data_5HMG
# 
_entry.id   5HMG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HMG         
WWPDB D_1000179724 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5HMG 
_pdbx_database_status.recvd_initial_deposition_date   1989-09-11 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Weis, W.I.'     1 
'Bruenger, A.T.' 2 
'Skehel, J.J.'   3 
'Wiley, D.C.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Refinement of the influenza virus hemagglutinin by simulated annealing.' J.Mol.Biol. 212 737 761 1990 JMOBAK UK 0022-2836 
0070 ? 2329580 '10.1016/0022-2836(90)90234-D' 
1       'Structure of the Influenza Virus Haemagglutinin Complexes with its Receptor, Sialic Acid' Nature      333 426 ?   1988 
NATUAS UK 0028-0836 0006 ? ?       ?                              
2       'Three-Dimensional Structure of an Antigenic Mutant of the Influenza Virus Haemagglutinin' Nature      311 678 ?   1984 
NATUAS UK 0028-0836 0006 ? ?       ?                              
3       'Structure of the Haemagglutinin Membrane Glycoprotein of Influenza Virus at 3 Angstroms Resolution' Nature      289 366 ? 
1981 NATUAS UK 0028-0836 0006 ? ?       ?                              
4       
;Structural Identification of the Antibody-Binding Sites of Hong Kong Influenza Haemagglutinin and Their Involvement in Antigenic Variation
;
Nature      289 373 ?   1981 NATUAS UK 0028-0836 0006 ? ?       ?                              
5       'Crystallization and X-Ray Diffraction Studies on the Haemagglutinin Glycoprotein from the Membrane of Influenza Virus' 
J.Mol.Biol. 112 343 ?   1977 JMOBAK UK 0022-2836 0070 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Weis, W.I.'    1  ? 
primary 'Brunger, A.T.' 2  ? 
primary 'Skehel, J.J.'  3  ? 
primary 'Wiley, D.C.'   4  ? 
1       'Weis, W.'      5  ? 
1       'Brown, J.H.'   6  ? 
1       'Cusack, S.'    7  ? 
1       'Paulson, J.C.' 8  ? 
1       'Skehel, J.J.'  9  ? 
1       'Wiley, D.C.'   10 ? 
2       'Knossow, M.'   11 ? 
2       'Daniels, R.S.' 12 ? 
2       'Douglas, A.R.' 13 ? 
2       'Skehel, J.J.'  14 ? 
2       'Wiley, D.C.'   15 ? 
3       'Wilson, I.A.'  16 ? 
3       'Skehel, J.J.'  17 ? 
3       'Wiley, D.C.'   18 ? 
4       'Wiley, D.C.'   19 ? 
4       'Wilson, I.A.'  20 ? 
4       'Skehel, J.J.'  21 ? 
5       'Wiley, D.C.'   22 ? 
5       'Skehel, J.J.'  23 ? 
# 
_cell.entry_id           5HMG 
_cell.length_a           162.600 
_cell.length_b           162.600 
_cell.length_c           177.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         5HMG 
_symmetry.space_group_name_H-M             'P 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                76 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hemagglutinin HA1 chain' 36065.457 3  ? ? ? ? 
2 polymer     man 'Hemagglutinin HA2 chain' 20154.314 3  ? ? ? ? 
3 branched    man 
'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   3  
? ? ? ? 
4 non-polymer man 'N-acetyl-alpha-neuraminic acid' 309.270   3  ? ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   12 ? ? ? ? 
6 water       nat water 18.015    39 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Hemagglutinin 
2 Hemagglutinin 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQ
NETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGST
YPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPG
DVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGM
RNVPEKQT
;
;QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQ
NETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGST
YPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPG
DVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGM
RNVPEKQT
;
A,C,E ? 
2 'polypeptide(L)' no no 
;GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDL
EKYVEDTKIDLWSYNAELLVALENQHTIDLTGSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHD
VYRDEALNNRFQIKG
;
;GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDL
EKYVEDTKIDLWSYNAELLVALENQHTIDLTGSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHD
VYRDEALNNRFQIKG
;
B,D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   ASP n 
1 3   LEU n 
1 4   PRO n 
1 5   GLY n 
1 6   ASN n 
1 7   ASP n 
1 8   ASN n 
1 9   SER n 
1 10  THR n 
1 11  ALA n 
1 12  THR n 
1 13  LEU n 
1 14  CYS n 
1 15  LEU n 
1 16  GLY n 
1 17  HIS n 
1 18  HIS n 
1 19  ALA n 
1 20  VAL n 
1 21  PRO n 
1 22  ASN n 
1 23  GLY n 
1 24  THR n 
1 25  LEU n 
1 26  VAL n 
1 27  LYS n 
1 28  THR n 
1 29  ILE n 
1 30  THR n 
1 31  ASP n 
1 32  ASP n 
1 33  GLN n 
1 34  ILE n 
1 35  GLU n 
1 36  VAL n 
1 37  THR n 
1 38  ASN n 
1 39  ALA n 
1 40  THR n 
1 41  GLU n 
1 42  LEU n 
1 43  VAL n 
1 44  GLN n 
1 45  SER n 
1 46  SER n 
1 47  SER n 
1 48  THR n 
1 49  GLY n 
1 50  LYS n 
1 51  ILE n 
1 52  CYS n 
1 53  ASN n 
1 54  ASN n 
1 55  PRO n 
1 56  HIS n 
1 57  ARG n 
1 58  ILE n 
1 59  LEU n 
1 60  ASP n 
1 61  GLY n 
1 62  ILE n 
1 63  ASP n 
1 64  CYS n 
1 65  THR n 
1 66  LEU n 
1 67  ILE n 
1 68  ASP n 
1 69  ALA n 
1 70  LEU n 
1 71  LEU n 
1 72  GLY n 
1 73  ASP n 
1 74  PRO n 
1 75  HIS n 
1 76  CYS n 
1 77  ASP n 
1 78  VAL n 
1 79  PHE n 
1 80  GLN n 
1 81  ASN n 
1 82  GLU n 
1 83  THR n 
1 84  TRP n 
1 85  ASP n 
1 86  LEU n 
1 87  PHE n 
1 88  VAL n 
1 89  GLU n 
1 90  ARG n 
1 91  SER n 
1 92  LYS n 
1 93  ALA n 
1 94  PHE n 
1 95  SER n 
1 96  ASN n 
1 97  CYS n 
1 98  TYR n 
1 99  PRO n 
1 100 TYR n 
1 101 ASP n 
1 102 VAL n 
1 103 PRO n 
1 104 ASP n 
1 105 TYR n 
1 106 ALA n 
1 107 SER n 
1 108 LEU n 
1 109 ARG n 
1 110 SER n 
1 111 LEU n 
1 112 VAL n 
1 113 ALA n 
1 114 SER n 
1 115 SER n 
1 116 GLY n 
1 117 THR n 
1 118 LEU n 
1 119 GLU n 
1 120 PHE n 
1 121 ILE n 
1 122 THR n 
1 123 GLU n 
1 124 GLY n 
1 125 PHE n 
1 126 THR n 
1 127 TRP n 
1 128 THR n 
1 129 GLY n 
1 130 VAL n 
1 131 THR n 
1 132 GLN n 
1 133 ASN n 
1 134 GLY n 
1 135 GLY n 
1 136 SER n 
1 137 ASN n 
1 138 ALA n 
1 139 CYS n 
1 140 LYS n 
1 141 ARG n 
1 142 GLY n 
1 143 PRO n 
1 144 GLY n 
1 145 SER n 
1 146 GLY n 
1 147 PHE n 
1 148 PHE n 
1 149 SER n 
1 150 ARG n 
1 151 LEU n 
1 152 ASN n 
1 153 TRP n 
1 154 LEU n 
1 155 THR n 
1 156 LYS n 
1 157 SER n 
1 158 GLY n 
1 159 SER n 
1 160 THR n 
1 161 TYR n 
1 162 PRO n 
1 163 VAL n 
1 164 LEU n 
1 165 ASN n 
1 166 VAL n 
1 167 THR n 
1 168 MET n 
1 169 PRO n 
1 170 ASN n 
1 171 ASN n 
1 172 ASP n 
1 173 ASN n 
1 174 PHE n 
1 175 ASP n 
1 176 LYS n 
1 177 LEU n 
1 178 TYR n 
1 179 ILE n 
1 180 TRP n 
1 181 GLY n 
1 182 ILE n 
1 183 HIS n 
1 184 HIS n 
1 185 PRO n 
1 186 SER n 
1 187 THR n 
1 188 ASN n 
1 189 GLN n 
1 190 GLU n 
1 191 GLN n 
1 192 THR n 
1 193 SER n 
1 194 LEU n 
1 195 TYR n 
1 196 VAL n 
1 197 GLN n 
1 198 ALA n 
1 199 SER n 
1 200 GLY n 
1 201 ARG n 
1 202 VAL n 
1 203 THR n 
1 204 VAL n 
1 205 SER n 
1 206 THR n 
1 207 ARG n 
1 208 ARG n 
1 209 SER n 
1 210 GLN n 
1 211 GLN n 
1 212 THR n 
1 213 ILE n 
1 214 ILE n 
1 215 PRO n 
1 216 ASN n 
1 217 ILE n 
1 218 GLY n 
1 219 SER n 
1 220 ARG n 
1 221 PRO n 
1 222 TRP n 
1 223 VAL n 
1 224 ARG n 
1 225 GLY n 
1 226 LEU n 
1 227 SER n 
1 228 SER n 
1 229 ARG n 
1 230 ILE n 
1 231 SER n 
1 232 ILE n 
1 233 TYR n 
1 234 TRP n 
1 235 THR n 
1 236 ILE n 
1 237 VAL n 
1 238 LYS n 
1 239 PRO n 
1 240 GLY n 
1 241 ASP n 
1 242 VAL n 
1 243 LEU n 
1 244 VAL n 
1 245 ILE n 
1 246 ASN n 
1 247 SER n 
1 248 ASN n 
1 249 GLY n 
1 250 ASN n 
1 251 LEU n 
1 252 ILE n 
1 253 ALA n 
1 254 PRO n 
1 255 ARG n 
1 256 GLY n 
1 257 TYR n 
1 258 PHE n 
1 259 LYS n 
1 260 MET n 
1 261 ARG n 
1 262 THR n 
1 263 GLY n 
1 264 LYS n 
1 265 SER n 
1 266 SER n 
1 267 ILE n 
1 268 MET n 
1 269 ARG n 
1 270 SER n 
1 271 ASP n 
1 272 ALA n 
1 273 PRO n 
1 274 ILE n 
1 275 ASP n 
1 276 THR n 
1 277 CYS n 
1 278 ILE n 
1 279 SER n 
1 280 GLU n 
1 281 CYS n 
1 282 ILE n 
1 283 THR n 
1 284 PRO n 
1 285 ASN n 
1 286 GLY n 
1 287 SER n 
1 288 ILE n 
1 289 PRO n 
1 290 ASN n 
1 291 ASP n 
1 292 LYS n 
1 293 PRO n 
1 294 PHE n 
1 295 GLN n 
1 296 ASN n 
1 297 VAL n 
1 298 ASN n 
1 299 LYS n 
1 300 ILE n 
1 301 THR n 
1 302 TYR n 
1 303 GLY n 
1 304 ALA n 
1 305 CYS n 
1 306 PRO n 
1 307 LYS n 
1 308 TYR n 
1 309 VAL n 
1 310 LYS n 
1 311 GLN n 
1 312 ASN n 
1 313 THR n 
1 314 LEU n 
1 315 LYS n 
1 316 LEU n 
1 317 ALA n 
1 318 THR n 
1 319 GLY n 
1 320 MET n 
1 321 ARG n 
1 322 ASN n 
1 323 VAL n 
1 324 PRO n 
1 325 GLU n 
1 326 LYS n 
1 327 GLN n 
1 328 THR n 
2 1   GLY n 
2 2   LEU n 
2 3   PHE n 
2 4   GLY n 
2 5   ALA n 
2 6   ILE n 
2 7   ALA n 
2 8   GLY n 
2 9   PHE n 
2 10  ILE n 
2 11  GLU n 
2 12  ASN n 
2 13  GLY n 
2 14  TRP n 
2 15  GLU n 
2 16  GLY n 
2 17  MET n 
2 18  ILE n 
2 19  ASP n 
2 20  GLY n 
2 21  TRP n 
2 22  TYR n 
2 23  GLY n 
2 24  PHE n 
2 25  ARG n 
2 26  HIS n 
2 27  GLN n 
2 28  ASN n 
2 29  SER n 
2 30  GLU n 
2 31  GLY n 
2 32  THR n 
2 33  GLY n 
2 34  GLN n 
2 35  ALA n 
2 36  ALA n 
2 37  ASP n 
2 38  LEU n 
2 39  LYS n 
2 40  SER n 
2 41  THR n 
2 42  GLN n 
2 43  ALA n 
2 44  ALA n 
2 45  ILE n 
2 46  ASP n 
2 47  GLN n 
2 48  ILE n 
2 49  ASN n 
2 50  GLY n 
2 51  LYS n 
2 52  LEU n 
2 53  ASN n 
2 54  ARG n 
2 55  VAL n 
2 56  ILE n 
2 57  GLU n 
2 58  LYS n 
2 59  THR n 
2 60  ASN n 
2 61  GLU n 
2 62  LYS n 
2 63  PHE n 
2 64  HIS n 
2 65  GLN n 
2 66  ILE n 
2 67  GLU n 
2 68  LYS n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  GLU n 
2 73  VAL n 
2 74  GLU n 
2 75  GLY n 
2 76  ARG n 
2 77  ILE n 
2 78  GLN n 
2 79  ASP n 
2 80  LEU n 
2 81  GLU n 
2 82  LYS n 
2 83  TYR n 
2 84  VAL n 
2 85  GLU n 
2 86  ASP n 
2 87  THR n 
2 88  LYS n 
2 89  ILE n 
2 90  ASP n 
2 91  LEU n 
2 92  TRP n 
2 93  SER n 
2 94  TYR n 
2 95  ASN n 
2 96  ALA n 
2 97  GLU n 
2 98  LEU n 
2 99  LEU n 
2 100 VAL n 
2 101 ALA n 
2 102 LEU n 
2 103 GLU n 
2 104 ASN n 
2 105 GLN n 
2 106 HIS n 
2 107 THR n 
2 108 ILE n 
2 109 ASP n 
2 110 LEU n 
2 111 THR n 
2 112 GLY n 
2 113 SER n 
2 114 GLU n 
2 115 MET n 
2 116 ASN n 
2 117 LYS n 
2 118 LEU n 
2 119 PHE n 
2 120 GLU n 
2 121 LYS n 
2 122 THR n 
2 123 ARG n 
2 124 ARG n 
2 125 GLN n 
2 126 LEU n 
2 127 ARG n 
2 128 GLU n 
2 129 ASN n 
2 130 ALA n 
2 131 GLU n 
2 132 GLU n 
2 133 MET n 
2 134 GLY n 
2 135 ASN n 
2 136 GLY n 
2 137 CYS n 
2 138 PHE n 
2 139 LYS n 
2 140 ILE n 
2 141 TYR n 
2 142 HIS n 
2 143 LYS n 
2 144 CYS n 
2 145 ASP n 
2 146 ASN n 
2 147 ALA n 
2 148 CYS n 
2 149 ILE n 
2 150 GLU n 
2 151 SER n 
2 152 ILE n 
2 153 ARG n 
2 154 ASN n 
2 155 GLY n 
2 156 THR n 
2 157 TYR n 
2 158 ASP n 
2 159 HIS n 
2 160 ASP n 
2 161 VAL n 
2 162 TYR n 
2 163 ARG n 
2 164 ASP n 
2 165 GLU n 
2 166 ALA n 
2 167 LEU n 
2 168 ASN n 
2 169 ASN n 
2 170 ARG n 
2 171 PHE n 
2 172 GLN n 
2 173 ILE n 
2 174 LYS n 
2 175 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? 'Influenzavirus A' HA 'Influenza A virus' '(A/Aichi/2/1968(H3N2))' ? ? ? ? 
'Influenza A virus (A/Aichi/2/1968(H3N2))' 387139 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? 'Influenzavirus A' HA 'Influenza A virus' '(A/Aichi/2/1968(H3N2))' ? ? ? ? 
'Influenza A virus (A/Aichi/2/1968(H3N2))' 387139 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP HEMA_I68A0 1 P03437 17  
;QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQ
NETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGST
YPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPG
DVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGM
RNVPEKQT
;
? 
2 UNP HEMA_I68A0 2 P03437 346 
;GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDL
EKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHD
VYRDEALNNRFQIKG
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HMG A 1 ? 328 ? P03437 17  ? 344 ? 1 328 
2 2 5HMG B 1 ? 175 ? P03437 346 ? 520 ? 1 175 
3 1 5HMG C 1 ? 328 ? P03437 17  ? 344 ? 1 328 
4 2 5HMG D 1 ? 175 ? P03437 346 ? 520 ? 1 175 
5 1 5HMG E 1 ? 328 ? P03437 17  ? 344 ? 1 328 
6 2 5HMG F 1 ? 175 ? P03437 346 ? 520 ? 1 175 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 5HMG GLY B 112 ? UNP P03437 ASP 457 conflict 112 1 
4 5HMG GLY D 112 ? UNP P03437 ASP 457 conflict 112 2 
6 5HMG GLY F 112 ? UNP P03437 ASP 457 conflict 112 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
SIA 'D-saccharide, alpha linking' . 'N-acetyl-alpha-neuraminic acid'         ? 'C11 H19 N O9'   309.270 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          5HMG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 5HMG 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'A TEMPERATURE FACTOR OF 65.0 OR LARGER SIGNIFIES AN ATOM WHOSE COORDINATES WERE GENERATED USING STEREOCHEMICAL CRITERIA.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11847 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         348 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               12234 
_refine_hist.d_res_high                       3.2 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.8   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.034333 -0.550874 0.833882  -0.851708 0.420417 0.312800  -0.522891 -0.720963 -0.454749 41.41870 45.28070 61.88980  
2 given ? 0.034333 -0.851708 -0.522891 -0.550874 0.420417 -0.720963 0.833882  0.312800  -0.454749 69.50550 48.39990 -20.55770 
# 
_struct.entry_id                  5HMG 
_struct.title                     'REFINEMENT OF THE INFLUENZA VIRUS HEMAGGLUTININ BY SIMULATED ANNEALING' 
_struct.pdbx_descriptor           
'HEMAGGLUTININ (D112(B)G) (BROMELAIN DIGESTED) (MUTANT WITH ASP 112 REPLACED BY GLY IN HA2 CHAINS) COMPLEX WITH SIALIC ACID' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5HMG 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'INFLUENZA VIRUS HEMAGGLUTININ, Viral Protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
CA N N 6 ? 
DA N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THERE IS ONE TRIMERIC HEMAGGLUTININ MOLECULE IN THE
ASYMMETRIC UNIT, WITH THE MONOMERS RELATED TO EACH OTHER
BY A NON-CRYSTALLOGRAPHIC THREE-FOLD AXIS.  EACH MONOMER
OF HEMAGGLUTININ CONSISTS OF TWO CHAINS, IDENTIFIED
AS HA1 AND HA2 BY THE DEPOSITORS.  CHAINS HA1 AND HA2 OF
MONOMER 1 HAVE BEEN ASSIGNED CHAIN IDENTIFIERS *A* AND *B*,
RESPECTIVELY.  CHAINS HA1 AND HA2 OF MONOMER 2 HAVE BEEN
ASSIGNED CHAIN IDENTIFIERS *C* AND *D*, RESPECTIVELY.
CHAINS HA1 AND HA2 OF MONOMER 3 HAVE BEEN ASSIGNED CHAIN
IDENTIFIERS *E* AND *F*, RESPECTIVELY.

IN THE VIRUS, CHAIN HA1 CONSISTS OF 328 RESIDUES AND CHAIN
HA2 CONSISTS OF 220 RESIDUES.  HEMAGGLUTININ MAY BE
SOLUBILIZED FROM THE VIRAL MEMBRANE BY BROMELAIN DIGESTION,
WHICH REMOVES THE C-TERMINAL HYDROPHOBIC (ANCHORING) DOMAIN
FROM CHAIN HA2.  AFTER BROMELAIN DIGESTION CHAIN HA2
CONSISTS OF 175 RESIDUES, AS PRESENTED IN THIS ENTRY.

IN THIS ENTRY RESIDUE ASP 112 IN CHAINS *B*, *D*, AND *F*
HAS BEEN REPLACED BY GLY.  THE WATERS ASSOCIATED WITH EACH
MONOMER ARE PRESENTED IMMEDIATELY FOLLOWING CHAIN HA2 OF
THAT MONOMER AND HAVE BEEN ASSIGNED THE SAME CHAIN
INDICATOR (*B*, *D*, AND *F*).

THE *MTRIX 1* TRANSFORMATION BELOW YIELDS APPROXIMATE
COORDINATES FOR CHAINS *A* AND *B* WHEN APPLIED TO CHAINS
*C* AND *D*.  THE *MTRIX 2* TRANSFORMATION BELOW YIELDS
APPROXIMATE COORDINATES FOR CHAINS *A* AND *B* WHEN APPLIED
TO CHAINS *E* AND *F*.  FOR THE RESTRAINED REGIONS,
MONOMERS 1 AND 2 SUPERIMPOSE WITH AN RMS DEVIATION OF 0.030
ANGSTROMS AND MONOMERS 1 AND 3 SUPERIMPOSE WITH AN RMS
DEVIATION OF 0.029 ANGSTROMS.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  HAA LEU A 66  ? LEU A 71  ? LEU A 66  LEU A 71  1 ? 6  
HELX_P HELX_P2  HBA TYR A 105 ? SER A 115 ? TYR A 105 SER A 115 1 ? 11 
HELX_P HELX_P3  HCA ASN A 188 ? LEU A 194 ? ASN A 188 LEU A 194 1 ? 7  
HELX_P HELX_P4  HDB LEU B 38  ? VAL B 55  ? LEU B 38  VAL B 55  1 ? 18 
HELX_P HELX_P5  HEB ARG B 76  ? GLN B 125 ? ARG B 76  GLN B 125 1 ? 50 
HELX_P HELX_P6  HFB ASN B 146 ? ARG B 153 ? ASN B 146 ARG B 153 1 ? 8  
HELX_P HELX_P7  HGB ARG B 163 ? ASN B 168 ? ARG B 163 ASN B 168 1 ? 6  
HELX_P HELX_P8  HAC LEU C 66  ? LEU C 71  ? LEU C 66  LEU C 71  1 ? 6  
HELX_P HELX_P9  HBC TYR C 105 ? SER C 115 ? TYR C 105 SER C 115 1 ? 11 
HELX_P HELX_P10 HCC ASN C 188 ? LEU C 194 ? ASN C 188 LEU C 194 1 ? 7  
HELX_P HELX_P11 HDD LEU D 38  ? VAL D 55  ? LEU D 38  VAL D 55  1 ? 18 
HELX_P HELX_P12 HED ARG D 76  ? GLN D 125 ? ARG D 76  GLN D 125 1 ? 50 
HELX_P HELX_P13 HFD ASN D 146 ? ARG D 153 ? ASN D 146 ARG D 153 1 ? 8  
HELX_P HELX_P14 HGD ARG D 163 ? ASN D 168 ? ARG D 163 ASN D 168 1 ? 6  
HELX_P HELX_P15 HAE LEU E 66  ? LEU E 71  ? LEU E 66  LEU E 71  1 ? 6  
HELX_P HELX_P16 HBE TYR E 105 ? SER E 115 ? TYR E 105 SER E 115 1 ? 11 
HELX_P HELX_P17 HCE ASN E 188 ? LEU E 194 ? ASN E 188 LEU E 194 1 ? 7  
HELX_P HELX_P18 HDF LEU F 38  ? VAL F 55  ? LEU F 38  VAL F 55  1 ? 18 
HELX_P HELX_P19 HEF ARG F 76  ? GLN F 125 ? ARG F 76  GLN F 125 1 ? 50 
HELX_P HELX_P20 HFF ASN F 146 ? ARG F 153 ? ASN F 146 ARG F 153 1 ? 8  
HELX_P HELX_P21 HGF ARG F 163 ? ASN F 168 ? ARG F 163 ASN F 168 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 14  SG  ? ? ? 1_555 B CYS 137 SG ? ? A CYS 14  B CYS 137 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf2  disulf ?    ? A CYS 52  SG  ? ? ? 1_555 A CYS 277 SG ? ? A CYS 52  A CYS 277 1_555 ? ? ? ? ? ? ? 2.017 ? ?               
disulf3  disulf ?    ? A CYS 64  SG  ? ? ? 1_555 A CYS 76  SG ? ? A CYS 64  A CYS 76  1_555 ? ? ? ? ? ? ? 1.999 ? ?               
disulf4  disulf ?    ? A CYS 97  SG  ? ? ? 1_555 A CYS 139 SG ? ? A CYS 97  A CYS 139 1_555 ? ? ? ? ? ? ? 2.009 ? ?               
disulf5  disulf ?    ? A CYS 281 SG  ? ? ? 1_555 A CYS 305 SG ? ? A CYS 281 A CYS 305 1_555 ? ? ? ? ? ? ? 2.002 ? ?               
disulf6  disulf ?    ? B CYS 144 SG  ? ? ? 1_555 B CYS 148 SG ? ? B CYS 144 B CYS 148 1_555 ? ? ? ? ? ? ? 2.015 ? ?               
disulf7  disulf ?    ? C CYS 14  SG  ? ? ? 1_555 D CYS 137 SG ? ? C CYS 14  D CYS 137 1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf8  disulf ?    ? C CYS 52  SG  ? ? ? 1_555 C CYS 277 SG ? ? C CYS 52  C CYS 277 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf9  disulf ?    ? C CYS 64  SG  ? ? ? 1_555 C CYS 76  SG ? ? C CYS 64  C CYS 76  1_555 ? ? ? ? ? ? ? 2.003 ? ?               
disulf10 disulf ?    ? C CYS 97  SG  ? ? ? 1_555 C CYS 139 SG ? ? C CYS 97  C CYS 139 1_555 ? ? ? ? ? ? ? 2.009 ? ?               
disulf11 disulf ?    ? C CYS 281 SG  ? ? ? 1_555 C CYS 305 SG ? ? C CYS 281 C CYS 305 1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf12 disulf ?    ? D CYS 144 SG  ? ? ? 1_555 D CYS 148 SG ? ? D CYS 144 D CYS 148 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf13 disulf ?    ? E CYS 14  SG  ? ? ? 1_555 F CYS 137 SG ? ? E CYS 14  F CYS 137 1_555 ? ? ? ? ? ? ? 2.001 ? ?               
disulf14 disulf ?    ? E CYS 52  SG  ? ? ? 1_555 E CYS 277 SG ? ? E CYS 52  E CYS 277 1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf15 disulf ?    ? E CYS 64  SG  ? ? ? 1_555 E CYS 76  SG ? ? E CYS 64  E CYS 76  1_555 ? ? ? ? ? ? ? 1.997 ? ?               
disulf16 disulf ?    ? E CYS 97  SG  ? ? ? 1_555 E CYS 139 SG ? ? E CYS 97  E CYS 139 1_555 ? ? ? ? ? ? ? 2.001 ? ?               
disulf17 disulf ?    ? E CYS 281 SG  ? ? ? 1_555 E CYS 305 SG ? ? E CYS 281 E CYS 305 1_555 ? ? ? ? ? ? ? 2.000 ? ?               
disulf18 disulf ?    ? F CYS 144 SG  ? ? ? 1_555 F CYS 148 SG ? ? F CYS 144 F CYS 148 1_555 ? ? ? ? ? ? ? 2.016 ? ?               
covale1  covale one  ? A ASN 38  ND2 ? ? ? 1_555 K NAG .   C1 ? ? A ASN 38  A NAG 330 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale2  covale one  ? A ASN 81  ND2 ? ? ? 1_555 L NAG .   C1 ? ? A ASN 81  A NAG 334 1_555 ? ? ? ? ? ? ? 1.468 ? N-Glycosylation 
covale3  covale one  ? A ASN 165 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 165 G NAG 1   1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale4  covale one  ? A ASN 285 ND2 ? ? ? 1_555 M NAG .   C1 ? ? A ASN 285 A NAG 348 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale5  covale one  ? B ASN 154 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 154 B NAG 401 1_555 ? ? ? ? ? ? ? 1.464 ? N-Glycosylation 
covale6  covale one  ? C ASN 38  ND2 ? ? ? 1_555 P NAG .   C1 ? ? C ASN 38  C NAG 330 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale7  covale one  ? C ASN 81  ND2 ? ? ? 1_555 Q NAG .   C1 ? ? C ASN 81  C NAG 334 1_555 ? ? ? ? ? ? ? 1.470 ? N-Glycosylation 
covale8  covale one  ? C ASN 165 ND2 ? ? ? 1_555 H NAG .   C1 ? ? C ASN 165 H NAG 1   1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale9  covale one  ? C ASN 285 ND2 ? ? ? 1_555 R NAG .   C1 ? ? C ASN 285 C NAG 348 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale10 covale one  ? D ASN 154 ND2 ? ? ? 1_555 S NAG .   C1 ? ? D ASN 154 D NAG 401 1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation 
covale11 covale one  ? E ASN 38  ND2 ? ? ? 1_555 U NAG .   C1 ? ? E ASN 38  E NAG 330 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale12 covale one  ? E ASN 81  ND2 ? ? ? 1_555 V NAG .   C1 ? ? E ASN 81  E NAG 334 1_555 ? ? ? ? ? ? ? 1.467 ? N-Glycosylation 
covale13 covale one  ? E ASN 165 ND2 ? ? ? 1_555 I NAG .   C1 ? ? E ASN 165 I NAG 1   1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale14 covale one  ? E ASN 285 ND2 ? ? ? 1_555 W NAG .   C1 ? ? E ASN 285 E NAG 348 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale15 covale one  ? F ASN 154 ND2 ? ? ? 1_555 X NAG .   C1 ? ? F ASN 154 F NAG 401 1_555 ? ? ? ? ? ? ? 1.465 ? N-Glycosylation 
covale16 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.430 ? ?               
covale17 covale both ? G NAG .   O4  ? ? ? 1_555 G MAN .   C1 ? ? G NAG 2   G MAN 3   1_555 ? ? ? ? ? ? ? 1.413 ? ?               
covale18 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.432 ? ?               
covale19 covale both ? H NAG .   O4  ? ? ? 1_555 H MAN .   C1 ? ? H NAG 2   H MAN 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale20 covale both ? I NAG .   O4  ? ? ? 1_555 I NAG .   C1 ? ? I NAG 1   I NAG 2   1_555 ? ? ? ? ? ? ? 1.432 ? ?               
covale21 covale both ? I NAG .   O4  ? ? ? 1_555 I MAN .   C1 ? ? I NAG 2   I MAN 3   1_555 ? ? ? ? ? ? ? 1.423 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 54 A . ? ASN 54 A PRO 55 A ? PRO 55 A 1 0.37 
2 ASN 54 C . ? ASN 54 C PRO 55 C ? PRO 55 C 1 0.25 
3 ASN 54 E . ? ASN 54 E PRO 55 E ? PRO 55 E 1 0.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
B1A ? 9 ? 
B2A ? 9 ? 
B1C ? 9 ? 
B2C ? 9 ? 
B1E ? 9 ? 
B2E ? 9 ? 
SAB ? 5 ? 
SCD ? 5 ? 
SEF ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
B1A 1 2 ? anti-parallel 
B1A 2 3 ? anti-parallel 
B1A 3 4 ? anti-parallel 
B1A 4 5 ? anti-parallel 
B1A 5 6 ? anti-parallel 
B1A 6 7 ? anti-parallel 
B1A 7 8 ? anti-parallel 
B1A 8 9 ? anti-parallel 
B2A 1 2 ? anti-parallel 
B2A 2 3 ? anti-parallel 
B2A 3 4 ? anti-parallel 
B2A 4 5 ? anti-parallel 
B2A 5 6 ? anti-parallel 
B2A 6 7 ? anti-parallel 
B2A 7 8 ? anti-parallel 
B2A 8 9 ? anti-parallel 
B1C 1 2 ? anti-parallel 
B1C 2 3 ? anti-parallel 
B1C 3 4 ? anti-parallel 
B1C 4 5 ? anti-parallel 
B1C 5 6 ? anti-parallel 
B1C 6 7 ? anti-parallel 
B1C 7 8 ? anti-parallel 
B1C 8 9 ? anti-parallel 
B2C 1 2 ? anti-parallel 
B2C 2 3 ? anti-parallel 
B2C 3 4 ? anti-parallel 
B2C 4 5 ? anti-parallel 
B2C 5 6 ? anti-parallel 
B2C 6 7 ? anti-parallel 
B2C 7 8 ? anti-parallel 
B2C 8 9 ? anti-parallel 
B1E 1 2 ? anti-parallel 
B1E 2 3 ? anti-parallel 
B1E 3 4 ? anti-parallel 
B1E 4 5 ? anti-parallel 
B1E 5 6 ? anti-parallel 
B1E 6 7 ? anti-parallel 
B1E 7 8 ? anti-parallel 
B1E 8 9 ? anti-parallel 
B2E 1 2 ? anti-parallel 
B2E 2 3 ? anti-parallel 
B2E 3 4 ? anti-parallel 
B2E 4 5 ? anti-parallel 
B2E 5 6 ? anti-parallel 
B2E 6 7 ? anti-parallel 
B2E 7 8 ? anti-parallel 
B2E 8 9 ? anti-parallel 
SAB 1 2 ? anti-parallel 
SAB 2 3 ? anti-parallel 
SAB 3 4 ? anti-parallel 
SAB 4 5 ? anti-parallel 
SCD 1 2 ? anti-parallel 
SCD 2 3 ? anti-parallel 
SCD 3 4 ? anti-parallel 
SCD 4 5 ? anti-parallel 
SEF 1 2 ? anti-parallel 
SEF 2 3 ? anti-parallel 
SEF 3 4 ? anti-parallel 
SEF 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
B1A 1 GLU A 119 ? ILE A 121 ? GLU A 119 ILE A 121 
B1A 2 LEU A 251 ? LYS A 259 ? LEU A 251 LYS A 259 
B1A 3 LYS A 176 ? HIS A 184 ? LYS A 176 HIS A 184 
B1A 4 ARG A 229 ? VAL A 237 ? ARG A 229 VAL A 237 
B1A 5 GLN A 210 ? ILE A 213 ? GLN A 210 ILE A 213 
B1A 6 ARG A 201 ? SER A 205 ? ARG A 201 SER A 205 
B1A 7 ASP A 241 ? SER A 247 ? ASP A 241 SER A 247 
B1A 8 LEU A 164 ? ASN A 170 ? LEU A 164 ASN A 170 
B1A 9 GLU A 119 ? ILE A 121 ? GLU A 119 ILE A 121 
B2A 1 ASN A 152 ? LEU A 154 ? ASN A 152 LEU A 154 
B2A 2 LEU A 251 ? LYS A 259 ? LEU A 251 LYS A 259 
B2A 3 LYS A 176 ? HIS A 184 ? LYS A 176 HIS A 184 
B2A 4 ARG A 229 ? VAL A 237 ? ARG A 229 VAL A 237 
B2A 5 GLN A 210 ? ILE A 213 ? GLN A 210 ILE A 213 
B2A 6 ARG A 201 ? SER A 205 ? ARG A 201 SER A 205 
B2A 7 ASP A 241 ? SER A 247 ? ASP A 241 SER A 247 
B2A 8 LEU A 164 ? ASN A 170 ? LEU A 164 ASN A 170 
B2A 9 ASN A 152 ? LEU A 154 ? ASN A 152 LEU A 154 
B1C 1 GLU C 119 ? ILE C 121 ? GLU C 119 ILE C 121 
B1C 2 LEU C 251 ? LYS C 259 ? LEU C 251 LYS C 259 
B1C 3 LYS C 176 ? HIS C 184 ? LYS C 176 HIS C 184 
B1C 4 ARG C 229 ? VAL C 237 ? ARG C 229 VAL C 237 
B1C 5 GLN C 210 ? ILE C 213 ? GLN C 210 ILE C 213 
B1C 6 ARG C 201 ? SER C 205 ? ARG C 201 SER C 205 
B1C 7 ASP C 241 ? SER C 247 ? ASP C 241 SER C 247 
B1C 8 LEU C 164 ? ASN C 170 ? LEU C 164 ASN C 170 
B1C 9 GLU C 119 ? ILE C 121 ? GLU C 119 ILE C 121 
B2C 1 ASN C 152 ? LEU C 154 ? ASN C 152 LEU C 154 
B2C 2 LEU C 251 ? LYS C 259 ? LEU C 251 LYS C 259 
B2C 3 LYS C 176 ? HIS C 184 ? LYS C 176 HIS C 184 
B2C 4 ARG C 229 ? VAL C 237 ? ARG C 229 VAL C 237 
B2C 5 GLN C 210 ? ILE C 213 ? GLN C 210 ILE C 213 
B2C 6 ARG C 201 ? SER C 205 ? ARG C 201 SER C 205 
B2C 7 ASP C 241 ? SER C 247 ? ASP C 241 SER C 247 
B2C 8 LEU C 164 ? ASN C 170 ? LEU C 164 ASN C 170 
B2C 9 ASN C 152 ? LEU C 154 ? ASN C 152 LEU C 154 
B1E 1 GLU E 119 ? ILE E 121 ? GLU E 119 ILE E 121 
B1E 2 LEU E 251 ? LYS E 259 ? LEU E 251 LYS E 259 
B1E 3 LYS E 176 ? HIS E 184 ? LYS E 176 HIS E 184 
B1E 4 ARG E 229 ? VAL E 237 ? ARG E 229 VAL E 237 
B1E 5 GLN E 210 ? ILE E 213 ? GLN E 210 ILE E 213 
B1E 6 ARG E 201 ? SER E 205 ? ARG E 201 SER E 205 
B1E 7 ASP E 241 ? SER E 247 ? ASP E 241 SER E 247 
B1E 8 LEU E 164 ? ASN E 170 ? LEU E 164 ASN E 170 
B1E 9 GLU E 119 ? ILE E 121 ? GLU E 119 ILE E 121 
B2E 1 ASN E 152 ? LEU E 154 ? ASN E 152 LEU E 154 
B2E 2 LEU E 251 ? LYS E 259 ? LEU E 251 LYS E 259 
B2E 3 LYS E 176 ? HIS E 184 ? LYS E 176 HIS E 184 
B2E 4 ARG E 229 ? VAL E 237 ? ARG E 229 VAL E 237 
B2E 5 GLN E 210 ? ILE E 213 ? GLN E 210 ILE E 213 
B2E 6 ARG E 201 ? SER E 205 ? ARG E 201 SER E 205 
B2E 7 ASP E 241 ? SER E 247 ? ASP E 241 SER E 247 
B2E 8 LEU E 164 ? ASN E 170 ? LEU E 164 ASN E 170 
B2E 9 ASN E 152 ? LEU E 154 ? ASN E 152 LEU E 154 
SAB 1 GLY B 31  ? ASP B 37  ? GLY B 31  ASP B 37  
SAB 2 TYR B 22  ? ASN B 28  ? TYR B 22  ASN B 28  
SAB 3 ALA A 11  ? HIS A 17  ? ALA A 11  HIS A 17  
SAB 4 GLY B 136 ? ILE B 140 ? GLY B 136 ILE B 140 
SAB 5 ASN B 129 ? MET B 133 ? ASN B 129 MET B 133 
SCD 1 GLY D 31  ? ASP D 37  ? GLY D 31  ASP D 37  
SCD 2 TYR D 22  ? ASN D 28  ? TYR D 22  ASN D 28  
SCD 3 ALA C 11  ? HIS C 17  ? ALA C 11  HIS C 17  
SCD 4 GLY D 136 ? ILE D 140 ? GLY D 136 ILE D 140 
SCD 5 ASN D 129 ? MET D 133 ? ASN D 129 MET D 133 
SEF 1 GLY F 31  ? ASP F 37  ? GLY F 31  ASP F 37  
SEF 2 TYR F 22  ? ASN F 28  ? TYR F 22  ASN F 28  
SEF 3 ALA E 11  ? HIS E 17  ? ALA E 11  HIS E 17  
SEF 4 GLY F 136 ? ILE F 140 ? GLY F 136 ILE F 140 
SEF 5 ASN F 129 ? MET F 133 ? ASN F 129 MET F 133 
# 
_database_PDB_matrix.entry_id          5HMG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5HMG 
_atom_sites.fract_transf_matrix[1][1]   0.006150 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006150 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005637 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'RESIDUES PRO A 55, PRO C 55, PRO E 55 ARE CIS PROLINES.'                                                                  
2 'A TEMPERATURE FACTOR OF 65.0 OR LARGER SIGNIFIES AN ATOM WHOSE COORDINATES WERE GENERATED USING STEREOCHEMICAL CRITERIA.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1 1   ? 76.867  -8.654  37.823  1.00 132.54 ? 1   GLN A N   1 
ATOM   2     C CA  . GLN A  1 1   ? 77.399  -7.698  38.799  1.00 132.45 ? 1   GLN A CA  1 
ATOM   3     C C   . GLN A  1 1   ? 77.277  -8.402  40.136  1.00 132.15 ? 1   GLN A C   1 
ATOM   4     O O   . GLN A  1 1   ? 78.260  -8.502  40.869  1.00 131.83 ? 1   GLN A O   1 
ATOM   5     C CB  . GLN A  1 1   ? 76.627  -6.355  38.891  1.00 132.64 ? 1   GLN A CB  1 
ATOM   6     C CG  . GLN A  1 1   ? 77.270  -5.233  39.776  1.00 132.54 ? 1   GLN A CG  1 
ATOM   7     C CD  . GLN A  1 1   ? 77.160  -5.416  41.292  1.00 132.48 ? 1   GLN A CD  1 
ATOM   8     O OE1 . GLN A  1 1   ? 76.110  -5.838  41.763  1.00 132.30 ? 1   GLN A OE1 1 
ATOM   9     N NE2 . GLN A  1 1   ? 78.172  -5.171  42.118  1.00 132.34 ? 1   GLN A NE2 1 
ATOM   10    N N   . ASP A  1 2   ? 76.059  -8.767  40.525  1.00 132.12 ? 2   ASP A N   1 
ATOM   11    C CA  . ASP A  1 2   ? 75.917  -9.537  41.736  1.00 132.35 ? 2   ASP A CA  1 
ATOM   12    C C   . ASP A  1 2   ? 76.129  -11.002 41.370  1.00 131.97 ? 2   ASP A C   1 
ATOM   13    O O   . ASP A  1 2   ? 76.075  -11.371 40.185  1.00 131.82 ? 2   ASP A O   1 
ATOM   14    C CB  . ASP A  1 2   ? 74.526  -9.319  42.333  1.00 133.05 ? 2   ASP A CB  1 
ATOM   15    C CG  . ASP A  1 2   ? 74.411  -9.486  43.857  1.00 133.59 ? 2   ASP A CG  1 
ATOM   16    O OD1 . ASP A  1 2   ? 73.569  -8.812  44.450  1.00 133.99 ? 2   ASP A OD1 1 
ATOM   17    O OD2 . ASP A  1 2   ? 75.138  -10.275 44.473  1.00 133.60 ? 2   ASP A OD2 1 
ATOM   18    N N   . LEU A  1 3   ? 76.326  -11.807 42.406  1.00 131.45 ? 3   LEU A N   1 
ATOM   19    C CA  . LEU A  1 3   ? 76.620  -13.225 42.362  1.00 130.84 ? 3   LEU A CA  1 
ATOM   20    C C   . LEU A  1 3   ? 75.447  -14.069 41.829  1.00 130.01 ? 3   LEU A C   1 
ATOM   21    O O   . LEU A  1 3   ? 74.290  -13.632 41.897  1.00 130.25 ? 3   LEU A O   1 
ATOM   22    C CB  . LEU A  1 3   ? 76.996  -13.588 43.805  1.00 131.13 ? 3   LEU A CB  1 
ATOM   23    C CG  . LEU A  1 3   ? 77.695  -14.886 44.191  1.00 131.41 ? 3   LEU A CG  1 
ATOM   24    C CD1 . LEU A  1 3   ? 79.121  -14.890 43.660  1.00 131.74 ? 3   LEU A CD1 1 
ATOM   25    C CD2 . LEU A  1 3   ? 77.745  -15.002 45.702  1.00 131.41 ? 3   LEU A CD2 1 
ATOM   26    N N   . PRO A  1 4   ? 75.675  -15.270 41.247  1.00 128.89 ? 4   PRO A N   1 
ATOM   27    C CA  . PRO A  1 4   ? 74.617  -16.154 40.753  1.00 127.80 ? 4   PRO A CA  1 
ATOM   28    C C   . PRO A  1 4   ? 73.581  -16.458 41.838  1.00 126.53 ? 4   PRO A C   1 
ATOM   29    O O   . PRO A  1 4   ? 73.907  -16.970 42.920  1.00 126.69 ? 4   PRO A O   1 
ATOM   30    C CB  . PRO A  1 4   ? 75.366  -17.381 40.257  1.00 128.06 ? 4   PRO A CB  1 
ATOM   31    C CG  . PRO A  1 4   ? 76.751  -17.254 40.854  1.00 128.30 ? 4   PRO A CG  1 
ATOM   32    C CD  . PRO A  1 4   ? 76.953  -15.754 40.734  1.00 128.57 ? 4   PRO A CD  1 
ATOM   33    N N   . GLY A  1 5   ? 72.328  -16.094 41.549  1.00 124.75 ? 5   GLY A N   1 
ATOM   34    C CA  . GLY A  1 5   ? 71.229  -16.256 42.488  1.00 122.34 ? 5   GLY A CA  1 
ATOM   35    C C   . GLY A  1 5   ? 70.722  -17.688 42.543  1.00 120.35 ? 5   GLY A C   1 
ATOM   36    O O   . GLY A  1 5   ? 70.662  -18.384 41.527  1.00 120.64 ? 5   GLY A O   1 
ATOM   37    N N   . ASN A  1 6   ? 70.354  -18.136 43.741  1.00 117.81 ? 6   ASN A N   1 
ATOM   38    C CA  . ASN A  1 6   ? 69.822  -19.486 43.941  1.00 115.06 ? 6   ASN A CA  1 
ATOM   39    C C   . ASN A  1 6   ? 68.331  -19.587 43.621  1.00 111.83 ? 6   ASN A C   1 
ATOM   40    O O   . ASN A  1 6   ? 67.743  -20.671 43.676  1.00 111.64 ? 6   ASN A O   1 
ATOM   41    C CB  . ASN A  1 6   ? 70.012  -19.931 45.393  1.00 116.35 ? 6   ASN A CB  1 
ATOM   42    C CG  . ASN A  1 6   ? 69.216  -19.040 46.343  1.00 117.27 ? 6   ASN A CG  1 
ATOM   43    O OD1 . ASN A  1 6   ? 69.538  -17.860 46.512  1.00 117.80 ? 6   ASN A OD1 1 
ATOM   44    N ND2 . ASN A  1 6   ? 68.111  -19.484 46.919  1.00 117.53 ? 6   ASN A ND2 1 
ATOM   45    N N   . ASP A  1 7   ? 67.695  -18.447 43.397  1.00 107.60 ? 7   ASP A N   1 
ATOM   46    C CA  . ASP A  1 7   ? 66.278  -18.384 43.129  1.00 103.19 ? 7   ASP A CA  1 
ATOM   47    C C   . ASP A  1 7   ? 66.109  -17.995 41.664  1.00 99.76  ? 7   ASP A C   1 
ATOM   48    O O   . ASP A  1 7   ? 67.110  -17.726 40.985  1.00 99.65  ? 7   ASP A O   1 
ATOM   49    C CB  . ASP A  1 7   ? 65.694  -17.350 44.104  1.00 103.36 ? 7   ASP A CB  1 
ATOM   50    C CG  . ASP A  1 7   ? 64.399  -16.707 43.638  1.00 103.26 ? 7   ASP A CG  1 
ATOM   51    O OD1 . ASP A  1 7   ? 63.400  -17.414 43.512  1.00 103.17 ? 7   ASP A OD1 1 
ATOM   52    O OD2 . ASP A  1 7   ? 64.418  -15.522 43.321  1.00 103.27 ? 7   ASP A OD2 1 
ATOM   53    N N   . ASN A  1 8   ? 64.881  -18.043 41.148  1.00 95.17  ? 8   ASN A N   1 
ATOM   54    C CA  . ASN A  1 8   ? 64.567  -17.574 39.803  1.00 90.28  ? 8   ASN A CA  1 
ATOM   55    C C   . ASN A  1 8   ? 63.056  -17.367 39.678  1.00 85.05  ? 8   ASN A C   1 
ATOM   56    O O   . ASN A  1 8   ? 62.249  -18.290 39.830  1.00 85.11  ? 8   ASN A O   1 
ATOM   57    C CB  . ASN A  1 8   ? 65.051  -18.573 38.696  1.00 91.95  ? 8   ASN A CB  1 
ATOM   58    C CG  . ASN A  1 8   ? 64.394  -19.955 38.592  1.00 92.88  ? 8   ASN A CG  1 
ATOM   59    O OD1 . ASN A  1 8   ? 63.630  -20.220 37.655  1.00 93.07  ? 8   ASN A OD1 1 
ATOM   60    N ND2 . ASN A  1 8   ? 64.686  -20.916 39.474  1.00 92.98  ? 8   ASN A ND2 1 
ATOM   61    N N   . SER A  1 9   ? 62.634  -16.122 39.499  1.00 77.62  ? 9   SER A N   1 
ATOM   62    C CA  . SER A  1 9   ? 61.232  -15.818 39.264  1.00 70.28  ? 9   SER A CA  1 
ATOM   63    C C   . SER A  1 9   ? 61.138  -14.472 38.575  1.00 64.68  ? 9   SER A C   1 
ATOM   64    O O   . SER A  1 9   ? 62.125  -13.737 38.554  1.00 64.11  ? 9   SER A O   1 
ATOM   65    C CB  . SER A  1 9   ? 60.463  -15.807 40.606  1.00 70.64  ? 9   SER A CB  1 
ATOM   66    O OG  . SER A  1 9   ? 60.920  -14.879 41.591  1.00 70.21  ? 9   SER A OG  1 
ATOM   67    N N   . THR A  1 10  ? 59.995  -14.175 37.975  1.00 57.93  ? 10  THR A N   1 
ATOM   68    C CA  . THR A  1 10  ? 59.777  -12.935 37.267  1.00 51.77  ? 10  THR A CA  1 
ATOM   69    C C   . THR A  1 10  ? 58.805  -12.042 38.036  1.00 47.13  ? 10  THR A C   1 
ATOM   70    O O   . THR A  1 10  ? 58.420  -12.383 39.157  1.00 47.02  ? 10  THR A O   1 
ATOM   71    C CB  . THR A  1 10  ? 59.240  -13.313 35.878  1.00 52.11  ? 10  THR A CB  1 
ATOM   72    O OG1 . THR A  1 10  ? 58.285  -14.358 36.078  1.00 52.08  ? 10  THR A OG1 1 
ATOM   73    C CG2 . THR A  1 10  ? 60.330  -13.798 34.925  1.00 52.14  ? 10  THR A CG2 1 
ATOM   74    N N   . ALA A  1 11  ? 58.376  -10.909 37.470  1.00 41.36  ? 11  ALA A N   1 
ATOM   75    C CA  . ALA A  1 11  ? 57.376  -10.031 38.092  1.00 34.96  ? 11  ALA A CA  1 
ATOM   76    C C   . ALA A  1 11  ? 56.563  -9.448  36.958  1.00 30.84  ? 11  ALA A C   1 
ATOM   77    O O   . ALA A  1 11  ? 56.970  -9.613  35.798  1.00 30.68  ? 11  ALA A O   1 
ATOM   78    C CB  . ALA A  1 11  ? 58.004  -8.864  38.846  1.00 34.44  ? 11  ALA A CB  1 
ATOM   79    N N   . THR A  1 12  ? 55.439  -8.795  37.239  1.00 25.71  ? 12  THR A N   1 
ATOM   80    C CA  . THR A  1 12  ? 54.640  -8.162  36.197  1.00 21.13  ? 12  THR A CA  1 
ATOM   81    C C   . THR A  1 12  ? 54.252  -6.755  36.592  1.00 18.68  ? 12  THR A C   1 
ATOM   82    O O   . THR A  1 12  ? 53.737  -6.563  37.697  1.00 18.97  ? 12  THR A O   1 
ATOM   83    C CB  . THR A  1 12  ? 53.357  -8.896  35.962  1.00 20.21  ? 12  THR A CB  1 
ATOM   84    O OG1 . THR A  1 12  ? 53.654  -10.281 35.860  1.00 20.73  ? 12  THR A OG1 1 
ATOM   85    C CG2 . THR A  1 12  ? 52.677  -8.379  34.709  1.00 20.52  ? 12  THR A CG2 1 
ATOM   86    N N   . LEU A  1 13  ? 54.469  -5.778  35.720  1.00 15.53  ? 13  LEU A N   1 
ATOM   87    C CA  . LEU A  1 13  ? 54.070  -4.406  35.989  1.00 11.93  ? 13  LEU A CA  1 
ATOM   88    C C   . LEU A  1 13  ? 53.062  -4.043  34.925  1.00 10.84  ? 13  LEU A C   1 
ATOM   89    O O   . LEU A  1 13  ? 53.306  -4.363  33.759  1.00 11.05  ? 13  LEU A O   1 
ATOM   90    C CB  . LEU A  1 13  ? 55.206  -3.436  35.843  1.00 9.88   ? 13  LEU A CB  1 
ATOM   91    C CG  . LEU A  1 13  ? 55.645  -2.545  36.945  1.00 7.87   ? 13  LEU A CG  1 
ATOM   92    C CD1 . LEU A  1 13  ? 56.380  -1.428  36.282  1.00 7.57   ? 13  LEU A CD1 1 
ATOM   93    C CD2 . LEU A  1 13  ? 54.518  -1.913  37.686  1.00 7.73   ? 13  LEU A CD2 1 
ATOM   94    N N   . CYS A  1 14  ? 51.948  -3.408  35.245  1.00 9.67   ? 14  CYS A N   1 
ATOM   95    C CA  . CYS A  1 14  ? 51.027  -2.995  34.209  1.00 9.31   ? 14  CYS A CA  1 
ATOM   96    C C   . CYS A  1 14  ? 50.731  -1.541  34.370  1.00 9.27   ? 14  CYS A C   1 
ATOM   97    O O   . CYS A  1 14  ? 50.526  -1.103  35.504  1.00 9.43   ? 14  CYS A O   1 
ATOM   98    C CB  . CYS A  1 14  ? 49.731  -3.696  34.302  1.00 8.77   ? 14  CYS A CB  1 
ATOM   99    S SG  . CYS A  1 14  ? 49.963  -5.454  33.990  1.00 9.86   ? 14  CYS A SG  1 
ATOM   100   N N   . LEU A  1 15  ? 50.774  -0.785  33.288  1.00 9.59   ? 15  LEU A N   1 
ATOM   101   C CA  . LEU A  1 15  ? 50.388  0.606   33.340  1.00 10.02  ? 15  LEU A CA  1 
ATOM   102   C C   . LEU A  1 15  ? 48.938  0.723   32.916  1.00 11.08  ? 15  LEU A C   1 
ATOM   103   O O   . LEU A  1 15  ? 48.379  -0.148  32.224  1.00 11.95  ? 15  LEU A O   1 
ATOM   104   C CB  . LEU A  1 15  ? 51.234  1.400   32.420  1.00 10.63  ? 15  LEU A CB  1 
ATOM   105   C CG  . LEU A  1 15  ? 52.616  1.586   32.968  1.00 11.49  ? 15  LEU A CG  1 
ATOM   106   C CD1 . LEU A  1 15  ? 53.556  0.624   32.258  1.00 11.68  ? 15  LEU A CD1 1 
ATOM   107   C CD2 . LEU A  1 15  ? 53.074  3.018   32.747  1.00 12.05  ? 15  LEU A CD2 1 
ATOM   108   N N   . GLY A  1 16  ? 48.283  1.770   33.366  1.00 11.50  ? 16  GLY A N   1 
ATOM   109   C CA  . GLY A  1 16  ? 46.874  1.964   33.063  1.00 11.76  ? 16  GLY A CA  1 
ATOM   110   C C   . GLY A  1 16  ? 46.473  3.363   33.495  1.00 11.22  ? 16  GLY A C   1 
ATOM   111   O O   . GLY A  1 16  ? 47.306  4.138   33.990  1.00 11.12  ? 16  GLY A O   1 
ATOM   112   N N   . HIS A  1 17  ? 45.187  3.669   33.344  1.00 10.36  ? 17  HIS A N   1 
ATOM   113   C CA  . HIS A  1 17  ? 44.655  4.994   33.659  1.00 8.97   ? 17  HIS A CA  1 
ATOM   114   C C   . HIS A  1 17  ? 43.311  4.828   34.338  1.00 9.06   ? 17  HIS A C   1 
ATOM   115   O O   . HIS A  1 17  ? 42.627  3.852   34.049  1.00 10.02  ? 17  HIS A O   1 
ATOM   116   C CB  . HIS A  1 17  ? 44.462  5.822   32.389  1.00 7.15   ? 17  HIS A CB  1 
ATOM   117   C CG  . HIS A  1 17  ? 43.618  5.097   31.353  1.00 6.35   ? 17  HIS A CG  1 
ATOM   118   N ND1 . HIS A  1 17  ? 42.284  5.091   31.271  1.00 6.08   ? 17  HIS A ND1 1 
ATOM   119   C CD2 . HIS A  1 17  ? 44.106  4.283   30.378  1.00 5.83   ? 17  HIS A CD2 1 
ATOM   120   C CE1 . HIS A  1 17  ? 41.943  4.300   30.294  1.00 5.37   ? 17  HIS A CE1 1 
ATOM   121   N NE2 . HIS A  1 17  ? 43.043  3.830   29.774  1.00 5.46   ? 17  HIS A NE2 1 
ATOM   122   N N   . HIS A  1 18  ? 42.881  5.717   35.201  1.00 9.33   ? 18  HIS A N   1 
ATOM   123   C CA  . HIS A  1 18  ? 41.590  5.587   35.861  1.00 11.14  ? 18  HIS A CA  1 
ATOM   124   C C   . HIS A  1 18  ? 40.382  5.633   34.925  1.00 10.95  ? 18  HIS A C   1 
ATOM   125   O O   . HIS A  1 18  ? 40.523  6.078   33.785  1.00 11.25  ? 18  HIS A O   1 
ATOM   126   C CB  . HIS A  1 18  ? 41.468  6.698   36.869  1.00 13.37  ? 18  HIS A CB  1 
ATOM   127   C CG  . HIS A  1 18  ? 41.170  8.067   36.280  1.00 15.14  ? 18  HIS A CG  1 
ATOM   128   N ND1 . HIS A  1 18  ? 41.418  8.437   35.027  1.00 16.25  ? 18  HIS A ND1 1 
ATOM   129   C CD2 . HIS A  1 18  ? 40.578  9.119   36.926  1.00 16.38  ? 18  HIS A CD2 1 
ATOM   130   C CE1 . HIS A  1 18  ? 41.003  9.679   34.876  1.00 16.87  ? 18  HIS A CE1 1 
ATOM   131   N NE2 . HIS A  1 18  ? 40.503  10.077  36.021  1.00 17.11  ? 18  HIS A NE2 1 
ATOM   132   N N   . ALA A  1 19  ? 39.200  5.271   35.376  1.00 10.34  ? 19  ALA A N   1 
ATOM   133   C CA  . ALA A  1 19  ? 37.982  5.390   34.599  1.00 10.89  ? 19  ALA A CA  1 
ATOM   134   C C   . ALA A  1 19  ? 36.886  5.655   35.617  1.00 12.42  ? 19  ALA A C   1 
ATOM   135   O O   . ALA A  1 19  ? 37.044  5.297   36.779  1.00 13.60  ? 19  ALA A O   1 
ATOM   136   C CB  . ALA A  1 19  ? 37.658  4.105   33.886  1.00 9.94   ? 19  ALA A CB  1 
ATOM   137   N N   . VAL A  1 20  ? 35.815  6.349   35.288  1.00 13.56  ? 20  VAL A N   1 
ATOM   138   C CA  . VAL A  1 20  ? 34.763  6.630   36.244  1.00 14.76  ? 20  VAL A CA  1 
ATOM   139   C C   . VAL A  1 20  ? 33.526  5.858   35.846  1.00 17.88  ? 20  VAL A C   1 
ATOM   140   O O   . VAL A  1 20  ? 33.299  5.660   34.654  1.00 18.52  ? 20  VAL A O   1 
ATOM   141   C CB  . VAL A  1 20  ? 34.416  8.094   36.277  1.00 13.30  ? 20  VAL A CB  1 
ATOM   142   C CG1 . VAL A  1 20  ? 35.629  8.797   36.805  1.00 13.37  ? 20  VAL A CG1 1 
ATOM   143   C CG2 . VAL A  1 20  ? 34.004  8.612   34.929  1.00 13.16  ? 20  VAL A CG2 1 
ATOM   144   N N   . PRO A  1 21  ? 32.649  5.496   36.789  1.00 20.31  ? 21  PRO A N   1 
ATOM   145   C CA  . PRO A  1 21  ? 31.464  4.718   36.493  1.00 21.68  ? 21  PRO A CA  1 
ATOM   146   C C   . PRO A  1 21  ? 30.432  5.480   35.670  1.00 23.89  ? 21  PRO A C   1 
ATOM   147   O O   . PRO A  1 21  ? 29.759  4.918   34.809  1.00 24.59  ? 21  PRO A O   1 
ATOM   148   C CB  . PRO A  1 21  ? 31.053  4.314   37.881  1.00 20.79  ? 21  PRO A CB  1 
ATOM   149   C CG  . PRO A  1 21  ? 31.349  5.534   38.710  1.00 19.94  ? 21  PRO A CG  1 
ATOM   150   C CD  . PRO A  1 21  ? 32.719  5.853   38.212  1.00 20.14  ? 21  PRO A CD  1 
ATOM   151   N N   . ASN A  1 22  ? 30.326  6.773   35.992  1.00 26.31  ? 22  ASN A N   1 
ATOM   152   C CA  . ASN A  1 22  ? 29.387  7.712   35.394  1.00 28.23  ? 22  ASN A CA  1 
ATOM   153   C C   . ASN A  1 22  ? 29.983  8.394   34.152  1.00 27.25  ? 22  ASN A C   1 
ATOM   154   O O   . ASN A  1 22  ? 29.677  7.840   33.113  1.00 29.47  ? 22  ASN A O   1 
ATOM   155   C CB  . ASN A  1 22  ? 28.958  8.737   36.450  1.00 31.40  ? 22  ASN A CB  1 
ATOM   156   C CG  . ASN A  1 22  ? 30.072  9.287   37.341  1.00 34.28  ? 22  ASN A CG  1 
ATOM   157   O OD1 . ASN A  1 22  ? 31.246  8.928   37.209  1.00 35.91  ? 22  ASN A OD1 1 
ATOM   158   N ND2 . ASN A  1 22  ? 29.771  10.159  38.297  1.00 35.15  ? 22  ASN A ND2 1 
ATOM   159   N N   . GLY A  1 23  ? 30.743  9.493   34.110  1.00 24.52  ? 23  GLY A N   1 
ATOM   160   C CA  . GLY A  1 23  ? 31.308  9.910   32.821  1.00 22.61  ? 23  GLY A CA  1 
ATOM   161   C C   . GLY A  1 23  ? 30.373  10.674  31.887  1.00 21.52  ? 23  GLY A C   1 
ATOM   162   O O   . GLY A  1 23  ? 29.223  10.306  31.675  1.00 22.32  ? 23  GLY A O   1 
ATOM   163   N N   . THR A  1 24  ? 30.846  11.776  31.304  1.00 20.18  ? 24  THR A N   1 
ATOM   164   C CA  . THR A  1 24  ? 29.991  12.693  30.539  1.00 17.35  ? 24  THR A CA  1 
ATOM   165   C C   . THR A  1 24  ? 30.190  12.588  29.058  1.00 14.32  ? 24  THR A C   1 
ATOM   166   O O   . THR A  1 24  ? 31.301  12.336  28.632  1.00 13.19  ? 24  THR A O   1 
ATOM   167   C CB  . THR A  1 24  ? 30.291  14.127  30.951  1.00 18.37  ? 24  THR A CB  1 
ATOM   168   O OG1 . THR A  1 24  ? 30.392  14.159  32.384  1.00 19.52  ? 24  THR A OG1 1 
ATOM   169   C CG2 . THR A  1 24  ? 29.193  15.076  30.470  1.00 19.61  ? 24  THR A CG2 1 
ATOM   170   N N   . LEU A  1 25  ? 29.190  12.829  28.230  1.00 12.93  ? 25  LEU A N   1 
ATOM   171   C CA  . LEU A  1 25  ? 29.458  12.776  26.795  1.00 12.61  ? 25  LEU A CA  1 
ATOM   172   C C   . LEU A  1 25  ? 29.904  14.130  26.278  1.00 12.37  ? 25  LEU A C   1 
ATOM   173   O O   . LEU A  1 25  ? 29.469  15.146  26.818  1.00 13.77  ? 25  LEU A O   1 
ATOM   174   C CB  . LEU A  1 25  ? 28.234  12.335  26.028  1.00 12.12  ? 25  LEU A CB  1 
ATOM   175   C CG  . LEU A  1 25  ? 27.834  10.881  26.198  1.00 12.72  ? 25  LEU A CG  1 
ATOM   176   C CD1 . LEU A  1 25  ? 26.667  10.581  25.307  1.00 13.46  ? 25  LEU A CD1 1 
ATOM   177   C CD2 . LEU A  1 25  ? 28.916  9.960   25.734  1.00 12.00  ? 25  LEU A CD2 1 
ATOM   178   N N   . VAL A  1 26  ? 30.744  14.190  25.248  1.00 11.77  ? 26  VAL A N   1 
ATOM   179   C CA  . VAL A  1 26  ? 31.294  15.445  24.737  1.00 10.27  ? 26  VAL A CA  1 
ATOM   180   C C   . VAL A  1 26  ? 31.426  15.420  23.208  1.00 10.23  ? 26  VAL A C   1 
ATOM   181   O O   . VAL A  1 26  ? 31.431  14.333  22.628  1.00 10.85  ? 26  VAL A O   1 
ATOM   182   C CB  . VAL A  1 26  ? 32.610  15.577  25.546  1.00 9.46   ? 26  VAL A CB  1 
ATOM   183   C CG1 . VAL A  1 26  ? 33.879  15.517  24.747  1.00 8.22   ? 26  VAL A CG1 1 
ATOM   184   C CG2 . VAL A  1 26  ? 32.453  16.870  26.284  1.00 9.48   ? 26  VAL A CG2 1 
ATOM   185   N N   . LYS A  1 27  ? 31.465  16.543  22.494  1.00 9.92   ? 27  LYS A N   1 
ATOM   186   C CA  . LYS A  1 27  ? 31.642  16.537  21.034  1.00 10.61  ? 27  LYS A CA  1 
ATOM   187   C C   . LYS A  1 27  ? 33.111  16.626  20.678  1.00 11.21  ? 27  LYS A C   1 
ATOM   188   O O   . LYS A  1 27  ? 33.869  17.269  21.393  1.00 12.53  ? 27  LYS A O   1 
ATOM   189   C CB  . LYS A  1 27  ? 31.032  17.723  20.358  1.00 11.85  ? 27  LYS A CB  1 
ATOM   190   C CG  . LYS A  1 27  ? 29.549  17.657  20.176  1.00 14.94  ? 27  LYS A CG  1 
ATOM   191   C CD  . LYS A  1 27  ? 29.029  19.085  20.070  1.00 16.92  ? 27  LYS A CD  1 
ATOM   192   C CE  . LYS A  1 27  ? 27.553  19.084  19.594  1.00 18.70  ? 27  LYS A CE  1 
ATOM   193   N NZ  . LYS A  1 27  ? 26.978  20.435  19.609  1.00 20.14  ? 27  LYS A NZ  1 
ATOM   194   N N   . THR A  1 28  ? 33.537  16.121  19.543  1.00 11.38  ? 28  THR A N   1 
ATOM   195   C CA  . THR A  1 28  ? 34.924  16.138  19.139  1.00 10.87  ? 28  THR A CA  1 
ATOM   196   C C   . THR A  1 28  ? 34.959  16.589  17.694  1.00 11.64  ? 28  THR A C   1 
ATOM   197   O O   . THR A  1 28  ? 33.937  17.043  17.164  1.00 11.41  ? 28  THR A O   1 
ATOM   198   C CB  . THR A  1 28  ? 35.328  14.708  19.463  1.00 10.59  ? 28  THR A CB  1 
ATOM   199   O OG1 . THR A  1 28  ? 35.878  14.907  20.749  1.00 11.91  ? 28  THR A OG1 1 
ATOM   200   C CG2 . THR A  1 28  ? 36.320  14.000  18.616  1.00 10.45  ? 28  THR A CG2 1 
ATOM   201   N N   . ILE A  1 29  ? 36.108  16.610  17.037  1.00 13.29  ? 29  ILE A N   1 
ATOM   202   C CA  . ILE A  1 29  ? 36.142  16.912  15.604  1.00 14.21  ? 29  ILE A CA  1 
ATOM   203   C C   . ILE A  1 29  ? 35.570  15.723  14.875  1.00 15.16  ? 29  ILE A C   1 
ATOM   204   O O   . ILE A  1 29  ? 34.748  15.905  13.999  1.00 14.56  ? 29  ILE A O   1 
ATOM   205   C CB  . ILE A  1 29  ? 37.604  17.182  15.140  1.00 13.70  ? 29  ILE A CB  1 
ATOM   206   C CG1 . ILE A  1 29  ? 37.964  18.601  15.519  1.00 14.33  ? 29  ILE A CG1 1 
ATOM   207   C CG2 . ILE A  1 29  ? 37.792  17.019  13.657  1.00 13.06  ? 29  ILE A CG2 1 
ATOM   208   C CD1 . ILE A  1 29  ? 39.433  18.871  15.175  1.00 15.24  ? 29  ILE A CD1 1 
ATOM   209   N N   . THR A  1 30  ? 35.953  14.506  15.268  1.00 18.22  ? 30  THR A N   1 
ATOM   210   C CA  . THR A  1 30  ? 35.535  13.297  14.573  1.00 19.68  ? 30  THR A CA  1 
ATOM   211   C C   . THR A  1 30  ? 34.342  12.555  15.118  1.00 21.35  ? 30  THR A C   1 
ATOM   212   O O   . THR A  1 30  ? 33.810  11.738  14.390  1.00 21.48  ? 30  THR A O   1 
ATOM   213   C CB  . THR A  1 30  ? 36.724  12.325  14.484  1.00 19.21  ? 30  THR A CB  1 
ATOM   214   O OG1 . THR A  1 30  ? 37.364  12.268  15.742  1.00 19.92  ? 30  THR A OG1 1 
ATOM   215   C CG2 . THR A  1 30  ? 37.744  12.799  13.468  1.00 19.03  ? 30  THR A CG2 1 
ATOM   216   N N   . ASP A  1 31  ? 33.873  12.797  16.330  1.00 24.96  ? 31  ASP A N   1 
ATOM   217   C CA  . ASP A  1 31  ? 32.672  12.122  16.855  1.00 28.33  ? 31  ASP A CA  1 
ATOM   218   C C   . ASP A  1 31  ? 31.874  13.186  17.553  1.00 28.66  ? 31  ASP A C   1 
ATOM   219   O O   . ASP A  1 31  ? 32.459  14.202  17.942  1.00 29.28  ? 31  ASP A O   1 
ATOM   220   C CB  . ASP A  1 31  ? 32.925  11.095  17.960  1.00 30.69  ? 31  ASP A CB  1 
ATOM   221   C CG  . ASP A  1 31  ? 34.199  10.292  17.758  1.00 32.65  ? 31  ASP A CG  1 
ATOM   222   O OD1 . ASP A  1 31  ? 34.094  9.136   17.316  1.00 33.34  ? 31  ASP A OD1 1 
ATOM   223   O OD2 . ASP A  1 31  ? 35.294  10.834  18.026  1.00 32.75  ? 31  ASP A OD2 1 
ATOM   224   N N   . ASP A  1 32  ? 30.586  13.016  17.762  1.00 29.11  ? 32  ASP A N   1 
ATOM   225   C CA  . ASP A  1 32  ? 29.839  14.032  18.488  1.00 30.71  ? 32  ASP A CA  1 
ATOM   226   C C   . ASP A  1 32  ? 29.268  13.497  19.801  1.00 29.81  ? 32  ASP A C   1 
ATOM   227   O O   . ASP A  1 32  ? 28.605  14.192  20.581  1.00 29.55  ? 32  ASP A O   1 
ATOM   228   C CB  . ASP A  1 32  ? 28.746  14.560  17.583  1.00 32.51  ? 32  ASP A CB  1 
ATOM   229   C CG  . ASP A  1 32  ? 27.722  13.496  17.300  1.00 34.42  ? 32  ASP A CG  1 
ATOM   230   O OD1 . ASP A  1 32  ? 28.107  12.399  16.877  1.00 35.65  ? 32  ASP A OD1 1 
ATOM   231   O OD2 . ASP A  1 32  ? 26.545  13.760  17.529  1.00 35.95  ? 32  ASP A OD2 1 
ATOM   232   N N   . GLN A  1 33  ? 29.521  12.232  20.070  1.00 29.03  ? 33  GLN A N   1 
ATOM   233   C CA  . GLN A  1 33  ? 29.248  11.730  21.390  1.00 29.31  ? 33  GLN A CA  1 
ATOM   234   C C   . GLN A  1 33  ? 30.382  10.820  21.762  1.00 26.28  ? 33  GLN A C   1 
ATOM   235   O O   . GLN A  1 33  ? 30.431  9.691   21.302  1.00 25.98  ? 33  GLN A O   1 
ATOM   236   C CB  . GLN A  1 33  ? 27.965  10.935  21.453  1.00 33.27  ? 33  GLN A CB  1 
ATOM   237   C CG  . GLN A  1 33  ? 26.684  11.761  21.344  1.00 37.56  ? 33  GLN A CG  1 
ATOM   238   C CD  . GLN A  1 33  ? 25.474  10.876  21.636  1.00 40.25  ? 33  GLN A CD  1 
ATOM   239   O OE1 . GLN A  1 33  ? 25.340  9.747   21.135  1.00 41.49  ? 33  GLN A OE1 1 
ATOM   240   N NE2 . GLN A  1 33  ? 24.569  11.333  22.508  1.00 41.45  ? 33  GLN A NE2 1 
ATOM   241   N N   . ILE A  1 34  ? 31.356  11.323  22.498  1.00 23.05  ? 34  ILE A N   1 
ATOM   242   C CA  . ILE A  1 34  ? 32.395  10.471  22.991  1.00 21.56  ? 34  ILE A CA  1 
ATOM   243   C C   . ILE A  1 34  ? 32.413  10.681  24.500  1.00 20.93  ? 34  ILE A C   1 
ATOM   244   O O   . ILE A  1 34  ? 32.237  11.801  24.967  1.00 20.51  ? 34  ILE A O   1 
ATOM   245   C CB  . ILE A  1 34  ? 33.699  10.852  22.283  1.00 21.65  ? 34  ILE A CB  1 
ATOM   246   C CG1 . ILE A  1 34  ? 34.683  9.742   22.532  1.00 22.29  ? 34  ILE A CG1 1 
ATOM   247   C CG2 . ILE A  1 34  ? 34.280  12.150  22.788  1.00 22.19  ? 34  ILE A CG2 1 
ATOM   248   C CD1 . ILE A  1 34  ? 35.967  9.851   21.707  1.00 22.83  ? 34  ILE A CD1 1 
ATOM   249   N N   . GLU A  1 35  ? 32.566  9.631   25.300  1.00 20.27  ? 35  GLU A N   1 
ATOM   250   C CA  . GLU A  1 35  ? 32.403  9.740   26.733  1.00 19.43  ? 35  GLU A CA  1 
ATOM   251   C C   . GLU A  1 35  ? 33.699  10.029  27.435  1.00 18.18  ? 35  GLU A C   1 
ATOM   252   O O   . GLU A  1 35  ? 34.664  9.271   27.297  1.00 19.24  ? 35  GLU A O   1 
ATOM   253   C CB  . GLU A  1 35  ? 31.837  8.452   27.258  1.00 21.21  ? 35  GLU A CB  1 
ATOM   254   C CG  . GLU A  1 35  ? 31.006  8.613   28.522  1.00 23.25  ? 35  GLU A CG  1 
ATOM   255   C CD  . GLU A  1 35  ? 30.966  7.346   29.364  1.00 24.64  ? 35  GLU A CD  1 
ATOM   256   O OE1 . GLU A  1 35  ? 31.183  7.485   30.558  1.00 25.37  ? 35  GLU A OE1 1 
ATOM   257   O OE2 . GLU A  1 35  ? 30.781  6.234   28.847  1.00 25.10  ? 35  GLU A OE2 1 
ATOM   258   N N   . VAL A  1 36  ? 33.788  11.116  28.175  1.00 16.27  ? 36  VAL A N   1 
ATOM   259   C CA  . VAL A  1 36  ? 35.005  11.421  28.894  1.00 14.31  ? 36  VAL A CA  1 
ATOM   260   C C   . VAL A  1 36  ? 34.747  11.299  30.384  1.00 14.69  ? 36  VAL A C   1 
ATOM   261   O O   . VAL A  1 36  ? 33.620  11.231  30.851  1.00 14.17  ? 36  VAL A O   1 
ATOM   262   C CB  . VAL A  1 36  ? 35.526  12.855  28.564  1.00 12.63  ? 36  VAL A CB  1 
ATOM   263   C CG1 . VAL A  1 36  ? 35.972  12.908  27.115  1.00 11.36  ? 36  VAL A CG1 1 
ATOM   264   C CG2 . VAL A  1 36  ? 34.457  13.891  28.827  1.00 12.29  ? 36  VAL A CG2 1 
ATOM   265   N N   . THR A  1 37  ? 35.815  11.249  31.158  1.00 15.73  ? 37  THR A N   1 
ATOM   266   C CA  . THR A  1 37  ? 35.811  11.188  32.587  1.00 15.53  ? 37  THR A CA  1 
ATOM   267   C C   . THR A  1 37  ? 35.144  12.369  33.201  1.00 16.85  ? 37  THR A C   1 
ATOM   268   O O   . THR A  1 37  ? 34.598  12.235  34.286  1.00 17.89  ? 37  THR A O   1 
ATOM   269   C CB  . THR A  1 37  ? 37.261  11.081  32.966  1.00 15.64  ? 37  THR A CB  1 
ATOM   270   O OG1 . THR A  1 37  ? 37.457  9.685   32.918  1.00 17.09  ? 37  THR A OG1 1 
ATOM   271   C CG2 . THR A  1 37  ? 37.692  11.662  34.281  1.00 16.74  ? 37  THR A CG2 1 
ATOM   272   N N   . ASN A  1 38  ? 35.161  13.530  32.567  1.00 19.11  ? 38  ASN A N   1 
ATOM   273   C CA  . ASN A  1 38  ? 34.664  14.728  33.226  1.00 21.21  ? 38  ASN A CA  1 
ATOM   274   C C   . ASN A  1 38  ? 34.560  15.877  32.264  1.00 19.41  ? 38  ASN A C   1 
ATOM   275   O O   . ASN A  1 38  ? 35.400  16.006  31.387  1.00 18.92  ? 38  ASN A O   1 
ATOM   276   C CB  . ASN A  1 38  ? 35.618  15.093  34.324  1.00 26.30  ? 38  ASN A CB  1 
ATOM   277   C CG  . ASN A  1 38  ? 35.178  16.280  35.135  1.00 30.97  ? 38  ASN A CG  1 
ATOM   278   O OD1 . ASN A  1 38  ? 34.046  16.338  35.629  1.00 31.28  ? 38  ASN A OD1 1 
ATOM   279   N ND2 . ASN A  1 38  ? 36.093  17.233  35.323  1.00 34.83  ? 38  ASN A ND2 1 
ATOM   280   N N   . ALA A  1 39  ? 33.600  16.753  32.410  1.00 18.59  ? 39  ALA A N   1 
ATOM   281   C CA  . ALA A  1 39  ? 33.460  17.872  31.495  1.00 17.39  ? 39  ALA A CA  1 
ATOM   282   C C   . ALA A  1 39  ? 33.077  19.102  32.309  1.00 17.05  ? 39  ALA A C   1 
ATOM   283   O O   . ALA A  1 39  ? 32.799  18.970  33.500  1.00 18.53  ? 39  ALA A O   1 
ATOM   284   C CB  . ALA A  1 39  ? 32.363  17.565  30.486  1.00 17.01  ? 39  ALA A CB  1 
ATOM   285   N N   . THR A  1 40  ? 33.092  20.291  31.737  1.00 15.99  ? 40  THR A N   1 
ATOM   286   C CA  . THR A  1 40  ? 32.583  21.468  32.403  1.00 15.17  ? 40  THR A CA  1 
ATOM   287   C C   . THR A  1 40  ? 31.699  22.193  31.388  1.00 15.34  ? 40  THR A C   1 
ATOM   288   O O   . THR A  1 40  ? 31.944  22.162  30.183  1.00 15.50  ? 40  THR A O   1 
ATOM   289   C CB  . THR A  1 40  ? 33.777  22.287  32.907  1.00 15.00  ? 40  THR A CB  1 
ATOM   290   O OG1 . THR A  1 40  ? 33.170  23.445  33.434  1.00 16.04  ? 40  THR A OG1 1 
ATOM   291   C CG2 . THR A  1 40  ? 34.826  22.689  31.896  1.00 15.45  ? 40  THR A CG2 1 
ATOM   292   N N   . GLU A  1 41  ? 30.588  22.769  31.842  1.00 15.60  ? 41  GLU A N   1 
ATOM   293   C CA  . GLU A  1 41  ? 29.616  23.446  30.982  1.00 14.52  ? 41  GLU A CA  1 
ATOM   294   C C   . GLU A  1 41  ? 30.021  24.869  30.628  1.00 13.44  ? 41  GLU A C   1 
ATOM   295   O O   . GLU A  1 41  ? 30.197  25.702  31.530  1.00 14.03  ? 41  GLU A O   1 
ATOM   296   C CB  . GLU A  1 41  ? 28.304  23.485  31.695  1.00 15.82  ? 41  GLU A CB  1 
ATOM   297   C CG  . GLU A  1 41  ? 27.241  24.215  30.949  1.00 17.48  ? 41  GLU A CG  1 
ATOM   298   C CD  . GLU A  1 41  ? 26.934  23.547  29.646  1.00 18.98  ? 41  GLU A CD  1 
ATOM   299   O OE1 . GLU A  1 41  ? 27.197  24.153  28.608  1.00 19.77  ? 41  GLU A OE1 1 
ATOM   300   O OE2 . GLU A  1 41  ? 26.495  22.385  29.660  1.00 20.41  ? 41  GLU A OE2 1 
ATOM   301   N N   . LEU A  1 42  ? 30.143  25.170  29.348  1.00 12.06  ? 42  LEU A N   1 
ATOM   302   C CA  . LEU A  1 42  ? 30.581  26.492  28.945  1.00 11.18  ? 42  LEU A CA  1 
ATOM   303   C C   . LEU A  1 42  ? 29.443  27.478  28.640  1.00 11.87  ? 42  LEU A C   1 
ATOM   304   O O   . LEU A  1 42  ? 29.736  28.664  28.403  1.00 11.93  ? 42  LEU A O   1 
ATOM   305   C CB  . LEU A  1 42  ? 31.489  26.381  27.725  1.00 9.81   ? 42  LEU A CB  1 
ATOM   306   C CG  . LEU A  1 42  ? 32.883  25.798  27.897  1.00 9.37   ? 42  LEU A CG  1 
ATOM   307   C CD1 . LEU A  1 42  ? 33.647  25.900  26.604  1.00 8.48   ? 42  LEU A CD1 1 
ATOM   308   C CD2 . LEU A  1 42  ? 33.662  26.589  28.909  1.00 9.13   ? 42  LEU A CD2 1 
ATOM   309   N N   . VAL A  1 43  ? 28.158  27.055  28.644  1.00 11.11  ? 43  VAL A N   1 
ATOM   310   C CA  . VAL A  1 43  ? 27.067  27.968  28.337  1.00 9.73   ? 43  VAL A CA  1 
ATOM   311   C C   . VAL A  1 43  ? 26.267  28.280  29.591  1.00 10.11  ? 43  VAL A C   1 
ATOM   312   O O   . VAL A  1 43  ? 25.693  27.406  30.232  1.00 9.40   ? 43  VAL A O   1 
ATOM   313   C CB  . VAL A  1 43  ? 26.118  27.346  27.280  1.00 8.68   ? 43  VAL A CB  1 
ATOM   314   C CG1 . VAL A  1 43  ? 25.065  28.336  26.837  1.00 7.99   ? 43  VAL A CG1 1 
ATOM   315   C CG2 . VAL A  1 43  ? 26.888  27.010  26.046  1.00 8.70   ? 43  VAL A CG2 1 
ATOM   316   N N   . GLN A  1 44  ? 26.211  29.539  29.997  1.00 11.71  ? 44  GLN A N   1 
ATOM   317   C CA  . GLN A  1 44  ? 25.377  29.955  31.107  1.00 13.81  ? 44  GLN A CA  1 
ATOM   318   C C   . GLN A  1 44  ? 23.958  29.981  30.584  1.00 14.63  ? 44  GLN A C   1 
ATOM   319   O O   . GLN A  1 44  ? 23.667  30.657  29.602  1.00 13.44  ? 44  GLN A O   1 
ATOM   320   C CB  . GLN A  1 44  ? 25.780  31.350  31.582  1.00 14.14  ? 44  GLN A CB  1 
ATOM   321   C CG  . GLN A  1 44  ? 24.944  31.889  32.732  1.00 14.33  ? 44  GLN A CG  1 
ATOM   322   C CD  . GLN A  1 44  ? 25.046  31.043  33.983  1.00 14.88  ? 44  GLN A CD  1 
ATOM   323   O OE1 . GLN A  1 44  ? 26.097  30.496  34.352  1.00 15.49  ? 44  GLN A OE1 1 
ATOM   324   N NE2 . GLN A  1 44  ? 23.930  30.932  34.679  1.00 15.10  ? 44  GLN A NE2 1 
ATOM   325   N N   . SER A  1 45  ? 23.044  29.297  31.232  1.00 17.36  ? 45  SER A N   1 
ATOM   326   C CA  . SER A  1 45  ? 21.727  29.164  30.666  1.00 19.25  ? 45  SER A CA  1 
ATOM   327   C C   . SER A  1 45  ? 20.603  29.504  31.596  1.00 19.92  ? 45  SER A C   1 
ATOM   328   O O   . SER A  1 45  ? 19.469  29.164  31.307  1.00 21.69  ? 45  SER A O   1 
ATOM   329   C CB  . SER A  1 45  ? 21.610  27.735  30.166  1.00 20.70  ? 45  SER A CB  1 
ATOM   330   O OG  . SER A  1 45  ? 22.243  26.854  31.103  1.00 23.38  ? 45  SER A OG  1 
ATOM   331   N N   . SER A  1 46  ? 20.825  30.196  32.697  1.00 20.79  ? 46  SER A N   1 
ATOM   332   C CA  . SER A  1 46  ? 19.727  30.520  33.583  1.00 22.13  ? 46  SER A CA  1 
ATOM   333   C C   . SER A  1 46  ? 20.009  31.770  34.382  1.00 22.68  ? 46  SER A C   1 
ATOM   334   O O   . SER A  1 46  ? 21.145  32.044  34.775  1.00 23.13  ? 46  SER A O   1 
ATOM   335   C CB  . SER A  1 46  ? 19.495  29.345  34.496  1.00 22.52  ? 46  SER A CB  1 
ATOM   336   O OG  . SER A  1 46  ? 20.787  28.921  34.902  1.00 23.89  ? 46  SER A OG  1 
ATOM   337   N N   . SER A  1 47  ? 18.972  32.557  34.560  1.00 23.23  ? 47  SER A N   1 
ATOM   338   C CA  . SER A  1 47  ? 19.082  33.779  35.297  1.00 23.84  ? 47  SER A CA  1 
ATOM   339   C C   . SER A  1 47  ? 18.593  33.541  36.703  1.00 24.38  ? 47  SER A C   1 
ATOM   340   O O   . SER A  1 47  ? 17.823  32.619  36.978  1.00 24.74  ? 47  SER A O   1 
ATOM   341   C CB  . SER A  1 47  ? 18.225  34.836  34.654  1.00 24.29  ? 47  SER A CB  1 
ATOM   342   O OG  . SER A  1 47  ? 18.429  36.094  35.272  1.00 25.11  ? 47  SER A OG  1 
ATOM   343   N N   . THR A  1 48  ? 19.004  34.411  37.593  1.00 24.78  ? 48  THR A N   1 
ATOM   344   C CA  . THR A  1 48  ? 18.481  34.398  38.924  1.00 25.97  ? 48  THR A CA  1 
ATOM   345   C C   . THR A  1 48  ? 17.066  34.950  38.882  1.00 25.54  ? 48  THR A C   1 
ATOM   346   O O   . THR A  1 48  ? 16.291  34.780  39.815  1.00 26.71  ? 48  THR A O   1 
ATOM   347   C CB  . THR A  1 48  ? 19.383  35.252  39.792  1.00 27.40  ? 48  THR A CB  1 
ATOM   348   O OG1 . THR A  1 48  ? 19.354  36.575  39.265  1.00 29.10  ? 48  THR A OG1 1 
ATOM   349   C CG2 . THR A  1 48  ? 20.817  34.746  39.782  1.00 28.42  ? 48  THR A CG2 1 
ATOM   350   N N   . GLY A  1 49  ? 16.739  35.695  37.833  1.00 25.12  ? 49  GLY A N   1 
ATOM   351   C CA  . GLY A  1 49  ? 15.419  36.271  37.668  1.00 24.97  ? 49  GLY A CA  1 
ATOM   352   C C   . GLY A  1 49  ? 15.310  37.625  38.344  1.00 24.14  ? 49  GLY A C   1 
ATOM   353   O O   . GLY A  1 49  ? 14.222  38.193  38.468  1.00 24.42  ? 49  GLY A O   1 
ATOM   354   N N   . LYS A  1 50  ? 16.422  38.172  38.803  1.00 23.02  ? 50  LYS A N   1 
ATOM   355   C CA  . LYS A  1 50  ? 16.387  39.419  39.507  1.00 23.89  ? 50  LYS A CA  1 
ATOM   356   C C   . LYS A  1 50  ? 17.529  40.286  39.021  1.00 22.69  ? 50  LYS A C   1 
ATOM   357   O O   . LYS A  1 50  ? 18.605  39.761  38.740  1.00 22.68  ? 50  LYS A O   1 
ATOM   358   C CB  . LYS A  1 50  ? 16.530  39.150  40.984  1.00 26.20  ? 50  LYS A CB  1 
ATOM   359   C CG  . LYS A  1 50  ? 15.302  38.498  41.563  1.00 28.88  ? 50  LYS A CG  1 
ATOM   360   C CD  . LYS A  1 50  ? 15.664  37.747  42.834  1.00 31.81  ? 50  LYS A CD  1 
ATOM   361   C CE  . LYS A  1 50  ? 14.648  38.066  43.932  1.00 33.96  ? 50  LYS A CE  1 
ATOM   362   N NZ  . LYS A  1 50  ? 13.307  37.665  43.530  1.00 35.19  ? 50  LYS A NZ  1 
ATOM   363   N N   . ILE A  1 51  ? 17.327  41.591  38.851  1.00 20.64  ? 51  ILE A N   1 
ATOM   364   C CA  . ILE A  1 51  ? 18.386  42.488  38.442  1.00 18.49  ? 51  ILE A CA  1 
ATOM   365   C C   . ILE A  1 51  ? 19.078  42.912  39.729  1.00 19.39  ? 51  ILE A C   1 
ATOM   366   O O   . ILE A  1 51  ? 18.496  43.574  40.591  1.00 18.37  ? 51  ILE A O   1 
ATOM   367   C CB  . ILE A  1 51  ? 17.785  43.707  37.708  1.00 17.36  ? 51  ILE A CB  1 
ATOM   368   C CG1 . ILE A  1 51  ? 17.085  43.262  36.447  1.00 16.25  ? 51  ILE A CG1 1 
ATOM   369   C CG2 . ILE A  1 51  ? 18.873  44.700  37.369  1.00 16.56  ? 51  ILE A CG2 1 
ATOM   370   C CD1 . ILE A  1 51  ? 16.391  44.417  35.695  1.00 15.77  ? 51  ILE A CD1 1 
ATOM   371   N N   . CYS A  1 52  ? 20.309  42.469  39.898  1.00 21.10  ? 52  CYS A N   1 
ATOM   372   C CA  . CYS A  1 52  ? 21.090  42.843  41.047  1.00 22.74  ? 52  CYS A CA  1 
ATOM   373   C C   . CYS A  1 52  ? 21.410  44.305  40.982  1.00 23.81  ? 52  CYS A C   1 
ATOM   374   O O   . CYS A  1 52  ? 21.956  44.769  39.988  1.00 23.90  ? 52  CYS A O   1 
ATOM   375   C CB  . CYS A  1 52  ? 22.382  42.093  41.087  1.00 23.09  ? 52  CYS A CB  1 
ATOM   376   S SG  . CYS A  1 52  ? 22.154  40.414  41.700  1.00 23.64  ? 52  CYS A SG  1 
ATOM   377   N N   . ASN A  1 53  ? 21.140  45.037  42.049  1.00 25.87  ? 53  ASN A N   1 
ATOM   378   C CA  . ASN A  1 53  ? 21.351  46.475  42.092  1.00 27.34  ? 53  ASN A CA  1 
ATOM   379   C C   . ASN A  1 53  ? 22.783  46.880  42.406  1.00 27.06  ? 53  ASN A C   1 
ATOM   380   O O   . ASN A  1 53  ? 23.036  47.978  42.916  1.00 26.70  ? 53  ASN A O   1 
ATOM   381   C CB  . ASN A  1 53  ? 20.431  47.091  43.144  1.00 29.39  ? 53  ASN A CB  1 
ATOM   382   C CG  . ASN A  1 53  ? 20.721  46.662  44.582  1.00 31.38  ? 53  ASN A CG  1 
ATOM   383   O OD1 . ASN A  1 53  ? 21.682  45.945  44.935  1.00 32.83  ? 53  ASN A OD1 1 
ATOM   384   N ND2 . ASN A  1 53  ? 19.834  47.114  45.464  1.00 31.94  ? 53  ASN A ND2 1 
ATOM   385   N N   . ASN A  1 54  ? 23.742  46.019  42.135  1.00 27.20  ? 54  ASN A N   1 
ATOM   386   C CA  . ASN A  1 54  ? 25.109  46.337  42.450  1.00 27.62  ? 54  ASN A CA  1 
ATOM   387   C C   . ASN A  1 54  ? 25.968  45.531  41.500  1.00 25.60  ? 54  ASN A C   1 
ATOM   388   O O   . ASN A  1 54  ? 25.645  44.373  41.271  1.00 25.81  ? 54  ASN A O   1 
ATOM   389   C CB  . ASN A  1 54  ? 25.369  45.965  43.905  1.00 30.07  ? 54  ASN A CB  1 
ATOM   390   C CG  . ASN A  1 54  ? 26.542  46.784  44.430  1.00 32.34  ? 54  ASN A CG  1 
ATOM   391   O OD1 . ASN A  1 54  ? 27.701  46.362  44.438  1.00 33.65  ? 54  ASN A OD1 1 
ATOM   392   N ND2 . ASN A  1 54  ? 26.310  48.025  44.838  1.00 33.07  ? 54  ASN A ND2 1 
ATOM   393   N N   . PRO A  1 55  ? 27.060  46.013  40.918  1.00 23.28  ? 55  PRO A N   1 
ATOM   394   C CA  . PRO A  1 55  ? 27.592  47.343  41.099  1.00 22.20  ? 55  PRO A CA  1 
ATOM   395   C C   . PRO A  1 55  ? 27.061  48.450  40.206  1.00 21.97  ? 55  PRO A C   1 
ATOM   396   O O   . PRO A  1 55  ? 27.537  49.570  40.348  1.00 23.24  ? 55  PRO A O   1 
ATOM   397   C CB  . PRO A  1 55  ? 29.044  47.121  40.941  1.00 21.93  ? 55  PRO A CB  1 
ATOM   398   C CG  . PRO A  1 55  ? 29.029  46.202  39.754  1.00 21.87  ? 55  PRO A CG  1 
