data_5HKE
# 
_entry.id   5HKE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HKE         
WWPDB D_1000217136 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HKE 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Hu, X.-J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr F Struct Biol Commun' 
_citation.journal_id_ASTM           ACSFEN 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2053-230X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            72 
_citation.language                  ? 
_citation.page_first                376 
_citation.page_last                 381 
_citation.title                     'Crystal structure of bile salt hydrolase from Lactobacillus salivarius.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2053230X16005707 
_citation.pdbx_database_id_PubMed   27139829 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, F.'   1 
primary 'Guo, F.'  2 
primary 'Hu, X.J.' 3 
primary 'Lin, J.'  4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HKE 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     90.790 
_cell.length_a_esd                 ? 
_cell.length_b                     87.356 
_cell.length_b_esd                 ? 
_cell.length_c                     86.766 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HKE 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bile salt hydrolase' 37927.285 2   3.5.1.24 ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'       94.971    4   ?        ? ? ? 
3 water       nat water                 18.015    400 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;M(OCS)TAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVANDYPLYFDAINEDGLGMA
GLNFPGNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARNLVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTK
SGVHIYDNPIGILTNNPEFNYQMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSS
KGMTVEEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQIVAVTLNKDKDGNRLVTYPFER
KQIINKLNLERHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MCTAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVANDYPLYFDAINEDGLGMAGLNF
PGNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARNLVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTKSGVH
IYDNPIGILTNNPEFNYQMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSSKGMT
VEEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQIVAVTLNKDKDGNRLVTYPFERKQII
NKLNLERHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   OCS n 
1 3   THR n 
1 4   ALA n 
1 5   ILE n 
1 6   THR n 
1 7   LEU n 
1 8   ASN n 
1 9   GLY n 
1 10  ASN n 
1 11  SER n 
1 12  ASN n 
1 13  TYR n 
1 14  PHE n 
1 15  GLY n 
1 16  ARG n 
1 17  ASN n 
1 18  LEU n 
1 19  ASP n 
1 20  LEU n 
1 21  ASP n 
1 22  PHE n 
1 23  SER n 
1 24  TYR n 
1 25  GLY n 
1 26  GLU n 
1 27  GLU n 
1 28  VAL n 
1 29  ILE n 
1 30  ILE n 
1 31  THR n 
1 32  PRO n 
1 33  ALA n 
1 34  GLU n 
1 35  TYR n 
1 36  GLU n 
1 37  PHE n 
1 38  LYS n 
1 39  PHE n 
1 40  ARG n 
1 41  LYS n 
1 42  GLU n 
1 43  LYS n 
1 44  ALA n 
1 45  ILE n 
1 46  LYS n 
1 47  ASN n 
1 48  HIS n 
1 49  LYS n 
1 50  SER n 
1 51  LEU n 
1 52  ILE n 
1 53  GLY n 
1 54  VAL n 
1 55  GLY n 
1 56  ILE n 
1 57  VAL n 
1 58  ALA n 
1 59  ASN n 
1 60  ASP n 
1 61  TYR n 
1 62  PRO n 
1 63  LEU n 
1 64  TYR n 
1 65  PHE n 
1 66  ASP n 
1 67  ALA n 
1 68  ILE n 
1 69  ASN n 
1 70  GLU n 
1 71  ASP n 
1 72  GLY n 
1 73  LEU n 
1 74  GLY n 
1 75  MET n 
1 76  ALA n 
1 77  GLY n 
1 78  LEU n 
1 79  ASN n 
1 80  PHE n 
1 81  PRO n 
1 82  GLY n 
1 83  ASN n 
1 84  ALA n 
1 85  TYR n 
1 86  TYR n 
1 87  SER n 
1 88  ASP n 
1 89  ALA n 
1 90  LEU n 
1 91  GLU n 
1 92  ASN n 
1 93  ASP n 
1 94  LYS n 
1 95  ASP n 
1 96  ASN n 
1 97  ILE n 
1 98  THR n 
1 99  PRO n 
1 100 PHE n 
1 101 GLU n 
1 102 PHE n 
1 103 ILE n 
1 104 PRO n 
1 105 TRP n 
1 106 ILE n 
1 107 LEU n 
1 108 GLY n 
1 109 GLN n 
1 110 CYS n 
1 111 SER n 
1 112 ASP n 
1 113 VAL n 
1 114 ASN n 
1 115 GLU n 
1 116 ALA n 
1 117 ARG n 
1 118 ASN n 
1 119 LEU n 
1 120 VAL n 
1 121 GLU n 
1 122 LYS n 
1 123 ILE n 
1 124 ASN n 
1 125 LEU n 
1 126 ILE n 
1 127 ASN n 
1 128 LEU n 
1 129 SER n 
1 130 PHE n 
1 131 SER n 
1 132 GLU n 
1 133 GLN n 
1 134 LEU n 
1 135 PRO n 
1 136 LEU n 
1 137 ALA n 
1 138 GLY n 
1 139 LEU n 
1 140 HIS n 
1 141 TRP n 
1 142 LEU n 
1 143 ILE n 
1 144 ALA n 
1 145 ASP n 
1 146 ARG n 
1 147 GLU n 
1 148 LYS n 
1 149 SER n 
1 150 ILE n 
1 151 VAL n 
1 152 VAL n 
1 153 GLU n 
1 154 VAL n 
1 155 THR n 
1 156 LYS n 
1 157 SER n 
1 158 GLY n 
1 159 VAL n 
1 160 HIS n 
1 161 ILE n 
1 162 TYR n 
1 163 ASP n 
1 164 ASN n 
1 165 PRO n 
1 166 ILE n 
1 167 GLY n 
1 168 ILE n 
1 169 LEU n 
1 170 THR n 
1 171 ASN n 
1 172 ASN n 
1 173 PRO n 
1 174 GLU n 
1 175 PHE n 
1 176 ASN n 
1 177 TYR n 
1 178 GLN n 
1 179 MET n 
1 180 TYR n 
1 181 ASN n 
1 182 LEU n 
1 183 ASN n 
1 184 LYS n 
1 185 TYR n 
1 186 ARG n 
1 187 ASN n 
1 188 LEU n 
1 189 SER n 
1 190 ILE n 
1 191 SER n 
1 192 THR n 
1 193 PRO n 
1 194 GLN n 
1 195 ASN n 
1 196 THR n 
1 197 PHE n 
1 198 SER n 
1 199 ASP n 
1 200 SER n 
1 201 VAL n 
1 202 ASP n 
1 203 LEU n 
1 204 LYS n 
1 205 VAL n 
1 206 ASP n 
1 207 GLY n 
1 208 THR n 
1 209 GLY n 
1 210 PHE n 
1 211 GLY n 
1 212 GLY n 
1 213 ILE n 
1 214 GLY n 
1 215 LEU n 
1 216 PRO n 
1 217 GLY n 
1 218 ASP n 
1 219 VAL n 
1 220 SER n 
1 221 PRO n 
1 222 GLU n 
1 223 SER n 
1 224 ARG n 
1 225 PHE n 
1 226 VAL n 
1 227 ARG n 
1 228 ALA n 
1 229 THR n 
1 230 PHE n 
1 231 SER n 
1 232 LYS n 
1 233 LEU n 
1 234 ASN n 
1 235 SER n 
1 236 SER n 
1 237 LYS n 
1 238 GLY n 
1 239 MET n 
1 240 THR n 
1 241 VAL n 
1 242 GLU n 
1 243 GLU n 
1 244 ASP n 
1 245 ILE n 
1 246 THR n 
1 247 GLN n 
1 248 PHE n 
1 249 PHE n 
1 250 HIS n 
1 251 ILE n 
1 252 LEU n 
1 253 GLY n 
1 254 THR n 
1 255 VAL n 
1 256 GLU n 
1 257 GLN n 
1 258 ILE n 
1 259 LYS n 
1 260 GLY n 
1 261 VAL n 
1 262 ASN n 
1 263 LYS n 
1 264 THR n 
1 265 GLU n 
1 266 SER n 
1 267 GLY n 
1 268 LYS n 
1 269 GLU n 
1 270 GLU n 
1 271 TYR n 
1 272 THR n 
1 273 VAL n 
1 274 TYR n 
1 275 SER n 
1 276 ASN n 
1 277 CYS n 
1 278 TYR n 
1 279 ASP n 
1 280 LEU n 
1 281 ASP n 
1 282 ASN n 
1 283 LYS n 
1 284 THR n 
1 285 LEU n 
1 286 TYR n 
1 287 TYR n 
1 288 THR n 
1 289 THR n 
1 290 TYR n 
1 291 GLU n 
1 292 ASN n 
1 293 ARG n 
1 294 GLN n 
1 295 ILE n 
1 296 VAL n 
1 297 ALA n 
1 298 VAL n 
1 299 THR n 
1 300 LEU n 
1 301 ASN n 
1 302 LYS n 
1 303 ASP n 
1 304 LYS n 
1 305 ASP n 
1 306 GLY n 
1 307 ASN n 
1 308 ARG n 
1 309 LEU n 
1 310 VAL n 
1 311 THR n 
1 312 TYR n 
1 313 PRO n 
1 314 PHE n 
1 315 GLU n 
1 316 ARG n 
1 317 LYS n 
1 318 GLN n 
1 319 ILE n 
1 320 ILE n 
1 321 ASN n 
1 322 LYS n 
1 323 LEU n 
1 324 ASN n 
1 325 LEU n 
1 326 GLU n 
1 327 ARG n 
1 328 HIS n 
1 329 HIS n 
1 330 HIS n 
1 331 HIS n 
1 332 HIS n 
1 333 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   333 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lactobacillus salivarius' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1624 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            'NRRL B-30514' 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    J7H3P9_9LACO 
_struct_ref.pdbx_db_accession          J7H3P9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MCTAITLNGNSNYFGRNLDLDFSYGEEVIITPAEYEFKFRKEKAIKNHKSLIGVGIVANDYPLYFDAINEDGLGMAGLNF
PGNAYYSDALENDKDNITPFEFIPWILGQCSDVNEARNLVEKINLINLSFSEQLPLAGLHWLIADREKSIVVEVTKSGVH
IYDNPIGILTNNPEFNYQMYNLNKYRNLSISTPQNTFSDSVDLKVDGTGFGGIGLPGDVSPESRFVRATFSKLNSSKGMT
VEEDITQFFHILGTVEQIKGVNKTESGKEEYTVYSNCYDLDNKTLYYTTYENRQIVAVTLNKDKDGNRLVTYPFERKQII
NKLN
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HKE A 1 ? 324 ? J7H3P9 1 ? 324 ? 1 324 
2 1 5HKE B 1 ? 324 ? J7H3P9 1 ? 324 ? 1 324 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HKE LEU A 325 ? UNP J7H3P9 ? ? 'expression tag' 325 1  
1 5HKE GLU A 326 ? UNP J7H3P9 ? ? 'expression tag' 326 2  
1 5HKE ARG A 327 ? UNP J7H3P9 ? ? 'expression tag' 327 3  
1 5HKE HIS A 328 ? UNP J7H3P9 ? ? 'expression tag' 328 4  
1 5HKE HIS A 329 ? UNP J7H3P9 ? ? 'expression tag' 329 5  
1 5HKE HIS A 330 ? UNP J7H3P9 ? ? 'expression tag' 330 6  
1 5HKE HIS A 331 ? UNP J7H3P9 ? ? 'expression tag' 331 7  
1 5HKE HIS A 332 ? UNP J7H3P9 ? ? 'expression tag' 332 8  
1 5HKE HIS A 333 ? UNP J7H3P9 ? ? 'expression tag' 333 9  
2 5HKE LEU B 325 ? UNP J7H3P9 ? ? 'expression tag' 325 10 
2 5HKE GLU B 326 ? UNP J7H3P9 ? ? 'expression tag' 326 11 
2 5HKE ARG B 327 ? UNP J7H3P9 ? ? 'expression tag' 327 12 
2 5HKE HIS B 328 ? UNP J7H3P9 ? ? 'expression tag' 328 13 
2 5HKE HIS B 329 ? UNP J7H3P9 ? ? 'expression tag' 329 14 
2 5HKE HIS B 330 ? UNP J7H3P9 ? ? 'expression tag' 330 15 
2 5HKE HIS B 331 ? UNP J7H3P9 ? ? 'expression tag' 331 16 
2 5HKE HIS B 332 ? UNP J7H3P9 ? ? 'expression tag' 332 17 
2 5HKE HIS B 333 ? UNP J7H3P9 ? ? 'expression tag' 333 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S'   169.156 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'         ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HKE 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.13 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% Polyethylene glycol 3350, 0.2M potassium dihydrogen phosphate pH 4.8' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 944' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-05-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            13 
_reflns.entry_id                         5HKE 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.90 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       54757 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.7 
_reflns.pdbx_Rmerge_I_obs                0.054 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            28.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.90 
_reflns_shell.d_res_low                   1.93 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.91 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        90 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.236 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.77 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -0.54 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               19.805 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HKE 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             45.50 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     52091 
_refine.ls_number_reflns_R_free                  2619 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.19 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.15315 
_refine.ls_R_factor_R_free                       0.18533 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.15155 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2bjf 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.126 
_refine.pdbx_overall_ESU_R_Free                  0.117 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             2.414 
_refine.overall_SU_ML                            0.072 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        5058 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             400 
_refine_hist.number_atoms_total               5478 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        45.50 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.020  0.020  5265  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.020  4862  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.877  1.959  7160  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.391  3.000  11194 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.474  5.000  646   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.692 25.318 267   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.711 15.000 876   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 11.993 15.000 20    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.121  0.200  782   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.013  0.020  6086  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  1242  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.826  1.721  2572  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.808  1.720  2571  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.326  2.566  3222  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.326  2.567  3223  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.289  2.096  2693  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.252  2.089  2686  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.887  2.981  3927  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.931  14.629 6135  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.914  14.543 6078  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.08 0.05 ? ? A 38740 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.08 0.05 ? ? B 38740 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.899 
_refine_ls_shell.d_res_low                        1.948 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             213 
_refine_ls_shell.number_reflns_R_work             3432 
_refine_ls_shell.percent_reflns_obs               91.47 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.218 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.194 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 2 A 323 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 2 B 323 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5HKE 
_struct.title                        'bile salt hydrolase from Lactobacillus salivarius' 
_struct.pdbx_descriptor              'Bile salt hydrolase (E.C.3.5.1.24)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HKE 
_struct_keywords.text            'conjugated bile salt acid hydrolase, NTN-HYDROLASE, BILE ACIDS, HYDROLASE, CBAH, BSH' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 98  ? PHE A 100 ? THR A 98  PHE A 100 5 ? 3  
HELX_P HELX_P2  AA2 GLU A 101 ? CYS A 110 ? GLU A 101 CYS A 110 1 ? 10 
HELX_P HELX_P3  AA3 ASP A 112 ? GLU A 121 ? ASP A 112 GLU A 121 1 ? 10 
HELX_P HELX_P4  AA4 GLU A 174 ? LEU A 182 ? GLU A 174 LEU A 182 1 ? 9  
HELX_P HELX_P5  AA5 ASN A 183 ? ARG A 186 ? ASN A 183 ARG A 186 5 ? 4  
HELX_P HELX_P6  AA6 GLY A 209 ? ILE A 213 ? GLY A 209 ILE A 213 5 ? 5  
HELX_P HELX_P7  AA7 SER A 220 ? SER A 235 ? SER A 220 SER A 235 1 ? 16 
HELX_P HELX_P8  AA8 THR A 240 ? THR A 254 ? THR A 240 THR A 254 1 ? 15 
HELX_P HELX_P9  AA9 THR B 98  ? PHE B 100 ? THR B 98  PHE B 100 5 ? 3  
HELX_P HELX_P10 AB1 GLU B 101 ? GLY B 108 ? GLU B 101 GLY B 108 1 ? 8  
HELX_P HELX_P11 AB2 ASP B 112 ? GLU B 121 ? ASP B 112 GLU B 121 1 ? 10 
HELX_P HELX_P12 AB3 GLU B 174 ? LEU B 182 ? GLU B 174 LEU B 182 1 ? 9  
HELX_P HELX_P13 AB4 ASN B 183 ? ARG B 186 ? ASN B 183 ARG B 186 5 ? 4  
HELX_P HELX_P14 AB5 GLY B 209 ? ILE B 213 ? GLY B 209 ILE B 213 5 ? 5  
HELX_P HELX_P15 AB6 SER B 220 ? SER B 235 ? SER B 220 SER B 235 1 ? 16 
HELX_P HELX_P16 AB7 THR B 240 ? THR B 254 ? THR B 240 THR B 254 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A OCS 2 C ? ? ? 1_555 A THR 3 N ? ? A OCS 2 A THR 3 1_555 ? ? ? ? ? ? ? 1.309 ? 
covale2 covale both ? B OCS 2 C ? ? ? 1_555 B THR 3 N ? ? B OCS 2 B THR 3 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 172 A . ? ASN 172 A PRO 173 A ? PRO 173 A 1 1.93 
2 ASN 172 B . ? ASN 172 B PRO 173 B ? PRO 173 B 1 4.64 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 8 ? 
AA3 ? 2 ? 
AA4 ? 7 ? 
AA5 ? 8 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
AA5 7 8 ? anti-parallel 
AA6 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 168 ? LEU A 169 ? ILE A 168 LEU A 169 
AA1 2 THR A 3   ? ASN A 8   ? THR A 3   ASN A 8   
AA1 3 ASN A 12  ? LEU A 20  ? ASN A 12  LEU A 20  
AA1 4 TYR A 271 ? ASP A 279 ? TYR A 271 ASP A 279 
AA1 5 THR A 284 ? THR A 289 ? THR A 284 THR A 289 
AA1 6 ASN A 292 ? THR A 299 ? ASN A 292 THR A 299 
AA1 7 ASN B 321 ? LYS B 322 ? ASN B 321 LYS B 322 
AA2 1 GLY A 158 ? ASP A 163 ? GLY A 158 ASP A 163 
AA2 2 SER A 149 ? THR A 155 ? SER A 149 THR A 155 
AA2 3 LEU A 139 ? ALA A 144 ? LEU A 139 ALA A 144 
AA2 4 GLY A 74  ? ASN A 79  ? GLY A 74  ASN A 79  
AA2 5 TYR A 61  ? ASN A 69  ? TYR A 61  ASN A 69  
AA2 6 LEU A 51  ? ALA A 58  ? LEU A 51  ALA A 58  
AA2 7 GLU A 27  ? THR A 31  ? GLU A 27  THR A 31  
AA2 8 VAL A 310 ? PRO A 313 ? VAL A 310 PRO A 313 
AA3 1 ASP A 95  ? ILE A 97  ? ASP A 95  ILE A 97  
AA3 2 ILE A 123 ? LEU A 125 ? ILE A 123 LEU A 125 
AA4 1 ASN A 321 ? LYS A 322 ? ASN A 321 LYS A 322 
AA4 2 ASN B 292 ? THR B 299 ? ASN B 292 THR B 299 
AA4 3 THR B 284 ? THR B 289 ? THR B 284 THR B 289 
AA4 4 TYR B 271 ? ASP B 279 ? TYR B 271 ASP B 279 
AA4 5 ASN B 12  ? LEU B 20  ? ASN B 12  LEU B 20  
AA4 6 THR B 3   ? ASN B 8   ? THR B 3   ASN B 8   
AA4 7 ILE B 168 ? LEU B 169 ? ILE B 168 LEU B 169 
AA5 1 GLY B 158 ? ASP B 163 ? GLY B 158 ASP B 163 
AA5 2 SER B 149 ? THR B 155 ? SER B 149 THR B 155 
AA5 3 LEU B 139 ? ALA B 144 ? LEU B 139 ALA B 144 
AA5 4 GLY B 74  ? ASN B 79  ? GLY B 74  ASN B 79  
AA5 5 TYR B 61  ? ASN B 69  ? TYR B 61  ASN B 69  
AA5 6 LEU B 51  ? ALA B 58  ? LEU B 51  ALA B 58  
AA5 7 GLU B 27  ? THR B 31  ? GLU B 27  THR B 31  
AA5 8 VAL B 310 ? PRO B 313 ? VAL B 310 PRO B 313 
AA6 1 ASP B 95  ? ILE B 97  ? ASP B 95  ILE B 97  
AA6 2 ILE B 123 ? LEU B 125 ? ILE B 123 LEU B 125 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 169 ? O LEU A 169 N ALA A 4   ? N ALA A 4   
AA1 2 3 N LEU A 7   ? N LEU A 7   O TYR A 13  ? O TYR A 13  
AA1 3 4 N PHE A 14  ? N PHE A 14  O TYR A 278 ? O TYR A 278 
AA1 4 5 N CYS A 277 ? N CYS A 277 O TYR A 286 ? O TYR A 286 
AA1 5 6 N LEU A 285 ? N LEU A 285 O VAL A 298 ? O VAL A 298 
AA1 6 7 N ILE A 295 ? N ILE A 295 O ASN B 321 ? O ASN B 321 
AA2 1 2 O HIS A 160 ? O HIS A 160 N GLU A 153 ? N GLU A 153 
AA2 2 3 O VAL A 152 ? O VAL A 152 N TRP A 141 ? N TRP A 141 
AA2 3 4 O ALA A 144 ? O ALA A 144 N GLY A 74  ? N GLY A 74  
AA2 4 5 O MET A 75  ? O MET A 75  N ALA A 67  ? N ALA A 67  
AA2 5 6 O PHE A 65  ? O PHE A 65  N VAL A 54  ? N VAL A 54  
AA2 6 7 O GLY A 53  ? O GLY A 53  N ILE A 29  ? N ILE A 29  
AA2 7 8 N ILE A 30  ? N ILE A 30  O VAL A 310 ? O VAL A 310 
AA3 1 2 N ASP A 95  ? N ASP A 95  O ASN A 124 ? O ASN A 124 
AA4 1 2 N ASN A 321 ? N ASN A 321 O ILE B 295 ? O ILE B 295 
AA4 2 3 O VAL B 298 ? O VAL B 298 N LEU B 285 ? N LEU B 285 
AA4 3 4 O THR B 288 ? O THR B 288 N SER B 275 ? N SER B 275 
AA4 4 5 O TYR B 278 ? O TYR B 278 N PHE B 14  ? N PHE B 14  
AA4 5 6 O TYR B 13  ? O TYR B 13  N LEU B 7   ? N LEU B 7   
AA4 6 7 N ALA B 4   ? N ALA B 4   O LEU B 169 ? O LEU B 169 
AA5 1 2 O HIS B 160 ? O HIS B 160 N GLU B 153 ? N GLU B 153 
AA5 2 3 O ILE B 150 ? O ILE B 150 N ILE B 143 ? N ILE B 143 
AA5 3 4 O ALA B 144 ? O ALA B 144 N GLY B 74  ? N GLY B 74  
AA5 4 5 O GLY B 77  ? O GLY B 77  N PHE B 65  ? N PHE B 65  
AA5 5 6 O LEU B 63  ? O LEU B 63  N ILE B 56  ? N ILE B 56  
AA5 6 7 O GLY B 53  ? O GLY B 53  N ILE B 29  ? N ILE B 29  
AA5 7 8 N ILE B 30  ? N ILE B 30  O VAL B 310 ? O VAL B 310 
AA6 1 2 N ASP B 95  ? N ASP B 95  O ASN B 124 ? O ASN B 124 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PO4 401 ? 6 'binding site for residue PO4 A 401' 
AC2 Software A PO4 402 ? 4 'binding site for residue PO4 A 402' 
AC3 Software B PO4 401 ? 5 'binding site for residue PO4 B 401' 
AC4 Software B PO4 402 ? 4 'binding site for residue PO4 B 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 PRO A 81  ? PRO A 81  . ? 1_555 ? 
2  AC1 6 GLY A 82  ? GLY A 82  . ? 1_555 ? 
3  AC1 6 ALA A 84  ? ALA A 84  . ? 1_555 ? 
4  AC1 6 GLY A 138 ? GLY A 138 . ? 1_555 ? 
5  AC1 6 HOH G .   ? HOH A 502 . ? 1_555 ? 
6  AC1 6 HOH G .   ? HOH A 514 . ? 1_555 ? 
7  AC2 4 THR A 155 ? THR A 155 . ? 1_555 ? 
8  AC2 4 LYS A 156 ? LYS A 156 . ? 1_555 ? 
9  AC2 4 SER A 157 ? SER A 157 . ? 1_555 ? 
10 AC2 4 GLU A 174 ? GLU A 174 . ? 1_555 ? 
11 AC3 5 GLY B 82  ? GLY B 82  . ? 1_555 ? 
12 AC3 5 ASN B 83  ? ASN B 83  . ? 1_555 ? 
13 AC3 5 ALA B 84  ? ALA B 84  . ? 1_555 ? 
14 AC3 5 GLY B 138 ? GLY B 138 . ? 1_555 ? 
15 AC3 5 HOH H .   ? HOH B 575 . ? 1_555 ? 
16 AC4 4 THR B 155 ? THR B 155 . ? 1_555 ? 
17 AC4 4 LYS B 156 ? LYS B 156 . ? 1_555 ? 
18 AC4 4 SER B 157 ? SER B 157 . ? 1_555 ? 
19 AC4 4 GLU B 174 ? GLU B 174 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5HKE 
_atom_sites.fract_transf_matrix[1][1]   0.011014 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011447 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011525 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N N   . OCS A 1 2   ? 105.884 97.831  7.820   1.00 15.25 ? 2   OCS A N   1 
HETATM 2    C CA  . OCS A 1 2   ? 107.075 97.172  8.321   1.00 17.03 ? 2   OCS A CA  1 
HETATM 3    C CB  . OCS A 1 2   ? 107.233 97.486  9.796   1.00 21.77 ? 2   OCS A CB  1 
HETATM 4    S SG  . OCS A 1 2   ? 107.458 99.201  10.078  1.00 30.01 ? 2   OCS A SG  1 
HETATM 5    C C   . OCS A 1 2   ? 106.896 95.673  8.144   1.00 15.62 ? 2   OCS A C   1 
HETATM 6    O O   . OCS A 1 2   ? 105.749 95.148  8.380   1.00 14.04 ? 2   OCS A O   1 
HETATM 7    O OD1 . OCS A 1 2   ? 106.334 99.987  9.184   1.00 48.80 ? 2   OCS A OD1 1 
HETATM 8    O OD2 . OCS A 1 2   ? 107.411 99.511  11.519  1.00 29.90 ? 2   OCS A OD2 1 
HETATM 9    O OD3 . OCS A 1 2   ? 108.742 99.563  9.520   1.00 29.15 ? 2   OCS A OD3 1 
ATOM   10   N N   . THR A 1 3   ? 107.976 94.985  7.873   1.00 12.46 ? 3   THR A N   1 
ATOM   11   C CA  . THR A 1 3   ? 107.973 93.509  7.869   1.00 13.41 ? 3   THR A CA  1 
ATOM   12   C C   . THR A 1 3   ? 109.230 93.017  8.547   1.00 12.78 ? 3   THR A C   1 
ATOM   13   O O   . THR A 1 3   ? 110.328 93.406  8.109   1.00 14.68 ? 3   THR A O   1 
ATOM   14   C CB  . THR A 1 3   ? 107.910 92.871  6.444   1.00 14.64 ? 3   THR A CB  1 
ATOM   15   O OG1 . THR A 1 3   ? 106.811 93.431  5.728   1.00 14.37 ? 3   THR A OG1 1 
ATOM   16   C CG2 . THR A 1 3   ? 107.719 91.339  6.562   1.00 14.21 ? 3   THR A CG2 1 
ATOM   17   N N   . ALA A 1 4   ? 109.119 92.223  9.587   1.00 11.37 ? 4   ALA A N   1 
ATOM   18   C CA  . ALA A 1 4   ? 110.294 91.600  10.200  1.00 12.31 ? 4   ALA A CA  1 
ATOM   19   C C   . ALA A 1 4   ? 110.227 90.071  10.010  1.00 13.94 ? 4   ALA A C   1 
ATOM   20   O O   . ALA A 1 4   ? 109.173 89.484  10.145  1.00 12.68 ? 4   ALA A O   1 
ATOM   21   C CB  . ALA A 1 4   ? 110.379 91.962  11.675  1.00 14.17 ? 4   ALA A CB  1 
ATOM   22   N N   . ILE A 1 5   ? 111.347 89.458  9.713   1.00 12.92 ? 5   ILE A N   1 
ATOM   23   C CA  . ILE A 1 5   ? 111.424 88.038  9.585   1.00 13.16 ? 5   ILE A CA  1 
ATOM   24   C C   . ILE A 1 5   ? 112.658 87.459  10.225  1.00 13.14 ? 5   ILE A C   1 
ATOM   25   O O   . ILE A 1 5   ? 113.627 88.172  10.502  1.00 12.56 ? 5   ILE A O   1 
ATOM   26   C CB  . ILE A 1 5   ? 111.428 87.641  8.082   1.00 14.69 ? 5   ILE A CB  1 
ATOM   27   C CG1 . ILE A 1 5   ? 112.811 87.868  7.444   1.00 14.38 ? 5   ILE A CG1 1 
ATOM   28   C CG2 . ILE A 1 5   ? 110.347 88.386  7.294   1.00 13.08 ? 5   ILE A CG2 1 
ATOM   29   C CD1 . ILE A 1 5   ? 112.917 87.518  5.952   1.00 16.09 ? 5   ILE A CD1 1 
ATOM   30   N N   . THR A 1 6   ? 112.620 86.148  10.476  1.00 13.59 ? 6   THR A N   1 
ATOM   31   C CA  . THR A 1 6   ? 113.786 85.386  10.791  1.00 13.37 ? 6   THR A CA  1 
ATOM   32   C C   . THR A 1 6   ? 114.033 84.366  9.693   1.00 16.08 ? 6   THR A C   1 
ATOM   33   O O   . THR A 1 6   ? 113.126 84.041  8.931   1.00 13.96 ? 6   THR A O   1 
ATOM   34   C CB  . THR A 1 6   ? 113.653 84.623  12.097  1.00 14.95 ? 6   THR A CB  1 
ATOM   35   O OG1 . THR A 1 6   ? 112.604 83.691  12.011  1.00 14.90 ? 6   THR A OG1 1 
ATOM   36   C CG2 . THR A 1 6   ? 113.354 85.547  13.290  1.00 14.99 ? 6   THR A CG2 1 
ATOM   37   N N   . LEU A 1 7   ? 115.244 83.798  9.645   1.00 16.14 ? 7   LEU A N   1 
ATOM   38   C CA  . LEU A 1 7   ? 115.542 82.744  8.656   1.00 15.61 ? 7   LEU A CA  1 
ATOM   39   C C   . LEU A 1 7   ? 116.613 81.847  9.301   1.00 18.36 ? 7   LEU A C   1 
ATOM   40   O O   . LEU A 1 7   ? 117.555 82.369  9.911   1.00 16.28 ? 7   LEU A O   1 
ATOM   41   C CB  . LEU A 1 7   ? 116.032 83.323  7.356   1.00 15.17 ? 7   LEU A CB  1 
ATOM   42   C CG  . LEU A 1 7   ? 116.286 82.363  6.149   1.00 17.49 ? 7   LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 7   ? 114.932 81.880  5.633   1.00 20.76 ? 7   LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 7   ? 117.013 83.081  5.045   1.00 18.04 ? 7   LEU A CD2 1 
ATOM   45   N N   . ASN A 1 8   ? 116.438 80.521  9.185   1.00 17.23 ? 8   ASN A N   1 
ATOM   46   C CA  . ASN A 1 8   ? 117.431 79.611  9.656   1.00 23.73 ? 8   ASN A CA  1 
ATOM   47   C C   . ASN A 1 8   ? 118.034 78.912  8.446   1.00 25.31 ? 8   ASN A C   1 
ATOM   48   O O   . ASN A 1 8   ? 117.323 78.320  7.672   1.00 27.20 ? 8   ASN A O   1 
ATOM   49   C CB  . ASN A 1 8   ? 116.834 78.635  10.706  1.00 25.93 ? 8   ASN A CB  1 
ATOM   50   C CG  . ASN A 1 8   ? 116.210 79.413  11.894  1.00 28.79 ? 8   ASN A CG  1 
ATOM   51   O OD1 . ASN A 1 8   ? 114.991 79.513  11.969  1.00 31.63 ? 8   ASN A OD1 1 
ATOM   52   N ND2 . ASN A 1 8   ? 117.026 80.088  12.722  1.00 26.80 ? 8   ASN A ND2 1 
ATOM   53   N N   . GLY A 1 9   ? 119.336 78.999  8.276   1.00 21.53 ? 9   GLY A N   1 
ATOM   54   C CA  . GLY A 1 9   ? 120.022 78.313  7.191   1.00 21.37 ? 9   GLY A CA  1 
ATOM   55   C C   . GLY A 1 9   ? 121.415 77.887  7.630   1.00 21.72 ? 9   GLY A C   1 
ATOM   56   O O   . GLY A 1 9   ? 121.537 77.251  8.687   1.00 20.89 ? 9   GLY A O   1 
ATOM   57   N N   . ASN A 1 10  ? 122.449 78.368  6.933   1.00 18.86 ? 10  ASN A N   1 
ATOM   58   C CA  . ASN A 1 10  ? 123.829 78.050  7.343   1.00 22.42 ? 10  ASN A CA  1 
ATOM   59   C C   . ASN A 1 10  ? 124.272 78.844  8.582   1.00 23.27 ? 10  ASN A C   1 
ATOM   60   O O   . ASN A 1 10  ? 125.085 78.374  9.384   1.00 27.04 ? 10  ASN A O   1 
ATOM   61   C CB  . ASN A 1 10  ? 124.774 78.323  6.188   1.00 23.80 ? 10  ASN A CB  1 
ATOM   62   C CG  . ASN A 1 10  ? 124.404 77.481  4.977   1.00 22.78 ? 10  ASN A CG  1 
ATOM   63   O OD1 . ASN A 1 10  ? 123.742 77.935  4.022   1.00 23.10 ? 10  ASN A OD1 1 
ATOM   64   N ND2 . ASN A 1 10  ? 124.662 76.229  5.115   1.00 17.33 ? 10  ASN A ND2 1 
ATOM   65   N N   . SER A 1 11  ? 123.688 80.009  8.762   1.00 21.69 ? 11  SER A N   1 
ATOM   66   C CA  . SER A 1 11  ? 123.697 80.721  10.038  1.00 19.91 ? 11  SER A CA  1 
ATOM   67   C C   . SER A 1 11  ? 122.207 80.984  10.374  1.00 20.12 ? 11  SER A C   1 
ATOM   68   O O   . SER A 1 11  ? 121.319 80.290  9.843   1.00 18.84 ? 11  SER A O   1 
ATOM   69   C CB  . SER A 1 11  ? 124.522 81.999  9.984   1.00 20.45 ? 11  SER A CB  1 
ATOM   70   O OG  . SER A 1 11  ? 124.737 82.471  11.297  1.00 19.79 ? 11  SER A OG  1 
ATOM   71   N N   . ASN A 1 12  ? 121.962 81.848  11.342  1.00 17.74 ? 12  ASN A N   1 
ATOM   72   C CA  . ASN A 1 12  ? 120.636 82.205  11.771  1.00 18.05 ? 12  ASN A CA  1 
ATOM   73   C C   . ASN A 1 12  ? 120.517 83.728  11.669  1.00 17.74 ? 12  ASN A C   1 
ATOM   74   O O   . ASN A 1 12  ? 121.432 84.453  12.098  1.00 17.52 ? 12  ASN A O   1 
ATOM   75   C CB  . ASN A 1 12  ? 120.352 81.702  13.180  1.00 17.63 ? 12  ASN A CB  1 
ATOM   76   C CG  . ASN A 1 12  ? 120.525 80.176  13.264  1.00 22.25 ? 12  ASN A CG  1 
ATOM   77   O OD1 . ASN A 1 12  ? 119.674 79.440  12.778  1.00 21.72 ? 12  ASN A OD1 1 
ATOM   78   N ND2 . ASN A 1 12  ? 121.655 79.736  13.768  1.00 20.20 ? 12  ASN A ND2 1 
ATOM   79   N N   . TYR A 1 13  ? 119.395 84.176  11.112  1.00 15.49 ? 13  TYR A N   1 
ATOM   80   C CA  . TYR A 1 13  ? 119.202 85.571  10.685  1.00 16.36 ? 13  TYR A CA  1 
ATOM   81   C C   . TYR A 1 13  ? 117.908 86.161  11.177  1.00 13.86 ? 13  TYR A C   1 
ATOM   82   O O   . TYR A 1 13  ? 116.945 85.429  11.526  1.00 14.31 ? 13  TYR A O   1 
ATOM   83   C CB  . TYR A 1 13  ? 119.224 85.682  9.136   1.00 15.41 ? 13  TYR A CB  1 
ATOM   84   C CG  . TYR A 1 13  ? 120.332 84.859  8.492   1.00 15.81 ? 13  TYR A CG  1 
ATOM   85   C CD1 . TYR A 1 13  ? 121.616 85.354  8.346   1.00 16.64 ? 13  TYR A CD1 1 
ATOM   86   C CD2 . TYR A 1 13  ? 120.099 83.538  8.095   1.00 17.41 ? 13  TYR A CD2 1 
ATOM   87   C CE1 . TYR A 1 13  ? 122.632 84.566  7.788   1.00 18.43 ? 13  TYR A CE1 1 
ATOM   88   C CE2 . TYR A 1 13  ? 121.107 82.753  7.504   1.00 16.60 ? 13  TYR A CE2 1 
ATOM   89   C CZ  . TYR A 1 13  ? 122.367 83.274  7.398   1.00 17.90 ? 13  TYR A CZ  1 
ATOM   90   O OH  . TYR A 1 13  ? 123.363 82.516  6.867   1.00 17.79 ? 13  TYR A OH  1 
ATOM   91   N N   . PHE A 1 14  ? 117.913 87.461  11.220  1.00 12.98 ? 14  PHE A N   1 
ATOM   92   C CA  . PHE A 1 14  ? 116.800 88.289  11.768  1.00 14.26 ? 14  PHE A CA  1 
ATOM   93   C C   . PHE A 1 14  ? 116.928 89.641  11.111  1.00 13.31 ? 14  PHE A C   1 
ATOM   94   O O   . PHE A 1 14  ? 118.039 90.142  10.965  1.00 14.42 ? 14  PHE A O   1 
ATOM   95   C CB  . PHE A 1 14  ? 116.940 88.365  13.303  1.00 14.52 ? 14  PHE A CB  1 
ATOM   96   C CG  . PHE A 1 14  ? 116.235 89.524  13.952  1.00 14.37 ? 14  PHE A CG  1 
ATOM   97   C CD1 . PHE A 1 14  ? 114.871 89.469  14.208  1.00 15.59 ? 14  PHE A CD1 1 
ATOM   98   C CD2 . PHE A 1 14  ? 116.927 90.669  14.291  1.00 16.57 ? 14  PHE A CD2 1 
ATOM   99   C CE1 . PHE A 1 14  ? 114.228 90.524  14.894  1.00 16.65 ? 14  PHE A CE1 1 
ATOM   100  C CE2 . PHE A 1 14  ? 116.295 91.742  14.888  1.00 16.32 ? 14  PHE A CE2 1 
ATOM   101  C CZ  . PHE A 1 14  ? 114.963 91.675  15.197  1.00 17.36 ? 14  PHE A CZ  1 
ATOM   102  N N   . GLY A 1 15  ? 115.835 90.242  10.671  1.00 13.55 ? 15  GLY A N   1 
ATOM   103  C CA  . GLY A 1 15  ? 115.939 91.531  9.934   1.00 12.42 ? 15  GLY A CA  1 
ATOM   104  C C   . GLY A 1 15  ? 114.592 92.047  9.533   1.00 12.89 ? 15  GLY A C   1 
ATOM   105  O O   . GLY A 1 15  ? 113.544 91.406  9.799   1.00 13.06 ? 15  GLY A O   1 
ATOM   106  N N   . ARG A 1 16  ? 114.572 93.200  8.954   1.00 14.10 ? 16  ARG A N   1 
ATOM   107  C CA  . ARG A 1 16  ? 113.305 93.853  8.704   1.00 13.70 ? 16  ARG A CA  1 
ATOM   108  C C   . ARG A 1 16  ? 113.410 94.866  7.571   1.00 13.98 ? 16  ARG A C   1 
ATOM   109  O O   . ARG A 1 16  ? 114.520 95.403  7.242   1.00 12.12 ? 16  ARG A O   1 
ATOM   110  C CB  . ARG A 1 16  ? 112.765 94.532  10.001  1.00 13.21 ? 16  ARG A CB  1 
ATOM   111  C CG  . ARG A 1 16  ? 113.666 95.673  10.564  1.00 13.50 ? 16  ARG A CG  1 
ATOM   112  C CD  . ARG A 1 16  ? 113.338 97.081  10.032  1.00 13.83 ? 16  ARG A CD  1 
ATOM   113  N NE  . ARG A 1 16  ? 111.998 97.523  10.393  1.00 13.82 ? 16  ARG A NE  1 
ATOM   114  C CZ  . ARG A 1 16  ? 111.655 97.890  11.629  1.00 15.58 ? 16  ARG A CZ  1 
ATOM   115  N NH1 . ARG A 1 16  ? 110.410 98.227  11.869  1.00 15.94 ? 16  ARG A NH1 1 
ATOM   116  N NH2 . ARG A 1 16  ? 112.576 98.005  12.605  1.00 15.84 ? 16  ARG A NH2 1 
ATOM   117  N N   . ASN A 1 17  ? 112.227 95.169  7.023   1.00 12.83 ? 17  ASN A N   1 
ATOM   118  C CA  . ASN A 1 17  ? 111.991 96.333  6.206   1.00 13.77 ? 17  ASN A CA  1 
ATOM   119  C C   . ASN A 1 17  ? 111.439 97.388  7.136   1.00 13.50 ? 17  ASN A C   1 
ATOM   120  O O   . ASN A 1 17  ? 110.546 97.096  7.927   1.00 13.91 ? 17  ASN A O   1 
ATOM   121  C CB  . ASN A 1 17  ? 110.894 96.068  5.143   1.00 13.25 ? 17  ASN A CB  1 
ATOM   122  C CG  . ASN A 1 17  ? 111.391 95.296  3.968   1.00 13.94 ? 17  ASN A CG  1 
ATOM   123  O OD1 . ASN A 1 17  ? 112.577 95.194  3.727   1.00 14.64 ? 17  ASN A OD1 1 
ATOM   124  N ND2 . ASN A 1 17  ? 110.467 94.724  3.217   1.00 14.65 ? 17  ASN A ND2 1 
ATOM   125  N N   . LEU A 1 18  ? 111.948 98.612  7.055   1.00 15.03 ? 18  LEU A N   1 
ATOM   126  C CA  . LEU A 1 18  ? 111.344 99.757  7.727   1.00 15.02 ? 18  LEU A CA  1 
ATOM   127  C C   . LEU A 1 18  ? 110.564 100.546 6.737   1.00 15.17 ? 18  LEU A C   1 
ATOM   128  O O   . LEU A 1 18  ? 111.158 101.053 5.759   1.00 14.03 ? 18  LEU A O   1 
ATOM   129  C CB  . LEU A 1 18  ? 112.425 100.631 8.382   1.00 16.73 ? 18  LEU A CB  1 
ATOM   130  C CG  . LEU A 1 18  ? 111.857 101.905 8.998   1.00 19.85 ? 18  LEU A CG  1 
ATOM   131  C CD1 . LEU A 1 18  ? 111.112 101.541 10.261  1.00 22.39 ? 18  LEU A CD1 1 
ATOM   132  C CD2 . LEU A 1 18  ? 112.945 102.922 9.283   1.00 22.13 ? 18  LEU A CD2 1 
ATOM   133  N N   . ASP A 1 19  ? 109.226 100.545 6.892   1.00 14.29 ? 19  ASP A N   1 
ATOM   134  C CA  . ASP A 1 19  ? 108.351 101.188 5.924   1.00 14.52 ? 19  ASP A CA  1 
ATOM   135  C C   . ASP A 1 19  ? 107.771 102.441 6.560   1.00 17.08 ? 19  ASP A C   1 
ATOM   136  O O   . ASP A 1 19  ? 107.009 102.355 7.533   1.00 16.55 ? 19  ASP A O   1 
ATOM   137  C CB  . ASP A 1 19  ? 107.194 100.261 5.521   1.00 16.04 ? 19  ASP A CB  1 
ATOM   138  C CG  . ASP A 1 19  ? 107.659 98.972  4.818   1.00 15.37 ? 19  ASP A CG  1 
ATOM   139  O OD1 . ASP A 1 19  ? 108.797 98.871  4.278   1.00 14.53 ? 19  ASP A OD1 1 
ATOM   140  O OD2 . ASP A 1 19  ? 106.866 97.970  4.879   1.00 15.60 ? 19  ASP A OD2 1 
ATOM   141  N N   . LEU A 1 20  ? 108.031 103.606 5.986   1.00 16.29 ? 20  LEU A N   1 
ATOM   142  C CA  . LEU A 1 20  ? 107.527 104.851 6.543   1.00 17.54 ? 20  LEU A CA  1 
ATOM   143  C C   . LEU A 1 20  ? 107.242 105.797 5.393   1.00 18.01 ? 20  LEU A C   1 
ATOM   144  O O   . LEU A 1 20  ? 107.742 105.571 4.261   1.00 16.63 ? 20  LEU A O   1 
ATOM   145  C CB  . LEU A 1 20  ? 108.650 105.515 7.382   1.00 19.33 ? 20  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 20  ? 109.072 104.828 8.705   1.00 23.31 ? 20  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 20  ? 110.250 105.666 9.243   1.00 25.82 ? 20  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 20  ? 107.908 104.775 9.685   1.00 27.01 ? 20  LEU A CD2 1 
ATOM   149  N N   . ASP A 1 21  ? 106.551 106.898 5.676   1.00 17.73 ? 21  ASP A N   1 
ATOM   150  C CA  . ASP A 1 21  ? 106.352 107.945 4.649   1.00 22.37 ? 21  ASP A CA  1 
ATOM   151  C C   . ASP A 1 21  ? 107.329 109.102 4.770   1.00 25.45 ? 21  ASP A C   1 
ATOM   152  O O   . ASP A 1 21  ? 107.183 110.103 4.099   1.00 26.18 ? 21  ASP A O   1 
ATOM   153  C CB  . ASP A 1 21  ? 104.871 108.351 4.551   1.00 25.30 ? 21  ASP A CB  1 
ATOM   154  C CG  . ASP A 1 21  ? 104.339 109.111 5.820   1.00 28.05 ? 21  ASP A CG  1 
ATOM   155  O OD1 . ASP A 1 21  ? 105.120 109.289 6.774   1.00 25.67 ? 21  ASP A OD1 1 
ATOM   156  O OD2 . ASP A 1 21  ? 103.158 109.528 5.800   1.00 30.38 ? 21  ASP A OD2 1 
ATOM   157  N N   . PHE A 1 22  ? 108.377 108.926 5.576   1.00 28.99 ? 22  PHE A N   1 
ATOM   158  C CA  . PHE A 1 22  ? 109.570 109.834 5.610   1.00 30.79 ? 22  PHE A CA  1 
ATOM   159  C C   . PHE A 1 22  ? 110.802 109.078 6.136   1.00 28.32 ? 22  PHE A C   1 
ATOM   160  O O   . PHE A 1 22  ? 110.682 108.000 6.660   1.00 33.48 ? 22  PHE A O   1 
ATOM   161  C CB  . PHE A 1 22  ? 109.283 111.028 6.531   1.00 37.33 ? 22  PHE A CB  1 
ATOM   162  C CG  . PHE A 1 22  ? 109.193 110.641 7.961   1.00 44.34 ? 22  PHE A CG  1 
ATOM   163  C CD1 . PHE A 1 22  ? 108.082 109.880 8.439   1.00 48.78 ? 22  PHE A CD1 1 
ATOM   164  C CD2 . PHE A 1 22  ? 110.237 110.963 8.850   1.00 45.35 ? 22  PHE A CD2 1 
ATOM   165  C CE1 . PHE A 1 22  ? 108.014 109.454 9.773   1.00 48.68 ? 22  PHE A CE1 1 
ATOM   166  C CE2 . PHE A 1 22  ? 110.174 110.551 10.186  1.00 49.75 ? 22  PHE A CE2 1 
ATOM   167  C CZ  . PHE A 1 22  ? 109.058 109.818 10.649  1.00 59.48 ? 22  PHE A CZ  1 
ATOM   168  N N   . SER A 1 23  ? 111.980 109.654 6.046   1.00 27.89 ? 23  SER A N   1 
ATOM   169  C CA  . SER A 1 23  ? 113.153 109.041 6.641   1.00 28.42 ? 23  SER A CA  1 
ATOM   170  C C   . SER A 1 23  ? 113.667 109.945 7.783   1.00 29.82 ? 23  SER A C   1 
ATOM   171  O O   . SER A 1 23  ? 113.685 111.136 7.616   1.00 28.92 ? 23  SER A O   1 
ATOM   172  C CB  . SER A 1 23  ? 114.221 108.860 5.588   1.00 26.47 ? 23  SER A CB  1 
ATOM   173  O OG  . SER A 1 23  ? 115.478 108.750 6.140   1.00 25.73 ? 23  SER A OG  1 
ATOM   174  N N   . TYR A 1 24  ? 114.123 109.353 8.889   1.00 26.13 ? 24  TYR A N   1 
ATOM   175  C CA  . TYR A 1 24  ? 114.688 110.116 10.014  1.00 26.05 ? 24  TYR A CA  1 
ATOM   176  C C   . TYR A 1 24  ? 116.180 110.347 9.881   1.00 22.08 ? 24  TYR A C   1 
ATOM   177  O O   . TYR A 1 24  ? 116.799 110.814 10.862  1.00 21.34 ? 24  TYR A O   1 
ATOM   178  C CB  . TYR A 1 24  ? 114.517 109.363 11.317  1.00 30.63 ? 24  TYR A CB  1 
ATOM   179  C CG  . TYR A 1 24  ? 113.149 109.113 11.880  1.00 40.33 ? 24  TYR A CG  1 
ATOM   180  C CD1 . TYR A 1 24  ? 112.410 107.950 11.513  1.00 40.77 ? 24  TYR A CD1 1 
ATOM   181  C CD2 . TYR A 1 24  ? 112.645 109.932 12.902  1.00 39.02 ? 24  TYR A CD2 1 
ATOM   182  C CE1 . TYR A 1 24  ? 111.209 107.650 12.111  1.00 41.26 ? 24  TYR A CE1 1 
ATOM   183  C CE2 . TYR A 1 24  ? 111.426 109.642 13.506  1.00 51.01 ? 24  TYR A CE2 1 
ATOM   184  C CZ  . TYR A 1 24  ? 110.712 108.497 13.116  1.00 51.71 ? 24  TYR A CZ  1 
ATOM   185  O OH  . TYR A 1 24  ? 109.498 108.221 13.728  1.00 48.60 ? 24  TYR A OH  1 
ATOM   186  N N   . GLY A 1 25  ? 116.802 109.986 8.765   1.00 20.37 ? 25  GLY A N   1 
ATOM   187  C CA  . GLY A 1 25  ? 118.259 110.019 8.658   1.00 22.63 ? 25  GLY A CA  1 
ATOM   188  C C   . GLY A 1 25  ? 118.914 108.869 9.453   1.00 23.96 ? 25  GLY A C   1 
ATOM   189  O O   . GLY A 1 25  ? 119.826 109.024 10.275  1.00 21.33 ? 25  GLY A O   1 
ATOM   190  N N   . GLU A 1 26  ? 118.433 107.670 9.178   1.00 21.40 ? 26  GLU A N   1 
ATOM   191  C CA  . GLU A 1 26  ? 118.824 106.460 9.874   1.00 19.82 ? 26  GLU A CA  1 
ATOM   192  C C   . GLU A 1 26  ? 120.347 106.201 9.800   1.00 19.86 ? 26  GLU A C   1 
ATOM   193  O O   . GLU A 1 26  ? 121.009 106.590 8.826   1.00 17.14 ? 26  GLU A O   1 
ATOM   194  C CB  . GLU A 1 26  ? 118.108 105.229 9.207   1.00 21.25 ? 26  GLU A CB  1 
ATOM   195  C CG  . GLU A 1 26  ? 116.629 105.277 9.407   1.00 24.39 ? 26  GLU A CG  1 
ATOM   196  C CD  . GLU A 1 26  ? 115.876 106.292 8.571   1.00 23.58 ? 26  GLU A CD  1 
ATOM   197  O OE1 . GLU A 1 26  ? 116.390 106.661 7.503   1.00 22.93 ? 26  GLU A OE1 1 
ATOM   198  O OE2 . GLU A 1 26  ? 114.742 106.694 8.990   1.00 24.94 ? 26  GLU A OE2 1 
ATOM   199  N N   . GLU A 1 27  ? 120.909 105.524 10.796  1.00 16.95 ? 27  GLU A N   1 
ATOM   200  C CA  . GLU A 1 27  ? 122.328 105.221 10.810  1.00 17.33 ? 27  GLU A CA  1 
ATOM   201  C C   . GLU A 1 27  ? 122.568 103.971 11.595  1.00 17.26 ? 27  GLU A C   1 
ATOM   202  O O   . GLU A 1 27  ? 121.735 103.578 12.436  1.00 16.31 ? 27  GLU A O   1 
ATOM   203  C CB  . GLU A 1 27  ? 123.122 106.399 11.493  1.00 18.68 ? 27  GLU A CB  1 
ATOM   204  C CG  . GLU A 1 27  ? 122.654 106.764 12.836  1.00 19.94 ? 27  GLU A CG  1 
ATOM   205  C CD  . GLU A 1 27  ? 123.378 108.012 13.414  1.00 26.50 ? 27  GLU A CD  1 
ATOM   206  O OE1 . GLU A 1 27  ? 124.269 108.523 12.782  1.00 23.73 ? 27  GLU A OE1 1 
ATOM   207  O OE2 . GLU A 1 27  ? 123.000 108.404 14.506  1.00 25.30 ? 27  GLU A OE2 1 
ATOM   208  N N   . VAL A 1 28  ? 123.704 103.363 11.361  1.00 17.22 ? 28  VAL A N   1 
ATOM   209  C CA  . VAL A 1 28  ? 124.156 102.286 12.218  1.00 17.20 ? 28  VAL A CA  1 
ATOM   210  C C   . VAL A 1 28  ? 124.572 102.899 13.551  1.00 16.76 ? 28  VAL A C   1 
ATOM   211  O O   . VAL A 1 28  ? 125.272 103.932 13.559  1.00 18.18 ? 28  VAL A O   1 
ATOM   212  C CB  . VAL A 1 28  ? 125.355 101.569 11.614  1.00 20.60 ? 28  VAL A CB  1 
ATOM   213  C CG1 . VAL A 1 28  ? 125.811 100.434 12.487  1.00 22.10 ? 28  VAL A CG1 1 
ATOM   214  C CG2 . VAL A 1 28  ? 125.068 101.054 10.215  1.00 21.62 ? 28  VAL A CG2 1 
ATOM   215  N N   . ILE A 1 29  ? 124.227 102.260 14.650  1.00 16.11 ? 29  ILE A N   1 
ATOM   216  C CA  . ILE A 1 29  ? 124.619 102.699 15.975  1.00 15.29 ? 29  ILE A CA  1 
ATOM   217  C C   . ILE A 1 29  ? 125.126 101.484 16.737  1.00 16.72 ? 29  ILE A C   1 
ATOM   218  O O   . ILE A 1 29  ? 124.397 100.480 16.907  1.00 15.66 ? 29  ILE A O   1 
ATOM   219  C CB  . ILE A 1 29  ? 123.441 103.298 16.758  1.00 15.75 ? 29  ILE A CB  1 
ATOM   220  C CG1 . ILE A 1 29  ? 122.732 104.384 15.972  1.00 15.65 ? 29  ILE A CG1 1 
ATOM   221  C CG2 . ILE A 1 29  ? 123.933 103.863 18.115  1.00 15.90 ? 29  ILE A CG2 1 
ATOM   222  C CD1 . ILE A 1 29  ? 121.385 104.740 16.560  1.00 15.74 ? 29  ILE A CD1 1 
ATOM   223  N N   . ILE A 1 30  ? 126.377 101.539 17.177  1.00 16.58 ? 30  ILE A N   1 
ATOM   224  C CA  . ILE A 1 30  ? 126.956 100.557 18.082  1.00 17.50 ? 30  ILE A CA  1 
ATOM   225  C C   . ILE A 1 30  ? 126.919 101.180 19.452  1.00 17.50 ? 30  ILE A C   1 
ATOM   226  O O   . ILE A 1 30  ? 127.464 102.298 19.674  1.00 17.27 ? 30  ILE A O   1 
ATOM   227  C CB  . ILE A 1 30  ? 128.408 100.164 17.699  1.00 20.63 ? 30  ILE A CB  1 
ATOM   228  C CG1 . ILE A 1 30  ? 128.338 99.389  16.407  1.00 24.75 ? 30  ILE A CG1 1 
ATOM   229  C CG2 . ILE A 1 30  ? 129.071 99.315  18.811  1.00 22.62 ? 30  ILE A CG2 1 
ATOM   230  C CD1 . ILE A 1 30  ? 129.664 99.055  15.733  1.00 29.41 ? 30  ILE A CD1 1 
ATOM   231  N N   . THR A 1 31  ? 126.304 100.485 20.376  1.00 17.41 ? 31  THR A N   1 
ATOM   232  C CA  . THR A 1 31  ? 126.299 100.896 21.801  1.00 18.59 ? 31  THR A CA  1 
ATOM   233  C C   . THR A 1 31  ? 127.225 99.944  22.567  1.00 18.65 ? 31  THR A C   1 
ATOM   234  O O   . THR A 1 31  ? 126.919 98.768  22.789  1.00 19.08 ? 31  THR A O   1 
ATOM   235  C CB  . THR A 1 31  ? 124.914 100.817 22.437  1.00 18.39 ? 31  THR A CB  1 
ATOM   236  O OG1 . THR A 1 31  ? 124.013 101.636 21.664  1.00 16.68 ? 31  THR A OG1 1 
ATOM   237  C CG2 . THR A 1 31  ? 124.945 101.309 23.874  1.00 17.17 ? 31  THR A CG2 1 
ATOM   238  N N   . PRO A 1 32  ? 128.340 100.477 23.060  1.00 18.01 ? 32  PRO A N   1 
ATOM   239  C CA  . PRO A 1 32  ? 129.297 99.571  23.746  1.00 18.32 ? 32  PRO A CA  1 
ATOM   240  C C   . PRO A 1 32  ? 128.831 99.243  25.165  1.00 17.33 ? 32  PRO A C   1 
ATOM   241  O O   . PRO A 1 32  ? 127.877 99.855  25.663  1.00 16.20 ? 32  PRO A O   1 
ATOM   242  C CB  . PRO A 1 32  ? 130.592 100.376 23.739  1.00 20.33 ? 32  PRO A CB  1 
ATOM   243  C CG  . PRO A 1 32  ? 130.105 101.774 23.871  1.00 20.40 ? 32  PRO A CG  1 
ATOM   244  C CD  . PRO A 1 32  ? 128.857 101.824 22.950  1.00 17.36 ? 32  PRO A CD  1 
ATOM   245  N N   . ALA A 1 33  ? 129.502 98.261  25.781  1.00 16.55 ? 33  ALA A N   1 
ATOM   246  C CA  . ALA A 1 33  ? 129.089 97.687  27.017  1.00 19.21 ? 33  ALA A CA  1 
ATOM   247  C C   . ALA A 1 33  ? 129.022 98.696  28.195  1.00 21.51 ? 33  ALA A C   1 
ATOM   248  O O   . ALA A 1 33  ? 128.152 98.569  29.076  1.00 24.42 ? 33  ALA A O   1 
ATOM   249  C CB  . ALA A 1 33  ? 130.028 96.512  27.352  1.00 22.35 ? 33  ALA A CB  1 
ATOM   250  N N   . GLU A 1 34  ? 129.851 99.730  28.178  1.00 20.06 ? 34  GLU A N   1 
ATOM   251  C CA  . GLU A 1 34  ? 129.856 100.752 29.233  1.00 21.93 ? 34  GLU A CA  1 
ATOM   252  C C   . GLU A 1 34  ? 129.307 102.083 28.842  1.00 24.08 ? 34  GLU A C   1 
ATOM   253  O O   . GLU A 1 34  ? 129.488 103.073 29.576  1.00 20.57 ? 34  GLU A O   1 
ATOM   254  C CB  . GLU A 1 34  ? 131.288 100.875 29.850  1.00 28.01 ? 34  GLU A CB  1 
ATOM   255  C CG  . GLU A 1 34  ? 131.685 99.542  30.492  1.00 29.64 ? 34  GLU A CG  1 
ATOM   256  C CD  . GLU A 1 34  ? 133.120 99.476  31.034  1.00 41.99 ? 34  GLU A CD  1 
ATOM   257  O OE1 . GLU A 1 34  ? 133.855 100.467 31.008  1.00 40.72 ? 34  GLU A OE1 1 
ATOM   258  O OE2 . GLU A 1 34  ? 133.528 98.395  31.476  1.00 45.14 ? 34  GLU A OE2 1 
ATOM   259  N N   . TYR A 1 35  ? 128.561 102.151 27.720  1.00 18.85 ? 35  TYR A N   1 
ATOM   260  C CA  . TYR A 1 35  ? 127.693 103.283 27.513  1.00 17.75 ? 35  TYR A CA  1 
ATOM   261  C C   . TYR A 1 35  ? 126.618 103.215 28.603  1.00 17.52 ? 35  TYR A C   1 
ATOM   262  O O   . TYR A 1 35  ? 125.878 102.223 28.753  1.00 18.09 ? 35  TYR A O   1 
ATOM   263  C CB  . TYR A 1 35  ? 127.098 103.345 26.081  1.00 17.17 ? 35  TYR A CB  1 
ATOM   264  C CG  . TYR A 1 35  ? 125.974 104.384 25.945  1.00 17.98 ? 35  TYR A CG  1 
ATOM   265  C CD1 . TYR A 1 35  ? 126.246 105.685 25.620  1.00 17.07 ? 35  TYR A CD1 1 
ATOM   266  C CD2 . TYR A 1 35  ? 124.652 104.033 26.175  1.00 16.62 ? 35  TYR A CD2 1 
ATOM   267  C CE1 . TYR A 1 35  ? 125.243 106.640 25.549  1.00 18.93 ? 35  TYR A CE1 1 
ATOM   268  C CE2 . TYR A 1 35  ? 123.645 104.962 26.129  1.00 16.42 ? 35  TYR A CE2 1 
ATOM   269  C CZ  . TYR A 1 35  ? 123.926 106.256 25.814  1.00 17.83 ? 35  TYR A CZ  1 
ATOM   270  O OH  . TYR A 1 35  ? 122.934 107.178 25.760  1.00 18.78 ? 35  TYR A OH  1 
ATOM   271  N N   . GLU A 1 36  ? 126.501 104.257 29.448  1.00 17.22 ? 36  GLU A N   1 
ATOM   272  C CA  . GLU A 1 36  ? 125.484 104.211 30.472  1.00 19.00 ? 36  GLU A CA  1 
ATOM   273  C C   . GLU A 1 36  ? 124.073 104.428 29.958  1.00 19.23 ? 36  GLU A C   1 
ATOM   274  O O   . GLU A 1 36  ? 123.747 105.514 29.444  1.00 18.25 ? 36  GLU A O   1 
ATOM   275  C CB  . GLU A 1 36  ? 125.758 105.250 31.546  1.00 22.23 ? 36  GLU A CB  1 
ATOM   276  C CG  . GLU A 1 36  ? 124.756 105.205 32.702  1.00 26.09 ? 36  GLU A CG  1 
ATOM   277  C CD  . GLU A 1 36  ? 125.158 106.186 33.856  1.00 35.99 ? 36  GLU A CD  1 
ATOM   278  O OE1 . GLU A 1 36  ? 126.328 106.430 34.094  1.00 39.57 ? 36  GLU A OE1 1 
ATOM   279  O OE2 . GLU A 1 36  ? 124.304 106.688 34.541  1.00 38.70 ? 36  GLU A OE2 1 
ATOM   280  N N   . PHE A 1 37  ? 123.207 103.436 30.126  1.00 19.06 ? 37  PHE A N   1 
ATOM   281  C CA  . PHE A 1 37  ? 121.774 103.606 29.776  1.00 19.15 ? 37  PHE A CA  1 
ATOM   282  C C   . PHE A 1 37  ? 121.044 104.246 30.920  1.00 19.07 ? 37  PHE A C   1 
ATOM   283  O O   . PHE A 1 37  ? 121.028 103.702 32.063  1.00 19.28 ? 37  PHE A O   1 
ATOM   284  C CB  . PHE A 1 37  ? 121.123 102.273 29.461  1.00 19.15 ? 37  PHE A CB  1 
ATOM   285  C CG  . PHE A 1 37  ? 121.419 101.744 28.085  1.00 18.18 ? 37  PHE A CG  1 
ATOM   286  C CD1 . PHE A 1 37  ? 121.119 102.463 27.010  1.00 17.91 ? 37  PHE A CD1 1 
ATOM   287  C CD2 . PHE A 1 37  ? 121.841 100.431 27.915  1.00 21.15 ? 37  PHE A CD2 1 
ATOM   288  C CE1 . PHE A 1 37  ? 121.302 101.929 25.720  1.00 19.86 ? 37  PHE A CE1 1 
ATOM   289  C CE2 . PHE A 1 37  ? 122.023 99.900  26.628  1.00 22.05 ? 37  PHE A CE2 1 
ATOM   290  C CZ  . PHE A 1 37  ? 121.776 100.680 25.551  1.00 19.04 ? 37  PHE A CZ  1 
ATOM   291  N N   . LYS A 1 38  ? 120.416 105.368 30.649  1.00 18.10 ? 38  LYS A N   1 
ATOM   292  C CA  . LYS A 1 38  ? 119.583 106.014 31.626  1.00 20.26 ? 38  LYS A CA  1 
ATOM   293  C C   . LYS A 1 38  ? 118.131 105.771 31.283  1.00 18.93 ? 38  LYS A C   1 
ATOM   294  O O   . LYS A 1 38  ? 117.777 105.684 30.113  1.00 18.62 ? 38  LYS A O   1 
ATOM   295  C CB  . LYS A 1 38  ? 119.898 107.516 31.672  1.00 24.25 ? 38  LYS A CB  1 
ATOM   296  C CG  . LYS A 1 38  ? 121.319 107.707 32.168  1.00 32.74 ? 38  LYS A CG  1 
ATOM   297  C CD  . LYS A 1 38  ? 121.706 109.158 32.364  1.00 40.14 ? 38  LYS A CD  1 
ATOM   298  C CE  . LYS A 1 38  ? 123.208 109.202 32.670  1.00 46.30 ? 38  LYS A CE  1 
ATOM   299  N NZ  . LYS A 1 38  ? 123.651 110.608 32.573  1.00 59.62 ? 38  LYS A NZ  1 
ATOM   300  N N   . PHE A 1 39  ? 117.284 105.715 32.301  1.00 18.42 ? 39  PHE A N   1 
ATOM   301  C CA  . PHE A 1 39  ? 115.845 105.423 32.128  1.00 18.89 ? 39  PHE A CA  1 
ATOM   302  C C   . PHE A 1 39  ? 115.057 106.461 32.849  1.00 20.43 ? 39  PHE A C   1 
ATOM   303  O O   . PHE A 1 39  ? 115.495 106.929 33.949  1.00 18.98 ? 39  PHE A O   1 
ATOM   304  C CB  . PHE A 1 39  ? 115.517 104.038 32.661  1.00 18.34 ? 39  PHE A CB  1 
ATOM   305  C CG  . PHE A 1 39  ? 116.224 102.944 31.919  1.00 16.99 ? 39  PHE A CG  1 
ATOM   306  C CD1 . PHE A 1 39  ? 117.491 102.537 32.329  1.00 16.73 ? 39  PHE A CD1 1 
ATOM   307  C CD2 . PHE A 1 39  ? 115.601 102.298 30.863  1.00 14.74 ? 39  PHE A CD2 1 
ATOM   308  C CE1 . PHE A 1 39  ? 118.179 101.618 31.605  1.00 16.59 ? 39  PHE A CE1 1 
ATOM   309  C CE2 . PHE A 1 39  ? 116.278 101.343 30.138  1.00 16.70 ? 39  PHE A CE2 1 
ATOM   310  C CZ  . PHE A 1 39  ? 117.559 100.950 30.520  1.00 16.79 ? 39  PHE A CZ  1 
ATOM   311  N N   . ARG A 1 40  ? 113.905 106.843 32.300  1.00 18.30 ? 40  ARG A N   1 
ATOM   312  C CA  . ARG A 1 40  ? 113.076 107.879 32.934  1.00 20.31 ? 40  ARG A CA  1 
ATOM   313  C C   . ARG A 1 40  ? 112.596 107.471 34.323  1.00 24.69 ? 40  ARG A C   1 
ATOM   314  O O   . ARG A 1 40  ? 112.459 108.357 35.231  1.00 20.65 ? 40  ARG A O   1 
ATOM   315  C CB  . ARG A 1 40  ? 111.865 108.212 32.077  1.00 22.13 ? 40  ARG A CB  1 
ATOM   316  C CG  . ARG A 1 40  ? 112.202 108.884 30.783  1.00 21.99 ? 40  ARG A CG  1 
ATOM   317  C CD  . ARG A 1 40  ? 112.745 110.331 30.927  1.00 25.18 ? 40  ARG A CD  1 
ATOM   318  N NE  . ARG A 1 40  ? 113.393 110.679 29.646  1.00 28.93 ? 40  ARG A NE  1 
ATOM   319  C CZ  . ARG A 1 40  ? 112.751 111.149 28.526  1.00 25.66 ? 40  ARG A CZ  1 
ATOM   320  N NH1 . ARG A 1 40  ? 111.490 111.380 28.564  1.00 25.26 ? 40  ARG A NH1 1 
ATOM   321  N NH2 . ARG A 1 40  ? 113.423 111.358 27.368  1.00 25.21 ? 40  ARG A NH2 1 
ATOM   322  N N   . LYS A 1 41  ? 112.335 106.165 34.512  1.00 20.65 ? 41  LYS A N   1 
ATOM   323  C CA  . LYS A 1 41  ? 111.772 105.693 35.770  1.00 22.30 ? 41  LYS A CA  1 
ATOM   324  C C   . LYS A 1 41  ? 112.427 104.494 36.380  1.00 22.29 ? 41  LYS A C   1 
ATOM   325  O O   . LYS A 1 41  ? 111.842 103.841 37.241  1.00 23.60 ? 41  LYS A O   1 
ATOM   326  C CB  . LYS A 1 41  ? 110.239 105.447 35.657  1.00 22.14 ? 41  LYS A CB  1 
ATOM   327  C CG  . LYS A 1 41  ? 109.458 106.634 35.110  1.00 22.22 ? 41  LYS A CG  1 
ATOM   328  C CD  . LYS A 1 41  ? 109.342 107.766 36.132  1.00 24.25 ? 41  LYS A CD  1 
ATOM   329  C CE  . LYS A 1 41  ? 108.599 108.908 35.516  1.00 24.53 ? 41  LYS A CE  1 
ATOM   330  N NZ  . LYS A 1 41  ? 108.436 110.011 36.476  1.00 28.24 ? 41  LYS A NZ  1 
ATOM   331  N N   . GLU A 1 42  ? 113.655 104.231 36.028  1.00 20.12 ? 42  GLU A N   1 
ATOM   332  C CA  . GLU A 1 42  ? 114.437 103.093 36.569  1.00 21.65 ? 42  GLU A CA  1 
ATOM   333  C C   . GLU A 1 42  ? 115.879 103.548 36.731  1.00 21.88 ? 42  GLU A C   1 
ATOM   334  O O   . GLU A 1 42  ? 116.318 104.487 36.082  1.00 21.39 ? 42  GLU A O   1 
ATOM   335  C CB  . GLU A 1 42  ? 114.424 101.870 35.667  1.00 21.64 ? 42  GLU A CB  1 
ATOM   336  C CG  . GLU A 1 42  ? 113.059 101.250 35.454  1.00 24.29 ? 42  GLU A CG  1 
ATOM   337  C CD  . GLU A 1 42  ? 112.481 100.620 36.709  1.00 30.85 ? 42  GLU A CD  1 
ATOM   338  O OE1 . GLU A 1 42  ? 111.179 100.598 36.867  1.00 28.86 ? 42  GLU A OE1 1 
ATOM   339  O OE2 . GLU A 1 42  ? 113.331 100.254 37.542  1.00 30.42 ? 42  GLU A OE2 1 
ATOM   340  N N   . LYS A 1 43  ? 116.605 102.886 37.609  1.00 21.75 ? 43  LYS A N   1 
ATOM   341  C CA  . LYS A 1 43  ? 118.014 103.195 37.783  1.00 24.96 ? 43  LYS A CA  1 
ATOM   342  C C   . LYS A 1 43  ? 118.822 102.854 36.555  1.00 22.33 ? 43  LYS A C   1 
ATOM   343  O O   . LYS A 1 43  ? 118.527 101.930 35.776  1.00 20.75 ? 43  LYS A O   1 
ATOM   344  C CB  . LYS A 1 43  ? 118.621 102.623 39.076  1.00 28.92 ? 43  LYS A CB  1 
ATOM   345  C CG  . LYS A 1 43  ? 118.569 101.142 39.278  1.00 38.47 ? 43  LYS A CG  1 
ATOM   346  C CD  . LYS A 1 43  ? 119.473 100.701 40.486  1.00 43.61 ? 43  LYS A CD  1 
ATOM   347  C CE  . LYS A 1 43  ? 120.880 100.401 39.939  1.00 49.76 ? 43  LYS A CE  1 
ATOM   348  N NZ  . LYS A 1 43  ? 121.859 100.231 41.031  1.00 49.93 ? 43  LYS A NZ  1 
ATOM   349  N N   . ALA A 1 44  ? 119.904 103.601 36.424  1.00 21.42 ? 44  ALA A N   1 
ATOM   350  C CA  . ALA A 1 44  ? 120.777 103.556 35.260  1.00 21.87 ? 44  ALA A CA  1 
ATOM   351  C C   . ALA A 1 44  ? 121.431 102.243 35.187  1.00 23.00 ? 44  ALA A C   1 
ATOM   352  O O   . ALA A 1 44  ? 121.655 101.613 36.225  1.00 21.50 ? 44  ALA A O   1 
ATOM   353  C CB  . ALA A 1 44  ? 121.856 104.658 35.376  1.00 23.89 ? 44  ALA A CB  1 
ATOM   354  N N   . ILE A 1 45  ? 121.748 101.815 33.968  1.00 18.68 ? 45  ILE A N   1 
ATOM   355  C CA  . ILE A 1 45  ? 122.503 100.588 33.732  1.00 20.07 ? 45  ILE A CA  1 
ATOM   356  C C   . ILE A 1 45  ? 123.853 100.957 33.140  1.00 20.95 ? 45  ILE A C   1 
ATOM   357  O O   . ILE A 1 45  ? 123.967 101.368 31.961  1.00 19.85 ? 45  ILE A O   1 
ATOM   358  C CB  . ILE A 1 45  ? 121.810 99.564  32.801  1.00 19.46 ? 45  ILE A CB  1 
ATOM   359  C CG1 . ILE A 1 45  ? 120.478 99.138  33.419  1.00 22.00 ? 45  ILE A CG1 1 
ATOM   360  C CG2 . ILE A 1 45  ? 122.668 98.354  32.595  1.00 19.50 ? 45  ILE A CG2 1 
ATOM   361  C CD1 . ILE A 1 45  ? 119.651 98.277  32.494  1.00 21.27 ? 45  ILE A CD1 1 
ATOM   362  N N   . LYS A 1 46  ? 124.893 100.793 33.968  1.00 19.69 ? 46  LYS A N   1 
ATOM   363  C CA  . LYS A 1 46  ? 126.253 101.158 33.622  1.00 23.27 ? 46  LYS A CA  1 
ATOM   364  C C   . LYS A 1 46  ? 127.090 100.128 32.888  1.00 21.87 ? 46  LYS A C   1 
ATOM   365  O O   . LYS A 1 46  ? 128.072 100.481 32.232  1.00 23.09 ? 46  LYS A O   1 
ATOM   366  C CB  . LYS A 1 46  ? 127.015 101.589 34.899  1.00 26.81 ? 46  LYS A CB  1 
ATOM   367  C CG  . LYS A 1 46  ? 126.423 102.865 35.456  1.00 35.67 ? 46  LYS A CG  1 
ATOM   368  C CD  . LYS A 1 46  ? 127.086 103.325 36.750  1.00 41.25 ? 46  LYS A CD  1 
ATOM   369  C CE  . LYS A 1 46  ? 126.352 104.565 37.204  1.00 48.49 ? 46  LYS A CE  1 
ATOM   370  N NZ  . LYS A 1 46  ? 127.026 105.112 38.412  1.00 57.83 ? 46  LYS A NZ  1 
ATOM   371  N N   A ASN A 1 47  ? 126.753 98.852  33.033  0.50 22.24 ? 47  ASN A N   1 
ATOM   372  N N   B ASN A 1 47  ? 126.740 98.861  33.027  0.50 22.09 ? 47  ASN A N   1 
ATOM   373  C CA  A ASN A 1 47  ? 127.497 97.776  32.389  0.50 21.93 ? 47  ASN A CA  1 
ATOM   374  C CA  B ASN A 1 47  ? 127.474 97.808  32.371  0.50 21.81 ? 47  ASN A CA  1 
ATOM   375  C C   A ASN A 1 47  ? 126.466 96.835  31.843  0.50 20.97 ? 47  ASN A C   1 
ATOM   376  C C   B ASN A 1 47  ? 126.461 96.840  31.841  0.50 20.91 ? 47  ASN A C   1 
ATOM   377  O O   A ASN A 1 47  ? 125.612 96.388  32.592  0.50 20.40 ? 47  ASN A O   1 
ATOM   378  O O   B ASN A 1 47  ? 125.612 96.387  32.593  0.50 20.31 ? 47  ASN A O   1 
ATOM   379  C CB  A ASN A 1 47  ? 128.360 97.010  33.414  0.50 24.51 ? 47  ASN A CB  1 
ATOM   380  C CB  B ASN A 1 47  ? 128.401 97.106  33.352  0.50 24.56 ? 47  ASN A CB  1 
ATOM   381  C CG  A ASN A 1 47  ? 129.456 97.861  34.011  0.50 26.49 ? 47  ASN A CG  1 
ATOM   382  C CG  B ASN A 1 47  ? 129.527 96.402  32.646  0.50 26.82 ? 47  ASN A CG  1 
ATOM   383  O OD1 A ASN A 1 47  ? 129.289 98.445  35.068  0.50 33.39 ? 47  ASN A OD1 1 
ATOM   384  O OD1 B ASN A 1 47  ? 130.678 96.825  32.687  0.50 36.00 ? 47  ASN A OD1 1 
ATOM   385  N ND2 A ASN A 1 47  ? 130.562 97.955  33.332  0.50 27.26 ? 47  ASN A ND2 1 
ATOM   386  N ND2 B ASN A 1 47  ? 129.201 95.353  31.971  0.50 25.62 ? 47  ASN A ND2 1 
ATOM   387  N N   . HIS A 1 48  ? 126.521 96.535  30.558  1.00 19.60 ? 48  HIS A N   1 
ATOM   388  C CA  . HIS A 1 48  ? 125.476 95.742  29.923  1.00 18.25 ? 48  HIS A CA  1 
ATOM   389  C C   . HIS A 1 48  ? 126.024 95.149  28.690  1.00 19.10 ? 48  HIS A C   1 
ATOM   390  O O   . HIS A 1 48  ? 127.203 95.372  28.327  1.00 18.36 ? 48  HIS A O   1 
ATOM   391  C CB  . HIS A 1 48  ? 124.249 96.638  29.634  1.00 19.54 ? 48  HIS A CB  1 
ATOM   392  C CG  . HIS A 1 48  ? 124.597 97.827  28.832  1.00 18.34 ? 48  HIS A CG  1 
ATOM   393  N ND1 . HIS A 1 48  ? 124.958 97.734  27.499  1.00 20.34 ? 48  HIS A ND1 1 
ATOM   394  C CD2 . HIS A 1 48  ? 124.899 99.089  29.228  1.00 16.32 ? 48  HIS A CD2 1 
ATOM   395  C CE1 . HIS A 1 48  ? 125.363 98.927  27.096  1.00 18.24 ? 48  HIS A CE1 1 
ATOM   396  N NE2 . HIS A 1 48  ? 125.330 99.754  28.127  1.00 16.87 ? 48  HIS A NE2 1 
ATOM   397  N N   . LYS A 1 49  ? 125.191 94.363  28.013  1.00 18.17 ? 49  LYS A N   1 
ATOM   398  C CA  . LYS A 1 49  ? 125.605 93.773  26.760  1.00 17.06 ? 49  LYS A CA  1 
ATOM   399  C C   . LYS A 1 49  ? 125.761 94.832  25.663  1.00 17.98 ? 49  LYS A C   1 
ATOM   400  O O   . LYS A 1 49  ? 125.011 95.805  25.613  1.00 19.12 ? 49  LYS A O   1 
ATOM   401  C CB  . LYS A 1 49  ? 124.575 92.712  26.351  1.00 19.09 ? 49  LYS A CB  1 
ATOM   402  C CG  . LYS A 1 49  ? 124.546 91.529  27.318  1.00 20.39 ? 49  LYS A CG  1 
ATOM   403  C CD  . LYS A 1 49  ? 123.285 90.610  27.169  1.00 20.15 ? 49  LYS A CD  1 
ATOM   404  C CE  . LYS A 1 49  ? 123.266 89.573  28.340  1.00 20.19 ? 49  LYS A CE  1 
ATOM   405  N NZ  . LYS A 1 49  ? 124.500 88.743  28.321  1.00 20.67 ? 49  LYS A NZ  1 
ATOM   406  N N   . SER A 1 50  ? 126.710 94.663  24.745  1.00 16.15 ? 50  SER A N   1 
ATOM   407  C CA  . SER A 1 50  ? 126.839 95.633  23.680  1.00 18.72 ? 50  SER A CA  1 
ATOM   408  C C   . SER A 1 50  ? 125.794 95.360  22.582  1.00 18.90 ? 50  SER A C   1 
ATOM   409  O O   . SER A 1 50  ? 125.344 94.233  22.421  1.00 18.86 ? 50  SER A O   1 
ATOM   410  C CB  . SER A 1 50  ? 128.220 95.639  23.108  1.00 19.23 ? 50  SER A CB  1 
ATOM   411  O OG  . SER A 1 50  ? 128.455 94.365  22.619  1.00 23.65 ? 50  SER A OG  1 
ATOM   412  N N   . LEU A 1 51  ? 125.464 96.410  21.849  1.00 19.19 ? 51  LEU A N   1 
ATOM   413  C CA  . LEU A 1 51  ? 124.447 96.353  20.841  1.00 18.83 ? 51  LEU A CA  1 
ATOM   414  C C   . LEU A 1 51  ? 124.981 96.913  19.498  1.00 18.04 ? 51  LEU A C   1 
ATOM   415  O O   . LEU A 1 51  ? 125.743 97.868  19.447  1.00 15.76 ? 51  LEU A O   1 
ATOM   416  C CB  . LEU A 1 51  ? 123.261 97.278  21.227  1.00 20.64 ? 51  LEU A CB  1 
ATOM   417  C CG  . LEU A 1 51  ? 122.584 97.173  22.576  1.00 25.60 ? 51  LEU A CG  1 
ATOM   418  C CD1 . LEU A 1 51  ? 121.187 97.782  22.430  1.00 30.19 ? 51  LEU A CD1 1 
ATOM   419  C CD2 . LEU A 1 51  ? 122.396 95.809  23.103  1.00 24.94 ? 51  LEU A CD2 1 
ATOM   420  N N   . ILE A 1 52  ? 124.460 96.346  18.415  1.00 15.94 ? 52  ILE A N   1 
ATOM   421  C CA  . ILE A 1 52  ? 124.577 96.975  17.111  1.00 17.68 ? 52  ILE A CA  1 
ATOM   422  C C   . ILE A 1 52  ? 123.170 97.014  16.487  1.00 17.27 ? 52  ILE A C   1 
ATOM   423  O O   . ILE A 1 52  ? 122.499 96.002  16.525  1.00 15.53 ? 52  ILE A O   1 
ATOM   424  C CB  . ILE A 1 52  ? 125.526 96.245  16.170  1.00 16.32 ? 52  ILE A CB  1 
ATOM   425  C CG1 . ILE A 1 52  ? 125.648 96.996  14.871  1.00 18.52 ? 52  ILE A CG1 1 
ATOM   426  C CG2 . ILE A 1 52  ? 125.197 94.769  15.984  1.00 17.37 ? 52  ILE A CG2 1 
ATOM   427  C CD1 . ILE A 1 52  ? 126.901 96.595  14.061  1.00 19.20 ? 52  ILE A CD1 1 
ATOM   428  N N   . GLY A 1 53  ? 122.810 98.153  15.895  1.00 15.39 ? 53  GLY A N   1 
ATOM   429  C CA  . GLY A 1 53  ? 121.519 98.233  15.238  1.00 15.20 ? 53  GLY A CA  1 
ATOM   430  C C   . GLY A 1 53  ? 121.374 99.486  14.436  1.00 15.74 ? 53  GLY A C   1 
ATOM   431  O O   . GLY A 1 53  ? 122.381 100.136 14.103  1.00 15.71 ? 53  GLY A O   1 
ATOM   432  N N   . VAL A 1 54  ? 120.113 99.780  14.079  1.00 14.36 ? 54  VAL A N   1 
ATOM   433  C CA  . VAL A 1 54  ? 119.776 100.893 13.215  1.00 15.92 ? 54  VAL A CA  1 
ATOM   434  C C   . VAL A 1 54  ? 118.812 101.766 13.932  1.00 15.88 ? 54  VAL A C   1 
ATOM   435  O O   . VAL A 1 54  ? 117.851 101.303 14.526  1.00 14.26 ? 54  VAL A O   1 
ATOM   436  C CB  . VAL A 1 54  ? 119.155 100.399 11.850  1.00 16.11 ? 54  VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 54  ? 118.839 101.577 10.998  1.00 18.45 ? 54  VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 54  ? 120.127 99.414  11.199  1.00 15.77 ? 54  VAL A CG2 1 
ATOM   439  N N   . GLY A 1 55  ? 119.054 103.055 13.817  1.00 16.17 ? 55  GLY A N   1 
ATOM   440  C CA  . GLY A 1 55  ? 118.198 104.039 14.455  1.00 14.87 ? 55  GLY A CA  1 
ATOM   441  C C   . GLY A 1 55  ? 118.711 105.466 14.257  1.00 14.73 ? 55  GLY A C   1 
ATOM   442  O O   . GLY A 1 55  ? 119.422 105.748 13.284  1.00 14.51 ? 55  GLY A O   1 
ATOM   443  N N   . ILE A 1 56  ? 118.372 106.343 15.197  1.00 15.24 ? 56  ILE A N   1 
ATOM   444  C CA  . ILE A 1 56  ? 118.944 107.688 15.219  1.00 16.33 ? 56  ILE A CA  1 
ATOM   445  C C   . ILE A 1 56  ? 119.569 107.917 16.599  1.00 16.81 ? 56  ILE A C   1 
ATOM   446  O O   . ILE A 1 56  ? 119.136 107.318 17.585  1.00 16.52 ? 56  ILE A O   1 
ATOM   447  C CB  . ILE A 1 56  ? 117.882 108.759 14.821  1.00 17.49 ? 56  ILE A CB  1 
ATOM   448  C CG1 . ILE A 1 56  ? 116.728 108.794 15.823  1.00 17.33 ? 56  ILE A CG1 1 
ATOM   449  C CG2 . ILE A 1 56  ? 117.396 108.552 13.395  1.00 19.54 ? 56  ILE A CG2 1 
ATOM   450  C CD1 . ILE A 1 56  ? 115.777 109.953 15.649  1.00 18.52 ? 56  ILE A CD1 1 
ATOM   451  N N   . VAL A 1 57  ? 120.470 108.868 16.709  1.00 17.16 ? 57  VAL A N   1 
ATOM   452  C CA  . VAL A 1 57  ? 120.940 109.285 18.040  1.00 17.18 ? 57  VAL A CA  1 
ATOM   453  C C   . VAL A 1 57  ? 120.454 110.710 18.295  1.00 18.06 ? 57  VAL A C   1 
ATOM   454  O O   . VAL A 1 57  ? 120.622 111.601 17.465  1.00 20.84 ? 57  VAL A O   1 
ATOM   455  C CB  . VAL A 1 57  ? 122.471 109.243 18.121  1.00 16.19 ? 57  VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 57  ? 122.977 109.857 19.423  1.00 15.52 ? 57  VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 57  ? 122.981 107.860 17.982  1.00 17.92 ? 57  VAL A CG2 1 
ATOM   458  N N   . ALA A 1 58  ? 119.793 110.901 19.402  1.00 17.99 ? 58  ALA A N   1 
ATOM   459  C CA  . ALA A 1 58  ? 119.303 112.201 19.814  1.00 18.31 ? 58  ALA A CA  1 
ATOM   460  C C   . ALA A 1 58  ? 119.709 112.404 21.259  1.00 20.40 ? 58  ALA A C   1 
ATOM   461  O O   . ALA A 1 58  ? 119.510 111.518 22.080  1.00 17.15 ? 58  ALA A O   1 
ATOM   462  C CB  . ALA A 1 58  ? 117.819 112.298 19.684  1.00 19.90 ? 58  ALA A CB  1 
ATOM   463  N N   A ASN A 1 59  ? 120.244 113.601 21.547  0.65 20.45 ? 59  ASN A N   1 
ATOM   464  N N   B ASN A 1 59  ? 120.201 113.602 21.615  0.35 21.61 ? 59  ASN A N   1 
ATOM   465  C CA  A ASN A 1 59  ? 120.756 113.928 22.880  0.65 19.96 ? 59  ASN A CA  1 
ATOM   466  C CA  B ASN A 1 59  ? 120.777 113.863 22.969  0.35 22.39 ? 59  ASN A CA  1 
ATOM   467  C C   A ASN A 1 59  ? 121.644 112.813 23.449  0.65 19.28 ? 59  ASN A C   1 
ATOM   468  C C   B ASN A 1 59  ? 121.672 112.791 23.467  0.35 20.70 ? 59  ASN A C   1 
ATOM   469  O O   A ASN A 1 59  ? 121.480 112.433 24.589  0.65 17.81 ? 59  ASN A O   1 
ATOM   470  O O   B ASN A 1 59  ? 121.513 112.401 24.613  0.35 19.90 ? 59  ASN A O   1 
ATOM   471  C CB  A ASN A 1 59  ? 119.572 114.279 23.801  0.65 21.58 ? 59  ASN A CB  1 
ATOM   472  C CB  B ASN A 1 59  ? 119.749 113.870 24.092  0.35 25.66 ? 59  ASN A CB  1 
ATOM   473  C CG  A ASN A 1 59  ? 118.698 115.392 23.224  0.65 27.80 ? 59  ASN A CG  1 
ATOM   474  C CG  B ASN A 1 59  ? 119.523 115.197 24.677  0.35 30.25 ? 59  ASN A CG  1 
ATOM   475  O OD1 A ASN A 1 59  ? 119.195 116.329 22.578  0.65 29.31 ? 59  ASN A OD1 1 
ATOM   476  O OD1 B ASN A 1 59  ? 120.436 115.788 25.274  0.35 35.04 ? 59  ASN A OD1 1 
ATOM   477  N ND2 A ASN A 1 59  ? 117.379 115.314 23.476  0.65 29.27 ? 59  ASN A ND2 1 
ATOM   478  N ND2 B ASN A 1 59  ? 118.274 115.661 24.585  0.35 35.39 ? 59  ASN A ND2 1 
ATOM   479  N N   . ASP A 1 60  ? 122.515 112.257 22.609  1.00 18.26 ? 60  ASP A N   1 
ATOM   480  C CA  . ASP A 1 60  ? 123.440 111.204 22.965  1.00 19.78 ? 60  ASP A CA  1 
ATOM   481  C C   . ASP A 1 60  ? 122.786 109.900 23.445  1.00 19.12 ? 60  ASP A C   1 
ATOM   482  O O   . ASP A 1 60  ? 123.394 109.175 24.253  1.00 18.41 ? 60  ASP A O   1 
ATOM   483  C CB  . ASP A 1 60  ? 124.456 111.638 24.049  1.00 21.00 ? 60  ASP A CB  1 
ATOM   484  C CG  . ASP A 1 60  ? 125.648 110.713 24.105  1.00 21.04 ? 60  ASP A CG  1 
ATOM   485  O OD1 . ASP A 1 60  ? 126.100 110.181 23.081  1.00 25.38 ? 60  ASP A OD1 1 
ATOM   486  O OD2 . ASP A 1 60  ? 126.134 110.435 25.196  1.00 21.39 ? 60  ASP A OD2 1 
ATOM   487  N N   . TYR A 1 61  ? 121.575 109.662 22.969  1.00 15.17 ? 61  TYR A N   1 
ATOM   488  C CA  . TYR A 1 61  ? 120.766 108.482 23.334  1.00 16.30 ? 61  TYR A CA  1 
ATOM   489  C C   . TYR A 1 61  ? 120.516 107.679 22.023  1.00 16.40 ? 61  TYR A C   1 
ATOM   490  O O   . TYR A 1 61  ? 120.071 108.251 21.050  1.00 16.77 ? 61  TYR A O   1 
ATOM   491  C CB  . TYR A 1 61  ? 119.459 108.871 23.960  1.00 16.50 ? 61  TYR A CB  1 
ATOM   492  C CG  . TYR A 1 61  ? 118.747 107.646 24.595  1.00 16.51 ? 61  TYR A CG  1 
ATOM   493  C CD1 . TYR A 1 61  ? 119.135 107.155 25.862  1.00 18.10 ? 61  TYR A CD1 1 
ATOM   494  C CD2 . TYR A 1 61  ? 117.782 106.918 23.897  1.00 17.03 ? 61  TYR A CD2 1 
ATOM   495  C CE1 . TYR A 1 61  ? 118.544 106.009 26.391  1.00 18.30 ? 61  TYR A CE1 1 
ATOM   496  C CE2 . TYR A 1 61  ? 117.206 105.758 24.413  1.00 15.62 ? 61  TYR A CE2 1 
ATOM   497  C CZ  . TYR A 1 61  ? 117.591 105.296 25.628  1.00 19.24 ? 61  TYR A CZ  1 
ATOM   498  O OH  . TYR A 1 61  ? 117.024 104.121 26.127  1.00 18.88 ? 61  TYR A OH  1 
ATOM   499  N N   . PRO A 1 62  ? 120.782 106.383 22.023  1.00 15.87 ? 62  PRO A N   1 
ATOM   500  C CA  . PRO A 1 62  ? 120.508 105.607 20.838  1.00 15.32 ? 62  PRO A CA  1 
ATOM   501  C C   . PRO A 1 62  ? 119.013 105.158 20.746  1.00 17.14 ? 62  PRO A C   1 
ATOM   502  O O   . PRO A 1 62  ? 118.567 104.302 21.525  1.00 16.41 ? 62  PRO A O   1 
ATOM   503  C CB  . PRO A 1 62  ? 121.401 104.407 21.031  1.00 16.14 ? 62  PRO A CB  1 
ATOM   504  C CG  . PRO A 1 62  ? 121.367 104.149 22.543  1.00 16.67 ? 62  PRO A CG  1 
ATOM   505  C CD  . PRO A 1 62  ? 121.247 105.545 23.144  1.00 16.95 ? 62  PRO A CD  1 
ATOM   506  N N   . LEU A 1 63  ? 118.280 105.710 19.805  1.00 14.41 ? 63  LEU A N   1 
ATOM   507  C CA  . LEU A 1 63  ? 116.891 105.395 19.546  1.00 14.40 ? 63  LEU A CA  1 
ATOM   508  C C   . LEU A 1 63  ? 116.840 104.374 18.434  1.00 16.05 ? 63  LEU A C   1 
ATOM   509  O O   . LEU A 1 63  ? 116.790 104.681 17.236  1.00 15.28 ? 63  LEU A O   1 
ATOM   510  C CB  . LEU A 1 63  ? 116.096 106.622 19.178  1.00 14.15 ? 63  LEU A CB  1 
ATOM   511  C CG  . LEU A 1 63  ? 116.063 107.661 20.284  1.00 15.53 ? 63  LEU A CG  1 
ATOM   512  C CD1 . LEU A 1 63  ? 115.552 108.990 19.738  1.00 16.51 ? 63  LEU A CD1 1 
ATOM   513  C CD2 . LEU A 1 63  ? 115.090 107.165 21.374  1.00 16.45 ? 63  LEU A CD2 1 
ATOM   514  N N   . TYR A 1 64  ? 116.895 103.108 18.844  1.00 15.11 ? 64  TYR A N   1 
ATOM   515  C CA  . TYR A 1 64  ? 116.913 101.998 17.903  1.00 14.97 ? 64  TYR A CA  1 
ATOM   516  C C   . TYR A 1 64  ? 115.526 101.657 17.323  1.00 14.12 ? 64  TYR A C   1 
ATOM   517  O O   . TYR A 1 64  ? 114.511 101.621 18.046  1.00 13.67 ? 64  TYR A O   1 
ATOM   518  C CB  . TYR A 1 64  ? 117.407 100.752 18.619  1.00 14.48 ? 64  TYR A CB  1 
ATOM   519  C CG  . TYR A 1 64  ? 118.906 100.701 18.806  1.00 15.21 ? 64  TYR A CG  1 
ATOM   520  C CD1 . TYR A 1 64  ? 119.726 100.559 17.739  1.00 15.90 ? 64  TYR A CD1 1 
ATOM   521  C CD2 . TYR A 1 64  ? 119.459 100.758 20.075  1.00 15.15 ? 64  TYR A CD2 1 
ATOM   522  C CE1 . TYR A 1 64  ? 121.101 100.574 17.895  1.00 18.45 ? 64  TYR A CE1 1 
ATOM   523  C CE2 . TYR A 1 64  ? 120.852 100.726 20.265  1.00 17.87 ? 64  TYR A CE2 1 
ATOM   524  C CZ  . TYR A 1 64  ? 121.676 100.597 19.171  1.00 17.53 ? 64  TYR A CZ  1 
ATOM   525  O OH  . TYR A 1 64  ? 123.012 100.509 19.316  1.00 14.91 ? 64  TYR A OH  1 
ATOM   526  N N   . PHE A 1 65  ? 115.496 101.378 16.028  1.00 14.66 ? 65  PHE A N   1 
ATOM   527  C CA  . PHE A 1 65  ? 114.347 100.740 15.352  1.00 14.99 ? 65  PHE A CA  1 
ATOM   528  C C   . PHE A 1 65  ? 114.425 99.269  15.392  1.00 13.66 ? 65  PHE A C   1 
ATOM   529  O O   . PHE A 1 65  ? 113.393 98.570  15.442  1.00 14.09 ? 65  PHE A O   1 
ATOM   530  C CB  . PHE A 1 65  ? 114.247 101.209 13.892  1.00 17.64 ? 65  PHE A CB  1 
ATOM   531  C CG  . PHE A 1 65  ? 114.174 102.724 13.759  1.00 20.69 ? 65  PHE A CG  1 
ATOM   532  C CD1 . PHE A 1 65  ? 113.712 103.554 14.826  1.00 27.89 ? 65  PHE A CD1 1 
ATOM   533  C CD2 . PHE A 1 65  ? 114.620 103.338 12.641  1.00 22.11 ? 65  PHE A CD2 1 