ATOM   399   C CD  . PRO A  1 55  ? 27.964  45.203  40.124  1.00 22.01  ? 55  PRO A CD  1 
ATOM   400   N N   . HIS A  1 56  ? 26.129  48.229  39.280  1.00 20.67  ? 56  HIS A N   1 
ATOM   401   C CA  . HIS A  1 56  ? 25.763  49.330  38.402  1.00 18.77  ? 56  HIS A CA  1 
ATOM   402   C C   . HIS A  1 56  ? 24.676  50.186  39.026  1.00 19.24  ? 56  HIS A C   1 
ATOM   403   O O   . HIS A  1 56  ? 23.924  49.667  39.850  1.00 20.75  ? 56  HIS A O   1 
ATOM   404   C CB  . HIS A  1 56  ? 25.264  48.806  37.063  1.00 16.85  ? 56  HIS A CB  1 
ATOM   405   C CG  . HIS A  1 56  ? 26.280  48.009  36.275  1.00 14.91  ? 56  HIS A CG  1 
ATOM   406   N ND1 . HIS A  1 56  ? 27.418  48.521  35.829  1.00 14.03  ? 56  HIS A ND1 1 
ATOM   407   C CD2 . HIS A  1 56  ? 26.128  46.702  35.959  1.00 14.88  ? 56  HIS A CD2 1 
ATOM   408   C CE1 . HIS A  1 56  ? 27.978  47.500  35.222  1.00 14.02  ? 56  HIS A CE1 1 
ATOM   409   N NE2 . HIS A  1 56  ? 27.216  46.424  35.300  1.00 14.15  ? 56  HIS A NE2 1 
ATOM   410   N N   . ARG A  1 57  ? 24.564  51.475  38.689  1.00 18.61  ? 57  ARG A N   1 
ATOM   411   C CA  . ARG A  1 57  ? 23.477  52.274  39.191  1.00 18.77  ? 57  ARG A CA  1 
ATOM   412   C C   . ARG A  1 57  ? 22.221  51.915  38.449  1.00 17.40  ? 57  ARG A C   1 
ATOM   413   O O   . ARG A  1 57  ? 22.042  52.319  37.315  1.00 18.43  ? 57  ARG A O   1 
ATOM   414   C CB  . ARG A  1 57  ? 23.728  53.752  38.997  1.00 21.20  ? 57  ARG A CB  1 
ATOM   415   C CG  . ARG A  1 57  ? 23.779  54.422  40.375  1.00 25.19  ? 57  ARG A CG  1 
ATOM   416   C CD  . ARG A  1 57  ? 23.744  55.946  40.377  1.00 26.62  ? 57  ARG A CD  1 
ATOM   417   N NE  . ARG A  1 57  ? 22.386  56.465  40.262  1.00 27.32  ? 57  ARG A NE  1 
ATOM   418   C CZ  . ARG A  1 57  ? 21.621  56.734  41.323  1.00 27.32  ? 57  ARG A CZ  1 
ATOM   419   N NH1 . ARG A  1 57  ? 20.408  57.281  41.155  1.00 28.30  ? 57  ARG A NH1 1 
ATOM   420   N NH2 . ARG A  1 57  ? 22.065  56.410  42.526  1.00 26.80  ? 57  ARG A NH2 1 
ATOM   421   N N   . ILE A  1 58  ? 21.324  51.136  39.002  1.00 15.76  ? 58  ILE A N   1 
ATOM   422   C CA  . ILE A  1 58  ? 20.117  50.823  38.287  1.00 15.19  ? 58  ILE A CA  1 
ATOM   423   C C   . ILE A  1 58  ? 18.941  51.692  38.710  1.00 15.49  ? 58  ILE A C   1 
ATOM   424   O O   . ILE A  1 58  ? 18.515  51.675  39.861  1.00 17.05  ? 58  ILE A O   1 
ATOM   425   C CB  . ILE A  1 58  ? 19.925  49.350  38.502  1.00 14.73  ? 58  ILE A CB  1 
ATOM   426   C CG1 . ILE A  1 58  ? 20.918  48.717  37.580  1.00 14.52  ? 58  ILE A CG1 1 
ATOM   427   C CG2 . ILE A  1 58  ? 18.541  48.843  38.174  1.00 15.43  ? 58  ILE A CG2 1 
ATOM   428   C CD1 . ILE A  1 58  ? 21.316  47.374  38.119  1.00 16.05  ? 58  ILE A CD1 1 
ATOM   429   N N   . LEU A  1 59  ? 18.404  52.498  37.812  1.00 15.11  ? 59  LEU A N   1 
ATOM   430   C CA  . LEU A  1 59  ? 17.298  53.366  38.161  1.00 15.49  ? 59  LEU A CA  1 
ATOM   431   C C   . LEU A  1 59  ? 16.028  52.683  37.686  1.00 15.74  ? 59  LEU A C   1 
ATOM   432   O O   . LEU A  1 59  ? 15.936  52.403  36.490  1.00 17.01  ? 59  LEU A O   1 
ATOM   433   C CB  . LEU A  1 59  ? 17.470  54.690  37.467  1.00 14.53  ? 59  LEU A CB  1 
ATOM   434   C CG  . LEU A  1 59  ? 16.530  55.767  37.848  1.00 14.11  ? 59  LEU A CG  1 
ATOM   435   C CD1 . LEU A  1 59  ? 16.855  56.212  39.242  1.00 13.31  ? 59  LEU A CD1 1 
ATOM   436   C CD2 . LEU A  1 59  ? 16.660  56.909  36.891  1.00 14.46  ? 59  LEU A CD2 1 
ATOM   437   N N   . ASP A  1 60  ? 15.079  52.347  38.557  1.00 15.04  ? 60  ASP A N   1 
ATOM   438   C CA  . ASP A  1 60  ? 13.880  51.674  38.115  1.00 15.04  ? 60  ASP A CA  1 
ATOM   439   C C   . ASP A  1 60  ? 12.934  52.752  37.672  1.00 15.14  ? 60  ASP A C   1 
ATOM   440   O O   . ASP A  1 60  ? 12.655  53.682  38.424  1.00 16.38  ? 60  ASP A O   1 
ATOM   441   C CB  . ASP A  1 60  ? 13.247  50.891  39.245  1.00 15.14  ? 60  ASP A CB  1 
ATOM   442   C CG  . ASP A  1 60  ? 12.036  50.049  38.883  1.00 15.06  ? 60  ASP A CG  1 
ATOM   443   O OD1 . ASP A  1 60  ? 11.756  49.099  39.591  1.00 14.41  ? 60  ASP A OD1 1 
ATOM   444   O OD2 . ASP A  1 60  ? 11.362  50.274  37.892  1.00 16.07  ? 60  ASP A OD2 1 
ATOM   445   N N   . GLY A  1 61  ? 12.386  52.628  36.482  1.00 15.01  ? 61  GLY A N   1 
ATOM   446   C CA  . GLY A  1 61  ? 11.543  53.665  35.946  1.00 14.78  ? 61  GLY A CA  1 
ATOM   447   C C   . GLY A  1 61  ? 10.170  53.660  36.551  1.00 14.59  ? 61  GLY A C   1 
ATOM   448   O O   . GLY A  1 61  ? 9.408   54.610  36.341  1.00 14.92  ? 61  GLY A O   1 
ATOM   449   N N   . ILE A  1 62  ? 9.869   52.616  37.308  1.00 14.52  ? 62  ILE A N   1 
ATOM   450   C CA  . ILE A  1 62  ? 8.565   52.344  37.880  1.00 17.10  ? 62  ILE A CA  1 
ATOM   451   C C   . ILE A  1 62  ? 7.499   52.513  36.790  1.00 17.78  ? 62  ILE A C   1 
ATOM   452   O O   . ILE A  1 62  ? 7.576   51.788  35.798  1.00 17.90  ? 62  ILE A O   1 
ATOM   453   C CB  . ILE A  1 62  ? 8.244   53.286  39.080  1.00 17.77  ? 62  ILE A CB  1 
ATOM   454   C CG1 . ILE A  1 62  ? 9.438   53.700  39.926  1.00 17.54  ? 62  ILE A CG1 1 
ATOM   455   C CG2 . ILE A  1 62  ? 7.252   52.494  39.925  1.00 16.66  ? 62  ILE A CG2 1 
ATOM   456   C CD1 . ILE A  1 62  ? 10.052  52.576  40.738  1.00 18.36  ? 62  ILE A CD1 1 
ATOM   457   N N   . ASP A  1 63  ? 6.549   53.448  36.835  1.00 18.71  ? 63  ASP A N   1 
ATOM   458   C CA  . ASP A  1 63  ? 5.594   53.525  35.753  1.00 20.97  ? 63  ASP A CA  1 
ATOM   459   C C   . ASP A  1 63  ? 5.856   54.730  34.859  1.00 19.89  ? 63  ASP A C   1 
ATOM   460   O O   . ASP A  1 63  ? 4.949   55.280  34.211  1.00 20.46  ? 63  ASP A O   1 
ATOM   461   C CB  . ASP A  1 63  ? 4.169   53.562  36.320  1.00 23.63  ? 63  ASP A CB  1 
ATOM   462   C CG  . ASP A  1 63  ? 3.949   54.422  37.559  1.00 25.78  ? 63  ASP A CG  1 
ATOM   463   O OD1 . ASP A  1 63  ? 4.761   55.318  37.833  1.00 25.79  ? 63  ASP A OD1 1 
ATOM   464   O OD2 . ASP A  1 63  ? 2.983   54.145  38.296  1.00 27.36  ? 63  ASP A OD2 1 
ATOM   465   N N   . CYS A  1 64  ? 7.115   55.138  34.761  1.00 18.04  ? 64  CYS A N   1 
ATOM   466   C CA  . CYS A  1 64  ? 7.508   56.184  33.846  1.00 16.26  ? 64  CYS A CA  1 
ATOM   467   C C   . CYS A  1 64  ? 8.380   55.671  32.721  1.00 15.45  ? 64  CYS A C   1 
ATOM   468   O O   . CYS A  1 64  ? 9.203   54.809  32.918  1.00 14.55  ? 64  CYS A O   1 
ATOM   469   C CB  . CYS A  1 64  ? 8.283   57.244  34.553  1.00 15.42  ? 64  CYS A CB  1 
ATOM   470   S SG  . CYS A  1 64  ? 7.170   58.161  35.601  1.00 15.07  ? 64  CYS A SG  1 
ATOM   471   N N   . THR A  1 65  ? 8.231   56.180  31.521  1.00 14.53  ? 65  THR A N   1 
ATOM   472   C CA  . THR A  1 65  ? 9.120   55.877  30.419  1.00 13.38  ? 65  THR A CA  1 
ATOM   473   C C   . THR A  1 65  ? 10.277  56.857  30.552  1.00 13.38  ? 65  THR A C   1 
ATOM   474   O O   . THR A  1 65  ? 10.018  57.965  31.045  1.00 14.58  ? 65  THR A O   1 
ATOM   475   C CB  . THR A  1 65  ? 8.365   56.181  29.177  1.00 14.57  ? 65  THR A CB  1 
ATOM   476   O OG1 . THR A  1 65  ? 7.183   55.443  29.333  1.00 15.55  ? 65  THR A OG1 1 
ATOM   477   C CG2 . THR A  1 65  ? 9.127   55.941  27.897  1.00 14.71  ? 65  THR A CG2 1 
ATOM   478   N N   . LEU A  1 66  ? 11.513  56.590  30.096  1.00 12.30  ? 66  LEU A N   1 
ATOM   479   C CA  . LEU A  1 66  ? 12.551  57.637  30.175  1.00 11.09  ? 66  LEU A CA  1 
ATOM   480   C C   . LEU A  1 66  ? 12.130  58.947  29.491  1.00 11.15  ? 66  LEU A C   1 
ATOM   481   O O   . LEU A  1 66  ? 12.255  59.995  30.126  1.00 11.18  ? 66  LEU A O   1 
ATOM   482   C CB  . LEU A  1 66  ? 13.850  57.184  29.539  1.00 9.92   ? 66  LEU A CB  1 
ATOM   483   C CG  . LEU A  1 66  ? 15.011  58.152  29.385  1.00 8.28   ? 66  LEU A CG  1 
ATOM   484   C CD1 . LEU A  1 66  ? 15.529  58.627  30.714  1.00 7.93   ? 66  LEU A CD1 1 
ATOM   485   C CD2 . LEU A  1 66  ? 16.094  57.449  28.646  1.00 8.05   ? 66  LEU A CD2 1 
ATOM   486   N N   . ILE A  1 67  ? 11.568  58.949  28.265  1.00 11.23  ? 67  ILE A N   1 
ATOM   487   C CA  . ILE A  1 67  ? 11.096  60.186  27.616  1.00 11.04  ? 67  ILE A CA  1 
ATOM   488   C C   . ILE A  1 67  ? 10.084  60.950  28.504  1.00 12.35  ? 67  ILE A C   1 
ATOM   489   O O   . ILE A  1 67  ? 10.222  62.174  28.632  1.00 13.27  ? 67  ILE A O   1 
ATOM   490   C CB  . ILE A  1 67  ? 10.457  59.849  26.215  1.00 9.74   ? 67  ILE A CB  1 
ATOM   491   C CG1 . ILE A  1 67  ? 11.534  59.302  25.284  1.00 8.91   ? 67  ILE A CG1 1 
ATOM   492   C CG2 . ILE A  1 67  ? 9.811   61.081  25.579  1.00 8.81   ? 67  ILE A CG2 1 
ATOM   493   C CD1 . ILE A  1 67  ? 12.608  60.308  24.886  1.00 9.48   ? 67  ILE A CD1 1 
ATOM   494   N N   . ASP A  1 68  ? 9.109   60.298  29.182  1.00 12.03  ? 68  ASP A N   1 
ATOM   495   C CA  . ASP A  1 68  ? 8.224   61.027  30.088  1.00 10.83  ? 68  ASP A CA  1 
ATOM   496   C C   . ASP A  1 68  ? 8.999   61.566  31.267  1.00 9.99   ? 68  ASP A C   1 
ATOM   497   O O   . ASP A  1 68  ? 8.721   62.688  31.693  1.00 10.80  ? 68  ASP A O   1 
ATOM   498   C CB  . ASP A  1 68  ? 7.122   60.194  30.682  1.00 11.35  ? 68  ASP A CB  1 
ATOM   499   C CG  . ASP A  1 68  ? 6.125   59.681  29.663  1.00 13.33  ? 68  ASP A CG  1 
ATOM   500   O OD1 . ASP A  1 68  ? 5.917   58.444  29.635  1.00 13.99  ? 68  ASP A OD1 1 
ATOM   501   O OD2 . ASP A  1 68  ? 5.565   60.492  28.900  1.00 13.55  ? 68  ASP A OD2 1 
ATOM   502   N N   . ALA A  1 69  ? 9.984   60.837  31.797  1.00 8.04   ? 69  ALA A N   1 
ATOM   503   C CA  . ALA A  1 69  ? 10.820  61.354  32.852  1.00 7.86   ? 69  ALA A CA  1 
ATOM   504   C C   . ALA A  1 69  ? 11.551  62.626  32.387  1.00 8.69   ? 69  ALA A C   1 
ATOM   505   O O   . ALA A  1 69  ? 11.660  63.659  33.090  1.00 9.57   ? 69  ALA A O   1 
ATOM   506   C CB  . ALA A  1 69  ? 11.843  60.330  33.238  1.00 7.52   ? 69  ALA A CB  1 
ATOM   507   N N   . LEU A  1 70  ? 12.026  62.600  31.150  1.00 8.20   ? 70  LEU A N   1 
ATOM   508   C CA  . LEU A  1 70  ? 12.672  63.755  30.540  1.00 8.15   ? 70  LEU A CA  1 
ATOM   509   C C   . LEU A  1 70  ? 11.720  64.937  30.407  1.00 8.08   ? 70  LEU A C   1 
ATOM   510   O O   . LEU A  1 70  ? 11.989  65.985  31.013  1.00 8.80   ? 70  LEU A O   1 
ATOM   511   C CB  . LEU A  1 70  ? 13.190  63.370  29.163  1.00 7.81   ? 70  LEU A CB  1 
ATOM   512   C CG  . LEU A  1 70  ? 13.891  64.393  28.315  1.00 7.25   ? 70  LEU A CG  1 
ATOM   513   C CD1 . LEU A  1 70  ? 15.348  64.459  28.709  1.00 7.66   ? 70  LEU A CD1 1 
ATOM   514   C CD2 . LEU A  1 70  ? 13.822  63.990  26.869  1.00 7.52   ? 70  LEU A CD2 1 
ATOM   515   N N   . LEU A  1 71  ? 10.592  64.766  29.680  1.00 7.38   ? 71  LEU A N   1 
ATOM   516   C CA  . LEU A  1 71  ? 9.632   65.852  29.448  1.00 6.48   ? 71  LEU A CA  1 
ATOM   517   C C   . LEU A  1 71  ? 9.018   66.346  30.747  1.00 6.78   ? 71  LEU A C   1 
ATOM   518   O O   . LEU A  1 71  ? 8.801   67.544  30.966  1.00 7.52   ? 71  LEU A O   1 
ATOM   519   C CB  . LEU A  1 71  ? 8.522   65.407  28.514  1.00 3.65   ? 71  LEU A CB  1 
ATOM   520   C CG  . LEU A  1 71  ? 8.986   65.093  27.118  1.00 3.09   ? 71  LEU A CG  1 
ATOM   521   C CD1 . LEU A  1 71  ? 7.834   64.576  26.286  1.00 3.83   ? 71  LEU A CD1 1 
ATOM   522   C CD2 . LEU A  1 71  ? 9.525   66.335  26.478  1.00 2.30   ? 71  LEU A CD2 1 
ATOM   523   N N   . GLY A  1 72  ? 8.793   65.422  31.651  1.00 6.55   ? 72  GLY A N   1 
ATOM   524   C CA  . GLY A  1 72  ? 8.338   65.776  32.958  1.00 8.12   ? 72  GLY A CA  1 
ATOM   525   C C   . GLY A  1 72  ? 6.852   65.699  33.100  1.00 8.85   ? 72  GLY A C   1 
ATOM   526   O O   . GLY A  1 72  ? 6.199   66.660  33.526  1.00 9.41   ? 72  GLY A O   1 
ATOM   527   N N   . ASP A  1 73  ? 6.334   64.549  32.694  1.00 9.75   ? 73  ASP A N   1 
ATOM   528   C CA  . ASP A  1 73  ? 4.947   64.161  32.920  1.00 10.72  ? 73  ASP A CA  1 
ATOM   529   C C   . ASP A  1 73  ? 4.766   64.283  34.429  1.00 11.07  ? 73  ASP A C   1 
ATOM   530   O O   . ASP A  1 73  ? 5.624   63.793  35.146  1.00 10.99  ? 73  ASP A O   1 
ATOM   531   C CB  . ASP A  1 73  ? 4.779   62.729  32.463  1.00 11.59  ? 73  ASP A CB  1 
ATOM   532   C CG  . ASP A  1 73  ? 3.442   62.102  32.775  1.00 13.20  ? 73  ASP A CG  1 
ATOM   533   O OD1 . ASP A  1 73  ? 2.791   61.623  31.853  1.00 14.67  ? 73  ASP A OD1 1 
ATOM   534   O OD2 . ASP A  1 73  ? 3.029   62.058  33.939  1.00 13.71  ? 73  ASP A OD2 1 
ATOM   535   N N   . PRO A  1 74  ? 3.715   64.886  34.971  1.00 12.16  ? 74  PRO A N   1 
ATOM   536   C CA  . PRO A  1 74  ? 3.511   65.063  36.397  1.00 12.56  ? 74  PRO A CA  1 
ATOM   537   C C   . PRO A  1 74  ? 3.774   63.800  37.170  1.00 13.16  ? 74  PRO A C   1 
ATOM   538   O O   . PRO A  1 74  ? 4.593   63.749  38.083  1.00 12.29  ? 74  PRO A O   1 
ATOM   539   C CB  . PRO A  1 74  ? 2.096   65.530  36.521  1.00 12.52  ? 74  PRO A CB  1 
ATOM   540   C CG  . PRO A  1 74  ? 1.852   66.243  35.216  1.00 12.82  ? 74  PRO A CG  1 
ATOM   541   C CD  . PRO A  1 74  ? 2.524   65.290  34.240  1.00 12.81  ? 74  PRO A CD  1 
ATOM   542   N N   . HIS A  1 75  ? 3.208   62.683  36.717  1.00 14.37  ? 75  HIS A N   1 
ATOM   543   C CA  . HIS A  1 75  ? 3.372   61.463  37.479  1.00 15.24  ? 75  HIS A CA  1 
ATOM   544   C C   . HIS A  1 75  ? 4.811   60.932  37.516  1.00 16.27  ? 75  HIS A C   1 
ATOM   545   O O   . HIS A  1 75  ? 5.094   59.923  38.157  1.00 16.68  ? 75  HIS A O   1 
ATOM   546   C CB  . HIS A  1 75  ? 2.371   60.464  36.905  1.00 14.55  ? 75  HIS A CB  1 
ATOM   547   C CG  . HIS A  1 75  ? 2.851   59.387  35.954  1.00 14.68  ? 75  HIS A CG  1 
ATOM   548   N ND1 . HIS A  1 75  ? 2.808   59.493  34.637  1.00 15.01  ? 75  HIS A ND1 1 
ATOM   549   C CD2 . HIS A  1 75  ? 3.317   58.147  36.277  1.00 14.58  ? 75  HIS A CD2 1 
ATOM   550   C CE1 . HIS A  1 75  ? 3.222   58.371  34.130  1.00 14.80  ? 75  HIS A CE1 1 
ATOM   551   N NE2 . HIS A  1 75  ? 3.522   57.571  35.123  1.00 14.99  ? 75  HIS A NE2 1 
ATOM   552   N N   . CYS A  1 76  ? 5.760   61.603  36.886  1.00 16.88  ? 76  CYS A N   1 
ATOM   553   C CA  . CYS A  1 76  ? 7.146   61.180  36.847  1.00 17.20  ? 76  CYS A CA  1 
ATOM   554   C C   . CYS A  1 76  ? 8.026   62.259  37.437  1.00 18.43  ? 76  CYS A C   1 
ATOM   555   O O   . CYS A  1 76  ? 9.258   62.197  37.294  1.00 17.65  ? 76  CYS A O   1 
ATOM   556   C CB  . CYS A  1 76  ? 7.605   60.954  35.423  1.00 16.34  ? 76  CYS A CB  1 
ATOM   557   S SG  . CYS A  1 76  ? 6.508   59.786  34.644  1.00 15.72  ? 76  CYS A SG  1 
ATOM   558   N N   . ASP A  1 77  ? 7.478   63.244  38.163  1.00 20.07  ? 77  ASP A N   1 
ATOM   559   C CA  . ASP A  1 77  ? 8.343   64.316  38.650  1.00 21.11  ? 77  ASP A CA  1 
ATOM   560   C C   . ASP A  1 77  ? 9.379   63.807  39.615  1.00 20.09  ? 77  ASP A C   1 
ATOM   561   O O   . ASP A  1 77  ? 10.386  64.455  39.870  1.00 20.87  ? 77  ASP A O   1 
ATOM   562   C CB  . ASP A  1 77  ? 7.538   65.431  39.316  1.00 22.79  ? 77  ASP A CB  1 
ATOM   563   C CG  . ASP A  1 77  ? 6.809   66.271  38.275  1.00 25.41  ? 77  ASP A CG  1 
ATOM   564   O OD1 . ASP A  1 77  ? 5.607   66.463  38.442  1.00 26.72  ? 77  ASP A OD1 1 
ATOM   565   O OD2 . ASP A  1 77  ? 7.387   66.779  37.296  1.00 27.04  ? 77  ASP A OD2 1 
ATOM   566   N N   . VAL A  1 78  ? 9.173   62.583  40.074  1.00 18.60  ? 78  VAL A N   1 
ATOM   567   C CA  . VAL A  1 78  ? 10.107  61.861  40.912  1.00 18.16  ? 78  VAL A CA  1 
ATOM   568   C C   . VAL A  1 78  ? 11.488  61.837  40.309  1.00 18.05  ? 78  VAL A C   1 
ATOM   569   O O   . VAL A  1 78  ? 12.451  62.068  41.014  1.00 19.28  ? 78  VAL A O   1 
ATOM   570   C CB  . VAL A  1 78  ? 9.758   60.404  41.081  1.00 18.58  ? 78  VAL A CB  1 
ATOM   571   C CG1 . VAL A  1 78  ? 10.558  59.935  42.269  1.00 18.45  ? 78  VAL A CG1 1 
ATOM   572   C CG2 . VAL A  1 78  ? 8.237   60.176  41.213  1.00 20.27  ? 78  VAL A CG2 1 
ATOM   573   N N   . PHE A  1 79  ? 11.597  61.634  38.996  1.00 17.68  ? 79  PHE A N   1 
ATOM   574   C CA  . PHE A  1 79  ? 12.900  61.448  38.338  1.00 15.89  ? 79  PHE A CA  1 
ATOM   575   C C   . PHE A  1 79  ? 13.710  62.708  38.054  1.00 16.96  ? 79  PHE A C   1 
ATOM   576   O O   . PHE A  1 79  ? 14.781  62.595  37.444  1.00 16.60  ? 79  PHE A O   1 
ATOM   577   C CB  . PHE A  1 79  ? 12.710  60.706  37.014  1.00 11.96  ? 79  PHE A CB  1 
ATOM   578   C CG  . PHE A  1 79  ? 12.165  59.337  37.291  1.00 9.90   ? 79  PHE A CG  1 
ATOM   579   C CD1 . PHE A  1 79  ? 13.043  58.296  37.514  1.00 8.36   ? 79  PHE A CD1 1 
ATOM   580   C CD2 . PHE A  1 79  ? 10.790  59.152  37.370  1.00 9.39   ? 79  PHE A CD2 1 
ATOM   581   C CE1 . PHE A  1 79  ? 12.532  57.056  37.837  1.00 7.75   ? 79  PHE A CE1 1 
ATOM   582   C CE2 . PHE A  1 79  ? 10.286  57.912  37.692  1.00 8.34   ? 79  PHE A CE2 1 
ATOM   583   C CZ  . PHE A  1 79  ? 11.161  56.867  37.924  1.00 8.14   ? 79  PHE A CZ  1 
ATOM   584   N N   . GLN A  1 80  ? 13.277  63.903  38.468  1.00 18.38  ? 80  GLN A N   1 
ATOM   585   C CA  . GLN A  1 80  ? 13.976  65.104  38.062  1.00 20.18  ? 80  GLN A CA  1 
ATOM   586   C C   . GLN A  1 80  ? 15.398  65.067  38.545  1.00 20.04  ? 80  GLN A C   1 
ATOM   587   O O   . GLN A  1 80  ? 15.625  64.698  39.685  1.00 20.21  ? 80  GLN A O   1 
ATOM   588   C CB  . GLN A  1 80  ? 13.330  66.344  38.636  1.00 22.19  ? 80  GLN A CB  1 
ATOM   589   C CG  . GLN A  1 80  ? 11.856  66.489  38.287  1.00 24.19  ? 80  GLN A CG  1 
ATOM   590   C CD  . GLN A  1 80  ? 11.343  67.891  38.547  1.00 25.21  ? 80  GLN A CD  1 
ATOM   591   O OE1 . GLN A  1 80  ? 10.636  68.453  37.706  1.00 26.05  ? 80  GLN A OE1 1 
ATOM   592   N NE2 . GLN A  1 80  ? 11.735  68.577  39.622  1.00 25.33  ? 80  GLN A NE2 1 
ATOM   593   N N   . ASN A  1 81  ? 16.339  65.400  37.676  1.00 20.58  ? 81  ASN A N   1 
ATOM   594   C CA  . ASN A  1 81  ? 17.756  65.396  38.012  1.00 22.11  ? 81  ASN A CA  1 
ATOM   595   C C   . ASN A  1 81  ? 18.310  64.017  38.399  1.00 21.07  ? 81  ASN A C   1 
ATOM   596   O O   . ASN A  1 81  ? 19.369  63.927  39.027  1.00 20.85  ? 81  ASN A O   1 
ATOM   597   C CB  . ASN A  1 81  ? 18.071  66.389  39.159  1.00 25.85  ? 81  ASN A CB  1 
ATOM   598   C CG  . ASN A  1 81  ? 18.101  67.863  38.805  1.00 30.00  ? 81  ASN A CG  1 
ATOM   599   O OD1 . ASN A  1 81  ? 17.636  68.262  37.732  1.00 30.82  ? 81  ASN A OD1 1 
ATOM   600   N ND2 . ASN A  1 81  ? 18.594  68.732  39.700  1.00 33.92  ? 81  ASN A ND2 1 
ATOM   601   N N   . GLU A  1 82  ? 17.647  62.908  38.032  1.00 19.71  ? 82  GLU A N   1 
ATOM   602   C CA  . GLU A  1 82  ? 18.175  61.598  38.346  1.00 17.88  ? 82  GLU A CA  1 
ATOM   603   C C   . GLU A  1 82  ? 19.302  61.176  37.424  1.00 17.25  ? 82  GLU A C   1 
ATOM   604   O O   . GLU A  1 82  ? 19.548  61.752  36.352  1.00 17.66  ? 82  GLU A O   1 
ATOM   605   C CB  . GLU A  1 82  ? 17.085  60.551  38.291  1.00 18.21  ? 82  GLU A CB  1 
ATOM   606   C CG  . GLU A  1 82  ? 16.620  60.134  39.679  1.00 20.44  ? 82  GLU A CG  1 
ATOM   607   C CD  . GLU A  1 82  ? 17.638  59.504  40.647  1.00 21.74  ? 82  GLU A CD  1 
ATOM   608   O OE1 . GLU A  1 82  ? 18.751  59.148  40.256  1.00 22.42  ? 82  GLU A OE1 1 
ATOM   609   O OE2 . GLU A  1 82  ? 17.329  59.307  41.824  1.00 22.57  ? 82  GLU A OE2 1 
ATOM   610   N N   . THR A  1 83  ? 19.927  60.073  37.796  1.00 15.31  ? 83  THR A N   1 
ATOM   611   C CA  . THR A  1 83  ? 21.144  59.587  37.219  1.00 12.68  ? 83  THR A CA  1 
ATOM   612   C C   . THR A  1 83  ? 21.183  58.072  37.229  1.00 12.03  ? 83  THR A C   1 
ATOM   613   O O   . THR A  1 83  ? 20.774  57.450  38.206  1.00 12.98  ? 83  THR A O   1 
ATOM   614   C CB  . THR A  1 83  ? 22.153  60.280  38.074  1.00 12.94  ? 83  THR A CB  1 
ATOM   615   O OG1 . THR A  1 83  ? 22.616  61.238  37.163  1.00 13.24  ? 83  THR A OG1 1 
ATOM   616   C CG2 . THR A  1 83  ? 23.223  59.447  38.746  1.00 14.26  ? 83  THR A CG2 1 
ATOM   617   N N   . TRP A  1 84  ? 21.730  57.424  36.218  1.00 11.38  ? 84  TRP A N   1 
ATOM   618   C CA  . TRP A  1 84  ? 21.700  55.979  36.143  1.00 10.93  ? 84  TRP A CA  1 
ATOM   619   C C   . TRP A  1 84  ? 22.833  55.435  35.310  1.00 11.47  ? 84  TRP A C   1 
ATOM   620   O O   . TRP A  1 84  ? 23.398  56.186  34.519  1.00 11.66  ? 84  TRP A O   1 
ATOM   621   C CB  . TRP A  1 84  ? 20.399  55.497  35.506  1.00 10.66  ? 84  TRP A CB  1 
ATOM   622   C CG  . TRP A  1 84  ? 20.194  55.976  34.072  1.00 10.07  ? 84  TRP A CG  1 
ATOM   623   C CD1 . TRP A  1 84  ? 20.639  55.241  33.015  1.00 9.82   ? 84  TRP A CD1 1 
ATOM   624   C CD2 . TRP A  1 84  ? 19.657  57.173  33.684  1.00 10.01  ? 84  TRP A CD2 1 
ATOM   625   N NE1 . TRP A  1 84  ? 20.421  55.982  31.971  1.00 9.61   ? 84  TRP A NE1 1 
ATOM   626   C CE2 . TRP A  1 84  ? 19.847  57.133  32.318  1.00 9.45   ? 84  TRP A CE2 1 
ATOM   627   C CE3 . TRP A  1 84  ? 19.072  58.272  34.269  1.00 10.23  ? 84  TRP A CE3 1 
ATOM   628   C CZ2 . TRP A  1 84  ? 19.453  58.166  31.501  1.00 9.07   ? 84  TRP A CZ2 1 
ATOM   629   C CZ3 . TRP A  1 84  ? 18.674  59.309  33.452  1.00 10.07  ? 84  TRP A CZ3 1 
ATOM   630   C CH2 . TRP A  1 84  ? 18.871  59.265  32.083  1.00 9.60   ? 84  TRP A CH2 1 
ATOM   631   N N   . ASP A  1 85  ? 23.108  54.145  35.476  1.00 11.61  ? 85  ASP A N   1 
ATOM   632   C CA  . ASP A  1 85  ? 23.994  53.383  34.613  1.00 11.45  ? 85  ASP A CA  1 
ATOM   633   C C   . ASP A  1 85  ? 23.069  52.613  33.713  1.00 10.84  ? 85  ASP A C   1 
ATOM   634   O O   . ASP A  1 85  ? 23.309  52.423  32.516  1.00 12.24  ? 85  ASP A O   1 
ATOM   635   C CB  . ASP A  1 85  ? 24.793  52.327  35.297  1.00 13.02  ? 85  ASP A CB  1 
ATOM   636   C CG  . ASP A  1 85  ? 26.004  52.782  36.062  1.00 15.20  ? 85  ASP A CG  1 
ATOM   637   O OD1 . ASP A  1 85  ? 26.382  53.935  36.077  1.00 15.61  ? 85  ASP A OD1 1 
ATOM   638   O OD2 . ASP A  1 85  ? 26.624  51.929  36.684  1.00 17.96  ? 85  ASP A OD2 1 
ATOM   639   N N   . LEU A  1 86  ? 21.978  52.105  34.271  1.00 8.70   ? 86  LEU A N   1 
ATOM   640   C CA  . LEU A  1 86  ? 21.009  51.391  33.479  1.00 6.19   ? 86  LEU A CA  1 
ATOM   641   C C   . LEU A  1 86  ? 19.667  51.915  33.875  1.00 5.25   ? 86  LEU A C   1 
ATOM   642   O O   . LEU A  1 86  ? 19.365  51.968  35.065  1.00 5.88   ? 86  LEU A O   1 
ATOM   643   C CB  . LEU A  1 86  ? 21.091  49.935  33.775  1.00 5.04   ? 86  LEU A CB  1 
ATOM   644   C CG  . LEU A  1 86  ? 20.244  49.083  32.903  1.00 4.18   ? 86  LEU A CG  1 
ATOM   645   C CD1 . LEU A  1 86  ? 20.709  49.199  31.488  1.00 3.94   ? 86  LEU A CD1 1 
ATOM   646   C CD2 . LEU A  1 86  ? 20.339  47.651  33.366  1.00 4.70   ? 86  LEU A CD2 1 
ATOM   647   N N   . PHE A  1 87  ? 18.887  52.408  32.946  1.00 4.09   ? 87  PHE A N   1 
ATOM   648   C CA  . PHE A  1 87  ? 17.560  52.843  33.289  1.00 3.91   ? 87  PHE A CA  1 
ATOM   649   C C   . PHE A  1 87  ? 16.694  51.643  32.975  1.00 3.57   ? 87  PHE A C   1 
ATOM   650   O O   . PHE A  1 87  ? 16.850  51.125  31.882  1.00 3.92   ? 87  PHE A O   1 
ATOM   651   C CB  . PHE A  1 87  ? 17.201  54.047  32.429  1.00 3.05   ? 87  PHE A CB  1 
ATOM   652   C CG  . PHE A  1 87  ? 15.888  54.711  32.796  1.00 2.62   ? 87  PHE A CG  1 
ATOM   653   C CD1 . PHE A  1 87  ? 15.905  55.912  33.492  1.00 2.00   ? 87  PHE A CD1 1 
ATOM   654   C CD2 . PHE A  1 87  ? 14.682  54.084  32.496  1.00 2.15   ? 87  PHE A CD2 1 
ATOM   655   C CE1 . PHE A  1 87  ? 14.706  56.533  33.803  1.00 2.16   ? 87  PHE A CE1 1 
ATOM   656   C CE2 . PHE A  1 87  ? 13.498  54.714  32.810  1.00 2.52   ? 87  PHE A CE2 1 
ATOM   657   C CZ  . PHE A  1 87  ? 13.508  55.919  33.497  1.00 2.28   ? 87  PHE A CZ  1 
ATOM   658   N N   . VAL A  1 88  ? 15.837  51.127  33.851  1.00 4.03   ? 88  VAL A N   1 
ATOM   659   C CA  . VAL A  1 88  ? 15.003  49.986  33.498  1.00 3.71   ? 88  VAL A CA  1 
ATOM   660   C C   . VAL A  1 88  ? 13.606  50.484  33.189  1.00 5.12   ? 88  VAL A C   1 
ATOM   661   O O   . VAL A  1 88  ? 12.982  51.142  34.022  1.00 6.08   ? 88  VAL A O   1 
ATOM   662   C CB  . VAL A  1 88  ? 14.938  48.968  34.634  1.00 3.10   ? 88  VAL A CB  1 
ATOM   663   C CG1 . VAL A  1 88  ? 14.026  47.824  34.227  1.00 3.68   ? 88  VAL A CG1 1 
ATOM   664   C CG2 . VAL A  1 88  ? 16.319  48.401  34.908  1.00 2.15   ? 88  VAL A CG2 1 
ATOM   665   N N   . GLU A  1 89  ? 13.134  50.217  31.985  1.00 5.63   ? 89  GLU A N   1 
ATOM   666   C CA  . GLU A  1 89  ? 11.825  50.626  31.542  1.00 6.60   ? 89  GLU A CA  1 
ATOM   667   C C   . GLU A  1 89  ? 10.859  49.457  31.740  1.00 8.32   ? 89  GLU A C   1 
ATOM   668   O O   . GLU A  1 89  ? 11.099  48.326  31.254  1.00 7.94   ? 89  GLU A O   1 
ATOM   669   C CB  . GLU A  1 89  ? 11.939  50.999  30.102  1.00 5.62   ? 89  GLU A CB  1 
ATOM   670   C CG  . GLU A  1 89  ? 11.700  52.452  29.879  1.00 6.78   ? 89  GLU A CG  1 
ATOM   671   C CD  . GLU A  1 89  ? 11.673  52.840  28.421  1.00 8.36   ? 89  GLU A CD  1 
ATOM   672   O OE1 . GLU A  1 89  ? 11.957  54.019  28.137  1.00 9.90   ? 89  GLU A OE1 1 
ATOM   673   O OE2 . GLU A  1 89  ? 11.446  51.973  27.553  1.00 7.41   ? 89  GLU A OE2 1 
ATOM   674   N N   . ARG A  1 90  ? 9.772   49.687  32.462  1.00 9.34   ? 90  ARG A N   1 
ATOM   675   C CA  . ARG A  1 90  ? 8.828   48.637  32.805  1.00 10.52  ? 90  ARG A CA  1 
ATOM   676   C C   . ARG A  1 90  ? 7.704   48.549  31.832  1.00 12.34  ? 90  ARG A C   1 
ATOM   677   O O   . ARG A  1 90  ? 7.216   49.577  31.375  1.00 14.29  ? 90  ARG A O   1 
ATOM   678   C CB  . ARG A  1 90  ? 8.221   48.864  34.140  1.00 9.78   ? 90  ARG A CB  1 
ATOM   679   C CG  . ARG A  1 90  ? 9.235   49.072  35.248  1.00 9.25   ? 90  ARG A CG  1 
ATOM   680   C CD  . ARG A  1 90  ? 10.060  47.814  35.359  1.00 8.11   ? 90  ARG A CD  1 
ATOM   681   N NE  . ARG A  1 90  ? 10.890  47.851  36.531  1.00 6.62   ? 90  ARG A NE  1 
ATOM   682   C CZ  . ARG A  1 90  ? 11.671  46.846  36.848  1.00 6.09   ? 90  ARG A CZ  1 
ATOM   683   N NH1 . ARG A  1 90  ? 12.380  46.936  37.957  1.00 6.69   ? 90  ARG A NH1 1 
ATOM   684   N NH2 . ARG A  1 90  ? 11.758  45.793  36.058  1.00 5.98   ? 90  ARG A NH2 1 
ATOM   685   N N   . SER A  1 91  ? 7.189   47.360  31.568  1.00 14.16  ? 91  SER A N   1 
ATOM   686   C CA  . SER A  1 91  ? 6.124   47.188  30.587  1.00 15.64  ? 91  SER A CA  1 
ATOM   687   C C   . SER A  1 91  ? 4.858   47.940  30.986  1.00 17.28  ? 91  SER A C   1 
ATOM   688   O O   . SER A  1 91  ? 3.963   48.201  30.194  1.00 17.46  ? 91  SER A O   1 
ATOM   689   C CB  . SER A  1 91  ? 5.818   45.717  30.464  1.00 15.26  ? 91  SER A CB  1 
ATOM   690   O OG  . SER A  1 91  ? 5.208   45.211  31.653  1.00 17.53  ? 91  SER A OG  1 
ATOM   691   N N   . LYS A  1 92  ? 4.730   48.211  32.279  1.00 19.72  ? 92  LYS A N   1 
ATOM   692   C CA  . LYS A  1 92  ? 3.551   48.825  32.840  1.00 21.21  ? 92  LYS A CA  1 
ATOM   693   C C   . LYS A  1 92  ? 3.685   50.326  32.889  1.00 20.92  ? 92  LYS A C   1 
ATOM   694   O O   . LYS A  1 92  ? 2.932   50.926  33.645  1.00 21.06  ? 92  LYS A O   1 
ATOM   695   C CB  . LYS A  1 92  ? 3.336   48.290  34.243  1.00 23.43  ? 92  LYS A CB  1 
ATOM   696   C CG  . LYS A  1 92  ? 3.434   46.776  34.412  1.00 26.41  ? 92  LYS A CG  1 
ATOM   697   C CD  . LYS A  1 92  ? 2.078   46.066  34.459  1.00 29.13  ? 92  LYS A CD  1 
ATOM   698   C CE  . LYS A  1 92  ? 1.259   46.168  33.177  1.00 31.41  ? 92  LYS A CE  1 
ATOM   699   N NZ  . LYS A  1 92  ? 1.904   45.504  32.042  1.00 34.09  ? 92  LYS A NZ  1 
ATOM   700   N N   . ALA A  1 93  ? 4.621   50.927  32.151  1.00 20.24  ? 93  ALA A N   1 
ATOM   701   C CA  . ALA A  1 93  ? 4.839   52.353  32.236  1.00 20.28  ? 93  ALA A CA  1 
ATOM   702   C C   . ALA A  1 93  ? 3.714   53.009  31.510  1.00 21.45  ? 93  ALA A C   1 
ATOM   703   O O   . ALA A  1 93  ? 3.218   52.426  30.548  1.00 23.49  ? 93  ALA A O   1 
ATOM   704   C CB  . ALA A  1 93  ? 6.103   52.786  31.556  1.00 20.39  ? 93  ALA A CB  1 
ATOM   705   N N   . PHE A  1 94  ? 3.243   54.169  31.927  1.00 21.92  ? 94  PHE A N   1 
ATOM   706   C CA  . PHE A  1 94  ? 2.148   54.801  31.215  1.00 22.73  ? 94  PHE A CA  1 
ATOM   707   C C   . PHE A  1 94  ? 2.429   56.279  31.174  1.00 23.87  ? 94  PHE A C   1 
ATOM   708   O O   . PHE A  1 94  ? 3.411   56.732  31.767  1.00 24.33  ? 94  PHE A O   1 
ATOM   709   C CB  . PHE A  1 94  ? 0.816   54.541  31.931  1.00 22.09  ? 94  PHE A CB  1 
ATOM   710   C CG  . PHE A  1 94  ? 0.613   55.250  33.261  1.00 21.11  ? 94  PHE A CG  1 
ATOM   711   C CD1 . PHE A  1 94  ? -0.124  56.403  33.311  1.00 21.39  ? 94  PHE A CD1 1 
ATOM   712   C CD2 . PHE A  1 94  ? 1.178   54.759  34.399  1.00 20.32  ? 94  PHE A CD2 1 
ATOM   713   C CE1 . PHE A  1 94  ? -0.299  57.049  34.505  1.00 20.71  ? 94  PHE A CE1 1 
ATOM   714   C CE2 . PHE A  1 94  ? 1.002   55.405  35.588  1.00 19.94  ? 94  PHE A CE2 1 
ATOM   715   C CZ  . PHE A  1 94  ? 0.271   56.555  35.643  1.00 20.26  ? 94  PHE A CZ  1 
ATOM   716   N N   . SER A  1 95  ? 1.579   57.050  30.533  1.00 24.75  ? 95  SER A N   1 
ATOM   717   C CA  . SER A  1 95  ? 1.772   58.472  30.569  1.00 26.15  ? 95  SER A CA  1 
ATOM   718   C C   . SER A  1 95  ? 0.386   59.043  30.671  1.00 27.15  ? 95  SER A C   1 
ATOM   719   O O   . SER A  1 95  ? -0.605  58.434  30.221  1.00 28.07  ? 95  SER A O   1 
ATOM   720   C CB  . SER A  1 95  ? 2.443   58.963  29.301  1.00 25.87  ? 95  SER A CB  1 
ATOM   721   O OG  . SER A  1 95  ? 2.760   57.825  28.540  1.00 26.32  ? 95  SER A OG  1 
ATOM   722   N N   . ASN A  1 96  ? 0.282   60.170  31.321  1.00 27.47  ? 96  ASN A N   1 
ATOM   723   C CA  . ASN A  1 96  ? -0.961  60.849  31.410  1.00 28.86  ? 96  ASN A CA  1 
ATOM   724   C C   . ASN A  1 96  ? -0.559  62.292  31.546  1.00 28.49  ? 96  ASN A C   1 
ATOM   725   O O   . ASN A  1 96  ? -0.223  62.804  32.603  1.00 29.42  ? 96  ASN A O   1 
ATOM   726   C CB  . ASN A  1 96  ? -1.778  60.357  32.612  1.00 31.52  ? 96  ASN A CB  1 
ATOM   727   C CG  . ASN A  1 96  ? -1.115  60.495  33.973  1.00 33.78  ? 96  ASN A CG  1 
ATOM   728   O OD1 . ASN A  1 96  ? 0.023   60.070  34.173  1.00 35.57  ? 96  ASN A OD1 1 
ATOM   729   N ND2 . ASN A  1 96  ? -1.805  61.071  34.942  1.00 34.75  ? 96  ASN A ND2 1 
ATOM   730   N N   . CYS A  1 97  ? -0.490  62.910  30.381  1.00 27.04  ? 97  CYS A N   1 
ATOM   731   C CA  . CYS A  1 97  ? -0.241  64.321  30.265  1.00 25.99  ? 97  CYS A CA  1 
ATOM   732   C C   . CYS A  1 97  ? -0.667  64.645  28.842  1.00 25.35  ? 97  CYS A C   1 
ATOM   733   O O   . CYS A  1 97  ? -1.312  63.797  28.194  1.00 25.82  ? 97  CYS A O   1 
ATOM   734   C CB  . CYS A  1 97  ? 1.244   64.619  30.524  1.00 26.41  ? 97  CYS A CB  1 
ATOM   735   S SG  . CYS A  1 97  ? 1.726   66.371  30.617  1.00 27.52  ? 97  CYS A SG  1 
ATOM   736   N N   . TYR A  1 98  ? -0.365  65.835  28.317  1.00 23.35  ? 98  TYR A N   1 
ATOM   737   C CA  . TYR A  1 98  ? -0.826  66.226  26.997  1.00 20.94  ? 98  TYR A CA  1 
ATOM   738   C C   . TYR A  1 98  ? -0.365  65.213  25.969  1.00 19.17  ? 98  TYR A C   1 
ATOM   739   O O   . TYR A  1 98  ? 0.736   64.691  26.138  1.00 20.28  ? 98  TYR A O   1 
ATOM   740   C CB  . TYR A  1 98  ? -0.265  67.587  26.688  1.00 20.20  ? 98  TYR A CB  1 
ATOM   741   C CG  . TYR A  1 98  ? -1.188  68.352  25.764  1.00 20.09  ? 98  TYR A CG  1 
ATOM   742   C CD1 . TYR A  1 98  ? -1.908  69.418  26.242  1.00 19.56  ? 98  TYR A CD1 1 
ATOM   743   C CD2 . TYR A  1 98  ? -1.282  68.013  24.437  1.00 20.25  ? 98  TYR A CD2 1 
ATOM   744   C CE1 . TYR A  1 98  ? -2.700  70.155  25.400  1.00 19.61  ? 98  TYR A CE1 1 
ATOM   745   C CE2 . TYR A  1 98  ? -2.072  68.749  23.593  1.00 20.85  ? 98  TYR A CE2 1 
ATOM   746   C CZ  . TYR A  1 98  ? -2.777  69.826  24.070  1.00 20.41  ? 98  TYR A CZ  1 
ATOM   747   O OH  . TYR A  1 98  ? -3.491  70.610  23.190  1.00 20.82  ? 98  TYR A OH  1 
ATOM   748   N N   . PRO A  1 99  ? -1.209  64.764  25.042  1.00 17.26  ? 99  PRO A N   1 
ATOM   749   C CA  . PRO A  1 99  ? -0.798  63.817  24.017  1.00 17.34  ? 99  PRO A CA  1 
ATOM   750   C C   . PRO A  1 99  ? 0.340   64.392  23.168  1.00 17.23  ? 99  PRO A C   1 
ATOM   751   O O   . PRO A  1 99  ? 0.206   65.479  22.589  1.00 18.42  ? 99  PRO A O   1 
ATOM   752   C CB  . PRO A  1 99  ? -2.065  63.522  23.231  1.00 17.18  ? 99  PRO A CB  1 
ATOM   753   C CG  . PRO A  1 99  ? -3.096  64.472  23.762  1.00 16.98  ? 99  PRO A CG  1 
ATOM   754   C CD  . PRO A  1 99  ? -2.647  64.702  25.187  1.00 16.78  ? 99  PRO A CD  1 
ATOM   755   N N   . TYR A  1 100 ? 1.485   63.720  23.117  1.00 16.08  ? 100 TYR A N   1 
ATOM   756   C CA  . TYR A  1 100 ? 2.611   64.209  22.348  1.00 15.30  ? 100 TYR A CA  1 
ATOM   757   C C   . TYR A  1 100 ? 3.082   63.113  21.435  1.00 15.85  ? 100 TYR A C   1 
ATOM   758   O O   . TYR A  1 100 ? 2.675   61.967  21.654  1.00 16.28  ? 100 TYR A O   1 
ATOM   759   C CB  . TYR A  1 100 ? 3.783   64.607  23.239  1.00 14.49  ? 100 TYR A CB  1 
ATOM   760   C CG  . TYR A  1 100 ? 4.479   63.477  23.965  1.00 13.92  ? 100 TYR A CG  1 
ATOM   761   C CD1 . TYR A  1 100 ? 3.989   63.020  25.159  1.00 13.50  ? 100 TYR A CD1 1 
ATOM   762   C CD2 . TYR A  1 100 ? 5.574   62.878  23.392  1.00 13.91  ? 100 TYR A CD2 1 
ATOM   763   C CE1 . TYR A  1 100 ? 4.594   61.943  25.780  1.00 14.11  ? 100 TYR A CE1 1 
ATOM   764   C CE2 . TYR A  1 100 ? 6.171   61.800  24.012  1.00 14.36  ? 100 TYR A CE2 1 
ATOM   765   C CZ  . TYR A  1 100 ? 5.686   61.329  25.204  1.00 13.97  ? 100 TYR A CZ  1 
ATOM   766   O OH  . TYR A  1 100 ? 6.298   60.239  25.793  1.00 13.49  ? 100 TYR A OH  1 
ATOM   767   N N   . ASP A  1 101 ? 3.928   63.424  20.468  1.00 16.41  ? 101 ASP A N   1 
ATOM   768   C CA  . ASP A  1 101 ? 4.585   62.386  19.701  1.00 17.61  ? 101 ASP A CA  1 
ATOM   769   C C   . ASP A  1 101 ? 6.000   62.875  19.479  1.00 16.80  ? 101 ASP A C   1 
ATOM   770   O O   . ASP A  1 101 ? 6.278   64.090  19.504  1.00 16.53  ? 101 ASP A O   1 
ATOM   771   C CB  . ASP A  1 101 ? 3.887   62.120  18.342  1.00 19.30  ? 101 ASP A CB  1 
ATOM   772   C CG  . ASP A  1 101 ? 4.006   63.215  17.298  1.00 21.47  ? 101 ASP A CG  1 
ATOM   773   O OD1 . ASP A  1 101 ? 4.980   63.223  16.542  1.00 22.34  ? 101 ASP A OD1 1 
ATOM   774   O OD2 . ASP A  1 101 ? 3.126   64.071  17.235  1.00 22.83  ? 101 ASP A OD2 1 
ATOM   775   N N   . VAL A  1 102 ? 6.958   61.948  19.386  1.00 15.26  ? 102 VAL A N   1 
ATOM   776   C CA  . VAL A  1 102 ? 8.342   62.374  19.200  1.00 13.34  ? 102 VAL A CA  1 
ATOM   777   C C   . VAL A  1 102 ? 8.792   61.840  17.869  1.00 11.42  ? 102 VAL A C   1 
ATOM   778   O O   . VAL A  1 102 ? 8.993   60.635  17.757  1.00 11.47  ? 102 VAL A O   1 
ATOM   779   C CB  . VAL A  1 102 ? 9.308   61.820  20.281  1.00 12.53  ? 102 VAL A CB  1 
ATOM   780   C CG1 . VAL A  1 102 ? 10.635  62.505  20.118  1.00 12.85  ? 102 VAL A CG1 1 
ATOM   781   C CG2 . VAL A  1 102 ? 8.851   62.119  21.671  1.00 12.51  ? 102 VAL A CG2 1 
ATOM   782   N N   . PRO A  1 103 ? 8.883   62.625  16.810  1.00 10.61  ? 103 PRO A N   1 
ATOM   783   C CA  . PRO A  1 103 ? 9.355   62.143  15.532  1.00 10.89  ? 103 PRO A CA  1 
ATOM   784   C C   . PRO A  1 103 ? 10.775  61.702  15.861  1.00 11.99  ? 103 PRO A C   1 
ATOM   785   O O   . PRO A  1 103 ? 11.526  62.465  16.471  1.00 13.73  ? 103 PRO A O   1 
ATOM   786   C CB  . PRO A  1 103 ? 9.286   63.343  14.641  1.00 11.11  ? 103 PRO A CB  1 
ATOM   787   C CG  . PRO A  1 103 ? 8.327   64.288  15.318  1.00 10.98  ? 103 PRO A CG  1 
ATOM   788   C CD  . PRO A  1 103 ? 8.610   64.055  16.784  1.00 11.06  ? 103 PRO A CD  1 
ATOM   789   N N   . ASP A  1 104 ? 11.113  60.467  15.547  1.00 11.78  ? 104 ASP A N   1 
ATOM   790   C CA  . ASP A  1 104 ? 12.378  59.847  15.917  1.00 12.21  ? 104 ASP A CA  1 
ATOM   791   C C   . ASP A  1 104 ? 12.646  59.777  17.412  1.00 10.75  ? 104 ASP A C   1 
ATOM   792   O O   . ASP A  1 104 ? 13.677  60.083  18.017  1.00 10.88  ? 104 ASP A O   1 
ATOM   793   C CB  . ASP A  1 104 ? 13.584  60.520  15.255  1.00 15.58  ? 104 ASP A CB  1 
ATOM   794   C CG  . ASP A  1 104 ? 14.870  59.653  15.331  1.00 18.68  ? 104 ASP A CG  1 
ATOM   795   O OD1 . ASP A  1 104 ? 14.819  58.431  15.601  1.00 19.72  ? 104 ASP A OD1 1 
ATOM   796   O OD2 . ASP A  1 104 ? 15.951  60.212  15.133  1.00 19.94  ? 104 ASP A OD2 1 
ATOM   797   N N   . TYR A  1 105 ? 11.610  59.244  18.024  1.00 9.88   ? 105 TYR A N   1 
ATOM   798   C CA  . TYR A  1 105 ? 11.573  58.835  19.409  1.00 9.15   ? 105 TYR A CA  1 
ATOM   799   C C   . TYR A  1 105 ? 12.773  57.960  19.709  1.00 8.64   ? 105 TYR A C   1 
ATOM   800   O O   . TYR A  1 105 ? 13.433  58.058  20.751  1.00 9.06   ? 105 TYR A O   1 
ATOM   801   C CB  . TYR A  1 105 ? 10.302  58.072  19.581  1.00 9.89   ? 105 TYR A CB  1 
ATOM   802   C CG  . TYR A  1 105 ? 9.953   57.698  20.985  1.00 10.13  ? 105 TYR A CG  1 
ATOM   803   C CD1 . TYR A  1 105 ? 10.318  56.491  21.519  1.00 9.44   ? 105 TYR A CD1 1 
ATOM   804   C CD2 . TYR A  1 105 ? 9.273   58.633  21.704  1.00 11.49  ? 105 TYR A CD2 1 
ATOM   805   C CE1 . TYR A  1 105 ? 9.961   56.208  22.804  1.00 10.70  ? 105 TYR A CE1 1 
ATOM   806   C CE2 . TYR A  1 105 ? 8.911   58.352  22.986  1.00 12.45  ? 105 TYR A CE2 1 
ATOM   807   C CZ  . TYR A  1 105 ? 9.271   57.146  23.528  1.00 12.14  ? 105 TYR A CZ  1 
ATOM   808   O OH  . TYR A  1 105 ? 8.877   56.882  24.820  1.00 14.56  ? 105 TYR A OH  1 
ATOM   809   N N   . ALA A  1 106 ? 13.044  57.089  18.752  1.00 7.59   ? 106 ALA A N   1 
ATOM   810   C CA  . ALA A  1 106 ? 14.141  56.167  18.832  1.00 6.46   ? 106 ALA A CA  1 
ATOM   811   C C   . ALA A  1 106 ? 15.454  56.856  19.096  1.00 5.22   ? 106 ALA A C   1 
ATOM   812   O O   . ALA A  1 106 ? 16.159  56.412  19.996  1.00 5.64   ? 106 ALA A O   1 
ATOM   813   C CB  . ALA A  1 106 ? 14.227  55.421  17.547  1.00 7.21   ? 106 ALA A CB  1 
ATOM   814   N N   . SER A  1 107 ? 15.818  57.916  18.392  1.00 4.05   ? 107 SER A N   1 
ATOM   815   C CA  . SER A  1 107 ? 17.071  58.520  18.735  1.00 4.12   ? 107 SER A CA  1 
ATOM   816   C C   . SER A  1 107 ? 17.030  59.310  20.022  1.00 5.42   ? 107 SER A C   1 
ATOM   817   O O   . SER A  1 107 ? 18.020  59.193  20.770  1.00 7.21   ? 107 SER A O   1 
ATOM   818   C CB  . SER A  1 107 ? 17.526  59.381  17.615  1.00 2.90   ? 107 SER A CB  1 
ATOM   819   O OG  . SER A  1 107 ? 17.778  58.427  16.611  1.00 2.14   ? 107 SER A OG  1 
ATOM   820   N N   . LEU A  1 108 ? 15.936  60.031  20.348  1.00 5.29   ? 108 LEU A N   1 
ATOM   821   C CA  . LEU A  1 108 ? 15.868  60.786  21.612  1.00 4.78   ? 108 LEU A CA  1 
ATOM   822   C C   . LEU A  1 108 ? 16.042  59.840  22.809  1.00 4.13   ? 108 LEU A C   1 
ATOM   823   O O   . LEU A  1 108 ? 16.888  60.115  23.668  1.00 5.01   ? 108 LEU A O   1 
ATOM   824   C CB  . LEU A  1 108 ? 14.524  61.518  21.826  1.00 4.16   ? 108 LEU A CB  1 
ATOM   825   C CG  . LEU A  1 108 ? 14.434  62.989  22.279  1.00 3.80   ? 108 LEU A CG  1 
ATOM   826   C CD1 . LEU A  1 108 ? 13.051  63.215  22.833  1.00 3.20   ? 108 LEU A CD1 1 
ATOM   827   C CD2 . LEU A  1 108 ? 15.398  63.332  23.387  1.00 3.21   ? 108 LEU A CD2 1 
ATOM   828   N N   . ARG A  1 109 ? 15.323  58.708  22.845  1.00 2.40   ? 109 ARG A N   1 
ATOM   829   C CA  . ARG A  1 109 ? 15.468  57.764  23.929  1.00 2.00   ? 109 ARG A CA  1 
ATOM   830   C C   . ARG A  1 109 ? 16.903  57.297  23.994  1.00 2.44   ? 109 ARG A C   1 
ATOM   831   O O   . ARG A  1 109 ? 17.437  57.186  25.100  1.00 2.88   ? 109 ARG A O   1 
ATOM   832   C CB  . ARG A  1 109 ? 14.583  56.548  23.738  1.00 2.00   ? 109 ARG A CB  1 
ATOM   833   C CG  . ARG A  1 109 ? 14.573  55.575  24.921  1.00 2.00   ? 109 ARG A CG  1 
ATOM   834   C CD  . ARG A  1 109 ? 13.613  54.442  24.692  1.00 2.00   ? 109 ARG A CD  1 
ATOM   835   N NE  . ARG A  1 109 ? 14.288  53.183  24.379  1.00 2.27   ? 109 ARG A NE  1 
ATOM   836   C CZ  . ARG A  1 109 ? 14.288  52.185  25.266  1.00 3.23   ? 109 ARG A CZ  1 
ATOM   837   N NH1 . ARG A  1 109 ? 14.863  51.013  25.003  1.00 4.46   ? 109 ARG A NH1 1 
ATOM   838   N NH2 . ARG A  1 109 ? 13.740  52.377  26.446  1.00 4.38   ? 109 ARG A NH2 1 
ATOM   839   N N   . SER A  1 110 ? 17.548  57.057  22.835  1.00 2.86   ? 110 SER A N   1 
ATOM   840   C CA  . SER A  1 110 ? 18.933  56.593  22.836  1.00 3.09   ? 110 SER A CA  1 
ATOM   841   C C   . SER A  1 110 ? 19.825  57.648  23.416  1.00 3.68   ? 110 SER A C   1 
ATOM   842   O O   . SER A  1 110 ? 20.507  57.319  24.414  1.00 4.83   ? 110 SER A O   1 
ATOM   843   C CB  . SER A  1 110 ? 19.591  56.286  21.460  1.00 2.87   ? 110 SER A CB  1 
ATOM   844   O OG  . SER A  1 110 ? 21.015  56.029  21.548  1.00 2.57   ? 110 SER A OG  1 
ATOM   845   N N   . LEU A  1 111 ? 19.803  58.885  22.877  1.00 2.09   ? 111 LEU A N   1 
ATOM   846   C CA  . LEU A  1 111 ? 20.856  59.766  23.315  1.00 3.20   ? 111 LEU A CA  1 
ATOM   847   C C   . LEU A  1 111 ? 20.669  60.247  24.732  1.00 4.29   ? 111 LEU A C   1 
ATOM   848   O O   . LEU A  1 111 ? 21.694  60.521  25.394  1.00 5.67   ? 111 LEU A O   1 
ATOM   849   C CB  . LEU A  1 111 ? 21.010  60.926  22.369  1.00 2.82   ? 111 LEU A CB  1 
ATOM   850   C CG  . LEU A  1 111 ? 19.890  61.845  22.027  1.00 3.63   ? 111 LEU A CG  1 
ATOM   851   C CD1 . LEU A  1 111 ? 19.968  63.154  22.803  1.00 3.56   ? 111 LEU A CD1 1 
ATOM   852   C CD2 . LEU A  1 111 ? 19.997  62.109  20.535  1.00 2.97   ? 111 LEU A CD2 1 
ATOM   853   N N   . VAL A  1 112 ? 19.422  60.249  25.244  1.00 3.39   ? 112 VAL A N   1 
ATOM   854   C CA  . VAL A  1 112 ? 19.214  60.556  26.645  1.00 3.33   ? 112 VAL A CA  1 
ATOM   855   C C   . VAL A  1 112 ? 19.762  59.413  27.465  1.00 4.14   ? 112 VAL A C   1 
ATOM   856   O O   . VAL A  1 112 ? 20.599  59.616  28.354  1.00 4.77   ? 112 VAL A O   1 
ATOM   857   C CB  . VAL A  1 112 ? 17.740  60.746  26.900  1.00 2.80   ? 112 VAL A CB  1 
ATOM   858   C CG1 . VAL A  1 112 ? 17.447  60.926  28.369  1.00 3.27   ? 112 VAL A CG1 1 
ATOM   859   C CG2 . VAL A  1 112 ? 17.313  62.028  26.199  1.00 3.57   ? 112 VAL A CG2 1 
ATOM   860   N N   . ALA A  1 113 ? 19.411  58.184  27.073  1.00 5.27   ? 113 ALA A N   1 
ATOM   861   C CA  . ALA A  1 113 ? 19.815  56.984  27.795  1.00 6.68   ? 113 ALA A CA  1 
ATOM   862   C C   . ALA A  1 113 ? 21.304  56.766  27.872  1.00 8.60   ? 113 ALA A C   1 
ATOM   863   O O   . ALA A  1 113 ? 21.741  56.145  28.839  1.00 9.46   ? 113 ALA A O   1 
ATOM   864   C CB  . ALA A  1 113 ? 19.269  55.736  27.180  1.00 5.25   ? 113 ALA A CB  1 
ATOM   865   N N   . SER A  1 114 ? 22.096  57.203  26.894  1.00 10.16  ? 114 SER A N   1 
ATOM   866   C CA  . SER A  1 114 ? 23.531  57.056  27.016  1.00 12.67  ? 114 SER A CA  1 
ATOM   867   C C   . SER A  1 114 ? 24.102  58.194  27.827  1.00 14.25  ? 114 SER A C   1 
ATOM   868   O O   . SER A  1 114 ? 25.120  57.998  28.517  1.00 16.32  ? 114 SER A O   1 
ATOM   869   C CB  . SER A  1 114 ? 24.234  57.088  25.698  1.00 13.66  ? 114 SER A CB  1 
ATOM   870   O OG  . SER A  1 114 ? 23.469  56.369  24.744  1.00 16.82  ? 114 SER A OG  1 
ATOM   871   N N   . SER A  1 115 ? 23.484  59.388  27.771  1.00 13.79  ? 115 SER A N   1 
ATOM   872   C CA  . SER A  1 115 ? 23.978  60.514  28.545  1.00 13.19  ? 115 SER A CA  1 
ATOM   873   C C   . SER A  1 115 ? 23.938  60.109  29.995  1.00 13.08  ? 115 SER A C   1 
ATOM   874   O O   . SER A  1 115 ? 24.859  60.414  30.739  1.00 13.38  ? 115 SER A O   1 
ATOM   875   C CB  . SER A  1 115 ? 23.098  61.706  28.343  1.00 13.84  ? 115 SER A CB  1 
ATOM   876   O OG  . SER A  1 115 ? 23.658  62.915  28.797  1.00 14.63  ? 115 SER A OG  1 
ATOM   877   N N   . GLY A  1 116 ? 22.890  59.405  30.412  1.00 13.27  ? 116 GLY A N   1 
ATOM   878   C CA  . GLY A  1 116 ? 22.855  58.885  31.767  1.00 14.46  ? 116 GLY A CA  1 
ATOM   879   C C   . GLY A  1 116 ? 22.414  59.864  32.850  1.00 14.31  ? 116 GLY A C   1 
ATOM   880   O O   . GLY A  1 116 ? 22.307  59.491  34.028  1.00 15.21  ? 116 GLY A O   1 
ATOM   881   N N   . THR A  1 117 ? 22.086  61.099  32.482  1.00 13.08  ? 117 THR A N   1 
ATOM   882   C CA  . THR A  1 117 ? 21.711  62.089  33.453  1.00 12.60  ? 117 THR A CA  1 
ATOM   883   C C   . THR A  1 117 ? 20.459  62.755  32.933  1.00 12.71  ? 117 THR A C   1 
ATOM   884   O O   . THR A  1 117 ? 20.203  62.726  31.728  1.00 11.83  ? 117 THR A O   1 
ATOM   885   C CB  . THR A  1 117 ? 22.878  63.095  33.620  1.00 12.76  ? 117 THR A CB  1 
ATOM   886   O OG1 . THR A  1 117 ? 22.481  64.067  34.572  1.00 12.32  ? 117 THR A OG1 1 
ATOM   887   C CG2 . THR A  1 117 ? 23.265  63.752  32.304  1.00 12.70  ? 117 THR A CG2 1 
ATOM   888   N N   . LEU A  1 118 ? 19.690  63.302  33.865  1.00 13.05  ? 118 LEU A N   1 
ATOM   889   C CA  . LEU A  1 118 ? 18.495  64.038  33.563  1.00 13.87  ? 118 LEU A CA  1 
ATOM   890   C C   . LEU A  1 118 ? 18.569  65.423  34.250  1.00 15.71  ? 118 LEU A C   1 
ATOM   891   O O   . LEU A  1 118 ? 17.542  66.084  34.485  1.00 15.37  ? 118 LEU A O   1 
ATOM   892   C CB  . LEU A  1 118 ? 17.376  63.127  34.054  1.00 12.70  ? 118 LEU A CB  1 
ATOM   893   C CG  . LEU A  1 118 ? 16.128  62.898  33.229  1.00 12.45  ? 118 LEU A CG  1 
ATOM   894   C CD1 . LEU A  1 118 ? 16.511  62.548  31.818  1.00 12.79  ? 118 LEU A CD1 1 
ATOM   895   C CD2 . LEU A  1 118 ? 15.317  61.753  33.817  1.00 12.28  ? 118 LEU A CD2 1 
ATOM   896   N N   . GLU A  1 119 ? 19.799  65.809  34.643  1.00 17.88  ? 119 GLU A N   1 
ATOM   897   C CA  . GLU A  1 119 ? 20.125  67.064  35.325  1.00 21.01  ? 119 GLU A CA  1 
ATOM   898   C C   . GLU A  1 119 ? 19.669  68.272  34.563  1.00 21.49  ? 119 GLU A C   1 
ATOM   899   O O   . GLU A  1 119 ? 20.199  68.519  33.477  1.00 23.27  ? 119 GLU A O   1 
ATOM   900   C CB  . GLU A  1 119 ? 21.602  67.250  35.510  1.00 23.12  ? 119 GLU A CB  1 
ATOM   901   C CG  . GLU A  1 119 ? 22.217  66.428  36.606  1.00 26.87  ? 119 GLU A CG  1 
ATOM   902   C CD  . GLU A  1 119 ? 23.726  66.339  36.492  1.00 28.83  ? 119 GLU A CD  1 
ATOM   903   O OE1 . GLU A  1 119 ? 24.256  65.223  36.630  1.00 29.30  ? 119 GLU A OE1 1 
ATOM   904   O OE2 . GLU A  1 119 ? 24.410  67.344  36.173  1.00 29.57  ? 119 GLU A OE2 1 
ATOM   905   N N   . PHE A  1 120 ? 18.755  69.046  35.129  1.00 20.79  ? 120 PHE A N   1 
ATOM   906   C CA  . PHE A  1 120 ? 18.215  70.164  34.394  1.00 20.00  ? 120 PHE A CA  1 
ATOM   907   C C   . PHE A  1 120 ? 18.637  71.484  34.965  1.00 19.25  ? 120 PHE A C   1 
ATOM   908   O O   . PHE A  1 120 ? 18.571  71.738  36.173  1.00 19.53  ? 120 PHE A O   1 
ATOM   909   C CB  . PHE A  1 120 ? 16.691  70.070  34.372  1.00 20.15  ? 120 PHE A CB  1 
ATOM   910   C CG  . PHE A  1 120 ? 16.048  71.010  33.377  1.00 20.18  ? 120 PHE A CG  1 
ATOM   911   C CD1 . PHE A  1 120 ? 16.275  70.858  32.038  1.00 20.38  ? 120 PHE A CD1 1 
ATOM   912   C CD2 . PHE A  1 120 ? 15.238  72.021  33.817  1.00 20.72  ? 120 PHE A CD2 1 
ATOM   913   C CE1 . PHE A  1 120 ? 15.693  71.720  31.142  1.00 20.76  ? 120 PHE A CE1 1 
ATOM   914   C CE2 . PHE A  1 120 ? 14.655  72.887  32.918  1.00 20.59  ? 120 PHE A CE2 1 
ATOM   915   C CZ  . PHE A  1 120 ? 14.883  72.736  31.583  1.00 20.66  ? 120 PHE A CZ  1 
ATOM   916   N N   . ILE A  1 121 ? 19.053  72.353  34.077  1.00 18.91  ? 121 ILE A N   1 
ATOM   917   C CA  . ILE A  1 121 ? 19.416  73.704  34.453  1.00 19.52  ? 121 ILE A CA  1 
ATOM   918   C C   . ILE A  1 121 ? 18.349  74.644  33.888  1.00 19.82  ? 121 ILE A C   1 
ATOM   919   O O   . ILE A  1 121 ? 18.109  74.615  32.677  1.00 20.70  ? 121 ILE A O   1 
ATOM   920   C CB  . ILE A  1 121 ? 20.804  74.018  33.875  1.00 18.48  ? 121 ILE A CB  1 
ATOM   921   C CG1 . ILE A  1 121 ? 21.843  72.983  34.276  1.00 18.24  ? 121 ILE A CG1 1 
ATOM   922   C CG2 . ILE A  1 121 ? 21.207  75.368  34.366  1.00 18.27  ? 121 ILE A CG2 1 
ATOM   923   C CD1 . ILE A  1 121 ? 21.999  72.716  35.765  1.00 18.32  ? 121 ILE A CD1 1 
ATOM   924   N N   . THR A  1 122 ? 17.666  75.440  34.709  1.00 19.32  ? 122 THR A N   1 
ATOM   925   C CA  . THR A  1 122 ? 16.673  76.324  34.156  1.00 20.36  ? 122 THR A CA  1 
ATOM   926   C C   . THR A  1 122 ? 17.349  77.564  33.605  1.00 21.94  ? 122 THR A C   1 
ATOM   927   O O   . THR A  1 122 ? 18.261  78.078  34.253  1.00 23.01  ? 122 THR A O   1 
ATOM   928   C CB  . THR A  1 122 ? 15.688  76.694  35.229  1.00 20.01  ? 122 THR A CB  1 
ATOM   929   O OG1 . THR A  1 122 ? 15.083  75.489  35.672  1.00 20.53  ? 122 THR A OG1 1 
ATOM   930   C CG2 . THR A  1 122 ? 14.587  77.590  34.719  1.00 21.32  ? 122 THR A CG2 1 
ATOM   931   N N   . GLU A  1 123 ? 16.967  78.067  32.437  1.00 23.12  ? 123 GLU A N   1 
ATOM   932   C CA  . GLU A  1 123 ? 17.602  79.259  31.931  1.00 24.47  ? 123 GLU A CA  1 
ATOM   933   C C   . GLU A  1 123 ? 16.616  80.399  31.881  1.00 26.07  ? 123 GLU A C   1 
ATOM   934   O O   . GLU A  1 123 ? 15.398  80.209  31.734  1.00 26.27  ? 123 GLU A O   1 
ATOM   935   C CB  . GLU A  1 123 ? 18.157  79.023  30.544  1.00 24.79  ? 123 GLU A CB  1 
ATOM   936   C CG  . GLU A  1 123 ? 19.480  78.305  30.684  1.00 24.79  ? 123 GLU A CG  1 
ATOM   937   C CD  . GLU A  1 123 ? 20.232  78.099  29.396  1.00 24.30  ? 123 GLU A CD  1 
ATOM   938   O OE1 . GLU A  1 123 ? 21.397  78.471  29.331  1.00 24.52  ? 123 GLU A OE1 1 
ATOM   939   O OE2 . GLU A  1 123 ? 19.693  77.524  28.466  1.00 24.15  ? 123 GLU A OE2 1 
ATOM   940   N N   . GLY A  1 124 ? 17.141  81.620  31.976  1.00 27.21  ? 124 GLY A N   1 
ATOM   941   C CA  . GLY A  1 124 ? 16.296  82.798  32.002  1.00 28.26  ? 124 GLY A CA  1 
ATOM   942   C C   . GLY A  1 124 ? 15.788  83.176  30.627  1.00 29.23  ? 124 GLY A C   1 
ATOM   943   O O   . GLY A  1 124 ? 16.257  84.166  30.065  1.00 29.94  ? 124 GLY A O   1 
ATOM   944   N N   . PHE A  1 125 ? 14.894  82.382  30.035  1.00 29.25  ? 125 PHE A N   1 
ATOM   945   C CA  . PHE A  1 125 ? 14.305  82.776  28.766  1.00 29.83  ? 125 PHE A CA  1 
ATOM   946   C C   . PHE A  1 125 ? 13.272  83.864  29.036  1.00 30.30  ? 125 PHE A C   1 
ATOM   947   O O   . PHE A  1 125 ? 12.573  83.818  30.050  1.00 30.26  ? 125 PHE A O   1 
ATOM   948   C CB  . PHE A  1 125 ? 13.631  81.590  28.116  1.00 29.67  ? 125 PHE A CB  1 
ATOM   949   C CG  . PHE A  1 125 ? 14.633  80.689  27.433  1.00 29.59  ? 125 PHE A CG  1 
ATOM   950   C CD1 . PHE A  1 125 ? 15.021  79.515  28.042  1.00 29.64  ? 125 PHE A CD1 1 
ATOM   951   C CD2 . PHE A  1 125 ? 15.159  81.058  26.217  1.00 29.25  ? 125 PHE A CD2 1 
ATOM   952   C CE1 . PHE A  1 125 ? 15.949  78.705  27.442  1.00 28.67  ? 125 PHE A CE1 1 
ATOM   953   C CE2 . PHE A  1 125 ? 16.090  80.241  25.620  1.00 29.04  ? 125 PHE A CE2 1 
ATOM   954   C CZ  . PHE A  1 125 ? 16.478  79.072  26.232  1.00 29.01  ? 125 PHE A CZ  1 
ATOM   955   N N   . THR A  1 126 ? 13.162  84.877  28.198  1.00 30.83  ? 126 THR A N   1 
ATOM   956   C CA  . THR A  1 126 ? 12.195  85.913  28.473  1.00 32.23  ? 126 THR A CA  1 
ATOM   957   C C   . THR A  1 126 ? 11.252  86.059  27.306  1.00 31.65  ? 126 THR A C   1 
ATOM   958   O O   . THR A  1 126 ? 11.610  86.564  26.234  1.00 30.80  ? 126 THR A O   1 
ATOM   959   C CB  . THR A  1 126 ? 12.987  87.211  28.789  1.00 33.91  ? 126 THR A CB  1 
ATOM   960   O OG1 . THR A  1 126 ? 14.078  87.236  27.857  1.00 35.36  ? 126 THR A OG1 1 
ATOM   961   C CG2 . THR A  1 126 ? 13.497  87.292  30.247  1.00 34.07  ? 126 THR A CG2 1 
ATOM   962   N N   . TRP A  1 127 ? 10.044  85.568  27.484  1.00 31.43  ? 127 TRP A N   1 
ATOM   963   C CA  . TRP A  1 127 ? 9.097   85.587  26.402  1.00 32.31  ? 127 TRP A CA  1 
ATOM   964   C C   . TRP A  1 127 ? 8.316   86.889  26.435  1.00 33.08  ? 127 TRP A C   1 
ATOM   965   O O   . TRP A  1 127 ? 7.378   87.071  27.206  1.00 33.37  ? 127 TRP A O   1 
ATOM   966   C CB  . TRP A  1 127 ? 8.225   84.321  26.555  1.00 31.61  ? 127 TRP A CB  1 
ATOM   967   C CG  . TRP A  1 127 ? 9.115   83.093  26.561  1.00 30.76  ? 127 TRP A CG  1 
ATOM   968   C CD1 . TRP A  1 127 ? 9.369   82.437  27.727  1.00 30.57  ? 127 TRP A CD1 1 
ATOM   969   C CD2 . TRP A  1 127 ? 9.824   82.594  25.495  1.00 30.27  ? 127 TRP A CD2 1 
ATOM   970   N NE1 . TRP A  1 127 ? 10.253  81.532  27.411  1.00 31.05  ? 127 TRP A NE1 1 
ATOM   971   C CE2 . TRP A  1 127 ? 10.553  81.584  26.099  1.00 30.35  ? 127 TRP A CE2 1 
ATOM   972   C CE3 . TRP A  1 127 ? 9.964   82.840  24.148  1.00 29.27  ? 127 TRP A CE3 1 
ATOM   973   C CZ2 . TRP A  1 127 ? 11.436  80.810  25.375  1.00 29.07  ? 127 TRP A CZ2 1 
ATOM   974   C CZ3 . TRP A  1 127 ? 10.842  82.068  23.430  1.00 28.82  ? 127 TRP A CZ3 1 
ATOM   975   C CH2 . TRP A  1 127 ? 11.569  81.067  24.034  1.00 28.79  ? 127 TRP A CH2 1 
ATOM   976   N N   . THR A  1 128 ? 8.720   87.868  25.639  1.00 34.42  ? 128 THR A N   1 
ATOM   977   C CA  . THR A  1 128 ? 8.045   89.161  25.639  1.00 35.32  ? 128 THR A CA  1 
ATOM   978   C C   . THR A  1 128 ? 6.818   89.233  24.763  1.00 35.00  ? 128 THR A C   1 
ATOM   979   O O   . THR A  1 128 ? 6.902   89.126  23.530  1.00 35.03  ? 128 THR A O   1 
ATOM   980   C CB  . THR A  1 128 ? 9.006   90.283  25.201  1.00 36.72  ? 128 THR A CB  1 
ATOM   981   O OG1 . THR A  1 128 ? 10.217  89.697  24.668  1.00 38.26  ? 128 THR A OG1 1 
ATOM   982   C CG2 . THR A  1 128 ? 9.274   91.213  26.377  1.00 36.46  ? 128 THR A CG2 1 
ATOM   983   N N   . GLY A  1 129 ? 5.663   89.393  25.397  1.00 34.20  ? 129 GLY A N   1 
ATOM   984   C CA  . GLY A  1 129 ? 4.472   89.626  24.613  1.00 33.85  ? 129 GLY A CA  1 
ATOM   985   C C   . GLY A  1 129 ? 3.623   88.405  24.414  1.00 33.15  ? 129 GLY A C   1 
ATOM   986   O O   . GLY A  1 129 ? 2.744   88.421  23.556  1.00 33.52  ? 129 GLY A O   1 
ATOM   987   N N   . VAL A  1 130 ? 3.842   87.359  25.198  1.00 32.84  ? 130 VAL A N   1 
ATOM   988   C CA  . VAL A  1 130 ? 3.001   86.174  25.126  1.00 32.36  ? 130 VAL A CA  1 
ATOM   989   C C   . VAL A  1 130 ? 2.715   85.739  26.538  1.00 32.46  ? 130 VAL A C   1 
ATOM   990   O O   . VAL A  1 130 ? 3.366   86.192  27.487  1.00 31.74  ? 130 VAL A O   1 
ATOM   991   C CB  . VAL A  1 130 ? 3.671   84.988  24.393  1.00 31.87  ? 130 VAL A CB  1 
ATOM   992   C CG1 . VAL A  1 130 ? 3.703   85.259  22.898  1.00 32.16  ? 130 VAL A CG1 1 
ATOM   993   C CG2 . VAL A  1 130 ? 5.077   84.779  24.911  1.00 31.43  ? 130 VAL A CG2 1 
ATOM   994   N N   . THR A  1 131 ? 1.689   84.936  26.682  1.00 33.38  ? 131 THR A N   1 
ATOM   995   C CA  . THR A  1 131 ? 1.334   84.341  27.952  1.00 35.24  ? 131 THR A CA  1 
ATOM   996   C C   . THR A  1 131 ? 2.074   83.032  28.154  1.00 35.34  ? 131 THR A C   1 
ATOM   997   O O   . THR A  1 131 ? 2.139   82.164  27.271  1.00 35.57  ? 131 THR A O   1 
ATOM   998   C CB  . THR A  1 131 ? -0.172  84.139  27.965  1.00 36.28  ? 131 THR A CB  1 
ATOM   999   O OG1 . THR A  1 131 ? -0.680  85.460  27.803  1.00 38.06  ? 131 THR A OG1 1 
ATOM   1000  C CG2 . THR A  1 131 ? -0.732  83.485  29.218  1.00 36.23  ? 131 THR A CG2 1 
ATOM   1001  N N   . GLN A  1 132 ? 2.668   82.919  29.335  1.00 35.25  ? 132 GLN A N   1 
ATOM   1002  C CA  . GLN A  1 132 ? 3.456   81.757  29.697  1.00 35.48  ? 132 GLN A CA  1 
ATOM   1003  C C   . GLN A  1 132 ? 2.701   80.803  30.577  1.00 34.59  ? 132 GLN A C   1 
ATOM   1004  O O   . GLN A  1 132 ? 1.586   81.085  31.004  1.00 35.17  ? 132 GLN A O   1 
ATOM   1005  C CB  . GLN A  1 132 ? 4.679   82.141  30.464  1.00 36.55  ? 132 GLN A CB  1 
ATOM   1006  C CG  . GLN A  1 132 ? 5.883   82.307  29.598  1.00 38.43  ? 132 GLN A CG  1 
ATOM   1007  C CD  . GLN A  1 132 ? 7.052   82.717  30.452  1.00 39.44  ? 132 GLN A CD  1 
ATOM   1008  O OE1 . GLN A  1 132 ? 7.789   83.624  30.094  1.00 41.02  ? 132 GLN A OE1 1 
ATOM   1009  N NE2 . GLN A  1 132 ? 7.260   82.137  31.627  1.00 39.80  ? 132 GLN A NE2 1 
ATOM   1010  N N   . ASN A  1 133 ? 3.332   79.656  30.805  1.00 33.05  ? 133 ASN A N   1 
ATOM   1011  C CA  . ASN A  1 133 ? 2.870   78.675  31.758  1.00 32.17  ? 133 ASN A CA  1 
ATOM   1012  C C   . ASN A  1 133 ? 1.545   78.030  31.512  1.00 31.25  ? 133 ASN A C   1 
ATOM   1013  O O   . ASN A  1 133 ? 0.982   77.453  32.441  1.00 30.60  ? 133 ASN A O   1 
ATOM   1014  C CB  . ASN A  1 133 ? 2.845   79.276  33.137  1.00 33.86  ? 133 ASN A CB  1 
ATOM   1015  C CG  . ASN A  1 133 ? 4.248   79.236  33.669  1.00 35.83  ? 133 ASN A CG  1 
ATOM   1016  O OD1 . ASN A  1 133 ? 5.204   79.709  33.028  1.00 37.32  ? 133 ASN A OD1 1 
ATOM   1017  N ND2 . ASN A  1 133 ? 4.480   78.532  34.763  1.00 36.45  ? 133 ASN A ND2 1 
ATOM   1018  N N   . GLY A  1 134 ? 1.070   78.065  30.268  1.00 31.17  ? 134 GLY A N   1 
ATOM   1019  C CA  . GLY A  1 134 ? -0.160  77.376  29.914  1.00 30.88  ? 134 GLY A CA  1 
ATOM   1020  C C   . GLY A  1 134 ? -0.089  75.884  30.268  1.00 29.83  ? 134 GLY A C   1 
ATOM   1021  O O   . GLY A  1 134 ? 0.972   75.262  30.216  1.00 30.38  ? 134 GLY A O   1 
ATOM   1022  N N   . GLY A  1 135 ? -1.218  75.308  30.615  1.00 28.87  ? 135 GLY A N   1 
ATOM   1023  C CA  . GLY A  1 135 ? -1.283  73.923  30.988  1.00 28.59  ? 135 GLY A CA  1 
ATOM   1024  C C   . GLY A  1 135 ? -2.567  73.338  30.427  1.00 29.12  ? 135 GLY A C   1 
ATOM   1025  O O   . GLY A  1 135 ? -3.313  74.025  29.720  1.00 28.71  ? 135 GLY A O   1 
ATOM   1026  N N   . SER A  1 136 ? -2.858  72.101  30.794  1.00 29.33  ? 136 SER A N   1 
ATOM   1027  C CA  . SER A  1 136 ? -3.965  71.364  30.246  1.00 30.23  ? 136 SER A CA  1 
ATOM   1028  C C   . SER A  1 136 ? -4.601  70.564  31.318  1.00 32.28  ? 136 SER A C   1 
ATOM   1029  O O   . SER A  1 136 ? -3.957  70.139  32.280  1.00 32.77  ? 136 SER A O   1 
ATOM   1030  C CB  . SER A  1 136 ? -3.537  70.390  29.180  1.00 29.41  ? 136 SER A CB  1 
ATOM   1031  O OG  . SER A  1 136 ? -4.576  69.563  28.643  1.00 28.00  ? 136 SER A OG  1 
ATOM   1032  N N   . ASN A  1 137 ? -5.881  70.331  31.122  1.00 35.36  ? 137 ASN A N   1 
ATOM   1033  C CA  . ASN A  1 137 ? -6.616  69.574  32.093  1.00 37.66  ? 137 ASN A CA  1 
ATOM   1034  C C   . ASN A  1 137 ? -6.360  68.102  31.856  1.00 37.32  ? 137 ASN A C   1 
ATOM   1035  O O   . ASN A  1 137 ? -6.779  67.263  32.654  1.00 37.60  ? 137 ASN A O   1 
ATOM   1036  C CB  . ASN A  1 137 ? -8.088  69.909  31.977  1.00 41.15  ? 137 ASN A CB  1 
ATOM   1037  C CG  . ASN A  1 137 ? -8.811  69.591  33.290  1.00 44.73  ? 137 ASN A CG  1 
ATOM   1038  O OD1 . ASN A  1 137 ? -8.748  70.334  34.297  1.00 46.03  ? 137 ASN A OD1 1 
ATOM   1039  N ND2 . ASN A  1 137 ? -9.443  68.414  33.403  1.00 46.30  ? 137 ASN A ND2 1 
ATOM   1040  N N   . ALA A  1 138 ? -5.679  67.759  30.760  1.00 36.65  ? 138 ALA A N   1 
ATOM   1041  C CA  . ALA A  1 138 ? -5.253  66.381  30.527  1.00 35.55  ? 138 ALA A CA  1 
ATOM   1042  C C   . ALA A  1 138 ? -3.921  66.068  31.196  1.00 34.96  ? 138 ALA A C   1 
ATOM   1043  O O   . ALA A  1 138 ? -3.466  64.919  31.195  1.00 35.13  ? 138 ALA A O   1 
ATOM   1044  C CB  . ALA A  1 138 ? -5.076  66.101  29.050  1.00 34.84  ? 138 ALA A CB  1 
ATOM   1045  N N   . CYS A  1 139 ? -3.219  67.072  31.719  1.00 34.22  ? 139 CYS A N   1 
ATOM   1046  C CA  . CYS A  1 139 ? -1.932  66.879  32.355  1.00 33.29  ? 139 CYS A CA  1 
ATOM   1047  C C   . CYS A  1 139 ? -2.012  67.525  33.708  1.00 35.04  ? 139 CYS A C   1 
ATOM   1048  O O   . CYS A  1 139 ? -1.569  68.653  33.907  1.00 34.00  ? 139 CYS A O   1 
ATOM   1049  C CB  . CYS A  1 139 ? -0.846  67.554  31.555  1.00 31.33  ? 139 CYS A CB  1 
ATOM   1050  S SG  . CYS A  1 139 ? 0.786   67.142  32.217  1.00 28.57  ? 139 CYS A SG  1 
ATOM   1051  N N   . LYS A  1 140 ? -2.588  66.850  34.695  1.00 38.10  ? 140 LYS A N   1 
ATOM   1052  C CA  . LYS A  1 140 ? -2.840  67.542  35.947  1.00 40.59  ? 140 LYS A CA  1 
ATOM   1053  C C   . LYS A  1 140 ? -1.680  67.632  36.902  1.00 41.68  ? 140 LYS A C   1 
ATOM   1054  O O   . LYS A  1 140 ? -0.968  66.677  37.173  1.00 41.08  ? 140 LYS A O   1 
ATOM   1055  C CB  . LYS A  1 140 ? -4.018  66.901  36.660  1.00 40.57  ? 140 LYS A CB  1 
ATOM   1056  C CG  . LYS A  1 140 ? -5.285  67.309  35.930  1.00 42.07  ? 140 LYS A CG  1 
ATOM   1057  C CD  . LYS A  1 140 ? -6.529  67.012  36.742  1.00 43.08  ? 140 LYS A CD  1 
ATOM   1058  C CE  . LYS A  1 140 ? -7.624  67.998  36.325  1.00 43.74  ? 140 LYS A CE  1 
ATOM   1059  N NZ  . LYS A  1 140 ? -7.312  69.382  36.683  1.00 43.92  ? 140 LYS A NZ  1 
ATOM   1060  N N   . ARG A  1 141 ? -1.407  68.837  37.369  1.00 44.46  ? 141 ARG A N   1 
ATOM   1061  C CA  . ARG A  1 141 ? -0.438  69.007  38.430  1.00 46.28  ? 141 ARG A CA  1 
ATOM   1062  C C   . ARG A  1 141 ? -1.330  69.054  39.650  1.00 48.48  ? 141 ARG A C   1 
ATOM   1063  O O   . ARG A  1 141 ? -2.002  70.057  39.955  1.00 49.10  ? 141 ARG A O   1 
ATOM   1064  C CB  . ARG A  1 141 ? 0.343   70.321  38.310  1.00 45.59  ? 141 ARG A CB  1 
ATOM   1065  C CG  . ARG A  1 141 ? 1.496   70.312  37.316  1.00 44.40  ? 141 ARG A CG  1 
ATOM   1066  C CD  . ARG A  1 141 ? 2.670   69.487  37.787  1.00 42.93  ? 141 ARG A CD  1 
ATOM   1067  N NE  . ARG A  1 141 ? 3.319   68.968  36.602  1.00 42.67  ? 141 ARG A NE  1 
ATOM   1068  C CZ  . ARG A  1 141 ? 4.603   68.625  36.578  1.00 42.34  ? 141 ARG A CZ  1 
ATOM   1069  N NH1 . ARG A  1 141 ? 5.148   68.064  35.499  1.00 42.16  ? 141 ARG A NH1 1 
ATOM   1070  N NH2 . ARG A  1 141 ? 5.400   68.929  37.588  1.00 42.59  ? 141 ARG A NH2 1 
ATOM   1071  N N   . GLY A  1 142 ? -1.440  67.887  40.265  1.00 50.39  ? 142 GLY A N   1 
ATOM   1072  C CA  . GLY A  1 142 ? -2.279  67.726  41.441  1.00 52.81  ? 142 GLY A CA  1 
ATOM   1073  C C   . GLY A  1 142 ? -3.755  68.011  41.128  1.00 54.27  ? 142 GLY A C   1 
ATOM   1074  O O   . GLY A  1 142 ? -4.348  67.389  40.241  1.00 55.38  ? 142 GLY A O   1 
ATOM   1075  N N   . PRO A  1 143 ? -4.382  68.974  41.804  1.00 54.79  ? 143 PRO A N   1 
ATOM   1076  C CA  . PRO A  1 143 ? -5.784  69.321  41.582  1.00 54.73  ? 143 PRO A CA  1 
ATOM   1077  C C   . PRO A  1 143 ? -6.002  70.014  40.230  1.00 54.29  ? 143 PRO A C   1 
ATOM   1078  O O   . PRO A  1 143 ? -6.977  69.771  39.483  1.00 54.37  ? 143 PRO A O   1 
ATOM   1079  C CB  . PRO A  1 143 ? -6.087  70.181  42.786  1.00 55.14  ? 143 PRO A CB  1 
ATOM   1080  C CG  . PRO A  1 143 ? -4.781  70.944  43.005  1.00 55.18  ? 143 PRO A CG  1 
ATOM   1081  C CD  . PRO A  1 143 ? -3.749  69.844  42.802  1.00 55.11  ? 143 PRO A CD  1 
ATOM   1082  N N   . GLY A  1 144 ? -5.026  70.863  39.874  1.00 53.18  ? 144 GLY A N   1 
ATOM   1083  C CA  . GLY A  1 144 ? -5.167  71.747  38.744  1.00 50.97  ? 144 GLY A CA  1 
ATOM   1084  C C   . GLY A  1 144 ? -4.732  71.159  37.426  1.00 48.81  ? 144 GLY A C   1 
ATOM   1085  O O   . GLY A  1 144 ? -4.477  69.966  37.257  1.00 48.32  ? 144 GLY A O   1 
ATOM   1086  N N   . SER A  1 145 ? -4.860  72.004  36.435  1.00 46.75  ? 145 SER A N   1 
ATOM   1087  C CA  . SER A  1 145 ? -4.345  71.684  35.133  1.00 44.98  ? 145 SER A CA  1 
ATOM   1088  C C   . SER A  1 145 ? -2.845  71.862  35.195  1.00 42.50  ? 145 SER A C   1 
ATOM   1089  O O   . SER A  1 145 ? -2.359  72.511  36.135  1.00 42.78  ? 145 SER A O   1 
ATOM   1090  C CB  . SER A  1 145 ? -5.017  72.624  34.186  1.00 46.30  ? 145 SER A CB  1 
ATOM   1091  O OG  . SER A  1 145 ? -6.371  72.167  34.227  1.00 48.04  ? 145 SER A OG  1 
ATOM   1092  N N   . GLY A  1 146 ? -2.096  71.260  34.277  1.00 38.94  ? 146 GLY A N   1 
ATOM   1093  C CA  . GLY A  1 146 ? -0.656  71.433  34.284  1.00 34.83  ? 146 GLY A CA  1 
ATOM   1094  C C   . GLY A  1 146 ? -0.050  70.989  32.969  1.00 30.80  ? 146 GLY A C   1 
ATOM   1095  O O   . GLY A  1 146 ? -0.764  70.786  31.982  1.00 29.70  ? 146 GLY A O   1 
ATOM   1096  N N   . PHE A  1 147 ? 1.263   70.841  32.947  1.00 26.96  ? 147 PHE A N   1 
ATOM   1097  C CA  . PHE A  1 147 ? 1.948   70.480  31.745  1.00 23.24  ? 147 PHE A CA  1 
ATOM   1098  C C   . PHE A  1 147 ? 3.195   69.747  32.176  1.00 22.13  ? 147 PHE A C   1 
ATOM   1099  O O   . PHE A  1 147 ? 3.416   69.463  33.360  1.00 21.85  ? 147 PHE A O   1 
ATOM   1100  C CB  . PHE A  1 147 ? 2.295   71.739  30.995  1.00 21.90  ? 147 PHE A CB  1 
ATOM   1101  C CG  . PHE A  1 147 ? 2.346   71.600  29.488  1.00 20.96  ? 147 PHE A CG  1 
ATOM   1102  C CD1 . PHE A  1 147 ? 1.209   71.257  28.797  1.00 20.86  ? 147 PHE A CD1 1 
ATOM   1103  C CD2 . PHE A  1 147 ? 3.524   71.868  28.823  1.00 21.14  ? 147 PHE A CD2 1 