ATOM   534  C CE1 . PHE A 1 65  ? 113.710 104.961 14.725  1.00 31.33 ? 65  PHE A CE1 1 
ATOM   535  C CE2 . PHE A 1 65  ? 114.499 104.720 12.475  1.00 27.07 ? 65  PHE A CE2 1 
ATOM   536  C CZ  . PHE A 1 65  ? 114.096 105.545 13.505  1.00 26.44 ? 65  PHE A CZ  1 
ATOM   537  N N   . ASP A 1 66  ? 115.652 98.765  15.413  1.00 13.25 ? 66  ASP A N   1 
ATOM   538  C CA  . ASP A 1 66  ? 115.943 97.423  15.581  1.00 11.98 ? 66  ASP A CA  1 
ATOM   539  C C   . ASP A 1 66  ? 117.437 97.295  15.975  1.00 13.58 ? 66  ASP A C   1 
ATOM   540  O O   . ASP A 1 66  ? 118.236 98.210  15.730  1.00 12.39 ? 66  ASP A O   1 
ATOM   541  C CB  . ASP A 1 66  ? 115.622 96.605  14.297  1.00 12.18 ? 66  ASP A CB  1 
ATOM   542  C CG  . ASP A 1 66  ? 116.146 97.238  13.050  1.00 13.71 ? 66  ASP A CG  1 
ATOM   543  O OD1 . ASP A 1 66  ? 117.382 97.070  12.781  1.00 13.23 ? 66  ASP A OD1 1 
ATOM   544  O OD2 . ASP A 1 66  ? 115.355 97.890  12.334  1.00 13.50 ? 66  ASP A OD2 1 
ATOM   545  N N   . ALA A 1 67  ? 117.797 96.139  16.536  1.00 13.28 ? 67  ALA A N   1 
ATOM   546  C CA  . ALA A 1 67  ? 119.181 95.910  16.999  1.00 14.13 ? 67  ALA A CA  1 
ATOM   547  C C   . ALA A 1 67  ? 119.347 94.471  17.396  1.00 14.97 ? 67  ALA A C   1 
ATOM   548  O O   . ALA A 1 67  ? 118.354 93.729  17.581  1.00 13.18 ? 67  ALA A O   1 
ATOM   549  C CB  . ALA A 1 67  ? 119.492 96.803  18.195  1.00 14.33 ? 67  ALA A CB  1 
ATOM   550  N N   . ILE A 1 68  ? 120.593 94.069  17.475  1.00 15.56 ? 68  ILE A N   1 
ATOM   551  C CA  . ILE A 1 68  ? 120.958 92.826  18.166  1.00 15.03 ? 68  ILE A CA  1 
ATOM   552  C C   . ILE A 1 68  ? 121.992 93.130  19.244  1.00 14.70 ? 68  ILE A C   1 
ATOM   553  O O   . ILE A 1 68  ? 122.623 94.193  19.209  1.00 14.88 ? 68  ILE A O   1 
ATOM   554  C CB  . ILE A 1 68  ? 121.506 91.757  17.188  1.00 14.88 ? 68  ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 68  ? 122.849 92.183  16.572  1.00 13.28 ? 68  ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 68  ? 120.487 91.474  16.074  1.00 14.93 ? 68  ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 68  ? 123.603 91.056  15.888  1.00 15.00 ? 68  ILE A CD1 1 
ATOM   558  N N   . ASN A 1 69  ? 122.221 92.145  20.124  1.00 15.17 ? 69  ASN A N   1 
ATOM   559  C CA  . ASN A 1 69  ? 123.276 92.258  21.152  1.00 16.58 ? 69  ASN A CA  1 
ATOM   560  C C   . ASN A 1 69  ? 124.383 91.288  20.884  1.00 16.98 ? 69  ASN A C   1 
ATOM   561  O O   . ASN A 1 69  ? 124.360 90.524  19.913  1.00 15.04 ? 69  ASN A O   1 
ATOM   562  C CB  . ASN A 1 69  ? 122.703 92.168  22.556  1.00 16.07 ? 69  ASN A CB  1 
ATOM   563  C CG  . ASN A 1 69  ? 122.224 90.779  22.934  1.00 14.85 ? 69  ASN A CG  1 
ATOM   564  O OD1 . ASN A 1 69  ? 122.511 89.790  22.277  1.00 16.33 ? 69  ASN A OD1 1 
ATOM   565  N ND2 . ASN A 1 69  ? 121.468 90.728  24.032  1.00 15.99 ? 69  ASN A ND2 1 
ATOM   566  N N   . GLU A 1 70  ? 125.411 91.363  21.728  1.00 17.08 ? 70  GLU A N   1 
ATOM   567  C CA  . GLU A 1 70  ? 126.593 90.550  21.582  1.00 17.90 ? 70  GLU A CA  1 
ATOM   568  C C   . GLU A 1 70  ? 126.313 89.049  21.703  1.00 18.99 ? 70  GLU A C   1 
ATOM   569  O O   . GLU A 1 70  ? 127.164 88.237  21.310  1.00 20.26 ? 70  GLU A O   1 
ATOM   570  C CB  . GLU A 1 70  ? 127.616 90.975  22.626  1.00 19.89 ? 70  GLU A CB  1 
ATOM   571  C CG  . GLU A 1 70  ? 127.195 90.609  24.036  1.00 20.65 ? 70  GLU A CG  1 
ATOM   572  C CD  . GLU A 1 70  ? 128.104 91.187  25.142  1.00 24.37 ? 70  GLU A CD  1 
ATOM   573  O OE1 . GLU A 1 70  ? 128.410 92.377  25.142  1.00 20.45 ? 70  GLU A OE1 1 
ATOM   574  O OE2 . GLU A 1 70  ? 128.321 90.440  26.144  1.00 27.02 ? 70  GLU A OE2 1 
ATOM   575  N N   . ASP A 1 71  ? 125.157 88.645  22.246  1.00 17.36 ? 71  ASP A N   1 
ATOM   576  C CA  . ASP A 1 71  ? 124.781 87.265  22.335  1.00 18.83 ? 71  ASP A CA  1 
ATOM   577  C C   . ASP A 1 71  ? 123.943 86.775  21.117  1.00 18.58 ? 71  ASP A C   1 
ATOM   578  O O   . ASP A 1 71  ? 123.548 85.618  21.066  1.00 18.93 ? 71  ASP A O   1 
ATOM   579  C CB  . ASP A 1 71  ? 123.983 86.999  23.595  1.00 18.74 ? 71  ASP A CB  1 
ATOM   580  C CG  . ASP A 1 71  ? 124.774 87.300  24.830  1.00 23.22 ? 71  ASP A CG  1 
ATOM   581  O OD1 . ASP A 1 71  ? 125.996 87.000  24.771  1.00 23.45 ? 71  ASP A OD1 1 
ATOM   582  O OD2 . ASP A 1 71  ? 124.193 87.773  25.839  1.00 24.66 ? 71  ASP A OD2 1 
ATOM   583  N N   . GLY A 1 72  ? 123.642 87.633  20.157  1.00 19.69 ? 72  GLY A N   1 
ATOM   584  C CA  . GLY A 1 72  ? 122.780 87.212  19.041  1.00 19.48 ? 72  GLY A CA  1 
ATOM   585  C C   . GLY A 1 72  ? 121.309 87.203  19.359  1.00 17.11 ? 72  GLY A C   1 
ATOM   586  O O   . GLY A 1 72  ? 120.539 86.499  18.690  1.00 16.98 ? 72  GLY A O   1 
ATOM   587  N N   . LEU A 1 73  ? 120.892 87.958  20.361  1.00 15.13 ? 73  LEU A N   1 
ATOM   588  C CA  . LEU A 1 73  ? 119.498 88.237  20.604  1.00 13.62 ? 73  LEU A CA  1 
ATOM   589  C C   . LEU A 1 73  ? 119.138 89.535  19.816  1.00 15.15 ? 73  LEU A C   1 
ATOM   590  O O   . LEU A 1 73  ? 119.771 90.610  19.988  1.00 14.67 ? 73  LEU A O   1 
ATOM   591  C CB  . LEU A 1 73  ? 119.215 88.473  22.087  1.00 13.95 ? 73  LEU A CB  1 
ATOM   592  C CG  . LEU A 1 73  ? 117.745 88.709  22.479  1.00 13.55 ? 73  LEU A CG  1 
ATOM   593  C CD1 . LEU A 1 73  ? 116.847 87.503  22.148  1.00 14.19 ? 73  LEU A CD1 1 
ATOM   594  C CD2 . LEU A 1 73  ? 117.606 89.040  23.934  1.00 15.67 ? 73  LEU A CD2 1 
ATOM   595  N N   . GLY A 1 74  ? 118.033 89.476  19.099  1.00 14.33 ? 74  GLY A N   1 
ATOM   596  C CA  . GLY A 1 74  ? 117.531 90.590  18.283  1.00 14.50 ? 74  GLY A CA  1 
ATOM   597  C C   . GLY A 1 74  ? 116.149 91.068  18.691  1.00 12.89 ? 74  GLY A C   1 
ATOM   598  O O   . GLY A 1 74  ? 115.329 90.317  19.241  1.00 12.48 ? 74  GLY A O   1 
ATOM   599  N N   . MET A 1 75  ? 115.879 92.367  18.471  1.00 12.74 ? 75  MET A N   1 
ATOM   600  C CA  . MET A 1 75  ? 114.601 92.956  18.745  1.00 12.80 ? 75  MET A CA  1 
ATOM   601  C C   . MET A 1 75  ? 114.303 94.067  17.733  1.00 14.09 ? 75  MET A C   1 
ATOM   602  O O   . MET A 1 75  ? 115.202 94.890  17.401  1.00 14.59 ? 75  MET A O   1 
ATOM   603  C CB  . MET A 1 75  ? 114.525 93.527  20.176  1.00 13.24 ? 75  MET A CB  1 
ATOM   604  C CG  . MET A 1 75  ? 113.172 94.072  20.618  1.00 13.56 ? 75  MET A CG  1 
ATOM   605  S SD  . MET A 1 75  ? 113.318 94.264  22.427  1.00 14.84 ? 75  MET A SD  1 
ATOM   606  C CE  . MET A 1 75  ? 111.763 95.077  22.790  1.00 15.14 ? 75  MET A CE  1 
ATOM   607  N N   . ALA A 1 76  ? 113.069 94.062  17.255  1.00 14.11 ? 76  ALA A N   1 
ATOM   608  C CA  . ALA A 1 76  ? 112.624 95.141  16.333  1.00 16.28 ? 76  ALA A CA  1 
ATOM   609  C C   . ALA A 1 76  ? 111.290 95.675  16.758  1.00 14.18 ? 76  ALA A C   1 
ATOM   610  O O   . ALA A 1 76  ? 110.411 94.916  17.099  1.00 14.55 ? 76  ALA A O   1 
ATOM   611  C CB  . ALA A 1 76  ? 112.540 94.552  14.902  1.00 16.45 ? 76  ALA A CB  1 
ATOM   612  N N   . GLY A 1 77  ? 111.119 96.998  16.685  1.00 13.66 ? 77  GLY A N   1 
ATOM   613  C CA  . GLY A 1 77  ? 109.857 97.659  16.907  1.00 12.84 ? 77  GLY A CA  1 
ATOM   614  C C   . GLY A 1 77  ? 109.219 97.971  15.558  1.00 12.89 ? 77  GLY A C   1 
ATOM   615  O O   . GLY A 1 77  ? 109.855 98.563  14.670  1.00 12.15 ? 77  GLY A O   1 
ATOM   616  N N   . LEU A 1 78  ? 107.979 97.518  15.396  1.00 12.69 ? 78  LEU A N   1 
ATOM   617  C CA  . LEU A 1 78  ? 107.187 97.703  14.180  1.00 13.26 ? 78  LEU A CA  1 
ATOM   618  C C   . LEU A 1 78  ? 105.923 98.463  14.477  1.00 13.33 ? 78  LEU A C   1 
ATOM   619  O O   . LEU A 1 78  ? 105.303 98.276  15.531  1.00 13.74 ? 78  LEU A O   1 
ATOM   620  C CB  . LEU A 1 78  ? 106.814 96.318  13.583  1.00 13.81 ? 78  LEU A CB  1 
ATOM   621  C CG  . LEU A 1 78  ? 108.002 95.576  12.895  1.00 14.73 ? 78  LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 78  ? 108.986 95.018  13.864  1.00 17.76 ? 78  LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 78  ? 107.487 94.454  11.999  1.00 14.15 ? 78  LEU A CD2 1 
ATOM   624  N N   . ASN A 1 79  ? 105.481 99.314  13.554  1.00 13.81 ? 79  ASN A N   1 
ATOM   625  C CA  . ASN A 1 79  ? 104.259 100.084 13.798  1.00 15.45 ? 79  ASN A CA  1 
ATOM   626  C C   . ASN A 1 79  ? 103.013 99.211  14.099  1.00 15.34 ? 79  ASN A C   1 
ATOM   627  O O   . ASN A 1 79  ? 102.839 98.130  13.531  1.00 12.70 ? 79  ASN A O   1 
ATOM   628  C CB  . ASN A 1 79  ? 103.984 101.059 12.624  1.00 19.36 ? 79  ASN A CB  1 
ATOM   629  C CG  . ASN A 1 79  ? 105.012 102.168 12.528  1.00 29.38 ? 79  ASN A CG  1 
ATOM   630  O OD1 . ASN A 1 79  ? 105.510 102.486 11.420  1.00 43.15 ? 79  ASN A OD1 1 
ATOM   631  N ND2 . ASN A 1 79  ? 105.415 102.701 13.659  1.00 30.78 ? 79  ASN A ND2 1 
ATOM   632  N N   . PHE A 1 80  ? 102.230 99.670  15.083  1.00 13.27 ? 80  PHE A N   1 
ATOM   633  C CA  . PHE A 1 80  ? 101.073 98.955  15.637  1.00 14.74 ? 80  PHE A CA  1 
ATOM   634  C C   . PHE A 1 80  ? 100.064 100.024 16.087  1.00 15.26 ? 80  PHE A C   1 
ATOM   635  O O   . PHE A 1 80  ? 99.771  100.136 17.238  1.00 14.71 ? 80  PHE A O   1 
ATOM   636  C CB  . PHE A 1 80  ? 101.583 98.124  16.787  1.00 18.31 ? 80  PHE A CB  1 
ATOM   637  C CG  . PHE A 1 80  ? 100.631 97.064  17.327  1.00 17.28 ? 80  PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 80  ? 100.125 96.090  16.485  1.00 19.41 ? 80  PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 80  ? 100.416 96.953  18.692  1.00 19.45 ? 80  PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 80  ? 99.326  95.058  16.987  1.00 18.71 ? 80  PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 80  ? 99.633  95.903  19.210  1.00 22.50 ? 80  PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 80  ? 99.078  94.980  18.335  1.00 19.83 ? 80  PHE A CZ  1 
ATOM   643  N N   . PRO A 1 81  ? 99.583  100.809 15.148  1.00 15.47 ? 81  PRO A N   1 
ATOM   644  C CA  . PRO A 1 81  ? 98.806  102.011 15.567  1.00 16.43 ? 81  PRO A CA  1 
ATOM   645  C C   . PRO A 1 81  ? 97.478  101.650 16.184  1.00 19.09 ? 81  PRO A C   1 
ATOM   646  O O   . PRO A 1 81  ? 96.815  100.680 15.753  1.00 16.56 ? 81  PRO A O   1 
ATOM   647  C CB  . PRO A 1 81  ? 98.593  102.782 14.236  1.00 16.61 ? 81  PRO A CB  1 
ATOM   648  C CG  . PRO A 1 81  ? 98.678  101.718 13.120  1.00 17.34 ? 81  PRO A CG  1 
ATOM   649  C CD  . PRO A 1 81  ? 99.690  100.705 13.677  1.00 16.24 ? 81  PRO A CD  1 
ATOM   650  N N   . GLY A 1 82  ? 97.041  102.429 17.172  1.00 18.67 ? 82  GLY A N   1 
ATOM   651  C CA  . GLY A 1 82  ? 95.753  102.209 17.803  1.00 19.16 ? 82  GLY A CA  1 
ATOM   652  C C   . GLY A 1 82  ? 95.715  101.071 18.804  1.00 21.11 ? 82  GLY A C   1 
ATOM   653  O O   . GLY A 1 82  ? 95.188  101.240 19.909  1.00 21.33 ? 82  GLY A O   1 
ATOM   654  N N   . ASN A 1 83  ? 96.276  99.911  18.494  1.00 19.02 ? 83  ASN A N   1 
ATOM   655  C CA  . ASN A 1 83  ? 96.251  98.795  19.399  1.00 19.45 ? 83  ASN A CA  1 
ATOM   656  C C   . ASN A 1 83  ? 97.323  98.925  20.515  1.00 18.41 ? 83  ASN A C   1 
ATOM   657  O O   . ASN A 1 83  ? 97.117  98.335  21.565  1.00 18.39 ? 83  ASN A O   1 
ATOM   658  C CB  . ASN A 1 83  ? 96.480  97.469  18.652  1.00 22.90 ? 83  ASN A CB  1 
ATOM   659  C CG  . ASN A 1 83  ? 95.276  97.046  17.883  1.00 25.12 ? 83  ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 83  ? 94.153  97.209  18.367  1.00 22.73 ? 83  ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 83  ? 95.479  96.584  16.661  1.00 21.15 ? 83  ASN A ND2 1 
ATOM   662  N N   . ALA A 1 84  ? 98.441  99.622  20.276  1.00 17.20 ? 84  ALA A N   1 
ATOM   663  C CA  . ALA A 1 84  ? 99.479  99.703  21.276  1.00 16.39 ? 84  ALA A CA  1 
ATOM   664  C C   . ALA A 1 84  ? 98.924  100.522 22.422  1.00 18.75 ? 84  ALA A C   1 
ATOM   665  O O   . ALA A 1 84  ? 98.263  101.526 22.191  1.00 17.88 ? 84  ALA A O   1 
ATOM   666  C CB  . ALA A 1 84  ? 100.747 100.345 20.768  1.00 16.90 ? 84  ALA A CB  1 
ATOM   667  N N   . TYR A 1 85  ? 99.198  100.099 23.640  1.00 18.83 ? 85  TYR A N   1 
ATOM   668  C CA  . TYR A 1 85  ? 98.651  100.824 24.813  1.00 22.01 ? 85  TYR A CA  1 
ATOM   669  C C   . TYR A 1 85  ? 99.753  101.090 25.790  1.00 18.56 ? 85  TYR A C   1 
ATOM   670  O O   . TYR A 1 85  ? 100.398 100.144 26.259  1.00 18.53 ? 85  TYR A O   1 
ATOM   671  C CB  . TYR A 1 85  ? 97.544  100.002 25.510  1.00 29.58 ? 85  TYR A CB  1 
ATOM   672  C CG  . TYR A 1 85  ? 97.210  100.565 26.921  1.00 34.88 ? 85  TYR A CG  1 
ATOM   673  C CD1 . TYR A 1 85  ? 96.411  101.675 27.088  1.00 36.14 ? 85  TYR A CD1 1 
ATOM   674  C CD2 . TYR A 1 85  ? 97.755  99.963  28.053  1.00 44.70 ? 85  TYR A CD2 1 
ATOM   675  C CE1 . TYR A 1 85  ? 96.137  102.180 28.380  1.00 38.83 ? 85  TYR A CE1 1 
ATOM   676  C CE2 . TYR A 1 85  ? 97.506  100.465 29.334  1.00 44.62 ? 85  TYR A CE2 1 
ATOM   677  C CZ  . TYR A 1 85  ? 96.689  101.564 29.481  1.00 38.54 ? 85  TYR A CZ  1 
ATOM   678  O OH  . TYR A 1 85  ? 96.506  102.007 30.785  1.00 43.01 ? 85  TYR A OH  1 
ATOM   679  N N   . TYR A 1 86  ? 100.079 102.365 26.001  1.00 16.05 ? 86  TYR A N   1 
ATOM   680  C CA  . TYR A 1 86  ? 101.138 102.737 26.921  1.00 14.14 ? 86  TYR A CA  1 
ATOM   681  C C   . TYR A 1 86  ? 100.488 103.400 28.145  1.00 16.41 ? 86  TYR A C   1 
ATOM   682  O O   . TYR A 1 86  ? 99.589  104.239 27.989  1.00 17.37 ? 86  TYR A O   1 
ATOM   683  C CB  . TYR A 1 86  ? 102.028 103.735 26.264  1.00 13.86 ? 86  TYR A CB  1 
ATOM   684  C CG  . TYR A 1 86  ? 102.570 103.275 24.964  1.00 14.56 ? 86  TYR A CG  1 
ATOM   685  C CD1 . TYR A 1 86  ? 103.017 101.933 24.786  1.00 13.46 ? 86  TYR A CD1 1 
ATOM   686  C CD2 . TYR A 1 86  ? 102.694 104.144 23.887  1.00 14.20 ? 86  TYR A CD2 1 
ATOM   687  C CE1 . TYR A 1 86  ? 103.551 101.515 23.576  1.00 12.99 ? 86  TYR A CE1 1 
ATOM   688  C CE2 . TYR A 1 86  ? 103.306 103.715 22.689  1.00 14.94 ? 86  TYR A CE2 1 
ATOM   689  C CZ  . TYR A 1 86  ? 103.735 102.419 22.560  1.00 14.78 ? 86  TYR A CZ  1 
ATOM   690  O OH  . TYR A 1 86  ? 104.308 102.019 21.323  1.00 14.54 ? 86  TYR A OH  1 
ATOM   691  N N   . SER A 1 87  ? 100.848 102.971 29.335  1.00 17.07 ? 87  SER A N   1 
ATOM   692  C CA  . SER A 1 87  ? 100.152 103.370 30.553  1.00 18.98 ? 87  SER A CA  1 
ATOM   693  C C   . SER A 1 87  ? 100.416 104.792 30.977  1.00 18.56 ? 87  SER A C   1 
ATOM   694  O O   . SER A 1 87  ? 101.560 105.237 30.988  1.00 16.34 ? 87  SER A O   1 
ATOM   695  C CB  . SER A 1 87  ? 100.553 102.509 31.769  1.00 24.41 ? 87  SER A CB  1 
ATOM   696  O OG  . SER A 1 87  ? 100.359 101.126 31.491  1.00 27.90 ? 87  SER A OG  1 
ATOM   697  N N   . ASP A 1 88  ? 99.374  105.485 31.379  1.00 17.84 ? 88  ASP A N   1 
ATOM   698  C CA  . ASP A 1 88  ? 99.558  106.830 31.886  1.00 23.26 ? 88  ASP A CA  1 
ATOM   699  C C   . ASP A 1 88  ? 100.036 106.866 33.366  1.00 25.44 ? 88  ASP A C   1 
ATOM   700  O O   . ASP A 1 88  ? 100.494 107.882 33.805  1.00 28.47 ? 88  ASP A O   1 
ATOM   701  C CB  . ASP A 1 88  ? 98.253  107.616 31.735  1.00 25.58 ? 88  ASP A CB  1 
ATOM   702  C CG  . ASP A 1 88  ? 98.090  108.168 30.322  1.00 30.92 ? 88  ASP A CG  1 
ATOM   703  O OD1 . ASP A 1 88  ? 99.097  108.377 29.615  1.00 33.12 ? 88  ASP A OD1 1 
ATOM   704  O OD2 . ASP A 1 88  ? 96.966  108.409 29.945  1.00 35.57 ? 88  ASP A OD2 1 
ATOM   705  N N   . ALA A 1 89  ? 99.918  105.758 34.080  1.00 20.40 ? 89  ALA A N   1 
ATOM   706  C CA  . ALA A 1 89  ? 100.382 105.645 35.443  1.00 22.51 ? 89  ALA A CA  1 
ATOM   707  C C   . ALA A 1 89  ? 101.523 104.616 35.576  1.00 20.92 ? 89  ALA A C   1 
ATOM   708  O O   . ALA A 1 89  ? 101.579 103.620 34.884  1.00 18.53 ? 89  ALA A O   1 
ATOM   709  C CB  . ALA A 1 89  ? 99.227  105.232 36.327  1.00 23.88 ? 89  ALA A CB  1 
ATOM   710  N N   . LEU A 1 90  ? 102.397 104.900 36.512  1.00 18.52 ? 90  LEU A N   1 
ATOM   711  C CA  . LEU A 1 90  ? 103.418 103.908 37.016  1.00 20.49 ? 90  LEU A CA  1 
ATOM   712  C C   . LEU A 1 90  ? 102.718 102.795 37.689  1.00 19.07 ? 90  LEU A C   1 
ATOM   713  O O   . LEU A 1 90  ? 101.583 102.940 38.191  1.00 18.30 ? 90  LEU A O   1 
ATOM   714  C CB  . LEU A 1 90  ? 104.381 104.547 38.002  1.00 21.38 ? 90  LEU A CB  1 
ATOM   715  C CG  . LEU A 1 90  ? 105.117 105.773 37.430  1.00 24.53 ? 90  LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 90  ? 105.996 106.362 38.516  1.00 27.76 ? 90  LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 90  ? 105.966 105.459 36.203  1.00 26.13 ? 90  LEU A CD2 1 
ATOM   718  N N   . GLU A 1 91  ? 103.296 101.635 37.584  1.00 18.66 ? 91  GLU A N   1 
ATOM   719  C CA  . GLU A 1 91  ? 102.782 100.475 38.282  1.00 18.86 ? 91  GLU A CA  1 
ATOM   720  C C   . GLU A 1 91  ? 103.842 100.037 39.272  1.00 19.30 ? 91  GLU A C   1 
ATOM   721  O O   . GLU A 1 91  ? 104.963 99.744  38.882  1.00 18.50 ? 91  GLU A O   1 
ATOM   722  C CB  . GLU A 1 91  ? 102.377 99.369  37.307  1.00 22.14 ? 91  GLU A CB  1 
ATOM   723  C CG  . GLU A 1 91  ? 101.065 99.706  36.576  1.00 22.99 ? 91  GLU A CG  1 
ATOM   724  C CD  . GLU A 1 91  ? 100.733 98.796  35.396  1.00 27.16 ? 91  GLU A CD  1 
ATOM   725  O OE1 . GLU A 1 91  ? 101.430 97.772  35.131  1.00 22.69 ? 91  GLU A OE1 1 
ATOM   726  O OE2 . GLU A 1 91  ? 99.733  99.184  34.663  1.00 29.68 ? 91  GLU A OE2 1 
ATOM   727  N N   . ASN A 1 92  ? 103.491 100.020 40.549  1.00 18.14 ? 92  ASN A N   1 
ATOM   728  C CA  . ASN A 1 92  ? 104.477 99.741  41.612  1.00 20.29 ? 92  ASN A CA  1 
ATOM   729  C C   . ASN A 1 92  ? 104.952 98.291  41.640  1.00 19.26 ? 92  ASN A C   1 
ATOM   730  O O   . ASN A 1 92  ? 105.945 97.995  42.278  1.00 19.55 ? 92  ASN A O   1 
ATOM   731  C CB  . ASN A 1 92  ? 103.972 100.163 43.006  1.00 21.24 ? 92  ASN A CB  1 
ATOM   732  C CG  . ASN A 1 92  ? 103.793 101.668 43.113  1.00 23.75 ? 92  ASN A CG  1 
ATOM   733  O OD1 . ASN A 1 92  ? 104.424 102.416 42.423  1.00 25.95 ? 92  ASN A OD1 1 
ATOM   734  N ND2 . ASN A 1 92  ? 102.900 102.084 43.969  1.00 24.55 ? 92  ASN A ND2 1 
ATOM   735  N N   . ASP A 1 93  ? 104.219 97.392  40.975  1.00 17.36 ? 93  ASP A N   1 
ATOM   736  C CA  . ASP A 1 93  ? 104.582 96.005  40.894  1.00 18.60 ? 93  ASP A CA  1 
ATOM   737  C C   . ASP A 1 93  ? 105.252 95.628  39.588  1.00 17.24 ? 93  ASP A C   1 
ATOM   738  O O   . ASP A 1 93  ? 105.435 94.440  39.282  1.00 16.93 ? 93  ASP A O   1 
ATOM   739  C CB  . ASP A 1 93  ? 103.340 95.121  41.131  1.00 19.01 ? 93  ASP A CB  1 
ATOM   740  C CG  . ASP A 1 93  ? 102.303 95.219  40.045  1.00 23.55 ? 93  ASP A CG  1 
ATOM   741  O OD1 . ASP A 1 93  ? 102.174 96.284  39.428  1.00 22.60 ? 93  ASP A OD1 1 
ATOM   742  O OD2 . ASP A 1 93  ? 101.549 94.260  39.868  1.00 25.96 ? 93  ASP A OD2 1 
ATOM   743  N N   . LYS A 1 94  ? 105.638 96.624  38.807  1.00 15.37 ? 94  LYS A N   1 
ATOM   744  C CA  . LYS A 1 94  ? 106.307 96.400  37.513  1.00 15.08 ? 94  LYS A CA  1 
ATOM   745  C C   . LYS A 1 94  ? 107.516 97.305  37.318  1.00 16.57 ? 94  LYS A C   1 
ATOM   746  O O   . LYS A 1 94  ? 107.657 98.332  37.983  1.00 17.28 ? 94  LYS A O   1 
ATOM   747  C CB  . LYS A 1 94  ? 105.327 96.696  36.336  1.00 15.46 ? 94  LYS A CB  1 
ATOM   748  C CG  . LYS A 1 94  ? 104.105 95.791  36.266  1.00 15.94 ? 94  LYS A CG  1 
ATOM   749  C CD  . LYS A 1 94  ? 104.455 94.383  35.853  1.00 17.32 ? 94  LYS A CD  1 
ATOM   750  C CE  . LYS A 1 94  ? 103.182 93.509  35.926  1.00 22.53 ? 94  LYS A CE  1 
ATOM   751  N NZ  . LYS A 1 94  ? 103.475 92.158  35.381  1.00 21.79 ? 94  LYS A NZ  1 
ATOM   752  N N   . ASP A 1 95  ? 108.358 96.946  36.351  1.00 15.75 ? 95  ASP A N   1 
ATOM   753  C CA  . ASP A 1 95  ? 109.385 97.851  35.873  1.00 17.32 ? 95  ASP A CA  1 
ATOM   754  C C   . ASP A 1 95  ? 108.677 98.848  34.926  1.00 20.90 ? 95  ASP A C   1 
ATOM   755  O O   . ASP A 1 95  ? 107.995 98.408  33.998  1.00 20.80 ? 95  ASP A O   1 
ATOM   756  C CB  . ASP A 1 95  ? 110.465 97.089  35.108  1.00 17.05 ? 95  ASP A CB  1 
ATOM   757  C CG  . ASP A 1 95  ? 111.091 95.979  35.936  1.00 20.65 ? 95  ASP A CG  1 
ATOM   758  O OD1 . ASP A 1 95  ? 111.393 96.297  37.122  1.00 19.12 ? 95  ASP A OD1 1 
ATOM   759  O OD2 . ASP A 1 95  ? 111.343 94.871  35.406  1.00 17.74 ? 95  ASP A OD2 1 
ATOM   760  N N   . ASN A 1 96  ? 108.875 100.147 35.119  1.00 16.69 ? 96  ASN A N   1 
ATOM   761  C CA  . ASN A 1 96  ? 108.205 101.160 34.317  1.00 17.61 ? 96  ASN A CA  1 
ATOM   762  C C   . ASN A 1 96  ? 109.185 101.716 33.278  1.00 16.03 ? 96  ASN A C   1 
ATOM   763  O O   . ASN A 1 96  ? 110.143 102.420 33.627  1.00 16.22 ? 96  ASN A O   1 
ATOM   764  C CB  . ASN A 1 96  ? 107.687 102.256 35.227  1.00 17.91 ? 96  ASN A CB  1 
ATOM   765  C CG  . ASN A 1 96  ? 106.658 101.747 36.187  1.00 16.99 ? 96  ASN A CG  1 
ATOM   766  O OD1 . ASN A 1 96  ? 105.507 101.498 35.818  1.00 17.65 ? 96  ASN A OD1 1 
ATOM   767  N ND2 . ASN A 1 96  ? 107.049 101.584 37.452  1.00 17.66 ? 96  ASN A ND2 1 
ATOM   768  N N   . ILE A 1 97  ? 108.962 101.329 32.005  1.00 16.25 ? 97  ILE A N   1 
ATOM   769  C CA  . ILE A 1 97  ? 109.906 101.484 30.898  1.00 15.23 ? 97  ILE A CA  1 
ATOM   770  C C   . ILE A 1 97  ? 109.182 102.120 29.732  1.00 14.97 ? 97  ILE A C   1 
ATOM   771  O O   . ILE A 1 97  ? 108.001 101.805 29.422  1.00 13.79 ? 97  ILE A O   1 
ATOM   772  C CB  . ILE A 1 97  ? 110.481 100.099 30.481  1.00 15.89 ? 97  ILE A CB  1 
ATOM   773  C CG1 . ILE A 1 97  ? 111.238 99.419  31.632  1.00 17.70 ? 97  ILE A CG1 1 
ATOM   774  C CG2 . ILE A 1 97  ? 111.329 100.163 29.216  1.00 15.26 ? 97  ILE A CG2 1 
ATOM   775  C CD1 . ILE A 1 97  ? 112.479 100.159 32.067  1.00 20.55 ? 97  ILE A CD1 1 
ATOM   776  N N   . THR A 1 98  ? 109.827 103.106 29.125  1.00 14.62 ? 98  THR A N   1 
ATOM   777  C CA  . THR A 1 98  ? 109.222 103.784 28.003  1.00 14.00 ? 98  THR A CA  1 
ATOM   778  C C   . THR A 1 98  ? 109.411 102.911 26.754  1.00 13.34 ? 98  THR A C   1 
ATOM   779  O O   . THR A 1 98  ? 110.317 102.095 26.701  1.00 13.91 ? 98  THR A O   1 
ATOM   780  C CB  . THR A 1 98  ? 109.834 105.200 27.690  1.00 13.99 ? 98  THR A CB  1 
ATOM   781  O OG1 . THR A 1 98  ? 111.106 105.022 27.130  1.00 16.12 ? 98  THR A OG1 1 
ATOM   782  C CG2 . THR A 1 98  ? 109.912 106.098 28.950  1.00 14.59 ? 98  THR A CG2 1 
ATOM   783  N N   . PRO A 1 99  ? 108.579 103.108 25.728  1.00 13.29 ? 99  PRO A N   1 
ATOM   784  C CA  . PRO A 1 99  ? 108.748 102.327 24.524  1.00 13.73 ? 99  PRO A CA  1 
ATOM   785  C C   . PRO A 1 99  ? 110.081 102.561 23.851  1.00 14.89 ? 99  PRO A C   1 
ATOM   786  O O   . PRO A 1 99  ? 110.629 101.615 23.279  1.00 16.72 ? 99  PRO A O   1 
ATOM   787  C CB  . PRO A 1 99  ? 107.564 102.766 23.624  1.00 13.87 ? 99  PRO A CB  1 
ATOM   788  C CG  . PRO A 1 99  ? 106.520 103.155 24.633  1.00 14.80 ? 99  PRO A CG  1 
ATOM   789  C CD  . PRO A 1 99  ? 107.296 103.869 25.706  1.00 15.20 ? 99  PRO A CD  1 
ATOM   790  N N   . PHE A 1 100 ? 110.655 103.775 23.954  1.00 15.89 ? 100 PHE A N   1 
ATOM   791  C CA  . PHE A 1 100 ? 111.971 104.055 23.319  1.00 16.73 ? 100 PHE A CA  1 
ATOM   792  C C   . PHE A 1 100 ? 113.146 103.436 24.112  1.00 15.17 ? 100 PHE A C   1 
ATOM   793  O O   . PHE A 1 100 ? 114.228 103.301 23.603  1.00 14.58 ? 100 PHE A O   1 
ATOM   794  C CB  . PHE A 1 100 ? 112.145 105.563 23.012  1.00 16.58 ? 100 PHE A CB  1 
ATOM   795  C CG  . PHE A 1 100 ? 112.198 106.416 24.220  1.00 15.80 ? 100 PHE A CG  1 
ATOM   796  C CD1 . PHE A 1 100 ? 113.341 106.529 24.952  1.00 15.27 ? 100 PHE A CD1 1 
ATOM   797  C CD2 . PHE A 1 100 ? 111.069 107.055 24.644  1.00 16.76 ? 100 PHE A CD2 1 
ATOM   798  C CE1 . PHE A 1 100 ? 113.359 107.310 26.120  1.00 16.24 ? 100 PHE A CE1 1 
ATOM   799  C CE2 . PHE A 1 100 ? 111.053 107.833 25.776  1.00 16.85 ? 100 PHE A CE2 1 
ATOM   800  C CZ  . PHE A 1 100 ? 112.184 107.954 26.521  1.00 16.16 ? 100 PHE A CZ  1 
ATOM   801  N N   . GLU A 1 101 ? 112.887 103.059 25.374  1.00 14.67 ? 101 GLU A N   1 
ATOM   802  C CA  . GLU A 1 101 ? 113.857 102.393 26.227  1.00 14.90 ? 101 GLU A CA  1 
ATOM   803  C C   . GLU A 1 101 ? 113.811 100.877 26.104  1.00 15.29 ? 101 GLU A C   1 
ATOM   804  O O   . GLU A 1 101 ? 114.636 100.213 26.661  1.00 14.54 ? 101 GLU A O   1 
ATOM   805  C CB  . GLU A 1 101 ? 113.585 102.789 27.703  1.00 14.77 ? 101 GLU A CB  1 
ATOM   806  C CG  . GLU A 1 101 ? 113.971 104.215 28.068  1.00 15.84 ? 101 GLU A CG  1 
ATOM   807  C CD  . GLU A 1 101 ? 113.284 104.683 29.359  1.00 16.24 ? 101 GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 101 ? 112.496 103.910 29.972  1.00 13.68 ? 101 GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 101 ? 113.558 105.845 29.764  1.00 16.70 ? 101 GLU A OE2 1 
ATOM   810  N N   . PHE A 1 102 ? 112.807 100.341 25.413  1.00 15.30 ? 102 PHE A N   1 
ATOM   811  C CA  . PHE A 1 102 ? 112.448 98.920  25.529  1.00 15.11 ? 102 PHE A CA  1 
ATOM   812  C C   . PHE A 1 102 ? 113.525 98.081  24.916  1.00 13.21 ? 102 PHE A C   1 
ATOM   813  O O   . PHE A 1 102 ? 113.934 97.059  25.498  1.00 14.21 ? 102 PHE A O   1 
ATOM   814  C CB  . PHE A 1 102 ? 111.042 98.716  24.936  1.00 14.38 ? 102 PHE A CB  1 
ATOM   815  C CG  . PHE A 1 102 ? 110.417 97.405  25.180  1.00 14.11 ? 102 PHE A CG  1 
ATOM   816  C CD1 . PHE A 1 102 ? 110.765 96.583  26.259  1.00 14.78 ? 102 PHE A CD1 1 
ATOM   817  C CD2 . PHE A 1 102 ? 109.331 97.030  24.385  1.00 13.60 ? 102 PHE A CD2 1 
ATOM   818  C CE1 . PHE A 1 102 ? 110.106 95.399  26.500  1.00 14.95 ? 102 PHE A CE1 1 
ATOM   819  C CE2 . PHE A 1 102 ? 108.663 95.853  24.635  1.00 13.89 ? 102 PHE A CE2 1 
ATOM   820  C CZ  . PHE A 1 102 ? 109.059 95.024  25.660  1.00 14.14 ? 102 PHE A CZ  1 
ATOM   821  N N   . ILE A 1 103 ? 114.030 98.485  23.749  1.00 13.57 ? 103 ILE A N   1 
ATOM   822  C CA  . ILE A 1 103 ? 115.124 97.742  23.139  1.00 13.45 ? 103 ILE A CA  1 
ATOM   823  C C   . ILE A 1 103 ? 116.414 97.701  24.005  1.00 14.64 ? 103 ILE A C   1 
ATOM   824  O O   . ILE A 1 103 ? 116.919 96.618  24.280  1.00 13.31 ? 103 ILE A O   1 
ATOM   825  C CB  . ILE A 1 103 ? 115.405 98.209  21.673  1.00 15.25 ? 103 ILE A CB  1 
ATOM   826  C CG1 . ILE A 1 103 ? 114.275 97.728  20.770  1.00 14.46 ? 103 ILE A CG1 1 
ATOM   827  C CG2 . ILE A 1 103 ? 116.743 97.637  21.191  1.00 14.52 ? 103 ILE A CG2 1 
ATOM   828  C CD1 . ILE A 1 103 ? 114.309 98.292  19.352  1.00 14.51 ? 103 ILE A CD1 1 
ATOM   829  N N   . PRO A 1 104 ? 116.914 98.855  24.486  1.00 13.80 ? 104 PRO A N   1 
ATOM   830  C CA  . PRO A 1 104 ? 117.950 98.797  25.510  1.00 14.11 ? 104 PRO A CA  1 
ATOM   831  C C   . PRO A 1 104 ? 117.649 97.924  26.742  1.00 14.29 ? 104 PRO A C   1 
ATOM   832  O O   . PRO A 1 104 ? 118.526 97.234  27.213  1.00 15.45 ? 104 PRO A O   1 
ATOM   833  C CB  . PRO A 1 104 ? 118.137 100.248 25.930  1.00 14.57 ? 104 PRO A CB  1 
ATOM   834  C CG  . PRO A 1 104 ? 117.814 101.017 24.663  1.00 15.34 ? 104 PRO A CG  1 
ATOM   835  C CD  . PRO A 1 104 ? 116.671 100.243 24.040  1.00 15.49 ? 104 PRO A CD  1 
ATOM   836  N N   . TRP A 1 105 ? 116.453 98.014  27.262  1.00 13.62 ? 105 TRP A N   1 
ATOM   837  C CA  . TRP A 1 105 ? 116.109 97.334  28.521  1.00 14.47 ? 105 TRP A CA  1 
ATOM   838  C C   . TRP A 1 105 ? 116.231 95.799  28.304  1.00 15.08 ? 105 TRP A C   1 
ATOM   839  O O   . TRP A 1 105 ? 116.823 95.083  29.124  1.00 13.25 ? 105 TRP A O   1 
ATOM   840  C CB  . TRP A 1 105 ? 114.677 97.729  28.891  1.00 14.78 ? 105 TRP A CB  1 
ATOM   841  C CG  . TRP A 1 105 ? 114.173 97.131  30.121  1.00 15.68 ? 105 TRP A CG  1 
ATOM   842  C CD1 . TRP A 1 105 ? 113.192 96.232  30.224  1.00 18.22 ? 105 TRP A CD1 1 
ATOM   843  C CD2 . TRP A 1 105 ? 114.591 97.430  31.456  1.00 16.06 ? 105 TRP A CD2 1 
ATOM   844  N NE1 . TRP A 1 105 ? 112.940 95.912  31.543  1.00 17.97 ? 105 TRP A NE1 1 
ATOM   845  C CE2 . TRP A 1 105 ? 113.816 96.611  32.327  1.00 18.04 ? 105 TRP A CE2 1 
ATOM   846  C CE3 . TRP A 1 105 ? 115.578 98.274  32.011  1.00 17.41 ? 105 TRP A CE3 1 
ATOM   847  C CZ2 . TRP A 1 105 ? 113.953 96.641  33.709  1.00 18.57 ? 105 TRP A CZ2 1 
ATOM   848  C CZ3 . TRP A 1 105 ? 115.718 98.309  33.473  1.00 16.38 ? 105 TRP A CZ3 1 
ATOM   849  C CH2 . TRP A 1 105 ? 114.901 97.519  34.274  1.00 19.33 ? 105 TRP A CH2 1 
ATOM   850  N N   . ILE A 1 106 ? 115.710 95.323  27.171  1.00 12.61 ? 106 ILE A N   1 
ATOM   851  C CA  . ILE A 1 106 ? 115.771 93.913  26.880  1.00 13.87 ? 106 ILE A CA  1 
ATOM   852  C C   . ILE A 1 106 ? 117.157 93.463  26.409  1.00 14.36 ? 106 ILE A C   1 
ATOM   853  O O   . ILE A 1 106 ? 117.774 92.528  26.986  1.00 15.89 ? 106 ILE A O   1 
ATOM   854  C CB  . ILE A 1 106 ? 114.694 93.506  25.867  1.00 14.92 ? 106 ILE A CB  1 
ATOM   855  C CG1 . ILE A 1 106 ? 113.291 93.769  26.400  1.00 16.08 ? 106 ILE A CG1 1 
ATOM   856  C CG2 . ILE A 1 106 ? 114.858 92.037  25.431  1.00 16.43 ? 106 ILE A CG2 1 
ATOM   857  C CD1 . ILE A 1 106 ? 112.894 93.084  27.700  1.00 14.81 ? 106 ILE A CD1 1 
ATOM   858  N N   . LEU A 1 107 ? 117.649 94.089  25.349  1.00 14.48 ? 107 LEU A N   1 
ATOM   859  C CA  . LEU A 1 107 ? 118.870 93.612  24.715  1.00 14.08 ? 107 LEU A CA  1 
ATOM   860  C C   . LEU A 1 107 ? 120.099 93.884  25.594  1.00 15.24 ? 107 LEU A C   1 
ATOM   861  O O   . LEU A 1 107 ? 121.072 93.160  25.500  1.00 16.74 ? 107 LEU A O   1 
ATOM   862  C CB  . LEU A 1 107 ? 119.067 94.230  23.365  1.00 14.55 ? 107 LEU A CB  1 
ATOM   863  C CG  . LEU A 1 107 ? 118.073 93.866  22.264  1.00 14.49 ? 107 LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 107 ? 118.608 94.378  20.925  1.00 15.28 ? 107 LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 107 ? 117.852 92.390  22.175  1.00 15.91 ? 107 LEU A CD2 1 
ATOM   866  N N   . GLY A 1 108 ? 120.024 94.898  26.461  1.00 15.47 ? 108 GLY A N   1 
ATOM   867  C CA  . GLY A 1 108 ? 121.158 95.215  27.326  1.00 16.64 ? 108 GLY A CA  1 
ATOM   868  C C   . GLY A 1 108 ? 121.308 94.141  28.410  1.00 19.31 ? 108 GLY A C   1 
ATOM   869  O O   . GLY A 1 108 ? 122.433 93.912  28.864  1.00 19.87 ? 108 GLY A O   1 
ATOM   870  N N   . GLN A 1 109 ? 120.235 93.397  28.709  1.00 19.10 ? 109 GLN A N   1 
ATOM   871  C CA  . GLN A 1 109 ? 120.217 92.523  29.899  1.00 18.72 ? 109 GLN A CA  1 
ATOM   872  C C   . GLN A 1 109 ? 119.921 91.081  29.609  1.00 19.60 ? 109 GLN A C   1 
ATOM   873  O O   . GLN A 1 109 ? 120.022 90.274  30.521  1.00 22.31 ? 109 GLN A O   1 
ATOM   874  C CB  . GLN A 1 109 ? 119.128 93.015  30.873  1.00 19.42 ? 109 GLN A CB  1 
ATOM   875  C CG  . GLN A 1 109 ? 119.332 94.445  31.229  1.00 20.50 ? 109 GLN A CG  1 
ATOM   876  C CD  . GLN A 1 109 ? 118.421 94.933  32.307  1.00 21.32 ? 109 GLN A CD  1 
ATOM   877  O OE1 . GLN A 1 109 ? 118.842 94.941  33.427  1.00 24.19 ? 109 GLN A OE1 1 
ATOM   878  N NE2 . GLN A 1 109 ? 117.195 95.354  31.981  1.00 16.71 ? 109 GLN A NE2 1 
ATOM   879  N N   . CYS A 1 110 ? 119.505 90.724  28.407  1.00 17.48 ? 110 CYS A N   1 
ATOM   880  C CA  . CYS A 1 110 ? 119.000 89.396  28.170  1.00 16.18 ? 110 CYS A CA  1 
ATOM   881  C C   . CYS A 1 110 ? 119.894 88.729  27.115  1.00 17.31 ? 110 CYS A C   1 
ATOM   882  O O   . CYS A 1 110 ? 120.280 89.354  26.118  1.00 15.48 ? 110 CYS A O   1 
ATOM   883  C CB  . CYS A 1 110 ? 117.533 89.432  27.694  1.00 14.90 ? 110 CYS A CB  1 
ATOM   884  S SG  . CYS A 1 110 ? 116.443 90.085  28.907  1.00 17.83 ? 110 CYS A SG  1 
ATOM   885  N N   . SER A 1 111 ? 120.172 87.434  27.321  1.00 17.09 ? 111 SER A N   1 
ATOM   886  C CA  . SER A 1 111 ? 120.996 86.709  26.364  1.00 17.87 ? 111 SER A CA  1 
ATOM   887  C C   . SER A 1 111 ? 120.196 85.902  25.367  1.00 18.15 ? 111 SER A C   1 
ATOM   888  O O   . SER A 1 111 ? 120.761 85.458  24.355  1.00 18.94 ? 111 SER A O   1 
ATOM   889  C CB  . SER A 1 111 ? 121.960 85.764  27.076  1.00 21.32 ? 111 SER A CB  1 
ATOM   890  O OG  . SER A 1 111 ? 121.165 84.767  27.690  1.00 25.99 ? 111 SER A OG  1 
ATOM   891  N N   . ASP A 1 112 ? 118.925 85.634  25.616  1.00 18.62 ? 112 ASP A N   1 
ATOM   892  C CA  . ASP A 1 112 ? 118.153 84.754  24.739  1.00 18.07 ? 112 ASP A CA  1 
ATOM   893  C C   . ASP A 1 112 ? 116.704 85.037  24.897  1.00 16.80 ? 112 ASP A C   1 
ATOM   894  O O   . ASP A 1 112 ? 116.298 85.856  25.738  1.00 16.72 ? 112 ASP A O   1 
ATOM   895  C CB  . ASP A 1 112 ? 118.435 83.259  25.036  1.00 18.60 ? 112 ASP A CB  1 
ATOM   896  C CG  . ASP A 1 112 ? 118.123 82.859  26.481  1.00 25.22 ? 112 ASP A CG  1 
ATOM   897  O OD1 . ASP A 1 112 ? 117.353 83.485  27.206  1.00 19.16 ? 112 ASP A OD1 1 
ATOM   898  O OD2 . ASP A 1 112 ? 118.715 81.826  26.907  1.00 29.01 ? 112 ASP A OD2 1 
ATOM   899  N N   . VAL A 1 113 ? 115.897 84.345  24.123  1.00 16.19 ? 113 VAL A N   1 
ATOM   900  C CA  . VAL A 1 113 ? 114.468 84.606  24.117  1.00 16.74 ? 113 VAL A CA  1 
ATOM   901  C C   . VAL A 1 113 ? 113.781 84.334  25.450  1.00 16.16 ? 113 VAL A C   1 
ATOM   902  O O   . VAL A 1 113 ? 112.910 85.129  25.858  1.00 15.30 ? 113 VAL A O   1 
ATOM   903  C CB  . VAL A 1 113 ? 113.799 83.869  22.950  1.00 14.64 ? 113 VAL A CB  1 
ATOM   904  C CG1 . VAL A 1 113 ? 112.273 83.807  23.161  1.00 16.98 ? 113 VAL A CG1 1 
ATOM   905  C CG2 . VAL A 1 113 ? 114.123 84.550  21.652  1.00 14.39 ? 113 VAL A CG2 1 
ATOM   906  N N   . ASN A 1 114 ? 114.133 83.229  26.127  1.00 17.13 ? 114 ASN A N   1 
ATOM   907  C CA  . ASN A 1 114 ? 113.523 82.977  27.445  1.00 17.58 ? 114 ASN A CA  1 
ATOM   908  C C   . ASN A 1 114 ? 113.766 84.092  28.437  1.00 15.98 ? 114 ASN A C   1 
ATOM   909  O O   . ASN A 1 114 ? 112.838 84.497  29.117  1.00 18.00 ? 114 ASN A O   1 
ATOM   910  C CB  . ASN A 1 114 ? 113.954 81.605  28.031  1.00 19.96 ? 114 ASN A CB  1 
ATOM   911  C CG  . ASN A 1 114 ? 113.248 80.448  27.286  1.00 24.68 ? 114 ASN A CG  1 
ATOM   912  O OD1 . ASN A 1 114 ? 112.347 80.648  26.439  1.00 25.47 ? 114 ASN A OD1 1 
ATOM   913  N ND2 . ASN A 1 114 ? 113.631 79.258  27.612  1.00 28.62 ? 114 ASN A ND2 1 
ATOM   914  N N   . GLU A 1 115 ? 114.997 84.603  28.516  1.00 17.39 ? 115 GLU A N   1 
ATOM   915  C CA  . GLU A 1 115 ? 115.263 85.677  29.427  1.00 16.63 ? 115 GLU A CA  1 
ATOM   916  C C   . GLU A 1 115 ? 114.473 86.922  29.002  1.00 15.54 ? 115 GLU A C   1 
ATOM   917  O O   . GLU A 1 115 ? 113.955 87.668  29.842  1.00 13.50 ? 115 GLU A O   1 
ATOM   918  C CB  . GLU A 1 115 ? 116.750 86.016  29.438  1.00 19.43 ? 115 GLU A CB  1 
ATOM   919  C CG  . GLU A 1 115 ? 117.555 85.073  30.311  1.00 21.30 ? 115 GLU A CG  1 
ATOM   920  C CD  . GLU A 1 115 ? 119.026 85.375  30.359  1.00 23.89 ? 115 GLU A CD  1 
ATOM   921  O OE1 . GLU A 1 115 ? 119.519 86.408  29.872  1.00 20.84 ? 115 GLU A OE1 1 
ATOM   922  O OE2 . GLU A 1 115 ? 119.720 84.550  30.962  1.00 26.81 ? 115 GLU A OE2 1 
ATOM   923  N N   . ALA A 1 116 ? 114.403 87.184  27.683  1.00 13.76 ? 116 ALA A N   1 
ATOM   924  C CA  . ALA A 1 116 ? 113.594 88.331  27.205  1.00 14.29 ? 116 ALA A CA  1 
ATOM   925  C C   . ALA A 1 116 ? 112.111 88.234  27.628  1.00 13.84 ? 116 ALA A C   1 
ATOM   926  O O   . ALA A 1 116 ? 111.556 89.187  28.158  1.00 15.06 ? 116 ALA A O   1 
ATOM   927  C CB  . ALA A 1 116 ? 113.703 88.442  25.682  1.00 14.46 ? 116 ALA A CB  1 
ATOM   928  N N   . ARG A 1 117 ? 111.504 87.063  27.401  1.00 14.47 ? 117 ARG A N   1 
ATOM   929  C CA  . ARG A 1 117 ? 110.174 86.808  27.824  1.00 16.29 ? 117 ARG A CA  1 
ATOM   930  C C   . ARG A 1 117 ? 109.989 87.114  29.330  1.00 14.68 ? 117 ARG A C   1 
ATOM   931  O O   . ARG A 1 117 ? 109.011 87.770  29.726  1.00 13.67 ? 117 ARG A O   1 
ATOM   932  C CB  . ARG A 1 117 ? 109.795 85.300  27.598  1.00 19.45 ? 117 ARG A CB  1 
ATOM   933  C CG  . ARG A 1 117 ? 108.373 84.944  28.094  1.00 22.48 ? 117 ARG A CG  1 
ATOM   934  C CD  . ARG A 1 117 ? 108.066 83.456  28.099  1.00 26.91 ? 117 ARG A CD  1 
ATOM   935  N NE  . ARG A 1 117 ? 107.882 82.905  26.758  1.00 32.79 ? 117 ARG A NE  1 
ATOM   936  C CZ  . ARG A 1 117 ? 108.786 82.231  26.037  1.00 43.95 ? 117 ARG A CZ  1 
ATOM   937  N NH1 . ARG A 1 117 ? 110.052 82.014  26.460  1.00 51.68 ? 117 ARG A NH1 1 
ATOM   938  N NH2 . ARG A 1 117 ? 108.417 81.752  24.867  1.00 44.23 ? 117 ARG A NH2 1 
ATOM   939  N N   . ASN A 1 118 ? 110.857 86.532  30.163  1.00 16.12 ? 118 ASN A N   1 
ATOM   940  C CA  . ASN A 1 118 ? 110.707 86.750  31.619  1.00 16.82 ? 118 ASN A CA  1 
ATOM   941  C C   . ASN A 1 118 ? 110.785 88.222  31.989  1.00 16.06 ? 118 ASN A C   1 
ATOM   942  O O   . ASN A 1 118 ? 110.075 88.664  32.846  1.00 15.76 ? 118 ASN A O   1 
ATOM   943  C CB  . ASN A 1 118 ? 111.743 85.956  32.343  1.00 18.74 ? 118 ASN A CB  1 
ATOM   944  C CG  . ASN A 1 118 ? 111.540 84.460  32.158  1.00 19.59 ? 118 ASN A CG  1 
ATOM   945  O OD1 . ASN A 1 118 ? 110.526 83.986  31.669  1.00 19.39 ? 118 ASN A OD1 1 
ATOM   946  N ND2 . ASN A 1 118 ? 112.516 83.733  32.548  1.00 21.86 ? 118 ASN A ND2 1 
ATOM   947  N N   . LEU A 1 119 ? 111.609 88.996  31.290  1.00 15.75 ? 119 LEU A N   1 
ATOM   948  C CA  . LEU A 1 119 ? 111.739 90.439  31.645  1.00 16.83 ? 119 LEU A CA  1 
ATOM   949  C C   . LEU A 1 119 ? 110.526 91.189  31.133  1.00 15.33 ? 119 LEU A C   1 
ATOM   950  O O   . LEU A 1 119 ? 109.982 92.015  31.825  1.00 15.22 ? 119 LEU A O   1 
ATOM   951  C CB  . LEU A 1 119 ? 113.070 90.967  31.120  1.00 16.26 ? 119 LEU A CB  1 
ATOM   952  C CG  . LEU A 1 119 ? 113.398 92.394  31.481  1.00 16.20 ? 119 LEU A CG  1 
ATOM   953  C CD1 . LEU A 1 119 ? 113.348 92.580  32.980  1.00 18.02 ? 119 LEU A CD1 1 
ATOM   954  C CD2 . LEU A 1 119 ? 114.766 92.730  30.964  1.00 17.39 ? 119 LEU A CD2 1 
ATOM   955  N N   . VAL A 1 120 ? 110.031 90.810  29.942  1.00 14.97 ? 120 VAL A N   1 
ATOM   956  C CA  . VAL A 1 120 ? 108.742 91.381  29.466  1.00 14.00 ? 120 VAL A CA  1 
ATOM   957  C C   . VAL A 1 120 ? 107.573 91.100  30.379  1.00 13.59 ? 120 VAL A C   1 
ATOM   958  O O   . VAL A 1 120 ? 106.729 91.960  30.576  1.00 14.63 ? 120 VAL A O   1 
ATOM   959  C CB  . VAL A 1 120 ? 108.426 90.931  28.027  1.00 13.99 ? 120 VAL A CB  1 
ATOM   960  C CG1 . VAL A 1 120 ? 107.097 91.496  27.622  1.00 15.72 ? 120 VAL A CG1 1 
ATOM   961  C CG2 . VAL A 1 120 ? 109.502 91.404  27.079  1.00 14.20 ? 120 VAL A CG2 1 
ATOM   962  N N   . GLU A 1 121 ? 107.553 89.923  31.035  1.00 14.33 ? 121 GLU A N   1 
ATOM   963  C CA  . GLU A 1 121 ? 106.524 89.597  32.004  1.00 15.41 ? 121 GLU A CA  1 
ATOM   964  C C   . GLU A 1 121 ? 106.512 90.516  33.224  1.00 17.28 ? 121 GLU A C   1 
ATOM   965  O O   . GLU A 1 121 ? 105.527 90.559  33.943  1.00 15.97 ? 121 GLU A O   1 
ATOM   966  C CB  . GLU A 1 121 ? 106.660 88.137  32.414  1.00 17.31 ? 121 GLU A CB  1 
ATOM   967  C CG  . GLU A 1 121 ? 106.238 87.167  31.290  1.00 17.06 ? 121 GLU A CG  1 
ATOM   968  C CD  . GLU A 1 121 ? 106.146 85.730  31.770  1.00 21.52 ? 121 GLU A CD  1 
ATOM   969  O OE1 . GLU A 1 121 ? 105.848 85.544  32.972  1.00 20.26 ? 121 GLU A OE1 1 
ATOM   970  O OE2 . GLU A 1 121 ? 106.330 84.804  30.948  1.00 22.46 ? 121 GLU A OE2 1 
ATOM   971  N N   . LYS A 1 122 ? 107.600 91.283  33.409  1.00 16.25 ? 122 LYS A N   1 
ATOM   972  C CA  . LYS A 1 122 ? 107.711 92.219  34.562  1.00 16.29 ? 122 LYS A CA  1 
ATOM   973  C C   . LYS A 1 122 ? 107.536 93.683  34.189  1.00 16.45 ? 122 LYS A C   1 
ATOM   974  O O   . LYS A 1 122 ? 107.656 94.539  35.070  1.00 17.63 ? 122 LYS A O   1 
ATOM   975  C CB  . LYS A 1 122 ? 109.084 92.062  35.226  1.00 16.87 ? 122 LYS A CB  1 
ATOM   976  C CG  . LYS A 1 122 ? 109.362 90.642  35.709  1.00 17.75 ? 122 LYS A CG  1 
ATOM   977  C CD  . LYS A 1 122 ? 110.775 90.472  36.234  1.00 16.82 ? 122 LYS A CD  1 
ATOM   978  C CE  . LYS A 1 122 ? 111.090 89.040  36.657  1.00 19.05 ? 122 LYS A CE  1 
ATOM   979  N NZ  . LYS A 1 122 ? 111.250 88.090  35.532  1.00 20.33 ? 122 LYS A NZ  1 
ATOM   980  N N   . ILE A 1 123 ? 107.177 93.986  32.926  1.00 16.42 ? 123 ILE A N   1 
ATOM   981  C CA  . ILE A 1 123 ? 107.150 95.356  32.444  1.00 13.97 ? 123 ILE A CA  1 
ATOM   982  C C   . ILE A 1 123 ? 105.808 96.027  32.483  1.00 15.55 ? 123 ILE A C   1 
ATOM   983  O O   . ILE A 1 123 ? 104.747 95.418  32.336  1.00 15.69 ? 123 ILE A O   1 
ATOM   984  C CB  . ILE A 1 123 ? 107.748 95.429  31.023  1.00 15.73 ? 123 ILE A CB  1 
ATOM   985  C CG1 . ILE A 1 123 ? 108.547 96.707  30.820  1.00 16.22 ? 123 ILE A CG1 1 
ATOM   986  C CG2 . ILE A 1 123 ? 106.708 95.260  29.938  1.00 14.84 ? 123 ILE A CG2 1 
ATOM   987  C CD1 . ILE A 1 123 ? 109.549 96.581  29.685  1.00 17.14 ? 123 ILE A CD1 1 
ATOM   988  N N   . ASN A 1 124 ? 105.887 97.342  32.577  1.00 15.22 ? 124 ASN A N   1 
ATOM   989  C CA  . ASN A 1 124 ? 104.766 98.224  32.310  1.00 16.05 ? 124 ASN A CA  1 
ATOM   990  C C   . ASN A 1 124 ? 105.290 99.298  31.356  1.00 16.21 ? 124 ASN A C   1 
ATOM   991  O O   . ASN A 1 124 ? 106.168 100.099 31.752  1.00 15.22 ? 124 ASN A O   1 
ATOM   992  C CB  . ASN A 1 124 ? 104.332 98.930  33.601  1.00 17.27 ? 124 ASN A CB  1 
ATOM   993  C CG  . ASN A 1 124 ? 103.186 99.927  33.366  1.00 17.14 ? 124 ASN A CG  1 
ATOM   994  O OD1 . ASN A 1 124 ? 102.279 99.681  32.532  1.00 19.03 ? 124 ASN A OD1 1 
ATOM   995  N ND2 . ASN A 1 124 ? 103.264 101.066 34.051  1.00 16.71 ? 124 ASN A ND2 1 
ATOM   996  N N   . LEU A 1 125 ? 104.774 99.323  30.143  1.00 13.80 ? 125 LEU A N   1 
ATOM   997  C CA  . LEU A 1 125 ? 105.236 100.318 29.168  1.00 14.85 ? 125 LEU A CA  1 
ATOM   998  C C   . LEU A 1 125 ? 104.497 101.600 29.476  1.00 15.41 ? 125 LEU A C   1 
ATOM   999  O O   . LEU A 1 125 ? 103.245 101.625 29.541  1.00 16.07 ? 125 LEU A O   1 
ATOM   1000 C CB  . LEU A 1 125 ? 105.026 99.852  27.738  1.00 15.32 ? 125 LEU A CB  1 
ATOM   1001 C CG  . LEU A 1 125 ? 105.909 98.761  27.187  1.00 15.11 ? 125 LEU A CG  1 
ATOM   1002 C CD1 . LEU A 1 125 ? 105.590 98.564  25.711  1.00 16.80 ? 125 LEU A CD1 1 
ATOM   1003 C CD2 . LEU A 1 125 ? 107.379 99.035  27.393  1.00 15.87 ? 125 LEU A CD2 1 
ATOM   1004 N N   . ILE A 1 126 ? 105.250 102.660 29.673  1.00 14.64 ? 126 ILE A N   1 
ATOM   1005 C CA  . ILE A 1 126 ? 104.670 103.939 30.110  1.00 16.15 ? 126 ILE A CA  1 
ATOM   1006 C C   . ILE A 1 126 ? 104.652 104.995 28.992  1.00 15.97 ? 126 ILE A C   1 
ATOM   1007 O O   . ILE A 1 126 ? 105.555 105.040 28.166  1.00 16.65 ? 126 ILE A O   1 
ATOM   1008 C CB  . ILE A 1 126 ? 105.320 104.513 31.381  1.00 15.90 ? 126 ILE A CB  1 
ATOM   1009 C CG1 . ILE A 1 126 ? 106.844 104.698 31.150  1.00 14.87 ? 126 ILE A CG1 1 
ATOM   1010 C CG2 . ILE A 1 126 ? 104.978 103.634 32.574  1.00 18.84 ? 126 ILE A CG2 1 
ATOM   1011 C CD1 . ILE A 1 126 ? 107.564 105.457 32.254  1.00 15.67 ? 126 ILE A CD1 1 
ATOM   1012 N N   . ASN A 1 127 ? 103.589 105.795 28.993  1.00 16.40 ? 127 ASN A N   1 
ATOM   1013 C CA  . ASN A 1 127 ? 103.311 106.767 27.968  1.00 16.45 ? 127 ASN A CA  1 
ATOM   1014 C C   . ASN A 1 127 ? 104.097 108.061 28.125  1.00 19.48 ? 127 ASN A C   1 
ATOM   1015 O O   . ASN A 1 127 ? 103.559 109.122 28.411  1.00 17.94 ? 127 ASN A O   1 
ATOM   1016 C CB  . ASN A 1 127 ? 101.854 107.058 28.000  1.00 18.62 ? 127 ASN A CB  1 
ATOM   1017 C CG  . ASN A 1 127 ? 101.397 107.828 26.777  1.00 22.71 ? 127 ASN A CG  1 
ATOM   1018 O OD1 . ASN A 1 127 ? 102.044 107.835 25.764  1.00 23.34 ? 127 ASN A OD1 1 
ATOM   1019 N ND2 . ASN A 1 127 ? 100.261 108.439 26.876  1.00 24.08 ? 127 ASN A ND2 1 
ATOM   1020 N N   . LEU A 1 128 ? 105.389 107.966 28.004  1.00 17.99 ? 128 LEU A N   1 
ATOM   1021 C CA  . LEU A 1 128 ? 106.301 109.106 28.092  1.00 21.27 ? 128 LEU A CA  1 
ATOM   1022 C C   . LEU A 1 128 ? 107.148 109.113 26.835  1.00 22.42 ? 128 LEU A C   1 
ATOM   1023 O O   . LEU A 1 128 ? 107.815 108.148 26.511  1.00 20.15 ? 128 LEU A O   1 
ATOM   1024 C CB  . LEU A 1 128 ? 107.146 108.838 29.341  1.00 27.28 ? 128 LEU A CB  1 
ATOM   1025 C CG  . LEU A 1 128 ? 107.826 109.864 30.131  1.00 35.49 ? 128 LEU A CG  1 
ATOM   1026 C CD1 . LEU A 1 128 ? 106.995 111.153 30.224  1.00 38.28 ? 128 LEU A CD1 1 
ATOM   1027 C CD2 . LEU A 1 128 ? 108.100 109.255 31.521  1.00 34.01 ? 128 LEU A CD2 1 
ATOM   1028 N N   . SER A 1 129 ? 107.069 110.193 26.083  1.00 20.61 ? 129 SER A N   1 
ATOM   1029 C CA  . SER A 1 129 ? 107.846 110.408 24.838  1.00 19.53 ? 129 SER A CA  1 
ATOM   1030 C C   . SER A 1 129 ? 109.275 110.827 25.079  1.00 18.16 ? 129 SER A C   1 
ATOM   1031 O O   . SER A 1 129 ? 109.610 111.391 26.114  1.00 18.97 ? 129 SER A O   1 
ATOM   1032 C CB  . SER A 1 129 ? 107.147 111.532 24.027  1.00 24.28 ? 129 SER A CB  1 
ATOM   1033 O OG  . SER A 1 129 ? 106.000 110.981 23.436  1.00 26.83 ? 129 SER A OG  1 
ATOM   1034 N N   . PHE A 1 130 ? 110.125 110.522 24.129  1.00 16.34 ? 130 PHE A N   1 
ATOM   1035 C CA  . PHE A 1 130 ? 111.494 110.885 24.199  1.00 16.81 ? 130 PHE A CA  1 
ATOM   1036 C C   . PHE A 1 130 ? 111.675 112.454 24.322  1.00 18.93 ? 130 PHE A C   1 
ATOM   1037 O O   . PHE A 1 130 ? 112.452 112.942 25.127  1.00 16.91 ? 130 PHE A O   1 
ATOM   1038 C CB  . PHE A 1 130 ? 112.255 110.422 22.990  1.00 19.94 ? 130 PHE A CB  1 
ATOM   1039 C CG  . PHE A 1 130 ? 113.724 110.735 23.068  1.00 19.59 ? 130 PHE A CG  1 
ATOM   1040 C CD1 . PHE A 1 130 ? 114.562 109.976 23.888  1.00 18.15 ? 130 PHE A CD1 1 
ATOM   1041 C CD2 . PHE A 1 130 ? 114.263 111.882 22.415  1.00 21.00 ? 130 PHE A CD2 1 
ATOM   1042 C CE1 . PHE A 1 130 ? 115.874 110.280 23.992  1.00 21.08 ? 130 PHE A CE1 1 
ATOM   1043 C CE2 . PHE A 1 130 ? 115.587 112.202 22.579  1.00 20.81 ? 130 PHE A CE2 1 
ATOM   1044 C CZ  . PHE A 1 130 ? 116.400 111.413 23.329  1.00 21.34 ? 130 PHE A CZ  1 
ATOM   1045 N N   . SER A 1 131 ? 110.970 113.177 23.494  1.00 20.16 ? 131 SER A N   1 
ATOM   1046 C CA  . SER A 1 131 ? 111.048 114.670 23.425  1.00 21.62 ? 131 SER A CA  1 
ATOM   1047 C C   . SER A 1 131 ? 109.801 115.142 22.671  1.00 22.80 ? 131 SER A C   1 
ATOM   1048 O O   . SER A 1 131 ? 109.066 114.354 22.081  1.00 20.64 ? 131 SER A O   1 
ATOM   1049 C CB  . SER A 1 131 ? 112.281 115.086 22.653  1.00 22.34 ? 131 SER A CB  1 
ATOM   1050 O OG  . SER A 1 131 ? 112.101 114.758 21.248  1.00 23.14 ? 131 SER A OG  1 
ATOM   1051 N N   . GLU A 1 132 ? 109.552 116.442 22.651  1.00 21.04 ? 132 GLU A N   1 
ATOM   1052 C CA  . GLU A 1 132 ? 108.447 116.955 21.947  1.00 21.95 ? 132 GLU A CA  1 
ATOM   1053 C C   . GLU A 1 132 ? 108.513 116.715 20.471  1.00 24.07 ? 132 GLU A C   1 
ATOM   1054 O O   . GLU A 1 132 ? 107.457 116.525 19.833  1.00 24.28 ? 132 GLU A O   1 
ATOM   1055 C CB  . GLU A 1 132 ? 108.363 118.449 22.214  1.00 26.69 ? 132 GLU A CB  1 
ATOM   1056 C CG  . GLU A 1 132 ? 107.993 118.759 23.638  1.00 27.96 ? 132 GLU A CG  1 
ATOM   1057 C CD  . GLU A 1 132 ? 107.232 120.071 23.666  1.00 40.42 ? 132 GLU A CD  1 
ATOM   1058 O OE1 . GLU A 1 132 ? 106.022 120.085 23.284  1.00 52.56 ? 132 GLU A OE1 1 
ATOM   1059 O OE2 . GLU A 1 132 ? 107.867 121.084 23.980  1.00 33.70 ? 132 GLU A OE2 1 
ATOM   1060 N N   . GLN A 1 133 ? 109.725 116.685 19.916  1.00 23.81 ? 133 GLN A N   1 
ATOM   1061 C CA  . GLN A 1 133 ? 109.871 116.514 18.484  1.00 26.45 ? 133 GLN A CA  1 
ATOM   1062 C C   . GLN A 1 133 ? 109.889 115.030 18.054  1.00 26.32 ? 133 GLN A C   1 
ATOM   1063 O O   . GLN A 1 133 ? 109.778 114.735 16.853  1.00 24.37 ? 133 GLN A O   1 
ATOM   1064 C CB  . GLN A 1 133 ? 111.099 117.238 17.887  1.00 33.66 ? 133 GLN A CB  1 
ATOM   1065 C CG  . GLN A 1 133 ? 112.462 117.051 18.463  1.00 33.27 ? 133 GLN A CG  1 
ATOM   1066 C CD  . GLN A 1 133 ? 112.702 118.010 19.574  1.00 36.28 ? 133 GLN A CD  1 
ATOM   1067 O OE1 . GLN A 1 133 ? 112.053 117.958 20.595  1.00 31.75 ? 133 GLN A OE1 1 
ATOM   1068 N NE2 . GLN A 1 133 ? 113.652 118.899 19.382  1.00 44.73 ? 133 GLN A NE2 1 
ATOM   1069 N N   . LEU A 1 134 ? 109.970 114.112 19.016  1.00 23.29 ? 134 LEU A N   1 
ATOM   1070 C CA  . LEU A 1 134 ? 109.955 112.672 18.717  1.00 20.75 ? 134 LEU A CA  1 
ATOM   1071 C C   . LEU A 1 134 ? 108.849 112.059 19.603  1.00 20.69 ? 134 LEU A C   1 
ATOM   1072 O O   . LEU A 1 134 ? 109.140 111.443 20.600  1.00 22.80 ? 134 LEU A O   1 
ATOM   1073 C CB  . LEU A 1 134 ? 111.329 112.084 19.009  1.00 21.15 ? 134 LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 134 ? 112.473 112.539 18.078  1.00 23.30 ? 134 LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 134 ? 113.845 112.089 18.541  1.00 24.34 ? 134 LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 134 ? 112.243 112.077 16.658  1.00 21.20 ? 134 LEU A CD2 1 
ATOM   1077 N N   . PRO A 1 135 ? 107.576 112.305 19.292  1.00 22.35 ? 135 PRO A N   1 
ATOM   1078 C CA  . PRO A 1 135 ? 106.475 111.740 20.090  1.00 21.35 ? 135 PRO A CA  1 
ATOM   1079 C C   . PRO A 1 135 ? 106.383 110.242 19.868  1.00 22.65 ? 135 PRO A C   1 
ATOM   1080 O O   . PRO A 1 135 ? 106.886 109.715 18.875  1.00 22.35 ? 135 PRO A O   1 
ATOM   1081 C CB  . PRO A 1 135 ? 105.249 112.425 19.538  1.00 21.47 ? 135 PRO A CB  1 
ATOM   1082 C CG  . PRO A 1 135 ? 105.596 112.669 18.137  1.00 23.38 ? 135 PRO A CG  1 
ATOM   1083 C CD  . PRO A 1 135 ? 107.051 113.032 18.126  1.00 21.87 ? 135 PRO A CD  1 
ATOM   1084 N N   . LEU A 1 136 ? 105.783 109.552 20.822  1.00 18.52 ? 136 LEU A N   1 
ATOM   1085 C CA  . LEU A 1 136 ? 105.650 108.088 20.741  1.00 19.84 ? 136 LEU A CA  1 
ATOM   1086 C C   . LEU A 1 136 ? 104.722 107.726 19.566  1.00 20.57 ? 136 LEU A C   1 
ATOM   1087 O O   . LEU A 1 136 ? 103.755 108.429 19.281  1.00 23.77 ? 136 LEU A O   1 
ATOM   1088 C CB  . LEU A 1 136 ? 105.034 107.609 21.999  1.00 19.85 ? 136 LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 136 ? 105.945 107.522 23.206  1.00 21.17 ? 136 LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 136 ? 105.184 106.992 24.414  1.00 21.27 ? 136 LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 136 ? 107.211 106.706 22.996  1.00 20.85 ? 136 LEU A CD2 1 
ATOM   1092 N N   . ALA A 1 137 ? 105.016 106.634 18.925  1.00 20.65 ? 137 ALA A N   1 
ATOM   1093 C CA  . ALA A 1 137 ? 104.131 105.941 18.013  1.00 21.30 ? 137 ALA A CA  1 
ATOM   1094 C C   . ALA A 1 137 ? 103.742 104.558 18.668  1.00 19.14 ? 137 ALA A C   1 
ATOM   1095 O O   . ALA A 1 137 ? 104.537 103.983 19.442  1.00 18.26 ? 137 ALA A O   1 
ATOM   1096 C CB  . ALA A 1 137 ? 104.877 105.644 16.732  1.00 22.19 ? 137 ALA A CB  1 
ATOM   1097 N N   . GLY A 1 138 ? 102.570 104.049 18.294  1.00 15.76 ? 138 GLY A N   1 
ATOM   1098 C CA  . GLY A 1 138 ? 102.198 102.683 18.701  1.00 17.26 ? 138 GLY A CA  1 
ATOM   1099 C C   . GLY A 1 138 ? 103.087 101.645 18.007  1.00 14.75 ? 138 GLY A C   1 
ATOM   1100 O O   . GLY A 1 138 ? 103.263 101.711 16.777  1.00 13.83 ? 138 GLY A O   1 
ATOM   1101 N N   . LEU A 1 139 ? 103.657 100.712 18.795  1.00 13.17 ? 139 LEU A N   1 
ATOM   1102 C CA  . LEU A 1 139 ? 104.539 99.719  18.286  1.00 12.80 ? 139 LEU A CA  1 
ATOM   1103 C C   . LEU A 1 139 ? 104.167 98.357  18.901  1.00 13.61 ? 139 LEU A C   1 
ATOM   1104 O O   . LEU A 1 139 ? 103.597 98.283  19.962  1.00 12.63 ? 139 LEU A O   1 
ATOM   1105 C CB  . LEU A 1 139 ? 106.009 99.965  18.666  1.00 13.68 ? 139 LEU A CB  1 
ATOM   1106 C CG  . LEU A 1 139 ? 106.670 101.239 18.179  1.00 15.83 ? 139 LEU A CG  1 
ATOM   1107 C CD1 . LEU A 1 139 ? 108.008 101.544 18.905  1.00 16.65 ? 139 LEU A CD1 1 
ATOM   1108 C CD2 . LEU A 1 139 ? 106.839 101.201 16.680  1.00 16.17 ? 139 LEU A CD2 1 
ATOM   1109 N N   . HIS A 1 140 ? 104.580 97.293  18.183  1.00 14.22 ? 140 HIS A N   1 
ATOM   1110 C CA  . HIS A 1 140 ? 104.767 95.952  18.774  1.00 14.23 ? 140 HIS A CA  1 
ATOM   1111 C C   . HIS A 1 140 ? 106.133 95.451  18.351  1.00 13.54 ? 140 HIS A C   1 
ATOM   1112 O O   . HIS A 1 140 ? 106.784 96.039  17.478  1.00 15.52 ? 140 HIS A O   1 
ATOM   1113 C CB  . HIS A 1 140 ? 103.616 95.046  18.417  1.00 13.24 ? 140 HIS A CB  1 
ATOM   1114 C CG  . HIS A 1 140 ? 103.488 94.705  16.929  1.00 14.54 ? 140 HIS A CG  1 
ATOM   1115 N ND1 . HIS A 1 140 ? 102.645 93.688  16.486  1.00 15.35 ? 140 HIS A ND1 1 
ATOM   1116 C CD2 . HIS A 1 140 ? 103.992 95.283  15.802  1.00 13.58 ? 140 HIS A CD2 1 
ATOM   1117 C CE1 . HIS A 1 140 ? 102.660 93.651  15.160  1.00 14.71 ? 140 HIS A CE1 1 
ATOM   1118 N NE2 . HIS A 1 140 ? 103.496 94.585  14.729  1.00 14.77 ? 140 HIS A NE2 1 
ATOM   1119 N N   . TRP A 1 141 ? 106.561 94.345  18.915  1.00 13.85 ? 141 TRP A N   1 
ATOM   1120 C CA  . TRP A 1 141 ? 107.936 93.935  18.747  1.00 13.49 ? 141 TRP A CA  1 
ATOM   1121 C C   . TRP A 1 141 ? 108.053 92.487  18.365  1.00 13.29 ? 141 TRP A C   1 
ATOM   1122 O O   . TRP A 1 141 ? 107.293 91.621  18.884  1.00 12.12 ? 141 TRP A O   1 
ATOM   1123 C CB  . TRP A 1 141 ? 108.733 94.161  20.075  1.00 13.42 ? 141 TRP A CB  1 
ATOM   1124 C CG  . TRP A 1 141 ? 108.800 95.638  20.379  1.00 13.63 ? 141 TRP A CG  1 
ATOM   1125 C CD1 . TRP A 1 141 ? 109.818 96.471  20.093  1.00 14.40 ? 141 TRP A CD1 1 
ATOM   1126 C CD2 . TRP A 1 141 ? 107.809 96.424  21.062  1.00 14.80 ? 141 TRP A CD2 1 
ATOM   1127 N NE1 . TRP A 1 141 ? 109.544 97.746  20.559  1.00 15.17 ? 141 TRP A NE1 1 
ATOM   1128 C CE2 . TRP A 1 141 ? 108.290 97.764  21.103  1.00 15.12 ? 141 TRP A CE2 1 
ATOM   1129 C CE3 . TRP A 1 141 ? 106.594 96.133  21.658  1.00 15.07 ? 141 TRP A CE3 1 
ATOM   1130 C CZ2 . TRP A 1 141 ? 107.578 98.799  21.728  1.00 14.09 ? 141 TRP A CZ2 1 
ATOM   1131 C CZ3 . TRP A 1 141 ? 105.854 97.175  22.236  1.00 14.68 ? 141 TRP A CZ3 1 
ATOM   1132 C CH2 . TRP A 1 141 ? 106.368 98.500  22.266  1.00 14.26 ? 141 TRP A CH2 1 
ATOM   1133 N N   . LEU A 1 142 ? 109.102 92.229  17.586  1.00 11.77 ? 142 LEU A N   1 
ATOM   1134 C CA  . LEU A 1 142 ? 109.602 90.851  17.383  1.00 12.62 ? 142 LEU A CA  1 
ATOM   1135 C C   . LEU A 1 142 ? 110.924 90.717  18.084  1.00 14.36 ? 142 LEU A C   1 
ATOM   1136 O O   . LEU A 1 142 ? 111.812 91.558  17.924  1.00 13.82 ? 142 LEU A O   1 
ATOM   1137 C CB  . LEU A 1 142 ? 109.802 90.554  15.881  1.00 13.69 ? 142 LEU A CB  1 
ATOM   1138 C CG  . LEU A 1 142 ? 110.257 89.133  15.456  1.00 14.51 ? 142 LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1 142 ? 109.126 88.159  15.842  1.00 15.52 ? 142 LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1 142 ? 110.564 89.024  13.997  1.00 14.92 ? 142 LEU A CD2 1 
ATOM   1141 N N   . ILE A 1 143 ? 111.048 89.674  18.889  1.00 14.61 ? 143 ILE A N   1 
ATOM   1142 C CA  . ILE A 1 143 ? 112.265 89.373  19.616  1.00 14.30 ? 143 ILE A CA  1 
ATOM   1143 C C   . ILE A 1 143 ? 112.722 87.985  19.140  1.00 14.38 ? 143 ILE A C   1 
ATOM   1144 O O   . ILE A 1 143 ? 111.923 87.028  19.162  1.00 13.76 ? 143 ILE A O   1 
ATOM   1145 C CB  . ILE A 1 143 ? 112.030 89.408  21.164  1.00 13.61 ? 143 ILE A CB  1 
ATOM   1146 C CG1 . ILE A 1 143 ? 111.639 90.808  21.602  1.00 13.77 ? 143 ILE A CG1 1 
ATOM   1147 C CG2 . ILE A 1 143 ? 113.303 88.923  21.867  1.00 13.58 ? 143 ILE A CG2 1 
ATOM   1148 C CD1 . ILE A 1 143 ? 111.231 90.947  23.028  1.00 15.16 ? 143 ILE A CD1 1 
ATOM   1149 N N   . ALA A 1 144 ? 113.964 87.870  18.691  1.00 14.26 ? 144 ALA A N   1 
ATOM   1150 C CA  . ALA A 1 144 ? 114.441 86.602  18.140  1.00 14.81 ? 144 ALA A CA  1 
ATOM   1151 C C   . ALA A 1 144 ? 115.838 86.272  18.579  1.00 15.20 ? 144 ALA A C   1 
ATOM   1152 O O   . ALA A 1 144 ? 116.696 87.141  18.644  1.00 16.10 ? 144 ALA A O   1 
ATOM   1153 C CB  . ALA A 1 144 ? 114.398 86.661  16.645  1.00 14.38 ? 144 ALA A CB  1 
ATOM   1154 N N   . ASP A 1 145 ? 116.091 84.983  18.773  1.00 15.37 ? 145 ASP A N   1 
ATOM   1155 C CA  . ASP A 1 145 ? 117.485 84.495  18.906  1.00 16.02 ? 145 ASP A CA  1 
ATOM   1156 C C   . ASP A 1 145 ? 117.674 83.435  17.859  1.00 18.66 ? 145 ASP A C   1 
ATOM   1157 O O   . ASP A 1 145 ? 116.868 83.308  16.966  1.00 18.82 ? 145 ASP A O   1 
ATOM   1158 C CB  . ASP A 1 145 ? 117.820 84.025  20.320  1.00 16.95 ? 145 ASP A CB  1 
ATOM   1159 C CG  . ASP A 1 145 ? 117.040 82.792  20.753  1.00 17.55 ? 145 ASP A CG  1 
ATOM   1160 O OD1 . ASP A 1 145 ? 116.467 82.065  19.923  1.00 18.11 ? 145 ASP A OD1 1 
ATOM   1161 O OD2 . ASP A 1 145 ? 116.945 82.640  21.993  1.00 16.70 ? 145 ASP A OD2 1 
ATOM   1162 N N   . ARG A 1 146 ? 118.825 82.777  17.873  1.00 16.74 ? 146 ARG A N   1 
ATOM   1163 C CA  . ARG A 1 146 ? 119.130 81.807  16.811  1.00 19.95 ? 146 ARG A CA  1 
ATOM   1164 C C   . ARG A 1 146 ? 118.173 80.559  16.796  1.00 23.09 ? 146 ARG A C   1 
ATOM   1165 O O   . ARG A 1 146 ? 118.097 79.873  15.797  1.00 22.34 ? 146 ARG A O   1 
ATOM   1166 C CB  . ARG A 1 146 ? 120.577 81.331  16.970  1.00 21.99 ? 146 ARG A CB  1 
ATOM   1167 C CG  . ARG A 1 146 ? 120.788 80.389  18.144  1.00 25.43 ? 146 ARG A CG  1 
ATOM   1168 C CD  . ARG A 1 146 ? 122.281 80.220  18.454  1.00 36.98 ? 146 ARG A CD  1 
ATOM   1169 N NE  . ARG A 1 146 ? 123.058 79.742  17.315  1.00 41.38 ? 146 ARG A NE  1 
ATOM   1170 C CZ  . ARG A 1 146 ? 123.156 78.460  16.913  1.00 46.01 ? 146 ARG A CZ  1 
ATOM   1171 N NH1 . ARG A 1 146 ? 123.947 78.157  15.867  1.00 35.11 ? 146 ARG A NH1 1 
ATOM   1172 N NH2 . ARG A 1 146 ? 122.458 77.489  17.514  1.00 45.68 ? 146 ARG A NH2 1 
ATOM   1173 N N   . GLU A 1 147 ? 117.422 80.353  17.871  1.00 22.51 ? 147 GLU A N   1 
ATOM   1174 C CA  . GLU A 1 147 ? 116.540 79.228  18.000  1.00 23.68 ? 147 GLU A CA  1 
ATOM   1175 C C   . GLU A 1 147 ? 115.075 79.582  17.679  1.00 23.30 ? 147 GLU A C   1 
ATOM   1176 O O   . GLU A 1 147 ? 114.360 78.762  17.080  1.00 19.48 ? 147 GLU A O   1 
ATOM   1177 C CB  . GLU A 1 147 ? 116.684 78.667  19.418  1.00 29.97 ? 147 GLU A CB  1 
ATOM   1178 C CG  . GLU A 1 147 ? 115.767 77.464  19.718  1.00 42.96 ? 147 GLU A CG  1 
ATOM   1179 C CD  . GLU A 1 147 ? 115.635 77.087  21.213  1.00 52.73 ? 147 GLU A CD  1 
ATOM   1180 O OE1 . GLU A 1 147 ? 116.192 77.794  22.089  1.00 45.07 ? 147 GLU A OE1 1 
ATOM   1181 O OE2 . GLU A 1 147 ? 114.942 76.077  21.513  1.00 54.78 ? 147 GLU A OE2 1 
ATOM   1182 N N   . LYS A 1 148 ? 114.587 80.716  18.128  1.00 18.80 ? 148 LYS A N   1 
ATOM   1183 C CA  . LYS A 1 148 ? 113.136 80.950  18.118  1.00 18.28 ? 148 LYS A CA  1 
ATOM   1184 C C   . LYS A 1 148 ? 112.820 82.446  18.189  1.00 17.63 ? 148 LYS A C   1 
ATOM   1185 O O   . LYS A 1 148 ? 113.756 83.234  18.369  1.00 16.15 ? 148 LYS A O   1 
ATOM   1186 C CB  . LYS A 1 148 ? 112.475 80.199  19.277  1.00 20.05 ? 148 LYS A CB  1 
ATOM   1187 C CG  . LYS A 1 148 ? 112.885 80.605  20.669  1.00 21.82 ? 148 LYS A CG  1 
ATOM   1188 C CD  . LYS A 1 148 ? 112.302 79.623  21.703  1.00 25.75 ? 148 LYS A CD  1 
ATOM   1189 C CE  . LYS A 1 148 ? 112.564 80.105  23.085  1.00 27.81 ? 148 LYS A CE  1 
ATOM   1190 N NZ  . LYS A 1 148 ? 112.092 79.095  24.070  1.00 31.62 ? 148 LYS A NZ  1 
ATOM   1191 N N   . SER A 1 149 ? 111.539 82.794  18.111  1.00 15.48 ? 149 SER A N   1 
ATOM   1192 C CA  . SER A 1 149 ? 111.138 84.208  18.276  1.00 17.07 ? 149 SER A CA  1 
ATOM   1193 C C   . SER A 1 149 ? 109.822 84.294  18.999  1.00 15.79 ? 149 SER A C   1 
ATOM   1194 O O   . SER A 1 149 ? 108.997 83.345  18.969  1.00 13.29 ? 149 SER A O   1 
ATOM   1195 C CB  . SER A 1 149 ? 111.033 84.931  16.919  1.00 15.47 ? 149 SER A CB  1 
ATOM   1196 O OG  . SER A 1 149 ? 110.270 84.229  15.959  1.00 15.21 ? 149 SER A OG  1 
ATOM   1197 N N   . ILE A 1 150 ? 109.592 85.490  19.542  1.00 13.51 ? 150 ILE A N   1 
ATOM   1198 C CA  . ILE A 1 150 ? 108.351 85.798  20.173  1.00 12.23 ? 150 ILE A CA  1 
ATOM   1199 C C   . ILE A 1 150 ? 107.893 87.171  19.685  1.00 12.40 ? 150 ILE A C   1 
ATOM   1200 O O   . ILE A 1 150 ? 108.690 87.999  19.252  1.00 11.89 ? 150 ILE A O   1 
ATOM   1201 C CB  . ILE A 1 150 ? 108.457 85.797  21.728  1.00 12.99 ? 150 ILE A CB  1 
ATOM   1202 C CG1 . ILE A 1 150 ? 109.527 86.767  22.181  1.00 13.61 ? 150 ILE A CG1 1 
ATOM   1203 C CG2 . ILE A 1 150 ? 108.688 84.367  22.285  1.00 13.86 ? 150 ILE A CG2 1 
ATOM   1204 C CD1 . ILE A 1 150 ? 109.644 86.926  23.650  1.00 16.31 ? 150 ILE A CD1 1 
ATOM   1205 N N   . VAL A 1 151 ? 106.606 87.374  19.847  1.00 11.05 ? 151 VAL A N   1 
ATOM   1206 C CA  . VAL A 1 151 ? 105.940 88.612  19.540  1.00 12.46 ? 151 VAL A CA  1 
ATOM   1207 C C   . VAL A 1 151 ? 105.483 89.206  20.839  1.00 13.43 ? 151 VAL A C   1 
ATOM   1208 O O   . VAL A 1 151 ? 104.834 88.531  21.657  1.00 14.96 ? 151 VAL A O   1 
ATOM   1209 C CB  . VAL A 1 151 ? 104.800 88.395  18.588  1.00 11.66 ? 151 VAL A CB  1 
ATOM   1210 C CG1 . VAL A 1 151 ? 104.048 89.696  18.297  1.00 13.79 ? 151 VAL A CG1 1 
ATOM   1211 C CG2 . VAL A 1 151 ? 105.355 87.887  17.255  1.00 11.61 ? 151 VAL A CG2 1 
ATOM   1212 N N   . VAL A 1 152 ? 105.766 90.503  21.019  1.00 12.77 ? 152 VAL A N   1 
ATOM   1213 C CA  . VAL A 1 152 ? 105.238 91.248  22.163  1.00 14.68 ? 152 VAL A CA  1 
ATOM   1214 C C   . VAL A 1 152 ? 104.241 92.282  21.704  1.00 13.50 ? 152 VAL A C   1 
ATOM   1215 O O   . VAL A 1 152 ? 104.595 93.197  20.957  1.00 13.54 ? 152 VAL A O   1 
ATOM   1216 C CB  . VAL A 1 152 ? 106.357 91.949  23.001  1.00 15.28 ? 152 VAL A CB  1 
ATOM   1217 C CG1 . VAL A 1 152 ? 105.776 92.722  24.173  1.00 16.36 ? 152 VAL A CG1 1 
ATOM   1218 C CG2 . VAL A 1 152 ? 107.358 90.918  23.471  1.00 15.67 ? 152 VAL A CG2 1 
ATOM   1219 N N   . GLU A 1 153 ? 103.008 92.179  22.198  1.00 13.04 ? 153 GLU A N   1 
ATOM   1220 C CA  . GLU A 1 153 ? 101.964 93.141  21.883  1.00 13.60 ? 153 GLU A CA  1 
ATOM   1221 C C   . GLU A 1 153 ? 101.388 93.597  23.221  1.00 15.10 ? 153 GLU A C   1 
ATOM   1222 O O   . GLU A 1 153 ? 100.751 92.792  23.958  1.00 15.46 ? 153 GLU A O   1 
ATOM   1223 C CB  . GLU A 1 153 ? 100.893 92.538  20.942  1.00 13.23 ? 153 GLU A CB  1 
ATOM   1224 C CG  . GLU A 1 153 ? 101.452 92.452  19.533  1.00 13.72 ? 153 GLU A CG  1 
ATOM   1225 C CD  . GLU A 1 153 ? 100.552 91.802  18.487  1.00 14.63 ? 153 GLU A CD  1 
ATOM   1226 O OE1 . GLU A 1 153 ? 99.484  91.190  18.849  1.00 14.94 ? 153 GLU A OE1 1 
ATOM   1227 O OE2 . GLU A 1 153 ? 100.980 91.850  17.276  1.00 14.74 ? 153 GLU A OE2 1 
ATOM   1228 N N   . VAL A 1 154 ? 101.582 94.869  23.543  1.00 14.34 ? 154 VAL A N   1 
ATOM   1229 C CA  . VAL A 1 154 ? 101.031 95.473  24.743  1.00 16.25 ? 154 VAL A CA  1 
ATOM   1230 C C   . VAL A 1 154 ? 99.833  96.283  24.318  1.00 16.61 ? 154 VAL A C   1 
ATOM   1231 O O   . VAL A 1 154 ? 99.956  97.301  23.681  1.00 18.67 ? 154 VAL A O   1 
ATOM   1232 C CB  . VAL A 1 154 ? 102.071 96.371  25.482  1.00 18.59 ? 154 VAL A CB  1 
ATOM   1233 C CG1 . VAL A 1 154 ? 101.496 96.950  26.807  1.00 20.37 ? 154 VAL A CG1 1 
ATOM   1234 C CG2 . VAL A 1 154 ? 103.304 95.521  25.792  1.00 20.15 ? 154 VAL A CG2 1 
ATOM   1235 N N   . THR A 1 155 ? 98.671  95.844  24.757  1.00 15.34 ? 155 THR A N   1 
ATOM   1236 C CA  . THR A 1 155 ? 97.424  96.456  24.369  1.00 16.66 ? 155 THR A CA  1 
ATOM   1237 C C   . THR A 1 155 ? 96.600  96.770  25.598  1.00 19.54 ? 155 THR A C   1 
ATOM   1238 O O   . THR A 1 155 ? 97.036  96.495  26.720  1.00 18.52 ? 155 THR A O   1 
ATOM   1239 C CB  . THR A 1 155 ? 96.580  95.453  23.533  1.00 17.01 ? 155 THR A CB  1 
ATOM   1240 O OG1 . THR A 1 155 ? 96.206  94.333  24.343  1.00 18.47 ? 155 THR A OG1 1 
ATOM   1241 C CG2 . THR A 1 155 ? 97.415  94.928  22.375  1.00 19.70 ? 155 THR A CG2 1 
ATOM   1242 N N   . LYS A 1 156 ? 95.422  97.330  25.395  1.00 19.69 ? 156 LYS A N   1 
ATOM   1243 C CA  . LYS A 1 156 ? 94.542  97.653  26.549  1.00 25.58 ? 156 LYS A CA  1 
ATOM   1244 C C   . LYS A 1 156 ? 94.249  96.434  27.409  1.00 25.86 ? 156 LYS A C   1 
ATOM   1245 O O   . LYS A 1 156 ? 94.036  96.599  28.603  1.00 26.16 ? 156 LYS A O   1 
ATOM   1246 C CB  . LYS A 1 156 ? 93.228  98.296  26.102  1.00 27.78 ? 156 LYS A CB  1 
ATOM   1247 C CG  . LYS A 1 156 ? 93.418  99.708  25.654  1.00 43.46 ? 156 LYS A CG  1 
ATOM   1248 C CD  . LYS A 1 156 ? 92.145  100.374 25.107  1.00 52.19 ? 156 LYS A CD  1 
ATOM   1249 C CE  . LYS A 1 156 ? 92.469  101.677 24.348  1.00 58.72 ? 156 LYS A CE  1 
ATOM   1250 N NZ  . LYS A 1 156 ? 91.583  102.812 24.753  1.00 55.91 ? 156 LYS A NZ  1 
ATOM   1251 N N   . SER A 1 157 ? 94.254  95.235  26.841  1.00 21.32 ? 157 SER A N   1 
ATOM   1252 C CA  . SER A 1 157 ? 94.019  94.035  27.629  1.00 22.22 ? 157 SER A CA  1 
ATOM   1253 C C   . SER A 1 157 ? 95.204  93.397  28.287  1.00 25.21 ? 157 SER A C   1 
ATOM   1254 O O   . SER A 1 157 ? 95.023  92.393  28.920  1.00 26.37 ? 157 SER A O   1 
ATOM   1255 C CB  . SER A 1 157 ? 93.294  92.956  26.818  1.00 24.25 ? 157 SER A CB  1 
ATOM   1256 O OG  . SER A 1 157 ? 94.088  92.581  25.745  1.00 23.55 ? 157 SER A OG  1 
ATOM   1257 N N   . GLY A 1 158 ? 96.404  93.930  28.157  1.00 23.22 ? 158 GLY A N   1 
ATOM   1258 C CA  . GLY A 1 158 ? 97.538  93.328  28.833  1.00 26.44 ? 158 GLY A CA  1 
ATOM   1259 C C   . GLY A 1 158 ? 98.810  93.274  27.994  1.00 22.69 ? 158 GLY A C   1 
ATOM   1260 O O   . GLY A 1 158 ? 98.859  93.734  26.851  1.00 18.09 ? 158 GLY A O   1 
ATOM   1261 N N   . VAL A 1 159 ? 99.846  92.742  28.611  1.00 20.05 ? 159 VAL A N   1 
ATOM   1262 C CA  . VAL A 1 159 ? 101.114 92.527  27.971  1.00 19.98 ? 159 VAL A CA  1 
ATOM   1263 C C   . VAL A 1 159 ? 101.031 91.105  27.374  1.00 22.17 ? 159 VAL A C   1 
ATOM   1264 O O   . VAL A 1 159 ? 101.127 90.096  28.113  1.00 24.26 ? 159 VAL A O   1 
ATOM   1265 C CB  . VAL A 1 159 ? 102.231 92.610  29.015  1.00 20.58 ? 159 VAL A CB  1 
ATOM   1266 C CG1 . VAL A 1 159 ? 103.527 92.166  28.395  1.00 19.66 ? 159 VAL A CG1 1 
ATOM   1267 C CG2 . VAL A 1 159 ? 102.292 94.016  29.553  1.00 21.29 ? 159 VAL A CG2 1 
ATOM   1268 N N   . HIS A 1 160 ? 100.906 90.991  26.056  1.00 17.17 ? 160 HIS A N   1 
ATOM   1269 C CA  . HIS A 1 160 ? 100.730 89.665  25.442  1.00 18.82 ? 160 HIS A CA  1 
ATOM   1270 C C   . HIS A 1 160 ? 102.041 89.262  24.782  1.00 18.82 ? 160 HIS A C   1 
ATOM   1271 O O   . HIS A 1 160 ? 102.617 90.076  24.036  1.00 14.17 ? 160 HIS A O   1 
ATOM   1272 C CB  . HIS A 1 160 ? 99.630  89.724  24.380  1.00 18.83 ? 160 HIS A CB  1 
ATOM   1273 C CG  . HIS A 1 160 ? 98.331  90.252  24.901  1.00 22.53 ? 160 HIS A CG  1 
ATOM   1274 N ND1 . HIS A 1 160 ? 97.516  89.503  25.725  1.00 26.62 ? 160 HIS A ND1 1 
ATOM   1275 C CD2 . HIS A 1 160 ? 97.713  91.436  24.743  1.00 20.89 ? 160 HIS A CD2 1 
ATOM   1276 C CE1 . HIS A 1 160 ? 96.461  90.217  26.067  1.00 26.73 ? 160 HIS A CE1 1 
ATOM   1277 N NE2 . HIS A 1 160 ? 96.539  91.385  25.458  1.00 22.29 ? 160 HIS A NE2 1 
ATOM   1278 N N   . ILE A 1 161 ? 102.489 88.020  25.073  1.00 16.00 ? 161 ILE A N   1 
ATOM   1279 C CA  . ILE A 1 161 ? 103.656 87.431  24.513  1.00 14.77 ? 161 ILE A CA  1 
ATOM   1280 C C   . ILE A 1 161 ? 103.258 86.175  23.767  1.00 18.08 ? 161 ILE A C   1 
ATOM   1281 O O   . ILE A 1 161 ? 102.654 85.289  24.363  1.00 15.93 ? 161 ILE A O   1 
ATOM   1282 C CB  . ILE A 1 161 ? 104.701 87.135  25.584  1.00 15.23 ? 161 ILE A CB  1 
ATOM   1283 C CG1 . ILE A 1 161 ? 104.871 88.375  26.504  1.00 15.47 ? 161 ILE A CG1 1 
ATOM   1284 C CG2 . ILE A 1 161 ? 106.007 86.688  24.911  1.00 16.46 ? 161 ILE A CG2 1 
ATOM   1285 C CD1 . ILE A 1 161 ? 105.764 88.130  27.722  1.00 18.26 ? 161 ILE A CD1 1 
ATOM   1286 N N   . TYR A 1 162 ? 103.566 86.115  22.467  1.00 13.64 ? 162 TYR A N   1 
ATOM   1287 C CA  . TYR A 1 162 ? 103.224 84.939  21.655  1.00 15.18 ? 162 TYR A CA  1 
ATOM   1288 C C   . TYR A 1 162 ? 104.482 84.282  21.146  1.00 14.42 ? 162 TYR A C   1 
ATOM   1289 O O   . TYR A 1 162 ? 105.399 84.935  20.626  1.00 13.58 ? 162 TYR A O   1 
ATOM   1290 C CB  . TYR A 1 162 ? 102.438 85.368  20.447  1.00 15.91 ? 162 TYR A CB  1 
ATOM   1291 C CG  . TYR A 1 162 ? 101.250 86.191  20.746  1.00 16.48 ? 162 TYR A CG  1 
ATOM   1292 C CD1 . TYR A 1 162 ? 100.052 85.609  21.062  1.00 21.40 ? 162 TYR A CD1 1 
ATOM   1293 C CD2 . TYR A 1 162 ? 101.286 87.567  20.632  1.00 19.08 ? 162 TYR A CD2 1 
ATOM   1294 C CE1 . TYR A 1 162 ? 98.915  86.376  21.297  1.00 22.06 ? 162 TYR A CE1 1 
ATOM   1295 C CE2 . TYR A 1 162 ? 100.177 88.351  20.950  1.00 18.19 ? 162 TYR A CE2 1 
ATOM   1296 C CZ  . TYR A 1 162 ? 98.988  87.743  21.222  1.00 19.22 ? 162 TYR A CZ  1 
ATOM   1297 O OH  . TYR A 1 162 ? 97.898  88.479  21.545  1.00 19.66 ? 162 TYR A OH  1 
ATOM   1298 N N   . ASP A 1 163 ? 104.514 82.971  21.216  1.00 14.94 ? 163 ASP A N   1 
ATOM   1299 C CA  . ASP A 1 163 ? 105.472 82.233  20.443  1.00 16.63 ? 163 ASP A CA  1 
ATOM   1300 C C   . ASP A 1 163 ? 105.190 82.481  18.951  1.00 15.78 ? 163 ASP A C   1 
ATOM   1301 O O   . ASP A 1 163 ? 104.051 82.424  18.527  1.00 14.57 ? 163 ASP A O   1 
ATOM   1302 C CB  . ASP A 1 163 ? 105.376 80.737  20.766  1.00 18.38 ? 163 ASP A CB  1 
ATOM   1303 C CG  . ASP A 1 163 ? 105.922 80.425  22.158  1.00 23.05 ? 163 ASP A CG  1 
ATOM   1304 O OD1 . ASP A 1 163 ? 106.842 81.108  22.641  1.00 27.13 ? 163 ASP A OD1 1 
ATOM   1305 O OD2 . ASP A 1 163 ? 105.496 79.428  22.727  1.00 28.40 ? 163 ASP A OD2 1 
ATOM   1306 N N   . ASN A 1 164 ? 106.244 82.701  18.161  1.00 15.08 ? 164 ASN A N   1 
ATOM   1307 C CA  . ASN A 1 164 ? 106.063 82.964  16.730  1.00 15.24 ? 164 ASN A CA  1 
ATOM   1308 C C   . ASN A 1 164 ? 106.488 81.750  15.933  1.00 17.06 ? 164 ASN A C   1 
ATOM   1309 O O   . ASN A 1 164 ? 107.657 81.594  15.691  1.00 18.68 ? 164 ASN A O   1 
ATOM   1310 C CB  . ASN A 1 164 ? 106.807 84.238  16.307  1.00 15.12 ? 164 ASN A CB  1 
ATOM   1311 C CG  . ASN A 1 164 ? 106.421 84.701  14.902  1.00 14.23 ? 164 ASN A CG  1 
ATOM   1312 O OD1 . ASN A 1 164 ? 106.087 83.861  14.043  1.00 14.42 ? 164 ASN A OD1 1 
ATOM   1313 N ND2 . ASN A 1 164 ? 106.426 85.995  14.658  1.00 14.87 ? 164 ASN A ND2 1 
ATOM   1314 N N   . PRO A 1 165 ? 105.534 80.907  15.462  1.00 17.22 ? 165 PRO A N   1 
ATOM   1315 C CA  . PRO A 1 165 ? 105.942 79.630  14.823  1.00 18.35 ? 165 PRO A CA  1 
ATOM   1316 C C   . PRO A 1 165 ? 106.550 79.762  13.451  1.00 17.44 ? 165 PRO A C   1 
ATOM   1317 O O   . PRO A 1 165 ? 107.112 78.802  12.943  1.00 15.92 ? 165 PRO A O   1 
ATOM   1318 C CB  . PRO A 1 165 ? 104.639 78.825  14.739  1.00 18.80 ? 165 PRO A CB  1 
ATOM   1319 C CG  . PRO A 1 165 ? 103.587 79.794  14.787  1.00 19.26 ? 165 PRO A CG  1 
ATOM   1320 C CD  . PRO A 1 165 ? 104.088 81.052  15.521  1.00 19.13 ? 165 PRO A CD  1 
ATOM   1321 N N   . ILE A 1 166 ? 106.476 80.955  12.858  1.00 12.89 ? 166 ILE A N   1 
ATOM   1322 C CA  . ILE A 1 166 ? 106.930 81.133  11.465  1.00 13.53 ? 166 ILE A CA  1 
ATOM   1323 C C   . ILE A 1 166 ? 107.995 82.209  11.308  1.00 12.61 ? 166 ILE A C   1 
ATOM   1324 O O   . ILE A 1 166 ? 108.446 82.419  10.219  1.00 12.42 ? 166 ILE A O   1 
ATOM   1325 C CB  . ILE A 1 166 ? 105.733 81.441  10.515  1.00 14.15 ? 166 ILE A CB  1 
ATOM   1326 C CG1 . ILE A 1 166 ? 104.893 82.621  11.022  1.00 14.16 ? 166 ILE A CG1 1 
ATOM   1327 C CG2 . ILE A 1 166 ? 104.842 80.203  10.365  1.00 14.71 ? 166 ILE A CG2 1 
ATOM   1328 C CD1 . ILE A 1 166 ? 103.801 83.114  10.076  1.00 14.61 ? 166 ILE A CD1 1 
ATOM   1329 N N   . GLY A 1 167 ? 108.294 82.953  12.369  1.00 12.75 ? 167 GLY A N   1 
ATOM   1330 C CA  . GLY A 1 167 ? 109.269 84.044  12.272  1.00 13.31 ? 167 GLY A CA  1 
ATOM   1331 C C   . GLY A 1 167 ? 108.872 85.156  11.323  1.00 13.67 ? 167 GLY A C   1 
ATOM   1332 O O   . GLY A 1 167 ? 109.682 85.630  10.531  1.00 14.86 ? 167 GLY A O   1 
ATOM   1333 N N   . ILE A 1 168 ? 107.632 85.625  11.407  1.00 12.85 ? 168 ILE A N   1 
ATOM   1334 C CA  . ILE A 1 168 ? 107.098 86.714  10.566  1.00 14.12 ? 168 ILE A CA  1 
ATOM   1335 C C   . ILE A 1 168 ? 106.309 87.679  11.418  1.00 12.16 ? 168 ILE A C   1 
ATOM   1336 O O   . ILE A 1 168 ? 105.573 87.268  12.328  1.00 13.35 ? 168 ILE A O   1 
ATOM   1337 C CB  . ILE A 1 168 ? 106.115 86.175  9.456   1.00 12.51 ? 168 ILE A CB  1 
ATOM   1338 C CG1 . ILE A 1 168 ? 106.745 85.164  8.557   1.00 13.12 ? 168 ILE A CG1 1 
ATOM   1339 C CG2 . ILE A 1 168 ? 105.438 87.310  8.663   1.00 13.60 ? 168 ILE A CG2 1 
ATOM   1340 C CD1 . ILE A 1 168 ? 107.750 85.722  7.595   1.00 14.63 ? 168 ILE A CD1 1 
ATOM   1341 N N   . LEU A 1 169 ? 106.494 88.958  11.181  1.00 11.64 ? 169 LEU A N   1 
ATOM   1342 C CA  . LEU A 1 169 ? 105.639 89.998  11.779  1.00 11.86 ? 169 LEU A CA  1 
ATOM   1343 C C   . LEU A 1 169 ? 105.484 91.182  10.847  1.00 11.97 ? 169 LEU A C   1 
ATOM   1344 O O   . LEU A 1 169 ? 106.464 91.602  10.199  1.00 11.70 ? 169 LEU A O   1 
ATOM   1345 C CB  . LEU A 1 169 ? 106.234 90.474  13.150  1.00 13.22 ? 169 LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 169 ? 105.288 91.259  14.067  1.00 13.05 ? 169 LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 169 ? 104.163 90.397  14.543  1.00 12.83 ? 169 LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 169 ? 106.092 91.862  15.241  1.00 13.48 ? 169 LEU A CD2 1 
ATOM   1349 N N   . THR A 1 170 ? 104.300 91.784  10.845  1.00 12.02 ? 170 THR A N   1 
ATOM   1350 C CA  . THR A 1 170 ? 104.085 93.059  10.157  1.00 11.65 ? 170 THR A CA  1 
ATOM   1351 C C   . THR A 1 170 ? 103.490 94.081  11.061  1.00 12.08 ? 170 THR A C   1 
ATOM   1352 O O   . THR A 1 170 ? 104.128 94.433  12.083  1.00 12.52 ? 170 THR A O   1 
ATOM   1353 C CB  . THR A 1 170 ? 103.336 92.924  8.804   1.00 11.69 ? 170 THR A CB  1 
ATOM   1354 O OG1 . THR A 1 170 ? 101.994 92.511  9.010   1.00 11.04 ? 170 THR A OG1 1 
ATOM   1355 C CG2 . THR A 1 170 ? 104.052 91.955  7.918   1.00 10.99 ? 170 THR A CG2 1 
ATOM   1356 N N   . ASN A 1 171 ? 102.279 94.565  10.776  1.00 11.48 ? 171 ASN A N   1 
ATOM   1357 C CA  . ASN A 1 171 ? 101.654 95.598  11.545  1.00 13.11 ? 171 ASN A CA  1 
ATOM   1358 C C   . ASN A 1 171 ? 100.314 95.047  12.061  1.00 13.99 ? 171 ASN A C   1 
ATOM   1359 O O   . ASN A 1 171 ? 100.276 93.878  12.451  1.00 16.14 ? 171 ASN A O   1 
ATOM   1360 C CB  . ASN A 1 171 ? 101.507 96.877  10.710  1.00 14.57 ? 171 ASN A CB  1 
ATOM   1361 C CG  . ASN A 1 171 ? 102.809 97.294  10.043  1.00 14.81 ? 171 ASN A CG  1 
ATOM   1362 O OD1 . ASN A 1 171 ? 103.021 97.124  8.865   1.00 14.12 ? 171 ASN A OD1 1 
ATOM   1363 N ND2 . ASN A 1 171 ? 103.721 97.836  10.861  1.00 16.78 ? 171 ASN A ND2 1 
ATOM   1364 N N   . ASN A 1 172 ? 99.238  95.850  12.096  1.00 13.83 ? 172 ASN A N   1 
ATOM   1365 C CA  . ASN A 1 172 ? 97.895  95.327  12.515  1.00 13.34 ? 172 ASN A CA  1 
ATOM   1366 C C   . ASN A 1 172 ? 97.391  94.355  11.481  1.00 15.75 ? 172 ASN A C   1 
ATOM   1367 O O   . ASN A 1 172 ? 97.791  94.481  10.313  1.00 14.45 ? 172 ASN A O   1 
ATOM   1368 C CB  . ASN A 1 172 ? 96.900  96.461  12.706  1.00 13.39 ? 172 ASN A CB  1 
ATOM   1369 C CG  . ASN A 1 172 ? 97.226  97.326  13.927  1.00 13.56 ? 172 ASN A CG  1 
ATOM   1370 O OD1 . ASN A 1 172 ? 97.615  96.809  14.955  1.00 16.67 ? 172 ASN A OD1 1 
ATOM   1371 N ND2 . ASN A 1 172 ? 97.059  98.639  13.813  1.00 13.68 ? 172 ASN A ND2 1 
ATOM   1372 N N   . PRO A 1 173 ? 96.515  93.420  11.866  1.00 14.94 ? 173 PRO A N   1 
ATOM   1373 C CA  . PRO A 1 173 ? 95.960  93.282  13.234  1.00 13.40 ? 173 PRO A CA  1 
ATOM   1374 C C   . PRO A 1 173 ? 96.863  92.519  14.197  1.00 13.09 ? 173 PRO A C   1 
ATOM   1375 O O   . PRO A 1 173 ? 98.022  92.138  13.892  1.00 11.49 ? 173 PRO A O   1 
ATOM   1376 C CB  . PRO A 1 173 ? 94.642  92.499  12.973  1.00 14.85 ? 173 PRO A CB  1 
ATOM   1377 C CG  . PRO A 1 173 ? 95.038  91.593  11.826  1.00 14.26 ? 173 PRO A CG  1 
ATOM   1378 C CD  . PRO A 1 173 ? 95.831  92.519  10.927  1.00 16.27 ? 173 PRO A CD  1 
ATOM   1379 N N   . GLU A 1 174 ? 96.329  92.298  15.399  1.00 12.75 ? 174 GLU A N   1 
ATOM   1380 C CA  . GLU A 1 174 ? 97.011  91.571  16.428  1.00 13.86 ? 174 GLU A CA  1 
ATOM   1381 C C   . GLU A 1 174 ? 97.405  90.167  15.989  1.00 14.23 ? 174 GLU A C   1 
ATOM   1382 O O   . GLU A 1 174 ? 96.807  89.598  15.032  1.00 14.44 ? 174 GLU A O   1 
ATOM   1383 C CB  . GLU A 1 174 ? 96.107  91.511  17.656  1.00 16.13 ? 174 GLU A CB  1 
ATOM   1384 C CG  . GLU A 1 174 ? 95.999  92.872  18.352  1.00 21.16 ? 174 GLU A CG  1 
ATOM   1385 C CD  . GLU A 1 174 ? 94.769  93.059  19.292  1.00 28.86 ? 174 GLU A CD  1 
ATOM   1386 O OE1 . GLU A 1 174 ? 93.817  92.225  19.295  1.00 34.55 ? 174 GLU A OE1 1 
ATOM   1387 O OE2 . GLU A 1 174 ? 94.724  94.153  19.896  1.00 31.36 ? 174 GLU A OE2 1 
ATOM   1388 N N   . PHE A 1 175 ? 98.404  89.612  16.669  1.00 13.10 ? 175 PHE A N   1 
ATOM   1389 C CA  . PHE A 1 175 ? 99.105  88.476  16.110  1.00 13.71 ? 175 PHE A CA  1 
ATOM   1390 C C   . PHE A 1 175 ? 98.228  87.234  15.895  1.00 14.34 ? 175 PHE A C   1 
ATOM   1391 O O   . PHE A 1 175 ? 98.383  86.544  14.880  1.00 13.59 ? 175 PHE A O   1 
ATOM   1392 C CB  . PHE A 1 175 ? 100.305 88.116  16.976  1.00 13.91 ? 175 PHE A CB  1 
ATOM   1393 C CG  . PHE A 1 175 ? 101.227 87.122  16.345  1.00 13.91 ? 175 PHE A CG  1 
ATOM   1394 C CD1 . PHE A 1 175 ? 101.943 87.476  15.212  1.00 13.97 ? 175 PHE A CD1 1 
ATOM   1395 C CD2 . PHE A 1 175 ? 101.405 85.840  16.896  1.00 15.94 ? 175 PHE A CD2 1 
ATOM   1396 C CE1 . PHE A 1 175 ? 102.779 86.544  14.598  1.00 14.65 ? 175 PHE A CE1 1 
ATOM   1397 C CE2 . PHE A 1 175 ? 102.300 84.919  16.307  1.00 16.30 ? 175 PHE A CE2 1 
ATOM   1398 C CZ  . PHE A 1 175 ? 102.961 85.260  15.143  1.00 15.12 ? 175 PHE A CZ  1 
ATOM   1399 N N   . ASN A 1 176 ? 97.318  86.931  16.831  1.00 13.94 ? 176 ASN A N   1 
ATOM   1400 C CA  . ASN A 1 176 ? 96.478  85.746  16.616  1.00 15.80 ? 176 ASN A CA  1 
ATOM   1401 C C   . ASN A 1 176 ? 95.618  85.893  15.339  1.00 14.13 ? 176 ASN A C   1 
ATOM   1402 O O   . ASN A 1 176 ? 95.284  84.913  14.675  1.00 13.47 ? 176 ASN A O   1 
ATOM   1403 C CB  . ASN A 1 176 ? 95.556  85.435  17.780  1.00 17.27 ? 176 ASN A CB  1 
ATOM   1404 C CG  . ASN A 1 176 ? 96.292  84.841  18.966  1.00 24.00 ? 176 ASN A CG  1 
ATOM   1405 O OD1 . ASN A 1 176 ? 97.332  84.192  18.846  1.00 23.46 ? 176 ASN A OD1 1 
ATOM   1406 N ND2 . ASN A 1 176 ? 95.679  84.980  20.116  1.00 25.54 ? 176 ASN A ND2 1 
ATOM   1407 N N   . TYR A 1 177 ? 95.231  87.122  15.034  1.00 13.80 ? 177 TYR A N   1 
ATOM   1408 C CA  . TYR A 1 177 ? 94.482  87.421  13.802  1.00 14.04 ? 177 TYR A CA  1 
ATOM   1409 C C   . TYR A 1 177 ? 95.343  87.198  12.568  1.00 13.31 ? 177 TYR A C   1 
ATOM   1410 O O   . TYR A 1 177 ? 94.854  86.654  11.571  1.00 12.45 ? 177 TYR A O   1 
ATOM   1411 C CB  . TYR A 1 177 ? 93.922  88.837  13.802  1.00 14.39 ? 177 TYR A CB  1 
ATOM   1412 C CG  . TYR A 1 177 ? 92.730  89.022  14.768  1.00 16.58 ? 177 TYR A CG  1 
ATOM   1413 C CD1 . TYR A 1 177 ? 92.850  88.854  16.152  1.00 19.23 ? 177 TYR A CD1 1 
ATOM   1414 C CD2 . TYR A 1 177 ? 91.458  89.318  14.259  1.00 18.72 ? 177 TYR A CD2 1 
ATOM   1415 C CE1 . TYR A 1 177 ? 91.732  88.989  17.015  1.00 20.97 ? 177 TYR A CE1 1 
ATOM   1416 C CE2 . TYR A 1 177 ? 90.361  89.492  15.072  1.00 19.18 ? 177 TYR A CE2 1 
ATOM   1417 C CZ  . TYR A 1 177 ? 90.474  89.288  16.422  1.00 21.41 ? 177 TYR A CZ  1 
ATOM   1418 O OH  . TYR A 1 177 ? 89.363  89.513  17.096  1.00 22.10 ? 177 TYR A OH  1 
ATOM   1419 N N   . GLN A 1 178 ? 96.602  87.676  12.577  1.00 12.28 ? 178 GLN A N   1 
ATOM   1420 C CA  . GLN A 1 178 ? 97.479  87.459  11.464  1.00 13.36 ? 178 GLN A CA  1 
ATOM   1421 C C   . GLN A 1 178 ? 97.697  85.957  11.217  1.00 14.20 ? 178 GLN A C   1 
ATOM   1422 O O   . GLN A 1 178 ? 97.648  85.512  10.070  1.00 13.97 ? 178 GLN A O   1 
ATOM   1423 C CB  . GLN A 1 178 ? 98.891  88.077  11.690  1.00 12.80 ? 178 GLN A CB  1 
ATOM   1424 C CG  . GLN A 1 178 ? 98.877  89.569  11.813  1.00 13.47 ? 178 GLN A CG  1 
ATOM   1425 C CD  . GLN A 1 178 ? 98.800  90.299  10.501  1.00 14.10 ? 178 GLN A CD  1 
ATOM   1426 O OE1 . GLN A 1 178 ? 98.420  89.750  9.474   1.00 13.27 ? 178 GLN A OE1 1 
ATOM   1427 N NE2 . GLN A 1 178 ? 99.067  91.592  10.576  1.00 14.80 ? 178 GLN A NE2 1 
ATOM   1428 N N   . MET A 1 179 ? 97.865  85.187  12.292  1.00 13.05 ? 179 MET A N   1 
ATOM   1429 C CA  . MET A 1 179 ? 98.114  83.737  12.160  1.00 13.06 ? 179 MET A CA  1 
ATOM   1430 C C   . MET A 1 179 ? 96.855  83.030  11.643  1.00 12.91 ? 179 MET A C   1 
ATOM   1431 O O   . MET A 1 179 ? 96.936  82.178  10.690  1.00 11.99 ? 179 MET A O   1 
ATOM   1432 C CB  . MET A 1 179 ? 98.588  83.137  13.486  1.00 15.22 ? 179 MET A CB  1 
ATOM   1433 C CG  . MET A 1 179 ? 100.009 83.596  13.858  1.00 14.46 ? 179 MET A CG  1 
ATOM   1434 S SD  . MET A 1 179 ? 101.244 83.094  12.625  1.00 15.42 ? 179 MET A SD  1 
ATOM   1435 C CE  . MET A 1 179 ? 100.982 81.313  12.529  1.00 17.37 ? 179 MET A CE  1 
ATOM   1436 N N   . TYR A 1 180 ? 95.709  83.370  12.253  1.00 13.84 ? 180 TYR A N   1 
ATOM   1437 C CA  . TYR A 1 180 ? 94.454  82.800  11.774  1.00 13.91 ? 180 TYR A CA  1 
ATOM   1438 C C   . TYR A 1 180 ? 94.215  83.059  10.283  1.00 12.96 ? 180 TYR A C   1 
ATOM   1439 O O   . TYR A 1 180 ? 93.766  82.168  9.530   1.00 14.22 ? 180 TYR A O   1 
ATOM   1440 C CB  . TYR A 1 180 ? 93.212  83.302  12.546  1.00 14.24 ? 180 TYR A CB  1 
ATOM   1441 C CG  . TYR A 1 180 ? 91.969  82.658  12.041  1.00 13.24 ? 180 TYR A CG  1 
ATOM   1442 C CD1 . TYR A 1 180 ? 91.641  81.379  12.470  1.00 15.61 ? 180 TYR A CD1 1 
ATOM   1443 C CD2 . TYR A 1 180 ? 91.155  83.286  11.074  1.00 15.59 ? 180 TYR A CD2 1 
ATOM   1444 C CE1 . TYR A 1 180 ? 90.487  80.730  11.973  1.00 15.58 ? 180 TYR A CE1 1 
ATOM   1445 C CE2 . TYR A 1 180 ? 90.060  82.618  10.545  1.00 14.99 ? 180 TYR A CE2 1 
ATOM   1446 C CZ  . TYR A 1 180 ? 89.721  81.356  11.017  1.00 14.51 ? 180 TYR A CZ  1 
ATOM   1447 O OH  . TYR A 1 180 ? 88.644  80.687  10.495  1.00 14.40 ? 180 TYR A OH  1 
ATOM   1448 N N   . ASN A 1 181 ? 94.534  84.281  9.841   1.00 12.20 ? 181 ASN A N   1 
ATOM   1449 C CA  . ASN A 1 181 ? 94.371  84.682  8.448   1.00 13.81 ? 181 ASN A CA  1 
ATOM   1450 C C   . ASN A 1 181 ? 95.096  83.817  7.403   1.00 13.57 ? 181 ASN A C   1 
ATOM   1451 O O   . ASN A 1 181 ? 94.621  83.686  6.282   1.00 12.81 ? 181 ASN A O   1 
ATOM   1452 C CB  . ASN A 1 181 ? 94.773  86.123  8.255   1.00 13.45 ? 181 ASN A CB  1 
ATOM   1453 C CG  . ASN A 1 181 ? 94.451  86.668  6.866   1.00 14.40 ? 181 ASN A CG  1 
ATOM   1454 O OD1 . ASN A 1 181 ? 93.300  86.619  6.413   1.00 16.73 ? 181 ASN A OD1 1 
ATOM   1455 N ND2 . ASN A 1 181 ? 95.420  87.259  6.255   1.00 12.96 ? 181 ASN A ND2 1 
ATOM   1456 N N   . LEU A 1 182 ? 96.215  83.210  7.795   1.00 12.39 ? 182 LEU A N   1 
ATOM   1457 C CA  . LEU A 1 182 ? 96.891  82.281  6.905   1.00 13.52 ? 182 LEU A CA  1 
ATOM   1458 C C   . LEU A 1 182 ? 96.053  81.044  6.514   1.00 12.91 ? 182 LEU A C   1 
ATOM   1459 O O   . LEU A 1 182 ? 96.283  80.471  5.429   1.00 12.63 ? 182 LEU A O   1 
ATOM   1460 C CB  . LEU A 1 182 ? 98.182  81.764  7.531   1.00 13.73 ? 182 LEU A CB  1 
ATOM   1461 C CG  . LEU A 1 182 ? 99.239  82.788  7.921   1.00 12.72 ? 182 LEU A CG  1 
ATOM   1462 C CD1 . LEU A 1 182 ? 100.391 82.033  8.592   1.00 13.60 ? 182 LEU A CD1 1 
ATOM   1463 C CD2 . LEU A 1 182 ? 99.745  83.507  6.676   1.00 13.91 ? 182 LEU A CD2 1 
ATOM   1464 N N   . ASN A 1 183 ? 95.089  80.662  7.361   1.00 12.45 ? 183 ASN A N   1 
ATOM   1465 C CA  . ASN A 1 183 ? 94.398  79.406  7.167   1.00 13.77 ? 183 ASN A CA  1 
ATOM   1466 C C   . ASN A 1 183 ? 93.683  79.326  5.837   1.00 14.03 ? 183 ASN A C   1 
ATOM   1467 O O   . ASN A 1 183 ? 93.655  78.262  5.192   1.00 13.64 ? 183 ASN A O   1 
ATOM   1468 C CB  . ASN A 1 183 ? 93.464  79.085  8.325   1.00 13.94 ? 183 ASN A CB  1 
ATOM   1469 C CG  . ASN A 1 183 ? 94.176  78.747  9.604   1.00 15.38 ? 183 ASN A CG  1 
ATOM   1470 O OD1 . ASN A 1 183 ? 95.250  78.148  9.609   1.00 15.80 ? 183 ASN A OD1 1 
ATOM   1471 N ND2 . ASN A 1 183 ? 93.594  79.162  10.726  1.00 15.19 ? 183 ASN A ND2 1 
ATOM   1472 N N   . LYS A 1 184 ? 93.149  80.452  5.377   1.00 12.41 ? 184 LYS A N   1 
ATOM   1473 C CA  . LYS A 1 184 ? 92.417  80.453  4.136   1.00 14.13 ? 184 LYS A CA  1 
ATOM   1474 C C   . LYS A 1 184 ? 93.277  80.338  2.889   1.00 14.95 ? 184 LYS A C   1 
ATOM   1475 O O   . LYS A 1 184 ? 92.742  80.143  1.808   1.00 14.43 ? 184 LYS A O   1 
ATOM   1476 C CB  . LYS A 1 184 ? 91.502  81.634  3.960   1.00 17.79 ? 184 LYS A CB  1 
ATOM   1477 C CG  . LYS A 1 184 ? 92.202  82.930  3.744   1.00 20.68 ? 184 LYS A CG  1 
ATOM   1478 C CD  . LYS A 1 184 ? 91.122  83.980  3.511   1.00 28.40 ? 184 LYS A CD  1 
ATOM   1479 C CE  . LYS A 1 184 ? 91.553  85.045  2.560   1.00 38.31 ? 184 LYS A CE  1 
ATOM   1480 N NZ  . LYS A 1 184 ? 92.165  86.150  3.366   1.00 50.39 ? 184 LYS A NZ  1 
ATOM   1481 N N   . TYR A 1 185 ? 94.597  80.385  3.051   1.00 13.53 ? 185 TYR A N   1 
ATOM   1482 C CA  . TYR A 1 185 ? 95.552  80.211  1.935   1.00 13.62 ? 185 TYR A CA  1 
ATOM   1483 C C   . TYR A 1 185 ? 96.170  78.835  1.832   1.00 14.24 ? 185 TYR A C   1 
ATOM   1484 O O   . TYR A 1 185 ? 97.144  78.660  1.108   1.00 13.56 ? 185 TYR A O   1 
ATOM   1485 C CB  . TYR A 1 185 ? 96.666  81.257  2.041   1.00 13.06 ? 185 TYR A CB  1 
ATOM   1486 C CG  . TYR A 1 185 ? 96.128  82.670  1.943   1.00 11.69 ? 185 TYR A CG  1 
ATOM   1487 C CD1 . TYR A 1 185 ? 95.851  83.232  0.729   1.00 14.18 ? 185 TYR A CD1 1 
ATOM   1488 C CD2 . TYR A 1 185 ? 95.839  83.394  3.070   1.00 12.73 ? 185 TYR A CD2 1 
ATOM   1489 C CE1 . TYR A 1 185 ? 95.298  84.527  0.614   1.00 14.44 ? 185 TYR A CE1 1 
ATOM   1490 C CE2 . TYR A 1 185 ? 95.287  84.664  3.004   1.00 13.78 ? 185 TYR A CE2 1 
ATOM   1491 C CZ  . TYR A 1 185 ? 95.050  85.251  1.763   1.00 16.82 ? 185 TYR A CZ  1 
ATOM   1492 O OH  . TYR A 1 185 ? 94.554  86.566  1.745   1.00 16.67 ? 185 TYR A OH  1 
ATOM   1493 N N   . ARG A 1 186 ? 95.598  77.847  2.531   1.00 13.11 ? 186 ARG A N   1 
ATOM   1494 C CA  . ARG A 1 186 ? 96.203  76.512  2.516   1.00 14.36 ? 186 ARG A CA  1 
ATOM   1495 C C   . ARG A 1 186 ? 96.394  75.868  1.150   1.00 13.57 ? 186 ARG A C   1 
ATOM   1496 O O   . ARG A 1 186 ? 97.335  75.122  0.967   1.00 14.21 ? 186 ARG A O   1 
ATOM   1497 C CB  . ARG A 1 186 ? 95.456  75.553  3.451   1.00 15.88 ? 186 ARG A CB  1 
ATOM   1498 C CG  . ARG A 1 186 ? 94.117  75.200  2.903   1.00 16.30 ? 186 ARG A CG  1 
ATOM   1499 C CD  . ARG A 1 186 ? 93.319  74.327  3.851   1.00 17.56 ? 186 ARG A CD  1 
ATOM   1500 N NE  . ARG A 1 186 ? 93.817  72.958  4.065   1.00 18.77 ? 186 ARG A NE  1 
ATOM   1501 C CZ  . ARG A 1 186 ? 94.502  72.489  5.089   1.00 17.34 ? 186 ARG A CZ  1 
ATOM   1502 N NH1 . ARG A 1 186 ? 94.957  73.258  6.055   1.00 18.23 ? 186 ARG A NH1 1 
ATOM   1503 N NH2 . ARG A 1 186 ? 94.771  71.179  5.129   1.00 19.30 ? 186 ARG A NH2 1 
ATOM   1504 N N   . ASN A 1 187 ? 95.560  76.237  0.199   1.00 13.13 ? 187 ASN A N   1 
ATOM   1505 C CA  . ASN A 1 187 ? 95.537  75.674  -1.142  1.00 15.09 ? 187 ASN A CA  1 
ATOM   1506 C C   . ASN A 1 187 ? 96.567  76.286  -2.097  1.00 14.04 ? 187 ASN A C   1 
ATOM   1507 O O   . ASN A 1 187 ? 96.753  75.746  -3.191  1.00 10.97 ? 187 ASN A O   1 
ATOM   1508 C CB  . ASN A 1 187 ? 94.108  75.925  -1.714  1.00 17.27 ? 187 ASN A CB  1 
ATOM   1509 C CG  . ASN A 1 187 ? 93.770  75.087  -2.920  1.00 26.48 ? 187 ASN A CG  1 
ATOM   1510 O OD1 . ASN A 1 187 ? 94.255  73.965  -3.137  1.00 25.12 ? 187 ASN A OD1 1 
ATOM   1511 N ND2 . ASN A 1 187 ? 92.871  75.602  -3.697  1.00 28.71 ? 187 ASN A ND2 1 
ATOM   1512 N N   . LEU A 1 188 ? 97.251  77.353  -1.708  1.00 13.76 ? 188 LEU A N   1 
ATOM   1513 C CA  . LEU A 1 188 ? 98.338  77.845  -2.516  1.00 13.86 ? 188 LEU A CA  1 
ATOM   1514 C C   . LEU A 1 188 ? 99.446  76.819  -2.634  1.00 15.17 ? 188 LEU A C   1 
ATOM   1515 O O   . LEU A 1 188 ? 99.636  75.994  -1.741  1.00 15.21 ? 188 LEU A O   1 
ATOM   1516 C CB  . LEU A 1 188 ? 98.896  79.163  -1.998  1.00 14.42 ? 188 LEU A CB  1 
ATOM   1517 C CG  . LEU A 1 188 ? 97.943  80.353  -1.760  1.00 15.68 ? 188 LEU A CG  1 
ATOM   1518 C CD1 . LEU A 1 188 ? 98.704  81.601  -1.367  1.00 16.07 ? 188 LEU A CD1 1 
ATOM   1519 C CD2 . LEU A 1 188 ? 97.069  80.675  -2.941  1.00 17.71 ? 188 LEU A CD2 1 
ATOM   1520 N N   . SER A 1 189 ? 100.183 76.892  -3.745  1.00 14.63 ? 189 SER A N   1 
ATOM   1521 C CA  . SER A 1 189 ? 101.193 75.934  -4.026  1.00 15.16 ? 189 SER A CA  1 
ATOM   1522 C C   . SER A 1 189 ? 102.345 76.565  -4.798  1.00 14.95 ? 189 SER A C   1 
ATOM   1523 O O   . SER A 1 189 ? 102.150 77.555  -5.497  1.00 13.94 ? 189 SER A O   1 
ATOM   1524 C CB  . SER A 1 189 ? 100.588 74.804  -4.878  1.00 17.83 ? 189 SER A CB  1 
ATOM   1525 O OG  . SER A 1 189 ? 101.589 73.815  -5.064  1.00 19.33 ? 189 SER A OG  1 
ATOM   1526 N N   . ILE A 1 190 ? 103.526 75.972  -4.683  1.00 14.10 ? 190 ILE A N   1 
ATOM   1527 C CA  . ILE A 1 190 ? 104.655 76.389  -5.473  1.00 15.93 ? 190 ILE A CA  1 
ATOM   1528 C C   . ILE A 1 190 ? 104.661 75.738  -6.858  1.00 17.45 ? 190 ILE A C   1 
ATOM   1529 O O   . ILE A 1 190 ? 105.380 76.216  -7.728  1.00 17.80 ? 190 ILE A O   1 
ATOM   1530 C CB  . ILE A 1 190 ? 105.992 76.128  -4.754  1.00 15.86 ? 190 ILE A CB  1 
ATOM   1531 C CG1 . ILE A 1 190 ? 106.268 74.629  -4.619  1.00 18.16 ? 190 ILE A CG1 1 
ATOM   1532 C CG2 . ILE A 1 190 ? 105.952 76.879  -3.454  1.00 16.73 ? 190 ILE A CG2 1 
ATOM   1533 C CD1 . ILE A 1 190 ? 107.708 74.339  -4.233  1.00 22.67 ? 190 ILE A CD1 1 
ATOM   1534 N N   . SER A 1 191 ? 103.792 74.758  -7.134  1.00 16.84 ? 191 SER A N   1 
ATOM   1535 C CA  . SER A 1 191 ? 103.813 74.136  -8.427  1.00 18.05 ? 191 SER A CA  1 
ATOM   1536 C C   . SER A 1 191 ? 102.412 74.185  -9.047  1.00 17.56 ? 191 SER A C   1 
ATOM   1537 O O   . SER A 1 191 ? 101.433 74.547  -8.402  1.00 15.45 ? 191 SER A O   1 
ATOM   1538 C CB  . SER A 1 191 ? 104.429 72.716  -8.286  1.00 23.23 ? 191 SER A CB  1 
ATOM   1539 O OG  . SER A 1 191 ? 103.663 72.038  -7.424  1.00 26.48 ? 191 SER A OG  1 
ATOM   1540 N N   . THR A 1 192 ? 102.354 73.899  -10.318 1.00 15.85 ? 192 THR A N   1 
ATOM   1541 C CA  . THR A 1 192 ? 101.115 73.976  -11.088 1.00 16.60 ? 192 THR A CA  1 
ATOM   1542 C C   . THR A 1 192 ? 100.150 72.958  -10.463 1.00 16.57 ? 192 THR A C   1 
ATOM   1543 O O   . THR A 1 192 ? 100.466 71.773  -10.373 1.00 13.63 ? 192 THR A O   1 
ATOM   1544 C CB  . THR A 1 192 ? 101.373 73.559  -12.528 1.00 17.63 ? 192 THR A CB  1 
ATOM   1545 O OG1 . THR A 1 192 ? 102.332 74.435  -13.064 1.00 15.69 ? 192 THR A OG1 1 
ATOM   1546 C CG2 . THR A 1 192 ? 100.114 73.675  -13.368 1.00 17.73 ? 192 THR A CG2 1 
ATOM   1547 N N   . PRO A 1 193 ? 98.983  73.381  -10.098 1.00 16.22 ? 193 PRO A N   1 
ATOM   1548 C CA  . PRO A 1 193 ? 98.042  72.400  -9.590  1.00 18.60 ? 193 PRO A CA  1 
ATOM   1549 C C   . PRO A 1 193 ? 97.336  71.551  -10.625 1.00 16.35 ? 193 PRO A C   1 
ATOM   1550 O O   . PRO A 1 193 ? 97.286  71.906  -11.778 1.00 16.04 ? 193 PRO A O   1 
ATOM   1551 C CB  . PRO A 1 193 ? 97.002  73.237  -8.856  1.00 19.06 ? 193 PRO A CB  1 
ATOM   1552 C CG  . PRO A 1 193 ? 97.329  74.679  -9.154  1.00 20.25 ? 193 PRO A CG  1 
ATOM   1553 C CD  . PRO A 1 193 ? 98.408  74.738  -10.162 1.00 18.83 ? 193 PRO A CD  1 
ATOM   1554 N N   . GLN A 1 194 ? 96.707  70.483  -10.115 1.00 14.79 ? 194 GLN A N   1 
ATOM   1555 C CA  . GLN A 1 194 ? 95.819  69.650  -10.953 1.00 17.83 ? 194 GLN A CA  1 
ATOM   1556 C C   . GLN A 1 194 ? 94.542  70.432  -11.157 1.00 15.01 ? 194 GLN A C   1 
ATOM   1557 O O   . GLN A 1 194 ? 94.256  71.340  -10.417 1.00 15.04 ? 194 GLN A O   1 
ATOM   1558 C CB  . GLN A 1 194 ? 95.499  68.330  -10.259 1.00 21.45 ? 194 GLN A CB  1 
ATOM   1559 C CG  . GLN A 1 194 ? 96.773  67.568  -9.974  1.00 26.52 ? 194 GLN A CG  1 
ATOM   1560 C CD  . GLN A 1 194 ? 96.883  66.349  -10.820 1.00 37.91 ? 194 GLN A CD  1 
ATOM   1561 O OE1 . GLN A 1 194 ? 97.557  66.350  -11.846 1.00 44.49 ? 194 GLN A OE1 1 
ATOM   1562 N NE2 . GLN A 1 194 ? 96.224  65.279  -10.388 1.00 38.80 ? 194 GLN A NE2 1 
ATOM   1563 N N   . ASN A 1 195 ? 93.794  70.080  -12.185 1.00 14.95 ? 195 ASN A N   1 
ATOM   1564 C CA  . ASN A 1 195 ? 92.476  70.630  -12.365 1.00 15.82 ? 195 ASN A CA  1 
ATOM   1565 C C   . ASN A 1 195 ? 91.514  69.929  -11.432 1.00 16.36 ? 195 ASN A C   1 
ATOM   1566 O O   . ASN A 1 195 ? 91.040  68.842  -11.734 1.00 14.89 ? 195 ASN A O   1 
ATOM   1567 C CB  . ASN A 1 195 ? 92.048  70.463  -13.820 1.00 16.45 ? 195 ASN A CB  1 
ATOM   1568 C CG  . ASN A 1 195 ? 90.590  70.887  -14.046 1.00 16.59 ? 195 ASN A CG  1 
ATOM   1569 O OD1 . ASN A 1 195 ? 89.927  71.383  -13.138 1.00 15.59 ? 195 ASN A OD1 1 
ATOM   1570 N ND2 . ASN A 1 195 ? 90.109  70.699  -15.272 1.00 13.93 ? 195 ASN A ND2 1 
ATOM   1571 N N   . THR A 1 196 ? 91.260  70.518  -10.283 1.00 13.74 ? 196 THR A N   1 
ATOM   1572 C CA  . THR A 1 196 ? 90.238  70.058  -9.392  1.00 14.03 ? 196 THR A CA  1 
ATOM   1573 C C   . THR A 1 196 ? 88.940  70.828  -9.534  1.00 14.92 ? 196 THR A C   1 
ATOM   1574 O O   . THR A 1 196 ? 87.927  70.496  -8.915  1.00 15.51 ? 196 THR A O   1 
ATOM   1575 C CB  . THR A 1 196 ? 90.743  70.127  -7.909  1.00 14.76 ? 196 THR A CB  1 
ATOM   1576 O OG1 . THR A 1 196 ? 91.355  71.408  -7.649  1.00 14.36 ? 196 THR A OG1 1 
ATOM   1577 C CG2 . THR A 1 196 ? 91.810  69.094  -7.599  1.00 17.26 ? 196 THR A CG2 1 
ATOM   1578 N N   . PHE A 1 197 ? 88.930  71.866  -10.348 1.00 14.03 ? 197 PHE A N   1 
ATOM   1579 C CA  . PHE A 1 197 ? 87.711  72.680  -10.603 1.00 14.34 ? 197 PHE A CA  1 
ATOM   1580 C C   . PHE A 1 197 ? 86.609  71.822  -11.184 1.00 14.73 ? 197 PHE A C   1 
ATOM   1581 O O   . PHE A 1 197 ? 85.500  71.775  -10.686 1.00 13.66 ? 197 PHE A O   1 
ATOM   1582 C CB  . PHE A 1 197 ? 88.137  73.805  -11.544 1.00 14.01 ? 197 PHE A CB  1 
ATOM   1583 C CG  . PHE A 1 197 ? 87.005  74.723  -11.987 1.00 14.27 ? 197 PHE A CG  1 
ATOM   1584 C CD1 . PHE A 1 197 ? 86.152  74.321  -13.020 1.00 14.76 ? 197 PHE A CD1 1 
ATOM   1585 C CD2 . PHE A 1 197 ? 86.826  75.950  -11.418 1.00 13.20 ? 197 PHE A CD2 1 
ATOM   1586 C CE1 . PHE A 1 197 ? 85.123  75.175  -13.468 1.00 14.63 ? 197 PHE A CE1 1 
ATOM   1587 C CE2 . PHE A 1 197 ? 85.834  76.821  -11.856 1.00 13.44 ? 197 PHE A CE2 1 
ATOM   1588 C CZ  . PHE A 1 197 ? 84.989  76.432  -12.887 1.00 12.98 ? 197 PHE A CZ  1 
ATOM   1589 N N   . SER A 1 198 ? 86.964  71.060  -12.219 1.00 14.93 ? 198 SER A N   1 
ATOM   1590 C CA  . SER A 1 198 ? 86.080  70.020  -12.758 1.00 16.87 ? 198 SER A CA  1 
ATOM   1591 C C   . SER A 1 198 ? 86.752  69.325  -13.886 1.00 17.87 ? 198 SER A C   1 
ATOM   1592 O O   . SER A 1 198 ? 87.229  69.963  -14.846 1.00 17.29 ? 198 SER A O   1 
ATOM   1593 C CB  . SER A 1 198 ? 84.770  70.565  -13.283 1.00 17.63 ? 198 SER A CB  1 
ATOM   1594 O OG  . SER A 1 198 ? 84.043  69.563  -14.046 1.00 18.02 ? 198 SER A OG  1 
ATOM   1595 N N   . ASP A 1 199 ? 86.670  67.995  -13.845 1.00 21.61 ? 199 ASP A N   1 
ATOM   1596 C CA  . ASP A 1 199 ? 87.219  67.230  -14.989 1.00 24.05 ? 199 ASP A CA  1 
ATOM   1597 C C   . ASP A 1 199 ? 86.329  67.285  -16.227 1.00 25.04 ? 199 ASP A C   1 
ATOM   1598 O O   . ASP A 1 199 ? 86.734  66.738  -17.268 1.00 21.92 ? 199 ASP A O   1 
ATOM   1599 C CB  . ASP A 1 199 ? 87.684  65.842  -14.585 1.00 32.60 ? 199 ASP A CB  1 
ATOM   1600 C CG  . ASP A 1 199 ? 86.658  65.011  -14.103 1.00 33.71 ? 199 ASP A CG  1 
ATOM   1601 O OD1 . ASP A 1 199 ? 85.466  65.310  -14.299 1.00 39.73 ? 199 ASP A OD1 1 
ATOM   1602 O OD2 . ASP A 1 199 ? 87.085  64.017  -13.461 1.00 42.77 ? 199 ASP A OD2 1 
ATOM   1603 N N   . SER A 1 200 ? 85.160  67.938  -16.169 1.00 17.20 ? 200 SER A N   1 
ATOM   1604 C CA  . SER A 1 200 ? 84.348  68.132  -17.334 1.00 18.52 ? 200 SER A CA  1 
ATOM   1605 C C   . SER A 1 200 ? 84.720  69.313  -18.233 1.00 20.15 ? 200 SER A C   1 
ATOM   1606 O O   . SER A 1 200 ? 83.987  69.600  -19.180 1.00 18.35 ? 200 SER A O   1 
ATOM   1607 C CB  . SER A 1 200 ? 82.895  68.286  -16.921 1.00 21.09 ? 200 SER A CB  1 
ATOM   1608 O OG  . SER A 1 200 ? 82.543  67.127  -16.178 1.00 21.87 ? 200 SER A OG  1 
ATOM   1609 N N   . VAL A 1 201 ? 85.747  70.092  -17.877 1.00 16.91 ? 201 VAL A N   1 
ATOM   1610 C CA  . VAL A 1 201 ? 86.191  71.195  -18.709 1.00 17.30 ? 201 VAL A CA  1 
ATOM   1611 C C   . VAL A 1 201 ? 87.695  71.097  -18.792 1.00 19.25 ? 201 VAL A C   1 
ATOM   1612 O O   . VAL A 1 201 ? 88.394  70.813  -17.810 1.00 14.92 ? 201 VAL A O   1 
ATOM   1613 C CB  . VAL A 1 201 ? 85.712  72.580  -18.191 1.00 18.65 ? 201 VAL A CB  1 
ATOM   1614 C CG1 . VAL A 1 201 ? 86.252  72.865  -16.796 1.00 18.29 ? 201 VAL A CG1 1 
ATOM   1615 C CG2 . VAL A 1 201 ? 86.082  73.703  -19.158 1.00 20.75 ? 201 VAL A CG2 1 
ATOM   1616 N N   . ASP A 1 202 ? 88.192  71.307  -20.011 1.00 19.88 ? 202 ASP A N   1 
ATOM   1617 C CA  . ASP A 1 202 ? 89.612  71.084  -20.317 1.00 20.94 ? 202 ASP A CA  1 
ATOM   1618 C C   . ASP A 1 202 ? 90.371  72.377  -20.015 1.00 19.03 ? 202 ASP A C   1 
ATOM   1619 O O   . ASP A 1 202 ? 90.696  73.163  -20.898 1.00 19.14 ? 202 ASP A O   1 
ATOM   1620 C CB  . ASP A 1 202 ? 89.718  70.652  -21.816 1.00 23.32 ? 202 ASP A CB  1 
ATOM   1621 C CG  . ASP A 1 202 ? 91.125  70.332  -22.247 1.00 27.83 ? 202 ASP A CG  1 
ATOM   1622 O OD1 . ASP A 1 202 ? 91.952  70.072  -21.377 1.00 29.57 ? 202 ASP A OD1 1 
ATOM   1623 O OD2 . ASP A 1 202 ? 91.369  70.388  -23.462 1.00 31.84 ? 202 ASP A OD2 1 
ATOM   1624 N N   . LEU A 1 203 ? 90.703  72.607  -18.753 1.00 16.06 ? 203 LEU A N   1 
ATOM   1625 C CA  . LEU A 1 203 ? 91.332  73.863  -18.399 1.00 15.94 ? 203 LEU A CA  1 
ATOM   1626 C C   . LEU A 1 203 ? 92.795  73.743  -18.776 1.00 17.38 ? 203 LEU A C   1 
ATOM   1627 O O   . LEU A 1 203 ? 93.429  72.681  -18.547 1.00 18.49 ? 203 LEU A O   1 
ATOM   1628 C CB  . LEU A 1 203 ? 91.207  74.147  -16.895 1.00 16.02 ? 203 LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 203 ? 89.782  74.333  -16.419 1.00 15.12 ? 203 LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 203 ? 89.774  74.638  -14.946 1.00 15.26 ? 203 LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 203 ? 89.051  75.418  -17.184 1.00 16.06 ? 203 LEU A CD2 1 
ATOM   1632 N N   . LYS A 1 204 ? 93.349  74.822  -19.295 1.00 16.68 ? 204 LYS A N   1 
ATOM   1633 C CA  . LYS A 1 204 ? 94.712  74.812  -19.820 1.00 18.56 ? 204 LYS A CA  1 
ATOM   1634 C C   . LYS A 1 204 ? 95.662  75.702  -19.022 1.00 15.84 ? 204 LYS A C   1 
ATOM   1635 O O   . LYS A 1 204 ? 95.205  76.656  -18.449 1.00 14.94 ? 204 LYS A O   1 
ATOM   1636 C CB  . LYS A 1 204 ? 94.661  75.239  -21.310 1.00 24.64 ? 204 LYS A CB  1 
ATOM   1637 C CG  . LYS A 1 204 ? 94.066  74.117  -22.220 1.00 31.56 ? 204 LYS A CG  1 
ATOM   1638 C CD  . LYS A 1 204 ? 93.504  74.729  -23.488 1.00 41.49 ? 204 LYS A CD  1 
ATOM   1639 C CE  . LYS A 1 204 ? 92.538  73.784  -24.220 1.00 48.44 ? 204 LYS A CE  1 
ATOM   1640 N NZ  . LYS A 1 204 ? 93.221  72.470  -24.441 1.00 56.96 ? 204 LYS A NZ  1 
ATOM   1641 N N   . VAL A 1 205 ? 96.930  75.315  -18.946 1.00 13.93 ? 205 VAL A N   1 
ATOM   1642 C CA  . VAL A 1 205 ? 97.956  76.100  -18.234 1.00 13.84 ? 205 VAL A CA  1 
ATOM   1643 C C   . VAL A 1 205 ? 98.910  76.578  -19.281 1.00 16.50 ? 205 VAL A C   1 
ATOM   1644 O O   . VAL A 1 205 ? 99.598  75.744  -19.908 1.00 14.71 ? 205 VAL A O   1 
ATOM   1645 C CB  . VAL A 1 205 ? 98.634  75.250  -17.219 1.00 17.35 ? 205 VAL A CB  1 
ATOM   1646 C CG1 . VAL A 1 205 ? 99.812  75.943  -16.521 1.00 18.40 ? 205 VAL A CG1 1 
ATOM   1647 C CG2 . VAL A 1 205 ? 97.620  74.775  -16.171 1.00 16.96 ? 205 VAL A CG2 1 
ATOM   1648 N N   . ASP A 1 206 ? 99.012  77.879  -19.431 1.00 13.65 ? 206 ASP A N   1 
ATOM   1649 C CA  . ASP A 1 206 ? 99.869  78.507  -20.473 1.00 14.53 ? 206 ASP A CA  1 
ATOM   1650 C C   . ASP A 1 206 ? 101.080 79.272  -19.926 1.00 14.25 ? 206 ASP A C   1 
ATOM   1651 O O   . ASP A 1 206 ? 101.757 80.026  -20.655 1.00 12.35 ? 206 ASP A O   1 
ATOM   1652 C CB  . ASP A 1 206 ? 98.987  79.370  -21.377 1.00 15.33 ? 206 ASP A CB  1 
ATOM   1653 C CG  . ASP A 1 206 ? 98.391  80.575  -20.644 1.00 15.40 ? 206 ASP A CG  1 
ATOM   1654 O OD1 . ASP A 1 206 ? 98.610  80.724  -19.384 1.00 16.69 ? 206 ASP A OD1 1 
ATOM   1655 O OD2 . ASP A 1 206 ? 97.750  81.370  -21.330 1.00 16.25 ? 206 ASP A OD2 1 
ATOM   1656 N N   . GLY A 1 207 ? 101.393 79.040  -18.656 1.00 14.05 ? 207 GLY A N   1 
ATOM   1657 C CA  . GLY A 1 207 ? 102.545 79.609  -17.999 1.00 14.79 ? 207 GLY A CA  1 
ATOM   1658 C C   . GLY A 1 207 ? 102.845 78.976  -16.680 1.00 15.50 ? 207 GLY A C   1 
ATOM   1659 O O   . GLY A 1 207 ? 102.054 78.158  -16.170 1.00 14.63 ? 207 GLY A O   1 
ATOM   1660 N N   . THR A 1 208 ? 103.962 79.369  -16.095 1.00 15.32 ? 208 THR A N   1 
ATOM   1661 C CA  . THR A 1 208 ? 104.351 78.828  -14.748 1.00 14.77 ? 208 THR A CA  1 
ATOM   1662 C C   . THR A 1 208 ? 103.746 79.726  -13.656 1.00 14.26 ? 208 THR A C   1 
ATOM   1663 O O   . THR A 1 208 ? 103.215 80.812  -13.922 1.00 14.24 ? 208 THR A O   1 
ATOM   1664 C CB  . THR A 1 208 ? 105.885 78.784  -14.572 1.00 15.16 ? 208 THR A CB  1 
ATOM   1665 O OG1 . THR A 1 208 ? 106.392 80.092  -14.678 1.00 14.32 ? 208 THR A OG1 1 
ATOM   1666 C CG2 . THR A 1 208 ? 106.563 77.964  -15.666 1.00 18.33 ? 208 THR A CG2 1 
ATOM   1667 N N   . GLY A 1 209 ? 103.778 79.254  -12.430 1.00 13.91 ? 209 GLY A N   1 
ATOM   1668 C CA  . GLY A 1 209 ? 103.374 80.128  -11.296 1.00 14.42 ? 209 GLY A CA  1 
ATOM   1669 C C   . GLY A 1 209 ? 101.859 80.026  -10.991 1.00 14.56 ? 209 GLY A C   1 
ATOM   1670 O O   . GLY A 1 209 ? 101.382 80.709  -10.056 1.00 14.99 ? 209 GLY A O   1 
ATOM   1671 N N   . PHE A 1 210 ? 101.105 79.116  -11.635 1.00 12.61 ? 210 PHE A N   1 
ATOM   1672 C CA  . PHE A 1 210 ? 99.642  79.087  -11.411 1.00 12.93 ? 210 PHE A CA  1 
ATOM   1673 C C   . PHE A 1 210 ? 99.310  78.679  -9.966  1.00 13.29 ? 210 PHE A C   1 
ATOM   1674 O O   . PHE A 1 210 ? 98.261  79.046  -9.445  1.00 13.16 ? 210 PHE A O   1 
ATOM   1675 C CB  . PHE A 1 210 ? 98.916  78.150  -12.388 1.00 12.00 ? 210 PHE A CB  1 
ATOM   1676 C CG  . PHE A 1 210 ? 98.565  78.795  -13.710 1.00 12.98 ? 210 PHE A CG  1 
ATOM   1677 C CD1 . PHE A 1 210 ? 99.497  79.581  -14.410 1.00 14.27 ? 210 PHE A CD1 1 
ATOM   1678 C CD2 . PHE A 1 210 ? 97.407  78.534  -14.304 1.00 14.38 ? 210 PHE A CD2 1 
ATOM   1679 C CE1 . PHE A 1 210 ? 99.171  80.104  -15.646 1.00 14.76 ? 210 PHE A CE1 1 
ATOM   1680 C CE2 . PHE A 1 210 ? 97.066  79.099  -15.515 1.00 14.49 ? 210 PHE A CE2 1 
ATOM   1681 C CZ  . PHE A 1 210 ? 97.937  79.864  -16.187 1.00 14.87 ? 210 PHE A CZ  1 
ATOM   1682 N N   . GLY A 1 211 ? 100.209 77.945  -9.334  1.00 13.14 ? 211 GLY A N   1 
ATOM   1683 C CA  . GLY A 1 211 ? 99.994  77.473  -7.973  1.00 13.52 ? 211 GLY A CA  1 
ATOM   1684 C C   . GLY A 1 211 ? 99.782  78.617  -6.964  1.00 14.24 ? 211 GLY A C   1 
ATOM   1685 O O   . GLY A 1 211 ? 99.104  78.432  -5.940  1.00 11.84 ? 211 GLY A O   1 
ATOM   1686 N N   . GLY A 1 212 ? 100.433 79.758  -7.206  1.00 12.80 ? 212 GLY A N   1 
ATOM   1687 C CA  . GLY A 1 212 ? 100.295 80.863  -6.276  1.00 13.84 ? 212 GLY A CA  1 
ATOM   1688 C C   . GLY A 1 212 ? 99.067  81.751  -6.426  1.00 12.26 ? 212 GLY A C   1 
ATOM   1689 O O   . GLY A 1 212 ? 98.845  82.599  -5.567  1.00 12.89 ? 212 GLY A O   1 
ATOM   1690 N N   . ILE A 1 213 ? 98.228  81.526  -7.449  1.00 12.06 ? 213 ILE A N   1 
ATOM   1691 C CA  . ILE A 1 213 ? 97.078  82.400  -7.698  1.00 12.79 ? 213 ILE A CA  1 
ATOM   1692 C C   . ILE A 1 213 ? 96.143  82.388  -6.464  1.00 13.72 ? 213 ILE A C   1 
ATOM   1693 O O   . ILE A 1 213 ? 95.788  81.293  -5.973  1.00 14.14 ? 213 ILE A O   1 
ATOM   1694 C CB  . ILE A 1 213 ? 96.320  81.926  -8.940  1.00 14.41 ? 213 ILE A CB  1 
ATOM   1695 C CG1 . ILE A 1 213 ? 97.203  82.118  -10.205 1.00 15.43 ? 213 ILE A CG1 1 
ATOM   1696 C CG2 . ILE A 1 213 ? 94.957  82.606  -9.049  1.00 16.44 ? 213 ILE A CG2 1 
ATOM   1697 C CD1 . ILE A 1 213 ? 96.686  81.417  -11.442 1.00 16.63 ? 213 ILE A CD1 1 
ATOM   1698 N N   . GLY A 1 214 ? 95.877  83.578  -5.927  1.00 14.43 ? 214 GLY A N   1 
ATOM   1699 C CA  . GLY A 1 214 ? 95.197  83.726  -4.658  1.00 14.41 ? 214 GLY A CA  1 
ATOM   1700 C C   . GLY A 1 214 ? 96.123  84.488  -3.715  1.00 14.94 ? 214 GLY A C   1 
ATOM   1701 O O   . GLY A 1 214 ? 95.662  85.067  -2.737  1.00 13.83 ? 214 GLY A O   1 
ATOM   1702 N N   . LEU A 1 215 ? 97.431  84.375  -3.862  1.00 12.63 ? 215 LEU A N   1 
ATOM   1703 C CA  . LEU A 1 215 ? 98.295  85.143  -3.037  1.00 13.51 ? 215 LEU A CA  1 
ATOM   1704 C C   . LEU A 1 215 ? 98.078  86.650  -3.168  1.00 13.70 ? 215 LEU A C   1 
ATOM   1705 O O   . LEU A 1 215 ? 98.051  87.151  -4.260  1.00 14.63 ? 215 LEU A O   1 
ATOM   1706 C CB  . LEU A 1 215 ? 99.773  84.783  -3.363  1.00 12.25 ? 215 LEU A CB  1 
ATOM   1707 C CG  . LEU A 1 215 ? 100.849 85.295  -2.402  1.00 12.54 ? 215 LEU A CG  1 
ATOM   1708 C CD1 . LEU A 1 215 ? 100.829 84.470  -1.121  1.00 13.31 ? 215 LEU A CD1 1 
ATOM   1709 C CD2 . LEU A 1 215 ? 102.264 85.165  -3.032  1.00 13.00 ? 215 LEU A CD2 1 
ATOM   1710 N N   . PRO A 1 216 ? 97.981  87.366  -2.065  1.00 14.48 ? 216 PRO A N   1 
ATOM   1711 C CA  . PRO A 1 216 ? 97.761  88.813  -2.205  1.00 14.75 ? 216 PRO A CA  1 
ATOM   1712 C C   . PRO A 1 216 ? 99.043  89.585  -2.510  1.00 13.23 ? 216 PRO A C   1 
ATOM   1713 O O   . PRO A 1 216 ? 100.127 89.199  -2.042  1.00 12.76 ? 216 PRO A O   1 
ATOM   1714 C CB  . PRO A 1 216 ? 97.172  89.231  -0.868  1.00 16.36 ? 216 PRO A CB  1 
ATOM   1715 C CG  . PRO A 1 216 ? 97.705  88.207  0.093   1.00 16.19 ? 216 PRO A CG  1 
ATOM   1716 C CD  . PRO A 1 216 ? 97.778  86.901  -0.671  1.00 15.76 ? 216 PRO A CD  1 
ATOM   1717 N N   . GLY A 1 217 ? 98.907  90.608  -3.341  1.00 12.86 ? 217 GLY A N   1 
ATOM   1718 C CA  . GLY A 1 217 ? 100.054 91.387  -3.858  1.00 13.33 ? 217 GLY A CA  1 
ATOM   1719 C C   . GLY A 1 217 ? 100.196 92.788  -3.329  1.00 12.89 ? 217 GLY A C   1 
ATOM   1720 O O   . GLY A 1 217 ? 101.143 93.463  -3.706  1.00 12.97 ? 217 GLY A O   1 
ATOM   1721 N N   . ASP A 1 218 ? 99.187  93.283  -2.587  1.00 12.36 ? 218 ASP A N   1 
ATOM   1722 C CA  . ASP A 1 218 ? 99.175  94.693  -2.178  1.00 12.41 ? 218 ASP A CA  1 
ATOM   1723 C C   . ASP A 1 218 ? 100.121 94.872  -0.976  1.00 12.57 ? 218 ASP A C   1 
ATOM   1724 O O   . ASP A 1 218 ? 100.675 93.875  -0.483  1.00 12.31 ? 218 ASP A O   1 
ATOM   1725 C CB  . ASP A 1 218 ? 97.760  95.081  -1.837  1.00 12.17 ? 218 ASP A CB  1 
ATOM   1726 C CG  . ASP A 1 218 ? 97.235  94.323  -0.681  1.00 12.97 ? 218 ASP A CG  1 
ATOM   1727 O OD1 . ASP A 1 218 ? 96.778  93.167  -0.949  1.00 13.50 ? 218 ASP A OD1 1 
ATOM   1728 O OD2 . ASP A 1 218 ? 97.295  94.819  0.468   1.00 11.64 ? 218 ASP A OD2 1 
ATOM   1729 N N   . VAL A 1 219 ? 100.210 96.097  -0.482  1.00 12.55 ? 219 VAL A N   1 
ATOM   1730 C CA  . VAL A 1 219 ? 101.078 96.417  0.614   1.00 12.62 ? 219 VAL A CA  1 
ATOM   1731 C C   . VAL A 1 219 ? 100.363 96.697  1.900   1.00 12.67 ? 219 VAL A C   1 
ATOM   1732 O O   . VAL A 1 219 ? 100.993 97.209  2.813   1.00 12.94 ? 219 VAL A O   1 
ATOM   1733 C CB  . VAL A 1 219 ? 102.157 97.466  0.264   1.00 14.58 ? 219 VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 219 ? 103.073 96.890  -0.808  1.00 16.24 ? 219 VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 219 ? 101.572 98.792  -0.220  1.00 15.23 ? 219 VAL A CG2 1 
ATOM   1736 N N   . SER A 1 220 ? 99.095  96.292  2.022   1.00 10.73 ? 220 SER A N   1 
ATOM   1737 C CA  . SER A 1 220 ? 98.470  96.295  3.355   1.00 12.83 ? 220 SER A CA  1 
ATOM   1738 C C   . SER A 1 220 ? 99.246  95.385  4.290   1.00 12.33 ? 220 SER A C   1 
ATOM   1739 O O   . SER A 1 220 ? 99.880  94.435  3.846   1.00 10.44 ? 220 SER A O   1 
ATOM   1740 C CB  . SER A 1 220 ? 96.974  95.876  3.303   1.00 13.56 ? 220 SER A CB  1 
ATOM   1741 O OG  . SER A 1 220 ? 96.816  94.452  3.042   1.00 12.54 ? 220 SER A OG  1 
ATOM   1742 N N   . PRO A 1 221 ? 99.205  95.658  5.590   1.00 12.14 ? 221 PRO A N   1 
ATOM   1743 C CA  . PRO A 1 221 ? 99.983  94.788  6.490   1.00 13.13 ? 221 PRO A CA  1 
ATOM   1744 C C   . PRO A 1 221 ? 99.562  93.323  6.505   1.00 14.26 ? 221 PRO A C   1 
ATOM   1745 O O   . PRO A 1 221 ? 100.415 92.449  6.626   1.00 10.84 ? 221 PRO A O   1 
ATOM   1746 C CB  . PRO A 1 221 ? 99.718  95.389  7.876   1.00 14.35 ? 221 PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 221 ? 99.446  96.836  7.619   1.00 13.34 ? 221 PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 221 ? 98.685  96.832  6.323   1.00 13.59 ? 221 PRO A CD  1 
ATOM   1749 N N   . GLU A 1 222 ? 98.262  93.031  6.395   1.00 13.49 ? 222 GLU A N   1 
ATOM   1750 C CA  . GLU A 1 222 ? 97.877  91.616  6.345   1.00 14.19 ? 222 GLU A CA  1 
ATOM   1751 C C   . GLU A 1 222 ? 98.359  90.895  5.076   1.00 14.46 ? 222 GLU A C   1 
ATOM   1752 O O   . GLU A 1 222 ? 98.764  89.741  5.125   1.00 12.80 ? 222 GLU A O   1 
ATOM   1753 C CB  . GLU A 1 222 ? 96.337  91.422  6.431   1.00 16.99 ? 222 GLU A CB  1 
ATOM   1754 C CG  . GLU A 1 222 ? 95.880  91.114  7.781   1.00 21.66 ? 222 GLU A CG  1 
ATOM   1755 C CD  . GLU A 1 222 ? 94.443  90.551  7.898   1.00 21.92 ? 222 GLU A CD  1 
ATOM   1756 O OE1 . GLU A 1 222 ? 93.572  91.114  7.284   1.00 21.03 ? 222 GLU A OE1 1 
ATOM   1757 O OE2 . GLU A 1 222 ? 94.202  89.600  8.677   1.00 20.32 ? 222 GLU A OE2 1 
ATOM   1758 N N   . SER A 1 223 ? 98.273  91.571  3.935   1.00 13.41 ? 223 SER A N   1 
ATOM   1759 C CA  . SER A 1 223 ? 98.710  90.986  2.702   1.00 14.27 ? 223 SER A CA  1 
ATOM   1760 C C   . SER A 1 223 ? 100.237 90.761  2.743   1.00 13.73 ? 223 SER A C   1 
ATOM   1761 O O   . SER A 1 223 ? 100.742 89.667  2.300   1.00 13.88 ? 223 SER A O   1 
ATOM   1762 C CB  . SER A 1 223 ? 98.365  91.865  1.496   1.00 13.51 ? 223 SER A CB  1 
ATOM   1763 O OG  . SER A 1 223 ? 96.938  91.861  1.376   1.00 12.37 ? 223 SER A OG  1 
ATOM   1764 N N   . ARG A 1 224 ? 100.962 91.729  3.299   1.00 10.86 ? 224 ARG A N   1 
ATOM   1765 C CA  . ARG A 1 224 ? 102.384 91.556  3.408   1.00 12.00 ? 224 ARG A CA  1 
ATOM   1766 C C   . ARG A 1 224 ? 102.697 90.360  4.334   1.00 12.76 ? 224 ARG A C   1 
ATOM   1767 O O   . ARG A 1 224 ? 103.692 89.622  4.128   1.00 11.05 ? 224 ARG A O   1 
ATOM   1768 C CB  . ARG A 1 224 ? 103.054 92.849  3.872   1.00 11.67 ? 224 ARG A CB  1 
ATOM   1769 C CG  . ARG A 1 224 ? 103.135 93.832  2.714   1.00 12.71 ? 224 ARG A CG  1 
ATOM   1770 C CD  . ARG A 1 224 ? 103.951 95.036  3.091   1.00 14.02 ? 224 ARG A CD  1 
ATOM   1771 N NE  . ARG A 1 224 ? 103.250 95.919  4.008   1.00 13.93 ? 224 ARG A NE  1 
ATOM   1772 C CZ  . ARG A 1 224 ? 103.489 96.024  5.338   1.00 14.91 ? 224 ARG A CZ  1 
ATOM   1773 N NH1 . ARG A 1 224 ? 104.259 95.152  5.963   1.00 14.19 ? 224 ARG A NH1 1 
ATOM   1774 N NH2 . ARG A 1 224 ? 102.836 96.963  6.064   1.00 15.34 ? 224 ARG A NH2 1 
ATOM   1775 N N   . PHE A 1 225 ? 101.878 90.213  5.383   1.00 11.56 ? 225 PHE A N   1 
ATOM   1776 C CA  . PHE A 1 225 ? 102.102 89.107  6.333   1.00 11.67 ? 225 PHE A CA  1 
ATOM   1777 C C   . PHE A 1 225 ? 101.968 87.767  5.557   1.00 11.88 ? 225 PHE A C   1 
ATOM   1778 O O   . PHE A 1 225 ? 102.847 86.861  5.672   1.00 11.83 ? 225 PHE A O   1 
ATOM   1779 C CB  . PHE A 1 225 ? 101.160 89.234  7.495   1.00 11.77 ? 225 PHE A CB  1 
ATOM   1780 C CG  . PHE A 1 225 ? 101.495 88.329  8.663   1.00 12.85 ? 225 PHE A CG  1 
ATOM   1781 C CD1 . PHE A 1 225 ? 101.229 86.948  8.573   1.00 12.15 ? 225 PHE A CD1 1 
ATOM   1782 C CD2 . PHE A 1 225 ? 102.041 88.843  9.830   1.00 12.10 ? 225 PHE A CD2 1 
ATOM   1783 C CE1 . PHE A 1 225 ? 101.467 86.098  9.660   1.00 12.94 ? 225 PHE A CE1 1 
ATOM   1784 C CE2 . PHE A 1 225 ? 102.326 88.006  10.889  1.00 13.16 ? 225 PHE A CE2 1 
ATOM   1785 C CZ  . PHE A 1 225 ? 102.067 86.612  10.806  1.00 12.35 ? 225 PHE A CZ  1 
ATOM   1786 N N   . VAL A 1 226 ? 100.874 87.622  4.836   1.00 11.43 ? 226 VAL A N   1 
ATOM   1787 C CA  . VAL A 1 226 ? 100.675 86.421  4.035   1.00 12.95 ? 226 VAL A CA  1 
ATOM   1788 C C   . VAL A 1 226 ? 101.796 86.158  3.019   1.00 12.99 ? 226 VAL A C   1 
ATOM   1789 O O   . VAL A 1 226 ? 102.347 85.038  2.935   1.00 11.49 ? 226 VAL A O   1 
ATOM   1790 C CB  . VAL A 1 226 ? 99.320  86.401  3.333   1.00 12.74 ? 226 VAL A CB  1 
ATOM   1791 C CG1 . VAL A 1 226 ? 99.181  85.109  2.508   1.00 13.58 ? 226 VAL A CG1 1 
ATOM   1792 C CG2 . VAL A 1 226 ? 98.208  86.475  4.364   1.00 11.43 ? 226 VAL A CG2 1 
ATOM   1793 N N   . ARG A 1 227 ? 102.121 87.197  2.272   1.00 11.07 ? 227 ARG A N   1 
ATOM   1794 C CA  . ARG A 1 227 ? 103.088 87.083  1.160   1.00 11.56 ? 227 ARG A CA  1 
ATOM   1795 C C   . ARG A 1 227 ? 104.490 86.844  1.697   1.00 12.45 ? 227 ARG A C   1 
ATOM   1796 O O   . ARG A 1 227 ? 105.232 86.015  1.153   1.00 11.20 ? 227 ARG A O   1 
ATOM   1797 C CB  . ARG A 1 227 ? 103.016 88.303  0.257   1.00 11.58 ? 227 ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 227 ? 103.961 88.284  -0.900  1.00 12.33 ? 227 ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 227 ? 103.619 89.281  -1.989  1.00 12.82 ? 227 ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 227 ? 103.909 90.672  -1.621  1.00 12.82 ? 227 ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 227 ? 103.036 91.574  -1.210  1.00 12.23 ? 227 ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 227 ? 103.427 92.819  -1.067  1.00 14.09 ? 227 ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 227 ? 101.793 91.312  -0.959  1.00 13.56 ? 227 ARG A NH2 1 
ATOM   1804 N N   . ALA A 1 228 ? 104.856 87.498  2.793   1.00 11.16 ? 228 ALA A N   1 
ATOM   1805 C CA  . ALA A 1 228 ? 106.169 87.237  3.363   1.00 12.13 ? 228 ALA A CA  1 
ATOM   1806 C C   . ALA A 1 228 ? 106.268 85.775  3.935   1.00 11.23 ? 228 ALA A C   1 
ATOM   1807 O O   . ALA A 1 228 ? 107.304 85.175  3.802   1.00 11.16 ? 228 ALA A O   1 
ATOM   1808 C CB  . ALA A 1 228 ? 106.483 88.226  4.482   1.00 12.63 ? 228 ALA A CB  1 
ATOM   1809 N N   . THR A 1 229 ? 105.188 85.290  4.511   1.00 11.84 ? 229 THR A N   1 
ATOM   1810 C CA  . THR A 1 229 ? 105.147 83.953  5.092   1.00 12.87 ? 229 THR A CA  1 
ATOM   1811 C C   . THR A 1 229 ? 105.366 82.939  3.953   1.00 12.72 ? 229 THR A C   1 
ATOM   1812 O O   . THR A 1 229 ? 106.250 82.095  4.010   1.00 14.39 ? 229 THR A O   1 
ATOM   1813 C CB  . THR A 1 229 ? 103.843 83.676  5.826   1.00 11.53 ? 229 THR A CB  1 
ATOM   1814 O OG1 . THR A 1 229 ? 103.711 84.530  6.958   1.00 10.53 ? 229 THR A OG1 1 
ATOM   1815 C CG2 . THR A 1 229 ? 103.834 82.209  6.320   1.00 11.22 ? 229 THR A CG2 1 
ATOM   1816 N N   . PHE A 1 230 ? 104.606 83.093  2.876   1.00 14.55 ? 230 PHE A N   1 
ATOM   1817 C CA  . PHE A 1 230 ? 104.699 82.125  1.741   1.00 13.68 ? 230 PHE A CA  1 
ATOM   1818 C C   . PHE A 1 230 ? 106.067 82.166  1.104   1.00 12.79 ? 230 PHE A C   1 
ATOM   1819 O O   . PHE A 1 230 ? 106.617 81.135  0.769   1.00 12.04 ? 230 PHE A O   1 
ATOM   1820 C CB  . PHE A 1 230 ? 103.628 82.495  0.666   1.00 14.67 ? 230 PHE A CB  1 
ATOM   1821 C CG  . PHE A 1 230 ? 103.587 81.583  -0.515  1.00 14.42 ? 230 PHE A CG  1 
ATOM   1822 C CD1 . PHE A 1 230 ? 102.920 80.349  -0.425  1.00 15.63 ? 230 PHE A CD1 1 
ATOM   1823 C CD2 . PHE A 1 230 ? 104.093 81.996  -1.727  1.00 16.27 ? 230 PHE A CD2 1 
ATOM   1824 C CE1 . PHE A 1 230 ? 102.917 79.480  -1.508  1.00 15.67 ? 230 PHE A CE1 1 
ATOM   1825 C CE2 . PHE A 1 230 ? 104.044 81.138  -2.858  1.00 16.11 ? 230 PHE A CE2 1 
ATOM   1826 C CZ  . PHE A 1 230 ? 103.423 79.904  -2.728  1.00 15.54 ? 230 PHE A CZ  1 
ATOM   1827 N N   . SER A 1 231 ? 106.594 83.381  0.940   1.00 14.13 ? 231 SER A N   1 
ATOM   1828 C CA  . SER A 1 231 ? 107.896 83.577  0.328   1.00 13.72 ? 231 SER A CA  1 
ATOM   1829 C C   . SER A 1 231 ? 109.010 83.026  1.191   1.00 14.03 ? 231 SER A C   1 
ATOM   1830 O O   . SER A 1 231 ? 109.918 82.292  0.663   1.00 15.38 ? 231 SER A O   1 
ATOM   1831 C CB  . SER A 1 231 ? 108.125 85.056  0.005   1.00 14.34 ? 231 SER A CB  1 
ATOM   1832 O OG  . SER A 1 231 ? 107.144 85.523  -0.966  1.00 15.30 ? 231 SER A OG  1 
ATOM   1833 N N   . LYS A 1 232 ? 108.986 83.316  2.478   1.00 12.52 ? 232 LYS A N   1 
ATOM   1834 C CA  . LYS A 1 232 ? 110.017 82.799  3.384   1.00 14.28 ? 232 LYS A CA  1 
ATOM   1835 C C   . LYS A 1 232 ? 109.946 81.297  3.541   1.00 14.74 ? 232 LYS A C   1 
ATOM   1836 O O   . LYS A 1 232 ? 110.962 80.622  3.445   1.00 13.61 ? 232 LYS A O   1 
ATOM   1837 C CB  . LYS A 1 232 ? 109.909 83.453  4.800   1.00 14.53 ? 232 LYS A CB  1 
ATOM   1838 C CG  . LYS A 1 232 ? 110.972 82.986  5.810   1.00 17.47 ? 232 LYS A CG  1 
ATOM   1839 C CD  . LYS A 1 232 ? 110.529 83.144  7.290   1.00 21.37 ? 232 LYS A CD  1 
ATOM   1840 C CE  . LYS A 1 232 ? 110.929 81.897  8.027   1.00 21.72 ? 232 LYS A CE  1 
ATOM   1841 N NZ  . LYS A 1 232 ? 111.052 82.227  9.383   1.00 20.67 ? 232 LYS A NZ  1 
ATOM   1842 N N   . LEU A 1 233 ? 108.776 80.756  3.825   1.00 15.50 ? 233 LEU A N   1 
ATOM   1843 C CA  . LEU A 1 233 ? 108.692 79.339  4.108   1.00 15.70 ? 233 LEU A CA  1 
ATOM   1844 C C   . LEU A 1 233 ? 109.026 78.488  2.907   1.00 18.10 ? 233 LEU A C   1 
ATOM   1845 O O   . LEU A 1 233 ? 109.513 77.348  3.073   1.00 18.00 ? 233 LEU A O   1 
ATOM   1846 C CB  . LEU A 1 233 ? 107.341 78.956  4.671   1.00 17.44 ? 233 LEU A CB  1 
ATOM   1847 C CG  . LEU A 1 233 ? 106.952 79.533  6.024   1.00 21.49 ? 233 LEU A CG  1 
ATOM   1848 C CD1 . LEU A 1 233 ? 105.624 78.931  6.503   1.00 20.09 ? 233 LEU A CD1 1 
ATOM   1849 C CD2 . LEU A 1 233 ? 108.019 79.329  7.048   1.00 22.78 ? 233 LEU A CD2 1 
ATOM   1850 N N   . ASN A 1 234 ? 108.824 79.005  1.694   1.00 14.51 ? 234 ASN A N   1 
ATOM   1851 C CA  . ASN A 1 234 ? 109.128 78.260  0.520   1.00 15.12 ? 234 ASN A CA  1 
ATOM   1852 C C   . ASN A 1 234 ? 110.481 78.580  -0.095  1.00 15.55 ? 234 ASN A C   1 
ATOM   1853 O O   . ASN A 1 234 ? 110.850 78.003  -1.142  1.00 15.66 ? 234 ASN A O   1 
ATOM   1854 C CB  . ASN A 1 234 ? 107.985 78.416  -0.516  1.00 14.72 ? 234 ASN A CB  1 
ATOM   1855 C CG  . ASN A 1 234 ? 106.730 77.724  -0.052  1.00 15.06 ? 234 ASN A CG  1 
ATOM   1856 O OD1 . ASN A 1 234 ? 105.707 78.369  0.225   1.00 17.46 ? 234 ASN A OD1 1 
ATOM   1857 N ND2 . ASN A 1 234 ? 106.792 76.405  0.098   1.00 11.95 ? 234 ASN A ND2 1 
ATOM   1858 N N   . SER A 1 235 ? 111.206 79.524  0.457   1.00 15.83 ? 235 SER A N   1 
ATOM   1859 C CA  . SER A 1 235 ? 112.441 79.945  -0.169  1.00 15.44 ? 235 SER A CA  1 
ATOM   1860 C C   . SER A 1 235 ? 113.438 78.789  -0.180  1.00 17.60 ? 235 SER A C   1 
ATOM   1861 O O   . SER A 1 235 ? 113.567 78.028  0.772   1.00 14.20 ? 235 SER A O   1 
ATOM   1862 C CB  . SER A 1 235 ? 113.044 81.203  0.484   1.00 19.93 ? 235 SER A CB  1 
ATOM   1863 O OG  . SER A 1 235 ? 113.291 80.884  1.769   1.00 27.11 ? 235 SER A OG  1 
ATOM   1864 N N   . SER A 1 236 ? 114.129 78.644  -1.280  1.00 15.31 ? 236 SER A N   1 
ATOM   1865 C CA  . SER A 1 236 ? 115.196 77.612  -1.459  1.00 16.91 ? 236 SER A CA  1 
ATOM   1866 C C   . SER A 1 236 ? 116.320 77.837  -0.466  1.00 17.85 ? 236 SER A C   1 
ATOM   1867 O O   . SER A 1 236 ? 116.653 78.943  -0.119  1.00 17.02 ? 236 SER A O   1 
ATOM   1868 C CB  . SER A 1 236 ? 115.727 77.612  -2.947  1.00 17.63 ? 236 SER A CB  1 
ATOM   1869 O OG  . SER A 1 236 ? 114.605 77.330  -3.852  1.00 19.20 ? 236 SER A OG  1 
ATOM   1870 N N   . LYS A 1 237 ? 116.843 76.740  0.053   1.00 18.02 ? 237 LYS A N   1 
ATOM   1871 C CA  . LYS A 1 237 ? 117.995 76.782  0.950   1.00 24.27 ? 237 LYS A CA  1 
ATOM   1872 C C   . LYS A 1 237 ? 119.233 77.164  0.169   1.00 24.74 ? 237 LYS A C   1 
ATOM   1873 O O   . LYS A 1 237 ? 119.372 76.849  -0.992  1.00 31.12 ? 237 LYS A O   1 
ATOM   1874 C CB  . LYS A 1 237 ? 118.292 75.407  1.564   1.00 26.44 ? 237 LYS A CB  1 
ATOM   1875 C CG  . LYS A 1 237 ? 117.149 74.817  2.337   1.00 34.39 ? 237 LYS A CG  1 
ATOM   1876 C CD  . LYS A 1 237 ? 116.675 75.676  3.484   1.00 39.66 ? 237 LYS A CD  1 
ATOM   1877 C CE  . LYS A 1 237 ? 115.589 74.918  4.260   1.00 45.18 ? 237 LYS A CE  1 
ATOM   1878 N NZ  . LYS A 1 237 ? 115.614 75.353  5.679   1.00 49.58 ? 237 LYS A NZ  1 
ATOM   1879 N N   . GLY A 1 238 ? 120.136 77.826  0.814   1.00 23.62 ? 238 GLY A N   1 
ATOM   1880 C CA  . GLY A 1 238 ? 121.422 78.148  0.209   1.00 24.77 ? 238 GLY A CA  1 
ATOM   1881 C C   . GLY A 1 238 ? 122.475 77.181  0.774   1.00 23.74 ? 238 GLY A C   1 
ATOM   1882 O O   . GLY A 1 238 ? 122.286 76.613  1.828   1.00 21.72 ? 238 GLY A O   1 
ATOM   1883 N N   . MET A 1 239 ? 123.598 77.107  0.106   1.00 24.74 ? 239 MET A N   1 
ATOM   1884 C CA  . MET A 1 239 ? 124.728 76.302  0.555   1.00 29.72 ? 239 MET A CA  1 
ATOM   1885 C C   . MET A 1 239 ? 125.722 77.090  1.340   1.00 25.86 ? 239 MET A C   1 
ATOM   1886 O O   . MET A 1 239 ? 126.541 76.506  2.031   1.00 25.20 ? 239 MET A O   1 
ATOM   1887 C CB  . MET A 1 239 ? 125.431 75.695  -0.666  1.00 38.78 ? 239 MET A CB  1 
ATOM   1888 C CG  . MET A 1 239 ? 124.455 74.814  -1.437  1.00 45.50 ? 239 MET A CG  1 
ATOM   1889 S SD  . MET A 1 239 ? 124.604 73.143  -0.831  1.00 64.24 ? 239 MET A SD  1 
ATOM   1890 C CE  . MET A 1 239 ? 126.356 72.780  -1.050  1.00 52.65 ? 239 MET A CE  1 
ATOM   1891 N N   . THR A 1 240 ? 125.702 78.413  1.265   1.00 19.85 ? 240 THR A N   1 
ATOM   1892 C CA  . THR A 1 240 ? 126.618 79.202  2.080   1.00 19.79 ? 240 THR A CA  1 
ATOM   1893 C C   . THR A 1 240 ? 125.888 80.314  2.837   1.00 19.21 ? 240 THR A C   1 
ATOM   1894 O O   . THR A 1 240 ? 124.757 80.679  2.452   1.00 18.38 ? 240 THR A O   1 
ATOM   1895 C CB  . THR A 1 240 ? 127.672 79.862  1.206   1.00 21.78 ? 240 THR A CB  1 
ATOM   1896 O OG1 . THR A 1 240 ? 127.056 80.802  0.324   1.00 20.74 ? 240 THR A OG1 1 
ATOM   1897 C CG2 . THR A 1 240 ? 128.468 78.809  0.366   1.00 23.86 ? 240 THR A CG2 1 
ATOM   1898 N N   . VAL A 1 241 ? 126.572 80.929  3.774   1.00 17.32 ? 241 VAL A N   1 
ATOM   1899 C CA  . VAL A 1 241 ? 126.060 82.119  4.438   1.00 18.54 ? 241 VAL A CA  1 
ATOM   1900 C C   . VAL A 1 241 ? 125.796 83.230  3.417   1.00 21.33 ? 241 VAL A C   1 
ATOM   1901 O O   . VAL A 1 241 ? 124.771 83.915  3.504   1.00 17.19 ? 241 VAL A O   1 
ATOM   1902 C CB  . VAL A 1 241 ? 126.986 82.567  5.563   1.00 20.58 ? 241 VAL A CB  1 
ATOM   1903 C CG1 . VAL A 1 241 ? 126.583 83.919  6.139   1.00 20.84 ? 241 VAL A CG1 1 
ATOM   1904 C CG2 . VAL A 1 241 ? 127.016 81.527  6.671   1.00 19.77 ? 241 VAL A CG2 1 
ATOM   1905 N N   . GLU A 1 242 ? 126.683 83.406  2.442   1.00 18.80 ? 242 GLU A N   1 
ATOM   1906 C CA  . GLU A 1 242 ? 126.434 84.469  1.428   1.00 21.64 ? 242 GLU A CA  1 
ATOM   1907 C C   . GLU A 1 242 ? 125.131 84.242  0.681   1.00 20.97 ? 242 GLU A C   1 
ATOM   1908 O O   . GLU A 1 242 ? 124.367 85.186  0.461   1.00 16.50 ? 242 GLU A O   1 
ATOM   1909 C CB  . GLU A 1 242 ? 127.559 84.608  0.392   1.00 23.50 ? 242 GLU A CB  1 
ATOM   1910 C CG  . GLU A 1 242 ? 127.274 85.601  -0.736  1.00 30.83 ? 242 GLU A CG  1 
ATOM   1911 C CD  . GLU A 1 242 ? 128.202 85.509  -1.978  1.00 37.40 ? 242 GLU A CD  1 
ATOM   1912 O OE1 . GLU A 1 242 ? 129.381 85.679  -1.725  1.00 41.44 ? 242 GLU A OE1 1 
ATOM   1913 O OE2 . GLU A 1 242 ? 127.729 85.412  -3.182  1.00 30.47 ? 242 GLU A OE2 1 
ATOM   1914 N N   . GLU A 1 243 ? 124.883 82.987  0.277   1.00 19.16 ? 243 GLU A N   1 
ATOM   1915 C CA  . GLU A 1 243 ? 123.655 82.672  -0.433  1.00 20.13 ? 243 GLU A CA  1 
ATOM   1916 C C   . GLU A 1 243 ? 122.426 82.924  0.455   1.00 21.36 ? 243 GLU A C   1 
ATOM   1917 O O   . GLU A 1 243 ? 121.394 83.362  -0.052  1.00 17.25 ? 243 GLU A O   1 
ATOM   1918 C CB  . GLU A 1 243 ? 123.680 81.215  -0.927  1.00 21.32 ? 243 GLU A CB  1 
ATOM   1919 C CG  . GLU A 1 243 ? 124.670 81.023  -2.053  1.00 22.63 ? 243 GLU A CG  1 
ATOM   1920 C CD  . GLU A 1 243 ? 124.722 79.589  -2.606  1.00 29.13 ? 243 GLU A CD  1 
ATOM   1921 O OE1 . GLU A 1 243 ? 124.034 78.632  -2.111  1.00 32.62 ? 243 GLU A OE1 1 
ATOM   1922 O OE2 . GLU A 1 243 ? 125.368 79.479  -3.630  1.00 31.25 ? 243 GLU A OE2 1 
ATOM   1923 N N   . ASP A 1 244 ? 122.529 82.610  1.746   1.00 18.12 ? 244 ASP A N   1 
ATOM   1924 C CA  . ASP A 1 244 ? 121.465 82.869  2.692   1.00 17.10 ? 244 ASP A CA  1 
ATOM   1925 C C   . ASP A 1 244 ? 121.126 84.361  2.791   1.00 17.37 ? 244 ASP A C   1 
ATOM   1926 O O   . ASP A 1 244 ? 119.958 84.736  2.755   1.00 15.55 ? 244 ASP A O   1 
ATOM   1927 C CB  . ASP A 1 244 ? 121.866 82.399  4.104   1.00 17.28 ? 244 ASP A CB  1 
ATOM   1928 C CG  . ASP A 1 244 ? 121.943 80.888  4.249   1.00 18.12 ? 244 ASP A CG  1 
ATOM   1929 O OD1 . ASP A 1 244 ? 121.420 80.117  3.420   1.00 17.26 ? 244 ASP A OD1 1 
ATOM   1930 O OD2 . ASP A 1 244 ? 122.442 80.471  5.315   1.00 19.22 ? 244 ASP A OD2 1 
ATOM   1931 N N   . ILE A 1 245 ? 122.136 85.220  2.876   1.00 14.76 ? 245 ILE A N   1 
ATOM   1932 C CA  . ILE A 1 245 ? 121.934 86.675  2.979   1.00 15.32 ? 245 ILE A CA  1 
ATOM   1933 C C   . ILE A 1 245 ? 121.320 87.207  1.685   1.00 14.89 ? 245 ILE A C   1 
ATOM   1934 O O   . ILE A 1 245 ? 120.364 87.998  1.698   1.00 12.44 ? 245 ILE A O   1 
ATOM   1935 C CB  . ILE A 1 245 ? 123.289 87.377  3.269   1.00 16.74 ? 245 ILE A CB  1 
ATOM   1936 C CG1 . ILE A 1 245 ? 123.728 87.020  4.702   1.00 19.61 ? 245 ILE A CG1 1 
ATOM   1937 C CG2 . ILE A 1 245 ? 123.182 88.901  3.134   1.00 17.58 ? 245 ILE A CG2 1 
ATOM   1938 C CD1 . ILE A 1 245 ? 125.203 87.245  4.839   1.00 21.83 ? 245 ILE A CD1 1 
ATOM   1939 N N   . THR A 1 246 ? 121.816 86.697  0.571   1.00 13.54 ? 246 THR A N   1 
ATOM   1940 C CA  . THR A 1 246 ? 121.185 86.986  -0.720  1.00 14.21 ? 246 THR A CA  1 
ATOM   1941 C C   . THR A 1 246 ? 119.712 86.616  -0.731  1.00 13.51 ? 246 THR A C   1 
ATOM   1942 O O   . THR A 1 246 ? 118.896 87.455  -1.155  1.00 14.58 ? 246 THR A O   1 
ATOM   1943 C CB  . THR A 1 246 ? 121.987 86.381  -1.891  1.00 14.78 ? 246 THR A CB  1 
ATOM   1944 O OG1 . THR A 1 246 ? 123.285 86.994  -1.931  1.00 16.51 ? 246 THR A OG1 1 
ATOM   1945 C CG2 . THR A 1 246 ? 121.266 86.535  -3.193  1.00 16.87 ? 246 THR A CG2 1 
ATOM   1946 N N   . GLN A 1 247 ? 119.380 85.384  -0.310  1.00 15.30 ? 247 GLN A N   1 
ATOM   1947 C CA  . GLN A 1 247 ? 117.993 84.908  -0.281  1.00 15.21 ? 247 GLN A CA  1 
ATOM   1948 C C   . GLN A 1 247 ? 117.154 85.815  0.668   1.00 15.59 ? 247 GLN A C   1 
ATOM   1949 O O   . GLN A 1 247 ? 116.014 86.194  0.334   1.00 13.45 ? 247 GLN A O   1 
ATOM   1950 C CB  . GLN A 1 247 ? 117.989 83.445  0.101   1.00 18.82 ? 247 GLN A CB  1 
ATOM   1951 C CG  . GLN A 1 247 ? 116.669 82.793  -0.093  1.00 21.84 ? 247 GLN A CG  1 
ATOM   1952 C CD  . GLN A 1 247 ? 116.141 82.684  -1.559  1.00 22.27 ? 247 GLN A CD  1 
ATOM   1953 O OE1 . GLN A 1 247 ? 114.893 82.431  -1.805  1.00 29.01 ? 247 GLN A OE1 1 
ATOM   1954 N NE2 . GLN A 1 247 ? 116.977 83.037  -2.506  1.00 17.64 ? 247 GLN A NE2 1 
ATOM   1955 N N   . PHE A 1 248 ? 117.720 86.161  1.826   1.00 13.34 ? 248 PHE A N   1 
ATOM   1956 C CA  . PHE A 1 248 ? 117.019 87.002  2.819   1.00 13.68 ? 248 PHE A CA  1 
ATOM   1957 C C   . PHE A 1 248 ? 116.584 88.367  2.225   1.00 13.40 ? 248 PHE A C   1 
ATOM   1958 O O   . PHE A 1 248 ? 115.411 88.731  2.376   1.00 14.69 ? 248 PHE A O   1 
ATOM   1959 C CB  . PHE A 1 248 ? 117.936 87.243  4.003   1.00 13.57 ? 248 PHE A CB  1 
ATOM   1960 C CG  . PHE A 1 248 ? 117.241 87.724  5.244   1.00 13.98 ? 248 PHE A CG  1 
ATOM   1961 C CD1 . PHE A 1 248 ? 116.947 89.046  5.427   1.00 15.30 ? 248 PHE A CD1 1 
ATOM   1962 C CD2 . PHE A 1 248 ? 116.982 86.853  6.263   1.00 13.07 ? 248 PHE A CD2 1 
ATOM   1963 C CE1 . PHE A 1 248 ? 116.387 89.487  6.604   1.00 13.86 ? 248 PHE A CE1 1 
ATOM   1964 C CE2 . PHE A 1 248 ? 116.425 87.272  7.461   1.00 14.96 ? 248 PHE A CE2 1 
ATOM   1965 C CZ  . PHE A 1 248 ? 116.108 88.590  7.635   1.00 15.11 ? 248 PHE A CZ  1 
ATOM   1966 N N   . PHE A 1 249 ? 117.463 89.057  1.500   1.00 12.58 ? 249 PHE A N   1 
ATOM   1967 C CA  . PHE A 1 249 ? 117.083 90.271  0.848   1.00 13.45 ? 249 PHE A CA  1 
ATOM   1968 C C   . PHE A 1 249 ? 116.005 90.058  -0.227  1.00 13.80 ? 249 PHE A C   1 
ATOM   1969 O O   . PHE A 1 249 ? 115.104 90.871  -0.396  1.00 13.45 ? 249 PHE A O   1 
ATOM   1970 C CB  . PHE A 1 249 ? 118.317 91.050  0.317   1.00 12.94 ? 249 PHE A CB  1 
ATOM   1971 C CG  . PHE A 1 249 ? 119.064 91.819  1.406   1.00 13.67 ? 249 PHE A CG  1 
ATOM   1972 C CD1 . PHE A 1 249 ? 118.578 93.011  1.862   1.00 15.85 ? 249 PHE A CD1 1 
ATOM   1973 C CD2 . PHE A 1 249 ? 120.149 91.276  2.035   1.00 14.39 ? 249 PHE A CD2 1 
ATOM   1974 C CE1 . PHE A 1 249 ? 119.201 93.688  2.929   1.00 17.28 ? 249 PHE A CE1 1 
ATOM   1975 C CE2 . PHE A 1 249 ? 120.796 91.946  3.063   1.00 15.71 ? 249 PHE A CE2 1 
ATOM   1976 C CZ  . PHE A 1 249 ? 120.309 93.152  3.517   1.00 15.73 ? 249 PHE A CZ  1 
ATOM   1977 N N   . HIS A 1 250 ? 116.091 88.951  -0.943  1.00 13.29 ? 250 HIS A N   1 
ATOM   1978 C CA  . HIS A 1 250 ? 115.049 88.607  -1.925  1.00 14.83 ? 250 HIS A CA  1 
ATOM   1979 C C   . HIS A 1 250 ? 113.718 88.432  -1.195  1.00 13.58 ? 250 HIS A C   1 
ATOM   1980 O O   . HIS A 1 250 ? 112.670 88.926  -1.718  1.00 15.41 ? 250 HIS A O   1 
ATOM   1981 C CB  . HIS A 1 250 ? 115.407 87.360  -2.752  1.00 13.71 ? 250 HIS A CB  1 
ATOM   1982 C CG  . HIS A 1 250 ? 116.416 87.618  -3.865  1.00 13.85 ? 250 HIS A CG  1 
ATOM   1983 N ND1 . HIS A 1 250 ? 116.162 88.449  -4.937  1.00 16.29 ? 250 HIS A ND1 1 
ATOM   1984 C CD2 . HIS A 1 250 ? 117.662 87.144  -4.054  1.00 14.71 ? 250 HIS A CD2 1 
ATOM   1985 C CE1 . HIS A 1 250 ? 117.205 88.450  -5.757  1.00 16.93 ? 250 HIS A CE1 1 
ATOM   1986 N NE2 . HIS A 1 250 ? 118.139 87.689  -5.221  1.00 14.64 ? 250 HIS A NE2 1 
ATOM   1987 N N   . ILE A 1 251 ? 113.734 87.757  -0.047  1.00 12.72 ? 251 ILE A N   1 
ATOM   1988 C CA  . ILE A 1 251 ? 112.492 87.573  0.690   1.00 12.90 ? 251 ILE A CA  1 
ATOM   1989 C C   . ILE A 1 251 ? 111.846 88.890  1.128   1.00 12.68 ? 251 ILE A C   1 
ATOM   1990 O O   . ILE A 1 251 ? 110.657 89.155  0.898   1.00 12.76 ? 251 ILE A O   1 
ATOM   1991 C CB  . ILE A 1 251 ? 112.679 86.662  1.922   1.00 12.58 ? 251 ILE A CB  1 
ATOM   1992 C CG1 . ILE A 1 251 ? 113.046 85.226  1.433   1.00 14.05 ? 251 ILE A CG1 1 
ATOM   1993 C CG2 . ILE A 1 251 ? 111.435 86.649  2.745   1.00 12.21 ? 251 ILE A CG2 1 
ATOM   1994 C CD1 . ILE A 1 251 ? 113.690 84.406  2.547   1.00 14.05 ? 251 ILE A CD1 1 
ATOM   1995 N N   . LEU A 1 252 ? 112.648 89.747  1.709   1.00 13.26 ? 252 LEU A N   1 
ATOM   1996 C CA  . LEU A 1 252 ? 112.190 91.097  2.132   1.00 13.25 ? 252 LEU A CA  1 
ATOM   1997 C C   . LEU A 1 252 ? 111.747 91.892  0.949   1.00 13.63 ? 252 LEU A C   1 
ATOM   1998 O O   . LEU A 1 252 ? 110.767 92.638  1.039   1.00 12.63 ? 252 LEU A O   1 
ATOM   1999 C CB  . LEU A 1 252 ? 113.274 91.874  2.857   1.00 14.03 ? 252 LEU A CB  1 
ATOM   2000 C CG  . LEU A 1 252 ? 113.567 91.441  4.317   1.00 15.23 ? 252 LEU A CG  1 
ATOM   2001 C CD1 . LEU A 1 252 ? 114.618 92.335  4.854   1.00 17.45 ? 252 LEU A CD1 1 
ATOM   2002 C CD2 . LEU A 1 252 ? 112.362 91.441  5.205   1.00 18.30 ? 252 LEU A CD2 1 
ATOM   2003 N N   . GLY A 1 253 ? 112.443 91.719  -0.187  1.00 13.29 ? 253 GLY A N   1 
ATOM   2004 C CA  . GLY A 1 253 ? 112.011 92.359  -1.475  1.00 13.51 ? 253 GLY A CA  1 
ATOM   2005 C C   . GLY A 1 253 ? 110.591 92.010  -1.925  1.00 12.64 ? 253 GLY A C   1 
ATOM   2006 O O   . GLY A 1 253 ? 109.894 92.835  -2.508  1.00 11.68 ? 253 GLY A O   1 
ATOM   2007 N N   . THR A 1 254 ? 110.114 90.823  -1.618  1.00 12.87 ? 254 THR A N   1 
ATOM   2008 C CA  . THR A 1 254 ? 108.742 90.438  -2.038  1.00 13.67 ? 254 THR A CA  1 
ATOM   2009 C C   . THR A 1 254 ? 107.634 91.287  -1.396  1.00 13.50 ? 254 THR A C   1 
ATOM   2010 O O   . THR A 1 254 ? 106.497 91.355  -1.905  1.00 13.55 ? 254 THR A O   1 
ATOM   2011 C CB  . THR A 1 254 ? 108.413 88.957  -1.752  1.00 12.44 ? 254 THR A CB  1 
ATOM   2012 O OG1 . THR A 1 254 ? 108.269 88.704  -0.357  1.00 12.06 ? 254 THR A OG1 1 
ATOM   2013 C CG2 . THR A 1 254 ? 109.449 87.938  -2.397  1.00 13.49 ? 254 THR A CG2 1 
ATOM   2014 N N   . VAL A 1 255 ? 107.960 91.922  -0.264  1.00 13.29 ? 255 VAL A N   1 
ATOM   2015 C CA  . VAL A 1 255 ? 107.032 92.782  0.445   1.00 12.22 ? 255 VAL A CA  1 
ATOM   2016 C C   . VAL A 1 255 ? 107.496 94.211  0.633   1.00 12.91 ? 255 VAL A C   1 
ATOM   2017 O O   . VAL A 1 255 ? 106.925 94.976  1.440   1.00 12.09 ? 255 VAL A O   1 
ATOM   2018 C CB  . VAL A 1 255 ? 106.662 92.146  1.791   1.00 12.75 ? 255 VAL A CB  1 
ATOM   2019 C CG1 . VAL A 1 255 ? 105.817 90.887  1.553   1.00 13.60 ? 255 VAL A CG1 1 
ATOM   2020 C CG2 . VAL A 1 255 ? 107.871 91.894  2.654   1.00 12.39 ? 255 VAL A CG2 1 
ATOM   2021 N N   . GLU A 1 256 ? 108.449 94.600  -0.200  1.00 13.14 ? 256 GLU A N   1 
ATOM   2022 C CA  . GLU A 1 256 ? 108.951 95.981  -0.276  1.00 15.62 ? 256 GLU A CA  1 
ATOM   2023 C C   . GLU A 1 256 ? 107.834 96.921  -0.737  1.00 13.66 ? 256 GLU A C   1 
ATOM   2024 O O   . GLU A 1 256 ? 106.968 96.522  -1.525  1.00 13.67 ? 256 GLU A O   1 
ATOM   2025 C CB  . GLU A 1 256 ? 110.061 96.045  -1.404  1.00 20.10 ? 256 GLU A CB  1 
ATOM   2026 C CG  . GLU A 1 256 ? 110.724 97.359  -1.436  1.00 23.34 ? 256 GLU A CG  1 
ATOM   2027 C CD  . GLU A 1 256 ? 111.880 97.472  -2.329  1.00 20.14 ? 256 GLU A CD  1 
ATOM   2028 O OE1 . GLU A 1 256 ? 111.690 97.548  -3.572  1.00 17.77 ? 256 GLU A OE1 1 
ATOM   2029 O OE2 . GLU A 1 256 ? 112.916 97.590  -1.703  1.00 22.14 ? 256 GLU A OE2 1 
ATOM   2030 N N   . GLN A 1 257 ? 107.870 98.169  -0.262  1.00 12.10 ? 257 GLN A N   1 
ATOM   2031 C CA  . GLN A 1 257 ? 106.910 99.202  -0.673  1.00 12.73 ? 257 GLN A CA  1 
ATOM   2032 C C   . GLN A 1 257 ? 107.641 100.191 -1.481  1.00 14.47 ? 257 GLN A C   1 
ATOM   2033 O O   . GLN A 1 257 ? 108.580 100.835 -0.983  1.00 13.65 ? 257 GLN A O   1 
ATOM   2034 C CB  . GLN A 1 257 ? 106.284 99.878  0.514   1.00 12.93 ? 257 GLN A CB  1 
ATOM   2035 C CG  . GLN A 1 257 ? 105.528 98.897  1.407   1.00 14.91 ? 257 GLN A CG  1 
ATOM   2036 C CD  . GLN A 1 257 ? 104.498 99.583  2.290   1.00 15.08 ? 257 GLN A CD  1 
ATOM   2037 O OE1 . GLN A 1 257 ? 103.697 100.411 1.832   1.00 15.32 ? 257 GLN A OE1 1 
ATOM   2038 N NE2 . GLN A 1 257 ? 104.479 99.178  3.576   1.00 16.57 ? 257 GLN A NE2 1 
ATOM   2039 N N   . ILE A 1 258 ? 107.230 100.337 -2.748  1.00 14.29 ? 258 ILE A N   1 
ATOM   2040 C CA  . ILE A 1 258 ? 107.844 101.297 -3.618  1.00 13.51 ? 258 ILE A CA  1 
ATOM   2041 C C   . ILE A 1 258 ? 107.166 102.585 -3.502  1.00 14.04 ? 258 ILE A C   1 
ATOM   2042 O O   . ILE A 1 258 ? 105.963 102.665 -3.226  1.00 15.66 ? 258 ILE A O   1 
ATOM   2043 C CB  . ILE A 1 258 ? 107.960 100.802 -5.124  1.00 13.89 ? 258 ILE A CB  1 
ATOM   2044 C CG1 . ILE A 1 258 ? 106.677 100.944 -5.885  1.00 13.89 ? 258 ILE A CG1 1 
ATOM   2045 C CG2 . ILE A 1 258 ? 108.459 99.354  -5.120  1.00 16.04 ? 258 ILE A CG2 1 
ATOM   2046 C CD1 . ILE A 1 258 ? 106.824 100.724 -7.403  1.00 15.25 ? 258 ILE A CD1 1 
ATOM   2047 N N   . LYS A 1 259 ? 107.890 103.661 -3.755  1.00 13.59 ? 259 LYS A N   1 
ATOM   2048 C CA  . LYS A 1 259 ? 107.229 104.945 -3.719  1.00 15.16 ? 259 LYS A CA  1 
ATOM   2049 C C   . LYS A 1 259 ? 106.185 105.156 -4.844  1.00 15.32 ? 259 LYS A C   1 
ATOM   2050 O O   . LYS A 1 259 ? 106.545 105.111 -6.020  1.00 14.32 ? 259 LYS A O   1 
ATOM   2051 C CB  . LYS A 1 259 ? 108.267 106.075 -3.846  1.00 17.26 ? 259 LYS A CB  1 
ATOM   2052 C CG  . LYS A 1 259 ? 109.164 106.268 -2.648  1.00 18.67 ? 259 LYS A CG  1 
ATOM   2053 C CD  . LYS A 1 259 ? 110.158 107.420 -2.955  1.00 20.50 ? 259 LYS A CD  1 
ATOM   2054 C CE  . LYS A 1 259 ? 111.147 107.577 -1.789  1.00 22.33 ? 259 LYS A CE  1 
ATOM   2055 N NZ  . LYS A 1 259 ? 112.092 108.634 -2.222  1.00 23.74 ? 259 LYS A NZ  1 
ATOM   2056 N N   . GLY A 1 260 ? 104.950 105.420 -4.448  1.00 14.94 ? 260 GLY A N   1 
ATOM   2057 C CA  . GLY A 1 260 ? 103.865 105.720 -5.281  1.00 14.85 ? 260 GLY A CA  1 