ATOM   1104  C CE1 . PHE A  1 147 ? 1.263   71.181  27.428  1.00 21.72  ? 147 PHE A CE1 1 
ATOM   1105  C CE2 . PHE A  1 147 ? 3.576   71.794  27.453  1.00 21.56  ? 147 PHE A CE2 1 
ATOM   1106  C CZ  . PHE A  1 147 ? 2.440   71.452  26.755  1.00 22.34  ? 147 PHE A CZ  1 
ATOM   1107  N N   . PHE A  1 148 ? 4.009   69.402  31.199  1.00 20.69  ? 148 PHE A N   1 
ATOM   1108  C CA  . PHE A  1 148 ? 5.301   68.808  31.431  1.00 18.52  ? 148 PHE A CA  1 
ATOM   1109  C C   . PHE A  1 148 ? 6.134   69.786  32.242  1.00 17.56  ? 148 PHE A C   1 
ATOM   1110  O O   . PHE A  1 148 ? 6.110   70.969  31.909  1.00 18.35  ? 148 PHE A O   1 
ATOM   1111  C CB  . PHE A  1 148 ? 5.933   68.548  30.081  1.00 18.33  ? 148 PHE A CB  1 
ATOM   1112  C CG  . PHE A  1 148 ? 5.131   67.606  29.192  1.00 17.74  ? 148 PHE A CG  1 
ATOM   1113  C CD1 . PHE A  1 148 ? 4.318   68.124  28.203  1.00 17.16  ? 148 PHE A CD1 1 
ATOM   1114  C CD2 . PHE A  1 148 ? 5.241   66.242  29.369  1.00 17.27  ? 148 PHE A CD2 1 
ATOM   1115  C CE1 . PHE A  1 148 ? 3.608   67.275  27.391  1.00 17.19  ? 148 PHE A CE1 1 
ATOM   1116  C CE2 . PHE A  1 148 ? 4.526   65.401  28.552  1.00 17.12  ? 148 PHE A CE2 1 
ATOM   1117  C CZ  . PHE A  1 148 ? 3.714   65.915  27.559  1.00 17.31  ? 148 PHE A CZ  1 
ATOM   1118  N N   . SER A  1 149 ? 6.864   69.380  33.276  1.00 16.27  ? 149 SER A N   1 
ATOM   1119  C CA  . SER A  1 149 ? 7.667   70.306  34.063  1.00 15.62  ? 149 SER A CA  1 
ATOM   1120  C C   . SER A  1 149 ? 8.758   71.013  33.284  1.00 16.00  ? 149 SER A C   1 
ATOM   1121  O O   . SER A  1 149 ? 9.124   72.160  33.571  1.00 16.28  ? 149 SER A O   1 
ATOM   1122  C CB  . SER A  1 149 ? 8.321   69.578  35.226  1.00 15.22  ? 149 SER A CB  1 
ATOM   1123  O OG  . SER A  1 149 ? 8.674   68.255  34.873  1.00 15.24  ? 149 SER A OG  1 
ATOM   1124  N N   . ARG A  1 150 ? 9.318   70.378  32.267  1.00 16.11  ? 150 ARG A N   1 
ATOM   1125  C CA  . ARG A  1 150 ? 10.399  71.035  31.562  1.00 16.39  ? 150 ARG A CA  1 
ATOM   1126  C C   . ARG A  1 150 ? 10.012  71.822  30.310  1.00 15.12  ? 150 ARG A C   1 
ATOM   1127  O O   . ARG A  1 150 ? 10.879  72.383  29.620  1.00 15.49  ? 150 ARG A O   1 
ATOM   1128  C CB  . ARG A  1 150 ? 11.443  69.951  31.263  1.00 17.45  ? 150 ARG A CB  1 
ATOM   1129  C CG  . ARG A  1 150 ? 12.534  69.946  32.334  1.00 18.15  ? 150 ARG A CG  1 
ATOM   1130  C CD  . ARG A  1 150 ? 12.068  69.380  33.664  1.00 18.14  ? 150 ARG A CD  1 
ATOM   1131  N NE  . ARG A  1 150 ? 12.666  70.089  34.792  1.00 18.16  ? 150 ARG A NE  1 
ATOM   1132  C CZ  . ARG A  1 150 ? 13.486  69.478  35.670  1.00 17.89  ? 150 ARG A CZ  1 
ATOM   1133  N NH1 . ARG A  1 150 ? 13.968  70.151  36.726  1.00 18.34  ? 150 ARG A NH1 1 
ATOM   1134  N NH2 . ARG A  1 150 ? 13.857  68.208  35.496  1.00 17.56  ? 150 ARG A NH2 1 
ATOM   1135  N N   . LEU A  1 151 ? 8.731   71.941  30.004  1.00 13.95  ? 151 LEU A N   1 
ATOM   1136  C CA  . LEU A  1 151 ? 8.330   72.632  28.793  1.00 14.45  ? 151 LEU A CA  1 
ATOM   1137  C C   . LEU A  1 151 ? 7.503   73.867  29.140  1.00 16.09  ? 151 LEU A C   1 
ATOM   1138  O O   . LEU A  1 151 ? 6.926   73.970  30.237  1.00 18.04  ? 151 LEU A O   1 
ATOM   1139  C CB  . LEU A  1 151 ? 7.543   71.655  27.903  1.00 12.08  ? 151 LEU A CB  1 
ATOM   1140  C CG  . LEU A  1 151 ? 8.350   70.540  27.223  1.00 10.30  ? 151 LEU A CG  1 
ATOM   1141  C CD1 . LEU A  1 151 ? 7.440   69.560  26.519  1.00 9.50   ? 151 LEU A CD1 1 
ATOM   1142  C CD2 . LEU A  1 151 ? 9.315   71.171  26.239  1.00 9.51   ? 151 LEU A CD2 1 
ATOM   1143  N N   . ASN A  1 152 ? 7.429   74.876  28.280  1.00 16.04  ? 152 ASN A N   1 
ATOM   1144  C CA  . ASN A  1 152 ? 6.702   76.083  28.618  1.00 15.63  ? 152 ASN A CA  1 
ATOM   1145  C C   . ASN A  1 152 ? 5.749   76.433  27.490  1.00 16.32  ? 152 ASN A C   1 
ATOM   1146  O O   . ASN A  1 152 ? 6.203   76.867  26.423  1.00 16.39  ? 152 ASN A O   1 
ATOM   1147  C CB  . ASN A  1 152 ? 7.735   77.164  28.848  1.00 15.75  ? 152 ASN A CB  1 
ATOM   1148  C CG  . ASN A  1 152 ? 7.185   78.486  29.323  1.00 16.32  ? 152 ASN A CG  1 
ATOM   1149  O OD1 . ASN A  1 152 ? 7.944   79.431  29.483  1.00 16.37  ? 152 ASN A OD1 1 
ATOM   1150  N ND2 . ASN A  1 152 ? 5.914   78.712  29.653  1.00 16.48  ? 152 ASN A ND2 1 
ATOM   1151  N N   . TRP A  1 153 ? 4.437   76.210  27.683  1.00 16.50  ? 153 TRP A N   1 
ATOM   1152  C CA  . TRP A  1 153 ? 3.446   76.466  26.625  1.00 16.76  ? 153 TRP A CA  1 
ATOM   1153  C C   . TRP A  1 153 ? 3.053   77.946  26.530  1.00 18.09  ? 153 TRP A C   1 
ATOM   1154  O O   . TRP A  1 153 ? 2.472   78.522  27.466  1.00 17.96  ? 153 TRP A O   1 
ATOM   1155  C CB  . TRP A  1 153 ? 2.217   75.594  26.898  1.00 13.77  ? 153 TRP A CB  1 
ATOM   1156  C CG  . TRP A  1 153 ? 1.107   75.559  25.842  1.00 12.07  ? 153 TRP A CG  1 
ATOM   1157  C CD1 . TRP A  1 153 ? 1.165   76.202  24.621  1.00 10.92  ? 153 TRP A CD1 1 
ATOM   1158  C CD2 . TRP A  1 153 ? -0.032  74.807  25.976  1.00 10.08  ? 153 TRP A CD2 1 
ATOM   1159  N NE1 . TRP A  1 153 ? 0.083   75.844  23.995  1.00 10.13  ? 153 TRP A NE1 1 
ATOM   1160  C CE2 . TRP A  1 153 ? -0.662  75.024  24.764  1.00 10.18  ? 153 TRP A CE2 1 
ATOM   1161  C CE3 . TRP A  1 153 ? -0.586  74.012  26.946  1.00 7.82   ? 153 TRP A CE3 1 
ATOM   1162  C CZ2 . TRP A  1 153 ? -1.866  74.419  24.488  1.00 9.37   ? 153 TRP A CZ2 1 
ATOM   1163  C CZ3 . TRP A  1 153 ? -1.778  73.416  26.672  1.00 7.48   ? 153 TRP A CZ3 1 
ATOM   1164  C CH2 . TRP A  1 153 ? -2.412  73.624  25.468  1.00 8.51   ? 153 TRP A CH2 1 
ATOM   1165  N N   . LEU A  1 154 ? 3.360   78.534  25.388  1.00 19.25  ? 154 LEU A N   1 
ATOM   1166  C CA  . LEU A  1 154 ? 3.140   79.938  25.197  1.00 20.77  ? 154 LEU A CA  1 
ATOM   1167  C C   . LEU A  1 154 ? 1.930   80.154  24.327  1.00 23.28  ? 154 LEU A C   1 
ATOM   1168  O O   . LEU A  1 154 ? 1.780   79.496  23.281  1.00 23.01  ? 154 LEU A O   1 
ATOM   1169  C CB  . LEU A  1 154 ? 4.345   80.549  24.538  1.00 19.17  ? 154 LEU A CB  1 
ATOM   1170  C CG  . LEU A  1 154 ? 5.517   81.075  25.338  1.00 18.08  ? 154 LEU A CG  1 
ATOM   1171  C CD1 . LEU A  1 154 ? 5.922   80.197  26.483  1.00 17.39  ? 154 LEU A CD1 1 
ATOM   1172  C CD2 . LEU A  1 154 ? 6.682   81.160  24.388  1.00 18.56  ? 154 LEU A CD2 1 
ATOM   1173  N N   . THR A  1 155 ? 1.100   81.079  24.805  1.00 26.48  ? 155 THR A N   1 
ATOM   1174  C CA  . THR A  1 155 ? -0.113  81.503  24.113  1.00 29.89  ? 155 THR A CA  1 
ATOM   1175  C C   . THR A  1 155 ? -0.224  83.030  24.018  1.00 33.12  ? 155 THR A C   1 
ATOM   1176  O O   . THR A  1 155 ? 0.662   83.723  24.549  1.00 33.07  ? 155 THR A O   1 
ATOM   1177  C CB  . THR A  1 155 ? -1.268  80.916  24.869  1.00 29.17  ? 155 THR A CB  1 
ATOM   1178  O OG1 . THR A  1 155 ? -0.992  81.005  26.274  1.00 27.91  ? 155 THR A OG1 1 
ATOM   1179  C CG2 . THR A  1 155 ? -1.539  79.511  24.349  1.00 29.52  ? 155 THR A CG2 1 
ATOM   1180  N N   . LYS A  1 156 ? -1.349  83.566  23.502  1.00 37.71  ? 156 LYS A N   1 
ATOM   1181  C CA  . LYS A  1 156 ? -1.561  85.007  23.255  1.00 41.64  ? 156 LYS A CA  1 
ATOM   1182  C C   . LYS A  1 156 ? -1.516  85.830  24.518  1.00 43.49  ? 156 LYS A C   1 
ATOM   1183  O O   . LYS A  1 156 ? -2.090  85.391  25.514  1.00 43.92  ? 156 LYS A O   1 
ATOM   1184  C CB  . LYS A  1 156 ? -2.942  85.294  22.607  1.00 42.26  ? 156 LYS A CB  1 
ATOM   1185  C CG  . LYS A  1 156 ? -4.131  85.148  23.564  1.00 43.34  ? 156 LYS A CG  1 
ATOM   1186  C CD  . LYS A  1 156 ? -5.470  84.916  22.957  1.00 44.66  ? 156 LYS A CD  1 
ATOM   1187  C CE  . LYS A  1 156 ? -5.789  86.138  22.154  1.00 45.67  ? 156 LYS A CE  1 
ATOM   1188  N NZ  . LYS A  1 156 ? -6.926  85.873  21.305  1.00 46.56  ? 156 LYS A NZ  1 
ATOM   1189  N N   . SER A  1 157 ? -0.823  86.949  24.577  1.00 46.14  ? 157 SER A N   1 
ATOM   1190  C CA  . SER A  1 157 ? -1.112  87.785  25.714  1.00 48.94  ? 157 SER A CA  1 
ATOM   1191  C C   . SER A  1 157 ? -2.055  88.824  25.140  1.00 50.26  ? 157 SER A C   1 
ATOM   1192  O O   . SER A  1 157 ? -1.965  89.191  23.942  1.00 50.62  ? 157 SER A O   1 
ATOM   1193  C CB  . SER A  1 157 ? 0.139   88.401  26.274  1.00 50.10  ? 157 SER A CB  1 
ATOM   1194  O OG  . SER A  1 157 ? 0.877   89.071  25.276  1.00 52.18  ? 157 SER A OG  1 
ATOM   1195  N N   . GLY A  1 158 ? -3.021  89.248  25.968  1.00 50.68  ? 158 GLY A N   1 
ATOM   1196  C CA  . GLY A  1 158 ? -4.046  90.174  25.502  1.00 51.05  ? 158 GLY A CA  1 
ATOM   1197  C C   . GLY A  1 158 ? -4.695  89.588  24.242  1.00 51.15  ? 158 GLY A C   1 
ATOM   1198  O O   . GLY A  1 158 ? -5.399  88.576  24.315  1.00 51.31  ? 158 GLY A O   1 
ATOM   1199  N N   . SER A  1 159 ? -4.372  90.126  23.067  1.00 50.93  ? 159 SER A N   1 
ATOM   1200  C CA  . SER A  1 159 ? -4.926  89.534  21.873  1.00 51.24  ? 159 SER A CA  1 
ATOM   1201  C C   . SER A  1 159 ? -3.974  89.488  20.708  1.00 51.84  ? 159 SER A C   1 
ATOM   1202  O O   . SER A  1 159 ? -4.340  89.643  19.543  1.00 51.63  ? 159 SER A O   1 
ATOM   1203  C CB  . SER A  1 159 ? -6.218  90.252  21.500  1.00 51.01  ? 159 SER A CB  1 
ATOM   1204  O OG  . SER A  1 159 ? -7.242  89.378  21.998  1.00 50.97  ? 159 SER A OG  1 
ATOM   1205  N N   . THR A  1 160 ? -2.730  89.129  21.027  1.00 52.63  ? 160 THR A N   1 
ATOM   1206  C CA  . THR A  1 160 ? -1.717  88.964  20.004  1.00 52.52  ? 160 THR A CA  1 
ATOM   1207  C C   . THR A  1 160 ? -0.647  87.978  20.476  1.00 51.80  ? 160 THR A C   1 
ATOM   1208  O O   . THR A  1 160 ? -0.608  87.577  21.651  1.00 51.96  ? 160 THR A O   1 
ATOM   1209  C CB  . THR A  1 160 ? -1.061  90.350  19.641  1.00 52.87  ? 160 THR A CB  1 
ATOM   1210  O OG1 . THR A  1 160 ? -1.123  91.207  20.794  1.00 53.51  ? 160 THR A OG1 1 
ATOM   1211  C CG2 . THR A  1 160 ? -1.691  90.933  18.373  1.00 52.09  ? 160 THR A CG2 1 
ATOM   1212  N N   . TYR A  1 161 ? 0.136   87.528  19.494  1.00 49.97  ? 161 TYR A N   1 
ATOM   1213  C CA  . TYR A  1 161 ? 1.297   86.686  19.669  1.00 47.30  ? 161 TYR A CA  1 
ATOM   1214  C C   . TYR A  1 161 ? 2.323   87.329  18.713  1.00 43.91  ? 161 TYR A C   1 
ATOM   1215  O O   . TYR A  1 161 ? 2.050   87.480  17.514  1.00 44.90  ? 161 TYR A O   1 
ATOM   1216  C CB  . TYR A  1 161 ? 0.912   85.262  19.259  1.00 48.49  ? 161 TYR A CB  1 
ATOM   1217  C CG  . TYR A  1 161 ? 1.795   84.155  19.812  1.00 49.48  ? 161 TYR A CG  1 
ATOM   1218  C CD1 . TYR A  1 161 ? 2.967   83.777  19.170  1.00 49.57  ? 161 TYR A CD1 1 
ATOM   1219  C CD2 . TYR A  1 161 ? 1.386   83.474  20.939  1.00 49.21  ? 161 TYR A CD2 1 
ATOM   1220  C CE1 . TYR A  1 161 ? 3.713   82.721  19.637  1.00 49.43  ? 161 TYR A CE1 1 
ATOM   1221  C CE2 . TYR A  1 161 ? 2.132   82.417  21.401  1.00 49.40  ? 161 TYR A CE2 1 
ATOM   1222  C CZ  . TYR A  1 161 ? 3.285   82.034  20.749  1.00 49.53  ? 161 TYR A CZ  1 
ATOM   1223  O OH  . TYR A  1 161 ? 3.964   80.911  21.160  1.00 49.92  ? 161 TYR A OH  1 
ATOM   1224  N N   . PRO A  1 162 ? 3.413   87.900  19.220  1.00 39.46  ? 162 PRO A N   1 
ATOM   1225  C CA  . PRO A  1 162 ? 4.492   88.531  18.459  1.00 37.88  ? 162 PRO A CA  1 
ATOM   1226  C C   . PRO A  1 162 ? 5.444   87.520  17.842  1.00 36.59  ? 162 PRO A C   1 
ATOM   1227  O O   . PRO A  1 162 ? 5.398   86.333  18.187  1.00 37.43  ? 162 PRO A O   1 
ATOM   1228  C CB  . PRO A  1 162 ? 5.164   89.416  19.467  1.00 37.85  ? 162 PRO A CB  1 
ATOM   1229  C CG  . PRO A  1 162 ? 4.974   88.642  20.750  1.00 37.98  ? 162 PRO A CG  1 
ATOM   1230  C CD  . PRO A  1 162 ? 3.531   88.217  20.624  1.00 38.04  ? 162 PRO A CD  1 
ATOM   1231  N N   . VAL A  1 163 ? 6.319   87.946  16.935  1.00 34.42  ? 163 VAL A N   1 
ATOM   1232  C CA  . VAL A  1 163 ? 7.324   87.018  16.463  1.00 32.80  ? 163 VAL A CA  1 
ATOM   1233  C C   . VAL A  1 163 ? 8.359   86.917  17.570  1.00 32.16  ? 163 VAL A C   1 
ATOM   1234  O O   . VAL A  1 163 ? 9.076   87.879  17.845  1.00 33.20  ? 163 VAL A O   1 
ATOM   1235  C CB  . VAL A  1 163 ? 7.965   87.529  15.181  1.00 32.71  ? 163 VAL A CB  1 
ATOM   1236  C CG1 . VAL A  1 163 ? 9.175   86.691  14.775  1.00 32.50  ? 163 VAL A CG1 1 
ATOM   1237  C CG2 . VAL A  1 163 ? 6.925   87.425  14.083  1.00 33.22  ? 163 VAL A CG2 1 
ATOM   1238  N N   . LEU A  1 164 ? 8.349   85.818  18.302  1.00 30.72  ? 164 LEU A N   1 
ATOM   1239  C CA  . LEU A  1 164 ? 9.348   85.545  19.304  1.00 29.38  ? 164 LEU A CA  1 
ATOM   1240  C C   . LEU A  1 164 ? 10.696  85.352  18.616  1.00 29.86  ? 164 LEU A C   1 
ATOM   1241  O O   . LEU A  1 164 ? 10.820  84.694  17.568  1.00 30.41  ? 164 LEU A O   1 
ATOM   1242  C CB  . LEU A  1 164 ? 8.940   84.287  20.062  1.00 28.93  ? 164 LEU A CB  1 
ATOM   1243  C CG  . LEU A  1 164 ? 8.099   84.334  21.359  1.00 28.96  ? 164 LEU A CG  1 
ATOM   1244  C CD1 . LEU A  1 164 ? 7.334   85.633  21.487  1.00 29.63  ? 164 LEU A CD1 1 
ATOM   1245  C CD2 . LEU A  1 164 ? 7.121   83.175  21.344  1.00 28.29  ? 164 LEU A CD2 1 
ATOM   1246  N N   . ASN A  1 165 ? 11.737  85.941  19.183  1.00 29.59  ? 165 ASN A N   1 
ATOM   1247  C CA  . ASN A  1 165 ? 13.057  85.816  18.616  1.00 30.02  ? 165 ASN A CA  1 
ATOM   1248  C C   . ASN A  1 165 ? 14.006  85.896  19.795  1.00 29.70  ? 165 ASN A C   1 
ATOM   1249  O O   . ASN A  1 165 ? 14.431  86.993  20.168  1.00 30.52  ? 165 ASN A O   1 
ATOM   1250  C CB  . ASN A  1 165 ? 13.270  86.961  17.655  1.00 31.54  ? 165 ASN A CB  1 
ATOM   1251  C CG  . ASN A  1 165 ? 14.585  86.892  16.922  1.00 33.70  ? 165 ASN A CG  1 
ATOM   1252  O OD1 . ASN A  1 165 ? 14.710  86.043  16.045  1.00 34.55  ? 165 ASN A OD1 1 
ATOM   1253  N ND2 . ASN A  1 165 ? 15.557  87.773  17.190  1.00 35.55  ? 165 ASN A ND2 1 
ATOM   1254  N N   . VAL A  1 166 ? 14.308  84.788  20.469  1.00 28.22  ? 166 VAL A N   1 
ATOM   1255  C CA  . VAL A  1 166 ? 15.169  84.829  21.641  1.00 27.27  ? 166 VAL A CA  1 
ATOM   1256  C C   . VAL A  1 166 ? 16.481  84.140  21.357  1.00 27.58  ? 166 VAL A C   1 
ATOM   1257  O O   . VAL A  1 166 ? 16.559  83.380  20.387  1.00 28.82  ? 166 VAL A O   1 
ATOM   1258  C CB  . VAL A  1 166 ? 14.490  84.145  22.819  1.00 27.17  ? 166 VAL A CB  1 
ATOM   1259  C CG1 . VAL A  1 166 ? 13.166  84.829  23.113  1.00 27.78  ? 166 VAL A CG1 1 
ATOM   1260  C CG2 . VAL A  1 166 ? 14.221  82.691  22.499  1.00 27.26  ? 166 VAL A CG2 1 
ATOM   1261  N N   . THR A  1 167 ? 17.488  84.300  22.208  1.00 27.61  ? 167 THR A N   1 
ATOM   1262  C CA  . THR A  1 167 ? 18.777  83.682  21.980  1.00 27.32  ? 167 THR A CA  1 
ATOM   1263  C C   . THR A  1 167 ? 19.346  83.232  23.311  1.00 27.84  ? 167 THR A C   1 
ATOM   1264  O O   . THR A  1 167 ? 19.038  83.816  24.354  1.00 28.27  ? 167 THR A O   1 
ATOM   1265  C CB  . THR A  1 167 ? 19.656  84.724  21.285  1.00 27.01  ? 167 THR A CB  1 
ATOM   1266  O OG1 . THR A  1 167 ? 20.763  84.035  20.726  1.00 27.33  ? 167 THR A OG1 1 
ATOM   1267  C CG2 . THR A  1 167 ? 20.082  85.832  22.225  1.00 26.80  ? 167 THR A CG2 1 
ATOM   1268  N N   . MET A  1 168 ? 20.180  82.213  23.322  1.00 28.42  ? 168 MET A N   1 
ATOM   1269  C CA  . MET A  1 168 ? 20.727  81.724  24.560  1.00 29.35  ? 168 MET A CA  1 
ATOM   1270  C C   . MET A  1 168 ? 22.059  81.107  24.202  1.00 30.51  ? 168 MET A C   1 
ATOM   1271  O O   . MET A  1 168 ? 22.122  80.049  23.576  1.00 30.79  ? 168 MET A O   1 
ATOM   1272  C CB  . MET A  1 168 ? 19.752  80.726  25.101  1.00 29.89  ? 168 MET A CB  1 
ATOM   1273  C CG  . MET A  1 168 ? 20.091  80.224  26.461  1.00 31.18  ? 168 MET A CG  1 
ATOM   1274  S SD  . MET A  1 168 ? 20.044  81.591  27.619  1.00 32.37  ? 168 MET A SD  1 
ATOM   1275  C CE  . MET A  1 168 ? 18.306  81.793  27.863  1.00 32.41  ? 168 MET A CE  1 
ATOM   1276  N N   . PRO A  1 169 ? 23.173  81.787  24.468  1.00 31.85  ? 169 PRO A N   1 
ATOM   1277  C CA  . PRO A  1 169 ? 24.511  81.314  24.167  1.00 32.38  ? 169 PRO A CA  1 
ATOM   1278  C C   . PRO A  1 169 ? 24.947  80.136  24.986  1.00 33.14  ? 169 PRO A C   1 
ATOM   1279  O O   . PRO A  1 169 ? 24.451  79.818  26.076  1.00 33.55  ? 169 PRO A O   1 
ATOM   1280  C CB  . PRO A  1 169 ? 25.391  82.503  24.383  1.00 32.22  ? 169 PRO A CB  1 
ATOM   1281  C CG  . PRO A  1 169 ? 24.666  83.195  25.508  1.00 32.14  ? 169 PRO A CG  1 
ATOM   1282  C CD  . PRO A  1 169 ? 23.230  83.137  25.011  1.00 32.12  ? 169 PRO A CD  1 
ATOM   1283  N N   . ASN A  1 170 ? 25.898  79.436  24.431  1.00 34.37  ? 170 ASN A N   1 
ATOM   1284  C CA  . ASN A  1 170 ? 26.474  78.361  25.159  1.00 35.87  ? 170 ASN A CA  1 
ATOM   1285  C C   . ASN A  1 170 ? 27.835  78.886  25.470  1.00 38.24  ? 170 ASN A C   1 
ATOM   1286  O O   . ASN A  1 170 ? 28.786  78.692  24.723  1.00 39.08  ? 170 ASN A O   1 
ATOM   1287  C CB  . ASN A  1 170 ? 26.643  77.089  24.367  1.00 34.56  ? 170 ASN A CB  1 
ATOM   1288  C CG  . ASN A  1 170 ? 26.910  75.978  25.342  1.00 33.19  ? 170 ASN A CG  1 
ATOM   1289  O OD1 . ASN A  1 170 ? 26.999  76.218  26.533  1.00 32.67  ? 170 ASN A OD1 1 
ATOM   1290  N ND2 . ASN A  1 170 ? 26.938  74.736  24.948  1.00 33.66  ? 170 ASN A ND2 1 
ATOM   1291  N N   . ASN A  1 171 ? 27.917  79.680  26.518  1.00 40.97  ? 171 ASN A N   1 
ATOM   1292  C CA  . ASN A  1 171 ? 29.218  80.165  26.924  1.00 43.39  ? 171 ASN A CA  1 
ATOM   1293  C C   . ASN A  1 171 ? 29.911  79.181  27.842  1.00 44.52  ? 171 ASN A C   1 
ATOM   1294  O O   . ASN A  1 171 ? 31.024  79.422  28.298  1.00 45.56  ? 171 ASN A O   1 
ATOM   1295  C CB  . ASN A  1 171 ? 29.092  81.504  27.627  1.00 44.43  ? 171 ASN A CB  1 
ATOM   1296  C CG  . ASN A  1 171 ? 28.997  82.642  26.619  1.00 45.51  ? 171 ASN A CG  1 
ATOM   1297  O OD1 . ASN A  1 171 ? 28.200  83.566  26.787  1.00 46.29  ? 171 ASN A OD1 1 
ATOM   1298  N ND2 . ASN A  1 171 ? 29.747  82.637  25.522  1.00 45.80  ? 171 ASN A ND2 1 
ATOM   1299  N N   . ASP A  1 172 ? 29.250  78.047  28.054  1.00 45.16  ? 172 ASP A N   1 
ATOM   1300  C CA  . ASP A  1 172 ? 29.692  77.036  28.960  1.00 44.76  ? 172 ASP A CA  1 
ATOM   1301  C C   . ASP A  1 172 ? 30.741  76.118  28.406  1.00 44.40  ? 172 ASP A C   1 
ATOM   1302  O O   . ASP A  1 172 ? 31.138  76.156  27.237  1.00 44.34  ? 172 ASP A O   1 
ATOM   1303  C CB  . ASP A  1 172 ? 28.498  76.233  29.377  1.00 45.31  ? 172 ASP A CB  1 
ATOM   1304  C CG  . ASP A  1 172 ? 28.268  76.439  30.839  1.00 45.50  ? 172 ASP A CG  1 
ATOM   1305  O OD1 . ASP A  1 172 ? 29.213  76.156  31.585  1.00 45.96  ? 172 ASP A OD1 1 
ATOM   1306  O OD2 . ASP A  1 172 ? 27.165  76.867  31.198  1.00 45.64  ? 172 ASP A OD2 1 
ATOM   1307  N N   . ASN A  1 173 ? 31.125  75.210  29.269  1.00 44.44  ? 173 ASN A N   1 
ATOM   1308  C CA  . ASN A  1 173 ? 32.143  74.269  28.918  1.00 44.39  ? 173 ASN A CA  1 
ATOM   1309  C C   . ASN A  1 173 ? 31.615  73.026  28.224  1.00 42.28  ? 173 ASN A C   1 
ATOM   1310  O O   . ASN A  1 173 ? 32.367  72.206  27.716  1.00 42.49  ? 173 ASN A O   1 
ATOM   1311  C CB  . ASN A  1 173 ? 32.858  73.897  30.191  1.00 47.19  ? 173 ASN A CB  1 
ATOM   1312  C CG  . ASN A  1 173 ? 34.117  73.133  29.833  1.00 50.03  ? 173 ASN A CG  1 
ATOM   1313  O OD1 . ASN A  1 173 ? 34.889  73.564  28.967  1.00 51.44  ? 173 ASN A OD1 1 
ATOM   1314  N ND2 . ASN A  1 173 ? 34.372  71.988  30.466  1.00 51.55  ? 173 ASN A ND2 1 
ATOM   1315  N N   . PHE A  1 174 ? 30.314  72.820  28.157  1.00 39.71  ? 174 PHE A N   1 
ATOM   1316  C CA  . PHE A  1 174 ? 29.791  71.529  27.721  1.00 37.25  ? 174 PHE A CA  1 
ATOM   1317  C C   . PHE A  1 174 ? 28.661  71.662  26.721  1.00 35.80  ? 174 PHE A C   1 
ATOM   1318  O O   . PHE A  1 174 ? 28.136  72.763  26.559  1.00 35.55  ? 174 PHE A O   1 
ATOM   1319  C CB  . PHE A  1 174 ? 29.300  70.753  28.949  1.00 36.41  ? 174 PHE A CB  1 
ATOM   1320  C CG  . PHE A  1 174 ? 28.488  71.625  29.881  1.00 35.41  ? 174 PHE A CG  1 
ATOM   1321  C CD1 . PHE A  1 174 ? 27.156  71.859  29.638  1.00 35.44  ? 174 PHE A CD1 1 
ATOM   1322  C CD2 . PHE A  1 174 ? 29.110  72.193  30.961  1.00 35.24  ? 174 PHE A CD2 1 
ATOM   1323  C CE1 . PHE A  1 174 ? 26.442  72.688  30.465  1.00 35.28  ? 174 PHE A CE1 1 
ATOM   1324  C CE2 . PHE A  1 174 ? 28.382  73.019  31.776  1.00 35.75  ? 174 PHE A CE2 1 
ATOM   1325  C CZ  . PHE A  1 174 ? 27.048  73.264  31.540  1.00 35.22  ? 174 PHE A CZ  1 
ATOM   1326  N N   . ASP A  1 175 ? 28.289  70.561  26.079  1.00 33.79  ? 175 ASP A N   1 
ATOM   1327  C CA  . ASP A  1 175 ? 27.134  70.549  25.213  1.00 32.14  ? 175 ASP A CA  1 
ATOM   1328  C C   . ASP A  1 175 ? 25.863  70.593  26.046  1.00 29.78  ? 175 ASP A C   1 
ATOM   1329  O O   . ASP A  1 175 ? 25.788  70.028  27.158  1.00 29.95  ? 175 ASP A O   1 
ATOM   1330  C CB  . ASP A  1 175 ? 27.132  69.290  24.341  1.00 33.91  ? 175 ASP A CB  1 
ATOM   1331  C CG  . ASP A  1 175 ? 28.186  69.229  23.232  1.00 35.29  ? 175 ASP A CG  1 
ATOM   1332  O OD1 . ASP A  1 175 ? 28.810  70.244  22.934  1.00 35.86  ? 175 ASP A OD1 1 
ATOM   1333  O OD2 . ASP A  1 175 ? 28.388  68.168  22.630  1.00 35.45  ? 175 ASP A OD2 1 
ATOM   1334  N N   . LYS A  1 176 ? 24.874  71.316  25.528  1.00 26.32  ? 176 LYS A N   1 
ATOM   1335  C CA  . LYS A  1 176 ? 23.602  71.489  26.192  1.00 23.10  ? 176 LYS A CA  1 
ATOM   1336  C C   . LYS A  1 176 ? 22.543  70.856  25.314  1.00 21.06  ? 176 LYS A C   1 
ATOM   1337  O O   . LYS A  1 176 ? 22.589  71.099  24.116  1.00 21.23  ? 176 LYS A O   1 
ATOM   1338  C CB  . LYS A  1 176 ? 23.291  72.948  26.348  1.00 22.54  ? 176 LYS A CB  1 
ATOM   1339  C CG  . LYS A  1 176 ? 24.186  73.776  27.240  1.00 22.81  ? 176 LYS A CG  1 
ATOM   1340  C CD  . LYS A  1 176 ? 23.582  75.162  27.108  1.00 23.53  ? 176 LYS A CD  1 
ATOM   1341  C CE  . LYS A  1 176 ? 24.083  76.258  28.026  1.00 23.72  ? 176 LYS A CE  1 
ATOM   1342  N NZ  . LYS A  1 176 ? 23.256  77.435  27.824  1.00 25.13  ? 176 LYS A NZ  1 
ATOM   1343  N N   . LEU A  1 177 ? 21.615  70.048  25.834  1.00 17.99  ? 177 LEU A N   1 
ATOM   1344  C CA  . LEU A  1 177 ? 20.572  69.430  25.032  1.00 15.45  ? 177 LEU A CA  1 
ATOM   1345  C C   . LEU A  1 177 ? 19.285  70.188  25.330  1.00 15.10  ? 177 LEU A C   1 
ATOM   1346  O O   . LEU A  1 177 ? 18.883  70.200  26.497  1.00 16.67  ? 177 LEU A O   1 
ATOM   1347  C CB  . LEU A  1 177 ? 20.528  67.936  25.450  1.00 14.11  ? 177 LEU A CB  1 
ATOM   1348  C CG  . LEU A  1 177 ? 19.601  66.782  24.990  1.00 12.58  ? 177 LEU A CG  1 
ATOM   1349  C CD1 . LEU A  1 177 ? 18.450  66.682  25.916  1.00 12.50  ? 177 LEU A CD1 1 
ATOM   1350  C CD2 . LEU A  1 177 ? 19.069  66.995  23.609  1.00 12.39  ? 177 LEU A CD2 1 
ATOM   1351  N N   . TYR A  1 178 ? 18.663  70.903  24.389  1.00 13.16  ? 178 TYR A N   1 
ATOM   1352  C CA  . TYR A  1 178 ? 17.378  71.552  24.652  1.00 11.77  ? 178 TYR A CA  1 
ATOM   1353  C C   . TYR A  1 178 ? 16.237  70.738  24.043  1.00 11.39  ? 178 TYR A C   1 
ATOM   1354  O O   . TYR A  1 178 ? 16.332  70.332  22.876  1.00 12.01  ? 178 TYR A O   1 
ATOM   1355  C CB  . TYR A  1 178 ? 17.269  72.947  24.040  1.00 11.29  ? 178 TYR A CB  1 
ATOM   1356  C CG  . TYR A  1 178 ? 18.190  73.995  24.623  1.00 10.60  ? 178 TYR A CG  1 
ATOM   1357  C CD1 . TYR A  1 178 ? 17.789  74.847  25.634  1.00 9.60   ? 178 TYR A CD1 1 
ATOM   1358  C CD2 . TYR A  1 178 ? 19.462  74.073  24.121  1.00 11.22  ? 178 TYR A CD2 1 
ATOM   1359  C CE1 . TYR A  1 178 ? 18.652  75.796  26.146  1.00 9.72   ? 178 TYR A CE1 1 
ATOM   1360  C CE2 . TYR A  1 178 ? 20.328  75.018  24.621  1.00 12.41  ? 178 TYR A CE2 1 
ATOM   1361  C CZ  . TYR A  1 178 ? 19.938  75.883  25.642  1.00 11.72  ? 178 TYR A CZ  1 
ATOM   1362  O OH  . TYR A  1 178 ? 20.896  76.820  26.070  1.00 11.65  ? 178 TYR A OH  1 
ATOM   1363  N N   . ILE A  1 179 ? 15.181  70.440  24.801  1.00 10.15  ? 179 ILE A N   1 
ATOM   1364  C CA  . ILE A  1 179 ? 13.986  69.762  24.287  1.00 9.46   ? 179 ILE A CA  1 
ATOM   1365  C C   . ILE A  1 179 ? 12.910  70.842  24.096  1.00 10.82  ? 179 ILE A C   1 
ATOM   1366  O O   . ILE A  1 179 ? 12.620  71.630  25.024  1.00 11.94  ? 179 ILE A O   1 
ATOM   1367  C CB  . ILE A  1 179 ? 13.430  68.716  25.286  1.00 7.74   ? 179 ILE A CB  1 
ATOM   1368  C CG1 . ILE A  1 179 ? 14.458  67.677  25.581  1.00 7.66   ? 179 ILE A CG1 1 
ATOM   1369  C CG2 . ILE A  1 179 ? 12.200  68.055  24.709  1.00 5.50   ? 179 ILE A CG2 1 
ATOM   1370  C CD1 . ILE A  1 179 ? 14.875  66.831  24.358  1.00 7.87   ? 179 ILE A CD1 1 
ATOM   1371  N N   . TRP A  1 180 ? 12.320  70.911  22.917  1.00 10.04  ? 180 TRP A N   1 
ATOM   1372  C CA  . TRP A  1 180 ? 11.277  71.871  22.668  1.00 10.08  ? 180 TRP A CA  1 
ATOM   1373  C C   . TRP A  1 180 ? 10.180  71.189  21.856  1.00 11.96  ? 180 TRP A C   1 
ATOM   1374  O O   . TRP A  1 180 ? 10.216  69.966  21.644  1.00 12.74  ? 180 TRP A O   1 
ATOM   1375  C CB  . TRP A  1 180 ? 11.866  73.050  21.930  1.00 9.07   ? 180 TRP A CB  1 
ATOM   1376  C CG  . TRP A  1 180 ? 12.663  72.711  20.683  1.00 8.92   ? 180 TRP A CG  1 
ATOM   1377  C CD1 . TRP A  1 180 ? 14.012  72.482  20.762  1.00 8.82   ? 180 TRP A CD1 1 
ATOM   1378  C CD2 . TRP A  1 180 ? 12.186  72.672  19.405  1.00 8.22   ? 180 TRP A CD2 1 
ATOM   1379  N NE1 . TRP A  1 180 ? 14.395  72.307  19.527  1.00 8.42   ? 180 TRP A NE1 1 
ATOM   1380  C CE2 . TRP A  1 180 ? 13.344  72.397  18.701  1.00 8.31   ? 180 TRP A CE2 1 
ATOM   1381  C CE3 . TRP A  1 180 ? 10.990  72.800  18.746  1.00 7.71   ? 180 TRP A CE3 1 
ATOM   1382  C CZ2 . TRP A  1 180 ? 13.341  72.281  17.330  1.00 7.66   ? 180 TRP A CZ2 1 
ATOM   1383  C CZ3 . TRP A  1 180 ? 10.984  72.680  17.370  1.00 7.87   ? 180 TRP A CZ3 1 
ATOM   1384  C CH2 . TRP A  1 180 ? 12.142  72.410  16.676  1.00 7.32   ? 180 TRP A CH2 1 
ATOM   1385  N N   . GLY A  1 181 ? 9.174   71.908  21.371  1.00 12.73  ? 181 GLY A N   1 
ATOM   1386  C CA  . GLY A  1 181 ? 8.130   71.263  20.617  1.00 12.57  ? 181 GLY A CA  1 
ATOM   1387  C C   . GLY A  1 181 ? 7.246   72.280  19.958  1.00 12.97  ? 181 GLY A C   1 
ATOM   1388  O O   . GLY A  1 181 ? 7.451   73.486  20.112  1.00 13.31  ? 181 GLY A O   1 
ATOM   1389  N N   . ILE A  1 182 ? 6.253   71.790  19.240  1.00 13.32  ? 182 ILE A N   1 
ATOM   1390  C CA  . ILE A  1 182 ? 5.322   72.639  18.534  1.00 13.53  ? 182 ILE A CA  1 
ATOM   1391  C C   . ILE A  1 182 ? 3.959   72.051  18.825  1.00 15.02  ? 182 ILE A C   1 
ATOM   1392  O O   . ILE A  1 182 ? 3.892   70.829  19.009  1.00 15.54  ? 182 ILE A O   1 
ATOM   1393  C CB  . ILE A  1 182 ? 5.681   72.605  17.052  1.00 12.65  ? 182 ILE A CB  1 
ATOM   1394  C CG1 . ILE A  1 182 ? 4.810   73.596  16.370  1.00 12.32  ? 182 ILE A CG1 1 
ATOM   1395  C CG2 . ILE A  1 182 ? 5.472   71.224  16.431  1.00 12.84  ? 182 ILE A CG2 1 
ATOM   1396  C CD1 . ILE A  1 182 ? 5.346   73.937  14.980  1.00 13.34  ? 182 ILE A CD1 1 
ATOM   1397  N N   . HIS A  1 183 ? 2.902   72.863  18.952  1.00 16.70  ? 183 HIS A N   1 
ATOM   1398  C CA  . HIS A  1 183 ? 1.548   72.362  19.236  1.00 17.44  ? 183 HIS A CA  1 
ATOM   1399  C C   . HIS A  1 183 ? 0.784   72.290  17.945  1.00 17.83  ? 183 HIS A C   1 
ATOM   1400  O O   . HIS A  1 183 ? 0.862   73.254  17.172  1.00 19.17  ? 183 HIS A O   1 
ATOM   1401  C CB  . HIS A  1 183 ? 0.814   73.301  20.174  1.00 19.14  ? 183 HIS A CB  1 
ATOM   1402  C CG  . HIS A  1 183 ? -0.684  73.037  20.416  1.00 21.32  ? 183 HIS A CG  1 
ATOM   1403  N ND1 . HIS A  1 183 ? -1.613  73.818  19.854  1.00 22.56  ? 183 HIS A ND1 1 
ATOM   1404  C CD2 . HIS A  1 183 ? -1.237  72.197  21.348  1.00 21.11  ? 183 HIS A CD2 1 
ATOM   1405  C CE1 . HIS A  1 183 ? -2.751  73.475  20.445  1.00 21.44  ? 183 HIS A CE1 1 
ATOM   1406  N NE2 . HIS A  1 183 ? -2.510  72.521  21.324  1.00 20.76  ? 183 HIS A NE2 1 
ATOM   1407  N N   . HIS A  1 184 ? 0.094   71.186  17.683  1.00 17.42  ? 184 HIS A N   1 
ATOM   1408  C CA  . HIS A  1 184 ? -0.707  71.075  16.483  1.00 17.88  ? 184 HIS A CA  1 
ATOM   1409  C C   . HIS A  1 184 ? -2.118  71.202  16.974  1.00 19.06  ? 184 HIS A C   1 
ATOM   1410  O O   . HIS A  1 184 ? -2.551  70.349  17.741  1.00 18.58  ? 184 HIS A O   1 
ATOM   1411  C CB  . HIS A  1 184 ? -0.616  69.729  15.793  1.00 17.33  ? 184 HIS A CB  1 
ATOM   1412  C CG  . HIS A  1 184 ? 0.767   69.372  15.313  1.00 17.47  ? 184 HIS A CG  1 
ATOM   1413  N ND1 . HIS A  1 184 ? 1.333   70.017  14.309  1.00 17.52  ? 184 HIS A ND1 1 
ATOM   1414  C CD2 . HIS A  1 184 ? 1.558   68.427  15.887  1.00 17.26  ? 184 HIS A CD2 1 
ATOM   1415  C CE1 . HIS A  1 184 ? 2.532   69.463  14.244  1.00 17.70  ? 184 HIS A CE1 1 
ATOM   1416  N NE2 . HIS A  1 184 ? 2.648   68.533  15.173  1.00 17.65  ? 184 HIS A NE2 1 
ATOM   1417  N N   . PRO A  1 185 ? -2.861  72.249  16.638  1.00 21.14  ? 185 PRO A N   1 
ATOM   1418  C CA  . PRO A  1 185 ? -4.248  72.443  17.063  1.00 21.93  ? 185 PRO A CA  1 
ATOM   1419  C C   . PRO A  1 185 ? -5.171  71.470  16.329  1.00 23.91  ? 185 PRO A C   1 
ATOM   1420  O O   . PRO A  1 185 ? -4.790  70.916  15.278  1.00 24.60  ? 185 PRO A O   1 
ATOM   1421  C CB  . PRO A  1 185 ? -4.495  73.886  16.738  1.00 21.86  ? 185 PRO A CB  1 
ATOM   1422  C CG  . PRO A  1 185 ? -3.116  74.498  16.703  1.00 21.82  ? 185 PRO A CG  1 
ATOM   1423  C CD  . PRO A  1 185 ? -2.363  73.430  15.937  1.00 21.78  ? 185 PRO A CD  1 
ATOM   1424  N N   . SER A  1 186 ? -6.377  71.194  16.802  1.00 26.02  ? 186 SER A N   1 
ATOM   1425  C CA  . SER A  1 186 ? -7.211  70.279  16.044  1.00 28.81  ? 186 SER A CA  1 
ATOM   1426  C C   . SER A  1 186 ? -8.172  71.024  15.132  1.00 30.89  ? 186 SER A C   1 
ATOM   1427  O O   . SER A  1 186 ? -8.608  70.485  14.095  1.00 30.95  ? 186 SER A O   1 
ATOM   1428  C CB  . SER A  1 186 ? -7.984  69.378  16.980  1.00 28.76  ? 186 SER A CB  1 
ATOM   1429  O OG  . SER A  1 186 ? -8.984  70.056  17.727  1.00 29.43  ? 186 SER A OG  1 
ATOM   1430  N N   . THR A  1 187 ? -8.522  72.273  15.481  1.00 32.72  ? 187 THR A N   1 
ATOM   1431  C CA  . THR A  1 187 ? -9.402  73.050  14.631  1.00 34.31  ? 187 THR A CA  1 
ATOM   1432  C C   . THR A  1 187 ? -8.777  74.397  14.309  1.00 35.74  ? 187 THR A C   1 
ATOM   1433  O O   . THR A  1 187 ? -7.959  74.931  15.065  1.00 35.43  ? 187 THR A O   1 
ATOM   1434  C CB  . THR A  1 187 ? -10.743 73.249  15.332  1.00 34.01  ? 187 THR A CB  1 
ATOM   1435  O OG1 . THR A  1 187 ? -10.479 74.048  16.477  1.00 33.51  ? 187 THR A OG1 1 
ATOM   1436  C CG2 . THR A  1 187 ? -11.408 71.930  15.712  1.00 34.50  ? 187 THR A CG2 1 
ATOM   1437  N N   . ASN A  1 188 ? -9.180  74.998  13.190  1.00 37.57  ? 188 ASN A N   1 
ATOM   1438  C CA  . ASN A  1 188 ? -8.644  76.285  12.799  1.00 39.24  ? 188 ASN A CA  1 
ATOM   1439  C C   . ASN A  1 188 ? -8.979  77.339  13.814  1.00 40.38  ? 188 ASN A C   1 
ATOM   1440  O O   . ASN A  1 188 ? -8.151  78.174  14.158  1.00 40.34  ? 188 ASN A O   1 
ATOM   1441  C CB  . ASN A  1 188 ? -9.197  76.697  11.480  1.00 40.19  ? 188 ASN A CB  1 
ATOM   1442  C CG  . ASN A  1 188 ? -8.098  76.598  10.447  1.00 41.67  ? 188 ASN A CG  1 
ATOM   1443  O OD1 . ASN A  1 188 ? -7.045  77.223  10.564  1.00 43.16  ? 188 ASN A OD1 1 
ATOM   1444  N ND2 . ASN A  1 188 ? -8.272  75.805  9.395   1.00 41.74  ? 188 ASN A ND2 1 
ATOM   1445  N N   . GLN A  1 189 ? -10.185 77.239  14.368  1.00 42.27  ? 189 GLN A N   1 
ATOM   1446  C CA  . GLN A  1 189 ? -10.624 78.110  15.447  1.00 44.12  ? 189 GLN A CA  1 
ATOM   1447  C C   . GLN A  1 189 ? -9.689  77.989  16.640  1.00 42.87  ? 189 GLN A C   1 
ATOM   1448  O O   . GLN A  1 189 ? -9.375  79.007  17.268  1.00 42.37  ? 189 GLN A O   1 
ATOM   1449  C CB  . GLN A  1 189 ? -12.037 77.757  15.934  1.00 47.71  ? 189 GLN A CB  1 
ATOM   1450  C CG  . GLN A  1 189 ? -13.240 78.119  15.024  1.00 51.49  ? 189 GLN A CG  1 
ATOM   1451  C CD  . GLN A  1 189 ? -13.379 77.348  13.699  1.00 54.05  ? 189 GLN A CD  1 
ATOM   1452  O OE1 . GLN A  1 189 ? -12.817 76.256  13.474  1.00 55.48  ? 189 GLN A OE1 1 
ATOM   1453  N NE2 . GLN A  1 189 ? -14.122 77.922  12.751  1.00 55.18  ? 189 GLN A NE2 1 
ATOM   1454  N N   . GLU A  1 190 ? -9.195  76.777  16.931  1.00 41.49  ? 190 GLU A N   1 
ATOM   1455  C CA  . GLU A  1 190 ? -8.275  76.569  18.048  1.00 40.23  ? 190 GLU A CA  1 
ATOM   1456  C C   . GLU A  1 190 ? -6.929  77.261  17.768  1.00 38.92  ? 190 GLU A C   1 
ATOM   1457  O O   . GLU A  1 190 ? -6.377  77.971  18.633  1.00 38.20  ? 190 GLU A O   1 
ATOM   1458  C CB  . GLU A  1 190 ? -8.086  75.080  18.233  1.00 40.45  ? 190 GLU A CB  1 
ATOM   1459  C CG  . GLU A  1 190 ? -7.424  74.629  19.516  1.00 40.91  ? 190 GLU A CG  1 
ATOM   1460  C CD  . GLU A  1 190 ? -7.070  73.147  19.492  1.00 41.60  ? 190 GLU A CD  1 
ATOM   1461  O OE1 . GLU A  1 190 ? -5.911  72.798  19.743  1.00 41.99  ? 190 GLU A OE1 1 
ATOM   1462  O OE2 . GLU A  1 190 ? -7.921  72.301  19.211  1.00 41.34  ? 190 GLU A OE2 1 
ATOM   1463  N N   . GLN A  1 191 ? -6.429  77.136  16.528  1.00 36.83  ? 191 GLN A N   1 
ATOM   1464  C CA  . GLN A  1 191 ? -5.184  77.757  16.117  1.00 35.37  ? 191 GLN A CA  1 
ATOM   1465  C C   . GLN A  1 191 ? -5.220  79.250  16.387  1.00 35.34  ? 191 GLN A C   1 
ATOM   1466  O O   . GLN A  1 191 ? -4.431  79.770  17.184  1.00 34.30  ? 191 GLN A O   1 
ATOM   1467  C CB  . GLN A  1 191 ? -4.977  77.476  14.630  1.00 35.17  ? 191 GLN A CB  1 
ATOM   1468  C CG  . GLN A  1 191 ? -3.884  78.258  13.906  1.00 35.43  ? 191 GLN A CG  1 
ATOM   1469  C CD  . GLN A  1 191 ? -2.475  78.027  14.437  1.00 35.49  ? 191 GLN A CD  1 
ATOM   1470  O OE1 . GLN A  1 191 ? -1.962  76.912  14.485  1.00 35.74  ? 191 GLN A OE1 1 
ATOM   1471  N NE2 . GLN A  1 191 ? -1.760  79.049  14.852  1.00 35.37  ? 191 GLN A NE2 1 
ATOM   1472  N N   . THR A  1 192 ? -6.197  79.926  15.786  1.00 35.80  ? 192 THR A N   1 
ATOM   1473  C CA  . THR A  1 192 ? -6.333  81.370  15.877  1.00 35.92  ? 192 THR A CA  1 
ATOM   1474  C C   . THR A  1 192 ? -6.647  81.828  17.286  1.00 34.83  ? 192 THR A C   1 
ATOM   1475  O O   . THR A  1 192 ? -6.115  82.839  17.756  1.00 35.57  ? 192 THR A O   1 
ATOM   1476  C CB  . THR A  1 192 ? -7.430  81.817  14.905  1.00 36.67  ? 192 THR A CB  1 
ATOM   1477  O OG1 . THR A  1 192 ? -8.575  80.976  15.131  1.00 37.44  ? 192 THR A OG1 1 
ATOM   1478  C CG2 . THR A  1 192 ? -6.923  81.759  13.451  1.00 36.74  ? 192 THR A CG2 1 
ATOM   1479  N N   . SER A  1 193 ? -7.481  81.076  17.986  1.00 32.92  ? 193 SER A N   1 
ATOM   1480  C CA  . SER A  1 193 ? -7.794  81.386  19.351  1.00 32.08  ? 193 SER A CA  1 
ATOM   1481  C C   . SER A  1 193 ? -6.523  81.485  20.185  1.00 31.24  ? 193 SER A C   1 
ATOM   1482  O O   . SER A  1 193 ? -6.294  82.524  20.825  1.00 31.20  ? 193 SER A O   1 
ATOM   1483  C CB  . SER A  1 193 ? -8.682  80.301  19.887  1.00 33.27  ? 193 SER A CB  1 
ATOM   1484  O OG  . SER A  1 193 ? -9.075  80.535  21.234  1.00 34.92  ? 193 SER A OG  1 
ATOM   1485  N N   . LEU A  1 194 ? -5.663  80.466  20.101  1.00 29.91  ? 194 LEU A N   1 
ATOM   1486  C CA  . LEU A  1 194 ? -4.464  80.453  20.918  1.00 28.47  ? 194 LEU A CA  1 
ATOM   1487  C C   . LEU A  1 194 ? -3.328  81.325  20.428  1.00 28.34  ? 194 LEU A C   1 
ATOM   1488  O O   . LEU A  1 194 ? -2.729  82.076  21.207  1.00 27.81  ? 194 LEU A O   1 
ATOM   1489  C CB  . LEU A  1 194 ? -3.898  79.057  21.036  1.00 26.82  ? 194 LEU A CB  1 
ATOM   1490  C CG  . LEU A  1 194 ? -4.702  78.041  21.756  1.00 25.96  ? 194 LEU A CG  1 
ATOM   1491  C CD1 . LEU A  1 194 ? -3.900  76.776  21.841  1.00 25.92  ? 194 LEU A CD1 1 
ATOM   1492  C CD2 . LEU A  1 194 ? -5.026  78.517  23.144  1.00 24.91  ? 194 LEU A CD2 1 
ATOM   1493  N N   . TYR A  1 195 ? -2.999  81.187  19.153  1.00 28.11  ? 195 TYR A N   1 
ATOM   1494  C CA  . TYR A  1 195 ? -1.780  81.791  18.661  1.00 28.16  ? 195 TYR A CA  1 
ATOM   1495  C C   . TYR A  1 195 ? -2.028  82.949  17.703  1.00 29.24  ? 195 TYR A C   1 
ATOM   1496  O O   . TYR A  1 195 ? -1.084  83.495  17.115  1.00 29.61  ? 195 TYR A O   1 
ATOM   1497  C CB  . TYR A  1 195 ? -0.949  80.672  17.996  1.00 27.46  ? 195 TYR A CB  1 
ATOM   1498  C CG  . TYR A  1 195 ? -0.803  79.425  18.851  1.00 27.17  ? 195 TYR A CG  1 
ATOM   1499  C CD1 . TYR A  1 195 ? -0.244  79.490  20.117  1.00 26.97  ? 195 TYR A CD1 1 
ATOM   1500  C CD2 . TYR A  1 195 ? -1.279  78.214  18.389  1.00 27.11  ? 195 TYR A CD2 1 
ATOM   1501  C CE1 . TYR A  1 195 ? -0.173  78.367  20.912  1.00 26.20  ? 195 TYR A CE1 1 
ATOM   1502  C CE2 . TYR A  1 195 ? -1.207  77.086  19.186  1.00 26.27  ? 195 TYR A CE2 1 
ATOM   1503  C CZ  . TYR A  1 195 ? -0.665  77.168  20.448  1.00 25.71  ? 195 TYR A CZ  1 
ATOM   1504  O OH  . TYR A  1 195 ? -0.646  76.063  21.254  1.00 24.31  ? 195 TYR A OH  1 
ATOM   1505  N N   . VAL A  1 196 ? -3.294  83.351  17.547  1.00 29.93  ? 196 VAL A N   1 
ATOM   1506  C CA  . VAL A  1 196 ? -3.739  84.446  16.694  1.00 30.33  ? 196 VAL A CA  1 
ATOM   1507  C C   . VAL A  1 196 ? -3.501  84.204  15.224  1.00 30.54  ? 196 VAL A C   1 
ATOM   1508  O O   . VAL A  1 196 ? -4.488  84.192  14.496  1.00 30.75  ? 196 VAL A O   1 
ATOM   1509  C CB  . VAL A  1 196 ? -3.070  85.762  17.179  1.00 31.08  ? 196 VAL A CB  1 
ATOM   1510  C CG1 . VAL A  1 196 ? -3.257  86.908  16.205  1.00 32.06  ? 196 VAL A CG1 1 
ATOM   1511  C CG2 . VAL A  1 196 ? -3.744  86.164  18.491  1.00 30.56  ? 196 VAL A CG2 1 
ATOM   1512  N N   . GLN A  1 197 ? -2.280  84.007  14.749  1.00 31.53  ? 197 GLN A N   1 
ATOM   1513  C CA  . GLN A  1 197 ? -2.062  83.774  13.326  1.00 34.11  ? 197 GLN A CA  1 
ATOM   1514  C C   . GLN A  1 197 ? -2.694  82.476  12.849  1.00 34.82  ? 197 GLN A C   1 
ATOM   1515  O O   . GLN A  1 197 ? -2.919  81.538  13.616  1.00 34.86  ? 197 GLN A O   1 
ATOM   1516  C CB  . GLN A  1 197 ? -0.592  83.665  12.929  1.00 35.34  ? 197 GLN A CB  1 
ATOM   1517  C CG  . GLN A  1 197 ? 0.443   83.896  14.001  1.00 36.72  ? 197 GLN A CG  1 
ATOM   1518  C CD  . GLN A  1 197 ? 0.480   85.318  14.547  1.00 37.63  ? 197 GLN A CD  1 
ATOM   1519  O OE1 . GLN A  1 197 ? -0.252  86.205  14.130  1.00 37.76  ? 197 GLN A OE1 1 
ATOM   1520  N NE2 . GLN A  1 197 ? 1.329   85.582  15.516  1.00 38.75  ? 197 GLN A NE2 1 
ATOM   1521  N N   . ALA A  1 198 ? -2.958  82.376  11.557  1.00 35.79  ? 198 ALA A N   1 
ATOM   1522  C CA  . ALA A  1 198 ? -3.559  81.170  11.009  1.00 37.12  ? 198 ALA A CA  1 
ATOM   1523  C C   . ALA A  1 198 ? -2.588  80.005  10.907  1.00 37.62  ? 198 ALA A C   1 
ATOM   1524  O O   . ALA A  1 198 ? -2.997  78.847  10.845  1.00 37.16  ? 198 ALA A O   1 
ATOM   1525  C CB  . ALA A  1 198 ? -4.088  81.442  9.615   1.00 38.52  ? 198 ALA A CB  1 
ATOM   1526  N N   . SER A  1 199 ? -1.292  80.316  10.857  1.00 38.22  ? 199 SER A N   1 
ATOM   1527  C CA  . SER A  1 199 ? -0.266  79.305  10.726  1.00 38.92  ? 199 SER A CA  1 
ATOM   1528  C C   . SER A  1 199 ? 0.893   79.701  11.606  1.00 38.53  ? 199 SER A C   1 
ATOM   1529  O O   . SER A  1 199 ? 1.438   80.814  11.485  1.00 39.10  ? 199 SER A O   1 
ATOM   1530  C CB  . SER A  1 199 ? 0.240   79.217  9.292   1.00 40.02  ? 199 SER A CB  1 
ATOM   1531  O OG  . SER A  1 199 ? -0.843  79.294  8.374   1.00 41.10  ? 199 SER A OG  1 
ATOM   1532  N N   . GLY A  1 200 ? 1.202   78.843  12.567  1.00 37.54  ? 200 GLY A N   1 
ATOM   1533  C CA  . GLY A  1 200 ? 2.377   79.068  13.389  1.00 35.69  ? 200 GLY A CA  1 
ATOM   1534  C C   . GLY A  1 200 ? 3.612   78.634  12.626  1.00 33.97  ? 200 GLY A C   1 
ATOM   1535  O O   . GLY A  1 200 ? 3.519   78.131  11.499  1.00 33.58  ? 200 GLY A O   1 
ATOM   1536  N N   . ARG A  1 201 ? 4.750   78.746  13.281  1.00 32.92  ? 201 ARG A N   1 
ATOM   1537  C CA  . ARG A  1 201 ? 6.025   78.432  12.686  1.00 32.33  ? 201 ARG A CA  1 
ATOM   1538  C C   . ARG A  1 201 ? 7.021   78.395  13.831  1.00 30.06  ? 201 ARG A C   1 
ATOM   1539  O O   . ARG A  1 201 ? 7.001   79.326  14.648  1.00 28.87  ? 201 ARG A O   1 
ATOM   1540  C CB  . ARG A  1 201 ? 6.410   79.542  11.689  1.00 34.16  ? 201 ARG A CB  1 
ATOM   1541  C CG  . ARG A  1 201 ? 7.804   79.401  11.091  1.00 36.31  ? 201 ARG A CG  1 
ATOM   1542  C CD  . ARG A  1 201 ? 8.148   80.559  10.196  1.00 38.25  ? 201 ARG A CD  1 
ATOM   1543  N NE  . ARG A  1 201 ? 8.439   81.798  10.904  1.00 40.75  ? 201 ARG A NE  1 
ATOM   1544  C CZ  . ARG A  1 201 ? 7.944   82.978  10.462  1.00 42.32  ? 201 ARG A CZ  1 
ATOM   1545  N NH1 . ARG A  1 201 ? 8.301   84.106  11.119  1.00 43.03  ? 201 ARG A NH1 1 
ATOM   1546  N NH2 . ARG A  1 201 ? 7.075   83.014  9.412   1.00 42.18  ? 201 ARG A NH2 1 
ATOM   1547  N N   . VAL A  1 202 ? 7.864   77.371  13.929  1.00 27.74  ? 202 VAL A N   1 
ATOM   1548  C CA  . VAL A  1 202 ? 8.921   77.377  14.917  1.00 25.88  ? 202 VAL A CA  1 
ATOM   1549  C C   . VAL A  1 202 ? 10.214  77.099  14.156  1.00 25.58  ? 202 VAL A C   1 
ATOM   1550  O O   . VAL A  1 202 ? 10.231  76.146  13.368  1.00 24.81  ? 202 VAL A O   1 
ATOM   1551  C CB  . VAL A  1 202 ? 8.667   76.288  15.962  1.00 24.88  ? 202 VAL A CB  1 
ATOM   1552  C CG1 . VAL A  1 202 ? 9.793   76.273  16.977  1.00 24.31  ? 202 VAL A CG1 1 
ATOM   1553  C CG2 . VAL A  1 202 ? 7.383   76.567  16.690  1.00 24.03  ? 202 VAL A CG2 1 
ATOM   1554  N N   . THR A  1 203 ? 11.232  77.947  14.300  1.00 25.05  ? 203 THR A N   1 
ATOM   1555  C CA  . THR A  1 203 ? 12.543  77.700  13.727  1.00 26.40  ? 203 THR A CA  1 
ATOM   1556  C C   . THR A  1 203 ? 13.532  77.737  14.892  1.00 26.87  ? 203 THR A C   1 
ATOM   1557  O O   . THR A  1 203 ? 13.570  78.723  15.647  1.00 28.58  ? 203 THR A O   1 
ATOM   1558  C CB  . THR A  1 203 ? 12.932  78.791  12.700  1.00 26.86  ? 203 THR A CB  1 
ATOM   1559  O OG1 . THR A  1 203 ? 11.999  78.735  11.626  1.00 26.91  ? 203 THR A OG1 1 
ATOM   1560  C CG2 . THR A  1 203 ? 14.358  78.591  12.160  1.00 27.10  ? 203 THR A CG2 1 
ATOM   1561  N N   . VAL A  1 204 ? 14.291  76.669  15.124  1.00 25.30  ? 204 VAL A N   1 
ATOM   1562  C CA  . VAL A  1 204 ? 15.253  76.641  16.202  1.00 24.37  ? 204 VAL A CA  1 
ATOM   1563  C C   . VAL A  1 204 ? 16.552  76.448  15.477  1.00 24.29  ? 204 VAL A C   1 
ATOM   1564  O O   . VAL A  1 204 ? 16.638  75.552  14.631  1.00 24.41  ? 204 VAL A O   1 
ATOM   1565  C CB  . VAL A  1 204 ? 14.947  75.467  17.138  1.00 24.22  ? 204 VAL A CB  1 
ATOM   1566  C CG1 . VAL A  1 204 ? 16.025  75.307  18.193  1.00 24.17  ? 204 VAL A CG1 1 
ATOM   1567  C CG2 . VAL A  1 204 ? 13.640  75.737  17.844  1.00 23.39  ? 204 VAL A CG2 1 
ATOM   1568  N N   . SER A  1 205 ? 17.530  77.288  15.754  1.00 24.52  ? 205 SER A N   1 
ATOM   1569  C CA  . SER A  1 205 ? 18.769  77.254  15.027  1.00 25.23  ? 205 SER A CA  1 
ATOM   1570  C C   . SER A  1 205 ? 19.974  77.459  15.903  1.00 25.76  ? 205 SER A C   1 
ATOM   1571  O O   . SER A  1 205 ? 19.875  78.008  17.009  1.00 24.82  ? 205 SER A O   1 
ATOM   1572  C CB  . SER A  1 205 ? 18.733  78.337  13.972  1.00 26.50  ? 205 SER A CB  1 
ATOM   1573  O OG  . SER A  1 205 ? 17.606  79.246  14.032  1.00 27.74  ? 205 SER A OG  1 
ATOM   1574  N N   . THR A  1 206 ? 21.113  76.993  15.425  1.00 27.30  ? 206 THR A N   1 
ATOM   1575  C CA  . THR A  1 206 ? 22.381  77.275  16.065  1.00 29.34  ? 206 THR A CA  1 
ATOM   1576  C C   . THR A  1 206 ? 23.274  77.792  14.949  1.00 30.63  ? 206 THR A C   1 
ATOM   1577  O O   . THR A  1 206 ? 22.768  78.087  13.862  1.00 31.20  ? 206 THR A O   1 
ATOM   1578  C CB  . THR A  1 206 ? 22.943  75.996  16.688  1.00 29.55  ? 206 THR A CB  1 
ATOM   1579  O OG1 . THR A  1 206 ? 22.996  75.002  15.660  1.00 29.85  ? 206 THR A OG1 1 
ATOM   1580  C CG2 . THR A  1 206 ? 22.113  75.568  17.887  1.00 29.46  ? 206 THR A CG2 1 
ATOM   1581  N N   . ARG A  1 207 ? 24.579  77.958  15.093  1.00 32.56  ? 207 ARG A N   1 
ATOM   1582  C CA  . ARG A  1 207 ? 25.353  78.360  13.940  1.00 34.44  ? 207 ARG A CA  1 
ATOM   1583  C C   . ARG A  1 207 ? 25.468  77.180  13.014  1.00 35.96  ? 207 ARG A C   1 
ATOM   1584  O O   . ARG A  1 207 ? 25.485  77.354  11.797  1.00 36.50  ? 207 ARG A O   1 
ATOM   1585  C CB  . ARG A  1 207 ? 26.737  78.778  14.286  1.00 35.30  ? 207 ARG A CB  1 
ATOM   1586  C CG  . ARG A  1 207 ? 26.750  80.156  14.876  1.00 37.22  ? 207 ARG A CG  1 
ATOM   1587  C CD  . ARG A  1 207 ? 28.205  80.477  15.124  1.00 38.78  ? 207 ARG A CD  1 
ATOM   1588  N NE  . ARG A  1 207 ? 28.310  81.657  15.953  1.00 41.24  ? 207 ARG A NE  1 
ATOM   1589  C CZ  . ARG A  1 207 ? 28.668  81.574  17.251  1.00 42.52  ? 207 ARG A CZ  1 
ATOM   1590  N NH1 . ARG A  1 207 ? 28.760  82.716  17.959  1.00 43.80  ? 207 ARG A NH1 1 
ATOM   1591  N NH2 . ARG A  1 207 ? 28.891  80.386  17.852  1.00 42.39  ? 207 ARG A NH2 1 
ATOM   1592  N N   . ARG A  1 208 ? 25.463  75.987  13.589  1.00 37.69  ? 208 ARG A N   1 
ATOM   1593  C CA  . ARG A  1 208 ? 25.631  74.769  12.835  1.00 39.76  ? 208 ARG A CA  1 
ATOM   1594  C C   . ARG A  1 208 ? 24.363  74.191  12.212  1.00 38.82  ? 208 ARG A C   1 
ATOM   1595  O O   . ARG A  1 208 ? 24.458  73.316  11.352  1.00 38.66  ? 208 ARG A O   1 
ATOM   1596  C CB  . ARG A  1 208 ? 26.276  73.731  13.761  1.00 43.15  ? 208 ARG A CB  1 
ATOM   1597  C CG  . ARG A  1 208 ? 27.665  74.195  14.158  1.00 47.48  ? 208 ARG A CG  1 
ATOM   1598  C CD  . ARG A  1 208 ? 28.350  73.306  15.187  1.00 50.92  ? 208 ARG A CD  1 
ATOM   1599  N NE  . ARG A  1 208 ? 29.794  73.478  15.042  1.00 54.89  ? 208 ARG A NE  1 
ATOM   1600  C CZ  . ARG A  1 208 ? 30.518  72.718  14.173  1.00 57.02  ? 208 ARG A CZ  1 
ATOM   1601  N NH1 . ARG A  1 208 ? 31.848  72.939  14.022  1.00 58.10  ? 208 ARG A NH1 1 
ATOM   1602  N NH2 . ARG A  1 208 ? 29.917  71.723  13.469  1.00 57.46  ? 208 ARG A NH2 1 
ATOM   1603  N N   . SER A  1 209 ? 23.155  74.593  12.583  1.00 37.66  ? 209 SER A N   1 
ATOM   1604  C CA  . SER A  1 209 ? 21.979  73.903  12.065  1.00 36.62  ? 209 SER A CA  1 
ATOM   1605  C C   . SER A  1 209 ? 20.737  74.759  12.196  1.00 36.37  ? 209 SER A C   1 
ATOM   1606  O O   . SER A  1 209 ? 20.781  75.829  12.820  1.00 37.13  ? 209 SER A O   1 
ATOM   1607  C CB  . SER A  1 209 ? 21.764  72.633  12.846  1.00 36.66  ? 209 SER A CB  1 
ATOM   1608  O OG  . SER A  1 209 ? 21.539  72.940  14.230  1.00 36.97  ? 209 SER A OG  1 
ATOM   1609  N N   . GLN A  1 210 ? 19.626  74.300  11.643  1.00 34.58  ? 210 GLN A N   1 
ATOM   1610  C CA  . GLN A  1 210 ? 18.347  74.982  11.778  1.00 33.22  ? 210 GLN A CA  1 
ATOM   1611  C C   . GLN A  1 210 ? 17.278  73.914  11.656  1.00 33.64  ? 210 GLN A C   1 
ATOM   1612  O O   . GLN A  1 210 ? 17.578  72.845  11.118  1.00 35.12  ? 210 GLN A O   1 
ATOM   1613  C CB  . GLN A  1 210 ? 18.123  75.972  10.667  1.00 31.68  ? 210 GLN A CB  1 
ATOM   1614  C CG  . GLN A  1 210 ? 18.364  75.366  9.297   1.00 31.68  ? 210 GLN A CG  1 
ATOM   1615  C CD  . GLN A  1 210 ? 17.649  76.200  8.278   1.00 31.90  ? 210 GLN A CD  1 
ATOM   1616  O OE1 . GLN A  1 210 ? 18.139  77.254  7.896   1.00 32.58  ? 210 GLN A OE1 1 
ATOM   1617  N NE2 . GLN A  1 210 ? 16.398  75.949  7.939   1.00 32.11  ? 210 GLN A NE2 1 
ATOM   1618  N N   . GLN A  1 211 ? 16.080  74.086  12.186  1.00 32.49  ? 211 GLN A N   1 
ATOM   1619  C CA  . GLN A  1 211 ? 14.981  73.197  11.831  1.00 31.52  ? 211 GLN A CA  1 
ATOM   1620  C C   . GLN A  1 211 ? 13.758  74.053  11.971  1.00 31.25  ? 211 GLN A C   1 
ATOM   1621  O O   . GLN A  1 211 ? 13.679  74.892  12.868  1.00 30.71  ? 211 GLN A O   1 
ATOM   1622  C CB  . GLN A  1 211 ? 14.857  71.978  12.728  1.00 31.12  ? 211 GLN A CB  1 
ATOM   1623  C CG  . GLN A  1 211 ? 15.234  72.183  14.164  1.00 32.35  ? 211 GLN A CG  1 
ATOM   1624  C CD  . GLN A  1 211 ? 15.733  70.896  14.794  1.00 33.04  ? 211 GLN A CD  1 
ATOM   1625  O OE1 . GLN A  1 211 ? 15.177  69.804  14.597  1.00 32.72  ? 211 GLN A OE1 1 
ATOM   1626  N NE2 . GLN A  1 211 ? 16.809  71.038  15.567  1.00 33.04  ? 211 GLN A NE2 1 
ATOM   1627  N N   . THR A  1 212 ? 12.902  73.993  10.978  1.00 31.14  ? 212 THR A N   1 
ATOM   1628  C CA  . THR A  1 212 ? 11.700  74.785  11.019  1.00 30.42  ? 212 THR A CA  1 
ATOM   1629  C C   . THR A  1 212 ? 10.609  73.771  10.915  1.00 29.90  ? 212 THR A C   1 
ATOM   1630  O O   . THR A  1 212 ? 10.672  72.887  10.057  1.00 29.91  ? 212 THR A O   1 
ATOM   1631  C CB  . THR A  1 212 ? 11.650  75.752  9.834   1.00 30.91  ? 212 THR A CB  1 
ATOM   1632  O OG1 . THR A  1 212 ? 12.843  76.559  9.913   1.00 31.18  ? 212 THR A OG1 1 
ATOM   1633  C CG2 . THR A  1 212 ? 10.360  76.582  9.799   1.00 30.21  ? 212 THR A CG2 1 
ATOM   1634  N N   . ILE A  1 213 ? 9.701   73.813  11.857  1.00 29.44  ? 213 ILE A N   1 
ATOM   1635  C CA  . ILE A  1 213 ? 8.582   72.907  11.842  1.00 28.85  ? 213 ILE A CA  1 
ATOM   1636  C C   . ILE A  1 213 ? 7.373   73.810  11.719  1.00 28.98  ? 213 ILE A C   1 
ATOM   1637  O O   . ILE A  1 213 ? 7.370   74.920  12.266  1.00 28.78  ? 213 ILE A O   1 
ATOM   1638  C CB  . ILE A  1 213 ? 8.545   72.084  13.166  1.00 27.83  ? 213 ILE A CB  1 
ATOM   1639  C CG1 . ILE A  1 213 ? 9.661   71.043  13.266  1.00 27.14  ? 213 ILE A CG1 1 
ATOM   1640  C CG2 . ILE A  1 213 ? 7.257   71.303  13.210  1.00 27.61  ? 213 ILE A CG2 1 
ATOM   1641  C CD1 . ILE A  1 213 ? 11.067  71.543  13.588  1.00 28.27  ? 213 ILE A CD1 1 
ATOM   1642  N N   . ILE A  1 214 ? 6.398   73.416  10.905  1.00 29.17  ? 214 ILE A N   1 
ATOM   1643  C CA  . ILE A  1 214 ? 5.154   74.161  10.858  1.00 29.78  ? 214 ILE A CA  1 
ATOM   1644  C C   . ILE A  1 214 ? 4.118   73.186  11.417  1.00 29.60  ? 214 ILE A C   1 
ATOM   1645  O O   . ILE A  1 214 ? 4.249   71.972  11.198  1.00 29.37  ? 214 ILE A O   1 
ATOM   1646  C CB  . ILE A  1 214 ? 4.827   74.617  9.395   1.00 29.60  ? 214 ILE A CB  1 
ATOM   1647  C CG1 . ILE A  1 214 ? 4.982   73.502  8.370   1.00 30.12  ? 214 ILE A CG1 1 
ATOM   1648  C CG2 . ILE A  1 214 ? 5.754   75.782  9.092   1.00 28.87  ? 214 ILE A CG2 1 
ATOM   1649  C CD1 . ILE A  1 214 ? 4.655   73.887  6.912   1.00 31.31  ? 214 ILE A CD1 1 
ATOM   1650  N N   . PRO A  1 215 ? 3.150   73.645  12.224  1.00 29.42  ? 215 PRO A N   1 
ATOM   1651  C CA  . PRO A  1 215 ? 2.137   72.804  12.834  1.00 29.30  ? 215 PRO A CA  1 
ATOM   1652  C C   . PRO A  1 215 ? 1.167   72.251  11.812  1.00 29.96  ? 215 PRO A C   1 
ATOM   1653  O O   . PRO A  1 215 ? 1.196   72.621  10.637  1.00 30.04  ? 215 PRO A O   1 
ATOM   1654  C CB  . PRO A  1 215 ? 1.513   73.710  13.847  1.00 28.64  ? 215 PRO A CB  1 
ATOM   1655  C CG  . PRO A  1 215 ? 1.506   75.035  13.144  1.00 28.49  ? 215 PRO A CG  1 
ATOM   1656  C CD  . PRO A  1 215 ? 2.901   75.050  12.538  1.00 29.17  ? 215 PRO A CD  1 
ATOM   1657  N N   . ASN A  1 216 ? 0.255   71.385  12.232  1.00 31.03  ? 216 ASN A N   1 
ATOM   1658  C CA  . ASN A  1 216 ? -0.688  70.786  11.312  1.00 32.57  ? 216 ASN A CA  1 
ATOM   1659  C C   . ASN A  1 216 ? -2.016  70.708  12.005  1.00 31.88  ? 216 ASN A C   1 
ATOM   1660  O O   . ASN A  1 216 ? -2.168  69.948  12.970  1.00 31.85  ? 216 ASN A O   1 
ATOM   1661  C CB  . ASN A  1 216 ? -0.309  69.387  10.940  1.00 35.78  ? 216 ASN A CB  1 
ATOM   1662  C CG  . ASN A  1 216 ? 1.142   69.186  10.518  1.00 39.17  ? 216 ASN A CG  1 
ATOM   1663  O OD1 . ASN A  1 216 ? 1.839   68.325  11.092  1.00 40.89  ? 216 ASN A OD1 1 
ATOM   1664  N ND2 . ASN A  1 216 ? 1.627   69.934  9.517   1.00 39.78  ? 216 ASN A ND2 1 
ATOM   1665  N N   . ILE A  1 217 ? -2.968  71.497  11.533  1.00 30.85  ? 217 ILE A N   1 
ATOM   1666  C CA  . ILE A  1 217 ? -4.272  71.593  12.161  1.00 30.02  ? 217 ILE A CA  1 
ATOM   1667  C C   . ILE A  1 217 ? -5.168  70.484  11.654  1.00 29.68  ? 217 ILE A C   1 
ATOM   1668  O O   . ILE A  1 217 ? -5.328  70.353  10.433  1.00 30.67  ? 217 ILE A O   1 
ATOM   1669  C CB  . ILE A  1 217 ? -4.875  72.958  11.825  1.00 30.59  ? 217 ILE A CB  1 
ATOM   1670  C CG1 . ILE A  1 217 ? -3.967  74.076  12.292  1.00 30.67  ? 217 ILE A CG1 1 
ATOM   1671  C CG2 . ILE A  1 217 ? -6.207  73.108  12.513  1.00 29.90  ? 217 ILE A CG2 1 
ATOM   1672  C CD1 . ILE A  1 217 ? -4.099  75.290  11.332  1.00 31.81  ? 217 ILE A CD1 1 
ATOM   1673  N N   . GLY A  1 218 ? -5.754  69.693  12.537  1.00 28.93  ? 218 GLY A N   1 
ATOM   1674  C CA  . GLY A  1 218 ? -6.652  68.639  12.092  1.00 29.08  ? 218 GLY A CA  1 
ATOM   1675  C C   . GLY A  1 218 ? -7.062  67.751  13.255  1.00 28.59  ? 218 GLY A C   1 
ATOM   1676  O O   . GLY A  1 218 ? -6.430  67.788  14.312  1.00 28.50  ? 218 GLY A O   1 
ATOM   1677  N N   . SER A  1 219 ? -8.082  66.917  13.101  1.00 28.09  ? 219 SER A N   1 
ATOM   1678  C CA  . SER A  1 219 ? -8.453  66.082  14.213  1.00 28.00  ? 219 SER A CA  1 
ATOM   1679  C C   . SER A  1 219 ? -7.691  64.778  14.268  1.00 27.36  ? 219 SER A C   1 
ATOM   1680  O O   . SER A  1 219 ? -7.514  64.045  13.287  1.00 27.51  ? 219 SER A O   1 
ATOM   1681  C CB  . SER A  1 219 ? -9.916  65.787  14.145  1.00 29.01  ? 219 SER A CB  1 
ATOM   1682  O OG  . SER A  1 219 ? -10.614 67.019  14.160  1.00 31.60  ? 219 SER A OG  1 
ATOM   1683  N N   . ARG A  1 220 ? -7.151  64.543  15.438  1.00 26.30  ? 220 ARG A N   1 
ATOM   1684  C CA  . ARG A  1 220 ? -6.538  63.271  15.739  1.00 26.73  ? 220 ARG A CA  1 
ATOM   1685  C C   . ARG A  1 220 ? -7.487  62.528  16.670  1.00 28.14  ? 220 ARG A C   1 
ATOM   1686  O O   . ARG A  1 220 ? -8.538  63.083  17.046  1.00 28.67  ? 220 ARG A O   1 
ATOM   1687  C CB  . ARG A  1 220 ? -5.221  63.476  16.447  1.00 25.49  ? 220 ARG A CB  1 
ATOM   1688  C CG  . ARG A  1 220 ? -4.072  63.928  15.571  1.00 24.22  ? 220 ARG A CG  1 
ATOM   1689  C CD  . ARG A  1 220 ? -3.977  65.415  15.450  1.00 22.08  ? 220 ARG A CD  1 
ATOM   1690  N NE  . ARG A  1 220 ? -2.926  65.690  14.505  1.00 20.26  ? 220 ARG A NE  1 
ATOM   1691  C CZ  . ARG A  1 220 ? -2.610  66.949  14.212  1.00 20.72  ? 220 ARG A CZ  1 
ATOM   1692  N NH1 . ARG A  1 220 ? -1.663  67.196  13.288  1.00 21.13  ? 220 ARG A NH1 1 
ATOM   1693  N NH2 . ARG A  1 220 ? -3.221  67.972  14.843  1.00 20.06  ? 220 ARG A NH2 1 
ATOM   1694  N N   . PRO A  1 221 ? -7.231  61.264  17.037  1.00 28.54  ? 221 PRO A N   1 
ATOM   1695  C CA  . PRO A  1 221 ? -8.096  60.558  17.956  1.00 29.42  ? 221 PRO A CA  1 
ATOM   1696  C C   . PRO A  1 221 ? -7.933  61.127  19.350  1.00 30.69  ? 221 PRO A C   1 
ATOM   1697  O O   . PRO A  1 221 ? -6.850  61.577  19.771  1.00 30.01  ? 221 PRO A O   1 
ATOM   1698  C CB  . PRO A  1 221 ? -7.692  59.121  17.890  1.00 28.76  ? 221 PRO A CB  1 
ATOM   1699  C CG  . PRO A  1 221 ? -7.251  59.011  16.467  1.00 28.91  ? 221 PRO A CG  1 
ATOM   1700  C CD  . PRO A  1 221 ? -6.452  60.298  16.291  1.00 28.50  ? 221 PRO A CD  1 
ATOM   1701  N N   . TRP A  1 222 ? -9.061  61.075  20.037  1.00 32.35  ? 222 TRP A N   1 
ATOM   1702  C CA  . TRP A  1 222 ? -9.241  61.473  21.414  1.00 33.62  ? 222 TRP A CA  1 
ATOM   1703  C C   . TRP A  1 222 ? -8.206  60.787  22.304  1.00 32.23  ? 222 TRP A C   1 
ATOM   1704  O O   . TRP A  1 222 ? -8.159  59.552  22.389  1.00 32.84  ? 222 TRP A O   1 
ATOM   1705  C CB  . TRP A  1 222 ? -10.668 61.072  21.792  1.00 35.80  ? 222 TRP A CB  1 
ATOM   1706  C CG  . TRP A  1 222 ? -11.342 61.755  22.977  1.00 38.78  ? 222 TRP A CG  1 
ATOM   1707  C CD1 . TRP A  1 222 ? -11.507 61.156  24.215  1.00 39.66  ? 222 TRP A CD1 1 
ATOM   1708  C CD2 . TRP A  1 222 ? -11.924 62.987  22.907  1.00 40.27  ? 222 TRP A CD2 1 
ATOM   1709  N NE1 . TRP A  1 222 ? -12.208 62.015  24.923  1.00 40.43  ? 222 TRP A NE1 1 
ATOM   1710  C CE2 . TRP A  1 222 ? -12.476 63.112  24.180  1.00 40.84  ? 222 TRP A CE2 1 
ATOM   1711  C CE3 . TRP A  1 222 ? -12.033 63.969  21.945  1.00 41.09  ? 222 TRP A CE3 1 
ATOM   1712  C CZ2 . TRP A  1 222 ? -13.182 64.247  24.523  1.00 41.61  ? 222 TRP A CZ2 1 
ATOM   1713  C CZ3 . TRP A  1 222 ? -12.737 65.099  22.300  1.00 42.19  ? 222 TRP A CZ3 1 
ATOM   1714  C CH2 . TRP A  1 222 ? -13.302 65.237  23.568  1.00 42.21  ? 222 TRP A CH2 1 
ATOM   1715  N N   . VAL A  1 223 ? -7.306  61.536  22.915  1.00 29.69  ? 223 VAL A N   1 
ATOM   1716  C CA  . VAL A  1 223 ? -6.443  60.973  23.924  1.00 28.08  ? 223 VAL A CA  1 
ATOM   1717  C C   . VAL A  1 223 ? -6.553  61.941  25.060  1.00 27.67  ? 223 VAL A C   1 
ATOM   1718  O O   . VAL A  1 223 ? -6.256  63.121  24.900  1.00 28.08  ? 223 VAL A O   1 
ATOM   1719  C CB  . VAL A  1 223 ? -4.998  60.885  23.467  1.00 27.63  ? 223 VAL A CB  1 
ATOM   1720  C CG1 . VAL A  1 223 ? -4.070  60.618  24.640  1.00 26.80  ? 223 VAL A CG1 1 
ATOM   1721  C CG2 . VAL A  1 223 ? -4.867  59.713  22.525  1.00 26.87  ? 223 VAL A CG2 1 
ATOM   1722  N N   . ARG A  1 224 ? -7.046  61.442  26.183  1.00 27.56  ? 224 ARG A N   1 
ATOM   1723  C CA  . ARG A  1 224 ? -7.304  62.244  27.370  1.00 27.50  ? 224 ARG A CA  1 
ATOM   1724  C C   . ARG A  1 224 ? -8.113  63.525  27.116  1.00 27.42  ? 224 ARG A C   1 
ATOM   1725  O O   . ARG A  1 224 ? -7.791  64.627  27.561  1.00 27.68  ? 224 ARG A O   1 
ATOM   1726  C CB  . ARG A  1 224 ? -5.976  62.566  28.010  1.00 27.78  ? 224 ARG A CB  1 
ATOM   1727  C CG  . ARG A  1 224 ? -5.584  61.485  28.997  1.00 28.10  ? 224 ARG A CG  1 
ATOM   1728  C CD  . ARG A  1 224 ? -4.266  61.863  29.658  1.00 28.24  ? 224 ARG A CD  1 
ATOM   1729  N NE  . ARG A  1 224 ? -3.184  61.909  28.684  1.00 28.61  ? 224 ARG A NE  1 
ATOM   1730  C CZ  . ARG A  1 224 ? -2.618  60.807  28.164  1.00 28.32  ? 224 ARG A CZ  1 
ATOM   1731  N NH1 . ARG A  1 224 ? -1.617  60.927  27.294  1.00 29.06  ? 224 ARG A NH1 1 
ATOM   1732  N NH2 . ARG A  1 224 ? -3.033  59.591  28.513  1.00 28.41  ? 224 ARG A NH2 1 
ATOM   1733  N N   . GLY A  1 225 ? -9.198  63.396  26.347  1.00 27.01  ? 225 GLY A N   1 
ATOM   1734  C CA  . GLY A  1 225 ? -10.046 64.528  26.046  1.00 25.68  ? 225 GLY A CA  1 
ATOM   1735  C C   . GLY A  1 225 ? -9.496  65.395  24.937  1.00 25.92  ? 225 GLY A C   1 
ATOM   1736  O O   . GLY A  1 225 ? -10.190 66.292  24.465  1.00 27.62  ? 225 GLY A O   1 
ATOM   1737  N N   . LEU A  1 226 ? -8.288  65.144  24.440  1.00 24.99  ? 226 LEU A N   1 
ATOM   1738  C CA  . LEU A  1 226 ? -7.715  66.014  23.459  1.00 24.46  ? 226 LEU A CA  1 
ATOM   1739  C C   . LEU A  1 226 ? -7.555  65.386  22.102  1.00 24.79  ? 226 LEU A C   1 
ATOM   1740  O O   . LEU A  1 226 ? -7.244  64.206  21.945  1.00 25.23  ? 226 LEU A O   1 
ATOM   1741  C CB  . LEU A  1 226 ? -6.401  66.477  24.001  1.00 24.37  ? 226 LEU A CB  1 
ATOM   1742  C CG  . LEU A  1 226 ? -6.528  67.356  25.230  1.00 24.69  ? 226 LEU A CG  1 
ATOM   1743  C CD1 . LEU A  1 226 ? -5.194  67.527  25.886  1.00 25.05  ? 226 LEU A CD1 1 
ATOM   1744  C CD2 . LEU A  1 226 ? -7.073  68.713  24.819  1.00 25.61  ? 226 LEU A CD2 1 
ATOM   1745  N N   . SER A  1 227 ? -7.754  66.205  21.093  1.00 25.11  ? 227 SER A N   1 
ATOM   1746  C CA  . SER A  1 227 ? -7.599  65.810  19.718  1.00 25.39  ? 227 SER A CA  1 
ATOM   1747  C C   . SER A  1 227 ? -6.364  66.499  19.169  1.00 24.24  ? 227 SER A C   1 
ATOM   1748  O O   . SER A  1 227 ? -6.086  66.463  17.974  1.00 24.61  ? 227 SER A O   1 
ATOM   1749  C CB  . SER A  1 227 ? -8.856  66.244  18.973  1.00 27.98  ? 227 SER A CB  1 
ATOM   1750  O OG  . SER A  1 227 ? -8.869  66.029  17.550  1.00 31.10  ? 227 SER A OG  1 
ATOM   1751  N N   . SER A  1 228 ? -5.582  67.124  20.023  1.00 23.43  ? 228 SER A N   1 
ATOM   1752  C CA  . SER A  1 228 ? -4.433  67.847  19.556  1.00 23.57  ? 228 SER A CA  1 
ATOM   1753  C C   . SER A  1 228 ? -3.197  67.061  19.952  1.00 23.18  ? 228 SER A C   1 
ATOM   1754  O O   . SER A  1 228 ? -3.297  66.090  20.710  1.00 23.52  ? 228 SER A O   1 
ATOM   1755  C CB  . SER A  1 228 ? -4.516  69.201  20.188  1.00 23.31  ? 228 SER A CB  1 
ATOM   1756  O OG  . SER A  1 228 ? -5.828  69.647  19.919  1.00 25.03  ? 228 SER A OG  1 
ATOM   1757  N N   . ARG A  1 229 ? -2.054  67.342  19.372  1.00 22.05  ? 229 ARG A N   1 
ATOM   1758  C CA  . ARG A  1 229 ? -0.847  66.689  19.789  1.00 21.02  ? 229 ARG A CA  1 
ATOM   1759  C C   . ARG A  1 229 ? 0.209   67.757  19.898  1.00 20.85  ? 229 ARG A C   1 
ATOM   1760  O O   . ARG A  1 229 ? 0.011   68.896  19.437  1.00 21.70  ? 229 ARG A O   1 
ATOM   1761  C CB  . ARG A  1 229 ? -0.346  65.689  18.784  1.00 21.61  ? 229 ARG A CB  1 
ATOM   1762  C CG  . ARG A  1 229 ? -0.750  64.268  19.014  1.00 22.57  ? 229 ARG A CG  1 
ATOM   1763  C CD  . ARG A  1 229 ? -2.176  64.088  18.620  1.00 23.83  ? 229 ARG A CD  1 
ATOM   1764  N NE  . ARG A  1 229 ? -2.635  62.746  18.925  1.00 25.51  ? 229 ARG A NE  1 
ATOM   1765  C CZ  . ARG A  1 229 ? -3.728  62.535  19.686  1.00 26.14  ? 229 ARG A CZ  1 
ATOM   1766  N NH1 . ARG A  1 229 ? -4.193  61.288  19.828  1.00 25.98  ? 229 ARG A NH1 1 
ATOM   1767  N NH2 . ARG A  1 229 ? -4.290  63.533  20.394  1.00 26.34  ? 229 ARG A NH2 1 
ATOM   1768  N N   . ILE A  1 230 ? 1.272   67.467  20.610  1.00 19.36  ? 230 ILE A N   1 
ATOM   1769  C CA  . ILE A  1 230 ? 2.428   68.291  20.464  1.00 18.63  ? 230 ILE A CA  1 
ATOM   1770  C C   . ILE A  1 230 ? 3.509   67.353  19.978  1.00 18.70  ? 230 ILE A C   1 
ATOM   1771  O O   . ILE A  1 230 ? 3.507   66.192  20.376  1.00 19.15  ? 230 ILE A O   1 
ATOM   1772  C CB  . ILE A  1 230 ? 2.811   68.965  21.789  1.00 18.47  ? 230 ILE A CB  1 
ATOM   1773  C CG1 . ILE A  1 230 ? 2.973   68.013  22.910  1.00 18.48  ? 230 ILE A CG1 1 
ATOM   1774  C CG2 . ILE A  1 230 ? 1.712   69.968  22.118  1.00 18.66  ? 230 ILE A CG2 1 
ATOM   1775  C CD1 . ILE A  1 230 ? 3.266   68.783  24.220  1.00 19.92  ? 230 ILE A CD1 1 
ATOM   1776  N N   . SER A  1 231 ? 4.372   67.767  19.057  1.00 18.49  ? 231 SER A N   1 
ATOM   1777  C CA  . SER A  1 231 ? 5.458   66.914  18.606  1.00 17.43  ? 231 SER A CA  1 
ATOM   1778  C C   . SER A  1 231 ? 6.736   67.443  19.255  1.00 16.44  ? 231 SER A C   1 
ATOM   1779  O O   . SER A  1 231 ? 6.898   68.671  19.340  1.00 15.92  ? 231 SER A O   1 
ATOM   1780  C CB  . SER A  1 231 ? 5.514   66.980  17.097  1.00 18.08  ? 231 SER A CB  1 
ATOM   1781  O OG  . SER A  1 231 ? 4.251   66.706  16.506  1.00 18.39  ? 231 SER A OG  1 
ATOM   1782  N N   . ILE A  1 232 ? 7.601   66.545  19.744  1.00 14.95  ? 232 ILE A N   1 
ATOM   1783  C CA  . ILE A  1 232 ? 8.797   66.888  20.509  1.00 14.34  ? 232 ILE A CA  1 
ATOM   1784  C C   . ILE A  1 232 ? 10.044  66.942  19.622  1.00 14.76  ? 232 ILE A C   1 
ATOM   1785  O O   . ILE A  1 232 ? 10.194  66.102  18.722  1.00 15.74  ? 232 ILE A O   1 
ATOM   1786  C CB  . ILE A  1 232 ? 8.971   65.828  21.641  1.00 13.30  ? 232 ILE A CB  1 
ATOM   1787  C CG1 . ILE A  1 232 ? 7.824   65.912  22.657  1.00 12.37  ? 232 ILE A CG1 1 
ATOM   1788  C CG2 . ILE A  1 232 ? 10.287  66.044  22.358  1.00 13.36  ? 232 ILE A CG2 1 
ATOM   1789  C CD1 . ILE A  1 232 ? 7.567   67.247  23.365  1.00 11.13  ? 232 ILE A CD1 1 
ATOM   1790  N N   . TYR A  1 233 ? 10.959  67.896  19.840  1.00 13.70  ? 233 TYR A N   1 
ATOM   1791  C CA  . TYR A  1 233 ? 12.173  68.000  19.052  1.00 13.31  ? 233 TYR A CA  1 
ATOM   1792  C C   . TYR A  1 233 ? 13.333  68.250  19.995  1.00 13.53  ? 233 TYR A C   1 
ATOM   1793  O O   . TYR A  1 233 ? 13.131  68.632  21.150  1.00 13.66  ? 233 TYR A O   1 
ATOM   1794  C CB  . TYR A  1 233 ? 12.023  69.138  18.050  1.00 13.83  ? 233 TYR A CB  1 
ATOM   1795  C CG  . TYR A  1 233 ? 10.991  68.851  16.964  1.00 14.48  ? 233 TYR A CG  1 
ATOM   1796  C CD1 . TYR A  1 233 ? 9.670   69.184  17.119  1.00 14.82  ? 233 TYR A CD1 1 
ATOM   1797  C CD2 . TYR A  1 233 ? 11.358  68.162  15.840  1.00 15.68  ? 233 TYR A CD2 1 
ATOM   1798  C CE1 . TYR A  1 233 ? 8.732   68.814  16.187  1.00 14.55  ? 233 TYR A CE1 1 
ATOM   1799  C CE2 . TYR A  1 233 ? 10.425  67.793  14.894  1.00 15.52  ? 233 TYR A CE2 1 
ATOM   1800  C CZ  . TYR A  1 233 ? 9.121   68.118  15.084  1.00 14.94  ? 233 TYR A CZ  1 
ATOM   1801  O OH  . TYR A  1 233 ? 8.196   67.694  14.165  1.00 16.02  ? 233 TYR A OH  1 
ATOM   1802  N N   . TRP A  1 234 ? 14.565  68.031  19.572  1.00 14.09  ? 234 TRP A N   1 
ATOM   1803  C CA  . TRP A  1 234 ? 15.687  68.236  20.458  1.00 15.26  ? 234 TRP A CA  1 
ATOM   1804  C C   . TRP A  1 234 ? 16.753  68.979  19.700  1.00 15.00  ? 234 TRP A C   1 
ATOM   1805  O O   . TRP A  1 234 ? 16.868  68.799  18.487  1.00 15.59  ? 234 TRP A O   1 
ATOM   1806  C CB  . TRP A  1 234 ? 16.210  66.866  20.968  1.00 17.36  ? 234 TRP A CB  1 
ATOM   1807  C CG  . TRP A  1 234 ? 16.562  65.795  19.941  1.00 18.77  ? 234 TRP A CG  1 
ATOM   1808  C CD1 . TRP A  1 234 ? 15.639  64.936  19.378  1.00 19.59  ? 234 TRP A CD1 1 
ATOM   1809  C CD2 . TRP A  1 234 ? 17.812  65.603  19.445  1.00 20.41  ? 234 TRP A CD2 1 
ATOM   1810  N NE1 . TRP A  1 234 ? 16.305  64.200  18.514  1.00 19.74  ? 234 TRP A NE1 1 
ATOM   1811  C CE2 . TRP A  1 234 ? 17.602  64.578  18.533  1.00 20.92  ? 234 TRP A CE2 1 
ATOM   1812  C CE3 . TRP A  1 234 ? 19.055  66.162  19.654  1.00 22.02  ? 234 TRP A CE3 1 
ATOM   1813  C CZ2 . TRP A  1 234 ? 18.672  64.097  17.804  1.00 22.22  ? 234 TRP A CZ2 1 
ATOM   1814  C CZ3 . TRP A  1 234 ? 20.121  65.669  18.917  1.00 22.99  ? 234 TRP A CZ3 1 
ATOM   1815  C CH2 . TRP A  1 234 ? 19.930  64.652  17.999  1.00 22.78  ? 234 TRP A CH2 1 
ATOM   1816  N N   . THR A  1 235 ? 17.510  69.859  20.331  1.00 14.62  ? 235 THR A N   1 
ATOM   1817  C CA  . THR A  1 235 ? 18.611  70.539  19.679  1.00 14.79  ? 235 THR A CA  1 
ATOM   1818  C C   . THR A  1 235 ? 19.813  70.444  20.590  1.00 15.11  ? 235 THR A C   1 
ATOM   1819  O O   . THR A  1 235 ? 19.661  70.748  21.767  1.00 15.48  ? 235 THR A O   1 
ATOM   1820  C CB  . THR A  1 235 ? 18.223  71.990  19.458  1.00 15.22  ? 235 THR A CB  1 
ATOM   1821  O OG1 . THR A  1 235 ? 17.107  71.962  18.570  1.00 15.95  ? 235 THR A OG1 1 
ATOM   1822  C CG2 . THR A  1 235 ? 19.366  72.838  18.920  1.00 14.90  ? 235 THR A CG2 1 
ATOM   1823  N N   . ILE A  1 236 ? 20.969  69.961  20.160  1.00 15.62  ? 236 ILE A N   1 
ATOM   1824  C CA  . ILE A  1 236 ? 22.113  70.005  21.045  1.00 16.78  ? 236 ILE A CA  1 
ATOM   1825  C C   . ILE A  1 236 ? 22.866  71.263  20.670  1.00 18.44  ? 236 ILE A C   1 
ATOM   1826  O O   . ILE A  1 236 ? 22.994  71.521  19.483  1.00 20.12  ? 236 ILE A O   1 
ATOM   1827  C CB  . ILE A  1 236 ? 22.991  68.762  20.860  1.00 15.91  ? 236 ILE A CB  1 
ATOM   1828  C CG1 . ILE A  1 236 ? 22.251  67.566  21.448  1.00 15.78  ? 236 ILE A CG1 1 
ATOM   1829  C CG2 . ILE A  1 236 ? 24.350  68.962  21.534  1.00 16.00  ? 236 ILE A CG2 1 
ATOM   1830  C CD1 . ILE A  1 236 ? 22.877  66.163  21.269  1.00 15.52  ? 236 ILE A CD1 1 
ATOM   1831  N N   . VAL A  1 237 ? 23.305  72.089  21.610  1.00 19.75  ? 237 VAL A N   1 
ATOM   1832  C CA  . VAL A  1 237 ? 24.059  73.286  21.306  1.00 21.02  ? 237 VAL A CA  1 
ATOM   1833  C C   . VAL A  1 237 ? 25.448  73.078  21.866  1.00 22.81  ? 237 VAL A C   1 
ATOM   1834  O O   . VAL A  1 237 ? 25.599  72.932  23.078  1.00 23.37  ? 237 VAL A O   1 
ATOM   1835  C CB  . VAL A  1 237 ? 23.374  74.494  21.951  1.00 20.82  ? 237 VAL A CB  1 
ATOM   1836  C CG1 . VAL A  1 237 ? 24.082  75.768  21.566  1.00 20.28  ? 237 VAL A CG1 1 
ATOM   1837  C CG2 . VAL A  1 237 ? 21.942  74.584  21.465  1.00 20.46  ? 237 VAL A CG2 1 
ATOM   1838  N N   . LYS A  1 238 ? 26.435  73.060  20.975  1.00 25.20  ? 238 LYS A N   1 
ATOM   1839  C CA  . LYS A  1 238 ? 27.833  72.788  21.311  1.00 27.52  ? 238 LYS A CA  1 
ATOM   1840  C C   . LYS A  1 238 ? 28.433  73.959  22.080  1.00 27.76  ? 238 LYS A C   1 
ATOM   1841  O O   . LYS A  1 238 ? 27.840  75.051  21.994  1.00 28.64  ? 238 LYS A O   1 
ATOM   1842  C CB  . LYS A  1 238 ? 28.644  72.575  20.036  1.00 29.26  ? 238 LYS A CB  1 
ATOM   1843  C CG  . LYS A  1 238 ? 28.214  71.470  19.079  1.00 31.71  ? 238 LYS A CG  1 
ATOM   1844  C CD  . LYS A  1 238 ? 28.288  70.044  19.654  1.00 33.87  ? 238 LYS A CD  1 
ATOM   1845  C CE  . LYS A  1 238 ? 29.706  69.498  19.889  1.00 34.79  ? 238 LYS A CE  1 
ATOM   1846  N NZ  . LYS A  1 238 ? 30.366  69.164  18.639  1.00 35.93  ? 238 LYS A NZ  1 
ATOM   1847  N N   . PRO A  1 239 ? 29.560  73.865  22.815  1.00 27.12  ? 239 PRO A N   1 
ATOM   1848  C CA  . PRO A  1 239 ? 30.122  74.983  23.558  1.00 27.29  ? 239 PRO A CA  1 
ATOM   1849  C C   . PRO A  1 239 ? 30.589  76.056  22.609  1.00 27.26  ? 239 PRO A C   1 
ATOM   1850  O O   . PRO A  1 239 ? 31.145  75.788  21.542  1.00 27.39  ? 239 PRO A O   1 
ATOM   1851  C CB  . PRO A  1 239 ? 31.233  74.399  24.376  1.00 27.36  ? 239 PRO A CB  1 
ATOM   1852  C CG  . PRO A  1 239 ? 30.987  72.924  24.301  1.00 27.77  ? 239 PRO A CG  1 
ATOM   1853  C CD  . PRO A  1 239 ? 30.489  72.765  22.886  1.00 27.21  ? 239 PRO A CD  1 
ATOM   1854  N N   . GLY A  1 240 ? 30.298  77.281  22.976  1.00 27.79  ? 240 GLY A N   1 
ATOM   1855  C CA  . GLY A  1 240 ? 30.584  78.430  22.137  1.00 28.81  ? 240 GLY A CA  1 
ATOM   1856  C C   . GLY A  1 240 ? 29.455  78.782  21.169  1.00 28.64  ? 240 GLY A C   1 
ATOM   1857  O O   . GLY A  1 240 ? 29.459  79.881  20.588  1.00 28.96  ? 240 GLY A O   1 
ATOM   1858  N N   . ASP A  1 241 ? 28.474  77.884  20.966  1.00 28.47  ? 241 ASP A N   1 
ATOM   1859  C CA  . ASP A  1 241 ? 27.447  78.151  19.971  1.00 28.60  ? 241 ASP A CA  1 
ATOM   1860  C C   . ASP A  1 241 ? 26.282  78.964  20.517  1.00 27.59  ? 241 ASP A C   1 
ATOM   1861  O O   . ASP A  1 241 ? 26.327  79.422  21.664  1.00 27.91  ? 241 ASP A O   1 
ATOM   1862  C CB  . ASP A  1 241 ? 26.934  76.835  19.377  1.00 29.20  ? 241 ASP A CB  1 
ATOM   1863  C CG  . ASP A  1 241 ? 26.483  76.975  17.928  1.00 29.72  ? 241 ASP A CG  1 
ATOM   1864  O OD1 . ASP A  1 241 ? 26.250  78.102  17.470  1.00 29.88  ? 241 ASP A OD1 1 
ATOM   1865  O OD2 . ASP A  1 241 ? 26.360  75.966  17.218  1.00 30.06  ? 241 ASP A OD2 1 
ATOM   1866  N N   . VAL A  1 242 ? 25.249  79.241  19.750  1.00 25.79  ? 242 VAL A N   1 
ATOM   1867  C CA  . VAL A  1 242 ? 24.185  80.063  20.248  1.00 24.99  ? 242 VAL A CA  1 
ATOM   1868  C C   . VAL A  1 242 ? 22.943  79.308  19.892  1.00 25.82  ? 242 VAL A C   1 
ATOM   1869  O O   . VAL A  1 242 ? 22.931  78.628  18.862  1.00 27.09  ? 242 VAL A O   1 
ATOM   1870  C CB  . VAL A  1 242 ? 24.094  81.389  19.537  1.00 24.51  ? 242 VAL A CB  1 
ATOM   1871  C CG1 . VAL A  1 242 ? 23.322  82.298  20.451  1.00 23.89  ? 242 VAL A CG1 1 
ATOM   1872  C CG2 . VAL A  1 242 ? 25.449  81.996  19.229  1.00 25.81  ? 242 VAL A CG2 1 
ATOM   1873  N N   . LEU A  1 243 ? 21.918  79.351  20.738  1.00 25.36  ? 243 LEU A N   1 
ATOM   1874  C CA  . LEU A  1 243 ? 20.615  78.825  20.358  1.00 23.68  ? 243 LEU A CA  1 
ATOM   1875  C C   . LEU A  1 243 ? 19.791  80.048  20.002  1.00 23.57  ? 243 LEU A C   1 
ATOM   1876  O O   . LEU A  1 243 ? 19.857  81.050  20.740  1.00 23.65  ? 243 LEU A O   1 
ATOM   1877  C CB  . LEU A  1 243 ? 19.912  78.111  21.510  1.00 22.61  ? 243 LEU A CB  1 
ATOM   1878  C CG  . LEU A  1 243 ? 18.515  77.547  21.263  1.00 21.88  ? 243 LEU A CG  1 
ATOM   1879  C CD1 . LEU A  1 243 ? 18.589  76.388  20.293  1.00 21.79  ? 243 LEU A CD1 1 
ATOM   1880  C CD2 . LEU A  1 243 ? 17.925  77.049  22.555  1.00 21.42  ? 243 LEU A CD2 1 
ATOM   1881  N N   . VAL A  1 244 ? 19.083  80.049  18.870  1.00 22.81  ? 244 VAL A N   1 
ATOM   1882  C CA  . VAL A  1 244 ? 18.151  81.123  18.574  1.00 21.87  ? 244 VAL A CA  1 
ATOM   1883  C C   . VAL A  1 244 ? 16.818  80.454  18.349  1.00 21.53  ? 244 VAL A C   1 
ATOM   1884  O O   . VAL A  1 244 ? 16.731  79.564  17.499  1.00 22.48  ? 244 VAL A O   1 
ATOM   1885  C CB  . VAL A  1 244 ? 18.599  81.914  17.323  1.00 21.23  ? 244 VAL A CB  1 
ATOM   1886  C CG1 . VAL A  1 244 ? 17.495  82.834  16.810  1.00 20.51  ? 244 VAL A CG1 1 
ATOM   1887  C CG2 . VAL A  1 244 ? 19.750  82.819  17.728  1.00 20.35  ? 244 VAL A CG2 1 
ATOM   1888  N N   . ILE A  1 245 ? 15.806  80.781  19.141  1.00 21.40  ? 245 ILE A N   1 
ATOM   1889  C CA  . ILE A  1 245 ? 14.478  80.191  18.944  1.00 21.73  ? 245 ILE A CA  1 
ATOM   1890  C C   . ILE A  1 245 ? 13.635  81.312  18.380  1.00 21.61  ? 245 ILE A C   1 
ATOM   1891  O O   . ILE A  1 245 ? 13.547  82.376  18.996  1.00 21.79  ? 245 ILE A O   1 
ATOM   1892  C CB  . ILE A  1 245 ? 13.837  79.710  20.278  1.00 21.73  ? 245 ILE A CB  1 
ATOM   1893  C CG1 . ILE A  1 245 ? 14.814  78.758  20.961  1.00 21.88  ? 245 ILE A CG1 1 
ATOM   1894  C CG2 . ILE A  1 245 ? 12.481  79.032  20.025  1.00 20.72  ? 245 ILE A CG2 1 
ATOM   1895  C CD1 . ILE A  1 245 ? 14.400  78.378  22.376  1.00 21.28  ? 245 ILE A CD1 1 
ATOM   1896  N N   . ASN A  1 246 ? 13.041  81.126  17.224  1.00 22.02  ? 246 ASN A N   1 
ATOM   1897  C CA  . ASN A  1 246 ? 12.222  82.149  16.605  1.00 22.81  ? 246 ASN A CA  1 
ATOM   1898  C C   . ASN A  1 246 ? 10.895  81.512  16.256  1.00 23.58  ? 246 ASN A C   1 
ATOM   1899  O O   . ASN A  1 246 ? 10.867  80.426  15.638  1.00 24.50  ? 246 ASN A O   1 
ATOM   1900  C CB  . ASN A  1 246 ? 12.878  82.637  15.343  1.00 23.83  ? 246 ASN A CB  1 
ATOM   1901  C CG  . ASN A  1 246 ? 12.058  83.639  14.530  1.00 24.65  ? 246 ASN A CG  1 
ATOM   1902  O OD1 . ASN A  1 246 ? 11.044  83.358  13.860  1.00 24.28  ? 246 ASN A OD1 1 
ATOM   1903  N ND2 . ASN A  1 246 ? 12.560  84.867  14.516  1.00 25.79  ? 246 ASN A ND2 1 
ATOM   1904  N N   . SER A  1 247 ? 9.792   82.143  16.623  1.00 23.17  ? 247 SER A N   1 
ATOM   1905  C CA  . SER A  1 247 ? 8.502   81.569  16.331  1.00 23.90  ? 247 SER A CA  1 
ATOM   1906  C C   . SER A  1 247 ? 7.439   82.637  16.267  1.00 25.07  ? 247 SER A C   1 
ATOM   1907  O O   . SER A  1 247 ? 7.538   83.658  16.951  1.00 24.52  ? 247 SER A O   1 
ATOM   1908  C CB  . SER A  1 247 ? 8.121   80.576  17.404  1.00 23.68  ? 247 SER A CB  1 
ATOM   1909  O OG  . SER A  1 247 ? 6.740   80.184  17.390  1.00 24.59  ? 247 SER A OG  1 
ATOM   1910  N N   . ASN A  1 248 ? 6.413   82.434  15.446  1.00 26.57  ? 248 ASN A N   1 
ATOM   1911  C CA  . ASN A  1 248 ? 5.289   83.348  15.520  1.00 27.88  ? 248 ASN A CA  1 
ATOM   1912  C C   . ASN A  1 248 ? 4.075   82.577  15.985  1.00 28.36  ? 248 ASN A C   1 
ATOM   1913  O O   . ASN A  1 248 ? 2.953   83.073  15.831  1.00 29.61  ? 248 ASN A O   1 
ATOM   1914  C CB  . ASN A  1 248 ? 4.927   84.020  14.176  1.00 28.82  ? 248 ASN A CB  1 
ATOM   1915  C CG  . ASN A  1 248 ? 4.473   83.086  13.061  1.00 29.72  ? 248 ASN A CG  1 
ATOM   1916  O OD1 . ASN A  1 248 ? 5.230   82.898  12.108  1.00 30.82  ? 248 ASN A OD1 1 
ATOM   1917  N ND2 . ASN A  1 248 ? 3.300   82.463  13.095  1.00 29.55  ? 248 ASN A ND2 1 
ATOM   1918  N N   . GLY A  1 249 ? 4.209   81.360  16.513  1.00 27.52  ? 249 GLY A N   1 
ATOM   1919  C CA  . GLY A  1 249 ? 3.036   80.688  17.044  1.00 26.78  ? 249 GLY A CA  1 
ATOM   1920  C C   . GLY A  1 249 ? 3.275   79.221  17.266  1.00 26.23  ? 249 GLY A C   1 
ATOM   1921  O O   . GLY A  1 249 ? 4.169   78.644  16.644  1.00 27.63  ? 249 GLY A O   1 
ATOM   1922  N N   . ASN A  1 250 ? 2.507   78.625  18.172  1.00 24.51  ? 250 ASN A N   1 
ATOM   1923  C CA  . ASN A  1 250 ? 2.523   77.188  18.439  1.00 23.33  ? 250 ASN A CA  1 
ATOM   1924  C C   . ASN A  1 250 ? 3.791   76.685  19.127  1.00 22.62  ? 250 ASN A C   1 
ATOM   1925  O O   . ASN A  1 250 ? 3.969   75.461  19.271  1.00 21.67  ? 250 ASN A O   1 
ATOM   1926  C CB  . ASN A  1 250 ? 2.327   76.364  17.141  1.00 23.30  ? 250 ASN A CB  1 
ATOM   1927  C CG  . ASN A  1 250 ? 1.057   76.749  16.399  1.00 23.68  ? 250 ASN A CG  1 
ATOM   1928  O OD1 . ASN A  1 250 ? 0.913   77.894  15.952  1.00 23.46  ? 250 ASN A OD1 1 
ATOM   1929  N ND2 . ASN A  1 250 ? 0.080   75.878  16.267  1.00 23.53  ? 250 ASN A ND2 1 
ATOM   1930  N N   . LEU A  1 251 ? 4.649   77.590  19.623  1.00 21.06  ? 251 LEU A N   1 
ATOM   1931  C CA  . LEU A  1 251 ? 5.889   77.158  20.261  1.00 19.38  ? 251 LEU A CA  1 
ATOM   1932  C C   . LEU A  1 251 ? 5.555   76.564  21.616  1.00 18.44  ? 251 LEU A C   1 
ATOM   1933  O O   . LEU A  1 251 ? 4.685   77.079  22.321  1.00 18.99  ? 251 LEU A O   1 
ATOM   1934  C CB  . LEU A  1 251 ? 6.840   78.306  20.551  1.00 18.56  ? 251 LEU A CB  1 
ATOM   1935  C CG  . LEU A  1 251 ? 8.367   78.253  20.445  1.00 18.28  ? 251 LEU A CG  1 
ATOM   1936  C CD1 . LEU A  1 251 ? 8.859   79.230  21.486  1.00 16.73  ? 251 LEU A CD1 1 
ATOM   1937  C CD2 . LEU A  1 251 ? 8.970   76.871  20.642  1.00 17.69  ? 251 LEU A CD2 1 
ATOM   1938  N N   . ILE A  1 252 ? 6.213   75.456  21.932  1.00 17.12  ? 252 ILE A N   1 
ATOM   1939  C CA  . ILE A  1 252 ? 6.233   74.888  23.264  1.00 15.05  ? 252 ILE A CA  1 
ATOM   1940  C C   . ILE A  1 252 ? 7.685   75.157  23.617  1.00 14.13  ? 252 ILE A C   1 
ATOM   1941  O O   . ILE A  1 252 ? 8.558   74.477  23.102  1.00 14.65  ? 252 ILE A O   1 
ATOM   1942  C CB  . ILE A  1 252 ? 5.955   73.391  23.187  1.00 14.34  ? 252 ILE A CB  1 
ATOM   1943  C CG1 . ILE A  1 252 ? 4.540   73.144  22.734  1.00 14.88  ? 252 ILE A CG1 1 
ATOM   1944  C CG2 . ILE A  1 252 ? 6.175   72.767  24.538  1.00 14.91  ? 252 ILE A CG2 1 
ATOM   1945  C CD1 . ILE A  1 252 ? 3.460   73.788  23.601  1.00 14.01  ? 252 ILE A CD1 1 
ATOM   1946  N N   . ALA A  1 253 ? 7.978   76.185  24.394  1.00 13.27  ? 253 ALA A N   1 
ATOM   1947  C CA  . ALA A  1 253 ? 9.352   76.597  24.668  1.00 12.74  ? 253 ALA A CA  1 
ATOM   1948  C C   . ALA A  1 253 ? 10.150  75.786  25.683  1.00 11.84  ? 253 ALA A C   1 
ATOM   1949  O O   . ALA A  1 253 ? 9.582   75.215  26.611  1.00 11.60  ? 253 ALA A O   1 
ATOM   1950  C CB  . ALA A  1 253 ? 9.339   78.021  25.145  1.00 13.51  ? 253 ALA A CB  1 
ATOM   1951  N N   . PRO A  1 254 ? 11.463  75.677  25.555  1.00 11.77  ? 254 PRO A N   1 
ATOM   1952  C CA  . PRO A  1 254 ? 12.295  74.952  26.509  1.00 12.98  ? 254 PRO A CA  1 
ATOM   1953  C C   . PRO A  1 254 ? 12.407  75.751  27.809  1.00 14.19  ? 254 PRO A C   1 
ATOM   1954  O O   . PRO A  1 254 ? 12.479  76.982  27.732  1.00 16.51  ? 254 PRO A O   1 
ATOM   1955  C CB  . PRO A  1 254 ? 13.615  74.789  25.770  1.00 12.54  ? 254 PRO A CB  1 
ATOM   1956  C CG  . PRO A  1 254 ? 13.691  76.005  24.885  1.00 11.91  ? 254 PRO A CG  1 
ATOM   1957  C CD  . PRO A  1 254 ? 12.239  76.051  24.380  1.00 12.20  ? 254 PRO A CD  1 
ATOM   1958  N N   . ARG A  1 255 ? 12.443  75.185  29.025  1.00 13.69  ? 255 ARG A N   1 
ATOM   1959  C CA  . ARG A  1 255 ? 12.698  76.052  30.186  1.00 13.02  ? 255 ARG A CA  1 
ATOM   1960  C C   . ARG A  1 255 ? 14.185  76.094  30.569  1.00 12.42  ? 255 ARG A C   1 
ATOM   1961  O O   . ARG A  1 255 ? 14.566  76.634  31.598  1.00 11.16  ? 255 ARG A O   1 
ATOM   1962  C CB  . ARG A  1 255 ? 11.879  75.586  31.387  1.00 13.46  ? 255 ARG A CB  1 
ATOM   1963  C CG  . ARG A  1 255 ? 10.427  75.276  31.034  1.00 14.34  ? 255 ARG A CG  1 
ATOM   1964  C CD  . ARG A  1 255 ? 9.486   75.125  32.221  1.00 14.25  ? 255 ARG A CD  1 
ATOM   1965  N NE  . ARG A  1 255 ? 8.848   76.411  32.422  1.00 15.14  ? 255 ARG A NE  1 
ATOM   1966  C CZ  . ARG A  1 255 ? 7.525   76.592  32.483  1.00 15.62  ? 255 ARG A CZ  1 
ATOM   1967  N NH1 . ARG A  1 255 ? 7.119   77.853  32.675  1.00 15.75  ? 255 ARG A NH1 1 
ATOM   1968  N NH2 . ARG A  1 255 ? 6.654   75.580  32.286  1.00 16.22  ? 255 ARG A NH2 1 
ATOM   1969  N N   . GLY A  1 256 ? 15.079  75.546  29.749  1.00 12.52  ? 256 GLY A N   1 
ATOM   1970  C CA  . GLY A  1 256 ? 16.503  75.497  30.028  1.00 13.02  ? 256 GLY A CA  1 
ATOM   1971  C C   . GLY A  1 256 ? 17.102  74.284  29.332  1.00 13.28  ? 256 GLY A C   1 
ATOM   1972  O O   . GLY A  1 256 ? 16.496  73.776  28.380  1.00 13.66  ? 256 GLY A O   1 
ATOM   1973  N N   . TYR A  1 257 ? 18.198  73.729  29.831  1.00 13.68  ? 257 TYR A N   1 
ATOM   1974  C CA  . TYR A  1 257 ? 18.844  72.615  29.168  1.00 14.23  ? 257 TYR A CA  1 
ATOM   1975  C C   . TYR A  1 257 ? 19.143  71.424  30.050  1.00 14.03  ? 257 TYR A C   1 
ATOM   1976  O O   . TYR A  1 257 ? 19.290  71.551  31.275  1.00 15.21  ? 257 TYR A O   1 
ATOM   1977  C CB  . TYR A  1 257 ? 20.164  73.037  28.562  1.00 15.13  ? 257 TYR A CB  1 
ATOM   1978  C CG  . TYR A  1 257 ? 21.220  73.490  29.556  1.00 16.29  ? 257 TYR A CG  1 
ATOM   1979  C CD1 . TYR A  1 257 ? 22.180  72.622  30.035  1.00 16.34  ? 257 TYR A CD1 1 
ATOM   1980  C CD2 . TYR A  1 257 ? 21.223  74.800  29.958  1.00 17.46  ? 257 TYR A CD2 1 
ATOM   1981  C CE1 . TYR A  1 257 ? 23.156  73.062  30.896  1.00 16.74  ? 257 TYR A CE1 1 
ATOM   1982  C CE2 . TYR A  1 257 ? 22.198  75.253  30.814  1.00 18.00  ? 257 TYR A CE2 1 
ATOM   1983  C CZ  . TYR A  1 257 ? 23.154  74.380  31.283  1.00 18.13  ? 257 TYR A CZ  1 
ATOM   1984  O OH  . TYR A  1 257 ? 24.119  74.869  32.148  1.00 19.54  ? 257 TYR A OH  1 
ATOM   1985  N N   . PHE A  1 258 ? 19.286  70.271  29.416  1.00 12.66  ? 258 PHE A N   1 
ATOM   1986  C CA  . PHE A  1 258 ? 19.731  69.079  30.101  1.00 11.47  ? 258 PHE A CA  1 
ATOM   1987  C C   . PHE A  1 258 ? 21.217  69.036  29.883  1.00 12.70  ? 258 PHE A C   1 
ATOM   1988  O O   . PHE A  1 258 ? 21.657  69.476  28.818  1.00 13.09  ? 258 PHE A O   1 
ATOM   1989  C CB  . PHE A  1 258 ? 19.081  67.827  29.504  1.00 8.28   ? 258 PHE A CB  1 
ATOM   1990  C CG  . PHE A  1 258 ? 17.599  67.723  29.806  1.00 5.32   ? 258 PHE A CG  1 
ATOM   1991  C CD1 . PHE A  1 258 ? 16.674  68.285  28.960  1.00 4.15   ? 258 PHE A CD1 1 
ATOM   1992  C CD2 . PHE A  1 258 ? 17.190  67.127  30.971  1.00 4.27   ? 258 PHE A CD2 1 
ATOM   1993  C CE1 . PHE A  1 258 ? 15.344  68.208  29.277  1.00 3.25   ? 258 PHE A CE1 1 
ATOM   1994  C CE2 . PHE A  1 258 ? 15.854  67.058  31.281  1.00 2.92   ? 258 PHE A CE2 1 
ATOM   1995  C CZ  . PHE A  1 258 ? 14.938  67.612  30.445  1.00 2.64   ? 258 PHE A CZ  1 
ATOM   1996  N N   . LYS A  1 259 ? 22.007  68.609  30.859  1.00 14.71  ? 259 LYS A N   1 
ATOM   1997  C CA  . LYS A  1 259 ? 23.431  68.439  30.634  1.00 18.33  ? 259 LYS A CA  1 
ATOM   1998  C C   . LYS A  1 259 ? 23.702  67.141  29.915  1.00 20.21  ? 259 LYS A C   1 
ATOM   1999  O O   . LYS A  1 259 ? 23.129  66.099  30.256  1.00 20.76  ? 259 LYS A O   1 
ATOM   2000  C CB  . LYS A  1 259 ? 24.247  68.320  31.865  1.00 19.98  ? 259 LYS A CB  1 
ATOM   2001  C CG  . LYS A  1 259 ? 24.368  69.585  32.649  1.00 23.76  ? 259 LYS A CG  1 
ATOM   2002  C CD  . LYS A  1 259 ? 25.459  69.365  33.705  1.00 26.07  ? 259 LYS A CD  1 
ATOM   2003  C CE  . LYS A  1 259 ? 26.829  69.892  33.251  1.00 27.28  ? 259 LYS A CE  1 
ATOM   2004  N NZ  . LYS A  1 259 ? 27.215  69.495  31.896  1.00 28.28  ? 259 LYS A NZ  1 
ATOM   2005  N N   . MET A  1 260 ? 24.587  67.138  28.933  1.00 21.73  ? 260 MET A N   1 
ATOM   2006  C CA  . MET A  1 260 ? 24.923  65.872  28.329  1.00 23.09  ? 260 MET A CA  1 
ATOM   2007  C C   . MET A  1 260 ? 26.189  65.318  28.929  1.00 25.06  ? 260 MET A C   1 
ATOM   2008  O O   . MET A  1 260 ? 27.078  66.077  29.324  1.00 26.62  ? 260 MET A O   1 
ATOM   2009  C CB  . MET A  1 260 ? 25.078  66.046  26.860  1.00 22.16  ? 260 MET A CB  1 
ATOM   2010  C CG  . MET A  1 260 ? 23.701  66.291  26.335  1.00 21.53  ? 260 MET A CG  1 
ATOM   2011  S SD  . MET A  1 260 ? 23.587  65.779  24.620  1.00 20.71  ? 260 MET A SD  1 
ATOM   2012  C CE  . MET A  1 260 ? 22.917  64.181  24.968  1.00 21.25  ? 260 MET A CE  1 
ATOM   2013  N N   . ARG A  1 261 ? 26.211  64.023  29.179  1.00 27.24  ? 261 ARG A N   1 
ATOM   2014  C CA  . ARG A  1 261 ? 27.388  63.335  29.646  1.00 29.51  ? 261 ARG A CA  1 
ATOM   2015  C C   . ARG A  1 261 ? 27.763  62.276  28.619  1.00 29.36  ? 261 ARG A C   1 
ATOM   2016  O O   . ARG A  1 261 ? 27.038  62.043  27.647  1.00 29.11  ? 261 ARG A O   1 
ATOM   2017  C CB  . ARG A  1 261 ? 27.117  62.685  30.991  1.00 31.77  ? 261 ARG A CB  1 
ATOM   2018  C CG  . ARG A  1 261 ? 27.226  63.701  32.083  1.00 35.38  ? 261 ARG A CG  1 
ATOM   2019  C CD  . ARG A  1 261 ? 26.875  63.097  33.430  1.00 39.00  ? 261 ARG A CD  1 
ATOM   2020  N NE  . ARG A  1 261 ? 27.287  63.981  34.522  1.00 42.63  ? 261 ARG A NE  1 
ATOM   2021  C CZ  . ARG A  1 261 ? 26.656  65.133  34.842  1.00 44.44  ? 261 ARG A CZ  1 
ATOM   2022  N NH1 . ARG A  1 261 ? 27.102  65.905  35.851  1.00 45.12  ? 261 ARG A NH1 1 
ATOM   2023  N NH2 . ARG A  1 261 ? 25.564  65.549  34.175  1.00 45.30  ? 261 ARG A NH2 1 
ATOM   2024  N N   . THR A  1 262 ? 28.946  61.693  28.780  1.00 28.92  ? 262 THR A N   1 
ATOM   2025  C CA  . THR A  1 262 ? 29.445  60.616  27.958  1.00 28.61  ? 262 THR A CA  1 
ATOM   2026  C C   . THR A  1 262 ? 29.852  59.577  28.962  1.00 28.56  ? 262 THR A C   1 
ATOM   2027  O O   . THR A  1 262 ? 30.803  59.832  29.706  1.00 28.74  ? 262 THR A O   1 
ATOM   2028  C CB  . THR A  1 262 ? 30.641  61.077  27.209  1.00 29.17  ? 262 THR A CB  1 
ATOM   2029  O OG1 . THR A  1 262 ? 30.107  61.984  26.277  1.00 30.04  ? 262 THR A OG1 1 
ATOM   2030  C CG2 . THR A  1 262 ? 31.427  59.984  26.513  1.00 30.05  ? 262 THR A CG2 1 
ATOM   2031  N N   . GLY A  1 263 ? 29.142  58.460  29.038  1.00 28.34  ? 263 GLY A N   1 
ATOM   2032  C CA  . GLY A  1 263 ? 29.450  57.469  30.049  1.00 27.54  ? 263 GLY A CA  1 
ATOM   2033  C C   . GLY A  1 263 ? 29.113  56.096  29.532  1.00 25.87  ? 263 GLY A C   1 
ATOM   2034  O O   . GLY A  1 263 ? 29.123  55.881  28.326  1.00 25.92  ? 263 GLY A O   1 
ATOM   2035  N N   . LYS A  1 264 ? 28.759  55.188  30.427  1.00 24.22  ? 264 LYS A N   1 
ATOM   2036  C CA  . LYS A  1 264 ? 28.433  53.848  30.025  1.00 22.79  ? 264 LYS A CA  1 
ATOM   2037  C C   . LYS A  1 264 ? 26.964  53.581  30.293  1.00 20.25  ? 264 LYS A C   1 
ATOM   2038  O O   . LYS A  1 264 ? 26.564  52.461  30.597  1.00 19.22  ? 264 LYS A O   1 
ATOM   2039  C CB  . LYS A  1 264 ? 29.319  52.870  30.798  1.00 24.60  ? 264 LYS A CB  1 
ATOM   2040  C CG  . LYS A  1 264 ? 29.194  53.001  32.307  1.00 27.81  ? 264 LYS A CG  1 
ATOM   2041  C CD  . LYS A  1 264 ? 29.340  51.674  33.041  1.00 29.69  ? 264 LYS A CD  1 
ATOM   2042  C CE  . LYS A  1 264 ? 29.014  51.946  34.503  1.00 31.12  ? 264 LYS A CE  1 
ATOM   2043  N NZ  . LYS A  1 264 ? 28.630  50.773  35.269  1.00 32.14  ? 264 LYS A NZ  1 
ATOM   2044  N N   . SER A  1 265 ? 26.123  54.587  30.170  1.00 18.10  ? 265 SER A N   1 
ATOM   2045  C CA  . SER A  1 265 ? 24.742  54.397  30.540  1.00 16.15  ? 265 SER A CA  1 
ATOM   2046  C C   . SER A  1 265 ? 23.938  53.888  29.379  1.00 14.51  ? 265 SER A C   1 
ATOM   2047  O O   . SER A  1 265 ? 24.258  54.087  28.198  1.00 14.15  ? 265 SER A O   1 
ATOM   2048  C CB  . SER A  1 265 ? 24.142  55.696  31.036  1.00 16.28  ? 265 SER A CB  1 
ATOM   2049  O OG  . SER A  1 265 ? 25.126  56.395  31.791  1.00 18.10  ? 265 SER A OG  1 
ATOM   2050  N N   . SER A  1 266 ? 22.905  53.169  29.738  1.00 13.39  ? 266 SER A N   1 
ATOM   2051  C CA  . SER A  1 266 ? 22.002  52.592  28.791  1.00 12.45  ? 266 SER A CA  1 
ATOM   2052  C C   . SER A  1 266 ? 20.627  52.470  29.393  1.00 12.29  ? 266 SER A C   1 
ATOM   2053  O O   . SER A  1 266 ? 20.421  52.751  30.581  1.00 15.30  ? 266 SER A O   1 
ATOM   2054  C CB  . SER A  1 266 ? 22.451  51.238  28.423  1.00 12.07  ? 266 SER A CB  1 
ATOM   2055  O OG  . SER A  1 266 ? 22.342  51.201  27.014  1.00 13.01  ? 266 SER A OG  1 
ATOM   2056  N N   . ILE A  1 267 ? 19.677  52.015  28.602  1.00 9.33   ? 267 ILE A N   1 
ATOM   2057  C CA  . ILE A  1 267 ? 18.345  51.813  29.083  1.00 7.41   ? 267 ILE A CA  1 
ATOM   2058  C C   . ILE A  1 267 ? 18.019  50.389  28.729  1.00 7.02   ? 267 ILE A C   1 
ATOM   2059  O O   . ILE A  1 267 ? 18.596  49.911  27.766  1.00 8.13   ? 267 ILE A O   1 
ATOM   2060  C CB  . ILE A  1 267 ? 17.460  52.842  28.392  1.00 6.45   ? 267 ILE A CB  1 
ATOM   2061  C CG1 . ILE A  1 267 ? 16.100  52.758  28.992  1.00 6.17   ? 267 ILE A CG1 1 
ATOM   2062  C CG2 . ILE A  1 267 ? 17.395  52.618  26.906  1.00 5.54   ? 267 ILE A CG2 1 
ATOM   2063  C CD1 . ILE A  1 267 ? 15.313  54.013  28.686  1.00 5.73   ? 267 ILE A CD1 1 
ATOM   2064  N N   . MET A  1 268 ? 17.158  49.693  29.459  1.00 6.81   ? 268 MET A N   1 
ATOM   2065  C CA  . MET A  1 268 ? 16.801  48.315  29.164  1.00 6.94   ? 268 MET A CA  1 
ATOM   2066  C C   . MET A  1 268 ? 15.357  48.076  29.538  1.00 7.91   ? 268 MET A C   1 
ATOM   2067  O O   . MET A  1 268 ? 14.945  48.472  30.626  1.00 7.93   ? 268 MET A O   1 
ATOM   2068  C CB  . MET A  1 268 ? 17.642  47.338  29.954  1.00 5.88   ? 268 MET A CB  1 
ATOM   2069  C CG  . MET A  1 268 ? 17.311  45.944  29.574  1.00 4.70   ? 268 MET A CG  1 
ATOM   2070  S SD  . MET A  1 268 ? 18.103  44.826  30.701  1.00 6.64   ? 268 MET A SD  1 
ATOM   2071  C CE  . MET A  1 268 ? 19.772  44.935  30.138  1.00 7.09   ? 268 MET A CE  1 
ATOM   2072  N N   . ARG A  1 269 ? 14.552  47.454  28.678  1.00 9.62   ? 269 ARG A N   1 
ATOM   2073  C CA  . ARG A  1 269 ? 13.173  47.159  29.061  1.00 11.10  ? 269 ARG A CA  1 
ATOM   2074  C C   . ARG A  1 269 ? 13.199  45.824  29.760  1.00 11.28  ? 269 ARG A C   1 
ATOM   2075  O O   . ARG A  1 269 ? 13.760  44.882  29.201  1.00 10.87  ? 269 ARG A O   1 
ATOM   2076  C CB  . ARG A  1 269 ? 12.245  47.004  27.884  1.00 12.39  ? 269 ARG A CB  1 
ATOM   2077  C CG  . ARG A  1 269 ? 12.354  48.196  26.986  1.00 14.36  ? 269 ARG A CG  1 
ATOM   2078  C CD  . ARG A  1 269 ? 11.714  47.946  25.667  1.00 15.20  ? 269 ARG A CD  1 
ATOM   2079  N NE  . ARG A  1 269 ? 11.897  49.182  24.949  1.00 17.80  ? 269 ARG A NE  1 
ATOM   2080  C CZ  . ARG A  1 269 ? 12.371  49.205  23.700  1.00 19.58  ? 269 ARG A CZ  1 
ATOM   2081  N NH1 . ARG A  1 269 ? 12.554  50.398  23.125  1.00 21.08  ? 269 ARG A NH1 1 
ATOM   2082  N NH2 . ARG A  1 269 ? 12.600  48.074  23.004  1.00 20.61  ? 269 ARG A NH2 1 
ATOM   2083  N N   . SER A  1 270 ? 12.618  45.740  30.951  1.00 11.89  ? 270 SER A N   1 
ATOM   2084  C CA  . SER A  1 270 ? 12.622  44.524  31.726  1.00 12.03  ? 270 SER A CA  1 
ATOM   2085  C C   . SER A  1 270 ? 11.597  44.659  32.830  1.00 13.93  ? 270 SER A C   1 
ATOM   2086  O O   . SER A  1 270 ? 11.401  45.747  33.396  1.00 15.23  ? 270 SER A O   1 
ATOM   2087  C CB  . SER A  1 270 ? 13.982  44.303  32.334  1.00 10.91  ? 270 SER A CB  1 
ATOM   2088  O OG  . SER A  1 270 ? 13.930  43.292  33.315  1.00 11.52  ? 270 SER A OG  1 
ATOM   2089  N N   . ASP A  1 271 ? 10.931  43.555  33.171  1.00 14.77  ? 271 ASP A N   1 
ATOM   2090  C CA  . ASP A  1 271 ? 10.048  43.580  34.311  1.00 15.12  ? 271 ASP A CA  1 
ATOM   2091  C C   . ASP A  1 271 ? 10.657  42.794  35.438  1.00 14.93  ? 271 ASP A C   1 
ATOM   2092  O O   . ASP A  1 271 ? 10.047  42.596  36.487  1.00 15.63  ? 271 ASP A O   1 
ATOM   2093  C CB  . ASP A  1 271 ? 8.713   43.008  33.975  1.00 16.56  ? 271 ASP A CB  1 
ATOM   2094  C CG  . ASP A  1 271 ? 7.927   43.926  33.062  1.00 18.39  ? 271 ASP A CG  1 
ATOM   2095  O OD1 . ASP A  1 271 ? 7.555   43.484  31.988  1.00 20.37  ? 271 ASP A OD1 1 
ATOM   2096  O OD2 . ASP A  1 271 ? 7.657   45.088  33.363  1.00 19.07  ? 271 ASP A OD2 1 
ATOM   2097  N N   . ALA A  1 272 ? 11.913  42.400  35.295  1.00 13.99  ? 272 ALA A N   1 
ATOM   2098  C CA  . ALA A  1 272 ? 12.580  41.701  36.359  1.00 14.08  ? 272 ALA A CA  1 
ATOM   2099  C C   . ALA A  1 272 ? 12.699  42.596  37.578  1.00 14.64  ? 272 ALA A C   1 
ATOM   2100  O O   . ALA A  1 272 ? 12.941  43.799  37.439  1.00 14.93  ? 272 ALA A O   1 
ATOM   2101  C CB  . ALA A  1 272 ? 13.974  41.312  35.946  1.00 14.35  ? 272 ALA A CB  1 
ATOM   2102  N N   . PRO A  1 273 ? 12.418  42.099  38.776  1.00 15.71  ? 273 PRO A N   1 
ATOM   2103  C CA  . PRO A  1 273 ? 12.530  42.819  40.028  1.00 16.60  ? 273 PRO A CA  1 
ATOM   2104  C C   . PRO A  1 273 ? 13.964  43.174  40.288  1.00 17.08  ? 273 PRO A C   1 
ATOM   2105  O O   . PRO A  1 273 ? 14.830  42.362  39.991  1.00 16.62  ? 273 PRO A O   1 
ATOM   2106  C CB  . PRO A  1 273 ? 12.004  41.877  41.057  1.00 16.53  ? 273 PRO A CB  1 
ATOM   2107  C CG  . PRO A  1 273 ? 12.165  40.528  40.410  1.00 15.34  ? 273 PRO A CG  1 
ATOM   2108  C CD  . PRO A  1 273 ? 11.670  40.879  39.025  1.00 15.76  ? 273 PRO A CD  1 
ATOM   2109  N N   . ILE A  1 274 ? 14.215  44.356  40.822  1.00 18.87  ? 274 ILE A N   1 
ATOM   2110  C CA  . ILE A  1 274 ? 15.566  44.720  41.207  1.00 21.00  ? 274 ILE A CA  1 
ATOM   2111  C C   . ILE A  1 274 ? 15.731  44.204  42.623  1.00 23.51  ? 274 ILE A C   1 
ATOM   2112  O O   . ILE A  1 274 ? 14.811  44.310  43.442  1.00 24.53  ? 274 ILE A O   1 
ATOM   2113  C CB  . ILE A  1 274 ? 15.718  46.223  41.162  1.00 20.93  ? 274 ILE A CB  1 
ATOM   2114  C CG1 . ILE A  1 274 ? 15.701  46.621  39.711  1.00 20.73  ? 274 ILE A CG1 1 
ATOM   2115  C CG2 . ILE A  1 274 ? 16.982  46.691  41.857  1.00 20.86  ? 274 ILE A CG2 1 
ATOM   2116  C CD1 . ILE A  1 274 ? 15.503  48.138  39.544  1.00 21.56  ? 274 ILE A CD1 1 
ATOM   2117  N N   . ASP A  1 275 ? 16.882  43.652  42.928  1.00 26.04  ? 275 ASP A N   1 
ATOM   2118  C CA  . ASP A  1 275 ? 17.098  43.057  44.219  1.00 28.26  ? 275 ASP A CA  1 
ATOM   2119  C C   . ASP A  1 275 ? 18.496  43.403  44.653  1.00 27.67  ? 275 ASP A C   1 
ATOM   2120  O O   . ASP A  1 275 ? 19.322  43.846  43.850  1.00 26.50  ? 275 ASP A O   1 
ATOM   2121  C CB  . ASP A  1 275 ? 16.907  41.568  44.081  1.00 31.62  ? 275 ASP A CB  1 
ATOM   2122  C CG  . ASP A  1 275 ? 17.087  40.735  45.349  1.00 34.88  ? 275 ASP A CG  1 
ATOM   2123  O OD1 . ASP A  1 275 ? 16.976  41.256  46.470  1.00 36.02  ? 275 ASP A OD1 1 
ATOM   2124  O OD2 . ASP A  1 275 ? 17.306  39.528  45.198  1.00 36.50  ? 275 ASP A OD2 1 
ATOM   2125  N N   . THR A  1 276 ? 18.773  43.287  45.927  1.00 27.92  ? 276 THR A N   1 
ATOM   2126  C CA  . THR A  1 276 ? 20.056  43.683  46.399  1.00 28.70  ? 276 THR A CA  1 
ATOM   2127  C C   . THR A  1 276 ? 20.960  42.497  46.353  1.00 29.10  ? 276 THR A C   1 
ATOM   2128  O O   . THR A  1 276 ? 20.769  41.521  47.077  1.00 31.18  ? 276 THR A O   1 
ATOM   2129  C CB  . THR A  1 276 ? 19.956  44.208  47.804  1.00 28.96  ? 276 THR A CB  1 
ATOM   2130  O OG1 . THR A  1 276 ? 18.875  45.136  47.848  1.00 28.94  ? 276 THR A OG1 1 
ATOM   2131  C CG2 . THR A  1 276 ? 21.265  44.863  48.211  1.00 29.91  ? 276 THR A CG2 1 
ATOM   2132  N N   . CYS A  1 277 ? 21.949  42.590  45.496  1.00 28.30  ? 277 CYS A N   1 
ATOM   2133  C CA  . CYS A  1 277 ? 22.939  41.545  45.305  1.00 27.29  ? 277 CYS A CA  1 
ATOM   2134  C C   . CYS A  1 277 ? 23.891  42.080  44.296  1.00 27.55  ? 277 CYS A C   1 
ATOM   2135  O O   . CYS A  1 277 ? 23.606  43.127  43.694  1.00 28.06  ? 277 CYS A O   1 
ATOM   2136  C CB  . CYS A  1 277 ? 22.355  40.276  44.753  1.00 26.51  ? 277 CYS A CB  1 
ATOM   2137  S SG  . CYS A  1 277 ? 21.153  40.570  43.444  1.00 26.71  ? 277 CYS A SG  1 
ATOM   2138  N N   . ILE A  1 278 ? 25.026  41.431  44.094  1.00 27.61  ? 278 ILE A N   1 
ATOM   2139  C CA  . ILE A  1 278 ? 25.995  42.025  43.198  1.00 27.20  ? 278 ILE A CA  1 
ATOM   2140  C C   . ILE A  1 278 ? 26.241  41.064  42.076  1.00 26.74  ? 278 ILE A C   1 
ATOM   2141  O O   . ILE A  1 278 ? 26.430  39.877  42.316  1.00 27.45  ? 278 ILE A O   1 
ATOM   2142  C CB  . ILE A  1 278 ? 27.276  42.416  44.022  1.00 26.80  ? 278 ILE A CB  1 
ATOM   2143  C CG1 . ILE A  1 278 ? 28.408  42.620  43.059  1.00 27.85  ? 278 ILE A CG1 1 
ATOM   2144  C CG2 . ILE A  1 278 ? 27.593  41.416  45.104  1.00 26.17  ? 278 ILE A CG2 1 
ATOM   2145  C CD1 . ILE A  1 278 ? 29.615  43.344  43.715  1.00 29.75  ? 278 ILE A CD1 1 
ATOM   2146  N N   . SER A  1 279 ? 26.098  41.572  40.865  1.00 26.10  ? 279 SER A N   1 
ATOM   2147  C CA  . SER A  1 279 ? 26.252  40.813  39.646  1.00 25.32  ? 279 SER A CA  1 
ATOM   2148  C C   . SER A  1 279 ? 26.595  41.800  38.564  1.00 24.51  ? 279 SER A C   1 
ATOM   2149  O O   . SER A  1 279 ? 25.953  42.835  38.440  1.00 25.21  ? 279 SER A O   1 
ATOM   2150  C CB  . SER A  1 279 ? 24.966  40.130  39.272  1.00 25.86  ? 279 SER A CB  1 
ATOM   2151  O OG  . SER A  1 279 ? 25.126  39.346  38.100  1.00 26.19  ? 279 SER A OG  1 
ATOM   2152  N N   . GLU A  1 280 ? 27.591  41.520  37.752  1.00 24.02  ? 280 GLU A N   1 
ATOM   2153  C CA  . GLU A  1 280 ? 27.992  42.480  36.744  1.00 23.63  ? 280 GLU A CA  1 
ATOM   2154  C C   . GLU A  1 280 ? 27.288  42.338  35.420  1.00 20.45  ? 280 GLU A C   1 
ATOM   2155  O O   . GLU A  1 280 ? 27.288  43.266  34.610  1.00 20.24  ? 280 GLU A O   1 
ATOM   2156  C CB  . GLU A  1 280 ? 29.448  42.374  36.475  1.00 26.85  ? 280 GLU A CB  1 
ATOM   2157  C CG  . GLU A  1 280 ? 30.181  42.516  37.768  1.00 31.49  ? 280 GLU A CG  1 
ATOM   2158  C CD  . GLU A  1 280 ? 31.606  42.881  37.466  1.00 34.53  ? 280 GLU A CD  1 
ATOM   2159  O OE1 . GLU A  1 280 ? 32.379  41.941  37.212  1.00 36.94  ? 280 GLU A OE1 1 
ATOM   2160  O OE2 . GLU A  1 280 ? 31.906  44.086  37.466  1.00 35.55  ? 280 GLU A OE2 1 
ATOM   2161  N N   . CYS A  1 281 ? 26.726  41.183  35.160  1.00 16.71  ? 281 CYS A N   1 
ATOM   2162  C CA  . CYS A  1 281 ? 26.078  40.977  33.904  1.00 13.52  ? 281 CYS A CA  1 
ATOM   2163  C C   . CYS A  1 281 ? 24.596  41.098  34.135  1.00 12.63  ? 281 CYS A C   1 
ATOM   2164  O O   . CYS A  1 281 ? 24.056  40.448  35.052  1.00 12.11  ? 281 CYS A O   1 
ATOM   2165  C CB  . CYS A  1 281 ? 26.419  39.604  33.399  1.00 12.21  ? 281 CYS A CB  1 
ATOM   2166  S SG  . CYS A  1 281 ? 25.533  39.285  31.875  1.00 10.74  ? 281 CYS A SG  1 
ATOM   2167  N N   . ILE A  1 282 ? 23.935  41.958  33.365  1.00 11.43  ? 282 ILE A N   1 
ATOM   2168  C CA  . ILE A  1 282 ? 22.491  42.085  33.454  1.00 11.14  ? 282 ILE A CA  1 
ATOM   2169  C C   . ILE A  1 282 ? 21.878  41.768  32.101  1.00 11.38  ? 282 ILE A C   1 
ATOM   2170  O O   . ILE A  1 282 ? 22.367  42.218  31.063  1.00 10.62  ? 282 ILE A O   1 
ATOM   2171  C CB  . ILE A  1 282 ? 22.087  43.512  33.853  1.00 10.68  ? 282 ILE A CB  1 
ATOM   2172  C CG1 . ILE A  1 282 ? 22.633  43.813  35.223  1.00 11.43  ? 282 ILE A CG1 1 
ATOM   2173  C CG2 . ILE A  1 282 ? 20.576  43.657  33.874  1.00 9.71   ? 282 ILE A CG2 1 
ATOM   2174  C CD1 . ILE A  1 282 ? 22.664  45.314  35.444  1.00 12.17  ? 282 ILE A CD1 1 
ATOM   2175  N N   . THR A  1 283 ? 20.830  40.947  32.091  1.00 11.66  ? 283 THR A N   1 
ATOM   2176  C CA  . THR A  1 283 ? 20.041  40.733  30.890  1.00 10.49  ? 283 THR A CA  1 
ATOM   2177  C C   . THR A  1 283 ? 18.624  41.148  31.302  1.00 10.85  ? 283 THR A C   1 
ATOM   2178  O O   . THR A  1 283 ? 18.365  41.332  32.497  1.00 11.57  ? 283 THR A O   1 
ATOM   2179  C CB  . THR A  1 283 ? 20.053  39.256  30.467  1.00 8.49   ? 283 THR A CB  1 
ATOM   2180  O OG1 . THR A  1 283 ? 19.250  38.546  31.394  1.00 7.83   ? 283 THR A OG1 1 
ATOM   2181  C CG2 . THR A  1 283 ? 21.438  38.674  30.439  1.00 7.50   ? 283 THR A CG2 1 
ATOM   2182  N N   . PRO A  1 284 ? 17.654  41.325  30.428  1.00 11.04  ? 284 PRO A N   1 
ATOM   2183  C CA  . PRO A  1 284 ? 16.315  41.667  30.824  1.00 12.28  ? 284 PRO A CA  1 
ATOM   2184  C C   . PRO A  1 284 ? 15.658  40.533  31.605  1.00 14.14  ? 284 PRO A C   1 
ATOM   2185  O O   . PRO A  1 284 ? 14.609  40.761  32.219  1.00 15.14  ? 284 PRO A O   1 
ATOM   2186  C CB  . PRO A  1 284 ? 15.617  41.984  29.556  1.00 12.11  ? 284 PRO A CB  1 
ATOM   2187  C CG  . PRO A  1 284 ? 16.479  41.369  28.508  1.00 12.00  ? 284 PRO A CG  1 
ATOM   2188  C CD  . PRO A  1 284 ? 17.833  41.703  29.055  1.00 11.67  ? 284 PRO A CD  1 
ATOM   2189  N N   . ASN A  1 285 ? 16.251  39.333  31.632  1.00 14.48  ? 285 ASN A N   1 
ATOM   2190  C CA  . ASN A  1 285 ? 15.696  38.255  32.420  1.00 16.25  ? 285 ASN A CA  1 
ATOM   2191  C C   . ASN A  1 285 ? 16.209  38.278  33.842  1.00 15.35  ? 285 ASN A C   1 
ATOM   2192  O O   . ASN A  1 285 ? 15.854  37.409  34.642  1.00 15.41  ? 285 ASN A O   1 
ATOM   2193  C CB  . ASN A  1 285 ? 16.068  36.902  31.918  1.00 20.35  ? 285 ASN A CB  1 
ATOM   2194  C CG  . ASN A  1 285 ? 15.719  36.669  30.490  1.00 24.88  ? 285 ASN A CG  1 
ATOM   2195  O OD1 . ASN A  1 285 ? 16.002  37.498  29.637  1.00 25.30  ? 285 ASN A OD1 1 
ATOM   2196  N ND2 . ASN A  1 285 ? 15.153  35.523  30.162  1.00 30.01  ? 285 ASN A ND2 1 
ATOM   2197  N N   . GLY A  1 286 ? 17.062  39.223  34.198  1.00 13.60  ? 286 GLY A N   1 
ATOM   2198  C CA  . GLY A  1 286 ? 17.666  39.218  35.499  1.00 12.33  ? 286 GLY A CA  1 
ATOM   2199  C C   . GLY A  1 286 ? 19.156  39.038  35.302  1.00 11.55  ? 286 GLY A C   1 
ATOM   2200  O O   . GLY A  1 286 ? 19.650  38.893  34.183  1.00 10.79  ? 286 GLY A O   1 
ATOM   2201  N N   . SER A  1 287 ? 19.926  39.057  36.361  1.00 12.13  ? 287 SER A N   1 
ATOM   2202  C CA  . SER A  1 287 ? 21.343  38.958  36.230  1.00 12.81  ? 287 SER A CA  1 
ATOM   2203  C C   . SER A  1 287 ? 21.775  37.518  36.115  1.00 13.37  ? 287 SER A C   1 
ATOM   2204  O O   . SER A  1 287 ? 21.070  36.603  36.527  1.00 13.74  ? 287 SER A O   1 
ATOM   2205  C CB  . SER A  1 287 ? 21.940  39.657  37.421  1.00 12.89  ? 287 SER A CB  1 
ATOM   2206  O OG  . SER A  1 287 ? 21.723  41.064  37.318  1.00 13.50  ? 287 SER A OG  1 
ATOM   2207  N N   . ILE A  1 288 ? 22.911  37.304  35.466  1.00 14.46  ? 288 ILE A N   1 
ATOM   2208  C CA  . ILE A  1 288 ? 23.466  35.987  35.225  1.00 15.41  ? 288 ILE A CA  1 
ATOM   2209  C C   . ILE A  1 288 ? 24.947  36.014  35.572  1.00 16.94  ? 288 ILE A C   1 
ATOM   2210  O O   . ILE A  1 288 ? 25.572  37.077  35.497  1.00 18.36  ? 288 ILE A O   1 
ATOM   2211  C CB  . ILE A  1 288 ? 23.319  35.561  33.747  1.00 15.25  ? 288 ILE A CB  1 
ATOM   2212  C CG1 . ILE A  1 288 ? 24.035  36.500  32.799  1.00 15.03  ? 288 ILE A CG1 1 
ATOM   2213  C CG2 . ILE A  1 288 ? 21.836  35.488  33.438  1.00 15.43  ? 288 ILE A CG2 1 
ATOM   2214  C CD1 . ILE A  1 288 ? 23.897  36.110  31.314  1.00 14.35  ? 288 ILE A CD1 1 
ATOM   2215  N N   . PRO A  1 289 ? 25.557  34.924  36.014  1.00 17.52  ? 289 PRO A N   1 
ATOM   2216  C CA  . PRO A  1 289 ? 26.967  34.896  36.352  1.00 18.58  ? 289 PRO A CA  1 
ATOM   2217  C C   . PRO A  1 289 ? 27.872  34.794  35.143  1.00 19.24  ? 289 PRO A C   1 
ATOM   2218  O O   . PRO A  1 289 ? 27.744  33.919  34.287  1.00 19.94  ? 289 PRO A O   1 
ATOM   2219  C CB  . PRO A  1 289 ? 27.080  33.737  37.278  1.00 18.51  ? 289 PRO A CB  1 
ATOM   2220  C CG  . PRO A  1 289 ? 26.046  32.798  36.726  1.00 17.80  ? 289 PRO A CG  1 
ATOM   2221  C CD  . PRO A  1 289 ? 24.893  33.757  36.546  1.00 17.45  ? 289 PRO A CD  1 
ATOM   2222  N N   . ASN A  1 290 ? 28.834  35.689  35.083  1.00 19.87  ? 290 ASN A N   1 
ATOM   2223  C CA  . ASN A  1 290 ? 29.756  35.700  33.974  1.00 20.73  ? 290 ASN A CA  1 
ATOM   2224  C C   . ASN A  1 290 ? 30.957  34.797  34.202  1.00 21.48  ? 290 ASN A C   1 
ATOM   2225  O O   . ASN A  1 290 ? 32.057  35.140  33.772  1.00 22.06  ? 290 ASN A O   1 
ATOM   2226  C CB  . ASN A  1 290 ? 30.238  37.132  33.705  1.00 21.66  ? 290 ASN A CB  1 
ATOM   2227  C CG  . ASN A  1 290 ? 30.933  37.793  34.884  1.00 23.35  ? 290 ASN A CG  1 
ATOM   2228  O OD1 . ASN A  1 290 ? 30.932  37.259  36.001  1.00 25.00  ? 290 ASN A OD1 1 
ATOM   2229  N ND2 . ASN A  1 290 ? 31.465  38.993  34.727  1.00 23.62  ? 290 ASN A ND2 1 
ATOM   2230  N N   . ASP A  1 291 ? 30.810  33.665  34.897  1.00 21.74  ? 291 ASP A N   1 
ATOM   2231  C CA  . ASP A  1 291 ? 31.909  32.739  35.028  1.00 21.63  ? 291 ASP A CA  1 
ATOM   2232  C C   . ASP A  1 291 ? 32.096  32.036  33.692  1.00 20.35  ? 291 ASP A C   1 
ATOM   2233  O O   . ASP A  1 291 ? 33.198  31.895  33.179  1.00 21.04  ? 291 ASP A O   1 
ATOM   2234  C CB  . ASP A  1 291 ? 31.636  31.706  36.132  1.00 25.22  ? 291 ASP A CB  1 
ATOM   2235  C CG  . ASP A  1 291 ? 30.215  31.116  36.280  1.00 28.94  ? 291 ASP A CG  1 
ATOM   2236  O OD1 . ASP A  1 291 ? 29.798  30.228  35.521  1.00 30.31  ? 291 ASP A OD1 1 
ATOM   2237  O OD2 . ASP A  1 291 ? 29.495  31.524  37.190  1.00 30.92  ? 291 ASP A OD2 1 
ATOM   2238  N N   . LYS A  1 292 ? 31.036  31.595  33.028  1.00 18.61  ? 292 LYS A N   1 
ATOM   2239  C CA  . LYS A  1 292 ? 31.181  30.883  31.760  1.00 15.29  ? 292 LYS A CA  1 
ATOM   2240  C C   . LYS A  1 292 ? 31.443  31.811  30.597  1.00 12.77  ? 292 LYS A C   1 
ATOM   2241  O O   . LYS A  1 292 ? 31.015  32.955  30.634  1.00 12.53  ? 292 LYS A O   1 
ATOM   2242  C CB  . LYS A  1 292 ? 29.937  30.112  31.533  1.00 16.06  ? 292 LYS A CB  1 
ATOM   2243  C CG  . LYS A  1 292 ? 29.887  28.995  32.514  1.00 17.17  ? 292 LYS A CG  1 
ATOM   2244  C CD  . LYS A  1 292 ? 28.433  28.657  32.545  1.00 18.72  ? 292 LYS A CD  1 
ATOM   2245  C CE  . LYS A  1 292 ? 28.138  27.612  33.589  1.00 19.97  ? 292 LYS A CE  1 
ATOM   2246  N NZ  . LYS A  1 292 ? 28.602  28.075  34.879  1.00 21.73  ? 292 LYS A NZ  1 
ATOM   2247  N N   . PRO A  1 293 ? 32.107  31.401  29.525  1.00 11.30  ? 293 PRO A N   1 
ATOM   2248  C CA  . PRO A  1 293 ? 32.384  32.254  28.377  1.00 9.67   ? 293 PRO A CA  1 
ATOM   2249  C C   . PRO A  1 293 ? 31.192  32.573  27.516  1.00 7.96   ? 293 PRO A C   1 
ATOM   2250  O O   . PRO A  1 293 ? 31.180  33.590  26.830  1.00 8.62   ? 293 PRO A O   1 
ATOM   2251  C CB  . PRO A  1 293 ? 33.440  31.540  27.601  1.00 9.59   ? 293 PRO A CB  1 
ATOM   2252  C CG  . PRO A  1 293 ? 33.144  30.110  27.911  1.00 10.93  ? 293 PRO A CG  1 
ATOM   2253  C CD  . PRO A  1 293 ? 32.867  30.170  29.409  1.00 11.68  ? 293 PRO A CD  1 
ATOM   2254  N N   . PHE A  1 294 ? 30.170  31.745  27.499  1.00 7.40   ? 294 PHE A N   1 
ATOM   2255  C CA  . PHE A  1 294 ? 29.048  31.956  26.598  1.00 6.11   ? 294 PHE A CA  1 
ATOM   2256  C C   . PHE A  1 294 ? 27.774  31.869  27.387  1.00 5.53   ? 294 PHE A C   1 
ATOM   2257  O O   . PHE A  1 294 ? 27.775  31.309  28.477  1.00 6.20   ? 294 PHE A O   1 
ATOM   2258  C CB  . PHE A  1 294 ? 29.036  30.889  25.494  1.00 5.48   ? 294 PHE A CB  1 
ATOM   2259  C CG  . PHE A  1 294 ? 30.301  30.879  24.647  1.00 4.89   ? 294 PHE A CG  1 
ATOM   2260  C CD1 . PHE A  1 294 ? 31.167  29.799  24.710  1.00 4.64   ? 294 PHE A CD1 1 
ATOM   2261  C CD2 . PHE A  1 294 ? 30.589  31.951  23.828  1.00 4.26   ? 294 PHE A CD2 1 
ATOM   2262  C CE1 . PHE A  1 294 ? 32.331  29.795  23.963  1.00 3.80   ? 294 PHE A CE1 1 
ATOM   2263  C CE2 . PHE A  1 294 ? 31.747  31.932  23.078  1.00 4.00   ? 294 PHE A CE2 1 
ATOM   2264  C CZ  . PHE A  1 294 ? 32.616  30.856  23.138  1.00 3.62   ? 294 PHE A CZ  1 
ATOM   2265  N N   . GLN A  1 295 ? 26.679  32.399  26.886  1.00 4.74   ? 295 GLN A N   1 
ATOM   2266  C CA  . GLN A  1 295 ? 25.426  32.371  27.594  1.00 4.11   ? 295 GLN A CA  1 
ATOM   2267  C C   . GLN A  1 295 ? 24.312  32.231  26.606  1.00 4.44   ? 295 GLN A C   1 
ATOM   2268  O O   . GLN A  1 295 ? 24.462  32.520  25.424  1.00 4.41   ? 295 GLN A O   1 
ATOM   2269  C CB  . GLN A  1 295 ? 25.220  33.639  28.398  1.00 3.02   ? 295 GLN A CB  1 
ATOM   2270  C CG  . GLN A  1 295 ? 25.278  34.909  27.610  1.00 2.00   ? 295 GLN A CG  1 
ATOM   2271  C CD  . GLN A  1 295 ? 23.941  35.539  27.308  1.00 2.45   ? 295 GLN A CD  1 
ATOM   2272  O OE1 . GLN A  1 295 ? 22.865  34.979  27.504  1.00 3.39   ? 295 GLN A OE1 1 
ATOM   2273  N NE2 . GLN A  1 295 ? 24.003  36.748  26.812  1.00 2.01   ? 295 GLN A NE2 1 
ATOM   2274  N N   . ASN A  1 296 ? 23.175  31.818  27.091  1.00 5.55   ? 296 ASN A N   1 
ATOM   2275  C CA  . ASN A  1 296 ? 22.039  31.620  26.241  1.00 6.42   ? 296 ASN A CA  1 
ATOM   2276  C C   . ASN A  1 296 ? 20.776  32.200  26.889  1.00 6.60   ? 296 ASN A C   1 
ATOM   2277  O O   . ASN A  1 296 ? 19.637  31.993  26.454  1.00 6.96   ? 296 ASN A O   1 
ATOM   2278  C CB  . ASN A  1 296 ? 22.022  30.130  26.015  1.00 7.55   ? 296 ASN A CB  1 
ATOM   2279  C CG  . ASN A  1 296 ? 20.883  29.676  25.153  1.00 9.17   ? 296 ASN A CG  1 
ATOM   2280  O OD1 . ASN A  1 296 ? 20.071  28.885  25.621  1.00 11.02  ? 296 ASN A OD1 1 
ATOM   2281  N ND2 . ASN A  1 296 ? 20.743  30.103  23.909  1.00 9.95   ? 296 ASN A ND2 1 
ATOM   2282  N N   . VAL A  1 297 ? 20.956  33.031  27.923  1.00 6.12   ? 297 VAL A N   1 
ATOM   2283  C CA  . VAL A  1 297 ? 19.815  33.599  28.621  1.00 6.17   ? 297 VAL A CA  1 
ATOM   2284  C C   . VAL A  1 297 ? 19.094  34.621  27.742  1.00 6.83   ? 297 VAL A C   1 
ATOM   2285  O O   . VAL A  1 297 ? 17.879  34.528  27.519  1.00 7.10   ? 297 VAL A O   1 
ATOM   2286  C CB  . VAL A  1 297 ? 20.321  34.215  29.944  1.00 4.42   ? 297 VAL A CB  1 
ATOM   2287  C CG1 . VAL A  1 297 ? 19.294  35.104  30.630  1.00 2.97   ? 297 VAL A CG1 1 
ATOM   2288  C CG2 . VAL A  1 297 ? 20.631  33.062  30.848  1.00 3.09   ? 297 VAL A CG2 1 
ATOM   2289  N N   . ASN A  1 298 ? 19.817  35.592  27.206  1.00 8.23   ? 298 ASN A N   1 
ATOM   2290  C CA  . ASN A  1 298 ? 19.192  36.625  26.396  1.00 9.11   ? 298 ASN A CA  1 
ATOM   2291  C C   . ASN A  1 298 ? 20.275  37.318  25.588  1.00 8.74   ? 298 ASN A C   1 
ATOM   2292  O O   . ASN A  1 298 ? 21.429  37.340  26.012  1.00 7.89   ? 298 ASN A O   1 
ATOM   2293  C CB  . ASN A  1 298 ? 18.462  37.663  27.279  1.00 8.44   ? 298 ASN A CB  1 
ATOM   2294  C CG  . ASN A  1 298 ? 17.402  38.405  26.494  1.00 7.73   ? 298 ASN A CG  1 
ATOM   2295  O OD1 . ASN A  1 298 ? 17.671  38.891  25.398  1.00 8.79   ? 298 ASN A OD1 1 
ATOM   2296  N ND2 . ASN A  1 298 ? 16.163  38.520  26.927  1.00 7.89   ? 298 ASN A ND2 1 
ATOM   2297  N N   . LYS A  1 299 ? 19.922  37.817  24.396  1.00 9.20   ? 299 LYS A N   1 
ATOM   2298  C CA  . LYS A  1 299 ? 20.852  38.502  23.516  1.00 9.10   ? 299 LYS A CA  1 
ATOM   2299  C C   . LYS A  1 299 ? 20.970  39.952  23.925  1.00 9.03   ? 299 LYS A C   1 
ATOM   2300  O O   . LYS A  1 299 ? 21.817  40.670  23.385  1.00 11.19  ? 299 LYS A O   1 
ATOM   2301  C CB  . LYS A  1 299 ? 20.401  38.453  22.051  1.00 9.48   ? 299 LYS A CB  1 
ATOM   2302  C CG  . LYS A  1 299 ? 19.245  39.364  21.672  1.00 11.31  ? 299 LYS A CG  1 
ATOM   2303  C CD  . LYS A  1 299 ? 18.760  39.145  20.241  1.00 13.17  ? 299 LYS A CD  1 
ATOM   2304  C CE  . LYS A  1 299 ? 17.419  38.392  20.192  1.00 14.43  ? 299 LYS A CE  1 
ATOM   2305  N NZ  . LYS A  1 299 ? 16.296  39.138  20.769  1.00 16.14  ? 299 LYS A NZ  1 
ATOM   2306  N N   . ILE A  1 300 ? 20.097  40.449  24.791  1.00 7.67   ? 300 ILE A N   1 
ATOM   2307  C CA  . ILE A  1 300 ? 20.179  41.806  25.279  1.00 6.95   ? 300 ILE A CA  1 
ATOM   2308  C C   . ILE A  1 300 ? 20.975  41.753  26.571  1.00 8.14   ? 300 ILE A C   1 
ATOM   2309  O O   . ILE A  1 300 ? 20.647  40.937  27.448  1.00 9.49   ? 300 ILE A O   1 
ATOM   2310  C CB  . ILE A  1 300 ? 18.763  42.274  25.481  1.00 5.76   ? 300 ILE A CB  1 
ATOM   2311  C CG1 . ILE A  1 300 ? 18.170  42.405  24.125  1.00 4.91   ? 300 ILE A CG1 1 
ATOM   2312  C CG2 . ILE A  1 300 ? 18.692  43.590  26.224  1.00 5.93   ? 300 ILE A CG2 1 
ATOM   2313  C CD1 . ILE A  1 300 ? 16.670  42.257  24.149  1.00 5.52   ? 300 ILE A CD1 1 
ATOM   2314  N N   . THR A  1 301 ? 22.025  42.549  26.725  1.00 7.78   ? 301 THR A N   1 
ATOM   2315  C CA  . THR A  1 301 ? 22.819  42.473  27.943  1.00 8.41   ? 301 THR A CA  1 
ATOM   2316  C C   . THR A  1 301 ? 23.414  43.850  28.266  1.00 7.95   ? 301 THR A C   1 
ATOM   2317  O O   . THR A  1 301 ? 23.484  44.708  27.365  1.00 8.28   ? 301 THR A O   1 
ATOM   2318  C CB  . THR A  1 301 ? 23.958  41.437  27.757  1.00 8.75   ? 301 THR A CB  1 
ATOM   2319  O OG1 . THR A  1 301 ? 24.561  41.832  26.539  1.00 10.40  ? 301 THR A OG1 1 
ATOM   2320  C CG2 . THR A  1 301 ? 23.558  39.979  27.605  1.00 8.09   ? 301 THR A CG2 1 
ATOM   2321  N N   . TYR A  1 302 ? 23.794  44.092  29.523  1.00 6.23   ? 302 TYR A N   1 
ATOM   2322  C CA  . TYR A  1 302 ? 24.477  45.302  29.916  1.00 4.96   ? 302 TYR A CA  1 
ATOM   2323  C C   . TYR A  1 302 ? 25.601  44.857  30.850  1.00 5.55   ? 302 TYR A C   1 
ATOM   2324  O O   . TYR A  1 302 ? 25.328  44.013  31.720  1.00 8.47   ? 302 TYR A O   1 
ATOM   2325  C CB  . TYR A  1 302 ? 23.507  46.235  30.646  1.00 3.25   ? 302 TYR A CB  1 
ATOM   2326  C CG  . TYR A  1 302 ? 24.207  47.491  31.167  1.00 2.55   ? 302 TYR A CG  1 
ATOM   2327  C CD1 . TYR A  1 302 ? 24.667  47.517  32.462  1.00 2.10   ? 302 TYR A CD1 1 
ATOM   2328  C CD2 . TYR A  1 302 ? 24.422  48.569  30.346  1.00 2.00   ? 302 TYR A CD2 1 
ATOM   2329  C CE1 . TYR A  1 302 ? 25.357  48.589  32.923  1.00 2.00   ? 302 TYR A CE1 1 
ATOM   2330  C CE2 . TYR A  1 302 ? 25.108  49.652  30.816  1.00 2.00   ? 302 TYR A CE2 1 
ATOM   2331  C CZ  . TYR A  1 302 ? 25.573  49.649  32.098  1.00 2.14   ? 302 TYR A CZ  1 
ATOM   2332  O OH  . TYR A  1 302 ? 26.329  50.695  32.567  1.00 3.04   ? 302 TYR A OH  1 
ATOM   2333  N N   . GLY A  1 303 ? 26.827  45.368  30.729  1.00 3.66   ? 303 GLY A N   1 
ATOM   2334  C CA  . GLY A  1 303 ? 27.864  45.017  31.684  1.00 4.66   ? 303 GLY A CA  1 
ATOM   2335  C C   . GLY A  1 303 ? 28.808  43.917  31.206  1.00 5.45   ? 303 GLY A C   1 
ATOM   2336  O O   . GLY A  1 303 ? 28.839  43.615  30.011  1.00 7.47   ? 303 GLY A O   1 
ATOM   2337  N N   . ALA A  1 304 ? 29.625  43.316  32.078  1.00 5.11   ? 304 ALA A N   1 
ATOM   2338  C CA  . ALA A  1 304 ? 30.559  42.263  31.680  1.00 4.08   ? 304 ALA A CA  1 
ATOM   2339  C C   . ALA A  1 304 ? 29.871  40.918  31.527  1.00 4.22   ? 304 ALA A C   1 
ATOM   2340  O O   . ALA A  1 304 ? 29.794  40.143  32.491  1.00 4.02   ? 304 ALA A O   1 
ATOM   2341  C CB  . ALA A  1 304 ? 31.633  42.124  32.733  1.00 4.46   ? 304 ALA A CB  1 
ATOM   2342  N N   . CYS A  1 305 ? 29.398  40.569  30.349  1.00 4.10   ? 305 CYS A N   1 
ATOM   2343  C CA  . CYS A  1 305 ? 28.584  39.367  30.217  1.00 6.10   ? 305 CYS A CA  1 
ATOM   2344  C C   . CYS A  1 305 ? 29.151  38.279  29.332  1.00 6.41   ? 305 CYS A C   1 
ATOM   2345  O O   . CYS A  1 305 ? 30.060  38.532  28.538  1.00 8.20   ? 305 CYS A O   1 
ATOM   2346  C CB  . CYS A  1 305 ? 27.258  39.722  29.645  1.00 7.33   ? 305 CYS A CB  1 
ATOM   2347  S SG  . CYS A  1 305 ? 26.316  40.750  30.758  1.00 9.61   ? 305 CYS A SG  1 
ATOM   2348  N N   . PRO A  1 306 ? 28.681  37.036  29.423  1.00 5.46   ? 306 PRO A N   1 
ATOM   2349  C CA  . PRO A  1 306 ? 29.152  35.989  28.543  1.00 5.91   ? 306 PRO A CA  1 
ATOM   2350  C C   . PRO A  1 306 ? 28.602  36.293  27.153  1.00 6.97   ? 306 PRO A C   1 
ATOM   2351  O O   . PRO A  1 306 ? 27.600  37.010  26.994  1.00 8.06   ? 306 PRO A O   1 
ATOM   2352  C CB  . PRO A  1 306 ? 28.616  34.739  29.145  1.00 5.08   ? 306 PRO A CB  1 
ATOM   2353  C CG  . PRO A  1 306 ? 28.541  35.101  30.590  1.00 5.15   ? 306 PRO A CG  1 
ATOM   2354  C CD  . PRO A  1 306 ? 27.948  36.480  30.534  1.00 5.04   ? 306 PRO A CD  1 
ATOM   2355  N N   . LYS A  1 307 ? 29.195  35.748  26.098  1.00 8.10   ? 307 LYS A N   1 
ATOM   2356  C CA  . LYS A  1 307 ? 28.730  36.023  24.739  1.00 8.25   ? 307 LYS A CA  1 
ATOM   2357  C C   . LYS A  1 307 ? 27.548  35.148  24.423  1.00 7.60   ? 307 LYS A C   1 
ATOM   2358  O O   . LYS A  1 307 ? 27.554  33.942  24.699  1.00 6.98   ? 307 LYS A O   1 
ATOM   2359  C CB  . LYS A  1 307 ? 29.789  35.745  23.718  1.00 9.51   ? 307 LYS A CB  1 
ATOM   2360  C CG  . LYS A  1 307 ? 30.946  36.647  23.990  1.00 12.43  ? 307 LYS A CG  1 
ATOM   2361  C CD  . LYS A  1 307 ? 31.856  36.800  22.794  1.00 14.59  ? 307 LYS A CD  1 
ATOM   2362  C CE  . LYS A  1 307 ? 33.067  37.678  23.149  1.00 16.73  ? 307 LYS A CE  1 
ATOM   2363  N NZ  . LYS A  1 307 ? 33.874  37.114  24.239  1.00 18.60  ? 307 LYS A NZ  1 
ATOM   2364  N N   . TYR A  1 308 ? 26.495  35.778  23.922  1.00 7.50   ? 308 TYR A N   1 
ATOM   2365  C CA  . TYR A  1 308 ? 25.267  35.058  23.577  1.00 6.05   ? 308 TYR A CA  1 
ATOM   2366  C C   . TYR A  1 308 ? 25.527  34.105  22.437  1.00 5.48   ? 308 TYR A C   1 
ATOM   2367  O O   . TYR A  1 308 ? 26.120  34.479  21.424  1.00 6.70   ? 308 TYR A O   1 
ATOM   2368  C CB  . TYR A  1 308 ? 24.183  36.010  23.136  1.00 4.05   ? 308 TYR A CB  1 
ATOM   2369  C CG  . TYR A  1 308 ? 22.896  35.312  22.886  1.00 2.48   ? 308 TYR A CG  1 
ATOM   2370  C CD1 . TYR A  1 308 ? 22.501  35.072  21.603  1.00 2.15   ? 308 TYR A CD1 1 
ATOM   2371  C CD2 . TYR A  1 308 ? 22.152  34.902  23.952  1.00 3.12   ? 308 TYR A CD2 1 
ATOM   2372  C CE1 . TYR A  1 308 ? 21.338  34.405  21.366  1.00 2.81   ? 308 TYR A CE1 1 
ATOM   2373  C CE2 . TYR A  1 308 ? 20.981  34.236  23.715  1.00 3.96   ? 308 TYR A CE2 1 
ATOM   2374  C CZ  . TYR A  1 308 ? 20.580  33.994  22.426  1.00 3.59   ? 308 TYR A CZ  1 
ATOM   2375  O OH  . TYR A  1 308 ? 19.417  33.305  22.200  1.00 4.89   ? 308 TYR A OH  1 
ATOM   2376  N N   . VAL A  1 309 ? 24.994  32.923  22.574  1.00 4.49   ? 309 VAL A N   1 
ATOM   2377  C CA  . VAL A  1 309 ? 25.224  31.885  21.615  1.00 3.13   ? 309 VAL A CA  1 
ATOM   2378  C C   . VAL A  1 309 ? 23.873  31.221  21.456  1.00 3.65   ? 309 VAL A C   1 
ATOM   2379  O O   . VAL A  1 309 ? 22.959  31.434  22.269  1.00 4.13   ? 309 VAL A O   1 
ATOM   2380  C CB  . VAL A  1 309 ? 26.376  31.131  22.303  1.00 2.93   ? 309 VAL A CB  1 
ATOM   2381  C CG1 . VAL A  1 309 ? 25.990  29.752  22.756  1.00 2.00   ? 309 VAL A CG1 1 
ATOM   2382  C CG2 . VAL A  1 309 ? 27.545  31.238  21.365  1.00 2.00   ? 309 VAL A CG2 1 
ATOM   2383  N N   . LYS A  1 310 ? 23.667  30.502  20.366  1.00 3.92   ? 310 LYS A N   1 
ATOM   2384  C CA  . LYS A  1 310 ? 22.405  29.821  20.163  1.00 4.01   ? 310 LYS A CA  1 
ATOM   2385  C C   . LYS A  1 310 ? 22.389  28.560  20.996  1.00 3.86   ? 310 LYS A C   1 
ATOM   2386  O O   . LYS A  1 310 ? 21.369  28.208  21.566  1.00 5.81   ? 310 LYS A O   1 
ATOM   2387  C CB  . LYS A  1 310 ? 22.235  29.468  18.710  1.00 3.84   ? 310 LYS A CB  1 
ATOM   2388  C CG  . LYS A  1 310 ? 21.712  30.631  17.902  1.00 7.28   ? 310 LYS A CG  1 
ATOM   2389  C CD  . LYS A  1 310 ? 21.795  30.343  16.386  1.00 10.70  ? 310 LYS A CD  1 
ATOM   2390  C CE  . LYS A  1 310 ? 20.726  31.086  15.486  1.00 14.00  ? 310 LYS A CE  1 
ATOM   2391  N NZ  . LYS A  1 310 ? 20.813  32.567  15.341  1.00 16.76  ? 310 LYS A NZ  1 
ATOM   2392  N N   . GLN A  1 311 ? 23.517  27.889  21.111  1.00 3.97   ? 311 GLN A N   1 
ATOM   2393  C CA  . GLN A  1 311 ? 23.602  26.629  21.811  1.00 5.45   ? 311 GLN A CA  1 
ATOM   2394  C C   . GLN A  1 311 ? 23.189  26.753  23.263  1.00 8.30   ? 311 GLN A C   1 
ATOM   2395  O O   . GLN A  1 311 ? 23.612  27.699  23.938  1.00 9.84   ? 311 GLN A O   1 
ATOM   2396  C CB  . GLN A  1 311 ? 25.010  26.109  21.820  1.00 4.74   ? 311 GLN A CB  1 
ATOM   2397  C CG  . GLN A  1 311 ? 25.570  25.794  20.474  1.00 4.03   ? 311 GLN A CG  1 
ATOM   2398  C CD  . GLN A  1 311 ? 26.383  26.898  19.860  1.00 3.41   ? 311 GLN A CD  1 
ATOM   2399  O OE1 . GLN A  1 311 ? 26.116  28.074  20.067  1.00 3.38   ? 311 GLN A OE1 1 
ATOM   2400  N NE2 . GLN A  1 311 ? 27.378  26.543  19.079  1.00 3.88   ? 311 GLN A NE2 1 
ATOM   2401  N N   . ASN A  1 312 ? 22.404  25.829  23.801  1.00 10.26  ? 312 ASN A N   1 
ATOM   2402  C CA  . ASN A  1 312 ? 22.096  25.975  25.210  1.00 12.89  ? 312 ASN A CA  1 
ATOM   2403  C C   . ASN A  1 312 ? 23.015  25.111  26.043  1.00 11.94  ? 312 ASN A C   1 
ATOM   2404  O O   . ASN A  1 312 ? 22.977  25.176  27.274  1.00 12.37  ? 312 ASN A O   1 
ATOM   2405  C CB  . ASN A  1 312 ? 20.643  25.612  25.502  1.00 16.61  ? 312 ASN A CB  1 
ATOM   2406  C CG  . ASN A  1 312 ? 20.424  24.145  25.247  1.00 19.83  ? 312 ASN A CG  1 
ATOM   2407  O OD1 . ASN A  1 312 ? 20.800  23.629  24.186  1.00 21.77  ? 312 ASN A OD1 1 
ATOM   2408  N ND2 . ASN A  1 312 ? 19.881  23.439  26.232  1.00 21.16  ? 312 ASN A ND2 1 
ATOM   2409  N N   . THR A  1 313 ? 23.811  24.255  25.419  1.00 10.46  ? 313 THR A N   1 
ATOM   2410  C CA  . THR A  1 313 ? 24.822  23.543  26.174  1.00 10.44  ? 313 THR A CA  1 
ATOM   2411  C C   . THR A  1 313 ? 26.033  23.278  25.297  1.00 9.84   ? 313 THR A C   1 
ATOM   2412  O O   . THR A  1 313 ? 25.871  22.945  24.120  1.00 10.30  ? 313 THR A O   1 
ATOM   2413  C CB  . THR A  1 313 ? 24.203  22.253  26.700  1.00 10.61  ? 313 THR A CB  1 
ATOM   2414  O OG1 . THR A  1 313 ? 25.212  21.496  27.358  1.00 10.49  ? 313 THR A OG1 1 
ATOM   2415  C CG2 . THR A  1 313 ? 23.513  21.513  25.579  1.00 11.11  ? 313 THR A CG2 1 
ATOM   2416  N N   . LEU A  1 314 ? 27.243  23.473  25.834  1.00 8.59   ? 314 LEU A N   1 
ATOM   2417  C CA  . LEU A  1 314 ? 28.502  23.228  25.152  1.00 7.06   ? 314 LEU A CA  1 
ATOM   2418  C C   . LEU A  1 314 ? 29.485  22.726  26.208  1.00 7.62   ? 314 LEU A C   1 
ATOM   2419  O O   . LEU A  1 314 ? 29.989  23.502  27.023  1.00 8.52   ? 314 LEU A O   1 
ATOM   2420  C CB  . LEU A  1 314 ? 28.958  24.527  24.523  1.00 4.68   ? 314 LEU A CB  1 
ATOM   2421  C CG  . LEU A  1 314 ? 29.162  24.722  23.036  1.00 3.04   ? 314 LEU A CG  1 
ATOM   2422  C CD1 . LEU A  1 314 ? 28.272  23.872  22.186  1.00 2.87   ? 314 LEU A CD1 1 
ATOM   2423  C CD2 . LEU A  1 314 ? 28.858  26.158  22.763  1.00 2.00   ? 314 LEU A CD2 1 
ATOM   2424  N N   . LYS A  1 315 ? 29.730  21.412  26.251  1.00 7.48   ? 315 LYS A N   1 
ATOM   2425  C CA  . LYS A  1 315 ? 30.600  20.841  27.264  1.00 8.08   ? 315 LYS A CA  1 
ATOM   2426  C C   . LYS A  1 315 ? 32.062  20.775  26.875  1.00 7.11   ? 315 LYS A C   1 
ATOM   2427  O O   . LYS A  1 315 ? 32.370  20.267  25.793  1.00 8.64   ? 315 LYS A O   1 
ATOM   2428  C CB  . LYS A  1 315 ? 30.126  19.458  27.597  1.00 9.30   ? 315 LYS A CB  1 
ATOM   2429  C CG  . LYS A  1 315 ? 28.775  19.633  28.222  1.00 11.67  ? 315 LYS A CG  1 
ATOM   2430  C CD  . LYS A  1 315 ? 28.218  18.349  28.821  1.00 13.39  ? 315 LYS A CD  1 
ATOM   2431  C CE  . LYS A  1 315 ? 26.801  18.643  29.324  1.00 14.78  ? 315 LYS A CE  1 
ATOM   2432  N NZ  . LYS A  1 315 ? 26.749  19.719  30.315  1.00 16.69  ? 315 LYS A NZ  1 
ATOM   2433  N N   . LEU A  1 316 ? 32.942  21.290  27.712  1.00 4.71   ? 316 LEU A N   1 
ATOM   2434  C CA  . LEU A  1 316 ? 34.357  21.221  27.485  1.00 4.11   ? 316 LEU A CA  1 
ATOM   2435  C C   . LEU A  1 316 ? 34.881  20.037  28.281  1.00 5.23   ? 316 LEU A C   1 
ATOM   2436  O O   . LEU A  1 316 ? 34.704  19.984  29.503  1.00 6.51   ? 316 LEU A O   1 
ATOM   2437  C CB  . LEU A  1 316 ? 34.982  22.498  27.970  1.00 3.39   ? 316 LEU A CB  1 
ATOM   2438  C CG  . LEU A  1 316 ? 36.427  22.761  27.620  1.00 3.91   ? 316 LEU A CG  1 
ATOM   2439  C CD1 . LEU A  1 316 ? 36.579  23.063  26.128  1.00 2.96   ? 316 LEU A CD1 1 
ATOM   2440  C CD2 . LEU A  1 316 ? 36.898  23.963  28.402  1.00 3.14   ? 316 LEU A CD2 1 
ATOM   2441  N N   . ALA A  1 317 ? 35.463  19.019  27.641  1.00 5.59   ? 317 ALA A N   1 
ATOM   2442  C CA  . ALA A  1 317 ? 36.038  17.880  28.346  1.00 4.56   ? 317 ALA A CA  1 
ATOM   2443  C C   . ALA A  1 317 ? 37.207  18.373  29.155  1.00 3.87   ? 317 ALA A C   1 
ATOM   2444  O O   . ALA A  1 317 ? 38.055  19.127  28.667  1.00 3.71   ? 317 ALA A O   1 
ATOM   2445  C CB  . ALA A  1 317 ? 36.577  16.831  27.399  1.00 4.28   ? 317 ALA A CB  1 
ATOM   2446  N N   . THR A  1 318 ? 37.180  18.018  30.413  1.00 3.63   ? 318 THR A N   1 
ATOM   2447  C CA  . THR A  1 318 ? 38.254  18.333  31.324  1.00 3.78   ? 318 THR A CA  1 
ATOM   2448  C C   . THR A  1 318 ? 38.865  17.051  31.873  1.00 4.13   ? 318 THR A C   1 
ATOM   2449  O O   . THR A  1 318 ? 39.307  17.008  33.028  1.00 4.48   ? 318 THR A O   1 
ATOM   2450  C CB  . THR A  1 318 ? 37.703  19.201  32.467  1.00 3.54   ? 318 THR A CB  1 
ATOM   2451  O OG1 . THR A  1 318 ? 36.345  18.830  32.705  1.00 4.21   ? 318 THR A OG1 1 
ATOM   2452  C CG2 . THR A  1 318 ? 37.793  20.653  32.137  1.00 2.81   ? 318 THR A CG2 1 
ATOM   2453  N N   . GLY A  1 319 ? 38.858  15.975  31.083  1.00 4.12   ? 319 GLY A N   1 
ATOM   2454  C CA  . GLY A  1 319 ? 39.398  14.696  31.509  1.00 4.51   ? 319 GLY A CA  1 
ATOM   2455  C C   . GLY A  1 319 ? 39.587  13.807  30.301  1.00 4.59   ? 319 GLY A C   1 
ATOM   2456  O O   . GLY A  1 319 ? 39.115  14.154  29.223  1.00 4.73   ? 319 GLY A O   1 
ATOM   2457  N N   . MET A  1 320 ? 40.273  12.686  30.479  1.00 4.84   ? 320 MET A N   1 
ATOM   2458  C CA  . MET A  1 320 ? 40.535  11.744  29.397  1.00 5.33   ? 320 MET A CA  1 
ATOM   2459  C C   . MET A  1 320 ? 39.304  10.978  28.983  1.00 6.67   ? 320 MET A C   1 
ATOM   2460  O O   . MET A  1 320 ? 38.224  11.140  29.546  1.00 6.99   ? 320 MET A O   1 
ATOM   2461  C CB  . MET A  1 320 ? 41.547  10.704  29.807  1.00 4.84   ? 320 MET A CB  1 
ATOM   2462  C CG  . MET A  1 320 ? 41.110  9.807   30.959  1.00 3.86   ? 320 MET A CG  1 
ATOM   2463  S SD  . MET A  1 320 ? 42.361  8.545   31.245  1.00 2.78   ? 320 MET A SD  1 
ATOM   2464  C CE  . MET A  1 320 ? 43.515  9.528   32.138  1.00 3.15   ? 320 MET A CE  1 
ATOM   2465  N N   . ARG A  1 321 ? 39.474  10.095  28.019  1.00 8.44   ? 321 ARG A N   1 
ATOM   2466  C CA  . ARG A  1 321 ? 38.426  9.171   27.663  1.00 11.05  ? 321 ARG A CA  1 
ATOM   2467  C C   . ARG A  1 321 ? 38.031  8.288   28.838  1.00 13.23  ? 321 ARG A C   1 
ATOM   2468  O O   . ARG A  1 321 ? 38.865  7.857   29.647  1.00 14.58  ? 321 ARG A O   1 
ATOM   2469  C CB  . ARG A  1 321 ? 38.876  8.253   26.594  1.00 10.90  ? 321 ARG A CB  1 
ATOM   2470  C CG  . ARG A  1 321 ? 38.566  8.749   25.240  1.00 11.40  ? 321 ARG A CG  1 
ATOM   2471  C CD  . ARG A  1 321 ? 37.690  7.628   24.765  1.00 12.18  ? 321 ARG A CD  1 
ATOM   2472  N NE  . ARG A  1 321 ? 38.156  7.221   23.459  1.00 12.52  ? 321 ARG A NE  1 
ATOM   2473  C CZ  . ARG A  1 321 ? 37.573  6.237   22.795  1.00 13.05  ? 321 ARG A CZ  1 
ATOM   2474  N NH1 . ARG A  1 321 ? 38.084  5.956   21.600  1.00 13.85  ? 321 ARG A NH1 1 
ATOM   2475  N NH2 . ARG A  1 321 ? 36.515  5.589   23.309  1.00 13.66  ? 321 ARG A NH2 1 
ATOM   2476  N N   . ASN A  1 322 ? 36.760  7.980   28.940  1.00 14.91  ? 322 ASN A N   1 
ATOM   2477  C CA  . ASN A  1 322 ? 36.309  7.094   29.968  1.00 16.50  ? 322 ASN A CA  1 
ATOM   2478  C C   . ASN A  1 322 ? 36.205  5.720   29.350  1.00 17.59  ? 322 ASN A C   1 
ATOM   2479  O O   . ASN A  1 322 ? 35.397  5.567   28.448  1.00 18.39  ? 322 ASN A O   1 
ATOM   2480  C CB  . ASN A  1 322 ? 34.973  7.574   30.438  1.00 16.64  ? 322 ASN A CB  1 
ATOM   2481  C CG  . ASN A  1 322 ? 34.635  6.835   31.697  1.00 17.41  ? 322 ASN A CG  1 
ATOM   2482  O OD1 . ASN A  1 322 ? 35.516  6.652   32.550  1.00 16.93  ? 322 ASN A OD1 1 
ATOM   2483  N ND2 . ASN A  1 322 ? 33.402  6.385   31.839  1.00 18.23  ? 322 ASN A ND2 1 
ATOM   2484  N N   . VAL A  1 323 ? 37.056  4.746   29.664  1.00 18.95  ? 323 VAL A N   1 
ATOM   2485  C CA  . VAL A  1 323 ? 36.910  3.383   29.130  1.00 20.57  ? 323 VAL A CA  1 
ATOM   2486  C C   . VAL A  1 323 ? 36.731  2.470   30.358  1.00 24.11  ? 323 VAL A C   1 
ATOM   2487  O O   . VAL A  1 323 ? 37.711  1.877   30.811  1.00 22.85  ? 323 VAL A O   1 
ATOM   2488  C CB  . VAL A  1 323 ? 38.184  3.026   28.330  1.00 19.35  ? 323 VAL A CB  1 
ATOM   2489  C CG1 . VAL A  1 323 ? 37.918  1.797   27.525  1.00 19.03  ? 323 VAL A CG1 1 
ATOM   2490  C CG2 . VAL A  1 323 ? 38.575  4.112   27.356  1.00 18.76  ? 323 VAL A CG2 1 
ATOM   2491  N N   . PRO A  1 324 ? 35.526  2.327   30.967  1.00 28.20  ? 324 PRO A N   1 
ATOM   2492  C CA  . PRO A  1 324 ? 35.259  1.540   32.186  1.00 31.65  ? 324 PRO A CA  1 
ATOM   2493  C C   . PRO A  1 324 ? 35.480  0.049   32.081  1.00 36.73  ? 324 PRO A C   1 
ATOM   2494  O O   . PRO A  1 324 ? 35.393  -0.455  30.960  1.00 36.62  ? 324 PRO A O   1 
ATOM   2495  C CB  . PRO A  1 324 ? 33.843  1.908   32.520  1.00 29.85  ? 324 PRO A CB  1 
ATOM   2496  C CG  . PRO A  1 324 ? 33.242  1.915   31.145  1.00 28.78  ? 324 PRO A CG  1 
ATOM   2497  C CD  . PRO A  1 324 ? 34.254  2.724   30.374  1.00 28.28  ? 324 PRO A CD  1 
ATOM   2498  N N   . GLU A  1 325 ? 35.820  -0.652  33.180  1.00 44.77  ? 325 GLU A N   1 
ATOM   2499  C CA  . GLU A  1 325 ? 36.006  -2.096  33.055  1.00 52.92  ? 325 GLU A CA  1 
ATOM   2500  C C   . GLU A  1 325 ? 34.645  -2.743  33.270  1.00 58.59  ? 325 GLU A C   1 
ATOM   2501  O O   . GLU A  1 325 ? 34.246  -3.663  32.551  1.00 58.92  ? 325 GLU A O   1 
ATOM   2502  C CB  . GLU A  1 325 ? 36.913  -2.763  34.102  1.00 53.15  ? 325 GLU A CB  1 
ATOM   2503  C CG  . GLU A  1 325 ? 37.945  -1.952  34.874  1.00 53.69  ? 325 GLU A CG  1 
ATOM   2504  C CD  . GLU A  1 325 ? 37.616  -1.617  36.322  1.00 54.10  ? 325 GLU A CD  1 
ATOM   2505  O OE1 . GLU A  1 325 ? 36.435  -1.458  36.627  1.00 53.81  ? 325 GLU A OE1 1 
ATOM   2506  O OE2 . GLU A  1 325 ? 38.534  -1.493  37.165  1.00 54.30  ? 325 GLU A OE2 1 
ATOM   2507  N N   . LYS A  1 326 ? 34.011  -2.306  34.355  1.00 65.59  ? 326 LYS A N   1 
ATOM   2508  C CA  . LYS A  1 326 ? 32.682  -2.750  34.741  1.00 71.93  ? 326 LYS A CA  1 
ATOM   2509  C C   . LYS A  1 326 ? 31.712  -1.696  34.212  1.00 74.92  ? 326 LYS A C   1 
ATOM   2510  O O   . LYS A  1 326 ? 31.629  -1.508  32.990  1.00 74.65  ? 326 LYS A O   1 
ATOM   2511  C CB  . LYS A  1 326 ? 32.662  -2.889  36.283  1.00 73.46  ? 326 LYS A CB  1 
ATOM   2512  C CG  . LYS A  1 326 ? 33.579  -4.003  36.797  1.00 75.66  ? 326 LYS A CG  1 
ATOM   2513  C CD  . LYS A  1 326 ? 34.032  -3.720  38.235  1.00 77.13  ? 326 LYS A CD  1 