ATOM   2058 C C   . GLY A 1 260 ? 102.622 104.858 -5.138  1.00 15.88 ? 260 GLY A C   1 
ATOM   2059 O O   . GLY A 1 260 ? 101.533 105.276 -5.563  1.00 16.90 ? 260 GLY A O   1 
ATOM   2060 N N   . VAL A 1 261 ? 102.791 103.669 -4.561  1.00 14.93 ? 261 VAL A N   1 
ATOM   2061 C CA  . VAL A 1 261 ? 101.707 102.754 -4.478  1.00 16.34 ? 261 VAL A CA  1 
ATOM   2062 C C   . VAL A 1 261 ? 100.899 102.809 -3.183  1.00 15.70 ? 261 VAL A C   1 
ATOM   2063 O O   . VAL A 1 261 ? 99.834  102.160 -3.091  1.00 14.89 ? 261 VAL A O   1 
ATOM   2064 C CB  . VAL A 1 261 ? 102.170 101.288 -4.747  1.00 15.52 ? 261 VAL A CB  1 
ATOM   2065 C CG1 . VAL A 1 261 ? 102.703 101.172 -6.167  1.00 16.54 ? 261 VAL A CG1 1 
ATOM   2066 C CG2 . VAL A 1 261 ? 103.120 100.760 -3.695  1.00 15.66 ? 261 VAL A CG2 1 
ATOM   2067 N N   . ASN A 1 262 ? 101.442 103.505 -2.191  1.00 15.55 ? 262 ASN A N   1 
ATOM   2068 C CA  . ASN A 1 262 ? 100.786 103.576 -0.873  1.00 14.80 ? 262 ASN A CA  1 
ATOM   2069 C C   . ASN A 1 262 ? 100.836 105.008 -0.323  1.00 14.75 ? 262 ASN A C   1 
ATOM   2070 O O   . ASN A 1 262 ? 101.842 105.412 0.255   1.00 13.46 ? 262 ASN A O   1 
ATOM   2071 C CB  . ASN A 1 262 ? 101.443 102.591 0.092   1.00 14.86 ? 262 ASN A CB  1 
ATOM   2072 C CG  . ASN A 1 262 ? 100.751 102.515 1.437   1.00 16.82 ? 262 ASN A CG  1 
ATOM   2073 O OD1 . ASN A 1 262 ? 99.715  103.182 1.666   1.00 15.62 ? 262 ASN A OD1 1 
ATOM   2074 N ND2 . ASN A 1 262 ? 101.344 101.726 2.376   1.00 15.55 ? 262 ASN A ND2 1 
ATOM   2075 N N   . LYS A 1 263 ? 99.753  105.729 -0.577  1.00 14.66 ? 263 LYS A N   1 
ATOM   2076 C CA  . LYS A 1 263 ? 99.668  107.149 -0.266  1.00 19.34 ? 263 LYS A CA  1 
ATOM   2077 C C   . LYS A 1 263 ? 98.882  107.341 1.007   1.00 20.45 ? 263 LYS A C   1 
ATOM   2078 O O   . LYS A 1 263 ? 97.760  106.870 1.123   1.00 20.43 ? 263 LYS A O   1 
ATOM   2079 C CB  . LYS A 1 263 ? 99.022  107.903 -1.449  1.00 22.38 ? 263 LYS A CB  1 
ATOM   2080 C CG  . LYS A 1 263 ? 99.062  109.413 -1.307  1.00 29.14 ? 263 LYS A CG  1 
ATOM   2081 C CD  . LYS A 1 263 ? 98.493  110.102 -2.558  1.00 36.85 ? 263 LYS A CD  1 
ATOM   2082 C CE  . LYS A 1 263 ? 99.167  111.430 -2.808  1.00 48.65 ? 263 LYS A CE  1 
ATOM   2083 N NZ  . LYS A 1 263 ? 98.506  112.106 -3.949  1.00 56.98 ? 263 LYS A NZ  1 
ATOM   2084 N N   . THR A 1 264 ? 99.535  107.907 2.006   1.00 21.07 ? 264 THR A N   1 
ATOM   2085 C CA  . THR A 1 264 ? 99.010  107.893 3.373   1.00 27.45 ? 264 THR A CA  1 
ATOM   2086 C C   . THR A 1 264 ? 98.036  109.078 3.494   1.00 30.69 ? 264 THR A C   1 
ATOM   2087 O O   . THR A 1 264 ? 97.915  109.880 2.550   1.00 25.59 ? 264 THR A O   1 
ATOM   2088 C CB  . THR A 1 264 ? 100.116 108.022 4.447   1.00 29.04 ? 264 THR A CB  1 
ATOM   2089 O OG1 . THR A 1 264 ? 100.695 109.312 4.329   1.00 31.94 ? 264 THR A OG1 1 
ATOM   2090 C CG2 . THR A 1 264 ? 101.222 106.915 4.290   1.00 31.23 ? 264 THR A CG2 1 
ATOM   2091 N N   . GLU A 1 265 ? 97.364  109.209 4.641   1.00 34.80 ? 265 GLU A N   1 
ATOM   2092 C CA  . GLU A 1 265 ? 96.352  110.260 4.754   1.00 41.68 ? 265 GLU A CA  1 
ATOM   2093 C C   . GLU A 1 265 ? 97.001  111.651 4.644   1.00 36.60 ? 265 GLU A C   1 
ATOM   2094 O O   . GLU A 1 265 ? 96.383  112.540 4.055   1.00 39.53 ? 265 GLU A O   1 
ATOM   2095 C CB  . GLU A 1 265 ? 95.499  110.173 6.016   1.00 47.38 ? 265 GLU A CB  1 
ATOM   2096 C CG  . GLU A 1 265 ? 96.247  110.503 7.292   1.00 61.56 ? 265 GLU A CG  1 
ATOM   2097 C CD  . GLU A 1 265 ? 95.346  110.448 8.527   1.00 67.90 ? 265 GLU A CD  1 
ATOM   2098 O OE1 . GLU A 1 265 ? 94.111  110.197 8.388   1.00 69.43 ? 265 GLU A OE1 1 
ATOM   2099 O OE2 . GLU A 1 265 ? 95.890  110.642 9.633   1.00 65.02 ? 265 GLU A OE2 1 
ATOM   2100 N N   . SER A 1 266 ? 98.263  111.748 5.077   1.00 36.00 ? 266 SER A N   1 
ATOM   2101 C CA  . SER A 1 266 ? 99.086  112.973 4.988   1.00 38.27 ? 266 SER A CA  1 
ATOM   2102 C C   . SER A 1 266 ? 99.356  113.424 3.545   1.00 35.93 ? 266 SER A C   1 
ATOM   2103 O O   . SER A 1 266 ? 99.813  114.542 3.312   1.00 34.51 ? 266 SER A O   1 
ATOM   2104 C CB  . SER A 1 266 ? 100.403 112.778 5.770   1.00 35.54 ? 266 SER A CB  1 
ATOM   2105 O OG  . SER A 1 266 ? 101.447 112.095 5.036   1.00 38.64 ? 266 SER A OG  1 
ATOM   2106 N N   . GLY A 1 267 ? 99.105  112.559 2.573   1.00 29.77 ? 267 GLY A N   1 
ATOM   2107 C CA  . GLY A 1 267 ? 99.490  112.788 1.176   1.00 29.54 ? 267 GLY A CA  1 
ATOM   2108 C C   . GLY A 1 267 ? 100.887 112.302 0.802   1.00 26.24 ? 267 GLY A C   1 
ATOM   2109 O O   . GLY A 1 267 ? 101.276 112.366 -0.365  1.00 25.42 ? 267 GLY A O   1 
ATOM   2110 N N   . LYS A 1 268 ? 101.632 111.794 1.767   1.00 22.95 ? 268 LYS A N   1 
ATOM   2111 C CA  . LYS A 1 268 ? 102.975 111.306 1.506   1.00 25.20 ? 268 LYS A CA  1 
ATOM   2112 C C   . LYS A 1 268 ? 103.014 109.812 1.162   1.00 22.90 ? 268 LYS A C   1 
ATOM   2113 O O   . LYS A 1 268 ? 102.070 109.073 1.455   1.00 22.83 ? 268 LYS A O   1 
ATOM   2114 C CB  . LYS A 1 268 ? 103.865 111.574 2.667   1.00 32.12 ? 268 LYS A CB  1 
ATOM   2115 C CG  . LYS A 1 268 ? 103.967 113.083 2.869   1.00 39.96 ? 268 LYS A CG  1 
ATOM   2116 C CD  . LYS A 1 268 ? 104.972 113.484 3.924   1.00 55.93 ? 268 LYS A CD  1 
ATOM   2117 C CE  . LYS A 1 268 ? 105.160 114.999 3.839   1.00 67.69 ? 268 LYS A CE  1 
ATOM   2118 N NZ  . LYS A 1 268 ? 105.722 115.528 5.102   1.00 81.09 ? 268 LYS A NZ  1 
ATOM   2119 N N   . GLU A 1 269 ? 104.111 109.384 0.530   1.00 18.98 ? 269 GLU A N   1 
ATOM   2120 C CA  . GLU A 1 269 ? 104.181 108.017 -0.005  1.00 21.45 ? 269 GLU A CA  1 
ATOM   2121 C C   . GLU A 1 269 ? 104.920 107.156 1.022   1.00 18.41 ? 269 GLU A C   1 
ATOM   2122 O O   . GLU A 1 269 ? 106.066 107.504 1.435   1.00 17.61 ? 269 GLU A O   1 
ATOM   2123 C CB  . GLU A 1 269 ? 104.890 108.024 -1.352  1.00 23.56 ? 269 GLU A CB  1 
ATOM   2124 C CG  . GLU A 1 269 ? 104.194 108.750 -2.514  1.00 27.49 ? 269 GLU A CG  1 
ATOM   2125 C CD  . GLU A 1 269 ? 102.843 108.163 -2.886  1.00 31.42 ? 269 GLU A CD  1 
ATOM   2126 O OE1 . GLU A 1 269 ? 102.558 106.940 -2.682  1.00 27.52 ? 269 GLU A OE1 1 
ATOM   2127 O OE2 . GLU A 1 269 ? 102.014 108.957 -3.393  1.00 34.49 ? 269 GLU A OE2 1 
ATOM   2128 N N   . GLU A 1 270 ? 104.285 106.081 1.458   1.00 16.81 ? 270 GLU A N   1 
ATOM   2129 C CA  . GLU A 1 270 ? 104.922 105.068 2.287   1.00 17.23 ? 270 GLU A CA  1 
ATOM   2130 C C   . GLU A 1 270 ? 105.860 104.251 1.418   1.00 16.97 ? 270 GLU A C   1 
ATOM   2131 O O   . GLU A 1 270 ? 105.476 103.812 0.341   1.00 18.14 ? 270 GLU A O   1 
ATOM   2132 C CB  . GLU A 1 270 ? 103.876 104.201 3.000   1.00 18.13 ? 270 GLU A CB  1 
ATOM   2133 C CG  . GLU A 1 270 ? 104.478 103.214 3.977   1.00 21.68 ? 270 GLU A CG  1 
ATOM   2134 C CD  . GLU A 1 270 ? 103.523 102.594 5.006   1.00 26.09 ? 270 GLU A CD  1 
ATOM   2135 O OE1 . GLU A 1 270 ? 102.641 103.321 5.523   1.00 27.06 ? 270 GLU A OE1 1 
ATOM   2136 O OE2 . GLU A 1 270 ? 103.673 101.368 5.331   1.00 25.92 ? 270 GLU A OE2 1 
ATOM   2137 N N   . TYR A 1 271 ? 107.076 104.037 1.909   1.00 15.99 ? 271 TYR A N   1 
ATOM   2138 C CA  . TYR A 1 271 ? 108.080 103.234 1.178   1.00 16.23 ? 271 TYR A CA  1 
ATOM   2139 C C   . TYR A 1 271 ? 109.075 102.555 2.096   1.00 15.06 ? 271 TYR A C   1 
ATOM   2140 O O   . TYR A 1 271 ? 109.138 102.851 3.292   1.00 14.71 ? 271 TYR A O   1 
ATOM   2141 C CB  . TYR A 1 271 ? 108.836 104.091 0.154   1.00 15.53 ? 271 TYR A CB  1 
ATOM   2142 C CG  . TYR A 1 271 ? 109.740 105.130 0.770   1.00 16.94 ? 271 TYR A CG  1 
ATOM   2143 C CD1 . TYR A 1 271 ? 109.224 106.310 1.302   1.00 17.13 ? 271 TYR A CD1 1 
ATOM   2144 C CD2 . TYR A 1 271 ? 111.111 104.920 0.858   1.00 18.02 ? 271 TYR A CD2 1 
ATOM   2145 C CE1 . TYR A 1 271 ? 110.072 107.254 1.884   1.00 18.39 ? 271 TYR A CE1 1 
ATOM   2146 C CE2 . TYR A 1 271 ? 111.952 105.875 1.396   1.00 18.16 ? 271 TYR A CE2 1 
ATOM   2147 C CZ  . TYR A 1 271 ? 111.420 107.043 1.902   1.00 19.46 ? 271 TYR A CZ  1 
ATOM   2148 O OH  . TYR A 1 271 ? 112.270 107.944 2.512   1.00 17.53 ? 271 TYR A OH  1 
ATOM   2149 N N   . THR A 1 272 ? 109.782 101.558 1.547   1.00 14.45 ? 272 THR A N   1 
ATOM   2150 C CA  . THR A 1 272 ? 110.718 100.756 2.350   1.00 13.26 ? 272 THR A CA  1 
ATOM   2151 C C   . THR A 1 272 ? 112.046 101.552 2.413   1.00 13.08 ? 272 THR A C   1 
ATOM   2152 O O   . THR A 1 272 ? 112.853 101.563 1.497   1.00 12.42 ? 272 THR A O   1 
ATOM   2153 C CB  . THR A 1 272 ? 110.953 99.363  1.754   1.00 12.98 ? 272 THR A CB  1 
ATOM   2154 O OG1 . THR A 1 272 ? 109.701 98.623  1.817   1.00 13.14 ? 272 THR A OG1 1 
ATOM   2155 C CG2 . THR A 1 272 ? 112.058 98.675  2.541   1.00 12.87 ? 272 THR A CG2 1 
ATOM   2156 N N   . VAL A 1 273 ? 112.185 102.293 3.505   1.00 13.69 ? 273 VAL A N   1 
ATOM   2157 C CA  . VAL A 1 273 ? 113.336 103.203 3.728   1.00 13.85 ? 273 VAL A CA  1 
ATOM   2158 C C   . VAL A 1 273 ? 114.619 102.432 3.752   1.00 13.93 ? 273 VAL A C   1 
ATOM   2159 O O   . VAL A 1 273 ? 115.615 102.833 3.149   1.00 15.64 ? 273 VAL A O   1 
ATOM   2160 C CB  . VAL A 1 273 ? 113.093 103.933 5.066   1.00 15.58 ? 273 VAL A CB  1 
ATOM   2161 C CG1 . VAL A 1 273 ? 114.289 104.710 5.491   1.00 15.02 ? 273 VAL A CG1 1 
ATOM   2162 C CG2 . VAL A 1 273 ? 111.865 104.835 4.928   1.00 17.63 ? 273 VAL A CG2 1 
ATOM   2163 N N   . TYR A 1 274 ? 114.617 101.292 4.461   1.00 12.09 ? 274 TYR A N   1 
ATOM   2164 C CA  . TYR A 1 274 ? 115.717 100.380 4.448   1.00 12.29 ? 274 TYR A CA  1 
ATOM   2165 C C   . TYR A 1 274 ? 115.256 98.959  4.722   1.00 12.32 ? 274 TYR A C   1 
ATOM   2166 O O   . TYR A 1 274 ? 114.129 98.743  5.185   1.00 14.13 ? 274 TYR A O   1 
ATOM   2167 C CB  . TYR A 1 274 ? 116.814 100.760 5.449   1.00 12.78 ? 274 TYR A CB  1 
ATOM   2168 C CG  . TYR A 1 274 ? 116.491 100.539 6.923   1.00 12.76 ? 274 TYR A CG  1 
ATOM   2169 C CD1 . TYR A 1 274 ? 116.586 99.334  7.507   1.00 13.09 ? 274 TYR A CD1 1 
ATOM   2170 C CD2 . TYR A 1 274 ? 116.183 101.584 7.721   1.00 15.17 ? 274 TYR A CD2 1 
ATOM   2171 C CE1 . TYR A 1 274 ? 116.313 99.173  8.869   1.00 13.92 ? 274 TYR A CE1 1 
ATOM   2172 C CE2 . TYR A 1 274 ? 115.963 101.431 9.064   1.00 14.63 ? 274 TYR A CE2 1 
ATOM   2173 C CZ  . TYR A 1 274 ? 116.007 100.218 9.625   1.00 14.14 ? 274 TYR A CZ  1 
ATOM   2174 O OH  . TYR A 1 274 ? 115.716 100.070 10.976  1.00 12.30 ? 274 TYR A OH  1 
ATOM   2175 N N   . SER A 1 275 ? 116.133 98.036  4.398   1.00 12.94 ? 275 SER A N   1 
ATOM   2176 C CA  . SER A 1 275 ? 115.992 96.582  4.613   1.00 13.37 ? 275 SER A CA  1 
ATOM   2177 C C   . SER A 1 275 ? 117.275 96.118  5.311   1.00 15.14 ? 275 SER A C   1 
ATOM   2178 O O   . SER A 1 275 ? 118.380 96.507  4.921   1.00 13.80 ? 275 SER A O   1 
ATOM   2179 C CB  . SER A 1 275 ? 115.831 95.840  3.302   1.00 14.18 ? 275 SER A CB  1 
ATOM   2180 O OG  . SER A 1 275 ? 114.702 96.328  2.582   1.00 14.21 ? 275 SER A OG  1 
ATOM   2181 N N   . ASN A 1 276 ? 117.168 95.181  6.238   1.00 14.53 ? 276 ASN A N   1 
ATOM   2182 C CA  . ASN A 1 276 ? 118.390 94.649  6.830   1.00 14.31 ? 276 ASN A CA  1 
ATOM   2183 C C   . ASN A 1 276 ? 118.282 93.188  7.189   1.00 14.75 ? 276 ASN A C   1 
ATOM   2184 O O   . ASN A 1 276 ? 117.192 92.595  7.219   1.00 13.09 ? 276 ASN A O   1 
ATOM   2185 C CB  . ASN A 1 276 ? 118.864 95.525  7.989   1.00 13.98 ? 276 ASN A CB  1 
ATOM   2186 C CG  . ASN A 1 276 ? 117.952 95.551  9.228   1.00 14.49 ? 276 ASN A CG  1 
ATOM   2187 O OD1 . ASN A 1 276 ? 117.050 94.767  9.424   1.00 15.66 ? 276 ASN A OD1 1 
ATOM   2188 N ND2 . ASN A 1 276 ? 118.259 96.511  10.134  1.00 12.70 ? 276 ASN A ND2 1 
ATOM   2189 N N   . CYS A 1 277 ? 119.436 92.604  7.435   1.00 12.10 ? 277 CYS A N   1 
ATOM   2190 C CA  . CYS A 1 277 ? 119.598 91.191  7.773   1.00 12.94 ? 277 CYS A CA  1 
ATOM   2191 C C   . CYS A 1 277 ? 120.727 91.174  8.795   1.00 13.12 ? 277 CYS A C   1 
ATOM   2192 O O   . CYS A 1 277 ? 121.878 91.565  8.418   1.00 13.33 ? 277 CYS A O   1 
ATOM   2193 C CB  . CYS A 1 277 ? 120.055 90.416  6.542   1.00 13.06 ? 277 CYS A CB  1 
ATOM   2194 S SG  . CYS A 1 277 ? 120.411 88.666  6.817   1.00 15.48 ? 277 CYS A SG  1 
ATOM   2195 N N   . TYR A 1 278 ? 120.440 90.739  10.004  1.00 13.04 ? 278 TYR A N   1 
ATOM   2196 C CA  . TYR A 1 278 ? 121.477 90.427  10.970  1.00 15.21 ? 278 TYR A CA  1 
ATOM   2197 C C   . TYR A 1 278 ? 121.819 88.936  10.952  1.00 15.76 ? 278 TYR A C   1 
ATOM   2198 O O   . TYR A 1 278 ? 120.937 88.110  11.005  1.00 17.87 ? 278 TYR A O   1 
ATOM   2199 C CB  . TYR A 1 278 ? 121.063 90.795  12.357  1.00 14.40 ? 278 TYR A CB  1 
ATOM   2200 C CG  . TYR A 1 278 ? 120.732 92.256  12.588  1.00 14.83 ? 278 TYR A CG  1 
ATOM   2201 C CD1 . TYR A 1 278 ? 119.419 92.731  12.418  1.00 13.34 ? 278 TYR A CD1 1 
ATOM   2202 C CD2 . TYR A 1 278 ? 121.666 93.117  13.151  1.00 14.84 ? 278 TYR A CD2 1 
ATOM   2203 C CE1 . TYR A 1 278 ? 119.117 94.060  12.644  1.00 14.04 ? 278 TYR A CE1 1 
ATOM   2204 C CE2 . TYR A 1 278 ? 121.359 94.451  13.434  1.00 14.82 ? 278 TYR A CE2 1 
ATOM   2205 C CZ  . TYR A 1 278 ? 120.078 94.929  13.226  1.00 15.08 ? 278 TYR A CZ  1 
ATOM   2206 O OH  . TYR A 1 278 ? 119.720 96.254  13.519  1.00 14.05 ? 278 TYR A OH  1 
ATOM   2207 N N   . ASP A 1 279 ? 123.114 88.617  10.831  1.00 16.44 ? 279 ASP A N   1 
ATOM   2208 C CA  . ASP A 1 279 ? 123.606 87.292  11.071  1.00 16.47 ? 279 ASP A CA  1 
ATOM   2209 C C   . ASP A 1 279 ? 123.831 87.242  12.569  1.00 17.10 ? 279 ASP A C   1 
ATOM   2210 O O   . ASP A 1 279 ? 124.800 87.872  13.088  1.00 15.00 ? 279 ASP A O   1 
ATOM   2211 C CB  . ASP A 1 279 ? 124.876 87.057  10.248  1.00 18.13 ? 279 ASP A CB  1 
ATOM   2212 C CG  . ASP A 1 279 ? 125.484 85.711  10.462  1.00 21.17 ? 279 ASP A CG  1 
ATOM   2213 O OD1 . ASP A 1 279 ? 125.236 85.071  11.519  1.00 20.55 ? 279 ASP A OD1 1 
ATOM   2214 O OD2 . ASP A 1 279 ? 126.277 85.298  9.580   1.00 17.58 ? 279 ASP A OD2 1 
ATOM   2215 N N   . LEU A 1 280 ? 122.959 86.536  13.260  1.00 16.31 ? 280 LEU A N   1 
ATOM   2216 C CA  . LEU A 1 280 ? 122.938 86.454  14.715  1.00 16.62 ? 280 LEU A CA  1 
ATOM   2217 C C   . LEU A 1 280 ? 124.139 85.705  15.245  1.00 18.66 ? 280 LEU A C   1 
ATOM   2218 O O   . LEU A 1 280 ? 124.668 86.080  16.290  1.00 23.66 ? 280 LEU A O   1 
ATOM   2219 C CB  . LEU A 1 280 ? 121.691 85.755  15.210  1.00 15.85 ? 280 LEU A CB  1 
ATOM   2220 C CG  . LEU A 1 280 ? 120.372 86.501  14.904  1.00 16.06 ? 280 LEU A CG  1 
ATOM   2221 C CD1 . LEU A 1 280 ? 119.210 85.637  15.346  1.00 15.32 ? 280 LEU A CD1 1 
ATOM   2222 C CD2 . LEU A 1 280 ? 120.275 87.930  15.487  1.00 17.54 ? 280 LEU A CD2 1 
ATOM   2223 N N   . ASP A 1 281 ? 124.595 84.679  14.541  1.00 18.65 ? 281 ASP A N   1 
ATOM   2224 C CA  . ASP A 1 281 ? 125.749 83.881  15.005  1.00 21.52 ? 281 ASP A CA  1 
ATOM   2225 C C   . ASP A 1 281 ? 127.082 84.612  14.896  1.00 22.75 ? 281 ASP A C   1 
ATOM   2226 O O   . ASP A 1 281 ? 127.914 84.495  15.778  1.00 22.85 ? 281 ASP A O   1 
ATOM   2227 C CB  . ASP A 1 281 ? 125.862 82.584  14.220  1.00 22.76 ? 281 ASP A CB  1 
ATOM   2228 C CG  . ASP A 1 281 ? 124.703 81.618  14.507  1.00 28.48 ? 281 ASP A CG  1 
ATOM   2229 O OD1 . ASP A 1 281 ? 123.740 81.988  15.179  1.00 32.21 ? 281 ASP A OD1 1 
ATOM   2230 O OD2 . ASP A 1 281 ? 124.775 80.496  14.015  1.00 29.50 ? 281 ASP A OD2 1 
ATOM   2231 N N   . ASN A 1 282 ? 127.311 85.381  13.854  1.00 20.73 ? 282 ASN A N   1 
ATOM   2232 C CA  . ASN A 1 282 ? 128.546 86.191  13.864  1.00 26.09 ? 282 ASN A CA  1 
ATOM   2233 C C   . ASN A 1 282 ? 128.334 87.713  14.109  1.00 25.55 ? 282 ASN A C   1 
ATOM   2234 O O   . ASN A 1 282 ? 129.242 88.516  13.939  1.00 26.55 ? 282 ASN A O   1 
ATOM   2235 C CB  . ASN A 1 282 ? 129.385 85.844  12.633  1.00 33.80 ? 282 ASN A CB  1 
ATOM   2236 C CG  . ASN A 1 282 ? 128.930 86.529  11.425  1.00 39.60 ? 282 ASN A CG  1 
ATOM   2237 O OD1 . ASN A 1 282 ? 127.954 87.277  11.464  1.00 51.29 ? 282 ASN A OD1 1 
ATOM   2238 N ND2 . ASN A 1 282 ? 129.674 86.351  10.321  1.00 43.94 ? 282 ASN A ND2 1 
ATOM   2239 N N   . LYS A 1 283 ? 127.153 88.088  14.566  1.00 18.53 ? 283 LYS A N   1 
ATOM   2240 C CA  . LYS A 1 283 ? 126.849 89.449  15.024  1.00 21.31 ? 283 LYS A CA  1 
ATOM   2241 C C   . LYS A 1 283 ? 127.216 90.472  13.956  1.00 18.52 ? 283 LYS A C   1 
ATOM   2242 O O   . LYS A 1 283 ? 127.950 91.441  14.236  1.00 19.04 ? 283 LYS A O   1 
ATOM   2243 C CB  . LYS A 1 283 ? 127.503 89.802  16.392  1.00 23.51 ? 283 LYS A CB  1 
ATOM   2244 C CG  . LYS A 1 283 ? 126.935 88.993  17.563  1.00 25.65 ? 283 LYS A CG  1 
ATOM   2245 C CD  . LYS A 1 283 ? 127.568 87.656  17.512  1.00 29.19 ? 283 LYS A CD  1 
ATOM   2246 C CE  . LYS A 1 283 ? 127.411 86.859  18.743  1.00 35.00 ? 283 LYS A CE  1 
ATOM   2247 N NZ  . LYS A 1 283 ? 126.966 85.532  18.309  1.00 39.94 ? 283 LYS A NZ  1 
ATOM   2248 N N   . THR A 1 284 ? 126.788 90.237  12.705  1.00 16.92 ? 284 THR A N   1 
ATOM   2249 C CA  . THR A 1 284 ? 127.033 91.180  11.655  1.00 16.01 ? 284 THR A CA  1 
ATOM   2250 C C   . THR A 1 284 ? 125.685 91.747  11.090  1.00 16.85 ? 284 THR A C   1 
ATOM   2251 O O   . THR A 1 284 ? 124.775 90.998  10.844  1.00 15.60 ? 284 THR A O   1 
ATOM   2252 C CB  . THR A 1 284 ? 127.789 90.450  10.543  1.00 20.43 ? 284 THR A CB  1 
ATOM   2253 O OG1 . THR A 1 284 ? 129.009 90.012  11.119  1.00 20.53 ? 284 THR A OG1 1 
ATOM   2254 C CG2 . THR A 1 284 ? 128.087 91.347  9.379   1.00 21.21 ? 284 THR A CG2 1 
ATOM   2255 N N   . LEU A 1 285 ? 125.646 93.050  10.892  1.00 15.44 ? 285 LEU A N   1 
ATOM   2256 C CA  . LEU A 1 285 ? 124.520 93.739  10.299  1.00 16.37 ? 285 LEU A CA  1 
ATOM   2257 C C   . LEU A 1 285 ? 124.778 93.922  8.827   1.00 15.46 ? 285 LEU A C   1 
ATOM   2258 O O   . LEU A 1 285 ? 125.854 94.429  8.427   1.00 16.68 ? 285 LEU A O   1 
ATOM   2259 C CB  . LEU A 1 285 ? 124.348 95.097  10.971  1.00 16.51 ? 285 LEU A CB  1 
ATOM   2260 C CG  . LEU A 1 285 ? 123.495 96.180  10.297  1.00 16.65 ? 285 LEU A CG  1 
ATOM   2261 C CD1 . LEU A 1 285 ? 122.097 95.665  10.087  1.00 16.64 ? 285 LEU A CD1 1 
ATOM   2262 C CD2 . LEU A 1 285 ? 123.448 97.455  11.132  1.00 17.37 ? 285 LEU A CD2 1 
ATOM   2263 N N   . TYR A 1 286 ? 123.852 93.497  7.980   1.00 14.41 ? 286 TYR A N   1 
ATOM   2264 C CA  . TYR A 1 286 ? 123.865 93.835  6.554   1.00 12.84 ? 286 TYR A CA  1 
ATOM   2265 C C   . TYR A 1 286 ? 122.700 94.665  6.206   1.00 12.68 ? 286 TYR A C   1 
ATOM   2266 O O   . TYR A 1 286 ? 121.541 94.369  6.680   1.00 12.86 ? 286 TYR A O   1 
ATOM   2267 C CB  . TYR A 1 286 ? 123.758 92.554  5.720   1.00 14.55 ? 286 TYR A CB  1 
ATOM   2268 C CG  . TYR A 1 286 ? 124.843 91.601  5.967   1.00 14.89 ? 286 TYR A CG  1 
ATOM   2269 C CD1 . TYR A 1 286 ? 124.754 90.644  6.964   1.00 15.00 ? 286 TYR A CD1 1 
ATOM   2270 C CD2 . TYR A 1 286 ? 125.959 91.584  5.163   1.00 19.84 ? 286 TYR A CD2 1 
ATOM   2271 C CE1 . TYR A 1 286 ? 125.780 89.786  7.202   1.00 17.12 ? 286 TYR A CE1 1 
ATOM   2272 C CE2 . TYR A 1 286 ? 126.984 90.652  5.358   1.00 20.72 ? 286 TYR A CE2 1 
ATOM   2273 C CZ  . TYR A 1 286 ? 126.899 89.792  6.380   1.00 20.64 ? 286 TYR A CZ  1 
ATOM   2274 O OH  . TYR A 1 286 ? 127.943 88.913  6.628   1.00 22.25 ? 286 TYR A OH  1 
ATOM   2275 N N   . TYR A 1 287 ? 122.843 95.718  5.406   1.00 12.84 ? 287 TYR A N   1 
ATOM   2276 C CA  . TYR A 1 287 ? 121.636 96.518  5.034   1.00 14.68 ? 287 TYR A CA  1 
ATOM   2277 C C   . TYR A 1 287 ? 121.651 97.125  3.639   1.00 14.57 ? 287 TYR A C   1 
ATOM   2278 O O   . TYR A 1 287 ? 122.736 97.222  3.023   1.00 15.15 ? 287 TYR A O   1 
ATOM   2279 C CB  . TYR A 1 287 ? 121.373 97.623  6.034   1.00 15.97 ? 287 TYR A CB  1 
ATOM   2280 C CG  . TYR A 1 287 ? 122.412 98.738  6.012   1.00 16.37 ? 287 TYR A CG  1 
ATOM   2281 C CD1 . TYR A 1 287 ? 123.569 98.644  6.836   1.00 16.41 ? 287 TYR A CD1 1 
ATOM   2282 C CD2 . TYR A 1 287 ? 122.232 99.904  5.234   1.00 14.98 ? 287 TYR A CD2 1 
ATOM   2283 C CE1 . TYR A 1 287 ? 124.507 99.653  6.829   1.00 15.60 ? 287 TYR A CE1 1 
ATOM   2284 C CE2 . TYR A 1 287 ? 123.191 100.926 5.236   1.00 16.04 ? 287 TYR A CE2 1 
ATOM   2285 C CZ  . TYR A 1 287 ? 124.300 100.798 6.032   1.00 16.31 ? 287 TYR A CZ  1 
ATOM   2286 O OH  . TYR A 1 287 ? 125.306 101.758 6.010   1.00 20.47 ? 287 TYR A OH  1 
ATOM   2287 N N   . THR A 1 288 ? 120.464 97.477  3.151   1.00 14.31 ? 288 THR A N   1 
ATOM   2288 C CA  . THR A 1 288 ? 120.295 98.225  1.939   1.00 15.78 ? 288 THR A CA  1 
ATOM   2289 C C   . THR A 1 288 ? 119.351 99.359  2.237   1.00 16.94 ? 288 THR A C   1 
ATOM   2290 O O   . THR A 1 288 ? 118.647 99.350  3.268   1.00 16.42 ? 288 THR A O   1 
ATOM   2291 C CB  . THR A 1 288 ? 119.671 97.367  0.795   1.00 18.15 ? 288 THR A CB  1 
ATOM   2292 O OG1 . THR A 1 288 ? 118.348 96.942  1.196   1.00 16.86 ? 288 THR A OG1 1 
ATOM   2293 C CG2 . THR A 1 288 ? 120.499 96.199  0.525   1.00 19.08 ? 288 THR A CG2 1 
ATOM   2294 N N   . THR A 1 289 ? 119.338 100.375 1.372   1.00 16.16 ? 289 THR A N   1 
ATOM   2295 C CA  . THR A 1 289 ? 118.428 101.500 1.556   1.00 15.94 ? 289 THR A CA  1 
ATOM   2296 C C   . THR A 1 289 ? 117.622 101.687 0.275   1.00 16.66 ? 289 THR A C   1 
ATOM   2297 O O   . THR A 1 289 ? 117.963 101.143 -0.792  1.00 16.06 ? 289 THR A O   1 
ATOM   2298 C CB  . THR A 1 289 ? 119.160 102.827 1.824   1.00 18.06 ? 289 THR A CB  1 
ATOM   2299 O OG1 . THR A 1 289 ? 119.982 103.150 0.698   1.00 16.12 ? 289 THR A OG1 1 
ATOM   2300 C CG2 . THR A 1 289 ? 120.030 102.693 3.029   1.00 15.95 ? 289 THR A CG2 1 
ATOM   2301 N N   . TYR A 1 290 ? 116.519 102.413 0.361   1.00 15.43 ? 290 TYR A N   1 
ATOM   2302 C CA  . TYR A 1 290 ? 115.753 102.624 -0.840  1.00 14.93 ? 290 TYR A CA  1 
ATOM   2303 C C   . TYR A 1 290 ? 116.619 103.183 -1.974  1.00 15.54 ? 290 TYR A C   1 
ATOM   2304 O O   . TYR A 1 290 ? 116.386 102.852 -3.168  1.00 14.55 ? 290 TYR A O   1 
ATOM   2305 C CB  . TYR A 1 290 ? 114.558 103.573 -0.577  1.00 14.93 ? 290 TYR A CB  1 
ATOM   2306 C CG  . TYR A 1 290 ? 113.536 103.531 -1.701  1.00 13.05 ? 290 TYR A CG  1 
ATOM   2307 C CD1 . TYR A 1 290 ? 112.464 102.669 -1.627  1.00 13.37 ? 290 TYR A CD1 1 
ATOM   2308 C CD2 . TYR A 1 290 ? 113.548 104.472 -2.779  1.00 13.93 ? 290 TYR A CD2 1 
ATOM   2309 C CE1 . TYR A 1 290 ? 111.556 102.558 -2.661  1.00 13.42 ? 290 TYR A CE1 1 
ATOM   2310 C CE2 . TYR A 1 290 ? 112.597 104.411 -3.822  1.00 15.08 ? 290 TYR A CE2 1 
ATOM   2311 C CZ  . TYR A 1 290 ? 111.582 103.456 -3.734  1.00 13.45 ? 290 TYR A CZ  1 
ATOM   2312 O OH  . TYR A 1 290 ? 110.620 103.402 -4.713  1.00 15.49 ? 290 TYR A OH  1 
ATOM   2313 N N   . GLU A 1 291 ? 117.606 103.995 -1.616  1.00 14.69 ? 291 GLU A N   1 
ATOM   2314 C CA  . GLU A 1 291 ? 118.367 104.752 -2.608  1.00 16.00 ? 291 GLU A CA  1 
ATOM   2315 C C   . GLU A 1 291 ? 119.602 104.022 -3.061  1.00 14.87 ? 291 GLU A C   1 
ATOM   2316 O O   . GLU A 1 291 ? 120.257 104.437 -4.037  1.00 17.09 ? 291 GLU A O   1 
ATOM   2317 C CB  . GLU A 1 291 ? 118.809 106.095 -2.018  1.00 17.42 ? 291 GLU A CB  1 
ATOM   2318 C CG  . GLU A 1 291 ? 117.717 107.048 -1.623  1.00 19.51 ? 291 GLU A CG  1 
ATOM   2319 C CD  . GLU A 1 291 ? 117.035 106.661 -0.289  1.00 21.73 ? 291 GLU A CD  1 
ATOM   2320 O OE1 . GLU A 1 291 ? 117.562 105.847 0.532   1.00 22.45 ? 291 GLU A OE1 1 
ATOM   2321 O OE2 . GLU A 1 291 ? 115.951 107.232 -0.042  1.00 23.54 ? 291 GLU A OE2 1 
ATOM   2322 N N   . ASN A 1 292 ? 120.013 103.012 -2.319  1.00 14.73 ? 292 ASN A N   1 
ATOM   2323 C CA  . ASN A 1 292 ? 121.281 102.280 -2.612  1.00 16.21 ? 292 ASN A CA  1 
ATOM   2324 C C   . ASN A 1 292 ? 121.125 100.774 -2.515  1.00 15.62 ? 292 ASN A C   1 
ATOM   2325 O O   . ASN A 1 292 ? 120.839 100.218 -1.428  1.00 13.84 ? 292 ASN A O   1 
ATOM   2326 C CB  . ASN A 1 292 ? 122.435 102.740 -1.707  1.00 16.96 ? 292 ASN A CB  1 
ATOM   2327 C CG  . ASN A 1 292 ? 123.759 102.088 -2.071  1.00 17.00 ? 292 ASN A CG  1 
ATOM   2328 O OD1 . ASN A 1 292 ? 123.981 101.620 -3.206  1.00 18.45 ? 292 ASN A OD1 1 
ATOM   2329 N ND2 . ASN A 1 292 ? 124.632 101.999 -1.098  1.00 18.59 ? 292 ASN A ND2 1 
ATOM   2330 N N   . ARG A 1 293 ? 121.160 100.137 -3.661  1.00 16.32 ? 293 ARG A N   1 
ATOM   2331 C CA  . ARG A 1 293 ? 120.996 98.686  -3.739  1.00 17.27 ? 293 ARG A CA  1 
ATOM   2332 C C   . ARG A 1 293 ? 122.103 97.859  -3.141  1.00 15.62 ? 293 ARG A C   1 
ATOM   2333 O O   . ARG A 1 293 ? 121.871 96.660  -2.771  1.00 15.48 ? 293 ARG A O   1 
ATOM   2334 C CB  . ARG A 1 293 ? 120.843 98.190  -5.190  1.00 19.06 ? 293 ARG A CB  1 
ATOM   2335 C CG  . ARG A 1 293 ? 119.434 98.301  -5.729  1.00 24.10 ? 293 ARG A CG  1 
ATOM   2336 C CD  . ARG A 1 293 ? 119.213 97.758  -7.109  1.00 26.40 ? 293 ARG A CD  1 
ATOM   2337 N NE  . ARG A 1 293 ? 119.404 96.374  -7.075  1.00 31.51 ? 293 ARG A NE  1 
ATOM   2338 C CZ  . ARG A 1 293 ? 118.510 95.429  -6.956  1.00 29.58 ? 293 ARG A CZ  1 
ATOM   2339 N NH1 . ARG A 1 293 ? 117.248 95.679  -6.824  1.00 33.81 ? 293 ARG A NH1 1 
ATOM   2340 N NH2 . ARG A 1 293 ? 118.961 94.208  -6.930  1.00 30.03 ? 293 ARG A NH2 1 
ATOM   2341 N N   . GLN A 1 294 ? 123.320 98.378  -3.121  1.00 16.21 ? 294 GLN A N   1 
ATOM   2342 C CA  . GLN A 1 294 ? 124.420 97.568  -2.688  1.00 16.98 ? 294 GLN A CA  1 
ATOM   2343 C C   . GLN A 1 294 ? 124.339 97.303  -1.171  1.00 17.63 ? 294 GLN A C   1 
ATOM   2344 O O   . GLN A 1 294 ? 124.179 98.231  -0.423  1.00 18.03 ? 294 GLN A O   1 
ATOM   2345 C CB  . GLN A 1 294 ? 125.759 98.265  -2.980  1.00 18.02 ? 294 GLN A CB  1 
ATOM   2346 C CG  . GLN A 1 294 ? 126.903 97.394  -2.561  1.00 17.75 ? 294 GLN A CG  1 
ATOM   2347 C CD  . GLN A 1 294 ? 128.283 97.994  -2.843  1.00 20.14 ? 294 GLN A CD  1 
ATOM   2348 O OE1 . GLN A 1 294 ? 128.505 99.182  -2.623  1.00 17.39 ? 294 GLN A OE1 1 
ATOM   2349 N NE2 . GLN A 1 294 ? 129.269 97.098  -3.201  1.00 21.19 ? 294 GLN A NE2 1 
ATOM   2350 N N   . ILE A 1 295 ? 124.537 96.068  -0.769  1.00 15.85 ? 295 ILE A N   1 
ATOM   2351 C CA  . ILE A 1 295 ? 124.521 95.687  0.603   1.00 15.25 ? 295 ILE A CA  1 
ATOM   2352 C C   . ILE A 1 295 ? 125.766 96.215  1.300   1.00 17.75 ? 295 ILE A C   1 
ATOM   2353 O O   . ILE A 1 295 ? 126.886 96.128  0.731   1.00 17.01 ? 295 ILE A O   1 
ATOM   2354 C CB  . ILE A 1 295 ? 124.486 94.212  0.755   1.00 16.71 ? 295 ILE A CB  1 
ATOM   2355 C CG1 . ILE A 1 295 ? 123.186 93.655  0.159   1.00 16.86 ? 295 ILE A CG1 1 
ATOM   2356 C CG2 . ILE A 1 295 ? 124.601 93.783  2.222   1.00 18.15 ? 295 ILE A CG2 1 
ATOM   2357 C CD1 . ILE A 1 295 ? 123.177 92.176  -0.001  1.00 16.93 ? 295 ILE A CD1 1 
ATOM   2358 N N   . VAL A 1 296 ? 125.540 96.809  2.473   1.00 18.01 ? 296 VAL A N   1 
ATOM   2359 C CA  . VAL A 1 296 ? 126.577 97.268  3.402   1.00 17.53 ? 296 VAL A CA  1 
ATOM   2360 C C   . VAL A 1 296 ? 126.629 96.370  4.632   1.00 19.15 ? 296 VAL A C   1 
ATOM   2361 O O   . VAL A 1 296 ? 125.568 96.041  5.177   1.00 15.83 ? 296 VAL A O   1 
ATOM   2362 C CB  . VAL A 1 296 ? 126.303 98.736  3.760   1.00 17.95 ? 296 VAL A CB  1 
ATOM   2363 C CG1 . VAL A 1 296 ? 127.335 99.245  4.774   1.00 21.56 ? 296 VAL A CG1 1 
ATOM   2364 C CG2 . VAL A 1 296 ? 126.322 99.587  2.504   1.00 19.72 ? 296 VAL A CG2 1 
ATOM   2365 N N   . ALA A 1 297 ? 127.842 96.005  5.113   1.00 16.47 ? 297 ALA A N   1 
ATOM   2366 C CA  . ALA A 1 297 ? 128.025 95.115  6.236   1.00 18.48 ? 297 ALA A CA  1 
ATOM   2367 C C   . ALA A 1 297 ? 128.858 95.801  7.347   1.00 19.78 ? 297 ALA A C   1 
ATOM   2368 O O   . ALA A 1 297 ? 129.825 96.572  7.037   1.00 20.48 ? 297 ALA A O   1 
ATOM   2369 C CB  . ALA A 1 297 ? 128.772 93.878  5.812   1.00 19.19 ? 297 ALA A CB  1 
ATOM   2370 N N   . VAL A 1 298 ? 128.484 95.556  8.576   1.00 17.92 ? 298 VAL A N   1 
ATOM   2371 C CA  . VAL A 1 298 ? 129.226 96.077  9.736   1.00 20.31 ? 298 VAL A CA  1 
ATOM   2372 C C   . VAL A 1 298 ? 129.093 95.065  10.857  1.00 20.65 ? 298 VAL A C   1 
ATOM   2373 O O   . VAL A 1 298 ? 127.987 94.583  11.150  1.00 19.01 ? 298 VAL A O   1 
ATOM   2374 C CB  . VAL A 1 298 ? 128.770 97.524  10.117  1.00 24.46 ? 298 VAL A CB  1 
ATOM   2375 C CG1 . VAL A 1 298 ? 127.311 97.584  10.279  1.00 30.82 ? 298 VAL A CG1 1 
ATOM   2376 C CG2 . VAL A 1 298 ? 129.471 98.081  11.410  1.00 23.76 ? 298 VAL A CG2 1 
ATOM   2377 N N   . THR A 1 299 ? 130.216 94.684  11.481  1.00 18.14 ? 299 THR A N   1 
ATOM   2378 C CA  . THR A 1 299 ? 130.196 93.692  12.513  1.00 21.38 ? 299 THR A CA  1 
ATOM   2379 C C   . THR A 1 299 ? 130.358 94.367  13.887  1.00 21.52 ? 299 THR A C   1 
ATOM   2380 O O   . THR A 1 299 ? 130.897 95.489  14.001  1.00 24.62 ? 299 THR A O   1 
ATOM   2381 C CB  . THR A 1 299 ? 131.331 92.671  12.298  1.00 25.68 ? 299 THR A CB  1 
ATOM   2382 O OG1 . THR A 1 299 ? 131.135 92.018  11.070  1.00 25.57 ? 299 THR A OG1 1 
ATOM   2383 C CG2 . THR A 1 299 ? 131.376 91.599  13.405  1.00 27.89 ? 299 THR A CG2 1 
ATOM   2384 N N   . LEU A 1 300 ? 129.784 93.749  14.915  1.00 21.53 ? 300 LEU A N   1 
ATOM   2385 C CA  . LEU A 1 300 ? 129.872 94.322  16.257  1.00 21.94 ? 300 LEU A CA  1 
ATOM   2386 C C   . LEU A 1 300 ? 131.280 93.960  16.853  1.00 21.82 ? 300 LEU A C   1 
ATOM   2387 O O   . LEU A 1 300 ? 131.433 92.751  16.888  1.00 33.09 ? 300 LEU A O   1 
ATOM   2388 C CB  . LEU A 1 300 ? 128.696 93.768  17.090  1.00 20.34 ? 300 LEU A CB  1 
ATOM   2389 C CG  . LEU A 1 300 ? 128.684 94.004  18.600  1.00 20.75 ? 300 LEU A CG  1 
ATOM   2390 C CD1 . LEU A 1 300 ? 128.645 95.497  18.881  1.00 21.29 ? 300 LEU A CD1 1 
ATOM   2391 C CD2 . LEU A 1 300 ? 127.490 93.332  19.262  1.00 22.96 ? 300 LEU A CD2 1 
ATOM   2392 N N   . GLY A 1 306 ? 134.492 100.509 26.202  1.00 35.50 ? 306 GLY A N   1 
ATOM   2393 C CA  . GLY A 1 306 ? 134.099 101.762 25.569  1.00 33.95 ? 306 GLY A CA  1 
ATOM   2394 C C   . GLY A 1 306 ? 132.821 102.284 26.177  1.00 28.03 ? 306 GLY A C   1 
ATOM   2395 O O   . GLY A 1 306 ? 131.947 101.523 26.635  1.00 29.78 ? 306 GLY A O   1 
ATOM   2396 N N   . ASN A 1 307 ? 132.687 103.595 26.227  1.00 27.64 ? 307 ASN A N   1 
ATOM   2397 C CA  . ASN A 1 307 ? 131.459 104.201 26.708  1.00 30.00 ? 307 ASN A CA  1 
ATOM   2398 C C   . ASN A 1 307 ? 130.797 105.193 25.744  1.00 24.61 ? 307 ASN A C   1 
ATOM   2399 O O   . ASN A 1 307 ? 129.807 105.828 26.086  1.00 27.60 ? 307 ASN A O   1 
ATOM   2400 C CB  . ASN A 1 307 ? 131.694 104.827 28.067  1.00 33.62 ? 307 ASN A CB  1 
ATOM   2401 C CG  . ASN A 1 307 ? 132.589 106.009 27.982  1.00 40.90 ? 307 ASN A CG  1 
ATOM   2402 O OD1 . ASN A 1 307 ? 133.224 106.226 26.976  1.00 40.06 ? 307 ASN A OD1 1 
ATOM   2403 N ND2 . ASN A 1 307 ? 132.694 106.743 29.056  1.00 48.24 ? 307 ASN A ND2 1 
ATOM   2404 N N   . ARG A 1 308 ? 131.349 105.344 24.549  1.00 21.79 ? 308 ARG A N   1 
ATOM   2405 C CA  . ARG A 1 308 ? 130.769 106.277 23.566  1.00 24.68 ? 308 ARG A CA  1 
ATOM   2406 C C   . ARG A 1 308 ? 129.992 105.543 22.463  1.00 19.97 ? 308 ARG A C   1 
ATOM   2407 O O   . ARG A 1 308 ? 130.417 104.539 22.018  1.00 19.77 ? 308 ARG A O   1 
ATOM   2408 C CB  . ARG A 1 308 ? 131.885 107.054 22.896  1.00 28.44 ? 308 ARG A CB  1 
ATOM   2409 C CG  . ARG A 1 308 ? 132.609 108.057 23.785  1.00 38.15 ? 308 ARG A CG  1 
ATOM   2410 C CD  . ARG A 1 308 ? 133.517 108.883 22.889  1.00 43.17 ? 308 ARG A CD  1 
ATOM   2411 N NE  . ARG A 1 308 ? 134.412 109.690 23.709  1.00 61.20 ? 308 ARG A NE  1 
ATOM   2412 C CZ  . ARG A 1 308 ? 134.354 111.007 23.857  1.00 64.49 ? 308 ARG A CZ  1 
ATOM   2413 N NH1 . ARG A 1 308 ? 133.460 111.738 23.211  1.00 68.86 ? 308 ARG A NH1 1 
ATOM   2414 N NH2 . ARG A 1 308 ? 135.224 111.608 24.655  1.00 70.95 ? 308 ARG A NH2 1 
ATOM   2415 N N   . LEU A 1 309 ? 128.857 106.088 22.040  1.00 19.95 ? 309 LEU A N   1 
ATOM   2416 C CA  . LEU A 1 309 ? 128.156 105.515 20.869  1.00 20.30 ? 309 LEU A CA  1 
ATOM   2417 C C   . LEU A 1 309 ? 129.024 105.668 19.670  1.00 20.89 ? 309 LEU A C   1 
ATOM   2418 O O   . LEU A 1 309 ? 129.801 106.663 19.547  1.00 18.05 ? 309 LEU A O   1 
ATOM   2419 C CB  . LEU A 1 309 ? 126.845 106.226 20.634  1.00 19.04 ? 309 LEU A CB  1 
ATOM   2420 C CG  . LEU A 1 309 ? 125.893 106.227 21.811  1.00 18.03 ? 309 LEU A CG  1 
ATOM   2421 C CD1 . LEU A 1 309 ? 124.651 107.027 21.426  1.00 19.77 ? 309 LEU A CD1 1 
ATOM   2422 C CD2 . LEU A 1 309 ? 125.493 104.829 22.209  1.00 17.56 ? 309 LEU A CD2 1 
ATOM   2423 N N   . VAL A 1 310 ? 129.029 104.671 18.799  1.00 18.66 ? 310 VAL A N   1 
ATOM   2424 C CA  . VAL A 1 310 ? 129.770 104.762 17.530  1.00 21.62 ? 310 VAL A CA  1 
ATOM   2425 C C   . VAL A 1 310 ? 128.715 104.689 16.387  1.00 23.97 ? 310 VAL A C   1 
ATOM   2426 O O   . VAL A 1 310 ? 127.844 103.792 16.461  1.00 19.16 ? 310 VAL A O   1 
ATOM   2427 C CB  . VAL A 1 310 ? 130.739 103.604 17.379  1.00 23.08 ? 310 VAL A CB  1 
ATOM   2428 C CG1 . VAL A 1 310 ? 131.403 103.649 15.984  1.00 23.57 ? 310 VAL A CG1 1 
ATOM   2429 C CG2 . VAL A 1 310 ? 131.742 103.624 18.534  1.00 26.98 ? 310 VAL A CG2 1 
ATOM   2430 N N   . THR A 1 311 ? 128.781 105.602 15.410  1.00 19.40 ? 311 THR A N   1 
ATOM   2431 C CA  . THR A 1 311 ? 127.741 105.694 14.393  1.00 19.46 ? 311 THR A CA  1 
ATOM   2432 C C   . THR A 1 311 ? 128.286 105.722 12.998  1.00 22.87 ? 311 THR A C   1 
ATOM   2433 O O   . THR A 1 311 ? 129.420 106.092 12.789  1.00 19.96 ? 311 THR A O   1 
ATOM   2434 C CB  . THR A 1 311 ? 126.845 106.878 14.558  1.00 21.53 ? 311 THR A CB  1 
ATOM   2435 O OG1 . THR A 1 311 ? 127.623 108.064 14.440  1.00 20.48 ? 311 THR A OG1 1 
ATOM   2436 C CG2 . THR A 1 311 ? 126.231 106.911 15.899  1.00 20.18 ? 311 THR A CG2 1 
ATOM   2437 N N   A TYR A 1 312 ? 127.483 105.275 12.041  0.45 22.06 ? 312 TYR A N   1 
ATOM   2438 N N   B TYR A 1 312 ? 127.476 105.285 12.045  0.55 21.93 ? 312 TYR A N   1 
ATOM   2439 C CA  A TYR A 1 312 ? 127.865 105.226 10.625  0.45 23.52 ? 312 TYR A CA  1 
ATOM   2440 C CA  B TYR A 1 312 ? 127.822 105.356 10.622  0.55 23.97 ? 312 TYR A CA  1 
ATOM   2441 C C   A TYR A 1 312 ? 126.598 105.563 9.797   0.45 26.31 ? 312 TYR A C   1 
ATOM   2442 C C   B TYR A 1 312 ? 126.572 105.614 9.817   0.55 26.55 ? 312 TYR A C   1 
ATOM   2443 O O   A TYR A 1 312 ? 125.669 104.762 9.762   0.45 26.19 ? 312 TYR A O   1 
ATOM   2444 O O   B TYR A 1 312 ? 125.666 104.773 9.769   0.55 26.39 ? 312 TYR A O   1 
ATOM   2445 C CB  A TYR A 1 312 ? 128.393 103.797 10.253  0.45 24.16 ? 312 TYR A CB  1 
ATOM   2446 C CB  B TYR A 1 312 ? 128.517 104.156 10.076  0.55 24.97 ? 312 TYR A CB  1 
ATOM   2447 C CG  A TYR A 1 312 ? 129.608 103.155 11.031  0.45 27.15 ? 312 TYR A CG  1 
ATOM   2448 C CG  B TYR A 1 312 ? 128.870 104.339 8.585   0.55 29.00 ? 312 TYR A CG  1 
ATOM   2449 C CD1 A TYR A 1 312 ? 129.430 102.297 12.118  0.45 25.86 ? 312 TYR A CD1 1 
ATOM   2450 C CD1 B TYR A 1 312 ? 127.939 103.994 7.586   0.55 28.94 ? 312 TYR A CD1 1 
ATOM   2451 C CD2 A TYR A 1 312 ? 130.912 103.340 10.586  0.45 28.51 ? 312 TYR A CD2 1 
ATOM   2452 C CD2 B TYR A 1 312 ? 130.147 104.827 8.180   0.55 26.40 ? 312 TYR A CD2 1 
ATOM   2453 C CE1 A TYR A 1 312 ? 130.509 101.699 12.744  0.45 25.18 ? 312 TYR A CE1 1 
ATOM   2454 C CE1 B TYR A 1 312 ? 128.254 104.109 6.268   0.55 28.26 ? 312 TYR A CE1 1 
ATOM   2455 C CE2 A TYR A 1 312 ? 131.974 102.739 11.215  0.45 29.07 ? 312 TYR A CE2 1 
ATOM   2456 C CE2 B TYR A 1 312 ? 130.455 104.958 6.848   0.55 28.86 ? 312 TYR A CE2 1 
ATOM   2457 C CZ  A TYR A 1 312 ? 131.759 101.938 12.287  0.45 27.56 ? 312 TYR A CZ  1 
ATOM   2458 C CZ  B TYR A 1 312 ? 129.490 104.583 5.898   0.55 29.23 ? 312 TYR A CZ  1 
ATOM   2459 O OH  A TYR A 1 312 ? 132.871 101.448 12.860  0.45 28.86 ? 312 TYR A OH  1 
ATOM   2460 O OH  B TYR A 1 312 ? 129.700 104.627 4.536   0.55 29.46 ? 312 TYR A OH  1 
ATOM   2461 N N   . PRO A 1 313 ? 126.507 106.778 9.206   1.00 28.29 ? 313 PRO A N   1 
ATOM   2462 C CA  . PRO A 1 313 ? 125.335 107.218 8.530   1.00 28.36 ? 313 PRO A CA  1 
ATOM   2463 C C   . PRO A 1 313 ? 125.113 106.451 7.246   1.00 25.34 ? 313 PRO A C   1 
ATOM   2464 O O   . PRO A 1 313 ? 126.038 106.026 6.623   1.00 24.08 ? 313 PRO A O   1 
ATOM   2465 C CB  . PRO A 1 313 ? 125.638 108.718 8.232   1.00 33.28 ? 313 PRO A CB  1 
ATOM   2466 C CG  . PRO A 1 313 ? 126.415 109.123 9.428   1.00 37.75 ? 313 PRO A CG  1 
ATOM   2467 C CD  . PRO A 1 313 ? 127.382 107.949 9.518   1.00 36.40 ? 313 PRO A CD  1 
ATOM   2468 N N   . PHE A 1 314 ? 123.850 106.162 6.973   1.00 21.80 ? 314 PHE A N   1 
ATOM   2469 C CA  . PHE A 1 314 ? 123.512 105.435 5.759   1.00 24.00 ? 314 PHE A CA  1 
ATOM   2470 C C   . PHE A 1 314 ? 123.769 106.305 4.521   1.00 27.69 ? 314 PHE A C   1 
ATOM   2471 O O   . PHE A 1 314 ? 123.349 107.436 4.507   1.00 31.66 ? 314 PHE A O   1 
ATOM   2472 C CB  . PHE A 1 314 ? 122.030 105.126 5.798   1.00 21.91 ? 314 PHE A CB  1 
ATOM   2473 C CG  . PHE A 1 314 ? 121.665 103.923 6.607   1.00 19.82 ? 314 PHE A CG  1 
ATOM   2474 C CD1 . PHE A 1 314 ? 122.540 103.326 7.511   1.00 18.74 ? 314 PHE A CD1 1 
ATOM   2475 C CD2 . PHE A 1 314 ? 120.361 103.423 6.520   1.00 20.61 ? 314 PHE A CD2 1 
ATOM   2476 C CE1 . PHE A 1 314 ? 122.154 102.181 8.240   1.00 18.83 ? 314 PHE A CE1 1 
ATOM   2477 C CE2 . PHE A 1 314 ? 119.994 102.289 7.216   1.00 19.05 ? 314 PHE A CE2 1 
ATOM   2478 C CZ  . PHE A 1 314 ? 120.881 101.676 8.084   1.00 22.50 ? 314 PHE A CZ  1 
ATOM   2479 N N   . GLU A 1 315 ? 124.398 105.712 3.517   1.00 30.29 ? 315 GLU A N   1 
ATOM   2480 C CA  . GLU A 1 315 ? 124.535 106.284 2.175   1.00 34.20 ? 315 GLU A CA  1 
ATOM   2481 C C   . GLU A 1 315 ? 123.147 106.171 1.454   1.00 35.00 ? 315 GLU A C   1 
ATOM   2482 O O   . GLU A 1 315 ? 122.363 105.088 1.529   1.00 28.40 ? 315 GLU A O   1 
ATOM   2483 C CB  . GLU A 1 315 ? 125.649 105.500 1.464   1.00 37.41 ? 315 GLU A CB  1 
ATOM   2484 C CG  . GLU A 1 315 ? 125.907 105.913 0.009   1.00 42.37 ? 315 GLU A CG  1 
ATOM   2485 C CD  . GLU A 1 315 ? 126.993 106.976 -0.077  1.00 42.03 ? 315 GLU A CD  1 
ATOM   2486 O OE1 . GLU A 1 315 ? 127.682 107.234 0.914   1.00 50.72 ? 315 GLU A OE1 1 
ATOM   2487 O OE2 . GLU A 1 315 ? 127.111 107.609 -1.115  1.00 36.93 ? 315 GLU A OE2 1 
ATOM   2488 N N   . ARG A 1 316 ? 122.762 107.325 0.902   1.00 32.23 ? 316 ARG A N   1 
ATOM   2489 C CA  . ARG A 1 316 ? 121.500 107.478 0.154   1.00 33.11 ? 316 ARG A CA  1 
ATOM   2490 C C   . ARG A 1 316 ? 121.742 107.849 -1.317  1.00 30.42 ? 316 ARG A C   1 
ATOM   2491 O O   . ARG A 1 316 ? 121.009 108.606 -1.876  1.00 30.32 ? 316 ARG A O   1 
ATOM   2492 C CB  . ARG A 1 316 ? 120.488 108.417 0.873   1.00 35.88 ? 316 ARG A CB  1 
ATOM   2493 C CG  . ARG A 1 316 ? 119.897 107.788 2.136   1.00 39.11 ? 316 ARG A CG  1 
ATOM   2494 C CD  . ARG A 1 316 ? 119.242 108.793 3.047   1.00 49.04 ? 316 ARG A CD  1 
ATOM   2495 N NE  . ARG A 1 316 ? 119.088 108.154 4.341   1.00 57.20 ? 316 ARG A NE  1 
ATOM   2496 C CZ  . ARG A 1 316 ? 119.881 108.310 5.412   1.00 61.34 ? 316 ARG A CZ  1 
ATOM   2497 N NH1 . ARG A 1 316 ? 120.921 109.136 5.424   1.00 63.41 ? 316 ARG A NH1 1 
ATOM   2498 N NH2 . ARG A 1 316 ? 119.613 107.611 6.513   1.00 62.33 ? 316 ARG A NH2 1 
ATOM   2499 N N   . LYS A 1 317 ? 122.770 107.273 -1.893  1.00 27.95 ? 317 LYS A N   1 
ATOM   2500 C CA  . LYS A 1 317 ? 123.193 107.464 -3.273  1.00 32.82 ? 317 LYS A CA  1 
ATOM   2501 C C   . LYS A 1 317 ? 123.347 106.037 -3.786  1.00 24.28 ? 317 LYS A C   1 
ATOM   2502 O O   . LYS A 1 317 ? 123.929 105.175 -3.100  1.00 19.99 ? 317 LYS A O   1 
ATOM   2503 C CB  . LYS A 1 317 ? 124.567 108.096 -3.343  1.00 38.05 ? 317 LYS A CB  1 
ATOM   2504 C CG  . LYS A 1 317 ? 124.644 109.392 -4.140  1.00 57.74 ? 317 LYS A CG  1 
ATOM   2505 C CD  . LYS A 1 317 ? 126.051 110.018 -4.069  1.00 62.42 ? 317 LYS A CD  1 
ATOM   2506 C CE  . LYS A 1 317 ? 127.203 109.164 -4.673  1.00 67.18 ? 317 LYS A CE  1 
ATOM   2507 N NZ  . LYS A 1 317 ? 127.400 109.396 -6.131  1.00 66.40 ? 317 LYS A NZ  1 
ATOM   2508 N N   . GLN A 1 318 ? 122.929 105.833 -5.007  1.00 22.15 ? 318 GLN A N   1 
ATOM   2509 C CA  . GLN A 1 318 ? 123.102 104.496 -5.652  1.00 21.26 ? 318 GLN A CA  1 
ATOM   2510 C C   . GLN A 1 318 ? 124.560 104.210 -5.981  1.00 23.08 ? 318 GLN A C   1 
ATOM   2511 O O   . GLN A 1 318 ? 125.147 104.915 -6.806  1.00 23.09 ? 318 GLN A O   1 
ATOM   2512 C CB  . GLN A 1 318 ? 122.219 104.470 -6.905  1.00 19.52 ? 318 GLN A CB  1 
ATOM   2513 C CG  . GLN A 1 318 ? 122.037 103.140 -7.506  1.00 19.61 ? 318 GLN A CG  1 
ATOM   2514 C CD  . GLN A 1 318 ? 121.321 102.221 -6.565  1.00 16.88 ? 318 GLN A CD  1 
ATOM   2515 O OE1 . GLN A 1 318 ? 121.942 101.382 -5.967  1.00 17.23 ? 318 GLN A OE1 1 
ATOM   2516 N NE2 . GLN A 1 318 ? 120.002 102.297 -6.554  1.00 18.82 ? 318 GLN A NE2 1 
ATOM   2517 N N   . ILE A 1 319 ? 125.182 103.212 -5.368  1.00 20.52 ? 319 ILE A N   1 
ATOM   2518 C CA  . ILE A 1 319 ? 126.592 102.924 -5.640  1.00 20.67 ? 319 ILE A CA  1 
ATOM   2519 C C   . ILE A 1 319 ? 126.711 101.909 -6.739  1.00 20.90 ? 319 ILE A C   1 
ATOM   2520 O O   . ILE A 1 319 ? 126.491 100.741 -6.498  1.00 18.67 ? 319 ILE A O   1 
ATOM   2521 C CB  . ILE A 1 319 ? 127.385 102.444 -4.395  1.00 23.21 ? 319 ILE A CB  1 
ATOM   2522 C CG1 . ILE A 1 319 ? 127.207 103.462 -3.269  1.00 26.85 ? 319 ILE A CG1 1 
ATOM   2523 C CG2 . ILE A 1 319 ? 128.879 102.219 -4.717  1.00 23.39 ? 319 ILE A CG2 1 
ATOM   2524 C CD1 . ILE A 1 319 ? 127.434 104.916 -3.653  1.00 27.02 ? 319 ILE A CD1 1 
ATOM   2525 N N   . ILE A 1 320 ? 127.099 102.376 -7.926  1.00 21.89 ? 320 ILE A N   1 
ATOM   2526 C CA  . ILE A 1 320 ? 127.045 101.613 -9.208  1.00 21.70 ? 320 ILE A CA  1 
ATOM   2527 C C   . ILE A 1 320 ? 128.471 101.246 -9.608  1.00 25.90 ? 320 ILE A C   1 
ATOM   2528 O O   . ILE A 1 320 ? 129.361 102.078 -9.549  1.00 24.66 ? 320 ILE A O   1 
ATOM   2529 C CB  . ILE A 1 320 ? 126.401 102.485 -10.296 1.00 23.17 ? 320 ILE A CB  1 
ATOM   2530 C CG1 . ILE A 1 320 ? 124.911 102.728 -9.931  1.00 21.70 ? 320 ILE A CG1 1 
ATOM   2531 C CG2 . ILE A 1 320 ? 126.486 101.857 -11.675 1.00 23.33 ? 320 ILE A CG2 1 
ATOM   2532 C CD1 . ILE A 1 320 ? 124.183 103.741 -10.780 1.00 26.29 ? 320 ILE A CD1 1 
ATOM   2533 N N   . ASN A 1 321 ? 128.683 99.998  -9.965  1.00 23.36 ? 321 ASN A N   1 
ATOM   2534 C CA  . ASN A 1 321 ? 129.941 99.523  -10.539 1.00 24.98 ? 321 ASN A CA  1 
ATOM   2535 C C   . ASN A 1 321 ? 129.962 99.881  -12.048 1.00 26.89 ? 321 ASN A C   1 
ATOM   2536 O O   . ASN A 1 321 ? 129.311 99.246  -12.879 1.00 22.28 ? 321 ASN A O   1 
ATOM   2537 C CB  . ASN A 1 321 ? 130.064 98.028  -10.285 1.00 25.53 ? 321 ASN A CB  1 
ATOM   2538 C CG  . ASN A 1 321 ? 131.330 97.418  -10.896 1.00 29.61 ? 321 ASN A CG  1 
ATOM   2539 O OD1 . ASN A 1 321 ? 132.185 98.110  -11.376 1.00 34.05 ? 321 ASN A OD1 1 
ATOM   2540 N ND2 . ASN A 1 321 ? 131.370 96.133  -10.964 1.00 34.16 ? 321 ASN A ND2 1 
ATOM   2541 N N   . LYS A 1 322 ? 130.700 100.927 -12.379 1.00 29.13 ? 322 LYS A N   1 
ATOM   2542 C CA  . LYS A 1 322 ? 130.782 101.403 -13.778 1.00 34.09 ? 322 LYS A CA  1 
ATOM   2543 C C   . LYS A 1 322 ? 131.910 100.693 -14.487 1.00 40.35 ? 322 LYS A C   1 
ATOM   2544 O O   . LYS A 1 322 ? 133.042 100.862 -14.082 1.00 35.35 ? 322 LYS A O   1 
ATOM   2545 C CB  . LYS A 1 322 ? 131.037 102.897 -13.792 1.00 39.58 ? 322 LYS A CB  1 
ATOM   2546 C CG  . LYS A 1 322 ? 129.828 103.718 -13.438 1.00 46.09 ? 322 LYS A CG  1 
ATOM   2547 C CD  . LYS A 1 322 ? 130.205 105.023 -12.719 1.00 52.45 ? 322 LYS A CD  1 
ATOM   2548 C CE  . LYS A 1 322 ? 129.083 105.701 -11.955 1.00 59.00 ? 322 LYS A CE  1 
ATOM   2549 N NZ  . LYS A 1 322 ? 128.076 106.314 -12.817 1.00 61.90 ? 322 LYS A NZ  1 
ATOM   2550 N N   . LEU A 1 323 ? 131.609 99.869  -15.507 1.00 36.31 ? 323 LEU A N   1 
ATOM   2551 C CA  . LEU A 1 323 ? 132.664 99.293  -16.404 1.00 42.09 ? 323 LEU A CA  1 
ATOM   2552 C C   . LEU A 1 323 ? 132.937 100.291 -17.534 1.00 36.53 ? 323 LEU A C   1 
ATOM   2553 O O   . LEU A 1 323 ? 134.051 100.280 -18.021 1.00 53.02 ? 323 LEU A O   1 
ATOM   2554 C CB  . LEU A 1 323 ? 132.258 97.924  -16.980 1.00 38.95 ? 323 LEU A CB  1 
ATOM   2555 C CG  . LEU A 1 323 ? 131.522 96.862  -16.090 1.00 45.94 ? 323 LEU A CG  1 
ATOM   2556 C CD1 . LEU A 1 323 ? 131.001 95.691  -16.917 1.00 46.91 ? 323 LEU A CD1 1 
ATOM   2557 C CD2 . LEU A 1 323 ? 132.315 96.279  -14.906 1.00 47.20 ? 323 LEU A CD2 1 
HETATM 2558 N N   . OCS B 1 2   ? 109.087 86.310  -17.268 1.00 18.16 ? 2   OCS B N   1 
HETATM 2559 C CA  . OCS B 1 2   ? 109.744 87.505  -17.767 1.00 19.18 ? 2   OCS B CA  1 
HETATM 2560 C CB  . OCS B 1 2   ? 110.072 87.338  -19.280 1.00 26.63 ? 2   OCS B CB  1 
HETATM 2561 S SG  . OCS B 1 2   ? 111.119 85.974  -19.580 1.00 28.64 ? 2   OCS B SG  1 
HETATM 2562 C C   . OCS B 1 2   ? 108.796 88.665  -17.592 1.00 16.46 ? 2   OCS B C   1 
HETATM 2563 O O   . OCS B 1 2   ? 107.605 88.555  -17.823 1.00 14.26 ? 2   OCS B O   1 
HETATM 2564 O OD1 . OCS B 1 2   ? 111.381 85.638  -21.173 1.00 34.80 ? 2   OCS B OD1 1 
HETATM 2565 O OD2 . OCS B 1 2   ? 112.264 86.212  -18.865 1.00 28.95 ? 2   OCS B OD2 1 
HETATM 2566 O OD3 . OCS B 1 2   ? 109.983 85.045  -19.309 1.00 45.41 ? 2   OCS B OD3 1 
ATOM   2567 N N   . THR B 1 3   ? 109.365 89.830  -17.299 1.00 14.67 ? 3   THR B N   1 
ATOM   2568 C CA  . THR B 1 3   ? 108.602 91.064  -17.329 1.00 13.57 ? 3   THR B CA  1 
ATOM   2569 C C   . THR B 1 3   ? 109.423 92.127  -17.990 1.00 14.32 ? 3   THR B C   1 
ATOM   2570 O O   . THR B 1 3   ? 110.584 92.342  -17.572 1.00 16.09 ? 3   THR B O   1 
ATOM   2571 C CB  . THR B 1 3   ? 108.241 91.580  -15.947 1.00 14.59 ? 3   THR B CB  1 
ATOM   2572 O OG1 . THR B 1 3   ? 107.599 90.543  -15.200 1.00 14.69 ? 3   THR B OG1 1 
ATOM   2573 C CG2 . THR B 1 3   ? 107.318 92.803  -16.030 1.00 14.31 ? 3   THR B CG2 1 
ATOM   2574 N N   . ALA B 1 4   ? 108.878 92.809  -18.992 1.00 12.25 ? 4   ALA B N   1 
ATOM   2575 C CA  . ALA B 1 4   ? 109.604 93.948  -19.643 1.00 13.07 ? 4   ALA B CA  1 
ATOM   2576 C C   . ALA B 1 4   ? 108.795 95.195  -19.491 1.00 14.23 ? 4   ALA B C   1 
ATOM   2577 O O   . ALA B 1 4   ? 107.586 95.120  -19.593 1.00 14.08 ? 4   ALA B O   1 
ATOM   2578 C CB  . ALA B 1 4   ? 109.861 93.664  -21.115 1.00 12.54 ? 4   ALA B CB  1 
ATOM   2579 N N   . ILE B 1 5   ? 109.427 96.317  -19.208 1.00 12.99 ? 5   ILE B N   1 
ATOM   2580 C CA  . ILE B 1 5   ? 108.752 97.582  -19.016 1.00 13.72 ? 5   ILE B CA  1 
ATOM   2581 C C   . ILE B 1 5   ? 109.497 98.737  -19.663 1.00 14.97 ? 5   ILE B C   1 
ATOM   2582 O O   . ILE B 1 5   ? 110.673 98.599  -19.957 1.00 15.07 ? 5   ILE B O   1 
ATOM   2583 C CB  . ILE B 1 5   ? 108.536 97.933  -17.514 1.00 13.18 ? 5   ILE B CB  1 
ATOM   2584 C CG1 . ILE B 1 5   ? 109.843 98.404  -16.864 1.00 13.54 ? 5   ILE B CG1 1 
ATOM   2585 C CG2 . ILE B 1 5   ? 108.006 96.702  -16.733 1.00 13.92 ? 5   ILE B CG2 1 
ATOM   2586 C CD1 . ILE B 1 5   ? 109.783 98.762  -15.394 1.00 14.36 ? 5   ILE B CD1 1 
ATOM   2587 N N   . THR B 1 6   ? 108.787 99.808  -19.916 1.00 14.57 ? 6   THR B N   1 
ATOM   2588 C CA  . THR B 1 6   ? 109.387 101.076 -20.242 1.00 14.80 ? 6   THR B CA  1 
ATOM   2589 C C   . THR B 1 6   ? 109.071 102.051 -19.122 1.00 15.30 ? 6   THR B C   1 
ATOM   2590 O O   . THR B 1 6   ? 108.138 101.826 -18.352 1.00 14.14 ? 6   THR B O   1 
ATOM   2591 C CB  . THR B 1 6   ? 108.840 101.652 -21.512 1.00 14.45 ? 6   THR B CB  1 
ATOM   2592 O OG1 . THR B 1 6   ? 107.446 101.926 -21.412 1.00 13.15 ? 6   THR B OG1 1 
ATOM   2593 C CG2 . THR B 1 6   ? 109.056 100.724 -22.694 1.00 15.85 ? 6   THR B CG2 1 
ATOM   2594 N N   . LEU B 1 7   ? 109.827 103.161 -19.049 1.00 15.03 ? 7   LEU B N   1 
ATOM   2595 C CA  . LEU B 1 7   ? 109.517 104.214 -18.073 1.00 15.22 ? 7   LEU B CA  1 
ATOM   2596 C C   . LEU B 1 7   ? 109.971 105.512 -18.742 1.00 17.03 ? 7   LEU B C   1 
ATOM   2597 O O   . LEU B 1 7   ? 111.050 105.557 -19.355 1.00 15.15 ? 7   LEU B O   1 
ATOM   2598 C CB  . LEU B 1 7   ? 110.238 103.953 -16.785 1.00 14.64 ? 7   LEU B CB  1 
ATOM   2599 C CG  . LEU B 1 7   ? 109.986 104.868 -15.606 1.00 17.80 ? 7   LEU B CG  1 
ATOM   2600 C CD1 . LEU B 1 7   ? 108.581 104.621 -15.082 1.00 20.30 ? 7   LEU B CD1 1 
ATOM   2601 C CD2 . LEU B 1 7   ? 110.997 104.662 -14.479 1.00 18.96 ? 7   LEU B CD2 1 
ATOM   2602 N N   . ASN B 1 8   ? 109.158 106.544 -18.594 1.00 18.96 ? 8   ASN B N   1 
ATOM   2603 C CA  . ASN B 1 8   ? 109.491 107.884 -19.067 1.00 22.83 ? 8   ASN B CA  1 
ATOM   2604 C C   . ASN B 1 8   ? 109.673 108.803 -17.891 1.00 23.36 ? 8   ASN B C   1 
ATOM   2605 O O   . ASN B 1 8   ? 108.811 108.901 -17.073 1.00 26.78 ? 8   ASN B O   1 
ATOM   2606 C CB  . ASN B 1 8   ? 108.461 108.360 -20.104 1.00 25.90 ? 8   ASN B CB  1 
ATOM   2607 C CG  . ASN B 1 8   ? 108.361 107.378 -21.301 1.00 29.01 ? 8   ASN B CG  1 
ATOM   2608 O OD1 . ASN B 1 8   ? 107.363 106.686 -21.424 1.00 35.33 ? 8   ASN B OD1 1 
ATOM   2609 N ND2 . ASN B 1 8   ? 109.426 107.253 -22.142 1.00 26.43 ? 8   ASN B ND2 1 
ATOM   2610 N N   . GLY B 1 9   ? 110.882 109.359 -17.715 1.00 22.43 ? 9   GLY B N   1 
ATOM   2611 C CA  . GLY B 1 9   ? 111.154 110.279 -16.593 1.00 21.15 ? 9   GLY B CA  1 
ATOM   2612 C C   . GLY B 1 9   ? 112.088 111.386 -17.066 1.00 20.50 ? 9   GLY B C   1 
ATOM   2613 O O   . GLY B 1 9   ? 111.814 111.956 -18.095 1.00 20.94 ? 9   GLY B O   1 
ATOM   2614 N N   . ASN B 1 10  ? 113.201 111.572 -16.373 1.00 17.83 ? 10  ASN B N   1 
ATOM   2615 C CA  . ASN B 1 10  ? 114.222 112.526 -16.759 1.00 19.70 ? 10  ASN B CA  1 
ATOM   2616 C C   . ASN B 1 10  ? 115.004 112.046 -17.973 1.00 23.78 ? 10  ASN B C   1 
ATOM   2617 O O   . ASN B 1 10  ? 115.410 112.876 -18.816 1.00 25.91 ? 10  ASN B O   1 
ATOM   2618 C CB  . ASN B 1 10  ? 115.165 112.783 -15.615 1.00 19.43 ? 10  ASN B CB  1 
ATOM   2619 C CG  . ASN B 1 10  ? 114.453 113.378 -14.429 1.00 23.24 ? 10  ASN B CG  1 
ATOM   2620 O OD1 . ASN B 1 10  ? 114.084 114.574 -14.445 1.00 22.86 ? 10  ASN B OD1 1 
ATOM   2621 N ND2 . ASN B 1 10  ? 114.123 112.539 -13.453 1.00 18.69 ? 10  ASN B ND2 1 
ATOM   2622 N N   . SER B 1 11  ? 115.160 110.749 -18.138 1.00 18.81 ? 11  SER B N   1 
ATOM   2623 C CA  . SER B 1 11  ? 115.490 110.198 -19.433 1.00 18.06 ? 11  SER B CA  1 
ATOM   2624 C C   . SER B 1 11  ? 114.346 109.231 -19.802 1.00 20.09 ? 11  SER B C   1 
ATOM   2625 O O   . SER B 1 11  ? 113.263 109.326 -19.263 1.00 16.79 ? 11  SER B O   1 
ATOM   2626 C CB  . SER B 1 11  ? 116.865 109.511 -19.396 1.00 18.25 ? 11  SER B CB  1 
ATOM   2627 O OG  . SER B 1 11  ? 117.310 109.190 -20.707 1.00 17.65 ? 11  SER B OG  1 
ATOM   2628 N N   . ASN B 1 12  ? 114.602 108.336 -20.778 1.00 15.33 ? 12  ASN B N   1 
ATOM   2629 C CA  . ASN B 1 12  ? 113.636 107.333 -21.212 1.00 17.78 ? 12  ASN B CA  1 
ATOM   2630 C C   . ASN B 1 12  ? 114.285 105.966 -21.130 1.00 15.32 ? 12  ASN B C   1 
ATOM   2631 O O   . ASN B 1 12  ? 115.455 105.796 -21.519 1.00 16.03 ? 12  ASN B O   1 
ATOM   2632 C CB  . ASN B 1 12  ? 113.141 107.653 -22.619 1.00 17.46 ? 12  ASN B CB  1 
ATOM   2633 C CG  . ASN B 1 12  ? 112.488 109.023 -22.660 1.00 20.87 ? 12  ASN B CG  1 
ATOM   2634 O OD1 . ASN B 1 12  ? 111.365 109.193 -22.169 1.00 19.12 ? 12  ASN B OD1 1 
ATOM   2635 N ND2 . ASN B 1 12  ? 113.222 109.998 -23.125 1.00 21.41 ? 12  ASN B ND2 1 
ATOM   2636 N N   . TYR B 1 13  ? 113.577 105.011 -20.528 1.00 15.29 ? 13  TYR B N   1 
ATOM   2637 C CA  . TYR B 1 13  ? 114.133 103.737 -20.107 1.00 13.82 ? 13  TYR B CA  1 
ATOM   2638 C C   . TYR B 1 13  ? 113.308 102.544 -20.628 1.00 14.30 ? 13  TYR B C   1 
ATOM   2639 O O   . TYR B 1 13  ? 112.122 102.643 -20.930 1.00 14.45 ? 13  TYR B O   1 
ATOM   2640 C CB  . TYR B 1 13  ? 114.229 103.643 -18.554 1.00 15.24 ? 13  TYR B CB  1 
ATOM   2641 C CG  . TYR B 1 13  ? 114.750 104.899 -17.909 1.00 14.83 ? 13  TYR B CG  1 
ATOM   2642 C CD1 . TYR B 1 13  ? 116.089 105.136 -17.786 1.00 15.20 ? 13  TYR B CD1 1 
ATOM   2643 C CD2 . TYR B 1 13  ? 113.870 105.906 -17.498 1.00 16.54 ? 13  TYR B CD2 1 
ATOM   2644 C CE1 . TYR B 1 13  ? 116.567 106.286 -17.205 1.00 15.41 ? 13  TYR B CE1 1 
ATOM   2645 C CE2 . TYR B 1 13  ? 114.324 107.040 -16.929 1.00 15.47 ? 13  TYR B CE2 1 
ATOM   2646 C CZ  . TYR B 1 13  ? 115.664 107.245 -16.823 1.00 15.81 ? 13  TYR B CZ  1 
ATOM   2647 O OH  . TYR B 1 13  ? 116.131 108.444 -16.295 1.00 16.70 ? 13  TYR B OH  1 
ATOM   2648 N N   . PHE B 1 14  ? 113.993 101.420 -20.713 1.00 14.42 ? 14  PHE B N   1 
ATOM   2649 C CA  . PHE B 1 14  ? 113.470 100.177 -21.230 1.00 14.35 ? 14  PHE B CA  1 
ATOM   2650 C C   . PHE B 1 14  ? 114.271 99.082  -20.574 1.00 14.41 ? 14  PHE B C   1 
ATOM   2651 O O   . PHE B 1 14  ? 115.480 99.208  -20.388 1.00 12.87 ? 14  PHE B O   1 
ATOM   2652 C CB  . PHE B 1 14  ? 113.613 100.131 -22.739 1.00 13.43 ? 14  PHE B CB  1 
ATOM   2653 C CG  . PHE B 1 14  ? 113.604 98.757  -23.332 1.00 14.18 ? 14  PHE B CG  1 
ATOM   2654 C CD1 . PHE B 1 14  ? 112.413 98.133  -23.614 1.00 14.97 ? 14  PHE B CD1 1 
ATOM   2655 C CD2 . PHE B 1 14  ? 114.779 98.151  -23.717 1.00 15.26 ? 14  PHE B CD2 1 
ATOM   2656 C CE1 . PHE B 1 14  ? 112.412 96.908  -24.267 1.00 17.34 ? 14  PHE B CE1 1 
ATOM   2657 C CE2 . PHE B 1 14  ? 114.789 96.899  -24.307 1.00 15.76 ? 14  PHE B CE2 1 
ATOM   2658 C CZ  . PHE B 1 14  ? 113.620 96.272  -24.589 1.00 14.38 ? 14  PHE B CZ  1 
ATOM   2659 N N   . GLY B 1 15  ? 113.619 98.008  -20.147 1.00 12.70 ? 15  GLY B N   1 
ATOM   2660 C CA  . GLY B 1 15  ? 114.368 96.938  -19.432 1.00 13.32 ? 15  GLY B CA  1 
ATOM   2661 C C   . GLY B 1 15  ? 113.509 95.759  -19.047 1.00 14.09 ? 15  GLY B C   1 
ATOM   2662 O O   . GLY B 1 15  ? 112.280 95.787  -19.282 1.00 13.21 ? 15  GLY B O   1 
ATOM   2663 N N   . ARG B 1 16  ? 114.121 94.776  -18.434 1.00 13.37 ? 16  ARG B N   1 
ATOM   2664 C CA  . ARG B 1 16  ? 113.398 93.546  -18.125 1.00 13.74 ? 16  ARG B CA  1 
ATOM   2665 C C   . ARG B 1 16  ? 114.006 92.701  -17.043 1.00 13.15 ? 16  ARG B C   1 
ATOM   2666 O O   . ARG B 1 16  ? 115.219 92.821  -16.714 1.00 12.67 ? 16  ARG B O   1 
ATOM   2667 C CB  . ARG B 1 16  ? 113.271 92.701  -19.413 1.00 14.11 ? 16  ARG B CB  1 
ATOM   2668 C CG  . ARG B 1 16  ? 114.610 92.203  -19.991 1.00 12.84 ? 16  ARG B CG  1 
ATOM   2669 C CD  . ARG B 1 16  ? 115.067 90.854  -19.489 1.00 13.60 ? 16  ARG B CD  1 
ATOM   2670 N NE  . ARG B 1 16  ? 114.107 89.752  -19.846 1.00 14.82 ? 16  ARG B NE  1 
ATOM   2671 C CZ  . ARG B 1 16  ? 113.978 89.205  -21.080 1.00 15.80 ? 16  ARG B CZ  1 
ATOM   2672 N NH1 . ARG B 1 16  ? 114.719 89.650  -22.099 1.00 17.58 ? 16  ARG B NH1 1 
ATOM   2673 N NH2 . ARG B 1 16  ? 113.071 88.288  -21.328 1.00 15.40 ? 16  ARG B NH2 1 
ATOM   2674 N N   . ASN B 1 17  ? 113.140 91.870  -16.465 1.00 12.82 ? 17  ASN B N   1 
ATOM   2675 C CA  . ASN B 1 17  ? 113.512 90.706  -15.642 1.00 12.73 ? 17  ASN B CA  1 
ATOM   2676 C C   . ASN B 1 17  ? 113.588 89.518  -16.544 1.00 12.80 ? 17  ASN B C   1 
ATOM   2677 O O   . ASN B 1 17  ? 112.710 89.334  -17.390 1.00 13.56 ? 17  ASN B O   1 
ATOM   2678 C CB  . ASN B 1 17  ? 112.465 90.381  -14.601 1.00 12.44 ? 17  ASN B CB  1 
ATOM   2679 C CG  . ASN B 1 17  ? 112.468 91.329  -13.451 1.00 12.37 ? 17  ASN B CG  1 
ATOM   2680 O OD1 . ASN B 1 17  ? 113.443 91.993  -13.184 1.00 13.46 ? 17  ASN B OD1 1 
ATOM   2681 N ND2 . ASN B 1 17  ? 111.353 91.338  -12.679 1.00 12.61 ? 17  ASN B ND2 1 
ATOM   2682 N N   . LEU B 1 18  ? 114.664 88.772  -16.480 1.00 14.24 ? 18  LEU B N   1 
ATOM   2683 C CA  . LEU B 1 18  ? 114.755 87.521  -17.194 1.00 14.82 ? 18  LEU B CA  1 
ATOM   2684 C C   . LEU B 1 18  ? 114.474 86.424  -16.189 1.00 15.79 ? 18  LEU B C   1 
ATOM   2685 O O   . LEU B 1 18  ? 115.265 86.238  -15.253 1.00 15.12 ? 18  LEU B O   1 
ATOM   2686 C CB  . LEU B 1 18  ? 116.124 87.337  -17.859 1.00 17.16 ? 18  LEU B CB  1 
ATOM   2687 C CG  . LEU B 1 18  ? 116.299 85.942  -18.490 1.00 21.37 ? 18  LEU B CG  1 
ATOM   2688 C CD1 . LEU B 1 18  ? 115.473 85.868  -19.731 1.00 26.06 ? 18  LEU B CD1 1 
ATOM   2689 C CD2 . LEU B 1 18  ? 117.771 85.588  -18.772 1.00 23.95 ? 18  LEU B CD2 1 
ATOM   2690 N N   . ASP B 1 19  ? 113.328 85.737  -16.366 1.00 15.13 ? 19  ASP B N   1 
ATOM   2691 C CA  . ASP B 1 19  ? 112.908 84.723  -15.420 1.00 15.64 ? 19  ASP B CA  1 
ATOM   2692 C C   . ASP B 1 19  ? 113.103 83.346  -16.061 1.00 16.16 ? 19  ASP B C   1 
ATOM   2693 O O   . ASP B 1 19  ? 112.442 83.061  -17.026 1.00 16.59 ? 19  ASP B O   1 
ATOM   2694 C CB  . ASP B 1 19  ? 111.467 84.927  -15.028 1.00 15.44 ? 19  ASP B CB  1 
ATOM   2695 C CG  . ASP B 1 19  ? 111.190 86.297  -14.323 1.00 15.56 ? 19  ASP B CG  1 
ATOM   2696 O OD1 . ASP B 1 19  ? 112.124 86.923  -13.729 1.00 15.54 ? 19  ASP B OD1 1 
ATOM   2697 O OD2 . ASP B 1 19  ? 110.017 86.719  -14.360 1.00 15.90 ? 19  ASP B OD2 1 
ATOM   2698 N N   . LEU B 1 20  ? 113.908 82.474  -15.465 1.00 16.89 ? 20  LEU B N   1 
ATOM   2699 C CA  . LEU B 1 20  ? 114.162 81.183  -16.041 1.00 17.91 ? 20  LEU B CA  1 
ATOM   2700 C C   . LEU B 1 20  ? 114.396 80.233  -14.910 1.00 17.79 ? 20  LEU B C   1 
ATOM   2701 O O   . LEU B 1 20  ? 114.652 80.647  -13.764 1.00 15.86 ? 20  LEU B O   1 
ATOM   2702 C CB  . LEU B 1 20  ? 115.431 81.198  -16.899 1.00 22.03 ? 20  LEU B CB  1 
ATOM   2703 C CG  . LEU B 1 20  ? 115.480 81.964  -18.204 1.00 26.18 ? 20  LEU B CG  1 
ATOM   2704 C CD1 . LEU B 1 20  ? 116.893 81.822  -18.761 1.00 25.82 ? 20  LEU B CD1 1 
ATOM   2705 C CD2 . LEU B 1 20  ? 114.427 81.385  -19.171 1.00 30.69 ? 20  LEU B CD2 1 
ATOM   2706 N N   . ASP B 1 21  ? 114.359 78.938  -15.224 1.00 17.25 ? 21  ASP B N   1 
ATOM   2707 C CA  . ASP B 1 21  ? 114.681 77.921  -14.179 1.00 19.57 ? 21  ASP B CA  1 
ATOM   2708 C C   . ASP B 1 21  ? 116.069 77.351  -14.348 1.00 22.67 ? 21  ASP B C   1 
ATOM   2709 O O   . ASP B 1 21  ? 116.463 76.450  -13.649 1.00 22.90 ? 21  ASP B O   1 
ATOM   2710 C CB  . ASP B 1 21  ? 113.599 76.836  -14.086 1.00 20.73 ? 21  ASP B CB  1 
ATOM   2711 C CG  . ASP B 1 21  ? 113.448 76.024  -15.391 1.00 25.22 ? 21  ASP B CG  1 
ATOM   2712 O OD1 . ASP B 1 21  ? 114.028 76.405  -16.427 1.00 27.22 ? 21  ASP B OD1 1 
ATOM   2713 O OD2 . ASP B 1 21  ? 112.699 75.001  -15.338 1.00 23.72 ? 21  ASP B OD2 1 
ATOM   2714 N N   . PHE B 1 22  ? 116.881 78.025  -15.124 1.00 21.69 ? 22  PHE B N   1 
ATOM   2715 C CA  . PHE B 1 22  ? 118.293 77.698  -15.171 1.00 23.93 ? 22  PHE B CA  1 
ATOM   2716 C C   . PHE B 1 22  ? 119.078 78.921  -15.615 1.00 23.72 ? 22  PHE B C   1 
ATOM   2717 O O   . PHE B 1 22  ? 118.543 79.869  -16.182 1.00 22.42 ? 22  PHE B O   1 
ATOM   2718 C CB  . PHE B 1 22  ? 118.535 76.558  -16.188 1.00 23.14 ? 22  PHE B CB  1 
ATOM   2719 C CG  . PHE B 1 22  ? 118.294 76.951  -17.593 1.00 27.06 ? 22  PHE B CG  1 
ATOM   2720 C CD1 . PHE B 1 22  ? 117.004 77.100  -18.071 1.00 25.72 ? 22  PHE B CD1 1 
ATOM   2721 C CD2 . PHE B 1 22  ? 119.389 77.170  -18.493 1.00 22.93 ? 22  PHE B CD2 1 
ATOM   2722 C CE1 . PHE B 1 22  ? 116.781 77.480  -19.402 1.00 28.81 ? 22  PHE B CE1 1 
ATOM   2723 C CE2 . PHE B 1 22  ? 119.170 77.561  -19.792 1.00 24.80 ? 22  PHE B CE2 1 
ATOM   2724 C CZ  . PHE B 1 22  ? 117.866 77.752  -20.270 1.00 27.91 ? 22  PHE B CZ  1 
ATOM   2725 N N   . SER B 1 23  ? 120.395 78.820  -15.496 1.00 26.44 ? 23  SER B N   1 
ATOM   2726 C CA  . SER B 1 23  ? 121.255 79.792  -16.134 1.00 29.18 ? 23  SER B CA  1 
ATOM   2727 C C   . SER B 1 23  ? 122.633 79.168  -16.214 1.00 31.21 ? 23  SER B C   1 
ATOM   2728 O O   . SER B 1 23  ? 123.126 78.666  -15.181 1.00 34.88 ? 23  SER B O   1 
ATOM   2729 C CB  . SER B 1 23  ? 121.408 81.004  -15.231 1.00 29.24 ? 23  SER B CB  1 
ATOM   2730 O OG  . SER B 1 23  ? 122.418 81.886  -15.707 1.00 27.62 ? 23  SER B OG  1 
ATOM   2731 N N   A TYR B 1 24  ? 123.203 79.120  -17.394 0.62 34.11 ? 24  TYR B N   1 
ATOM   2732 N N   B TYR B 1 24  ? 123.292 79.154  -17.369 0.38 32.14 ? 24  TYR B N   1 
ATOM   2733 C CA  A TYR B 1 24  ? 124.659 78.815  -17.549 0.62 44.17 ? 24  TYR B CA  1 
ATOM   2734 C CA  B TYR B 1 24  ? 124.782 78.851  -17.376 0.38 36.51 ? 24  TYR B CA  1 
ATOM   2735 C C   A TYR B 1 24  ? 125.508 80.101  -17.743 0.62 43.71 ? 24  TYR B C   1 
ATOM   2736 C C   B TYR B 1 24  ? 125.624 80.117  -17.295 0.38 37.34 ? 24  TYR B C   1 
ATOM   2737 O O   A TYR B 1 24  ? 126.639 80.020  -18.235 0.62 40.01 ? 24  TYR B O   1 
ATOM   2738 O O   B TYR B 1 24  ? 126.860 80.062  -17.140 0.38 32.98 ? 24  TYR B O   1 
ATOM   2739 C CB  A TYR B 1 24  ? 124.835 77.752  -18.675 0.62 44.23 ? 24  TYR B CB  1 
ATOM   2740 C CB  B TYR B 1 24  ? 125.266 78.001  -18.575 0.38 35.97 ? 24  TYR B CB  1 
ATOM   2741 C CG  A TYR B 1 24  ? 123.946 76.499  -18.401 0.62 44.88 ? 24  TYR B CG  1 
ATOM   2742 C CG  B TYR B 1 24  ? 124.563 78.237  -19.886 0.38 35.11 ? 24  TYR B CG  1 
ATOM   2743 C CD1 A TYR B 1 24  ? 124.016 75.801  -17.161 0.62 45.00 ? 24  TYR B CD1 1 
ATOM   2744 C CD1 B TYR B 1 24  ? 123.197 78.168  -19.961 0.38 35.24 ? 24  TYR B CD1 1 
ATOM   2745 C CD2 A TYR B 1 24  ? 122.991 76.064  -19.339 0.62 40.54 ? 24  TYR B CD2 1 
ATOM   2746 C CD2 B TYR B 1 24  ? 125.285 78.457  -21.079 0.38 34.30 ? 24  TYR B CD2 1 
ATOM   2747 C CE1 A TYR B 1 24  ? 123.173 74.714  -16.891 0.62 43.91 ? 24  TYR B CE1 1 
ATOM   2748 C CE1 B TYR B 1 24  ? 122.553 78.360  -21.149 0.38 34.94 ? 24  TYR B CE1 1 
ATOM   2749 C CE2 A TYR B 1 24  ? 122.164 74.975  -19.074 0.62 40.99 ? 24  TYR B CE2 1 
ATOM   2750 C CE2 B TYR B 1 24  ? 124.630 78.636  -22.267 0.38 29.55 ? 24  TYR B CE2 1 
ATOM   2751 C CZ  A TYR B 1 24  ? 122.247 74.309  -17.855 0.62 41.03 ? 24  TYR B CZ  1 
ATOM   2752 C CZ  B TYR B 1 24  ? 123.262 78.586  -22.267 0.38 31.84 ? 24  TYR B CZ  1 
ATOM   2753 O OH  A TYR B 1 24  ? 121.404 73.242  -17.598 0.62 40.15 ? 24  TYR B OH  1 
ATOM   2754 O OH  B TYR B 1 24  ? 122.520 78.732  -23.385 0.38 35.92 ? 24  TYR B OH  1 
ATOM   2755 N N   . GLY B 1 25  ? 124.942 81.257  -17.343 1.00 37.61 ? 25  GLY B N   1 
ATOM   2756 C CA  . GLY B 1 25  ? 125.597 82.517  -17.356 1.00 37.55 ? 25  GLY B CA  1 
ATOM   2757 C C   . GLY B 1 25  ? 125.081 83.185  -18.638 1.00 35.20 ? 25  GLY B C   1 
ATOM   2758 O O   . GLY B 1 25  ? 124.481 82.539  -19.494 1.00 37.41 ? 25  GLY B O   1 
ATOM   2759 N N   . GLU B 1 26  ? 125.314 84.477  -18.690 1.00 27.37 ? 26  GLU B N   1 
ATOM   2760 C CA  . GLU B 1 26  ? 124.980 85.371  -19.754 1.00 25.81 ? 26  GLU B CA  1 
ATOM   2761 C C   . GLU B 1 26  ? 125.970 86.469  -19.577 1.00 22.52 ? 26  GLU B C   1 
ATOM   2762 O O   . GLU B 1 26  ? 126.706 86.486  -18.577 1.00 19.80 ? 26  GLU B O   1 
ATOM   2763 C CB  . GLU B 1 26  ? 123.547 85.805  -19.668 1.00 28.70 ? 26  GLU B CB  1 
ATOM   2764 C CG  . GLU B 1 26  ? 123.089 86.422  -18.424 1.00 30.60 ? 26  GLU B CG  1 
ATOM   2765 C CD  . GLU B 1 26  ? 122.854 85.427  -17.325 1.00 32.65 ? 26  GLU B CD  1 
ATOM   2766 O OE1 . GLU B 1 26  ? 122.238 84.363  -17.564 1.00 37.13 ? 26  GLU B OE1 1 
ATOM   2767 O OE2 . GLU B 1 26  ? 123.383 85.742  -16.209 1.00 38.78 ? 26  GLU B OE2 1 
ATOM   2768 N N   . GLU B 1 27  ? 125.979 87.384  -20.490 1.00 20.01 ? 27  GLU B N   1 
ATOM   2769 C CA  . GLU B 1 27  ? 126.990 88.442  -20.473 1.00 20.61 ? 27  GLU B CA  1 
ATOM   2770 C C   . GLU B 1 27  ? 126.526 89.640  -21.223 1.00 18.71 ? 27  GLU B C   1 
ATOM   2771 O O   . GLU B 1 27  ? 125.567 89.546  -22.018 1.00 15.50 ? 27  GLU B O   1 
ATOM   2772 C CB  . GLU B 1 27  ? 128.245 87.880  -21.156 1.00 22.29 ? 27  GLU B CB  1 
ATOM   2773 C CG  . GLU B 1 27  ? 127.993 87.271  -22.490 1.00 24.60 ? 27  GLU B CG  1 
ATOM   2774 C CD  . GLU B 1 27  ? 129.221 86.601  -23.079 1.00 31.24 ? 27  GLU B CD  1 
ATOM   2775 O OE1 . GLU B 1 27  ? 130.282 86.599  -22.457 1.00 29.67 ? 27  GLU B OE1 1 
ATOM   2776 O OE2 . GLU B 1 27  ? 129.089 86.057  -24.159 1.00 30.44 ? 27  GLU B OE2 1 
ATOM   2777 N N   . VAL B 1 28  ? 127.161 90.763  -20.946 1.00 15.96 ? 28  VAL B N   1 
ATOM   2778 C CA  . VAL B 1 28  ? 126.973 91.924  -21.761 1.00 16.00 ? 28  VAL B CA  1 
ATOM   2779 C C   . VAL B 1 28  ? 127.635 91.617  -23.099 1.00 15.88 ? 28  VAL B C   1 
ATOM   2780 O O   . VAL B 1 28  ? 128.727 91.097  -23.151 1.00 16.25 ? 28  VAL B O   1 
ATOM   2781 C CB  . VAL B 1 28  ? 127.638 93.139  -21.163 1.00 19.14 ? 28  VAL B CB  1 
ATOM   2782 C CG1 . VAL B 1 28  ? 127.455 94.326  -22.044 1.00 19.00 ? 28  VAL B CG1 1 
ATOM   2783 C CG2 . VAL B 1 28  ? 127.158 93.410  -19.726 1.00 20.28 ? 28  VAL B CG2 1 
ATOM   2784 N N   . ILE B 1 29  ? 126.962 91.959  -24.190 1.00 14.89 ? 29  ILE B N   1 
ATOM   2785 C CA  . ILE B 1 29  ? 127.508 91.793  -25.511 1.00 14.83 ? 29  ILE B CA  1 
ATOM   2786 C C   . ILE B 1 29  ? 127.293 93.123  -26.249 1.00 16.22 ? 29  ILE B C   1 
ATOM   2787 O O   . ILE B 1 29  ? 126.164 93.578  -26.455 1.00 15.47 ? 29  ILE B O   1 
ATOM   2788 C CB  . ILE B 1 29  ? 126.815 90.657  -26.316 1.00 15.05 ? 29  ILE B CB  1 
ATOM   2789 C CG1 . ILE B 1 29  ? 126.762 89.364  -25.530 1.00 16.71 ? 29  ILE B CG1 1 
ATOM   2790 C CG2 . ILE B 1 29  ? 127.479 90.452  -27.683 1.00 16.95 ? 29  ILE B CG2 1 
ATOM   2791 C CD1 . ILE B 1 29  ? 125.777 88.346  -26.107 1.00 18.07 ? 29  ILE B CD1 1 
ATOM   2792 N N   . ILE B 1 30  ? 128.397 93.717  -26.701 1.00 15.17 ? 30  ILE B N   1 
ATOM   2793 C CA  . ILE B 1 30  ? 128.379 94.826  -27.633 1.00 17.37 ? 30  ILE B CA  1 
ATOM   2794 C C   . ILE B 1 30  ? 128.670 94.325  -29.035 1.00 16.82 ? 30  ILE B C   1 
ATOM   2795 O O   . ILE B 1 30  ? 129.681 93.627  -29.237 1.00 16.75 ? 30  ILE B O   1 
ATOM   2796 C CB  . ILE B 1 30  ? 129.418 95.934  -27.263 1.00 18.95 ? 30  ILE B CB  1 
ATOM   2797 C CG1 . ILE B 1 30  ? 128.968 96.576  -25.970 1.00 20.21 ? 30  ILE B CG1 1 
ATOM   2798 C CG2 . ILE B 1 30  ? 129.551 97.013  -28.384 1.00 20.49 ? 30  ILE B CG2 1 
ATOM   2799 C CD1 . ILE B 1 30  ? 129.951 97.549  -25.311 1.00 23.75 ? 30  ILE B CD1 1 
ATOM   2800 N N   . THR B 1 31  ? 127.761 94.614  -29.960 1.00 16.22 ? 31  THR B N   1 
ATOM   2801 C CA  . THR B 1 31  ? 127.922 94.271  -31.364 1.00 15.46 ? 31  THR B CA  1 
ATOM   2802 C C   . THR B 1 31  ? 128.232 95.565  -32.127 1.00 16.56 ? 31  THR B C   1 
ATOM   2803 O O   . THR B 1 31  ? 127.377 96.413  -32.346 1.00 18.93 ? 31  THR B O   1 
ATOM   2804 C CB  . THR B 1 31  ? 126.695 93.629  -31.983 1.00 15.35 ? 31  THR B CB  1 
ATOM   2805 O OG1 . THR B 1 31  ? 126.326 92.435  -31.215 1.00 14.98 ? 31  THR B OG1 1 
ATOM   2806 C CG2 . THR B 1 31  ? 126.973 93.244  -33.419 1.00 16.28 ? 31  THR B CG2 1 
ATOM   2807 N N   . PRO B 1 32  ? 129.491 95.714  -32.580 1.00 17.16 ? 32  PRO B N   1 
ATOM   2808 C CA  . PRO B 1 32  ? 129.834 96.935  -33.271 1.00 16.63 ? 32  PRO B CA  1 
ATOM   2809 C C   . PRO B 1 32  ? 129.261 97.005  -34.652 1.00 15.93 ? 32  PRO B C   1 
ATOM   2810 O O   . PRO B 1 32  ? 128.761 96.007  -35.212 1.00 16.41 ? 32  PRO B O   1 
ATOM   2811 C CB  . PRO B 1 32  ? 131.391 96.895  -33.273 1.00 18.35 ? 32  PRO B CB  1 
ATOM   2812 C CG  . PRO B 1 32  ? 131.649 95.438  -33.428 1.00 20.09 ? 32  PRO B CG  1 
ATOM   2813 C CD  . PRO B 1 32  ? 130.611 94.792  -32.497 1.00 18.85 ? 32  PRO B CD  1 
ATOM   2814 N N   . ALA B 1 33  ? 129.347 98.196  -35.222 1.00 15.35 ? 33  ALA B N   1 
ATOM   2815 C CA  . ALA B 1 33  ? 128.703 98.506  -36.502 1.00 17.41 ? 33  ALA B CA  1 
ATOM   2816 C C   . ALA B 1 33  ? 129.125 97.602  -37.687 1.00 18.02 ? 33  ALA B C   1 
ATOM   2817 O O   . ALA B 1 33  ? 128.338 97.328  -38.586 1.00 18.76 ? 33  ALA B O   1 
ATOM   2818 C CB  . ALA B 1 33  ? 128.918 100.010 -36.836 1.00 19.78 ? 33  ALA B CB  1 
ATOM   2819 N N   . GLU B 1 34  ? 130.379 97.166  -37.671 1.00 18.14 ? 34  GLU B N   1 
ATOM   2820 C CA  . GLU B 1 34  ? 130.898 96.340  -38.755 1.00 20.32 ? 34  GLU B CA  1 
ATOM   2821 C C   . GLU B 1 34  ? 131.075 94.864  -38.381 1.00 19.81 ? 34  GLU B C   1 
ATOM   2822 O O   . GLU B 1 34  ? 131.788 94.121  -39.100 1.00 18.80 ? 34  GLU B O   1 
ATOM   2823 C CB  . GLU B 1 34  ? 132.182 96.979  -39.362 1.00 22.64 ? 34  GLU B CB  1 