ATOM   2514  C CE  . LYS A  1 326 ? 35.073  -4.731  38.752  1.00 77.75  ? 326 LYS A CE  1 
ATOM   2515  N NZ  . LYS A  1 326 ? 34.492  -6.046  39.000  1.00 77.80  ? 326 LYS A NZ  1 
ATOM   2516  N N   . GLN A  1 327 ? 30.957  -1.021  35.076  1.00 79.15  ? 327 GLN A N   1 
ATOM   2517  C CA  . GLN A  1 327 ? 30.080  0.057   34.644  1.00 83.03  ? 327 GLN A CA  1 
ATOM   2518  C C   . GLN A  1 327 ? 29.998  1.057   35.767  1.00 84.40  ? 327 GLN A C   1 
ATOM   2519  O O   . GLN A  1 327 ? 30.112  2.256   35.535  1.00 84.07  ? 327 GLN A O   1 
ATOM   2520  C CB  . GLN A  1 327 ? 28.632  -0.403  34.324  1.00 84.51  ? 327 GLN A CB  1 
ATOM   2521  C CG  . GLN A  1 327 ? 27.651  0.764   34.015  1.00 86.23  ? 327 GLN A CG  1 
ATOM   2522  C CD  . GLN A  1 327 ? 28.084  1.719   32.893  1.00 87.23  ? 327 GLN A CD  1 
ATOM   2523  O OE1 . GLN A  1 327 ? 27.742  1.512   31.725  1.00 88.01  ? 327 GLN A OE1 1 
ATOM   2524  N NE2 . GLN A  1 327 ? 28.824  2.793   33.146  1.00 87.48  ? 327 GLN A NE2 1 
ATOM   2525  N N   . THR A  1 328 ? 29.750  0.524   36.947  1.00 86.38  ? 328 THR A N   1 
ATOM   2526  C CA  . THR A  1 328 ? 29.493  1.292   38.141  1.00 88.31  ? 328 THR A CA  1 
ATOM   2527  C C   . THR A  1 328 ? 29.994  0.453   39.329  1.00 88.80  ? 328 THR A C   1 
ATOM   2528  O O   . THR A  1 328 ? 30.290  1.037   40.377  1.00 88.91  ? 328 THR A O   1 
ATOM   2529  C CB  . THR A  1 328 ? 27.935  1.597   38.214  1.00 88.77  ? 328 THR A CB  1 
ATOM   2530  O OG1 . THR A  1 328 ? 27.351  0.608   37.359  1.00 89.14  ? 328 THR A OG1 1 
ATOM   2531  C CG2 . THR A  1 328 ? 27.515  3.039   37.887  1.00 88.72  ? 328 THR A CG2 1 
ATOM   2532  O OXT . THR A  1 328 ? 30.110  -0.777  39.174  1.00 89.27  ? 328 THR A OXT 1 
ATOM   2533  N N   . GLY B  2 1   ? 42.401  7.815   19.515  1.00 21.64  ? 1   GLY B N   1 
ATOM   2534  C CA  . GLY B  2 1   ? 43.472  8.620   20.075  1.00 20.90  ? 1   GLY B CA  1 
ATOM   2535  C C   . GLY B  2 1   ? 44.688  8.421   19.169  1.00 20.15  ? 1   GLY B C   1 
ATOM   2536  O O   . GLY B  2 1   ? 44.933  7.279   18.738  1.00 20.67  ? 1   GLY B O   1 
ATOM   2537  N N   . LEU B  2 2   ? 45.397  9.503   18.844  1.00 18.61  ? 2   LEU B N   1 
ATOM   2538  C CA  . LEU B  2 2   ? 46.560  9.447   17.981  1.00 16.37  ? 2   LEU B CA  1 
ATOM   2539  C C   . LEU B  2 2   ? 47.584  8.437   18.476  1.00 14.78  ? 2   LEU B C   1 
ATOM   2540  O O   . LEU B  2 2   ? 48.190  7.752   17.663  1.00 14.71  ? 2   LEU B O   1 
ATOM   2541  C CB  . LEU B  2 2   ? 47.259  10.806  17.888  1.00 16.18  ? 2   LEU B CB  1 
ATOM   2542  C CG  . LEU B  2 2   ? 46.606  12.027  17.274  1.00 15.76  ? 2   LEU B CG  1 
ATOM   2543  C CD1 . LEU B  2 2   ? 47.665  13.102  17.180  1.00 15.63  ? 2   LEU B CD1 1 
ATOM   2544  C CD2 . LEU B  2 2   ? 46.100  11.770  15.879  1.00 15.46  ? 2   LEU B CD2 1 
ATOM   2545  N N   . PHE B  2 3   ? 47.743  8.274   19.780  1.00 13.05  ? 3   PHE B N   1 
ATOM   2546  C CA  . PHE B  2 3   ? 48.805  7.418   20.196  1.00 13.94  ? 3   PHE B CA  1 
ATOM   2547  C C   . PHE B  2 3   ? 48.403  5.975   20.421  1.00 15.14  ? 3   PHE B C   1 
ATOM   2548  O O   . PHE B  2 3   ? 49.277  5.115   20.526  1.00 17.15  ? 3   PHE B O   1 
ATOM   2549  C CB  . PHE B  2 3   ? 49.429  8.030   21.432  1.00 13.88  ? 3   PHE B CB  1 
ATOM   2550  C CG  . PHE B  2 3   ? 50.026  9.388   21.108  1.00 13.49  ? 3   PHE B CG  1 
ATOM   2551  C CD1 . PHE B  2 3   ? 49.281  10.521  21.335  1.00 13.94  ? 3   PHE B CD1 1 
ATOM   2552  C CD2 . PHE B  2 3   ? 51.275  9.467   20.545  1.00 13.40  ? 3   PHE B CD2 1 
ATOM   2553  C CE1 . PHE B  2 3   ? 49.794  11.747  20.984  1.00 14.62  ? 3   PHE B CE1 1 
ATOM   2554  C CE2 . PHE B  2 3   ? 51.790  10.688  20.190  1.00 13.80  ? 3   PHE B CE2 1 
ATOM   2555  C CZ  . PHE B  2 3   ? 51.047  11.828  20.409  1.00 14.86  ? 3   PHE B CZ  1 
ATOM   2556  N N   . GLY B  2 4   ? 47.125  5.636   20.488  1.00 14.53  ? 4   GLY B N   1 
ATOM   2557  C CA  . GLY B  2 4   ? 46.766  4.217   20.589  1.00 14.19  ? 4   GLY B CA  1 
ATOM   2558  C C   . GLY B  2 4   ? 47.022  3.487   21.918  1.00 13.71  ? 4   GLY B C   1 
ATOM   2559  O O   . GLY B  2 4   ? 46.970  2.258   21.976  1.00 13.04  ? 4   GLY B O   1 
ATOM   2560  N N   . ALA B  2 5   ? 47.289  4.212   23.007  1.00 13.85  ? 5   ALA B N   1 
ATOM   2561  C CA  . ALA B  2 5   ? 47.418  3.606   24.325  1.00 13.37  ? 5   ALA B CA  1 
ATOM   2562  C C   . ALA B  2 5   ? 46.054  3.467   24.985  1.00 13.22  ? 5   ALA B C   1 
ATOM   2563  O O   . ALA B  2 5   ? 45.570  2.340   25.071  1.00 12.78  ? 5   ALA B O   1 
ATOM   2564  C CB  . ALA B  2 5   ? 48.318  4.466   25.183  1.00 13.37  ? 5   ALA B CB  1 
ATOM   2565  N N   . ILE B  2 6   ? 45.398  4.574   25.391  1.00 13.34  ? 6   ILE B N   1 
ATOM   2566  C CA  . ILE B  2 6   ? 44.061  4.565   26.018  1.00 12.11  ? 6   ILE B CA  1 
ATOM   2567  C C   . ILE B  2 6   ? 43.096  4.061   24.975  1.00 12.71  ? 6   ILE B C   1 
ATOM   2568  O O   . ILE B  2 6   ? 43.214  4.422   23.802  1.00 13.74  ? 6   ILE B O   1 
ATOM   2569  C CB  . ILE B  2 6   ? 43.640  6.002   26.453  1.00 10.08  ? 6   ILE B CB  1 
ATOM   2570  C CG1 . ILE B  2 6   ? 44.446  6.433   27.661  1.00 10.33  ? 6   ILE B CG1 1 
ATOM   2571  C CG2 . ILE B  2 6   ? 42.186  6.044   26.835  1.00 10.11  ? 6   ILE B CG2 1 
ATOM   2572  C CD1 . ILE B  2 6   ? 44.349  7.929   28.010  1.00 10.57  ? 6   ILE B CD1 1 
ATOM   2573  N N   . ALA B  2 7   ? 42.186  3.197   25.367  1.00 13.31  ? 7   ALA B N   1 
ATOM   2574  C CA  . ALA B  2 7   ? 41.250  2.584   24.431  1.00 14.31  ? 7   ALA B CA  1 
ATOM   2575  C C   . ALA B  2 7   ? 42.001  1.873   23.312  1.00 14.99  ? 7   ALA B C   1 
ATOM   2576  O O   . ALA B  2 7   ? 41.425  1.585   22.263  1.00 16.61  ? 7   ALA B O   1 
ATOM   2577  C CB  . ALA B  2 7   ? 40.315  3.623   23.787  1.00 13.54  ? 7   ALA B CB  1 
ATOM   2578  N N   . GLY B  2 8   ? 43.271  1.552   23.569  1.00 14.93  ? 8   GLY B N   1 
ATOM   2579  C CA  . GLY B  2 8   ? 44.124  0.957   22.573  1.00 14.32  ? 8   GLY B CA  1 
ATOM   2580  C C   . GLY B  2 8   ? 44.780  -0.230  23.232  1.00 14.25  ? 8   GLY B C   1 
ATOM   2581  O O   . GLY B  2 8   ? 44.079  -1.084  23.782  1.00 12.70  ? 8   GLY B O   1 
ATOM   2582  N N   . PHE B  2 9   ? 46.133  -0.233  23.261  1.00 14.32  ? 9   PHE B N   1 
ATOM   2583  C CA  . PHE B  2 9   ? 46.809  -1.377  23.848  1.00 14.30  ? 9   PHE B CA  1 
ATOM   2584  C C   . PHE B  2 9   ? 46.498  -1.498  25.303  1.00 15.10  ? 9   PHE B C   1 
ATOM   2585  O O   . PHE B  2 9   ? 46.588  -2.593  25.845  1.00 17.31  ? 9   PHE B O   1 
ATOM   2586  C CB  . PHE B  2 9   ? 48.340  -1.357  23.720  1.00 13.81  ? 9   PHE B CB  1 
ATOM   2587  C CG  . PHE B  2 9   ? 49.166  -0.211  24.254  1.00 13.74  ? 9   PHE B CG  1 
ATOM   2588  C CD1 . PHE B  2 9   ? 49.702  -0.282  25.506  1.00 13.81  ? 9   PHE B CD1 1 
ATOM   2589  C CD2 . PHE B  2 9   ? 49.419  0.881   23.459  1.00 13.57  ? 9   PHE B CD2 1 
ATOM   2590  C CE1 . PHE B  2 9   ? 50.493  0.746   25.974  1.00 13.74  ? 9   PHE B CE1 1 
ATOM   2591  C CE2 . PHE B  2 9   ? 50.206  1.898   23.929  1.00 13.25  ? 9   PHE B CE2 1 
ATOM   2592  C CZ  . PHE B  2 9   ? 50.750  1.838   25.186  1.00 13.41  ? 9   PHE B CZ  1 
ATOM   2593  N N   . ILE B  2 10  ? 46.144  -0.407  25.969  1.00 15.12  ? 10  ILE B N   1 
ATOM   2594  C CA  . ILE B  2 10  ? 45.660  -0.513  27.333  1.00 13.98  ? 10  ILE B CA  1 
ATOM   2595  C C   . ILE B  2 10  ? 44.147  -0.640  27.206  1.00 14.96  ? 10  ILE B C   1 
ATOM   2596  O O   . ILE B  2 10  ? 43.425  0.351   27.137  1.00 14.13  ? 10  ILE B O   1 
ATOM   2597  C CB  . ILE B  2 10  ? 46.145  0.733   28.061  1.00 12.54  ? 10  ILE B CB  1 
ATOM   2598  C CG1 . ILE B  2 10  ? 47.626  0.561   28.239  1.00 12.01  ? 10  ILE B CG1 1 
ATOM   2599  C CG2 . ILE B  2 10  ? 45.457  0.945   29.373  1.00 12.12  ? 10  ILE B CG2 1 
ATOM   2600  C CD1 . ILE B  2 10  ? 48.316  1.763   28.848  1.00 12.93  ? 10  ILE B CD1 1 
ATOM   2601  N N   . GLU B  2 11  ? 43.727  -1.890  27.078  1.00 17.59  ? 11  GLU B N   1 
ATOM   2602  C CA  . GLU B  2 11  ? 42.350  -2.297  26.875  1.00 21.30  ? 11  GLU B CA  1 
ATOM   2603  C C   . GLU B  2 11  ? 41.280  -1.436  27.531  1.00 21.13  ? 11  GLU B C   1 
ATOM   2604  O O   . GLU B  2 11  ? 40.386  -0.902  26.870  1.00 22.21  ? 11  GLU B O   1 
ATOM   2605  C CB  . GLU B  2 11  ? 42.222  -3.748  27.325  1.00 25.16  ? 11  GLU B CB  1 
ATOM   2606  C CG  . GLU B  2 11  ? 40.828  -4.323  27.045  1.00 30.73  ? 11  GLU B CG  1 
ATOM   2607  C CD  . GLU B  2 11  ? 40.692  -5.855  26.898  1.00 34.49  ? 11  GLU B CD  1 
ATOM   2608  O OE1 . GLU B  2 11  ? 39.916  -6.310  26.017  1.00 35.42  ? 11  GLU B OE1 1 
ATOM   2609  O OE2 . GLU B  2 11  ? 41.363  -6.601  27.653  1.00 36.50  ? 11  GLU B OE2 1 
ATOM   2610  N N   . ASN B  2 12  ? 41.369  -1.184  28.818  1.00 20.56  ? 12  ASN B N   1 
ATOM   2611  C CA  . ASN B  2 12  ? 40.362  -0.363  29.477  1.00 19.72  ? 12  ASN B CA  1 
ATOM   2612  C C   . ASN B  2 12  ? 40.962  0.297   30.684  1.00 18.06  ? 12  ASN B C   1 
ATOM   2613  O O   . ASN B  2 12  ? 42.165  0.188   30.940  1.00 17.84  ? 12  ASN B O   1 
ATOM   2614  C CB  . ASN B  2 12  ? 39.181  -1.201  29.889  1.00 21.10  ? 12  ASN B CB  1 
ATOM   2615  C CG  . ASN B  2 12  ? 39.657  -2.308  30.778  1.00 23.21  ? 12  ASN B CG  1 
ATOM   2616  O OD1 . ASN B  2 12  ? 40.245  -3.282  30.298  1.00 24.66  ? 12  ASN B OD1 1 
ATOM   2617  N ND2 . ASN B  2 12  ? 39.504  -2.143  32.084  1.00 23.80  ? 12  ASN B ND2 1 
ATOM   2618  N N   . GLY B  2 13  ? 40.145  1.040   31.387  1.00 16.53  ? 13  GLY B N   1 
ATOM   2619  C CA  . GLY B  2 13  ? 40.625  1.851   32.473  1.00 16.45  ? 13  GLY B CA  1 
ATOM   2620  C C   . GLY B  2 13  ? 40.391  1.110   33.754  1.00 16.84  ? 13  GLY B C   1 
ATOM   2621  O O   . GLY B  2 13  ? 39.794  0.039   33.724  1.00 17.37  ? 13  GLY B O   1 
ATOM   2622  N N   . TRP B  2 14  ? 40.848  1.644   34.874  1.00 16.60  ? 14  TRP B N   1 
ATOM   2623  C CA  . TRP B  2 14  ? 40.655  0.994   36.140  1.00 16.43  ? 14  TRP B CA  1 
ATOM   2624  C C   . TRP B  2 14  ? 39.715  1.883   36.920  1.00 18.32  ? 14  TRP B C   1 
ATOM   2625  O O   . TRP B  2 14  ? 40.106  2.991   37.289  1.00 16.95  ? 14  TRP B O   1 
ATOM   2626  C CB  . TRP B  2 14  ? 41.989  0.856   36.897  1.00 14.65  ? 14  TRP B CB  1 
ATOM   2627  C CG  . TRP B  2 14  ? 43.083  0.015   36.251  1.00 12.90  ? 14  TRP B CG  1 
ATOM   2628  C CD1 . TRP B  2 14  ? 42.777  -0.970  35.364  1.00 12.41  ? 14  TRP B CD1 1 
ATOM   2629  C CD2 . TRP B  2 14  ? 44.433  0.158   36.431  1.00 12.25  ? 14  TRP B CD2 1 
ATOM   2630  N NE1 . TRP B  2 14  ? 43.924  -1.443  34.978  1.00 12.18  ? 14  TRP B NE1 1 
ATOM   2631  C CE2 . TRP B  2 14  ? 44.925  -0.812  35.588  1.00 11.95  ? 14  TRP B CE2 1 
ATOM   2632  C CE3 . TRP B  2 14  ? 45.310  0.926   37.158  1.00 12.17  ? 14  TRP B CE3 1 
ATOM   2633  C CZ2 . TRP B  2 14  ? 46.276  -1.029  35.427  1.00 12.01  ? 14  TRP B CZ2 1 
ATOM   2634  C CZ3 . TRP B  2 14  ? 46.674  0.714   37.012  1.00 12.02  ? 14  TRP B CZ3 1 
ATOM   2635  C CH2 . TRP B  2 14  ? 47.158  -0.253  36.153  1.00 11.95  ? 14  TRP B CH2 1 
ATOM   2636  N N   . GLU B  2 15  ? 38.484  1.450   37.186  1.00 21.99  ? 15  GLU B N   1 
ATOM   2637  C CA  . GLU B  2 15  ? 37.552  2.239   37.988  1.00 25.36  ? 15  GLU B CA  1 
ATOM   2638  C C   . GLU B  2 15  ? 38.057  2.310   39.414  1.00 26.32  ? 15  GLU B C   1 
ATOM   2639  O O   . GLU B  2 15  ? 37.747  3.206   40.197  1.00 26.21  ? 15  GLU B O   1 
ATOM   2640  C CB  . GLU B  2 15  ? 36.148  1.617   37.994  1.00 27.53  ? 15  GLU B CB  1 
ATOM   2641  C CG  . GLU B  2 15  ? 35.473  1.656   36.606  1.00 30.56  ? 15  GLU B CG  1 
ATOM   2642  C CD  . GLU B  2 15  ? 34.085  1.015   36.487  1.00 32.02  ? 15  GLU B CD  1 
ATOM   2643  O OE1 . GLU B  2 15  ? 33.193  1.349   37.276  1.00 32.32  ? 15  GLU B OE1 1 
ATOM   2644  O OE2 . GLU B  2 15  ? 33.902  0.205   35.566  1.00 32.63  ? 15  GLU B OE2 1 
ATOM   2645  N N   . GLY B  2 16  ? 38.887  1.331   39.765  1.00 27.92  ? 16  GLY B N   1 
ATOM   2646  C CA  . GLY B  2 16  ? 39.462  1.259   41.094  1.00 29.29  ? 16  GLY B CA  1 
ATOM   2647  C C   . GLY B  2 16  ? 40.552  2.290   41.381  1.00 29.87  ? 16  GLY B C   1 
ATOM   2648  O O   . GLY B  2 16  ? 40.895  2.503   42.551  1.00 30.28  ? 16  GLY B O   1 
ATOM   2649  N N   . MET B  2 17  ? 41.145  2.944   40.379  1.00 29.69  ? 17  MET B N   1 
ATOM   2650  C CA  . MET B  2 17  ? 42.266  3.789   40.709  1.00 29.54  ? 17  MET B CA  1 
ATOM   2651  C C   . MET B  2 17  ? 41.702  5.128   41.070  1.00 30.35  ? 17  MET B C   1 
ATOM   2652  O O   . MET B  2 17  ? 41.533  6.012   40.242  1.00 31.33  ? 17  MET B O   1 
ATOM   2653  C CB  . MET B  2 17  ? 43.196  3.876   39.535  1.00 28.92  ? 17  MET B CB  1 
ATOM   2654  C CG  . MET B  2 17  ? 44.347  4.727   39.970  1.00 28.69  ? 17  MET B CG  1 
ATOM   2655  S SD  . MET B  2 17  ? 45.635  4.620   38.741  1.00 30.23  ? 17  MET B SD  1 
ATOM   2656  C CE  . MET B  2 17  ? 46.596  3.381   39.582  1.00 29.41  ? 17  MET B CE  1 
ATOM   2657  N N   . ILE B  2 18  ? 41.386  5.281   42.337  1.00 31.42  ? 18  ILE B N   1 
ATOM   2658  C CA  . ILE B  2 18  ? 40.755  6.509   42.808  1.00 31.84  ? 18  ILE B CA  1 
ATOM   2659  C C   . ILE B  2 18  ? 41.731  7.603   43.200  1.00 31.04  ? 18  ILE B C   1 
ATOM   2660  O O   . ILE B  2 18  ? 41.275  8.664   43.599  1.00 30.44  ? 18  ILE B O   1 
ATOM   2661  C CB  . ILE B  2 18  ? 39.861  6.200   44.015  1.00 32.74  ? 18  ILE B CB  1 
ATOM   2662  C CG1 . ILE B  2 18  ? 40.726  5.603   45.141  1.00 34.07  ? 18  ILE B CG1 1 
ATOM   2663  C CG2 . ILE B  2 18  ? 38.762  5.227   43.602  1.00 32.82  ? 18  ILE B CG2 1 
ATOM   2664  C CD1 . ILE B  2 18  ? 40.071  5.679   46.524  1.00 35.24  ? 18  ILE B CD1 1 
ATOM   2665  N N   . ASP B  2 19  ? 43.038  7.387   43.107  1.00 31.39  ? 19  ASP B N   1 
ATOM   2666  C CA  . ASP B  2 19  ? 44.033  8.326   43.620  1.00 31.78  ? 19  ASP B CA  1 
ATOM   2667  C C   . ASP B  2 19  ? 44.944  8.998   42.587  1.00 30.25  ? 19  ASP B C   1 
ATOM   2668  O O   . ASP B  2 19  ? 45.899  9.706   42.934  1.00 29.68  ? 19  ASP B O   1 
ATOM   2669  C CB  . ASP B  2 19  ? 44.882  7.590   44.653  1.00 34.32  ? 19  ASP B CB  1 
ATOM   2670  C CG  . ASP B  2 19  ? 45.625  6.369   44.107  1.00 37.13  ? 19  ASP B CG  1 
ATOM   2671  O OD1 . ASP B  2 19  ? 46.817  6.219   44.409  1.00 38.51  ? 19  ASP B OD1 1 
ATOM   2672  O OD2 . ASP B  2 19  ? 45.019  5.552   43.383  1.00 38.50  ? 19  ASP B OD2 1 
ATOM   2673  N N   . GLY B  2 20  ? 44.662  8.864   41.288  1.00 28.16  ? 20  GLY B N   1 
ATOM   2674  C CA  . GLY B  2 20  ? 45.445  9.536   40.260  1.00 24.25  ? 20  GLY B CA  1 
ATOM   2675  C C   . GLY B  2 20  ? 44.827  9.236   38.908  1.00 22.25  ? 20  GLY B C   1 
ATOM   2676  O O   . GLY B  2 20  ? 43.807  8.527   38.820  1.00 23.24  ? 20  GLY B O   1 
ATOM   2677  N N   . TRP B  2 21  ? 45.378  9.771   37.822  1.00 18.55  ? 21  TRP B N   1 
ATOM   2678  C CA  . TRP B  2 21  ? 44.787  9.491   36.526  1.00 15.13  ? 21  TRP B CA  1 
ATOM   2679  C C   . TRP B  2 21  ? 45.505  8.371   35.818  1.00 13.64  ? 21  TRP B C   1 
ATOM   2680  O O   . TRP B  2 21  ? 44.880  7.655   35.039  1.00 13.97  ? 21  TRP B O   1 
ATOM   2681  C CB  . TRP B  2 21  ? 44.828  10.688  35.616  1.00 14.54  ? 21  TRP B CB  1 
ATOM   2682  C CG  . TRP B  2 21  ? 43.953  11.861  36.002  1.00 14.39  ? 21  TRP B CG  1 
ATOM   2683  C CD1 . TRP B  2 21  ? 43.315  11.957  37.206  1.00 14.56  ? 21  TRP B CD1 1 
ATOM   2684  C CD2 . TRP B  2 21  ? 43.676  12.917  35.184  1.00 14.52  ? 21  TRP B CD2 1 
ATOM   2685  N NE1 . TRP B  2 21  ? 42.637  13.066  37.149  1.00 14.19  ? 21  TRP B NE1 1 
ATOM   2686  C CE2 . TRP B  2 21  ? 42.827  13.664  35.975  1.00 14.13  ? 21  TRP B CE2 1 
ATOM   2687  C CE3 . TRP B  2 21  ? 44.026  13.354  33.919  1.00 14.49  ? 21  TRP B CE3 1 
ATOM   2688  C CZ2 . TRP B  2 21  ? 42.283  14.841  35.517  1.00 14.00  ? 21  TRP B CZ2 1 
ATOM   2689  C CZ3 . TRP B  2 21  ? 43.485  14.540  33.456  1.00 14.00  ? 21  TRP B CZ3 1 
ATOM   2690  C CH2 . TRP B  2 21  ? 42.629  15.279  34.249  1.00 13.87  ? 21  TRP B CH2 1 
ATOM   2691  N N   . TYR B  2 22  ? 46.793  8.223   36.052  1.00 11.64  ? 22  TYR B N   1 
ATOM   2692  C CA  . TYR B  2 22  ? 47.592  7.198   35.420  1.00 10.14  ? 22  TYR B CA  1 
ATOM   2693  C C   . TYR B  2 22  ? 48.290  6.451   36.547  1.00 10.64  ? 22  TYR B C   1 
ATOM   2694  O O   . TYR B  2 22  ? 48.434  7.011   37.647  1.00 10.93  ? 22  TYR B O   1 
ATOM   2695  C CB  . TYR B  2 22  ? 48.624  7.838   34.511  1.00 8.23   ? 22  TYR B CB  1 
ATOM   2696  C CG  . TYR B  2 22  ? 48.045  8.837   33.510  1.00 6.22   ? 22  TYR B CG  1 
ATOM   2697  C CD1 . TYR B  2 22  ? 47.388  8.405   32.364  1.00 5.54   ? 22  TYR B CD1 1 
ATOM   2698  C CD2 . TYR B  2 22  ? 48.188  10.183  33.760  1.00 4.99   ? 22  TYR B CD2 1 
ATOM   2699  C CE1 . TYR B  2 22  ? 46.876  9.316   31.468  1.00 4.35   ? 22  TYR B CE1 1 
ATOM   2700  C CE2 . TYR B  2 22  ? 47.683  11.096  32.873  1.00 3.97   ? 22  TYR B CE2 1 
ATOM   2701  C CZ  . TYR B  2 22  ? 47.032  10.653  31.745  1.00 4.19   ? 22  TYR B CZ  1 
ATOM   2702  O OH  . TYR B  2 22  ? 46.493  11.577  30.888  1.00 4.11   ? 22  TYR B OH  1 
ATOM   2703  N N   . GLY B  2 23  ? 48.691  5.197   36.373  1.00 10.53  ? 23  GLY B N   1 
ATOM   2704  C CA  . GLY B  2 23  ? 49.332  4.504   37.476  1.00 11.33  ? 23  GLY B CA  1 
ATOM   2705  C C   . GLY B  2 23  ? 49.788  3.107   37.136  1.00 12.58  ? 23  GLY B C   1 
ATOM   2706  O O   . GLY B  2 23  ? 49.723  2.675   35.964  1.00 14.35  ? 23  GLY B O   1 
ATOM   2707  N N   . PHE B  2 24  ? 50.245  2.427   38.190  1.00 11.81  ? 24  PHE B N   1 
ATOM   2708  C CA  . PHE B  2 24  ? 50.829  1.107   38.093  1.00 12.52  ? 24  PHE B CA  1 
ATOM   2709  C C   . PHE B  2 24  ? 50.102  0.055   38.906  1.00 14.52  ? 24  PHE B C   1 
ATOM   2710  O O   . PHE B  2 24  ? 49.618  0.349   39.988  1.00 15.00  ? 24  PHE B O   1 
ATOM   2711  C CB  . PHE B  2 24  ? 52.217  1.110   38.608  1.00 10.32  ? 24  PHE B CB  1 
ATOM   2712  C CG  . PHE B  2 24  ? 53.135  2.075   37.923  1.00 8.53   ? 24  PHE B CG  1 
ATOM   2713  C CD1 . PHE B  2 24  ? 53.289  3.314   38.468  1.00 7.73   ? 24  PHE B CD1 1 
ATOM   2714  C CD2 . PHE B  2 24  ? 53.812  1.696   36.784  1.00 8.77   ? 24  PHE B CD2 1 
ATOM   2715  C CE1 . PHE B  2 24  ? 54.173  4.192   37.884  1.00 8.17   ? 24  PHE B CE1 1 
ATOM   2716  C CE2 . PHE B  2 24  ? 54.694  2.573   36.205  1.00 8.94   ? 24  PHE B CE2 1 
ATOM   2717  C CZ  . PHE B  2 24  ? 54.865  3.827   36.752  1.00 8.55   ? 24  PHE B CZ  1 
ATOM   2718  N N   . ARG B  2 25  ? 50.000  -1.177  38.451  1.00 18.04  ? 25  ARG B N   1 
ATOM   2719  C CA  . ARG B  2 25  ? 49.543  -2.294  39.263  1.00 20.80  ? 25  ARG B CA  1 
ATOM   2720  C C   . ARG B  2 25  ? 50.656  -3.332  39.123  1.00 23.25  ? 25  ARG B C   1 
ATOM   2721  O O   . ARG B  2 25  ? 51.330  -3.346  38.081  1.00 24.48  ? 25  ARG B O   1 
ATOM   2722  C CB  . ARG B  2 25  ? 48.276  -2.917  38.735  1.00 20.87  ? 25  ARG B CB  1 
ATOM   2723  C CG  . ARG B  2 25  ? 47.007  -2.192  39.055  1.00 21.71  ? 25  ARG B CG  1 
ATOM   2724  C CD  . ARG B  2 25  ? 45.784  -2.993  38.589  1.00 23.04  ? 25  ARG B CD  1 
ATOM   2725  N NE  . ARG B  2 25  ? 44.619  -2.309  39.116  1.00 24.06  ? 25  ARG B NE  1 
ATOM   2726  C CZ  . ARG B  2 25  ? 43.340  -2.573  38.816  1.00 24.81  ? 25  ARG B CZ  1 
ATOM   2727  N NH1 . ARG B  2 25  ? 42.430  -1.808  39.434  1.00 25.75  ? 25  ARG B NH1 1 
ATOM   2728  N NH2 . ARG B  2 25  ? 42.960  -3.532  37.955  1.00 24.71  ? 25  ARG B NH2 1 
ATOM   2729  N N   . HIS B  2 26  ? 50.900  -4.225  40.071  1.00 25.23  ? 26  HIS B N   1 
ATOM   2730  C CA  . HIS B  2 26  ? 51.964  -5.203  39.896  1.00 28.01  ? 26  HIS B CA  1 
ATOM   2731  C C   . HIS B  2 26  ? 51.572  -6.499  40.576  1.00 29.09  ? 26  HIS B C   1 
ATOM   2732  O O   . HIS B  2 26  ? 50.913  -6.453  41.611  1.00 28.68  ? 26  HIS B O   1 
ATOM   2733  C CB  . HIS B  2 26  ? 53.300  -4.714  40.513  1.00 29.90  ? 26  HIS B CB  1 
ATOM   2734  C CG  . HIS B  2 26  ? 53.205  -4.571  42.028  1.00 31.88  ? 26  HIS B CG  1 
ATOM   2735  N ND1 . HIS B  2 26  ? 52.669  -3.494  42.630  1.00 32.54  ? 26  HIS B ND1 1 
ATOM   2736  C CD2 . HIS B  2 26  ? 53.500  -5.493  42.970  1.00 32.45  ? 26  HIS B CD2 1 
ATOM   2737  C CE1 . HIS B  2 26  ? 52.630  -3.800  43.907  1.00 32.88  ? 26  HIS B CE1 1 
ATOM   2738  N NE2 . HIS B  2 26  ? 53.123  -4.990  44.120  1.00 33.18  ? 26  HIS B NE2 1 
ATOM   2739  N N   . GLN B  2 27  ? 51.956  -7.633  40.016  1.00 31.17  ? 27  GLN B N   1 
ATOM   2740  C CA  . GLN B  2 27  ? 51.794  -8.943  40.639  1.00 33.25  ? 27  GLN B CA  1 
ATOM   2741  C C   . GLN B  2 27  ? 53.246  -9.139  41.037  1.00 34.07  ? 27  GLN B C   1 
ATOM   2742  O O   . GLN B  2 27  ? 54.125  -8.937  40.188  1.00 34.35  ? 27  GLN B O   1 
ATOM   2743  C CB  . GLN B  2 27  ? 51.378  -9.998  39.615  1.00 34.75  ? 27  GLN B CB  1 
ATOM   2744  C CG  . GLN B  2 27  ? 50.927  -11.408 40.055  1.00 37.01  ? 27  GLN B CG  1 
ATOM   2745  C CD  . GLN B  2 27  ? 49.444  -11.579 40.447  1.00 38.38  ? 27  GLN B CD  1 
ATOM   2746  O OE1 . GLN B  2 27  ? 49.011  -12.536 41.116  1.00 38.45  ? 27  GLN B OE1 1 
ATOM   2747  N NE2 . GLN B  2 27  ? 48.570  -10.680 40.021  1.00 39.08  ? 27  GLN B NE2 1 
ATOM   2748  N N   . ASN B  2 28  ? 53.574  -9.439  42.289  1.00 35.27  ? 28  ASN B N   1 
ATOM   2749  C CA  . ASN B  2 28  ? 54.974  -9.521  42.658  1.00 36.70  ? 28  ASN B CA  1 
ATOM   2750  C C   . ASN B  2 28  ? 55.220  -10.495 43.776  1.00 39.34  ? 28  ASN B C   1 
ATOM   2751  O O   . ASN B  2 28  ? 54.258  -10.921 44.418  1.00 39.19  ? 28  ASN B O   1 
ATOM   2752  C CB  . ASN B  2 28  ? 55.491  -8.138  43.071  1.00 35.40  ? 28  ASN B CB  1 
ATOM   2753  C CG  . ASN B  2 28  ? 55.924  -7.946  44.512  1.00 34.10  ? 28  ASN B CG  1 
ATOM   2754  O OD1 . ASN B  2 28  ? 57.107  -8.002  44.825  1.00 33.69  ? 28  ASN B OD1 1 
ATOM   2755  N ND2 . ASN B  2 28  ? 54.983  -7.809  45.413  1.00 33.37  ? 28  ASN B ND2 1 
ATOM   2756  N N   . SER B  2 29  ? 56.526  -10.702 43.998  1.00 42.95  ? 29  SER B N   1 
ATOM   2757  C CA  . SER B  2 29  ? 57.188  -11.552 44.988  1.00 45.50  ? 29  SER B CA  1 
ATOM   2758  C C   . SER B  2 29  ? 56.843  -11.285 46.470  1.00 46.21  ? 29  SER B C   1 
ATOM   2759  O O   . SER B  2 29  ? 57.703  -11.491 47.323  1.00 47.45  ? 29  SER B O   1 
ATOM   2760  C CB  . SER B  2 29  ? 58.726  -11.395 44.788  1.00 46.51  ? 29  SER B CB  1 
ATOM   2761  O OG  . SER B  2 29  ? 59.237  -11.014 43.494  1.00 48.40  ? 29  SER B OG  1 
ATOM   2762  N N   . GLU B  2 30  ? 55.616  -10.877 46.805  1.00 46.40  ? 30  GLU B N   1 
ATOM   2763  C CA  . GLU B  2 30  ? 55.098  -10.556 48.137  1.00 45.79  ? 30  GLU B CA  1 
ATOM   2764  C C   . GLU B  2 30  ? 53.788  -9.789  47.988  1.00 44.99  ? 30  GLU B C   1 
ATOM   2765  O O   . GLU B  2 30  ? 53.460  -8.896  48.766  1.00 44.12  ? 30  GLU B O   1 
ATOM   2766  C CB  . GLU B  2 30  ? 56.053  -9.705  48.986  1.00 46.07  ? 30  GLU B CB  1 
ATOM   2767  C CG  . GLU B  2 30  ? 56.572  -8.414  48.458  1.00 47.26  ? 30  GLU B CG  1 
ATOM   2768  C CD  . GLU B  2 30  ? 57.420  -7.676  49.475  1.00 48.92  ? 30  GLU B CD  1 
ATOM   2769  O OE1 . GLU B  2 30  ? 58.518  -7.216  49.109  1.00 49.47  ? 30  GLU B OE1 1 
ATOM   2770  O OE2 . GLU B  2 30  ? 56.969  -7.486  50.617  1.00 49.81  ? 30  GLU B OE2 1 
ATOM   2771  N N   . GLY B  2 31  ? 53.027  -10.130 46.925  1.00 44.60  ? 31  GLY B N   1 
ATOM   2772  C CA  . GLY B  2 31  ? 51.683  -9.598  46.743  1.00 43.54  ? 31  GLY B CA  1 
ATOM   2773  C C   . GLY B  2 31  ? 51.410  -8.575  45.642  1.00 42.25  ? 31  GLY B C   1 
ATOM   2774  O O   . GLY B  2 31  ? 52.202  -7.684  45.289  1.00 42.34  ? 31  GLY B O   1 
ATOM   2775  N N   . THR B  2 32  ? 50.199  -8.701  45.130  1.00 40.99  ? 32  THR B N   1 
ATOM   2776  C CA  . THR B  2 32  ? 49.721  -7.857  44.061  1.00 40.29  ? 32  THR B CA  1 
ATOM   2777  C C   . THR B  2 32  ? 49.273  -6.516  44.596  1.00 38.76  ? 32  THR B C   1 
ATOM   2778  O O   . THR B  2 32  ? 48.674  -6.489  45.665  1.00 39.79  ? 32  THR B O   1 
ATOM   2779  C CB  . THR B  2 32  ? 48.591  -8.575  43.382  1.00 40.90  ? 32  THR B CB  1 
ATOM   2780  O OG1 . THR B  2 32  ? 49.113  -9.872  43.073  1.00 41.62  ? 32  THR B OG1 1 
ATOM   2781  C CG2 . THR B  2 32  ? 48.109  -7.860  42.117  1.00 41.86  ? 32  THR B CG2 1 
ATOM   2782  N N   . GLY B  2 33  ? 49.546  -5.409  43.914  1.00 36.13  ? 33  GLY B N   1 
ATOM   2783  C CA  . GLY B  2 33  ? 49.163  -4.116  44.442  1.00 33.15  ? 33  GLY B CA  1 
ATOM   2784  C C   . GLY B  2 33  ? 49.218  -3.046  43.372  1.00 31.26  ? 33  GLY B C   1 
ATOM   2785  O O   . GLY B  2 33  ? 49.924  -3.205  42.370  1.00 31.93  ? 33  GLY B O   1 
ATOM   2786  N N   . GLN B  2 34  ? 48.620  -1.896  43.646  1.00 27.87  ? 34  GLN B N   1 
ATOM   2787  C CA  . GLN B  2 34  ? 48.410  -0.835  42.676  1.00 26.31  ? 34  GLN B CA  1 
ATOM   2788  C C   . GLN B  2 34  ? 48.931  0.461   43.262  1.00 25.93  ? 34  GLN B C   1 
ATOM   2789  O O   . GLN B  2 34  ? 49.113  0.498   44.474  1.00 27.59  ? 34  GLN B O   1 
ATOM   2790  C CB  . GLN B  2 34  ? 46.934  -0.753  42.438  1.00 25.97  ? 34  GLN B CB  1 
ATOM   2791  C CG  . GLN B  2 34  ? 46.431  0.278   41.458  1.00 26.18  ? 34  GLN B CG  1 
ATOM   2792  C CD  . GLN B  2 34  ? 44.924  0.469   41.545  1.00 26.45  ? 34  GLN B CD  1 
ATOM   2793  O OE1 . GLN B  2 34  ? 44.110  -0.251  40.943  1.00 25.53  ? 34  GLN B OE1 1 
ATOM   2794  N NE2 . GLN B  2 34  ? 44.534  1.488   42.301  1.00 26.79  ? 34  GLN B NE2 1 
ATOM   2795  N N   . ALA B  2 35  ? 49.212  1.510   42.496  1.00 25.09  ? 35  ALA B N   1 
ATOM   2796  C CA  . ALA B  2 35  ? 49.673  2.788   43.026  1.00 24.00  ? 35  ALA B CA  1 
ATOM   2797  C C   . ALA B  2 35  ? 49.559  3.823   41.922  1.00 24.16  ? 35  ALA B C   1 
ATOM   2798  O O   . ALA B  2 35  ? 49.981  3.503   40.800  1.00 25.64  ? 35  ALA B O   1 
ATOM   2799  C CB  . ALA B  2 35  ? 51.117  2.668   43.416  1.00 23.95  ? 35  ALA B CB  1 
ATOM   2800  N N   . ALA B  2 36  ? 48.981  5.009   42.121  1.00 23.55  ? 36  ALA B N   1 
ATOM   2801  C CA  . ALA B  2 36  ? 48.876  5.982   41.024  1.00 22.71  ? 36  ALA B CA  1 
ATOM   2802  C C   . ALA B  2 36  ? 50.147  6.756   40.810  1.00 21.93  ? 36  ALA B C   1 
ATOM   2803  O O   . ALA B  2 36  ? 50.925  6.902   41.749  1.00 21.46  ? 36  ALA B O   1 
ATOM   2804  C CB  . ALA B  2 36  ? 47.815  7.010   41.280  1.00 23.20  ? 36  ALA B CB  1 
ATOM   2805  N N   . ASP B  2 37  ? 50.402  7.207   39.584  1.00 22.09  ? 37  ASP B N   1 
ATOM   2806  C CA  . ASP B  2 37  ? 51.594  7.992   39.306  1.00 22.79  ? 37  ASP B CA  1 
ATOM   2807  C C   . ASP B  2 37  ? 51.245  9.465   39.376  1.00 22.20  ? 37  ASP B C   1 
ATOM   2808  O O   . ASP B  2 37  ? 50.452  9.996   38.589  1.00 21.31  ? 37  ASP B O   1 
ATOM   2809  C CB  . ASP B  2 37  ? 52.200  7.694   37.912  1.00 23.25  ? 37  ASP B CB  1 
ATOM   2810  C CG  . ASP B  2 37  ? 53.352  8.648   37.554  1.00 24.29  ? 37  ASP B CG  1 
ATOM   2811  O OD1 . ASP B  2 37  ? 54.233  8.909   38.363  1.00 25.26  ? 37  ASP B OD1 1 
ATOM   2812  O OD2 . ASP B  2 37  ? 53.363  9.227   36.472  1.00 24.97  ? 37  ASP B OD2 1 
ATOM   2813  N N   . LEU B  2 38  ? 51.852  10.186  40.309  1.00 22.44  ? 38  LEU B N   1 
ATOM   2814  C CA  . LEU B  2 38  ? 51.485  11.576  40.436  1.00 22.59  ? 38  LEU B CA  1 
ATOM   2815  C C   . LEU B  2 38  ? 52.123  12.507  39.456  1.00 22.04  ? 38  LEU B C   1 
ATOM   2816  O O   . LEU B  2 38  ? 51.515  13.545  39.198  1.00 22.09  ? 38  LEU B O   1 
ATOM   2817  C CB  . LEU B  2 38  ? 51.769  12.133  41.823  1.00 23.56  ? 38  LEU B CB  1 
ATOM   2818  C CG  . LEU B  2 38  ? 50.704  11.830  42.901  1.00 24.74  ? 38  LEU B CG  1 
ATOM   2819  C CD1 . LEU B  2 38  ? 49.325  11.502  42.287  1.00 25.31  ? 38  LEU B CD1 1 
ATOM   2820  C CD2 . LEU B  2 38  ? 51.143  10.602  43.683  1.00 25.27  ? 38  LEU B CD2 1 
ATOM   2821  N N   . LYS B  2 39  ? 53.261  12.174  38.858  1.00 21.55  ? 39  LYS B N   1 
ATOM   2822  C CA  . LYS B  2 39  ? 53.851  13.107  37.923  1.00 21.23  ? 39  LYS B CA  1 
ATOM   2823  C C   . LYS B  2 39  ? 53.080  13.186  36.616  1.00 19.17  ? 39  LYS B C   1 
ATOM   2824  O O   . LYS B  2 39  ? 52.860  14.305  36.133  1.00 19.20  ? 39  LYS B O   1 
ATOM   2825  C CB  . LYS B  2 39  ? 55.272  12.737  37.595  1.00 24.75  ? 39  LYS B CB  1 
ATOM   2826  C CG  . LYS B  2 39  ? 56.287  13.202  38.635  1.00 28.32  ? 39  LYS B CG  1 
ATOM   2827  C CD  . LYS B  2 39  ? 57.680  13.263  37.976  1.00 31.73  ? 39  LYS B CD  1 
ATOM   2828  C CE  . LYS B  2 39  ? 57.673  14.332  36.839  1.00 34.19  ? 39  LYS B CE  1 
ATOM   2829  N NZ  . LYS B  2 39  ? 58.941  14.441  36.120  1.00 35.93  ? 39  LYS B NZ  1 
ATOM   2830  N N   . SER B  2 40  ? 52.631  12.069  36.024  1.00 15.80  ? 40  SER B N   1 
ATOM   2831  C CA  . SER B  2 40  ? 51.885  12.187  34.792  1.00 13.03  ? 40  SER B CA  1 
ATOM   2832  C C   . SER B  2 40  ? 50.487  12.697  35.105  1.00 12.05  ? 40  SER B C   1 
ATOM   2833  O O   . SER B  2 40  ? 49.909  13.467  34.328  1.00 10.89  ? 40  SER B O   1 
ATOM   2834  C CB  . SER B  2 40  ? 51.808  10.853  34.089  1.00 12.74  ? 40  SER B CB  1 
ATOM   2835  O OG  . SER B  2 40  ? 51.123  9.926   34.907  1.00 12.69  ? 40  SER B OG  1 
ATOM   2836  N N   . THR B  2 41  ? 49.914  12.322  36.255  1.00 11.51  ? 41  THR B N   1 
ATOM   2837  C CA  . THR B  2 41  ? 48.624  12.892  36.621  1.00 11.26  ? 41  THR B CA  1 
ATOM   2838  C C   . THR B  2 41  ? 48.650  14.426  36.716  1.00 12.47  ? 41  THR B C   1 
ATOM   2839  O O   . THR B  2 41  ? 47.743  15.094  36.196  1.00 11.61  ? 41  THR B O   1 
ATOM   2840  C CB  . THR B  2 41  ? 48.179  12.267  37.922  1.00 9.46   ? 41  THR B CB  1 
ATOM   2841  O OG1 . THR B  2 41  ? 48.016  10.873  37.661  1.00 9.01   ? 41  THR B OG1 1 
ATOM   2842  C CG2 . THR B  2 41  ? 46.862  12.794  38.391  1.00 8.60   ? 41  THR B CG2 1 
ATOM   2843  N N   . GLN B  2 42  ? 49.701  15.032  37.284  1.00 14.02  ? 42  GLN B N   1 
ATOM   2844  C CA  . GLN B  2 42  ? 49.792  16.480  37.278  1.00 14.67  ? 42  GLN B CA  1 
ATOM   2845  C C   . GLN B  2 42  ? 49.967  17.005  35.874  1.00 13.48  ? 42  GLN B C   1 
ATOM   2846  O O   . GLN B  2 42  ? 49.175  17.844  35.477  1.00 13.33  ? 42  GLN B O   1 
ATOM   2847  C CB  . GLN B  2 42  ? 50.953  16.986  38.113  1.00 17.85  ? 42  GLN B CB  1 
ATOM   2848  C CG  . GLN B  2 42  ? 50.556  17.410  39.519  1.00 21.33  ? 42  GLN B CG  1 
ATOM   2849  C CD  . GLN B  2 42  ? 49.284  18.271  39.556  1.00 23.94  ? 42  GLN B CD  1 
ATOM   2850  O OE1 . GLN B  2 42  ? 48.325  17.922  40.269  1.00 25.97  ? 42  GLN B OE1 1 
ATOM   2851  N NE2 . GLN B  2 42  ? 49.183  19.389  38.828  1.00 23.83  ? 42  GLN B NE2 1 
ATOM   2852  N N   . ALA B  2 43  ? 50.896  16.463  35.082  1.00 12.30  ? 43  ALA B N   1 
ATOM   2853  C CA  . ALA B  2 43  ? 51.069  16.895  33.698  1.00 11.93  ? 43  ALA B CA  1 
ATOM   2854  C C   . ALA B  2 43  ? 49.763  16.965  32.935  1.00 11.46  ? 43  ALA B C   1 
ATOM   2855  O O   . ALA B  2 43  ? 49.471  17.993  32.322  1.00 10.44  ? 43  ALA B O   1 
ATOM   2856  C CB  . ALA B  2 43  ? 51.933  15.951  32.916  1.00 12.81  ? 43  ALA B CB  1 
ATOM   2857  N N   . ALA B  2 44  ? 48.947  15.903  33.001  1.00 11.41  ? 44  ALA B N   1 
ATOM   2858  C CA  . ALA B  2 44  ? 47.641  15.913  32.355  1.00 11.02  ? 44  ALA B CA  1 
ATOM   2859  C C   . ALA B  2 44  ? 46.758  17.035  32.890  1.00 10.82  ? 44  ALA B C   1 
ATOM   2860  O O   . ALA B  2 44  ? 46.203  17.819  32.098  1.00 9.81   ? 44  ALA B O   1 
ATOM   2861  C CB  . ALA B  2 44  ? 46.913  14.620  32.591  1.00 10.42  ? 44  ALA B CB  1 
ATOM   2862  N N   . ILE B  2 45  ? 46.707  17.166  34.232  1.00 11.02  ? 45  ILE B N   1 
ATOM   2863  C CA  . ILE B  2 45  ? 45.866  18.162  34.906  1.00 9.49   ? 45  ILE B CA  1 
ATOM   2864  C C   . ILE B  2 45  ? 46.241  19.604  34.607  1.00 10.60  ? 45  ILE B C   1 
ATOM   2865  O O   . ILE B  2 45  ? 45.346  20.383  34.269  1.00 10.42  ? 45  ILE B O   1 
ATOM   2866  C CB  . ILE B  2 45  ? 45.923  17.861  36.396  1.00 6.73   ? 45  ILE B CB  1 
ATOM   2867  C CG1 . ILE B  2 45  ? 44.799  16.961  36.633  1.00 5.39   ? 45  ILE B CG1 1 
ATOM   2868  C CG2 . ILE B  2 45  ? 45.785  19.051  37.291  1.00 6.34   ? 45  ILE B CG2 1 
ATOM   2869  C CD1 . ILE B  2 45  ? 45.073  16.158  37.868  1.00 6.00   ? 45  ILE B CD1 1 
ATOM   2870  N N   . ASP B  2 46  ? 47.525  19.960  34.663  1.00 11.93  ? 46  ASP B N   1 
ATOM   2871  C CA  . ASP B  2 46  ? 47.949  21.327  34.455  1.00 12.99  ? 46  ASP B CA  1 
ATOM   2872  C C   . ASP B  2 46  ? 47.670  21.781  33.054  1.00 12.83  ? 46  ASP B C   1 
ATOM   2873  O O   . ASP B  2 46  ? 47.122  22.860  32.882  1.00 13.70  ? 46  ASP B O   1 
ATOM   2874  C CB  . ASP B  2 46  ? 49.423  21.457  34.749  1.00 16.32  ? 46  ASP B CB  1 
ATOM   2875  C CG  . ASP B  2 46  ? 49.788  21.211  36.217  1.00 19.77  ? 46  ASP B CG  1 
ATOM   2876  O OD1 . ASP B  2 46  ? 49.030  21.603  37.121  1.00 21.07  ? 46  ASP B OD1 1 
ATOM   2877  O OD2 . ASP B  2 46  ? 50.837  20.600  36.478  1.00 21.30  ? 46  ASP B OD2 1 
ATOM   2878  N N   . GLN B  2 47  ? 47.943  20.972  32.014  1.00 12.05  ? 47  GLN B N   1 
ATOM   2879  C CA  . GLN B  2 47  ? 47.579  21.322  30.638  1.00 9.79   ? 47  GLN B CA  1 
ATOM   2880  C C   . GLN B  2 47  ? 46.073  21.538  30.542  1.00 9.10   ? 47  GLN B C   1 
ATOM   2881  O O   . GLN B  2 47  ? 45.632  22.548  29.982  1.00 8.07   ? 47  GLN B O   1 
ATOM   2882  C CB  . GLN B  2 47  ? 47.923  20.231  29.675  1.00 10.59  ? 47  GLN B CB  1 
ATOM   2883  C CG  . GLN B  2 47  ? 49.393  20.051  29.658  1.00 13.27  ? 47  GLN B CG  1 
ATOM   2884  C CD  . GLN B  2 47  ? 49.833  18.841  28.854  1.00 14.90  ? 47  GLN B CD  1 
ATOM   2885  O OE1 . GLN B  2 47  ? 50.050  18.952  27.643  1.00 16.29  ? 47  GLN B OE1 1 
ATOM   2886  N NE2 . GLN B  2 47  ? 50.005  17.678  29.483  1.00 15.28  ? 47  GLN B NE2 1 
ATOM   2887  N N   . ILE B  2 48  ? 45.252  20.638  31.122  1.00 8.10   ? 48  ILE B N   1 
ATOM   2888  C CA  . ILE B  2 48  ? 43.817  20.822  31.037  1.00 7.50   ? 48  ILE B CA  1 
ATOM   2889  C C   . ILE B  2 48  ? 43.429  22.092  31.766  1.00 7.69   ? 48  ILE B C   1 
ATOM   2890  O O   . ILE B  2 48  ? 42.577  22.833  31.284  1.00 7.51   ? 48  ILE B O   1 
ATOM   2891  C CB  . ILE B  2 48  ? 43.083  19.597  31.609  1.00 7.05   ? 48  ILE B CB  1 
ATOM   2892  C CG1 . ILE B  2 48  ? 43.278  18.481  30.642  1.00 6.90   ? 48  ILE B CG1 1 
ATOM   2893  C CG2 . ILE B  2 48  ? 41.571  19.791  31.727  1.00 6.23   ? 48  ILE B CG2 1 
ATOM   2894  C CD1 . ILE B  2 48  ? 42.671  17.170  31.177  1.00 7.97   ? 48  ILE B CD1 1 
ATOM   2895  N N   . ASN B  2 49  ? 44.078  22.443  32.863  1.00 9.17   ? 49  ASN B N   1 
ATOM   2896  C CA  . ASN B  2 49  ? 43.717  23.680  33.543  1.00 10.79  ? 49  ASN B CA  1 
ATOM   2897  C C   . ASN B  2 49  ? 44.126  24.877  32.740  1.00 8.94   ? 49  ASN B C   1 
ATOM   2898  O O   . ASN B  2 49  ? 43.370  25.831  32.682  1.00 8.57   ? 49  ASN B O   1 
ATOM   2899  C CB  . ASN B  2 49  ? 44.367  23.811  34.908  1.00 13.79  ? 49  ASN B CB  1 
ATOM   2900  C CG  . ASN B  2 49  ? 43.729  22.876  35.929  1.00 16.35  ? 49  ASN B CG  1 
ATOM   2901  O OD1 . ASN B  2 49  ? 44.412  22.358  36.818  1.00 17.67  ? 49  ASN B OD1 1 
ATOM   2902  N ND2 . ASN B  2 49  ? 42.420  22.597  35.898  1.00 17.17  ? 49  ASN B ND2 1 
ATOM   2903  N N   . GLY B  2 50  ? 45.235  24.767  32.034  1.00 7.49   ? 50  GLY B N   1 
ATOM   2904  C CA  . GLY B  2 50  ? 45.757  25.857  31.259  1.00 6.94   ? 50  GLY B CA  1 
ATOM   2905  C C   . GLY B  2 50  ? 44.784  26.247  30.180  1.00 6.13   ? 50  GLY B C   1 
ATOM   2906  O O   . GLY B  2 50  ? 44.364  27.399  30.088  1.00 6.45   ? 50  GLY B O   1 
ATOM   2907  N N   . LYS B  2 51  ? 44.353  25.273  29.400  1.00 5.87   ? 51  LYS B N   1 
ATOM   2908  C CA  . LYS B  2 51  ? 43.413  25.581  28.348  1.00 5.94   ? 51  LYS B CA  1 
ATOM   2909  C C   . LYS B  2 51  ? 42.135  26.024  28.980  1.00 6.70   ? 51  LYS B C   1 
ATOM   2910  O O   . LYS B  2 51  ? 41.568  27.024  28.574  1.00 6.44   ? 51  LYS B O   1 
ATOM   2911  C CB  . LYS B  2 51  ? 43.118  24.392  27.435  1.00 4.98   ? 51  LYS B CB  1 
ATOM   2912  C CG  . LYS B  2 51  ? 42.674  23.099  28.050  1.00 3.43   ? 51  LYS B CG  1 
ATOM   2913  C CD  . LYS B  2 51  ? 42.207  22.251  26.928  1.00 2.50   ? 51  LYS B CD  1 
ATOM   2914  C CE  . LYS B  2 51  ? 43.330  21.703  26.077  1.00 2.00   ? 51  LYS B CE  1 
ATOM   2915  N NZ  . LYS B  2 51  ? 42.762  21.035  24.927  1.00 2.00   ? 51  LYS B NZ  1 
ATOM   2916  N N   . LEU B  2 52  ? 41.752  25.411  30.083  1.00 9.27   ? 52  LEU B N   1 
ATOM   2917  C CA  . LEU B  2 52  ? 40.515  25.790  30.705  1.00 12.26  ? 52  LEU B CA  1 
ATOM   2918  C C   . LEU B  2 52  ? 40.573  27.238  31.159  1.00 14.88  ? 52  LEU B C   1 
ATOM   2919  O O   . LEU B  2 52  ? 39.618  27.989  30.954  1.00 16.49  ? 52  LEU B O   1 
ATOM   2920  C CB  . LEU B  2 52  ? 40.247  24.852  31.859  1.00 11.21  ? 52  LEU B CB  1 
ATOM   2921  C CG  . LEU B  2 52  ? 38.983  24.994  32.656  1.00 10.99  ? 52  LEU B CG  1 
ATOM   2922  C CD1 . LEU B  2 52  ? 37.721  24.991  31.820  1.00 10.61  ? 52  LEU B CD1 1 
ATOM   2923  C CD2 . LEU B  2 52  ? 38.991  23.822  33.588  1.00 11.26  ? 52  LEU B CD2 1 
ATOM   2924  N N   . ASN B  2 53  ? 41.702  27.721  31.645  1.00 17.64  ? 53  ASN B N   1 
ATOM   2925  C CA  . ASN B  2 53  ? 41.762  29.091  32.113  1.00 20.83  ? 53  ASN B CA  1 
ATOM   2926  C C   . ASN B  2 53  ? 41.738  30.062  30.969  1.00 20.70  ? 53  ASN B C   1 
ATOM   2927  O O   . ASN B  2 53  ? 41.158  31.128  31.100  1.00 21.25  ? 53  ASN B O   1 
ATOM   2928  C CB  . ASN B  2 53  ? 43.018  29.404  32.914  1.00 23.79  ? 53  ASN B CB  1 
ATOM   2929  C CG  . ASN B  2 53  ? 43.039  28.728  34.276  1.00 27.00  ? 53  ASN B CG  1 
ATOM   2930  O OD1 . ASN B  2 53  ? 44.027  28.086  34.671  1.00 28.91  ? 53  ASN B OD1 1 
ATOM   2931  N ND2 . ASN B  2 53  ? 41.960  28.818  35.061  1.00 28.16  ? 53  ASN B ND2 1 
ATOM   2932  N N   . ARG B  2 54  ? 42.310  29.699  29.842  1.00 20.76  ? 54  ARG B N   1 
ATOM   2933  C CA  . ARG B  2 54  ? 42.374  30.592  28.711  1.00 21.66  ? 54  ARG B CA  1 
ATOM   2934  C C   . ARG B  2 54  ? 40.978  30.763  28.163  1.00 22.19  ? 54  ARG B C   1 
ATOM   2935  O O   . ARG B  2 54  ? 40.539  31.856  27.874  1.00 21.02  ? 54  ARG B O   1 
ATOM   2936  C CB  . ARG B  2 54  ? 43.335  29.956  27.721  1.00 22.41  ? 54  ARG B CB  1 
ATOM   2937  C CG  . ARG B  2 54  ? 43.967  30.777  26.614  1.00 23.69  ? 54  ARG B CG  1 
ATOM   2938  C CD  . ARG B  2 54  ? 45.519  30.833  26.700  1.00 25.27  ? 54  ARG B CD  1 
ATOM   2939  N NE  . ARG B  2 54  ? 46.084  31.191  25.396  1.00 26.87  ? 54  ARG B NE  1 
ATOM   2940  C CZ  . ARG B  2 54  ? 45.871  32.389  24.794  1.00 27.81  ? 54  ARG B CZ  1 
ATOM   2941  N NH1 . ARG B  2 54  ? 46.315  32.581  23.521  1.00 27.38  ? 54  ARG B NH1 1 
ATOM   2942  N NH2 . ARG B  2 54  ? 45.289  33.429  25.456  1.00 27.30  ? 54  ARG B NH2 1 
ATOM   2943  N N   . VAL B  2 55  ? 40.197  29.699  28.061  1.00 24.89  ? 55  VAL B N   1 
ATOM   2944  C CA  . VAL B  2 55  ? 38.845  29.823  27.529  1.00 27.26  ? 55  VAL B CA  1 
ATOM   2945  C C   . VAL B  2 55  ? 37.914  30.468  28.560  1.00 30.81  ? 55  VAL B C   1 
ATOM   2946  O O   . VAL B  2 55  ? 36.898  31.050  28.199  1.00 30.94  ? 55  VAL B O   1 
ATOM   2947  C CB  . VAL B  2 55  ? 38.385  28.385  27.074  1.00 25.81  ? 55  VAL B CB  1 
ATOM   2948  C CG1 . VAL B  2 55  ? 38.140  27.482  28.242  1.00 26.03  ? 55  VAL B CG1 1 
ATOM   2949  C CG2 . VAL B  2 55  ? 37.074  28.445  26.369  1.00 25.60  ? 55  VAL B CG2 1 
ATOM   2950  N N   . ILE B  2 56  ? 38.214  30.394  29.859  1.00 34.97  ? 56  ILE B N   1 
ATOM   2951  C CA  . ILE B  2 56  ? 37.342  30.978  30.854  1.00 39.50  ? 56  ILE B CA  1 
ATOM   2952  C C   . ILE B  2 56  ? 37.672  32.451  31.106  1.00 43.68  ? 56  ILE B C   1 
ATOM   2953  O O   . ILE B  2 56  ? 37.006  33.115  31.911  1.00 44.41  ? 56  ILE B O   1 
ATOM   2954  C CB  . ILE B  2 56  ? 37.466  30.050  32.118  1.00 39.09  ? 56  ILE B CB  1 
ATOM   2955  C CG1 . ILE B  2 56  ? 36.067  29.692  32.500  1.00 38.93  ? 56  ILE B CG1 1 
ATOM   2956  C CG2 . ILE B  2 56  ? 38.169  30.656  33.325  1.00 39.40  ? 56  ILE B CG2 1 
ATOM   2957  C CD1 . ILE B  2 56  ? 35.579  28.541  31.624  1.00 38.38  ? 56  ILE B CD1 1 
ATOM   2958  N N   . GLU B  2 57  ? 38.697  33.008  30.440  1.00 48.70  ? 57  GLU B N   1 
ATOM   2959  C CA  . GLU B  2 57  ? 39.132  34.388  30.669  1.00 52.86  ? 57  GLU B CA  1 
ATOM   2960  C C   . GLU B  2 57  ? 38.511  35.396  29.691  1.00 54.49  ? 57  GLU B C   1 
ATOM   2961  O O   . GLU B  2 57  ? 37.720  35.076  28.798  1.00 54.48  ? 57  GLU B O   1 
ATOM   2962  C CB  . GLU B  2 57  ? 40.703  34.351  30.642  1.00 54.34  ? 57  GLU B CB  1 
ATOM   2963  C CG  . GLU B  2 57  ? 41.664  35.358  29.965  1.00 56.70  ? 57  GLU B CG  1 
ATOM   2964  C CD  . GLU B  2 57  ? 42.213  35.009  28.557  1.00 58.25  ? 57  GLU B CD  1 
ATOM   2965  O OE1 . GLU B  2 57  ? 41.460  34.985  27.577  1.00 59.14  ? 57  GLU B OE1 1 
ATOM   2966  O OE2 . GLU B  2 57  ? 43.431  34.862  28.353  1.00 58.76  ? 57  GLU B OE2 1 
ATOM   2967  N N   . LYS B  2 58  ? 38.741  36.679  29.996  1.00 56.46  ? 58  LYS B N   1 
ATOM   2968  C CA  . LYS B  2 58  ? 38.344  37.828  29.176  1.00 57.77  ? 58  LYS B CA  1 
ATOM   2969  C C   . LYS B  2 58  ? 36.861  38.085  28.802  1.00 57.44  ? 58  LYS B C   1 
ATOM   2970  O O   . LYS B  2 58  ? 36.506  38.103  27.608  1.00 58.55  ? 58  LYS B O   1 
ATOM   2971  C CB  . LYS B  2 58  ? 39.180  37.792  27.865  1.00 58.66  ? 58  LYS B CB  1 
ATOM   2972  C CG  . LYS B  2 58  ? 40.653  38.189  27.901  1.00 59.83  ? 58  LYS B CG  1 
ATOM   2973  C CD  . LYS B  2 58  ? 41.131  37.930  26.469  1.00 60.94  ? 58  LYS B CD  1 
ATOM   2974  C CE  . LYS B  2 58  ? 42.633  37.678  26.299  1.00 61.64  ? 58  LYS B CE  1 
ATOM   2975  N NZ  . LYS B  2 58  ? 42.789  36.615  25.321  1.00 61.32  ? 58  LYS B NZ  1 
ATOM   2976  N N   . THR B  2 59  ? 35.931  38.332  29.751  1.00 56.17  ? 59  THR B N   1 
ATOM   2977  C CA  . THR B  2 59  ? 34.593  38.762  29.318  1.00 54.65  ? 59  THR B CA  1 
ATOM   2978  C C   . THR B  2 59  ? 34.710  40.214  28.879  1.00 52.91  ? 59  THR B C   1 
ATOM   2979  O O   . THR B  2 59  ? 35.367  41.049  29.513  1.00 53.64  ? 59  THR B O   1 
ATOM   2980  C CB  . THR B  2 59  ? 33.473  38.692  30.421  1.00 54.98  ? 59  THR B CB  1 
ATOM   2981  O OG1 . THR B  2 59  ? 33.988  39.179  31.655  1.00 55.74  ? 59  THR B OG1 1 
ATOM   2982  C CG2 . THR B  2 59  ? 32.953  37.271  30.572  1.00 55.26  ? 59  THR B CG2 1 
ATOM   2983  N N   . ASN B  2 60  ? 34.160  40.503  27.723  1.00 50.14  ? 60  ASN B N   1 
ATOM   2984  C CA  . ASN B  2 60  ? 34.189  41.843  27.198  1.00 47.08  ? 60  ASN B CA  1 
ATOM   2985  C C   . ASN B  2 60  ? 32.965  42.528  27.786  1.00 43.85  ? 60  ASN B C   1 
ATOM   2986  O O   . ASN B  2 60  ? 31.888  41.917  27.893  1.00 44.12  ? 60  ASN B O   1 
ATOM   2987  C CB  . ASN B  2 60  ? 34.141  41.776  25.647  1.00 49.80  ? 60  ASN B CB  1 
ATOM   2988  C CG  . ASN B  2 60  ? 33.073  40.864  24.977  1.00 51.69  ? 60  ASN B CG  1 
ATOM   2989  O OD1 . ASN B  2 60  ? 32.625  39.841  25.530  1.00 52.03  ? 60  ASN B OD1 1 
ATOM   2990  N ND2 . ASN B  2 60  ? 32.697  41.043  23.703  1.00 51.77  ? 60  ASN B ND2 1 
ATOM   2991  N N   . GLU B  2 61  ? 33.131  43.751  28.292  1.00 39.20  ? 61  GLU B N   1 
ATOM   2992  C CA  . GLU B  2 61  ? 31.990  44.506  28.793  1.00 34.46  ? 61  GLU B CA  1 
ATOM   2993  C C   . GLU B  2 61  ? 31.353  45.186  27.615  1.00 29.33  ? 61  GLU B C   1 
ATOM   2994  O O   . GLU B  2 61  ? 32.055  45.610  26.698  1.00 28.67  ? 61  GLU B O   1 
ATOM   2995  C CB  . GLU B  2 61  ? 32.339  45.636  29.721  1.00 36.03  ? 61  GLU B CB  1 
ATOM   2996  C CG  . GLU B  2 61  ? 33.122  45.299  30.953  1.00 38.44  ? 61  GLU B CG  1 
ATOM   2997  C CD  . GLU B  2 61  ? 32.992  46.399  32.000  1.00 40.04  ? 61  GLU B CD  1 
ATOM   2998  O OE1 . GLU B  2 61  ? 31.986  46.396  32.728  1.00 40.24  ? 61  GLU B OE1 1 
ATOM   2999  O OE2 . GLU B  2 61  ? 33.889  47.249  32.068  1.00 40.80  ? 61  GLU B OE2 1 
ATOM   3000  N N   . LYS B  2 62  ? 30.049  45.269  27.545  1.00 23.96  ? 62  LYS B N   1 
ATOM   3001  C CA  . LYS B  2 62  ? 29.430  46.064  26.512  1.00 19.31  ? 62  LYS B CA  1 
ATOM   3002  C C   . LYS B  2 62  ? 28.368  46.843  27.215  1.00 17.14  ? 62  LYS B C   1 
ATOM   3003  O O   . LYS B  2 62  ? 27.736  46.327  28.144  1.00 17.77  ? 62  LYS B O   1 
ATOM   3004  C CB  . LYS B  2 62  ? 28.774  45.223  25.430  1.00 18.20  ? 62  LYS B CB  1 
ATOM   3005  C CG  . LYS B  2 62  ? 29.756  44.443  24.554  1.00 16.51  ? 62  LYS B CG  1 
ATOM   3006  C CD  . LYS B  2 62  ? 30.678  45.300  23.698  1.00 15.19  ? 62  LYS B CD  1 
ATOM   3007  C CE  . LYS B  2 62  ? 31.886  44.466  23.329  1.00 13.90  ? 62  LYS B CE  1 
ATOM   3008  N NZ  . LYS B  2 62  ? 32.791  45.168  22.454  1.00 13.23  ? 62  LYS B NZ  1 
ATOM   3009  N N   . PHE B  2 63  ? 28.217  48.110  26.878  1.00 13.97  ? 63  PHE B N   1 
ATOM   3010  C CA  . PHE B  2 63  ? 27.183  48.874  27.523  1.00 11.44  ? 63  PHE B CA  1 
ATOM   3011  C C   . PHE B  2 63  ? 26.084  49.215  26.526  1.00 9.85   ? 63  PHE B C   1 
ATOM   3012  O O   . PHE B  2 63  ? 25.403  48.311  26.036  1.00 9.96   ? 63  PHE B O   1 
ATOM   3013  C CB  . PHE B  2 63  ? 27.865  50.075  28.145  1.00 10.79  ? 63  PHE B CB  1 
ATOM   3014  C CG  . PHE B  2 63  ? 28.829  49.659  29.244  1.00 10.80  ? 63  PHE B CG  1 
ATOM   3015  C CD1 . PHE B  2 63  ? 28.370  49.005  30.367  1.00 11.45  ? 63  PHE B CD1 1 
ATOM   3016  C CD2 . PHE B  2 63  ? 30.173  49.898  29.097  1.00 10.69  ? 63  PHE B CD2 1 
ATOM   3017  C CE1 . PHE B  2 63  ? 29.253  48.599  31.337  1.00 11.77  ? 63  PHE B CE1 1 
ATOM   3018  C CE2 . PHE B  2 63  ? 31.061  49.492  30.064  1.00 10.55  ? 63  PHE B CE2 1 
ATOM   3019  C CZ  . PHE B  2 63  ? 30.603  48.839  31.178  1.00 11.39  ? 63  PHE B CZ  1 
ATOM   3020  N N   . HIS B  2 64  ? 25.896  50.461  26.126  1.00 8.25   ? 64  HIS B N   1 
ATOM   3021  C CA  . HIS B  2 64  ? 24.812  50.825  25.225  1.00 6.61   ? 64  HIS B CA  1 
ATOM   3022  C C   . HIS B  2 64  ? 25.088  50.223  23.885  1.00 6.17   ? 64  HIS B C   1 
ATOM   3023  O O   . HIS B  2 64  ? 26.112  50.546  23.301  1.00 6.63   ? 64  HIS B O   1 
ATOM   3024  C CB  . HIS B  2 64  ? 24.747  52.324  25.114  1.00 4.92   ? 64  HIS B CB  1 
ATOM   3025  C CG  . HIS B  2 64  ? 23.552  52.865  24.391  1.00 3.41   ? 64  HIS B CG  1 
ATOM   3026  N ND1 . HIS B  2 64  ? 22.298  52.778  24.786  1.00 3.45   ? 64  HIS B ND1 1 
ATOM   3027  C CD2 . HIS B  2 64  ? 23.601  53.617  23.263  1.00 4.69   ? 64  HIS B CD2 1 
ATOM   3028  C CE1 . HIS B  2 64  ? 21.567  53.472  23.937  1.00 3.96   ? 64  HIS B CE1 1 
ATOM   3029  N NE2 . HIS B  2 64  ? 22.357  53.973  23.026  1.00 5.17   ? 64  HIS B NE2 1 
ATOM   3030  N N   . GLN B  2 65  ? 24.265  49.283  23.461  1.00 6.13   ? 65  GLN B N   1 
ATOM   3031  C CA  . GLN B  2 65  ? 24.446  48.702  22.139  1.00 5.82   ? 65  GLN B CA  1 
ATOM   3032  C C   . GLN B  2 65  ? 23.339  49.159  21.177  1.00 5.67   ? 65  GLN B C   1 
ATOM   3033  O O   . GLN B  2 65  ? 22.968  50.324  21.188  1.00 6.78   ? 65  GLN B O   1 
ATOM   3034  C CB  . GLN B  2 65  ? 24.475  47.209  22.341  1.00 5.55   ? 65  GLN B CB  1 
ATOM   3035  C CG  . GLN B  2 65  ? 25.696  46.763  23.098  1.00 5.59   ? 65  GLN B CG  1 
ATOM   3036  C CD  . GLN B  2 65  ? 25.453  45.405  23.727  1.00 5.87   ? 65  GLN B CD  1 
ATOM   3037  O OE1 . GLN B  2 65  ? 25.458  44.356  23.052  1.00 5.02   ? 65  GLN B OE1 1 
ATOM   3038  N NE2 . GLN B  2 65  ? 25.195  45.454  25.032  1.00 6.14   ? 65  GLN B NE2 1 
ATOM   3039  N N   . ILE B  2 66  ? 22.797  48.319  20.309  1.00 4.50   ? 66  ILE B N   1 
ATOM   3040  C CA  . ILE B  2 66  ? 21.685  48.675  19.457  1.00 3.19   ? 66  ILE B CA  1 
ATOM   3041  C C   . ILE B  2 66  ? 20.510  47.979  20.068  1.00 4.70   ? 66  ILE B C   1 
ATOM   3042  O O   . ILE B  2 66  ? 20.719  47.059  20.874  1.00 4.97   ? 66  ILE B O   1 
ATOM   3043  C CB  . ILE B  2 66  ? 21.892  48.162  18.045  1.00 2.55   ? 66  ILE B CB  1 
ATOM   3044  C CG1 . ILE B  2 66  ? 22.195  46.701  17.953  1.00 2.00   ? 66  ILE B CG1 1 
ATOM   3045  C CG2 . ILE B  2 66  ? 23.064  48.923  17.508  1.00 3.38   ? 66  ILE B CG2 1 
ATOM   3046  C CD1 . ILE B  2 66  ? 22.098  46.285  16.505  1.00 2.28   ? 66  ILE B CD1 1 
ATOM   3047  N N   . GLU B  2 67  ? 19.296  48.375  19.698  1.00 7.21   ? 67  GLU B N   1 
ATOM   3048  C CA  . GLU B  2 67  ? 18.098  47.783  20.279  1.00 9.09   ? 67  GLU B CA  1 
ATOM   3049  C C   . GLU B  2 67  ? 17.897  46.449  19.616  1.00 8.99   ? 67  GLU B C   1 
ATOM   3050  O O   . GLU B  2 67  ? 18.205  46.284  18.448  1.00 8.52   ? 67  GLU B O   1 
ATOM   3051  C CB  . GLU B  2 67  ? 16.897  48.684  20.036  1.00 10.40  ? 67  GLU B CB  1 
ATOM   3052  C CG  . GLU B  2 67  ? 15.874  48.537  21.156  1.00 12.85  ? 67  GLU B CG  1 
ATOM   3053  C CD  . GLU B  2 67  ? 16.178  49.265  22.476  1.00 14.50  ? 67  GLU B CD  1 
ATOM   3054  O OE1 . GLU B  2 67  ? 15.708  48.753  23.503  1.00 16.49  ? 67  GLU B OE1 1 
ATOM   3055  O OE2 . GLU B  2 67  ? 16.751  50.375  22.519  1.00 13.92  ? 67  GLU B OE2 1 
ATOM   3056  N N   . LYS B  2 68  ? 17.429  45.436  20.305  1.00 10.66  ? 68  LYS B N   1 
ATOM   3057  C CA  . LYS B  2 68  ? 17.354  44.139  19.654  1.00 12.49  ? 68  LYS B CA  1 
ATOM   3058  C C   . LYS B  2 68  ? 15.977  43.526  19.650  1.00 15.65  ? 68  LYS B C   1 
ATOM   3059  O O   . LYS B  2 68  ? 15.852  42.330  19.373  1.00 17.16  ? 68  LYS B O   1 
ATOM   3060  C CB  . LYS B  2 68  ? 18.315  43.190  20.336  1.00 10.95  ? 68  LYS B CB  1 
ATOM   3061  C CG  . LYS B  2 68  ? 19.722  43.730  20.222  1.00 10.01  ? 68  LYS B CG  1 
ATOM   3062  C CD  . LYS B  2 68  ? 20.666  42.844  20.936  1.00 8.62   ? 68  LYS B CD  1 
ATOM   3063  C CE  . LYS B  2 68  ? 21.998  43.504  21.010  1.00 7.34   ? 68  LYS B CE  1 
ATOM   3064  N NZ  . LYS B  2 68  ? 22.869  42.494  21.556  1.00 8.46   ? 68  LYS B NZ  1 
ATOM   3065  N N   . GLU B  2 69  ? 14.955  44.293  20.012  1.00 18.65  ? 69  GLU B N   1 
ATOM   3066  C CA  . GLU B  2 69  ? 13.586  43.832  20.081  1.00 21.65  ? 69  GLU B CA  1 
ATOM   3067  C C   . GLU B  2 69  ? 12.735  45.030  19.712  1.00 22.46  ? 69  GLU B C   1 
ATOM   3068  O O   . GLU B  2 69  ? 12.905  46.127  20.277  1.00 24.11  ? 69  GLU B O   1 
ATOM   3069  C CB  . GLU B  2 69  ? 13.289  43.366  21.489  1.00 24.54  ? 69  GLU B CB  1 
ATOM   3070  C CG  . GLU B  2 69  ? 13.430  41.849  21.568  1.00 28.70  ? 69  GLU B CG  1 
ATOM   3071  C CD  . GLU B  2 69  ? 13.452  41.231  22.969  1.00 31.72  ? 69  GLU B CD  1 
ATOM   3072  O OE1 . GLU B  2 69  ? 14.189  40.226  23.125  1.00 33.11  ? 69  GLU B OE1 1 
ATOM   3073  O OE2 . GLU B  2 69  ? 12.770  41.749  23.872  1.00 33.04  ? 69  GLU B OE2 1 
ATOM   3074  N N   . PHE B  2 70  ? 11.836  44.881  18.747  1.00 22.27  ? 70  PHE B N   1 
ATOM   3075  C CA  . PHE B  2 70  ? 11.065  46.014  18.241  1.00 22.15  ? 70  PHE B CA  1 
ATOM   3076  C C   . PHE B  2 70  ? 9.607   45.729  18.470  1.00 23.93  ? 70  PHE B C   1 
ATOM   3077  O O   . PHE B  2 70  ? 9.248   44.577  18.663  1.00 25.03  ? 70  PHE B O   1 
ATOM   3078  C CB  . PHE B  2 70  ? 11.305  46.192  16.762  1.00 20.33  ? 70  PHE B CB  1 
ATOM   3079  C CG  . PHE B  2 70  ? 12.788  46.270  16.496  1.00 19.18  ? 70  PHE B CG  1 
ATOM   3080  C CD1 . PHE B  2 70  ? 13.421  47.498  16.540  1.00 18.86  ? 70  PHE B CD1 1 
ATOM   3081  C CD2 . PHE B  2 70  ? 13.497  45.104  16.281  1.00 18.07  ? 70  PHE B CD2 1 
ATOM   3082  C CE1 . PHE B  2 70  ? 14.790  47.552  16.401  1.00 18.52  ? 70  PHE B CE1 1 
ATOM   3083  C CE2 . PHE B  2 70  ? 14.857  45.170  16.147  1.00 17.80  ? 70  PHE B CE2 1 
ATOM   3084  C CZ  . PHE B  2 70  ? 15.502  46.391  16.199  1.00 18.42  ? 70  PHE B CZ  1 
ATOM   3085  N N   . SER B  2 71  ? 8.729   46.706  18.441  1.00 26.01  ? 71  SER B N   1 
ATOM   3086  C CA  . SER B  2 71  ? 7.339   46.419  18.736  1.00 28.12  ? 71  SER B CA  1 
ATOM   3087  C C   . SER B  2 71  ? 6.407   47.124  17.783  1.00 28.94  ? 71  SER B C   1 
ATOM   3088  O O   . SER B  2 71  ? 5.186   47.209  18.004  1.00 30.42  ? 71  SER B O   1 
ATOM   3089  C CB  . SER B  2 71  ? 7.092   46.849  20.167  1.00 29.55  ? 71  SER B CB  1 
ATOM   3090  O OG  . SER B  2 71  ? 7.877   48.018  20.461  1.00 31.26  ? 71  SER B OG  1 
ATOM   3091  N N   . GLU B  2 72  ? 6.980   47.603  16.691  1.00 29.18  ? 72  GLU B N   1 
ATOM   3092  C CA  . GLU B  2 72  ? 6.275   48.376  15.708  1.00 29.33  ? 72  GLU B CA  1 
ATOM   3093  C C   . GLU B  2 72  ? 6.957   48.016  14.389  1.00 26.89  ? 72  GLU B C   1 
ATOM   3094  O O   . GLU B  2 72  ? 8.121   47.607  14.393  1.00 26.80  ? 72  GLU B O   1 
ATOM   3095  C CB  . GLU B  2 72  ? 6.431   49.826  16.162  1.00 33.02  ? 72  GLU B CB  1 
ATOM   3096  C CG  . GLU B  2 72  ? 5.302   50.770  15.737  1.00 37.98  ? 72  GLU B CG  1 
ATOM   3097  C CD  . GLU B  2 72  ? 5.190   50.970  14.209  1.00 41.03  ? 72  GLU B CD  1 
ATOM   3098  O OE1 . GLU B  2 72  ? 5.857   51.873  13.667  1.00 41.73  ? 72  GLU B OE1 1 
ATOM   3099  O OE2 . GLU B  2 72  ? 4.444   50.193  13.574  1.00 42.48  ? 72  GLU B OE2 1 
ATOM   3100  N N   . VAL B  2 73  ? 6.292   48.048  13.253  1.00 24.30  ? 73  VAL B N   1 
ATOM   3101  C CA  . VAL B  2 73  ? 6.921   47.592  12.037  1.00 22.49  ? 73  VAL B CA  1 
ATOM   3102  C C   . VAL B  2 73  ? 7.477   48.791  11.316  1.00 21.24  ? 73  VAL B C   1 
ATOM   3103  O O   . VAL B  2 73  ? 6.739   49.645  10.825  1.00 22.45  ? 73  VAL B O   1 
ATOM   3104  C CB  . VAL B  2 73  ? 5.904   46.896  11.153  1.00 23.56  ? 73  VAL B CB  1 
ATOM   3105  C CG1 . VAL B  2 73  ? 6.627   46.296  9.957   1.00 23.18  ? 73  VAL B CG1 1 
ATOM   3106  C CG2 . VAL B  2 73  ? 5.157   45.825  11.946  1.00 23.86  ? 73  VAL B CG2 1 
ATOM   3107  N N   . GLU B  2 74  ? 8.790   48.814  11.159  1.00 18.80  ? 74  GLU B N   1 
ATOM   3108  C CA  . GLU B  2 74  ? 9.401   50.006  10.596  1.00 15.89  ? 74  GLU B CA  1 
ATOM   3109  C C   . GLU B  2 74  ? 9.953   49.878  9.182   1.00 14.84  ? 74  GLU B C   1 
ATOM   3110  O O   . GLU B  2 74  ? 10.073  50.858  8.459   1.00 14.55  ? 74  GLU B O   1 
ATOM   3111  C CB  . GLU B  2 74  ? 10.504  50.431  11.510  1.00 14.90  ? 74  GLU B CB  1 
ATOM   3112  C CG  . GLU B  2 74  ? 10.096  50.574  12.938  1.00 14.68  ? 74  GLU B CG  1 
ATOM   3113  C CD  . GLU B  2 74  ? 11.254  51.109  13.703  1.00 15.53  ? 74  GLU B CD  1 
ATOM   3114  O OE1 . GLU B  2 74  ? 11.632  52.234  13.440  1.00 16.47  ? 74  GLU B OE1 1 
ATOM   3115  O OE2 . GLU B  2 74  ? 11.842  50.406  14.512  1.00 16.27  ? 74  GLU B OE2 1 
ATOM   3116  N N   . GLY B  2 75  ? 10.375  48.687  8.750   1.00 13.95  ? 75  GLY B N   1 
ATOM   3117  C CA  . GLY B  2 75  ? 10.961  48.538  7.432   1.00 11.01  ? 75  GLY B CA  1 
ATOM   3118  C C   . GLY B  2 75  ? 12.495  48.540  7.405   1.00 9.22   ? 75  GLY B C   1 
ATOM   3119  O O   . GLY B  2 75  ? 13.179  48.090  8.310   1.00 9.42   ? 75  GLY B O   1 
ATOM   3120  N N   . ARG B  2 76  ? 13.030  49.230  6.438   1.00 8.07   ? 76  ARG B N   1 
ATOM   3121  C CA  . ARG B  2 76  ? 14.432  49.148  6.109   1.00 6.70   ? 76  ARG B CA  1 
ATOM   3122  C C   . ARG B  2 76  ? 15.434  49.277  7.247   1.00 5.92   ? 76  ARG B C   1 
ATOM   3123  O O   . ARG B  2 76  ? 16.266  48.400  7.393   1.00 5.49   ? 76  ARG B O   1 
ATOM   3124  C CB  . ARG B  2 76  ? 14.726  50.189  5.046   1.00 6.38   ? 76  ARG B CB  1 
ATOM   3125  C CG  . ARG B  2 76  ? 16.085  50.011  4.430   1.00 6.04   ? 76  ARG B CG  1 
ATOM   3126  C CD  . ARG B  2 76  ? 16.394  51.285  3.692   1.00 5.65   ? 76  ARG B CD  1 
ATOM   3127  N NE  . ARG B  2 76  ? 17.640  51.106  2.976   1.00 6.14   ? 76  ARG B NE  1 
ATOM   3128  C CZ  . ARG B  2 76  ? 17.920  51.780  1.866   1.00 5.33   ? 76  ARG B CZ  1 
ATOM   3129  N NH1 . ARG B  2 76  ? 19.047  51.536  1.211   1.00 5.15   ? 76  ARG B NH1 1 
ATOM   3130  N NH2 . ARG B  2 76  ? 17.094  52.719  1.426   1.00 4.59   ? 76  ARG B NH2 1 
ATOM   3131  N N   . ILE B  2 77  ? 15.391  50.314  8.099   1.00 5.67   ? 77  ILE B N   1 
ATOM   3132  C CA  . ILE B  2 77  ? 16.403  50.419  9.139   1.00 4.33   ? 77  ILE B CA  1 
ATOM   3133  C C   . ILE B  2 77  ? 16.255  49.280  10.166  1.00 3.99   ? 77  ILE B C   1 
ATOM   3134  O O   . ILE B  2 77  ? 17.234  48.633  10.514  1.00 3.57   ? 77  ILE B O   1 
ATOM   3135  C CB  . ILE B  2 77  ? 16.304  51.826  9.776   1.00 4.77   ? 77  ILE B CB  1 
ATOM   3136  C CG1 . ILE B  2 77  ? 17.282  51.956  10.921  1.00 3.99   ? 77  ILE B CG1 1 
ATOM   3137  C CG2 . ILE B  2 77  ? 14.890  52.078  10.281  1.00 6.28   ? 77  ILE B CG2 1 
ATOM   3138  C CD1 . ILE B  2 77  ? 18.681  52.223  10.361  1.00 4.25   ? 77  ILE B CD1 1 
ATOM   3139  N N   . GLN B  2 78  ? 15.020  48.897  10.522  1.00 3.64   ? 78  GLN B N   1 
ATOM   3140  C CA  . GLN B  2 78  ? 14.825  47.849  11.506  1.00 4.06   ? 78  GLN B CA  1 
ATOM   3141  C C   . GLN B  2 78  ? 15.278  46.499  10.954  1.00 4.65   ? 78  GLN B C   1 
ATOM   3142  O O   . GLN B  2 78  ? 15.769  45.649  11.713  1.00 5.66   ? 78  GLN B O   1 
ATOM   3143  C CB  . GLN B  2 78  ? 13.368  47.808  11.877  1.00 4.01   ? 78  GLN B CB  1 
ATOM   3144  C CG  . GLN B  2 78  ? 13.139  46.792  12.953  1.00 5.00   ? 78  GLN B CG  1 
ATOM   3145  C CD  . GLN B  2 78  ? 11.681  46.524  13.239  1.00 5.75   ? 78  GLN B CD  1 
ATOM   3146  O OE1 . GLN B  2 78  ? 11.204  45.408  13.026  1.00 6.34   ? 78  GLN B OE1 1 
ATOM   3147  N NE2 . GLN B  2 78  ? 10.937  47.488  13.763  1.00 5.74   ? 78  GLN B NE2 1 
ATOM   3148  N N   . ASP B  2 79  ? 15.090  46.299  9.640   1.00 4.57   ? 79  ASP B N   1 
ATOM   3149  C CA  . ASP B  2 79  ? 15.544  45.121  8.908   1.00 4.39   ? 79  ASP B CA  1 
ATOM   3150  C C   . ASP B  2 79  ? 17.059  44.965  9.053   1.00 4.05   ? 79  ASP B C   1 
ATOM   3151  O O   . ASP B  2 79  ? 17.620  43.874  9.283   1.00 4.28   ? 79  ASP B O   1 
ATOM   3152  C CB  . ASP B  2 79  ? 15.233  45.245  7.418   1.00 5.61   ? 79  ASP B CB  1 
ATOM   3153  C CG  . ASP B  2 79  ? 13.849  44.993  6.865   1.00 6.77   ? 79  ASP B CG  1 
ATOM   3154  O OD1 . ASP B  2 79  ? 12.919  44.678  7.613   1.00 8.37   ? 79  ASP B OD1 1 
ATOM   3155  O OD2 . ASP B  2 79  ? 13.737  45.093  5.634   1.00 6.80   ? 79  ASP B OD2 1 
ATOM   3156  N N   . LEU B  2 80  ? 17.777  46.084  8.955   1.00 2.97   ? 80  LEU B N   1 
ATOM   3157  C CA  . LEU B  2 80  ? 19.217  46.084  9.093   1.00 2.60   ? 80  LEU B CA  1 
ATOM   3158  C C   . LEU B  2 80  ? 19.638  45.802  10.533  1.00 3.03   ? 80  LEU B C   1 
ATOM   3159  O O   . LEU B  2 80  ? 20.554  45.007  10.775  1.00 2.36   ? 80  LEU B O   1 
ATOM   3160  C CB  . LEU B  2 80  ? 19.728  47.423  8.632   1.00 2.29   ? 80  LEU B CB  1 
ATOM   3161  C CG  . LEU B  2 80  ? 21.210  47.756  8.639   1.00 2.14   ? 80  LEU B CG  1 
ATOM   3162  C CD1 . LEU B  2 80  ? 22.045  46.832  7.775   1.00 2.00   ? 80  LEU B CD1 1 
ATOM   3163  C CD2 . LEU B  2 80  ? 21.316  49.162  8.135   1.00 2.00   ? 80  LEU B CD2 1 
ATOM   3164  N N   . GLU B  2 81  ? 18.969  46.412  11.508  1.00 3.27   ? 81  GLU B N   1 
ATOM   3165  C CA  . GLU B  2 81  ? 19.265  46.140  12.903  1.00 3.99   ? 81  GLU B CA  1 
ATOM   3166  C C   . GLU B  2 81  ? 19.132  44.666  13.219  1.00 3.92   ? 81  GLU B C   1 
ATOM   3167  O O   . GLU B  2 81  ? 20.037  44.083  13.809  1.00 4.44   ? 81  GLU B O   1 
ATOM   3168  C CB  . GLU B  2 81  ? 18.330  46.896  13.795  1.00 4.73   ? 81  GLU B CB  1 
ATOM   3169  C CG  . GLU B  2 81  ? 18.729  48.337  13.686  1.00 6.30   ? 81  GLU B CG  1 
ATOM   3170  C CD  . GLU B  2 81  ? 17.677  49.295  14.180  1.00 7.81   ? 81  GLU B CD  1 
ATOM   3171  O OE1 . GLU B  2 81  ? 16.484  49.011  14.026  1.00 8.24   ? 81  GLU B OE1 1 
ATOM   3172  O OE2 . GLU B  2 81  ? 18.051  50.352  14.695  1.00 8.73   ? 81  GLU B OE2 1 
ATOM   3173  N N   . LYS B  2 82  ? 18.064  44.025  12.751  1.00 3.73   ? 82  LYS B N   1 
ATOM   3174  C CA  . LYS B  2 82  ? 17.905  42.626  13.000  1.00 4.93   ? 82  LYS B CA  1 
ATOM   3175  C C   . LYS B  2 82  ? 18.955  41.806  12.283  1.00 5.06   ? 82  LYS B C   1 
ATOM   3176  O O   . LYS B  2 82  ? 19.444  40.828  12.864  1.00 5.42   ? 82  LYS B O   1 
ATOM   3177  C CB  . LYS B  2 82  ? 16.561  42.173  12.567  1.00 6.43   ? 82  LYS B CB  1 
ATOM   3178  C CG  . LYS B  2 82  ? 15.500  42.844  13.374  1.00 9.40   ? 82  LYS B CG  1 
ATOM   3179  C CD  . LYS B  2 82  ? 14.214  42.096  13.101  1.00 11.77  ? 82  LYS B CD  1 
ATOM   3180  C CE  . LYS B  2 82  ? 13.098  43.063  13.446  1.00 14.81  ? 82  LYS B CE  1 
ATOM   3181  N NZ  . LYS B  2 82  ? 11.794  42.570  13.031  1.00 16.66  ? 82  LYS B NZ  1 
ATOM   3182  N N   . TYR B  2 83  ? 19.364  42.196  11.074  1.00 4.13   ? 83  TYR B N   1 
ATOM   3183  C CA  . TYR B  2 83  ? 20.380  41.442  10.346  1.00 3.58   ? 83  TYR B CA  1 
ATOM   3184  C C   . TYR B  2 83  ? 21.757  41.507  11.009  1.00 3.23   ? 83  TYR B C   1 
ATOM   3185  O O   . TYR B  2 83  ? 22.473  40.500  11.077  1.00 3.02   ? 83  TYR B O   1 
ATOM   3186  C CB  . TYR B  2 83  ? 20.499  41.980  8.951   1.00 3.15   ? 83  TYR B CB  1 
ATOM   3187  C CG  . TYR B  2 83  ? 21.284  41.102  7.987   1.00 3.22   ? 83  TYR B CG  1 
ATOM   3188  C CD1 . TYR B  2 83  ? 22.565  41.411  7.571   1.00 2.93   ? 83  TYR B CD1 1 
ATOM   3189  C CD2 . TYR B  2 83  ? 20.644  40.010  7.475   1.00 3.87   ? 83  TYR B CD2 1 
ATOM   3190  C CE1 . TYR B  2 83  ? 23.213  40.654  6.624   1.00 2.00   ? 83  TYR B CE1 1 
ATOM   3191  C CE2 . TYR B  2 83  ? 21.272  39.255  6.542   1.00 3.27   ? 83  TYR B CE2 1 
ATOM   3192  C CZ  . TYR B  2 83  ? 22.529  39.586  6.143   1.00 2.00   ? 83  TYR B CZ  1 
ATOM   3193  O OH  . TYR B  2 83  ? 23.034  38.746  5.216   1.00 2.60   ? 83  TYR B OH  1 
ATOM   3194  N N   . VAL B  2 84  ? 22.152  42.675  11.505  1.00 2.35   ? 84  VAL B N   1 
ATOM   3195  C CA  . VAL B  2 84  ? 23.433  42.810  12.154  1.00 2.00   ? 84  VAL B CA  1 
ATOM   3196  C C   . VAL B  2 84  ? 23.495  41.883  13.350  1.00 2.01   ? 84  VAL B C   1 
ATOM   3197  O O   . VAL B  2 84  ? 24.441  41.099  13.444  1.00 2.04   ? 84  VAL B O   1 
ATOM   3198  C CB  . VAL B  2 84  ? 23.634  44.264  12.563  1.00 2.00   ? 84  VAL B CB  1 
ATOM   3199  C CG1 . VAL B  2 84  ? 24.810  44.506  13.480  1.00 2.00   ? 84  VAL B CG1 1 
ATOM   3200  C CG2 . VAL B  2 84  ? 23.875  44.999  11.261  1.00 2.08   ? 84  VAL B CG2 1 
ATOM   3201  N N   . GLU B  2 85  ? 22.463  41.850  14.187  1.00 2.00   ? 85  GLU B N   1 
ATOM   3202  C CA  . GLU B  2 85  ? 22.545  41.015  15.355  1.00 2.00   ? 85  GLU B CA  1 
ATOM   3203  C C   . GLU B  2 85  ? 22.441  39.560  14.993  1.00 2.66   ? 85  GLU B C   1 
ATOM   3204  O O   . GLU B  2 85  ? 23.179  38.752  15.553  1.00 2.42   ? 85  GLU B O   1 
ATOM   3205  C CB  . GLU B  2 85  ? 21.452  41.353  16.327  1.00 2.00   ? 85  GLU B CB  1 
ATOM   3206  C CG  . GLU B  2 85  ? 21.554  40.706  17.708  1.00 2.00   ? 85  GLU B CG  1 
ATOM   3207  C CD  . GLU B  2 85  ? 22.733  41.107  18.569  1.00 2.00   ? 85  GLU B CD  1 
ATOM   3208  O OE1 . GLU B  2 85  ? 23.465  42.013  18.234  1.00 2.00   ? 85  GLU B OE1 1 
ATOM   3209  O OE2 . GLU B  2 85  ? 22.920  40.544  19.642  1.00 2.00   ? 85  GLU B OE2 1 
ATOM   3210  N N   . ASP B  2 86  ? 21.606  39.176  14.012  1.00 4.72   ? 86  ASP B N   1 
ATOM   3211  C CA  . ASP B  2 86  ? 21.460  37.763  13.696  1.00 5.45   ? 86  ASP B CA  1 
ATOM   3212  C C   . ASP B  2 86  ? 22.738  37.259  13.115  1.00 3.85   ? 86  ASP B C   1 
ATOM   3213  O O   . ASP B  2 86  ? 23.216  36.206  13.554  1.00 4.24   ? 86  ASP B O   1 
ATOM   3214  C CB  . ASP B  2 86  ? 20.343  37.478  12.707  1.00 7.83   ? 86  ASP B CB  1 
ATOM   3215  C CG  . ASP B  2 86  ? 20.233  36.006  12.283  1.00 11.02  ? 86  ASP B CG  1 
ATOM   3216  O OD1 . ASP B  2 86  ? 20.078  35.067  13.104  1.00 12.86  ? 86  ASP B OD1 1 
ATOM   3217  O OD2 . ASP B  2 86  ? 20.303  35.793  11.067  1.00 13.01  ? 86  ASP B OD2 1 
ATOM   3218  N N   . THR B  2 87  ? 23.399  38.067  12.291  1.00 3.07   ? 87  THR B N   1 
ATOM   3219  C CA  . THR B  2 87  ? 24.652  37.552  11.775  1.00 4.83   ? 87  THR B CA  1 
ATOM   3220  C C   . THR B  2 87  ? 25.730  37.537  12.854  1.00 4.41   ? 87  THR B C   1 
ATOM   3221  O O   . THR B  2 87  ? 26.589  36.653  12.854  1.00 4.94   ? 87  THR B O   1 
ATOM   3222  C CB  . THR B  2 87  ? 25.148  38.340  10.494  1.00 4.94   ? 87  THR B CB  1 
ATOM   3223  O OG1 . THR B  2 87  ? 25.510  39.638  10.802  1.00 7.09   ? 87  THR B OG1 1 
ATOM   3224  C CG2 . THR B  2 87  ? 24.030  38.445  9.476   1.00 4.88   ? 87  THR B CG2 1 
ATOM   3225  N N   . LYS B  2 88  ? 25.657  38.427  13.843  1.00 3.64   ? 88  LYS B N   1 
ATOM   3226  C CA  . LYS B  2 88  ? 26.613  38.402  14.914  1.00 2.09   ? 88  LYS B CA  1 
ATOM   3227  C C   . LYS B  2 88  ? 26.443  37.129  15.709  1.00 2.02   ? 88  LYS B C   1 
ATOM   3228  O O   . LYS B  2 88  ? 27.421  36.419  15.929  1.00 3.46   ? 88  LYS B O   1 
ATOM   3229  C CB  . LYS B  2 88  ? 26.365  39.587  15.737  1.00 2.08   ? 88  LYS B CB  1 
ATOM   3230  C CG  . LYS B  2 88  ? 27.274  39.664  16.904  1.00 2.25   ? 88  LYS B CG  1 
ATOM   3231  C CD  . LYS B  2 88  ? 26.771  40.851  17.670  1.00 2.00   ? 88  LYS B CD  1 
ATOM   3232  C CE  . LYS B  2 88  ? 27.098  40.547  19.091  1.00 2.24   ? 88  LYS B CE  1 
ATOM   3233  N NZ  . LYS B  2 88  ? 27.191  41.794  19.792  1.00 2.52   ? 88  LYS B NZ  1 
ATOM   3234  N N   . ILE B  2 89  ? 25.205  36.794  16.070  1.00 2.00   ? 89  ILE B N   1 
ATOM   3235  C CA  . ILE B  2 89  ? 24.894  35.610  16.846  1.00 2.00   ? 89  ILE B CA  1 
ATOM   3236  C C   . ILE B  2 89  ? 25.314  34.358  16.108  1.00 2.00   ? 89  ILE B C   1 
ATOM   3237  O O   . ILE B  2 89  ? 25.820  33.411  16.708  1.00 2.14   ? 89  ILE B O   1 
ATOM   3238  C CB  . ILE B  2 89  ? 23.384  35.575  17.142  1.00 2.00   ? 89  ILE B CB  1 
ATOM   3239  C CG1 . ILE B  2 89  ? 23.089  36.663  18.138  1.00 2.00   ? 89  ILE B CG1 1 
ATOM   3240  C CG2 . ILE B  2 89  ? 22.941  34.226  17.694  1.00 2.30   ? 89  ILE B CG2 1 
ATOM   3241  C CD1 . ILE B  2 89  ? 21.603  36.931  18.424  1.00 2.00   ? 89  ILE B CD1 1 
ATOM   3242  N N   . ASP B  2 90  ? 25.120  34.287  14.816  1.00 2.00   ? 90  ASP B N   1 
ATOM   3243  C CA  . ASP B  2 90  ? 25.484  33.062  14.145  1.00 3.85   ? 90  ASP B CA  1 
ATOM   3244  C C   . ASP B  2 90  ? 26.988  32.895  14.077  1.00 3.50   ? 90  ASP B C   1 
ATOM   3245  O O   . ASP B  2 90  ? 27.515  31.778  14.206  1.00 4.01   ? 90  ASP B O   1 
ATOM   3246  C CB  . ASP B  2 90  ? 24.915  33.025  12.730  1.00 5.32   ? 90  ASP B CB  1 
ATOM   3247  C CG  . ASP B  2 90  ? 23.449  32.724  12.580  1.00 5.63   ? 90  ASP B CG  1 
ATOM   3248  O OD1 . ASP B  2 90  ? 22.739  32.412  13.512  1.00 6.17   ? 90  ASP B OD1 1 
ATOM   3249  O OD2 . ASP B  2 90  ? 22.991  32.772  11.464  1.00 7.55   ? 90  ASP B OD2 1 
ATOM   3250  N N   . LEU B  2 91  ? 27.716  33.996  13.947  1.00 2.85   ? 91  LEU B N   1 
ATOM   3251  C CA  . LEU B  2 91  ? 29.161  33.902  13.873  1.00 2.16   ? 91  LEU B CA  1 
ATOM   3252  C C   . LEU B  2 91  ? 29.713  33.493  15.208  1.00 2.00   ? 91  LEU B C   1 
ATOM   3253  O O   . LEU B  2 91  ? 30.527  32.578  15.258  1.00 2.00   ? 91  LEU B O   1 
ATOM   3254  C CB  . LEU B  2 91  ? 29.758  35.238  13.442  1.00 2.43   ? 91  LEU B CB  1 
ATOM   3255  C CG  . LEU B  2 91  ? 29.732  35.490  11.940  1.00 2.00   ? 91  LEU B CG  1 
ATOM   3256  C CD1 . LEU B  2 91  ? 30.216  36.850  11.654  1.00 2.00   ? 91  LEU B CD1 1 
ATOM   3257  C CD2 . LEU B  2 91  ? 30.655  34.573  11.242  1.00 2.00   ? 91  LEU B CD2 1 
ATOM   3258  N N   . TRP B  2 92  ? 29.233  34.069  16.310  1.00 2.14   ? 92  TRP B N   1 
ATOM   3259  C CA  . TRP B  2 92  ? 29.715  33.637  17.598  1.00 2.11   ? 92  TRP B CA  1 
ATOM   3260  C C   . TRP B  2 92  ? 29.274  32.223  17.903  1.00 2.42   ? 92  TRP B C   1 
ATOM   3261  O O   . TRP B  2 92  ? 30.060  31.503  18.521  1.00 3.69   ? 92  TRP B O   1 
ATOM   3262  C CB  . TRP B  2 92  ? 29.247  34.570  18.705  1.00 2.34   ? 92  TRP B CB  1 
ATOM   3263  C CG  . TRP B  2 92  ? 30.282  35.662  18.847  1.00 2.00   ? 92  TRP B CG  1 
ATOM   3264  C CD1 . TRP B  2 92  ? 30.013  36.930  18.438  1.00 2.00   ? 92  TRP B CD1 1 
ATOM   3265  C CD2 . TRP B  2 92  ? 31.560  35.498  19.321  1.00 2.39   ? 92  TRP B CD2 1 
ATOM   3266  N NE1 . TRP B  2 92  ? 31.134  37.570  18.638  1.00 2.33   ? 92  TRP B NE1 1 
ATOM   3267  C CE2 . TRP B  2 92  ? 32.072  36.762  19.160  1.00 2.20   ? 92  TRP B CE2 1 
ATOM   3268  C CE3 . TRP B  2 92  ? 32.375  34.515  19.839  1.00 3.20   ? 92  TRP B CE3 1 
ATOM   3269  C CZ2 . TRP B  2 92  ? 33.372  37.053  19.511  1.00 2.00   ? 92  TRP B CZ2 1 
ATOM   3270  C CZ3 . TRP B  2 92  ? 33.686  34.807  20.189  1.00 2.43   ? 92  TRP B CZ3 1 
ATOM   3271  C CH2 . TRP B  2 92  ? 34.174  36.067  20.029  1.00 2.00   ? 92  TRP B CH2 1 
ATOM   3272  N N   . SER B  2 93  ? 28.117  31.749  17.434  1.00 2.00   ? 93  SER B N   1 
ATOM   3273  C CA  . SER B  2 93  ? 27.743  30.388  17.721  1.00 2.00   ? 93  SER B CA  1 
ATOM   3274  C C   . SER B  2 93  ? 28.654  29.436  17.019  1.00 2.00   ? 93  SER B C   1 
ATOM   3275  O O   . SER B  2 93  ? 29.069  28.456  17.648  1.00 2.00   ? 93  SER B O   1 
ATOM   3276  C CB  . SER B  2 93  ? 26.329  30.152  17.309  1.00 2.62   ? 93  SER B CB  1 
ATOM   3277  O OG  . SER B  2 93  ? 25.438  30.852  18.187  1.00 4.23   ? 93  SER B OG  1 
ATOM   3278  N N   . TYR B  2 94  ? 29.053  29.764  15.783  1.00 2.00   ? 94  TYR B N   1 
ATOM   3279  C CA  . TYR B  2 94  ? 29.979  28.929  15.024  1.00 2.00   ? 94  TYR B CA  1 
ATOM   3280  C C   . TYR B  2 94  ? 31.258  28.845  15.784  1.00 2.00   ? 94  TYR B C   1 
ATOM   3281  O O   . TYR B  2 94  ? 31.758  27.757  15.992  1.00 2.00   ? 94  TYR B O   1 
ATOM   3282  C CB  . TYR B  2 94  ? 30.276  29.506  13.655  1.00 2.00   ? 94  TYR B CB  1 
ATOM   3283  C CG  . TYR B  2 94  ? 31.334  28.772  12.854  1.00 2.00   ? 94  TYR B CG  1 
ATOM   3284  C CD1 . TYR B  2 94  ? 32.538  29.356  12.663  1.00 3.35   ? 94  TYR B CD1 1 
ATOM   3285  C CD2 . TYR B  2 94  ? 31.159  27.527  12.370  1.00 2.15   ? 94  TYR B CD2 1 
ATOM   3286  C CE1 . TYR B  2 94  ? 33.553  28.700  12.012  1.00 3.92   ? 94  TYR B CE1 1 
ATOM   3287  C CE2 . TYR B  2 94  ? 32.167  26.852  11.721  1.00 2.62   ? 94  TYR B CE2 1 
ATOM   3288  C CZ  . TYR B  2 94  ? 33.372  27.439  11.548  1.00 3.33   ? 94  TYR B CZ  1 
ATOM   3289  O OH  . TYR B  2 94  ? 34.437  26.771  10.987  1.00 4.40   ? 94  TYR B OH  1 
ATOM   3290  N N   . ASN B  2 95  ? 31.741  29.974  16.264  1.00 3.38   ? 95  ASN B N   1 
ATOM   3291  C CA  . ASN B  2 95  ? 32.949  30.000  17.057  1.00 4.53   ? 95  ASN B CA  1 
ATOM   3292  C C   . ASN B  2 95  ? 32.829  29.163  18.307  1.00 4.36   ? 95  ASN B C   1 
ATOM   3293  O O   . ASN B  2 95  ? 33.730  28.348  18.511  1.00 5.44   ? 95  ASN B O   1 
ATOM   3294  C CB  . ASN B  2 95  ? 33.341  31.407  17.515  1.00 6.93   ? 95  ASN B CB  1 
ATOM   3295  C CG  . ASN B  2 95  ? 33.770  32.336  16.387  1.00 8.37   ? 95  ASN B CG  1 
ATOM   3296  O OD1 . ASN B  2 95  ? 33.884  31.922  15.236  1.00 8.34   ? 95  ASN B OD1 1 
ATOM   3297  N ND2 . ASN B  2 95  ? 33.984  33.633  16.596  1.00 8.94   ? 95  ASN B ND2 1 
ATOM   3298  N N   . ALA B  2 96  ? 31.767  29.242  19.129  1.00 3.02   ? 96  ALA B N   1 
ATOM   3299  C CA  . ALA B  2 96  ? 31.750  28.429  20.332  1.00 2.56   ? 96  ALA B CA  1 
ATOM   3300  C C   . ALA B  2 96  ? 31.754  26.940  19.982  1.00 3.69   ? 96  ALA B C   1 
ATOM   3301  O O   . ALA B  2 96  ? 32.482  26.140  20.580  1.00 4.50   ? 96  ALA B O   1 
ATOM   3302  C CB  . ALA B  2 96  ? 30.537  28.726  21.141  1.00 2.00   ? 96  ALA B CB  1 
ATOM   3303  N N   . GLU B  2 97  ? 31.053  26.549  18.923  1.00 4.27   ? 97  GLU B N   1 
ATOM   3304  C CA  . GLU B  2 97  ? 30.951  25.150  18.567  1.00 4.85   ? 97  GLU B CA  1 
ATOM   3305  C C   . GLU B  2 97  ? 32.271  24.607  18.026  1.00 4.30   ? 97  GLU B C   1 
ATOM   3306  O O   . GLU B  2 97  ? 32.736  23.523  18.441  1.00 6.21   ? 97  GLU B O   1 
ATOM   3307  C CB  . GLU B  2 97  ? 29.817  25.027  17.575  1.00 5.71   ? 97  GLU B CB  1 
ATOM   3308  C CG  . GLU B  2 97  ? 29.545  23.663  17.013  1.00 8.27   ? 97  GLU B CG  1 
ATOM   3309  C CD  . GLU B  2 97  ? 28.675  22.702  17.776  1.00 10.55  ? 97  GLU B CD  1 
ATOM   3310  O OE1 . GLU B  2 97  ? 28.988  21.507  17.764  1.00 12.18  ? 97  GLU B OE1 1 
ATOM   3311  O OE2 . GLU B  2 97  ? 27.601  23.047  18.261  1.00 11.88  ? 97  GLU B OE2 1 
ATOM   3312  N N   . LEU B  2 98  ? 32.947  25.332  17.156  1.00 2.75   ? 98  LEU B N   1 
ATOM   3313  C CA  . LEU B  2 98  ? 34.214  24.836  16.659  1.00 2.29   ? 98  LEU B CA  1 
ATOM   3314  C C   . LEU B  2 98  ? 35.212  24.841  17.789  1.00 2.47   ? 98  LEU B C   1 
ATOM   3315  O O   . LEU B  2 98  ? 36.009  23.913  17.867  1.00 3.15   ? 98  LEU B O   1 
ATOM   3316  C CB  . LEU B  2 98  ? 34.775  25.699  15.523  1.00 2.32   ? 98  LEU B CB  1 
ATOM   3317  C CG  . LEU B  2 98  ? 36.190  25.484  14.986  1.00 2.00   ? 98  LEU B CG  1 
ATOM   3318  C CD1 . LEU B  2 98  ? 36.406  24.150  14.321  1.00 2.00   ? 98  LEU B CD1 1 
ATOM   3319  C CD2 . LEU B  2 98  ? 36.398  26.534  13.953  1.00 2.00   ? 98  LEU B CD2 1 
ATOM   3320  N N   . LEU B  2 99  ? 35.179  25.819  18.696  1.00 2.28   ? 99  LEU B N   1 
ATOM   3321  C CA  . LEU B  2 99  ? 36.143  25.875  19.788  1.00 2.23   ? 99  LEU B CA  1 
ATOM   3322  C C   . LEU B  2 99  ? 36.026  24.654  20.661  1.00 3.19   ? 99  LEU B C   1 
ATOM   3323  O O   . LEU B  2 99  ? 37.028  23.969  20.809  1.00 3.26   ? 99  LEU B O   1 
ATOM   3324  C CB  . LEU B  2 99  ? 35.930  27.079  20.680  1.00 2.34   ? 99  LEU B CB  1 
ATOM   3325  C CG  . LEU B  2 99  ? 36.715  27.245  21.945  1.00 2.00   ? 99  LEU B CG  1 
ATOM   3326  C CD1 . LEU B  2 99  ? 38.135  27.531  21.610  1.00 2.00   ? 99  LEU B CD1 1 
ATOM   3327  C CD2 . LEU B  2 99  ? 36.130  28.370  22.753  1.00 2.00   ? 99  LEU B CD2 1 
ATOM   3328  N N   . VAL B  2 100 ? 34.851  24.283  21.198  1.00 3.82   ? 100 VAL B N   1 
ATOM   3329  C CA  . VAL B  2 100 ? 34.857  23.131  22.088  1.00 3.97   ? 100 VAL B CA  1 
ATOM   3330  C C   . VAL B  2 100 ? 35.162  21.856  21.307  1.00 4.64   ? 100 VAL B C   1 
ATOM   3331  O O   . VAL B  2 100 ? 35.786  20.946  21.855  1.00 4.89   ? 100 VAL B O   1 
ATOM   3332  C CB  . VAL B  2 100 ? 33.510  22.942  22.869  1.00 3.25   ? 100 VAL B CB  1 
ATOM   3333  C CG1 . VAL B  2 100 ? 33.083  24.314  23.298  1.00 2.95   ? 100 VAL B CG1 1 
ATOM   3334  C CG2 . VAL B  2 100 ? 32.438  22.239  22.105  1.00 3.38   ? 100 VAL B CG2 1 
ATOM   3335  N N   . ALA B  2 101 ? 34.798  21.755  20.025  1.00 5.08   ? 101 ALA B N   1 
ATOM   3336  C CA  . ALA B  2 101 ? 35.121  20.543  19.291  1.00 6.06   ? 101 ALA B CA  1 
ATOM   3337  C C   . ALA B  2 101 ? 36.642  20.373  19.153  1.00 6.48   ? 101 ALA B C   1 
ATOM   3338  O O   . ALA B  2 101 ? 37.219  19.362  19.577  1.00 7.93   ? 101 ALA B O   1 
ATOM   3339  C CB  . ALA B  2 101 ? 34.490  20.619  17.936  1.00 5.54   ? 101 ALA B CB  1 
ATOM   3340  N N   . LEU B  2 102 ? 37.303  21.404  18.640  1.00 5.85   ? 102 LEU B N   1 
ATOM   3341  C CA  . LEU B  2 102 ? 38.748  21.486  18.487  1.00 5.23   ? 102 LEU B CA  1 
ATOM   3342  C C   . LEU B  2 102 ? 39.432  21.167  19.815  1.00 5.40   ? 102 LEU B C   1 
ATOM   3343  O O   . LEU B  2 102 ? 40.265  20.263  19.920  1.00 5.90   ? 102 LEU B O   1 
ATOM   3344  C CB  . LEU B  2 102 ? 39.041  22.889  18.045  1.00 4.51   ? 102 LEU B CB  1 
ATOM   3345  C CG  . LEU B  2 102 ? 39.989  23.198  16.960  1.00 4.35   ? 102 LEU B CG  1 
ATOM   3346  C CD1 . LEU B  2 102 ? 39.624  22.483  15.698  1.00 3.98   ? 102 LEU B CD1 1 
ATOM   3347  C CD2 . LEU B  2 102 ? 39.890  24.674  16.679  1.00 5.30   ? 102 LEU B CD2 1 
ATOM   3348  N N   . GLU B  2 103 ? 39.025  21.869  20.865  1.00 5.11   ? 103 GLU B N   1 
ATOM   3349  C CA  . GLU B  2 103 ? 39.525  21.639  22.187  1.00 5.23   ? 103 GLU B CA  1 
ATOM   3350  C C   . GLU B  2 103 ? 39.369  20.183  22.666  1.00 6.09   ? 103 GLU B C   1 
ATOM   3351  O O   . GLU B  2 103 ? 40.376  19.539  23.003  1.00 6.33   ? 103 GLU B O   1 
ATOM   3352  C CB  . GLU B  2 103 ? 38.805  22.555  23.142  1.00 5.39   ? 103 GLU B CB  1 
ATOM   3353  C CG  . GLU B  2 103 ? 39.274  23.970  23.100  1.00 5.40   ? 103 GLU B CG  1 
ATOM   3354  C CD  . GLU B  2 103 ? 40.612  24.179  23.771  1.00 7.47   ? 103 GLU B CD  1 
ATOM   3355  O OE1 . GLU B  2 103 ? 40.938  25.307  24.136  1.00 9.33   ? 103 GLU B OE1 1 
ATOM   3356  O OE2 . GLU B  2 103 ? 41.363  23.225  23.958  1.00 8.17   ? 103 GLU B OE2 1 
ATOM   3357  N N   . ASN B  2 104 ? 38.149  19.613  22.631  1.00 4.95   ? 104 ASN B N   1 
ATOM   3358  C CA  . ASN B  2 104 ? 37.865  18.291  23.145  1.00 4.73   ? 104 ASN B CA  1 
ATOM   3359  C C   . ASN B  2 104 ? 38.677  17.239  22.473  1.00 5.49   ? 104 ASN B C   1 
ATOM   3360  O O   . ASN B  2 104 ? 39.258  16.347  23.111  1.00 6.17   ? 104 ASN B O   1 
ATOM   3361  C CB  . ASN B  2 104 ? 36.430  17.938  22.971  1.00 5.30   ? 104 ASN B CB  1 
ATOM   3362  C CG  . ASN B  2 104 ? 35.571  18.679  23.980  1.00 7.11   ? 104 ASN B CG  1 
ATOM   3363  O OD1 . ASN B  2 104 ? 36.068  19.215  24.979  1.00 6.90   ? 104 ASN B OD1 1 
ATOM   3364  N ND2 . ASN B  2 104 ? 34.257  18.765  23.803  1.00 7.65   ? 104 ASN B ND2 1 
ATOM   3365  N N   . GLN B  2 105 ? 38.835  17.444  21.179  1.00 6.32   ? 105 GLN B N   1 
ATOM   3366  C CA  . GLN B  2 105 ? 39.651  16.585  20.361  1.00 6.95   ? 105 GLN B CA  1 
ATOM   3367  C C   . GLN B  2 105 ? 41.069  16.580  20.914  1.00 6.54   ? 105 GLN B C   1 
ATOM   3368  O O   . GLN B  2 105 ? 41.621  15.518  21.222  1.00 5.65   ? 105 GLN B O   1 
ATOM   3369  C CB  . GLN B  2 105 ? 39.597  17.141  18.971  1.00 8.41   ? 105 GLN B CB  1 
ATOM   3370  C CG  . GLN B  2 105 ? 40.384  16.318  17.982  1.00 10.89  ? 105 GLN B CG  1 
ATOM   3371  C CD  . GLN B  2 105 ? 39.732  14.967  17.740  1.00 11.14  ? 105 GLN B CD  1 
ATOM   3372  O OE1 . GLN B  2 105 ? 38.775  14.828  16.975  1.00 10.40  ? 105 GLN B OE1 1 
ATOM   3373  N NE2 . GLN B  2 105 ? 40.249  13.945  18.386  1.00 12.22  ? 105 GLN B NE2 1 
ATOM   3374  N N   . HIS B  2 106 ? 41.590  17.790  21.151  1.00 6.25   ? 106 HIS B N   1 
ATOM   3375  C CA  . HIS B  2 106 ? 42.941  17.952  21.651  1.00 6.46   ? 106 HIS B CA  1 
ATOM   3376  C C   . HIS B  2 106 ? 43.100  17.428  23.075  1.00 7.27   ? 106 HIS B C   1 
ATOM   3377  O O   . HIS B  2 106 ? 44.202  16.957  23.394  1.00 8.62   ? 106 HIS B O   1 
ATOM   3378  C CB  . HIS B  2 106 ? 43.350  19.431  21.616  1.00 5.55   ? 106 HIS B CB  1 
ATOM   3379  C CG  . HIS B  2 106 ? 44.707  19.751  22.240  1.00 4.86   ? 106 HIS B CG  1 
ATOM   3380  N ND1 . HIS B  2 106 ? 44.804  20.579  23.275  1.00 4.65   ? 106 HIS B ND1 1 
ATOM   3381  C CD2 . HIS B  2 106 ? 45.905  19.290  21.798  1.00 4.01   ? 106 HIS B CD2 1 
ATOM   3382  C CE1 . HIS B  2 106 ? 46.106  20.644  23.477  1.00 4.87   ? 106 HIS B CE1 1 
ATOM   3383  N NE2 . HIS B  2 106 ? 46.745  19.887  22.607  1.00 4.42   ? 106 HIS B NE2 1 
ATOM   3384  N N   . THR B  2 107 ? 42.078  17.532  23.945  1.00 5.95   ? 107 THR B N   1 
ATOM   3385  C CA  . THR B  2 107 ? 42.205  17.055  25.306  1.00 5.60   ? 107 THR B CA  1 
ATOM   3386  C C   . THR B  2 107 ? 42.302  15.541  25.311  1.00 6.02   ? 107 THR B C   1 
ATOM   3387  O O   . THR B  2 107 ? 43.132  14.976  26.047  1.00 6.84   ? 107 THR B O   1 
ATOM   3388  C CB  . THR B  2 107 ? 41.007  17.519  26.116  1.00 5.59   ? 107 THR B CB  1 
ATOM   3389  O OG1 . THR B  2 107 ? 41.045  18.953  26.031  1.00 5.84   ? 107 THR B OG1 1 
ATOM   3390  C CG2 . THR B  2 107 ? 41.006  17.001  27.556  1.00 6.07   ? 107 THR B CG2 1 
ATOM   3391  N N   . ILE B  2 108 ? 41.536  14.870  24.447  1.00 5.61   ? 108 ILE B N   1 
ATOM   3392  C CA  . ILE B  2 108 ? 41.632  13.416  24.370  1.00 5.25   ? 108 ILE B CA  1 
ATOM   3393  C C   . ILE B  2 108 ? 43.024  13.003  23.875  1.00 5.79   ? 108 ILE B C   1 
ATOM   3394  O O   . ILE B  2 108 ? 43.565  11.994  24.370  1.00 6.80   ? 108 ILE B O   1 
ATOM   3395  C CB  . ILE B  2 108 ? 40.491  12.888  23.458  1.00 2.73   ? 108 ILE B CB  1 
ATOM   3396  C CG1 . ILE B  2 108 ? 39.209  13.051  24.208  1.00 2.04   ? 108 ILE B CG1 1 
ATOM   3397  C CG2 . ILE B  2 108 ? 40.617  11.427  23.136  1.00 2.00   ? 108 ILE B CG2 1 
ATOM   3398  C CD1 . ILE B  2 108 ? 37.978  12.944  23.321  1.00 2.00   ? 108 ILE B CD1 1 
ATOM   3399  N N   . ASP B  2 109 ? 43.649  13.754  22.964  1.00 5.42   ? 109 ASP B N   1 
ATOM   3400  C CA  . ASP B  2 109 ? 44.964  13.337  22.518  1.00 6.22   ? 109 ASP B CA  1 
ATOM   3401  C C   . ASP B  2 109 ? 46.056  13.633  23.534  1.00 5.79   ? 109 ASP B C   1 
ATOM   3402  O O   . ASP B  2 109 ? 46.978  12.833  23.764  1.00 4.70   ? 109 ASP B O   1 
ATOM   3403  C CB  . ASP B  2 109 ? 45.249  14.005  21.179  1.00 7.70   ? 109 ASP B CB  1 
ATOM   3404  C CG  . ASP B  2 109 ? 44.496  13.339  20.031  1.00 9.12   ? 109 ASP B CG  1 
ATOM   3405  O OD1 . ASP B  2 109 ? 44.259  12.122  20.050  1.00 10.19  ? 109 ASP B OD1 1 
ATOM   3406  O OD2 . ASP B  2 109 ? 44.133  14.028  19.085  1.00 9.99   ? 109 ASP B OD2 1 
ATOM   3407  N N   . LEU B  2 110 ? 45.927  14.765  24.216  1.00 5.39   ? 110 LEU B N   1 
ATOM   3408  C CA  . LEU B  2 110 ? 46.819  15.190  25.271  1.00 4.16   ? 110 LEU B CA  1 
ATOM   3409  C C   . LEU B  2 110 ? 46.795  14.181  26.416  1.00 4.98   ? 110 LEU B C   1 
ATOM   3410  O O   . LEU B  2 110 ? 47.858  13.687  26.789  1.00 6.71   ? 110 LEU B O   1 
ATOM   3411  C CB  . LEU B  2 110 ? 46.334  16.555  25.650  1.00 3.67   ? 110 LEU B CB  1 
ATOM   3412  C CG  . LEU B  2 110 ? 46.776  17.420  26.787  1.00 4.86   ? 110 LEU B CG  1 
ATOM   3413  C CD1 . LEU B  2 110 ? 46.064  18.738  26.586  1.00 4.67   ? 110 LEU B CD1 1 
ATOM   3414  C CD2 . LEU B  2 110 ? 46.378  16.885  28.165  1.00 5.66   ? 110 LEU B CD2 1 
ATOM   3415  N N   . THR B  2 111 ? 45.647  13.786  26.980  1.00 4.60   ? 111 THR B N   1 
ATOM   3416  C CA  . THR B  2 111 ? 45.648  12.796  28.048  1.00 4.73   ? 111 THR B CA  1 
ATOM   3417  C C   . THR B  2 111 ? 46.156  11.431  27.557  1.00 5.61   ? 111 THR B C   1 
ATOM   3418  O O   . THR B  2 111 ? 46.921  10.718  28.210  1.00 7.46   ? 111 THR B O   1 
ATOM   3419  C CB  . THR B  2 111 ? 44.238  12.697  28.602  1.00 4.23   ? 111 THR B CB  1 
ATOM   3420  O OG1 . THR B  2 111 ? 43.326  12.444  27.539  1.00 3.91   ? 111 THR B OG1 1 
ATOM   3421  C CG2 . THR B  2 111 ? 43.842  14.007  29.266  1.00 4.12   ? 111 THR B CG2 1 
ATOM   3422  N N   . GLY B  2 112 ? 45.821  11.089  26.315  1.00 5.55   ? 112 GLY B N   1 
ATOM   3423  C CA  . GLY B  2 112 ? 46.346  9.877   25.698  1.00 6.19   ? 112 GLY B CA  1 
ATOM   3424  C C   . GLY B  2 112 ? 47.861  9.916   25.539  1.00 6.67   ? 112 GLY B C   1 
ATOM   3425  O O   . GLY B  2 112 ? 48.537  8.871   25.664  1.00 6.71   ? 112 GLY B O   1 
ATOM   3426  N N   . SER B  2 113 ? 48.432  11.091  25.250  1.00 6.33   ? 113 SER B N   1 
ATOM   3427  C CA  . SER B  2 113 ? 49.828  11.249  25.079  1.00 7.24   ? 113 SER B CA  1 
ATOM   3428  C C   . SER B  2 113 ? 50.517  10.926  26.384  1.00 7.91   ? 113 SER B C   1 
ATOM   3429  O O   . SER B  2 113 ? 51.408  10.079  26.369  1.00 8.02   ? 113 SER B O   1 
ATOM   3430  C CB  . SER B  2 113 ? 50.100  12.689  24.675  1.00 8.48   ? 113 SER B CB  1 
ATOM   3431  O OG  . SER B  2 113 ? 51.445  13.152  24.742  1.00 9.90   ? 113 SER B OG  1 
ATOM   3432  N N   . GLU B  2 114 ? 50.014  11.502  27.493  1.00 8.81   ? 114 GLU B N   1 
ATOM   3433  C CA  . GLU B  2 114 ? 50.585  11.280  28.811  1.00 9.10   ? 114 GLU B CA  1 
ATOM   3434  C C   . GLU B  2 114 ? 50.584  9.826   29.189  1.00 8.31   ? 114 GLU B C   1 
ATOM   3435  O O   . GLU B  2 114 ? 51.578  9.356   29.755  1.00 8.41   ? 114 GLU B O   1 
ATOM   3436  C CB  . GLU B  2 114 ? 49.826  12.068  29.854  1.00 10.37  ? 114 GLU B CB  1 
ATOM   3437  C CG  . GLU B  2 114 ? 50.011  13.590  29.691  1.00 12.39  ? 114 GLU B CG  1 
ATOM   3438  C CD  . GLU B  2 114 ? 51.467  14.079  29.593  1.00 13.48  ? 114 GLU B CD  1 
ATOM   3439  O OE1 . GLU B  2 114 ? 51.733  14.972  28.773  1.00 14.53  ? 114 GLU B OE1 1 
ATOM   3440  O OE2 . GLU B  2 114 ? 52.359  13.569  30.278  1.00 13.01  ? 114 GLU B OE2 1 
ATOM   3441  N N   . MET B  2 115 ? 49.539  9.075   28.782  1.00 6.87   ? 115 MET B N   1 
ATOM   3442  C CA  . MET B  2 115 ? 49.532  7.639   29.044  1.00 6.06   ? 115 MET B CA  1 
ATOM   3443  C C   . MET B  2 115 ? 50.736  6.998   28.380  1.00 5.39   ? 115 MET B C   1 
ATOM   3444  O O   . MET B  2 115 ? 51.603  6.420   29.023  1.00 4.56   ? 115 MET B O   1 
ATOM   3445  C CB  . MET B  2 115 ? 48.286  6.931   28.502  1.00 4.95   ? 115 MET B CB  1 
ATOM   3446  C CG  . MET B  2 115 ? 48.236  5.422   28.788  1.00 4.62   ? 115 MET B CG  1 
ATOM   3447  S SD  . MET B  2 115 ? 47.987  5.064   30.545  1.00 6.14   ? 115 MET B SD  1 
ATOM   3448  C CE  . MET B  2 115 ? 49.624  4.586   30.993  1.00 6.00   ? 115 MET B CE  1 
ATOM   3449  N N   . ASN B  2 116 ? 50.847  7.223   27.083  1.00 6.23   ? 116 ASN B N   1 
ATOM   3450  C CA  . ASN B  2 116 ? 51.871  6.607   26.288  1.00 5.92   ? 116 ASN B CA  1 
ATOM   3451  C C   . ASN B  2 116 ? 53.235  7.075   26.721  1.00 5.57   ? 116 ASN B C   1 
ATOM   3452  O O   . ASN B  2 116 ? 54.167  6.292   26.799  1.00 5.94   ? 116 ASN B O   1 
ATOM   3453  C CB  . ASN B  2 116 ? 51.582  6.946   24.869  1.00 6.61   ? 116 ASN B CB  1 
ATOM   3454  C CG  . ASN B  2 116 ? 52.587  6.319   23.936  1.00 8.13   ? 116 ASN B CG  1 
ATOM   3455  O OD1 . ASN B  2 116 ? 52.561  5.130   23.619  1.00 8.73   ? 116 ASN B OD1 1 
ATOM   3456  N ND2 . ASN B  2 116 ? 53.500  7.159   23.465  1.00 8.39   ? 116 ASN B ND2 1 
ATOM   3457  N N   . LYS B  2 117 ? 53.391  8.310   27.121  1.00 6.06   ? 117 LYS B N   1 
ATOM   3458  C CA  . LYS B  2 117 ? 54.676  8.772   27.630  1.00 7.27   ? 117 LYS B CA  1 
ATOM   3459  C C   . LYS B  2 117 ? 55.062  8.029   28.906  1.00 7.90   ? 117 LYS B C   1 
ATOM   3460  O O   . LYS B  2 117 ? 56.211  7.602   28.986  1.00 9.02   ? 117 LYS B O   1 
ATOM   3461  C CB  . LYS B  2 117 ? 54.611  10.280  27.895  1.00 7.15   ? 117 LYS B CB  1 
ATOM   3462  C CG  . LYS B  2 117 ? 54.734  10.976  26.561  1.00 7.47   ? 117 LYS B CG  1 
ATOM   3463  C CD  . LYS B  2 117 ? 54.084  12.326  26.497  1.00 7.55   ? 117 LYS B CD  1 
ATOM   3464  C CE  . LYS B  2 117 ? 54.823  13.419  27.221  1.00 7.65   ? 117 LYS B CE  1 
ATOM   3465  N NZ  . LYS B  2 117 ? 53.899  14.527  27.270  1.00 7.84   ? 117 LYS B NZ  1 
ATOM   3466  N N   . LEU B  2 118 ? 54.156  7.813   29.878  1.00 7.80   ? 118 LEU B N   1 
ATOM   3467  C CA  . LEU B  2 118 ? 54.474  7.056   31.087  1.00 7.46   ? 118 LEU B CA  1 
ATOM   3468  C C   . LEU B  2 118 ? 54.930  5.663   30.680  1.00 8.30   ? 118 LEU B C   1 
ATOM   3469  O O   . LEU B  2 118 ? 55.929  5.175   31.205  1.00 8.90   ? 118 LEU B O   1 
ATOM   3470  C CB  . LEU B  2 118 ? 53.272  6.839   32.002  1.00 7.28   ? 118 LEU B CB  1 
ATOM   3471  C CG  . LEU B  2 118 ? 53.311  6.973   33.529  1.00 5.74   ? 118 LEU B CG  1 
ATOM   3472  C CD1 . LEU B  2 118 ? 52.064  6.378   34.116  1.00 5.29   ? 118 LEU B CD1 1 
ATOM   3473  C CD2 . LEU B  2 118 ? 54.422  6.199   34.118  1.00 5.39   ? 118 LEU B CD2 1 
ATOM   3474  N N   . PHE B  2 119 ? 54.252  5.031   29.719  1.00 9.00   ? 119 PHE B N   1 
ATOM   3475  C CA  . PHE B  2 119 ? 54.603  3.709   29.264  1.00 9.36   ? 119 PHE B CA  1 
ATOM   3476  C C   . PHE B  2 119 ? 56.012  3.701   28.713  1.00 10.97  ? 119 PHE B C   1 
ATOM   3477  O O   . PHE B  2 119 ? 56.845  2.952   29.210  1.00 11.86  ? 119 PHE B O   1 
ATOM   3478  C CB  . PHE B  2 119 ? 53.642  3.249   28.188  1.00 8.68   ? 119 PHE B CB  1 
ATOM   3479  C CG  . PHE B  2 119 ? 53.870  1.800   27.826  1.00 8.04   ? 119 PHE B CG  1 
ATOM   3480  C CD1 . PHE B  2 119 ? 53.174  0.846   28.503  1.00 8.07   ? 119 PHE B CD1 1 
ATOM   3481  C CD2 . PHE B  2 119 ? 54.800  1.446   26.883  1.00 8.50   ? 119 PHE B CD2 1 
ATOM   3482  C CE1 . PHE B  2 119 ? 53.414  -0.471  28.241  1.00 8.27   ? 119 PHE B CE1 1 
ATOM   3483  C CE2 . PHE B  2 119 ? 55.036  0.125   26.622  1.00 8.73   ? 119 PHE B CE2 1 
ATOM   3484  C CZ  . PHE B  2 119 ? 54.343  -0.829  27.310  1.00 8.60   ? 119 PHE B CZ  1 
ATOM   3485  N N   . GLU B  2 120 ? 56.300  4.510   27.709  1.00 13.27  ? 120 GLU B N   1 
ATOM   3486  C CA  . GLU B  2 120 ? 57.617  4.604   27.107  1.00 15.05  ? 120 GLU B CA  1 
ATOM   3487  C C   . GLU B  2 120 ? 58.701  4.879   28.102  1.00 14.49  ? 120 GLU B C   1 
ATOM   3488  O O   . GLU B  2 120 ? 59.807  4.353   28.004  1.00 14.61  ? 120 GLU B O   1 
ATOM   3489  C CB  . GLU B  2 120 ? 57.616  5.696   26.083  1.00 18.01  ? 120 GLU B CB  1 
ATOM   3490  C CG  . GLU B  2 120 ? 57.040  5.180   24.775  1.00 21.59  ? 120 GLU B CG  1 
ATOM   3491  C CD  . GLU B  2 120 ? 58.028  4.215   24.151  1.00 23.78  ? 120 GLU B CD  1 
ATOM   3492  O OE1 . GLU B  2 120 ? 59.149  4.651   23.811  1.00 25.09  ? 120 GLU B OE1 1 
ATOM   3493  O OE2 . GLU B  2 120 ? 57.712  3.026   24.072  1.00 24.65  ? 120 GLU B OE2 1 
ATOM   3494  N N   . LYS B  2 121 ? 58.395  5.680   29.096  1.00 15.19  ? 121 LYS B N   1 
ATOM   3495  C CA  . LYS B  2 121 ? 59.347  5.992   30.127  1.00 17.07  ? 121 LYS B CA  1 
ATOM   3496  C C   . LYS B  2 121 ? 59.639  4.764   30.961  1.00 17.13  ? 121 LYS B C   1 
ATOM   3497  O O   . LYS B  2 121 ? 60.814  4.439   31.178  1.00 18.44  ? 121 LYS B O   1 
ATOM   3498  C CB  . LYS B  2 121 ? 58.801  7.086   30.999  1.00 18.78  ? 121 LYS B CB  1 
ATOM   3499  C CG  . LYS B  2 121 ? 59.751  7.471   32.092  1.00 21.08  ? 121 LYS B CG  1 
ATOM   3500  C CD  . LYS B  2 121 ? 59.117  8.570   32.908  1.00 23.45  ? 121 LYS B CD  1 
ATOM   3501  C CE  . LYS B  2 121 ? 59.900  8.597   34.208  1.00 26.19  ? 121 LYS B CE  1 
ATOM   3502  N NZ  . LYS B  2 121 ? 59.452  9.688   35.046  1.00 27.60  ? 121 LYS B NZ  1 
ATOM   3503  N N   . THR B  2 122 ? 58.601  4.052   31.396  1.00 16.08  ? 122 THR B N   1 
ATOM   3504  C CA  . THR B  2 122 ? 58.810  2.841   32.162  1.00 14.79  ? 122 THR B CA  1 
ATOM   3505  C C   . THR B  2 122 ? 59.577  1.819   31.321  1.00 14.85  ? 122 THR B C   1 
ATOM   3506  O O   . THR B  2 122 ? 60.516  1.197   31.839  1.00 14.90  ? 122 THR B O   1 
ATOM   3507  C CB  . THR B  2 122 ? 57.442  2.346   32.605  1.00 13.75  ? 122 THR B CB  1 
ATOM   3508  O OG1 . THR B  2 122 ? 56.963  3.385   33.445  1.00 12.41  ? 122 THR B OG1 1 
ATOM   3509  C CG2 . THR B  2 122 ? 57.447  1.036   33.355  1.00 13.79  ? 122 THR B CG2 1 
ATOM   3510  N N   . ARG B  2 123 ? 59.286  1.754   30.012  1.00 14.45  ? 123 ARG B N   1 
ATOM   3511  C CA  . ARG B  2 123 ? 59.966  0.877   29.089  1.00 13.94  ? 123 ARG B CA  1 
ATOM   3512  C C   . ARG B  2 123 ? 61.460  1.159   29.110  1.00 14.33  ? 123 ARG B C   1 
ATOM   3513  O O   . ARG B  2 123 ? 62.272  0.263   29.392  1.00 15.47  ? 123 ARG B O   1 
ATOM   3514  C CB  . ARG B  2 123 ? 59.415  1.085   27.697  1.00 13.46  ? 123 ARG B CB  1 
ATOM   3515  C CG  . ARG B  2 123 ? 60.150  0.356   26.614  1.00 14.37  ? 123 ARG B CG  1 
ATOM   3516  C CD  . ARG B  2 123 ? 59.623  0.795   25.284  1.00 15.29  ? 123 ARG B CD  1 
ATOM   3517  N NE  . ARG B  2 123 ? 60.726  1.152   24.419  1.00 17.58  ? 123 ARG B NE  1 
ATOM   3518  C CZ  . ARG B  2 123 ? 61.362  2.325   24.511  1.00 19.51  ? 123 ARG B CZ  1 
ATOM   3519  N NH1 . ARG B  2 123 ? 62.454  2.595   23.762  1.00 20.75  ? 123 ARG B NH1 1 
ATOM   3520  N NH2 . ARG B  2 123 ? 60.821  3.268   25.265  1.00 20.86  ? 123 ARG B NH2 1 
ATOM   3521  N N   . ARG B  2 124 ? 61.833  2.413   28.891  1.00 13.06  ? 124 ARG B N   1 
ATOM   3522  C CA  . ARG B  2 124 ? 63.240  2.736   28.832  1.00 12.84  ? 124 ARG B CA  1 
ATOM   3523  C C   . ARG B  2 124 ? 64.007  2.404   30.093  1.00 12.92  ? 124 ARG B C   1 
ATOM   3524  O O   . ARG B  2 124 ? 65.152  1.963   30.038  1.00 13.77  ? 124 ARG B O   1 
ATOM   3525  C CB  . ARG B  2 124 ? 63.386  4.177   28.554  1.00 12.18  ? 124 ARG B CB  1 
ATOM   3526  C CG  . ARG B  2 124 ? 63.491  4.318   27.095  1.00 11.58  ? 124 ARG B CG  1 
ATOM   3527  C CD  . ARG B  2 124 ? 62.834  5.622   26.858  1.00 11.54  ? 124 ARG B CD  1 
ATOM   3528  N NE  . ARG B  2 124 ? 62.846  5.736   25.432  1.00 12.02  ? 124 ARG B NE  1 
ATOM   3529  C CZ  . ARG B  2 124 ? 62.108  6.580   24.743  1.00 13.28  ? 124 ARG B CZ  1 
ATOM   3530  N NH1 . ARG B  2 124 ? 62.214  6.572   23.406  1.00 13.72  ? 124 ARG B NH1 1 
ATOM   3531  N NH2 . ARG B  2 124 ? 61.361  7.461   25.415  1.00 15.26  ? 124 ARG B NH2 1 
ATOM   3532  N N   . GLN B  2 125 ? 63.376  2.603   31.236  1.00 12.43  ? 125 GLN B N   1 
ATOM   3533  C CA  . GLN B  2 125 ? 63.990  2.362   32.515  1.00 11.62  ? 125 GLN B CA  1 
ATOM   3534  C C   . GLN B  2 125 ? 64.331  0.916   32.688  1.00 11.90  ? 125 GLN B C   1 
ATOM   3535  O O   . GLN B  2 125 ? 65.439  0.600   33.106  1.00 13.30  ? 125 GLN B O   1 
ATOM   3536  C CB  . GLN B  2 125 ? 63.033  2.784   33.537  1.00 12.46  ? 125 GLN B CB  1 
ATOM   3537  C CG  . GLN B  2 125 ? 63.552  2.641   34.911  1.00 14.11  ? 125 GLN B CG  1 
ATOM   3538  C CD  . GLN B  2 125 ? 62.921  3.704   35.772  1.00 16.05  ? 125 GLN B CD  1 
ATOM   3539  O OE1 . GLN B  2 125 ? 63.642  4.539   36.316  1.00 17.85  ? 125 GLN B OE1 1 
ATOM   3540  N NE2 . GLN B  2 125 ? 61.596  3.759   35.908  1.00 16.45  ? 125 GLN B NE2 1 
ATOM   3541  N N   . LEU B  2 126 ? 63.417  0.026   32.309  1.00 11.11  ? 126 LEU B N   1 
ATOM   3542  C CA  . LEU B  2 126 ? 63.630  -1.402  32.494  1.00 10.42  ? 126 LEU B CA  1 
ATOM   3543  C C   . LEU B  2 126 ? 64.685  -2.029  31.593  1.00 10.66  ? 126 LEU B C   1 
ATOM   3544  O O   . LEU B  2 126 ? 64.990  -3.215  31.758  1.00 11.56  ? 126 LEU B O   1 
ATOM   3545  C CB  . LEU B  2 126 ? 62.331  -2.156  32.274  1.00 8.61   ? 126 LEU B CB  1 
ATOM   3546  C CG  . LEU B  2 126 ? 61.268  -1.851  33.277  1.00 6.75   ? 126 LEU B CG  1 
ATOM   3547  C CD1 . LEU B  2 126 ? 59.962  -2.456  32.838  1.00 5.88   ? 126 LEU B CD1 1 
ATOM   3548  C CD2 . LEU B  2 126 ? 61.727  -2.342  34.613  1.00 5.93   ? 126 LEU B CD2 1 
ATOM   3549  N N   . ARG B  2 127 ? 65.236  -1.258  30.667  1.00 10.11  ? 127 ARG B N   1 
ATOM   3550  C CA  . ARG B  2 127 ? 66.200  -1.719  29.697  1.00 10.53  ? 127 ARG B CA  1 
ATOM   3551  C C   . ARG B  2 127 ? 66.113  -3.181  29.245  1.00 11.45  ? 127 ARG B C   1 
ATOM   3552  O O   . ARG B  2 127 ? 65.053  -3.552  28.761  1.00 13.21  ? 127 ARG B O   1 
ATOM   3553  C CB  . ARG B  2 127 ? 67.536  -1.354  30.250  1.00 9.00   ? 127 ARG B CB  1 
ATOM   3554  C CG  . ARG B  2 127 ? 67.808  -0.139  29.390  1.00 8.95   ? 127 ARG B CG  1 
ATOM   3555  C CD  . ARG B  2 127 ? 69.065  -0.283  28.602  1.00 9.91   ? 127 ARG B CD  1 
ATOM   3556  N NE  . ARG B  2 127 ? 70.110  0.447   29.288  1.00 9.86   ? 127 ARG B NE  1 
ATOM   3557  C CZ  . ARG B  2 127 ? 71.347  0.487   28.806  1.00 10.77  ? 127 ARG B CZ  1 
ATOM   3558  N NH1 . ARG B  2 127 ? 72.273  1.182   29.457  1.00 11.62  ? 127 ARG B NH1 1 
ATOM   3559  N NH2 . ARG B  2 127 ? 71.672  -0.202  27.714  1.00 11.62  ? 127 ARG B NH2 1 
ATOM   3560  N N   . GLU B  2 128 ? 67.059  -4.085  29.467  1.00 11.28  ? 128 GLU B N   1 
ATOM   3561  C CA  . GLU B  2 128 ? 66.981  -5.388  28.833  1.00 11.03  ? 128 GLU B CA  1 
ATOM   3562  C C   . GLU B  2 128 ? 66.328  -6.386  29.746  1.00 10.45  ? 128 GLU B C   1 
ATOM   3563  O O   . GLU B  2 128 ? 66.262  -7.584  29.430  1.00 10.99  ? 128 GLU B O   1 
ATOM   3564  C CB  . GLU B  2 128 ? 68.380  -5.827  28.496  1.00 12.70  ? 128 GLU B CB  1 
ATOM   3565  C CG  . GLU B  2 128 ? 68.646  -6.194  27.069  1.00 15.28  ? 128 GLU B CG  1 
ATOM   3566  C CD  . GLU B  2 128 ? 67.997  -5.333  26.020  1.00 16.66  ? 128 GLU B CD  1 
ATOM   3567  O OE1 . GLU B  2 128 ? 67.273  -5.910  25.201  1.00 17.48  ? 128 GLU B OE1 1 
ATOM   3568  O OE2 . GLU B  2 128 ? 68.213  -4.116  26.000  1.00 18.02  ? 128 GLU B OE2 1 
ATOM   3569  N N   . ASN B  2 129 ? 65.763  -5.908  30.840  1.00 9.25   ? 129 ASN B N   1 
ATOM   3570  C CA  . ASN B  2 129 ? 65.309  -6.817  31.868  1.00 8.89   ? 129 ASN B CA  1 
ATOM   3571  C C   . ASN B  2 129 ? 63.832  -7.086  31.791  1.00 9.40   ? 129 ASN B C   1 
ATOM   3572  O O   . ASN B  2 129 ? 63.289  -7.833  32.615  1.00 8.08   ? 129 ASN B O   1 
ATOM   3573  C CB  . ASN B  2 129 ? 65.599  -6.264  33.233  1.00 8.67   ? 129 ASN B CB  1 
ATOM   3574  C CG  . ASN B  2 129 ? 67.028  -5.776  33.392  1.00 10.23  ? 129 ASN B CG  1 
ATOM   3575  O OD1 . ASN B  2 129 ? 67.873  -5.760  32.483  1.00 9.64   ? 129 ASN B OD1 1 
ATOM   3576  N ND2 . ASN B  2 129 ? 67.321  -5.266  34.575  1.00 11.57  ? 129 ASN B ND2 1 
ATOM   3577  N N   . ALA B  2 130 ? 63.133  -6.512  30.818  1.00 9.85   ? 130 ALA B N   1 
ATOM   3578  C CA  . ALA B  2 130 ? 61.720  -6.748  30.744  1.00 9.89   ? 130 ALA B CA  1 
ATOM   3579  C C   . ALA B  2 130 ? 61.288  -6.787  29.321  1.00 10.54  ? 130 ALA B C   1 
ATOM   3580  O O   . ALA B  2 130 ? 61.952  -6.225  28.446  1.00 10.83  ? 130 ALA B O   1 
ATOM   3581  C CB  . ALA B  2 130 ? 60.954  -5.650  31.425  1.00 9.20   ? 130 ALA B CB  1 
ATOM   3582  N N   . GLU B  2 131 ? 60.195  -7.477  29.093  1.00 11.86  ? 131 GLU B N   1 
ATOM   3583  C CA  . GLU B  2 131 ? 59.621  -7.523  27.782  1.00 14.70  ? 131 GLU B CA  1 
ATOM   3584  C C   . GLU B  2 131 ? 58.207  -6.981  27.877  1.00 15.88  ? 131 GLU B C   1 
ATOM   3585  O O   . GLU B  2 131 ? 57.500  -7.151  28.866  1.00 14.51  ? 131 GLU B O   1 
ATOM   3586  C CB  . GLU B  2 131 ? 59.604  -8.957  27.253  1.00 15.15  ? 131 GLU B CB  1 
ATOM   3587  C CG  . GLU B  2 131 ? 60.968  -9.417  26.785  1.00 16.01  ? 131 GLU B CG  1 
ATOM   3588  C CD  . GLU B  2 131 ? 61.101  -10.810 26.203  1.00 16.97  ? 131 GLU B CD  1 
ATOM   3589  O OE1 . GLU B  2 131 ? 60.131  -11.453 25.794  1.00 16.92  ? 131 GLU B OE1 1 
ATOM   3590  O OE2 . GLU B  2 131 ? 62.229  -11.288 26.184  1.00 17.31  ? 131 GLU B OE2 1 
ATOM   3591  N N   . GLU B  2 132 ? 57.795  -6.283  26.840  1.00 18.51  ? 132 GLU B N   1 
ATOM   3592  C CA  . GLU B  2 132 ? 56.454  -5.753  26.761  1.00 20.23  ? 132 GLU B CA  1 
ATOM   3593  C C   . GLU B  2 132 ? 55.541  -6.888  26.357  1.00 21.13  ? 132 GLU B C   1 
ATOM   3594  O O   . GLU B  2 132 ? 55.818  -7.580  25.376  1.00 22.16  ? 132 GLU B O   1 
ATOM   3595  C CB  . GLU B  2 132 ? 56.382  -4.679  25.713  1.00 20.72  ? 132 GLU B CB  1 
ATOM   3596  C CG  . GLU B  2 132 ? 55.048  -4.050  25.847  1.00 21.10  ? 132 GLU B CG  1 
ATOM   3597  C CD  . GLU B  2 132 ? 54.669  -3.070  24.777  1.00 22.97  ? 132 GLU B CD  1 
ATOM   3598  O OE1 . GLU B  2 132 ? 53.453  -2.842  24.695  1.00 23.98  ? 132 GLU B OE1 1 
ATOM   3599  O OE2 . GLU B  2 132 ? 55.519  -2.524  24.031  1.00 23.28  ? 132 GLU B OE2 1 
ATOM   3600  N N   . MET B  2 133 ? 54.501  -7.149  27.113  1.00 22.27  ? 133 MET B N   1 
ATOM   3601  C CA  . MET B  2 133 ? 53.531  -8.172  26.760  1.00 24.16  ? 133 MET B CA  1 
ATOM   3602  C C   . MET B  2 133 ? 52.463  -7.557  25.863  1.00 24.78  ? 133 MET B C   1 
ATOM   3603  O O   . MET B  2 133 ? 51.415  -8.166  25.624  1.00 25.74  ? 133 MET B O   1 
ATOM   3604  C CB  . MET B  2 133 ? 52.826  -8.675  28.011  1.00 24.94  ? 133 MET B CB  1 
ATOM   3605  C CG  . MET B  2 133 ? 53.762  -8.985  29.150  1.00 26.70  ? 133 MET B CG  1 
ATOM   3606  S SD  . MET B  2 133 ? 52.914  -8.989  30.741  1.00 28.01  ? 133 MET B SD  1 
ATOM   3607  C CE  . MET B  2 133 ? 53.681  -10.429 31.408  1.00 28.50  ? 133 MET B CE  1 
ATOM   3608  N N   . GLY B  2 134 ? 52.629  -6.288  25.487  1.00 24.92  ? 134 GLY B N   1 
ATOM   3609  C CA  . GLY B  2 134 ? 51.765  -5.619  24.523  1.00 25.80  ? 134 GLY B CA  1 
ATOM   3610  C C   . GLY B  2 134 ? 50.334  -5.318  24.950  1.00 25.25  ? 134 GLY B C   1 
ATOM   3611  O O   . GLY B  2 134 ? 49.478  -4.972  24.132  1.00 26.63  ? 134 GLY B O   1 
ATOM   3612  N N   . ASN B  2 135 ? 50.048  -5.436  26.219  1.00 23.57  ? 135 ASN B N   1 
ATOM   3613  C CA  . ASN B  2 135 ? 48.738  -5.120  26.727  1.00 22.52  ? 135 ASN B CA  1 
ATOM   3614  C C   . ASN B  2 135 ? 48.936  -4.043  27.765  1.00 20.64  ? 135 ASN B C   1 
ATOM   3615  O O   . ASN B  2 135 ? 48.113  -3.935  28.684  1.00 19.34  ? 135 ASN B O   1 
ATOM   3616  C CB  . ASN B  2 135 ? 48.121  -6.337  27.393  1.00 25.55  ? 135 ASN B CB  1 
ATOM   3617  C CG  . ASN B  2 135 ? 48.966  -6.836  28.557  1.00 27.03  ? 135 ASN B CG  1 
ATOM   3618  O OD1 . ASN B  2 135 ? 50.156  -6.491  28.704  1.00 27.81  ? 135 ASN B OD1 1 
ATOM   3619  N ND2 . ASN B  2 135 ? 48.399  -7.680  29.406  1.00 27.44  ? 135 ASN B ND2 1 
ATOM   3620  N N   . GLY B  2 136 ? 50.049  -3.286  27.671  1.00 18.89  ? 136 GLY B N   1 
ATOM   3621  C CA  . GLY B  2 136 ? 50.334  -2.295  28.709  1.00 15.99  ? 136 GLY B CA  1 
ATOM   3622  C C   . GLY B  2 136 ? 51.049  -2.894  29.919  1.00 14.25  ? 136 GLY B C   1 
ATOM   3623  O O   . GLY B  2 136 ? 51.370  -2.165  30.851  1.00 13.50  ? 136 GLY B O   1 
ATOM   3624  N N   . CYS B  2 137 ? 51.327  -4.198  29.963  1.00 12.95  ? 137 CYS B N   1 
ATOM   3625  C CA  . CYS B  2 137 ? 52.114  -4.773  31.028  1.00 11.15  ? 137 CYS B CA  1 
ATOM   3626  C C   . CYS B  2 137 ? 53.480  -5.193  30.560  1.00 12.25  ? 137 CYS B C   1 
ATOM   3627  O O   . CYS B  2 137 ? 53.651  -5.667  29.423  1.00 13.94  ? 137 CYS B O   1 
ATOM   3628  C CB  . CYS B  2 137 ? 51.543  -6.006  31.567  1.00 10.21  ? 137 CYS B CB  1 
ATOM   3629  S SG  . CYS B  2 137 ? 49.824  -5.732  31.993  1.00 10.30  ? 137 CYS B SG  1 
ATOM   3630  N N   . PHE B  2 138 ? 54.476  -5.010  31.411  1.00 12.28  ? 138 PHE B N   1 
ATOM   3631  C CA  . PHE B  2 138 ? 55.809  -5.505  31.182  1.00 13.06  ? 138 PHE B CA  1 
ATOM   3632  C C   . PHE B  2 138 ? 56.004  -6.783  31.996  1.00 14.84  ? 138 PHE B C   1 
ATOM   3633  O O   . PHE B  2 138 ? 55.575  -6.848  33.157  1.00 14.95  ? 138 PHE B O   1 
ATOM   3634  C CB  . PHE B  2 138 ? 56.849  -4.519  31.640  1.00 10.21  ? 138 PHE B CB  1 
ATOM   3635  C CG  . PHE B  2 138 ? 56.882  -3.256  30.838  1.00 9.03   ? 138 PHE B CG  1 
ATOM   3636  C CD1 . PHE B  2 138 ? 56.254  -2.138  31.313  1.00 7.99   ? 138 PHE B CD1 1 
ATOM   3637  C CD2 . PHE B  2 138 ? 57.555  -3.242  29.636  1.00 9.71   ? 138 PHE B CD2 1 
ATOM   3638  C CE1 . PHE B  2 138 ? 56.326  -0.981  30.587  1.00 8.01   ? 138 PHE B CE1 1 
ATOM   3639  C CE2 . PHE B  2 138 ? 57.620  -2.070  28.909  1.00 9.30   ? 138 PHE B CE2 1 
ATOM   3640  C CZ  . PHE B  2 138 ? 56.998  -0.945  29.386  1.00 9.00   ? 138 PHE B CZ  1 
ATOM   3641  N N   . LYS B  2 139 ? 56.609  -7.814  31.411  1.00 16.25  ? 139 LYS B N   1 
ATOM   3642  C CA  . LYS B  2 139 ? 57.052  -8.934  32.191  1.00 17.87  ? 139 LYS B CA  1 
ATOM   3643  C C   . LYS B  2 139 ? 58.460  -8.597  32.635  1.00 18.30  ? 139 LYS B C   1 
ATOM   3644  O O   . LYS B  2 139 ? 59.324  -8.406  31.769  1.00 19.47  ? 139 LYS B O   1 
ATOM   3645  C CB  . LYS B  2 139 ? 57.132  -10.183 31.386  1.00 19.83  ? 139 LYS B CB  1 
ATOM   3646  C CG  . LYS B  2 139 ? 57.571  -11.352 32.250  1.00 22.45  ? 139 LYS B CG  1 
ATOM   3647  C CD  . LYS B  2 139 ? 57.403  -12.565 31.379  1.00 25.61  ? 139 LYS B CD  1 
ATOM   3648  C CE  . LYS B  2 139 ? 57.703  -13.863 32.121  1.00 27.76  ? 139 LYS B CE  1 
ATOM   3649  N NZ  . LYS B  2 139 ? 57.786  -14.976 31.174  1.00 29.53  ? 139 LYS B NZ  1 
ATOM   3650  N N   . ILE B  2 140 ? 58.711  -8.489  33.945  1.00 18.09  ? 140 ILE B N   1 
ATOM   3651  C CA  . ILE B  2 140 ? 60.056  -8.222  34.452  1.00 17.36  ? 140 ILE B CA  1 
ATOM   3652  C C   . ILE B  2 140 ? 60.726  -9.567  34.649  1.00 18.08  ? 140 ILE B C   1 
ATOM   3653  O O   . ILE B  2 140 ? 60.231  -10.387 35.420  1.00 16.42  ? 140 ILE B O   1 
ATOM   3654  C CB  . ILE B  2 140 ? 59.978  -7.441  35.764  1.00 15.04  ? 140 ILE B CB  1 
ATOM   3655  C CG1 . ILE B  2 140 ? 59.205  -6.162  35.513  1.00 14.74  ? 140 ILE B CG1 1 
ATOM   3656  C CG2 . ILE B  2 140 ? 61.361  -7.103  36.254  1.00 13.39  ? 140 ILE B CG2 1 
ATOM   3657  C CD1 . ILE B  2 140 ? 58.993  -5.275  36.724  1.00 15.77  ? 140 ILE B CD1 1 
ATOM   3658  N N   . TYR B  2 141 ? 61.803  -9.825  33.899  1.00 19.54  ? 141 TYR B N   1 
ATOM   3659  C CA  . TYR B  2 141 ? 62.466  -11.117 33.909  1.00 20.43  ? 141 TYR B CA  1 
ATOM   3660  C C   . TYR B  2 141 ? 63.466  -11.331 35.027  1.00 20.84  ? 141 TYR B C   1 
ATOM   3661  O O   . TYR B  2 141 ? 64.531  -11.900 34.803  1.00 21.04  ? 141 TYR B O   1 
ATOM   3662  C CB  . TYR B  2 141 ? 63.149  -11.336 32.551  1.00 20.42  ? 141 TYR B CB  1 
ATOM   3663  C CG  . TYR B  2 141 ? 62.161  -11.831 31.517  1.00 20.52  ? 141 TYR B CG  1 
ATOM   3664  C CD1 . TYR B  2 141 ? 61.522  -10.955 30.666  1.00 20.66  ? 141 TYR B CD1 1 
ATOM   3665  C CD2 . TYR B  2 141 ? 61.918  -13.181 31.435  1.00 20.70  ? 141 TYR B CD2 1 
ATOM   3666  C CE1 . TYR B  2 141 ? 60.633  -11.430 29.723  1.00 20.82  ? 141 TYR B CE1 1 
ATOM   3667  C CE2 . TYR B  2 141 ? 61.034  -13.659 30.497  1.00 20.90  ? 141 TYR B CE2 1 
ATOM   3668  C CZ  . TYR B  2 141 ? 60.393  -12.784 29.643  1.00 20.98  ? 141 TYR B CZ  1 
ATOM   3669  O OH  . TYR B  2 141 ? 59.497  -13.293 28.711  1.00 20.68  ? 141 TYR B OH  1 
ATOM   3670  N N   . HIS B  2 142 ? 63.191  -10.874 36.238  1.00 21.68  ? 142 HIS B N   1 
ATOM   3671  C CA  . HIS B  2 142 ? 64.089  -11.138 37.346  1.00 23.77  ? 142 HIS B CA  1 
ATOM   3672  C C   . HIS B  2 142 ? 63.297  -10.990 38.627  1.00 25.85  ? 142 HIS B C   1 
ATOM   3673  O O   . HIS B  2 142 ? 62.201  -10.431 38.598  1.00 25.30  ? 142 HIS B O   1 
ATOM   3674  C CB  . HIS B  2 142 ? 65.299  -10.168 37.353  1.00 23.00  ? 142 HIS B CB  1 
ATOM   3675  C CG  . HIS B  2 142 ? 64.976  -8.739  37.691  1.00 21.91  ? 142 HIS B CG  1 
ATOM   3676  N ND1 . HIS B  2 142 ? 64.651  -8.314  38.897  1.00 20.95  ? 142 HIS B ND1 1 
ATOM   3677  C CD2 . HIS B  2 142 ? 64.931  -7.707  36.802  1.00 22.56  ? 142 HIS B CD2 1 
ATOM   3678  C CE1 . HIS B  2 142 ? 64.386  -7.047  38.792  1.00 21.31  ? 142 HIS B CE1 1 
ATOM   3679  N NE2 . HIS B  2 142 ? 64.558  -6.689  37.545  1.00 22.52  ? 142 HIS B NE2 1 
ATOM   3680  N N   . LYS B  2 143 ? 63.801  -11.464 39.764  1.00 29.94  ? 143 LYS B N   1 
ATOM   3681  C CA  . LYS B  2 143 ? 63.077  -11.403 41.029  1.00 33.22  ? 143 LYS B CA  1 
ATOM   3682  C C   . LYS B  2 143 ? 62.929  -9.942  41.418  1.00 33.56  ? 143 LYS B C   1 
ATOM   3683  O O   . LYS B  2 143 ? 63.914  -9.261  41.713  1.00 34.89  ? 143 LYS B O   1 
ATOM   3684  C CB  . LYS B  2 143 ? 63.883  -12.222 42.072  1.00 35.05  ? 143 LYS B CB  1 
ATOM   3685  C CG  . LYS B  2 143 ? 63.259  -12.403 43.474  1.00 37.46  ? 143 LYS B CG  1 
ATOM   3686  C CD  . LYS B  2 143 ? 63.794  -11.379 44.497  1.00 39.10  ? 143 LYS B CD  1 
ATOM   3687  C CE  . LYS B  2 143 ? 63.214  -11.510 45.920  1.00 40.05  ? 143 LYS B CE  1 
ATOM   3688  N NZ  . LYS B  2 143 ? 63.503  -10.318 46.720  1.00 40.89  ? 143 LYS B NZ  1 
ATOM   3689  N N   . CYS B  2 144 ? 61.724  -9.404  41.416  1.00 33.56  ? 144 CYS B N   1 
ATOM   3690  C CA  . CYS B  2 144 ? 61.560  -7.989  41.718  1.00 34.46  ? 144 CYS B CA  1 
ATOM   3691  C C   . CYS B  2 144 ? 60.550  -7.799  42.827  1.00 35.84  ? 144 CYS B C   1 
ATOM   3692  O O   . CYS B  2 144 ? 59.331  -7.865  42.616  1.00 35.20  ? 144 CYS B O   1 
ATOM   3693  C CB  . CYS B  2 144 ? 61.123  -7.273  40.439  1.00 33.57  ? 144 CYS B CB  1 
ATOM   3694  S SG  . CYS B  2 144 ? 60.772  -5.496  40.623  1.00 31.55  ? 144 CYS B SG  1 
ATOM   3695  N N   . ASP B  2 145 ? 61.069  -7.658  44.045  1.00 37.88  ? 145 ASP B N   1 
ATOM   3696  C CA  . ASP B  2 145 ? 60.211  -7.501  45.228  1.00 39.45  ? 145 ASP B CA  1 
ATOM   3697  C C   . ASP B  2 145 ? 59.587  -6.121  45.297  1.00 38.47  ? 145 ASP B C   1 
ATOM   3698  O O   . ASP B  2 145 ? 59.853  -5.263  44.433  1.00 38.77  ? 145 ASP B O   1 
ATOM   3699  C CB  . ASP B  2 145 ? 61.005  -7.740  46.526  1.00 41.31  ? 145 ASP B CB  1 
ATOM   3700  C CG  . ASP B  2 145 ? 62.304  -6.968  46.562  1.00 43.27  ? 145 ASP B CG  1 
ATOM   3701  O OD1 . ASP B  2 145 ? 63.325  -7.651  46.353  1.00 45.10  ? 145 ASP B OD1 1 
ATOM   3702  O OD2 . ASP B  2 145 ? 62.289  -5.738  46.728  1.00 42.93  ? 145 ASP B OD2 1 
ATOM   3703  N N   . ASN B  2 146 ? 58.835  -5.854  46.356  1.00 37.31  ? 146 ASN B N   1 
ATOM   3704  C CA  . ASN B  2 146 ? 58.140  -4.582  46.449  1.00 36.98  ? 146 ASN B CA  1 
ATOM   3705  C C   . ASN B  2 146 ? 59.030  -3.355  46.412  1.00 36.21  ? 146 ASN B C   1 
ATOM   3706  O O   . ASN B  2 146 ? 58.611  -2.318  45.888  1.00 36.95  ? 146 ASN B O   1 
ATOM   3707  C CB  . ASN B  2 146 ? 57.316  -4.465  47.713  1.00 37.62  ? 146 ASN B CB  1 
ATOM   3708  C CG  . ASN B  2 146 ? 55.972  -5.168  47.611  1.00 38.36  ? 146 ASN B CG  1 
ATOM   3709  O OD1 . ASN B  2 146 ? 55.454  -5.540  46.545  1.00 38.77  ? 146 ASN B OD1 1 
ATOM   3710  N ND2 . ASN B  2 146 ? 55.366  -5.361  48.770  1.00 38.26  ? 146 ASN B ND2 1 
ATOM   3711  N N   . ALA B  2 147 ? 60.282  -3.414  46.868  1.00 34.54  ? 147 ALA B N   1 
ATOM   3712  C CA  . ALA B  2 147 ? 61.103  -2.221  46.837  1.00 32.20  ? 147 ALA B CA  1 
ATOM   3713  C C   . ALA B  2 147 ? 61.597  -2.003  45.441  1.00 31.25  ? 147 ALA B C   1 
ATOM   3714  O O   . ALA B  2 147 ? 61.796  -0.861  45.030  1.00 31.12  ? 147 ALA B O   1 
ATOM   3715  C CB  . ALA B  2 147 ? 62.309  -2.344  47.707  1.00 32.92  ? 147 ALA B CB  1 
ATOM   3716  N N   . CYS B  2 148 ? 61.800  -3.102  44.713  1.00 30.43  ? 148 CYS B N   1 
ATOM   3717  C CA  . CYS B  2 148 ? 62.191  -3.028  43.317  1.00 29.78  ? 148 CYS B CA  1 
ATOM   3718  C C   . CYS B  2 148 ? 61.056  -2.351  42.572  1.00 29.02  ? 148 CYS B C   1 
ATOM   3719  O O   . CYS B  2 148 ? 61.281  -1.327  41.910  1.00 29.09  ? 148 CYS B O   1 
ATOM   3720  C CB  . CYS B  2 148 ? 62.447  -4.432  42.817  1.00 29.64  ? 148 CYS B CB  1 
ATOM   3721  S SG  . CYS B  2 148 ? 62.526  -4.595  41.039  1.00 30.25  ? 148 CYS B SG  1 
ATOM   3722  N N   . ILE B  2 149 ? 59.814  -2.804  42.776  1.00 27.87  ? 149 ILE B N   1 
ATOM   3723  C CA  . ILE B  2 149 ? 58.672  -2.156  42.142  1.00 27.36  ? 149 ILE B CA  1 
ATOM   3724  C C   . ILE B  2 149 ? 58.616  -0.687  42.536  1.00 28.38  ? 149 ILE B C   1 
ATOM   3725  O O   . ILE B  2 149 ? 58.411  0.161   41.671  1.00 28.42  ? 149 ILE B O   1 
ATOM   3726  C CB  . ILE B  2 149 ? 57.374  -2.897  42.531  1.00 25.89  ? 149 ILE B CB  1 
ATOM   3727  C CG1 . ILE B  2 149 ? 57.400  -4.293  41.916  1.00 25.64  ? 149 ILE B CG1 1 
ATOM   3728  C CG2 . ILE B  2 149 ? 56.143  -2.137  42.055  1.00 25.22  ? 149 ILE B CG2 1 
ATOM   3729  C CD1 . ILE B  2 149 ? 57.301  -4.375  40.375  1.00 25.69  ? 149 ILE B CD1 1 
ATOM   3730  N N   . GLU B  2 150 ? 58.875  -0.336  43.792  1.00 30.18  ? 150 GLU B N   1 
ATOM   3731  C CA  . GLU B  2 150 ? 58.886  1.051   44.205  1.00 31.09  ? 150 GLU B CA  1 
ATOM   3732  C C   . GLU B  2 150 ? 59.977  1.827   43.479  1.00 29.96  ? 150 GLU B C   1 
ATOM   3733  O O   . GLU B  2 150 ? 59.726  2.946   43.048  1.00 30.06  ? 150 GLU B O   1 
ATOM   3734  C CB  . GLU B  2 150 ? 59.064  1.067   45.703  1.00 33.53  ? 150 GLU B CB  1 
ATOM   3735  C CG  . GLU B  2 150 ? 58.018  1.928   46.386  1.00 37.15  ? 150 GLU B CG  1 
ATOM   3736  C CD  . GLU B  2 150 ? 58.172  3.429   46.102  1.00 39.81  ? 150 GLU B CD  1 
ATOM   3737  O OE1 . GLU B  2 150 ? 57.443  3.959   45.244  1.00 40.88  ? 150 GLU B OE1 1 
ATOM   3738  O OE2 . GLU B  2 150 ? 59.005  4.065   46.757  1.00 41.51  ? 150 GLU B OE2 1 
ATOM   3739  N N   . SER B  2 151 ? 61.140  1.251   43.191  1.00 29.27  ? 151 SER B N   1 
ATOM   3740  C CA  . SER B  2 151 ? 62.154  2.026   42.501  1.00 29.59  ? 151 SER B CA  1 
ATOM   3741  C C   . SER B  2 151 ? 61.859  2.199   41.012  1.00 29.77  ? 151 SER B C   1 
ATOM   3742  O O   . SER B  2 151 ? 62.318  3.186   40.404  1.00 30.24  ? 151 SER B O   1 
ATOM   3743  C CB  . SER B  2 151 ? 63.529  1.389   42.684  1.00 29.85  ? 151 SER B CB  1 
ATOM   3744  O OG  . SER B  2 151 ? 63.647  0.028   42.269  1.00 31.33  ? 151 SER B OG  1 
ATOM   3745  N N   . ILE B  2 152 ? 61.101  1.271   40.370  1.00 28.32  ? 152 ILE B N   1 
ATOM   3746  C CA  . ILE B  2 152 ? 60.737  1.468   38.964  1.00 26.35  ? 152 ILE B CA  1 
ATOM   3747  C C   . ILE B  2 152 ? 59.759  2.630   38.930  1.00 26.85  ? 152 ILE B C   1 
ATOM   3748  O O   . ILE B  2 152 ? 59.895  3.576   38.150  1.00 26.85  ? 152 ILE B O   1 
ATOM   3749  C CB  . ILE B  2 152 ? 60.083  0.214   38.367  1.00 24.33  ? 152 ILE B CB  1 
ATOM   3750  C CG1 . ILE B  2 152 ? 61.054  -0.938  38.447  1.00 24.30  ? 152 ILE B CG1 1 
ATOM   3751  C CG2 . ILE B  2 152 ? 59.718  0.463   36.919  1.00 23.29  ? 152 ILE B CG2 1 
ATOM   3752  C CD1 . ILE B  2 152 ? 60.539  -2.297  37.952  1.00 23.79  ? 152 ILE B CD1 1 
ATOM   3753  N N   . ARG B  2 153 ? 58.830  2.610   39.869  1.00 27.42  ? 153 ARG B N   1 
ATOM   3754  C CA  . ARG B  2 153 ? 57.840  3.649   39.972  1.00 28.25  ? 153 ARG B CA  1 
ATOM   3755  C C   . ARG B  2 153 ? 58.429  4.971   40.372  1.00 29.82  ? 153 ARG B C   1 
ATOM   3756  O O   . ARG B  2 153 ? 57.865  5.983   39.988  1.00 31.07  ? 153 ARG B O   1 
ATOM   3757  C CB  . ARG B  2 153 ? 56.789  3.355   40.999  1.00 27.23  ? 153 ARG B CB  1 
ATOM   3758  C CG  . ARG B  2 153 ? 56.003  2.097   40.777  1.00 27.00  ? 153 ARG B CG  1 
ATOM   3759  C CD  . ARG B  2 153 ? 54.755  2.416   41.529  1.00 26.39  ? 153 ARG B CD  1 
ATOM   3760  N NE  . ARG B  2 153 ? 54.284  1.299   42.304  1.00 26.21  ? 153 ARG B NE  1 
ATOM   3761  C CZ  . ARG B  2 153 ? 54.475  1.292   43.629  1.00 26.18  ? 153 ARG B CZ  1 
ATOM   3762  N NH1 . ARG B  2 153 ? 54.013  0.260   44.349  1.00 26.29  ? 153 ARG B NH1 1 
ATOM   3763  N NH2 . ARG B  2 153 ? 55.125  2.319   44.214  1.00 26.02  ? 153 ARG B NH2 1 
ATOM   3764  N N   . ASN B  2 154 ? 59.494  5.053   41.160  1.00 32.08  ? 154 ASN B N   1 
ATOM   3765  C CA  . ASN B  2 154 ? 60.010  6.373   41.485  1.00 34.38  ? 154 ASN B CA  1 
ATOM   3766  C C   . ASN B  2 154 ? 61.260  6.698   40.684  1.00 33.62  ? 154 ASN B C   1 
ATOM   3767  O O   . ASN B  2 154 ? 62.059  7.558   41.058  1.00 33.73  ? 154 ASN B O   1 
ATOM   3768  C CB  . ASN B  2 154 ? 60.279  6.484   42.994  1.00 37.85  ? 154 ASN B CB  1 
ATOM   3769  C CG  . ASN B  2 154 ? 61.387  5.614   43.533  1.00 42.41  ? 154 ASN B CG  1 
ATOM   3770  O OD1 . ASN B  2 154 ? 62.222  5.105   42.782  1.00 42.44  ? 154 ASN B OD1 1 
ATOM   3771  N ND2 . ASN B  2 154 ? 61.432  5.388   44.849  1.00 47.35  ? 154 ASN B ND2 1 
ATOM   3772  N N   . GLY B  2 155 ? 61.470  5.959   39.600  1.00 32.17  ? 155 GLY B N   1 
ATOM   3773  C CA  . GLY B  2 155 ? 62.508  6.285   38.651  1.00 31.42  ? 155 GLY B CA  1 
ATOM   3774  C C   . GLY B  2 155 ? 63.933  6.098   39.113  1.00 30.73  ? 155 GLY B C   1 
ATOM   3775  O O   . GLY B  2 155 ? 64.847  6.714   38.560  1.00 31.40  ? 155 GLY B O   1 
ATOM   3776  N N   . THR B  2 156 ? 64.170  5.275   40.115  1.00 30.10  ? 156 THR B N   1 
ATOM   3777  C CA  . THR B  2 156 ? 65.534  5.054   40.535  1.00 29.72  ? 156 THR B CA  1 
ATOM   3778  C C   . THR B  2 156 ? 66.002  3.636   40.188  1.00 29.84  ? 156 THR B C   1 
ATOM   3779  O O   . THR B  2 156 ? 67.072  3.201   40.632  1.00 30.04  ? 156 THR B O   1 
ATOM   3780  C CB  . THR B  2 156 ? 65.621  5.324   42.060  1.00 28.89  ? 156 THR B CB  1 
ATOM   3781  O OG1 . THR B  2 156 ? 64.803  4.385   42.742  1.00 28.49  ? 156 THR B OG1 1 
ATOM   3782  C CG2 . THR B  2 156 ? 65.118  6.691   42.422  1.00 28.30  ? 156 THR B CG2 1 
ATOM   3783  N N   . TYR B  2 157 ? 65.223  2.874   39.417  1.00 28.81  ? 157 TYR B N   1 
ATOM   3784  C CA  . TYR B  2 157 ? 65.562  1.487   39.143  1.00 28.84  ? 157 TYR B CA  1 
ATOM   3785  C C   . TYR B  2 157 ? 66.914  1.325   38.441  1.00 30.44  ? 157 TYR B C   1 
ATOM   3786  O O   . TYR B  2 157 ? 67.075  1.790   37.298  1.00 31.80  ? 157 TYR B O   1 
ATOM   3787  C CB  . TYR B  2 157 ? 64.430  0.888   38.292  1.00 27.03  ? 157 TYR B CB  1 
ATOM   3788  C CG  . TYR B  2 157 ? 64.651  -0.515  37.733  1.00 24.82  ? 157 TYR B CG  1 
ATOM   3789  C CD1 . TYR B  2 157 ? 65.110  -0.688  36.441  1.00 24.57  ? 157 TYR B CD1 1 
ATOM   3790  C CD2 . TYR B  2 157 ? 64.399  -1.599  38.525  1.00 23.70  ? 157 TYR B CD2 1 
ATOM   3791  C CE1 . TYR B  2 157 ? 65.323  -1.952  35.947  1.00 24.80  ? 157 TYR B CE1 1 
ATOM   3792  C CE2 . TYR B  2 157 ? 64.603  -2.865  38.038  1.00 23.85  ? 157 TYR B CE2 1 
ATOM   3793  C CZ  . TYR B  2 157 ? 65.071  -3.043  36.757  1.00 24.49  ? 157 TYR B CZ  1 
ATOM   3794  O OH  . TYR B  2 157 ? 65.326  -4.327  36.305  1.00 23.24  ? 157 TYR B OH  1 
ATOM   3795  N N   . ASP B  2 158 ? 67.905  0.671   39.061  1.00 30.74  ? 158 ASP B N   1 
ATOM   3796  C CA  . ASP B  2 158 ? 69.148  0.481   38.340  1.00 31.49  ? 158 ASP B CA  1 
ATOM   3797  C C   . ASP B  2 158 ? 69.026  -0.813  37.574  1.00 30.60  ? 158 ASP B C   1 
ATOM   3798  O O   . ASP B  2 158 ? 68.920  -1.887  38.167  1.00 30.46  ? 158 ASP B O   1 
ATOM   3799  C CB  . ASP B  2 158 ? 70.349  0.370   39.250  1.00 34.00  ? 158 ASP B CB  1 
ATOM   3800  C CG  . ASP B  2 158 ? 71.666  0.476   38.483  1.00 37.02  ? 158 ASP B CG  1 
ATOM   3801  O OD1 . ASP B  2 158 ? 72.592  1.099   38.993  1.00 38.82  ? 158 ASP B OD1 1 
ATOM   3802  O OD2 . ASP B  2 158 ? 71.796  -0.062  37.376  1.00 38.66  ? 158 ASP B OD2 1 
ATOM   3803  N N   . HIS B  2 159 ? 69.071  -0.747  36.247  1.00 29.48  ? 159 HIS B N   1 
ATOM   3804  C CA  . HIS B  2 159 ? 68.853  -1.947  35.469  1.00 27.95  ? 159 HIS B CA  1 
ATOM   3805  C C   . HIS B  2 159 ? 70.037  -2.866  35.537  1.00 28.53  ? 159 HIS B C   1 
ATOM   3806  O O   . HIS B  2 159 ? 69.839  -4.078  35.491  1.00 28.50  ? 159 HIS B O   1 
ATOM   3807  C CB  . HIS B  2 159 ? 68.563  -1.606  34.014  1.00 26.50  ? 159 HIS B CB  1 
ATOM   3808  C CG  . HIS B  2 159 ? 69.775  -1.351  33.148  1.00 24.51  ? 159 HIS B CG  1 
ATOM   3809  N ND1 . HIS B  2 159 ? 70.139  -2.280  32.310  1.00 23.55  ? 159 HIS B ND1 1 
ATOM   3810  C CD2 . HIS B  2 159 ? 70.637  -0.312  33.227  1.00 23.71  ? 159 HIS B CD2 1 
ATOM   3811  C CE1 . HIS B  2 159 ? 71.277  -1.839  31.847  1.00 23.58  ? 159 HIS B CE1 1 
ATOM   3812  N NE2 . HIS B  2 159 ? 71.572  -0.677  32.392  1.00 23.77  ? 159 HIS B NE2 1 
ATOM   3813  N N   . ASP B  2 160 ? 71.243  -2.317  35.710  1.00 29.62  ? 160 ASP B N   1 
ATOM   3814  C CA  . ASP B  2 160 ? 72.434  -3.140  35.735  1.00 30.65  ? 160 ASP B CA  1 
ATOM   3815  C C   . ASP B  2 160 ? 72.422  -4.130  36.861  1.00 30.20  ? 160 ASP B C   1 
ATOM   3816  O O   . ASP B  2 160 ? 72.736  -5.315  36.678  1.00 30.22  ? 160 ASP B O   1 
ATOM   3817  C CB  . ASP B  2 160 ? 73.675  -2.296  35.854  1.00 31.82  ? 160 ASP B CB  1 
ATOM   3818  C CG  . ASP B  2 160 ? 74.291  -2.360  34.482  1.00 34.20  ? 160 ASP B CG  1 
ATOM   3819  O OD1 . ASP B  2 160 ? 74.774  -3.442  34.105  1.00 34.75  ? 160 ASP B OD1 1 
ATOM   3820  O OD2 . ASP B  2 160 ? 74.225  -1.345  33.767  1.00 35.76  ? 160 ASP B OD2 1 
ATOM   3821  N N   . VAL B  2 161 ? 71.894  -3.672  37.992  1.00 29.58  ? 161 VAL B N   1 
ATOM   3822  C CA  . VAL B  2 161 ? 71.760  -4.491  39.186  1.00 28.90  ? 161 VAL B CA  1 
ATOM   3823  C C   . VAL B  2 161 ? 71.121  -5.830  38.888  1.00 29.20  ? 161 VAL B C   1 
ATOM   3824  O O   . VAL B  2 161 ? 71.503  -6.828  39.489  1.00 31.05  ? 161 VAL B O   1 
ATOM   3825  C CB  . VAL B  2 161 ? 70.939  -3.736  40.219  1.00 28.21  ? 161 VAL B CB  1 
ATOM   3826  C CG1 . VAL B  2 161 ? 70.626  -4.547  41.439  1.00 27.10  ? 161 VAL B CG1 1 
ATOM   3827  C CG2 . VAL B  2 161 ? 71.781  -2.558  40.674  1.00 28.67  ? 161 VAL B CG2 1 
ATOM   3828  N N   . TYR B  2 162 ? 70.222  -5.909  37.906  1.00 28.57  ? 162 TYR B N   1 
ATOM   3829  C CA  . TYR B  2 162 ? 69.561  -7.174  37.607  1.00 27.48  ? 162 TYR B CA  1 
ATOM   3830  C C   . TYR B  2 162 ? 69.796  -7.652  36.187  1.00 27.95  ? 162 TYR B C   1 
ATOM   3831  O O   . TYR B  2 162 ? 69.235  -8.681  35.787  1.00 28.31  ? 162 TYR B O   1 
ATOM   3832  C CB  . TYR B  2 162 ? 68.091  -7.063  37.775  1.00 25.72  ? 162 TYR B CB  1 
ATOM   3833  C CG  . TYR B  2 162 ? 67.655  -6.320  39.002  1.00 24.78  ? 162 TYR B CG  1 
ATOM   3834  C CD1 . TYR B  2 162 ? 67.322  -6.990  40.138  1.00 24.05  ? 162 TYR B CD1 1 
ATOM   3835  C CD2 . TYR B  2 162 ? 67.533  -4.966  38.919  1.00 25.07  ? 162 TYR B CD2 1 
ATOM   3836  C CE1 . TYR B  2 162 ? 66.833  -6.297  41.207  1.00 24.02  ? 162 TYR B CE1 1 
ATOM   3837  C CE2 . TYR B  2 162 ? 67.058  -4.268  39.986  1.00 25.00  ? 162 TYR B CE2 1 
ATOM   3838  C CZ  . TYR B  2 162 ? 66.704  -4.938  41.119  1.00 24.89  ? 162 TYR B CZ  1 
ATOM   3839  O OH  . TYR B  2 162 ? 66.170  -4.211  42.171  1.00 26.39  ? 162 TYR B OH  1 
ATOM   3840  N N   . ARG B  2 163 ? 70.633  -6.960  35.418  1.00 28.30  ? 163 ARG B N   1 
ATOM   3841  C CA  . ARG B  2 163 ? 70.845  -7.307  34.035  1.00 29.23  ? 163 ARG B CA  1 
ATOM   3842  C C   . ARG B  2 163 ? 71.225  -8.770  33.848  1.00 31.24  ? 163 ARG B C   1 
ATOM   3843  O O   . ARG B  2 163 ? 70.521  -9.467  33.119  1.00 31.60  ? 163 ARG B O   1 
ATOM   3844  C CB  . ARG B  2 163 ? 71.927  -6.425  33.444  1.00 27.95  ? 163 ARG B CB  1 
ATOM   3845  C CG  . ARG B  2 163 ? 71.892  -6.503  31.939  1.00 26.84  ? 163 ARG B CG  1 
ATOM   3846  C CD  . ARG B  2 163 ? 72.621  -5.288  31.460  1.00 26.72  ? 163 ARG B CD  1 
ATOM   3847  N NE  . ARG B  2 163 ? 72.162  -4.890  30.145  1.00 25.97  ? 163 ARG B NE  1 
ATOM   3848  C CZ  . ARG B  2 163 ? 72.602  -5.469  29.044  1.00 26.41  ? 163 ARG B CZ  1 
ATOM   3849  N NH1 . ARG B  2 163 ? 72.126  -5.033  27.890  1.00 26.71  ? 163 ARG B NH1 1 
ATOM   3850  N NH2 . ARG B  2 163 ? 73.490  -6.478  29.106  1.00 26.91  ? 163 ARG B NH2 1 
ATOM   3851  N N   . ASP B  2 164 ? 72.249  -9.286  34.544  1.00 33.09  ? 164 ASP B N   1 
ATOM   3852  C CA  . ASP B  2 164 ? 72.697  -10.655 34.332  1.00 34.55  ? 164 ASP B CA  1 
ATOM   3853  C C   . ASP B  2 164 ? 71.610  -11.650 34.637  1.00 34.46  ? 164 ASP B C   1 
ATOM   3854  O O   . ASP B  2 164 ? 71.301  -12.499 33.796  1.00 34.88  ? 164 ASP B O   1 
ATOM   3855  C CB  . ASP B  2 164 ? 73.927  -10.973 35.192  1.00 36.56  ? 164 ASP B CB  1 
ATOM   3856  C CG  . ASP B  2 164 ? 75.255  -10.371 34.691  1.00 39.25  ? 164 ASP B CG  1 
ATOM   3857  O OD1 . ASP B  2 164 ? 75.775  -10.827 33.662  1.00 40.33  ? 164 ASP B OD1 1 
ATOM   3858  O OD2 . ASP B  2 164 ? 75.774  -9.434  35.338  1.00 40.04  ? 164 ASP B OD2 1 
ATOM   3859  N N   . GLU B  2 165 ? 70.938  -11.470 35.781  1.00 34.47  ? 165 GLU B N   1 
ATOM   3860  C CA  . GLU B  2 165 ? 69.876  -12.374 36.222  1.00 34.43  ? 165 GLU B CA  1 
ATOM   3861  C C   . GLU B  2 165 ? 68.802  -12.439 35.175  1.00 33.84  ? 165 GLU B C   1 
ATOM   3862  O O   . GLU B  2 165 ? 68.574  -13.520 34.621  1.00 34.13  ? 165 GLU B O   1 
ATOM   3863  C CB  . GLU B  2 165 ? 69.220  -11.908 37.514  1.00 35.73  ? 165 GLU B CB  1 
ATOM   3864  C CG  . GLU B  2 165 ? 68.142  -12.897 37.964  1.00 36.93  ? 165 GLU B CG  1 
ATOM   3865  C CD  . GLU B  2 165 ? 67.271  -12.535 39.176  1.00 38.03  ? 165 GLU B CD  1 
ATOM   3866  O OE1 . GLU B  2 165 ? 67.600  -11.621 39.948  1.00 37.87  ? 165 GLU B OE1 1 
ATOM   3867  O OE2 . GLU B  2 165 ? 66.222  -13.178 39.331  1.00 38.67  ? 165 GLU B OE2 1 
ATOM   3868  N N   . ALA B  2 166 ? 68.255  -11.261 34.861  1.00 32.81  ? 166 ALA B N   1 
ATOM   3869  C CA  . ALA B  2 166 ? 67.228  -11.128 33.863  1.00 32.34  ? 166 ALA B CA  1 
ATOM   3870  C C   . ALA B  2 166 ? 67.632  -11.764 32.538  1.00 33.07  ? 166 ALA B C   1 
ATOM   3871  O O   . ALA B  2 166 ? 67.089  -12.805 32.141  1.00 32.58  ? 166 ALA B O   1 
ATOM   3872  C CB  . ALA B  2 166 ? 66.944  -9.668  33.642  1.00 31.78  ? 166 ALA B CB  1 
ATOM   3873  N N   . LEU B  2 167 ? 68.690  -11.216 31.932  1.00 33.50  ? 167 LEU B N   1 
ATOM   3874  C CA  . LEU B  2 167 ? 69.207  -11.595 30.642  1.00 33.98  ? 167 LEU B CA  1 
ATOM   3875  C C   . LEU B  2 167 ? 69.356  -13.089 30.527  1.00 35.96  ? 167 LEU B C   1 
ATOM   3876  O O   . LEU B  2 167 ? 68.925  -13.674 29.533  1.00 36.83  ? 167 LEU B O   1 
ATOM   3877  C CB  . LEU B  2 167 ? 70.535  -10.899 30.453  1.00 32.66  ? 167 LEU B CB  1 
ATOM   3878  C CG  . LEU B  2 167 ? 70.899  -10.343 29.110  1.00 31.93  ? 167 LEU B CG  1 
ATOM   3879  C CD1 . LEU B  2 167 ? 69.783  -9.487  28.579  1.00 31.58  ? 167 LEU B CD1 1 
ATOM   3880  C CD2 . LEU B  2 167 ? 72.149  -9.519  29.261  1.00 31.76  ? 167 LEU B CD2 1 
ATOM   3881  N N   . ASN B  2 168 ? 69.858  -13.727 31.574  1.00 38.38  ? 168 ASN B N   1 
ATOM   3882  C CA  . ASN B  2 168 ? 70.018  -15.163 31.555  1.00 40.93  ? 168 ASN B CA  1 
ATOM   3883  C C   . ASN B  2 168 ? 68.680  -15.872 31.433  1.00 41.66  ? 168 ASN B C   1 
ATOM   3884  O O   . ASN B  2 168 ? 68.456  -16.639 30.493  1.00 41.89  ? 168 ASN B O   1 
ATOM   3885  C CB  . ASN B  2 168 ? 70.740  -15.625 32.826  1.00 42.22  ? 168 ASN B CB  1 
ATOM   3886  C CG  . ASN B  2 168 ? 70.487  -17.100 33.135  1.00 43.57  ? 168 ASN B CG  1 
ATOM   3887  O OD1 . ASN B  2 168 ? 69.790  -17.440 34.092  1.00 43.58  ? 168 ASN B OD1 1 
ATOM   3888  N ND2 . ASN B  2 168 ? 70.943  -18.043 32.315  1.00 44.83  ? 168 ASN B ND2 1 
ATOM   3889  N N   . ASN B  2 169 ? 67.744  -15.605 32.322  1.00 42.90  ? 169 ASN B N   1 
ATOM   3890  C CA  . ASN B  2 169 ? 66.526  -16.372 32.251  1.00 44.74  ? 169 ASN B CA  1 
ATOM   3891  C C   . ASN B  2 169 ? 65.515  -15.750 31.299  1.00 45.19  ? 169 ASN B C   1 
ATOM   3892  O O   . ASN B  2 169 ? 64.400  -16.235 31.110  1.00 45.36  ? 169 ASN B O   1 
ATOM   3893  C CB  . ASN B  2 169 ? 66.006  -16.550 33.686  1.00 46.11  ? 169 ASN B CB  1 
ATOM   3894  C CG  . ASN B  2 169 ? 65.205  -15.439 34.336  1.00 47.11  ? 169 ASN B CG  1 
ATOM   3895  O OD1 . ASN B  2 169 ? 63.982  -15.441 34.258  1.00 47.14  ? 169 ASN B OD1 1 
ATOM   3896  N ND2 . ASN B  2 169 ? 65.814  -14.505 35.058  1.00 48.17  ? 169 ASN B ND2 1 
ATOM   3897  N N   . ARG B  2 170 ? 65.933  -14.720 30.578  1.00 46.05  ? 170 ARG B N   1 
ATOM   3898  C CA  . ARG B  2 170 ? 65.128  -14.159 29.512  1.00 47.34  ? 170 ARG B CA  1 
ATOM   3899  C C   . ARG B  2 170 ? 65.458  -14.934 28.241  1.00 50.18  ? 170 ARG B C   1 
ATOM   3900  O O   . ARG B  2 170 ? 64.566  -15.409 27.524  1.00 50.63  ? 170 ARG B O   1 
ATOM   3901  C CB  . ARG B  2 170 ? 65.462  -12.679 29.349  1.00 45.04  ? 170 ARG B CB  1 
ATOM   3902  C CG  . ARG B  2 170 ? 64.601  -11.869 28.409  1.00 42.10  ? 170 ARG B CG  1 
ATOM   3903  C CD  . ARG B  2 170 ? 65.058  -10.421 28.343  1.00 40.36  ? 170 ARG B CD  1 
ATOM   3904  N NE  . ARG B  2 170 ? 64.535  -9.891  27.103  1.00 38.95  ? 170 ARG B NE  1 
ATOM   3905  C CZ  . ARG B  2 170 ? 65.088  -8.922  26.368  1.00 38.60  ? 170 ARG B CZ  1 
ATOM   3906  N NH1 . ARG B  2 170 ? 64.494  -8.677  25.188  1.00 39.68  ? 170 ARG B NH1 1 
ATOM   3907  N NH2 . ARG B  2 170 ? 66.125  -8.187  26.803  1.00 36.97  ? 170 ARG B NH2 1 
ATOM   3908  N N   . PHE B  2 171 ? 66.743  -15.094 27.934  1.00 53.57  ? 171 PHE B N   1 
ATOM   3909  C CA  . PHE B  2 171 ? 67.138  -15.800 26.738  1.00 57.37  ? 171 PHE B CA  1 
ATOM   3910  C C   . PHE B  2 171 ? 67.590  -17.234 27.002  1.00 62.11  ? 171 PHE B C   1 
ATOM   3911  O O   . PHE B  2 171 ? 68.410  -17.777 26.255  1.00 62.75  ? 171 PHE B O   1 
ATOM   3912  C CB  . PHE B  2 171 ? 68.250  -15.013 26.046  1.00 55.00  ? 171 PHE B CB  1 
ATOM   3913  C CG  . PHE B  2 171 ? 67.844  -13.651 25.512  1.00 53.15  ? 171 PHE B CG  1 
ATOM   3914  C CD1 . PHE B  2 171 ? 66.668  -13.482 24.814  1.00 52.62  ? 171 PHE B CD1 1 
ATOM   3915  C CD2 . PHE B  2 171 ? 68.687  -12.582 25.718  1.00 52.67  ? 171 PHE B CD2 1 
ATOM   3916  C CE1 . PHE B  2 171 ? 66.342  -12.238 24.326  1.00 52.33  ? 171 PHE B CE1 1 
ATOM   3917  C CE2 . PHE B  2 171 ? 68.357  -11.342 25.227  1.00 52.26  ? 171 PHE B CE2 1 
ATOM   3918  C CZ  . PHE B  2 171 ? 67.185  -11.169 24.529  1.00 52.18  ? 171 PHE B CZ  1 
ATOM   3919  N N   . GLN B  2 172 ? 67.081  -17.920 28.032  1.00 67.95  ? 172 GLN B N   1 
ATOM   3920  C CA  . GLN B  2 172 ? 67.462  -19.309 28.249  1.00 73.46  ? 172 GLN B CA  1 
ATOM   3921  C C   . GLN B  2 172 ? 66.710  -20.182 27.238  1.00 76.93  ? 172 GLN B C   1 
ATOM   3922  O O   . GLN B  2 172 ? 65.625  -20.723 27.484  1.00 77.15  ? 172 GLN B O   1 
ATOM   3923  C CB  . GLN B  2 172 ? 67.148  -19.689 29.723  1.00 74.37  ? 172 GLN B CB  1 