ATOM   2824 C CG  . GLU B 1 34  ? 131.855 98.314  -40.006 1.00 28.51 ? 34  GLU B CG  1 
ATOM   2825 C CD  . GLU B 1 34  ? 133.079 99.021  -40.630 1.00 36.14 ? 34  GLU B CD  1 
ATOM   2826 O OE1 . GLU B 1 34  ? 134.204 98.498  -40.567 1.00 37.33 ? 34  GLU B OE1 1 
ATOM   2827 O OE2 . GLU B 1 34  ? 132.900 100.143 -41.164 1.00 37.67 ? 34  GLU B OE2 1 
ATOM   2828 N N   . TYR B 1 35  ? 130.447 94.403  -37.289 1.00 16.53 ? 35  TYR B N   1 
ATOM   2829 C CA  . TYR B 1 35  ? 130.342 92.949  -37.109 1.00 15.78 ? 35  TYR B CA  1 
ATOM   2830 C C   . TYR B 1 35  ? 129.364 92.449  -38.168 1.00 17.31 ? 35  TYR B C   1 
ATOM   2831 O O   . TYR B 1 35  ? 128.234 92.958  -38.292 1.00 17.16 ? 35  TYR B O   1 
ATOM   2832 C CB  . TYR B 1 35  ? 129.869 92.598  -35.666 1.00 16.34 ? 35  TYR B CB  1 
ATOM   2833 C CG  . TYR B 1 35  ? 129.450 91.162  -35.547 1.00 15.61 ? 35  TYR B CG  1 
ATOM   2834 C CD1 . TYR B 1 35  ? 128.118 90.799  -35.800 1.00 17.17 ? 35  TYR B CD1 1 
ATOM   2835 C CD2 . TYR B 1 35  ? 130.339 90.167  -35.176 1.00 16.30 ? 35  TYR B CD2 1 
ATOM   2836 C CE1 . TYR B 1 35  ? 127.688 89.500  -35.651 1.00 17.35 ? 35  TYR B CE1 1 
ATOM   2837 C CE2 . TYR B 1 35  ? 129.920 88.840  -35.048 1.00 17.29 ? 35  TYR B CE2 1 
ATOM   2838 C CZ  . TYR B 1 35  ? 128.574 88.520  -35.289 1.00 16.55 ? 35  TYR B CZ  1 
ATOM   2839 O OH  . TYR B 1 35  ? 128.171 87.218  -35.246 1.00 17.38 ? 35  TYR B OH  1 
ATOM   2840 N N   . GLU B 1 36  ? 129.769 91.483  -38.997 1.00 16.63 ? 36  GLU B N   1 
ATOM   2841 C CA  . GLU B 1 36  ? 128.945 91.052  -40.068 1.00 17.20 ? 36  GLU B CA  1 
ATOM   2842 C C   . GLU B 1 36  ? 127.831 90.113  -39.534 1.00 16.66 ? 36  GLU B C   1 
ATOM   2843 O O   . GLU B 1 36  ? 128.124 89.054  -38.991 1.00 15.38 ? 36  GLU B O   1 
ATOM   2844 C CB  . GLU B 1 36  ? 129.755 90.302  -41.105 1.00 19.01 ? 36  GLU B CB  1 
ATOM   2845 C CG  . GLU B 1 36  ? 128.905 89.861  -42.266 1.00 22.33 ? 36  GLU B CG  1 
ATOM   2846 C CD  . GLU B 1 36  ? 129.728 89.231  -43.412 1.00 28.01 ? 36  GLU B CD  1 
ATOM   2847 O OE1 . GLU B 1 36  ? 130.846 89.613  -43.646 1.00 35.39 ? 36  GLU B OE1 1 
ATOM   2848 O OE2 . GLU B 1 36  ? 129.249 88.382  -44.090 1.00 28.67 ? 36  GLU B OE2 1 
ATOM   2849 N N   . PHE B 1 37  ? 126.589 90.565  -39.618 1.00 18.30 ? 37  PHE B N   1 
ATOM   2850 C CA  . PHE B 1 37  ? 125.439 89.733  -39.306 1.00 17.91 ? 37  PHE B CA  1 
ATOM   2851 C C   . PHE B 1 37  ? 125.141 88.781  -40.488 1.00 17.80 ? 37  PHE B C   1 
ATOM   2852 O O   . PHE B 1 37  ? 124.882 89.220  -41.628 1.00 21.00 ? 37  PHE B O   1 
ATOM   2853 C CB  . PHE B 1 37  ? 124.175 90.534  -39.001 1.00 17.12 ? 37  PHE B CB  1 
ATOM   2854 C CG  . PHE B 1 37  ? 124.116 91.119  -37.619 1.00 16.93 ? 37  PHE B CG  1 
ATOM   2855 C CD1 . PHE B 1 37  ? 124.291 90.332  -36.530 1.00 19.89 ? 37  PHE B CD1 1 
ATOM   2856 C CD2 . PHE B 1 37  ? 123.826 92.445  -37.453 1.00 21.06 ? 37  PHE B CD2 1 
ATOM   2857 C CE1 . PHE B 1 37  ? 124.205 90.854  -35.229 1.00 19.59 ? 37  PHE B CE1 1 
ATOM   2858 C CE2 . PHE B 1 37  ? 123.709 92.955  -36.157 1.00 21.52 ? 37  PHE B CE2 1 
ATOM   2859 C CZ  . PHE B 1 37  ? 123.965 92.148  -35.072 1.00 18.83 ? 37  PHE B CZ  1 
ATOM   2860 N N   . LYS B 1 38  ? 125.214 87.478  -40.215 1.00 17.56 ? 38  LYS B N   1 
ATOM   2861 C CA  . LYS B 1 38  ? 124.863 86.476  -41.210 1.00 18.80 ? 38  LYS B CA  1 
ATOM   2862 C C   . LYS B 1 38  ? 123.498 85.901  -40.863 1.00 15.82 ? 38  LYS B C   1 
ATOM   2863 O O   . LYS B 1 38  ? 123.124 85.835  -39.707 1.00 13.83 ? 38  LYS B O   1 
ATOM   2864 C CB  . LYS B 1 38  ? 125.921 85.367  -41.220 1.00 21.39 ? 38  LYS B CB  1 
ATOM   2865 C CG  . LYS B 1 38  ? 127.249 85.965  -41.711 1.00 28.05 ? 38  LYS B CG  1 
ATOM   2866 C CD  . LYS B 1 38  ? 128.320 84.937  -41.881 1.00 34.63 ? 38  LYS B CD  1 
ATOM   2867 C CE  . LYS B 1 38  ? 129.621 85.662  -42.194 1.00 40.71 ? 38  LYS B CE  1 
ATOM   2868 N NZ  . LYS B 1 38  ? 130.731 84.697  -42.094 1.00 46.20 ? 38  LYS B NZ  1 
ATOM   2869 N N   . PHE B 1 39  ? 122.752 85.568  -41.874 1.00 16.39 ? 39  PHE B N   1 
ATOM   2870 C CA  . PHE B 1 39  ? 121.356 85.086  -41.731 1.00 17.68 ? 39  PHE B CA  1 
ATOM   2871 C C   . PHE B 1 39  ? 121.248 83.784  -42.489 1.00 19.26 ? 39  PHE B C   1 
ATOM   2872 O O   . PHE B 1 39  ? 121.868 83.655  -43.603 1.00 18.21 ? 39  PHE B O   1 
ATOM   2873 C CB  . PHE B 1 39  ? 120.346 86.123  -42.297 1.00 17.74 ? 39  PHE B CB  1 
ATOM   2874 C CG  . PHE B 1 39  ? 120.389 87.423  -41.570 1.00 17.43 ? 39  PHE B CG  1 
ATOM   2875 C CD1 . PHE B 1 39  ? 121.277 88.422  -41.931 1.00 16.32 ? 39  PHE B CD1 1 
ATOM   2876 C CD2 . PHE B 1 39  ? 119.537 87.647  -40.491 1.00 16.69 ? 39  PHE B CD2 1 
ATOM   2877 C CE1 . PHE B 1 39  ? 121.326 89.610  -41.236 1.00 15.98 ? 39  PHE B CE1 1 
ATOM   2878 C CE2 . PHE B 1 39  ? 119.592 88.810  -39.768 1.00 16.97 ? 39  PHE B CE2 1 
ATOM   2879 C CZ  . PHE B 1 39  ? 120.502 89.813  -40.129 1.00 16.21 ? 39  PHE B CZ  1 
ATOM   2880 N N   . ARG B 1 40  ? 120.441 82.860  -41.970 1.00 15.50 ? 40  ARG B N   1 
ATOM   2881 C CA  . ARG B 1 40  ? 120.244 81.580  -42.617 1.00 18.11 ? 40  ARG B CA  1 
ATOM   2882 C C   . ARG B 1 40  ? 119.660 81.723  -44.027 1.00 19.40 ? 40  ARG B C   1 
ATOM   2883 O O   . ARG B 1 40  ? 119.968 80.909  -44.927 1.00 19.51 ? 40  ARG B O   1 
ATOM   2884 C CB  . ARG B 1 40  ? 119.360 80.647  -41.759 1.00 17.79 ? 40  ARG B CB  1 
ATOM   2885 C CG  . ARG B 1 40  ? 120.059 80.242  -40.439 1.00 18.57 ? 40  ARG B CG  1 
ATOM   2886 C CD  . ARG B 1 40  ? 121.277 79.251  -40.632 1.00 19.56 ? 40  ARG B CD  1 
ATOM   2887 N NE  . ARG B 1 40  ? 122.038 79.283  -39.387 1.00 18.50 ? 40  ARG B NE  1 
ATOM   2888 C CZ  . ARG B 1 40  ? 121.759 78.572  -38.267 1.00 17.37 ? 40  ARG B CZ  1 
ATOM   2889 N NH1 . ARG B 1 40  ? 122.377 78.846  -37.121 1.00 18.06 ? 40  ARG B NH1 1 
ATOM   2890 N NH2 . ARG B 1 40  ? 120.791 77.704  -38.266 1.00 20.33 ? 40  ARG B NH2 1 
ATOM   2891 N N   . LYS B 1 41  ? 118.776 82.711  -44.204 1.00 17.58 ? 41  LYS B N   1 
ATOM   2892 C CA  . LYS B 1 41  ? 118.009 82.803  -45.467 1.00 19.39 ? 41  LYS B CA  1 
ATOM   2893 C C   . LYS B 1 41  ? 117.947 84.182  -46.049 1.00 19.51 ? 41  LYS B C   1 
ATOM   2894 O O   . LYS B 1 41  ? 117.123 84.432  -46.870 1.00 19.41 ? 41  LYS B O   1 
ATOM   2895 C CB  . LYS B 1 41  ? 116.596 82.201  -45.305 1.00 17.58 ? 41  LYS B CB  1 
ATOM   2896 C CG  . LYS B 1 41  ? 116.565 80.757  -44.789 1.00 20.48 ? 41  LYS B CG  1 
ATOM   2897 C CD  . LYS B 1 41  ? 117.017 79.757  -45.847 1.00 24.32 ? 41  LYS B CD  1 
ATOM   2898 C CE  . LYS B 1 41  ? 117.000 78.377  -45.234 1.00 28.64 ? 41  LYS B CE  1 
ATOM   2899 N NZ  . LYS B 1 41  ? 117.432 77.416  -46.214 1.00 30.60 ? 41  LYS B NZ  1 
ATOM   2900 N N   . GLU B 1 42  ? 118.860 85.061  -45.644 1.00 18.98 ? 42  GLU B N   1 
ATOM   2901 C CA  . GLU B 1 42  ? 118.938 86.409  -46.176 1.00 20.21 ? 42  GLU B CA  1 
ATOM   2902 C C   . GLU B 1 42  ? 120.406 86.780  -46.320 1.00 21.72 ? 42  GLU B C   1 
ATOM   2903 O O   . GLU B 1 42  ? 121.276 86.185  -45.695 1.00 18.87 ? 42  GLU B O   1 
ATOM   2904 C CB  . GLU B 1 42  ? 118.312 87.404  -45.230 1.00 21.35 ? 42  GLU B CB  1 
ATOM   2905 C CG  . GLU B 1 42  ? 116.828 87.240  -45.035 1.00 24.05 ? 42  GLU B CG  1 
ATOM   2906 C CD  . GLU B 1 42  ? 116.030 87.451  -46.318 1.00 30.89 ? 42  GLU B CD  1 
ATOM   2907 O OE1 . GLU B 1 42  ? 116.514 88.211  -47.210 1.00 31.88 ? 42  GLU B OE1 1 
ATOM   2908 O OE2 . GLU B 1 42  ? 114.947 86.844  -46.442 1.00 27.25 ? 42  GLU B OE2 1 
ATOM   2909 N N   . LYS B 1 43  ? 120.683 87.806  -47.128 1.00 20.39 ? 43  LYS B N   1 
ATOM   2910 C CA  . LYS B 1 43  ? 122.009 88.263  -47.305 1.00 22.91 ? 43  LYS B CA  1 
ATOM   2911 C C   . LYS B 1 43  ? 122.595 88.819  -46.059 1.00 19.75 ? 43  LYS B C   1 
ATOM   2912 O O   . LYS B 1 43  ? 121.877 89.482  -45.309 1.00 20.41 ? 43  LYS B O   1 
ATOM   2913 C CB  . LYS B 1 43  ? 122.036 89.330  -48.378 1.00 27.69 ? 43  LYS B CB  1 
ATOM   2914 C CG  . LYS B 1 43  ? 121.884 88.728  -49.757 1.00 36.13 ? 43  LYS B CG  1 
ATOM   2915 C CD  . LYS B 1 43  ? 122.151 89.772  -50.829 1.00 46.89 ? 43  LYS B CD  1 
ATOM   2916 C CE  . LYS B 1 43  ? 122.360 89.126  -52.196 1.00 51.16 ? 43  LYS B CE  1 
ATOM   2917 N NZ  . LYS B 1 43  ? 121.132 88.464  -52.696 1.00 52.91 ? 43  LYS B NZ  1 
ATOM   2918 N N   . ALA B 1 44  ? 123.919 88.770  -45.997 1.00 18.91 ? 44  ALA B N   1 
ATOM   2919 C CA  . ALA B 1 44  ? 124.661 89.258  -44.843 1.00 19.82 ? 44  ALA B CA  1 
ATOM   2920 C C   . ALA B 1 44  ? 124.577 90.746  -44.749 1.00 19.99 ? 44  ALA B C   1 
ATOM   2921 O O   . ALA B 1 44  ? 124.374 91.410  -45.760 1.00 18.58 ? 44  ALA B O   1 
ATOM   2922 C CB  . ALA B 1 44  ? 126.107 88.842  -44.927 1.00 21.38 ? 44  ALA B CB  1 
ATOM   2923 N N   . ILE B 1 45  ? 124.619 91.257  -43.538 1.00 17.99 ? 45  ILE B N   1 
ATOM   2924 C CA  . ILE B 1 45  ? 124.598 92.696  -43.297 1.00 18.65 ? 45  ILE B CA  1 
ATOM   2925 C C   . ILE B 1 45  ? 125.909 93.064  -42.656 1.00 19.61 ? 45  ILE B C   1 
ATOM   2926 O O   . ILE B 1 45  ? 126.218 92.742  -41.499 1.00 16.79 ? 45  ILE B O   1 
ATOM   2927 C CB  . ILE B 1 45  ? 123.447 93.182  -42.396 1.00 20.10 ? 45  ILE B CB  1 
ATOM   2928 C CG1 . ILE B 1 45  ? 122.081 92.882  -43.002 1.00 20.39 ? 45  ILE B CG1 1 
ATOM   2929 C CG2 . ILE B 1 45  ? 123.530 94.705  -42.183 1.00 22.06 ? 45  ILE B CG2 1 
ATOM   2930 C CD1 . ILE B 1 45  ? 120.938 93.217  -42.037 1.00 17.86 ? 45  ILE B CD1 1 
ATOM   2931 N N   . LYS B 1 46  ? 126.728 93.747  -43.452 1.00 20.50 ? 46  LYS B N   1 
ATOM   2932 C CA  . LYS B 1 46  ? 128.084 94.135  -43.085 1.00 21.60 ? 46  LYS B CA  1 
ATOM   2933 C C   . LYS B 1 46  ? 128.259 95.425  -42.388 1.00 19.90 ? 46  LYS B C   1 
ATOM   2934 O O   . LYS B 1 46  ? 129.289 95.626  -41.726 1.00 20.18 ? 46  LYS B O   1 
ATOM   2935 C CB  . LYS B 1 46  ? 128.986 94.180  -44.367 1.00 25.15 ? 46  LYS B CB  1 
ATOM   2936 C CG  . LYS B 1 46  ? 129.134 92.774  -44.930 1.00 28.85 ? 46  LYS B CG  1 
ATOM   2937 C CD  . LYS B 1 46  ? 129.948 92.728  -46.234 1.00 35.61 ? 46  LYS B CD  1 
ATOM   2938 C CE  . LYS B 1 46  ? 129.965 91.281  -46.714 1.00 43.53 ? 46  LYS B CE  1 
ATOM   2939 N NZ  . LYS B 1 46  ? 130.844 91.159  -47.899 1.00 52.42 ? 46  LYS B NZ  1 
ATOM   2940 N N   . ASN B 1 47  ? 127.323 96.345  -42.542 1.00 19.95 ? 47  ASN B N   1 
ATOM   2941 C CA  . ASN B 1 47  ? 127.378 97.698  -41.902 1.00 22.14 ? 47  ASN B CA  1 
ATOM   2942 C C   . ASN B 1 47  ? 125.993 98.006  -41.347 1.00 20.08 ? 47  ASN B C   1 
ATOM   2943 O O   . ASN B 1 47  ? 125.060 97.907  -42.113 1.00 20.15 ? 47  ASN B O   1 
ATOM   2944 C CB  . ASN B 1 47  ? 127.690 98.782  -42.954 1.00 26.21 ? 47  ASN B CB  1 
ATOM   2945 C CG  . ASN B 1 47  ? 129.111 98.676  -43.400 1.00 35.74 ? 47  ASN B CG  1 
ATOM   2946 O OD1 . ASN B 1 47  ? 129.999 99.133  -42.698 1.00 45.40 ? 47  ASN B OD1 1 
ATOM   2947 N ND2 . ASN B 1 47  ? 129.353 98.011  -44.538 1.00 41.90 ? 47  ASN B ND2 1 
ATOM   2948 N N   . HIS B 1 48  ? 125.891 98.227  -40.066 1.00 18.31 ? 48  HIS B N   1 
ATOM   2949 C CA  . HIS B 1 48  ? 124.589 98.378  -39.440 1.00 18.94 ? 48  HIS B CA  1 
ATOM   2950 C C   . HIS B 1 48  ? 124.755 99.195  -38.205 1.00 17.55 ? 48  HIS B C   1 
ATOM   2951 O O   . HIS B 1 48  ? 125.887 99.590  -37.804 1.00 16.67 ? 48  HIS B O   1 
ATOM   2952 C CB  . HIS B 1 48  ? 124.001 96.995  -39.168 1.00 18.47 ? 48  HIS B CB  1 
ATOM   2953 C CG  . HIS B 1 48  ? 124.907 96.127  -38.388 1.00 16.57 ? 48  HIS B CG  1 
ATOM   2954 N ND1 . HIS B 1 48  ? 125.153 96.314  -37.052 1.00 17.64 ? 48  HIS B ND1 1 
ATOM   2955 C CD2 . HIS B 1 48  ? 125.786 95.190  -38.791 1.00 17.06 ? 48  HIS B CD2 1 
ATOM   2956 C CE1 . HIS B 1 48  ? 126.094 95.491  -36.661 1.00 18.39 ? 48  HIS B CE1 1 
ATOM   2957 N NE2 . HIS B 1 48  ? 126.527 94.841  -37.710 1.00 17.91 ? 48  HIS B NE2 1 
ATOM   2958 N N   . LYS B 1 49  ? 123.657 99.366  -37.465 1.00 16.58 ? 49  LYS B N   1 
ATOM   2959 C CA  . LYS B 1 49  ? 123.723 100.028 -36.221 1.00 15.30 ? 49  LYS B CA  1 
ATOM   2960 C C   . LYS B 1 49  ? 124.382 99.204  -35.123 1.00 16.55 ? 49  LYS B C   1 
ATOM   2961 O O   . LYS B 1 49  ? 124.274 97.994  -35.083 1.00 16.05 ? 49  LYS B O   1 
ATOM   2962 C CB  . LYS B 1 49  ? 122.273 100.415 -35.809 1.00 17.15 ? 49  LYS B CB  1 
ATOM   2963 C CG  . LYS B 1 49  ? 121.648 101.451 -36.778 1.00 17.84 ? 49  LYS B CG  1 
ATOM   2964 C CD  . LYS B 1 49  ? 120.103 101.572 -36.647 1.00 18.53 ? 49  LYS B CD  1 
ATOM   2965 C CE  . LYS B 1 49  ? 119.537 102.431 -37.774 1.00 18.75 ? 49  LYS B CE  1 
ATOM   2966 N NZ  . LYS B 1 49  ? 120.159 103.806 -37.735 1.00 19.37 ? 49  LYS B NZ  1 
ATOM   2967 N N   . SER B 1 50  ? 125.116 99.828  -34.242 1.00 15.26 ? 50  SER B N   1 
ATOM   2968 C CA  . SER B 1 50  ? 125.716 99.069  -33.164 1.00 15.88 ? 50  SER B CA  1 
ATOM   2969 C C   . SER B 1 50  ? 124.682 98.766  -32.046 1.00 15.76 ? 50  SER B C   1 
ATOM   2970 O O   . SER B 1 50  ? 123.716 99.488  -31.899 1.00 15.59 ? 50  SER B O   1 
ATOM   2971 C CB  . SER B 1 50  ? 126.912 99.783  -32.578 1.00 17.82 ? 50  SER B CB  1 
ATOM   2972 O OG  . SER B 1 50  ? 126.494 101.007 -32.070 1.00 20.07 ? 50  SER B OG  1 
ATOM   2973 N N   . LEU B 1 51  ? 124.956 97.728  -31.292 1.00 16.98 ? 51  LEU B N   1 
ATOM   2974 C CA  . LEU B 1 51  ? 124.065 97.198  -30.273 1.00 16.88 ? 51  LEU B CA  1 
ATOM   2975 C C   . LEU B 1 51  ? 124.800 97.011  -28.987 1.00 16.63 ? 51  LEU B C   1 
ATOM   2976 O O   . LEU B 1 51  ? 125.974 96.554  -28.956 1.00 15.88 ? 51  LEU B O   1 
ATOM   2977 C CB  . LEU B 1 51  ? 123.504 95.811  -30.713 1.00 19.60 ? 51  LEU B CB  1 
ATOM   2978 C CG  . LEU B 1 51  ? 122.882 95.551  -32.096 1.00 23.42 ? 51  LEU B CG  1 
ATOM   2979 C CD1 . LEU B 1 51  ? 121.993 94.298  -31.964 1.00 28.62 ? 51  LEU B CD1 1 
ATOM   2980 C CD2 . LEU B 1 51  ? 122.023 96.629  -32.592 1.00 22.37 ? 51  LEU B CD2 1 
ATOM   2981 N N   . ILE B 1 52  ? 124.077 97.224  -27.882 1.00 13.85 ? 52  ILE B N   1 
ATOM   2982 C CA  . ILE B 1 52  ? 124.526 96.712  -26.605 1.00 15.40 ? 52  ILE B CA  1 
ATOM   2983 C C   . ILE B 1 52  ? 123.361 95.955  -25.984 1.00 16.08 ? 52  ILE B C   1 
ATOM   2984 O O   . ILE B 1 52  ? 122.241 96.457  -26.036 1.00 15.04 ? 52  ILE B O   1 
ATOM   2985 C CB  . ILE B 1 52  ? 124.988 97.820  -25.656 1.00 15.51 ? 52  ILE B CB  1 
ATOM   2986 C CG1 . ILE B 1 52  ? 125.513 97.236  -24.363 1.00 16.52 ? 52  ILE B CG1 1 
ATOM   2987 C CG2 . ILE B 1 52  ? 123.939 98.902  -25.466 1.00 15.14 ? 52  ILE B CG2 1 
ATOM   2988 C CD1 . ILE B 1 52  ? 126.357 98.201  -23.547 1.00 17.80 ? 52  ILE B CD1 1 
ATOM   2989 N N   . GLY B 1 53  ? 123.631 94.820  -25.409 1.00 15.44 ? 53  GLY B N   1 
ATOM   2990 C CA  . GLY B 1 53  ? 122.558 94.047  -24.766 1.00 15.56 ? 53  GLY B CA  1 
ATOM   2991 C C   . GLY B 1 53  ? 123.093 92.919  -23.929 1.00 15.25 ? 53  GLY B C   1 
ATOM   2992 O O   . GLY B 1 53  ? 124.306 92.862  -23.640 1.00 15.30 ? 53  GLY B O   1 
ATOM   2993 N N   . VAL B 1 54  ? 122.185 92.034  -23.536 1.00 15.21 ? 54  VAL B N   1 
ATOM   2994 C CA  . VAL B 1 54  ? 122.484 90.888  -22.700 1.00 14.10 ? 54  VAL B CA  1 
ATOM   2995 C C   . VAL B 1 54  ? 122.132 89.634  -23.446 1.00 14.21 ? 54  VAL B C   1 
ATOM   2996 O O   . VAL B 1 54  ? 121.054 89.525  -24.042 1.00 14.12 ? 54  VAL B O   1 
ATOM   2997 C CB  . VAL B 1 54  ? 121.725 90.950  -21.371 1.00 14.59 ? 54  VAL B CB  1 
ATOM   2998 C CG1 . VAL B 1 54  ? 122.116 89.760  -20.478 1.00 14.08 ? 54  VAL B CG1 1 
ATOM   2999 C CG2 . VAL B 1 54  ? 122.051 92.273  -20.670 1.00 15.46 ? 54  VAL B CG2 1 
ATOM   3000 N N   . GLY B 1 55  ? 123.030 88.661  -23.390 1.00 13.14 ? 55  GLY B N   1 
ATOM   3001 C CA  . GLY B 1 55  ? 122.763 87.366  -24.048 1.00 13.79 ? 55  GLY B CA  1 
ATOM   3002 C C   . GLY B 1 55  ? 123.873 86.369  -23.863 1.00 14.07 ? 55  GLY B C   1 
ATOM   3003 O O   . GLY B 1 55  ? 124.670 86.477  -22.871 1.00 15.70 ? 55  GLY B O   1 
ATOM   3004 N N   . ILE B 1 56  ? 123.968 85.403  -24.789 1.00 16.07 ? 56  ILE B N   1 
ATOM   3005 C CA  . ILE B 1 56  ? 125.085 84.488  -24.794 1.00 16.02 ? 56  ILE B CA  1 
ATOM   3006 C C   . ILE B 1 56  ? 125.692 84.529  -26.190 1.00 16.84 ? 56  ILE B C   1 
ATOM   3007 O O   . ILE B 1 56  ? 125.065 84.940  -27.145 1.00 14.93 ? 56  ILE B O   1 
ATOM   3008 C CB  . ILE B 1 56  ? 124.697 83.021  -24.416 1.00 19.65 ? 56  ILE B CB  1 
ATOM   3009 C CG1 . ILE B 1 56  ? 123.744 82.410  -25.427 1.00 19.43 ? 56  ILE B CG1 1 
ATOM   3010 C CG2 . ILE B 1 56  ? 124.187 82.951  -22.995 1.00 20.54 ? 56  ILE B CG2 1 
ATOM   3011 C CD1 . ILE B 1 56  ? 123.524 80.942  -25.277 1.00 24.59 ? 56  ILE B CD1 1 
ATOM   3012 N N   . VAL B 1 57  ? 126.954 84.162  -26.316 1.00 15.94 ? 57  VAL B N   1 
ATOM   3013 C CA  . VAL B 1 57  ? 127.567 84.084  -27.624 1.00 17.53 ? 57  VAL B CA  1 
ATOM   3014 C C   . VAL B 1 57  ? 127.783 82.613  -27.903 1.00 18.50 ? 57  VAL B C   1 
ATOM   3015 O O   . VAL B 1 57  ? 128.378 81.913  -27.092 1.00 17.78 ? 57  VAL B O   1 
ATOM   3016 C CB  . VAL B 1 57  ? 128.911 84.889  -27.706 1.00 19.49 ? 57  VAL B CB  1 
ATOM   3017 C CG1 . VAL B 1 57  ? 129.617 84.701  -29.031 1.00 18.32 ? 57  VAL B CG1 1 
ATOM   3018 C CG2 . VAL B 1 57  ? 128.703 86.389  -27.527 1.00 20.86 ? 57  VAL B CG2 1 
ATOM   3019 N N   . ALA B 1 58  ? 127.414 82.179  -29.086 1.00 19.75 ? 58  ALA B N   1 
ATOM   3020 C CA  . ALA B 1 58  ? 127.654 80.812  -29.531 1.00 21.02 ? 58  ALA B CA  1 
ATOM   3021 C C   . ALA B 1 58  ? 128.062 80.846  -30.964 1.00 19.07 ? 58  ALA B C   1 
ATOM   3022 O O   . ALA B 1 58  ? 127.466 81.537  -31.756 1.00 18.13 ? 58  ALA B O   1 
ATOM   3023 C CB  . ALA B 1 58  ? 126.409 79.952  -29.374 1.00 22.07 ? 58  ALA B CB  1 
ATOM   3024 N N   A ASN B 1 59  ? 129.133 80.107  -31.294 0.53 20.00 ? 59  ASN B N   1 
ATOM   3025 N N   B ASN B 1 59  ? 129.114 80.094  -31.284 0.47 19.12 ? 59  ASN B N   1 
ATOM   3026 C CA  A ASN B 1 59  ? 129.737 80.132  -32.643 0.53 20.97 ? 59  ASN B CA  1 
ATOM   3027 C CA  B ASN B 1 59  ? 129.740 80.132  -32.617 0.47 19.56 ? 59  ASN B CA  1 
ATOM   3028 C C   A ASN B 1 59  ? 129.907 81.584  -33.163 0.53 18.90 ? 59  ASN B C   1 
ATOM   3029 C C   B ASN B 1 59  ? 129.891 81.573  -33.162 0.47 18.17 ? 59  ASN B C   1 
ATOM   3030 O O   A ASN B 1 59  ? 129.602 81.886  -34.303 0.53 18.74 ? 59  ASN B O   1 
ATOM   3031 O O   B ASN B 1 59  ? 129.551 81.842  -34.328 0.47 17.90 ? 59  ASN B O   1 
ATOM   3032 C CB  A ASN B 1 59  ? 128.932 79.265  -33.620 0.53 23.34 ? 59  ASN B CB  1 
ATOM   3033 C CB  B ASN B 1 59  ? 129.008 79.242  -33.623 0.47 20.83 ? 59  ASN B CB  1 
ATOM   3034 C CG  A ASN B 1 59  ? 128.829 77.811  -33.170 0.53 26.48 ? 59  ASN B CG  1 
ATOM   3035 C CG  B ASN B 1 59  ? 129.880 78.890  -34.819 0.47 22.33 ? 59  ASN B CG  1 
ATOM   3036 O OD1 A ASN B 1 59  ? 129.762 77.257  -32.576 0.53 31.58 ? 59  ASN B OD1 1 
ATOM   3037 O OD1 B ASN B 1 59  ? 131.102 78.984  -34.773 0.47 24.59 ? 59  ASN B OD1 1 
ATOM   3038 N ND2 A ASN B 1 59  ? 127.676 77.212  -33.397 0.53 26.65 ? 59  ASN B ND2 1 
ATOM   3039 N ND2 B ASN B 1 59  ? 129.256 78.487  -35.881 0.47 22.56 ? 59  ASN B ND2 1 
ATOM   3040 N N   . ASP B 1 60  ? 130.364 82.458  -32.290 1.00 15.96 ? 60  ASP B N   1 
ATOM   3041 C CA  . ASP B 1 60  ? 130.670 83.876  -32.600 1.00 16.96 ? 60  ASP B CA  1 
ATOM   3042 C C   . ASP B 1 60  ? 129.434 84.664  -33.033 1.00 16.48 ? 60  ASP B C   1 
ATOM   3043 O O   . ASP B 1 60  ? 129.566 85.615  -33.805 1.00 18.36 ? 60  ASP B O   1 
ATOM   3044 C CB  . ASP B 1 60  ? 131.790 84.038  -33.684 1.00 16.09 ? 60  ASP B CB  1 
ATOM   3045 C CG  . ASP B 1 60  ? 132.334 85.443  -33.755 1.00 16.53 ? 60  ASP B CG  1 
ATOM   3046 O OD1 . ASP B 1 60  ? 132.467 86.096  -32.703 1.00 18.57 ? 60  ASP B OD1 1 
ATOM   3047 O OD2 . ASP B 1 60  ? 132.467 85.930  -34.867 1.00 17.53 ? 60  ASP B OD2 1 
ATOM   3048 N N   . TYR B 1 61  ? 128.249 84.218  -32.567 1.00 16.46 ? 61  TYR B N   1 
ATOM   3049 C CA  . TYR B 1 61  ? 126.955 84.860  -32.892 1.00 15.73 ? 61  TYR B CA  1 
ATOM   3050 C C   . TYR B 1 61  ? 126.343 85.395  -31.582 1.00 15.48 ? 61  TYR B C   1 
ATOM   3051 O O   . TYR B 1 61  ? 126.322 84.687  -30.610 1.00 14.89 ? 61  TYR B O   1 
ATOM   3052 C CB  . TYR B 1 61  ? 126.002 83.879  -33.566 1.00 16.24 ? 61  TYR B CB  1 
ATOM   3053 C CG  . TYR B 1 61  ? 124.822 84.604  -34.168 1.00 14.25 ? 61  TYR B CG  1 
ATOM   3054 C CD1 . TYR B 1 61  ? 124.903 85.199  -35.459 1.00 14.31 ? 61  TYR B CD1 1 
ATOM   3055 C CD2 . TYR B 1 61  ? 123.681 84.772  -33.462 1.00 15.18 ? 61  TYR B CD2 1 
ATOM   3056 C CE1 . TYR B 1 61  ? 123.898 85.987  -35.950 1.00 15.38 ? 61  TYR B CE1 1 
ATOM   3057 C CE2 . TYR B 1 61  ? 122.597 85.445  -34.001 1.00 13.37 ? 61  TYR B CE2 1 
ATOM   3058 C CZ  . TYR B 1 61  ? 122.695 86.066  -35.227 1.00 15.00 ? 61  TYR B CZ  1 
ATOM   3059 O OH  . TYR B 1 61  ? 121.674 86.799  -35.749 1.00 15.86 ? 61  TYR B OH  1 
ATOM   3060 N N   . PRO B 1 62  ? 125.860 86.622  -31.561 1.00 15.03 ? 62  PRO B N   1 
ATOM   3061 C CA  . PRO B 1 62  ? 125.293 87.158  -30.349 1.00 14.45 ? 62  PRO B CA  1 
ATOM   3062 C C   . PRO B 1 62  ? 123.816 86.773  -30.230 1.00 14.51 ? 62  PRO B C   1 
ATOM   3063 O O   . PRO B 1 62  ? 123.004 87.338  -30.969 1.00 14.94 ? 62  PRO B O   1 
ATOM   3064 C CB  . PRO B 1 62  ? 125.471 88.664  -30.536 1.00 14.34 ? 62  PRO B CB  1 
ATOM   3065 C CG  . PRO B 1 62  ? 125.330 88.881  -32.025 1.00 13.39 ? 62  PRO B CG  1 
ATOM   3066 C CD  . PRO B 1 62  ? 125.925 87.637  -32.666 1.00 15.01 ? 62  PRO B CD  1 
ATOM   3067 N N   . LEU B 1 63  ? 123.491 85.893  -29.289 1.00 12.88 ? 63  LEU B N   1 
ATOM   3068 C CA  . LEU B 1 63  ? 122.129 85.459  -29.061 1.00 13.79 ? 63  LEU B CA  1 
ATOM   3069 C C   . LEU B 1 63  ? 121.596 86.316  -27.924 1.00 13.83 ? 63  LEU B C   1 
ATOM   3070 O O   . LEU B 1 63  ? 121.634 85.969  -26.765 1.00 13.94 ? 63  LEU B O   1 
ATOM   3071 C CB  . LEU B 1 63  ? 122.099 83.948  -28.715 1.00 14.00 ? 63  LEU B CB  1 
ATOM   3072 C CG  . LEU B 1 63  ? 122.616 83.064  -29.837 1.00 15.12 ? 63  LEU B CG  1 
ATOM   3073 C CD1 . LEU B 1 63  ? 122.895 81.662  -29.340 1.00 17.07 ? 63  LEU B CD1 1 
ATOM   3074 C CD2 . LEU B 1 63  ? 121.582 83.017  -30.945 1.00 15.52 ? 63  LEU B CD2 1 
ATOM   3075 N N   . TYR B 1 64  ? 121.017 87.439  -28.324 1.00 13.49 ? 64  TYR B N   1 
ATOM   3076 C CA  . TYR B 1 64  ? 120.493 88.420  -27.376 1.00 14.63 ? 64  TYR B CA  1 
ATOM   3077 C C   . TYR B 1 64  ? 119.145 87.974  -26.746 1.00 14.02 ? 64  TYR B C   1 
ATOM   3078 O O   . TYR B 1 64  ? 118.183 87.598  -27.498 1.00 15.21 ? 64  TYR B O   1 
ATOM   3079 C CB  . TYR B 1 64  ? 120.293 89.741  -28.096 1.00 14.13 ? 64  TYR B CB  1 
ATOM   3080 C CG  . TYR B 1 64  ? 121.546 90.531  -28.273 1.00 14.13 ? 64  TYR B CG  1 
ATOM   3081 C CD1 . TYR B 1 64  ? 122.217 91.065  -27.185 1.00 14.23 ? 64  TYR B CD1 1 
ATOM   3082 C CD2 . TYR B 1 64  ? 122.004 90.848  -29.553 1.00 13.13 ? 64  TYR B CD2 1 
ATOM   3083 C CE1 . TYR B 1 64  ? 123.354 91.824  -27.385 1.00 14.79 ? 64  TYR B CE1 1 
ATOM   3084 C CE2 . TYR B 1 64  ? 123.160 91.574  -29.740 1.00 14.08 ? 64  TYR B CE2 1 
ATOM   3085 C CZ  . TYR B 1 64  ? 123.790 92.119  -28.676 1.00 13.66 ? 64  TYR B CZ  1 
ATOM   3086 O OH  . TYR B 1 64  ? 124.932 92.874  -28.856 1.00 14.33 ? 64  TYR B OH  1 
ATOM   3087 N N   . PHE B 1 65  ? 119.049 88.144  -25.453 1.00 13.39 ? 65  PHE B N   1 
ATOM   3088 C CA  . PHE B 1 65  ? 117.701 88.149  -24.747 1.00 15.34 ? 65  PHE B CA  1 
ATOM   3089 C C   . PHE B 1 65  ? 117.028 89.516  -24.866 1.00 14.65 ? 65  PHE B C   1 
ATOM   3090 O O   . PHE B 1 65  ? 115.789 89.593  -24.918 1.00 13.85 ? 65  PHE B O   1 
ATOM   3091 C CB  . PHE B 1 65  ? 117.846 87.830  -23.254 1.00 17.95 ? 65  PHE B CB  1 
ATOM   3092 C CG  . PHE B 1 65  ? 118.556 86.530  -22.935 1.00 20.04 ? 65  PHE B CG  1 
ATOM   3093 C CD1 . PHE B 1 65  ? 117.998 85.313  -23.269 1.00 29.33 ? 65  PHE B CD1 1 
ATOM   3094 C CD2 . PHE B 1 65  ? 119.742 86.534  -22.219 1.00 21.73 ? 65  PHE B CD2 1 
ATOM   3095 C CE1 . PHE B 1 65  ? 118.672 84.119  -23.006 1.00 28.94 ? 65  PHE B CE1 1 
ATOM   3096 C CE2 . PHE B 1 65  ? 120.407 85.341  -21.959 1.00 22.92 ? 65  PHE B CE2 1 
ATOM   3097 C CZ  . PHE B 1 65  ? 119.858 84.151  -22.321 1.00 26.84 ? 65  PHE B CZ  1 
ATOM   3098 N N   . ASP B 1 66  ? 117.836 90.566  -24.894 1.00 13.11 ? 66  ASP B N   1 
ATOM   3099 C CA  . ASP B 1 66  ? 117.398 91.872  -25.052 1.00 12.97 ? 66  ASP B CA  1 
ATOM   3100 C C   . ASP B 1 66  ? 118.580 92.743  -25.426 1.00 13.80 ? 66  ASP B C   1 
ATOM   3101 O O   . ASP B 1 66  ? 119.749 92.385  -25.198 1.00 13.69 ? 66  ASP B O   1 
ATOM   3102 C CB  . ASP B 1 66  ? 116.708 92.408  -23.763 1.00 13.33 ? 66  ASP B CB  1 
ATOM   3103 C CG  . ASP B 1 66  ? 117.491 92.153  -22.536 1.00 13.09 ? 66  ASP B CG  1 
ATOM   3104 O OD1 . ASP B 1 66  ? 118.464 92.930  -22.271 1.00 13.82 ? 66  ASP B OD1 1 
ATOM   3105 O OD2 . ASP B 1 66  ? 117.181 91.174  -21.803 1.00 12.53 ? 66  ASP B OD2 1 
ATOM   3106 N N   . ALA B 1 67  ? 118.288 93.877  -26.042 1.00 13.63 ? 67  ALA B N   1 
ATOM   3107 C CA  . ALA B 1 67  ? 119.354 94.779  -26.527 1.00 14.62 ? 67  ALA B CA  1 
ATOM   3108 C C   . ALA B 1 67  ? 118.769 96.146  -26.873 1.00 14.94 ? 67  ALA B C   1 
ATOM   3109 O O   . ALA B 1 67  ? 117.544 96.281  -27.042 1.00 14.04 ? 67  ALA B O   1 
ATOM   3110 C CB  . ALA B 1 67  ? 120.069 94.197  -27.717 1.00 13.88 ? 67  ALA B CB  1 
ATOM   3111 N N   . ILE B 1 68  ? 119.649 97.158  -26.960 1.00 14.74 ? 68  ILE B N   1 
ATOM   3112 C CA  . ILE B 1 68  ? 119.307 98.418  -27.598 1.00 13.36 ? 68  ILE B CA  1 
ATOM   3113 C C   . ILE B 1 68  ? 120.346 98.733  -28.685 1.00 14.87 ? 68  ILE B C   1 
ATOM   3114 O O   . ILE B 1 68  ? 121.424 98.128  -28.682 1.00 13.71 ? 68  ILE B O   1 
ATOM   3115 C CB  . ILE B 1 68  ? 119.223 99.594  -26.618 1.00 14.19 ? 68  ILE B CB  1 
ATOM   3116 C CG1 . ILE B 1 68  ? 120.575 99.951  -26.027 1.00 14.84 ? 68  ILE B CG1 1 
ATOM   3117 C CG2 . ILE B 1 68  ? 118.218 99.286  -25.513 1.00 15.52 ? 68  ILE B CG2 1 
ATOM   3118 C CD1 . ILE B 1 68  ? 120.661 101.296 -25.350 1.00 14.66 ? 68  ILE B CD1 1 
ATOM   3119 N N   . ASN B 1 69  ? 120.022 99.665  -29.574 1.00 14.20 ? 69  ASN B N   1 
ATOM   3120 C CA  . ASN B 1 69  ? 120.970 100.088 -30.612 1.00 14.08 ? 69  ASN B CA  1 
ATOM   3121 C C   . ASN B 1 69  ? 121.408 101.505 -30.348 1.00 16.04 ? 69  ASN B C   1 
ATOM   3122 O O   . ASN B 1 69  ? 121.001 102.132 -29.349 1.00 15.51 ? 69  ASN B O   1 
ATOM   3123 C CB  . ASN B 1 69  ? 120.436 99.858  -32.014 1.00 14.08 ? 69  ASN B CB  1 
ATOM   3124 C CG  . ASN B 1 69  ? 119.296 100.779 -32.389 1.00 14.93 ? 69  ASN B CG  1 
ATOM   3125 O OD1 . ASN B 1 69  ? 119.036 101.837 -31.729 1.00 16.82 ? 69  ASN B OD1 1 
ATOM   3126 N ND2 . ASN B 1 69  ? 118.669 100.445 -33.473 1.00 14.22 ? 69  ASN B ND2 1 
ATOM   3127 N N   . GLU B 1 70  ? 122.312 101.996 -31.176 1.00 16.06 ? 70  GLU B N   1 
ATOM   3128 C CA  . GLU B 1 70  ? 122.901 103.316 -30.988 1.00 18.55 ? 70  GLU B CA  1 
ATOM   3129 C C   . GLU B 1 70  ? 121.879 104.438 -31.117 1.00 18.35 ? 70  GLU B C   1 
ATOM   3130 O O   . GLU B 1 70  ? 122.178 105.579 -30.756 1.00 18.59 ? 70  GLU B O   1 
ATOM   3131 C CB  . GLU B 1 70  ? 123.995 103.493 -32.059 1.00 18.74 ? 70  GLU B CB  1 
ATOM   3132 C CG  . GLU B 1 70  ? 123.443 103.554 -33.447 1.00 18.22 ? 70  GLU B CG  1 
ATOM   3133 C CD  . GLU B 1 70  ? 124.491 103.520 -34.558 1.00 24.47 ? 70  GLU B CD  1 
ATOM   3134 O OE1 . GLU B 1 70  ? 125.402 102.670 -34.544 1.00 19.88 ? 70  GLU B OE1 1 
ATOM   3135 O OE2 . GLU B 1 70  ? 124.304 104.303 -35.543 1.00 27.13 ? 70  GLU B OE2 1 
ATOM   3136 N N   . ASP B 1 71  ? 120.700 104.171 -31.627 1.00 16.33 ? 71  ASP B N   1 
ATOM   3137 C CA  . ASP B 1 71  ? 119.655 105.181 -31.753 1.00 16.98 ? 71  ASP B CA  1 
ATOM   3138 C C   . ASP B 1 71  ? 118.689 105.135 -30.540 1.00 18.90 ? 71  ASP B C   1 
ATOM   3139 O O   . ASP B 1 71  ? 117.749 105.931 -30.481 1.00 19.17 ? 71  ASP B O   1 
ATOM   3140 C CB  . ASP B 1 71  ? 118.873 105.000 -33.021 1.00 18.61 ? 71  ASP B CB  1 
ATOM   3141 C CG  . ASP B 1 71  ? 119.702 105.180 -34.268 1.00 20.93 ? 71  ASP B CG  1 
ATOM   3142 O OD1 . ASP B 1 71  ? 120.579 106.028 -34.197 1.00 24.32 ? 71  ASP B OD1 1 
ATOM   3143 O OD2 . ASP B 1 71  ? 119.445 104.496 -35.269 1.00 21.95 ? 71  ASP B OD2 1 
ATOM   3144 N N   . GLY B 1 72  ? 118.893 104.241 -29.585 1.00 15.98 ? 72  GLY B N   1 
ATOM   3145 C CA  . GLY B 1 72  ? 117.977 104.186 -28.480 1.00 17.72 ? 72  GLY B CA  1 
ATOM   3146 C C   . GLY B 1 72  ? 116.701 103.431 -28.818 1.00 16.64 ? 72  GLY B C   1 
ATOM   3147 O O   . GLY B 1 72  ? 115.683 103.634 -28.127 1.00 16.46 ? 72  GLY B O   1 
ATOM   3148 N N   . LEU B 1 73  ? 116.753 102.519 -29.779 1.00 14.56 ? 73  LEU B N   1 
ATOM   3149 C CA  . LEU B 1 73  ? 115.664 101.578 -30.021 1.00 15.94 ? 73  LEU B CA  1 
ATOM   3150 C C   . LEU B 1 73  ? 116.003 100.262 -29.294 1.00 15.84 ? 73  LEU B C   1 
ATOM   3151 O O   . LEU B 1 73  ? 117.121 99.709  -29.448 1.00 13.79 ? 73  LEU B O   1 
ATOM   3152 C CB  . LEU B 1 73  ? 115.498 101.269 -31.505 1.00 15.53 ? 73  LEU B CB  1 
ATOM   3153 C CG  . LEU B 1 73  ? 114.358 100.333 -31.867 1.00 14.38 ? 73  LEU B CG  1 
ATOM   3154 C CD1 . LEU B 1 73  ? 113.001 100.908 -31.539 1.00 16.40 ? 73  LEU B CD1 1 
ATOM   3155 C CD2 . LEU B 1 73  ? 114.432 99.960  -33.349 1.00 15.90 ? 73  LEU B CD2 1 
ATOM   3156 N N   . GLY B 1 74  ? 115.040 99.781  -28.509 1.00 15.00 ? 74  GLY B N   1 
ATOM   3157 C CA  . GLY B 1 74  ? 115.188 98.578  -27.720 1.00 15.40 ? 74  GLY B CA  1 
ATOM   3158 C C   . GLY B 1 74  ? 114.284 97.446  -28.212 1.00 13.32 ? 74  GLY B C   1 
ATOM   3159 O O   . GLY B 1 74  ? 113.172 97.676  -28.670 1.00 12.82 ? 74  GLY B O   1 
ATOM   3160 N N   . MET B 1 75  ? 114.722 96.194  -28.001 1.00 13.36 ? 75  MET B N   1 
ATOM   3161 C CA  . MET B 1 75  ? 113.916 95.041  -28.238 1.00 13.17 ? 75  MET B CA  1 
ATOM   3162 C C   . MET B 1 75  ? 114.256 93.930  -27.210 1.00 13.19 ? 75  MET B C   1 
ATOM   3163 O O   . MET B 1 75  ? 115.444 93.663  -26.881 1.00 11.97 ? 75  MET B O   1 
ATOM   3164 C CB  . MET B 1 75  ? 114.165 94.529  -29.677 1.00 13.57 ? 75  MET B CB  1 
ATOM   3165 C CG  . MET B 1 75  ? 113.281 93.384  -30.129 1.00 12.89 ? 75  MET B CG  1 
ATOM   3166 S SD  . MET B 1 75  ? 113.464 93.285  -31.909 1.00 14.23 ? 75  MET B SD  1 
ATOM   3167 C CE  . MET B 1 75  ? 112.560 91.774  -32.299 1.00 13.98 ? 75  MET B CE  1 
ATOM   3168 N N   . ALA B 1 76  ? 113.204 93.273  -26.721 1.00 14.36 ? 76  ALA B N   1 
ATOM   3169 C CA  . ALA B 1 76  ? 113.364 92.150  -25.790 1.00 14.44 ? 76  ALA B CA  1 
ATOM   3170 C C   . ALA B 1 76  ? 112.517 90.974  -26.215 1.00 13.96 ? 76  ALA B C   1 
ATOM   3171 O O   . ALA B 1 76  ? 111.361 91.173  -26.590 1.00 13.91 ? 76  ALA B O   1 
ATOM   3172 C CB  . ALA B 1 76  ? 113.003 92.582  -24.371 1.00 15.65 ? 76  ALA B CB  1 
ATOM   3173 N N   . GLY B 1 77  ? 113.072 89.765  -26.101 1.00 12.55 ? 77  GLY B N   1 
ATOM   3174 C CA  . GLY B 1 77  ? 112.345 88.515  -26.361 1.00 11.98 ? 77  GLY B CA  1 
ATOM   3175 C C   . GLY B 1 77  ? 111.930 87.947  -25.024 1.00 12.71 ? 77  GLY B C   1 
ATOM   3176 O O   . GLY B 1 77  ? 112.767 87.812  -24.110 1.00 13.80 ? 77  GLY B O   1 
ATOM   3177 N N   . LEU B 1 78  ? 110.628 87.663  -24.887 1.00 13.36 ? 78  LEU B N   1 
ATOM   3178 C CA  . LEU B 1 78  ? 110.024 87.110  -23.654 1.00 12.98 ? 78  LEU B CA  1 
ATOM   3179 C C   . LEU B 1 78  ? 109.327 85.805  -23.959 1.00 13.69 ? 78  LEU B C   1 
ATOM   3180 O O   . LEU B 1 78  ? 108.729 85.660  -25.028 1.00 12.48 ? 78  LEU B O   1 
ATOM   3181 C CB  . LEU B 1 78  ? 109.043 88.113  -23.023 1.00 14.47 ? 78  LEU B CB  1 
ATOM   3182 C CG  . LEU B 1 78  ? 109.653 89.339  -22.332 1.00 14.47 ? 78  LEU B CG  1 
ATOM   3183 C CD1 . LEU B 1 78  ? 110.185 90.335  -23.338 1.00 16.20 ? 78  LEU B CD1 1 
ATOM   3184 C CD2 . LEU B 1 78  ? 108.616 90.016  -21.472 1.00 15.57 ? 78  LEU B CD2 1 
ATOM   3185 N N   . ASN B 1 79  ? 109.402 84.829  -23.042 1.00 14.84 ? 79  ASN B N   1 
ATOM   3186 C CA  . ASN B 1 79  ? 108.782 83.541  -23.311 1.00 16.39 ? 79  ASN B CA  1 
ATOM   3187 C C   . ASN B 1 79  ? 107.295 83.669  -23.608 1.00 13.84 ? 79  ASN B C   1 
ATOM   3188 O O   . ASN B 1 79  ? 106.595 84.480  -23.047 1.00 13.69 ? 79  ASN B O   1 
ATOM   3189 C CB  . ASN B 1 79  ? 109.037 82.579  -22.154 1.00 18.57 ? 79  ASN B CB  1 
ATOM   3190 C CG  . ASN B 1 79  ? 110.447 82.101  -22.173 1.00 31.65 ? 79  ASN B CG  1 
ATOM   3191 O OD1 . ASN B 1 79  ? 111.011 81.764  -23.240 1.00 31.42 ? 79  ASN B OD1 1 
ATOM   3192 N ND2 . ASN B 1 79  ? 111.065 82.101  -21.008 1.00 37.94 ? 79  ASN B ND2 1 
ATOM   3193 N N   . PHE B 1 80  ? 106.863 82.856  -24.578 1.00 14.41 ? 80  PHE B N   1 
ATOM   3194 C CA  . PHE B 1 80  ? 105.478 82.898  -25.119 1.00 14.70 ? 80  PHE B CA  1 
ATOM   3195 C C   . PHE B 1 80  ? 105.159 81.467  -25.608 1.00 15.85 ? 80  PHE B C   1 
ATOM   3196 O O   . PHE B 1 80  ? 104.961 81.251  -26.788 1.00 16.57 ? 80  PHE B O   1 
ATOM   3197 C CB  . PHE B 1 80  ? 105.499 83.906  -26.280 1.00 15.65 ? 80  PHE B CB  1 
ATOM   3198 C CG  . PHE B 1 80  ? 104.165 84.339  -26.794 1.00 15.76 ? 80  PHE B CG  1 
ATOM   3199 C CD1 . PHE B 1 80  ? 103.222 84.868  -25.942 1.00 16.59 ? 80  PHE B CD1 1 
ATOM   3200 C CD2 . PHE B 1 80  ? 103.900 84.303  -28.185 1.00 16.56 ? 80  PHE B CD2 1 
ATOM   3201 C CE1 . PHE B 1 80  ? 101.985 85.297  -26.439 1.00 18.03 ? 80  PHE B CE1 1 
ATOM   3202 C CE2 . PHE B 1 80  ? 102.699 84.783  -28.676 1.00 18.59 ? 80  PHE B CE2 1 
ATOM   3203 C CZ  . PHE B 1 80  ? 101.758 85.295  -27.786 1.00 17.34 ? 80  PHE B CZ  1 
ATOM   3204 N N   . PRO B 1 81  ? 105.137 80.499  -24.709 1.00 16.74 ? 81  PRO B N   1 
ATOM   3205 C CA  . PRO B 1 81  ? 105.161 79.114  -25.138 1.00 16.51 ? 81  PRO B CA  1 
ATOM   3206 C C   . PRO B 1 81  ? 103.836 78.699  -25.736 1.00 20.41 ? 81  PRO B C   1 
ATOM   3207 O O   . PRO B 1 81  ? 102.778 79.168  -25.294 1.00 17.57 ? 81  PRO B O   1 
ATOM   3208 C CB  . PRO B 1 81  ? 105.379 78.319  -23.818 1.00 17.77 ? 81  PRO B CB  1 
ATOM   3209 C CG  . PRO B 1 81  ? 104.952 79.233  -22.667 1.00 19.37 ? 81  PRO B CG  1 
ATOM   3210 C CD  . PRO B 1 81  ? 105.223 80.638  -23.206 1.00 17.84 ? 81  PRO B CD  1 
ATOM   3211 N N   . GLY B 1 82  ? 103.871 77.836  -26.744 1.00 18.86 ? 82  GLY B N   1 
ATOM   3212 C CA  . GLY B 1 82  ? 102.616 77.367  -27.376 1.00 17.62 ? 82  GLY B CA  1 
ATOM   3213 C C   . GLY B 1 82  ? 101.979 78.331  -28.342 1.00 19.00 ? 82  GLY B C   1 
ATOM   3214 O O   . GLY B 1 82  ? 101.609 77.925  -29.437 1.00 23.24 ? 82  GLY B O   1 
ATOM   3215 N N   . ASN B 1 83  ? 101.845 79.625  -28.000 1.00 17.73 ? 83  ASN B N   1 
ATOM   3216 C CA  . ASN B 1 83  ? 101.305 80.597  -28.877 1.00 17.40 ? 83  ASN B CA  1 
ATOM   3217 C C   . ASN B 1 83  ? 102.222 81.039  -30.009 1.00 18.06 ? 83  ASN B C   1 
ATOM   3218 O O   . ASN B 1 83  ? 101.715 81.409  -31.074 1.00 15.42 ? 83  ASN B O   1 
ATOM   3219 C CB  . ASN B 1 83  ? 100.808 81.835  -28.123 1.00 18.17 ? 83  ASN B CB  1 
ATOM   3220 C CG  . ASN B 1 83  ? 99.589  81.518  -27.341 1.00 22.10 ? 83  ASN B CG  1 
ATOM   3221 O OD1 . ASN B 1 83  ? 98.698  80.824  -27.851 1.00 22.76 ? 83  ASN B OD1 1 
ATOM   3222 N ND2 . ASN B 1 83  ? 99.537  81.963  -26.107 1.00 19.23 ? 83  ASN B ND2 1 
ATOM   3223 N N   . ALA B 1 84  ? 103.544 80.988  -29.800 1.00 19.33 ? 84  ALA B N   1 
ATOM   3224 C CA  . ALA B 1 84  ? 104.445 81.467  -30.819 1.00 20.09 ? 84  ALA B CA  1 
ATOM   3225 C C   . ALA B 1 84  ? 104.373 80.462  -31.973 1.00 19.76 ? 84  ALA B C   1 
ATOM   3226 O O   . ALA B 1 84  ? 104.382 79.274  -31.718 1.00 19.39 ? 84  ALA B O   1 
ATOM   3227 C CB  . ALA B 1 84  ? 105.864 81.553  -30.302 1.00 19.80 ? 84  ALA B CB  1 
ATOM   3228 N N   . TYR B 1 85  ? 104.353 80.954  -33.188 1.00 18.11 ? 85  TYR B N   1 
ATOM   3229 C CA  . TYR B 1 85  ? 104.248 80.064  -34.352 1.00 22.43 ? 85  TYR B CA  1 
ATOM   3230 C C   . TYR B 1 85  ? 105.355 80.421  -35.345 1.00 18.22 ? 85  TYR B C   1 
ATOM   3231 O O   . TYR B 1 85  ? 105.398 81.554  -35.849 1.00 20.39 ? 85  TYR B O   1 
ATOM   3232 C CB  . TYR B 1 85  ? 102.894 80.210  -35.024 1.00 24.62 ? 85  TYR B CB  1 
ATOM   3233 C CG  . TYR B 1 85  ? 102.897 79.582  -36.434 1.00 28.72 ? 85  TYR B CG  1 
ATOM   3234 C CD1 . TYR B 1 85  ? 102.781 78.206  -36.623 1.00 34.73 ? 85  TYR B CD1 1 
ATOM   3235 C CD2 . TYR B 1 85  ? 103.058 80.400  -37.560 1.00 35.26 ? 85  TYR B CD2 1 
ATOM   3236 C CE1 . TYR B 1 85  ? 102.795 77.651  -37.918 1.00 35.33 ? 85  TYR B CE1 1 
ATOM   3237 C CE2 . TYR B 1 85  ? 103.084 79.870  -38.837 1.00 39.82 ? 85  TYR B CE2 1 
ATOM   3238 C CZ  . TYR B 1 85  ? 102.948 78.508  -39.008 1.00 38.84 ? 85  TYR B CZ  1 
ATOM   3239 O OH  . TYR B 1 85  ? 103.026 78.072  -40.331 1.00 43.56 ? 85  TYR B OH  1 
ATOM   3240 N N   . TYR B 1 86  ? 106.299 79.505  -35.569 1.00 16.56 ? 86  TYR B N   1 
ATOM   3241 C CA  . TYR B 1 86  ? 107.390 79.712  -36.547 1.00 16.01 ? 86  TYR B CA  1 
ATOM   3242 C C   . TYR B 1 86  ? 107.133 78.878  -37.767 1.00 18.03 ? 86  TYR B C   1 
ATOM   3243 O O   . TYR B 1 86  ? 106.837 77.699  -37.646 1.00 15.66 ? 86  TYR B O   1 
ATOM   3244 C CB  . TYR B 1 86  ? 108.711 79.356  -35.918 1.00 16.25 ? 86  TYR B CB  1 
ATOM   3245 C CG  . TYR B 1 86  ? 108.960 80.057  -34.590 1.00 14.20 ? 86  TYR B CG  1 
ATOM   3246 C CD1 . TYR B 1 86  ? 108.587 81.369  -34.392 1.00 14.52 ? 86  TYR B CD1 1 
ATOM   3247 C CD2 . TYR B 1 86  ? 109.511 79.370  -33.520 1.00 16.19 ? 86  TYR B CD2 1 
ATOM   3248 C CE1 . TYR B 1 86  ? 108.897 82.005  -33.204 1.00 14.58 ? 86  TYR B CE1 1 
ATOM   3249 C CE2 . TYR B 1 86  ? 109.794 80.002  -32.325 1.00 14.96 ? 86  TYR B CE2 1 
ATOM   3250 C CZ  . TYR B 1 86  ? 109.486 81.327  -32.174 1.00 13.59 ? 86  TYR B CZ  1 
ATOM   3251 O OH  . TYR B 1 86  ? 109.763 81.948  -30.960 1.00 14.25 ? 86  TYR B OH  1 
ATOM   3252 N N   . SER B 1 87  ? 107.203 79.462  -38.954 1.00 16.97 ? 87  SER B N   1 
ATOM   3253 C CA  . SER B 1 87  ? 106.837 78.744  -40.173 1.00 17.54 ? 87  SER B CA  1 
ATOM   3254 C C   . SER B 1 87  ? 107.796 77.675  -40.576 1.00 19.11 ? 87  SER B C   1 
ATOM   3255 O O   . SER B 1 87  ? 109.006 77.903  -40.626 1.00 16.08 ? 87  SER B O   1 
ATOM   3256 C CB  . SER B 1 87  ? 106.755 79.711  -41.398 1.00 19.12 ? 87  SER B CB  1 
ATOM   3257 O OG  . SER B 1 87  ? 105.900 80.813  -41.089 1.00 23.84 ? 87  SER B OG  1 
ATOM   3258 N N   . ASP B 1 88  ? 107.279 76.522  -40.997 1.00 18.16 ? 88  ASP B N   1 
ATOM   3259 C CA  . ASP B 1 88  ? 108.156 75.517  -41.546 1.00 22.29 ? 88  ASP B CA  1 
ATOM   3260 C C   . ASP B 1 88  ? 108.592 75.756  -42.980 1.00 23.48 ? 88  ASP B C   1 
ATOM   3261 O O   . ASP B 1 88  ? 109.549 75.156  -43.439 1.00 24.23 ? 88  ASP B O   1 
ATOM   3262 C CB  . ASP B 1 88  ? 107.489 74.153  -41.443 1.00 26.87 ? 88  ASP B CB  1 
ATOM   3263 C CG  . ASP B 1 88  ? 107.623 73.557  -40.032 1.00 32.21 ? 88  ASP B CG  1 
ATOM   3264 O OD1 . ASP B 1 88  ? 108.555 73.900  -39.287 1.00 32.61 ? 88  ASP B OD1 1 
ATOM   3265 O OD2 . ASP B 1 88  ? 106.766 72.780  -39.691 1.00 32.74 ? 88  ASP B OD2 1 
ATOM   3266 N N   . ALA B 1 89  ? 107.873 76.588  -43.683 1.00 19.82 ? 89  ALA B N   1 
ATOM   3267 C CA  . ALA B 1 89  ? 108.195 76.941  -45.074 1.00 23.69 ? 89  ALA B CA  1 
ATOM   3268 C C   . ALA B 1 89  ? 108.676 78.383  -45.202 1.00 21.58 ? 89  ALA B C   1 
ATOM   3269 O O   . ALA B 1 89  ? 108.230 79.287  -44.469 1.00 19.56 ? 89  ALA B O   1 
ATOM   3270 C CB  . ALA B 1 89  ? 106.973 76.729  -45.922 1.00 25.04 ? 89  ALA B CB  1 
ATOM   3271 N N   . LEU B 1 90  ? 109.605 78.585  -46.112 1.00 19.46 ? 90  LEU B N   1 
ATOM   3272 C CA  . LEU B 1 90  ? 109.927 79.957  -46.601 1.00 20.42 ? 90  LEU B CA  1 
ATOM   3273 C C   . LEU B 1 90  ? 108.745 80.595  -47.257 1.00 22.17 ? 90  LEU B C   1 
ATOM   3274 O O   . LEU B 1 90  ? 107.871 79.891  -47.818 1.00 20.03 ? 90  LEU B O   1 
ATOM   3275 C CB  . LEU B 1 90  ? 111.084 79.923  -47.596 1.00 22.75 ? 90  LEU B CB  1 
ATOM   3276 C CG  . LEU B 1 90  ? 112.344 79.296  -47.075 1.00 24.01 ? 90  LEU B CG  1 
ATOM   3277 C CD1 . LEU B 1 90  ? 113.379 79.255  -48.170 1.00 28.83 ? 90  LEU B CD1 1 
ATOM   3278 C CD2 . LEU B 1 90  ? 112.928 79.976  -45.838 1.00 24.83 ? 90  LEU B CD2 1 
ATOM   3279 N N   . GLU B 1 91  ? 108.627 81.913  -47.130 1.00 19.09 ? 91  GLU B N   1 
ATOM   3280 C CA  . GLU B 1 91  ? 107.602 82.656  -47.856 1.00 19.18 ? 91  GLU B CA  1 
ATOM   3281 C C   . GLU B 1 91  ? 108.284 83.569  -48.848 1.00 20.07 ? 91  GLU B C   1 
ATOM   3282 O O   . GLU B 1 91  ? 109.091 84.405  -48.448 1.00 16.98 ? 91  GLU B O   1 
ATOM   3283 C CB  . GLU B 1 91  ? 106.687 83.406  -46.905 1.00 21.79 ? 91  GLU B CB  1 
ATOM   3284 C CG  . GLU B 1 91  ? 105.801 82.404  -46.156 1.00 22.60 ? 91  GLU B CG  1 
ATOM   3285 C CD  . GLU B 1 91  ? 105.050 83.014  -44.956 1.00 27.08 ? 91  GLU B CD  1 
ATOM   3286 O OE1 . GLU B 1 91  ? 105.106 84.247  -44.717 1.00 23.54 ? 91  GLU B OE1 1 
ATOM   3287 O OE2 . GLU B 1 91  ? 104.351 82.203  -44.231 1.00 28.62 ? 91  GLU B OE2 1 
ATOM   3288 N N   . ASN B 1 92  ? 108.001 83.380  -50.152 1.00 16.82 ? 92  ASN B N   1 
ATOM   3289 C CA  . ASN B 1 92  ? 108.726 84.156  -51.180 1.00 18.43 ? 92  ASN B CA  1 
ATOM   3290 C C   . ASN B 1 92  ? 108.388 85.643  -51.189 1.00 18.33 ? 92  ASN B C   1 
ATOM   3291 O O   . ASN B 1 92  ? 109.068 86.417  -51.830 1.00 20.52 ? 92  ASN B O   1 
ATOM   3292 C CB  . ASN B 1 92  ? 108.510 83.571  -52.571 1.00 18.47 ? 92  ASN B CB  1 
ATOM   3293 C CG  . ASN B 1 92  ? 109.122 82.209  -52.729 1.00 22.94 ? 92  ASN B CG  1 
ATOM   3294 O OD1 . ASN B 1 92  ? 110.043 81.844  -52.018 1.00 23.68 ? 92  ASN B OD1 1 
ATOM   3295 N ND2 . ASN B 1 92  ? 108.532 81.403  -53.601 1.00 20.77 ? 92  ASN B ND2 1 
ATOM   3296 N N   . ASP B 1 93  ? 107.308 86.032  -50.510 1.00 16.39 ? 93  ASP B N   1 
ATOM   3297 C CA  . ASP B 1 93  ? 106.877 87.434  -50.419 1.00 17.44 ? 93  ASP B CA  1 
ATOM   3298 C C   . ASP B 1 93  ? 107.250 88.084  -49.077 1.00 15.64 ? 93  ASP B C   1 
ATOM   3299 O O   . ASP B 1 93  ? 106.807 89.184  -48.797 1.00 14.91 ? 93  ASP B O   1 
ATOM   3300 C CB  . ASP B 1 93  ? 105.349 87.532  -50.690 1.00 19.14 ? 93  ASP B CB  1 
ATOM   3301 C CG  . ASP B 1 93  ? 104.482 86.842  -49.632 1.00 22.40 ? 93  ASP B CG  1 
ATOM   3302 O OD1 . ASP B 1 93  ? 104.928 85.898  -49.004 1.00 19.90 ? 93  ASP B OD1 1 
ATOM   3303 O OD2 . ASP B 1 93  ? 103.343 87.290  -49.421 1.00 25.61 ? 93  ASP B OD2 1 
ATOM   3304 N N   . LYS B 1 94  ? 108.102 87.421  -48.299 1.00 13.43 ? 94  LYS B N   1 
ATOM   3305 C CA  . LYS B 1 94  ? 108.529 87.933  -47.007 1.00 14.69 ? 94  LYS B CA  1 
ATOM   3306 C C   . LYS B 1 94  ? 110.011 87.754  -46.872 1.00 14.12 ? 94  LYS B C   1 
ATOM   3307 O O   . LYS B 1 94  ? 110.675 86.977  -47.543 1.00 15.83 ? 94  LYS B O   1 
ATOM   3308 C CB  . LYS B 1 94  ? 107.828 87.183  -45.853 1.00 13.66 ? 94  LYS B CB  1 
ATOM   3309 C CG  . LYS B 1 94  ? 106.295 87.299  -45.839 1.00 14.47 ? 94  LYS B CG  1 
ATOM   3310 C CD  . LYS B 1 94  ? 105.869 88.686  -45.401 1.00 16.05 ? 94  LYS B CD  1 
ATOM   3311 C CE  . LYS B 1 94  ? 104.334 88.803  -45.479 1.00 18.11 ? 94  LYS B CE  1 
ATOM   3312 N NZ  . LYS B 1 94  ? 103.920 90.122  -44.987 1.00 17.04 ? 94  LYS B NZ  1 
ATOM   3313 N N   . ASP B 1 95  ? 110.542 88.509  -45.937 1.00 15.73 ? 95  ASP B N   1 
ATOM   3314 C CA  . ASP B 1 95  ? 111.903 88.256  -45.471 1.00 15.34 ? 95  ASP B CA  1 
ATOM   3315 C C   . ASP B 1 95  ? 111.852 87.050  -44.505 1.00 17.02 ? 95  ASP B C   1 
ATOM   3316 O O   . ASP B 1 95  ? 111.053 87.073  -43.560 1.00 14.78 ? 95  ASP B O   1 
ATOM   3317 C CB  . ASP B 1 95  ? 112.433 89.462  -44.678 1.00 14.24 ? 95  ASP B CB  1 
ATOM   3318 C CG  . ASP B 1 95  ? 112.413 90.754  -45.479 1.00 17.46 ? 95  ASP B CG  1 
ATOM   3319 O OD1 . ASP B 1 95  ? 112.778 90.648  -46.642 1.00 18.56 ? 95  ASP B OD1 1 
ATOM   3320 O OD2 . ASP B 1 95  ? 112.109 91.852  -44.928 1.00 14.44 ? 95  ASP B OD2 1 
ATOM   3321 N N   . ASN B 1 96  ? 112.696 86.048  -44.712 1.00 15.41 ? 96  ASN B N   1 
ATOM   3322 C CA  . ASN B 1 96  ? 112.645 84.809  -43.904 1.00 15.68 ? 96  ASN B CA  1 
ATOM   3323 C C   . ASN B 1 96  ? 113.767 84.838  -42.847 1.00 17.23 ? 96  ASN B C   1 
ATOM   3324 O O   . ASN B 1 96  ? 114.940 84.725  -43.204 1.00 16.40 ? 96  ASN B O   1 
ATOM   3325 C CB  . ASN B 1 96  ? 112.760 83.627  -44.822 1.00 16.70 ? 96  ASN B CB  1 
ATOM   3326 C CG  . ASN B 1 96  ? 111.596 83.525  -45.770 1.00 17.66 ? 96  ASN B CG  1 
ATOM   3327 O OD1 . ASN B 1 96  ? 110.485 83.166  -45.404 1.00 16.34 ? 96  ASN B OD1 1 
ATOM   3328 N ND2 . ASN B 1 96  ? 111.865 83.787  -47.034 1.00 17.23 ? 96  ASN B ND2 1 
ATOM   3329 N N   . ILE B 1 97  ? 113.379 85.091  -41.589 1.00 15.13 ? 97  ILE B N   1 
ATOM   3330 C CA  . ILE B 1 97  ? 114.261 85.419  -40.476 1.00 14.26 ? 97  ILE B CA  1 
ATOM   3331 C C   . ILE B 1 97  ? 113.949 84.448  -39.331 1.00 12.82 ? 97  ILE B C   1 
ATOM   3332 O O   . ILE B 1 97  ? 112.787 84.129  -39.040 1.00 13.63 ? 97  ILE B O   1 
ATOM   3333 C CB  . ILE B 1 97  ? 114.025 86.846  -40.049 1.00 14.38 ? 97  ILE B CB  1 
ATOM   3334 C CG1 . ILE B 1 97  ? 114.326 87.834  -41.237 1.00 14.00 ? 97  ILE B CG1 1 
ATOM   3335 C CG2 . ILE B 1 97  ? 114.773 87.252  -38.796 1.00 15.67 ? 97  ILE B CG2 1 
ATOM   3336 C CD1 . ILE B 1 97  ? 115.768 87.881  -41.648 1.00 15.91 ? 97  ILE B CD1 1 
ATOM   3337 N N   . THR B 1 98  ? 115.001 83.922  -38.761 1.00 11.50 ? 98  THR B N   1 
ATOM   3338 C CA  . THR B 1 98  ? 114.851 83.029  -37.628 1.00 12.32 ? 98  THR B CA  1 
ATOM   3339 C C   . THR B 1 98  ? 114.510 83.867  -36.400 1.00 11.68 ? 98  THR B C   1 
ATOM   3340 O O   . THR B 1 98  ? 114.891 85.036  -36.314 1.00 13.12 ? 98  THR B O   1 
ATOM   3341 C CB  . THR B 1 98  ? 116.084 82.134  -37.339 1.00 12.10 ? 98  THR B CB  1 
ATOM   3342 O OG1 . THR B 1 98  ? 117.108 82.959  -36.768 1.00 12.03 ? 98  THR B OG1 1 
ATOM   3343 C CG2 . THR B 1 98  ? 116.597 81.434  -38.575 1.00 13.69 ? 98  THR B CG2 1 
ATOM   3344 N N   . PRO B 1 99  ? 113.959 83.247  -35.361 1.00 14.01 ? 99  PRO B N   1 
ATOM   3345 C CA  . PRO B 1 99  ? 113.732 84.021  -34.139 1.00 13.82 ? 99  PRO B CA  1 
ATOM   3346 C C   . PRO B 1 99  ? 114.967 84.507  -33.459 1.00 14.73 ? 99  PRO B C   1 
ATOM   3347 O O   . PRO B 1 99  ? 114.939 85.592  -32.912 1.00 15.27 ? 99  PRO B O   1 
ATOM   3348 C CB  . PRO B 1 99  ? 112.953 83.025  -33.225 1.00 14.34 ? 99  PRO B CB  1 
ATOM   3349 C CG  . PRO B 1 99  ? 112.250 82.158  -34.218 1.00 14.89 ? 99  PRO B CG  1 
ATOM   3350 C CD  . PRO B 1 99  ? 113.279 81.916  -35.317 1.00 13.85 ? 99  PRO B CD  1 
ATOM   3351 N N   . PHE B 1 100 ? 116.052 83.744  -33.531 1.00 13.57 ? 100 PHE B N   1 
ATOM   3352 C CA  . PHE B 1 100 ? 117.293 84.181  -32.925 1.00 14.71 ? 100 PHE B CA  1 
ATOM   3353 C C   . PHE B 1 100 ? 118.008 85.324  -33.755 1.00 14.78 ? 100 PHE B C   1 
ATOM   3354 O O   . PHE B 1 100 ? 118.886 85.983  -33.229 1.00 13.24 ? 100 PHE B O   1 
ATOM   3355 C CB  . PHE B 1 100 ? 118.223 82.964  -32.667 1.00 15.35 ? 100 PHE B CB  1 
ATOM   3356 C CG  . PHE B 1 100 ? 118.699 82.301  -33.902 1.00 14.75 ? 100 PHE B CG  1 
ATOM   3357 C CD1 . PHE B 1 100 ? 119.776 82.810  -34.636 1.00 15.88 ? 100 PHE B CD1 1 
ATOM   3358 C CD2 . PHE B 1 100 ? 118.157 81.123  -34.286 1.00 15.42 ? 100 PHE B CD2 1 
ATOM   3359 C CE1 . PHE B 1 100 ? 120.201 82.160  -35.808 1.00 17.01 ? 100 PHE B CE1 1 
ATOM   3360 C CE2 . PHE B 1 100 ? 118.533 80.487  -35.437 1.00 15.18 ? 100 PHE B CE2 1 
ATOM   3361 C CZ  . PHE B 1 100 ? 119.547 80.994  -36.235 1.00 15.61 ? 100 PHE B CZ  1 
ATOM   3362 N N   . GLU B 1 101 ? 117.602 85.527  -35.012 1.00 15.20 ? 101 GLU B N   1 
ATOM   3363 C CA  . GLU B 1 101 ? 118.054 86.607  -35.863 1.00 14.21 ? 101 GLU B CA  1 
ATOM   3364 C C   . GLU B 1 101 ? 117.264 87.838  -35.765 1.00 15.43 ? 101 GLU B C   1 
ATOM   3365 O O   . GLU B 1 101 ? 117.670 88.879  -36.241 1.00 13.12 ? 101 GLU B O   1 
ATOM   3366 C CB  . GLU B 1 101 ? 118.055 86.131  -37.320 1.00 14.60 ? 101 GLU B CB  1 
ATOM   3367 C CG  . GLU B 1 101 ? 119.135 85.127  -37.690 1.00 14.40 ? 101 GLU B CG  1 
ATOM   3368 C CD  . GLU B 1 101 ? 118.814 84.416  -39.016 1.00 14.53 ? 101 GLU B CD  1 
ATOM   3369 O OE1 . GLU B 1 101 ? 117.712 84.662  -39.626 1.00 12.68 ? 101 GLU B OE1 1 
ATOM   3370 O OE2 . GLU B 1 101 ? 119.613 83.523  -39.412 1.00 15.30 ? 101 GLU B OE2 1 
ATOM   3371 N N   . PHE B 1 102 ? 116.125 87.786  -35.082 1.00 12.85 ? 102 PHE B N   1 
ATOM   3372 C CA  . PHE B 1 102 ? 115.129 88.858  -35.135 1.00 13.31 ? 102 PHE B CA  1 
ATOM   3373 C C   . PHE B 1 102 ? 115.623 90.131  -34.483 1.00 13.16 ? 102 PHE B C   1 
ATOM   3374 O O   . PHE B 1 102 ? 115.419 91.228  -35.029 1.00 13.62 ? 102 PHE B O   1 
ATOM   3375 C CB  . PHE B 1 102 ? 113.805 88.330  -34.496 1.00 12.72 ? 102 PHE B CB  1 
ATOM   3376 C CG  . PHE B 1 102 ? 112.560 89.124  -34.724 1.00 13.56 ? 102 PHE B CG  1 
ATOM   3377 C CD1 . PHE B 1 102 ? 112.415 90.003  -35.762 1.00 13.39 ? 102 PHE B CD1 1 
ATOM   3378 C CD2 . PHE B 1 102 ? 111.466 88.865  -33.892 1.00 15.42 ? 102 PHE B CD2 1 
ATOM   3379 C CE1 . PHE B 1 102 ? 111.244 90.673  -35.973 1.00 15.33 ? 102 PHE B CE1 1 
ATOM   3380 C CE2 . PHE B 1 102 ? 110.260 89.510  -34.119 1.00 16.78 ? 102 PHE B CE2 1 
ATOM   3381 C CZ  . PHE B 1 102 ? 110.159 90.429  -35.175 1.00 15.47 ? 102 PHE B CZ  1 
ATOM   3382 N N   . ILE B 1 103 ? 116.249 90.022  -33.324 1.00 13.80 ? 103 ILE B N   1 
ATOM   3383 C CA  . ILE B 1 103 ? 116.772 91.195  -32.664 1.00 14.02 ? 103 ILE B CA  1 
ATOM   3384 C C   . ILE B 1 103 ? 117.831 91.893  -33.537 1.00 13.44 ? 103 ILE B C   1 
ATOM   3385 O O   . ILE B 1 103 ? 117.709 93.096  -33.770 1.00 14.28 ? 103 ILE B O   1 
ATOM   3386 C CB  . ILE B 1 103 ? 117.245 90.920  -31.236 1.00 15.37 ? 103 ILE B CB  1 
ATOM   3387 C CG1 . ILE B 1 103 ? 116.005 90.739  -30.333 1.00 16.76 ? 103 ILE B CG1 1 
ATOM   3388 C CG2 . ILE B 1 103 ? 118.099 92.092  -30.706 1.00 14.26 ? 103 ILE B CG2 1 
ATOM   3389 C CD1 . ILE B 1 103 ? 116.322 90.271  -28.888 1.00 16.03 ? 103 ILE B CD1 1 
ATOM   3390 N N   . PRO B 1 104 ? 118.833 91.173  -34.003 1.00 13.49 ? 104 PRO B N   1 
ATOM   3391 C CA  . PRO B 1 104 ? 119.708 91.793  -35.034 1.00 13.18 ? 104 PRO B CA  1 
ATOM   3392 C C   . PRO B 1 104 ? 119.030 92.392  -36.240 1.00 13.49 ? 104 PRO B C   1 
ATOM   3393 O O   . PRO B 1 104 ? 119.442 93.457  -36.717 1.00 15.55 ? 104 PRO B O   1 
ATOM   3394 C CB  . PRO B 1 104 ? 120.617 90.629  -35.450 1.00 15.13 ? 104 PRO B CB  1 
ATOM   3395 C CG  . PRO B 1 104 ? 120.746 89.802  -34.157 1.00 15.55 ? 104 PRO B CG  1 
ATOM   3396 C CD  . PRO B 1 104 ? 119.356 89.839  -33.577 1.00 13.92 ? 104 PRO B CD  1 
ATOM   3397 N N   . TRP B 1 105 ? 118.056 91.703  -36.767 1.00 12.24 ? 105 TRP B N   1 
ATOM   3398 C CA  . TRP B 1 105 ? 117.424 92.106  -37.997 1.00 13.57 ? 105 TRP B CA  1 
ATOM   3399 C C   . TRP B 1 105 ? 116.756 93.486  -37.775 1.00 13.23 ? 105 TRP B C   1 
ATOM   3400 O O   . TRP B 1 105 ? 116.848 94.408  -38.630 1.00 12.96 ? 105 TRP B O   1 
ATOM   3401 C CB  . TRP B 1 105 ? 116.394 91.054  -38.414 1.00 13.14 ? 105 TRP B CB  1 
ATOM   3402 C CG  . TRP B 1 105 ? 115.655 91.340  -39.674 1.00 14.74 ? 105 TRP B CG  1 
ATOM   3403 C CD1 . TRP B 1 105 ? 114.329 91.613  -39.766 1.00 15.54 ? 105 TRP B CD1 1 
ATOM   3404 C CD2 . TRP B 1 105 ? 116.163 91.339  -41.014 1.00 14.57 ? 105 TRP B CD2 1 
ATOM   3405 N NE1 . TRP B 1 105 ? 113.968 91.754  -41.078 1.00 16.98 ? 105 TRP B NE1 1 
ATOM   3406 C CE2 . TRP B 1 105 ? 115.076 91.622  -41.870 1.00 16.60 ? 105 TRP B CE2 1 
ATOM   3407 C CE3 . TRP B 1 105 ? 117.418 91.117  -41.573 1.00 15.29 ? 105 TRP B CE3 1 
ATOM   3408 C CZ2 . TRP B 1 105 ? 115.211 91.727  -43.239 1.00 15.36 ? 105 TRP B CZ2 1 
ATOM   3409 C CZ3 . TRP B 1 105 ? 117.546 91.171  -43.007 1.00 14.44 ? 105 TRP B CZ3 1 
ATOM   3410 C CH2 . TRP B 1 105 ? 116.439 91.438  -43.795 1.00 16.11 ? 105 TRP B CH2 1 
ATOM   3411 N N   . ILE B 1 106 ? 116.061 93.620  -36.647 1.00 12.79 ? 106 ILE B N   1 
ATOM   3412 C CA  . ILE B 1 106 ? 115.338 94.861  -36.351 1.00 14.65 ? 106 ILE B CA  1 
ATOM   3413 C C   . ILE B 1 106 ? 116.334 95.958  -35.880 1.00 14.54 ? 106 ILE B C   1 
ATOM   3414 O O   . ILE B 1 106 ? 116.366 97.086  -36.465 1.00 15.24 ? 106 ILE B O   1 
ATOM   3415 C CB  . ILE B 1 106 ? 114.206 94.647  -35.343 1.00 15.45 ? 106 ILE B CB  1 
ATOM   3416 C CG1 . ILE B 1 106 ? 113.154 93.685  -35.900 1.00 15.65 ? 106 ILE B CG1 1 
ATOM   3417 C CG2 . ILE B 1 106 ? 113.606 95.972  -34.918 1.00 16.94 ? 106 ILE B CG2 1 
ATOM   3418 C CD1 . ILE B 1 106 ? 112.469 94.109  -37.156 1.00 16.42 ? 106 ILE B CD1 1 
ATOM   3419 N N   . LEU B 1 107 ? 117.083 95.653  -34.823 1.00 13.61 ? 107 LEU B N   1 
ATOM   3420 C CA  . LEU B 1 107 ? 117.835 96.689  -34.171 1.00 14.14 ? 107 LEU B CA  1 
ATOM   3421 C C   . LEU B 1 107 ? 119.073 97.122  -35.064 1.00 14.34 ? 107 LEU B C   1 
ATOM   3422 O O   . LEU B 1 107 ? 119.519 98.216  -34.975 1.00 15.77 ? 107 LEU B O   1 
ATOM   3423 C CB  . LEU B 1 107 ? 118.363 96.283  -32.826 1.00 14.63 ? 107 LEU B CB  1 
ATOM   3424 C CG  . LEU B 1 107 ? 117.341 96.047  -31.698 1.00 14.42 ? 107 LEU B CG  1 
ATOM   3425 C CD1 . LEU B 1 107 ? 118.051 95.866  -30.393 1.00 13.91 ? 107 LEU B CD1 1 
ATOM   3426 C CD2 . LEU B 1 107 ? 116.364 97.184  -31.592 1.00 15.02 ? 107 LEU B CD2 1 
ATOM   3427 N N   . GLY B 1 108 ? 119.555 96.227  -35.900 1.00 15.21 ? 108 GLY B N   1 
ATOM   3428 C CA  . GLY B 1 108 ? 120.664 96.552  -36.795 1.00 16.80 ? 108 GLY B CA  1 
ATOM   3429 C C   . GLY B 1 108 ? 120.226 97.575  -37.831 1.00 16.62 ? 108 GLY B C   1 
ATOM   3430 O O   . GLY B 1 108 ? 121.075 98.314  -38.354 1.00 17.85 ? 108 GLY B O   1 
ATOM   3431 N N   . GLN B 1 109 ? 118.930 97.613  -38.171 1.00 17.11 ? 109 GLN B N   1 
ATOM   3432 C CA  . GLN B 1 109 ? 118.463 98.358  -39.330 1.00 16.50 ? 109 GLN B CA  1 
ATOM   3433 C C   . GLN B 1 109 ? 117.477 99.478  -39.047 1.00 19.69 ? 109 GLN B C   1 
ATOM   3434 O O   . GLN B 1 109 ? 117.164 100.217 -39.976 1.00 18.55 ? 109 GLN B O   1 
ATOM   3435 C CB  . GLN B 1 109 ? 117.778 97.413  -40.355 1.00 17.37 ? 109 GLN B CB  1 
ATOM   3436 C CG  . GLN B 1 109 ? 118.667 96.289  -40.712 1.00 19.44 ? 109 GLN B CG  1 
ATOM   3437 C CD  . GLN B 1 109 ? 118.099 95.419  -41.814 1.00 21.97 ? 109 GLN B CD  1 
ATOM   3438 O OE1 . GLN B 1 109 ? 118.444 95.623  -42.964 1.00 23.01 ? 109 GLN B OE1 1 
ATOM   3439 N NE2 . GLN B 1 109 ? 117.294 94.417  -41.484 1.00 18.36 ? 109 GLN B NE2 1 
ATOM   3440 N N   . CYS B 1 110 ? 116.897 99.527  -37.852 1.00 16.51 ? 110 CYS B N   1 
ATOM   3441 C CA  . CYS B 1 110 ? 115.800 100.421 -37.564 1.00 16.13 ? 110 CYS B CA  1 
ATOM   3442 C C   . CYS B 1 110 ? 116.174 101.408 -36.488 1.00 16.82 ? 110 CYS B C   1 
ATOM   3443 O O   . CYS B 1 110 ? 116.891 101.072 -35.553 1.00 17.29 ? 110 CYS B O   1 
ATOM   3444 C CB  . CYS B 1 110 ? 114.554 99.649  -37.130 1.00 15.96 ? 110 CYS B CB  1 
ATOM   3445 S SG  . CYS B 1 110 ? 113.955 98.524  -38.345 1.00 16.36 ? 110 CYS B SG  1 
ATOM   3446 N N   . SER B 1 111 ? 115.769 102.690 -36.687 1.00 16.47 ? 111 SER B N   1 
ATOM   3447 C CA  . SER B 1 111 ? 116.127 103.713 -35.722 1.00 17.09 ? 111 SER B CA  1 
ATOM   3448 C C   . SER B 1 111 ? 115.026 104.000 -34.724 1.00 17.70 ? 111 SER B C   1 
ATOM   3449 O O   . SER B 1 111 ? 115.273 104.666 -33.743 1.00 18.71 ? 111 SER B O   1 
ATOM   3450 C CB  . SER B 1 111 ? 116.473 105.023 -36.460 1.00 19.32 ? 111 SER B CB  1 
ATOM   3451 O OG  . SER B 1 111 ? 115.333 105.520 -37.055 1.00 19.85 ? 111 SER B OG  1 
ATOM   3452 N N   . ASP B 1 112 ? 113.796 103.581 -34.995 1.00 18.12 ? 112 ASP B N   1 
ATOM   3453 C CA  . ASP B 1 112 ? 112.661 103.955 -34.133 1.00 17.08 ? 112 ASP B CA  1 
ATOM   3454 C C   . ASP B 1 112 ? 111.567 102.939 -34.286 1.00 14.24 ? 112 ASP B C   1 
ATOM   3455 O O   . ASP B 1 112 ? 111.641 102.022 -35.122 1.00 14.12 ? 112 ASP B O   1 
ATOM   3456 C CB  . ASP B 1 112 ? 112.145 105.384 -34.414 1.00 18.06 ? 112 ASP B CB  1 
ATOM   3457 C CG  . ASP B 1 112 ? 111.681 105.575 -35.839 1.00 22.90 ? 112 ASP B CG  1 
ATOM   3458 O OD1 . ASP B 1 112 ? 111.351 104.625 -36.561 1.00 20.76 ? 112 ASP B OD1 1 
ATOM   3459 O OD2 . ASP B 1 112 ? 111.673 106.747 -36.278 1.00 27.69 ? 112 ASP B OD2 1 
ATOM   3460 N N   . VAL B 1 113 ? 110.526 103.093 -33.502 1.00 14.63 ? 113 VAL B N   1 
ATOM   3461 C CA  . VAL B 1 113 ? 109.444 102.105 -33.504 1.00 14.67 ? 113 VAL B CA  1 
ATOM   3462 C C   . VAL B 1 113 ? 108.741 102.010 -34.838 1.00 16.68 ? 113 VAL B C   1 
ATOM   3463 O O   . VAL B 1 113 ? 108.376 100.897 -35.250 1.00 14.98 ? 113 VAL B O   1 
ATOM   3464 C CB  . VAL B 1 113 ? 108.475 102.377 -32.357 1.00 15.78 ? 113 VAL B CB  1 
ATOM   3465 C CG1 . VAL B 1 113 ? 107.170 101.641 -32.530 1.00 14.90 ? 113 VAL B CG1 1 
ATOM   3466 C CG2 . VAL B 1 113 ? 109.123 101.958 -31.040 1.00 14.87 ? 113 VAL B CG2 1 
ATOM   3467 N N   . ASN B 1 114 ? 108.484 103.161 -35.514 1.00 17.28 ? 114 ASN B N   1 
ATOM   3468 C CA  . ASN B 1 114 ? 107.764 103.068 -36.812 1.00 17.86 ? 114 ASN B CA  1 
ATOM   3469 C C   . ASN B 1 114 ? 108.527 102.284 -37.844 1.00 17.01 ? 114 ASN B C   1 
ATOM   3470 O O   . ASN B 1 114 ? 107.956 101.458 -38.514 1.00 18.11 ? 114 ASN B O   1 
ATOM   3471 C CB  . ASN B 1 114 ? 107.446 104.434 -37.350 1.00 21.63 ? 114 ASN B CB  1 
ATOM   3472 C CG  . ASN B 1 114 ? 106.247 105.051 -36.652 1.00 25.20 ? 114 ASN B CG  1 
ATOM   3473 O OD1 . ASN B 1 114 ? 105.581 104.447 -35.792 1.00 25.57 ? 114 ASN B OD1 1 
ATOM   3474 N ND2 . ASN B 1 114 ? 106.032 106.313 -36.938 1.00 29.42 ? 114 ASN B ND2 1 
ATOM   3475 N N   . GLU B 1 115 ? 109.843 102.457 -37.899 1.00 17.73 ? 115 GLU B N   1 
ATOM   3476 C CA  . GLU B 1 115 ? 110.648 101.654 -38.798 1.00 18.42 ? 115 GLU B CA  1 
ATOM   3477 C C   . GLU B 1 115 ? 110.623 100.172 -38.427 1.00 16.61 ? 115 GLU B C   1 
ATOM   3478 O O   . GLU B 1 115 ? 110.602 99.285  -39.293 1.00 14.06 ? 115 GLU B O   1 
ATOM   3479 C CB  . GLU B 1 115 ? 112.101 102.134 -38.802 1.00 19.01 ? 115 GLU B CB  1 
ATOM   3480 C CG  . GLU B 1 115 ? 112.319 103.388 -39.649 1.00 20.29 ? 115 GLU B CG  1 
ATOM   3481 C CD  . GLU B 1 115 ? 113.726 103.881 -39.719 1.00 22.05 ? 115 GLU B CD  1 
ATOM   3482 O OE1 . GLU B 1 115 ? 114.680 103.266 -39.254 1.00 20.75 ? 115 GLU B OE1 1 
ATOM   3483 O OE2 . GLU B 1 115 ? 113.875 104.981 -40.299 1.00 23.04 ? 115 GLU B OE2 1 
ATOM   3484 N N   . ALA B 1 116 ? 110.728 99.890  -37.129 1.00 15.71 ? 116 ALA B N   1 
ATOM   3485 C CA  . ALA B 1 116 ? 110.627 98.522  -36.664 1.00 15.37 ? 116 ALA B CA  1 
ATOM   3486 C C   . ALA B 1 116 ? 109.308 97.885  -37.113 1.00 14.48 ? 116 ALA B C   1 
ATOM   3487 O O   . ALA B 1 116 ? 109.310 96.743  -37.620 1.00 14.57 ? 116 ALA B O   1 
ATOM   3488 C CB  . ALA B 1 116 ? 110.773 98.466  -35.133 1.00 13.95 ? 116 ALA B CB  1 
ATOM   3489 N N   . ARG B 1 117 ? 108.194 98.617  -36.901 1.00 14.91 ? 117 ARG B N   1 
ATOM   3490 C CA  . ARG B 1 117 ? 106.843 98.112  -37.278 1.00 15.31 ? 117 ARG B CA  1 
ATOM   3491 C C   . ARG B 1 117 ? 106.854 97.747  -38.771 1.00 15.61 ? 117 ARG B C   1 
ATOM   3492 O O   . ARG B 1 117 ? 106.436 96.656  -39.189 1.00 13.92 ? 117 ARG B O   1 
ATOM   3493 C CB  . ARG B 1 117 ? 105.755 99.205  -37.040 1.00 18.71 ? 117 ARG B CB  1 
ATOM   3494 C CG  . ARG B 1 117 ? 104.371 98.758  -37.535 1.00 23.23 ? 117 ARG B CG  1 
ATOM   3495 C CD  . ARG B 1 117 ? 103.277 99.824  -37.581 1.00 29.48 ? 117 ARG B CD  1 
ATOM   3496 N NE  . ARG B 1 117 ? 103.527 100.846 -36.591 1.00 40.83 ? 117 ARG B NE  1 
ATOM   3497 C CZ  . ARG B 1 117 ? 103.037 100.937 -35.352 1.00 41.24 ? 117 ARG B CZ  1 
ATOM   3498 N NH1 . ARG B 1 117 ? 102.168 100.042 -34.842 1.00 41.05 ? 117 ARG B NH1 1 
ATOM   3499 N NH2 . ARG B 1 117 ? 103.451 101.980 -34.608 1.00 39.75 ? 117 ARG B NH2 1 
ATOM   3500 N N   . ASN B 1 118 ? 107.339 98.679  -39.580 1.00 14.27 ? 118 ASN B N   1 
ATOM   3501 C CA  . ASN B 1 118 ? 107.349 98.453  -41.043 1.00 17.16 ? 118 ASN B CA  1 
ATOM   3502 C C   . ASN B 1 118 ? 108.177 97.232  -41.450 1.00 16.27 ? 118 ASN B C   1 
ATOM   3503 O O   . ASN B 1 118 ? 107.771 96.472  -42.333 1.00 15.47 ? 118 ASN B O   1 
ATOM   3504 C CB  . ASN B 1 118 ? 107.833 99.709  -41.772 1.00 16.49 ? 118 ASN B CB  1 
ATOM   3505 C CG  . ASN B 1 118 ? 106.872 100.867 -41.594 1.00 19.24 ? 118 ASN B CG  1 
ATOM   3506 O OD1 . ASN B 1 118 ? 105.757 100.740 -41.122 1.00 17.94 ? 118 ASN B OD1 1 
ATOM   3507 N ND2 . ASN B 1 118 ? 107.337 102.034 -41.964 1.00 23.40 ? 118 ASN B ND2 1 
ATOM   3508 N N   . LEU B 1 119 ? 109.291 96.994  -40.769 1.00 14.68 ? 119 LEU B N   1 
ATOM   3509 C CA  . LEU B 1 119 ? 110.103 95.855  -41.104 1.00 15.31 ? 119 LEU B CA  1 
ATOM   3510 C C   . LEU B 1 119 ? 109.476 94.584  -40.605 1.00 14.76 ? 119 LEU B C   1 
ATOM   3511 O O   . LEU B 1 119 ? 109.446 93.553  -41.327 1.00 15.84 ? 119 LEU B O   1 
ATOM   3512 C CB  . LEU B 1 119 ? 111.532 96.076  -40.590 1.00 14.94 ? 119 LEU B CB  1 
ATOM   3513 C CG  . LEU B 1 119 ? 112.512 94.994  -40.964 1.00 15.71 ? 119 LEU B CG  1 
ATOM   3514 C CD1 . LEU B 1 119 ? 112.601 94.805  -42.475 1.00 16.91 ? 119 LEU B CD1 1 
ATOM   3515 C CD2 . LEU B 1 119 ? 113.864 95.406  -40.416 1.00 16.56 ? 119 LEU B CD2 1 
ATOM   3516 N N   . VAL B 1 120 ? 108.859 94.641  -39.435 1.00 14.39 ? 120 VAL B N   1 
ATOM   3517 C CA  . VAL B 1 120 ? 108.046 93.471  -38.986 1.00 14.54 ? 120 VAL B CA  1 
ATOM   3518 C C   . VAL B 1 120 ? 106.894 93.109  -39.924 1.00 14.27 ? 120 VAL B C   1 
ATOM   3519 O O   . VAL B 1 120 ? 106.608 91.944  -40.118 1.00 13.93 ? 120 VAL B O   1 
ATOM   3520 C CB  . VAL B 1 120 ? 107.520 93.646  -37.547 1.00 13.99 ? 120 VAL B CB  1 
ATOM   3521 C CG1 . VAL B 1 120 ? 106.643 92.495  -37.147 1.00 14.90 ? 120 VAL B CG1 1 
ATOM   3522 C CG2 . VAL B 1 120 ? 108.687 93.781  -36.575 1.00 13.43 ? 120 VAL B CG2 1 
ATOM   3523 N N   . GLU B 1 121 ? 106.263 94.098  -40.528 1.00 13.98 ? 121 GLU B N   1 
ATOM   3524 C CA  . GLU B 1 121 ? 105.198 93.846  -41.509 1.00 15.42 ? 121 GLU B CA  1 
ATOM   3525 C C   . GLU B 1 121 ? 105.665 93.078  -42.770 1.00 15.22 ? 121 GLU B C   1 
ATOM   3526 O O   . GLU B 1 121 ? 104.870 92.528  -43.494 1.00 16.77 ? 121 GLU B O   1 
ATOM   3527 C CB  . GLU B 1 121 ? 104.578 95.194  -41.899 1.00 16.94 ? 121 GLU B CB  1 
ATOM   3528 C CG  . GLU B 1 121 ? 103.731 95.805  -40.806 1.00 17.98 ? 121 GLU B CG  1 
ATOM   3529 C CD  . GLU B 1 121 ? 102.987 97.033  -41.273 1.00 21.65 ? 121 GLU B CD  1 
ATOM   3530 O OE1 . GLU B 1 121 ? 102.739 97.095  -42.502 1.00 23.05 ? 121 GLU B OE1 1 
ATOM   3531 O OE2 . GLU B 1 121 ? 102.630 97.902  -40.435 1.00 23.05 ? 121 GLU B OE2 1 
ATOM   3532 N N   . LYS B 1 122 ? 106.994 92.976  -42.982 1.00 13.84 ? 122 LYS B N   1 
ATOM   3533 C CA  . LYS B 1 122 ? 107.602 92.253  -44.110 1.00 15.37 ? 122 LYS B CA  1 
ATOM   3534 C C   . LYS B 1 122 ? 108.186 90.910  -43.736 1.00 15.29 ? 122 LYS B C   1 
ATOM   3535 O O   . LYS B 1 122 ? 108.737 90.233  -44.586 1.00 16.37 ? 122 LYS B O   1 
ATOM   3536 C CB  . LYS B 1 122 ? 108.728 93.096  -44.725 1.00 17.03 ? 122 LYS B CB  1 
ATOM   3537 C CG  . LYS B 1 122 ? 108.253 94.494  -45.205 1.00 18.21 ? 122 LYS B CG  1 
ATOM   3538 C CD  . LYS B 1 122 ? 109.417 95.328  -45.709 1.00 19.12 ? 122 LYS B CD  1 
ATOM   3539 C CE  . LYS B 1 122 ? 109.015 96.717  -46.111 1.00 21.90 ? 122 LYS B CE  1 
ATOM   3540 N NZ  . LYS B 1 122 ? 108.645 97.631  -44.996 1.00 20.52 ? 122 LYS B NZ  1 
ATOM   3541 N N   . ILE B 1 123 ? 108.021 90.513  -42.490 1.00 13.58 ? 123 ILE B N   1 
ATOM   3542 C CA  . ILE B 1 123 ? 108.713 89.282  -41.987 1.00 14.38 ? 123 ILE B CA  1 
ATOM   3543 C C   . ILE B 1 123 ? 107.944 88.001  -42.005 1.00 14.28 ? 123 ILE B C   1 
ATOM   3544 O O   . ILE B 1 123 ? 106.683 87.965  -41.892 1.00 17.24 ? 123 ILE B O   1 
ATOM   3545 C CB  . ILE B 1 123 ? 109.253 89.547  -40.561 1.00 13.75 ? 123 ILE B CB  1 
ATOM   3546 C CG1 . ILE B 1 123 ? 110.594 88.823  -40.351 1.00 14.98 ? 123 ILE B CG1 1 
ATOM   3547 C CG2 . ILE B 1 123 ? 108.268 89.114  -39.488 1.00 15.12 ? 123 ILE B CG2 1 
ATOM   3548 C CD1 . ILE B 1 123 ? 111.447 89.416  -39.229 1.00 14.73 ? 123 ILE B CD1 1 
ATOM   3549 N N   . ASN B 1 124 ? 108.697 86.904  -42.118 1.00 14.32 ? 124 ASN B N   1 
ATOM   3550 C CA  . ASN B 1 124 ? 108.186 85.583  -41.899 1.00 14.69 ? 124 ASN B CA  1 
ATOM   3551 C C   . ASN B 1 124 ? 109.175 84.933  -40.954 1.00 15.10 ? 124 ASN B C   1 
ATOM   3552 O O   . ASN B 1 124 ? 110.335 84.680  -41.340 1.00 15.61 ? 124 ASN B O   1 
ATOM   3553 C CB  . ASN B 1 124 ? 108.137 84.759  -43.194 1.00 15.86 ? 124 ASN B CB  1 
ATOM   3554 C CG  . ASN B 1 124 ? 107.688 83.303  -42.951 1.00 17.57 ? 124 ASN B CG  1 
ATOM   3555 O OD1 . ASN B 1 124 ? 106.801 83.038  -42.109 1.00 19.40 ? 124 ASN B OD1 1 
ATOM   3556 N ND2 . ASN B 1 124 ? 108.312 82.378  -43.638 1.00 17.79 ? 124 ASN B ND2 1 
ATOM   3557 N N   . LEU B 1 125 ? 108.749 84.627  -39.725 1.00 13.37 ? 125 LEU B N   1 
ATOM   3558 C CA  . LEU B 1 125 ? 109.624 83.966  -38.775 1.00 14.36 ? 125 LEU B CA  1 
ATOM   3559 C C   . LEU B 1 125 ? 109.644 82.484  -39.089 1.00 15.23 ? 125 LEU B C   1 
ATOM   3560 O O   . LEU B 1 125 ? 108.627 81.851  -39.138 1.00 14.82 ? 125 LEU B O   1 
ATOM   3561 C CB  . LEU B 1 125 ? 109.222 84.215  -37.332 1.00 16.87 ? 125 LEU B CB  1 
ATOM   3562 C CG  . LEU B 1 125 ? 109.422 85.618  -36.755 1.00 16.07 ? 125 LEU B CG  1 
ATOM   3563 C CD1 . LEU B 1 125 ? 109.072 85.623  -35.295 1.00 16.78 ? 125 LEU B CD1 1 
ATOM   3564 C CD2 . LEU B 1 125 ? 110.807 86.162  -36.986 1.00 16.15 ? 125 LEU B CD2 1 
ATOM   3565 N N   . ILE B 1 126 ? 110.854 81.935  -39.271 1.00 14.81 ? 126 ILE B N   1 
ATOM   3566 C CA  . ILE B 1 126 ? 111.038 80.543  -39.703 1.00 15.53 ? 126 ILE B CA  1 
ATOM   3567 C C   . ILE B 1 126 ? 111.545 79.678  -38.614 1.00 15.57 ? 126 ILE B C   1 
ATOM   3568 O O   . ILE B 1 126 ? 112.361 80.078  -37.785 1.00 14.89 ? 126 ILE B O   1 
ATOM   3569 C CB  . ILE B 1 126 ? 111.894 80.418  -40.991 1.00 15.22 ? 126 ILE B CB  1 
ATOM   3570 C CG1 . ILE B 1 126 ? 113.260 81.081  -40.800 1.00 15.39 ? 126 ILE B CG1 1 
ATOM   3571 C CG2 . ILE B 1 126 ? 111.158 81.018  -42.170 1.00 17.03 ? 126 ILE B CG2 1 
ATOM   3572 C CD1 . ILE B 1 126 ? 114.279 80.788  -41.888 1.00 16.78 ? 126 ILE B CD1 1 
ATOM   3573 N N   . ASN B 1 127 ? 111.034 78.457  -38.626 1.00 14.86 ? 127 ASN B N   1 
ATOM   3574 C CA  . ASN B 1 127 ? 111.345 77.439  -37.614 1.00 15.88 ? 127 ASN B CA  1 
ATOM   3575 C C   . ASN B 1 127 ? 112.689 76.739  -37.818 1.00 19.90 ? 127 ASN B C   1 
ATOM   3576 O O   . ASN B 1 127 ? 112.766 75.568  -38.130 1.00 18.55 ? 127 ASN B O   1 
ATOM   3577 C CB  . ASN B 1 127 ? 110.209 76.427  -37.616 1.00 17.20 ? 127 ASN B CB  1 
ATOM   3578 C CG  . ASN B 1 127 ? 110.210 75.546  -36.401 1.00 21.64 ? 127 ASN B CG  1 
ATOM   3579 O OD1 . ASN B 1 127 ? 110.822 75.851  -35.422 1.00 20.69 ? 127 ASN B OD1 1 
ATOM   3580 N ND2 . ASN B 1 127 ? 109.606 74.395  -36.517 1.00 22.53 ? 127 ASN B ND2 1 
ATOM   3581 N N   . LEU B 1 128 ? 113.770 77.496  -37.693 1.00 17.05 ? 128 LEU B N   1 
ATOM   3582 C CA  . LEU B 1 128 ? 115.086 76.998  -37.823 1.00 19.34 ? 128 LEU B CA  1 
ATOM   3583 C C   . LEU B 1 128 ? 115.845 77.344  -36.582 1.00 19.75 ? 128 LEU B C   1 
ATOM   3584 O O   . LEU B 1 128 ? 115.925 78.533  -36.205 1.00 18.65 ? 128 LEU B O   1 
ATOM   3585 C CB  . LEU B 1 128 ? 115.655 77.683  -39.029 1.00 23.15 ? 128 LEU B CB  1 
ATOM   3586 C CG  . LEU B 1 128 ? 116.796 77.140  -39.792 1.00 33.19 ? 128 LEU B CG  1 
ATOM   3587 C CD1 . LEU B 1 128 ? 116.764 75.599  -39.924 1.00 38.06 ? 128 LEU B CD1 1 
ATOM   3588 C CD2 . LEU B 1 128 ? 116.732 77.835  -41.187 1.00 30.70 ? 128 LEU B CD2 1 