ATOM   3924  C CG  . GLN B  2 172 ? 65.715  -19.714 30.282  1.00 75.29  ? 172 GLN B CG  1 
ATOM   3925  C CD  . GLN B  2 172 ? 65.260  -21.132 30.646  1.00 76.06  ? 172 GLN B CD  1 
ATOM   3926  O OE1 . GLN B  2 172 ? 65.646  -21.717 31.666  1.00 76.52  ? 172 GLN B OE1 1 
ATOM   3927  N NE2 . GLN B  2 172 ? 64.525  -21.824 29.786  1.00 76.34  ? 172 GLN B NE2 1 
ATOM   3928  N N   . ILE B  2 173 ? 67.256  -20.225 26.022  1.00 81.27  ? 173 ILE B N   1 
ATOM   3929  C CA  . ILE B  2 173 ? 66.712  -21.026 24.924  1.00 84.95  ? 173 ILE B CA  1 
ATOM   3930  C C   . ILE B  2 173 ? 66.961  -22.481 25.289  1.00 87.42  ? 173 ILE B C   1 
ATOM   3931  O O   . ILE B  2 173 ? 68.034  -23.051 25.048  1.00 87.78  ? 173 ILE B O   1 
ATOM   3932  C CB  . ILE B  2 173 ? 67.386  -20.714 23.525  1.00 85.01  ? 173 ILE B CB  1 
ATOM   3933  C CG1 . ILE B  2 173 ? 68.650  -19.827 23.580  1.00 85.32  ? 173 ILE B CG1 1 
ATOM   3934  C CG2 . ILE B  2 173 ? 66.284  -20.080 22.708  1.00 85.07  ? 173 ILE B CG2 1 
ATOM   3935  C CD1 . ILE B  2 173 ? 69.335  -19.430 22.255  1.00 85.41  ? 173 ILE B CD1 1 
ATOM   3936  N N   . LYS B  2 174 ? 65.973  -23.048 25.975  1.00 90.19  ? 174 LYS B N   1 
ATOM   3937  C CA  . LYS B  2 174 ? 66.060  -24.386 26.508  1.00 92.54  ? 174 LYS B CA  1 
ATOM   3938  C C   . LYS B  2 174 ? 64.655  -24.782 26.922  1.00 93.71  ? 174 LYS B C   1 
ATOM   3939  O O   . LYS B  2 174 ? 64.310  -24.644 28.108  1.00 93.72  ? 174 LYS B O   1 
ATOM   3940  C CB  . LYS B  2 174 ? 67.025  -24.378 27.716  1.00 93.18  ? 174 LYS B CB  1 
ATOM   3941  C CG  . LYS B  2 174 ? 67.758  -25.691 27.972  1.00 94.06  ? 174 LYS B CG  1 
ATOM   3942  C CD  . LYS B  2 174 ? 68.783  -25.566 29.103  1.00 94.65  ? 174 LYS B CD  1 
ATOM   3943  C CE  . LYS B  2 174 ? 68.239  -25.939 30.493  1.00 95.12  ? 174 LYS B CE  1 
ATOM   3944  N NZ  . LYS B  2 174 ? 67.224  -25.030 31.006  1.00 95.24  ? 174 LYS B NZ  1 
ATOM   3945  N N   . GLY B  2 175 ? 63.878  -25.253 25.953  1.00 95.44  ? 175 GLY B N   1 
ATOM   3946  C CA  . GLY B  2 175 ? 62.517  -25.719 26.165  1.00 97.69  ? 175 GLY B CA  1 
ATOM   3947  C C   . GLY B  2 175 ? 62.058  -26.640 25.019  1.00 98.97  ? 175 GLY B C   1 
ATOM   3948  O O   . GLY B  2 175 ? 62.893  -27.030 24.192  1.00 99.92  ? 175 GLY B O   1 
ATOM   3949  O OXT . GLY B  2 175 ? 60.862  -26.973 24.935  1.00 99.27  ? 175 GLY B OXT 1 
ATOM   3950  N N   . GLN C  1 1   ? 58.257  -27.270 22.778  1.00 128.69 ? 1   GLN C N   1 
ATOM   3951  C CA  . GLN C  1 1   ? 57.012  -28.028 22.641  1.00 128.50 ? 1   GLN C CA  1 
ATOM   3952  C C   . GLN C  1 1   ? 57.234  -29.016 21.493  1.00 127.93 ? 1   GLN C C   1 
ATOM   3953  O O   . GLN C  1 1   ? 57.427  -30.191 21.788  1.00 127.90 ? 1   GLN C O   1 
ATOM   3954  C CB  . GLN C  1 1   ? 55.787  -27.090 22.340  1.00 128.89 ? 1   GLN C CB  1 
ATOM   3955  C CG  . GLN C  1 1   ? 54.343  -27.696 22.387  1.00 129.36 ? 1   GLN C CG  1 
ATOM   3956  C CD  . GLN C  1 1   ? 53.897  -28.518 21.171  1.00 129.59 ? 1   GLN C CD  1 
ATOM   3957  O OE1 . GLN C  1 1   ? 54.281  -28.183 20.059  1.00 129.72 ? 1   GLN C OE1 1 
ATOM   3958  N NE2 . GLN C  1 1   ? 53.124  -29.593 21.274  1.00 129.60 ? 1   GLN C NE2 1 
ATOM   3959  N N   . ASP C  1 2   ? 57.220  -28.574 20.225  1.00 127.06 ? 2   ASP C N   1 
ATOM   3960  C CA  . ASP C  1 2   ? 57.471  -29.447 19.086  1.00 125.99 ? 2   ASP C CA  1 
ATOM   3961  C C   . ASP C  1 2   ? 58.902  -29.981 19.045  1.00 125.08 ? 2   ASP C C   1 
ATOM   3962  O O   . ASP C  1 2   ? 59.761  -29.571 19.846  1.00 124.70 ? 2   ASP C O   1 
ATOM   3963  C CB  . ASP C  1 2   ? 57.176  -28.676 17.803  1.00 126.24 ? 2   ASP C CB  1 
ATOM   3964  C CG  . ASP C  1 2   ? 56.410  -29.475 16.758  1.00 126.44 ? 2   ASP C CG  1 
ATOM   3965  O OD1 . ASP C  1 2   ? 55.398  -28.964 16.288  1.00 126.76 ? 2   ASP C OD1 1 
ATOM   3966  O OD2 . ASP C  1 2   ? 56.808  -30.590 16.409  1.00 126.47 ? 2   ASP C OD2 1 
ATOM   3967  N N   . LEU C  1 3   ? 59.154  -30.862 18.082  1.00 124.05 ? 3   LEU C N   1 
ATOM   3968  C CA  . LEU C  1 3   ? 60.421  -31.533 17.892  1.00 122.91 ? 3   LEU C CA  1 
ATOM   3969  C C   . LEU C  1 3   ? 61.274  -30.754 16.890  1.00 122.43 ? 3   LEU C C   1 
ATOM   3970  O O   . LEU C  1 3   ? 60.738  -30.088 15.994  1.00 122.30 ? 3   LEU C O   1 
ATOM   3971  C CB  . LEU C  1 3   ? 60.158  -32.951 17.369  1.00 122.35 ? 3   LEU C CB  1 
ATOM   3972  C CG  . LEU C  1 3   ? 61.239  -34.013 17.532  1.00 121.89 ? 3   LEU C CG  1 
ATOM   3973  C CD1 . LEU C  1 3   ? 61.340  -34.422 18.994  1.00 121.77 ? 3   LEU C CD1 1 
ATOM   3974  C CD2 . LEU C  1 3   ? 60.895  -35.227 16.701  1.00 121.79 ? 3   LEU C CD2 1 
ATOM   3975  N N   . PRO C  1 4   ? 62.615  -30.782 17.021  1.00 121.88 ? 4   PRO C N   1 
ATOM   3976  C CA  . PRO C  1 4   ? 63.563  -30.107 16.138  1.00 121.21 ? 4   PRO C CA  1 
ATOM   3977  C C   . PRO C  1 4   ? 63.356  -30.313 14.641  1.00 120.08 ? 4   PRO C C   1 
ATOM   3978  O O   . PRO C  1 4   ? 63.288  -31.441 14.136  1.00 120.01 ? 4   PRO C O   1 
ATOM   3979  C CB  . PRO C  1 4   ? 64.935  -30.586 16.605  1.00 121.45 ? 4   PRO C CB  1 
ATOM   3980  C CG  . PRO C  1 4   ? 64.636  -31.724 17.552  1.00 121.70 ? 4   PRO C CG  1 
ATOM   3981  C CD  . PRO C  1 4   ? 63.349  -31.233 18.198  1.00 121.77 ? 4   PRO C CD  1 
ATOM   3982  N N   . GLY C  1 5   ? 63.274  -29.170 13.954  1.00 118.63 ? 5   GLY C N   1 
ATOM   3983  C CA  . GLY C  1 5   ? 63.125  -29.119 12.516  1.00 116.39 ? 5   GLY C CA  1 
ATOM   3984  C C   . GLY C  1 5   ? 64.498  -29.002 11.860  1.00 114.47 ? 5   GLY C C   1 
ATOM   3985  O O   . GLY C  1 5   ? 65.370  -28.261 12.318  1.00 114.48 ? 5   GLY C O   1 
ATOM   3986  N N   . ASN C  1 6   ? 64.691  -29.803 10.815  1.00 112.20 ? 6   ASN C N   1 
ATOM   3987  C CA  . ASN C  1 6   ? 65.907  -29.823 10.004  1.00 109.46 ? 6   ASN C CA  1 
ATOM   3988  C C   . ASN C  1 6   ? 66.124  -28.511 9.251   1.00 107.03 ? 6   ASN C C   1 
ATOM   3989  O O   . ASN C  1 6   ? 67.256  -28.064 9.031   1.00 106.89 ? 6   ASN C O   1 
ATOM   3990  C CB  . ASN C  1 6   ? 65.834  -30.980 8.980   1.00 109.99 ? 6   ASN C CB  1 
ATOM   3991  C CG  . ASN C  1 6   ? 64.570  -30.979 8.112   1.00 110.16 ? 6   ASN C CG  1 
ATOM   3992  O OD1 . ASN C  1 6   ? 63.467  -31.147 8.629   1.00 110.42 ? 6   ASN C OD1 1 
ATOM   3993  N ND2 . ASN C  1 6   ? 64.578  -30.756 6.808   1.00 109.98 ? 6   ASN C ND2 1 
ATOM   3994  N N   . ASP C  1 7   ? 65.029  -27.918 8.779   1.00 103.73 ? 7   ASP C N   1 
ATOM   3995  C CA  . ASP C  1 7   ? 65.123  -26.687 8.035   1.00 100.18 ? 7   ASP C CA  1 
ATOM   3996  C C   . ASP C  1 7   ? 65.243  -25.541 9.021   1.00 96.85  ? 7   ASP C C   1 
ATOM   3997  O O   . ASP C  1 7   ? 64.788  -25.618 10.169  1.00 96.62  ? 7   ASP C O   1 
ATOM   3998  C CB  . ASP C  1 7   ? 63.878  -26.517 7.156   1.00 101.32 ? 7   ASP C CB  1 
ATOM   3999  C CG  . ASP C  1 7   ? 63.644  -25.093 6.645   1.00 101.94 ? 7   ASP C CG  1 
ATOM   4000  O OD1 . ASP C  1 7   ? 64.552  -24.516 6.036   1.00 102.02 ? 7   ASP C OD1 1 
ATOM   4001  O OD2 . ASP C  1 7   ? 62.573  -24.547 6.914   1.00 102.32 ? 7   ASP C OD2 1 
ATOM   4002  N N   . ASN C  1 8   ? 65.872  -24.480 8.548   1.00 92.57  ? 8   ASN C N   1 
ATOM   4003  C CA  . ASN C  1 8   ? 66.095  -23.292 9.346   1.00 88.02  ? 8   ASN C CA  1 
ATOM   4004  C C   . ASN C  1 8   ? 65.860  -22.107 8.409   1.00 83.28  ? 8   ASN C C   1 
ATOM   4005  O O   . ASN C  1 8   ? 66.672  -21.837 7.512   1.00 83.37  ? 8   ASN C O   1 
ATOM   4006  C CB  . ASN C  1 8   ? 67.552  -23.310 9.925   1.00 89.36  ? 8   ASN C CB  1 
ATOM   4007  C CG  . ASN C  1 8   ? 68.753  -23.189 8.971   1.00 90.05  ? 8   ASN C CG  1 
ATOM   4008  O OD1 . ASN C  1 8   ? 69.417  -22.149 8.907   1.00 90.21  ? 8   ASN C OD1 1 
ATOM   4009  N ND2 . ASN C  1 8   ? 69.170  -24.214 8.235   1.00 90.58  ? 8   ASN C ND2 1 
ATOM   4010  N N   . SER C  1 9   ? 64.739  -21.401 8.539   1.00 76.27  ? 9   SER C N   1 
ATOM   4011  C CA  . SER C  1 9   ? 64.532  -20.315 7.604   1.00 69.24  ? 9   SER C CA  1 
ATOM   4012  C C   . SER C  1 9   ? 63.750  -19.204 8.264   1.00 63.97  ? 9   SER C C   1 
ATOM   4013  O O   . SER C  1 9   ? 63.177  -19.420 9.323   1.00 63.30  ? 9   SER C O   1 
ATOM   4014  C CB  . SER C  1 9   ? 63.812  -20.869 6.351   1.00 69.17  ? 9   SER C CB  1 
ATOM   4015  O OG  . SER C  1 9   ? 62.527  -21.413 6.592   1.00 68.57  ? 9   SER C OG  1 
ATOM   4016  N N   . THR C  1 10  ? 63.772  -18.013 7.692   1.00 57.62  ? 10  THR C N   1 
ATOM   4017  C CA  . THR C  1 10  ? 63.079  -16.864 8.225   1.00 50.99  ? 10  THR C CA  1 
ATOM   4018  C C   . THR C  1 10  ? 61.879  -16.509 7.347   1.00 46.79  ? 10  THR C C   1 
ATOM   4019  O O   . THR C  1 10  ? 61.570  -17.252 6.409   1.00 47.47  ? 10  THR C O   1 
ATOM   4020  C CB  . THR C  1 10  ? 64.113  -15.729 8.285   1.00 51.11  ? 10  THR C CB  1 
ATOM   4021  O OG1 . THR C  1 10  ? 64.877  -15.771 7.081   1.00 50.55  ? 10  THR C OG1 1 
ATOM   4022  C CG2 . THR C  1 10  ? 65.058  -15.862 9.464   1.00 51.05  ? 10  THR C CG2 1 
ATOM   4023  N N   . ALA C  1 11  ? 61.194  -15.392 7.605   1.00 40.61  ? 11  ALA C N   1 
ATOM   4024  C CA  . ALA C  1 11  ? 60.093  -14.913 6.771   1.00 34.21  ? 11  ALA C CA  1 
ATOM   4025  C C   . ALA C  1 11  ? 60.160  -13.396 6.787   1.00 29.51  ? 11  ALA C C   1 
ATOM   4026  O O   . ALA C  1 11  ? 60.918  -12.857 7.594   1.00 28.55  ? 11  ALA C O   1 
ATOM   4027  C CB  . ALA C  1 11  ? 58.741  -15.321 7.322   1.00 33.13  ? 11  ALA C CB  1 
ATOM   4028  N N   . THR C  1 12  ? 59.423  -12.693 5.940   1.00 24.46  ? 12  THR C N   1 
ATOM   4029  C CA  . THR C  1 12  ? 59.413  -11.244 5.948   1.00 19.52  ? 12  THR C CA  1 
ATOM   4030  C C   . THR C  1 12  ? 57.989  -10.739 5.881   1.00 17.46  ? 12  THR C C   1 
ATOM   4031  O O   . THR C  1 12  ? 57.214  -11.196 5.031   1.00 18.71  ? 12  THR C O   1 
ATOM   4032  C CB  . THR C  1 12  ? 60.126  -10.674 4.753   1.00 19.13  ? 12  THR C CB  1 
ATOM   4033  O OG1 . THR C  1 12  ? 61.368  -11.333 4.606   1.00 19.50  ? 12  THR C OG1 1 
ATOM   4034  C CG2 . THR C  1 12  ? 60.313  -9.190  4.919   1.00 19.24  ? 12  THR C CG2 1 
ATOM   4035  N N   . LEU C  1 13  ? 57.618  -9.812  6.750   1.00 14.15  ? 13  LEU C N   1 
ATOM   4036  C CA  . LEU C  1 13  ? 56.300  -9.205  6.726   1.00 11.18  ? 13  LEU C CA  1 
ATOM   4037  C C   . LEU C  1 13  ? 56.504  -7.727  6.489   1.00 10.76  ? 13  LEU C C   1 
ATOM   4038  O O   . LEU C  1 13  ? 57.374  -7.145  7.126   1.00 11.12  ? 13  LEU C O   1 
ATOM   4039  C CB  . LEU C  1 13  ? 55.601  -9.313  8.032   1.00 9.41   ? 13  LEU C CB  1 
ATOM   4040  C CG  . LEU C  1 13  ? 54.273  -9.979  8.172   1.00 8.29   ? 13  LEU C CG  1 
ATOM   4041  C CD1 . LEU C  1 13  ? 53.704  -9.462  9.464   1.00 7.64   ? 13  LEU C CD1 1 
ATOM   4042  C CD2 . LEU C  1 13  ? 53.302  -9.619  7.081   1.00 7.53   ? 13  LEU C CD2 1 
ATOM   4043  N N   . CYS C  1 14  ? 55.769  -7.079  5.615   1.00 9.65   ? 14  CYS C N   1 
ATOM   4044  C CA  . CYS C  1 14  ? 55.933  -5.663  5.449   1.00 9.08   ? 14  CYS C CA  1 
ATOM   4045  C C   . CYS C  1 14  ? 54.597  -4.996  5.576   1.00 9.67   ? 14  CYS C C   1 
ATOM   4046  O O   . CYS C  1 14  ? 53.618  -5.532  5.037   1.00 10.23  ? 14  CYS C O   1 
ATOM   4047  C CB  . CYS C  1 14  ? 56.457  -5.324  4.111   1.00 8.20   ? 14  CYS C CB  1 
ATOM   4048  S SG  . CYS C  1 14  ? 58.106  -6.012  3.966   1.00 7.26   ? 14  CYS C SG  1 
ATOM   4049  N N   . LEU C  1 15  ? 54.533  -3.900  6.333   1.00 9.37   ? 15  LEU C N   1 
ATOM   4050  C CA  . LEU C  1 15  ? 53.322  -3.146  6.427   1.00 9.13   ? 15  LEU C CA  1 
ATOM   4051  C C   . LEU C  1 15  ? 53.381  -2.003  5.442   1.00 8.65   ? 15  LEU C C   1 
ATOM   4052  O O   . LEU C  1 15  ? 54.474  -1.601  5.032   1.00 7.92   ? 15  LEU C O   1 
ATOM   4053  C CB  . LEU C  1 15  ? 53.165  -2.640  7.821   1.00 9.95   ? 15  LEU C CB  1 
ATOM   4054  C CG  . LEU C  1 15  ? 52.729  -3.716  8.772   1.00 10.41  ? 15  LEU C CG  1 
ATOM   4055  C CD1 . LEU C  1 15  ? 53.933  -4.128  9.564   1.00 11.00  ? 15  LEU C CD1 1 
ATOM   4056  C CD2 . LEU C  1 15  ? 51.631  -3.217  9.692   1.00 10.73  ? 15  LEU C CD2 1 
ATOM   4057  N N   . GLY C  1 16  ? 52.222  -1.528  5.012   1.00 8.35   ? 16  GLY C N   1 
ATOM   4058  C CA  . GLY C  1 16  ? 52.170  -0.450  4.058   1.00 9.73   ? 16  GLY C CA  1 
ATOM   4059  C C   . GLY C  1 16  ? 50.740  0.045   3.965   1.00 11.00  ? 16  GLY C C   1 
ATOM   4060  O O   . GLY C  1 16  ? 49.844  -0.457  4.682   1.00 11.15  ? 16  GLY C O   1 
ATOM   4061  N N   . HIS C  1 17  ? 50.518  1.004   3.045   1.00 10.17  ? 17  HIS C N   1 
ATOM   4062  C CA  . HIS C  1 17  ? 49.201  1.632   2.881   1.00 8.81   ? 17  HIS C CA  1 
ATOM   4063  C C   . HIS C  1 17  ? 48.941  1.815   1.404   1.00 9.55   ? 17  HIS C C   1 
ATOM   4064  O O   . HIS C  1 17  ? 49.910  1.975   0.667   1.00 11.02  ? 17  HIS C O   1 
ATOM   4065  C CB  . HIS C  1 17  ? 49.145  3.006   3.557   1.00 6.39   ? 17  HIS C CB  1 
ATOM   4066  C CG  . HIS C  1 17  ? 50.280  3.906   3.123   1.00 4.98   ? 17  HIS C CG  1 
ATOM   4067  N ND1 . HIS C  1 17  ? 50.285  4.690   2.050   1.00 5.07   ? 17  HIS C ND1 1 
ATOM   4068  C CD2 . HIS C  1 17  ? 51.492  3.994   3.716   1.00 3.81   ? 17  HIS C CD2 1 
ATOM   4069  C CE1 . HIS C  1 17  ? 51.451  5.255   1.953   1.00 4.22   ? 17  HIS C CE1 1 
ATOM   4070  N NE2 . HIS C  1 17  ? 52.154  4.827   2.961   1.00 4.25   ? 17  HIS C NE2 1 
ATOM   4071  N N   . HIS C  1 18  ? 47.711  1.806   0.923   1.00 9.69   ? 18  HIS C N   1 
ATOM   4072  C CA  . HIS C  1 18  ? 47.437  1.978   -0.492  1.00 10.37  ? 18  HIS C CA  1 
ATOM   4073  C C   . HIS C  1 18  ? 47.851  3.333   -1.047  1.00 10.14  ? 18  HIS C C   1 
ATOM   4074  O O   . HIS C  1 18  ? 48.066  4.264   -0.272  1.00 10.45  ? 18  HIS C O   1 
ATOM   4075  C CB  . HIS C  1 18  ? 45.962  1.786   -0.703  1.00 12.75  ? 18  HIS C CB  1 
ATOM   4076  C CG  . HIS C  1 18  ? 45.098  2.962   -0.273  1.00 14.81  ? 18  HIS C CG  1 
ATOM   4077  N ND1 . HIS C  1 18  ? 45.445  3.877   0.624   1.00 16.21  ? 18  HIS C ND1 1 
ATOM   4078  C CD2 . HIS C  1 18  ? 43.843  3.262   -0.727  1.00 15.91  ? 18  HIS C CD2 1 
ATOM   4079  C CE1 . HIS C  1 18  ? 44.451  4.730   0.741   1.00 16.93  ? 18  HIS C CE1 1 
ATOM   4080  N NE2 . HIS C  1 18  ? 43.495  4.347   -0.074  1.00 16.82  ? 18  HIS C NE2 1 
ATOM   4081  N N   . ALA C  1 19  ? 47.886  3.505   -2.347  1.00 10.64  ? 19  ALA C N   1 
ATOM   4082  C CA  . ALA C  1 19  ? 48.140  4.792   -2.986  1.00 11.80  ? 19  ALA C CA  1 
ATOM   4083  C C   . ALA C  1 19  ? 47.351  4.774   -4.290  1.00 12.55  ? 19  ALA C C   1 
ATOM   4084  O O   . ALA C  1 19  ? 47.062  3.690   -4.795  1.00 12.08  ? 19  ALA C O   1 
ATOM   4085  C CB  . ALA C  1 19  ? 49.588  4.970   -3.343  1.00 10.90  ? 19  ALA C CB  1 
ATOM   4086  N N   . VAL C  1 20  ? 46.898  5.905   -4.805  1.00 13.29  ? 20  VAL C N   1 
ATOM   4087  C CA  . VAL C  1 20  ? 46.116  5.911   -6.018  1.00 14.62  ? 20  VAL C CA  1 
ATOM   4088  C C   . VAL C  1 20  ? 46.938  6.547   -7.102  1.00 17.86  ? 20  VAL C C   1 
ATOM   4089  O O   . VAL C  1 20  ? 47.735  7.427   -6.774  1.00 19.57  ? 20  VAL C O   1 
ATOM   4090  C CB  . VAL C  1 20  ? 44.849  6.697   -5.861  1.00 13.58  ? 20  VAL C CB  1 
ATOM   4091  C CG1 . VAL C  1 20  ? 44.012  5.940   -4.893  1.00 13.79  ? 20  VAL C CG1 1 
ATOM   4092  C CG2 . VAL C  1 20  ? 45.097  8.111   -5.393  1.00 13.70  ? 20  VAL C CG2 1 
ATOM   4093  N N   . PRO C  1 21  ? 46.722  6.211   -8.387  1.00 19.49  ? 21  PRO C N   1 
ATOM   4094  C CA  . PRO C  1 21  ? 47.501  6.756   -9.487  1.00 20.62  ? 21  PRO C CA  1 
ATOM   4095  C C   . PRO C  1 21  ? 47.240  8.243   -9.744  1.00 22.31  ? 21  PRO C C   1 
ATOM   4096  O O   . PRO C  1 21  ? 48.149  8.994   -10.097 1.00 22.38  ? 21  PRO C O   1 
ATOM   4097  C CB  . PRO C  1 21  ? 47.111  5.832   -10.580 1.00 19.95  ? 21  PRO C CB  1 
ATOM   4098  C CG  . PRO C  1 21  ? 45.643  5.604   -10.321 1.00 19.40  ? 21  PRO C CG  1 
ATOM   4099  C CD  . PRO C  1 21  ? 45.674  5.318   -8.855  1.00 19.33  ? 21  PRO C CD  1 
ATOM   4100  N N   . ASN C  1 22  ? 45.970  8.614   -9.559  1.00 23.97  ? 22  ASN C N   1 
ATOM   4101  C CA  . ASN C  1 22  ? 45.460  9.956   -9.762  1.00 26.51  ? 22  ASN C CA  1 
ATOM   4102  C C   . ASN C  1 22  ? 45.556  10.802  -8.492  1.00 25.84  ? 22  ASN C C   1 
ATOM   4103  O O   . ASN C  1 22  ? 46.542  11.508  -8.442  1.00 27.87  ? 22  ASN C O   1 
ATOM   4104  C CB  . ASN C  1 22  ? 44.016  9.879   -10.268 1.00 30.77  ? 22  ASN C CB  1 
ATOM   4105  C CG  . ASN C  1 22  ? 43.116  8.841   -9.587  1.00 33.91  ? 22  ASN C CG  1 
ATOM   4106  O OD1 . ASN C  1 22  ? 43.537  8.132   -8.668  1.00 35.39  ? 22  ASN C OD1 1 
ATOM   4107  N ND2 . ASN C  1 22  ? 41.862  8.677   -10.007 1.00 34.36  ? 22  ASN C ND2 1 
ATOM   4108  N N   . GLY C  1 23  ? 44.690  10.862  -7.486  1.00 23.73  ? 23  GLY C N   1 
ATOM   4109  C CA  . GLY C  1 23  ? 45.012  11.673  -6.296  1.00 22.11  ? 23  GLY C CA  1 
ATOM   4110  C C   . GLY C  1 23  ? 44.811  13.186  -6.409  1.00 20.56  ? 23  GLY C C   1 
ATOM   4111  O O   . GLY C  1 23  ? 45.181  13.813  -7.387  1.00 21.09  ? 23  GLY C O   1 
ATOM   4112  N N   . THR C  1 24  ? 44.196  13.815  -5.414  1.00 18.78  ? 24  THR C N   1 
ATOM   4113  C CA  . THR C  1 24  ? 43.778  15.205  -5.509  1.00 17.10  ? 24  THR C CA  1 
ATOM   4114  C C   . THR C  1 24  ? 44.659  16.108  -4.697  1.00 15.53  ? 24  THR C C   1 
ATOM   4115  O O   . THR C  1 24  ? 45.140  15.656  -3.662  1.00 14.84  ? 24  THR C O   1 
ATOM   4116  C CB  . THR C  1 24  ? 42.346  15.345  -5.007  1.00 18.33  ? 24  THR C CB  1 
ATOM   4117  O OG1 . THR C  1 24  ? 41.562  14.296  -5.587  1.00 19.35  ? 24  THR C OG1 1 
ATOM   4118  C CG2 . THR C  1 24  ? 41.752  16.693  -5.406  1.00 18.61  ? 24  THR C CG2 1 
ATOM   4119  N N   . LEU C  1 25  ? 44.850  17.376  -5.081  1.00 14.09  ? 25  LEU C N   1 
ATOM   4120  C CA  . LEU C  1 25  ? 45.651  18.226  -4.210  1.00 13.29  ? 25  LEU C CA  1 
ATOM   4121  C C   . LEU C  1 25  ? 44.778  18.917  -3.155  1.00 13.37  ? 25  LEU C C   1 
ATOM   4122  O O   . LEU C  1 25  ? 43.610  19.194  -3.453  1.00 14.15  ? 25  LEU C O   1 
ATOM   4123  C CB  . LEU C  1 25  ? 46.373  19.255  -5.031  1.00 12.13  ? 25  LEU C CB  1 
ATOM   4124  C CG  . LEU C  1 25  ? 47.503  18.748  -5.881  1.00 10.72  ? 25  LEU C CG  1 
ATOM   4125  C CD1 . LEU C  1 25  ? 48.191  19.913  -6.516  1.00 11.38  ? 25  LEU C CD1 1 
ATOM   4126  C CD2 . LEU C  1 25  ? 48.560  18.106  -5.057  1.00 10.96  ? 25  LEU C CD2 1 
ATOM   4127  N N   . VAL C  1 26  ? 45.306  19.203  -1.953  1.00 11.74  ? 26  VAL C N   1 
ATOM   4128  C CA  . VAL C  1 26  ? 44.526  19.791  -0.888  1.00 10.76  ? 26  VAL C CA  1 
ATOM   4129  C C   . VAL C  1 26  ? 45.348  20.813  -0.090  1.00 10.86  ? 26  VAL C C   1 
ATOM   4130  O O   . VAL C  1 26  ? 46.573  20.752  -0.183  1.00 10.18  ? 26  VAL C O   1 
ATOM   4131  C CB  . VAL C  1 26  ? 44.038  18.545  -0.143  1.00 9.66   ? 26  VAL C CB  1 
ATOM   4132  C CG1 . VAL C  1 26  ? 44.542  18.399  1.265   1.00 9.89   ? 26  VAL C CG1 1 
ATOM   4133  C CG2 . VAL C  1 26  ? 42.544  18.651  -0.202  1.00 10.71  ? 26  VAL C CG2 1 
ATOM   4134  N N   . LYS C  1 27  ? 44.758  21.799  0.619   1.00 11.07  ? 27  LYS C N   1 
ATOM   4135  C CA  . LYS C  1 27  ? 45.537  22.753  1.434   1.00 11.20  ? 27  LYS C CA  1 
ATOM   4136  C C   . LYS C  1 27  ? 45.695  22.236  2.845   1.00 11.37  ? 27  LYS C C   1 
ATOM   4137  O O   . LYS C  1 27  ? 44.788  21.557  3.322   1.00 12.89  ? 27  LYS C O   1 
ATOM   4138  C CB  . LYS C  1 27  ? 44.863  24.075  1.603   1.00 12.23  ? 27  LYS C CB  1 
ATOM   4139  C CG  . LYS C  1 27  ? 44.965  24.993  0.430   1.00 15.04  ? 27  LYS C CG  1 
ATOM   4140  C CD  . LYS C  1 27  ? 43.795  25.966  0.487   1.00 17.32  ? 27  LYS C CD  1 
ATOM   4141  C CE  . LYS C  1 27  ? 43.983  27.123  -0.531  1.00 17.65  ? 27  LYS C CE  1 
ATOM   4142  N NZ  . LYS C  1 27  ? 42.794  27.982  -0.580  1.00 18.85  ? 27  LYS C NZ  1 
ATOM   4143  N N   . THR C  1 28  ? 46.732  22.618  3.562   1.00 10.58  ? 28  THR C N   1 
ATOM   4144  C CA  . THR C  1 28  ? 46.972  22.138  4.905   1.00 10.67  ? 28  THR C CA  1 
ATOM   4145  C C   . THR C  1 28  ? 47.352  23.340  5.742   1.00 11.71  ? 28  THR C C   1 
ATOM   4146  O O   . THR C  1 28  ? 47.216  24.472  5.253   1.00 11.90  ? 28  THR C O   1 
ATOM   4147  C CB  . THR C  1 28  ? 48.035  21.058  4.649   1.00 10.51  ? 28  THR C CB  1 
ATOM   4148  O OG1 . THR C  1 28  ? 47.218  19.905  4.602   1.00 11.43  ? 28  THR C OG1 1 
ATOM   4149  C CG2 . THR C  1 28  ? 49.121  20.821  5.638   1.00 10.31  ? 28  THR C CG2 1 
ATOM   4150  N N   . ILE C  1 29  ? 47.711  23.179  7.019   1.00 12.65  ? 29  ILE C N   1 
ATOM   4151  C CA  . ILE C  1 29  ? 48.193  24.309  7.788   1.00 14.07  ? 29  ILE C CA  1 
ATOM   4152  C C   . ILE C  1 29  ? 49.580  24.649  7.267   1.00 16.05  ? 29  ILE C C   1 
ATOM   4153  O O   . ILE C  1 29  ? 49.875  25.815  7.054   1.00 16.81  ? 29  ILE C O   1 
ATOM   4154  C CB  . ILE C  1 29  ? 48.250  23.944  9.281   1.00 13.98  ? 29  ILE C CB  1 
ATOM   4155  C CG1 . ILE C  1 29  ? 46.865  24.099  9.852   1.00 14.87  ? 29  ILE C CG1 1 
ATOM   4156  C CG2 . ILE C  1 29  ? 49.170  24.846  10.082  1.00 14.85  ? 29  ILE C CG2 1 
ATOM   4157  C CD1 . ILE C  1 29  ? 46.859  23.653  11.328  1.00 16.20  ? 29  ILE C CD1 1 
ATOM   4158  N N   . THR C  1 30  ? 50.431  23.650  7.031   1.00 18.09  ? 30  THR C N   1 
ATOM   4159  C CA  . THR C  1 30  ? 51.798  23.885  6.615   1.00 19.46  ? 30  THR C CA  1 
ATOM   4160  C C   . THR C  1 30  ? 52.110  23.842  5.141   1.00 21.98  ? 30  THR C C   1 
ATOM   4161  O O   . THR C  1 30  ? 53.184  24.314  4.786   1.00 22.71  ? 30  THR C O   1 
ATOM   4162  C CB  . THR C  1 30  ? 52.708  22.891  7.330   1.00 19.07  ? 30  THR C CB  1 
ATOM   4163  O OG1 . THR C  1 30  ? 52.138  21.600  7.213   1.00 19.48  ? 30  THR C OG1 1 
ATOM   4164  C CG2 . THR C  1 30  ? 52.873  23.269  8.799   1.00 18.90  ? 30  THR C CG2 1 
ATOM   4165  N N   . ASP C  1 31  ? 51.250  23.327  4.265   1.00 25.17  ? 31  ASP C N   1 
ATOM   4166  C CA  . ASP C  1 31  ? 51.507  23.319  2.809   1.00 27.75  ? 31  ASP C CA  1 
ATOM   4167  C C   . ASP C  1 31  ? 50.209  23.699  2.163   1.00 28.69  ? 31  ASP C C   1 
ATOM   4168  O O   . ASP C  1 31  ? 49.156  23.540  2.793   1.00 29.62  ? 31  ASP C O   1 
ATOM   4169  C CB  . ASP C  1 31  ? 51.805  21.965  2.191   1.00 29.51  ? 31  ASP C CB  1 
ATOM   4170  C CG  . ASP C  1 31  ? 52.639  21.093  3.096   1.00 31.78  ? 31  ASP C CG  1 
ATOM   4171  O OD1 . ASP C  1 31  ? 53.848  20.993  2.856   1.00 32.93  ? 31  ASP C OD1 1 
ATOM   4172  O OD2 . ASP C  1 31  ? 52.079  20.542  4.066   1.00 32.51  ? 31  ASP C OD2 1 
ATOM   4173  N N   . ASP C  1 32  ? 50.198  24.189  0.941   1.00 29.63  ? 32  ASP C N   1 
ATOM   4174  C CA  . ASP C  1 32  ? 48.928  24.524  0.313   1.00 30.95  ? 32  ASP C CA  1 
ATOM   4175  C C   . ASP C  1 32  ? 48.688  23.683  -0.935  1.00 30.12  ? 32  ASP C C   1 
ATOM   4176  O O   . ASP C  1 32  ? 47.666  23.786  -1.622  1.00 30.46  ? 32  ASP C O   1 
ATOM   4177  C CB  . ASP C  1 32  ? 48.922  26.007  -0.012  1.00 33.12  ? 32  ASP C CB  1 
ATOM   4178  C CG  . ASP C  1 32  ? 49.944  26.322  -1.074  1.00 35.61  ? 32  ASP C CG  1 
ATOM   4179  O OD1 . ASP C  1 32  ? 51.115  25.936  -0.916  1.00 36.31  ? 32  ASP C OD1 1 
ATOM   4180  O OD2 . ASP C  1 32  ? 49.554  26.928  -2.076  1.00 37.84  ? 32  ASP C OD2 1 
ATOM   4181  N N   . GLN C  1 33  ? 49.633  22.828  -1.262  1.00 29.19  ? 33  GLN C N   1 
ATOM   4182  C CA  . GLN C  1 33  ? 49.354  21.808  -2.240  1.00 28.92  ? 33  GLN C CA  1 
ATOM   4183  C C   . GLN C  1 33  ? 49.980  20.522  -1.742  1.00 26.33  ? 33  GLN C C   1 
ATOM   4184  O O   . GLN C  1 33  ? 51.186  20.345  -1.837  1.00 25.63  ? 33  GLN C O   1 
ATOM   4185  C CB  . GLN C  1 33  ? 49.940  22.130  -3.581  1.00 31.93  ? 33  GLN C CB  1 
ATOM   4186  C CG  . GLN C  1 33  ? 49.262  23.248  -4.335  1.00 35.81  ? 33  GLN C CG  1 
ATOM   4187  C CD  . GLN C  1 33  ? 49.831  23.342  -5.752  1.00 38.44  ? 33  GLN C CD  1 
ATOM   4188  O OE1 . GLN C  1 33  ? 51.043  23.308  -6.000  1.00 39.10  ? 33  GLN C OE1 1 
ATOM   4189  N NE2 . GLN C  1 33  ? 48.964  23.419  -6.758  1.00 39.97  ? 33  GLN C NE2 1 
ATOM   4190  N N   . ILE C  1 34  ? 49.202  19.660  -1.110  1.00 23.54  ? 34  ILE C N   1 
ATOM   4191  C CA  . ILE C  1 34  ? 49.706  18.370  -0.744  1.00 21.62  ? 34  ILE C CA  1 
ATOM   4192  C C   . ILE C  1 34  ? 48.744  17.376  -1.366  1.00 20.78  ? 34  ILE C C   1 
ATOM   4193  O O   . ILE C  1 34  ? 47.533  17.611  -1.394  1.00 21.25  ? 34  ILE C O   1 
ATOM   4194  C CB  . ILE C  1 34  ? 49.782  18.319  0.785   1.00 22.00  ? 34  ILE C CB  1 
ATOM   4195  C CG1 . ILE C  1 34  ? 50.643  17.126  1.141   1.00 22.71  ? 34  ILE C CG1 1 
ATOM   4196  C CG2 . ILE C  1 34  ? 48.418  18.184  1.448   1.00 21.94  ? 34  ILE C CG2 1 
ATOM   4197  C CD1 . ILE C  1 34  ? 51.044  17.057  2.634   1.00 23.59  ? 34  ILE C CD1 1 
ATOM   4198  N N   . GLU C  1 35  ? 49.232  16.287  -1.929  1.00 19.56  ? 35  GLU C N   1 
ATOM   4199  C CA  . GLU C  1 35  ? 48.382  15.370  -2.668  1.00 19.24  ? 35  GLU C CA  1 
ATOM   4200  C C   . GLU C  1 35  ? 47.795  14.262  -1.820  1.00 17.69  ? 35  GLU C C   1 
ATOM   4201  O O   . GLU C  1 35  ? 48.531  13.501  -1.202  1.00 17.56  ? 35  GLU C O   1 
ATOM   4202  C CB  . GLU C  1 35  ? 49.178  14.746  -3.772  1.00 20.69  ? 35  GLU C CB  1 
ATOM   4203  C CG  . GLU C  1 35  ? 48.349  14.371  -4.989  1.00 22.83  ? 35  GLU C CG  1 
ATOM   4204  C CD  . GLU C  1 35  ? 48.974  13.272  -5.816  1.00 23.90  ? 35  GLU C CD  1 
ATOM   4205  O OE1 . GLU C  1 35  ? 48.225  12.362  -6.146  1.00 24.22  ? 35  GLU C OE1 1 
ATOM   4206  O OE2 . GLU C  1 35  ? 50.185  13.288  -6.081  1.00 24.62  ? 35  GLU C OE2 1 
ATOM   4207  N N   . VAL C  1 36  ? 46.482  14.140  -1.728  1.00 15.81  ? 36  VAL C N   1 
ATOM   4208  C CA  . VAL C  1 36  ? 45.895  13.087  -0.962  1.00 13.36  ? 36  VAL C CA  1 
ATOM   4209  C C   . VAL C  1 36  ? 45.229  12.100  -1.902  1.00 13.96  ? 36  VAL C C   1 
ATOM   4210  O O   . VAL C  1 36  ? 44.991  12.356  -3.067  1.00 14.44  ? 36  VAL C O   1 
ATOM   4211  C CB  . VAL C  1 36  ? 44.867  13.657  0.055   1.00 12.45  ? 36  VAL C CB  1 
ATOM   4212  C CG1 . VAL C  1 36  ? 45.600  14.481  1.109   1.00 11.71  ? 36  VAL C CG1 1 
ATOM   4213  C CG2 . VAL C  1 36  ? 43.813  14.480  -0.644  1.00 11.46  ? 36  VAL C CG2 1 
ATOM   4214  N N   . THR C  1 37  ? 44.923  10.924  -1.403  1.00 15.10  ? 37  THR C N   1 
ATOM   4215  C CA  . THR C  1 37  ? 44.202  9.876   -2.077  1.00 15.20  ? 37  THR C CA  1 
ATOM   4216  C C   . THR C  1 37  ? 42.836  10.306  -2.542  1.00 16.45  ? 37  THR C C   1 
ATOM   4217  O O   . THR C  1 37  ? 42.360  9.771   -3.518  1.00 16.33  ? 37  THR C O   1 
ATOM   4218  C CB  . THR C  1 37  ? 44.132  8.750   -1.065  1.00 15.11  ? 37  THR C CB  1 
ATOM   4219  O OG1 . THR C  1 37  ? 45.348  8.077   -1.329  1.00 15.56  ? 37  THR C OG1 1 
ATOM   4220  C CG2 . THR C  1 37  ? 42.933  7.829   -1.096  1.00 14.76  ? 37  THR C CG2 1 
ATOM   4221  N N   . ASN C  1 38  ? 42.169  11.251  -1.892  1.00 19.32  ? 38  ASN C N   1 
ATOM   4222  C CA  . ASN C  1 38  ? 40.788  11.555  -2.217  1.00 21.10  ? 38  ASN C CA  1 
ATOM   4223  C C   . ASN C  1 38  ? 40.322  12.791  -1.496  1.00 19.78  ? 38  ASN C C   1 
ATOM   4224  O O   . ASN C  1 38  ? 40.697  13.006  -0.337  1.00 20.36  ? 38  ASN C O   1 
ATOM   4225  C CB  . ASN C  1 38  ? 39.939  10.383  -1.797  1.00 26.21  ? 38  ASN C CB  1 
ATOM   4226  C CG  . ASN C  1 38  ? 38.490  10.550  -2.142  1.00 30.13  ? 38  ASN C CG  1 
ATOM   4227  O OD1 . ASN C  1 38  ? 38.143  10.835  -3.284  1.00 29.87  ? 38  ASN C OD1 1 
ATOM   4228  N ND2 . ASN C  1 38  ? 37.608  10.334  -1.168  1.00 34.59  ? 38  ASN C ND2 1 
ATOM   4229  N N   . ALA C  1 39  ? 39.483  13.585  -2.106  1.00 18.16  ? 39  ALA C N   1 
ATOM   4230  C CA  . ALA C  1 39  ? 38.993  14.780  -1.454  1.00 18.11  ? 39  ALA C CA  1 
ATOM   4231  C C   . ALA C  1 39  ? 37.503  14.940  -1.764  1.00 17.94  ? 39  ALA C C   1 
ATOM   4232  O O   . ALA C  1 39  ? 36.979  14.182  -2.576  1.00 18.33  ? 39  ALA C O   1 
ATOM   4233  C CB  . ALA C  1 39  ? 39.741  15.982  -1.974  1.00 17.32  ? 39  ALA C CB  1 
ATOM   4234  N N   . THR C  1 40  ? 36.790  15.852  -1.101  1.00 16.93  ? 40  THR C N   1 
ATOM   4235  C CA  . THR C  1 40  ? 35.419  16.132  -1.437  1.00 16.08  ? 40  THR C CA  1 
ATOM   4236  C C   . THR C  1 40  ? 35.308  17.645  -1.479  1.00 16.12  ? 40  THR C C   1 
ATOM   4237  O O   . THR C  1 40  ? 35.980  18.338  -0.709  1.00 16.47  ? 40  THR C O   1 
ATOM   4238  C CB  . THR C  1 40  ? 34.478  15.444  -0.391  1.00 15.99  ? 40  THR C CB  1 
ATOM   4239  O OG1 . THR C  1 40  ? 33.175  15.888  -0.751  1.00 16.51  ? 40  THR C OG1 1 
ATOM   4240  C CG2 . THR C  1 40  ? 34.701  15.766  1.063   1.00 15.44  ? 40  THR C CG2 1 
ATOM   4241  N N   . GLU C  1 41  ? 34.536  18.176  -2.438  1.00 15.86  ? 41  GLU C N   1 
ATOM   4242  C CA  . GLU C  1 41  ? 34.365  19.617  -2.631  1.00 14.06  ? 41  GLU C CA  1 
ATOM   4243  C C   . GLU C  1 41  ? 33.362  20.240  -1.681  1.00 12.01  ? 41  GLU C C   1 
ATOM   4244  O O   . GLU C  1 41  ? 32.198  19.836  -1.678  1.00 11.72  ? 41  GLU C O   1 
ATOM   4245  C CB  . GLU C  1 41  ? 33.912  19.840  -4.022  1.00 15.39  ? 41  GLU C CB  1 
ATOM   4246  C CG  . GLU C  1 41  ? 33.658  21.276  -4.336  1.00 17.69  ? 41  GLU C CG  1 
ATOM   4247  C CD  . GLU C  1 41  ? 34.905  22.108  -4.217  1.00 19.29  ? 41  GLU C CD  1 
ATOM   4248  O OE1 . GLU C  1 41  ? 34.926  22.965  -3.328  1.00 20.03  ? 41  GLU C OE1 1 
ATOM   4249  O OE2 . GLU C  1 41  ? 35.875  21.856  -4.960  1.00 19.80  ? 41  GLU C OE2 1 
ATOM   4250  N N   . LEU C  1 42  ? 33.779  21.217  -0.911  1.00 10.79  ? 42  LEU C N   1 
ATOM   4251  C CA  . LEU C  1 42  ? 32.877  21.815  0.052   1.00 10.82  ? 42  LEU C CA  1 
ATOM   4252  C C   . LEU C  1 42  ? 32.149  23.078  -0.456  1.00 11.20  ? 42  LEU C C   1 
ATOM   4253  O O   . LEU C  1 42  ? 31.268  23.572  0.269   1.00 11.45  ? 42  LEU C O   1 
ATOM   4254  C CB  . LEU C  1 42  ? 33.648  22.147  1.339   1.00 10.03  ? 42  LEU C CB  1 
ATOM   4255  C CG  . LEU C  1 42  ? 34.107  21.005  2.235   1.00 9.21   ? 42  LEU C CG  1 
ATOM   4256  C CD1 . LEU C  1 42  ? 34.724  21.575  3.486   1.00 8.55   ? 42  LEU C CD1 1 
ATOM   4257  C CD2 . LEU C  1 42  ? 32.940  20.156  2.669   1.00 8.67   ? 42  LEU C CD2 1 
ATOM   4258  N N   . VAL C  1 43  ? 32.456  23.611  -1.658  1.00 10.15  ? 43  VAL C N   1 
ATOM   4259  C CA  . VAL C  1 43  ? 31.816  24.821  -2.121  1.00 9.61   ? 43  VAL C CA  1 
ATOM   4260  C C   . VAL C  1 43  ? 30.877  24.501  -3.250  1.00 10.68  ? 43  VAL C C   1 
ATOM   4261  O O   . VAL C  1 43  ? 31.289  24.003  -4.291  1.00 11.17  ? 43  VAL C O   1 
ATOM   4262  C CB  . VAL C  1 43  ? 32.867  25.842  -2.627  1.00 9.75   ? 43  VAL C CB  1 
ATOM   4263  C CG1 . VAL C  1 43  ? 32.228  27.166  -2.999  1.00 9.81   ? 43  VAL C CG1 1 
ATOM   4264  C CG2 . VAL C  1 43  ? 33.817  26.183  -1.530  1.00 10.31  ? 43  VAL C CG2 1 
ATOM   4265  N N   . GLN C  1 44  ? 29.586  24.772  -3.095  1.00 12.50  ? 44  GLN C N   1 
ATOM   4266  C CA  . GLN C  1 44  ? 28.617  24.599  -4.175  1.00 14.49  ? 44  GLN C CA  1 
ATOM   4267  C C   . GLN C  1 44  ? 28.814  25.763  -5.113  1.00 15.46  ? 44  GLN C C   1 
ATOM   4268  O O   . GLN C  1 44  ? 28.750  26.912  -4.677  1.00 14.96  ? 44  GLN C O   1 
ATOM   4269  C CB  . GLN C  1 44  ? 27.205  24.622  -3.626  1.00 14.69  ? 44  GLN C CB  1 
ATOM   4270  C CG  . GLN C  1 44  ? 26.138  24.495  -4.684  1.00 15.06  ? 44  GLN C CG  1 
ATOM   4271  C CD  . GLN C  1 44  ? 26.194  23.184  -5.444  1.00 15.15  ? 44  GLN C CD  1 
ATOM   4272  O OE1 . GLN C  1 44  ? 26.495  22.112  -4.919  1.00 16.94  ? 44  GLN C OE1 1 
ATOM   4273  N NE2 . GLN C  1 44  ? 25.880  23.227  -6.720  1.00 13.96  ? 44  GLN C NE2 1 
ATOM   4274  N N   . SER C  1 45  ? 29.034  25.502  -6.384  1.00 17.75  ? 45  SER C N   1 
ATOM   4275  C CA  . SER C  1 45  ? 29.400  26.585  -7.266  1.00 20.36  ? 45  SER C CA  1 
ATOM   4276  C C   . SER C  1 45  ? 28.601  26.693  -8.532  1.00 20.90  ? 45  SER C C   1 
ATOM   4277  O O   . SER C  1 45  ? 29.007  27.397  -9.440  1.00 21.36  ? 45  SER C O   1 
ATOM   4278  C CB  . SER C  1 45  ? 30.865  26.420  -7.581  1.00 22.24  ? 45  SER C CB  1 
ATOM   4279  O OG  . SER C  1 45  ? 31.126  25.024  -7.744  1.00 24.56  ? 45  SER C OG  1 
ATOM   4280  N N   . SER C  1 46  ? 27.442  26.073  -8.631  1.00 22.19  ? 46  SER C N   1 
ATOM   4281  C CA  . SER C  1 46  ? 26.661  26.184  -9.842  1.00 22.99  ? 46  SER C CA  1 
ATOM   4282  C C   . SER C  1 46  ? 25.192  25.976  -9.579  1.00 24.42  ? 46  SER C C   1 
ATOM   4283  O O   . SER C  1 46  ? 24.795  25.168  -8.720  1.00 25.23  ? 46  SER C O   1 
ATOM   4284  C CB  . SER C  1 46  ? 27.172  25.172  -10.799 1.00 23.17  ? 46  SER C CB  1 
ATOM   4285  O OG  . SER C  1 46  ? 27.348  23.985  -10.040 1.00 24.73  ? 46  SER C OG  1 
ATOM   4286  N N   . SER C  1 47  ? 24.392  26.755  -10.290 1.00 25.70  ? 47  SER C N   1 
ATOM   4287  C CA  . SER C  1 47  ? 22.958  26.687  -10.147 1.00 25.75  ? 47  SER C CA  1 
ATOM   4288  C C   . SER C  1 47  ? 22.411  25.851  -11.267 1.00 25.94  ? 47  SER C C   1 
ATOM   4289  O O   . SER C  1 47  ? 23.026  25.699  -12.322 1.00 26.14  ? 47  SER C O   1 
ATOM   4290  C CB  . SER C  1 47  ? 22.363  28.064  -10.237 1.00 25.29  ? 47  SER C CB  1 
ATOM   4291  O OG  . SER C  1 47  ? 20.978  27.994  -9.926  1.00 25.84  ? 47  SER C OG  1 
ATOM   4292  N N   . THR C  1 48  ? 21.226  25.342  -11.039 1.00 26.57  ? 48  THR C N   1 
ATOM   4293  C CA  . THR C  1 48  ? 20.517  24.659  -12.089 1.00 27.70  ? 48  THR C CA  1 
ATOM   4294  C C   . THR C  1 48  ? 20.015  25.706  -13.081 1.00 27.04  ? 48  THR C C   1 
ATOM   4295  O O   . THR C  1 48  ? 19.639  25.403  -14.204 1.00 28.04  ? 48  THR C O   1 
ATOM   4296  C CB  . THR C  1 48  ? 19.358  23.898  -11.460 1.00 29.01  ? 48  THR C CB  1 
ATOM   4297  O OG1 . THR C  1 48  ? 18.506  24.867  -10.820 1.00 30.21  ? 48  THR C OG1 1 
ATOM   4298  C CG2 . THR C  1 48  ? 19.848  22.874  -10.433 1.00 29.68  ? 48  THR C CG2 1 
ATOM   4299  N N   . GLY C  1 49  ? 19.919  26.953  -12.644 1.00 26.33  ? 49  GLY C N   1 
ATOM   4300  C CA  . GLY C  1 49  ? 19.467  28.033  -13.494 1.00 25.50  ? 49  GLY C CA  1 
ATOM   4301  C C   . GLY C  1 49  ? 17.965  28.183  -13.459 1.00 24.53  ? 49  GLY C C   1 
ATOM   4302  O O   . GLY C  1 49  ? 17.386  28.947  -14.231 1.00 24.08  ? 49  GLY C O   1 
ATOM   4303  N N   . LYS C  1 50  ? 17.291  27.459  -12.579 1.00 24.20  ? 50  LYS C N   1 
ATOM   4304  C CA  . LYS C  1 50  ? 15.851  27.509  -12.523 1.00 24.55  ? 50  LYS C CA  1 
ATOM   4305  C C   . LYS C  1 50  ? 15.402  27.582  -11.081 1.00 23.17  ? 50  LYS C C   1 
ATOM   4306  O O   . LYS C  1 50  ? 16.034  26.972  -10.207 1.00 23.43  ? 50  LYS C O   1 
ATOM   4307  C CB  . LYS C  1 50  ? 15.320  26.271  -13.160 1.00 27.54  ? 50  LYS C CB  1 
ATOM   4308  C CG  . LYS C  1 50  ? 15.542  26.238  -14.661 1.00 30.42  ? 50  LYS C CG  1 
ATOM   4309  C CD  . LYS C  1 50  ? 15.527  24.797  -15.180 1.00 32.38  ? 50  LYS C CD  1 
ATOM   4310  C CE  . LYS C  1 50  ? 14.639  24.710  -16.419 1.00 33.72  ? 50  LYS C CE  1 
ATOM   4311  N NZ  . LYS C  1 50  ? 15.150  25.570  -17.474 1.00 34.94  ? 50  LYS C NZ  1 
ATOM   4312  N N   . ILE C  1 51  ? 14.369  28.359  -10.781 1.00 20.72  ? 51  ILE C N   1 
ATOM   4313  C CA  . ILE C  1 51  ? 13.864  28.458  -9.432  1.00 19.04  ? 51  ILE C CA  1 
ATOM   4314  C C   . ILE C  1 51  ? 12.870  27.326  -9.292  1.00 20.23  ? 51  ILE C C   1 
ATOM   4315  O O   . ILE C  1 51  ? 11.836  27.301  -9.948  1.00 20.35  ? 51  ILE C O   1 
ATOM   4316  C CB  . ILE C  1 51  ? 13.186  29.824  -9.218  1.00 17.27  ? 51  ILE C CB  1 
ATOM   4317  C CG1 . ILE C  1 51  ? 14.195  30.943  -9.372  1.00 16.15  ? 51  ILE C CG1 1 
ATOM   4318  C CG2 . ILE C  1 51  ? 12.562  29.869  -7.836  1.00 17.09  ? 51  ILE C CG2 1 
ATOM   4319  C CD1 . ILE C  1 51  ? 13.599  32.356  -9.236  1.00 15.21  ? 51  ILE C CD1 1 
ATOM   4320  N N   . CYS C  1 52  ? 13.192  26.334  -8.495  1.00 22.36  ? 52  CYS C N   1 
ATOM   4321  C CA  . CYS C  1 52  ? 12.287  25.234  -8.252  1.00 23.88  ? 52  CYS C CA  1 
ATOM   4322  C C   . CYS C  1 52  ? 11.092  25.717  -7.503  1.00 24.20  ? 52  CYS C C   1 
ATOM   4323  O O   . CYS C  1 52  ? 11.242  26.333  -6.449  1.00 24.66  ? 52  CYS C O   1 
ATOM   4324  C CB  . CYS C  1 52  ? 12.958  24.168  -7.428  1.00 25.91  ? 52  CYS C CB  1 
ATOM   4325  S SG  . CYS C  1 52  ? 14.077  23.149  -8.424  1.00 28.45  ? 52  CYS C SG  1 
ATOM   4326  N N   . ASN C  1 53  ? 9.915   25.393  -7.995  1.00 25.14  ? 53  ASN C N   1 
ATOM   4327  C CA  . ASN C  1 53  ? 8.683   25.858  -7.379  1.00 27.53  ? 53  ASN C CA  1 
ATOM   4328  C C   . ASN C  1 53  ? 8.210   25.016  -6.189  1.00 28.10  ? 53  ASN C C   1 
ATOM   4329  O O   . ASN C  1 53  ? 7.017   24.971  -5.849  1.00 28.51  ? 53  ASN C O   1 
ATOM   4330  C CB  . ASN C  1 53  ? 7.582   25.874  -8.420  1.00 29.29  ? 53  ASN C CB  1 
ATOM   4331  C CG  . ASN C  1 53  ? 7.202   24.502  -8.967  1.00 30.69  ? 53  ASN C CG  1 
ATOM   4332  O OD1 . ASN C  1 53  ? 7.669   23.423  -8.551  1.00 31.57  ? 53  ASN C OD1 1 
ATOM   4333  N ND2 . ASN C  1 53  ? 6.323   24.546  -9.964  1.00 31.14  ? 53  ASN C ND2 1 
ATOM   4334  N N   . ASN C  1 54  ? 9.112   24.320  -5.523  1.00 28.46  ? 54  ASN C N   1 
ATOM   4335  C CA  . ASN C  1 54  ? 8.726   23.466  -4.428  1.00 27.98  ? 54  ASN C CA  1 
ATOM   4336  C C   . ASN C  1 54  ? 9.944   23.343  -3.548  1.00 25.69  ? 54  ASN C C   1 
ATOM   4337  O O   . ASN C  1 54  ? 11.042  23.214  -4.082  1.00 24.86  ? 54  ASN C O   1 
ATOM   4338  C CB  . ASN C  1 54  ? 8.301   22.115  -4.994  1.00 30.74  ? 54  ASN C CB  1 
ATOM   4339  C CG  . ASN C  1 54  ? 7.366   21.433  -4.011  1.00 33.29  ? 54  ASN C CG  1 
ATOM   4340  O OD1 . ASN C  1 54  ? 7.773   20.612  -3.184  1.00 34.29  ? 54  ASN C OD1 1 
ATOM   4341  N ND2 . ASN C  1 54  ? 6.083   21.792  -4.007  1.00 34.49  ? 54  ASN C ND2 1 
ATOM   4342  N N   . PRO C  1 55  ? 9.866   23.366  -2.224  1.00 23.83  ? 55  PRO C N   1 
ATOM   4343  C CA  . PRO C  1 55  ? 8.657   23.501  -1.450  1.00 23.30  ? 55  PRO C CA  1 
ATOM   4344  C C   . PRO C  1 55  ? 8.161   24.898  -1.137  1.00 22.97  ? 55  PRO C C   1 
ATOM   4345  O O   . PRO C  1 55  ? 7.144   24.992  -0.439  1.00 24.15  ? 55  PRO C O   1 
ATOM   4346  C CB  . PRO C  1 55  ? 8.983   22.706  -0.224  1.00 23.58  ? 55  PRO C CB  1 
ATOM   4347  C CG  . PRO C  1 55  ? 10.386  23.180  0.017   1.00 23.52  ? 55  PRO C CG  1 
ATOM   4348  C CD  . PRO C  1 55  ? 10.992  23.087  -1.359  1.00 23.48  ? 55  PRO C CD  1 
ATOM   4349  N N   . HIS C  1 56  ? 8.814   25.981  -1.578  1.00 21.44  ? 56  HIS C N   1 
ATOM   4350  C CA  . HIS C  1 56  ? 8.335   27.280  -1.128  1.00 20.17  ? 56  HIS C CA  1 
ATOM   4351  C C   . HIS C  1 56  ? 7.248   27.804  -2.049  1.00 20.83  ? 56  HIS C C   1 
ATOM   4352  O O   . HIS C  1 56  ? 7.244   27.408  -3.222  1.00 21.28  ? 56  HIS C O   1 
ATOM   4353  C CB  . HIS C  1 56  ? 9.464   28.286  -1.103  1.00 18.73  ? 56  HIS C CB  1 
ATOM   4354  C CG  . HIS C  1 56  ? 10.582  27.941  -0.139  1.00 17.09  ? 56  HIS C CG  1 
ATOM   4355  N ND1 . HIS C  1 56  ? 10.407  27.864  1.186   1.00 16.86  ? 56  HIS C ND1 1 
ATOM   4356  C CD2 . HIS C  1 56  ? 11.843  27.681  -0.540  1.00 15.71  ? 56  HIS C CD2 1 
ATOM   4357  C CE1 . HIS C  1 56  ? 11.612  27.546  1.604   1.00 16.43  ? 56  HIS C CE1 1 
ATOM   4358  N NE2 . HIS C  1 56  ? 12.445  27.440  0.583   1.00 15.72  ? 56  HIS C NE2 1 
ATOM   4359  N N   . ARG C  1 57  ? 6.315   28.645  -1.570  1.00 20.63  ? 57  ARG C N   1 
ATOM   4360  C CA  . ARG C  1 57  ? 5.327   29.210  -2.454  1.00 20.90  ? 57  ARG C CA  1 
ATOM   4361  C C   . ARG C  1 57  ? 5.967   30.299  -3.274  1.00 19.29  ? 57  ARG C C   1 
ATOM   4362  O O   . ARG C  1 57  ? 6.219   31.399  -2.777  1.00 19.83  ? 57  ARG C O   1 
ATOM   4363  C CB  . ARG C  1 57  ? 4.177   29.811  -1.677  1.00 24.28  ? 57  ARG C CB  1 
ATOM   4364  C CG  . ARG C  1 57  ? 2.883   29.079  -2.058  1.00 28.21  ? 57  ARG C CG  1 
ATOM   4365  C CD  . ARG C  1 57  ? 1.588   29.768  -1.586  1.00 30.19  ? 57  ARG C CD  1 
ATOM   4366  N NE  . ARG C  1 57  ? 1.158   30.835  -2.502  1.00 32.25  ? 57  ARG C NE  1 
ATOM   4367  C CZ  . ARG C  1 57  ? 0.377   30.601  -3.589  1.00 33.99  ? 57  ARG C CZ  1 
ATOM   4368  N NH1 . ARG C  1 57  ? -0.038  31.633  -4.364  1.00 34.04  ? 57  ARG C NH1 1 
ATOM   4369  N NH2 . ARG C  1 57  ? 0.037   29.325  -3.894  1.00 34.51  ? 57  ARG C NH2 1 
ATOM   4370  N N   . ILE C  1 58  ? 6.286   30.056  -4.528  1.00 17.12  ? 58  ILE C N   1 
ATOM   4371  C CA  . ILE C  1 58  ? 6.907   31.112  -5.298  1.00 16.55  ? 58  ILE C CA  1 
ATOM   4372  C C   . ILE C  1 58  ? 5.917   31.813  -6.194  1.00 17.00  ? 58  ILE C C   1 
ATOM   4373  O O   . ILE C  1 58  ? 5.321   31.200  -7.073  1.00 18.18  ? 58  ILE C O   1 
ATOM   4374  C CB  . ILE C  1 58  ? 8.048   30.459  -6.039  1.00 16.17  ? 58  ILE C CB  1 
ATOM   4375  C CG1 . ILE C  1 58  ? 9.111   30.297  -4.972  1.00 17.41  ? 58  ILE C CG1 1 
ATOM   4376  C CG2 . ILE C  1 58  ? 8.606   31.248  -7.195  1.00 14.41  ? 58  ILE C CG2 1 
ATOM   4377  C CD1 . ILE C  1 58  ? 9.984   29.093  -5.299  1.00 18.34  ? 58  ILE C CD1 1 
ATOM   4378  N N   . LEU C  1 59  ? 5.676   33.098  -5.982  1.00 17.03  ? 59  LEU C N   1 
ATOM   4379  C CA  . LEU C  1 59  ? 4.719   33.834  -6.794  1.00 16.49  ? 59  LEU C CA  1 
ATOM   4380  C C   . LEU C  1 59  ? 5.515   34.592  -7.834  1.00 16.37  ? 59  LEU C C   1 
ATOM   4381  O O   . LEU C  1 59  ? 6.373   35.389  -7.452  1.00 17.02  ? 59  LEU C O   1 
ATOM   4382  C CB  . LEU C  1 59  ? 3.977   34.798  -5.924  1.00 17.14  ? 59  LEU C CB  1 
ATOM   4383  C CG  . LEU C  1 59  ? 2.829   35.512  -6.559  1.00 17.68  ? 59  LEU C CG  1 
ATOM   4384  C CD1 . LEU C  1 59  ? 1.712   34.509  -6.782  1.00 18.18  ? 59  LEU C CD1 1 
ATOM   4385  C CD2 . LEU C  1 59  ? 2.336   36.614  -5.634  1.00 18.38  ? 59  LEU C CD2 1 
ATOM   4386  N N   . ASP C  1 60  ? 5.334   34.339  -9.124  1.00 16.25  ? 60  ASP C N   1 
ATOM   4387  C CA  . ASP C  1 60  ? 6.095   35.040  -10.141 1.00 15.22  ? 60  ASP C CA  1 
ATOM   4388  C C   . ASP C  1 60  ? 5.368   36.336  -10.398 1.00 16.02  ? 60  ASP C C   1 
ATOM   4389  O O   . ASP C  1 60  ? 4.169   36.337  -10.688 1.00 17.40  ? 60  ASP C O   1 
ATOM   4390  C CB  . ASP C  1 60  ? 6.125   34.262  -11.409 1.00 15.14  ? 60  ASP C CB  1 
ATOM   4391  C CG  . ASP C  1 60  ? 6.989   34.844  -12.511 1.00 16.13  ? 60  ASP C CG  1 
ATOM   4392  O OD1 . ASP C  1 60  ? 7.421   34.084  -13.377 1.00 17.26  ? 60  ASP C OD1 1 
ATOM   4393  O OD2 . ASP C  1 60  ? 7.306   36.030  -12.531 1.00 16.06  ? 60  ASP C OD2 1 
ATOM   4394  N N   . GLY C  1 61  ? 6.075   37.447  -10.344 1.00 15.91  ? 61  GLY C N   1 
ATOM   4395  C CA  . GLY C  1 61  ? 5.438   38.738  -10.460 1.00 15.61  ? 61  GLY C CA  1 
ATOM   4396  C C   . GLY C  1 61  ? 5.073   39.066  -11.890 1.00 15.61  ? 61  GLY C C   1 
ATOM   4397  O O   . GLY C  1 61  ? 4.353   40.042  -12.148 1.00 15.24  ? 61  GLY C O   1 
ATOM   4398  N N   . ILE C  1 62  ? 5.558   38.251  -12.817 1.00 15.49  ? 62  ILE C N   1 
ATOM   4399  C CA  . ILE C  1 62  ? 5.447   38.442  -14.249 1.00 17.12  ? 62  ILE C CA  1 
ATOM   4400  C C   . ILE C  1 62  ? 5.843   39.881  -14.577 1.00 17.74  ? 62  ILE C C   1 
ATOM   4401  O O   . ILE C  1 62  ? 6.976   40.245  -14.284 1.00 17.29  ? 62  ILE C O   1 
ATOM   4402  C CB  . ILE C  1 62  ? 4.003   38.154  -14.770 1.00 17.94  ? 62  ILE C CB  1 
ATOM   4403  C CG1 . ILE C  1 62  ? 3.240   37.053  -14.030 1.00 18.38  ? 62  ILE C CG1 1 
ATOM   4404  C CG2 . ILE C  1 62  ? 4.205   37.766  -16.242 1.00 17.06  ? 62  ILE C CG2 1 
ATOM   4405  C CD1 . ILE C  1 62  ? 3.786   35.634  -14.241 1.00 19.57  ? 62  ILE C CD1 1 
ATOM   4406  N N   . ASP C  1 63  ? 5.004   40.774  -15.098 1.00 18.87  ? 63  ASP C N   1 
ATOM   4407  C CA  . ASP C  1 63  ? 5.466   42.118  -15.383 1.00 20.18  ? 63  ASP C CA  1 
ATOM   4408  C C   . ASP C  1 63  ? 4.916   43.120  -14.376 1.00 19.96  ? 63  ASP C C   1 
ATOM   4409  O O   . ASP C  1 63  ? 4.760   44.319  -14.651 1.00 20.00  ? 63  ASP C O   1 
ATOM   4410  C CB  . ASP C  1 63  ? 5.081   42.530  -16.803 1.00 22.20  ? 63  ASP C CB  1 
ATOM   4411  C CG  . ASP C  1 63  ? 3.692   42.129  -17.291 1.00 25.33  ? 63  ASP C CG  1 
ATOM   4412  O OD1 . ASP C  1 63  ? 2.803   41.864  -16.466 1.00 26.44  ? 63  ASP C OD1 1 
ATOM   4413  O OD2 . ASP C  1 63  ? 3.515   42.052  -18.514 1.00 26.48  ? 63  ASP C OD2 1 
ATOM   4414  N N   . CYS C  1 64  ? 4.661   42.669  -13.149 1.00 18.76  ? 64  CYS C N   1 
ATOM   4415  C CA  . CYS C  1 64  ? 4.255   43.560  -12.090 1.00 17.22  ? 64  CYS C CA  1 
ATOM   4416  C C   . CYS C  1 64  ? 5.307   43.662  -11.016 1.00 17.08  ? 64  CYS C C   1 
ATOM   4417  O O   . CYS C  1 64  ? 5.980   42.683  -10.700 1.00 17.32  ? 64  CYS C O   1 
ATOM   4418  C CB  . CYS C  1 64  ? 2.993   43.066  -11.453 1.00 17.40  ? 64  CYS C CB  1 
ATOM   4419  S SG  . CYS C  1 64  ? 1.642   43.328  -12.623 1.00 16.13  ? 64  CYS C SG  1 
ATOM   4420  N N   . THR C  1 65  ? 5.466   44.824  -10.418 1.00 16.00  ? 65  THR C N   1 
ATOM   4421  C CA  . THR C  1 65  ? 6.331   45.003  -9.261  1.00 14.67  ? 65  THR C CA  1 
ATOM   4422  C C   . THR C  1 65  ? 5.465   44.676  -8.049  1.00 13.81  ? 65  THR C C   1 
ATOM   4423  O O   . THR C  1 65  ? 4.269   44.942  -8.142  1.00 13.06  ? 65  THR C O   1 
ATOM   4424  C CB  . THR C  1 65  ? 6.703   46.422  -9.228  1.00 15.33  ? 65  THR C CB  1 
ATOM   4425  O OG1 . THR C  1 65  ? 7.238   46.648  -10.516 1.00 16.66  ? 65  THR C OG1 1 
ATOM   4426  C CG2 . THR C  1 65  ? 7.585   46.811  -8.066  1.00 16.12  ? 65  THR C CG2 1 
ATOM   4427  N N   . LEU C  1 66  ? 5.961   44.176  -6.903  1.00 13.23  ? 66  LEU C N   1 
ATOM   4428  C CA  . LEU C  1 66  ? 5.082   43.979  -5.746  1.00 11.09  ? 66  LEU C CA  1 
ATOM   4429  C C   . LEU C  1 66  ? 4.344   45.258  -5.376  1.00 11.06  ? 66  LEU C C   1 
ATOM   4430  O O   . LEU C  1 66  ? 3.148   45.171  -5.208  1.00 11.99  ? 66  LEU C O   1 
ATOM   4431  C CB  . LEU C  1 66  ? 5.858   43.535  -4.530  1.00 11.36  ? 66  LEU C CB  1 
ATOM   4432  C CG  . LEU C  1 66  ? 5.156   43.430  -3.185  1.00 11.04  ? 66  LEU C CG  1 
ATOM   4433  C CD1 . LEU C  1 66  ? 4.076   42.380  -3.214  1.00 11.22  ? 66  LEU C CD1 1 
ATOM   4434  C CD2 . LEU C  1 66  ? 6.181   43.056  -2.146  1.00 11.13  ? 66  LEU C CD2 1 
ATOM   4435  N N   . ILE C  1 67  ? 4.952   46.457  -5.302  1.00 11.70  ? 67  ILE C N   1 
ATOM   4436  C CA  . ILE C  1 67  ? 4.220   47.705  -4.994  1.00 11.86  ? 67  ILE C CA  1 
ATOM   4437  C C   . ILE C  1 67  ? 3.070   47.950  -5.989  1.00 12.39  ? 67  ILE C C   1 
ATOM   4438  O O   . ILE C  1 67  ? 1.970   48.300  -5.542  1.00 12.07  ? 67  ILE C O   1 
ATOM   4439  C CB  . ILE C  1 67  ? 5.223   48.940  -4.987  1.00 11.79  ? 67  ILE C CB  1 
ATOM   4440  C CG1 . ILE C  1 67  ? 6.209   48.776  -3.833  1.00 11.55  ? 67  ILE C CG1 1 
ATOM   4441  C CG2 . ILE C  1 67  ? 4.497   50.280  -4.838  1.00 10.52  ? 67  ILE C CG2 1 
ATOM   4442  C CD1 . ILE C  1 67  ? 5.583   48.897  -2.429  1.00 11.70  ? 67  ILE C CD1 1 
ATOM   4443  N N   . ASP C  1 68  ? 3.242   47.718  -7.312  1.00 12.66  ? 68  ASP C N   1 
ATOM   4444  C CA  . ASP C  1 68  ? 2.108   47.878  -8.229  1.00 11.99  ? 68  ASP C CA  1 
ATOM   4445  C C   . ASP C  1 68  ? 1.051   46.834  -7.964  1.00 10.21  ? 68  ASP C C   1 
ATOM   4446  O O   . ASP C  1 68  ? -0.124  47.162  -8.031  1.00 10.23  ? 68  ASP C O   1 
ATOM   4447  C CB  . ASP C  1 68  ? 2.481   47.730  -9.685  1.00 13.65  ? 68  ASP C CB  1 
ATOM   4448  C CG  . ASP C  1 68  ? 3.419   48.811  -10.217 1.00 15.14  ? 68  ASP C CG  1 
ATOM   4449  O OD1 . ASP C  1 68  ? 4.480   48.433  -10.779 1.00 16.50  ? 68  ASP C OD1 1 
ATOM   4450  O OD2 . ASP C  1 68  ? 3.117   50.015  -10.063 1.00 13.87  ? 68  ASP C OD2 1 
ATOM   4451  N N   . ALA C  1 69  ? 1.415   45.595  -7.639  1.00 8.38   ? 69  ALA C N   1 
ATOM   4452  C CA  . ALA C  1 69  ? 0.445   44.593  -7.262  1.00 7.45   ? 69  ALA C CA  1 
ATOM   4453  C C   . ALA C  1 69  ? -0.358  45.059  -6.049  1.00 7.75   ? 69  ALA C C   1 
ATOM   4454  O O   . ALA C  1 69  ? -1.594  44.918  -5.989  1.00 7.26   ? 69  ALA C O   1 
ATOM   4455  C CB  . ALA C  1 69  ? 1.144   43.307  -6.911  1.00 7.43   ? 69  ALA C CB  1 
ATOM   4456  N N   . LEU C  1 70  ? 0.329   45.671  -5.085  1.00 8.45   ? 70  LEU C N   1 
ATOM   4457  C CA  . LEU C  1 70  ? -0.300  46.222  -3.887  1.00 8.93   ? 70  LEU C CA  1 
ATOM   4458  C C   . LEU C  1 70  ? -1.268  47.364  -4.258  1.00 8.86   ? 70  LEU C C   1 
ATOM   4459  O O   . LEU C  1 70  ? -2.460  47.251  -3.970  1.00 9.49   ? 70  LEU C O   1 
ATOM   4460  C CB  . LEU C  1 70  ? 0.781   46.744  -2.939  1.00 7.97   ? 70  LEU C CB  1 
ATOM   4461  C CG  . LEU C  1 70  ? 0.369   47.414  -1.664  1.00 8.20   ? 70  LEU C CG  1 
ATOM   4462  C CD1 . LEU C  1 70  ? 0.129   46.359  -0.614  1.00 8.67   ? 70  LEU C CD1 1 
ATOM   4463  C CD2 . LEU C  1 70  ? 1.462   48.353  -1.203  1.00 8.14   ? 70  LEU C CD2 1 
ATOM   4464  N N   . LEU C  1 71  ? -0.792  48.426  -4.932  1.00 7.82   ? 71  LEU C N   1 
ATOM   4465  C CA  . LEU C  1 71  ? -1.621  49.580  -5.258  1.00 6.74   ? 71  LEU C CA  1 
ATOM   4466  C C   . LEU C  1 71  ? -2.745  49.195  -6.197  1.00 7.33   ? 71  LEU C C   1 
ATOM   4467  O O   . LEU C  1 71  ? -3.883  49.681  -6.103  1.00 7.66   ? 71  LEU C O   1 
ATOM   4468  C CB  . LEU C  1 71  ? -0.774  50.686  -5.907  1.00 4.14   ? 71  LEU C CB  1 
ATOM   4469  C CG  . LEU C  1 71  ? 0.240   51.320  -4.990  1.00 2.73   ? 71  LEU C CG  1 
ATOM   4470  C CD1 . LEU C  1 71  ? 1.053   52.318  -5.750  1.00 2.00   ? 71  LEU C CD1 1 
ATOM   4471  C CD2 . LEU C  1 71  ? -0.460  51.984  -3.829  1.00 2.13   ? 71  LEU C CD2 1 
ATOM   4472  N N   . GLY C  1 72  ? -2.436  48.276  -7.086  1.00 7.35   ? 72  GLY C N   1 
ATOM   4473  C CA  . GLY C  1 72  ? -3.445  47.753  -7.959  1.00 8.30   ? 72  GLY C CA  1 
ATOM   4474  C C   . GLY C  1 72  ? -3.499  48.445  -9.288  1.00 8.76   ? 72  GLY C C   1 
ATOM   4475  O O   . GLY C  1 72  ? -4.557  48.902  -9.734  1.00 8.18   ? 72  GLY C O   1 
ATOM   4476  N N   . ASP C  1 73  ? -2.321  48.535  -9.904  1.00 10.66  ? 73  ASP C N   1 
ATOM   4477  C CA  . ASP C  1 73  ? -2.158  48.979  -11.286 1.00 11.83  ? 73  ASP C CA  1 
ATOM   4478  C C   . ASP C  1 73  ? -3.051  48.044  -12.081 1.00 12.10  ? 73  ASP C C   1 
ATOM   4479  O O   . ASP C  1 73  ? -2.949  46.842  -11.844 1.00 13.08  ? 73  ASP C O   1 
ATOM   4480  C CB  . ASP C  1 73  ? -0.710  48.793  -11.672 1.00 13.31  ? 73  ASP C CB  1 
ATOM   4481  C CG  . ASP C  1 73  ? -0.382  49.064  -13.130 1.00 14.95  ? 73  ASP C CG  1 
ATOM   4482  O OD1 . ASP C  1 73  ? 0.493   49.891  -13.398 1.00 15.83  ? 73  ASP C OD1 1 
ATOM   4483  O OD2 . ASP C  1 73  ? -0.971  48.441  -14.026 1.00 15.28  ? 73  ASP C OD2 1 
ATOM   4484  N N   . PRO C  1 74  ? -3.892  48.490  -13.007 1.00 12.16  ? 74  PRO C N   1 
ATOM   4485  C CA  . PRO C  1 74  ? -4.791  47.652  -13.780 1.00 12.69  ? 74  PRO C CA  1 
ATOM   4486  C C   . PRO C  1 74  ? -4.113  46.421  -14.319 1.00 14.20  ? 74  PRO C C   1 
ATOM   4487  O O   . PRO C  1 74  ? -4.533  45.291  -14.067 1.00 15.20  ? 74  PRO C O   1 
ATOM   4488  C CB  . PRO C  1 74  ? -5.282  48.533  -14.869 1.00 12.90  ? 74  PRO C CB  1 
ATOM   4489  C CG  . PRO C  1 74  ? -5.212  49.903  -14.255 1.00 12.80  ? 74  PRO C CG  1 
ATOM   4490  C CD  . PRO C  1 74  ? -3.873  49.833  -13.551 1.00 12.66  ? 74  PRO C CD  1 
ATOM   4491  N N   . HIS C  1 75  ? -2.936  46.581  -14.933 1.00 15.12  ? 75  HIS C N   1 
ATOM   4492  C CA  . HIS C  1 75  ? -2.280  45.430  -15.516 1.00 15.19  ? 75  HIS C CA  1 
ATOM   4493  C C   . HIS C  1 75  ? -1.802  44.398  -14.505 1.00 15.44  ? 75  HIS C C   1 
ATOM   4494  O O   . HIS C  1 75  ? -1.272  43.373  -14.895 1.00 16.01  ? 75  HIS C O   1 
ATOM   4495  C CB  . HIS C  1 75  ? -1.167  45.985  -16.396 1.00 15.59  ? 75  HIS C CB  1 
ATOM   4496  C CG  . HIS C  1 75  ? 0.263   45.955  -15.905 1.00 16.34  ? 75  HIS C CG  1 
ATOM   4497  N ND1 . HIS C  1 75  ? 0.856   46.968  -15.316 1.00 16.36  ? 75  HIS C ND1 1 
ATOM   4498  C CD2 . HIS C  1 75  ? 1.169   44.934  -16.049 1.00 17.17  ? 75  HIS C CD2 1 
ATOM   4499  C CE1 . HIS C  1 75  ? 2.087   46.623  -15.089 1.00 16.80  ? 75  HIS C CE1 1 
ATOM   4500  N NE2 . HIS C  1 75  ? 2.268   45.403  -15.534 1.00 17.18  ? 75  HIS C NE2 1 
ATOM   4501  N N   . CYS C  1 76  ? -2.014  44.609  -13.217 1.00 16.43  ? 76  CYS C N   1 
ATOM   4502  C CA  . CYS C  1 76  ? -1.602  43.707  -12.172 1.00 17.49  ? 76  CYS C CA  1 
ATOM   4503  C C   . CYS C  1 76  ? -2.802  43.249  -11.381 1.00 18.21  ? 76  CYS C C   1 
ATOM   4504  O O   . CYS C  1 76  ? -2.622  42.636  -10.315 1.00 19.00  ? 76  CYS C O   1 
ATOM   4505  C CB  . CYS C  1 76  ? -0.639  44.400  -11.222 1.00 16.93  ? 76  CYS C CB  1 
ATOM   4506  S SG  . CYS C  1 76  ? 0.720   45.058  -12.210 1.00 17.06  ? 76  CYS C SG  1 
ATOM   4507  N N   . ASP C  1 77  ? -4.031  43.427  -11.871 1.00 18.81  ? 77  ASP C N   1 
ATOM   4508  C CA  . ASP C  1 77  ? -5.157  43.040  -11.035 1.00 21.08  ? 77  ASP C CA  1 
ATOM   4509  C C   . ASP C  1 77  ? -5.203  41.558  -10.770 1.00 20.83  ? 77  ASP C C   1 
ATOM   4510  O O   . ASP C  1 77  ? -5.851  41.098  -9.821  1.00 21.84  ? 77  ASP C O   1 
ATOM   4511  C CB  . ASP C  1 77  ? -6.475  43.468  -11.642 1.00 23.10  ? 77  ASP C CB  1 
ATOM   4512  C CG  . ASP C  1 77  ? -6.690  44.973  -11.504 1.00 25.28  ? 77  ASP C CG  1 
ATOM   4513  O OD1 . ASP C  1 77  ? -6.976  45.597  -12.538 1.00 25.89  ? 77  ASP C OD1 1 
ATOM   4514  O OD2 . ASP C  1 77  ? -6.611  45.549  -10.396 1.00 25.54  ? 77  ASP C OD2 1 
ATOM   4515  N N   . VAL C  1 78  ? -4.406  40.827  -11.552 1.00 18.99  ? 78  VAL C N   1 
ATOM   4516  C CA  . VAL C  1 78  ? -4.206  39.409  -11.373 1.00 18.17  ? 78  VAL C CA  1 
ATOM   4517  C C   . VAL C  1 78  ? -3.831  39.077  -9.936  1.00 18.14  ? 78  VAL C C   1 
ATOM   4518  O O   . VAL C  1 78  ? -4.365  38.130  -9.380  1.00 19.26  ? 78  VAL C O   1 
ATOM   4519  C CB  . VAL C  1 78  ? -3.076  38.873  -12.208 1.00 18.70  ? 78  VAL C CB  1 
ATOM   4520  C CG1 . VAL C  1 78  ? -3.271  37.365  -12.239 1.00 19.17  ? 78  VAL C CG1 1 
ATOM   4521  C CG2 . VAL C  1 78  ? -3.002  39.521  -13.585 1.00 18.94  ? 78  VAL C CG2 1 
ATOM   4522  N N   . PHE C  1 79  ? -2.969  39.876  -9.303  1.00 17.15  ? 79  PHE C N   1 
ATOM   4523  C CA  . PHE C  1 79  ? -2.420  39.533  -7.987  1.00 15.31  ? 79  PHE C CA  1 
ATOM   4524  C C   . PHE C  1 79  ? -3.311  39.809  -6.797  1.00 15.60  ? 79  PHE C C   1 
ATOM   4525  O O   . PHE C  1 79  ? -2.834  39.603  -5.672  1.00 14.98  ? 79  PHE C O   1 
ATOM   4526  C CB  . PHE C  1 79  ? -1.078  40.271  -7.782  1.00 12.12  ? 79  PHE C CB  1 
ATOM   4527  C CG  . PHE C  1 79  ? -0.084  39.816  -8.805  1.00 8.67   ? 79  PHE C CG  1 
ATOM   4528  C CD1 . PHE C  1 79  ? 0.688   38.731  -8.507  1.00 8.97   ? 79  PHE C CD1 1 
ATOM   4529  C CD2 . PHE C  1 79  ? -0.020  40.432  -10.028 1.00 7.43   ? 79  PHE C CD2 1 
ATOM   4530  C CE1 . PHE C  1 79  ? 1.542   38.259  -9.473  1.00 9.28   ? 79  PHE C CE1 1 
ATOM   4531  C CE2 . PHE C  1 79  ? 0.832   39.956  -10.984 1.00 7.43   ? 79  PHE C CE2 1 
ATOM   4532  C CZ  . PHE C  1 79  ? 1.610   38.864  -10.712 1.00 8.05   ? 79  PHE C CZ  1 
ATOM   4533  N N   . GLN C  1 80  ? -4.559  40.255  -6.984  1.00 16.77  ? 80  GLN C N   1 
ATOM   4534  C CA  . GLN C  1 80  ? -5.336  40.670  -5.831  1.00 19.75  ? 80  GLN C CA  1 
ATOM   4535  C C   . GLN C  1 80  ? -5.510  39.522  -4.869  1.00 20.42  ? 80  GLN C C   1 
ATOM   4536  O O   . GLN C  1 80  ? -5.749  38.403  -5.311  1.00 20.51  ? 80  GLN C O   1 
ATOM   4537  C CB  . GLN C  1 80  ? -6.697  41.146  -6.233  1.00 21.89  ? 80  GLN C CB  1 
ATOM   4538  C CG  . GLN C  1 80  ? -6.692  42.261  -7.255  1.00 24.31  ? 80  GLN C CG  1 
ATOM   4539  C CD  . GLN C  1 80  ? -8.040  42.944  -7.359  1.00 26.11  ? 80  GLN C CD  1 
ATOM   4540  O OE1 . GLN C  1 80  ? -8.101  44.173  -7.386  1.00 27.76  ? 80  GLN C OE1 1 
ATOM   4541  N NE2 . GLN C  1 80  ? -9.179  42.252  -7.309  1.00 26.21  ? 80  GLN C NE2 1 
ATOM   4542  N N   . ASN C  1 81  ? -5.307  39.776  -3.581  1.00 21.44  ? 81  ASN C N   1 
ATOM   4543  C CA  . ASN C  1 81  ? -5.429  38.746  -2.559  1.00 23.62  ? 81  ASN C CA  1 
ATOM   4544  C C   . ASN C  1 81  ? -4.448  37.577  -2.716  1.00 22.47  ? 81  ASN C C   1 
ATOM   4545  O O   . ASN C  1 81  ? -4.679  36.501  -2.153  1.00 22.77  ? 81  ASN C O   1 
ATOM   4546  C CB  . ASN C  1 81  ? -6.870  38.165  -2.509  1.00 27.19  ? 81  ASN C CB  1 
ATOM   4547  C CG  . ASN C  1 81  ? -7.939  39.030  -1.858  1.00 30.87  ? 81  ASN C CG  1 
ATOM   4548  O OD1 . ASN C  1 81  ? -7.735  40.229  -1.619  1.00 30.83  ? 81  ASN C OD1 1 
ATOM   4549  N ND2 . ASN C  1 81  ? -9.125  38.467  -1.588  1.00 34.72  ? 81  ASN C ND2 1 
ATOM   4550  N N   . GLU C  1 82  ? -3.334  37.747  -3.440  1.00 21.13  ? 82  GLU C N   1 
ATOM   4551  C CA  . GLU C  1 82  ? -2.352  36.685  -3.549  1.00 19.52  ? 82  GLU C CA  1 
ATOM   4552  C C   . GLU C  1 82  ? -1.460  36.556  -2.328  1.00 17.64  ? 82  GLU C C   1 
ATOM   4553  O O   . GLU C  1 82  ? -1.396  37.432  -1.451  1.00 17.05  ? 82  GLU C O   1 
ATOM   4554  C CB  . GLU C  1 82  ? -1.464  36.876  -4.776  1.00 20.74  ? 82  GLU C CB  1 
ATOM   4555  C CG  . GLU C  1 82  ? -1.854  35.960  -5.939  1.00 22.10  ? 82  GLU C CG  1 
ATOM   4556  C CD  . GLU C  1 82  ? -1.792  34.438  -5.715  1.00 24.15  ? 82  GLU C CD  1 
ATOM   4557  O OE1 . GLU C  1 82  ? -1.239  33.951  -4.713  1.00 25.44  ? 82  GLU C OE1 1 
ATOM   4558  O OE2 . GLU C  1 82  ? -2.270  33.689  -6.570  1.00 24.88  ? 82  GLU C OE2 1 
ATOM   4559  N N   . THR C  1 83  ? -0.707  35.466  -2.338  1.00 16.23  ? 83  THR C N   1 
ATOM   4560  C CA  . THR C  1 83  ? 0.040   34.981  -1.207  1.00 14.78  ? 83  THR C CA  1 
ATOM   4561  C C   . THR C  1 83  ? 1.333   34.302  -1.654  1.00 14.45  ? 83  THR C C   1 
ATOM   4562  O O   . THR C  1 83  ? 1.329   33.570  -2.657  1.00 14.17  ? 83  THR C O   1 
ATOM   4563  C CB  . THR C  1 83  ? -0.984  34.094  -0.522  1.00 13.71  ? 83  THR C CB  1 
ATOM   4564  O OG1 . THR C  1 83  ? -1.311  34.895  0.604   1.00 13.09  ? 83  THR C OG1 1 
ATOM   4565  C CG2 . THR C  1 83  ? -0.586  32.670  -0.237  1.00 13.75  ? 83  THR C CG2 1 
ATOM   4566  N N   . TRP C  1 84  ? 2.432   34.456  -0.918  1.00 13.49  ? 84  TRP C N   1 
ATOM   4567  C CA  . TRP C  1 84  ? 3.702   33.928  -1.375  1.00 13.39  ? 84  TRP C CA  1 
ATOM   4568  C C   . TRP C  1 84  ? 4.629   33.669  -0.216  1.00 13.74  ? 84  TRP C C   1 
ATOM   4569  O O   . TRP C  1 84  ? 4.422   34.229  0.854   1.00 14.71  ? 84  TRP C O   1 
ATOM   4570  C CB  . TRP C  1 84  ? 4.415   34.920  -2.345  1.00 12.17  ? 84  TRP C CB  1 
ATOM   4571  C CG  . TRP C  1 84  ? 4.736   36.263  -1.698  1.00 11.82  ? 84  TRP C CG  1 
ATOM   4572  C CD1 . TRP C  1 84  ? 5.932   36.465  -1.060  1.00 11.52  ? 84  TRP C CD1 1 
ATOM   4573  C CD2 . TRP C  1 84  ? 3.899   37.344  -1.594  1.00 11.88  ? 84  TRP C CD2 1 
ATOM   4574  N NE1 . TRP C  1 84  ? 5.840   37.650  -0.527  1.00 11.67  ? 84  TRP C NE1 1 
ATOM   4575  C CE2 . TRP C  1 84  ? 4.654   38.203  -0.809  1.00 11.88  ? 84  TRP C CE2 1 
ATOM   4576  C CE3 . TRP C  1 84  ? 2.638   37.708  -2.000  1.00 11.99  ? 84  TRP C CE3 1 
ATOM   4577  C CZ2 . TRP C  1 84  ? 4.194   39.448  -0.443  1.00 12.08  ? 84  TRP C CZ2 1 
ATOM   4578  C CZ3 . TRP C  1 84  ? 2.166   38.955  -1.631  1.00 12.17  ? 84  TRP C CZ3 1 
ATOM   4579  C CH2 . TRP C  1 84  ? 2.925   39.811  -0.854  1.00 12.34  ? 84  TRP C CH2 1 
ATOM   4580  N N   . ASP C  1 85  ? 5.650   32.869  -0.480  1.00 14.06  ? 85  ASP C N   1 
ATOM   4581  C CA  . ASP C  1 85  ? 6.783   32.683  0.405   1.00 14.49  ? 85  ASP C CA  1 
ATOM   4582  C C   . ASP C  1 85  ? 7.888   33.529  -0.186  1.00 13.65  ? 85  ASP C C   1 
ATOM   4583  O O   . ASP C  1 85  ? 8.683   34.180  0.515   1.00 15.14  ? 85  ASP C O   1 
ATOM   4584  C CB  . ASP C  1 85  ? 7.351   31.291  0.409   1.00 15.92  ? 85  ASP C CB  1 
ATOM   4585  C CG  . ASP C  1 85  ? 6.606   30.259  1.209   1.00 17.89  ? 85  ASP C CG  1 
ATOM   4586  O OD1 . ASP C  1 85  ? 5.624   30.549  1.884   1.00 19.13  ? 85  ASP C OD1 1 
ATOM   4587  O OD2 . ASP C  1 85  ? 7.051   29.106  1.175   1.00 19.11  ? 85  ASP C OD2 1 
ATOM   4588  N N   . LEU C  1 86  ? 7.992   33.500  -1.511  1.00 10.43  ? 86  LEU C N   1 
ATOM   4589  C CA  . LEU C  1 86  ? 8.979   34.299  -2.172  1.00 7.82   ? 86  LEU C CA  1 
ATOM   4590  C C   . LEU C  1 86  ? 8.278   34.992  -3.298  1.00 7.50   ? 86  LEU C C   1 
ATOM   4591  O O   . LEU C  1 86  ? 7.608   34.311  -4.077  1.00 9.42   ? 86  LEU C O   1 
ATOM   4592  C CB  . LEU C  1 86  ? 10.052  33.419  -2.706  1.00 6.58   ? 86  LEU C CB  1 
ATOM   4593  C CG  . LEU C  1 86  ? 11.194  34.173  -3.304  1.00 6.70   ? 86  LEU C CG  1 
ATOM   4594  C CD1 . LEU C  1 86  ? 11.870  35.004  -2.207  1.00 7.87   ? 86  LEU C CD1 1 
ATOM   4595  C CD2 . LEU C  1 86  ? 12.160  33.194  -3.919  1.00 6.58   ? 86  LEU C CD2 1 
ATOM   4596  N N   . PHE C  1 87  ? 8.305   36.309  -3.375  1.00 5.30   ? 87  PHE C N   1 
ATOM   4597  C CA  . PHE C  1 87  ? 7.711   36.970  -4.511  1.00 4.11   ? 87  PHE C CA  1 
ATOM   4598  C C   . PHE C  1 87  ? 8.872   37.172  -5.468  1.00 4.64   ? 87  PHE C C   1 
ATOM   4599  O O   . PHE C  1 87  ? 9.905   37.671  -5.015  1.00 6.57   ? 87  PHE C O   1 
ATOM   4600  C CB  . PHE C  1 87  ? 7.133   38.277  -4.043  1.00 3.30   ? 87  PHE C CB  1 
ATOM   4601  C CG  . PHE C  1 87  ? 6.341   39.026  -5.097  1.00 3.16   ? 87  PHE C CG  1 
ATOM   4602  C CD1 . PHE C  1 87  ? 4.956   39.040  -5.013  1.00 3.53   ? 87  PHE C CD1 1 
ATOM   4603  C CD2 . PHE C  1 87  ? 6.986   39.667  -6.150  1.00 2.77   ? 87  PHE C CD2 1 
ATOM   4604  C CE1 . PHE C  1 87  ? 4.225   39.727  -5.973  1.00 3.45   ? 87  PHE C CE1 1 
ATOM   4605  C CE2 . PHE C  1 87  ? 6.246   40.345  -7.097  1.00 3.01   ? 87  PHE C CE2 1 
ATOM   4606  C CZ  . PHE C  1 87  ? 4.866   40.365  -7.019  1.00 3.11   ? 87  PHE C CZ  1 
ATOM   4607  N N   . VAL C  1 88  ? 8.820   36.794  -6.740  1.00 3.67   ? 88  VAL C N   1 
ATOM   4608  C CA  . VAL C  1 88  ? 9.947   37.037  -7.620  1.00 3.45   ? 88  VAL C CA  1 
ATOM   4609  C C   . VAL C  1 88  ? 9.635   38.235  -8.482  1.00 4.97   ? 88  VAL C C   1 
ATOM   4610  O O   . VAL C  1 88  ? 8.634   38.251  -9.196  1.00 5.77   ? 88  VAL C O   1 
ATOM   4611  C CB  . VAL C  1 88  ? 10.241  35.830  -8.527  1.00 2.83   ? 88  VAL C CB  1 
ATOM   4612  C CG1 . VAL C  1 88  ? 11.398  36.138  -9.466  1.00 2.00   ? 88  VAL C CG1 1 
ATOM   4613  C CG2 . VAL C  1 88  ? 10.643  34.637  -7.677  1.00 2.71   ? 88  VAL C CG2 1 
ATOM   4614  N N   . GLU C  1 89  ? 10.464  39.263  -8.408  1.00 6.45   ? 89  GLU C N   1 
ATOM   4615  C CA  . GLU C  1 89  ? 10.327  40.487  -9.185  1.00 6.42   ? 89  GLU C CA  1 
ATOM   4616  C C   . GLU C  1 89  ? 11.182  40.397  -10.435 1.00 6.95   ? 89  GLU C C   1 
ATOM   4617  O O   . GLU C  1 89  ? 12.399  40.161  -10.360 1.00 7.55   ? 89  GLU C O   1 
ATOM   4618  C CB  . GLU C  1 89  ? 10.760  41.615  -8.334  1.00 5.70   ? 89  GLU C CB  1 
ATOM   4619  C CG  . GLU C  1 89  ? 9.636   42.528  -7.975  1.00 6.50   ? 89  GLU C CG  1 
ATOM   4620  C CD  . GLU C  1 89  ? 10.073  43.757  -7.188  1.00 8.05   ? 89  GLU C CD  1 
ATOM   4621  O OE1 . GLU C  1 89  ? 9.243   44.291  -6.435  1.00 9.06   ? 89  GLU C OE1 1 
ATOM   4622  O OE2 . GLU C  1 89  ? 11.245  44.172  -7.238  1.00 7.66   ? 89  GLU C OE2 1 
ATOM   4623  N N   . ARG C  1 90  ? 10.572  40.588  -11.581 1.00 8.06   ? 90  ARG C N   1 
ATOM   4624  C CA  . ARG C  1 90  ? 11.251  40.405  -12.843 1.00 11.06  ? 90  ARG C CA  1 
ATOM   4625  C C   . ARG C  1 90  ? 11.788  41.699  -13.377 1.00 12.87  ? 90  ARG C C   1 
ATOM   4626  O O   . ARG C  1 90  ? 11.138  42.737  -13.254 1.00 11.74  ? 90  ARG C O   1 
ATOM   4627  C CB  . ARG C  1 90  ? 10.340  39.850  -13.902 1.00 10.65  ? 90  ARG C CB  1 
ATOM   4628  C CG  . ARG C  1 90  ? 9.634   38.562  -13.528 1.00 10.19  ? 90  ARG C CG  1 