ATOM   3589 N N   A SER B 1 129 ? 116.307 76.332  -35.847 0.46 18.91 ? 129 SER B N   1 
ATOM   3590 N N   B SER B 1 129 ? 116.358 76.312  -35.910 0.54 19.17 ? 129 SER B N   1 
ATOM   3591 C CA  A SER B 1 129 ? 117.069 76.548  -34.621 0.46 18.91 ? 129 SER B CA  1 
ATOM   3592 C CA  B SER B 1 129 ? 117.077 76.512  -34.663 0.54 19.51 ? 129 SER B CA  1 
ATOM   3593 C C   A SER B 1 129 ? 118.508 76.947  -34.902 0.46 17.56 ? 129 SER B C   1 
ATOM   3594 C C   B SER B 1 129 ? 118.516 76.923  -34.918 0.54 17.64 ? 129 SER B C   1 
ATOM   3595 O O   A SER B 1 129 ? 119.082 76.672  -35.950 0.46 16.12 ? 129 SER B O   1 
ATOM   3596 O O   B SER B 1 129 ? 119.073 76.659  -36.006 0.54 15.70 ? 129 SER B O   1 
ATOM   3597 C CB  A SER B 1 129 ? 117.095 75.257  -33.776 0.46 19.31 ? 129 SER B CB  1 
ATOM   3598 C CB  B SER B 1 129 ? 117.012 75.228  -33.806 0.54 20.52 ? 129 SER B CB  1 
ATOM   3599 O OG  A SER B 1 129 ? 117.862 74.287  -34.445 0.46 19.96 ? 129 SER B OG  1 
ATOM   3600 O OG  B SER B 1 129 ? 115.648 74.880  -33.623 0.54 22.18 ? 129 SER B OG  1 
ATOM   3601 N N   . PHE B 1 130 ? 119.102 77.585  -33.916 1.00 18.41 ? 130 PHE B N   1 
ATOM   3602 C CA  . PHE B 1 130 ? 120.497 77.995  -33.969 1.00 18.14 ? 130 PHE B CA  1 
ATOM   3603 C C   . PHE B 1 130 ? 121.441 76.832  -34.193 1.00 18.54 ? 130 PHE B C   1 
ATOM   3604 O O   . PHE B 1 130 ? 122.326 76.865  -35.058 1.00 15.25 ? 130 PHE B O   1 
ATOM   3605 C CB  . PHE B 1 130 ? 120.889 78.793  -32.716 1.00 19.05 ? 130 PHE B CB  1 
ATOM   3606 C CG  . PHE B 1 130 ? 122.279 79.294  -32.807 1.00 20.15 ? 130 PHE B CG  1 
ATOM   3607 C CD1 . PHE B 1 130 ? 122.555 80.413  -33.559 1.00 19.93 ? 130 PHE B CD1 1 
ATOM   3608 C CD2 . PHE B 1 130 ? 123.332 78.558  -32.256 1.00 20.61 ? 130 PHE B CD2 1 
ATOM   3609 C CE1 . PHE B 1 130 ? 123.851 80.859  -33.722 1.00 22.28 ? 130 PHE B CE1 1 
ATOM   3610 C CE2 . PHE B 1 130 ? 124.607 78.989  -32.407 1.00 18.75 ? 130 PHE B CE2 1 
ATOM   3611 C CZ  . PHE B 1 130 ? 124.890 80.111  -33.148 1.00 22.13 ? 130 PHE B CZ  1 
ATOM   3612 N N   . SER B 1 131 ? 121.230 75.772  -33.418 1.00 19.54 ? 131 SER B N   1 
ATOM   3613 C CA  . SER B 1 131 ? 122.021 74.572  -33.532 1.00 22.05 ? 131 SER B CA  1 
ATOM   3614 C C   . SER B 1 131 ? 121.176 73.473  -32.878 1.00 26.18 ? 131 SER B C   1 
ATOM   3615 O O   . SER B 1 131 ? 120.180 73.761  -32.149 1.00 21.43 ? 131 SER B O   1 
ATOM   3616 C CB  . SER B 1 131 ? 123.322 74.708  -32.753 1.00 22.15 ? 131 SER B CB  1 
ATOM   3617 O OG  . SER B 1 131 ? 123.064 74.782  -31.337 1.00 20.82 ? 131 SER B OG  1 
ATOM   3618 N N   . GLU B 1 132 ? 121.658 72.255  -32.986 1.00 28.57 ? 132 GLU B N   1 
ATOM   3619 C CA  . GLU B 1 132 ? 120.993 71.140  -32.309 1.00 31.36 ? 132 GLU B CA  1 
ATOM   3620 C C   . GLU B 1 132 ? 121.051 71.185  -30.802 1.00 31.98 ? 132 GLU B C   1 
ATOM   3621 O O   . GLU B 1 132 ? 120.139 70.724  -30.155 1.00 37.28 ? 132 GLU B O   1 
ATOM   3622 C CB  . GLU B 1 132 ? 121.563 69.884  -32.858 1.00 36.24 ? 132 GLU B CB  1 
ATOM   3623 C CG  . GLU B 1 132 ? 121.251 69.769  -34.326 1.00 45.19 ? 132 GLU B CG  1 
ATOM   3624 C CD  . GLU B 1 132 ? 120.924 68.361  -34.660 1.00 48.32 ? 132 GLU B CD  1 
ATOM   3625 O OE1 . GLU B 1 132 ? 119.830 67.918  -34.348 1.00 42.57 ? 132 GLU B OE1 1 
ATOM   3626 O OE2 . GLU B 1 132 ? 121.819 67.663  -35.156 1.00 70.83 ? 132 GLU B OE2 1 
ATOM   3627 N N   . GLN B 1 133 ? 122.057 71.857  -30.259 1.00 28.23 ? 133 GLN B N   1 
ATOM   3628 C CA  . GLN B 1 133 ? 122.203 72.065  -28.809 1.00 33.79 ? 133 GLN B CA  1 
ATOM   3629 C C   . GLN B 1 133 ? 121.443 73.313  -28.224 1.00 32.19 ? 133 GLN B C   1 
ATOM   3630 O O   . GLN B 1 133 ? 121.292 73.456  -26.994 1.00 25.52 ? 133 GLN B O   1 
ATOM   3631 C CB  . GLN B 1 133 ? 123.681 72.206  -28.448 1.00 38.08 ? 133 GLN B CB  1 
ATOM   3632 C CG  . GLN B 1 133 ? 124.663 71.077  -28.884 1.00 46.60 ? 133 GLN B CG  1 
ATOM   3633 C CD  . GLN B 1 133 ? 124.663 70.796  -30.381 1.00 53.60 ? 133 GLN B CD  1 
ATOM   3634 O OE1 . GLN B 1 133 ? 124.803 71.721  -31.205 1.00 45.66 ? 133 GLN B OE1 1 
ATOM   3635 N NE2 . GLN B 1 133 ? 124.428 69.537  -30.748 1.00 56.86 ? 133 GLN B NE2 1 
ATOM   3636 N N   . LEU B 1 134 ? 121.022 74.246  -29.091 1.00 23.59 ? 134 LEU B N   1 
ATOM   3637 C CA  . LEU B 1 134 ? 120.299 75.422  -28.641 1.00 25.07 ? 134 LEU B CA  1 
ATOM   3638 C C   . LEU B 1 134 ? 118.940 75.485  -29.383 1.00 24.66 ? 134 LEU B C   1 
ATOM   3639 O O   . LEU B 1 134 ? 118.809 76.159  -30.399 1.00 27.91 ? 134 LEU B O   1 
ATOM   3640 C CB  . LEU B 1 134 ? 121.151 76.675  -28.858 1.00 25.26 ? 134 LEU B CB  1 
ATOM   3641 C CG  . LEU B 1 134 ? 122.420 76.808  -27.963 1.00 27.37 ? 134 LEU B CG  1 
ATOM   3642 C CD1 . LEU B 1 134 ? 123.303 77.975  -28.405 1.00 27.25 ? 134 LEU B CD1 1 
ATOM   3643 C CD2 . LEU B 1 134 ? 122.024 77.013  -26.503 1.00 31.26 ? 134 LEU B CD2 1 
ATOM   3644 N N   . PRO B 1 135 ? 117.953 74.734  -28.925 1.00 26.08 ? 135 PRO B N   1 
ATOM   3645 C CA  . PRO B 1 135 ? 116.647 74.747  -29.640 1.00 25.65 ? 135 PRO B CA  1 
ATOM   3646 C C   . PRO B 1 135 ? 115.870 76.050  -29.508 1.00 22.52 ? 135 PRO B C   1 
ATOM   3647 O O   . PRO B 1 135 ? 116.155 76.880  -28.606 1.00 21.47 ? 135 PRO B O   1 
ATOM   3648 C CB  . PRO B 1 135 ? 115.880 73.634  -28.940 1.00 28.43 ? 135 PRO B CB  1 
ATOM   3649 C CG  . PRO B 1 135 ? 116.358 73.756  -27.504 1.00 29.69 ? 135 PRO B CG  1 
ATOM   3650 C CD  . PRO B 1 135 ? 117.841 74.065  -27.611 1.00 27.83 ? 135 PRO B CD  1 
ATOM   3651 N N   . LEU B 1 136 ? 114.929 76.274  -30.404 1.00 20.71 ? 136 LEU B N   1 
ATOM   3652 C CA  . LEU B 1 136 ? 114.099 77.457  -30.379 1.00 22.33 ? 136 LEU B CA  1 
ATOM   3653 C C   . LEU B 1 136 ? 113.113 77.399  -29.205 1.00 23.00 ? 136 LEU B C   1 
ATOM   3654 O O   . LEU B 1 136 ? 112.560 76.374  -28.923 1.00 25.09 ? 136 LEU B O   1 
ATOM   3655 C CB  . LEU B 1 136 ? 113.293 77.566  -31.675 1.00 21.84 ? 136 LEU B CB  1 
ATOM   3656 C CG  . LEU B 1 136 ? 114.045 78.051  -32.919 1.00 21.17 ? 136 LEU B CG  1 
ATOM   3657 C CD1 . LEU B 1 136 ? 113.080 78.147  -34.099 1.00 20.67 ? 136 LEU B CD1 1 
ATOM   3658 C CD2 . LEU B 1 136 ? 114.739 79.401  -32.703 1.00 20.49 ? 136 LEU B CD2 1 
ATOM   3659 N N   . ALA B 1 137 ? 112.894 78.520  -28.556 1.00 23.15 ? 137 ALA B N   1 
ATOM   3660 C CA  . ALA B 1 137 ? 111.777 78.671  -27.603 1.00 23.83 ? 137 ALA B CA  1 
ATOM   3661 C C   . ALA B 1 137 ? 110.708 79.540  -28.271 1.00 19.23 ? 137 ALA B C   1 
ATOM   3662 O O   . ALA B 1 137 ? 111.029 80.428  -29.102 1.00 19.10 ? 137 ALA B O   1 
ATOM   3663 C CB  . ALA B 1 137 ? 112.315 79.379  -26.366 1.00 25.55 ? 137 ALA B CB  1 
ATOM   3664 N N   . GLY B 1 138 ? 109.444 79.348  -27.898 1.00 16.27 ? 138 GLY B N   1 
ATOM   3665 C CA  . GLY B 1 138 ? 108.398 80.265  -28.294 1.00 15.79 ? 138 GLY B CA  1 
ATOM   3666 C C   . GLY B 1 138 ? 108.626 81.612  -27.570 1.00 16.08 ? 138 GLY B C   1 
ATOM   3667 O O   . GLY B 1 138 ? 108.735 81.652  -26.316 1.00 16.45 ? 138 GLY B O   1 
ATOM   3668 N N   . LEU B 1 139 ? 108.652 82.670  -28.335 1.00 15.03 ? 139 LEU B N   1 
ATOM   3669 C CA  . LEU B 1 139 ? 108.817 84.024  -27.815 1.00 15.79 ? 139 LEU B CA  1 
ATOM   3670 C C   . LEU B 1 139 ? 107.846 85.002  -28.391 1.00 13.78 ? 139 LEU B C   1 
ATOM   3671 O O   . LEU B 1 139 ? 107.291 84.794  -29.481 1.00 15.64 ? 139 LEU B O   1 
ATOM   3672 C CB  . LEU B 1 139 ? 110.209 84.587  -28.174 1.00 16.61 ? 139 LEU B CB  1 
ATOM   3673 C CG  . LEU B 1 139 ? 111.439 83.815  -27.712 1.00 17.76 ? 139 LEU B CG  1 
ATOM   3674 C CD1 . LEU B 1 139 ? 112.736 84.245  -28.443 1.00 19.50 ? 139 LEU B CD1 1 
ATOM   3675 C CD2 . LEU B 1 139 ? 111.581 83.956  -26.202 1.00 20.74 ? 139 LEU B CD2 1 
ATOM   3676 N N   . HIS B 1 140 ? 107.668 86.134  -27.673 1.00 12.35 ? 140 HIS B N   1 
ATOM   3677 C CA  . HIS B 1 140 ? 107.078 87.357  -28.234 1.00 12.09 ? 140 HIS B CA  1 
ATOM   3678 C C   . HIS B 1 140 ? 107.948 88.525  -27.790 1.00 11.78 ? 140 HIS B C   1 
ATOM   3679 O O   . HIS B 1 140 ? 108.862 88.316  -26.978 1.00 12.10 ? 140 HIS B O   1 
ATOM   3680 C CB  . HIS B 1 140 ? 105.621 87.520  -27.865 1.00 12.77 ? 140 HIS B CB  1 
ATOM   3681 C CG  . HIS B 1 140 ? 105.333 87.725  -26.405 1.00 13.96 ? 140 HIS B CG  1 
ATOM   3682 N ND1 . HIS B 1 140 ? 104.085 88.174  -25.951 1.00 13.66 ? 140 HIS B ND1 1 
ATOM   3683 C CD2 . HIS B 1 140 ? 106.079 87.503  -25.291 1.00 13.21 ? 140 HIS B CD2 1 
ATOM   3684 C CE1 . HIS B 1 140 ? 104.107 88.256  -24.627 1.00 11.87 ? 140 HIS B CE1 1 
ATOM   3685 N NE2 . HIS B 1 140 ? 105.296 87.867  -24.204 1.00 13.97 ? 140 HIS B NE2 1 
ATOM   3686 N N   . TRP B 1 141 ? 107.763 89.684  -28.397 1.00 11.75 ? 141 TRP B N   1 
ATOM   3687 C CA  . TRP B 1 141 ? 108.736 90.768  -28.265 1.00 12.87 ? 141 TRP B CA  1 
ATOM   3688 C C   . TRP B 1 141 ? 108.078 92.064  -27.880 1.00 13.83 ? 141 TRP B C   1 
ATOM   3689 O O   . TRP B 1 141 ? 106.973 92.404  -28.360 1.00 14.60 ? 141 TRP B O   1 
ATOM   3690 C CB  . TRP B 1 141 ? 109.555 90.972  -29.579 1.00 13.72 ? 141 TRP B CB  1 
ATOM   3691 C CG  . TRP B 1 141 ? 110.369 89.749  -29.913 1.00 13.43 ? 141 TRP B CG  1 
ATOM   3692 C CD1 . TRP B 1 141 ? 111.660 89.528  -29.564 1.00 12.56 ? 141 TRP B CD1 1 
ATOM   3693 C CD2 . TRP B 1 141 ? 109.911 88.539  -30.572 1.00 14.82 ? 141 TRP B CD2 1 
ATOM   3694 N NE1 . TRP B 1 141 ? 112.032 88.256  -29.960 1.00 11.86 ? 141 TRP B NE1 1 
ATOM   3695 C CE2 . TRP B 1 141 ? 110.993 87.677  -30.643 1.00 12.50 ? 141 TRP B CE2 1 
ATOM   3696 C CE3 . TRP B 1 141 ? 108.694 88.156  -31.175 1.00 15.47 ? 141 TRP B CE3 1 
ATOM   3697 C CZ2 . TRP B 1 141 ? 110.909 86.414  -31.221 1.00 15.22 ? 141 TRP B CZ2 1 
ATOM   3698 C CZ3 . TRP B 1 141 ? 108.628 86.926  -31.795 1.00 15.47 ? 141 TRP B CZ3 1 
ATOM   3699 C CH2 . TRP B 1 141 ? 109.695 86.049  -31.754 1.00 16.88 ? 141 TRP B CH2 1 
ATOM   3700 N N   . LEU B 1 142 ? 108.814 92.826  -27.063 1.00 12.70 ? 142 LEU B N   1 
ATOM   3701 C CA  . LEU B 1 142 ? 108.552 94.236  -26.892 1.00 13.19 ? 142 LEU B CA  1 
ATOM   3702 C C   . LEU B 1 142 ? 109.638 95.002  -27.625 1.00 13.84 ? 142 LEU B C   1 
ATOM   3703 O O   . LEU B 1 142 ? 110.831 94.783  -27.400 1.00 14.27 ? 142 LEU B O   1 
ATOM   3704 C CB  . LEU B 1 142 ? 108.633 94.601  -25.387 1.00 13.60 ? 142 LEU B CB  1 
ATOM   3705 C CG  . LEU B 1 142 ? 108.268 96.024  -24.963 1.00 14.77 ? 142 LEU B CG  1 
ATOM   3706 C CD1 . LEU B 1 142 ? 106.791 96.287  -25.285 1.00 15.34 ? 142 LEU B CD1 1 
ATOM   3707 C CD2 . LEU B 1 142 ? 108.496 96.279  -23.444 1.00 16.26 ? 142 LEU B CD2 1 
ATOM   3708 N N   . ILE B 1 143 ? 109.195 95.984  -28.398 1.00 14.90 ? 143 ILE B N   1 
ATOM   3709 C CA  . ILE B 1 143 ? 110.087 96.904  -29.107 1.00 14.31 ? 143 ILE B CA  1 
ATOM   3710 C C   . ILE B 1 143 ? 109.755 98.327  -28.608 1.00 15.53 ? 143 ILE B C   1 
ATOM   3711 O O   . ILE B 1 143 ? 108.567 98.718  -28.606 1.00 15.41 ? 143 ILE B O   1 
ATOM   3712 C CB  . ILE B 1 143 ? 109.874 96.794  -30.614 1.00 13.97 ? 143 ILE B CB  1 
ATOM   3713 C CG1 . ILE B 1 143 ? 110.245 95.356  -31.060 1.00 14.97 ? 143 ILE B CG1 1 
ATOM   3714 C CG2 . ILE B 1 143 ? 110.724 97.846  -31.326 1.00 14.63 ? 143 ILE B CG2 1 
ATOM   3715 C CD1 . ILE B 1 143 ? 109.961 95.060  -32.488 1.00 14.71 ? 143 ILE B CD1 1 
ATOM   3716 N N   . ALA B 1 144 ? 110.764 99.087  -28.157 1.00 14.92 ? 144 ALA B N   1 
ATOM   3717 C CA  . ALA B 1 144 ? 110.522 100.382 -27.583 1.00 15.33 ? 144 ALA B CA  1 
ATOM   3718 C C   . ALA B 1 144 ? 111.536 101.403 -27.968 1.00 16.11 ? 144 ALA B C   1 
ATOM   3719 O O   . ALA B 1 144 ? 112.739 101.111 -28.065 1.00 15.17 ? 144 ALA B O   1 
ATOM   3720 C CB  . ALA B 1 144 ? 110.530 100.283 -26.049 1.00 15.12 ? 144 ALA B CB  1 
ATOM   3721 N N   . ASP B 1 145 ? 111.077 102.627 -28.136 1.00 15.77 ? 145 ASP B N   1 
ATOM   3722 C CA  . ASP B 1 145 ? 112.007 103.751 -28.309 1.00 15.95 ? 145 ASP B CA  1 
ATOM   3723 C C   . ASP B 1 145 ? 111.672 104.731 -27.198 1.00 17.79 ? 145 ASP B C   1 
ATOM   3724 O O   . ASP B 1 145 ? 110.881 104.416 -26.305 1.00 17.57 ? 145 ASP B O   1 
ATOM   3725 C CB  . ASP B 1 145 ? 112.009 104.289 -29.735 1.00 15.83 ? 145 ASP B CB  1 
ATOM   3726 C CG  . ASP B 1 145 ? 110.721 104.955 -30.142 1.00 15.81 ? 145 ASP B CG  1 
ATOM   3727 O OD1 . ASP B 1 145 ? 109.883 105.314 -29.290 1.00 14.26 ? 145 ASP B OD1 1 
ATOM   3728 O OD2 . ASP B 1 145 ? 110.568 105.074 -31.352 1.00 17.02 ? 145 ASP B OD2 1 
ATOM   3729 N N   . ARG B 1 146 ? 112.240 105.927 -27.248 1.00 17.87 ? 146 ARG B N   1 
ATOM   3730 C CA  . ARG B 1 146 ? 112.040 106.906 -26.194 1.00 20.16 ? 146 ARG B CA  1 
ATOM   3731 C C   . ARG B 1 146 ? 110.629 107.430 -26.160 1.00 21.02 ? 146 ARG B C   1 
ATOM   3732 O O   . ARG B 1 146 ? 110.228 107.989 -25.166 1.00 21.00 ? 146 ARG B O   1 
ATOM   3733 C CB  . ARG B 1 146 ? 113.047 108.053 -26.377 1.00 23.08 ? 146 ARG B CB  1 
ATOM   3734 C CG  . ARG B 1 146 ? 112.753 108.969 -27.574 1.00 24.97 ? 146 ARG B CG  1 
ATOM   3735 C CD  . ARG B 1 146 ? 113.914 109.930 -27.848 1.00 32.62 ? 146 ARG B CD  1 
ATOM   3736 N NE  . ARG B 1 146 ? 114.259 110.700 -26.640 1.00 38.68 ? 146 ARG B NE  1 
ATOM   3737 C CZ  . ARG B 1 146 ? 113.784 111.909 -26.240 1.00 41.50 ? 146 ARG B CZ  1 
ATOM   3738 N NH1 . ARG B 1 146 ? 112.870 112.582 -26.932 1.00 40.40 ? 146 ARG B NH1 1 
ATOM   3739 N NH2 . ARG B 1 146 ? 114.204 112.428 -25.077 1.00 38.82 ? 146 ARG B NH2 1 
ATOM   3740 N N   . GLU B 1 147 ? 109.881 107.245 -27.234 1.00 19.75 ? 147 GLU B N   1 
ATOM   3741 C CA  . GLU B 1 147 ? 108.522 107.736 -27.337 1.00 24.40 ? 147 GLU B CA  1 
ATOM   3742 C C   . GLU B 1 147 ? 107.451 106.691 -27.030 1.00 22.52 ? 147 GLU B C   1 
ATOM   3743 O O   . GLU B 1 147 ? 106.437 107.028 -26.390 1.00 20.00 ? 147 GLU B O   1 
ATOM   3744 C CB  . GLU B 1 147 ? 108.306 108.315 -28.739 1.00 26.46 ? 147 GLU B CB  1 
ATOM   3745 C CG  . GLU B 1 147 ? 106.914 108.879 -29.008 1.00 34.83 ? 147 GLU B CG  1 
ATOM   3746 C CD  . GLU B 1 147 ? 106.626 109.146 -30.499 1.00 42.99 ? 147 GLU B CD  1 
ATOM   3747 O OE1 . GLU B 1 147 ? 107.446 108.818 -31.380 1.00 42.05 ? 147 GLU B OE1 1 
ATOM   3748 O OE2 . GLU B 1 147 ? 105.518 109.658 -30.813 1.00 45.49 ? 147 GLU B OE2 1 
ATOM   3749 N N   . LYS B 1 148 ? 107.573 105.459 -27.556 1.00 18.64 ? 148 LYS B N   1 
ATOM   3750 C CA  . LYS B 1 148 ? 106.471 104.519 -27.492 1.00 19.35 ? 148 LYS B CA  1 
ATOM   3751 C C   . LYS B 1 148 ? 106.973 103.096 -27.637 1.00 17.48 ? 148 LYS B C   1 
ATOM   3752 O O   . LYS B 1 148 ? 108.164 102.887 -27.778 1.00 15.46 ? 148 LYS B O   1 
ATOM   3753 C CB  . LYS B 1 148 ? 105.491 104.845 -28.603 1.00 20.59 ? 148 LYS B CB  1 
ATOM   3754 C CG  . LYS B 1 148 ? 106.040 104.712 -30.017 1.00 21.08 ? 148 LYS B CG  1 
ATOM   3755 C CD  . LYS B 1 148 ? 105.030 105.271 -31.039 1.00 24.69 ? 148 LYS B CD  1 
ATOM   3756 C CE  . LYS B 1 148 ? 105.502 105.015 -32.423 1.00 26.13 ? 148 LYS B CE  1 
ATOM   3757 N NZ  . LYS B 1 148 ? 104.575 105.633 -33.399 1.00 30.18 ? 148 LYS B NZ  1 
ATOM   3758 N N   . SER B 1 149 ? 106.075 102.144 -27.504 1.00 16.66 ? 149 SER B N   1 
ATOM   3759 C CA  . SER B 1 149 ? 106.438 100.719 -27.676 1.00 15.07 ? 149 SER B CA  1 
ATOM   3760 C C   . SER B 1 149 ? 105.341 99.957  -28.390 1.00 13.40 ? 149 SER B C   1 
ATOM   3761 O O   . SER B 1 149 ? 104.174 100.358 -28.363 1.00 13.55 ? 149 SER B O   1 
ATOM   3762 C CB  . SER B 1 149 ? 106.759 100.049 -26.301 1.00 15.36 ? 149 SER B CB  1 
ATOM   3763 O OG  . SER B 1 149 ? 105.721 100.229 -25.376 1.00 15.79 ? 149 SER B OG  1 
ATOM   3764 N N   . ILE B 1 150 ? 105.745 98.837  -28.956 1.00 13.71 ? 150 ILE B N   1 
ATOM   3765 C CA  . ILE B 1 150 ? 104.879 97.926  -29.609 1.00 13.87 ? 150 ILE B CA  1 
ATOM   3766 C C   . ILE B 1 150 ? 105.189 96.528  -29.146 1.00 13.68 ? 150 ILE B C   1 
ATOM   3767 O O   . ILE B 1 150 ? 106.313 96.221  -28.695 1.00 14.38 ? 150 ILE B O   1 
ATOM   3768 C CB  . ILE B 1 150 ? 104.965 97.982  -31.127 1.00 15.21 ? 150 ILE B CB  1 
ATOM   3769 C CG1 . ILE B 1 150 ? 106.388 97.711  -31.582 1.00 15.33 ? 150 ILE B CG1 1 
ATOM   3770 C CG2 . ILE B 1 150 ? 104.409 99.313  -31.660 1.00 16.65 ? 150 ILE B CG2 1 
ATOM   3771 C CD1 . ILE B 1 150 ? 106.554 97.639  -33.070 1.00 17.65 ? 150 ILE B CD1 1 
ATOM   3772 N N   . VAL B 1 151 ? 104.224 95.668  -29.336 1.00 13.28 ? 151 VAL B N   1 
ATOM   3773 C CA  . VAL B 1 151 ? 104.307 94.294  -29.020 1.00 13.34 ? 151 VAL B CA  1 
ATOM   3774 C C   . VAL B 1 151 ? 104.187 93.520  -30.330 1.00 13.63 ? 151 VAL B C   1 
ATOM   3775 O O   . VAL B 1 151 ? 103.290 93.793  -31.124 1.00 15.11 ? 151 VAL B O   1 
ATOM   3776 C CB  . VAL B 1 151 ? 103.196 93.865  -28.033 1.00 13.33 ? 151 VAL B CB  1 
ATOM   3777 C CG1 . VAL B 1 151 ? 103.223 92.364  -27.796 1.00 14.80 ? 151 VAL B CG1 1 
ATOM   3778 C CG2 . VAL B 1 151 ? 103.361 94.577  -26.716 1.00 14.76 ? 151 VAL B CG2 1 
ATOM   3779 N N   . VAL B 1 152 ? 105.064 92.542  -30.496 1.00 12.46 ? 152 VAL B N   1 
ATOM   3780 C CA  . VAL B 1 152 ? 105.011 91.651  -31.647 1.00 14.29 ? 152 VAL B CA  1 
ATOM   3781 C C   . VAL B 1 152 ? 104.696 90.282  -31.211 1.00 13.80 ? 152 VAL B C   1 
ATOM   3782 O O   . VAL B 1 152 ? 105.494 89.673  -30.471 1.00 14.51 ? 152 VAL B O   1 
ATOM   3783 C CB  . VAL B 1 152 ? 106.330 91.678  -32.480 1.00 13.76 ? 152 VAL B CB  1 
ATOM   3784 C CG1 . VAL B 1 152 ? 106.209 90.753  -33.690 1.00 14.75 ? 152 VAL B CG1 1 
ATOM   3785 C CG2 . VAL B 1 152 ? 106.621 93.099  -32.954 1.00 14.29 ? 152 VAL B CG2 1 
ATOM   3786 N N   . GLU B 1 153 ? 103.572 89.723  -31.699 1.00 12.78 ? 153 GLU B N   1 
ATOM   3787 C CA  . GLU B 1 153 ? 103.197 88.341  -31.412 1.00 13.50 ? 153 GLU B CA  1 
ATOM   3788 C C   . GLU B 1 153 ? 102.883 87.632  -32.730 1.00 14.03 ? 153 GLU B C   1 
ATOM   3789 O O   . GLU B 1 153 ? 101.965 88.023  -33.456 1.00 15.95 ? 153 GLU B O   1 
ATOM   3790 C CB  . GLU B 1 153 ? 101.965 88.311  -30.470 1.00 14.81 ? 153 GLU B CB  1 
ATOM   3791 C CG  . GLU B 1 153 ? 102.407 88.635  -29.031 1.00 15.62 ? 153 GLU B CG  1 
ATOM   3792 C CD  . GLU B 1 153 ? 101.312 88.756  -27.959 1.00 15.56 ? 153 GLU B CD  1 
ATOM   3793 O OE1 . GLU B 1 153 ? 100.075 88.704  -28.320 1.00 14.00 ? 153 GLU B OE1 1 
ATOM   3794 O OE2 . GLU B 1 153 ? 101.736 88.930  -26.764 1.00 13.58 ? 153 GLU B OE2 1 
ATOM   3795 N N   . VAL B 1 154 ? 103.733 86.688  -33.081 1.00 14.93 ? 154 VAL B N   1 
ATOM   3796 C CA  . VAL B 1 154 ? 103.595 85.886  -34.283 1.00 17.47 ? 154 VAL B CA  1 
ATOM   3797 C C   . VAL B 1 154 ? 102.969 84.566  -33.850 1.00 17.12 ? 154 VAL B C   1 
ATOM   3798 O O   . VAL B 1 154 ? 103.604 83.750  -33.204 1.00 18.09 ? 154 VAL B O   1 
ATOM   3799 C CB  . VAL B 1 154 ? 104.929 85.659  -34.992 1.00 16.35 ? 154 VAL B CB  1 
ATOM   3800 C CG1 . VAL B 1 154 ? 104.764 84.865  -36.325 1.00 17.84 ? 154 VAL B CG1 1 
ATOM   3801 C CG2 . VAL B 1 154 ? 105.550 87.022  -35.310 1.00 16.56 ? 154 VAL B CG2 1 
ATOM   3802 N N   . THR B 1 155 ? 101.736 84.372  -34.245 1.00 17.97 ? 155 THR B N   1 
ATOM   3803 C CA  . THR B 1 155 ? 100.979 83.178  -33.846 1.00 17.51 ? 155 THR B CA  1 
ATOM   3804 C C   . THR B 1 155 ? 100.454 82.483  -35.074 1.00 21.02 ? 155 THR B C   1 
ATOM   3805 O O   . THR B 1 155 ? 100.649 82.963  -36.219 1.00 19.46 ? 155 THR B O   1 
ATOM   3806 C CB  . THR B 1 155 ? 99.768  83.608  -33.024 1.00 18.83 ? 155 THR B CB  1 
ATOM   3807 O OG1 . THR B 1 155 ? 98.860  84.383  -33.831 1.00 20.66 ? 155 THR B OG1 1 
ATOM   3808 C CG2 . THR B 1 155 ? 100.225 84.488  -31.865 1.00 21.80 ? 155 THR B CG2 1 
ATOM   3809 N N   . LYS B 1 156 ? 99.728  81.380  -34.870 1.00 22.88 ? 156 LYS B N   1 
ATOM   3810 C CA  . LYS B 1 156 ? 99.111  80.688  -36.043 1.00 25.41 ? 156 LYS B CA  1 
ATOM   3811 C C   . LYS B 1 156 ? 98.198  81.604  -36.877 1.00 24.01 ? 156 LYS B C   1 
ATOM   3812 O O   . LYS B 1 156 ? 98.051  81.358  -38.081 1.00 26.06 ? 156 LYS B O   1 
ATOM   3813 C CB  . LYS B 1 156 ? 98.353  79.435  -35.598 1.00 28.05 ? 156 LYS B CB  1 
ATOM   3814 C CG  . LYS B 1 156 ? 99.260  78.315  -35.179 1.00 41.07 ? 156 LYS B CG  1 
ATOM   3815 C CD  . LYS B 1 156 ? 98.510  77.109  -34.617 1.00 50.92 ? 156 LYS B CD  1 
ATOM   3816 C CE  . LYS B 1 156 ? 99.462  76.180  -33.850 1.00 60.17 ? 156 LYS B CE  1 
ATOM   3817 N NZ  . LYS B 1 156 ? 99.287  74.751  -34.257 1.00 66.07 ? 156 LYS B NZ  1 
ATOM   3818 N N   . SER B 1 157 ? 97.609  82.653  -36.318 1.00 22.38 ? 157 SER B N   1 
ATOM   3819 C CA  . SER B 1 157 ? 96.759  83.542  -37.105 1.00 23.39 ? 157 SER B CA  1 
ATOM   3820 C C   . SER B 1 157 ? 97.439  84.709  -37.767 1.00 26.36 ? 157 SER B C   1 
ATOM   3821 O O   . SER B 1 157 ? 96.745  85.517  -38.361 1.00 26.63 ? 157 SER B O   1 
ATOM   3822 C CB  . SER B 1 157 ? 95.624  84.094  -36.275 1.00 25.99 ? 157 SER B CB  1 
ATOM   3823 O OG  . SER B 1 157 ? 96.131  84.832  -35.181 1.00 23.01 ? 157 SER B OG  1 
ATOM   3824 N N   . GLY B 1 158 ? 98.748  84.878  -37.629 1.00 24.28 ? 158 GLY B N   1 
ATOM   3825 C CA  . GLY B 1 158 ? 99.396  85.991  -38.309 1.00 27.46 ? 158 GLY B CA  1 
ATOM   3826 C C   . GLY B 1 158 ? 100.519 86.637  -37.498 1.00 24.42 ? 158 GLY B C   1 
ATOM   3827 O O   . GLY B 1 158 ? 100.803 86.265  -36.346 1.00 20.10 ? 158 GLY B O   1 
ATOM   3828 N N   . VAL B 1 159 ? 101.123 87.625  -38.136 1.00 20.50 ? 159 VAL B N   1 
ATOM   3829 C CA  . VAL B 1 159 ? 102.098 88.471  -37.480 1.00 18.42 ? 159 VAL B CA  1 
ATOM   3830 C C   . VAL B 1 159 ? 101.277 89.623  -36.861 1.00 19.92 ? 159 VAL B C   1 
ATOM   3831 O O   . VAL B 1 159 ? 100.818 90.538  -37.586 1.00 22.17 ? 159 VAL B O   1 
ATOM   3832 C CB  . VAL B 1 159 ? 103.062 89.015  -38.507 1.00 18.21 ? 159 VAL B CB  1 
ATOM   3833 C CG1 . VAL B 1 159 ? 103.945 90.096  -37.888 1.00 18.40 ? 159 VAL B CG1 1 
ATOM   3834 C CG2 . VAL B 1 159 ? 103.854 87.851  -39.062 1.00 19.58 ? 159 VAL B CG2 1 
ATOM   3835 N N   . HIS B 1 160 ? 101.161 89.669  -35.533 1.00 18.32 ? 160 HIS B N   1 
ATOM   3836 C CA  . HIS B 1 160 ? 100.332 90.708  -34.936 1.00 17.91 ? 160 HIS B CA  1 
ATOM   3837 C C   . HIS B 1 160 ? 101.239 91.738  -34.307 1.00 17.20 ? 160 HIS B C   1 
ATOM   3838 O O   . HIS B 1 160 ? 102.144 91.349  -33.499 1.00 18.02 ? 160 HIS B O   1 
ATOM   3839 C CB  . HIS B 1 160 ? 99.442  90.122  -33.850 1.00 20.05 ? 160 HIS B CB  1 
ATOM   3840 C CG  . HIS B 1 160 ? 98.577  89.022  -34.342 1.00 21.73 ? 160 HIS B CG  1 
ATOM   3841 N ND1 . HIS B 1 160 ? 97.432  89.254  -35.075 1.00 27.69 ? 160 HIS B ND1 1 
ATOM   3842 C CD2 . HIS B 1 160 ? 98.666  87.688  -34.194 1.00 23.93 ? 160 HIS B CD2 1 
ATOM   3843 C CE1 . HIS B 1 160 ? 96.867  88.101  -35.387 1.00 26.70 ? 160 HIS B CE1 1 
ATOM   3844 N NE2 . HIS B 1 160 ? 97.590  87.137  -34.860 1.00 24.53 ? 160 HIS B NE2 1 
ATOM   3845 N N   . ILE B 1 161 ? 100.962 93.016  -34.551 1.00 14.61 ? 161 ILE B N   1 
ATOM   3846 C CA  . ILE B 1 161 ? 101.690 94.117  -33.957 1.00 16.20 ? 161 ILE B CA  1 
ATOM   3847 C C   . ILE B 1 161 ? 100.672 95.000  -33.193 1.00 17.14 ? 161 ILE B C   1 
ATOM   3848 O O   . ILE B 1 161 ? 99.711  95.457  -33.779 1.00 16.48 ? 161 ILE B O   1 
ATOM   3849 C CB  . ILE B 1 161 ? 102.430 94.952  -35.021 1.00 16.01 ? 161 ILE B CB  1 
ATOM   3850 C CG1 . ILE B 1 161 ? 103.212 93.998  -35.975 1.00 16.93 ? 161 ILE B CG1 1 
ATOM   3851 C CG2 . ILE B 1 161 ? 103.298 96.046  -34.342 1.00 17.48 ? 161 ILE B CG2 1 
ATOM   3852 C CD1 . ILE B 1 161 ? 103.805 94.699  -37.182 1.00 19.61 ? 161 ILE B CD1 1 
ATOM   3853 N N   . TYR B 1 162 ? 100.913 95.198  -31.912 1.00 14.81 ? 162 TYR B N   1 
ATOM   3854 C CA  . TYR B 1 162 ? 100.059 96.002  -31.061 1.00 15.49 ? 162 TYR B CA  1 
ATOM   3855 C C   . TYR B 1 162 ? 100.790 97.209  -30.568 1.00 16.12 ? 162 TYR B C   1 
ATOM   3856 O O   . TYR B 1 162 ? 101.910 97.121  -30.048 1.00 14.76 ? 162 TYR B O   1 
ATOM   3857 C CB  . TYR B 1 162 ? 99.613  95.200  -29.843 1.00 14.74 ? 162 TYR B CB  1 
ATOM   3858 C CG  . TYR B 1 162 ? 99.025  93.893  -30.156 1.00 16.22 ? 162 TYR B CG  1 
ATOM   3859 C CD1 . TYR B 1 162 ? 97.671  93.784  -30.498 1.00 20.92 ? 162 TYR B CD1 1 
ATOM   3860 C CD2 . TYR B 1 162 ? 99.765  92.741  -30.129 1.00 16.92 ? 162 TYR B CD2 1 
ATOM   3861 C CE1 . TYR B 1 162 ? 97.075  92.545  -30.779 1.00 22.98 ? 162 TYR B CE1 1 
ATOM   3862 C CE2 . TYR B 1 162 ? 99.191  91.525  -30.419 1.00 16.77 ? 162 TYR B CE2 1 
ATOM   3863 C CZ  . TYR B 1 162 ? 97.820  91.442  -30.739 1.00 19.16 ? 162 TYR B CZ  1 
ATOM   3864 O OH  . TYR B 1 162 ? 97.279  90.257  -31.071 1.00 17.62 ? 162 TYR B OH  1 
ATOM   3865 N N   . ASP B 1 163 ? 100.138 98.365  -30.614 1.00 16.71 ? 163 ASP B N   1 
ATOM   3866 C CA  . ASP B 1 163 ? 100.587 99.505  -29.841 1.00 16.71 ? 163 ASP B CA  1 
ATOM   3867 C C   . ASP B 1 163 ? 100.472 99.176  -28.348 1.00 16.51 ? 163 ASP B C   1 
ATOM   3868 O O   . ASP B 1 163 ? 99.485  98.568  -27.938 1.00 15.44 ? 163 ASP B O   1 
ATOM   3869 C CB  . ASP B 1 163 ? 99.750  100.743 -30.179 1.00 21.00 ? 163 ASP B CB  1 
ATOM   3870 C CG  . ASP B 1 163 ? 100.052 101.283 -31.596 1.00 27.49 ? 163 ASP B CG  1 
ATOM   3871 O OD1 . ASP B 1 163 ? 101.130 101.069 -32.125 1.00 26.81 ? 163 ASP B OD1 1 
ATOM   3872 O OD2 . ASP B 1 163 ? 99.221  101.956 -32.149 1.00 32.18 ? 163 ASP B OD2 1 
ATOM   3873 N N   . ASN B 1 164 ? 101.484 99.513  -27.558 1.00 15.32 ? 164 ASN B N   1 
ATOM   3874 C CA  . ASN B 1 164 ? 101.488 99.163  -26.118 1.00 16.04 ? 164 ASN B CA  1 
ATOM   3875 C C   . ASN B 1 164 ? 101.261 100.397 -25.310 1.00 15.49 ? 164 ASN B C   1 
ATOM   3876 O O   . ASN B 1 164 ? 102.180 101.121 -25.077 1.00 15.74 ? 164 ASN B O   1 
ATOM   3877 C CB  . ASN B 1 164 ? 102.771 98.429  -25.698 1.00 16.60 ? 164 ASN B CB  1 
ATOM   3878 C CG  . ASN B 1 164 ? 102.677 97.822  -24.315 1.00 14.29 ? 164 ASN B CG  1 
ATOM   3879 O OD1 . ASN B 1 164 ? 102.005 98.358  -23.467 1.00 14.31 ? 164 ASN B OD1 1 
ATOM   3880 N ND2 . ASN B 1 164 ? 103.347 96.680  -24.102 1.00 14.74 ? 164 ASN B ND2 1 
ATOM   3881 N N   . PRO B 1 165 ? 100.033 100.619 -24.858 1.00 15.85 ? 165 PRO B N   1 
ATOM   3882 C CA  . PRO B 1 165 ? 99.722  101.926 -24.265 1.00 18.71 ? 165 PRO B CA  1 
ATOM   3883 C C   . PRO B 1 165 ? 100.309 102.101 -22.874 1.00 17.05 ? 165 PRO B C   1 
ATOM   3884 O O   . PRO B 1 165 ? 100.290 103.241 -22.378 1.00 16.66 ? 165 PRO B O   1 
ATOM   3885 C CB  . PRO B 1 165 ? 98.168  101.972 -24.211 1.00 19.52 ? 165 PRO B CB  1 
ATOM   3886 C CG  . PRO B 1 165 ? 97.748  100.608 -24.163 1.00 20.92 ? 165 PRO B CG  1 
ATOM   3887 C CD  . PRO B 1 165 ? 98.836  99.745  -24.906 1.00 19.17 ? 165 PRO B CD  1 
ATOM   3888 N N   . ILE B 1 166 ? 100.825 101.036 -22.272 1.00 13.02 ? 166 ILE B N   1 
ATOM   3889 C CA  . ILE B 1 166 ? 101.319 101.101 -20.891 1.00 14.07 ? 166 ILE B CA  1 
ATOM   3890 C C   . ILE B 1 166 ? 102.766 100.702 -20.744 1.00 14.28 ? 166 ILE B C   1 
ATOM   3891 O O   . ILE B 1 166 ? 103.283 100.792 -19.624 1.00 15.24 ? 166 ILE B O   1 
ATOM   3892 C CB  . ILE B 1 166 ? 100.454 100.240 -19.926 1.00 14.50 ? 166 ILE B CB  1 
ATOM   3893 C CG1 . ILE B 1 166 ? 100.369 98.779  -20.419 1.00 15.20 ? 166 ILE B CG1 1 
ATOM   3894 C CG2 . ILE B 1 166 ? 99.061  100.830 -19.766 1.00 17.52 ? 166 ILE B CG2 1 
ATOM   3895 C CD1 . ILE B 1 166 ? 99.662  97.807  -19.510 1.00 14.24 ? 166 ILE B CD1 1 
ATOM   3896 N N   . GLY B 1 167 ? 103.417 100.222 -21.792 1.00 13.58 ? 167 GLY B N   1 
ATOM   3897 C CA  . GLY B 1 167 ? 104.799 99.826  -21.694 1.00 13.93 ? 167 GLY B CA  1 
ATOM   3898 C C   . GLY B 1 167 ? 105.092 98.637  -20.755 1.00 13.29 ? 167 GLY B C   1 
ATOM   3899 O O   . GLY B 1 167 ? 106.002 98.690  -19.952 1.00 14.20 ? 167 GLY B O   1 
ATOM   3900 N N   . ILE B 1 168 ? 104.251 97.616  -20.822 1.00 12.99 ? 168 ILE B N   1 
ATOM   3901 C CA  . ILE B 1 168 ? 104.369 96.416  -19.959 1.00 12.76 ? 168 ILE B CA  1 
ATOM   3902 C C   . ILE B 1 168 ? 104.183 95.185  -20.823 1.00 12.54 ? 168 ILE B C   1 
ATOM   3903 O O   . ILE B 1 168 ? 103.351 95.192  -21.765 1.00 11.53 ? 168 ILE B O   1 
ATOM   3904 C CB  . ILE B 1 168 ? 103.251 96.387  -18.879 1.00 13.17 ? 168 ILE B CB  1 
ATOM   3905 C CG1 . ILE B 1 168 ? 103.249 97.607  -17.954 1.00 14.27 ? 168 ILE B CG1 1 
ATOM   3906 C CG2 . ILE B 1 168 ? 103.298 95.094  -18.084 1.00 13.28 ? 168 ILE B CG2 1 
ATOM   3907 C CD1 . ILE B 1 168 ? 104.419 97.638  -17.018 1.00 15.44 ? 168 ILE B CD1 1 
ATOM   3908 N N   . LEU B 1 169 ? 105.009 94.160  -20.602 1.00 12.67 ? 169 LEU B N   1 
ATOM   3909 C CA  . LEU B 1 169 ? 104.795 92.855  -21.261 1.00 13.58 ? 169 LEU B CA  1 
ATOM   3910 C C   . LEU B 1 169 ? 105.301 91.758  -20.336 1.00 15.39 ? 169 LEU B C   1 
ATOM   3911 O O   . LEU B 1 169 ? 106.342 91.948  -19.650 1.00 12.25 ? 169 LEU B O   1 
ATOM   3912 C CB  . LEU B 1 169 ? 105.549 92.781  -22.594 1.00 14.25 ? 169 LEU B CB  1 
ATOM   3913 C CG  . LEU B 1 169 ? 105.136 91.629  -23.548 1.00 14.77 ? 169 LEU B CG  1 
ATOM   3914 C CD1 . LEU B 1 169 ? 103.709 91.784  -24.033 1.00 13.56 ? 169 LEU B CD1 1 
ATOM   3915 C CD2 . LEU B 1 169 ? 106.112 91.553  -24.732 1.00 14.85 ? 169 LEU B CD2 1 
ATOM   3916 N N   . THR B 1 170 ? 104.570 90.614  -20.311 1.00 12.97 ? 170 THR B N   1 
ATOM   3917 C CA  . THR B 1 170 ? 105.036 89.451  -19.619 1.00 12.50 ? 170 THR B CA  1 
ATOM   3918 C C   . THR B 1 170 ? 105.025 88.280  -20.567 1.00 13.86 ? 170 THR B C   1 
ATOM   3919 O O   . THR B 1 170 ? 105.789 88.314  -21.553 1.00 11.78 ? 170 THR B O   1 
ATOM   3920 C CB  . THR B 1 170 ? 104.350 89.192  -18.281 1.00 12.84 ? 170 THR B CB  1 
ATOM   3921 O OG1 . THR B 1 170 ? 102.963 88.859  -18.472 1.00 12.10 ? 170 THR B OG1 1 
ATOM   3922 C CG2 . THR B 1 170 ? 104.461 90.378  -17.390 1.00 12.23 ? 170 THR B CG2 1 
ATOM   3923 N N   . ASN B 1 171 ? 104.295 87.223  -20.247 1.00 11.35 ? 171 ASN B N   1 
ATOM   3924 C CA  . ASN B 1 171 ? 104.297 85.994  -21.015 1.00 13.03 ? 171 ASN B CA  1 
ATOM   3925 C C   . ASN B 1 171 ? 102.876 85.783  -21.580 1.00 13.30 ? 171 ASN B C   1 
ATOM   3926 O O   . ASN B 1 171 ? 102.232 86.781  -21.906 1.00 15.63 ? 171 ASN B O   1 
ATOM   3927 C CB  . ASN B 1 171 ? 104.848 84.854  -20.164 1.00 13.15 ? 171 ASN B CB  1 
ATOM   3928 C CG  . ASN B 1 171 ? 106.163 85.184  -19.537 1.00 15.38 ? 171 ASN B CG  1 
ATOM   3929 O OD1 . ASN B 1 171 ? 106.283 85.442  -18.329 1.00 14.56 ? 171 ASN B OD1 1 
ATOM   3930 N ND2 . ASN B 1 171 ? 107.218 85.176  -20.366 1.00 16.08 ? 171 ASN B ND2 1 
ATOM   3931 N N   . ASN B 1 172 ? 102.366 84.548  -21.605 1.00 14.28 ? 172 ASN B N   1 
ATOM   3932 C CA  . ASN B 1 172 ? 100.963 84.295  -21.988 1.00 12.66 ? 172 ASN B CA  1 
ATOM   3933 C C   . ASN B 1 172 ? 100.043 84.847  -20.950 1.00 14.35 ? 172 ASN B C   1 
ATOM   3934 O O   . ASN B 1 172 ? 100.447 84.949  -19.797 1.00 15.25 ? 172 ASN B O   1 
ATOM   3935 C CB  . ASN B 1 172 ? 100.698 82.802  -22.159 1.00 14.58 ? 172 ASN B CB  1 
ATOM   3936 C CG  . ASN B 1 172 ? 101.389 82.203  -23.386 1.00 16.28 ? 172 ASN B CG  1 
ATOM   3937 O OD1 . ASN B 1 172 ? 101.486 82.883  -24.434 1.00 15.14 ? 172 ASN B OD1 1 
ATOM   3938 N ND2 . ASN B 1 172 ? 101.825 80.978  -23.282 1.00 15.77 ? 172 ASN B ND2 1 
ATOM   3939 N N   . PRO B 1 173 ? 98.807  85.224  -21.316 1.00 14.75 ? 173 PRO B N   1 
ATOM   3940 C CA  . PRO B 1 173 ? 98.246  85.043  -22.667 1.00 14.53 ? 173 PRO B CA  1 
ATOM   3941 C C   . PRO B 1 173 ? 98.589  86.168  -23.615 1.00 15.40 ? 173 PRO B C   1 
ATOM   3942 O O   . PRO B 1 173 ? 99.392  87.107  -23.330 1.00 14.09 ? 173 PRO B O   1 
ATOM   3943 C CB  . PRO B 1 173 ? 96.733  85.031  -22.414 1.00 15.57 ? 173 PRO B CB  1 
ATOM   3944 C CG  . PRO B 1 173 ? 96.624  86.012  -21.254 1.00 14.41 ? 173 PRO B CG  1 
ATOM   3945 C CD  . PRO B 1 173 ? 97.758  85.615  -20.366 1.00 15.27 ? 173 PRO B CD  1 
ATOM   3946 N N   . GLU B 1 174 ? 98.047  86.036  -24.824 1.00 15.19 ? 174 GLU B N   1 
ATOM   3947 C CA  . GLU B 1 174 ? 98.216  87.062  -25.862 1.00 15.57 ? 174 GLU B CA  1 
ATOM   3948 C C   . GLU B 1 174 ? 97.860  88.446  -25.392 1.00 13.23 ? 174 GLU B C   1 
ATOM   3949 O O   . GLU B 1 174 ? 97.063  88.653  -24.454 1.00 12.99 ? 174 GLU B O   1 
ATOM   3950 C CB  . GLU B 1 174 ? 97.426  86.654  -27.127 1.00 16.89 ? 174 GLU B CB  1 
ATOM   3951 C CG  . GLU B 1 174 ? 98.008  85.445  -27.807 1.00 21.04 ? 174 GLU B CG  1 
ATOM   3952 C CD  . GLU B 1 174 ? 97.040  84.680  -28.772 1.00 25.99 ? 174 GLU B CD  1 
ATOM   3953 O OE1 . GLU B 1 174 ? 95.796  84.855  -28.704 1.00 34.20 ? 174 GLU B OE1 1 
ATOM   3954 O OE2 . GLU B 1 174 ? 97.535  83.758  -29.415 1.00 30.65 ? 174 GLU B OE2 1 
ATOM   3955 N N   . PHE B 1 175 ? 98.405  89.455  -26.088 1.00 13.38 ? 175 PHE B N   1 
ATOM   3956 C CA  . PHE B 1 175 ? 98.449  90.812  -25.564 1.00 13.84 ? 175 PHE B CA  1 
ATOM   3957 C C   . PHE B 1 175 ? 97.054  91.418  -25.338 1.00 15.06 ? 175 PHE B C   1 
ATOM   3958 O O   . PHE B 1 175 ? 96.815  92.050  -24.294 1.00 15.01 ? 175 PHE B O   1 
ATOM   3959 C CB  . PHE B 1 175 ? 99.257  91.775  -26.441 1.00 13.72 ? 175 PHE B CB  1 
ATOM   3960 C CG  . PHE B 1 175 ? 99.502  93.097  -25.803 1.00 13.04 ? 175 PHE B CG  1 
ATOM   3961 C CD1 . PHE B 1 175 ? 100.291 93.178  -24.660 1.00 13.01 ? 175 PHE B CD1 1 
ATOM   3962 C CD2 . PHE B 1 175 ? 99.002  94.277  -26.346 1.00 14.32 ? 175 PHE B CD2 1 
ATOM   3963 C CE1 . PHE B 1 175 ? 100.564 94.401  -24.052 1.00 12.26 ? 175 PHE B CE1 1 
ATOM   3964 C CE2 . PHE B 1 175 ? 99.295  95.481  -25.757 1.00 14.15 ? 175 PHE B CE2 1 
ATOM   3965 C CZ  . PHE B 1 175 ? 100.047 95.532  -24.571 1.00 13.14 ? 175 PHE B CZ  1 
ATOM   3966 N N   . ASN B 1 176 ? 96.084  91.167  -26.244 1.00 16.53 ? 176 ASN B N   1 
ATOM   3967 C CA  . ASN B 1 176 ? 94.748  91.722  -26.005 1.00 17.05 ? 176 ASN B CA  1 
ATOM   3968 C C   . ASN B 1 176 ? 94.103  91.138  -24.745 1.00 15.75 ? 176 ASN B C   1 
ATOM   3969 O O   . ASN B 1 176 ? 93.282  91.825  -24.073 1.00 14.19 ? 176 ASN B O   1 
ATOM   3970 C CB  . ASN B 1 176 ? 93.774  91.520  -27.179 1.00 20.20 ? 176 ASN B CB  1 
ATOM   3971 C CG  . ASN B 1 176 ? 94.099  92.435  -28.374 1.00 23.40 ? 176 ASN B CG  1 
ATOM   3972 O OD1 . ASN B 1 176 ? 94.624  93.502  -28.231 1.00 27.92 ? 176 ASN B OD1 1 
ATOM   3973 N ND2 . ASN B 1 176 ? 93.655  92.019  -29.534 1.00 28.51 ? 176 ASN B ND2 1 
ATOM   3974 N N   . TYR B 1 177 ? 94.420  89.908  -24.438 1.00 13.30 ? 177 TYR B N   1 
ATOM   3975 C CA  . TYR B 1 177 ? 93.920  89.263  -23.223 1.00 13.98 ? 177 TYR B CA  1 
ATOM   3976 C C   . TYR B 1 177 ? 94.532  89.896  -21.980 1.00 14.19 ? 177 TYR B C   1 
ATOM   3977 O O   . TYR B 1 177 ? 93.847  90.091  -20.976 1.00 13.14 ? 177 TYR B O   1 
ATOM   3978 C CB  . TYR B 1 177 ? 94.202  87.766  -23.231 1.00 15.41 ? 177 TYR B CB  1 
ATOM   3979 C CG  . TYR B 1 177 ? 93.297  86.993  -24.170 1.00 18.58 ? 177 TYR B CG  1 
ATOM   3980 C CD1 . TYR B 1 177 ? 93.269  87.208  -25.536 1.00 19.66 ? 177 TYR B CD1 1 
ATOM   3981 C CD2 . TYR B 1 177 ? 92.432  86.041  -23.656 1.00 20.42 ? 177 TYR B CD2 1 
ATOM   3982 C CE1 . TYR B 1 177 ? 92.407  86.477  -26.378 1.00 23.97 ? 177 TYR B CE1 1 
ATOM   3983 C CE2 . TYR B 1 177 ? 91.578  85.305  -24.468 1.00 22.62 ? 177 TYR B CE2 1 
ATOM   3984 C CZ  . TYR B 1 177 ? 91.538  85.540  -25.816 1.00 24.15 ? 177 TYR B CZ  1 
ATOM   3985 O OH  . TYR B 1 177 ? 90.669  84.775  -26.496 1.00 26.28 ? 177 TYR B OH  1 
ATOM   3986 N N   . GLN B 1 178 ? 95.840  90.172  -22.026 1.00 11.94 ? 178 GLN B N   1 
ATOM   3987 C CA  . GLN B 1 178 ? 96.538  90.839  -20.904 1.00 12.90 ? 178 GLN B CA  1 
ATOM   3988 C C   . GLN B 1 178 ? 95.910  92.188  -20.644 1.00 13.05 ? 178 GLN B C   1 
ATOM   3989 O O   . GLN B 1 178 ? 95.653  92.545  -19.496 1.00 12.83 ? 178 GLN B O   1 
ATOM   3990 C CB  . GLN B 1 178 ? 98.049  91.009  -21.148 1.00 12.73 ? 178 GLN B CB  1 
ATOM   3991 C CG  . GLN B 1 178 ? 98.832  89.767  -21.283 1.00 13.99 ? 178 GLN B CG  1 
ATOM   3992 C CD  . GLN B 1 178 ? 99.131  89.088  -19.964 1.00 14.35 ? 178 GLN B CD  1 
ATOM   3993 O OE1 . GLN B 1 178 ? 98.540  89.361  -18.921 1.00 15.42 ? 178 GLN B OE1 1 
ATOM   3994 N NE2 . GLN B 1 178 ? 100.028 88.133  -20.043 1.00 15.07 ? 178 GLN B NE2 1 
ATOM   3995 N N   . MET B 1 179 ? 95.680  92.964  -21.703 1.00 12.15 ? 179 MET B N   1 
ATOM   3996 C CA  . MET B 1 179 ? 95.156  94.326  -21.561 1.00 13.46 ? 179 MET B CA  1 
ATOM   3997 C C   . MET B 1 179 ? 93.696  94.248  -21.055 1.00 14.18 ? 179 MET B C   1 
ATOM   3998 O O   . MET B 1 179 ? 93.301  95.027  -20.118 1.00 14.67 ? 179 MET B O   1 
ATOM   3999 C CB  . MET B 1 179 ? 95.229  95.096  -22.895 1.00 14.27 ? 179 MET B CB  1 
ATOM   4000 C CG  . MET B 1 179 ? 96.660  95.442  -23.271 1.00 15.93 ? 179 MET B CG  1 
ATOM   4001 S SD  . MET B 1 179 ? 97.457  96.493  -22.057 1.00 16.52 ? 179 MET B SD  1 
ATOM   4002 C CE  . MET B 1 179 ? 96.309  97.875  -21.918 1.00 17.81 ? 179 MET B CE  1 
ATOM   4003 N N   . TYR B 1 180 ? 92.917  93.341  -21.620 1.00 13.64 ? 180 TYR B N   1 
ATOM   4004 C CA  . TYR B 1 180 ? 91.526  93.187  -21.168 1.00 13.46 ? 180 TYR B CA  1 
ATOM   4005 C C   . TYR B 1 180 ? 91.485  92.841  -19.666 1.00 12.83 ? 180 TYR B C   1 
ATOM   4006 O O   . TYR B 1 180 ? 90.610  93.337  -18.902 1.00 14.51 ? 180 TYR B O   1 
ATOM   4007 C CB  . TYR B 1 180 ? 90.761  92.111  -21.956 1.00 12.53 ? 180 TYR B CB  1 
ATOM   4008 C CG  . TYR B 1 180 ? 89.379  91.982  -21.482 1.00 12.13 ? 180 TYR B CG  1 
ATOM   4009 C CD1 . TYR B 1 180 ? 88.402  92.904  -21.889 1.00 14.59 ? 180 TYR B CD1 1 
ATOM   4010 C CD2 . TYR B 1 180 ? 89.029  91.013  -20.488 1.00 13.27 ? 180 TYR B CD2 1 
ATOM   4011 C CE1 . TYR B 1 180 ? 87.063  92.846  -21.390 1.00 13.53 ? 180 TYR B CE1 1 
ATOM   4012 C CE2 . TYR B 1 180 ? 87.709  90.999  -19.966 1.00 13.27 ? 180 TYR B CE2 1 
ATOM   4013 C CZ  . TYR B 1 180 ? 86.764  91.918  -20.385 1.00 12.79 ? 180 TYR B CZ  1 
ATOM   4014 O OH  . TYR B 1 180 ? 85.469  91.861  -19.876 1.00 13.13 ? 180 TYR B OH  1 
ATOM   4015 N N   . ASN B 1 181 ? 92.377  91.930  -19.231 1.00 14.96 ? 181 ASN B N   1 
ATOM   4016 C CA  . ASN B 1 181 ? 92.417  91.518  -17.861 1.00 14.12 ? 181 ASN B CA  1 
ATOM   4017 C C   . ASN B 1 181 ? 92.554  92.650  -16.858 1.00 14.14 ? 181 ASN B C   1 
ATOM   4018 O O   . ASN B 1 181 ? 92.134  92.500  -15.686 1.00 13.28 ? 181 ASN B O   1 
ATOM   4019 C CB  . ASN B 1 181 ? 93.527  90.507  -17.651 1.00 16.24 ? 181 ASN B CB  1 
ATOM   4020 C CG  . ASN B 1 181 ? 93.541  89.875  -16.271 1.00 15.63 ? 181 ASN B CG  1 
ATOM   4021 O OD1 . ASN B 1 181 ? 92.551  89.323  -15.813 1.00 14.50 ? 181 ASN B OD1 1 
ATOM   4022 N ND2 . ASN B 1 181 ? 94.683  89.872  -15.657 1.00 13.30 ? 181 ASN B ND2 1 
ATOM   4023 N N   . LEU B 1 182 ? 93.213  93.762  -17.262 1.00 13.23 ? 182 LEU B N   1 
ATOM   4024 C CA  . LEU B 1 182 ? 93.368  94.891  -16.335 1.00 13.35 ? 182 LEU B CA  1 
ATOM   4025 C C   . LEU B 1 182 ? 92.014  95.478  -15.909 1.00 13.36 ? 182 LEU B C   1 
ATOM   4026 O O   . LEU B 1 182 ? 91.896  96.097  -14.837 1.00 12.47 ? 182 LEU B O   1 
ATOM   4027 C CB  . LEU B 1 182 ? 94.167  96.017  -16.957 1.00 12.93 ? 182 LEU B CB  1 
ATOM   4028 C CG  . LEU B 1 182 ? 95.605  95.728  -17.340 1.00 15.23 ? 182 LEU B CG  1 
ATOM   4029 C CD1 . LEU B 1 182 ? 96.146  96.966  -18.027 1.00 13.95 ? 182 LEU B CD1 1 
ATOM   4030 C CD2 . LEU B 1 182 ? 96.441  95.395  -16.102 1.00 15.43 ? 182 LEU B CD2 1 
ATOM   4031 N N   . ASN B 1 183 ? 90.993  95.338  -16.759 1.00 13.12 ? 183 ASN B N   1 
ATOM   4032 C CA  . ASN B 1 183 ? 89.750  96.084  -16.554 1.00 12.74 ? 183 ASN B CA  1 
ATOM   4033 C C   . ASN B 1 183 ? 89.046  95.751  -15.217 1.00 13.61 ? 183 ASN B C   1 
ATOM   4034 O O   . ASN B 1 183 ? 88.465  96.635  -14.554 1.00 14.38 ? 183 ASN B O   1 
ATOM   4035 C CB  . ASN B 1 183 ? 88.807  95.848  -17.704 1.00 13.13 ? 183 ASN B CB  1 
ATOM   4036 C CG  . ASN B 1 183 ? 89.285  96.442  -18.985 1.00 14.36 ? 183 ASN B CG  1 
ATOM   4037 O OD1 . ASN B 1 183 ? 89.847  97.534  -19.004 1.00 16.07 ? 183 ASN B OD1 1 
ATOM   4038 N ND2 . ASN B 1 183 ? 88.955  95.794  -20.098 1.00 14.46 ? 183 ASN B ND2 1 
ATOM   4039 N N   . LYS B 1 184 ? 89.154  94.515  -14.789 1.00 12.64 ? 184 LYS B N   1 
ATOM   4040 C CA  . LYS B 1 184 ? 88.558  94.127  -13.538 1.00 16.49 ? 184 LYS B CA  1 
ATOM   4041 C C   . LYS B 1 184 ? 89.230  94.684  -12.279 1.00 16.60 ? 184 LYS B C   1 
ATOM   4042 O O   . LYS B 1 184 ? 88.657  94.583  -11.218 1.00 13.80 ? 184 LYS B O   1 
ATOM   4043 C CB  . LYS B 1 184 ? 88.381  92.630  -13.407 1.00 19.59 ? 184 LYS B CB  1 
ATOM   4044 C CG  . LYS B 1 184 ? 89.660  91.880  -13.199 1.00 24.51 ? 184 LYS B CG  1 
ATOM   4045 C CD  . LYS B 1 184 ? 89.303  90.422  -12.968 1.00 33.58 ? 184 LYS B CD  1 
ATOM   4046 C CE  . LYS B 1 184 ? 90.208  89.747  -11.997 1.00 42.18 ? 184 LYS B CE  1 
ATOM   4047 N NZ  . LYS B 1 184 ? 91.324  89.137  -12.790 1.00 59.98 ? 184 LYS B NZ  1 
ATOM   4048 N N   . TYR B 1 185 ? 90.379  95.341  -12.429 1.00 13.25 ? 185 TYR B N   1 
ATOM   4049 C CA  . TYR B 1 185 ? 91.093  95.941  -11.275 1.00 13.90 ? 185 TYR B CA  1 
ATOM   4050 C C   . TYR B 1 185 ? 90.898  97.440  -11.197 1.00 14.85 ? 185 TYR B C   1 
ATOM   4051 O O   . TYR B 1 185 ? 91.638  98.110  -10.486 1.00 15.13 ? 185 TYR B O   1 
ATOM   4052 C CB  . TYR B 1 185 ? 92.599  95.647  -11.462 1.00 14.67 ? 185 TYR B CB  1 
ATOM   4053 C CG  . TYR B 1 185 ? 92.890  94.190  -11.343 1.00 12.92 ? 185 TYR B CG  1 
ATOM   4054 C CD1 . TYR B 1 185 ? 92.885  93.543  -10.100 1.00 14.29 ? 185 TYR B CD1 1 
ATOM   4055 C CD2 . TYR B 1 185 ? 93.044  93.419  -12.466 1.00 15.91 ? 185 TYR B CD2 1 
ATOM   4056 C CE1 . TYR B 1 185 ? 93.135  92.163  -9.982  1.00 14.94 ? 185 TYR B CE1 1 
ATOM   4057 C CE2 . TYR B 1 185 ? 93.252  92.055  -12.375 1.00 16.18 ? 185 TYR B CE2 1 
ATOM   4058 C CZ  . TYR B 1 185 ? 93.312  91.427  -11.153 1.00 17.44 ? 185 TYR B CZ  1 
ATOM   4059 O OH  . TYR B 1 185 ? 93.577  90.064  -11.155 1.00 17.24 ? 185 TYR B OH  1 
ATOM   4060 N N   . ARG B 1 186 ? 89.893  98.008  -11.933 1.00 13.55 ? 186 ARG B N   1 
ATOM   4061 C CA  . ARG B 1 186 ? 89.731  99.450  -11.915 1.00 14.69 ? 186 ARG B CA  1 
ATOM   4062 C C   . ARG B 1 186 ? 89.581  100.086 -10.554 1.00 13.74 ? 186 ARG B C   1 
ATOM   4063 O O   . ARG B 1 186 ? 89.970  101.242 -10.380 1.00 14.27 ? 186 ARG B O   1 
ATOM   4064 C CB  . ARG B 1 186 ? 88.594  99.876  -12.844 1.00 16.03 ? 186 ARG B CB  1 
ATOM   4065 C CG  . ARG B 1 186 ? 87.274  99.496  -12.331 1.00 17.28 ? 186 ARG B CG  1 
ATOM   4066 C CD  . ARG B 1 186 ? 86.164  99.850  -13.305 1.00 19.38 ? 186 ARG B CD  1 
ATOM   4067 N NE  . ARG B 1 186 ? 85.920  101.248 -13.456 1.00 18.23 ? 186 ARG B NE  1 
ATOM   4068 C CZ  . ARG B 1 186 ? 86.252  102.000 -14.486 1.00 17.53 ? 186 ARG B CZ  1 
ATOM   4069 N NH1 . ARG B 1 186 ? 86.983  101.583 -15.495 1.00 17.29 ? 186 ARG B NH1 1 
ATOM   4070 N NH2 . ARG B 1 186 ? 85.848  103.236 -14.493 1.00 21.58 ? 186 ARG B NH2 1 
ATOM   4071 N N   A ASN B 1 187 ? 89.060  99.331  -9.598  0.48 13.71 ? 187 ASN B N   1 
ATOM   4072 N N   B ASN B 1 187 ? 89.044  99.368  -9.573  0.52 14.87 ? 187 ASN B N   1 
ATOM   4073 C CA  A ASN B 1 187 ? 88.751  99.809  -8.250  0.48 14.82 ? 187 ASN B CA  1 
ATOM   4074 C CA  B ASN B 1 187 ? 88.827  99.988  -8.247  0.52 16.77 ? 187 ASN B CA  1 
ATOM   4075 C C   A ASN B 1 187 ? 89.946  99.852  -7.320  0.48 14.74 ? 187 ASN B C   1 
ATOM   4076 C C   B ASN B 1 187 ? 89.998  99.936  -7.315  0.52 15.95 ? 187 ASN B C   1 
ATOM   4077 O O   A ASN B 1 187 ? 89.832  100.419 -6.220  0.48 13.53 ? 187 ASN B O   1 
ATOM   4078 O O   B ASN B 1 187 ? 89.930  100.527 -6.213  0.52 13.92 ? 187 ASN B O   1 
ATOM   4079 C CB  A ASN B 1 187 ? 87.637  98.892  -7.668  0.48 15.05 ? 187 ASN B CB  1 
ATOM   4080 C CB  B ASN B 1 187 ? 87.534  99.496  -7.551  0.52 19.40 ? 187 ASN B CB  1 
ATOM   4081 C CG  A ASN B 1 187 ? 86.933  99.470  -6.458  0.48 15.78 ? 187 ASN B CG  1 
ATOM   4082 C CG  B ASN B 1 187 ? 87.584  98.043  -7.119  0.52 21.03 ? 187 ASN B CG  1 
ATOM   4083 O OD1 A ASN B 1 187 ? 86.771  100.671 -6.283  0.48 13.99 ? 187 ASN B OD1 1 
ATOM   4084 O OD1 B ASN B 1 187 ? 88.547  97.318  -7.328  0.52 25.23 ? 187 ASN B OD1 1 
ATOM   4085 N ND2 A ASN B 1 187 ? 86.456  98.592  -5.646  0.48 16.62 ? 187 ASN B ND2 1 
ATOM   4086 N ND2 B ASN B 1 187 ? 86.507  97.605  -6.551  0.52 25.06 ? 187 ASN B ND2 1 
ATOM   4087 N N   . LEU B 1 188 ? 91.107  99.314  -7.723  1.00 14.75 ? 188 LEU B N   1 
ATOM   4088 C CA  . LEU B 1 188 ? 92.297  99.410  -6.899  1.00 14.51 ? 188 LEU B CA  1 
ATOM   4089 C C   . LEU B 1 188 ? 92.681  100.870 -6.765  1.00 14.59 ? 188 LEU B C   1 
ATOM   4090 O O   . LEU B 1 188 ? 92.433  101.689 -7.669  1.00 12.47 ? 188 LEU B O   1 
ATOM   4091 C CB  . LEU B 1 188 ? 93.495  98.617  -7.455  1.00 15.46 ? 188 LEU B CB  1 
ATOM   4092 C CG  . LEU B 1 188 ? 93.283  97.086  -7.640  1.00 15.89 ? 188 LEU B CG  1 
ATOM   4093 C CD1 . LEU B 1 188 ? 94.555  96.414  -8.090  1.00 16.83 ? 188 LEU B CD1 1 
ATOM   4094 C CD2 . LEU B 1 188 ? 92.690  96.351  -6.470  1.00 17.47 ? 188 LEU B CD2 1 
ATOM   4095 N N   . SER B 1 189 ? 93.333  101.184 -5.668  1.00 14.42 ? 189 SER B N   1 
ATOM   4096 C CA  . SER B 1 189 ? 93.716  102.542 -5.379  1.00 15.19 ? 189 SER B CA  1 
ATOM   4097 C C   . SER B 1 189 ? 95.029  102.598 -4.637  1.00 13.95 ? 189 SER B C   1 
ATOM   4098 O O   . SER B 1 189 ? 95.415  101.713 -3.901  1.00 13.51 ? 189 SER B O   1 
ATOM   4099 C CB  . SER B 1 189 ? 92.590  103.235 -4.572  1.00 15.60 ? 189 SER B CB  1 
ATOM   4100 O OG  . SER B 1 189 ? 92.965  104.603 -4.350  1.00 17.14 ? 189 SER B OG  1 
ATOM   4101 N N   . ILE B 1 190 ? 95.717  103.726 -4.788  1.00 13.79 ? 190 ILE B N   1 
ATOM   4102 C CA  . ILE B 1 190 ? 96.916  103.969 -3.997  1.00 15.87 ? 190 ILE B CA  1 
ATOM   4103 C C   . ILE B 1 190 ? 96.601  104.503 -2.580  1.00 17.01 ? 190 ILE B C   1 
ATOM   4104 O O   . ILE B 1 190 ? 97.492  104.618 -1.766  1.00 15.36 ? 190 ILE B O   1 
ATOM   4105 C CB  . ILE B 1 190 ? 97.907  104.907 -4.726  1.00 18.96 ? 190 ILE B CB  1 
ATOM   4106 C CG1 . ILE B 1 190 ? 97.337  106.338 -4.913  1.00 21.13 ? 190 ILE B CG1 1 
ATOM   4107 C CG2 . ILE B 1 190 ? 98.294  104.244 -6.060  1.00 19.45 ? 190 ILE B CG2 1 
ATOM   4108 C CD1 . ILE B 1 190 ? 98.380  107.356 -5.321  1.00 24.24 ? 190 ILE B CD1 1 
ATOM   4109 N N   . SER B 1 191 ? 95.356  104.915 -2.337  1.00 16.68 ? 191 SER B N   1 
ATOM   4110 C CA  . SER B 1 191 ? 94.922  105.525 -1.097  1.00 18.44 ? 191 SER B CA  1 
ATOM   4111 C C   . SER B 1 191 ? 93.829  104.683 -0.415  1.00 16.30 ? 191 SER B C   1 
ATOM   4112 O O   . SER B 1 191 ? 93.192  103.893 -1.054  1.00 15.08 ? 191 SER B O   1 
ATOM   4113 C CB  . SER B 1 191 ? 94.295  106.887 -1.471  1.00 19.97 ? 191 SER B CB  1 
ATOM   4114 O OG  . SER B 1 191 ? 95.391  107.695 -1.702  1.00 23.49 ? 191 SER B OG  1 
ATOM   4115 N N   . THR B 1 192 ? 93.656  104.891 0.873   1.00 15.65 ? 192 THR B N   1 
ATOM   4116 C CA  . THR B 1 192 ? 92.596  104.220 1.630   1.00 14.73 ? 192 THR B CA  1 
ATOM   4117 C C   . THR B 1 192 ? 91.274  104.535 1.015   1.00 16.20 ? 192 THR B C   1 
ATOM   4118 O O   . THR B 1 192 ? 90.904  105.687 0.887   1.00 16.66 ? 192 THR B O   1 
ATOM   4119 C CB  . THR B 1 192 ? 92.606  104.710 3.071   1.00 14.16 ? 192 THR B CB  1 
ATOM   4120 O OG1 . THR B 1 192 ? 93.892  104.493 3.605   1.00 14.70 ? 192 THR B OG1 1 
ATOM   4121 C CG2 . THR B 1 192 ? 91.603  103.942 3.858   1.00 14.74 ? 192 THR B CG2 1 
ATOM   4122 N N   . PRO B 1 193 ? 90.500  103.541 0.657   1.00 17.55 ? 193 PRO B N   1 
ATOM   4123 C CA  . PRO B 1 193 ? 89.210  103.904 0.087   1.00 17.00 ? 193 PRO B CA  1 
ATOM   4124 C C   . PRO B 1 193 ? 88.171  104.245 1.106   1.00 16.15 ? 193 PRO B C   1 
ATOM   4125 O O   . PRO B 1 193 ? 88.304  103.884 2.276   1.00 15.26 ? 193 PRO B O   1 
ATOM   4126 C CB  . PRO B 1 193 ? 88.775  102.653 -0.651  1.00 19.03 ? 193 PRO B CB  1 
ATOM   4127 C CG  . PRO B 1 193 ? 89.802  101.607 -0.348  1.00 22.77 ? 193 PRO B CG  1 
ATOM   4128 C CD  . PRO B 1 193 ? 90.753  102.090 0.669   1.00 17.53 ? 193 PRO B CD  1 
ATOM   4129 N N   . GLN B 1 194 ? 87.087  104.848 0.634   1.00 15.02 ? 194 GLN B N   1 
ATOM   4130 C CA  . GLN B 1 194 ? 85.930  105.045 1.489   1.00 17.82 ? 194 GLN B CA  1 
ATOM   4131 C C   . GLN B 1 194 ? 85.221  103.705 1.722   1.00 18.20 ? 194 GLN B C   1 
ATOM   4132 O O   . GLN B 1 194 ? 85.430  102.749 0.965   1.00 16.10 ? 194 GLN B O   1 
ATOM   4133 C CB  . GLN B 1 194 ? 84.952  105.986 0.782   1.00 23.31 ? 194 GLN B CB  1 
ATOM   4134 C CG  . GLN B 1 194 ? 85.576  107.323 0.489   1.00 26.93 ? 194 GLN B CG  1 
ATOM   4135 C CD  . GLN B 1 194 ? 84.507  108.338 0.250   1.00 39.97 ? 194 GLN B CD  1 
ATOM   4136 O OE1 . GLN B 1 194 ? 83.901  108.370 -0.829  1.00 49.50 ? 194 GLN B OE1 1 
ATOM   4137 N NE2 . GLN B 1 194 ? 84.195  109.100 1.272   1.00 44.27 ? 194 GLN B NE2 1 
ATOM   4138 N N   . ASN B 1 195 ? 84.387  103.642 2.747   1.00 15.81 ? 195 ASN B N   1 
ATOM   4139 C CA  . ASN B 1 195 ? 83.524  102.448 2.924   1.00 16.02 ? 195 ASN B CA  1 
ATOM   4140 C C   . ASN B 1 195 ? 82.350  102.579 2.009   1.00 16.49 ? 195 ASN B C   1 
ATOM   4141 O O   . ASN B 1 195 ? 81.378  103.288 2.290   1.00 13.78 ? 195 ASN B O   1 
ATOM   4142 C CB  . ASN B 1 195 ? 83.113  102.344 4.374   1.00 15.93 ? 195 ASN B CB  1 
ATOM   4143 C CG  . ASN B 1 195 ? 82.098  101.230 4.639   1.00 16.13 ? 195 ASN B CG  1 
ATOM   4144 O OD1 . ASN B 1 195 ? 81.704  100.509 3.710   1.00 16.06 ? 195 ASN B OD1 1 
ATOM   4145 N ND2 . ASN B 1 195 ? 81.536  101.223 5.874   1.00 13.63 ? 195 ASN B ND2 1 
ATOM   4146 N N   . THR B 1 196 ? 82.433  101.948 0.872   1.00 13.06 ? 196 THR B N   1 
ATOM   4147 C CA  . THR B 1 196 ? 81.318  101.847 -0.045  1.00 14.01 ? 196 THR B CA  1 
ATOM   4148 C C   . THR B 1 196 ? 80.587  100.498 0.109   1.00 15.53 ? 196 THR B C   1 
ATOM   4149 O O   . THR B 1 196 ? 79.552  100.268 -0.510  1.00 15.48 ? 196 THR B O   1 
ATOM   4150 C CB  . THR B 1 196 ? 81.798  102.013 -1.550  1.00 14.80 ? 196 THR B CB  1 
ATOM   4151 O OG1 . THR B 1 196 ? 82.959  101.180 -1.800  1.00 13.39 ? 196 THR B OG1 1 
ATOM   4152 C CG2 . THR B 1 196 ? 82.233  103.406 -1.889  1.00 15.74 ? 196 THR B CG2 1 
ATOM   4153 N N   . PHE B 1 197 ? 81.132  99.606  0.931   1.00 14.80 ? 197 PHE B N   1 
ATOM   4154 C CA  . PHE B 1 197 ? 80.502  98.290  1.208   1.00 14.47 ? 197 PHE B CA  1 
ATOM   4155 C C   . PHE B 1 197 ? 79.094  98.466  1.781   1.00 15.68 ? 197 PHE B C   1 
ATOM   4156 O O   . PHE B 1 197 ? 78.118  97.961  1.286   1.00 18.21 ? 197 PHE B O   1 
ATOM   4157 C CB  . PHE B 1 197 ? 81.447  97.536  2.142   1.00 13.45 ? 197 PHE B CB  1 
ATOM   4158 C CG  . PHE B 1 197 ? 80.959  96.162  2.600   1.00 14.18 ? 197 PHE B CG  1 
ATOM   4159 C CD1 . PHE B 1 197 ? 80.035  96.048  3.620   1.00 15.89 ? 197 PHE B CD1 1 
ATOM   4160 C CD2 . PHE B 1 197 ? 81.472  95.014  2.026   1.00 14.33 ? 197 PHE B CD2 1 
ATOM   4161 C CE1 . PHE B 1 197 ? 79.603  94.780  4.037   1.00 17.03 ? 197 PHE B CE1 1 
ATOM   4162 C CE2 . PHE B 1 197 ? 81.078  93.760  2.455   1.00 14.38 ? 197 PHE B CE2 1 
ATOM   4163 C CZ  . PHE B 1 197 ? 80.151  93.650  3.455   1.00 16.98 ? 197 PHE B CZ  1 
ATOM   4164 N N   . SER B 1 198 ? 79.001  99.273  2.826   1.00 16.07 ? 198 SER B N   1 
ATOM   4165 C CA  . SER B 1 198 ? 77.706  99.722  3.341   1.00 17.06 ? 198 SER B CA  1 
ATOM   4166 C C   . SER B 1 198 ? 77.940  100.705 4.480   1.00 19.43 ? 198 SER B C   1 
ATOM   4167 O O   . SER B 1 198 ? 78.667  100.397 5.423   1.00 17.31 ? 198 SER B O   1 
ATOM   4168 C CB  . SER B 1 198 ? 76.909  98.570  3.872   1.00 16.37 ? 198 SER B CB  1 
ATOM   4169 O OG  . SER B 1 198 ? 75.751  99.004  4.643   1.00 18.29 ? 198 SER B OG  1 
ATOM   4170 N N   . ASP B 1 199 ? 77.152  101.764 4.483   1.00 20.72 ? 199 ASP B N   1 
ATOM   4171 C CA  . ASP B 1 199 ? 77.127  102.734 5.599   1.00 23.45 ? 199 ASP B CA  1 
ATOM   4172 C C   . ASP B 1 199 ? 76.500  102.180 6.851   1.00 22.48 ? 199 ASP B C   1 
ATOM   4173 O O   . ASP B 1 199 ? 76.547  102.840 7.888   1.00 18.94 ? 199 ASP B O   1 
ATOM   4174 C CB  . ASP B 1 199 ? 76.146  103.887 5.242   1.00 28.17 ? 199 ASP B CB  1 
ATOM   4175 C CG  . ASP B 1 199 ? 76.617  104.758 4.186   1.00 37.00 ? 199 ASP B CG  1 
ATOM   4176 O OD1 . ASP B 1 199 ? 77.834  104.865 3.991   1.00 44.35 ? 199 ASP B OD1 1 
ATOM   4177 O OD2 . ASP B 1 199 ? 75.749  105.406 3.540   1.00 53.31 ? 199 ASP B OD2 1 
ATOM   4178 N N   . SER B 1 200 ? 75.869  101.007 6.777   1.00 19.55 ? 200 SER B N   1 
ATOM   4179 C CA  . SER B 1 200 ? 75.264  100.421 7.959   1.00 19.99 ? 200 SER B CA  1 
ATOM   4180 C C   . SER B 1 200 ? 76.183  99.628  8.831   1.00 19.90 ? 200 SER B C   1 
ATOM   4181 O O   . SER B 1 200 ? 75.707  98.984  9.796   1.00 18.22 ? 200 SER B O   1 
ATOM   4182 C CB  . SER B 1 200 ? 74.119  99.530  7.544   1.00 23.24 ? 200 SER B CB  1 
ATOM   4183 O OG  . SER B 1 200 ? 73.191  100.256 6.794   1.00 25.84 ? 200 SER B OG  1 
ATOM   4184 N N   . VAL B 1 201 ? 77.449  99.511  8.459   1.00 17.69 ? 201 VAL B N   1 
ATOM   4185 C CA  . VAL B 1 201 ? 78.406  98.792  9.286   1.00 18.15 ? 201 VAL B CA  1 
ATOM   4186 C C   . VAL B 1 201 ? 79.645  99.699  9.334   1.00 20.41 ? 201 VAL B C   1 
ATOM   4187 O O   . VAL B 1 201 ? 80.087  100.262 8.328   1.00 17.53 ? 201 VAL B O   1 
ATOM   4188 C CB  . VAL B 1 201 ? 78.716  97.348  8.804   1.00 17.64 ? 201 VAL B CB  1 
ATOM   4189 C CG1 . VAL B 1 201 ? 79.327  97.349  7.418   1.00 19.65 ? 201 VAL B CG1 1 
ATOM   4190 C CG2 . VAL B 1 201 ? 79.630  96.615  9.772   1.00 18.35 ? 201 VAL B CG2 1 
ATOM   4191 N N   . ASP B 1 202 ? 80.197  99.818  10.527  1.00 17.99 ? 202 ASP B N   1 
ATOM   4192 C CA  . ASP B 1 202 ? 81.343  100.692 10.787  1.00 20.88 ? 202 ASP B CA  1 
ATOM   4193 C C   . ASP B 1 202 ? 82.635  99.941  10.527  1.00 18.30 ? 202 ASP B C   1 
ATOM   4194 O O   . ASP B 1 202 ? 83.330  99.486  11.439  1.00 19.06 ? 202 ASP B O   1 
ATOM   4195 C CB  . ASP B 1 202 ? 81.224  101.214 12.244  1.00 22.90 ? 202 ASP B CB  1 
ATOM   4196 C CG  . ASP B 1 202 ? 82.300  102.180 12.616  1.00 31.48 ? 202 ASP B CG  1 
ATOM   4197 O OD1 . ASP B 1 202 ? 82.857  102.836 11.754  1.00 33.19 ? 202 ASP B OD1 1 
ATOM   4198 O OD2 . ASP B 1 202 ? 82.562  102.302 13.820  1.00 38.34 ? 202 ASP B OD2 1 
ATOM   4199 N N   . LEU B 1 203 ? 83.034  99.890  9.280   1.00 16.63 ? 203 LEU B N   1 
ATOM   4200 C CA  . LEU B 1 203 ? 84.262  99.176  8.930   1.00 15.90 ? 203 LEU B CA  1 
ATOM   4201 C C   . LEU B 1 203 ? 85.458  100.061 9.296   1.00 16.69 ? 203 LEU B C   1 
ATOM   4202 O O   . LEU B 1 203 ? 85.432  101.288 9.025   1.00 20.70 ? 203 LEU B O   1 
ATOM   4203 C CB  . LEU B 1 203 ? 84.265  98.813  7.431   1.00 15.09 ? 203 LEU B CB  1 
ATOM   4204 C CG  . LEU B 1 203 ? 83.119  97.979  7.002   1.00 13.80 ? 203 LEU B CG  1 
ATOM   4205 C CD1 . LEU B 1 203 ? 83.252  97.651  5.530   1.00 14.99 ? 203 LEU B CD1 1 
ATOM   4206 C CD2 . LEU B 1 203 ? 83.041  96.664  7.812   1.00 13.92 ? 203 LEU B CD2 1 
ATOM   4207 N N   . LYS B 1 204 ? 86.492  99.470  9.859   1.00 17.92 ? 204 LYS B N   1 
ATOM   4208 C CA  . LYS B 1 204 ? 87.625  100.220 10.406  1.00 18.10 ? 204 LYS B CA  1 
ATOM   4209 C C   . LYS B 1 204 ? 88.888  99.908  9.618   1.00 17.75 ? 204 LYS B C   1 
ATOM   4210 O O   . LYS B 1 204 ? 88.984  98.834  9.037   1.00 14.54 ? 204 LYS B O   1 
ATOM   4211 C CB  . LYS B 1 204 ? 87.779  99.853  11.859  1.00 23.04 ? 204 LYS B CB  1 
ATOM   4212 C CG  . LYS B 1 204 ? 86.697  100.466 12.734  1.00 33.04 ? 204 LYS B CG  1 
ATOM   4213 C CD  . LYS B 1 204 ? 86.512  99.631  14.030  1.00 49.02 ? 204 LYS B CD  1 
ATOM   4214 C CE  . LYS B 1 204 ? 85.194  99.942  14.771  1.00 58.91 ? 204 LYS B CE  1 
ATOM   4215 N NZ  . LYS B 1 204 ? 85.108  101.418 14.989  1.00 67.28 ? 204 LYS B NZ  1 
ATOM   4216 N N   . VAL B 1 205 ? 89.803  100.899 9.515   1.00 14.07 ? 205 VAL B N   1 
ATOM   4217 C CA  . VAL B 1 205 ? 91.055  100.758 8.791   1.00 13.81 ? 205 VAL B CA  1 
ATOM   4218 C C   . VAL B 1 205 ? 92.117  100.819 9.824   1.00 15.99 ? 205 VAL B C   1 
ATOM   4219 O O   . VAL B 1 205 ? 92.253  101.861 10.496  1.00 14.63 ? 205 VAL B O   1 
ATOM   4220 C CB  . VAL B 1 205 ? 91.189  101.868 7.733   1.00 15.40 ? 205 VAL B CB  1 
ATOM   4221 C CG1 . VAL B 1 205 ? 92.526  101.852 7.036   1.00 16.18 ? 205 VAL B CG1 1 
ATOM   4222 C CG2 . VAL B 1 205 ? 90.078  101.713 6.708   1.00 15.69 ? 205 VAL B CG2 1 
ATOM   4223 N N   . ASP B 1 206 ? 92.888  99.745  9.972   1.00 14.31 ? 206 ASP B N   1 
ATOM   4224 C CA  . ASP B 1 206 ? 93.972  99.661  10.992  1.00 14.70 ? 206 ASP B CA  1 
ATOM   4225 C C   . ASP B 1 206 ? 95.399  99.667  10.459  1.00 14.64 ? 206 ASP B C   1 
ATOM   4226 O O   . ASP B 1 206 ? 96.353  99.370  11.190  1.00 14.24 ? 206 ASP B O   1 
ATOM   4227 C CB  . ASP B 1 206 ? 93.693  98.458  11.893  1.00 14.90 ? 206 ASP B CB  1 
ATOM   4228 C CG  . ASP B 1 206 ? 93.826  97.131  11.162  1.00 14.95 ? 206 ASP B CG  1 
ATOM   4229 O OD1 . ASP B 1 206 ? 94.054  97.119  9.880   1.00 13.69 ? 206 ASP B OD1 1 
ATOM   4230 O OD2 . ASP B 1 206 ? 93.680  96.067  11.816  1.00 15.76 ? 206 ASP B OD2 1 
ATOM   4231 N N   . GLY B 1 207 ? 95.539  99.994  9.174   1.00 12.80 ? 207 GLY B N   1 
ATOM   4232 C CA  . GLY B 1 207 ? 96.829  100.076 8.547   1.00 13.80 ? 207 GLY B CA  1 
ATOM   4233 C C   . GLY B 1 207 ? 96.738  100.871 7.229   1.00 13.71 ? 207 GLY B C   1 
ATOM   4234 O O   . GLY B 1 207 ? 95.623  101.110 6.740   1.00 13.00 ? 207 GLY B O   1 
ATOM   4235 N N   . THR B 1 208 ? 97.901  101.152 6.630   1.00 12.97 ? 208 THR B N   1 
ATOM   4236 C CA  . THR B 1 208 ? 97.956  101.806 5.295   1.00 13.39 ? 208 THR B CA  1 
ATOM   4237 C C   . THR B 1 208 ? 97.938  100.711 4.212   1.00 14.23 ? 208 THR B C   1 
ATOM   4238 O O   . THR B 1 208 ? 98.052  99.514  4.477   1.00 13.98 ? 208 THR B O   1 
ATOM   4239 C CB  . THR B 1 208 ? 99.217  102.687 5.148   1.00 14.02 ? 208 THR B CB  1 
ATOM   4240 O OG1 . THR B 1 208 ? 100.364 101.850 5.287   1.00 13.08 ? 208 THR B OG1 1 
ATOM   4241 C CG2 . THR B 1 208 ? 99.256  103.750 6.226   1.00 16.05 ? 208 THR B CG2 1 
ATOM   4242 N N   . GLY B 1 209 ? 97.733  101.121 2.988   1.00 13.30 ? 209 GLY B N   1 
ATOM   4243 C CA  . GLY B 1 209 ? 97.798  100.162 1.859   1.00 13.49 ? 209 GLY B CA  1 
ATOM   4244 C C   . GLY B 1 209 ? 96.470  99.453  1.553   1.00 12.79 ? 209 GLY B C   1 
ATOM   4245 O O   . GLY B 1 209 ? 96.437  98.602  0.641   1.00 14.21 ? 209 GLY B O   1 
ATOM   4246 N N   . PHE B 1 210 ? 95.348  99.799  2.220   1.00 11.32 ? 210 PHE B N   1 
ATOM   4247 C CA  . PHE B 1 210 ? 94.093  99.080  1.999   1.00 11.88 ? 210 PHE B CA  1 
ATOM   4248 C C   . PHE B 1 210 ? 93.550  99.255  0.553   1.00 13.59 ? 210 PHE B C   1 
ATOM   4249 O O   . PHE B 1 210 ? 92.878  98.374  0.023   1.00 12.23 ? 210 PHE B O   1 
ATOM   4250 C CB  . PHE B 1 210 ? 92.985  99.489  2.949   1.00 12.81 ? 210 PHE B CB  1 
ATOM   4251 C CG  . PHE B 1 210 ? 93.009  98.757  4.264   1.00 13.21 ? 210 PHE B CG  1 
ATOM   4252 C CD1 . PHE B 1 210 ? 94.185  98.656  5.011   1.00 13.95 ? 210 PHE B CD1 1 
ATOM   4253 C CD2 . PHE B 1 210 ? 91.826  98.263  4.801   1.00 14.27 ? 210 PHE B CD2 1 
ATOM   4254 C CE1 . PHE B 1 210 ? 94.181  97.972  6.214   1.00 14.99 ? 210 PHE B CE1 1 
ATOM   4255 C CE2 . PHE B 1 210 ? 91.823  97.689  6.058   1.00 14.13 ? 210 PHE B CE2 1 
ATOM   4256 C CZ  . PHE B 1 210 ? 93.026  97.501  6.747   1.00 14.10 ? 210 PHE B CZ  1 
ATOM   4257 N N   . GLY B 1 211 ? 93.916  100.356 -0.083  1.00 13.40 ? 211 GLY B N   1 
ATOM   4258 C CA  . GLY B 1 211 ? 93.552  100.660 -1.481  1.00 13.27 ? 211 GLY B CA  1 
ATOM   4259 C C   . GLY B 1 211 ? 93.957  99.569  -2.472  1.00 13.21 ? 211 GLY B C   1 
ATOM   4260 O O   . GLY B 1 211 ? 93.262  99.361  -3.488  1.00 14.25 ? 211 GLY B O   1 
ATOM   4261 N N   . GLY B 1 212 ? 95.098  98.923  -2.227  1.00 11.98 ? 212 GLY B N   1 
ATOM   4262 C CA  . GLY B 1 212 ? 95.535  97.886  -3.176  1.00 11.80 ? 212 GLY B CA  1 
ATOM   4263 C C   . GLY B 1 212 ? 94.929  96.522  -3.051  1.00 12.01 ? 212 GLY B C   1 
ATOM   4264 O O   . GLY B 1 212 ? 95.188  95.631  -3.892  1.00 11.52 ? 212 GLY B O   1 
ATOM   4265 N N   . ILE B 1 213 ? 94.125  96.273  -1.988  1.00 10.91 ? 213 ILE B N   1 
ATOM   4266 C CA  . ILE B 1 213 ? 93.607  94.956  -1.740  1.00 12.07 ? 213 ILE B CA  1 
ATOM   4267 C C   . ILE B 1 213 ? 92.812  94.487  -2.950  1.00 12.23 ? 213 ILE B C   1 
ATOM   4268 O O   . ILE B 1 213 ? 91.941  95.201  -3.443  1.00 12.31 ? 213 ILE B O   1 
ATOM   4269 C CB  . ILE B 1 213 ? 92.713  94.949  -0.458  1.00 13.02 ? 213 ILE B CB  1 
ATOM   4270 C CG1 . ILE B 1 213 ? 93.565  95.232  0.771   1.00 12.27 ? 213 ILE B CG1 1 
ATOM   4271 C CG2 . ILE B 1 213 ? 91.862  93.640  -0.364  1.00 15.35 ? 213 ILE B CG2 1 
ATOM   4272 C CD1 . ILE B 1 213 ? 92.761  95.584  1.977   1.00 14.84 ? 213 ILE B CD1 1 
ATOM   4273 N N   . GLY B 1 214 ? 93.151  93.316  -3.445  1.00 12.79 ? 214 GLY B N   1 
ATOM   4274 C CA  . GLY B 1 214 ? 92.651  92.843  -4.744  1.00 13.42 ? 214 GLY B CA  1 
ATOM   4275 C C   . GLY B 1 214 ? 93.815  92.661  -5.721  1.00 14.08 ? 214 GLY B C   1 
ATOM   4276 O O   . GLY B 1 214 ? 93.730  91.869  -6.675  1.00 14.86 ? 214 GLY B O   1 
ATOM   4277 N N   . LEU B 1 215 ? 94.911  93.377  -5.564  1.00 12.26 ? 215 LEU B N   1 
ATOM   4278 C CA  . LEU B 1 215 ? 96.067  93.204  -6.409  1.00 13.42 ? 215 LEU B CA  1 
ATOM   4279 C C   . LEU B 1 215 ? 96.679  91.812  -6.252  1.00 13.31 ? 215 LEU B C   1 
ATOM   4280 O O   . LEU B 1 215 ? 96.911  91.379  -5.147  1.00 12.80 ? 215 LEU B O   1 
ATOM   4281 C CB  . LEU B 1 215 ? 97.138  94.274  -6.088  1.00 13.15 ? 215 LEU B CB  1 
ATOM   4282 C CG  . LEU B 1 215 ? 98.270  94.417  -7.038  1.00 12.09 ? 215 LEU B CG  1 
ATOM   4283 C CD1 . LEU B 1 215 ? 97.801  95.099  -8.315  1.00 14.48 ? 215 LEU B CD1 1 
ATOM   4284 C CD2 . LEU B 1 215 ? 99.403  95.205  -6.401  1.00 13.04 ? 215 LEU B CD2 1 
ATOM   4285 N N   . PRO B 1 216 ? 96.917  91.127  -7.362  1.00 14.23 ? 216 PRO B N   1 
ATOM   4286 C CA  . PRO B 1 216 ? 97.495  89.773  -7.240  1.00 13.94 ? 216 PRO B CA  1 
ATOM   4287 C C   . PRO B 1 216 ? 98.993  89.806  -6.945  1.00 12.90 ? 216 PRO B C   1 
ATOM   4288 O O   . PRO B 1 216 ? 99.721  90.684  -7.415  1.00 12.53 ? 216 PRO B O   1 
ATOM   4289 C CB  . PRO B 1 216 ? 97.214  89.113  -8.547  1.00 14.97 ? 216 PRO B CB  1 
ATOM   4290 C CG  . PRO B 1 216 ? 97.154  90.223  -9.530  1.00 15.16 ? 216 PRO B CG  1 
ATOM   4291 C CD  . PRO B 1 216 ? 96.497  91.410  -8.743  1.00 14.61 ? 216 PRO B CD  1 
ATOM   4292 N N   . GLY B 1 217 ? 99.404  88.849  -6.123  1.00 12.72 ? 217 GLY B N   1 
ATOM   4293 C CA  . GLY B 1 217 ? 100.751 88.779  -5.591  1.00 13.71 ? 217 GLY B CA  1 
ATOM   4294 C C   . GLY B 1 217 ? 101.567 87.610  -6.059  1.00 12.97 ? 217 GLY B C   1 
ATOM   4295 O O   . GLY B 1 217 ? 102.784 87.554  -5.756  1.00 13.85 ? 217 GLY B O   1 
ATOM   4296 N N   . ASP B 1 218 ? 100.995 86.713  -6.832  1.00 12.81 ? 218 ASP B N   1 
ATOM   4297 C CA  . ASP B 1 218 ? 101.695 85.545  -7.251  1.00 12.56 ? 218 ASP B CA  1 
ATOM   4298 C C   . ASP B 1 218 ? 102.595 85.868  -8.475  1.00 14.10 ? 218 ASP B C   1 
ATOM   4299 O O   . ASP B 1 218 ? 102.571 87.011  -8.963  1.00 14.72 ? 218 ASP B O   1 
ATOM   4300 C CB  . ASP B 1 218 ? 100.709 84.440  -7.585  1.00 11.76 ? 218 ASP B CB  1 
ATOM   4301 C CG  . ASP B 1 218 ? 99.833  84.771  -8.736  1.00 13.06 ? 218 ASP B CG  1 
ATOM   4302 O OD1 . ASP B 1 218 ? 98.867  85.570  -8.481  1.00 12.30 ? 218 ASP B OD1 1 
ATOM   4303 O OD2 . ASP B 1 218 ? 100.170 84.397  -9.916  1.00 13.24 ? 218 ASP B OD2 1 
ATOM   4304 N N   . VAL B 1 219 ? 103.328 84.868  -8.948  1.00 12.96 ? 219 VAL B N   1 
ATOM   4305 C CA  . VAL B 1 219 ? 104.271 85.031  -10.044 1.00 13.87 ? 219 VAL B CA  1 
ATOM   4306 C C   . VAL B 1 219 ? 103.804 84.382  -11.338 1.00 13.69 ? 219 VAL B C   1 
ATOM   4307 O O   . VAL B 1 219 ? 104.594 84.279  -12.281 1.00 12.83 ? 219 VAL B O   1 
ATOM   4308 C CB  . VAL B 1 219 ? 105.723 84.701  -9.724  1.00 14.63 ? 219 VAL B CB  1 
ATOM   4309 C CG1 . VAL B 1 219 ? 106.198 85.706  -8.642  1.00 17.12 ? 219 VAL B CG1 1 
ATOM   4310 C CG2 . VAL B 1 219 ? 105.911 83.257  -9.232  1.00 14.87 ? 219 VAL B CG2 1 
ATOM   4311 N N   . SER B 1 220 ? 102.484 84.116  -11.466 1.00 11.64 ? 220 SER B N   1 
ATOM   4312 C CA  . SER B 1 220 ? 101.951 83.800  -12.808 1.00 12.87 ? 220 SER B CA  1 
ATOM   4313 C C   . SER B 1 220 ? 102.143 84.959  -13.740 1.00 12.65 ? 220 SER B C   1 
ATOM   4314 O O   . SER B 1 220 ? 102.167 86.102  -13.290 1.00 11.89 ? 220 SER B O   1 
ATOM   4315 C CB  . SER B 1 220 ? 100.452 83.391  -12.766 1.00 13.28 ? 220 SER B CB  1 
ATOM   4316 O OG  . SER B 1 220 ? 99.581  84.470  -12.512 1.00 13.67 ? 220 SER B OG  1 
ATOM   4317 N N   . PRO B 1 221 ? 102.198 84.720  -15.063 1.00 11.69 ? 221 PRO B N   1 
ATOM   4318 C CA  . PRO B 1 221 ? 102.446 85.860  -15.935 1.00 13.51 ? 221 PRO B CA  1 
ATOM   4319 C C   . PRO B 1 221 ? 101.344 86.885  -15.919 1.00 12.64 ? 221 PRO B C   1 
ATOM   4320 O O   . PRO B 1 221 ? 101.605 88.067  -16.079 1.00 13.15 ? 221 PRO B O   1 
ATOM   4321 C CB  . PRO B 1 221 ? 102.555 85.204  -17.336 1.00 14.82 ? 221 PRO B CB  1 
ATOM   4322 C CG  . PRO B 1 221 ? 103.060 83.823  -17.074 1.00 13.55 ? 221 PRO B CG  1 
ATOM   4323 C CD  . PRO B 1 221 ? 102.387 83.449  -15.784 1.00 13.48 ? 221 PRO B CD  1 
ATOM   4324 N N   . GLU B 1 222 ? 100.089 86.453  -15.837 1.00 12.62 ? 222 GLU B N   1 
ATOM   4325 C CA  . GLU B 1 222 ? 98.994  87.468  -15.791 1.00 14.02 ? 222 GLU B CA  1 
ATOM   4326 C C   . GLU B 1 222 ? 99.065  88.322  -14.521 1.00 14.98 ? 222 GLU B C   1 
ATOM   4327 O O   . GLU B 1 222 ? 98.816  89.534  -14.557 1.00 13.13 ? 222 GLU B O   1 
ATOM   4328 C CB  . GLU B 1 222 ? 97.589  86.860  -15.863 1.00 17.08 ? 222 GLU B CB  1 
ATOM   4329 C CG  . GLU B 1 222 ? 97.050  86.876  -17.238 1.00 21.34 ? 222 GLU B CG  1 
ATOM   4330 C CD  . GLU B 1 222 ? 95.531  86.620  -17.345 1.00 20.76 ? 222 GLU B CD  1 
ATOM   4331 O OE1 . GLU B 1 222 ? 95.085  85.691  -16.784 1.00 20.08 ? 222 GLU B OE1 1 
ATOM   4332 O OE2 . GLU B 1 222 ? 94.861  87.287  -18.120 1.00 21.79 ? 222 GLU B OE2 1 
ATOM   4333 N N   . SER B 1 223 ? 99.310  87.679  -13.376 1.00 13.14 ? 223 SER B N   1 
ATOM   4334 C CA  . SER B 1 223 ? 99.409  88.441  -12.124 1.00 13.35 ? 223 SER B CA  1 
ATOM   4335 C C   . SER B 1 223 ? 100.557 89.422  -12.195 1.00 12.71 ? 223 SER B C   1 
ATOM   4336 O O   . SER B 1 223 ? 100.445 90.596  -11.752 1.00 12.88 ? 223 SER B O   1 
ATOM   4337 C CB  . SER B 1 223 ? 99.570  87.489  -10.953 1.00 13.47 ? 223 SER B CB  1 
ATOM   4338 O OG  . SER B 1 223 ? 98.363  86.753  -10.825 1.00 12.32 ? 223 SER B OG  1 
ATOM   4339 N N   . ARG B 1 224 ? 101.705 88.955  -12.709 1.00 11.76 ? 224 ARG B N   1 
ATOM   4340 C CA  . ARG B 1 224 ? 102.843 89.865  -12.851 1.00 12.47 ? 224 ARG B CA  1 
ATOM   4341 C C   . ARG B 1 224 ? 102.504 91.047  -13.780 1.00 12.64 ? 224 ARG B C   1 
ATOM   4342 O O   . ARG B 1 224 ? 102.915 92.182  -13.546 1.00 13.58 ? 224 ARG B O   1 
ATOM   4343 C CB  . ARG B 1 224 ? 104.066 89.124  -13.313 1.00 11.97 ? 224 ARG B CB  1 
ATOM   4344 C CG  . ARG B 1 224 ? 104.641 88.332  -12.181 1.00 11.83 ? 224 ARG B CG  1 
ATOM   4345 C CD  . ARG B 1 224 ? 105.972 87.722  -12.580 1.00 12.74 ? 224 ARG B CD  1 
ATOM   4346 N NE  . ARG B 1 224 ? 105.862 86.548  -13.471 1.00 13.00 ? 224 ARG B NE  1 
ATOM   4347 C CZ  . ARG B 1 224 ? 106.075 86.597  -14.786 1.00 13.57 ? 224 ARG B CZ  1 
ATOM   4348 N NH1 . ARG B 1 224 ? 106.313 87.771  -15.412 1.00 14.43 ? 224 ARG B NH1 1 
ATOM   4349 N NH2 . ARG B 1 224 ? 106.018 85.479  -15.495 1.00 12.57 ? 224 ARG B NH2 1 
ATOM   4350 N N   . PHE B 1 225 ? 101.781 90.762  -14.851 1.00 12.18 ? 225 PHE B N   1 
ATOM   4351 C CA  . PHE B 1 225 ? 101.353 91.821  -15.774 1.00 12.01 ? 225 PHE B CA  1 
ATOM   4352 C C   . PHE B 1 225 ? 100.516 92.880  -15.024 1.00 12.73 ? 225 PHE B C   1 
ATOM   4353 O O   . PHE B 1 225 ? 100.793 94.099  -15.129 1.00 12.60 ? 225 PHE B O   1 
ATOM   4354 C CB  . PHE B 1 225 ? 100.587 91.229  -16.944 1.00 11.60 ? 225 PHE B CB  1 
ATOM   4355 C CG  . PHE B 1 225 ? 100.394 92.179  -18.097 1.00 12.02 ? 225 PHE B CG  1 
ATOM   4356 C CD1 . PHE B 1 225 ? 99.414  93.205  -18.028 1.00 12.23 ? 225 PHE B CD1 1 
ATOM   4357 C CD2 . PHE B 1 225 ? 101.139 92.060  -19.253 1.00 12.36 ? 225 PHE B CD2 1 
ATOM   4358 C CE1 . PHE B 1 225 ? 99.178  94.065  -19.090 1.00 12.35 ? 225 PHE B CE1 1 
ATOM   4359 C CE2 . PHE B 1 225 ? 100.931 92.922  -20.306 1.00 12.76 ? 225 PHE B CE2 1 
ATOM   4360 C CZ  . PHE B 1 225 ? 99.968  93.960  -20.237 1.00 11.53 ? 225 PHE B CZ  1 
ATOM   4361 N N   . VAL B 1 226 ? 99.543  92.428  -14.224 1.00 11.44 ? 226 VAL B N   1 
ATOM   4362 C CA  . VAL B 1 226 ? 98.744  93.362  -13.445 1.00 11.03 ? 226 VAL B CA  1 
ATOM   4363 C C   . VAL B 1 226 ? 99.559  94.148  -12.421 1.00 11.66 ? 226 VAL B C   1 
ATOM   4364 O O   . VAL B 1 226 ? 99.450  95.397  -12.339 1.00 13.18 ? 226 VAL B O   1 
ATOM   4365 C CB  . VAL B 1 226 ? 97.530  92.666  -12.759 1.00 11.16 ? 226 VAL B CB  1 
ATOM   4366 C CG1 . VAL B 1 226 ? 96.753  93.705  -11.985 1.00 11.72 ? 226 VAL B CG1 1 
ATOM   4367 C CG2 . VAL B 1 226 ? 96.620  92.021  -13.786 1.00 10.33 ? 226 VAL B CG2 1 
ATOM   4368 N N   . ARG B 1 227 ? 100.407 93.453  -11.701 1.00 11.08 ? 227 ARG B N   1 
ATOM   4369 C CA  . ARG B 1 227 ? 101.173 94.034  -10.599 1.00 11.78 ? 227 ARG B CA  1 
ATOM   4370 C C   . ARG B 1 227 ? 102.260 94.968  -11.133 1.00 12.38 ? 227 ARG B C   1 
ATOM   4371 O O   . ARG B 1 227 ? 102.422 96.071  -10.594 1.00 12.30 ? 227 ARG B O   1 
ATOM   4372 C CB  . ARG B 1 227 ? 101.720 92.954  -9.713  1.00 11.85 ? 227 ARG B CB  1 
ATOM   4373 C CG  . ARG B 1 227 ? 102.496 93.482  -8.541  1.00 13.13 ? 227 ARG B CG  1 
ATOM   4374 C CD  . ARG B 1 227 ? 102.719 92.449  -7.452  1.00 13.88 ? 227 ARG B CD  1 
ATOM   4375 N NE  . ARG B 1 227 ? 103.688 91.408  -7.788  1.00 13.60 ? 227 ARG B NE  1 
ATOM   4376 C CZ  . ARG B 1 227 ? 103.429 90.186  -8.270  1.00 13.55 ? 227 ARG B CZ  1 
ATOM   4377 N NH1 . ARG B 1 227 ? 104.415 89.352  -8.392  1.00 14.71 ? 227 ARG B NH1 1 
ATOM   4378 N NH2 . ARG B 1 227 ? 102.196 89.739  -8.520  1.00 13.56 ? 227 ARG B NH2 1 
ATOM   4379 N N   . ALA B 1 228 ? 102.877 94.609  -12.236 1.00 13.17 ? 228 ALA B N   1 
ATOM   4380 C CA  . ALA B 1 228 ? 103.891 95.511  -12.841 1.00 13.82 ? 228 ALA B CA  1 
ATOM   4381 C C   . ALA B 1 228 ? 103.217 96.738  -13.370 1.00 12.47 ? 228 ALA B C   1 
ATOM   4382 O O   . ALA B 1 228 ? 103.732 97.856  -13.252 1.00 11.03 ? 228 ALA B O   1 
ATOM   4383 C CB  . ALA B 1 228 ? 104.630 94.819  -13.956 1.00 13.69 ? 228 ALA B CB  1 
ATOM   4384 N N   . THR B 1 229 ? 102.038 96.580  -13.939 1.00 12.46 ? 229 THR B N   1 
ATOM   4385 C CA  . THR B 1 229 ? 101.334 97.734  -14.466 1.00 12.86 ? 229 THR B CA  1 
ATOM   4386 C C   . THR B 1 229 ? 100.964 98.730  -13.347 1.00 13.03 ? 229 THR B C   1 
ATOM   4387 O O   . THR B 1 229 ? 101.225 99.949  -13.448 1.00 11.56 ? 229 THR B O   1 
ATOM   4388 C CB  . THR B 1 229 ? 100.044 97.325  -15.228 1.00 13.36 ? 229 THR B CB  1 
ATOM   4389 O OG1 . THR B 1 229 ? 100.360 96.533  -16.384 1.00 11.70 ? 229 THR B OG1 1 
ATOM   4390 C CG2 . THR B 1 229 ? 99.252  98.587  -15.767 1.00 12.28 ? 229 THR B CG2 1 
ATOM   4391 N N   . PHE B 1 230 ? 100.312 98.236  -12.304 1.00 13.18 ? 230 PHE B N   1 
ATOM   4392 C CA  . PHE B 1 230 ? 99.916  99.088  -11.184 1.00 11.92 ? 230 PHE B CA  1 
ATOM   4393 C C   . PHE B 1 230 ? 101.148 99.780  -10.579 1.00 12.95 ? 230 PHE B C   1 
ATOM   4394 O O   . PHE B 1 230 ? 101.040 100.983 -10.234 1.00 14.17 ? 230 PHE B O   1 
ATOM   4395 C CB  . PHE B 1 230 ? 99.224  98.253  -10.117 1.00 11.92 ? 230 PHE B CB  1 
ATOM   4396 C CG  . PHE B 1 230 ? 98.724  99.021  -8.945  1.00 11.26 ? 230 PHE B CG  1 
ATOM   4397 C CD1 . PHE B 1 230 ? 97.544  99.738  -9.038  1.00 13.76 ? 230 PHE B CD1 1 
ATOM   4398 C CD2 . PHE B 1 230 ? 99.358  98.945  -7.732  1.00 12.49 ? 230 PHE B CD2 1 
ATOM   4399 C CE1 . PHE B 1 230 ? 97.038  100.395 -7.903  1.00 14.20 ? 230 PHE B CE1 1 
ATOM   4400 C CE2 . PHE B 1 230 ? 98.887  99.609  -6.608  1.00 13.40 ? 230 PHE B CE2 1 
ATOM   4401 C CZ  . PHE B 1 230 ? 97.705  100.321 -6.711  1.00 13.01 ? 230 PHE B CZ  1 
ATOM   4402 N N   . SER B 1 231 ? 102.243 99.031  -10.396 1.00 13.17 ? 231 SER B N   1 
ATOM   4403 C CA  . SER B 1 231 ? 103.440 99.560  -9.754  1.00 14.40 ? 231 SER B CA  1 
ATOM   4404 C C   . SER B 1 231 ? 104.061 100.635 -10.641 1.00 15.10 ? 231 SER B C   1 
ATOM   4405 O O   . SER B 1 231 ? 104.462 101.705 -10.144 1.00 15.19 ? 231 SER B O   1 
ATOM   4406 C CB  . SER B 1 231 ? 104.395 98.430  -9.379  1.00 15.51 ? 231 SER B CB  1 
ATOM   4407 O OG  . SER B 1 231 ? 103.799 97.523  -8.487  1.00 14.92 ? 231 SER B OG  1 
ATOM   4408 N N   . LYS B 1 232 ? 104.190 100.339 -11.942 1.00 13.41 ? 232 LYS B N   1 
ATOM   4409 C CA  . LYS B 1 232 ? 104.836 101.287 -12.878 1.00 14.91 ? 232 LYS B CA  1 
ATOM   4410 C C   . LYS B 1 232 ? 104.022 102.569 -13.035 1.00 15.52 ? 232 LYS B C   1 
ATOM   4411 O O   . LYS B 1 232 ? 104.532 103.650 -12.893 1.00 14.01 ? 232 LYS B O   1 
ATOM   4412 C CB  . LYS B 1 232 ? 105.059 100.644 -14.243 1.00 16.27 ? 232 LYS B CB  1 
ATOM   4413 C CG  . LYS B 1 232 ? 105.764 101.576 -15.265 1.00 19.98 ? 232 LYS B CG  1 
ATOM   4414 C CD  . LYS B 1 232 ? 105.442 101.267 -16.704 1.00 22.63 ? 232 LYS B CD  1 
ATOM   4415 C CE  . LYS B 1 232 ? 105.126 102.541 -17.447 1.00 23.44 ? 232 LYS B CE  1 
ATOM   4416 N NZ  . LYS B 1 232 ? 105.413 102.350 -18.809 1.00 20.92 ? 232 LYS B NZ  1 
ATOM   4417 N N   . LEU B 1 233 ? 102.719 102.438 -13.268 1.00 14.62 ? 233 LEU B N   1 
ATOM   4418 C CA  . LEU B 1 233 ? 101.922 103.593 -13.594 1.00 15.66 ? 233 LEU B CA  1 
ATOM   4419 C C   . LEU B 1 233 ? 101.780 104.495 -12.394 1.00 15.03 ? 233 LEU B C   1 
ATOM   4420 O O   . LEU B 1 233 ? 101.653 105.724 -12.557 1.00 14.95 ? 233 LEU B O   1 
ATOM   4421 C CB  . LEU B 1 233 ? 100.556 103.245 -14.153 1.00 15.98 ? 233 LEU B CB  1 
ATOM   4422 C CG  . LEU B 1 233 ? 100.493 102.495 -15.484 1.00 19.51 ? 233 LEU B CG  1 
ATOM   4423 C CD1 . LEU B 1 233 ? 99.051  102.320 -15.923 1.00 18.30 ? 233 LEU B CD1 1 
ATOM   4424 C CD2 . LEU B 1 233 ? 101.280 103.219 -16.513 1.00 21.40 ? 233 LEU B CD2 1 
ATOM   4425 N N   . ASN B 1 234 ? 101.823 103.947 -11.199 1.00 13.62 ? 234 ASN B N   1 
ATOM   4426 C CA  . ASN B 1 234 ? 101.709 104.753 -10.021 1.00 12.98 ? 234 ASN B CA  1 
ATOM   4427 C C   . ASN B 1 234 ? 103.047 105.167 -9.404  1.00 14.01 ? 234 ASN B C   1 
ATOM   4428 O O   . ASN B 1 234 ? 103.047 105.885 -8.344  1.00 14.28 ? 234 ASN B O   1 
ATOM   4429 C CB  . ASN B 1 234 ? 100.865 104.000 -8.957  1.00 15.29 ? 234 ASN B CB  1 
ATOM   4430 C CG  . ASN B 1 234 ? 99.401  104.017 -9.322  1.00 14.80 ? 234 ASN B CG  1 
ATOM   4431 O OD1 . ASN B 1 234 ? 98.812  105.107 -9.466  1.00 15.31 ? 234 ASN B OD1 1 
ATOM   4432 N ND2 . ASN B 1 234 ? 98.833  102.852 -9.576  1.00 12.59 ? 234 ASN B ND2 1 
ATOM   4433 N N   . SER B 1 235 ? 104.155 104.718 -9.954  1.00 14.98 ? 235 SER B N   1 
ATOM   4434 C CA  . SER B 1 235 ? 105.429 104.985 -9.321  1.00 17.24 ? 235 SER B CA  1 
ATOM   4435 C C   . SER B 1 235 ? 105.669 106.496 -9.254  1.00 16.34 ? 235 SER B C   1 
ATOM   4436 O O   . SER B 1 235 ? 105.435 107.212 -10.204 1.00 15.10 ? 235 SER B O   1 
ATOM   4437 C CB  . SER B 1 235 ? 106.605 104.246 -9.939  1.00 21.06 ? 235 SER B CB  1 
ATOM   4438 O OG  . SER B 1 235 ? 106.679 104.627 -11.214 1.00 27.43 ? 235 SER B OG  1 
ATOM   4439 N N   . SER B 1 236 ? 106.138 106.968 -8.122  1.00 16.34 ? 236 SER B N   1 
ATOM   4440 C CA  . SER B 1 236 ? 106.512 108.392 -7.981  1.00 19.18 ? 236 SER B CA  1 
ATOM   4441 C C   . SER B 1 236 ? 107.617 108.804 -9.009  1.00 19.04 ? 236 SER B C   1 
ATOM   4442 O O   . SER B 1 236 ? 108.530 108.031 -9.350  1.00 16.13 ? 236 SER B O   1 
ATOM   4443 C CB  . SER B 1 236 ? 107.035 108.649 -6.532  1.00 17.74 ? 236 SER B CB  1 
ATOM   4444 O OG  . SER B 1 236 ? 106.025 108.417 -5.584  1.00 20.03 ? 236 SER B OG  1 
ATOM   4445 N N   . LYS B 1 237 ? 107.550 110.038 -9.458  1.00 22.11 ? 237 LYS B N   1 
ATOM   4446 C CA  . LYS B 1 237 ? 108.559 110.569 -10.364 1.00 24.45 ? 237 LYS B CA  1 
ATOM   4447 C C   . LYS B 1 237 ? 109.832 110.838 -9.612  1.00 24.92 ? 237 LYS B C   1 
ATOM   4448 O O   . LYS B 1 237 ? 109.802 111.136 -8.435  1.00 27.67 ? 237 LYS B O   1 
ATOM   4449 C CB  . LYS B 1 237 ? 108.097 111.885 -10.957 1.00 28.96 ? 237 LYS B CB  1 
ATOM   4450 C CG  . LYS B 1 237 ? 106.839 111.816 -11.733 1.00 37.05 ? 237 LYS B CG  1 
ATOM   4451 C CD  . LYS B 1 237 ? 106.855 110.847 -12.894 1.00 40.79 ? 237 LYS B CD  1 
ATOM   4452 C CE  . LYS B 1 237 ? 105.539 110.974 -13.694 1.00 49.58 ? 237 LYS B CE  1 
ATOM   4453 N NZ  . LYS B 1 237 ? 105.772 110.644 -15.124 1.00 53.01 ? 237 LYS B NZ  1 
ATOM   4454 N N   . GLY B 1 238 ? 110.960 110.694 -10.279 1.00 24.23 ? 238 GLY B N   1 
ATOM   4455 C CA  . GLY B 1 238 ? 112.249 111.017 -9.678  1.00 23.48 ? 238 GLY B CA  1 
ATOM   4456 C C   . GLY B 1 238 ? 112.692 112.385 -10.171 1.00 26.67 ? 238 GLY B C   1 
ATOM   4457 O O   . GLY B 1 238 ? 112.196 112.875 -11.198 1.00 22.66 ? 238 GLY B O   1 
ATOM   4458 N N   . MET B 1 239 ? 113.610 112.992 -9.435  1.00 27.64 ? 239 MET B N   1 
ATOM   4459 C CA  . MET B 1 239 ? 114.106 114.310 -9.806  1.00 33.83 ? 239 MET B CA  1 
ATOM   4460 C C   . MET B 1 239 ? 115.373 114.223 -10.622 1.00 27.60 ? 239 MET B C   1 
ATOM   4461 O O   . MET B 1 239 ? 115.728 115.191 -11.239 1.00 27.76 ? 239 MET B O   1 
ATOM   4462 C CB  . MET B 1 239 ? 114.387 115.131 -8.546  1.00 40.52 ? 239 MET B CB  1 
ATOM   4463 C CG  . MET B 1 239 ? 113.153 115.716 -7.836  1.00 53.93 ? 239 MET B CG  1 
ATOM   4464 S SD  . MET B 1 239 ? 113.696 116.995 -6.694  1.00 67.63 ? 239 MET B SD  1 
ATOM   4465 C CE  . MET B 1 239 ? 114.573 118.199 -7.733  1.00 60.66 ? 239 MET B CE  1 
ATOM   4466 N N   . THR B 1 240 ? 116.060 113.085 -10.623 1.00 22.44 ? 240 THR B N   1 
ATOM   4467 C CA  . THR B 1 240 ? 117.248 112.938 -11.435 1.00 21.66 ? 240 THR B CA  1 
ATOM   4468 C C   . THR B 1 240 ? 117.189 111.638 -12.220 1.00 21.93 ? 240 THR B C   1 
ATOM   4469 O O   . THR B 1 240 ? 116.406 110.717 -11.864 1.00 18.48 ? 240 THR B O   1 
ATOM   4470 C CB  . THR B 1 240 ? 118.494 112.886 -10.584 1.00 20.03 ? 240 THR B CB  1 
ATOM   4471 O OG1 . THR B 1 240 ? 118.451 111.716 -9.721  1.00 19.56 ? 240 THR B OG1 1 
ATOM   4472 C CG2 . THR B 1 240 ? 118.646 114.155 -9.754  1.00 21.57 ? 240 THR B CG2 1 
ATOM   4473 N N   . VAL B 1 241 ? 118.087 111.501 -13.179 1.00 17.98 ? 241 VAL B N   1 
ATOM   4474 C CA  . VAL B 1 241 ? 118.244 110.203 -13.845 1.00 18.32 ? 241 VAL B CA  1 
ATOM   4475 C C   . VAL B 1 241 ? 118.600 109.072 -12.836 1.00 19.24 ? 241 VAL B C   1 
ATOM   4476 O O   . VAL B 1 241 ? 118.112 107.930 -12.962 1.00 17.50 ? 241 VAL B O   1 
ATOM   4477 C CB  . VAL B 1 241 ? 119.286 110.293 -14.981 1.00 19.64 ? 241 VAL B CB  1 
ATOM   4478 C CG1 . VAL B 1 241 ? 119.623 108.926 -15.554 1.00 20.69 ? 241 VAL B CG1 1 
ATOM   4479 C CG2 . VAL B 1 241 ? 118.772 111.204 -16.102 1.00 23.30 ? 241 VAL B CG2 1 
ATOM   4480 N N   . GLU B 1 242 ? 119.471 109.346 -11.872 1.00 19.42 ? 242 GLU B N   1 
ATOM   4481 C CA  . GLU B 1 242 ? 119.810 108.280 -10.915 1.00 19.71 ? 242 GLU B CA  1 
ATOM   4482 C C   . GLU B 1 242 ? 118.570 107.812 -10.163 1.00 21.65 ? 242 GLU B C   1 
ATOM   4483 O O   . GLU B 1 242 ? 118.392 106.592 -9.956  1.00 20.11 ? 242 GLU B O   1 
ATOM   4484 C CB  . GLU B 1 242 ? 120.862 108.717 -9.896  1.00 24.27 ? 242 GLU B CB  1 
ATOM   4485 C CG  . GLU B 1 242 ? 121.181 107.639 -8.816  1.00 29.82 ? 242 GLU B CG  1 
ATOM   4486 C CD  . GLU B 1 242 ? 122.053 108.118 -7.665  1.00 39.83 ? 242 GLU B CD  1 
ATOM   4487 O OE1 . GLU B 1 242 ? 123.151 108.553 -8.022  1.00 36.36 ? 242 GLU B OE1 1 
ATOM   4488 O OE2 . GLU B 1 242 ? 121.661 108.020 -6.435  1.00 38.94 ? 242 GLU B OE2 1 
ATOM   4489 N N   . GLU B 1 243 ? 117.734 108.751 -9.740  1.00 17.31 ? 243 GLU B N   1 
ATOM   4490 C CA  . GLU B 1 243 ? 116.521 108.405 -9.009  1.00 20.31 ? 243 GLU B CA  1 
ATOM   4491 C C   . GLU B 1 243 ? 115.557 107.621 -9.875  1.00 17.77 ? 243 GLU B C   1 
ATOM   4492 O O   . GLU B 1 243 ? 114.935 106.660 -9.368  1.00 16.86 ? 243 GLU B O   1 
ATOM   4493 C CB  . GLU B 1 243 ? 115.757 109.616 -8.498  1.00 22.08 ? 243 GLU B CB  1 
ATOM   4494 C CG  . GLU B 1 243 ? 116.486 110.264 -7.330  1.00 25.20 ? 243 GLU B CG  1 
ATOM   4495 C CD  . GLU B 1 243 ? 115.691 111.378 -6.699  1.00 31.56 ? 243 GLU B CD  1 
ATOM   4496 O OE1 . GLU B 1 243 ? 114.610 111.831 -7.201  1.00 30.11 ? 243 GLU B OE1 1 
ATOM   4497 O OE2 . GLU B 1 243 ? 116.166 111.776 -5.623  1.00 32.04 ? 243 GLU B OE2 1 
ATOM   4498 N N   . ASP B 1 244 ? 115.495 107.963 -11.171 1.00 16.46 ? 244 ASP B N   1 
ATOM   4499 C CA  . ASP B 1 244 ? 114.718 107.144 -12.121 1.00 15.57 ? 244 ASP B CA  1 
ATOM   4500 C C   . ASP B 1 244 ? 115.223 105.680 -12.197 1.00 17.32 ? 244 ASP B C   1 
ATOM   4501 O O   . ASP B 1 244 ? 114.401 104.738 -12.204 1.00 13.99 ? 244 ASP B O   1 
ATOM   4502 C CB  . ASP B 1 244 ? 114.770 107.714 -13.556 1.00 17.11 ? 244 ASP B CB  1 
ATOM   4503 C CG  . ASP B 1 244 ? 114.096 109.075 -13.694 1.00 18.36 ? 244 ASP B CG  1 
ATOM   4504 O OD1 . ASP B 1 244 ? 113.221 109.460 -12.877 1.00 17.92 ? 244 ASP B OD1 1 
ATOM   4505 O OD2 . ASP B 1 244 ? 114.329 109.701 -14.731 1.00 17.63 ? 244 ASP B OD2 1 
ATOM   4506 N N   . ILE B 1 245 ? 116.529 105.485 -12.350 1.00 14.61 ? 245 ILE B N   1 
ATOM   4507 C CA  . ILE B 1 245 ? 117.094 104.117 -12.435 1.00 16.44 ? 245 ILE B CA  1 
ATOM   4508 C C   . ILE B 1 245 ? 116.807 103.349 -11.187 1.00 16.05 ? 245 ILE B C   1 
ATOM   4509 O O   . ILE B 1 245 ? 116.443 102.157 -11.191 1.00 14.55 ? 245 ILE B O   1 
ATOM   4510 C CB  . ILE B 1 245 ? 118.606 104.190 -12.697 1.00 17.41 ? 245 ILE B CB  1 
ATOM   4511 C CG1 . ILE B 1 245 ? 118.790 104.748 -14.145 1.00 18.38 ? 245 ILE B CG1 1 
ATOM   4512 C CG2 . ILE B 1 245 ? 119.270 102.828 -12.622 1.00 17.25 ? 245 ILE B CG2 1 
ATOM   4513 C CD1 . ILE B 1 245 ? 120.158 105.318 -14.312 1.00 19.70 ? 245 ILE B CD1 1 
ATOM   4514 N N   . THR B 1 246 ? 116.990 104.023 -10.065 1.00 14.95 ? 246 THR B N   1 
ATOM   4515 C CA  . THR B 1 246 ? 116.662 103.404 -8.765  1.00 15.43 ? 246 THR B CA  1 
ATOM   4516 C C   . THR B 1 246 ? 115.187 102.962 -8.702  1.00 14.63 ? 246 THR B C   1 
ATOM   4517 O O   . THR B 1 246 ? 114.935 101.849 -8.308  1.00 14.07 ? 246 THR B O   1 
ATOM   4518 C CB  . THR B 1 246 ? 117.052 104.359 -7.589  1.00 14.62 ? 246 THR B CB  1 
ATOM   4519 O OG1 . THR B 1 246 ? 118.480 104.488 -7.586  1.00 14.19 ? 246 THR B OG1 1 
ATOM   4520 C CG2 . THR B 1 246 ? 116.488 103.845 -6.282  1.00 15.31 ? 246 THR B CG2 1 
ATOM   4521 N N   . GLN B 1 247 ? 114.275 103.820 -9.127  1.00 14.55 ? 247 GLN B N   1 
ATOM   4522 C CA  . GLN B 1 247 ? 112.862 103.547 -9.184  1.00 15.35 ? 247 GLN B CA  1 
ATOM   4523 C C   . GLN B 1 247 ? 112.536 102.372 -10.142 1.00 15.80 ? 247 GLN B C   1 
ATOM   4524 O O   . GLN B 1 247 ? 111.743 101.484 -9.799  1.00 12.80 ? 247 GLN B O   1 
ATOM   4525 C CB  . GLN B 1 247 ? 112.083 104.826 -9.542  1.00 18.20 ? 247 GLN B CB  1 
ATOM   4526 C CG  . GLN B 1 247 ? 110.627 104.739 -9.327  1.00 20.96 ? 247 GLN B CG  1 
ATOM   4527 C CD  . GLN B 1 247 ? 110.215 104.645 -7.847  1.00 21.13 ? 247 GLN B CD  1 
ATOM   4528 O OE1 . GLN B 1 247 ? 111.012 104.725 -6.950  1.00 18.17 ? 247 GLN B OE1 1 
ATOM   4529 N NE2 . GLN B 1 247 ? 108.992 104.307 -7.643  1.00 25.00 ? 247 GLN B NE2 1 
ATOM   4530 N N   . PHE B 1 248 ? 113.235 102.331 -11.261 1.00 13.73 ? 248 PHE B N   1 
ATOM   4531 C CA  . PHE B 1 248 ? 113.037 101.292 -12.284 1.00 14.71 ? 248 PHE B CA  1 
ATOM   4532 C C   . PHE B 1 248 ? 113.346 99.948  -11.674 1.00 15.09 ? 248 PHE B C   1 
ATOM   4533 O O   . PHE B 1 248 ? 112.554 98.999  -11.824 1.00 14.16 ? 248 PHE B O   1 
ATOM   4534 C CB  . PHE B 1 248 ? 113.962 101.595 -13.468 1.00 14.12 ? 248 PHE B CB  1 
ATOM   4535 C CG  . PHE B 1 248 ? 113.625 100.837 -14.707 1.00 13.51 ? 248 PHE B CG  1 
ATOM   4536 C CD1 . PHE B 1 248 ? 113.996 99.530  -14.854 1.00 12.68 ? 248 PHE B CD1 1 
ATOM   4537 C CD2 . PHE B 1 248 ? 112.892 101.447 -15.711 1.00 13.13 ? 248 PHE B CD2 1 
ATOM   4538 C CE1 . PHE B 1 248 ? 113.685 98.871  -16.020 1.00 13.02 ? 248 PHE B CE1 1 
ATOM   4539 C CE2 . PHE B 1 248 ? 112.588 100.786 -16.903 1.00 14.55 ? 248 PHE B CE2 1 
ATOM   4540 C CZ  . PHE B 1 248 ? 113.024 99.498  -17.072 1.00 12.82 ? 248 PHE B CZ  1 
ATOM   4541 N N   . PHE B 1 249 ? 114.489 99.834  -10.974 1.00 14.54 ? 249 PHE B N   1 
ATOM   4542 C CA  . PHE B 1 249 ? 114.800 98.552  -10.309 1.00 14.30 ? 249 PHE B CA  1 
ATOM   4543 C C   . PHE B 1 249 ? 113.785 98.165  -9.234  1.00 13.65 ? 249 PHE B C   1 
ATOM   4544 O O   . PHE B 1 249 ? 113.410 96.973  -9.090  1.00 14.27 ? 249 PHE B O   1 
ATOM   4545 C CB  . PHE B 1 249 ? 116.206 98.450  -9.806  1.00 14.39 ? 249 PHE B CB  1 
ATOM   4546 C CG  . PHE B 1 249 ? 117.229 98.193  -10.898 1.00 15.43 ? 249 PHE B CG  1 
ATOM   4547 C CD1 . PHE B 1 249 ? 117.454 96.908  -11.362 1.00 15.35 ? 249 PHE B CD1 1 
ATOM   4548 C CD2 . PHE B 1 249 ? 117.917 99.241  -11.498 1.00 15.72 ? 249 PHE B CD2 1 
ATOM   4549 C CE1 . PHE B 1 249 ? 118.362 96.673  -12.386 1.00 16.80 ? 249 PHE B CE1 1 
ATOM   4550 C CE2 . PHE B 1 249 ? 118.769 99.003  -12.553 1.00 15.64 ? 249 PHE B CE2 1 
ATOM   4551 C CZ  . PHE B 1 249 ? 119.013 97.740  -12.984 1.00 15.65 ? 249 PHE B CZ  1 
ATOM   4552 N N   . HIS B 1 250 ? 113.278 99.165  -8.497  1.00 14.62 ? 250 HIS B N   1 
ATOM   4553 C CA  . HIS B 1 250 ? 112.194 98.904  -7.531  1.00 14.76 ? 250 HIS B CA  1 
ATOM   4554 C C   . HIS B 1 250 ? 110.932 98.370  -8.239  1.00 13.77 ? 250 HIS B C   1 
ATOM   4555 O O   . HIS B 1 250 ? 110.288 97.428  -7.727  1.00 13.84 ? 250 HIS B O   1 
ATOM   4556 C CB  . HIS B 1 250 ? 111.859 100.176 -6.700  1.00 13.55 ? 250 HIS B CB  1 
ATOM   4557 C CG  . HIS B 1 250 ? 112.850 100.458 -5.628  1.00 14.54 ? 250 HIS B CG  1 
ATOM   4558 N ND1 . HIS B 1 250 ? 113.056 99.604  -4.546  1.00 16.52 ? 250 HIS B ND1 1 
ATOM   4559 C CD2 . HIS B 1 250 ? 113.707 101.502 -5.443  1.00 15.09 ? 250 HIS B CD2 1 
ATOM   4560 C CE1 . HIS B 1 250 ? 113.977 100.137 -3.731  1.00 16.96 ? 250 HIS B CE1 1 
ATOM   4561 N NE2 . HIS B 1 250 ? 114.347 101.300 -4.238  1.00 15.32 ? 250 HIS B NE2 1 
ATOM   4562 N N   . ILE B 1 251 ? 110.597 98.955  -9.395  1.00 12.08 ? 251 ILE B N   1 
ATOM   4563 C CA  . ILE B 1 251 ? 109.416 98.483  -10.139 1.00 13.42 ? 251 ILE B CA  1 
ATOM   4564 C C   . ILE B 1 251 ? 109.594 97.010  -10.556 1.00 13.38 ? 251 ILE B C   1 
ATOM   4565 O O   . ILE B 1 251 ? 108.721 96.193  -10.350 1.00 13.73 ? 251 ILE B O   1 
ATOM   4566 C CB  . ILE B 1 251 ? 109.116 99.353  -11.337 1.00 12.59 ? 251 ILE B CB  1 
ATOM   4567 C CG1 . ILE B 1 251 ? 108.733 100.770 -10.881 1.00 12.96 ? 251 ILE B CG1 1 
ATOM   4568 C CG2 . ILE B 1 251 ? 108.011 98.746  -12.184 1.00 11.61 ? 251 ILE B CG2 1 
ATOM   4569 C CD1 . ILE B 1 251 ? 108.809 101.806 -11.981 1.00 14.90 ? 251 ILE B CD1 1 
ATOM   4570 N N   . LEU B 1 252 ? 110.731 96.699  -11.189 1.00 13.93 ? 252 LEU B N   1 
ATOM   4571 C CA  . LEU B 1 252 ? 110.996 95.334  -11.613 1.00 14.40 ? 252 LEU B CA  1 
ATOM   4572 C C   . LEU B 1 252 ? 111.005 94.413  -10.383 1.00 13.19 ? 252 LEU B C   1 
ATOM   4573 O O   . LEU B 1 252 ? 110.580 93.283  -10.484 1.00 12.72 ? 252 LEU B O   1 
ATOM   4574 C CB  . LEU B 1 252 ? 112.315 95.210  -12.340 1.00 16.71 ? 252 LEU B CB  1 
ATOM   4575 C CG  . LEU B 1 252 ? 112.351 95.763  -13.791 1.00 16.50 ? 252 LEU B CG  1 
ATOM   4576 C CD1 . LEU B 1 252 ? 113.739 95.494  -14.325 1.00 18.76 ? 252 LEU B CD1 1 
ATOM   4577 C CD2 . LEU B 1 252 ? 111.330 95.106  -14.692 1.00 15.72 ? 252 LEU B CD2 1 
ATOM   4578 N N   . GLY B 1 253 ? 111.485 94.931  -9.231  1.00 12.25 ? 253 GLY B N   1 
ATOM   4579 C CA  . GLY B 1 253 ? 111.449 94.185  -7.947  1.00 13.48 ? 253 GLY B CA  1 
ATOM   4580 C C   . GLY B 1 253 ? 110.047 93.729  -7.512  1.00 12.31 ? 253 GLY B C   1 
ATOM   4581 O O   . GLY B 1 253 ? 109.913 92.671  -6.921  1.00 13.56 ? 253 GLY B O   1 
ATOM   4582 N N   . THR B 1 254 ? 109.008 94.470  -7.853  1.00 12.65 ? 254 THR B N   1 
ATOM   4583 C CA  . THR B 1 254 ? 107.650 94.107  -7.430  1.00 12.25 ? 254 THR B CA  1 
ATOM   4584 C C   . THR B 1 254 ? 107.162 92.809  -8.060  1.00 13.13 ? 254 THR B C   1 
ATOM   4585 O O   . THR B 1 254 ? 106.241 92.173  -7.558  1.00 12.88 ? 254 THR B O   1 
ATOM   4586 C CB  . THR B 1 254 ? 106.613 95.218  -7.717  1.00 13.03 ? 254 THR B CB  1 
ATOM   4587 O OG1 . THR B 1 254 ? 106.387 95.390  -9.122  1.00 12.79 ? 254 THR B OG1 1 
ATOM   4588 C CG2 . THR B 1 254 ? 107.013 96.575  -7.094  1.00 12.85 ? 254 THR B CG2 1 
ATOM   4589 N N   . VAL B 1 255 ? 107.794 92.424  -9.159  1.00 12.69 ? 255 VAL B N   1 
ATOM   4590 C CA  . VAL B 1 255 ? 107.430 91.221  -9.906  1.00 14.38 ? 255 VAL B CA  1 
ATOM   4591 C C   . VAL B 1 255 ? 108.579 90.231  -10.072 1.00 13.90 ? 255 VAL B C   1 
ATOM   4592 O O   . VAL B 1 255 ? 108.516 89.297  -10.892 1.00 14.79 ? 255 VAL B O   1 
ATOM   4593 C CB  . VAL B 1 255 ? 106.799 91.578  -11.236 1.00 14.09 ? 255 VAL B CB  1 
ATOM   4594 C CG1 . VAL B 1 255 ? 105.435 92.227  -11.026 1.00 13.61 ? 255 VAL B CG1 1 
ATOM   4595 C CG2 . VAL B 1 255 ? 107.701 92.414  -12.114 1.00 14.06 ? 255 VAL B CG2 1 
ATOM   4596 N N   . GLU B 1 256 ? 109.597 90.397  -9.231  1.00 13.32 ? 256 GLU B N   1 
ATOM   4597 C CA  . GLU B 1 256 ? 110.777 89.485  -9.161  1.00 14.95 ? 256 GLU B CA  1 
ATOM   4598 C C   . GLU B 1 256 ? 110.285 88.090  -8.737  1.00 13.70 ? 256 GLU B C   1 
ATOM   4599 O O   . GLU B 1 256 ? 109.348 87.992  -7.918  1.00 12.94 ? 256 GLU B O   1 
ATOM   4600 C CB  . GLU B 1 256 ? 111.723 89.983  -8.013  1.00 17.15 ? 256 GLU B CB  1 
ATOM   4601 C CG  . GLU B 1 256 ? 112.956 89.224  -7.997  1.00 21.79 ? 256 GLU B CG  1 
ATOM   4602 C CD  . GLU B 1 256 ? 114.003 89.762  -7.119  1.00 20.28 ? 256 GLU B CD  1 
ATOM   4603 O OE1 . GLU B 1 256 ? 113.903 89.523  -5.883  1.00 15.17 ? 256 GLU B OE1 1 
ATOM   4604 O OE2 . GLU B 1 256 ? 114.969 90.221  -7.785  1.00 18.35 ? 256 GLU B OE2 1 
ATOM   4605 N N   . GLN B 1 257 ? 110.934 87.042  -9.240  1.00 12.03 ? 257 GLN B N   1 
ATOM   4606 C CA  . GLN B 1 257 ? 110.661 85.660  -8.805  1.00 11.48 ? 257 GLN B CA  1 
ATOM   4607 C C   . GLN B 1 257 ? 111.795 85.200  -7.965  1.00 12.91 ? 257 GLN B C   1 
ATOM   4608 O O   . GLN B 1 257 ? 112.965 85.121  -8.474  1.00 13.00 ? 257 GLN B O   1 
ATOM   4609 C CB  . GLN B 1 257 ? 110.494 84.785  -10.019 1.00 12.49 ? 257 GLN B CB  1 
ATOM   4610 C CG  . GLN B 1 257 ? 109.325 85.253  -10.895 1.00 12.56 ? 257 GLN B CG  1 
ATOM   4611 C CD  . GLN B 1 257 ? 108.770 84.130  -11.779 1.00 14.28 ? 257 GLN B CD  1 
ATOM   4612 O OE1 . GLN B 1 257 ? 108.519 83.013  -11.313 1.00 14.95 ? 257 GLN B OE1 1 
ATOM   4613 N NE2 . GLN B 1 257 ? 108.569 84.441  -13.072 1.00 13.48 ? 257 GLN B NE2 1 
ATOM   4614 N N   . ILE B 1 258 ? 111.544 84.929  -6.688  1.00 12.50 ? 258 ILE B N   1 
ATOM   4615 C CA  . ILE B 1 258 ? 112.577 84.401  -5.815  1.00 12.73 ? 258 ILE B CA  1 
ATOM   4616 C C   . ILE B 1 258 ? 112.651 82.883  -5.920  1.00 13.31 ? 258 ILE B C   1 
ATOM   4617 O O   . ILE B 1 258 ? 111.657 82.225  -6.267  1.00 14.22 ? 258 ILE B O   1 
ATOM   4618 C CB  . ILE B 1 258 ? 112.438 84.856  -4.349  1.00 13.01 ? 258 ILE B CB  1 
ATOM   4619 C CG1 . ILE B 1 258 ? 111.347 84.134  -3.609  1.00 12.32 ? 258 ILE B CG1 1 
ATOM   4620 C CG2 . ILE B 1 258 ? 112.152 86.351  -4.354  1.00 13.25 ? 258 ILE B CG2 1 
ATOM   4621 C CD1 . ILE B 1 258 ? 111.383 84.403  -2.097  1.00 14.53 ? 258 ILE B CD1 1 
ATOM   4622 N N   . LYS B 1 259 ? 113.835 82.329  -5.678  1.00 14.12 ? 259 LYS B N   1 
ATOM   4623 C CA  . LYS B 1 259 ? 113.967 80.888  -5.741  1.00 15.57 ? 259 LYS B CA  1 
ATOM   4624 C C   . LYS B 1 259 ? 113.149 80.210  -4.684  1.00 15.35 ? 259 LYS B C   1 
ATOM   4625 O O   . LYS B 1 259 ? 113.378 80.394  -3.485  1.00 15.79 ? 259 LYS B O   1 
ATOM   4626 C CB  . LYS B 1 259 ? 115.433 80.446  -5.590  1.00 17.55 ? 259 LYS B CB  1 
ATOM   4627 C CG  . LYS B 1 259 ? 116.268 80.792  -6.799  1.00 17.62 ? 259 LYS B CG  1 
ATOM   4628 C CD  . LYS B 1 259 ? 117.724 80.316  -6.543  1.00 21.00 ? 259 LYS B CD  1 
ATOM   4629 C CE  . LYS B 1 259 ? 118.630 80.666  -7.718  1.00 22.90 ? 259 LYS B CE  1 
ATOM   4630 N NZ  . LYS B 1 259 ? 120.017 80.341  -7.336  1.00 26.28 ? 259 LYS B NZ  1 
ATOM   4631 N N   . GLY B 1 260 ? 112.268 79.330  -5.132  1.00 15.47 ? 260 GLY B N   1 
ATOM   4632 C CA  . GLY B 1 260 ? 111.477 78.529  -4.227  1.00 16.02 ? 260 GLY B CA  1 
ATOM   4633 C C   . GLY B 1 260 ? 109.990 78.640  -4.344  1.00 15.43 ? 260 GLY B C   1 
ATOM   4634 O O   . GLY B 1 260 ? 109.242 77.731  -3.931  1.00 16.38 ? 260 GLY B O   1 
ATOM   4635 N N   . VAL B 1 261 ? 109.516 79.715  -4.897  1.00 14.71 ? 261 VAL B N   1 
ATOM   4636 C CA  . VAL B 1 261 ? 108.096 79.936  -4.963  1.00 15.74 ? 261 VAL B CA  1 
ATOM   4637 C C   . VAL B 1 261 ? 107.389 79.482  -6.276  1.00 15.17 ? 261 VAL B C   1 
ATOM   4638 O O   . VAL B 1 261 ? 106.156 79.517  -6.366  1.00 14.58 ? 261 VAL B O   1 
ATOM   4639 C CB  . VAL B 1 261 ? 107.688 81.421  -4.711  1.00 16.21 ? 261 VAL B CB  1 
ATOM   4640 C CG1 . VAL B 1 261 ? 108.082 81.853  -3.289  1.00 16.60 ? 261 VAL B CG1 1 
ATOM   4641 C CG2 . VAL B 1 261 ? 108.241 82.350  -5.760  1.00 14.52 ? 261 VAL B CG2 1 
ATOM   4642 N N   . ASN B 1 262 ? 108.177 79.128  -7.282  1.00 15.36 ? 262 ASN B N   1 
ATOM   4643 C CA  . ASN B 1 262 ? 107.661 78.758  -8.604  1.00 14.98 ? 262 ASN B CA  1 
ATOM   4644 C C   . ASN B 1 262 ? 108.452 77.573  -9.159  1.00 14.36 ? 262 ASN B C   1 
ATOM   4645 O O   . ASN B 1 262 ? 109.538 77.741  -9.740  1.00 13.60 ? 262 ASN B O   1 
ATOM   4646 C CB  . ASN B 1 262 ? 107.659 79.971  -9.525  1.00 14.17 ? 262 ASN B CB  1 
ATOM   4647 C CG  . ASN B 1 262 ? 107.053 79.677  -10.911 1.00 16.21 ? 262 ASN B CG  1 
ATOM   4648 O OD1 . ASN B 1 262 ? 106.602 78.573  -11.165 1.00 16.02 ? 262 ASN B OD1 1 
ATOM   4649 N ND2 . ASN B 1 262 ? 107.110 80.661  -11.806 1.00 16.16 ? 262 ASN B ND2 1 
ATOM   4650 N N   . LYS B 1 263 ? 107.943 76.397  -8.897  1.00 13.46 ? 263 LYS B N   1 
ATOM   4651 C CA  . LYS B 1 263 ? 108.615 75.124  -9.325  1.00 17.90 ? 263 LYS B CA  1 
ATOM   4652 C C   . LYS B 1 263 ? 108.029 74.727  -10.682 1.00 18.32 ? 263 LYS B C   1 
ATOM   4653 O O   . LYS B 1 263 ? 106.789 74.595  -10.834 1.00 19.98 ? 263 LYS B O   1 
ATOM   4654 C CB  . LYS B 1 263 ? 108.409 74.049  -8.276  1.00 21.48 ? 263 LYS B CB  1 
ATOM   4655 C CG  . LYS B 1 263 ? 109.181 72.787  -8.524  1.00 29.32 ? 263 LYS B CG  1 
ATOM   4656 C CD  . LYS B 1 263 ? 108.911 71.770  -7.405  1.00 35.60 ? 263 LYS B CD  1 
ATOM   4657 C CE  . LYS B 1 263 ? 110.081 70.838  -7.180  1.00 45.70 ? 263 LYS B CE  1 
ATOM   4658 N NZ  . LYS B 1 263 ? 109.712 69.767  -6.207  1.00 47.32 ? 263 LYS B NZ  1 
ATOM   4659 N N   . THR B 1 264 ? 108.864 74.560  -11.686 1.00 14.72 ? 264 THR B N   1 
ATOM   4660 C CA  . THR B 1 264 ? 108.402 74.405  -13.042 1.00 16.37 ? 264 THR B CA  1 
ATOM   4661 C C   . THR B 1 264 ? 108.224 72.933  -13.352 1.00 18.96 ? 264 THR B C   1 
ATOM   4662 O O   . THR B 1 264 ? 108.487 72.040  -12.484 1.00 17.24 ? 264 THR B O   1 
ATOM   4663 C CB  . THR B 1 264 ? 109.413 74.916  -14.069 1.00 17.71 ? 264 THR B CB  1 
ATOM   4664 O OG1 . THR B 1 264 ? 110.592 74.071  -13.991 1.00 18.90 ? 264 THR B OG1 1 
ATOM   4665 C CG2 . THR B 1 264 ? 109.806 76.376  -13.807 1.00 18.71 ? 264 THR B CG2 1 
ATOM   4666 N N   . GLU B 1 265 ? 107.828 72.668  -14.601 1.00 18.86 ? 265 GLU B N   1 
ATOM   4667 C CA  . GLU B 1 265 ? 107.543 71.242  -14.951 1.00 25.13 ? 265 GLU B CA  1 
ATOM   4668 C C   . GLU B 1 265 ? 108.802 70.358  -14.936 1.00 25.23 ? 265 GLU B C   1 
ATOM   4669 O O   . GLU B 1 265 ? 108.711 69.146  -14.794 1.00 28.93 ? 265 GLU B O   1 
ATOM   4670 C CB  . GLU B 1 265 ? 106.706 71.169  -16.224 1.00 26.48 ? 265 GLU B CB  1 
ATOM   4671 C CG  . GLU B 1 265 ? 107.434 71.532  -17.469 1.00 33.93 ? 265 GLU B CG  1 
ATOM   4672 C CD  . GLU B 1 265 ? 106.493 71.596  -18.689 1.00 34.37 ? 265 GLU B CD  1 
ATOM   4673 O OE1 . GLU B 1 265 ? 105.305 71.229  -18.591 1.00 40.57 ? 265 GLU B OE1 1 
ATOM   4674 O OE2 . GLU B 1 265 ? 107.011 71.983  -19.748 1.00 44.31 ? 265 GLU B OE2 1 
ATOM   4675 N N   . SER B 1 266 ? 109.966 70.987  -15.101 1.00 24.21 ? 266 SER B N   1 
ATOM   4676 C CA  . SER B 1 266 ? 111.276 70.327  -14.988 1.00 26.22 ? 266 SER B CA  1 
ATOM   4677 C C   . SER B 1 266 ? 111.718 70.021  -13.566 1.00 26.65 ? 266 SER B C   1 
ATOM   4678 O O   . SER B 1 266 ? 112.792 69.482  -13.375 1.00 28.92 ? 266 SER B O   1 
ATOM   4679 C CB  . SER B 1 266 ? 112.313 71.238  -15.674 1.00 30.50 ? 266 SER B CB  1 
ATOM   4680 O OG  . SER B 1 266 ? 112.817 72.216  -14.707 1.00 33.90 ? 266 SER B OG  1 
ATOM   4681 N N   . GLY B 1 267 ? 110.940 70.394  -12.537 1.00 19.74 ? 267 GLY B N   1 
ATOM   4682 C CA  . GLY B 1 267 ? 111.351 70.241  -11.179 1.00 21.85 ? 267 GLY B CA  1 
ATOM   4683 C C   . GLY B 1 267 ? 112.293 71.309  -10.632 1.00 23.20 ? 267 GLY B C   1 
ATOM   4684 O O   . GLY B 1 267 ? 112.549 71.345  -9.390  1.00 25.61 ? 267 GLY B O   1 
ATOM   4685 N N   . LYS B 1 268 ? 112.628 72.287  -11.466 1.00 20.50 ? 268 LYS B N   1 
ATOM   4686 C CA  . LYS B 1 268 ? 113.521 73.354  -11.026 1.00 21.58 ? 268 LYS B CA  1 
ATOM   4687 C C   . LYS B 1 268 ? 112.765 74.631  -10.654 1.00 22.89 ? 268 LYS B C   1 
ATOM   4688 O O   . LYS B 1 268 ? 111.624 74.798  -11.059 1.00 20.07 ? 268 LYS B O   1 
ATOM   4689 C CB  . LYS B 1 268 ? 114.508 73.592  -12.138 1.00 26.91 ? 268 LYS B CB  1 
ATOM   4690 C CG  . LYS B 1 268 ? 115.331 72.300  -12.349 1.00 33.92 ? 268 LYS B CG  1 
ATOM   4691 C CD  . LYS B 1 268 ? 116.467 72.425  -13.335 1.00 45.86 ? 268 LYS B CD  1 
ATOM   4692 C CE  . LYS B 1 268 ? 117.313 71.155  -13.219 1.00 51.83 ? 268 LYS B CE  1 
ATOM   4693 N NZ  . LYS B 1 268 ? 118.149 70.988  -14.418 1.00 62.80 ? 268 LYS B NZ  1 
ATOM   4694 N N   . GLU B 1 269 ? 113.448 75.541  -9.972  1.00 18.61 ? 269 GLU B N   1 
ATOM   4695 C CA  . GLU B 1 269 ? 112.849 76.722  -9.498  1.00 19.02 ? 269 GLU B CA  1 
ATOM   4696 C C   . GLU B 1 269 ? 113.048 77.853  -10.510 1.00 19.44 ? 269 GLU B C   1 
ATOM   4697 O O   . GLU B 1 269 ? 114.177 78.128  -10.933 1.00 17.88 ? 269 GLU B O   1 
ATOM   4698 C CB  . GLU B 1 269 ? 113.456 77.091  -8.148  1.00 24.01 ? 269 GLU B CB  1 
ATOM   4699 C CG  . GLU B 1 269 ? 113.199 76.099  -7.002  1.00 27.22 ? 269 GLU B CG  1 
ATOM   4700 C CD  . GLU B 1 269 ? 111.742 75.890  -6.660  1.00 34.87 ? 269 GLU B CD  1 
ATOM   4701 O OE1 . GLU B 1 269 ? 110.863 76.820  -6.820  1.00 27.71 ? 269 GLU B OE1 1 
ATOM   4702 O OE2 . GLU B 1 269 ? 111.434 74.740  -6.204  1.00 41.30 ? 269 GLU B OE2 1 
ATOM   4703 N N   . GLU B 1 270 ? 111.955 78.487  -10.922 1.00 16.90 ? 270 GLU B N   1 
ATOM   4704 C CA  . GLU B 1 270 ? 111.988 79.693  -11.788 1.00 17.15 ? 270 GLU B CA  1 
ATOM   4705 C C   . GLU B 1 270 ? 112.349 80.863  -10.914 1.00 17.68 ? 270 GLU B C   1 
ATOM   4706 O O   . GLU B 1 270 ? 111.764 81.021  -9.801  1.00 17.46 ? 270 GLU B O   1 
ATOM   4707 C CB  . GLU B 1 270 ? 110.674 79.897  -12.482 1.00 17.66 ? 270 GLU B CB  1 
ATOM   4708 C CG  . GLU B 1 270 ? 110.673 81.054  -13.500 1.00 21.56 ? 270 GLU B CG  1 
ATOM   4709 C CD  . GLU B 1 270 ? 109.550 81.053  -14.520 1.00 26.17 ? 270 GLU B CD  1 
ATOM   4710 O OE1 . GLU B 1 270 ? 109.194 79.978  -15.024 1.00 24.75 ? 270 GLU B OE1 1 
ATOM   4711 O OE2 . GLU B 1 270 ? 109.003 82.161  -14.822 1.00 27.82 ? 270 GLU B OE2 1 
ATOM   4712 N N   . TYR B 1 271 ? 113.286 81.696  -11.377 1.00 13.86 ? 271 TYR B N   1 
ATOM   4713 C CA  . TYR B 1 271 ? 113.727 82.843  -10.645 1.00 14.03 ? 271 TYR B CA  1 
ATOM   4714 C C   . TYR B 1 271 ? 114.210 83.945  -11.572 1.00 13.32 ? 271 TYR B C   1 
ATOM   4715 O O   . TYR B 1 271 ? 114.506 83.699  -12.756 1.00 13.02 ? 271 TYR B O   1 
ATOM   4716 C CB  . TYR B 1 271 ? 114.817 82.471  -9.628  1.00 14.29 ? 271 TYR B CB  1 
ATOM   4717 C CG  . TYR B 1 271 ? 116.132 82.037  -10.201 1.00 14.69 ? 271 TYR B CG  1 
ATOM   4718 C CD1 . TYR B 1 271 ? 116.277 80.759  -10.774 1.00 15.06 ? 271 TYR B CD1 1 
ATOM   4719 C CD2 . TYR B 1 271 ? 117.215 82.933  -10.329 1.00 15.05 ? 271 TYR B CD2 1 
ATOM   4720 C CE1 . TYR B 1 271 ? 117.471 80.379  -11.363 1.00 16.46 ? 271 TYR B CE1 1 
ATOM   4721 C CE2 . TYR B 1 271 ? 118.428 82.530  -10.868 1.00 15.68 ? 271 TYR B CE2 1 
ATOM   4722 C CZ  . TYR B 1 271 ? 118.556 81.257  -11.396 1.00 17.95 ? 271 TYR B CZ  1 
ATOM   4723 O OH  . TYR B 1 271 ? 119.726 80.851  -12.030 1.00 17.90 ? 271 TYR B OH  1 
ATOM   4724 N N   . THR B 1 272 ? 114.264 85.136  -11.058 1.00 13.68 ? 272 THR B N   1 
ATOM   4725 C CA  . THR B 1 272 ? 114.744 86.289  -11.816 1.00 14.08 ? 272 THR B CA  1 
ATOM   4726 C C   . THR B 1 272 ? 116.293 86.263  -11.865 1.00 14.07 ? 272 THR B C   1 
ATOM   4727 O O   . THR B 1 272 ? 117.011 86.672  -10.940 1.00 13.19 ? 272 THR B O   1 
ATOM   4728 C CB  . THR B 1 272 ? 114.222 87.598  -11.230 1.00 14.34 ? 272 THR B CB  1 
ATOM   4729 O OG1 . THR B 1 272 ? 112.788 87.591  -11.272 1.00 13.79 ? 272 THR B OG1 1 
ATOM   4730 C CG2 . THR B 1 272 ? 114.806 88.781  -11.995 1.00 13.45 ? 272 THR B CG2 1 
ATOM   4731 N N   . VAL B 1 273 ? 116.790 85.768  -12.984 1.00 14.01 ? 273 VAL B N   1 
ATOM   4732 C CA  . VAL B 1 273 ? 118.246 85.574  -13.253 1.00 13.62 ? 273 VAL B CA  1 
ATOM   4733 C C   . VAL B 1 273 ? 118.947 86.878  -13.255 1.00 13.99 ? 273 VAL B C   1 
ATOM   4734 O O   . VAL B 1 273 ? 120.024 87.016  -12.632 1.00 12.05 ? 273 VAL B O   1 
ATOM   4735 C CB  . VAL B 1 273 ? 118.423 84.816  -14.568 1.00 14.99 ? 273 VAL B CB  1 
ATOM   4736 C CG1 . VAL B 1 273 ? 119.842 84.734  -14.956 1.00 17.28 ? 273 VAL B CG1 1 
ATOM   4737 C CG2 . VAL B 1 273 ? 117.824 83.400  -14.427 1.00 15.75 ? 273 VAL B CG2 1 
ATOM   4738 N N   . TYR B 1 274 ? 118.370 87.836  -13.931 1.00 13.06 ? 274 TYR B N   1 
ATOM   4739 C CA  . TYR B 1 274 ? 118.843 89.201  -13.911 1.00 12.80 ? 274 TYR B CA  1 
ATOM   4740 C C   . TYR B 1 274 ? 117.715 90.169  -14.184 1.00 13.30 ? 274 TYR B C   1 
ATOM   4741 O O   . TYR B 1 274 ? 116.626 89.770  -14.664 1.00 12.92 ? 274 TYR B O   1 
ATOM   4742 C CB  . TYR B 1 274 ? 119.972 89.373  -14.927 1.00 12.66 ? 274 TYR B CB  1 
ATOM   4743 C CG  . TYR B 1 274 ? 119.596 89.414  -16.383 1.00 12.51 ? 274 TYR B CG  1 
ATOM   4744 C CD1 . TYR B 1 274 ? 118.995 90.529  -16.957 1.00 12.31 ? 274 TYR B CD1 1 
ATOM   4745 C CD2 . TYR B 1 274 ? 119.837 88.352  -17.191 1.00 13.47 ? 274 TYR B CD2 1 
ATOM   4746 C CE1 . TYR B 1 274 ? 118.688 90.542  -18.309 1.00 12.25 ? 274 TYR B CE1 1 
ATOM   4747 C CE2 . TYR B 1 274 ? 119.568 88.372  -18.530 1.00 13.68 ? 274 TYR B CE2 1 
ATOM   4748 C CZ  . TYR B 1 274 ? 118.969 89.466  -19.076 1.00 11.99 ? 274 TYR B CZ  1 
ATOM   4749 O OH  . TYR B 1 274 ? 118.643 89.447  -20.418 1.00 13.10 ? 274 TYR B OH  1 
ATOM   4750 N N   . SER B 1 275 ? 117.991 91.421  -13.834 1.00 12.91 ? 275 SER B N   1 
ATOM   4751 C CA  . SER B 1 275 ? 117.149 92.579  -14.069 1.00 12.14 ? 275 SER B CA  1 
ATOM   4752 C C   . SER B 1 275 ? 117.961 93.643  -14.776 1.00 14.82 ? 275 SER B C   1 
ATOM   4753 O O   . SER B 1 275 ? 119.142 93.856  -14.390 1.00 15.52 ? 275 SER B O   1 
ATOM   4754 C CB  . SER B 1 275 ? 116.614 93.127  -12.777 1.00 13.07 ? 275 SER B CB  1 
ATOM   4755 O OG  . SER B 1 275 ? 115.856 92.146  -12.089 1.00 13.20 ? 275 SER B OG  1 
ATOM   4756 N N   . ASN B 1 276 ? 117.363 94.371  -15.734 1.00 13.17 ? 276 ASN B N   1 
ATOM   4757 C CA  . ASN B 1 276 ? 118.107 95.450  -16.314 1.00 14.91 ? 276 ASN B CA  1 
ATOM   4758 C C   . ASN B 1 276 ? 117.276 96.648  -16.652 1.00 14.21 ? 276 ASN B C   1 
ATOM   4759 O O   . ASN B 1 276 ? 116.040 96.606  -16.642 1.00 13.51 ? 276 ASN B O   1 
ATOM   4760 C CB  . ASN B 1 276 ? 118.977 94.973  -17.466 1.00 14.59 ? 276 ASN B CB  1 
ATOM   4761 C CG  . ASN B 1 276 ? 118.201 94.437  -18.675 1.00 15.19 ? 276 ASN B CG  1 
ATOM   4762 O OD1 . ASN B 1 276 ? 117.021 94.714  -18.889 1.00 15.28 ? 276 ASN B OD1 1 
ATOM   4763 N ND2 . ASN B 1 276 ? 118.953 93.789  -19.568 1.00 13.71 ? 276 ASN B ND2 1 
ATOM   4764 N N   . CYS B 1 277 ? 117.987 97.746  -16.864 1.00 14.71 ? 277 CYS B N   1 
ATOM   4765 C CA  . CYS B 1 277 ? 117.399 99.064  -17.200 1.00 14.49 ? 277 CYS B CA  1 
ATOM   4766 C C   . CYS B 1 277 ? 118.348 99.709  -18.205 1.00 15.17 ? 277 CYS B C   1 
ATOM   4767 O O   . CYS B 1 277 ? 119.536 99.903  -17.848 1.00 15.30 ? 277 CYS B O   1 
ATOM   4768 C CB  . CYS B 1 277 ? 117.396 99.921  -15.974 1.00 13.91 ? 277 CYS B CB  1 
ATOM   4769 S SG  . CYS B 1 277 ? 116.820 101.624 -16.279 1.00 16.46 ? 277 CYS B SG  1 
ATOM   4770 N N   . TYR B 1 278 ? 117.865 99.934  -19.436 1.00 13.74 ? 278 TYR B N   1 
ATOM   4771 C CA  . TYR B 1 278 ? 118.594 100.707 -20.412 1.00 16.54 ? 278 TYR B CA  1 
ATOM   4772 C C   . TYR B 1 278 ? 118.128 102.159 -20.372 1.00 14.77 ? 278 TYR B C   1 
ATOM   4773 O O   . TYR B 1 278 ? 116.935 102.416 -20.448 1.00 14.06 ? 278 TYR B O   1 
ATOM   4774 C CB  . TYR B 1 278 ? 118.410 100.170 -21.804 1.00 15.10 ? 278 TYR B CB  1 
ATOM   4775 C CG  . TYR B 1 278 ? 118.841 98.764  -22.049 1.00 14.86 ? 278 TYR B CG  1 
ATOM   4776 C CD1 . TYR B 1 278 ? 117.999 97.684  -21.784 1.00 15.40 ? 278 TYR B CD1 1 
ATOM   4777 C CD2 . TYR B 1 278 ? 120.082 98.491  -22.623 1.00 15.02 ? 278 TYR B CD2 1 
ATOM   4778 C CE1 . TYR B 1 278 ? 118.413 96.373  -22.082 1.00 14.27 ? 278 TYR B CE1 1 
ATOM   4779 C CE2 . TYR B 1 278 ? 120.503 97.196  -22.938 1.00 14.26 ? 278 TYR B CE2 1 
ATOM   4780 C CZ  . TYR B 1 278 ? 119.674 96.137  -22.706 1.00 13.51 ? 278 TYR B CZ  1 
ATOM   4781 O OH  . TYR B 1 278 ? 120.036 94.851  -23.030 1.00 12.57 ? 278 TYR B OH  1 
ATOM   4782 N N   . ASP B 1 279 ? 119.084 103.107 -20.231 1.00 16.21 ? 279 ASP B N   1 
ATOM   4783 C CA  . ASP B 1 279 ? 118.788 104.485 -20.498 1.00 15.10 ? 279 ASP B CA  1 
ATOM   4784 C C   . ASP B 1 279 ? 118.905 104.614 -22.019 1.00 15.71 ? 279 ASP B C   1 
ATOM   4785 O O   . ASP B 1 279 ? 120.055 104.589 -22.542 1.00 15.22 ? 279 ASP B O   1 
ATOM   4786 C CB  . ASP B 1 279 ? 119.764 105.338 -19.698 1.00 16.45 ? 279 ASP B CB  1 
ATOM   4787 C CG  . ASP B 1 279 ? 119.594 106.816 -19.926 1.00 19.12 ? 279 ASP B CG  1 
ATOM   4788 O OD1 . ASP B 1 279 ? 119.058 107.211 -20.964 1.00 17.29 ? 279 ASP B OD1 1 
ATOM   4789 O OD2 . ASP B 1 279 ? 120.080 107.583 -19.033 1.00 17.35 ? 279 ASP B OD2 1 
ATOM   4790 N N   . LEU B 1 280 ? 117.789 104.839 -22.690 1.00 13.89 ? 280 LEU B N   1 
ATOM   4791 C CA  . LEU B 1 280 ? 117.750 104.858 -24.152 1.00 16.36 ? 280 LEU B CA  1 
ATOM   4792 C C   . LEU B 1 280 ? 118.427 106.148 -24.684 1.00 20.04 ? 280 LEU B C   1 
ATOM   4793 O O   . LEU B 1 280 ? 119.055 106.100 -25.747 1.00 18.34 ? 280 LEU B O   1 
ATOM   4794 C CB  . LEU B 1 280 ? 116.351 104.829 -24.681 1.00 17.41 ? 280 LEU B CB  1 
ATOM   4795 C CG  . LEU B 1 280 ? 115.574 103.493 -24.359 1.00 15.93 ? 280 LEU B CG  1 
ATOM   4796 C CD1 . LEU B 1 280 ? 114.118 103.616 -24.768 1.00 14.85 ? 280 LEU B CD1 1 
ATOM   4797 C CD2 . LEU B 1 280 ? 116.232 102.277 -24.936 1.00 16.59 ? 280 LEU B CD2 1 
ATOM   4798 N N   . ASP B 1 281 ? 118.263 107.257 -23.986 1.00 18.83 ? 281 ASP B N   1 
ATOM   4799 C CA  . ASP B 1 281 ? 118.834 108.544 -24.418 1.00 21.47 ? 281 ASP B CA  1 
ATOM   4800 C C   . ASP B 1 281 ? 120.354 108.576 -24.324 1.00 22.65 ? 281 ASP B C   1 
ATOM   4801 O O   . ASP B 1 281 ? 120.989 109.112 -25.241 1.00 21.27 ? 281 ASP B O   1 
ATOM   4802 C CB  . ASP B 1 281 ? 118.267 109.698 -23.654 1.00 22.04 ? 281 ASP B CB  1 
ATOM   4803 C CG  . ASP B 1 281 ? 116.810 109.880 -23.896 1.00 23.50 ? 281 ASP B CG  1 
ATOM   4804 O OD1 . ASP B 1 281 ? 116.156 109.076 -24.594 1.00 27.41 ? 281 ASP B OD1 1 
ATOM   4805 O OD2 . ASP B 1 281 ? 116.304 110.895 -23.423 1.00 27.02 ? 281 ASP B OD2 1 
ATOM   4806 N N   . ASN B 1 282 ? 120.979 107.997 -23.308 1.00 22.48 ? 282 ASN B N   1 
ATOM   4807 C CA  . ASN B 1 282 ? 122.428 107.969 -23.327 1.00 28.47 ? 282 ASN B CA  1 
ATOM   4808 C C   . ASN B 1 282 ? 123.063 106.565 -23.596 1.00 25.71 ? 282 ASN B C   1 
ATOM   4809 O O   . ASN B 1 282 ? 124.245 106.357 -23.403 1.00 25.00 ? 282 ASN B O   1 
ATOM   4810 C CB  . ASN B 1 282 ? 122.980 108.696 -22.113 1.00 33.16 ? 282 ASN B CB  1 
ATOM   4811 C CG  . ASN B 1 282 ? 122.930 107.887 -20.909 1.00 39.89 ? 282 ASN B CG  1 
ATOM   4812 O OD1 . ASN B 1 282 ? 122.515 106.717 -20.945 1.00 42.37 ? 282 ASN B OD1 1 
ATOM   4813 N ND2 . ASN B 1 282 ? 123.455 108.438 -19.798 1.00 48.71 ? 282 ASN B ND2 1 
ATOM   4814 N N   . LYS B 1 283 ? 122.249 105.629 -24.033 1.00 19.44 ? 283 LYS B N   1 
ATOM   4815 C CA  . LYS B 1 283 ? 122.679 104.325 -24.435 1.00 21.20 ? 283 LYS B CA  1 
ATOM   4816 C C   . LYS B 1 283 ? 123.506 103.626 -23.390 1.00 18.80 ? 283 LYS B C   1 
ATOM   4817 O O   . LYS B 1 283 ? 124.643 103.161 -23.679 1.00 17.84 ? 283 LYS B O   1 
ATOM   4818 C CB  . LYS B 1 283 ? 123.521 104.312 -25.731 1.00 25.96 ? 283 LYS B CB  1 
ATOM   4819 C CG  . LYS B 1 283 ? 123.149 105.234 -26.884 1.00 35.12 ? 283 LYS B CG  1 
ATOM   4820 C CD  . LYS B 1 283 ? 121.743 105.529 -27.097 1.00 33.59 ? 283 LYS B CD  1 
ATOM   4821 C CE  . LYS B 1 283 ? 121.676 106.678 -28.059 1.00 38.90 ? 283 LYS B CE  1 
ATOM   4822 N NZ  . LYS B 1 283 ? 120.720 107.755 -27.762 1.00 43.58 ? 283 LYS B NZ  1 
ATOM   4823 N N   . THR B 1 284 ? 123.001 103.574 -22.149 1.00 16.00 ? 284 THR B N   1 
ATOM   4824 C CA  . THR B 1 284 ? 123.705 102.861 -21.113 1.00 16.31 ? 284 THR B CA  1 
ATOM   4825 C C   . THR B 1 284 ? 122.883 101.710 -20.577 1.00 14.54 ? 284 THR B C   1 
ATOM   4826 O O   . THR B 1 284 ? 121.710 101.910 -20.302 1.00 14.56 ? 284 THR B O   1 
ATOM   4827 C CB  . THR B 1 284 ? 124.022 103.876 -20.012 1.00 17.97 ? 284 THR B CB  1 
ATOM   4828 O OG1 . THR B 1 284 ? 124.847 104.916 -20.593 1.00 20.33 ? 284 THR B OG1 1 
ATOM   4829 C CG2 . THR B 1 284 ? 124.762 103.266 -18.877 1.00 17.87 ? 284 THR B CG2 1 
ATOM   4830 N N   . LEU B 1 285 ? 123.531 100.596 -20.330 1.00 16.04 ? 285 LEU B N   1 
ATOM   4831 C CA  . LEU B 1 285 ? 122.904 99.370  -19.784 1.00 15.73 ? 285 LEU B CA  1 
ATOM   4832 C C   . LEU B 1 285 ? 123.245 99.295  -18.281 1.00 15.74 ? 285 LEU B C   1 
ATOM   4833 O O   . LEU B 1 285 ? 124.406 99.487  -17.926 1.00 15.42 ? 285 LEU B O   1 
ATOM   4834 C CB  . LEU B 1 285 ? 123.464 98.122  -20.500 1.00 15.73 ? 285 LEU B CB  1 
ATOM   4835 C CG  . LEU B 1 285 ? 123.298 96.751  -19.808 1.00 16.37 ? 285 LEU B CG  1 
ATOM   4836 C CD1 . LEU B 1 285 ? 121.814 96.524  -19.583 1.00 15.91 ? 285 LEU B CD1 1 
ATOM   4837 C CD2 . LEU B 1 285 ? 123.893 95.636  -20.636 1.00 17.93 ? 285 LEU B CD2 1 
ATOM   4838 N N   . TYR B 1 286 ? 122.220 99.191  -17.410 1.00 13.66 ? 286 TYR B N   1 
ATOM   4839 C CA  . TYR B 1 286 ? 122.438 98.960  -15.959 1.00 15.13 ? 286 TYR B CA  1 
ATOM   4840 C C   . TYR B 1 286 ? 121.836 97.604  -15.631 1.00 15.51 ? 286 TYR B C   1 
ATOM   4841 O O   . TYR B 1 286 ? 120.726 97.315  -16.120 1.00 15.11 ? 286 TYR B O   1 
ATOM   4842 C CB  . TYR B 1 286 ? 121.669 100.007 -15.164 1.00 14.86 ? 286 TYR B CB  1 
ATOM   4843 C CG  . TYR B 1 286 ? 122.126 101.410 -15.425 1.00 14.43 ? 286 TYR B CG  1 
ATOM   4844 C CD1 . TYR B 1 286 ? 121.572 102.175 -16.433 1.00 16.33 ? 286 TYR B CD1 1 
ATOM   4845 C CD2 . TYR B 1 286 ? 123.097 101.974 -14.644 1.00 15.99 ? 286 TYR B CD2 1 
ATOM   4846 C CE1 . TYR B 1 286 ? 121.995 103.501 -16.667 1.00 19.91 ? 286 TYR B CE1 1 
ATOM   4847 C CE2 . TYR B 1 286 ? 123.543 103.293 -14.890 1.00 18.70 ? 286 TYR B CE2 1 
ATOM   4848 C CZ  . TYR B 1 286 ? 123.005 104.024 -15.905 1.00 20.39 ? 286 TYR B CZ  1 
ATOM   4849 O OH  . TYR B 1 286 ? 123.443 105.313 -16.124 1.00 20.30 ? 286 TYR B OH  1 
ATOM   4850 N N   . TYR B 1 287 ? 122.543 96.792  -14.876 1.00 13.81 ? 287 TYR B N   1 
ATOM   4851 C CA  . TYR B 1 287 ? 121.942 95.514  -14.546 1.00 15.80 ? 287 TYR B CA  1 
ATOM   4852 C C   . TYR B 1 287 ? 122.253 95.033  -13.153 1.00 16.35 ? 287 TYR B C   1 
ATOM   4853 O O   . TYR B 1 287 ? 123.253 95.444  -12.551 1.00 14.75 ? 287 TYR B O   1 
ATOM   4854 C CB  . TYR B 1 287 ? 122.269 94.449  -15.591 1.00 14.66 ? 287 TYR B CB  1 
ATOM   4855 C CG  . TYR B 1 287 ? 123.707 93.972  -15.618 1.00 14.66 ? 287 TYR B CG  1 
ATOM   4856 C CD1 . TYR B 1 287 ? 124.137 92.969  -14.767 1.00 14.25 ? 287 TYR B CD1 1 
ATOM   4857 C CD2 . TYR B 1 287 ? 124.645 94.610  -16.420 1.00 15.62 ? 287 TYR B CD2 1 
ATOM   4858 C CE1 . TYR B 1 287 ? 125.471 92.608  -14.730 1.00 17.75 ? 287 TYR B CE1 1 
ATOM   4859 C CE2 . TYR B 1 287 ? 125.999 94.212  -16.431 1.00 15.66 ? 287 TYR B CE2 1 
ATOM   4860 C CZ  . TYR B 1 287 ? 126.391 93.193  -15.626 1.00 17.26 ? 287 TYR B CZ  1 
ATOM   4861 O OH  . TYR B 1 287 ? 127.710 92.822  -15.553 1.00 17.76 ? 287 TYR B OH  1 
ATOM   4862 N N   . THR B 1 288 ? 121.389 94.153  -12.650 1.00 15.19 ? 288 THR B N   1 
ATOM   4863 C CA  . THR B 1 288 ? 121.631 93.374  -11.447 1.00 14.40 ? 288 THR B CA  1 
ATOM   4864 C C   . THR B 1 288 ? 121.410 91.910  -11.747 1.00 16.16 ? 288 THR B C   1 
ATOM   4865 O O   . THR B 1 288 ? 120.843 91.544  -12.791 1.00 15.96 ? 288 THR B O   1 
ATOM   4866 C CB  . THR B 1 288 ? 120.688 93.787  -10.285 1.00 15.12 ? 288 THR B CB  1 
ATOM   4867 O OG1 . THR B 1 288 ? 119.331 93.478  -10.671 1.00 13.81 ? 288 THR B OG1 1 
ATOM   4868 C CG2 . THR B 1 288 ? 120.809 95.203  -10.029 1.00 15.92 ? 288 THR B CG2 1 
ATOM   4869 N N   . THR B 1 289 ? 121.871 91.032  -10.853 1.00 16.05 ? 289 THR B N   1 
ATOM   4870 C CA  . THR B 1 289 ? 121.702 89.597  -11.043 1.00 15.66 ? 289 THR B CA  1 
ATOM   4871 C C   . THR B 1 289 ? 121.071 89.028  -9.768  1.00 17.06 ? 289 THR B C   1 
ATOM   4872 O O   . THR B 1 289 ? 121.102 89.673  -8.722  1.00 14.01 ? 289 THR B O   1 
ATOM   4873 C CB  . THR B 1 289 ? 123.023 88.833  -11.304 1.00 15.42 ? 289 THR B CB  1 
ATOM   4874 O OG1 . THR B 1 289 ? 123.887 88.965  -10.195 1.00 15.32 ? 289 THR B OG1 1 
ATOM   4875 C CG2 . THR B 1 289 ? 123.727 89.397  -12.532 1.00 15.59 ? 289 THR B CG2 1 
ATOM   4876 N N   . TYR B 1 290 ? 120.580 87.795  -9.848  1.00 14.63 ? 290 TYR B N   1 
ATOM   4877 C CA  . TYR B 1 290 ? 120.039 87.218  -8.656  1.00 15.43 ? 290 TYR B CA  1 
ATOM   4878 C C   . TYR B 1 290 ? 121.064 87.199  -7.525  1.00 15.56 ? 290 TYR B C   1 
ATOM   4879 O O   . TYR B 1 290 ? 120.696 87.388  -6.329  1.00 15.02 ? 290 TYR B O   1 
ATOM   4880 C CB  . TYR B 1 290 ? 119.547 85.801  -8.909  1.00 14.16 ? 290 TYR B CB  1 
ATOM   4881 C CG  . TYR B 1 290 ? 118.640 85.302  -7.811  1.00 13.67 ? 290 TYR B CG  1 
ATOM   4882 C CD1 . TYR B 1 290 ? 119.140 84.606  -6.708  1.00 13.60 ? 290 TYR B CD1 1 
ATOM   4883 C CD2 . TYR B 1 290 ? 117.254 85.538  -7.883  1.00 13.91 ? 290 TYR B CD2 1 
ATOM   4884 C CE1 . TYR B 1 290 ? 118.284 84.164  -5.689  1.00 14.47 ? 290 TYR B CE1 1 
ATOM   4885 C CE2 . TYR B 1 290 ? 116.415 85.125  -6.868  1.00 13.83 ? 290 TYR B CE2 1 
ATOM   4886 C CZ  . TYR B 1 290 ? 116.935 84.416  -5.794  1.00 14.04 ? 290 TYR B CZ  1 
ATOM   4887 O OH  . TYR B 1 290 ? 116.042 83.983  -4.804  1.00 15.53 ? 290 TYR B OH  1 
ATOM   4888 N N   . GLU B 1 291 ? 122.315 86.968  -7.883  1.00 15.49 ? 291 GLU B N   1 
ATOM   4889 C CA  . GLU B 1 291 ? 123.370 86.760  -6.870  1.00 17.88 ? 291 GLU B CA  1 
ATOM   4890 C C   . GLU B 1 291 ? 124.010 88.043  -6.424  1.00 16.13 ? 291 GLU B C   1 
ATOM   4891 O O   . GLU B 1 291 ? 124.787 88.045  -5.490  1.00 17.87 ? 291 GLU B O   1 
ATOM   4892 C CB  . GLU B 1 291 ? 124.499 85.884  -7.482  1.00 19.23 ? 291 GLU B CB  1 
ATOM   4893 C CG  . GLU B 1 291 ? 124.077 84.497  -7.914  1.00 22.29 ? 291 GLU B CG  1 
ATOM   4894 C CD  . GLU B 1 291 ? 123.357 84.444  -9.297  1.00 25.83 ? 291 GLU B CD  1 
ATOM   4895 O OE1 . GLU B 1 291 ? 123.302 85.446  -10.062 1.00 20.11 ? 291 GLU B OE1 1 
ATOM   4896 O OE2 . GLU B 1 291 ? 122.758 83.360  -9.574  1.00 32.18 ? 291 GLU B OE2 1 
ATOM   4897 N N   . ASN B 1 292 ? 123.821 89.117  -7.147  1.00 16.63 ? 292 ASN B N   1 
ATOM   4898 C CA  . ASN B 1 292 ? 124.542 90.381  -6.870  1.00 15.18 ? 292 ASN B CA  1 
ATOM   4899 C C   . ASN B 1 292 ? 123.617 91.578  -6.991  1.00 15.72 ? 292 ASN B C   1 
ATOM   4900 O O   . ASN B 1 292 ? 123.141 91.931  -8.092  1.00 17.13 ? 292 ASN B O   1 
ATOM   4901 C CB  . ASN B 1 292 ? 125.729 90.591  -7.805  1.00 16.48 ? 292 ASN B CB  1 
ATOM   4902 C CG  . ASN B 1 292 ? 126.553 91.841  -7.451  1.00 16.80 ? 292 ASN B CG  1 
ATOM   4903 O OD1 . ASN B 1 292 ? 126.527 92.363  -6.313  1.00 17.20 ? 292 ASN B OD1 1 
ATOM   4904 N ND2 . ASN B 1 292 ? 127.277 92.353  -8.431  1.00 15.99 ? 292 ASN B ND2 1 
ATOM   4905 N N   . ARG B 1 293 ? 123.341 92.202  -5.868  1.00 14.26 ? 293 ARG B N   1 
ATOM   4906 C CA  . ARG B 1 293 ? 122.428 93.352  -5.821  1.00 15.03 ? 293 ARG B CA  1 
ATOM   4907 C C   . ARG B 1 293 ? 122.999 94.604  -6.403  1.00 15.33 ? 293 ARG B C   1 
ATOM   4908 O O   . ARG B 1 293 ? 122.246 95.489  -6.781  1.00 14.34 ? 293 ARG B O   1 
ATOM   4909 C CB  . ARG B 1 293 ? 122.065 93.713  -4.382  1.00 18.76 ? 293 ARG B CB  1 
ATOM   4910 C CG  . ARG B 1 293 ? 120.879 92.989  -3.798  1.00 23.58 ? 293 ARG B CG  1 
ATOM   4911 C CD  . ARG B 1 293 ? 120.461 93.671  -2.490  1.00 26.49 ? 293 ARG B CD  1 
ATOM   4912 N NE  . ARG B 1 293 ? 119.078 93.852  -2.557  1.00 31.35 ? 293 ARG B NE  1 
ATOM   4913 C CZ  . ARG B 1 293 ? 118.426 94.969  -2.603  1.00 33.77 ? 293 ARG B CZ  1 
ATOM   4914 N NH1 . ARG B 1 293 ? 119.022 96.119  -2.590  1.00 32.35 ? 293 ARG B NH1 1 
ATOM   4915 N NH2 . ARG B 1 293 ? 117.117 94.904  -2.602  1.00 38.84 ? 293 ARG B NH2 1 
ATOM   4916 N N   . GLN B 1 294 ? 124.338 94.762  -6.428  1.00 16.56 ? 294 GLN B N   1 
ATOM   4917 C CA  . GLN B 1 294 ? 124.905 96.008  -6.829  1.00 16.26 ? 294 GLN B CA  1 
ATOM   4918 C C   . GLN B 1 294 ? 124.683 96.203  -8.321  1.00 16.04 ? 294 GLN B C   1 
ATOM   4919 O O   . GLN B 1 294 ? 125.009 95.319  -9.096  1.00 18.32 ? 294 GLN B O   1 
ATOM   4920 C CB  . GLN B 1 294 ? 126.403 96.091  -6.566  1.00 18.03 ? 294 GLN B CB  1 
ATOM   4921 C CG  . GLN B 1 294 ? 127.002 97.435  -7.002  1.00 18.86 ? 294 GLN B CG  1 
ATOM   4922 C CD  . GLN B 1 294 ? 128.469 97.604  -6.674  1.00 20.27 ? 294 GLN B CD  1 
ATOM   4923 O OE1 . GLN B 1 294 ? 129.245 96.695  -6.855  1.00 17.92 ? 294 GLN B OE1 1 
ATOM   4924 N NE2 . GLN B 1 294 ? 128.847 98.832  -6.222  1.00 23.12 ? 294 GLN B NE2 1 
ATOM   4925 N N   . ILE B 1 295 ? 124.212 97.354  -8.704  1.00 14.80 ? 295 ILE B N   1 
ATOM   4926 C CA  . ILE B 1 295 ? 124.010 97.690  -10.131 1.00 15.27 ? 295 ILE B CA  1 
ATOM   4927 C C   . ILE B 1 295 ? 125.368 97.815  -10.840 1.00 16.71 ? 295 ILE B C   1 
ATOM   4928 O O   . ILE B 1 295 ? 126.276 98.498  -10.287 1.00 15.63 ? 295 ILE B O   1 
ATOM   4929 C CB  . ILE B 1 295 ? 123.223 98.967  -10.277 1.00 15.38 ? 295 ILE B CB  1 
ATOM   4930 C CG1 . ILE B 1 295 ? 121.830 98.779  -9.660  1.00 16.83 ? 295 ILE B CG1 1 
ATOM   4931 C CG2 . ILE B 1 295 ? 123.055 99.343  -11.754 1.00 19.23 ? 295 ILE B CG2 1 
ATOM   4932 C CD1 . ILE B 1 295 ? 121.028 100.019 -9.474  1.00 16.15 ? 295 ILE B CD1 1 
ATOM   4933 N N   . VAL B 1 296 ? 125.460 97.213  -12.023 1.00 15.16 ? 296 VAL B N   1 
ATOM   4934 C CA  . VAL B 1 296 ? 126.593 97.329  -12.942 1.00 16.10 ? 296 VAL B CA  1 
ATOM   4935 C C   . VAL B 1 296 ? 126.171 98.135  -14.174 1.00 17.54 ? 296 VAL B C   1 
ATOM   4936 O O   . VAL B 1 296 ? 125.082 97.927  -14.690 1.00 17.41 ? 296 VAL B O   1 
ATOM   4937 C CB  . VAL B 1 296 ? 127.078 95.936  -13.316 1.00 17.36 ? 296 VAL B CB  1 
ATOM   4938 C CG1 . VAL B 1 296 ? 128.183 96.024  -14.365 1.00 20.63 ? 296 VAL B CG1 1 
ATOM   4939 C CG2 . VAL B 1 296 ? 127.541 95.235  -12.076 1.00 18.04 ? 296 VAL B CG2 1 
ATOM   4940 N N   . ALA B 1 297 ? 127.007 99.073  -14.637 1.00 15.14 ? 297 ALA B N   1 
ATOM   4941 C CA  . ALA B 1 297 ? 126.680 99.975  -15.745 1.00 17.20 ? 297 ALA B CA  1 
ATOM   4942 C C   . ALA B 1 297 ? 127.732 99.800  -16.859 1.00 18.53 ? 297 ALA B C   1 
ATOM   4943 O O   . ALA B 1 297 ? 128.939 99.671  -16.574 1.00 16.62 ? 297 ALA B O   1 
ATOM   4944 C CB  . ALA B 1 297 ? 126.685 101.447 -15.300 1.00 18.14 ? 297 ALA B CB  1 
ATOM   4945 N N   . VAL B 1 298 ? 127.260 99.742  -18.094 1.00 18.06 ? 298 VAL B N   1 
ATOM   4946 C CA  . VAL B 1 298 ? 128.154 99.724  -19.287 1.00 18.88 ? 298 VAL B CA  1 
ATOM   4947 C C   . VAL B 1 298 ? 127.512 100.549 -20.404 1.00 20.49 ? 298 VAL B C   1 
ATOM   4948 O O   . VAL B 1 298 ? 126.309 100.448 -20.652 1.00 18.01 ? 298 VAL B O   1 
ATOM   4949 C CB  . VAL B 1 298 ? 128.498 98.297  -19.676 1.00 22.89 ? 298 VAL B CB  1 
ATOM   4950 C CG1 . VAL B 1 298 ? 127.244 97.527  -19.809 1.00 32.17 ? 298 VAL B CG1 1 
ATOM   4951 C CG2 . VAL B 1 298 ? 129.359 98.194  -20.952 1.00 20.57 ? 298 VAL B CG2 1 
ATOM   4952 N N   . THR B 1 299 ? 128.293 101.436 -21.034 1.00 18.49 ? 299 THR B N   1 
ATOM   4953 C CA  . THR B 1 299 ? 127.761 102.322 -22.045 1.00 19.65 ? 299 THR B CA  1 
ATOM   4954 C C   . THR B 1 299 ? 128.192 101.814 -23.399 1.00 20.98 ? 299 THR B C   1 
ATOM   4955 O O   . THR B 1 299 ? 129.253 101.160 -23.540 1.00 22.48 ? 299 THR B O   1 
ATOM   4956 C CB  . THR B 1 299 ? 128.227 103.780 -21.808 1.00 22.75 ? 299 THR B CB  1 
ATOM   4957 O OG1 . THR B 1 299 ? 127.771 104.241 -20.549 1.00 27.17 ? 299 THR B OG1 1 
ATOM   4958 C CG2 . THR B 1 299 ? 127.673 104.739 -22.853 1.00 29.99 ? 299 THR B CG2 1 
ATOM   4959 N N   . LEU B 1 300 ? 127.398 102.073 -24.416 1.00 18.42 ? 300 LEU B N   1 
ATOM   4960 C CA  . LEU B 1 300 ? 127.751 101.670 -25.764 1.00 19.39 ? 300 LEU B CA  1 
ATOM   4961 C C   . LEU B 1 300 ? 128.756 102.712 -26.399 1.00 23.44 ? 300 LEU B C   1 
ATOM   4962 O O   . LEU B 1 300 ? 128.237 103.853 -26.377 1.00 27.95 ? 300 LEU B O   1 
ATOM   4963 C CB  . LEU B 1 300 ? 126.457 101.568 -26.563 1.00 19.93 ? 300 LEU B CB  1 
ATOM   4964 C CG  . LEU B 1 300 ? 126.525 101.350 -28.086 1.00 23.37 ? 300 LEU B CG  1 
ATOM   4965 C CD1 . LEU B 1 300 ? 127.247 100.064 -28.383 1.00 22.12 ? 300 LEU B CD1 1 
ATOM   4966 C CD2 . LEU B 1 300 ? 125.132 101.334 -28.736 1.00 24.58 ? 300 LEU B CD2 1 
ATOM   4967 N N   . GLY B 1 306 ? 134.280 98.683  -35.448 1.00 28.89 ? 306 GLY B N   1 
ATOM   4968 C CA  . GLY B 1 306 ? 134.990 97.456  -35.136 1.00 27.10 ? 306 GLY B CA  1 
ATOM   4969 C C   . GLY B 1 306 ? 134.193 96.323  -35.790 1.00 24.33 ? 306 GLY B C   1 
ATOM   4970 O O   . GLY B 1 306 ? 133.048 96.542  -36.216 1.00 25.39 ? 306 GLY B O   1 
ATOM   4971 N N   . ASN B 1 307 ? 134.772 95.134  -35.915 1.00 21.89 ? 307 ASN B N   1 
ATOM   4972 C CA  . ASN B 1 307 ? 134.016 93.973  -36.445 1.00 25.26 ? 307 ASN B CA  1 
ATOM   4973 C C   . ASN B 1 307 ? 133.950 92.678  -35.567 1.00 19.95 ? 307 ASN B C   1 
ATOM   4974 O O   . ASN B 1 307 ? 133.530 91.627  -36.005 1.00 18.57 ? 307 ASN B O   1 
ATOM   4975 C CB  . ASN B 1 307 ? 134.542 93.667  -37.839 1.00 27.96 ? 307 ASN B CB  1 
ATOM   4976 C CG  . ASN B 1 307 ? 135.932 93.248  -37.812 1.00 32.24 ? 307 ASN B CG  1 
ATOM   4977 O OD1 . ASN B 1 307 ? 136.591 93.384  -36.810 1.00 38.09 ? 307 ASN B OD1 1 
ATOM   4978 N ND2 . ASN B 1 307 ? 136.401 92.731  -38.903 1.00 35.33 ? 307 ASN B ND2 1 
ATOM   4979 N N   . ARG B 1 308 ? 134.358 92.778  -34.314 1.00 17.51 ? 308 ARG B N   1 
ATOM   4980 C CA  . ARG B 1 308 ? 134.270 91.690  -33.360 1.00 17.08 ? 308 ARG B CA  1 
ATOM   4981 C C   . ARG B 1 308 ? 133.373 92.043  -32.174 1.00 16.48 ? 308 ARG B C   1 
ATOM   4982 O O   . ARG B 1 308 ? 133.306 93.162  -31.727 1.00 16.16 ? 308 ARG B O   1 
ATOM   4983 C CB  . ARG B 1 308 ? 135.633 91.366  -32.809 1.00 19.34 ? 308 ARG B CB  1 
ATOM   4984 C CG  . ARG B 1 308 ? 136.583 90.846  -33.921 1.00 19.76 ? 308 ARG B CG  1 
ATOM   4985 C CD  . ARG B 1 308 ? 136.542 89.345  -33.997 1.00 20.17 ? 308 ARG B CD  1 
ATOM   4986 N NE  . ARG B 1 308 ? 135.334 88.802  -34.612 1.00 17.98 ? 308 ARG B NE  1 
ATOM   4987 C CZ  . ARG B 1 308 ? 135.063 88.696  -35.921 1.00 19.26 ? 308 ARG B CZ  1 
ATOM   4988 N NH1 . ARG B 1 308 ? 133.904 88.136  -36.289 1.00 17.10 ? 308 ARG B NH1 1 
ATOM   4989 N NH2 . ARG B 1 308 ? 135.849 89.137  -36.873 1.00 18.25 ? 308 ARG B NH2 1 
ATOM   4990 N N   . LEU B 1 309 ? 132.703 91.046  -31.652 1.00 17.99 ? 309 LEU B N   1 
ATOM   4991 C CA  . LEU B 1 309 ? 131.877 91.239  -30.441 1.00 18.00 ? 309 LEU B CA  1 
ATOM   4992 C C   . LEU B 1 309 ? 132.754 91.602  -29.273 1.00 19.49 ? 309 LEU B C   1 
ATOM   4993 O O   . LEU B 1 309 ? 133.904 91.123  -29.172 1.00 17.45 ? 309 LEU B O   1 
ATOM   4994 C CB  . LEU B 1 309 ? 131.130 89.956  -30.161 1.00 18.03 ? 309 LEU B CB  1 
ATOM   4995 C CG  . LEU B 1 309 ? 130.254 89.434  -31.325 1.00 16.72 ? 309 LEU B CG  1 
ATOM   4996 C CD1 . LEU B 1 309 ? 129.623 88.108  -30.959 1.00 17.01 ? 309 LEU B CD1 1 
ATOM   4997 C CD2 . LEU B 1 309 ? 129.193 90.423  -31.733 1.00 17.27 ? 309 LEU B CD2 1 
ATOM   4998 N N   . VAL B 1 310 ? 132.255 92.430  -28.391 1.00 18.50 ? 310 VAL B N   1 
ATOM   4999 C CA  . VAL B 1 310 ? 132.957 92.737  -27.135 1.00 19.94 ? 310 VAL B CA  1 
ATOM   5000 C C   . VAL B 1 310 ? 132.060 92.273  -26.019 1.00 19.27 ? 310 VAL B C   1 
ATOM   5001 O O   . VAL B 1 310 ? 130.847 92.564  -26.059 1.00 19.35 ? 310 VAL B O   1 
ATOM   5002 C CB  . VAL B 1 310 ? 133.218 94.240  -27.024 1.00 20.37 ? 310 VAL B CB  1 
ATOM   5003 C CG1 . VAL B 1 310 ? 133.820 94.538  -25.653 1.00 20.77 ? 310 VAL B CG1 1 
ATOM   5004 C CG2 . VAL B 1 310 ? 134.061 94.747  -28.219 1.00 22.82 ? 310 VAL B CG2 1 
ATOM   5005 N N   . THR B 1 311 ? 132.583 91.523  -25.051 1.00 16.79 ? 311 THR B N   1 
ATOM   5006 C CA  . THR B 1 311 ? 131.733 90.911  -24.045 1.00 17.52 ? 311 THR B CA  1 
ATOM   5007 C C   . THR B 1 311 ? 132.232 91.162  -22.670 1.00 22.21 ? 311 THR B C   1 
ATOM   5008 O O   . THR B 1 311 ? 133.416 91.368  -22.467 1.00 19.42 ? 311 THR B O   1 
ATOM   5009 C CB  . THR B 1 311 ? 131.622 89.387  -24.198 1.00 19.92 ? 311 THR B CB  1 
ATOM   5010 O OG1 . THR B 1 311 ? 132.903 88.805  -24.115 1.00 21.75 ? 311 THR B OG1 1 
ATOM   5011 C CG2 . THR B 1 311 ? 131.115 89.035  -25.540 1.00 19.48 ? 311 THR B CG2 1 
ATOM   5012 N N   A TYR B 1 312 ? 131.345 91.113  -21.694 0.45 22.26 ? 312 TYR B N   1 
ATOM   5013 N N   B TYR B 1 312 ? 131.313 91.205  -21.718 0.55 20.94 ? 312 TYR B N   1 
ATOM   5014 C CA  A TYR B 1 312 ? 131.729 91.190  -20.283 0.45 23.75 ? 312 TYR B CA  1 
ATOM   5015 C CA  B TYR B 1 312 ? 131.623 91.362  -20.294 0.55 21.43 ? 312 TYR B CA  1 
ATOM   5016 C C   A TYR B 1 312 ? 130.814 90.295  -19.486 0.45 26.11 ? 312 TYR B C   1 
ATOM   5017 C C   B TYR B 1 312 ? 130.765 90.292  -19.523 0.55 24.64 ? 312 TYR B C   1 
ATOM   5018 O O   A TYR B 1 312 ? 129.595 90.539  -19.382 0.45 24.16 ? 312 TYR B O   1 
ATOM   5019 O O   B TYR B 1 312 ? 129.524 90.401  -19.509 0.55 22.07 ? 312 TYR B O   1 
ATOM   5020 C CB  A TYR B 1 312 ? 131.712 92.576  -19.710 0.45 24.82 ? 312 TYR B CB  1 
ATOM   5021 C CB  B TYR B 1 312 ? 131.305 92.822  -19.858 0.55 21.49 ? 312 TYR B CB  1 
ATOM   5022 C CG  A TYR B 1 312 ? 132.085 92.583  -18.218 0.45 26.51 ? 312 TYR B CG  1 
ATOM   5023 C CG  B TYR B 1 312 ? 132.027 93.972  -20.623 0.55 22.20 ? 312 TYR B CG  1 
ATOM   5024 C CD1 A TYR B 1 312 ? 131.103 92.408  -17.267 0.45 27.10 ? 312 TYR B CD1 1 
ATOM   5025 C CD1 B TYR B 1 312 ? 131.466 94.583  -21.729 0.55 20.97 ? 312 TYR B CD1 1 
ATOM   5026 C CD2 A TYR B 1 312 ? 133.416 92.730  -17.769 0.45 26.21 ? 312 TYR B CD2 1 
ATOM   5027 C CD2 B TYR B 1 312 ? 133.250 94.487  -20.165 0.55 22.55 ? 312 TYR B CD2 1 
ATOM   5028 C CE1 A TYR B 1 312 ? 131.370 92.434  -15.932 0.45 24.81 ? 312 TYR B CE1 1 
ATOM   5029 C CE1 B TYR B 1 312 ? 132.108 95.601  -22.380 0.55 22.04 ? 312 TYR B CE1 1 
ATOM   5030 C CE2 A TYR B 1 312 ? 133.698 92.730  -16.401 0.45 25.13 ? 312 TYR B CE2 1 
ATOM   5031 C CE2 B TYR B 1 312 ? 133.888 95.508  -20.819 0.55 23.28 ? 312 TYR B CE2 1 
ATOM   5032 C CZ  A TYR B 1 312 ? 132.641 92.591  -15.484 0.45 27.28 ? 312 TYR B CZ  1 
ATOM   5033 C CZ  B TYR B 1 312 ? 133.302 96.052  -21.920 0.55 23.70 ? 312 TYR B CZ  1 
ATOM   5034 O OH  A TYR B 1 312 ? 132.771 92.584  -14.093 0.45 21.49 ? 312 TYR B OH  1 
ATOM   5035 O OH  B TYR B 1 312 ? 133.976 97.033  -22.539 0.55 26.32 ? 312 TYR B OH  1 
ATOM   5036 N N   . PRO B 1 313 ? 131.384 89.230  -18.944 1.00 28.76 ? 313 PRO B N   1 
ATOM   5037 C CA  . PRO B 1 313 ? 130.603 88.245  -18.202 1.00 30.01 ? 313 PRO B CA  1 
ATOM   5038 C C   . PRO B 1 313 ? 130.010 88.760  -16.908 1.00 26.21 ? 313 PRO B C   1 
ATOM   5039 O O   . PRO B 1 313 ? 130.576 89.606  -16.246 1.00 26.34 ? 313 PRO B O   1 
ATOM   5040 C CB  . PRO B 1 313 ? 131.634 87.138  -17.908 1.00 36.61 ? 313 PRO B CB  1 
ATOM   5041 C CG  . PRO B 1 313 ? 132.524 87.209  -19.097 1.00 39.24 ? 313 PRO B CG  1 
ATOM   5042 C CD  . PRO B 1 313 ? 132.742 88.699  -19.191 1.00 35.31 ? 313 PRO B CD  1 
ATOM   5043 N N   . PHE B 1 314 ? 128.791 88.334  -16.630 1.00 24.87 ? 314 PHE B N   1 
ATOM   5044 C CA  . PHE B 1 314 ? 128.072 88.747  -15.410 1.00 25.66 ? 314 PHE B CA  1 
ATOM   5045 C C   . PHE B 1 314 ? 128.758 88.057  -14.215 1.00 32.47 ? 314 PHE B C   1 
ATOM   5046 O O   . PHE B 1 314 ? 128.993 86.883  -14.262 1.00 35.21 ? 314 PHE B O   1 
ATOM   5047 C CB  . PHE B 1 314 ? 126.613 88.257  -15.449 1.00 24.13 ? 314 PHE B CB  1 
ATOM   5048 C CG  . PHE B 1 314 ? 125.688 89.102  -16.221 1.00 21.07 ? 314 PHE B CG  1 
ATOM   5049 C CD1 . PHE B 1 314 ? 126.125 90.060  -17.153 1.00 21.64 ? 314 PHE B CD1 1 
ATOM   5050 C CD2 . PHE B 1 314 ? 124.337 88.943  -16.033 1.00 19.73 ? 314 PHE B CD2 1 
ATOM   5051 C CE1 . PHE B 1 314 ? 125.232 90.847  -17.864 1.00 20.74 ? 314 PHE B CE1 1 
ATOM   5052 C CE2 . PHE B 1 314 ? 123.473 89.757  -16.687 1.00 20.84 ? 314 PHE B CE2 1 
ATOM   5053 C CZ  . PHE B 1 314 ? 123.889 90.718  -17.590 1.00 22.70 ? 314 PHE B CZ  1 
ATOM   5054 N N   . GLU B 1 315 ? 129.106 88.829  -13.207 1.00 29.71 ? 315 GLU B N   1 
ATOM   5055 C CA  . GLU B 1 315 ? 129.531 88.389  -11.898 1.00 35.81 ? 315 GLU B CA  1 
ATOM   5056 C C   . GLU B 1 315 ? 128.281 87.907  -11.123 1.00 28.93 ? 315 GLU B C   1 
ATOM   5057 O O   . GLU B 1 315 ? 127.086 88.541  -11.129 1.00 31.04 ? 315 GLU B O   1 
ATOM   5058 C CB  . GLU B 1 315 ? 130.220 89.565  -11.180 1.00 41.09 ? 315 GLU B CB  1 
ATOM   5059 C CG  . GLU B 1 315 ? 130.437 89.429  -9.649  1.00 53.74 ? 315 GLU B CG  1 
ATOM   5060 C CD  . GLU B 1 315 ? 131.901 89.588  -9.225  1.00 55.35 ? 315 GLU B CD  1 
ATOM   5061 O OE1 . GLU B 1 315 ? 132.458 88.657  -8.614  1.00 56.01 ? 315 GLU B OE1 1 
ATOM   5062 O OE2 . GLU B 1 315 ? 132.496 90.646  -9.486  1.00 62.44 ? 315 GLU B OE2 1 
ATOM   5063 N N   . ARG B 1 316 ? 128.509 86.731  -10.567 1.00 27.31 ? 316 ARG B N   1 
ATOM   5064 C CA  . ARG B 1 316 ? 127.516 86.016  -9.790  1.00 27.90 ? 316 ARG B CA  1 
ATOM   5065 C C   . ARG B 1 316 ? 127.965 85.837  -8.344  1.00 27.52 ? 316 ARG B C   1 
ATOM   5066 O O   . ARG B 1 316 ? 127.656 84.845  -7.731  1.00 27.15 ? 316 ARG B O   1 
ATOM   5067 C CB  . ARG B 1 316 ? 127.125 84.693  -10.452 1.00 32.36 ? 316 ARG B CB  1 
ATOM   5068 C CG  . ARG B 1 316 ? 126.316 84.921  -11.736 1.00 36.56 ? 316 ARG B CG  1 
ATOM   5069 C CD  . ARG B 1 316 ? 126.405 83.653  -12.620 1.00 43.75 ? 316 ARG B CD  1 
ATOM   5070 N NE  . ARG B 1 316 ? 125.373 82.726  -12.221 1.00 46.84 ? 316 ARG B NE  1 
ATOM   5071 C CZ  . ARG B 1 316 ? 125.130 81.546  -12.799 1.00 51.93 ? 316 ARG B CZ  1 
ATOM   5072 N NH1 . ARG B 1 316 ? 124.150 80.801  -12.318 1.00 38.49 ? 316 ARG B NH1 1 
ATOM   5073 N NH2 . ARG B 1 316 ? 125.854 81.093  -13.834 1.00 58.24 ? 316 ARG B NH2 1 
ATOM   5074 N N   . LYS B 1 317 ? 128.559 86.879  -7.787  1.00 28.51 ? 317 LYS B N   1 
ATOM   5075 C CA  . LYS B 1 317 ? 128.932 86.976  -6.368  1.00 28.51 ? 317 LYS B CA  1 
ATOM   5076 C C   . LYS B 1 317 ? 128.325 88.262  -5.805  1.00 24.35 ? 317 LYS B C   1 
ATOM   5077 O O   . LYS B 1 317 ? 128.327 89.277  -6.483  1.00 19.25 ? 317 LYS B O   1 
ATOM   5078 C CB  . LYS B 1 317 ? 130.427 87.096  -6.263  1.00 35.55 ? 317 LYS B CB  1 
ATOM   5079 C CG  . LYS B 1 317 ? 131.104 85.962  -5.504  1.00 49.40 ? 317 LYS B CG  1 
ATOM   5080 C CD  . LYS B 1 317 ? 132.625 86.164  -5.475  1.00 56.79 ? 317 LYS B CD  1 
ATOM   5081 C CE  . LYS B 1 317 ? 133.108 87.453  -4.760  1.00 63.01 ? 317 LYS B CE  1 
ATOM   5082 N NZ  . LYS B 1 317 ? 133.305 87.272  -3.289  1.00 69.87 ? 317 LYS B NZ  1 
ATOM   5083 N N   . GLN B 1 318 ? 127.848 88.228  -4.569  1.00 18.69 ? 318 GLN B N   1 
ATOM   5084 C CA  . GLN B 1 318 ? 127.288 89.383  -3.920  1.00 18.99 ? 318 GLN B CA  1 
ATOM   5085 C C   . GLN B 1 318 ? 128.390 90.362  -3.541  1.00 21.41 ? 318 GLN B C   1 
ATOM   5086 O O   . GLN B 1 318 ? 129.226 90.027  -2.717  1.00 23.43 ? 318 GLN B O   1 
ATOM   5087 C CB  . GLN B 1 318 ? 126.497 88.922  -2.657  1.00 17.61 ? 318 GLN B CB  1 
ATOM   5088 C CG  . GLN B 1 318 ? 125.668 89.996  -2.047  1.00 18.46 ? 318 GLN B CG  1 
ATOM   5089 C CD  . GLN B 1 318 ? 124.564 90.476  -2.932  1.00 15.67 ? 318 GLN B CD  1 
ATOM   5090 O OE1 . GLN B 1 318 ? 124.677 91.522  -3.519  1.00 16.54 ? 318 GLN B OE1 1 
ATOM   5091 N NE2 . GLN B 1 318 ? 123.492 89.720  -2.997  1.00 16.39 ? 318 GLN B NE2 1 
ATOM   5092 N N   . ILE B 1 319 ? 128.406 91.553  -4.116  1.00 18.30 ? 319 ILE B N   1 
ATOM   5093 C CA  . ILE B 1 319 ? 129.481 92.488  -3.831  1.00 22.90 ? 319 ILE B CA  1 
ATOM   5094 C C   . ILE B 1 319 ? 129.057 93.407  -2.748  1.00 21.16 ? 319 ILE B C   1 
ATOM   5095 O O   . ILE B 1 319 ? 128.313 94.320  -2.969  1.00 20.03 ? 319 ILE B O   1 
ATOM   5096 C CB  . ILE B 1 319 ? 129.898 93.313  -5.071  1.00 23.69 ? 319 ILE B CB  1 
ATOM   5097 C CG1 . ILE B 1 319 ? 130.232 92.357  -6.241  1.00 23.36 ? 319 ILE B CG1 1 
ATOM   5098 C CG2 . ILE B 1 319 ? 131.082 94.265  -4.769  1.00 24.44 ? 319 ILE B CG2 1 
ATOM   5099 C CD1 . ILE B 1 319 ? 131.193 91.246  -5.897  1.00 26.62 ? 319 ILE B CD1 1 
ATOM   5100 N N   . ILE B 1 320 ? 129.607 93.189  -1.570  1.00 20.60 ? 320 ILE B N   1 
ATOM   5101 C CA  . ILE B 1 320 ? 129.163 93.842  -0.305  1.00 24.01 ? 320 ILE B CA  1 
ATOM   5102 C C   . ILE B 1 320 ? 130.173 94.917  0.073   1.00 24.52 ? 320 ILE B C   1 
ATOM   5103 O O   . ILE B 1 320 ? 131.361 94.684  -0.011  1.00 24.33 ? 320 ILE B O   1 
ATOM   5104 C CB  . ILE B 1 320 ? 129.062 92.772  0.812   1.00 25.25 ? 320 ILE B CB  1 
ATOM   5105 C CG1 . ILE B 1 320 ? 127.923 91.808  0.426   1.00 25.25 ? 320 ILE B CG1 1 
ATOM   5106 C CG2 . ILE B 1 320 ? 128.807 93.369  2.203   1.00 23.80 ? 320 ILE B CG2 1 
ATOM   5107 C CD1 . ILE B 1 320 ? 127.771 90.606  1.298   1.00 25.06 ? 320 ILE B CD1 1 
ATOM   5108 N N   . ASN B 1 321 ? 129.710 96.101  0.433   1.00 21.00 ? 321 ASN B N   1 
ATOM   5109 C CA  . ASN B 1 321 ? 130.567 97.157  0.992   1.00 24.77 ? 321 ASN B CA  1 
ATOM   5110 C C   . ASN B 1 321 ? 130.789 96.865  2.497   1.00 27.11 ? 321 ASN B C   1 
ATOM   5111 O O   . ASN B 1 321 ? 129.912 97.104  3.345   1.00 23.05 ? 321 ASN B O   1 
ATOM   5112 C CB  . ASN B 1 321 ? 129.910 98.518  0.767   1.00 24.29 ? 321 ASN B CB  1 
ATOM   5113 C CG  . ASN B 1 321 ? 130.701 99.684  1.382   1.00 32.25 ? 321 ASN B CG  1 
ATOM   5114 O OD1 . ASN B 1 321 ? 131.808 99.529  1.817   1.00 35.06 ? 321 ASN B OD1 1 
ATOM   5115 N ND2 . ASN B 1 321 ? 130.103 100.825 1.409   1.00 36.02 ? 321 ASN B ND2 1 
ATOM   5116 N N   . LYS B 1 322 ? 131.954 96.335  2.823   1.00 29.92 ? 322 LYS B N   1 
ATOM   5117 C CA  . LYS B 1 322 ? 132.305 95.993  4.234   1.00 34.19 ? 322 LYS B CA  1 
ATOM   5118 C C   . LYS B 1 322 ? 132.905 97.190  4.955   1.00 34.80 ? 322 LYS B C   1 
ATOM   5119 O O   . LYS B 1 322 ? 133.946 97.618  4.556   1.00 37.73 ? 322 LYS B O   1 
ATOM   5120 C CB  . LYS B 1 322 ? 133.276 94.810  4.249   1.00 35.98 ? 322 LYS B CB  1 
ATOM   5121 C CG  . LYS B 1 322 ? 132.578 93.512  3.968   1.00 46.59 ? 322 LYS B CG  1 
ATOM   5122 C CD  . LYS B 1 322 ? 133.415 92.458  3.262   1.00 58.51 ? 322 LYS B CD  1 
ATOM   5123 C CE  . LYS B 1 322 ? 132.462 91.266  3.008   1.00 62.89 ? 322 LYS B CE  1 
ATOM   5124 N NZ  . LYS B 1 322 ? 132.774 90.194  2.028   1.00 72.55 ? 322 LYS B NZ  1 
ATOM   5125 N N   . LEU B 1 323 ? 132.225 97.731  5.974   1.00 32.42 ? 323 LEU B N   1 
ATOM   5126 C CA  . LEU B 1 323 ? 132.786 98.762  6.885   1.00 35.91 ? 323 LEU B CA  1 
ATOM   5127 C C   . LEU B 1 323 ? 133.515 98.068  8.047   1.00 32.20 ? 323 LEU B C   1 
ATOM   5128 O O   . LEU B 1 323 ? 134.493 98.646  8.516   1.00 44.55 ? 323 LEU B O   1 
ATOM   5129 C CB  . LEU B 1 323 ? 131.697 99.692  7.464   1.00 40.17 ? 323 LEU B CB  1 
ATOM   5130 C CG  . LEU B 1 323 ? 130.512 100.183 6.561   1.00 43.17 ? 323 LEU B CG  1 
ATOM   5131 C CD1 . LEU B 1 323 ? 129.458 100.911 7.391   1.00 48.76 ? 323 LEU B CD1 1 
ATOM   5132 C CD2 . LEU B 1 323 ? 130.868 101.080 5.372   1.00 44.27 ? 323 LEU B CD2 1 
HETATM 5133 P P   . PO4 C 2 .   ? 98.644  104.139 19.774  1.00 34.09 ? 401 PO4 A P   1 
HETATM 5134 O O1  . PO4 C 2 .   ? 98.653  104.444 18.235  1.00 31.73 ? 401 PO4 A O1  1 
HETATM 5135 O O2  . PO4 C 2 .   ? 100.048 104.101 20.402  1.00 27.84 ? 401 PO4 A O2  1 
HETATM 5136 O O3  . PO4 C 2 .   ? 97.997  102.800 20.061  1.00 28.65 ? 401 PO4 A O3  1 
HETATM 5137 O O4  . PO4 C 2 .   ? 97.914  105.232 20.575  1.00 34.07 ? 401 PO4 A O4  1 
HETATM 5138 P P   . PO4 D 2 .   ? 93.002  94.104  22.883  1.00 51.27 ? 402 PO4 A P   1 
HETATM 5139 O O1  . PO4 D 2 .   ? 93.143  95.033  21.647  1.00 46.22 ? 402 PO4 A O1  1 
HETATM 5140 O O2  . PO4 D 2 .   ? 91.649  93.385  22.974  1.00 52.63 ? 402 PO4 A O2  1 
HETATM 5141 O O3  . PO4 D 2 .   ? 93.059  95.013  24.133  1.00 49.54 ? 402 PO4 A O3  1 
HETATM 5142 O O4  . PO4 D 2 .   ? 94.206  93.090  22.860  1.00 48.28 ? 402 PO4 A O4  1 
HETATM 5143 P P   . PO4 E 2 .   ? 106.046 77.292  -29.449 1.00 42.03 ? 401 PO4 B P   1 
HETATM 5144 O O1  . PO4 E 2 .   ? 105.708 76.026  -30.266 1.00 39.23 ? 401 PO4 B O1  1 
HETATM 5145 O O2  . PO4 E 2 .   ? 106.315 76.883  -27.981 1.00 33.95 ? 401 PO4 B O2  1 
HETATM 5146 O O3  . PO4 E 2 .   ? 104.892 78.260  -29.559 1.00 35.81 ? 401 PO4 B O3  1 
HETATM 5147 O O4  . PO4 E 2 .   ? 107.214 78.052  -30.100 1.00 34.88 ? 401 PO4 B O4  1 
HETATM 5148 P P   . PO4 F 2 .   ? 96.122  82.890  -32.476 1.00 61.34 ? 402 PO4 B P   1 
HETATM 5149 O O1  . PO4 F 2 .   ? 96.673  81.917  -33.539 1.00 46.81 ? 402 PO4 B O1  1 
HETATM 5150 O O2  . PO4 F 2 .   ? 96.465  82.314  -31.099 1.00 50.93 ? 402 PO4 B O2  1 
HETATM 5151 O O3  . PO4 F 2 .   ? 94.641  82.932  -32.734 1.00 48.80 ? 402 PO4 B O3  1 
HETATM 5152 O O4  . PO4 F 2 .   ? 96.698  84.359  -32.513 1.00 51.66 ? 402 PO4 B O4  1 
HETATM 5153 O O   . HOH G 3 .   ? 104.339 118.429 22.520  1.00 39.29 ? 501 HOH A O   1 
HETATM 5154 O O   . HOH G 3 .   ? 100.508 105.341 16.811  1.00 22.75 ? 502 HOH A O   1 
HETATM 5155 O O   . HOH G 3 .   ? 95.443  106.933 2.125   1.00 19.93 ? 503 HOH A O   1 
HETATM 5156 O O   . HOH G 3 .   ? 115.791 80.533  22.782  1.00 31.88 ? 504 HOH A O   1 
HETATM 5157 O O   . HOH G 3 .   ? 97.907  90.967  21.086  1.00 13.70 ? 505 HOH A O   1 
HETATM 5158 O O   . HOH G 3 .   ? 106.093 82.397  31.695  1.00 23.10 ? 506 HOH A O   1 
HETATM 5159 O O   . HOH G 3 .   ? 117.995 103.566 28.409  1.00 18.70 ? 507 HOH A O   1 
HETATM 5160 O O   . HOH G 3 .   ? 127.853 86.907  8.218   1.00 21.10 ? 508 HOH A O   1 
HETATM 5161 O O   . HOH G 3 .   ? 127.218 88.208  26.769  1.00 34.30 ? 509 HOH A O   1 
HETATM 5162 O O   . HOH G 3 .   ? 101.618 81.600  18.697  1.00 27.95 ? 510 HOH A O   1 
HETATM 5163 O O   . HOH G 3 .   ? 111.972 98.103  38.886  1.00 27.58 ? 511 HOH A O   1 
HETATM 5164 O O   . HOH G 3 .   ? 118.547 81.295  29.448  1.00 34.67 ? 512 HOH A O   1 
HETATM 5165 O O   . HOH G 3 .   ? 104.201 104.476 -1.830  1.00 17.30 ? 513 HOH A O   1 
HETATM 5166 O O   . HOH G 3 .   ? 101.353 106.307 20.905  1.00 23.85 ? 514 HOH A O   1 
HETATM 5167 O O   . HOH G 3 .   ? 97.380  79.618  10.974  1.00 19.55 ? 515 HOH A O   1 
HETATM 5168 O O   . HOH G 3 .   ? 128.090 103.196 3.051   1.00 31.77 ? 516 HOH A O   1 
HETATM 5169 O O   . HOH G 3 .   ? 114.805 108.988 -1.607  1.00 34.77 ? 517 HOH A O   1 
HETATM 5170 O O   . HOH G 3 .   ? 115.574 107.303 28.954  1.00 20.69 ? 518 HOH A O   1 
HETATM 5171 O O   . HOH G 3 .   ? 95.399  91.766  -2.676  1.00 18.75 ? 519 HOH A O   1 
HETATM 5172 O O   . HOH G 3 .   ? 111.787 82.597  14.573  1.00 22.58 ? 520 HOH A O   1 
HETATM 5173 O O   . HOH G 3 .   ? 125.545 103.023 3.723   1.00 21.50 ? 521 HOH A O   1 
HETATM 5174 O O   . HOH G 3 .   ? 102.331 97.031  21.894  1.00 20.14 ? 522 HOH A O   1 
HETATM 5175 O O   . HOH G 3 .   ? 113.537 74.961  -3.441  1.00 38.63 ? 523 HOH A O   1 
HETATM 5176 O O   . HOH G 3 .   ? 100.455 91.111  14.802  1.00 13.50 ? 524 HOH A O   1 
HETATM 5177 O O   . HOH G 3 .   ? 119.919 77.983  3.798   1.00 21.02 ? 525 HOH A O   1 
HETATM 5178 O O   . HOH G 3 .   ? 127.323 100.626 -0.760  1.00 22.21 ? 526 HOH A O   1 
HETATM 5179 O O   . HOH G 3 .   ? 106.541 102.422 40.847  1.00 27.59 ? 527 HOH A O   1 
HETATM 5180 O O   . HOH G 3 .   ? 93.939  71.544  -7.127  1.00 23.94 ? 528 HOH A O   1 
HETATM 5181 O O   . HOH G 3 .   ? 110.077 96.194  -5.167  1.00 20.44 ? 529 HOH A O   1 
HETATM 5182 O O   . HOH G 3 .   ? 93.247  78.041  0.285   1.00 24.38 ? 530 HOH A O   1 
HETATM 5183 O O   . HOH G 3 .   ? 121.289 95.141  34.413  1.00 26.87 ? 531 HOH A O   1 
HETATM 5184 O O   . HOH G 3 .   ? 110.036 75.998  5.288   1.00 29.48 ? 532 HOH A O   1 
HETATM 5185 O O   . HOH G 3 .   ? 126.307 111.249 20.666  1.00 30.32 ? 533 HOH A O   1 
HETATM 5186 O O   . HOH G 3 .   ? 99.985  82.627  -18.156 1.00 18.97 ? 534 HOH A O   1 
HETATM 5187 O O   . HOH G 3 .   ? 107.545 95.552  4.034   1.00 12.94 ? 535 HOH A O   1 
HETATM 5188 O O   . HOH G 3 .   ? 128.062 83.549  10.462  1.00 27.28 ? 536 HOH A O   1 
HETATM 5189 O O   . HOH G 3 .   ? 115.663 97.709  -6.190  1.00 21.33 ? 537 HOH A O   1 
HETATM 5190 O O   . HOH G 3 .   ? 91.962  88.467  5.057   1.00 24.14 ? 538 HOH A O   1 
HETATM 5191 O O   . HOH G 3 .   ? 116.466 102.737 21.953  1.00 15.58 ? 539 HOH A O   1 
HETATM 5192 O O   . HOH G 3 .   ? 100.232 71.791  -6.122  1.00 29.05 ? 540 HOH A O   1 
HETATM 5193 O O   . HOH G 3 .   ? 97.493  81.450  -23.975 1.00 16.75 ? 541 HOH A O   1 
HETATM 5194 O O   . HOH G 3 .   ? 114.566 114.866 20.255  1.00 29.91 ? 542 HOH A O   1 
HETATM 5195 O O   . HOH G 3 .   ? 104.820 91.900  39.801  1.00 25.76 ? 543 HOH A O   1 
HETATM 5196 O O   . HOH G 3 .   ? 116.607 105.477 2.994   1.00 16.89 ? 544 HOH A O   1 
HETATM 5197 O O   . HOH G 3 .   ? 111.852 110.942 34.964  1.00 37.31 ? 545 HOH A O   1 
HETATM 5198 O O   . HOH G 3 .   ? 107.446 109.751 1.005   1.00 28.46 ? 546 HOH A O   1 
HETATM 5199 O O   . HOH G 3 .   ? 81.474  70.272  -19.797 1.00 30.52 ? 547 HOH A O   1 
HETATM 5200 O O   . HOH G 3 .   ? 110.394 75.728  -2.472  1.00 23.10 ? 548 HOH A O   1 
HETATM 5201 O O   . HOH G 3 .   ? 105.545 94.454  -2.452  1.00 16.82 ? 549 HOH A O   1 
HETATM 5202 O O   . HOH G 3 .   ? 128.410 108.516 23.075  1.00 22.30 ? 550 HOH A O   1 
HETATM 5203 O O   . HOH G 3 .   ? 111.860 104.383 32.570  1.00 19.04 ? 551 HOH A O   1 
HETATM 5204 O O   . HOH G 3 .   ? 129.182 103.092 32.237  1.00 31.19 ? 552 HOH A O   1 
HETATM 5205 O O   . HOH G 3 .   ? 94.760  88.502  3.587   1.00 19.52 ? 553 HOH A O   1 
HETATM 5206 O O   . HOH G 3 .   ? 108.075 94.065  -4.048  1.00 19.66 ? 554 HOH A O   1 
HETATM 5207 O O   . HOH G 3 .   ? 110.738 94.499  32.816  1.00 14.52 ? 555 HOH A O   1 
HETATM 5208 O O   . HOH G 3 .   ? 114.935 107.517 2.428   1.00 18.71 ? 556 HOH A O   1 
HETATM 5209 O O   . HOH G 3 .   ? 90.572  76.953  -3.336  1.00 21.01 ? 557 HOH A O   1 
HETATM 5210 O O   . HOH G 3 .   ? 102.907 82.038  -8.279  1.00 12.11 ? 558 HOH A O   1 
HETATM 5211 O O   . HOH G 3 .   ? 103.498 82.058  -20.348 1.00 13.42 ? 559 HOH A O   1 
HETATM 5212 O O   . HOH G 3 .   ? 101.207 107.444 23.233  1.00 31.72 ? 560 HOH A O   1 
HETATM 5213 O O   . HOH G 3 .   ? 104.876 74.517  -0.064  1.00 22.92 ? 561 HOH A O   1 
HETATM 5214 O O   . HOH G 3 .   ? 82.993  67.998  -12.119 1.00 26.35 ? 562 HOH A O   1 
HETATM 5215 O O   . HOH G 3 .   ? 114.974 82.614  15.177  1.00 30.94 ? 563 HOH A O   1 
HETATM 5216 O O   . HOH G 3 .   ? 120.453 77.384  11.213  1.00 29.94 ? 564 HOH A O   1 
HETATM 5217 O O   . HOH G 3 .   ? 117.908 99.357  36.306  1.00 19.56 ? 565 HOH A O   1 
HETATM 5218 O O   . HOH G 3 .   ? 122.356 84.932  30.494  1.00 28.64 ? 566 HOH A O   1 
HETATM 5219 O O   . HOH G 3 .   ? 124.893 85.810  -3.769  1.00 15.18 ? 567 HOH A O   1 
HETATM 5220 O O   . HOH G 3 .   ? 115.072 87.764  32.315  1.00 15.38 ? 568 HOH A O   1 
HETATM 5221 O O   . HOH G 3 .   ? 107.888 99.783  40.268  1.00 25.97 ? 569 HOH A O   1 
HETATM 5222 O O   . HOH G 3 .   ? 95.856  79.175  -19.234 1.00 18.07 ? 570 HOH A O   1 
HETATM 5223 O O   . HOH G 3 .   ? 107.107 104.961 19.395  1.00 23.05 ? 571 HOH A O   1 
HETATM 5224 O O   . HOH G 3 .   ? 102.337 110.041 20.957  1.00 35.01 ? 572 HOH A O   1 
HETATM 5225 O O   . HOH G 3 .   ? 125.166 107.796 28.992  1.00 22.77 ? 573 HOH A O   1 
HETATM 5226 O O   . HOH G 3 .   ? 93.965  89.526  19.655  1.00 31.14 ? 574 HOH A O   1 
HETATM 5227 O O   . HOH G 3 .   ? 98.778  104.247 24.516  1.00 31.53 ? 575 HOH A O   1 
HETATM 5228 O O   . HOH G 3 .   ? 93.990  75.951  6.602   1.00 12.62 ? 576 HOH A O   1 
HETATM 5229 O O   . HOH G 3 .   ? 97.584  72.976  -20.190 1.00 26.21 ? 577 HOH A O   1 
HETATM 5230 O O   . HOH G 3 .   ? 128.683 81.696  -1.676  1.00 28.40 ? 578 HOH A O   1 
HETATM 5231 O O   . HOH G 3 .   ? 97.565  101.034 -2.072  1.00 16.68 ? 579 HOH A O   1 
HETATM 5232 O O   . HOH G 3 .   ? 97.107  103.882 2.120   1.00 21.46 ? 580 HOH A O   1 
HETATM 5233 O O   . HOH G 3 .   ? 117.738 99.025  -2.513  1.00 16.65 ? 581 HOH A O   1 
HETATM 5234 O O   . HOH G 3 .   ? 117.852 105.674 5.405   1.00 29.49 ? 582 HOH A O   1 
HETATM 5235 O O   . HOH G 3 .   ? 102.104 96.035  32.736  1.00 24.94 ? 583 HOH A O   1 
HETATM 5236 O O   . HOH G 3 .   ? 124.013 99.597  -6.784  1.00 15.06 ? 584 HOH A O   1 
HETATM 5237 O O   . HOH G 3 .   ? 87.245  69.153  -6.617  1.00 17.61 ? 585 HOH A O   1 
HETATM 5238 O O   . HOH G 3 .   ? 109.885 80.659  17.005  1.00 17.50 ? 586 HOH A O   1 
HETATM 5239 O O   . HOH G 3 .   ? 91.612  88.720  8.974   1.00 27.00 ? 587 HOH A O   1 
HETATM 5240 O O   . HOH G 3 .   ? 113.365 93.336  36.476  1.00 27.51 ? 588 HOH A O   1 
HETATM 5241 O O   . HOH G 3 .   ? 109.204 109.049 21.966  1.00 20.23 ? 589 HOH A O   1 
HETATM 5242 O O   . HOH G 3 .   ? 118.401 105.884 34.817  1.00 20.25 ? 590 HOH A O   1 
HETATM 5243 O O   . HOH G 3 .   ? 111.797 101.119 17.989  1.00 25.63 ? 591 HOH A O   1 
HETATM 5244 O O   . HOH G 3 .   ? 122.825 100.059 1.147   1.00 21.03 ? 592 HOH A O   1 
HETATM 5245 O O   . HOH G 3 .   ? 103.230 89.327  33.018  1.00 30.33 ? 593 HOH A O   1 
HETATM 5246 O O   . HOH G 3 .   ? 94.670  98.331  22.866  1.00 21.46 ? 594 HOH A O   1 
HETATM 5247 O O   . HOH G 3 .   ? 113.827 95.617  0.020   1.00 21.58 ? 595 HOH A O   1 
HETATM 5248 O O   . HOH G 3 .   ? 121.111 83.816  19.101  1.00 24.24 ? 596 HOH A O   1 
HETATM 5249 O O   . HOH G 3 .   ? 91.838  82.203  7.533   1.00 13.25 ? 597 HOH A O   1 
HETATM 5250 O O   . HOH G 3 .   ? 116.275 80.286  2.282   1.00 22.25 ? 598 HOH A O   1 
HETATM 5251 O O   . HOH G 3 .   ? 109.511 102.537 38.318  1.00 31.58 ? 599 HOH A O   1 
HETATM 5252 O O   . HOH G 3 .   ? 93.409  93.673  6.213   1.00 26.36 ? 600 HOH A O   1 
HETATM 5253 O O   . HOH G 3 .   ? 101.612 77.105  -13.636 1.00 14.55 ? 601 HOH A O   1 
HETATM 5254 O O   . HOH G 3 .   ? 104.075 92.725  32.499  1.00 20.04 ? 602 HOH A O   1 
HETATM 5255 O O   . HOH G 3 .   ? 96.306  88.227  19.076  1.00 18.74 ? 603 HOH A O   1 
HETATM 5256 O O   . HOH G 3 .   ? 115.079 93.508  -1.287  1.00 20.87 ? 604 HOH A O   1 
HETATM 5257 O O   . HOH G 3 .   ? 92.731  72.150  -4.603  1.00 35.33 ? 605 HOH A O   1 
HETATM 5258 O O   . HOH G 3 .   ? 116.114 98.614  1.183   1.00 15.17 ? 606 HOH A O   1 
HETATM 5259 O O   . HOH G 3 .   ? 123.668 113.467 20.373  1.00 21.65 ? 607 HOH A O   1 
HETATM 5260 O O   . HOH G 3 .   ? 112.960 100.658 22.059  1.00 15.11 ? 608 HOH A O   1 
HETATM 5261 O O   . HOH G 3 .   ? 115.574 97.451  -2.575  1.00 21.38 ? 609 HOH A O   1 
HETATM 5262 O O   . HOH G 3 .   ? 94.101  75.861  -15.999 1.00 14.98 ? 610 HOH A O   1 
HETATM 5263 O O   . HOH G 3 .   ? 101.290 99.053  4.904   1.00 16.60 ? 611 HOH A O   1 
HETATM 5264 O O   . HOH G 3 .   ? 114.028 99.787  -0.361  1.00 15.69 ? 612 HOH A O   1 
HETATM 5265 O O   . HOH G 3 .   ? 115.364 100.967 39.342  1.00 32.68 ? 613 HOH A O   1 
HETATM 5266 O O   . HOH G 3 .   ? 109.228 81.150  20.705  1.00 21.90 ? 614 HOH A O   1 
HETATM 5267 O O   . HOH G 3 .   ? 115.723 81.071  25.290  1.00 24.31 ? 615 HOH A O   1 
HETATM 5268 O O   . HOH G 3 .   ? 117.971 100.988 -4.547  1.00 14.14 ? 616 HOH A O   1 
HETATM 5269 O O   . HOH G 3 .   ? 101.026 99.561  28.934  1.00 29.95 ? 617 HOH A O   1 
HETATM 5270 O O   . HOH G 3 .   ? 94.458  93.108  3.769   1.00 17.70 ? 618 HOH A O   1 
HETATM 5271 O O   . HOH G 3 .   ? 113.920 102.794 20.535  1.00 20.04 ? 619 HOH A O   1 
HETATM 5272 O O   . HOH G 3 .   ? 113.530 89.054  34.190  1.00 16.70 ? 620 HOH A O   1 
HETATM 5273 O O   . HOH G 3 .   ? 127.715 105.108 -8.257  1.00 30.67 ? 621 HOH A O   1 
HETATM 5274 O O   . HOH G 3 .   ? 94.629  67.918  -13.797 1.00 18.14 ? 622 HOH A O   1 
HETATM 5275 O O   . HOH G 3 .   ? 103.474 94.743  -4.654  1.00 15.90 ? 623 HOH A O   1 
HETATM 5276 O O   . HOH G 3 .   ? 111.099 100.085 20.264  1.00 20.28 ? 624 HOH A O   1 
HETATM 5277 O O   . HOH G 3 .   ? 101.911 91.575  12.477  1.00 10.73 ? 625 HOH A O   1 
HETATM 5278 O O   . HOH G 3 .   ? 119.382 89.826  -2.612  1.00 13.84 ? 626 HOH A O   1 
HETATM 5279 O O   . HOH G 3 .   ? 94.641  90.828  2.663   1.00 20.73 ? 627 HOH A O   1 
HETATM 5280 O O   . HOH G 3 .   ? 121.474 106.811 28.369  1.00 18.88 ? 628 HOH A O   1 
HETATM 5281 O O   . HOH G 3 .   ? 97.903  87.433  7.934   1.00 12.34 ? 629 HOH A O   1 
HETATM 5282 O O   . HOH G 3 .   ? 104.374 83.511  34.278  1.00 46.66 ? 630 HOH A O   1 
HETATM 5283 O O   . HOH G 3 .   ? 131.109 100.297 -2.511  1.00 26.88 ? 631 HOH A O   1 
HETATM 5284 O O   . HOH G 3 .   ? 120.903 83.226  -2.845  1.00 30.95 ? 632 HOH A O   1 
HETATM 5285 O O   . HOH G 3 .   ? 101.088 86.635  27.119  1.00 25.18 ? 633 HOH A O   1 
HETATM 5286 O O   . HOH G 3 .   ? 111.123 110.686 37.111  1.00 38.79 ? 634 HOH A O   1 
HETATM 5287 O O   . HOH G 3 .   ? 91.132  84.825  6.862   1.00 23.06 ? 635 HOH A O   1 
HETATM 5288 O O   . HOH G 3 .   ? 123.640 86.851  30.278  1.00 42.59 ? 636 HOH A O   1 
HETATM 5289 O O   . HOH G 3 .   ? 131.122 107.232 15.560  1.00 32.89 ? 637 HOH A O   1 
HETATM 5290 O O   . HOH G 3 .   ? 100.783 100.489 41.335  1.00 23.36 ? 638 HOH A O   1 
HETATM 5291 O O   . HOH G 3 .   ? 95.377  82.216  15.621  1.00 27.95 ? 639 HOH A O   1 
HETATM 5292 O O   . HOH G 3 .   ? 94.567  101.201 14.064  1.00 31.46 ? 640 HOH A O   1 
HETATM 5293 O O   . HOH G 3 .   ? 126.143 90.342  30.031  1.00 34.11 ? 641 HOH A O   1 
HETATM 5294 O O   . HOH G 3 .   ? 101.912 107.197 38.146  1.00 30.36 ? 642 HOH A O   1 
HETATM 5295 O O   . HOH G 3 .   ? 110.776 101.201 15.307  1.00 20.78 ? 643 HOH A O   1 
HETATM 5296 O O   . HOH G 3 .   ? 114.059 79.408  8.032   1.00 23.87 ? 644 HOH A O   1 
HETATM 5297 O O   . HOH G 3 .   ? 90.046  80.074  8.061   1.00 18.16 ? 645 HOH A O   1 
HETATM 5298 O O   . HOH G 3 .   ? 105.752 112.554 27.064  1.00 21.94 ? 646 HOH A O   1 
HETATM 5299 O O   . HOH G 3 .   ? 106.972 85.516  -3.838  1.00 14.60 ? 647 HOH A O   1 
HETATM 5300 O O   . HOH G 3 .   ? 128.029 106.657 29.017  1.00 28.68 ? 648 HOH A O   1 
HETATM 5301 O O   . HOH G 3 .   ? 132.693 95.729  10.450  1.00 27.00 ? 649 HOH A O   1 
HETATM 5302 O O   . HOH G 3 .   ? 92.296  70.299  -17.381 1.00 23.72 ? 650 HOH A O   1 
HETATM 5303 O O   . HOH G 3 .   ? 95.970  94.784  6.440   1.00 13.36 ? 651 HOH A O   1 
HETATM 5304 O O   . HOH G 3 .   ? 117.016 83.174  13.338  1.00 22.25 ? 652 HOH A O   1 
HETATM 5305 O O   . HOH G 3 .   ? 129.165 79.833  4.445   1.00 32.61 ? 653 HOH A O   1 
HETATM 5306 O O   . HOH G 3 .   ? 110.654 81.837  29.730  1.00 32.79 ? 654 HOH A O   1 
HETATM 5307 O O   . HOH G 3 .   ? 102.096 81.696  22.185  1.00 25.38 ? 655 HOH A O   1 
HETATM 5308 O O   . HOH G 3 .   ? 103.061 88.904  29.916  1.00 28.82 ? 656 HOH A O   1 
HETATM 5309 O O   . HOH G 3 .   ? 109.988 99.947  39.431  1.00 29.75 ? 657 HOH A O   1 
HETATM 5310 O O   . HOH G 3 .   ? 103.027 77.294  -9.586  1.00 14.98 ? 658 HOH A O   1 
HETATM 5311 O O   . HOH G 3 .   ? 129.480 82.651  2.654   1.00 23.31 ? 659 HOH A O   1 
HETATM 5312 O O   . HOH G 3 .   ? 86.357  71.781  -22.216 1.00 21.56 ? 660 HOH A O   1 
HETATM 5313 O O   . HOH G 3 .   ? 86.262  67.069  -11.110 1.00 34.20 ? 661 HOH A O   1 
HETATM 5314 O O   . HOH G 3 .   ? 123.765 102.450 1.653   1.00 16.65 ? 662 HOH A O   1 
HETATM 5315 O O   . HOH G 3 .   ? 96.456  70.477  7.412   1.00 33.51 ? 663 HOH A O   1 
HETATM 5316 O O   . HOH G 3 .   ? 93.841  68.467  4.523   1.00 26.02 ? 664 HOH A O   1 
HETATM 5317 O O   . HOH G 3 .   ? 96.180  70.130  -7.244  1.00 28.57 ? 665 HOH A O   1 
HETATM 5318 O O   . HOH G 3 .   ? 105.497 98.128  -3.635  1.00 15.07 ? 666 HOH A O   1 
HETATM 5319 O O   . HOH G 3 .   ? 120.211 105.909 38.239  1.00 29.90 ? 667 HOH A O   1 
HETATM 5320 O O   . HOH G 3 .   ? 100.574 91.588  35.574  1.00 40.90 ? 668 HOH A O   1 
HETATM 5321 O O   . HOH G 3 .   ? 132.179 97.684  -3.333  1.00 35.32 ? 669 HOH A O   1 
HETATM 5322 O O   . HOH G 3 .   ? 109.131 114.355 26.217  1.00 27.91 ? 670 HOH A O   1 
HETATM 5323 O O   . HOH G 3 .   ? 93.558  93.343  15.942  1.00 26.05 ? 671 HOH A O   1 
HETATM 5324 O O   . HOH G 3 .   ? 116.181 109.746 30.418  1.00 47.66 ? 672 HOH A O   1 
HETATM 5325 O O   . HOH G 3 .   ? 112.772 108.309 -5.270  1.00 37.50 ? 673 HOH A O   1 
HETATM 5326 O O   . HOH G 3 .   ? 114.944 85.447  33.625  1.00 29.66 ? 674 HOH A O   1 
HETATM 5327 O O   . HOH G 3 .   ? 105.566 81.275  -18.058 1.00 19.46 ? 675 HOH A O   1 
HETATM 5328 O O   . HOH G 3 .   ? 123.708 83.406  18.023  1.00 31.80 ? 676 HOH A O   1 
HETATM 5329 O O   . HOH G 3 .   ? 116.243 109.869 27.495  1.00 38.86 ? 677 HOH A O   1 
HETATM 5330 O O   . HOH G 3 .   ? 117.845 88.700  32.268  1.00 31.27 ? 678 HOH A O   1 
HETATM 5331 O O   . HOH G 3 .   ? 117.455 78.884  4.479   1.00 31.89 ? 679 HOH A O   1 
HETATM 5332 O O   . HOH G 3 .   ? 116.213 98.847  38.119  1.00 31.57 ? 680 HOH A O   1 
HETATM 5333 O O   . HOH G 3 .   ? 109.298 104.611 20.898  1.00 32.27 ? 681 HOH A O   1 
HETATM 5334 O O   . HOH G 3 .   ? 91.238  77.373  12.553  1.00 26.63 ? 682 HOH A O   1 
HETATM 5335 O O   . HOH G 3 .   ? 106.126 78.347  17.978  1.00 33.20 ? 683 HOH A O   1 
HETATM 5336 O O   . HOH G 3 .   ? 120.500 75.599  4.937   1.00 26.16 ? 684 HOH A O   1 
HETATM 5337 O O   . HOH G 3 .   ? 110.586 80.332  13.702  1.00 37.27 ? 685 HOH A O   1 
HETATM 5338 O O   . HOH G 3 .   ? 129.919 85.234  6.715   1.00 35.10 ? 686 HOH A O   1 
HETATM 5339 O O   . HOH G 3 .   ? 111.525 103.656 19.686  1.00 29.85 ? 687 HOH A O   1 
HETATM 5340 O O   . HOH G 3 .   ? 115.914 110.486 2.572   1.00 30.19 ? 688 HOH A O   1 
HETATM 5341 O O   . HOH G 3 .   ? 100.602 93.976  33.167  1.00 35.27 ? 689 HOH A O   1 
HETATM 5342 O O   . HOH G 3 .   ? 102.923 86.294  29.216  1.00 37.28 ? 690 HOH A O   1 
HETATM 5343 O O   . HOH G 3 .   ? 123.493 83.633  -4.439  1.00 24.54 ? 691 HOH A O   1 
HETATM 5344 O O   . HOH G 3 .   ? 93.006  69.782  -3.948  1.00 23.61 ? 692 HOH A O   1 
HETATM 5345 O O   . HOH G 3 .   ? 114.554 90.906  36.093  1.00 20.91 ? 693 HOH A O   1 
HETATM 5346 O O   . HOH G 3 .   ? 110.237 77.820  9.425   1.00 32.75 ? 694 HOH A O   1 
HETATM 5347 O O   . HOH G 3 .   ? 110.489 107.157 20.238  1.00 27.45 ? 695 HOH A O   1 
HETATM 5348 O O   . HOH H 3 .   ? 85.211  96.051  -6.009  1.00 21.05 ? 501 HOH B O   1 
HETATM 5349 O O   . HOH H 3 .   ? 120.797 82.849  -18.170 1.00 29.02 ? 502 HOH B O   1 
HETATM 5350 O O   . HOH H 3 .   ? 100.666 98.317  -35.578 1.00 35.22 ? 503 HOH B O   1 
HETATM 5351 O O   . HOH H 3 .   ? 123.321 84.038  -14.502 1.00 30.82 ? 504 HOH B O   1 
HETATM 5352 O O   . HOH H 3 .   ? 130.945 92.773  -12.481 1.00 28.28 ? 505 HOH B O   1 
HETATM 5353 O O   . HOH H 3 .   ? 113.313 78.273  -17.841 1.00 40.21 ? 506 HOH B O   1 
HETATM 5354 O O   . HOH H 3 .   ? 101.365 99.871  -41.235 1.00 29.29 ? 507 HOH B O   1 
HETATM 5355 O O   . HOH H 3 .   ? 133.511 88.332  -32.426 1.00 17.77 ? 508 HOH B O   1 
HETATM 5356 O O   . HOH H 3 .   ? 138.872 92.806  -36.011 1.00 31.48 ? 509 HOH B O   1 
HETATM 5357 O O   . HOH H 3 .   ? 108.675 106.465 -32.199 1.00 33.74 ? 510 HOH B O   1 
HETATM 5358 O O   . HOH H 3 .   ? 111.292 74.216  -17.269 1.00 35.29 ? 511 HOH B O   1 
HETATM 5359 O O   . HOH H 3 .   ? 104.988 73.032  -11.633 1.00 18.97 ? 512 HOH B O   1 
HETATM 5360 O O   . HOH H 3 .   ? 87.964  96.603  -9.697  1.00 24.08 ? 513 HOH B O   1 
HETATM 5361 O O   . HOH H 3 .   ? 122.274 105.683 -36.205 1.00 28.40 ? 514 HOH B O   1 
HETATM 5362 O O   . HOH H 3 .   ? 121.853 82.479  -11.782 1.00 23.53 ? 515 HOH B O   1 
HETATM 5363 O O   . HOH H 3 .   ? 111.069 79.815  -7.668  1.00 16.82 ? 516 HOH B O   1 
HETATM 5364 O O   . HOH H 3 .   ? 101.141 107.177 -14.601 1.00 32.98 ? 517 HOH B O   1 
HETATM 5365 O O   . HOH H 3 .   ? 111.911 89.822  -4.285  1.00 15.57 ? 518 HOH B O   1 
HETATM 5366 O O   . HOH H 3 .   ? 122.056 85.160  -12.309 1.00 19.09 ? 519 HOH B O   1 
HETATM 5367 O O   . HOH H 3 .   ? 92.385  87.168  -14.392 1.00 26.42 ? 520 HOH B O   1 
HETATM 5368 O O   . HOH H 3 .   ? 74.060  97.080  10.396  1.00 25.92 ? 521 HOH B O   1 
HETATM 5369 O O   . HOH H 3 .   ? 122.313 107.016 -17.721 1.00 19.05 ? 522 HOH B O   1 
HETATM 5370 O O   . HOH H 3 .   ? 101.527 107.555 -7.067  1.00 20.41 ? 523 HOH B O   1 
HETATM 5371 O O   . HOH H 3 .   ? 90.929  105.943 -3.459  1.00 31.50 ? 524 HOH B O   1 
HETATM 5372 O O   . HOH H 3 .   ? 103.516 79.699  -42.293 1.00 39.51 ? 525 HOH B O   1 
HETATM 5373 O O   . HOH H 3 .   ? 104.801 75.900  -40.508 1.00 33.47 ? 526 HOH B O   1 
HETATM 5374 O O   . HOH H 3 .   ? 96.281  96.300  8.798   1.00 17.28 ? 527 HOH B O   1 
HETATM 5375 O O   . HOH H 3 .   ? 110.869 110.548 -13.193 1.00 26.96 ? 528 HOH B O   1 
HETATM 5376 O O   . HOH H 3 .   ? 99.723  80.254  -32.311 1.00 22.88 ? 529 HOH B O   1 
HETATM 5377 O O   . HOH H 3 .   ? 122.240 87.865  -38.068 1.00 17.70 ? 530 HOH B O   1 
HETATM 5378 O O   . HOH H 3 .   ? 97.088  86.072  -6.631  1.00 16.53 ? 531 HOH B O   1 
HETATM 5379 O O   . HOH H 3 .   ? 98.657  88.078  -30.624 1.00 16.66 ? 532 HOH B O   1 
HETATM 5380 O O   . HOH H 3 .   ? 106.231 102.420 -24.016 1.00 21.51 ? 533 HOH B O   1 
HETATM 5381 O O   . HOH H 3 .   ? 105.000 91.006  -49.421 1.00 22.19 ? 534 HOH B O   1 
HETATM 5382 O O   . HOH H 3 .   ? 120.310 78.285  -11.783 1.00 32.56 ? 535 HOH B O   1 
HETATM 5383 O O   . HOH H 3 .   ? 92.351  97.486  -20.318 1.00 21.35 ? 536 HOH B O   1 
HETATM 5384 O O   . HOH H 3 .   ? 99.416  107.572 -8.721  1.00 33.08 ? 537 HOH B O   1 
HETATM 5385 O O   . HOH H 3 .   ? 116.524 76.961  -10.556 1.00 25.73 ? 538 HOH B O   1 
HETATM 5386 O O   . HOH H 3 .   ? 111.661 99.826  -41.671 1.00 18.47 ? 539 HOH B O   1 
HETATM 5387 O O   . HOH H 3 .   ? 131.340 93.589  -41.668 1.00 32.10 ? 540 HOH B O   1 
HETATM 5388 O O   . HOH H 3 .   ? 120.596 110.100 -19.754 1.00 29.06 ? 541 HOH B O   1 
HETATM 5389 O O   . HOH H 3 .   ? 114.231 89.229  -48.374 1.00 26.87 ? 542 HOH B O   1 
HETATM 5390 O O   . HOH H 3 .   ? 125.296 75.593  -30.112 1.00 35.21 ? 543 HOH B O   1 
HETATM 5391 O O   . HOH H 3 .   ? 112.969 94.128  -46.038 1.00 27.88 ? 544 HOH B O   1 
HETATM 5392 O O   . HOH H 3 .   ? 94.824  88.629  -13.036 1.00 21.41 ? 545 HOH B O   1 
HETATM 5393 O O   . HOH H 3 .   ? 119.847 91.200  -45.615 1.00 23.16 ? 546 HOH B O   1 
HETATM 5394 O O   . HOH H 3 .   ? 120.377 87.659  -31.382 1.00 14.17 ? 547 HOH B O   1 
HETATM 5395 O O   . HOH H 3 .   ? 74.123  99.614  2.602   1.00 26.75 ? 548 HOH B O   1 
HETATM 5396 O O   . HOH H 3 .   ? 117.364 83.896  -42.175 1.00 15.16 ? 549 HOH B O   1 
HETATM 5397 O O   . HOH H 3 .   ? 122.153 83.343  -38.554 1.00 16.94 ? 550 HOH B O   1 
HETATM 5398 O O   . HOH H 3 .   ? 117.217 103.154 -40.141 1.00 34.11 ? 551 HOH B O   1 
HETATM 5399 O O   . HOH H 3 .   ? 108.954 90.736  -5.315  1.00 20.10 ? 552 HOH B O   1 
HETATM 5400 O O   . HOH H 3 .   ? 108.956 106.633 -11.611 1.00 22.37 ? 553 HOH B O   1 
HETATM 5401 O O   . HOH H 3 .   ? 100.892 89.236  -24.224 1.00 10.69 ? 554 HOH B O   1 
HETATM 5402 O O   . HOH H 3 .   ? 108.870 103.907 -24.584 1.00 31.96 ? 555 HOH B O   1 
HETATM 5403 O O   . HOH H 3 .   ? 111.629 85.774  -49.763 1.00 24.93 ? 556 HOH B O   1 
HETATM 5404 O O   . HOH H 3 .   ? 109.388 89.214  -13.539 1.00 12.44 ? 557 HOH B O   1 
HETATM 5405 O O   . HOH H 3 .   ? 105.305 87.717  -4.799  1.00 18.75 ? 558 HOH B O   1 
HETATM 5406 O O   . HOH H 3 .   ? 113.482 74.129  -35.056 1.00 36.52 ? 559 HOH B O   1 
HETATM 5407 O O   . HOH H 3 .   ? 104.647 102.428 -39.325 1.00 33.50 ? 560 HOH B O   1 
HETATM 5408 O O   . HOH H 3 .   ? 93.300  89.014  -8.678  1.00 35.14 ? 561 HOH B O   1 
HETATM 5409 O O   . HOH H 3 .   ? 117.588 78.258  -31.599 1.00 23.27 ? 562 HOH B O   1 
HETATM 5410 O O   . HOH H 3 .   ? 111.379 91.705  -42.321 1.00 14.81 ? 563 HOH B O   1 
HETATM 5411 O O   . HOH H 3 .   ? 94.615  87.244  -29.207 1.00 28.84 ? 564 HOH B O   1 
HETATM 5412 O O   . HOH H 3 .   ? 124.843 93.081  -10.619 1.00 22.68 ? 565 HOH B O   1 
HETATM 5413 O O   . HOH H 3 .   ? 98.905  98.522  10.837  1.00 12.80 ? 566 HOH B O   1 
HETATM 5414 O O   . HOH H 3 .   ? 111.127 111.483 -20.735 1.00 31.22 ? 567 HOH B O   1 
HETATM 5415 O O   . HOH H 3 .   ? 128.950 94.832  -8.806  1.00 26.72 ? 568 HOH B O   1 
HETATM 5416 O O   . HOH H 3 .   ? 95.958  86.491  -12.059 1.00 25.82 ? 569 HOH B O   1 
HETATM 5417 O O   . HOH H 3 .   ? 107.016 89.050  -7.013  1.00 13.70 ? 570 HOH B O   1 
HETATM 5418 O O   . HOH H 3 .   ? 128.579 91.706  -13.234 1.00 20.50 ? 571 HOH B O   1 
HETATM 5419 O O   . HOH H 3 .   ? 126.892 86.915  -37.851 1.00 19.19 ? 572 HOH B O   1 
HETATM 5420 O O   . HOH H 3 .   ? 125.488 94.010  -2.762  1.00 16.14 ? 573 HOH B O   1 
HETATM 5421 O O   . HOH H 3 .   ? 100.353 87.759  -40.747 1.00 30.90 ? 574 HOH B O   1 
HETATM 5422 O O   . HOH H 3 .   ? 108.411 77.126  -26.251 1.00 34.08 ? 575 HOH B O   1 
HETATM 5423 O O   . HOH H 3 .   ? 96.172  105.776 -9.298  1.00 20.73 ? 576 HOH B O   1 
HETATM 5424 O O   . HOH H 3 .   ? 105.410 85.229  -31.498 1.00 21.88 ? 577 HOH B O   1 
HETATM 5425 O O   . HOH H 3 .   ? 133.512 85.011  -30.427 1.00 29.09 ? 578 HOH B O   1 
HETATM 5426 O O   . HOH H 3 .   ? 85.285  102.465 -2.435  1.00 23.06 ? 579 HOH B O   1 
HETATM 5427 O O   . HOH H 3 .   ? 120.800 96.716  -43.820 1.00 31.28 ? 580 HOH B O   1 
HETATM 5428 O O   . HOH H 3 .   ? 119.226 106.344 -5.719  1.00 17.02 ? 581 HOH B O   1 
HETATM 5429 O O   . HOH H 3 .   ? 115.632 86.615  -27.345 1.00 22.99 ? 582 HOH B O   1 
HETATM 5430 O O   . HOH H 3 .   ? 78.184  101.010 -2.770  1.00 16.14 ? 583 HOH B O   1 
HETATM 5431 O O   . HOH H 3 .   ? 89.045  103.278 10.658  1.00 28.26 ? 584 HOH B O   1 
HETATM 5432 O O   . HOH H 3 .   ? 106.920 74.630  -16.299 1.00 29.22 ? 585 HOH B O   1 
HETATM 5433 O O   . HOH H 3 .   ? 114.813 106.204 -28.592 1.00 22.62 ? 586 HOH B O   1 
HETATM 5434 O O   . HOH H 3 .   ? 116.339 87.607  -31.661 1.00 13.49 ? 587 HOH B O   1 
HETATM 5435 O O   . HOH H 3 .   ? 98.481  98.243  -1.174  1.00 13.24 ? 588 HOH B O   1 
HETATM 5436 O O   . HOH H 3 .   ? 105.528 111.644 -8.487  1.00 34.04 ? 589 HOH B O   1 
HETATM 5437 O O   . HOH H 3 .   ? 131.673 81.760  -29.964 1.00 22.70 ? 590 HOH B O   1 
HETATM 5438 O O   . HOH H 3 .   ? 118.319 86.529  -30.038 1.00 18.69 ? 591 HOH B O   1 
HETATM 5439 O O   . HOH H 3 .   ? 130.613 85.656  -36.897 1.00 22.95 ? 592 HOH B O   1 
HETATM 5440 O O   . HOH H 3 .   ? 84.038  105.754 4.495   1.00 20.24 ? 593 HOH B O   1 
HETATM 5441 O O   . HOH H 3 .   ? 130.564 87.874  -38.445 1.00 21.40 ? 594 HOH B O   1 
HETATM 5442 O O   . HOH H 3 .   ? 105.511 82.343  -38.498 1.00 29.15 ? 595 HOH B O   1 
HETATM 5443 O O   . HOH H 3 .   ? 92.165  86.680  -18.271 1.00 29.36 ? 596 HOH B O   1 
HETATM 5444 O O   . HOH H 3 .   ? 115.828 73.718  -36.721 1.00 30.36 ? 597 HOH B O   1 
HETATM 5445 O O   . HOH H 3 .   ? 102.429 89.545  -21.924 1.00 12.04 ? 598 HOH B O   1 
HETATM 5446 O O   . HOH H 3 .   ? 93.497  96.001  14.582  1.00 16.15 ? 599 HOH B O   1 
HETATM 5447 O O   . HOH H 3 .   ? 105.773 82.939  -14.407 1.00 15.77 ? 600 HOH B O   1 
HETATM 5448 O O   . HOH H 3 .   ? 111.039 98.003  -43.640 1.00 17.25 ? 601 HOH B O   1 
HETATM 5449 O O   . HOH H 3 .   ? 118.265 90.908  -10.629 1.00 15.38 ? 602 HOH B O   1 
HETATM 5450 O O   . HOH H 3 .   ? 119.890 91.465  -6.971  1.00 14.02 ? 603 HOH B O   1 
HETATM 5451 O O   . HOH H 3 .   ? 107.758 70.025  -10.704 1.00 29.70 ? 604 HOH B O   1 
HETATM 5452 O O   . HOH H 3 .   ? 96.021  89.503  -28.478 1.00 20.08 ? 605 HOH B O   1 
HETATM 5453 O O   . HOH H 3 .   ? 120.999 89.763  -4.903  1.00 12.96 ? 606 HOH B O   1 
HETATM 5454 O O   . HOH H 3 .   ? 90.929  96.993  9.808   1.00 18.93 ? 607 HOH B O   1 
HETATM 5455 O O   . HOH H 3 .   ? 103.585 79.179  -7.394  1.00 16.50 ? 608 HOH B O   1 
HETATM 5456 O O   . HOH H 3 .   ? 119.700 113.696 -13.781 1.00 27.08 ? 609 HOH B O   1 
HETATM 5457 O O   . HOH H 3 .   ? 117.294 91.340  -6.717  1.00 26.58 ? 610 HOH B O   1 
HETATM 5458 O O   . HOH H 3 .   ? 106.089 77.030  -34.288 1.00 27.65 ? 611 HOH B O   1 
HETATM 5459 O O   . HOH H 3 .   ? 96.882  91.044  -17.426 1.00 14.35 ? 612 HOH B O   1 
HETATM 5460 O O   . HOH H 3 .   ? 117.083 88.807  -9.134  1.00 15.86 ? 613 HOH B O   1 
HETATM 5461 O O   . HOH H 3 .   ? 96.872  84.340  -13.199 1.00 18.06 ? 614 HOH B O   1 
HETATM 5462 O O   . HOH H 3 .   ? 106.431 67.515  -14.668 1.00 25.30 ? 615 HOH B O   1 
HETATM 5463 O O   . HOH H 3 .   ? 104.688 89.938  -42.044 1.00 21.42 ? 616 HOH B O   1 
HETATM 5464 O O   . HOH H 3 .   ? 134.959 88.776  -30.301 1.00 31.20 ? 617 HOH B O   1 
HETATM 5465 O O   . HOH H 3 .   ? 122.566 103.696 -39.186 1.00 31.89 ? 618 HOH B O   1 
HETATM 5466 O O   . HOH H 3 .   ? 97.517  98.459  -31.638 1.00 24.84 ? 619 HOH B O   1 
HETATM 5467 O O   . HOH H 3 .   ? 108.686 79.762  -24.229 1.00 30.55 ? 620 HOH B O   1 
HETATM 5468 O O   . HOH H 3 .   ? 91.979  94.152  -24.982 1.00 22.81 ? 621 HOH B O   1 
HETATM 5469 O O   . HOH H 3 .   ? 114.750 94.689  -8.126  1.00 21.02 ? 622 HOH B O   1 
HETATM 5470 O O   . HOH H 3 .   ? 124.167 82.069  -43.212 1.00 38.29 ? 623 HOH B O   1 
HETATM 5471 O O   . HOH H 3 .   ? 99.051  83.831  -15.885 1.00 14.35 ? 624 HOH B O   1 
HETATM 5472 O O   . HOH H 3 .   ? 114.498 86.916  -29.680 1.00 17.28 ? 625 HOH B O   1 
HETATM 5473 O O   . HOH H 3 .   ? 114.584 84.132  -48.063 1.00 29.56 ? 626 HOH B O   1 
HETATM 5474 O O   . HOH H 3 .   ? 88.955  92.265  -16.882 1.00 13.45 ? 627 HOH B O   1 
HETATM 5475 O O   . HOH H 3 .   ? 94.777  101.865 4.149   1.00 13.04 ? 628 HOH B O   1 
HETATM 5476 O O   . HOH H 3 .   ? 130.410 100.264 -33.615 1.00 24.17 ? 629 HOH B O   1 
HETATM 5477 O O   . HOH H 3 .   ? 132.455 90.385  -38.310 1.00 18.61 ? 630 HOH B O   1 
HETATM 5478 O O   . HOH H 3 .   ? 133.927 84.351  -36.709 1.00 22.41 ? 631 HOH B O   1 
HETATM 5479 O O   . HOH H 3 .   ? 122.334 83.000  -46.320 1.00 29.63 ? 632 HOH B O   1 
HETATM 5480 O O   . HOH H 3 .   ? 114.398 92.422  -9.477  1.00 21.59 ? 633 HOH B O   1 
HETATM 5481 O O   . HOH H 3 .   ? 125.329 87.176  -47.879 1.00 25.69 ? 634 HOH B O   1 
HETATM 5482 O O   . HOH H 3 .   ? 105.921 81.614  -50.947 1.00 23.04 ? 635 HOH B O   1 
HETATM 5483 O O   . HOH H 3 .   ? 121.007 78.294  -44.520 1.00 37.42 ? 636 HOH B O   1 
HETATM 5484 O O   . HOH H 3 .   ? 111.982 83.103  -50.361 1.00 21.53 ? 637 HOH B O   1 
HETATM 5485 O O   . HOH H 3 .   ? 120.355 76.091  -40.568 1.00 30.79 ? 638 HOH B O   1 
HETATM 5486 O O   . HOH H 3 .   ? 103.105 102.367 -30.074 1.00 21.97 ? 639 HOH B O   1 
HETATM 5487 O O   . HOH H 3 .   ? 110.469 76.414  -47.754 1.00 27.71 ? 640 HOH B O   1 
HETATM 5488 O O   . HOH H 3 .   ? 86.349  93.165  -17.490 1.00 17.03 ? 641 HOH B O   1 
HETATM 5489 O O   . HOH H 3 .   ? 103.617 103.184 -26.481 1.00 17.24 ? 642 HOH B O   1 
HETATM 5490 O O   . HOH H 3 .   ? 126.752 91.378  -11.266 1.00 18.49 ? 643 HOH B O   1 
HETATM 5491 O O   . HOH H 3 .   ? 119.208 93.956  -45.160 1.00 34.53 ? 644 HOH B O   1 
HETATM 5492 O O   . HOH H 3 .   ? 123.870 86.011  -44.473 1.00 16.29 ? 645 HOH B O   1 
HETATM 5493 O O   . HOH H 3 .   ? 126.531 102.381 -37.740 1.00 33.62 ? 646 HOH B O   1 
HETATM 5494 O O   . HOH H 3 .   ? 123.969 71.925  -34.648 1.00 33.51 ? 647 HOH B O   1 
HETATM 5495 O O   . HOH H 3 .   ? 113.847 86.779  -49.088 1.00 28.82 ? 648 HOH B O   1 
HETATM 5496 O O   . HOH H 3 .   ? 86.355  104.620 -2.128  1.00 25.48 ? 649 HOH B O   1 
HETATM 5497 O O   . HOH H 3 .   ? 107.501 82.380  -17.254 1.00 32.55 ? 650 HOH B O   1 
HETATM 5498 O O   . HOH H 3 .   ? 108.963 85.872  -5.855  1.00 14.44 ? 651 HOH B O   1 
HETATM 5499 O O   . HOH H 3 .   ? 75.893  102.177 1.935   1.00 35.06 ? 652 HOH B O   1 
HETATM 5500 O O   . HOH H 3 .   ? 122.190 97.979  -41.966 1.00 31.03 ? 653 HOH B O   1 
HETATM 5501 O O   . HOH H 3 .   ? 106.607 106.257 -17.297 1.00 22.02 ? 654 HOH B O   1 
HETATM 5502 O O   . HOH H 3 .   ? 125.094 103.809 -38.270 1.00 34.50 ? 655 HOH B O   1 
HETATM 5503 O O   . HOH H 3 .   ? 104.615 76.558  -11.712 1.00 18.64 ? 656 HOH B O   1 
HETATM 5504 O O   . HOH H 3 .   ? 121.513 111.381 -12.073 1.00 22.13 ? 657 HOH B O   1 
HETATM 5505 O O   . HOH H 3 .   ? 89.722  89.680  -16.286 1.00 23.99 ? 658 HOH B O   1 
HETATM 5506 O O   . HOH H 3 .   ? 102.033 92.503  -39.324 1.00 28.46 ? 659 HOH B O   1 
HETATM 5507 O O   . HOH H 3 .   ? 116.643 100.059 -6.799  1.00 16.83 ? 660 HOH B O   1 
HETATM 5508 O O   . HOH H 3 .   ? 114.944 86.018  -24.781 1.00 28.95 ? 661 HOH B O   1 
HETATM 5509 O O   . HOH H 3 .   ? 131.034 101.615 -20.100 1.00 30.68 ? 662 HOH B O   1 
HETATM 5510 O O   . HOH H 3 .   ? 105.633 91.596  -4.778  1.00 15.20 ? 663 HOH B O   1 
HETATM 5511 O O   . HOH H 3 .   ? 128.562 83.867  -36.161 1.00 28.81 ? 664 HOH B O   1 
HETATM 5512 O O   . HOH H 3 .   ? 135.446 91.017  -25.246 1.00 27.68 ? 665 HOH B O   1 
HETATM 5513 O O   . HOH H 3 .   ? 104.659 85.901  -42.260 1.00 26.44 ? 666 HOH B O   1 
HETATM 5514 O O   . HOH H 3 .   ? 95.992  102.385 0.181   1.00 14.56 ? 667 HOH B O   1 
HETATM 5515 O O   . HOH H 3 .   ? 108.754 105.906 -34.540 1.00 22.66 ? 668 HOH B O   1 
HETATM 5516 O O   . HOH H 3 .   ? 103.599 97.299  -5.571  1.00 19.30 ? 669 HOH B O   1 
HETATM 5517 O O   . HOH H 3 .   ? 114.066 81.121  -29.237 1.00 32.03 ? 670 HOH B O   1 
HETATM 5518 O O   . HOH H 3 .   ? 118.639 105.033 -39.924 1.00 31.83 ? 671 HOH B O   1 
HETATM 5519 O O   . HOH H 3 .   ? 101.822 84.155  -38.633 1.00 33.80 ? 672 HOH B O   1 
HETATM 5520 O O   . HOH H 3 .   ? 98.926  93.528  -36.607 1.00 23.04 ? 673 HOH B O   1 
HETATM 5521 O O   . HOH H 3 .   ? 86.949  104.730 -16.780 1.00 37.27 ? 674 HOH B O   1 
HETATM 5522 O O   . HOH H 3 .   ? 78.891  98.587  12.864  1.00 25.90 ? 675 HOH B O   1 
HETATM 5523 O O   . HOH H 3 .   ? 83.108  102.716 7.891   1.00 20.08 ? 676 HOH B O   1 
HETATM 5524 O O   . HOH H 3 .   ? 128.304 83.195  -23.871 1.00 34.30 ? 677 HOH B O   1 
HETATM 5525 O O   . HOH H 3 .   ? 83.477  104.926 -13.957 1.00 28.56 ? 678 HOH B O   1 
HETATM 5526 O O   . HOH H 3 .   ? 117.424 91.471  -3.255  1.00 19.87 ? 679 HOH B O   1 
HETATM 5527 O O   . HOH H 3 .   ? 107.829 107.111 -39.181 1.00 47.60 ? 680 HOH B O   1 
HETATM 5528 O O   . HOH H 3 .   ? 123.780 81.486  -37.445 1.00 28.20 ? 681 HOH B O   1 
HETATM 5529 O O   . HOH H 3 .   ? 110.925 104.619 -22.855 1.00 27.18 ? 682 HOH B O   1 
HETATM 5530 O O   . HOH H 3 .   ? 114.351 106.544 -6.413  1.00 32.55 ? 683 HOH B O   1 
HETATM 5531 O O   . HOH H 3 .   ? 96.222  83.684  -25.335 1.00 21.36 ? 684 HOH B O   1 
HETATM 5532 O O   . HOH H 3 .   ? 96.333  83.271  -15.418 1.00 33.34 ? 685 HOH B O   1 
HETATM 5533 O O   . HOH H 3 .   ? 89.278  107.237 2.963   1.00 34.59 ? 686 HOH B O   1 
HETATM 5534 O O   . HOH H 3 .   ? 110.266 101.930 -42.845 1.00 24.26 ? 687 HOH B O   1 
HETATM 5535 O O   . HOH H 3 .   ? 118.216 90.798  -47.638 1.00 35.40 ? 688 HOH B O   1 
HETATM 5536 O O   . HOH H 3 .   ? 114.561 100.310 -41.748 1.00 24.47 ? 689 HOH B O   1 
HETATM 5537 O O   . HOH H 3 .   ? 103.049 90.791  -4.758  1.00 17.48 ? 690 HOH B O   1 
HETATM 5538 O O   . HOH H 3 .   ? 100.258 100.283 8.561   1.00 15.50 ? 691 HOH B O   1 
HETATM 5539 O O   . HOH H 3 .   ? 91.414  88.158  -20.307 1.00 44.31 ? 692 HOH B O   1 
HETATM 5540 O O   . HOH H 3 .   ? 103.950 103.765 -21.288 1.00 34.85 ? 693 HOH B O   1 
HETATM 5541 O O   . HOH H 3 .   ? 109.280 108.356 -13.895 1.00 29.86 ? 694 HOH B O   1 
HETATM 5542 O O   . HOH H 3 .   ? 123.058 109.385 -16.303 1.00 32.88 ? 695 HOH B O   1 
HETATM 5543 O O   . HOH H 3 .   ? 110.243 112.834 -14.381 1.00 28.97 ? 696 HOH B O   1 
HETATM 5544 O O   . HOH H 3 .   ? 94.052  86.380  -9.931  1.00 32.01 ? 697 HOH B O   1 
HETATM 5545 O O   . HOH H 3 .   ? 114.113 93.832  -4.868  1.00 28.82 ? 698 HOH B O   1 
HETATM 5546 O O   . HOH H 3 .   ? 83.627  103.194 -5.522  1.00 37.57 ? 699 HOH B O   1 
HETATM 5547 O O   . HOH H 3 .   ? 113.758 76.533  -44.488 1.00 38.15 ? 700 HOH B O   1 
HETATM 5548 O O   . HOH H 3 .   ? 116.720 107.203 -4.971  1.00 26.48 ? 701 HOH B O   1 
HETATM 5549 O O   . HOH H 3 .   ? 117.659 80.552  -29.929 1.00 25.96 ? 702 HOH B O   1 
HETATM 5550 O O   . HOH H 3 .   ? 112.892 96.882  -45.435 1.00 23.14 ? 703 HOH B O   1 
HETATM 5551 O O   . HOH H 3 .   ? 117.818 83.776  -29.533 1.00 25.74 ? 704 HOH B O   1 
HETATM 5552 O O   . HOH H 3 .   ? 81.874  103.535 -16.501 1.00 44.18 ? 705 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   OCS 2   2   2   OCS OCS A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TRP 105 105 105 TRP TRP A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 TYR 177 177 177 TYR TYR A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 MET 179 179 179 MET MET A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 ILE 190 190 190 ILE ILE A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 ASN 195 195 195 ASN ASN A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ASP 199 199 199 ASP ASP A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 LYS 237 237 237 LYS LYS A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 MET 239 239 239 MET MET A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 PHE 249 249 249 PHE PHE A . n 
A 1 250 HIS 250 250 250 HIS HIS A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 GLN 257 257 257 GLN GLN A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 GLU 269 269 269 GLU GLU A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 THR 272 272 272 THR THR A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 CYS 277 277 277 CYS CYS A . n 
A 1 278 TYR 278 278 278 TYR TYR A . n 
A 1 279 ASP 279 279 279 ASP ASP A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 ASN 282 282 282 ASN ASN A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 THR 284 284 284 THR THR A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 TYR 286 286 286 TYR TYR A . n 
A 1 287 TYR 287 287 287 TYR TYR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 TYR 290 290 290 TYR TYR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 ASN 292 292 292 ASN ASN A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 GLN 294 294 294 GLN GLN A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 ALA 297 297 297 ALA ALA A . n 
A 1 298 VAL 298 298 298 VAL VAL A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASN 301 301 ?   ?   ?   A . n 
A 1 302 LYS 302 302 ?   ?   ?   A . n 
A 1 303 ASP 303 303 ?   ?   ?   A . n 
A 1 304 LYS 304 304 ?   ?   ?   A . n 
A 1 305 ASP 305 305 ?   ?   ?   A . n 
A 1 306 GLY 306 306 306 GLY GLY A . n 
A 1 307 ASN 307 307 307 ASN ASN A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 ASN 321 321 321 ASN ASN A . n 
A 1 322 LYS 322 322 322 LYS LYS A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 ASN 324 324 ?   ?   ?   A . n 
A 1 325 LEU 325 325 ?   ?   ?   A . n 
A 1 326 GLU 326 326 ?   ?   ?   A . n 
A 1 327 ARG 327 327 ?   ?   ?   A . n 
A 1 328 HIS 328 328 ?   ?   ?   A . n 
A 1 329 HIS 329 329 ?   ?   ?   A . n 
A 1 330 HIS 330 330 ?   ?   ?   A . n 
A 1 331 HIS 331 331 ?   ?   ?   A . n 
A 1 332 HIS 332 332 ?   ?   ?   A . n 
A 1 333 HIS 333 333 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   OCS 2   2   2   OCS OCS B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   THR 6   6   6   THR THR B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  ASN 10  10  10  ASN ASN B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  ASN 12  12  12  ASN ASN B . n 
B 1 13  TYR 13  13  13  TYR TYR B . n 
B 1 14  PHE 14  14  14  PHE PHE B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  PHE 22  22  22  PHE PHE B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  TYR 24  24  24  TYR TYR B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  VAL 28  28  28  VAL VAL B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  ILE 30  30  30  ILE ILE B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  PRO 32  32  32  PRO PRO B . n 
B 1 33  ALA 33  33  33  ALA ALA B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  ARG 40  40  40  ARG ARG B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  ASN 47  47  47  ASN ASN B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  GLY 53  53  53  GLY GLY B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  ILE 56  56  56  ILE ILE B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  TYR 61  61  61  TYR TYR B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  TYR 64  64  64  TYR TYR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  GLU 70  70  70  GLU GLU B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  MET 75  75  75  MET MET B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LEU 78  78  78  LEU LEU B . n 
B 1 79  ASN 79  79  79  ASN ASN B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  PRO 81  81  81  PRO PRO B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  TYR 85  85  85  TYR TYR B . n 
B 1 86  TYR 86  86  86  TYR TYR B . n 
B 1 87  SER 87  87  87  SER SER B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  ASN 92  92  92  ASN ASN B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 PHE 100 100 100 PHE PHE B . n 
B 1 101 GLU 101 101 101 GLU GLU B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TRP 105 105 105 TRP TRP B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 GLN 109 109 109 GLN GLN B . n 
B 1 110 CYS 110 110 110 CYS CYS B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 LYS 122 122 122 LYS LYS B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 ASN 124 124 124 ASN ASN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ILE 126 126 126 ILE ILE B . n 
B 1 127 ASN 127 127 127 ASN ASN B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 PHE 130 130 130 PHE PHE B . n 
B 1 131 SER 131 131 131 SER SER B . n 
B 1 132 GLU 132 132 132 GLU GLU B . n 
B 1 133 GLN 133 133 133 GLN GLN B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 PRO 135 135 135 PRO PRO B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 LEU 139 139 139 LEU LEU B . n 
B 1 140 HIS 140 140 140 HIS HIS B . n 
B 1 141 TRP 141 141 141 TRP TRP B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASP 145 145 145 ASP ASP B . n 
B 1 146 ARG 146 146 146 ARG ARG B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 SER 149 149 149 SER SER B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 SER 157 157 157 SER SER B . n 
B 1 158 GLY 158 158 158 GLY GLY B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 HIS 160 160 160 HIS HIS B . n 
B 1 161 ILE 161 161 161 ILE ILE B . n 
B 1 162 TYR 162 162 162 TYR TYR B . n 
B 1 163 ASP 163 163 163 ASP ASP B . n 
B 1 164 ASN 164 164 164 ASN ASN B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 ILE 168 168 168 ILE ILE B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 THR 170 170 170 THR THR B . n 
B 1 171 ASN 171 171 171 ASN ASN B . n 
B 1 172 ASN 172 172 172 ASN ASN B . n 
B 1 173 PRO 173 173 173 PRO PRO B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 PHE 175 175 175 PHE PHE B . n 
B 1 176 ASN 176 176 176 ASN ASN B . n 
B 1 177 TYR 177 177 177 TYR TYR B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 MET 179 179 179 MET MET B . n 
B 1 180 TYR 180 180 180 TYR TYR B . n 
B 1 181 ASN 181 181 181 ASN ASN B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 ASN 183 183 183 ASN ASN B . n 
B 1 184 LYS 184 184 184 LYS LYS B . n 
B 1 185 TYR 185 185 185 TYR TYR B . n 
B 1 186 ARG 186 186 186 ARG ARG B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 LEU 188 188 188 LEU LEU B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 ILE 190 190 190 ILE ILE B . n 
B 1 191 SER 191 191 191 SER SER B . n 
B 1 192 THR 192 192 192 THR THR B . n 
B 1 193 PRO 193 193 193 PRO PRO B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 ASN 195 195 195 ASN ASN B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 ASP 199 199 199 ASP ASP B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 ASP 202 202 202 ASP ASP B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 ASP 206 206 206 ASP ASP B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 THR 208 208 208 THR THR B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 PHE 210 210 210 PHE PHE B . n 
B 1 211 GLY 211 211 211 GLY GLY B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 LEU 215 215 215 LEU LEU B . n 
B 1 216 PRO 216 216 216 PRO PRO B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 ASP 218 218 218 ASP ASP B . n 
B 1 219 VAL 219 219 219 VAL VAL B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 PRO 221 221 221 PRO PRO B . n 
B 1 222 GLU 222 222 222 GLU GLU B . n 
B 1 223 SER 223 223 223 SER SER B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 PHE 225 225 225 PHE PHE B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 ARG 227 227 227 ARG ARG B . n 
B 1 228 ALA 228 228 228 ALA ALA B . n 
B 1 229 THR 229 229 229 THR THR B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 SER 231 231 231 SER SER B . n 
B 1 232 LYS 232 232 232 LYS LYS B . n 
B 1 233 LEU 233 233 233 LEU LEU B . n 
B 1 234 ASN 234 234 234 ASN ASN B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 SER 236 236 236 SER SER B . n 
B 1 237 LYS 237 237 237 LYS LYS B . n 
B 1 238 GLY 238 238 238 GLY GLY B . n 
B 1 239 MET 239 239 239 MET MET B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 VAL 241 241 241 VAL VAL B . n 
B 1 242 GLU 242 242 242 GLU GLU B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ASP 244 244 244 ASP ASP B . n 
B 1 245 ILE 245 245 245 ILE ILE B . n 
B 1 246 THR 246 246 246 THR THR B . n 
B 1 247 GLN 247 247 247 GLN GLN B . n 
B 1 248 PHE 248 248 248 PHE PHE B . n 
B 1 249 PHE 249 249 249 PHE PHE B . n 
B 1 250 HIS 250 250 250 HIS HIS B . n 
B 1 251 ILE 251 251 251 ILE ILE B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 GLY 253 253 253 GLY GLY B . n 
B 1 254 THR 254 254 254 THR THR B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 GLN 257 257 257 GLN GLN B . n 
B 1 258 ILE 258 258 258 ILE ILE B . n 
B 1 259 LYS 259 259 259 LYS LYS B . n 
B 1 260 GLY 260 260 260 GLY GLY B . n 
B 1 261 VAL 261 261 261 VAL VAL B . n 
B 1 262 ASN 262 262 262 ASN ASN B . n 
B 1 263 LYS 263 263 263 LYS LYS B . n 
B 1 264 THR 264 264 264 THR THR B . n 
B 1 265 GLU 265 265 265 GLU GLU B . n 
B 1 266 SER 266 266 266 SER SER B . n 
B 1 267 GLY 267 267 267 GLY GLY B . n 
B 1 268 LYS 268 268 268 LYS LYS B . n 
B 1 269 GLU 269 269 269 GLU GLU B . n 
B 1 270 GLU 270 270 270 GLU GLU B . n 
B 1 271 TYR 271 271 271 TYR TYR B . n 
B 1 272 THR 272 272 272 THR THR B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 TYR 274 274 274 TYR TYR B . n 
B 1 275 SER 275 275 275 SER SER B . n 
B 1 276 ASN 276 276 276 ASN ASN B . n 
B 1 277 CYS 277 277 277 CYS CYS B . n 
B 1 278 TYR 278 278 278 TYR TYR B . n 
B 1 279 ASP 279 279 279 ASP ASP B . n 
B 1 280 LEU 280 280 280 LEU LEU B . n 
B 1 281 ASP 281 281 281 ASP ASP B . n 
B 1 282 ASN 282 282 282 ASN ASN B . n 
B 1 283 LYS 283 283 283 LYS LYS B . n 
B 1 284 THR 284 284 284 THR THR B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 TYR 286 286 286 TYR TYR B . n 
B 1 287 TYR 287 287 287 TYR TYR B . n 
B 1 288 THR 288 288 288 THR THR B . n 
B 1 289 THR 289 289 289 THR THR B . n 
B 1 290 TYR 290 290 290 TYR TYR B . n 
B 1 291 GLU 291 291 291 GLU GLU B . n 
B 1 292 ASN 292 292 292 ASN ASN B . n 
B 1 293 ARG 293 293 293 ARG ARG B . n 
B 1 294 GLN 294 294 294 GLN GLN B . n 
B 1 295 ILE 295 295 295 ILE ILE B . n 
B 1 296 VAL 296 296 296 VAL VAL B . n 
B 1 297 ALA 297 297 297 ALA ALA B . n 
B 1 298 VAL 298 298 298 VAL VAL B . n 
B 1 299 THR 299 299 299 THR THR B . n 
B 1 300 LEU 300 300 300 LEU LEU B . n 
B 1 301 ASN 301 301 ?   ?   ?   B . n 
B 1 302 LYS 302 302 ?   ?   ?   B . n 
B 1 303 ASP 303 303 ?   ?   ?   B . n 
B 1 304 LYS 304 304 ?   ?   ?   B . n 
B 1 305 ASP 305 305 ?   ?   ?   B . n 
B 1 306 GLY 306 306 306 GLY GLY B . n 
B 1 307 ASN 307 307 307 ASN ASN B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 VAL 310 310 310 VAL VAL B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 TYR 312 312 312 TYR TYR B . n 
B 1 313 PRO 313 313 313 PRO PRO B . n 
B 1 314 PHE 314 314 314 PHE PHE B . n 
B 1 315 GLU 315 315 315 GLU GLU B . n 
B 1 316 ARG 316 316 316 ARG ARG B . n 
B 1 317 LYS 317 317 317 LYS LYS B . n 
B 1 318 GLN 318 318 318 GLN GLN B . n 
B 1 319 ILE 319 319 319 ILE ILE B . n 
B 1 320 ILE 320 320 320 ILE ILE B . n 
B 1 321 ASN 321 321 321 ASN ASN B . n 
B 1 322 LYS 322 322 322 LYS LYS B . n 
B 1 323 LEU 323 323 323 LEU LEU B . n 
B 1 324 ASN 324 324 ?   ?   ?   B . n 
B 1 325 LEU 325 325 ?   ?   ?   B . n 
B 1 326 GLU 326 326 ?   ?   ?   B . n 
B 1 327 ARG 327 327 ?   ?   ?   B . n 
B 1 328 HIS 328 328 ?   ?   ?   B . n 
B 1 329 HIS 329 329 ?   ?   ?   B . n 
B 1 330 HIS 330 330 ?   ?   ?   B . n 
B 1 331 HIS 331 331 ?   ?   ?   B . n 
B 1 332 HIS 332 332 ?   ?   ?   B . n 
B 1 333 HIS 333 333 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PO4 1   401 401 PO4 PO4 A . 
D 2 PO4 1   402 402 PO4 PO4 A . 
E 2 PO4 1   401 401 PO4 PO4 B . 
F 2 PO4 1   402 402 PO4 PO4 B . 
G 3 HOH 1   501 649 HOH HOH A . 
G 3 HOH 2   502 597 HOH HOH A . 
G 3 HOH 3   503 551 HOH HOH A . 
G 3 HOH 4   504 648 HOH HOH A . 
G 3 HOH 5   505 515 HOH HOH A . 
G 3 HOH 6   506 681 HOH HOH A . 
G 3 HOH 7   507 543 HOH HOH A . 
G 3 HOH 8   508 554 HOH HOH A . 
G 3 HOH 9   509 656 HOH HOH A . 
G 3 HOH 10  510 625 HOH HOH A . 
G 3 HOH 11  511 631 HOH HOH A . 
G 3 HOH 12  512 646 HOH HOH A . 
G 3 HOH 13  513 525 HOH HOH A . 
G 3 HOH 14  514 582 HOH HOH A . 
G 3 HOH 15  515 559 HOH HOH A . 
G 3 HOH 16  516 688 HOH HOH A . 
G 3 HOH 17  517 647 HOH HOH A . 
G 3 HOH 18  518 562 HOH HOH A . 
G 3 HOH 19  519 536 HOH HOH A . 
G 3 HOH 20  520 564 HOH HOH A . 
G 3 HOH 21  521 575 HOH HOH A . 
G 3 HOH 22  522 566 HOH HOH A . 
G 3 HOH 23  523 654 HOH HOH A . 
G 3 HOH 24  524 505 HOH HOH A . 
G 3 HOH 25  525 553 HOH HOH A . 
G 3 HOH 26  526 579 HOH HOH A . 
G 3 HOH 27  527 611 HOH HOH A . 
G 3 HOH 28  528 600 HOH HOH A . 
G 3 HOH 29  529 548 HOH HOH A . 
G 3 HOH 30  530 591 HOH HOH A . 
G 3 HOH 31  531 658 HOH HOH A . 
G 3 HOH 32  532 641 HOH HOH A . 
G 3 HOH 33  533 633 HOH HOH A . 
G 3 HOH 34  534 558 HOH HOH A . 
G 3 HOH 35  535 503 HOH HOH A . 
G 3 HOH 36  536 675 HOH HOH A . 
G 3 HOH 37  537 542 HOH HOH A . 
G 3 HOH 38  538 593 HOH HOH A . 
G 3 HOH 39  539 519 HOH HOH A . 
G 3 HOH 40  540 665 HOH HOH A . 
G 3 HOH 41  541 534 HOH HOH A . 
G 3 HOH 42  542 669 HOH HOH A . 
G 3 HOH 43  543 619 HOH HOH A . 
G 3 HOH 44  544 533 HOH HOH A . 
G 3 HOH 45  545 645 HOH HOH A . 
G 3 HOH 46  546 620 HOH HOH A . 
G 3 HOH 47  547 632 HOH HOH A . 
G 3 HOH 48  548 568 HOH HOH A . 
G 3 HOH 49  549 535 HOH HOH A . 
G 3 HOH 50  550 577 HOH HOH A . 
G 3 HOH 51  551 552 HOH HOH A . 
G 3 HOH 52  552 666 HOH HOH A . 
G 3 HOH 53  553 545 HOH HOH A . 
G 3 HOH 54  554 538 HOH HOH A . 
G 3 HOH 55  555 511 HOH HOH A . 
G 3 HOH 56  556 549 HOH HOH A . 
G 3 HOH 57  557 570 HOH HOH A . 
G 3 HOH 58  558 504 HOH HOH A . 
G 3 HOH 59  559 509 HOH HOH A . 
G 3 HOH 60  560 671 HOH HOH A . 
G 3 HOH 61  561 583 HOH HOH A . 
G 3 HOH 62  562 624 HOH HOH A . 
G 3 HOH 63  563 682 HOH HOH A . 
G 3 HOH 64  564 684 HOH HOH A . 
G 3 HOH 65  565 555 HOH HOH A . 
G 3 HOH 66  566 621 HOH HOH A . 
G 3 HOH 67  567 518 HOH HOH A . 
G 3 HOH 68  568 520 HOH HOH A . 
G 3 HOH 69  569 594 HOH HOH A . 
G 3 HOH 70  570 537 HOH HOH A . 
G 3 HOH 71  571 578 HOH HOH A . 
G 3 HOH 72  572 653 HOH HOH A . 
G 3 HOH 73  573 590 HOH HOH A . 
G 3 HOH 74  574 638 HOH HOH A . 
G 3 HOH 75  575 636 HOH HOH A . 
G 3 HOH 76  576 507 HOH HOH A . 
G 3 HOH 77  577 617 HOH HOH A . 
G 3 HOH 78  578 694 HOH HOH A . 
G 3 HOH 79  579 530 HOH HOH A . 
G 3 HOH 80  580 550 HOH HOH A . 
G 3 HOH 81  581 529 HOH HOH A . 
G 3 HOH 82  582 639 HOH HOH A . 
G 3 HOH 83  583 614 HOH HOH A . 
G 3 HOH 84  584 527 HOH HOH A . 
G 3 HOH 85  585 532 HOH HOH A . 
G 3 HOH 86  586 531 HOH HOH A . 
G 3 HOH 87  587 628 HOH HOH A . 
G 3 HOH 88  588 618 HOH HOH A . 
G 3 HOH 89  589 556 HOH HOH A . 
G 3 HOH 90  590 569 HOH HOH A . 
G 3 HOH 91  591 606 HOH HOH A . 
G 3 HOH 92  592 584 HOH HOH A . 
G 3 HOH 93  593 634 HOH HOH A . 
G 3 HOH 94  594 567 HOH HOH A . 
G 3 HOH 95  595 599 HOH HOH A . 
G 3 HOH 96  596 612 HOH HOH A . 
G 3 HOH 97  597 508 HOH HOH A . 
G 3 HOH 98  598 598 HOH HOH A . 
G 3 HOH 99  599 672 HOH HOH A . 
G 3 HOH 100 600 608 HOH HOH A . 
G 3 HOH 101 601 510 HOH HOH A . 
G 3 HOH 102 602 573 HOH HOH A . 
G 3 HOH 103 603 546 HOH HOH A . 
G 3 HOH 104 604 585 HOH HOH A . 
G 3 HOH 105 605 673 HOH HOH A . 
G 3 HOH 106 606 517 HOH HOH A . 
G 3 HOH 107 607 574 HOH HOH A . 
G 3 HOH 108 608 522 HOH HOH A . 
G 3 HOH 109 609 586 HOH HOH A . 
G 3 HOH 110 610 521 HOH HOH A . 
G 3 HOH 111 611 524 HOH HOH A . 
G 3 HOH 112 612 528 HOH HOH A . 
G 3 HOH 113 613 630 HOH HOH A . 
G 3 HOH 114 614 568 HOH HOH A . 
G 3 HOH 115 615 601 HOH HOH A . 
G 3 HOH 116 616 512 HOH HOH A . 
G 3 HOH 117 617 623 HOH HOH A . 
G 3 HOH 118 618 540 HOH HOH A . 
G 3 HOH 119 619 571 HOH HOH A . 
G 3 HOH 120 620 541 HOH HOH A . 
G 3 HOH 121 621 642 HOH HOH A . 
G 3 HOH 122 622 547 HOH HOH A . 
G 3 HOH 123 623 526 HOH HOH A . 
G 3 HOH 124 624 560 HOH HOH A . 
G 3 HOH 125 625 501 HOH HOH A . 
G 3 HOH 126 626 514 HOH HOH A . 
G 3 HOH 127 627 572 HOH HOH A . 
G 3 HOH 128 628 557 HOH HOH A . 
G 3 HOH 129 629 502 HOH HOH A . 
G 3 HOH 130 630 589 HOH HOH A . 
G 3 HOH 131 631 605 HOH HOH A . 
G 3 HOH 132 632 678 HOH HOH A . 
G 3 HOH 133 633 604 HOH HOH A . 
G 3 HOH 134 634 655 HOH HOH A . 
G 3 HOH 135 635 581 HOH HOH A . 
G 3 HOH 136 636 677 HOH HOH A . 
G 3 HOH 137 637 676 HOH HOH A . 
G 3 HOH 138 638 596 HOH HOH A . 
G 3 HOH 139 639 602 HOH HOH A . 
G 3 HOH 140 640 668 HOH HOH A . 
G 3 HOH 141 641 652 HOH HOH A . 
G 3 HOH 142 642 615 HOH HOH A . 
G 3 HOH 143 643 561 HOH HOH A . 
G 3 HOH 144 644 576 HOH HOH A . 
G 3 HOH 145 645 539 HOH HOH A . 
G 3 HOH 146 646 580 HOH HOH A . 
G 3 HOH 147 647 516 HOH HOH A . 
G 3 HOH 148 648 607 HOH HOH A . 
G 3 HOH 149 649 631 HOH HOH A . 
G 3 HOH 150 650 659 HOH HOH A . 
G 3 HOH 151 651 506 HOH HOH A . 
G 3 HOH 152 652 588 HOH HOH A . 
G 3 HOH 153 653 664 HOH HOH A . 
G 3 HOH 154 654 637 HOH HOH A . 
G 3 HOH 155 655 595 HOH HOH A . 
G 3 HOH 156 656 674 HOH HOH A . 
G 3 HOH 157 657 622 HOH HOH A . 
G 3 HOH 158 658 523 HOH HOH A . 
G 3 HOH 159 659 587 HOH HOH A . 
G 3 HOH 160 660 563 HOH HOH A . 
G 3 HOH 161 661 644 HOH HOH A . 
G 3 HOH 162 662 521 HOH HOH A . 
G 3 HOH 163 663 635 HOH HOH A . 
G 3 HOH 164 664 616 HOH HOH A . 
G 3 HOH 165 665 592 HOH HOH A . 
G 3 HOH 166 666 513 HOH HOH A . 
G 3 HOH 167 667 662 HOH HOH A . 
G 3 HOH 168 668 650 HOH HOH A . 
G 3 HOH 169 669 651 HOH HOH A . 
G 3 HOH 170 670 609 HOH HOH A . 
G 3 HOH 171 671 692 HOH HOH A . 
G 3 HOH 172 672 660 HOH HOH A . 
G 3 HOH 173 673 634 HOH HOH A . 
G 3 HOH 174 674 627 HOH HOH A . 
G 3 HOH 175 675 565 HOH HOH A . 
G 3 HOH 176 676 640 HOH HOH A . 
G 3 HOH 177 677 680 HOH HOH A . 
G 3 HOH 178 678 661 HOH HOH A . 
G 3 HOH 179 679 669 HOH HOH A . 
G 3 HOH 180 680 679 HOH HOH A . 
G 3 HOH 181 681 685 HOH HOH A . 
G 3 HOH 182 682 689 HOH HOH A . 
G 3 HOH 183 683 690 HOH HOH A . 
G 3 HOH 184 684 629 HOH HOH A . 
G 3 HOH 185 685 687 HOH HOH A . 
G 3 HOH 186 686 643 HOH HOH A . 
G 3 HOH 187 687 663 HOH HOH A . 
G 3 HOH 188 688 670 HOH HOH A . 
G 3 HOH 189 689 667 HOH HOH A . 
G 3 HOH 190 690 686 HOH HOH A . 
G 3 HOH 191 691 620 HOH HOH A . 
G 3 HOH 192 692 600 HOH HOH A . 
G 3 HOH 193 693 544 HOH HOH A . 
G 3 HOH 194 694 626 HOH HOH A . 
G 3 HOH 195 695 693 HOH HOH A . 
H 3 HOH 1   501 565 HOH HOH B . 
H 3 HOH 2   502 658 HOH HOH B . 
H 3 HOH 3   503 666 HOH HOH B . 
H 3 HOH 4   504 661 HOH HOH B . 
H 3 HOH 5   505 687 HOH HOH B . 
H 3 HOH 6   506 704 HOH HOH B . 
H 3 HOH 7   507 683 HOH HOH B . 
H 3 HOH 8   508 551 HOH HOH B . 
H 3 HOH 9   509 645 HOH HOH B . 
H 3 HOH 10  510 643 HOH HOH B . 
H 3 HOH 11  511 647 HOH HOH B . 
H 3 HOH 12  512 558 HOH HOH B . 
H 3 HOH 13  513 598 HOH HOH B . 
H 3 HOH 14  514 674 HOH HOH B . 
H 3 HOH 15  515 591 HOH HOH B . 
H 3 HOH 16  516 536 HOH HOH B . 
H 3 HOH 17  517 659 HOH HOH B . 
H 3 HOH 18  518 524 HOH HOH B . 
H 3 HOH 19  519 547 HOH HOH B . 
H 3 HOH 20  520 616 HOH HOH B . 
H 3 HOH 21  521 629 HOH HOH B . 
H 3 HOH 22  522 552 HOH HOH B . 
H 3 HOH 23  523 554 HOH HOH B . 
H 3 HOH 24  524 667 HOH HOH B . 
H 3 HOH 25  525 703 HOH HOH B . 
H 3 HOH 26  526 652 HOH HOH B . 
H 3 HOH 27  527 527 HOH HOH B . 
H 3 HOH 28  528 602 HOH HOH B . 
H 3 HOH 29  529 585 HOH HOH B . 
H 3 HOH 30  530 538 HOH HOH B . 
H 3 HOH 31  531 533 HOH HOH B . 
H 3 HOH 32  532 550 HOH HOH B . 
H 3 HOH 33  533 570 HOH HOH B . 
H 3 HOH 34  534 586 HOH HOH B . 
H 3 HOH 35  535 683 HOH HOH B . 
H 3 HOH 36  536 573 HOH HOH B . 
H 3 HOH 37  537 705 HOH HOH B . 
H 3 HOH 38  538 604 HOH HOH B . 
H 3 HOH 39  539 545 HOH HOH B . 
H 3 HOH 40  540 654 HOH HOH B . 
H 3 HOH 41  541 644 HOH HOH B . 
H 3 HOH 42  542 653 HOH HOH B . 
H 3 HOH 43  543 693 HOH HOH B . 
H 3 HOH 44  544 626 HOH HOH B . 
H 3 HOH 45  545 575 HOH HOH B . 
H 3 HOH 46  546 576 HOH HOH B . 
H 3 HOH 47  547 508 HOH HOH B . 
H 3 HOH 48  548 619 HOH HOH B . 
H 3 HOH 49  549 523 HOH HOH B . 
H 3 HOH 50  550 534 HOH HOH B . 
H 3 HOH 51  551 679 HOH HOH B . 
H 3 HOH 52  552 579 HOH HOH B . 
H 3 HOH 53  553 577 HOH HOH B . 
H 3 HOH 54  554 501 HOH HOH B . 
H 3 HOH 55  555 691 HOH HOH B . 
H 3 HOH 56  556 597 HOH HOH B . 
H 3 HOH 57  557 504 HOH HOH B . 
H 3 HOH 58  558 559 HOH HOH B . 
H 3 HOH 59  559 665 HOH HOH B . 
H 3 HOH 60  560 650 HOH HOH B . 
H 3 HOH 61  561 699 HOH HOH B . 
H 3 HOH 62  562 583 HOH HOH B . 
H 3 HOH 63  563 525 HOH HOH B . 
H 3 HOH 64  564 632 HOH HOH B . 
H 3 HOH 65  565 582 HOH HOH B . 
H 3 HOH 66  566 503 HOH HOH B . 
H 3 HOH 67  567 673 HOH HOH B . 
H 3 HOH 68  568 675 HOH HOH B . 
H 3 HOH 69  569 594 HOH HOH B . 
H 3 HOH 70  570 516 HOH HOH B . 
H 3 HOH 71  571 563 HOH HOH B . 
H 3 HOH 72  572 556 HOH HOH B . 
H 3 HOH 73  573 515 HOH HOH B . 
H 3 HOH 74  574 636 HOH HOH B . 
H 3 HOH 75  575 688 HOH HOH B . 
H 3 HOH 76  576 566 HOH HOH B . 
H 3 HOH 77  577 589 HOH HOH B . 
H 3 HOH 78  578 686 HOH HOH B . 
H 3 HOH 79  579 606 HOH HOH B . 
H 3 HOH 80  580 640 HOH HOH B . 
H 3 HOH 81  581 548 HOH HOH B . 
H 3 HOH 82  582 596 HOH HOH B . 
H 3 HOH 83  583 529 HOH HOH B . 
H 3 HOH 84  584 618 HOH HOH B . 
H 3 HOH 85  585 633 HOH HOH B . 
H 3 HOH 86  586 587 HOH HOH B . 
H 3 HOH 87  587 510 HOH HOH B . 
H 3 HOH 88  588 505 HOH HOH B . 
H 3 HOH 89  589 660 HOH HOH B . 
H 3 HOH 90  590 580 HOH HOH B . 
H 3 HOH 91  591 543 HOH HOH B . 
H 3 HOH 92  592 590 HOH HOH B . 
H 3 HOH 93  593 569 HOH HOH B . 
H 3 HOH 94  594 571 HOH HOH B . 
H 3 HOH 95  595 627 HOH HOH B . 
H 3 HOH 96  596 625 HOH HOH B . 
H 3 HOH 97  597 639 HOH HOH B . 
H 3 HOH 98  598 502 HOH HOH B . 
H 3 HOH 99  599 540 HOH HOH B . 
H 3 HOH 100 600 526 HOH HOH B . 
H 3 HOH 101 601 546 HOH HOH B . 
H 3 HOH 102 602 512 HOH HOH B . 
H 3 HOH 103 603 513 HOH HOH B . 
H 3 HOH 104 604 689 HOH HOH B . 
H 3 HOH 105 605 562 HOH HOH B . 
H 3 HOH 106 606 517 HOH HOH B . 
H 3 HOH 107 607 544 HOH HOH B . 
H 3 HOH 108 608 520 HOH HOH B . 
H 3 HOH 109 609 613 HOH HOH B . 
H 3 HOH 110 610 617 HOH HOH B . 
H 3 HOH 111 611 637 HOH HOH B . 
H 3 HOH 112 612 509 HOH HOH B . 
H 3 HOH 113 613 519 HOH HOH B . 
H 3 HOH 114 614 537 HOH HOH B . 
H 3 HOH 115 615 610 HOH HOH B . 
H 3 HOH 116 616 574 HOH HOH B . 
H 3 HOH 117 617 695 HOH HOH B . 
H 3 HOH 118 618 646 HOH HOH B . 
H 3 HOH 119 619 614 HOH HOH B . 
H 3 HOH 120 620 630 HOH HOH B . 
H 3 HOH 121 621 588 HOH HOH B . 
H 3 HOH 122 622 584 HOH HOH B . 
H 3 HOH 123 623 655 HOH HOH B . 
H 3 HOH 124 624 514 HOH HOH B . 
H 3 HOH 125 625 531 HOH HOH B . 
H 3 HOH 126 626 615 HOH HOH B . 
H 3 HOH 127 627 507 HOH HOH B . 
H 3 HOH 128 628 506 HOH HOH B . 
H 3 HOH 129 629 694 HOH HOH B . 
H 3 HOH 130 630 549 HOH HOH B . 
H 3 HOH 131 631 603 HOH HOH B . 
H 3 HOH 132 632 641 HOH HOH B . 
H 3 HOH 133 633 560 HOH HOH B . 
H 3 HOH 134 634 609 HOH HOH B . 
H 3 HOH 135 635 593 HOH HOH B . 
H 3 HOH 136 636 662 HOH HOH B . 
H 3 HOH 137 637 578 HOH HOH B . 
H 3 HOH 138 638 700 HOH HOH B . 
H 3 HOH 139 639 561 HOH HOH B . 
H 3 HOH 140 640 622 HOH HOH B . 
H 3 HOH 141 641 528 HOH HOH B . 
H 3 HOH 142 642 522 HOH HOH B . 
H 3 HOH 143 643 557 HOH HOH B . 
H 3 HOH 144 644 681 HOH HOH B . 
H 3 HOH 145 645 535 HOH HOH B . 
H 3 HOH 146 646 668 HOH HOH B . 
H 3 HOH 147 647 649 HOH HOH B . 
H 3 HOH 148 648 611 HOH HOH B . 
H 3 HOH 149 649 612 HOH HOH B . 
H 3 HOH 150 650 657 HOH HOH B . 
H 3 HOH 151 651 511 HOH HOH B . 
H 3 HOH 152 652 663 HOH HOH B . 
H 3 HOH 153 653 635 HOH HOH B . 
H 3 HOH 154 654 564 HOH HOH B . 
H 3 HOH 155 655 656 HOH HOH B . 
H 3 HOH 156 656 541 HOH HOH B . 
H 3 HOH 157 657 567 HOH HOH B . 
H 3 HOH 158 658 581 HOH HOH B . 
H 3 HOH 159 659 677 HOH HOH B . 
H 3 HOH 160 660 532 HOH HOH B . 
H 3 HOH 161 661 680 HOH HOH B . 
H 3 HOH 162 662 696 HOH HOH B . 
H 3 HOH 163 663 518 HOH HOH B . 
H 3 HOH 164 664 671 HOH HOH B . 
H 3 HOH 165 665 670 HOH HOH B . 
H 3 HOH 166 666 607 HOH HOH B . 
H 3 HOH 167 667 530 HOH HOH B . 
H 3 HOH 168 668 595 HOH HOH B . 
H 3 HOH 169 669 553 HOH HOH B . 
H 3 HOH 170 670 684 HOH HOH B . 
H 3 HOH 171 671 624 HOH HOH B . 
H 3 HOH 172 672 628 HOH HOH B . 
H 3 HOH 173 673 592 HOH HOH B . 
H 3 HOH 174 674 648 HOH HOH B . 
H 3 HOH 175 675 678 HOH HOH B . 
H 3 HOH 176 676 572 HOH HOH B . 
H 3 HOH 177 677 698 HOH HOH B . 
H 3 HOH 178 678 642 HOH HOH B . 
H 3 HOH 179 679 555 HOH HOH B . 
H 3 HOH 180 680 685 HOH HOH B . 
H 3 HOH 181 681 610 HOH HOH B . 
H 3 HOH 182 682 608 HOH HOH B . 
H 3 HOH 183 683 701 HOH HOH B . 
H 3 HOH 184 684 706 HOH HOH B . 
H 3 HOH 185 685 651 HOH HOH B . 
H 3 HOH 186 686 638 HOH HOH B . 
H 3 HOH 187 687 605 HOH HOH B . 
H 3 HOH 188 688 623 HOH HOH B . 
H 3 HOH 189 689 603 HOH HOH B . 
H 3 HOH 190 690 542 HOH HOH B . 
H 3 HOH 191 691 539 HOH HOH B . 
H 3 HOH 192 692 672 HOH HOH B . 
H 3 HOH 193 693 664 HOH HOH B . 
H 3 HOH 194 694 682 HOH HOH B . 
H 3 HOH 195 695 690 HOH HOH B . 
H 3 HOH 196 696 676 HOH HOH B . 
H 3 HOH 197 697 692 HOH HOH B . 
H 3 HOH 198 698 691 HOH HOH B . 
H 3 HOH 199 699 702 HOH HOH B . 
H 3 HOH 200 700 697 HOH HOH B . 
H 3 HOH 201 701 613 HOH HOH B . 
H 3 HOH 202 702 601 HOH HOH B . 
H 3 HOH 203 703 599 HOH HOH B . 
H 3 HOH 204 704 621 HOH HOH B . 
H 3 HOH 205 705 657 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A OCS 2 A OCS 2 ? CYS 'modified residue' 
2 B OCS 2 B OCS 2 ? CYS 'modified residue' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5990  ? 
1 MORE         -47   ? 
1 'SSA (A^2)'  26410 ? 
2 'ABSA (A^2)' 18840 ? 
2 MORE         -125  ? 
2 'SSA (A^2)'  45960 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 181.5800000000 0.0000000000 -1.0000000000 
0.0000000000 174.7120000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-05-11 
2 'Structure model' 1 1 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_prerelease_seq   
4 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_abbrev'                  
2 2 'Structure model' '_citation.pdbx_database_id_PubMed'         
3 2 'Structure model' '_citation.title'                           
4 2 'Structure model' '_citation_author.name'                     
5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B HOH 646 ? ? O B HOH 655 ? ? 2.09 
2 1 ND2 B ASN 187 ? B O B HOH 501 ? ? 2.09 
3 1 OE1 B GLU 26  ? ? O B HOH 502 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     692 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     692 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_775 
_pdbx_validate_symm_contact.dist              2.03 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A SER 191 ? ? OG  A SER 191 ? ? 1.338 1.418 -0.080 0.013 N 
2 1 CD B GLU 222 ? ? OE1 B GLU 222 ? ? 1.173 1.252 -0.079 0.011 N 
3 1 CB B SER 235 ? ? OG  B SER 235 ? ? 1.333 1.418 -0.085 0.013 N 
4 1 C  B GLU 315 ? ? O   B GLU 315 ? ? 1.353 1.229 0.124  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 227 ? ? CZ A ARG 227 ? ? NH2 A ARG 227 ? ? 123.82 120.30 3.52  0.50 N 
2 1 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH2 A ARG 293 ? ? 116.31 120.30 -3.99 0.50 N 
3 1 NE B ARG 117 ? ? CZ B ARG 117 ? ? NH2 B ARG 117 ? ? 116.91 120.30 -3.39 0.50 N 
4 1 NE B ARG 186 ? ? CZ B ARG 186 ? ? NH1 B ARG 186 ? ? 124.01 120.30 3.71  0.50 N 
5 1 NE B ARG 227 ? ? CZ B ARG 227 ? ? NH2 B ARG 227 ? ? 123.48 120.30 3.18  0.50 N 
6 1 NE B ARG 308 ? ? CZ B ARG 308 ? ? NH2 B ARG 308 ? ? 124.13 120.30 3.83  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 11  ? ? -124.86 -166.71 
2 1 THR A 170 ? ? -126.65 -117.07 
3 1 ASN A 171 ? ? -122.05 -141.19 
4 1 SER A 198 ? ? -179.01 133.78  
5 1 SER B 11  ? ? -120.19 -162.46 
6 1 PHE B 80  ? ? -151.40 63.12   
7 1 THR B 170 ? ? -126.29 -121.26 
8 1 ASN B 171 ? ? -116.83 -140.66 
9 1 SER B 198 ? ? -176.30 138.05  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ASN 301 ? A ASN 301 
3  1 Y 1 A LYS 302 ? A LYS 302 
4  1 Y 1 A ASP 303 ? A ASP 303 
5  1 Y 1 A LYS 304 ? A LYS 304 
6  1 Y 1 A ASP 305 ? A ASP 305 
7  1 Y 1 A ASN 324 ? A ASN 324 
8  1 Y 1 A LEU 325 ? A LEU 325 
9  1 Y 1 A GLU 326 ? A GLU 326 
10 1 Y 1 A ARG 327 ? A ARG 327 
11 1 Y 1 A HIS 328 ? A HIS 328 
12 1 Y 1 A HIS 329 ? A HIS 329 
13 1 Y 1 A HIS 330 ? A HIS 330 
14 1 Y 1 A HIS 331 ? A HIS 331 
15 1 Y 1 A HIS 332 ? A HIS 332 
16 1 Y 1 A HIS 333 ? A HIS 333 
17 1 Y 1 B MET 1   ? B MET 1   
18 1 Y 1 B ASN 301 ? B ASN 301 
19 1 Y 1 B LYS 302 ? B LYS 302 
20 1 Y 1 B ASP 303 ? B ASP 303 
21 1 Y 1 B LYS 304 ? B LYS 304 
22 1 Y 1 B ASP 305 ? B ASP 305 
23 1 Y 1 B ASN 324 ? B ASN 324 
24 1 Y 1 B LEU 325 ? B LEU 325 
25 1 Y 1 B GLU 326 ? B GLU 326 
26 1 Y 1 B ARG 327 ? B ARG 327 
27 1 Y 1 B HIS 328 ? B HIS 328 
28 1 Y 1 B HIS 329 ? B HIS 329 
29 1 Y 1 B HIS 330 ? B HIS 330 
30 1 Y 1 B HIS 331 ? B HIS 331 
31 1 Y 1 B HIS 332 ? B HIS 332 
32 1 Y 1 B HIS 333 ? B HIS 333 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
#