ATOM   4629  C CD  . ARG C  1 90  ? 10.670  37.513  -13.312 1.00 9.20   ? 90  ARG C CD  1 
ATOM   4630  N NE  . ARG C  1 90  ? 10.043  36.229  -13.154 1.00 8.44   ? 90  ARG C NE  1 
ATOM   4631  C CZ  . ARG C  1 90  ? 10.769  35.137  -12.945 1.00 7.88   ? 90  ARG C CZ  1 
ATOM   4632  N NH1 . ARG C  1 90  ? 10.146  33.969  -12.822 1.00 7.24   ? 90  ARG C NH1 1 
ATOM   4633  N NH2 . ARG C  1 90  ? 12.092  35.216  -12.834 1.00 7.80   ? 90  ARG C NH2 1 
ATOM   4634  N N   . SER C  1 91  ? 12.928  41.656  -14.073 1.00 15.21  ? 91  SER C N   1 
ATOM   4635  C CA  . SER C  1 91  ? 13.549  42.862  -14.575 1.00 16.80  ? 91  SER C CA  1 
ATOM   4636  C C   . SER C  1 91  ? 12.655  43.594  -15.563 1.00 18.16  ? 91  SER C C   1 
ATOM   4637  O O   . SER C  1 91  ? 12.798  44.773  -15.872 1.00 18.99  ? 91  SER C O   1 
ATOM   4638  C CB  . SER C  1 91  ? 14.853  42.490  -15.251 1.00 16.58  ? 91  SER C CB  1 
ATOM   4639  O OG  . SER C  1 91  ? 14.612  41.757  -16.462 1.00 16.20  ? 91  SER C OG  1 
ATOM   4640  N N   . LYS C  1 92  ? 11.758  42.841  -16.166 1.00 20.10  ? 92  LYS C N   1 
ATOM   4641  C CA  . LYS C  1 92  ? 10.903  43.343  -17.209 1.00 22.20  ? 92  LYS C CA  1 
ATOM   4642  C C   . LYS C  1 92  ? 9.615   43.880  -16.658 1.00 22.19  ? 92  LYS C C   1 
ATOM   4643  O O   . LYS C  1 92  ? 8.678   44.022  -17.431 1.00 22.77  ? 92  LYS C O   1 
ATOM   4644  C CB  . LYS C  1 92  ? 10.602  42.213  -18.178 1.00 24.81  ? 92  LYS C CB  1 
ATOM   4645  C CG  . LYS C  1 92  ? 11.816  41.396  -18.668 1.00 28.65  ? 92  LYS C CG  1 
ATOM   4646  C CD  . LYS C  1 92  ? 12.373  41.825  -20.042 1.00 31.22  ? 92  LYS C CD  1 
ATOM   4647  C CE  . LYS C  1 92  ? 12.932  43.270  -20.092 1.00 32.93  ? 92  LYS C CE  1 
ATOM   4648  N NZ  . LYS C  1 92  ? 14.107  43.445  -19.240 1.00 33.83  ? 92  LYS C NZ  1 
ATOM   4649  N N   . ALA C  1 93  ? 9.523   44.141  -15.356 1.00 22.27  ? 93  ALA C N   1 
ATOM   4650  C CA  . ALA C  1 93  ? 8.266   44.572  -14.763 1.00 21.88  ? 93  ALA C CA  1 
ATOM   4651  C C   . ALA C  1 93  ? 8.048   45.989  -15.165 1.00 22.23  ? 93  ALA C C   1 
ATOM   4652  O O   . ALA C  1 93  ? 9.020   46.712  -15.328 1.00 23.71  ? 93  ALA C O   1 
ATOM   4653  C CB  . ALA C  1 93  ? 8.295   44.543  -13.248 1.00 21.36  ? 93  ALA C CB  1 
ATOM   4654  N N   . PHE C  1 94  ? 6.832   46.436  -15.366 1.00 23.20  ? 94  PHE C N   1 
ATOM   4655  C CA  . PHE C  1 94  ? 6.635   47.823  -15.767 1.00 23.92  ? 94  PHE C CA  1 
ATOM   4656  C C   . PHE C  1 94  ? 5.404   48.309  -15.048 1.00 24.83  ? 94  PHE C C   1 
ATOM   4657  O O   . PHE C  1 94  ? 4.751   47.524  -14.351 1.00 25.06  ? 94  PHE C O   1 
ATOM   4658  C CB  . PHE C  1 94  ? 6.435   47.946  -17.299 1.00 23.43  ? 94  PHE C CB  1 
ATOM   4659  C CG  . PHE C  1 94  ? 5.126   47.398  -17.852 1.00 23.49  ? 94  PHE C CG  1 
ATOM   4660  C CD1 . PHE C  1 94  ? 4.092   48.253  -18.135 1.00 23.04  ? 94  PHE C CD1 1 
ATOM   4661  C CD2 . PHE C  1 94  ? 4.964   46.044  -18.053 1.00 24.18  ? 94  PHE C CD2 1 
ATOM   4662  C CE1 . PHE C  1 94  ? 2.906   47.755  -18.604 1.00 22.92  ? 94  PHE C CE1 1 
ATOM   4663  C CE2 . PHE C  1 94  ? 3.771   45.544  -18.525 1.00 23.76  ? 94  PHE C CE2 1 
ATOM   4664  C CZ  . PHE C  1 94  ? 2.736   46.404  -18.802 1.00 23.47  ? 94  PHE C CZ  1 
ATOM   4665  N N   . SER C  1 95  ? 5.049   49.565  -15.232 1.00 25.89  ? 95  SER C N   1 
ATOM   4666  C CA  . SER C  1 95  ? 3.822   50.039  -14.633 1.00 27.15  ? 95  SER C CA  1 
ATOM   4667  C C   . SER C  1 95  ? 3.236   50.985  -15.638 1.00 27.30  ? 95  SER C C   1 
ATOM   4668  O O   . SER C  1 95  ? 3.958   51.608  -16.433 1.00 27.24  ? 95  SER C O   1 
ATOM   4669  C CB  . SER C  1 95  ? 4.085   50.784  -13.336 1.00 27.10  ? 95  SER C CB  1 
ATOM   4670  O OG  . SER C  1 95  ? 5.474   50.691  -13.092 1.00 27.55  ? 95  SER C OG  1 
ATOM   4671  N N   . ASN C  1 96  ? 1.934   51.037  -15.671 1.00 27.70  ? 96  ASN C N   1 
ATOM   4672  C CA  . ASN C  1 96  ? 1.263   51.937  -16.543 1.00 29.41  ? 96  ASN C CA  1 
ATOM   4673  C C   . ASN C  1 96  ? -0.022  52.214  -15.829 1.00 28.42  ? 96  ASN C C   1 
ATOM   4674  O O   . ASN C  1 96  ? -0.990  51.480  -15.859 1.00 29.24  ? 96  ASN C O   1 
ATOM   4675  C CB  . ASN C  1 96  ? 1.022   51.325  -17.941 1.00 32.86  ? 96  ASN C CB  1 
ATOM   4676  C CG  . ASN C  1 96  ? 0.215   50.033  -17.946 1.00 36.26  ? 96  ASN C CG  1 
ATOM   4677  O OD1 . ASN C  1 96  ? 0.516   49.065  -17.222 1.00 38.36  ? 96  ASN C OD1 1 
ATOM   4678  N ND2 . ASN C  1 96  ? -0.823  49.982  -18.779 1.00 37.16  ? 96  ASN C ND2 1 
ATOM   4679  N N   . CYS C  1 97  ? 0.063   53.269  -15.048 1.00 27.38  ? 97  CYS C N   1 
ATOM   4680  C CA  . CYS C  1 97  ? -1.069  53.819  -14.338 1.00 26.14  ? 97  CYS C CA  1 
ATOM   4681  C C   . CYS C  1 97  ? -0.603  55.221  -13.943 1.00 24.94  ? 97  CYS C C   1 
ATOM   4682  O O   . CYS C  1 97  ? 0.446   55.688  -14.449 1.00 24.23  ? 97  CYS C O   1 
ATOM   4683  C CB  . CYS C  1 97  ? -1.419  52.942  -13.108 1.00 27.04  ? 97  CYS C CB  1 
ATOM   4684  S SG  . CYS C  1 97  ? -2.954  53.378  -12.202 1.00 27.10  ? 97  CYS C SG  1 
ATOM   4685  N N   . TYR C  1 98  ? -1.348  55.931  -13.090 1.00 22.90  ? 98  TYR C N   1 
ATOM   4686  C CA  . TYR C  1 98  ? -1.005  57.295  -12.741 1.00 20.69  ? 98  TYR C CA  1 
ATOM   4687  C C   . TYR C  1 98  ? 0.414   57.343  -12.193 1.00 19.95  ? 98  TYR C C   1 
ATOM   4688  O O   . TYR C  1 98  ? 0.817   56.392  -11.512 1.00 20.39  ? 98  TYR C O   1 
ATOM   4689  C CB  . TYR C  1 98  ? -1.978  57.781  -11.701 1.00 20.03  ? 98  TYR C CB  1 
ATOM   4690  C CG  . TYR C  1 98  ? -2.182  59.273  -11.793 1.00 19.54  ? 98  TYR C CG  1 
ATOM   4691  C CD1 . TYR C  1 98  ? -3.366  59.768  -12.261 1.00 19.21  ? 98  TYR C CD1 1 
ATOM   4692  C CD2 . TYR C  1 98  ? -1.204  60.136  -11.377 1.00 19.99  ? 98  TYR C CD2 1 
ATOM   4693  C CE1 . TYR C  1 98  ? -3.584  61.117  -12.301 1.00 20.01  ? 98  TYR C CE1 1 
ATOM   4694  C CE2 . TYR C  1 98  ? -1.407  61.490  -11.412 1.00 20.61  ? 98  TYR C CE2 1 
ATOM   4695  C CZ  . TYR C  1 98  ? -2.602  61.986  -11.866 1.00 20.75  ? 98  TYR C CZ  1 
ATOM   4696  O OH  . TYR C  1 98  ? -2.819  63.351  -11.829 1.00 20.28  ? 98  TYR C OH  1 
ATOM   4697  N N   . PRO C  1 99  ? 1.255   58.302  -12.609 1.00 18.84  ? 99  PRO C N   1 
ATOM   4698  C CA  . PRO C  1 99  ? 2.618   58.419  -12.094 1.00 17.87  ? 99  PRO C CA  1 
ATOM   4699  C C   . PRO C  1 99  ? 2.605   58.645  -10.589 1.00 16.99  ? 99  PRO C C   1 
ATOM   4700  O O   . PRO C  1 99  ? 1.969   59.582  -10.104 1.00 17.33  ? 99  PRO C O   1 
ATOM   4701  C CB  . PRO C  1 99  ? 3.227   59.558  -12.885 1.00 17.60  ? 99  PRO C CB  1 
ATOM   4702  C CG  . PRO C  1 99  ? 2.107   60.147  -13.694 1.00 17.82  ? 99  PRO C CG  1 
ATOM   4703  C CD  . PRO C  1 99  ? 1.171   58.984  -13.895 1.00 18.37  ? 99  PRO C CD  1 
ATOM   4704  N N   . TYR C  1 100 ? 3.247   57.774  -9.822  1.00 16.25  ? 100 TYR C N   1 
ATOM   4705  C CA  . TYR C  1 100 ? 3.263   57.906  -8.377  1.00 14.92  ? 100 TYR C CA  1 
ATOM   4706  C C   . TYR C  1 100 ? 4.689   57.840  -7.915  1.00 15.66  ? 100 TYR C C   1 
ATOM   4707  O O   . TYR C  1 100 ? 5.540   57.437  -8.721  1.00 17.10  ? 100 TYR C O   1 
ATOM   4708  C CB  . TYR C  1 100 ? 2.501   56.772  -7.681  1.00 13.98  ? 100 TYR C CB  1 
ATOM   4709  C CG  . TYR C  1 100 ? 3.110   55.383  -7.795  1.00 13.02  ? 100 TYR C CG  1 
ATOM   4710  C CD1 . TYR C  1 100 ? 2.864   54.603  -8.887  1.00 13.08  ? 100 TYR C CD1 1 
ATOM   4711  C CD2 . TYR C  1 100 ? 3.951   54.929  -6.818  1.00 13.13  ? 100 TYR C CD2 1 
ATOM   4712  C CE1 . TYR C  1 100 ? 3.466   53.369  -8.999  1.00 14.14  ? 100 TYR C CE1 1 
ATOM   4713  C CE2 . TYR C  1 100 ? 4.553   53.702  -6.934  1.00 13.67  ? 100 TYR C CE2 1 
ATOM   4714  C CZ  . TYR C  1 100 ? 4.316   52.917  -8.021  1.00 13.81  ? 100 TYR C CZ  1 
ATOM   4715  O OH  . TYR C  1 100 ? 4.928   51.675  -8.114  1.00 14.33  ? 100 TYR C OH  1 
ATOM   4716  N N   . ASP C  1 101 ? 4.961   58.188  -6.666  1.00 15.74  ? 101 ASP C N   1 
ATOM   4717  C CA  . ASP C  1 101 ? 6.266   57.935  -6.096  1.00 16.51  ? 101 ASP C CA  1 
ATOM   4718  C C   . ASP C  1 101 ? 6.020   57.516  -4.671  1.00 15.10  ? 101 ASP C C   1 
ATOM   4719  O O   . ASP C  1 101 ? 4.996   57.856  -4.081  1.00 14.42  ? 101 ASP C O   1 
ATOM   4720  C CB  . ASP C  1 101 ? 7.179   59.182  -6.137  1.00 19.05  ? 101 ASP C CB  1 
ATOM   4721  C CG  . ASP C  1 101 ? 6.813   60.333  -5.227  1.00 21.38  ? 101 ASP C CG  1 
ATOM   4722  O OD1 . ASP C  1 101 ? 7.246   60.331  -4.072  1.00 22.58  ? 101 ASP C OD1 1 
ATOM   4723  O OD2 . ASP C  1 101 ? 6.101   61.236  -5.663  1.00 23.09  ? 101 ASP C OD2 1 
ATOM   4724  N N   . VAL C  1 102 ? 6.876   56.669  -4.117  1.00 14.16  ? 102 VAL C N   1 
ATOM   4725  C CA  . VAL C  1 102 ? 6.651   56.228  -2.751  1.00 13.24  ? 102 VAL C CA  1 
ATOM   4726  C C   . VAL C  1 102 ? 7.825   56.705  -1.938  1.00 11.76  ? 102 VAL C C   1 
ATOM   4727  O O   . VAL C  1 102 ? 8.924   56.171  -2.101  1.00 12.72  ? 102 VAL C O   1 
ATOM   4728  C CB  . VAL C  1 102 ? 6.586   54.679  -2.608  1.00 13.84  ? 102 VAL C CB  1 
ATOM   4729  C CG1 . VAL C  1 102 ? 6.150   54.334  -1.198  1.00 12.94  ? 102 VAL C CG1 1 
ATOM   4730  C CG2 . VAL C  1 102 ? 5.585   54.062  -3.542  1.00 13.96  ? 102 VAL C CG2 1 
ATOM   4731  N N   . PRO C  1 103 ? 7.711   57.732  -1.119  1.00 10.82  ? 103 PRO C N   1 
ATOM   4732  C CA  . PRO C  1 103 ? 8.808   58.192  -0.294  1.00 10.67  ? 103 PRO C CA  1 
ATOM   4733  C C   . PRO C  1 103 ? 9.060   56.986  0.585   1.00 11.24  ? 103 PRO C C   1 
ATOM   4734  O O   . PRO C  1 103 ? 8.124   56.459  1.166   1.00 13.18  ? 103 PRO C O   1 
ATOM   4735  C CB  . PRO C  1 103 ? 8.258   59.378  0.436   1.00 10.25  ? 103 PRO C CB  1 
ATOM   4736  C CG  . PRO C  1 103 ? 7.078   59.825  -0.398  1.00 10.40  ? 103 PRO C CG  1 
ATOM   4737  C CD  . PRO C  1 103 ? 6.509   58.512  -0.899  1.00 10.83  ? 103 PRO C CD  1 
ATOM   4738  N N   . ASP C  1 104 ? 10.280  56.501  0.621   1.00 11.59  ? 104 ASP C N   1 
ATOM   4739  C CA  . ASP C  1 104 ? 10.660  55.282  1.315   1.00 12.61  ? 104 ASP C CA  1 
ATOM   4740  C C   . ASP C  1 104 ? 9.944   54.027  0.826   1.00 11.16  ? 104 ASP C C   1 
ATOM   4741  O O   . ASP C  1 104 ? 9.404   53.140  1.504   1.00 10.79  ? 104 ASP C O   1 
ATOM   4742  C CB  . ASP C  1 104 ? 10.474  55.372  2.842   1.00 15.47  ? 104 ASP C CB  1 
ATOM   4743  C CG  . ASP C  1 104 ? 11.230  54.242  3.591   1.00 18.91  ? 104 ASP C CG  1 
ATOM   4744  O OD1 . ASP C  1 104 ? 12.145  53.559  3.063   1.00 19.67  ? 104 ASP C OD1 1 
ATOM   4745  O OD2 . ASP C  1 104 ? 10.888  54.015  4.749   1.00 20.72  ? 104 ASP C OD2 1 
ATOM   4746  N N   . TYR C  1 105 ? 10.059  53.943  -0.488  1.00 9.58   ? 105 TYR C N   1 
ATOM   4747  C CA  . TYR C  1 105 ? 9.687   52.791  -1.271  1.00 9.05   ? 105 TYR C CA  1 
ATOM   4748  C C   . TYR C  1 105 ? 10.308  51.538  -0.682  1.00 8.87   ? 105 TYR C C   1 
ATOM   4749  O O   . TYR C  1 105 ? 9.699   50.472  -0.570  1.00 8.87   ? 105 TYR C O   1 
ATOM   4750  C CB  . TYR C  1 105 ? 10.200  53.046  -2.636  1.00 9.24   ? 105 TYR C CB  1 
ATOM   4751  C CG  . TYR C  1 105 ? 9.749   52.067  -3.668  1.00 9.80   ? 105 TYR C CG  1 
ATOM   4752  C CD1 . TYR C  1 105 ? 10.509  50.980  -4.004  1.00 9.92   ? 105 TYR C CD1 1 
ATOM   4753  C CD2 . TYR C  1 105 ? 8.554   52.314  -4.271  1.00 10.55  ? 105 TYR C CD2 1 
ATOM   4754  C CE1 . TYR C  1 105 ? 10.066  50.126  -4.979  1.00 10.50  ? 105 TYR C CE1 1 
ATOM   4755  C CE2 . TYR C  1 105 ? 8.111   51.464  -5.241  1.00 11.45  ? 105 TYR C CE2 1 
ATOM   4756  C CZ  . TYR C  1 105 ? 8.869   50.379  -5.585  1.00 11.18  ? 105 TYR C CZ  1 
ATOM   4757  O OH  . TYR C  1 105 ? 8.404   49.573  -6.588  1.00 12.64  ? 105 TYR C OH  1 
ATOM   4758  N N   . ALA C  1 106 ? 11.562  51.701  -0.310  1.00 8.64   ? 106 ALA C N   1 
ATOM   4759  C CA  . ALA C  1 106 ? 12.337  50.652  0.285   1.00 7.54   ? 106 ALA C CA  1 
ATOM   4760  C C   . ALA C  1 106 ? 11.640  50.026  1.484   1.00 6.31   ? 106 ALA C C   1 
ATOM   4761  O O   . ALA C  1 106 ? 11.545  48.793  1.520   1.00 6.55   ? 106 ALA C O   1 
ATOM   4762  C CB  . ALA C  1 106 ? 13.641  51.238  0.718   1.00 9.21   ? 106 ALA C CB  1 
ATOM   4763  N N   . SER C  1 107 ? 11.128  50.782  2.448   1.00 3.73   ? 107 SER C N   1 
ATOM   4764  C CA  . SER C  1 107 ? 10.492  50.087  3.524   1.00 3.65   ? 107 SER C CA  1 
ATOM   4765  C C   . SER C  1 107 ? 9.140   49.511  3.148   1.00 4.60   ? 107 SER C C   1 
ATOM   4766  O O   . SER C  1 107 ? 8.856   48.391  3.597   1.00 4.35   ? 107 SER C O   1 
ATOM   4767  C CB  . SER C  1 107 ? 10.360  50.999  4.681   1.00 2.76   ? 107 SER C CB  1 
ATOM   4768  O OG  . SER C  1 107 ? 11.705  51.243  5.027   1.00 2.00   ? 107 SER C OG  1 
ATOM   4769  N N   . LEU C  1 108 ? 8.322   50.182  2.303   1.00 5.00   ? 108 LEU C N   1 
ATOM   4770  C CA  . LEU C  1 108 ? 7.006   49.646  1.920   1.00 4.38   ? 108 LEU C CA  1 
ATOM   4771  C C   . LEU C  1 108 ? 7.186   48.301  1.217   1.00 4.95   ? 108 LEU C C   1 
ATOM   4772  O O   . LEU C  1 108 ? 6.545   47.318  1.628   1.00 6.82   ? 108 LEU C O   1 
ATOM   4773  C CB  . LEU C  1 108 ? 6.231   50.533  0.941   1.00 3.56   ? 108 LEU C CB  1 
ATOM   4774  C CG  . LEU C  1 108 ? 4.744   50.874  1.116   1.00 2.45   ? 108 LEU C CG  1 
ATOM   4775  C CD1 . LEU C  1 108 ? 4.221   51.310  -0.238  1.00 2.56   ? 108 LEU C CD1 1 
ATOM   4776  C CD2 . LEU C  1 108 ? 3.918   49.714  1.536   1.00 2.00   ? 108 LEU C CD2 1 
ATOM   4777  N N   . ARG C  1 109 ? 8.088   48.198  0.221   1.00 3.35   ? 109 ARG C N   1 
ATOM   4778  C CA  . ARG C  1 109 ? 8.334   46.924  -0.434  1.00 2.31   ? 109 ARG C CA  1 
ATOM   4779  C C   . ARG C  1 109 ? 8.759   45.883  0.591   1.00 2.24   ? 109 ARG C C   1 
ATOM   4780  O O   . ARG C  1 109 ? 8.272   44.756  0.511   1.00 2.00   ? 109 ARG C O   1 
ATOM   4781  C CB  . ARG C  1 109 ? 9.425   47.056  -1.479  1.00 2.26   ? 109 ARG C CB  1 
ATOM   4782  C CG  . ARG C  1 109 ? 9.660   45.795  -2.338  1.00 2.28   ? 109 ARG C CG  1 
ATOM   4783  C CD  . ARG C  1 109 ? 10.743  46.024  -3.383  1.00 2.00   ? 109 ARG C CD  1 
ATOM   4784  N NE  . ARG C  1 109 ? 11.990  45.342  -3.089  1.00 2.00   ? 109 ARG C NE  1 
ATOM   4785  C CZ  . ARG C  1 109 ? 12.362  44.280  -3.792  1.00 2.00   ? 109 ARG C CZ  1 
ATOM   4786  N NH1 . ARG C  1 109 ? 13.523  43.663  -3.554  1.00 2.99   ? 109 ARG C NH1 1 
ATOM   4787  N NH2 . ARG C  1 109 ? 11.559  43.823  -4.710  1.00 2.00   ? 109 ARG C NH2 1 
ATOM   4788  N N   . SER C  1 110 ? 9.620   46.256  1.567   1.00 2.99   ? 110 SER C N   1 
ATOM   4789  C CA  . SER C  1 110 ? 10.050  45.295  2.591   1.00 3.60   ? 110 SER C CA  1 
ATOM   4790  C C   . SER C  1 110 ? 8.875   44.828  3.406   1.00 3.98   ? 110 SER C C   1 
ATOM   4791  O O   . SER C  1 110 ? 8.659   43.606  3.432   1.00 3.82   ? 110 SER C O   1 
ATOM   4792  C CB  . SER C  1 110 ? 11.058  45.812  3.663   1.00 3.28   ? 110 SER C CB  1 
ATOM   4793  O OG  . SER C  1 110 ? 11.261  44.858  4.690   1.00 2.14   ? 110 SER C OG  1 
ATOM   4794  N N   . LEU C  1 111 ? 8.086   45.750  4.005   1.00 3.55   ? 111 LEU C N   1 
ATOM   4795  C CA  . LEU C  1 111 ? 7.149   45.225  4.966   1.00 3.93   ? 111 LEU C CA  1 
ATOM   4796  C C   . LEU C  1 111 ? 5.998   44.510  4.321   1.00 4.02   ? 111 LEU C C   1 
ATOM   4797  O O   . LEU C  1 111 ? 5.470   43.577  4.943   1.00 3.57   ? 111 LEU C O   1 
ATOM   4798  C CB  . LEU C  1 111 ? 6.660   46.318  5.888   1.00 4.17   ? 111 LEU C CB  1 
ATOM   4799  C CG  . LEU C  1 111 ? 6.035   47.556  5.403   1.00 4.58   ? 111 LEU C CG  1 
ATOM   4800  C CD1 . LEU C  1 111 ? 4.514   47.502  5.537   1.00 5.35   ? 111 LEU C CD1 1 
ATOM   4801  C CD2 . LEU C  1 111 ? 6.580   48.677  6.268   1.00 5.02   ? 111 LEU C CD2 1 
ATOM   4802  N N   . VAL C  1 112 ? 5.667   44.848  3.068   1.00 3.93   ? 112 VAL C N   1 
ATOM   4803  C CA  . VAL C  1 112 ? 4.667   44.078  2.347   1.00 3.62   ? 112 VAL C CA  1 
ATOM   4804  C C   . VAL C  1 112 ? 5.246   42.695  2.060   1.00 5.15   ? 112 VAL C C   1 
ATOM   4805  O O   . VAL C  1 112 ? 4.647   41.674  2.413   1.00 5.43   ? 112 VAL C O   1 
ATOM   4806  C CB  . VAL C  1 112 ? 4.316   44.797  1.051   1.00 2.55   ? 112 VAL C CB  1 
ATOM   4807  C CG1 . VAL C  1 112 ? 3.386   43.976  0.190   1.00 2.00   ? 112 VAL C CG1 1 
ATOM   4808  C CG2 . VAL C  1 112 ? 3.622   46.075  1.415   1.00 2.00   ? 112 VAL C CG2 1 
ATOM   4809  N N   . ALA C  1 113 ? 6.474   42.647  1.532   1.00 6.79   ? 113 ALA C N   1 
ATOM   4810  C CA  . ALA C  1 113 ? 7.131   41.403  1.170   1.00 8.12   ? 113 ALA C CA  1 
ATOM   4811  C C   . ALA C  1 113 ? 7.330   40.447  2.320   1.00 9.75   ? 113 ALA C C   1 
ATOM   4812  O O   . ALA C  1 113 ? 7.386   39.256  2.049   1.00 10.83  ? 113 ALA C O   1 
ATOM   4813  C CB  . ALA C  1 113 ? 8.512   41.625  0.602   1.00 7.93   ? 113 ALA C CB  1 
ATOM   4814  N N   . SER C  1 114 ? 7.505   40.891  3.564   1.00 11.34  ? 114 SER C N   1 
ATOM   4815  C CA  . SER C  1 114 ? 7.624   39.944  4.654   1.00 13.59  ? 114 SER C CA  1 
ATOM   4816  C C   . SER C  1 114 ? 6.250   39.524  5.116   1.00 14.84  ? 114 SER C C   1 
ATOM   4817  O O   . SER C  1 114 ? 6.084   38.379  5.571   1.00 16.65  ? 114 SER C O   1 
ATOM   4818  C CB  . SER C  1 114 ? 8.320   40.521  5.855   1.00 14.89  ? 114 SER C CB  1 
ATOM   4819  O OG  . SER C  1 114 ? 9.421   41.326  5.448   1.00 17.82  ? 114 SER C OG  1 
ATOM   4820  N N   . SER C  1 115 ? 5.238   40.411  5.017   1.00 14.71  ? 115 SER C N   1 
ATOM   4821  C CA  . SER C  1 115 ? 3.886   40.053  5.416   1.00 13.16  ? 115 SER C CA  1 
ATOM   4822  C C   . SER C  1 115 ? 3.477   38.863  4.595   1.00 12.49  ? 115 SER C C   1 
ATOM   4823  O O   . SER C  1 115 ? 2.873   37.948  5.131   1.00 12.22  ? 115 SER C O   1 
ATOM   4824  C CB  . SER C  1 115 ? 2.945   41.178  5.134   1.00 14.06  ? 115 SER C CB  1 
ATOM   4825  O OG  . SER C  1 115 ? 1.692   41.049  5.767   1.00 15.30  ? 115 SER C OG  1 
ATOM   4826  N N   . GLY C  1 116 ? 3.826   38.852  3.310   1.00 12.38  ? 116 GLY C N   1 
ATOM   4827  C CA  . GLY C  1 116 ? 3.573   37.686  2.487   1.00 13.68  ? 116 GLY C CA  1 
ATOM   4828  C C   . GLY C  1 116 ? 2.166   37.567  1.918   1.00 14.89  ? 116 GLY C C   1 
ATOM   4829  O O   . GLY C  1 116 ? 1.883   36.644  1.149   1.00 15.51  ? 116 GLY C O   1 
ATOM   4830  N N   . THR C  1 117 ? 1.274   38.516  2.217   1.00 15.06  ? 117 THR C N   1 
ATOM   4831  C CA  . THR C  1 117 ? -0.099  38.438  1.776   1.00 13.97  ? 117 THR C CA  1 
ATOM   4832  C C   . THR C  1 117 ? -0.429  39.785  1.190   1.00 14.61  ? 117 THR C C   1 
ATOM   4833  O O   . THR C  1 117 ? 0.219   40.786  1.527   1.00 13.96  ? 117 THR C O   1 
ATOM   4834  C CB  . THR C  1 117 ? -0.996  38.092  2.983   1.00 12.88  ? 117 THR C CB  1 
ATOM   4835  O OG1 . THR C  1 117 ? -2.328  38.026  2.493   1.00 12.40  ? 117 THR C OG1 1 
ATOM   4836  C CG2 . THR C  1 117 ? -0.860  39.098  4.115   1.00 12.83  ? 117 THR C CG2 1 
ATOM   4837  N N   . LEU C  1 118 ? -1.405  39.764  0.287   1.00 15.70  ? 118 LEU C N   1 
ATOM   4838  C CA  . LEU C  1 118 ? -1.925  40.956  -0.350  1.00 16.00  ? 118 LEU C CA  1 
ATOM   4839  C C   . LEU C  1 118 ? -3.464  40.997  -0.176  1.00 17.81  ? 118 LEU C C   1 
ATOM   4840  O O   . LEU C  1 118 ? -4.181  41.674  -0.924  1.00 17.20  ? 118 LEU C O   1 
ATOM   4841  C CB  . LEU C  1 118 ? -1.444  40.837  -1.788  1.00 14.50  ? 118 LEU C CB  1 
ATOM   4842  C CG  . LEU C  1 118 ? -0.859  42.031  -2.523  1.00 14.70  ? 118 LEU C CG  1 
ATOM   4843  C CD1 . LEU C  1 118 ? 0.194   42.694  -1.670  1.00 15.30  ? 118 LEU C CD1 1 
ATOM   4844  C CD2 . LEU C  1 118 ? -0.214  41.573  -3.829  1.00 13.82  ? 118 LEU C CD2 1 
ATOM   4845  N N   . GLU C  1 119 ? -3.963  40.191  0.788   1.00 20.04  ? 119 GLU C N   1 
ATOM   4846  C CA  . GLU C  1 119 ? -5.371  40.055  1.158   1.00 22.27  ? 119 GLU C CA  1 
ATOM   4847  C C   . GLU C  1 119 ? -6.011  41.373  1.516   1.00 22.65  ? 119 GLU C C   1 
ATOM   4848  O O   . GLU C  1 119 ? -5.650  41.970  2.543   1.00 23.42  ? 119 GLU C O   1 
ATOM   4849  C CB  . GLU C  1 119 ? -5.566  39.198  2.375   1.00 24.75  ? 119 GLU C CB  1 
ATOM   4850  C CG  . GLU C  1 119 ? -5.417  37.717  2.127   1.00 28.33  ? 119 GLU C CG  1 
ATOM   4851  C CD  . GLU C  1 119 ? -5.236  36.926  3.411   1.00 29.67  ? 119 GLU C CD  1 
ATOM   4852  O OE1 . GLU C  1 119 ? -4.344  36.055  3.439   1.00 29.86  ? 119 GLU C OE1 1 
ATOM   4853  O OE2 . GLU C  1 119 ? -5.895  37.206  4.439   1.00 30.57  ? 119 GLU C OE2 1 
ATOM   4854  N N   . PHE C  1 120 ? -6.993  41.792  0.729   1.00 22.12  ? 120 PHE C N   1 
ATOM   4855  C CA  . PHE C  1 120 ? -7.581  43.091  0.967   1.00 21.67  ? 120 PHE C CA  1 
ATOM   4856  C C   . PHE C  1 120 ? -8.998  43.002  1.476   1.00 20.86  ? 120 PHE C C   1 
ATOM   4857  O O   . PHE C  1 120 ? -9.847  42.268  0.948   1.00 21.38  ? 120 PHE C O   1 
ATOM   4858  C CB  . PHE C  1 120 ? -7.538  43.914  -0.327  1.00 21.33  ? 120 PHE C CB  1 
ATOM   4859  C CG  . PHE C  1 120 ? -7.841  45.378  -0.107  1.00 21.16  ? 120 PHE C CG  1 
ATOM   4860  C CD1 . PHE C  1 120 ? -7.011  46.156  0.672   1.00 21.29  ? 120 PHE C CD1 1 
ATOM   4861  C CD2 . PHE C  1 120 ? -8.954  45.931  -0.671  1.00 21.42  ? 120 PHE C CD2 1 
ATOM   4862  C CE1 . PHE C  1 120 ? -7.303  47.486  0.886   1.00 21.12  ? 120 PHE C CE1 1 
ATOM   4863  C CE2 . PHE C  1 120 ? -9.245  47.269  -0.451  1.00 21.98  ? 120 PHE C CE2 1 
ATOM   4864  C CZ  . PHE C  1 120 ? -8.426  48.053  0.327   1.00 21.14  ? 120 PHE C CZ  1 
ATOM   4865  N N   . ILE C  1 121 ? -9.256  43.779  2.504   1.00 19.98  ? 121 ILE C N   1 
ATOM   4866  C CA  . ILE C  1 121 ? -10.582 43.870  3.061   1.00 20.47  ? 121 ILE C CA  1 
ATOM   4867  C C   . ILE C  1 121 ? -11.118 45.257  2.734   1.00 21.24  ? 121 ILE C C   1 
ATOM   4868  O O   . ILE C  1 121 ? -10.467 46.249  3.091   1.00 22.49  ? 121 ILE C O   1 
ATOM   4869  C CB  . ILE C  1 121 ? -10.498 43.659  4.570   1.00 19.69  ? 121 ILE C CB  1 
ATOM   4870  C CG1 . ILE C  1 121 ? -9.807  42.359  4.928   1.00 19.50  ? 121 ILE C CG1 1 
ATOM   4871  C CG2 . ILE C  1 121 ? -11.897 43.659  5.109   1.00 20.48  ? 121 ILE C CG2 1 
ATOM   4872  C CD1 . ILE C  1 121 ? -10.365 41.096  4.267   1.00 19.03  ? 121 ILE C CD1 1 
ATOM   4873  N N   . THR C  1 122 ? -12.242 45.386  2.029   1.00 21.51  ? 122 THR C N   1 
ATOM   4874  C CA  . THR C  1 122 ? -12.754 46.717  1.737   1.00 22.06  ? 122 THR C CA  1 
ATOM   4875  C C   . THR C  1 122 ? -13.509 47.259  2.939   1.00 22.52  ? 122 THR C C   1 
ATOM   4876  O O   . THR C  1 122 ? -14.245 46.516  3.570   1.00 23.20  ? 122 THR C O   1 
ATOM   4877  C CB  . THR C  1 122 ? -13.664 46.650  0.523   1.00 21.34  ? 122 THR C CB  1 
ATOM   4878  O OG1 . THR C  1 122 ? -12.890 46.158  -0.576  1.00 21.08  ? 122 THR C OG1 1 
ATOM   4879  C CG2 . THR C  1 122 ? -14.202 48.004  0.152   1.00 21.39  ? 122 THR C CG2 1 
ATOM   4880  N N   . GLU C  1 123 ? -13.341 48.510  3.311   1.00 23.30  ? 123 GLU C N   1 
ATOM   4881  C CA  . GLU C  1 123 ? -14.063 49.016  4.444   1.00 24.87  ? 123 GLU C CA  1 
ATOM   4882  C C   . GLU C  1 123 ? -15.039 50.079  4.008   1.00 26.58  ? 123 GLU C C   1 
ATOM   4883  O O   . GLU C  1 123 ? -14.850 50.777  3.002   1.00 28.25  ? 123 GLU C O   1 
ATOM   4884  C CB  . GLU C  1 123 ? -13.124 49.606  5.464   1.00 25.28  ? 123 GLU C CB  1 
ATOM   4885  C CG  . GLU C  1 123 ? -12.543 48.476  6.274   1.00 25.45  ? 123 GLU C CG  1 
ATOM   4886  C CD  . GLU C  1 123 ? -11.656 48.905  7.426   1.00 25.62  ? 123 GLU C CD  1 
ATOM   4887  O OE1 . GLU C  1 123 ? -11.885 48.442  8.542   1.00 26.09  ? 123 GLU C OE1 1 
ATOM   4888  O OE2 . GLU C  1 123 ? -10.698 49.641  7.225   1.00 25.19  ? 123 GLU C OE2 1 
ATOM   4889  N N   . GLY C  1 124 ? -16.105 50.248  4.780   1.00 27.19  ? 124 GLY C N   1 
ATOM   4890  C CA  . GLY C  1 124 ? -17.146 51.191  4.431   1.00 27.62  ? 124 GLY C CA  1 
ATOM   4891  C C   . GLY C  1 124 ? -16.776 52.612  4.760   1.00 28.62  ? 124 GLY C C   1 
ATOM   4892  O O   . GLY C  1 124 ? -17.307 53.181  5.709   1.00 28.99  ? 124 GLY C O   1 
ATOM   4893  N N   . PHE C  1 125 ? -15.822 53.195  4.049   1.00 30.00  ? 125 PHE C N   1 
ATOM   4894  C CA  . PHE C  1 125 ? -15.507 54.606  4.260   1.00 30.91  ? 125 PHE C CA  1 
ATOM   4895  C C   . PHE C  1 125 ? -16.608 55.438  3.618   1.00 31.95  ? 125 PHE C C   1 
ATOM   4896  O O   . PHE C  1 125 ? -17.122 55.065  2.544   1.00 32.61  ? 125 PHE C O   1 
ATOM   4897  C CB  . PHE C  1 125 ? -14.174 54.956  3.615   1.00 30.43  ? 125 PHE C CB  1 
ATOM   4898  C CG  . PHE C  1 125 ? -13.016 54.504  4.475   1.00 29.87  ? 125 PHE C CG  1 
ATOM   4899  C CD1 . PHE C  1 125 ? -12.336 53.347  4.155   1.00 29.89  ? 125 PHE C CD1 1 
ATOM   4900  C CD2 . PHE C  1 125 ? -12.673 55.246  5.579   1.00 29.34  ? 125 PHE C CD2 1 
ATOM   4901  C CE1 . PHE C  1 125 ? -11.298 52.928  4.948   1.00 29.16  ? 125 PHE C CE1 1 
ATOM   4902  C CE2 . PHE C  1 125 ? -11.638 54.817  6.371   1.00 29.12  ? 125 PHE C CE2 1 
ATOM   4903  C CZ  . PHE C  1 125 ? -10.955 53.664  6.058   1.00 29.07  ? 125 PHE C CZ  1 
ATOM   4904  N N   . THR C  1 126 ? -17.025 56.536  4.241   1.00 32.27  ? 126 THR C N   1 
ATOM   4905  C CA  . THR C  1 126 ? -18.089 57.312  3.625   1.00 33.10  ? 126 THR C CA  1 
ATOM   4906  C C   . THR C  1 126 ? -17.645 58.729  3.407   1.00 31.71  ? 126 THR C C   1 
ATOM   4907  O O   . THR C  1 126 ? -17.512 59.506  4.343   1.00 30.68  ? 126 THR C O   1 
ATOM   4908  C CB  . THR C  1 126 ? -19.337 57.183  4.546   1.00 33.99  ? 126 THR C CB  1 
ATOM   4909  O OG1 . THR C  1 126 ? -18.828 57.251  5.879   1.00 34.17  ? 126 THR C OG1 1 
ATOM   4910  C CG2 . THR C  1 126 ? -20.159 55.874  4.316   1.00 33.94  ? 126 THR C CG2 1 
ATOM   4911  N N   . TRP C  1 127 ? -17.349 59.058  2.171   1.00 32.12  ? 127 TRP C N   1 
ATOM   4912  C CA  . TRP C  1 127 ? -16.829 60.375  1.882   1.00 33.19  ? 127 TRP C CA  1 
ATOM   4913  C C   . TRP C  1 127 ? -17.978 61.334  1.620   1.00 34.45  ? 127 TRP C C   1 
ATOM   4914  O O   . TRP C  1 127 ? -18.569 61.361  0.529   1.00 35.70  ? 127 TRP C O   1 
ATOM   4915  C CB  . TRP C  1 127 ? -15.870 60.216  0.684   1.00 32.59  ? 127 TRP C CB  1 
ATOM   4916  C CG  . TRP C  1 127 ? -14.798 59.192  1.041   1.00 31.86  ? 127 TRP C CG  1 
ATOM   4917  C CD1 . TRP C  1 127 ? -14.841 57.934  0.507   1.00 31.74  ? 127 TRP C CD1 1 
ATOM   4918  C CD2 . TRP C  1 127 ? -13.792 59.352  1.965   1.00 30.48  ? 127 TRP C CD2 1 
ATOM   4919  N NE1 . TRP C  1 127 ? -13.874 57.295  1.113   1.00 31.96  ? 127 TRP C NE1 1 
ATOM   4920  C CE2 . TRP C  1 127 ? -13.234 58.094  1.982   1.00 30.50  ? 127 TRP C CE2 1 
ATOM   4921  C CE3 . TRP C  1 127 ? -13.293 60.346  2.767   1.00 29.45  ? 127 TRP C CE3 1 
ATOM   4922  C CZ2 . TRP C  1 127 ? -12.178 57.802  2.803   1.00 29.71  ? 127 TRP C CZ2 1 
ATOM   4923  C CZ3 . TRP C  1 127 ? -12.237 60.063  3.590   1.00 29.00  ? 127 TRP C CZ3 1 
ATOM   4924  C CH2 . TRP C  1 127 ? -11.685 58.805  3.602   1.00 29.49  ? 127 TRP C CH2 1 
ATOM   4925  N N   . THR C  1 128 ? -18.377 62.103  2.635   1.00 34.76  ? 128 THR C N   1 
ATOM   4926  C CA  . THR C  1 128 ? -19.512 63.004  2.470   1.00 35.31  ? 128 THR C CA  1 
ATOM   4927  C C   . THR C  1 128 ? -19.168 64.341  1.874   1.00 34.30  ? 128 THR C C   1 
ATOM   4928  O O   . THR C  1 128 ? -18.434 65.126  2.463   1.00 34.38  ? 128 THR C O   1 
ATOM   4929  C CB  . THR C  1 128 ? -20.204 63.264  3.819   1.00 36.68  ? 128 THR C CB  1 
ATOM   4930  O OG1 . THR C  1 128 ? -19.389 62.729  4.875   1.00 37.93  ? 128 THR C OG1 1 
ATOM   4931  C CG2 . THR C  1 128 ? -21.598 62.654  3.805   1.00 37.03  ? 128 THR C CG2 1 
ATOM   4932  N N   . GLY C  1 129 ? -19.676 64.603  0.684   1.00 33.81  ? 129 GLY C N   1 
ATOM   4933  C CA  . GLY C  1 129 ? -19.494 65.921  0.117   1.00 33.67  ? 129 GLY C CA  1 
ATOM   4934  C C   . GLY C  1 129 ? -18.381 66.017  -0.892  1.00 33.10  ? 129 GLY C C   1 
ATOM   4935  O O   . GLY C  1 129 ? -17.987 67.124  -1.253  1.00 33.07  ? 129 GLY C O   1 
ATOM   4936  N N   . VAL C  1 130 ? -17.888 64.891  -1.388  1.00 32.62  ? 130 VAL C N   1 
ATOM   4937  C CA  . VAL C  1 130 ? -16.878 64.908  -2.428  1.00 32.81  ? 130 VAL C CA  1 
ATOM   4938  C C   . VAL C  1 130 ? -17.258 63.860  -3.458  1.00 33.28  ? 130 VAL C C   1 
ATOM   4939  O O   . VAL C  1 130 ? -18.106 63.000  -3.193  1.00 32.71  ? 130 VAL C O   1 
ATOM   4940  C CB  . VAL C  1 130 ? -15.464 64.571  -1.907  1.00 32.34  ? 130 VAL C CB  1 
ATOM   4941  C CG1 . VAL C  1 130 ? -14.927 65.743  -1.128  1.00 32.17  ? 130 VAL C CG1 1 
ATOM   4942  C CG2 . VAL C  1 130 ? -15.501 63.326  -1.039  1.00 32.26  ? 130 VAL C CG2 1 
ATOM   4943  N N   . THR C  1 131 ? -16.684 63.988  -4.640  1.00 33.72  ? 131 THR C N   1 
ATOM   4944  C CA  . THR C  1 131 ? -16.857 63.021  -5.687  1.00 34.66  ? 131 THR C CA  1 
ATOM   4945  C C   . THR C  1 131 ? -15.817 61.915  -5.561  1.00 34.73  ? 131 THR C C   1 
ATOM   4946  O O   . THR C  1 131 ? -14.612 62.150  -5.367  1.00 34.44  ? 131 THR C O   1 
ATOM   4947  C CB  . THR C  1 131 ? -16.749 63.771  -7.004  1.00 35.48  ? 131 THR C CB  1 
ATOM   4948  O OG1 . THR C  1 131 ? -17.797 64.730  -6.907  1.00 35.66  ? 131 THR C OG1 1 
ATOM   4949  C CG2 . THR C  1 131 ? -16.842 62.893  -8.261  1.00 36.02  ? 131 THR C CG2 1 
ATOM   4950  N N   . GLN C  1 132 ? -16.311 60.684  -5.648  1.00 34.78  ? 132 GLN C N   1 
ATOM   4951  C CA  . GLN C  1 132 ? -15.485 59.499  -5.524  1.00 34.80  ? 132 GLN C CA  1 
ATOM   4952  C C   . GLN C  1 132 ? -15.174 58.891  -6.855  1.00 34.17  ? 132 GLN C C   1 
ATOM   4953  O O   . GLN C  1 132 ? -15.681 59.324  -7.889  1.00 34.56  ? 132 GLN C O   1 
ATOM   4954  C CB  . GLN C  1 132 ? -16.162 58.431  -4.745  1.00 35.74  ? 132 GLN C CB  1 
ATOM   4955  C CG  . GLN C  1 132 ? -15.823 58.466  -3.295  1.00 37.88  ? 132 GLN C CG  1 
ATOM   4956  C CD  . GLN C  1 132 ? -16.592 57.391  -2.567  1.00 39.34  ? 132 GLN C CD  1 
ATOM   4957  O OE1 . GLN C  1 132 ? -17.154 57.626  -1.500  1.00 39.69  ? 132 GLN C OE1 1 
ATOM   4958  N NE2 . GLN C  1 132 ? -16.704 56.185  -3.123  1.00 40.75  ? 132 GLN C NE2 1 
ATOM   4959  N N   . ASN C  1 133 ? -14.300 57.899  -6.790  1.00 33.37  ? 133 ASN C N   1 
ATOM   4960  C CA  . ASN C  1 133 ? -13.964 57.053  -7.919  1.00 33.08  ? 133 ASN C CA  1 
ATOM   4961  C C   . ASN C  1 133 ? -13.319 57.696  -9.115  1.00 32.07  ? 133 ASN C C   1 
ATOM   4962  O O   . ASN C  1 133 ? -13.349 57.102  -10.193 1.00 32.27  ? 133 ASN C O   1 
ATOM   4963  C CB  . ASN C  1 133 ? -15.205 56.323  -8.379  1.00 34.33  ? 133 ASN C CB  1 
ATOM   4964  C CG  . ASN C  1 133 ? -15.389 55.144  -7.471  1.00 35.47  ? 133 ASN C CG  1 
ATOM   4965  O OD1 . ASN C  1 133 ? -15.440 55.288  -6.242  1.00 36.53  ? 133 ASN C OD1 1 
ATOM   4966  N ND2 . ASN C  1 133 ? -15.339 53.927  -7.990  1.00 36.00  ? 133 ASN C ND2 1 
ATOM   4967  N N   . GLY C  1 134 ? -12.695 58.859  -8.926  1.00 30.88  ? 134 GLY C N   1 
ATOM   4968  C CA  . GLY C  1 134 ? -11.980 59.517  -9.999  1.00 30.34  ? 134 GLY C CA  1 
ATOM   4969  C C   . GLY C  1 134 ? -10.894 58.606  -10.557 1.00 29.53  ? 134 GLY C C   1 
ATOM   4970  O O   . GLY C  1 134 ? -10.329 57.791  -9.821  1.00 29.12  ? 134 GLY C O   1 
ATOM   4971  N N   . GLY C  1 135 ? -10.616 58.747  -11.847 1.00 29.17  ? 135 GLY C N   1 
ATOM   4972  C CA  . GLY C  1 135 ? -9.643  57.917  -12.520 1.00 28.64  ? 135 GLY C CA  1 
ATOM   4973  C C   . GLY C  1 135 ? -8.900  58.783  -13.513 1.00 28.61  ? 135 GLY C C   1 
ATOM   4974  O O   . GLY C  1 135 ? -9.131  59.988  -13.601 1.00 28.11  ? 135 GLY C O   1 
ATOM   4975  N N   . SER C  1 136 ? -8.070  58.169  -14.310 1.00 29.39  ? 136 SER C N   1 
ATOM   4976  C CA  . SER C  1 136 ? -7.197  58.860  -15.215 1.00 31.31  ? 136 SER C CA  1 
ATOM   4977  C C   . SER C  1 136 ? -7.097  58.097  -16.496 1.00 33.05  ? 136 SER C C   1 
ATOM   4978  O O   . SER C  1 136 ? -7.189  56.860  -16.524 1.00 33.56  ? 136 SER C O   1 
ATOM   4979  C CB  . SER C  1 136 ? -5.791  58.977  -14.659 1.00 31.83  ? 136 SER C CB  1 
ATOM   4980  O OG  . SER C  1 136 ? -4.824  59.578  -15.532 1.00 32.34  ? 136 SER C OG  1 
ATOM   4981  N N   . ASN C  1 137 ? -6.843  58.847  -17.549 1.00 34.98  ? 137 ASN C N   1 
ATOM   4982  C CA  . ASN C  1 137 ? -6.712  58.236  -18.832 1.00 37.37  ? 137 ASN C CA  1 
ATOM   4983  C C   . ASN C  1 137 ? -5.318  57.656  -18.970 1.00 37.17  ? 137 ASN C C   1 
ATOM   4984  O O   . ASN C  1 137 ? -5.025  56.966  -19.953 1.00 37.67  ? 137 ASN C O   1 
ATOM   4985  C CB  . ASN C  1 137 ? -6.997  59.267  -19.900 1.00 40.84  ? 137 ASN C CB  1 
ATOM   4986  C CG  . ASN C  1 137 ? -7.431  58.585  -21.210 1.00 43.88  ? 137 ASN C CG  1 
ATOM   4987  O OD1 . ASN C  1 137 ? -8.586  58.141  -21.383 1.00 44.71  ? 137 ASN C OD1 1 
ATOM   4988  N ND2 . ASN C  1 137 ? -6.519  58.361  -22.169 1.00 44.97  ? 137 ASN C ND2 1 
ATOM   4989  N N   . ALA C  1 138 ? -4.437  57.914  -18.005 1.00 36.37  ? 138 ALA C N   1 
ATOM   4990  C CA  . ALA C  1 138 ? -3.132  57.272  -17.982 1.00 35.66  ? 138 ALA C CA  1 
ATOM   4991  C C   . ALA C  1 138 ? -3.181  55.927  -17.273 1.00 35.51  ? 138 ALA C C   1 
ATOM   4992  O O   . ALA C  1 138 ? -2.192  55.185  -17.284 1.00 37.22  ? 138 ALA C O   1 
ATOM   4993  C CB  . ALA C  1 138 ? -2.115  58.110  -17.252 1.00 34.86  ? 138 ALA C CB  1 
ATOM   4994  N N   . CYS C  1 139 ? -4.284  55.598  -16.590 1.00 34.09  ? 139 CYS C N   1 
ATOM   4995  C CA  . CYS C  1 139 ? -4.401  54.339  -15.887 1.00 33.30  ? 139 CYS C CA  1 
ATOM   4996  C C   . CYS C  1 139 ? -5.658  53.683  -16.390 1.00 35.52  ? 139 CYS C C   1 
ATOM   4997  O O   . CYS C  1 139 ? -6.710  53.785  -15.768 1.00 35.41  ? 139 CYS C O   1 
ATOM   4998  C CB  . CYS C  1 139 ? -4.522  54.607  -14.413 1.00 30.68  ? 139 CYS C CB  1 
ATOM   4999  S SG  . CYS C  1 139 ? -4.482  53.074  -13.471 1.00 27.97  ? 139 CYS C SG  1 
ATOM   5000  N N   . LYS C  1 140 ? -5.630  52.998  -17.527 1.00 37.88  ? 140 LYS C N   1 
ATOM   5001  C CA  . LYS C  1 140 ? -6.888  52.538  -18.084 1.00 40.18  ? 140 LYS C CA  1 
ATOM   5002  C C   . LYS C  1 140 ? -7.420  51.245  -17.527 1.00 41.87  ? 140 LYS C C   1 
ATOM   5003  O O   . LYS C  1 140 ? -6.707  50.253  -17.361 1.00 42.18  ? 140 LYS C O   1 
ATOM   5004  C CB  . LYS C  1 140 ? -6.760  52.406  -19.584 1.00 40.87  ? 140 LYS C CB  1 
ATOM   5005  C CG  . LYS C  1 140 ? -6.761  53.792  -20.184 1.00 41.56  ? 140 LYS C CG  1 
ATOM   5006  C CD  . LYS C  1 140 ? -6.968  53.758  -21.682 1.00 42.73  ? 140 LYS C CD  1 
ATOM   5007  C CE  . LYS C  1 140 ? -7.611  55.075  -22.092 1.00 43.85  ? 140 LYS C CE  1 
ATOM   5008  N NZ  . LYS C  1 140 ? -8.956  55.229  -21.547 1.00 44.45  ? 140 LYS C NZ  1 
ATOM   5009  N N   . ARG C  1 141 ? -8.686  51.272  -17.140 1.00 43.97  ? 141 ARG C N   1 
ATOM   5010  C CA  . ARG C  1 141 ? -9.344  50.043  -16.764 1.00 46.61  ? 141 ARG C CA  1 
ATOM   5011  C C   . ARG C  1 141 ? -10.048 49.668  -18.051 1.00 49.03  ? 141 ARG C C   1 
ATOM   5012  O O   . ARG C  1 141 ? -11.087 50.232  -18.434 1.00 49.59  ? 141 ARG C O   1 
ATOM   5013  C CB  . ARG C  1 141 ? -10.372 50.248  -15.644 1.00 46.08  ? 141 ARG C CB  1 
ATOM   5014  C CG  . ARG C  1 141 ? -9.804  50.311  -14.227 1.00 45.29  ? 141 ARG C CG  1 
ATOM   5015  C CD  . ARG C  1 141 ? -9.313  48.974  -13.714 1.00 44.04  ? 141 ARG C CD  1 
ATOM   5016  N NE  . ARG C  1 141 ? -8.235  49.261  -12.792 1.00 43.80  ? 141 ARG C NE  1 
ATOM   5017  C CZ  . ARG C  1 141 ? -7.882  48.424  -11.821 1.00 43.95  ? 141 ARG C CZ  1 
ATOM   5018  N NH1 . ARG C  1 141 ? -6.819  48.669  -11.050 1.00 43.37  ? 141 ARG C NH1 1 
ATOM   5019  N NH2 . ARG C  1 141 ? -8.638  47.374  -11.527 1.00 44.64  ? 141 ARG C NH2 1 
ATOM   5020  N N   . GLY C  1 142 ? -9.375  48.797  -18.794 1.00 51.30  ? 142 GLY C N   1 
ATOM   5021  C CA  . GLY C  1 142 ? -9.884  48.336  -20.072 1.00 53.43  ? 142 GLY C CA  1 
ATOM   5022  C C   . GLY C  1 142 ? -10.003 49.498  -21.062 1.00 54.89  ? 142 GLY C C   1 
ATOM   5023  O O   . GLY C  1 142 ? -9.021  50.202  -21.330 1.00 55.14  ? 142 GLY C O   1 
ATOM   5024  N N   . PRO C  1 143 ? -11.205 49.759  -21.593 1.00 55.63  ? 143 PRO C N   1 
ATOM   5025  C CA  . PRO C  1 143 ? -11.437 50.840  -22.555 1.00 55.04  ? 143 PRO C CA  1 
ATOM   5026  C C   . PRO C  1 143 ? -11.329 52.215  -21.903 1.00 54.23  ? 143 PRO C C   1 
ATOM   5027  O O   . PRO C  1 143 ? -10.759 53.178  -22.455 1.00 54.79  ? 143 PRO C O   1 
ATOM   5028  C CB  . PRO C  1 143 ? -12.811 50.509  -23.087 1.00 55.31  ? 143 PRO C CB  1 
ATOM   5029  C CG  . PRO C  1 143 ? -13.528 49.942  -21.862 1.00 55.60  ? 143 PRO C CG  1 
ATOM   5030  C CD  . PRO C  1 143 ? -12.448 49.050  -21.249 1.00 55.69  ? 143 PRO C CD  1 
ATOM   5031  N N   . GLY C  1 144 ? -11.823 52.288  -20.664 1.00 52.89  ? 144 GLY C N   1 
ATOM   5032  C CA  . GLY C  1 144 ? -11.984 53.550  -19.987 1.00 51.14  ? 144 GLY C CA  1 
ATOM   5033  C C   . GLY C  1 144 ? -10.779 54.019  -19.198 1.00 48.87  ? 144 GLY C C   1 
ATOM   5034  O O   . GLY C  1 144 ? -9.662  53.498  -19.274 1.00 48.64  ? 144 GLY C O   1 
ATOM   5035  N N   . SER C  1 145 ? -10.985 55.162  -18.588 1.00 46.29  ? 145 SER C N   1 
ATOM   5036  C CA  . SER C  1 145 ? -10.026 55.683  -17.668 1.00 44.71  ? 145 SER C CA  1 
ATOM   5037  C C   . SER C  1 145 ? -10.160 54.884  -16.393 1.00 42.99  ? 145 SER C C   1 
ATOM   5038  O O   . SER C  1 145 ? -11.186 54.213  -16.216 1.00 43.93  ? 145 SER C O   1 
ATOM   5039  C CB  . SER C  1 145 ? -10.358 57.123  -17.499 1.00 45.60  ? 145 SER C CB  1 
ATOM   5040  O OG  . SER C  1 145 ? -10.040 57.635  -18.795 1.00 47.44  ? 145 SER C OG  1 
ATOM   5041  N N   . GLY C  1 146 ? -9.147  54.869  -15.532 1.00 40.02  ? 146 GLY C N   1 
ATOM   5042  C CA  . GLY C  1 146 ? -9.259  54.144  -14.276 1.00 35.62  ? 146 GLY C CA  1 
ATOM   5043  C C   . GLY C  1 146 ? -8.167  54.562  -13.315 1.00 31.80  ? 146 GLY C C   1 
ATOM   5044  O O   . GLY C  1 146 ? -7.491  55.569  -13.522 1.00 32.24  ? 146 GLY C O   1 
ATOM   5045  N N   . PHE C  1 147 ? -7.972  53.796  -12.265 1.00 27.73  ? 147 PHE C N   1 
ATOM   5046  C CA  . PHE C  1 147 ? -7.012  54.126  -11.257 1.00 23.55  ? 147 PHE C CA  1 
ATOM   5047  C C   . PHE C  1 147 ? -6.575  52.823  -10.635 1.00 22.22  ? 147 PHE C C   1 
ATOM   5048  O O   . PHE C  1 147 ? -6.947  51.723  -11.069 1.00 22.87  ? 147 PHE C O   1 
ATOM   5049  C CB  . PHE C  1 147 ? -7.679  55.004  -10.233 1.00 22.07  ? 147 PHE C CB  1 
ATOM   5050  C CG  . PHE C  1 147 ? -6.771  56.007  -9.538  1.00 20.78  ? 147 PHE C CG  1 
ATOM   5051  C CD1 . PHE C  1 147 ? -6.158  56.997  -10.272 1.00 19.98  ? 147 PHE C CD1 1 
ATOM   5052  C CD2 . PHE C  1 147 ? -6.613  55.945  -8.169  1.00 19.97  ? 147 PHE C CD2 1 
ATOM   5053  C CE1 . PHE C  1 147 ? -5.387  57.926  -9.625  1.00 19.78  ? 147 PHE C CE1 1 
ATOM   5054  C CE2 . PHE C  1 147 ? -5.839  56.879  -7.537  1.00 19.72  ? 147 PHE C CE2 1 
ATOM   5055  C CZ  . PHE C  1 147 ? -5.229  57.873  -8.263  1.00 19.87  ? 147 PHE C CZ  1 
ATOM   5056  N N   . PHE C  1 148 ? -5.755  52.939  -9.616  1.00 20.50  ? 148 PHE C N   1 
ATOM   5057  C CA  . PHE C  1 148 ? -5.316  51.807  -8.842  1.00 19.15  ? 148 PHE C CA  1 
ATOM   5058  C C   . PHE C  1 148 ? -6.538  51.167  -8.203  1.00 18.31  ? 148 PHE C C   1 
ATOM   5059  O O   . PHE C  1 148 ? -7.353  51.927  -7.686  1.00 18.54  ? 148 PHE C O   1 
ATOM   5060  C CB  . PHE C  1 148 ? -4.360  52.311  -7.782  1.00 18.59  ? 148 PHE C CB  1 
ATOM   5061  C CG  . PHE C  1 148 ? -3.120  53.000  -8.335  1.00 17.75  ? 148 PHE C CG  1 
ATOM   5062  C CD1 . PHE C  1 148 ? -3.065  54.377  -8.401  1.00 17.19  ? 148 PHE C CD1 1 
ATOM   5063  C CD2 . PHE C  1 148 ? -2.053  52.243  -8.756  1.00 17.61  ? 148 PHE C CD2 1 
ATOM   5064  C CE1 . PHE C  1 148 ? -1.943  55.004  -8.890  1.00 16.61  ? 148 PHE C CE1 1 
ATOM   5065  C CE2 . PHE C  1 148 ? -0.934  52.879  -9.240  1.00 17.70  ? 148 PHE C CE2 1 
ATOM   5066  C CZ  . PHE C  1 148 ? -0.877  54.258  -9.308  1.00 17.09  ? 148 PHE C CZ  1 
ATOM   5067  N N   . SER C  1 149 ? -6.714  49.842  -8.207  1.00 17.07  ? 149 SER C N   1 
ATOM   5068  C CA  . SER C  1 149 ? -7.884  49.227  -7.617  1.00 16.24  ? 149 SER C CA  1 
ATOM   5069  C C   . SER C  1 149 ? -8.029  49.483  -6.132  1.00 16.70  ? 149 SER C C   1 
ATOM   5070  O O   . SER C  1 149 ? -9.148  49.556  -5.600  1.00 18.30  ? 149 SER C O   1 
ATOM   5071  C CB  . SER C  1 149 ? -7.850  47.734  -7.844  1.00 16.60  ? 149 SER C CB  1 
ATOM   5072  O OG  . SER C  1 149 ? -6.519  47.233  -7.819  1.00 17.53  ? 149 SER C OG  1 
ATOM   5073  N N   . ARG C  1 150 ? -6.935  49.643  -5.398  1.00 16.13  ? 150 ARG C N   1 
ATOM   5074  C CA  . ARG C  1 150 ? -7.105  49.813  -3.967  1.00 16.17  ? 150 ARG C CA  1 
ATOM   5075  C C   . ARG C  1 150 ? -7.146  51.259  -3.471  1.00 15.95  ? 150 ARG C C   1 
ATOM   5076  O O   . ARG C  1 150 ? -7.222  51.517  -2.255  1.00 16.74  ? 150 ARG C O   1 
ATOM   5077  C CB  . ARG C  1 150 ? -5.992  49.001  -3.297  1.00 16.40  ? 150 ARG C CB  1 
ATOM   5078  C CG  . ARG C  1 150 ? -6.502  47.621  -2.879  1.00 17.13  ? 150 ARG C CG  1 
ATOM   5079  C CD  . ARG C  1 150 ? -6.738  46.681  -4.038  1.00 17.86  ? 150 ARG C CD  1 
ATOM   5080  N NE  . ARG C  1 150 ? -7.919  45.849  -3.838  1.00 18.16  ? 150 ARG C NE  1 
ATOM   5081  C CZ  . ARG C  1 150 ? -7.834  44.512  -3.774  1.00 18.87  ? 150 ARG C CZ  1 
ATOM   5082  N NH1 . ARG C  1 150 ? -8.944  43.772  -3.670  1.00 18.97  ? 150 ARG C NH1 1 
ATOM   5083  N NH2 . ARG C  1 150 ? -6.648  43.894  -3.788  1.00 19.49  ? 150 ARG C NH2 1 
ATOM   5084  N N   . LEU C  1 151 ? -7.152  52.244  -4.365  1.00 15.03  ? 151 LEU C N   1 
ATOM   5085  C CA  . LEU C  1 151 ? -7.103  53.623  -3.917  1.00 14.83  ? 151 LEU C CA  1 
ATOM   5086  C C   . LEU C  1 151 ? -8.352  54.342  -4.379  1.00 16.04  ? 151 LEU C C   1 
ATOM   5087  O O   . LEU C  1 151 ? -9.016  53.914  -5.340  1.00 16.68  ? 151 LEU C O   1 
ATOM   5088  C CB  . LEU C  1 151 ? -5.819  54.286  -4.467  1.00 12.51  ? 151 LEU C CB  1 
ATOM   5089  C CG  . LEU C  1 151 ? -4.478  53.876  -3.836  1.00 10.11  ? 151 LEU C CG  1 
ATOM   5090  C CD1 . LEU C  1 151 ? -3.303  54.485  -4.598  1.00 8.81   ? 151 LEU C CD1 1 
ATOM   5091  C CD2 . LEU C  1 151 ? -4.483  54.313  -2.379  1.00 9.16   ? 151 LEU C CD2 1 
ATOM   5092  N N   . ASN C  1 152 ? -8.752  55.429  -3.719  1.00 16.91  ? 152 ASN C N   1 
ATOM   5093  C CA  . ASN C  1 152 ? -9.983  56.109  -4.096  1.00 16.75  ? 152 ASN C CA  1 
ATOM   5094  C C   . ASN C  1 152 ? -9.728  57.594  -4.270  1.00 16.19  ? 152 ASN C C   1 
ATOM   5095  O O   . ASN C  1 152 ? -9.533  58.274  -3.269  1.00 15.11  ? 152 ASN C O   1 
ATOM   5096  C CB  . ASN C  1 152 ? -10.982 55.840  -3.006  1.00 16.95  ? 152 ASN C CB  1 
ATOM   5097  C CG  . ASN C  1 152 ? -12.375 56.358  -3.273  1.00 17.99  ? 152 ASN C CG  1 
ATOM   5098  O OD1 . ASN C  1 152 ? -13.245 56.210  -2.415  1.00 18.55  ? 152 ASN C OD1 1 
ATOM   5099  N ND2 . ASN C  1 152 ? -12.773 56.922  -4.414  1.00 17.94  ? 152 ASN C ND2 1 
ATOM   5100  N N   . TRP C  1 153 ? -9.680  58.095  -5.516  1.00 16.14  ? 153 TRP C N   1 
ATOM   5101  C CA  . TRP C  1 153 ? -9.376  59.510  -5.774  1.00 15.93  ? 153 TRP C CA  1 
ATOM   5102  C C   . TRP C  1 153 ? -10.603 60.407  -5.614  1.00 17.60  ? 153 TRP C C   1 
ATOM   5103  O O   . TRP C  1 153 ? -11.597 60.326  -6.345  1.00 18.51  ? 153 TRP C O   1 
ATOM   5104  C CB  . TRP C  1 153 ? -8.808  59.633  -7.188  1.00 14.07  ? 153 TRP C CB  1 
ATOM   5105  C CG  . TRP C  1 153 ? -8.248  60.982  -7.650  1.00 11.51  ? 153 TRP C CG  1 
ATOM   5106  C CD1 . TRP C  1 153 ? -8.155  62.083  -6.846  1.00 9.84   ? 153 TRP C CD1 1 
ATOM   5107  C CD2 . TRP C  1 153 ? -7.729  61.198  -8.902  1.00 9.31   ? 153 TRP C CD2 1 
ATOM   5108  N NE1 . TRP C  1 153 ? -7.576  62.977  -7.587  1.00 9.35   ? 153 TRP C NE1 1 
ATOM   5109  C CE2 . TRP C  1 153 ? -7.308  62.503  -8.813  1.00 8.74   ? 153 TRP C CE2 1 
ATOM   5110  C CE3 . TRP C  1 153 ? -7.585  60.468  -10.052 1.00 7.67   ? 153 TRP C CE3 1 
ATOM   5111  C CZ2 . TRP C  1 153 ? -6.700  63.119  -9.879  1.00 8.04   ? 153 TRP C CZ2 1 
ATOM   5112  C CZ3 . TRP C  1 153 ? -6.977  61.081  -11.118 1.00 8.10   ? 153 TRP C CZ3 1 
ATOM   5113  C CH2 . TRP C  1 153 ? -6.547  62.392  -11.037 1.00 7.93   ? 153 TRP C CH2 1 
ATOM   5114  N N   . LEU C  1 154 ? -10.518 61.302  -4.655  1.00 19.03  ? 154 LEU C N   1 
ATOM   5115  C CA  . LEU C  1 154 ? -11.614 62.153  -4.298  1.00 20.04  ? 154 LEU C CA  1 
ATOM   5116  C C   . LEU C  1 154 ? -11.377 63.538  -4.850  1.00 23.19  ? 154 LEU C C   1 
ATOM   5117  O O   . LEU C  1 154 ? -10.278 64.103  -4.721  1.00 23.93  ? 154 LEU C O   1 
ATOM   5118  C CB  . LEU C  1 154 ? -11.723 62.214  -2.802  1.00 18.25  ? 154 LEU C CB  1 
ATOM   5119  C CG  . LEU C  1 154 ? -12.550 61.213  -2.021  1.00 17.48  ? 154 LEU C CG  1 
ATOM   5120  C CD1 . LEU C  1 154 ? -12.393 59.808  -2.503  1.00 17.15  ? 154 LEU C CD1 1 
ATOM   5121  C CD2 . LEU C  1 154 ? -12.076 61.302  -0.600  1.00 16.75  ? 154 LEU C CD2 1 
ATOM   5122  N N   . THR C  1 155 ? -12.434 64.078  -5.458  1.00 25.79  ? 155 THR C N   1 
ATOM   5123  C CA  . THR C  1 155 ? -12.455 65.419  -6.017  1.00 27.72  ? 155 THR C CA  1 
ATOM   5124  C C   . THR C  1 155 ? -13.691 66.169  -5.515  1.00 30.05  ? 155 THR C C   1 
ATOM   5125  O O   . THR C  1 155 ? -14.543 65.531  -4.896  1.00 30.43  ? 155 THR C O   1 
ATOM   5126  C CB  . THR C  1 155 ? -12.411 65.258  -7.516  1.00 27.40  ? 155 THR C CB  1 
ATOM   5127  O OG1 . THR C  1 155 ? -13.205 64.127  -7.896  1.00 27.58  ? 155 THR C OG1 1 
ATOM   5128  C CG2 . THR C  1 155 ? -10.951 65.170  -7.940  1.00 27.22  ? 155 THR C CG2 1 
ATOM   5129  N N   . LYS C  1 156 ? -13.855 67.496  -5.575  1.00 32.65  ? 156 LYS C N   1 
ATOM   5130  C CA  . LYS C  1 156 ? -15.030 68.143  -4.916  1.00 35.31  ? 156 LYS C CA  1 
ATOM   5131  C C   . LYS C  1 156 ? -16.469 67.894  -5.447  1.00 36.74  ? 156 LYS C C   1 
ATOM   5132  O O   . LYS C  1 156 ? -16.666 67.360  -6.551  1.00 36.45  ? 156 LYS C O   1 
ATOM   5133  C CB  . LYS C  1 156 ? -14.807 69.677  -4.869  1.00 35.76  ? 156 LYS C CB  1 
ATOM   5134  C CG  . LYS C  1 156 ? -15.312 70.582  -5.995  1.00 36.38  ? 156 LYS C CG  1 
ATOM   5135  C CD  . LYS C  1 156 ? -14.585 70.236  -7.292  1.00 37.27  ? 156 LYS C CD  1 
ATOM   5136  C CE  . LYS C  1 156 ? -15.228 70.884  -8.495  1.00 37.63  ? 156 LYS C CE  1 
ATOM   5137  N NZ  . LYS C  1 156 ? -14.777 72.248  -8.628  1.00 37.76  ? 156 LYS C NZ  1 
ATOM   5138  N N   . SER C  1 157 ? -17.500 68.270  -4.665  1.00 38.45  ? 157 SER C N   1 
ATOM   5139  C CA  . SER C  1 157 ? -18.896 68.271  -5.108  1.00 40.22  ? 157 SER C CA  1 
ATOM   5140  C C   . SER C  1 157 ? -19.271 69.714  -5.389  1.00 41.18  ? 157 SER C C   1 
ATOM   5141  O O   . SER C  1 157 ? -18.954 70.592  -4.584  1.00 41.94  ? 157 SER C O   1 
ATOM   5142  C CB  . SER C  1 157 ? -19.858 67.795  -4.046  1.00 40.60  ? 157 SER C CB  1 
ATOM   5143  O OG  . SER C  1 157 ? -19.593 66.445  -3.756  1.00 42.07  ? 157 SER C OG  1 
ATOM   5144  N N   . GLY C  1 158 ? -19.913 70.031  -6.506  1.00 41.81  ? 158 GLY C N   1 
ATOM   5145  C CA  . GLY C  1 158 ? -20.289 71.413  -6.786  1.00 42.99  ? 158 GLY C CA  1 
ATOM   5146  C C   . GLY C  1 158 ? -19.109 72.377  -6.680  1.00 43.96  ? 158 GLY C C   1 
ATOM   5147  O O   . GLY C  1 158 ? -18.154 72.340  -7.479  1.00 44.17  ? 158 GLY C O   1 
ATOM   5148  N N   . SER C  1 159 ? -19.113 73.152  -5.601  1.00 44.81  ? 159 SER C N   1 
ATOM   5149  C CA  . SER C  1 159 ? -18.052 74.121  -5.373  1.00 45.64  ? 159 SER C CA  1 
ATOM   5150  C C   . SER C  1 159 ? -17.501 73.938  -3.965  1.00 45.22  ? 159 SER C C   1 
ATOM   5151  O O   . SER C  1 159 ? -17.092 74.887  -3.280  1.00 45.02  ? 159 SER C O   1 
ATOM   5152  C CB  . SER C  1 159 ? -18.625 75.545  -5.581  1.00 46.02  ? 159 SER C CB  1 
ATOM   5153  O OG  . SER C  1 159 ? -19.071 75.807  -6.922  1.00 45.99  ? 159 SER C OG  1 
ATOM   5154  N N   . THR C  1 160 ? -17.430 72.681  -3.536  1.00 44.74  ? 160 THR C N   1 
ATOM   5155  C CA  . THR C  1 160 ? -17.032 72.436  -2.172  1.00 44.20  ? 160 THR C CA  1 
ATOM   5156  C C   . THR C  1 160 ? -16.264 71.140  -1.991  1.00 43.49  ? 160 THR C C   1 
ATOM   5157  O O   . THR C  1 160 ? -16.650 70.063  -2.461  1.00 43.65  ? 160 THR C O   1 
ATOM   5158  C CB  . THR C  1 160 ? -18.269 72.412  -1.259  1.00 44.09  ? 160 THR C CB  1 
ATOM   5159  O OG1 . THR C  1 160 ? -19.446 72.807  -1.985  1.00 44.02  ? 160 THR C OG1 1 
ATOM   5160  C CG2 . THR C  1 160 ? -17.987 73.317  -0.062  1.00 44.06  ? 160 THR C CG2 1 
ATOM   5161  N N   . TYR C  1 161 ? -15.081 71.257  -1.400  1.00 42.24  ? 161 TYR C N   1 
ATOM   5162  C CA  . TYR C  1 161 ? -14.350 70.088  -0.990  1.00 40.46  ? 161 TYR C CA  1 
ATOM   5163  C C   . TYR C  1 161 ? -14.365 70.339  0.485   1.00 38.99  ? 161 TYR C C   1 
ATOM   5164  O O   . TYR C  1 161 ? -13.660 71.207  1.011   1.00 39.22  ? 161 TYR C O   1 
ATOM   5165  C CB  . TYR C  1 161 ? -12.920 70.074  -1.460  1.00 40.82  ? 161 TYR C CB  1 
ATOM   5166  C CG  . TYR C  1 161 ? -12.309 68.737  -1.159  1.00 41.02  ? 161 TYR C CG  1 
ATOM   5167  C CD1 . TYR C  1 161 ? -11.936 68.384  0.126   1.00 41.16  ? 161 TYR C CD1 1 
ATOM   5168  C CD2 . TYR C  1 161 ? -12.039 67.896  -2.203  1.00 41.66  ? 161 TYR C CD2 1 
ATOM   5169  C CE1 . TYR C  1 161 ? -11.316 67.208  0.387   1.00 41.42  ? 161 TYR C CE1 1 
ATOM   5170  C CE2 . TYR C  1 161 ? -11.410 66.714  -1.951  1.00 42.52  ? 161 TYR C CE2 1 
ATOM   5171  C CZ  . TYR C  1 161 ? -11.041 66.382  -0.666  1.00 42.24  ? 161 TYR C CZ  1 
ATOM   5172  O OH  . TYR C  1 161 ? -10.309 65.256  -0.464  1.00 43.00  ? 161 TYR C OH  1 
ATOM   5173  N N   . PRO C  1 162 ? -15.242 69.668  1.190   1.00 37.41  ? 162 PRO C N   1 
ATOM   5174  C CA  . PRO C  1 162 ? -15.347 69.861  2.615   1.00 36.32  ? 162 PRO C CA  1 
ATOM   5175  C C   . PRO C  1 162 ? -14.131 69.358  3.352   1.00 35.31  ? 162 PRO C C   1 
ATOM   5176  O O   . PRO C  1 162 ? -13.310 68.633  2.780   1.00 36.16  ? 162 PRO C O   1 
ATOM   5177  C CB  . PRO C  1 162 ? -16.608 69.136  2.970   1.00 36.77  ? 162 PRO C CB  1 
ATOM   5178  C CG  . PRO C  1 162 ? -16.620 67.994  1.986   1.00 37.02  ? 162 PRO C CG  1 
ATOM   5179  C CD  . PRO C  1 162 ? -16.222 68.706  0.709   1.00 37.50  ? 162 PRO C CD  1 
ATOM   5180  N N   . VAL C  1 163 ? -13.990 69.715  4.621   1.00 33.19  ? 163 VAL C N   1 
ATOM   5181  C CA  . VAL C  1 163 ? -12.933 69.101  5.386   1.00 31.95  ? 163 VAL C CA  1 
ATOM   5182  C C   . VAL C  1 163 ? -13.372 67.693  5.719   1.00 30.67  ? 163 VAL C C   1 
ATOM   5183  O O   . VAL C  1 163 ? -14.289 67.515  6.513   1.00 30.71  ? 163 VAL C O   1 
ATOM   5184  C CB  . VAL C  1 163 ? -12.677 69.883  6.662   1.00 32.80  ? 163 VAL C CB  1 
ATOM   5185  C CG1 . VAL C  1 163 ? -11.714 69.156  7.602   1.00 33.42  ? 163 VAL C CG1 1 
ATOM   5186  C CG2 . VAL C  1 163 ? -12.032 71.202  6.258   1.00 33.40  ? 163 VAL C CG2 1 
ATOM   5187  N N   . LEU C  1 164 ? -12.821 66.707  5.026   1.00 29.69  ? 164 LEU C N   1 
ATOM   5188  C CA  . LEU C  1 164 ? -13.080 65.313  5.313   1.00 28.52  ? 164 LEU C CA  1 
ATOM   5189  C C   . LEU C  1 164 ? -12.507 64.996  6.689   1.00 28.32  ? 164 LEU C C   1 
ATOM   5190  O O   . LEU C  1 164 ? -11.412 65.430  7.069   1.00 26.78  ? 164 LEU C O   1 
ATOM   5191  C CB  . LEU C  1 164 ? -12.424 64.458  4.228   1.00 28.04  ? 164 LEU C CB  1 
ATOM   5192  C CG  . LEU C  1 164 ? -13.169 64.013  2.960   1.00 28.02  ? 164 LEU C CG  1 
ATOM   5193  C CD1 . LEU C  1 164 ? -14.353 64.894  2.658   1.00 28.46  ? 164 LEU C CD1 1 
ATOM   5194  C CD2 . LEU C  1 164 ? -12.212 64.071  1.797   1.00 28.00  ? 164 LEU C CD2 1 
ATOM   5195  N N   . ASN C  1 165 ? -13.262 64.252  7.474   1.00 28.69  ? 165 ASN C N   1 
ATOM   5196  C CA  . ASN C  1 165 ? -12.820 63.873  8.795   1.00 29.35  ? 165 ASN C CA  1 
ATOM   5197  C C   . ASN C  1 165 ? -13.463 62.538  9.084   1.00 29.03  ? 165 ASN C C   1 
ATOM   5198  O O   . ASN C  1 165 ? -14.567 62.500  9.617   1.00 30.04  ? 165 ASN C O   1 
ATOM   5199  C CB  . ASN C  1 165 ? -13.287 64.915  9.774   1.00 31.71  ? 165 ASN C CB  1 
ATOM   5200  C CG  . ASN C  1 165 ? -12.793 64.690  11.184  1.00 33.97  ? 165 ASN C CG  1 
ATOM   5201  O OD1 . ASN C  1 165 ? -11.609 64.900  11.439  1.00 34.51  ? 165 ASN C OD1 1 
ATOM   5202  N ND2 . ASN C  1 165 ? -13.652 64.331  12.141  1.00 36.17  ? 165 ASN C ND2 1 
ATOM   5203  N N   . VAL C  1 166 ? -12.867 61.419  8.683   1.00 28.10  ? 166 VAL C N   1 
ATOM   5204  C CA  . VAL C  1 166 ? -13.494 60.116  8.876   1.00 27.29  ? 166 VAL C CA  1 
ATOM   5205  C C   . VAL C  1 166 ? -12.709 59.309  9.881   1.00 27.21  ? 166 VAL C C   1 
ATOM   5206  O O   . VAL C  1 166 ? -11.557 59.649  10.154  1.00 27.66  ? 166 VAL C O   1 
ATOM   5207  C CB  . VAL C  1 166 ? -13.555 59.351  7.554   1.00 27.42  ? 166 VAL C CB  1 
ATOM   5208  C CG1 . VAL C  1 166 ? -14.344 60.164  6.540   1.00 28.49  ? 166 VAL C CG1 1 
ATOM   5209  C CG2 . VAL C  1 166 ? -12.166 59.116  7.012   1.00 27.68  ? 166 VAL C CG2 1 
ATOM   5210  N N   . THR C  1 167 ? -13.247 58.208  10.375  1.00 27.11  ? 167 THR C N   1 
ATOM   5211  C CA  . THR C  1 167 ? -12.561 57.401  11.354  1.00 27.04  ? 167 THR C CA  1 
ATOM   5212  C C   . THR C  1 167 ? -12.866 55.940  11.077  1.00 28.13  ? 167 THR C C   1 
ATOM   5213  O O   . THR C  1 167 ? -13.902 55.593  10.520  1.00 29.60  ? 167 THR C O   1 
ATOM   5214  C CB  . THR C  1 167 ? -13.050 57.848  12.722  1.00 27.17  ? 167 THR C CB  1 
ATOM   5215  O OG1 . THR C  1 167 ? -12.149 57.331  13.694  1.00 27.17  ? 167 THR C OG1 1 
ATOM   5216  C CG2 . THR C  1 167 ? -14.487 57.399  12.990  1.00 28.47  ? 167 THR C CG2 1 
ATOM   5217  N N   . MET C  1 168 ? -12.002 55.037  11.459  1.00 29.32  ? 168 MET C N   1 
ATOM   5218  C CA  . MET C  1 168 ? -12.211 53.631  11.187  1.00 30.29  ? 168 MET C CA  1 
ATOM   5219  C C   . MET C  1 168 ? -11.434 52.888  12.267  1.00 31.52  ? 168 MET C C   1 
ATOM   5220  O O   . MET C  1 168 ? -10.193 52.840  12.275  1.00 31.40  ? 168 MET C O   1 
ATOM   5221  C CB  . MET C  1 168 ? -11.675 53.365  9.801   1.00 30.81  ? 168 MET C CB  1 
ATOM   5222  C CG  . MET C  1 168 ? -11.925 51.986  9.312   1.00 32.04  ? 168 MET C CG  1 
ATOM   5223  S SD  . MET C  1 168 ? -13.697 51.760  9.195   1.00 33.57  ? 168 MET C SD  1 
ATOM   5224  C CE  . MET C  1 168 ? -14.052 52.636  7.694   1.00 34.31  ? 168 MET C CE  1 
ATOM   5225  N N   . PRO C  1 169 ? -12.113 52.391  13.291  1.00 32.56  ? 169 PRO C N   1 
ATOM   5226  C CA  . PRO C  1 169 ? -11.506 51.668  14.397  1.00 33.32  ? 169 PRO C CA  1 
ATOM   5227  C C   . PRO C  1 169 ? -10.919 50.340  14.010  1.00 34.67  ? 169 PRO C C   1 
ATOM   5228  O O   . PRO C  1 169 ? -11.233 49.700  12.992  1.00 35.19  ? 169 PRO C O   1 
ATOM   5229  C CB  . PRO C  1 169 ? -12.600 51.526  15.412  1.00 32.75  ? 169 PRO C CB  1 
ATOM   5230  C CG  . PRO C  1 169 ? -13.803 51.413  14.508  1.00 33.51  ? 169 PRO C CG  1 
ATOM   5231  C CD  . PRO C  1 169 ? -13.540 52.534  13.506  1.00 32.90  ? 169 PRO C CD  1 
ATOM   5232  N N   . ASN C  1 170 ? -10.004 49.916  14.841  1.00 36.22  ? 170 ASN C N   1 
ATOM   5233  C CA  . ASN C  1 170 ? -9.441  48.619  14.650  1.00 37.54  ? 170 ASN C CA  1 
ATOM   5234  C C   . ASN C  1 170 ? -9.999  47.851  15.797  1.00 39.22  ? 170 ASN C C   1 
ATOM   5235  O O   . ASN C  1 170 ? -9.404  47.777  16.864  1.00 39.01  ? 170 ASN C O   1 
ATOM   5236  C CB  . ASN C  1 170 ? -7.936  48.561  14.765  1.00 36.88  ? 170 ASN C CB  1 
ATOM   5237  C CG  . ASN C  1 170 ? -7.492  47.236  14.184  1.00 36.67  ? 170 ASN C CG  1 
ATOM   5238  O OD1 . ASN C  1 170 ? -8.332  46.430  13.780  1.00 36.89  ? 170 ASN C OD1 1 
ATOM   5239  N ND2 . ASN C  1 170 ? -6.214  46.980  14.004  1.00 36.34  ? 170 ASN C ND2 1 
ATOM   5240  N N   . ASN C  1 171 ? -11.219 47.380  15.630  1.00 42.26  ? 171 ASN C N   1 
ATOM   5241  C CA  . ASN C  1 171 ? -11.808 46.575  16.685  1.00 44.37  ? 171 ASN C CA  1 
ATOM   5242  C C   . ASN C  1 171 ? -11.422 45.122  16.530  1.00 44.94  ? 171 ASN C C   1 
ATOM   5243  O O   . ASN C  1 171 ? -11.815 44.277  17.323  1.00 45.64  ? 171 ASN C O   1 
ATOM   5244  C CB  . ASN C  1 171 ? -13.330 46.707  16.676  1.00 45.20  ? 171 ASN C CB  1 
ATOM   5245  C CG  . ASN C  1 171 ? -13.770 47.967  17.415  1.00 46.12  ? 171 ASN C CG  1 
ATOM   5246  O OD1 . ASN C  1 171 ? -14.657 48.685  16.951  1.00 46.76  ? 171 ASN C OD1 1 
ATOM   5247  N ND2 . ASN C  1 171 ? -13.171 48.330  18.549  1.00 46.24  ? 171 ASN C ND2 1 
ATOM   5248  N N   . ASP C  1 172 ? -10.600 44.867  15.524  1.00 45.26  ? 172 ASP C N   1 
ATOM   5249  C CA  . ASP C  1 172 ? -10.203 43.549  15.163  1.00 45.45  ? 172 ASP C CA  1 
ATOM   5250  C C   . ASP C  1 172 ? -9.102  42.978  16.008  1.00 45.67  ? 172 ASP C C   1 
ATOM   5251  O O   . ASP C  1 172 ? -8.514  43.615  16.893  1.00 46.24  ? 172 ASP C O   1 
ATOM   5252  C CB  . ASP C  1 172 ? -9.763  43.568  13.734  1.00 45.86  ? 172 ASP C CB  1 
ATOM   5253  C CG  . ASP C  1 172 ? -10.708 42.729  12.937  1.00 46.66  ? 172 ASP C CG  1 
ATOM   5254  O OD1 . ASP C  1 172 ? -10.831 41.546  13.292  1.00 46.83  ? 172 ASP C OD1 1 
ATOM   5255  O OD2 . ASP C  1 172 ? -11.294 43.269  11.984  1.00 47.30  ? 172 ASP C OD2 1 
ATOM   5256  N N   . ASN C  1 173 ? -8.754  41.763  15.644  1.00 45.57  ? 173 ASN C N   1 
ATOM   5257  C CA  . ASN C  1 173 ? -7.735  41.053  16.363  1.00 45.09  ? 173 ASN C CA  1 
ATOM   5258  C C   . ASN C  1 173 ? -6.328  41.311  15.847  1.00 43.33  ? 173 ASN C C   1 
ATOM   5259  O O   . ASN C  1 173 ? -5.331  40.912  16.443  1.00 43.19  ? 173 ASN C O   1 
ATOM   5260  C CB  . ASN C  1 173 ? -8.056  39.585  16.261  1.00 47.71  ? 173 ASN C CB  1 
ATOM   5261  C CG  . ASN C  1 173 ? -7.170  38.826  17.224  1.00 50.11  ? 173 ASN C CG  1 
ATOM   5262  O OD1 . ASN C  1 173 ? -7.045  39.208  18.395  1.00 51.61  ? 173 ASN C OD1 1 
ATOM   5263  N ND2 . ASN C  1 173 ? -6.534  37.747  16.780  1.00 50.68  ? 173 ASN C ND2 1 
ATOM   5264  N N   . PHE C  1 174 ? -6.166  41.986  14.716  1.00 41.11  ? 174 PHE C N   1 
ATOM   5265  C CA  . PHE C  1 174 ? -4.852  42.058  14.081  1.00 38.38  ? 174 PHE C CA  1 
ATOM   5266  C C   . PHE C  1 174 ? -4.486  43.458  13.641  1.00 36.99  ? 174 PHE C C   1 
ATOM   5267  O O   . PHE C  1 174 ? -5.356  44.331  13.623  1.00 37.24  ? 174 PHE C O   1 
ATOM   5268  C CB  . PHE C  1 174 ? -4.848  41.124  12.877  1.00 37.51  ? 174 PHE C CB  1 
ATOM   5269  C CG  . PHE C  1 174 ? -6.109  41.269  12.045  1.00 37.14  ? 174 PHE C CG  1 
ATOM   5270  C CD1 . PHE C  1 174 ? -6.228  42.289  11.125  1.00 37.46  ? 174 PHE C CD1 1 
ATOM   5271  C CD2 . PHE C  1 174 ? -7.144  40.384  12.243  1.00 36.88  ? 174 PHE C CD2 1 
ATOM   5272  C CE1 . PHE C  1 174 ? -7.391  42.428  10.400  1.00 37.51  ? 174 PHE C CE1 1 
ATOM   5273  C CE2 . PHE C  1 174 ? -8.298  40.530  11.516  1.00 36.93  ? 174 PHE C CE2 1 
ATOM   5274  C CZ  . PHE C  1 174 ? -8.428  41.548  10.595  1.00 37.22  ? 174 PHE C CZ  1 
ATOM   5275  N N   . ASP C  1 175 ? -3.228  43.659  13.274  1.00 35.01  ? 175 ASP C N   1 
ATOM   5276  C CA  . ASP C  1 175 ? -2.805  44.921  12.708  1.00 33.39  ? 175 ASP C CA  1 
ATOM   5277  C C   . ASP C  1 175 ? -3.321  45.042  11.275  1.00 30.62  ? 175 ASP C C   1 
ATOM   5278  O O   . ASP C  1 175 ? -3.434  44.051  10.526  1.00 30.14  ? 175 ASP C O   1 
ATOM   5279  C CB  . ASP C  1 175 ? -1.271  45.018  12.721  1.00 35.12  ? 175 ASP C CB  1 
ATOM   5280  C CG  . ASP C  1 175 ? -0.613  45.202  14.093  1.00 36.06  ? 175 ASP C CG  1 
ATOM   5281  O OD1 . ASP C  1 175 ? -1.299  45.507  15.064  1.00 36.48  ? 175 ASP C OD1 1 
ATOM   5282  O OD2 . ASP C  1 175 ? 0.607   45.069  14.214  1.00 36.48  ? 175 ASP C OD2 1 
ATOM   5283  N N   . LYS C  1 176 ? -3.682  46.260  10.908  1.00 26.90  ? 176 LYS C N   1 
ATOM   5284  C CA  . LYS C  1 176 ? -4.220  46.546  9.605   1.00 23.86  ? 176 LYS C CA  1 
ATOM   5285  C C   . LYS C  1 176 ? -3.259  47.517  8.941   1.00 22.29  ? 176 LYS C C   1 
ATOM   5286  O O   . LYS C  1 176 ? -2.837  48.477  9.599   1.00 21.86  ? 176 LYS C O   1 
ATOM   5287  C CB  . LYS C  1 176 ? -5.570  47.212  9.737   1.00 24.81  ? 176 LYS C CB  1 
ATOM   5288  C CG  . LYS C  1 176 ? -6.730  46.438  10.359  1.00 24.54  ? 176 LYS C CG  1 
ATOM   5289  C CD  . LYS C  1 176 ? -7.850  47.468  10.350  1.00 24.77  ? 176 LYS C CD  1 
ATOM   5290  C CE  . LYS C  1 176 ? -9.238  46.973  10.660  1.00 24.90  ? 176 LYS C CE  1 
ATOM   5291  N NZ  . LYS C  1 176 ? -10.162 48.067  10.423  1.00 26.57  ? 176 LYS C NZ  1 
ATOM   5292  N N   . LEU C  1 177 ? -2.895  47.316  7.673   1.00 19.40  ? 177 LEU C N   1 
ATOM   5293  C CA  . LEU C  1 177 ? -1.987  48.212  6.975   1.00 16.68  ? 177 LEU C CA  1 
ATOM   5294  C C   . LEU C  1 177 ? -2.821  49.039  6.009   1.00 15.44  ? 177 LEU C C   1 
ATOM   5295  O O   . LEU C  1 177 ? -3.440  48.428  5.137   1.00 16.33  ? 177 LEU C O   1 
ATOM   5296  C CB  . LEU C  1 177 ? -0.936  47.306  6.279   1.00 15.58  ? 177 LEU C CB  1 
ATOM   5297  C CG  . LEU C  1 177 ? 0.258   47.653  5.346   1.00 14.91  ? 177 LEU C CG  1 
ATOM   5298  C CD1 . LEU C  1 177 ? -0.182  47.563  3.933   1.00 13.74  ? 177 LEU C CD1 1 
ATOM   5299  C CD2 . LEU C  1 177 ? 0.793   49.048  5.612   1.00 16.11  ? 177 LEU C CD2 1 
ATOM   5300  N N   . TYR C  1 178 ? -2.946  50.360  6.156   1.00 13.11  ? 178 TYR C N   1 
ATOM   5301  C CA  . TYR C  1 178 ? -3.683  51.155  5.176   1.00 13.10  ? 178 TYR C CA  1 
ATOM   5302  C C   . TYR C  1 178 ? -2.718  51.871  4.241   1.00 13.26  ? 178 TYR C C   1 
ATOM   5303  O O   . TYR C  1 178 ? -1.760  52.477  4.750   1.00 14.44  ? 178 TYR C O   1 
ATOM   5304  C CB  . TYR C  1 178 ? -4.552  52.257  5.800   1.00 12.23  ? 178 TYR C CB  1 
ATOM   5305  C CG  . TYR C  1 178 ? -5.723  51.766  6.621   1.00 12.42  ? 178 TYR C CG  1 
ATOM   5306  C CD1 . TYR C  1 178 ? -6.986  51.586  6.075   1.00 12.09  ? 178 TYR C CD1 1 
ATOM   5307  C CD2 . TYR C  1 178 ? -5.493  51.462  7.948   1.00 13.13  ? 178 TYR C CD2 1 
ATOM   5308  C CE1 . TYR C  1 178 ? -8.031  51.123  6.875   1.00 12.62  ? 178 TYR C CE1 1 
ATOM   5309  C CE2 . TYR C  1 178 ? -6.529  51.002  8.745   1.00 13.27  ? 178 TYR C CE2 1 
ATOM   5310  C CZ  . TYR C  1 178 ? -7.798  50.816  8.219   1.00 13.31  ? 178 TYR C CZ  1 
ATOM   5311  O OH  . TYR C  1 178 ? -8.782  50.381  9.115   1.00 13.48  ? 178 TYR C OH  1 
ATOM   5312  N N   . ILE C  1 179 ? -2.913  51.795  2.907   1.00 11.90  ? 179 ILE C N   1 
ATOM   5313  C CA  . ILE C  1 179 ? -2.104  52.533  1.931   1.00 10.27  ? 179 ILE C CA  1 
ATOM   5314  C C   . ILE C  1 179 ? -2.947  53.714  1.463   1.00 10.79  ? 179 ILE C C   1 
ATOM   5315  O O   . ILE C  1 179 ? -4.086  53.541  1.031   1.00 11.33  ? 179 ILE C O   1 
ATOM   5316  C CB  . ILE C  1 179 ? -1.760  51.682  0.696   1.00 8.84   ? 179 ILE C CB  1 
ATOM   5317  C CG1 . ILE C  1 179 ? -0.982  50.453  1.095   1.00 8.53   ? 179 ILE C CG1 1 
ATOM   5318  C CG2 . ILE C  1 179 ? -0.930  52.501  -0.278  1.00 7.72   ? 179 ILE C CG2 1 
ATOM   5319  C CD1 . ILE C  1 179 ? 0.380   50.770  1.743   1.00 8.71   ? 179 ILE C CD1 1 
ATOM   5320  N N   . TRP C  1 180 ? -2.420  54.917  1.554   1.00 10.78  ? 180 TRP C N   1 
ATOM   5321  C CA  . TRP C  1 180 ? -3.131  56.089  1.103   1.00 11.07  ? 180 TRP C CA  1 
ATOM   5322  C C   . TRP C  1 180 ? -2.173  57.010  0.354   1.00 12.53  ? 180 TRP C C   1 
ATOM   5323  O O   . TRP C  1 180 ? -1.018  56.629  0.103   1.00 14.57  ? 180 TRP C O   1 
ATOM   5324  C CB  . TRP C  1 180 ? -3.723  56.783  2.295   1.00 9.95   ? 180 TRP C CB  1 
ATOM   5325  C CG  . TRP C  1 180 ? -2.764  57.097  3.420   1.00 9.02   ? 180 TRP C CG  1 
ATOM   5326  C CD1 . TRP C  1 180 ? -2.564  56.198  4.429   1.00 8.99   ? 180 TRP C CD1 1 
ATOM   5327  C CD2 . TRP C  1 180 ? -2.074  58.258  3.590   1.00 8.80   ? 180 TRP C CD2 1 
ATOM   5328  N NE1 . TRP C  1 180 ? -1.759  56.806  5.258   1.00 8.87   ? 180 TRP C NE1 1 
ATOM   5329  C CE2 . TRP C  1 180 ? -1.455  58.023  4.804   1.00 8.55   ? 180 TRP C CE2 1 
ATOM   5330  C CE3 . TRP C  1 180 ? -1.899  59.452  2.941   1.00 9.21   ? 180 TRP C CE3 1 
ATOM   5331  C CZ2 . TRP C  1 180 ? -0.625  58.947  5.384   1.00 8.09   ? 180 TRP C CZ2 1 
ATOM   5332  C CZ3 . TRP C  1 180 ? -1.061  60.388  3.526   1.00 10.07  ? 180 TRP C CZ3 1 
ATOM   5333  C CH2 . TRP C  1 180 ? -0.441  60.146  4.737   1.00 8.74   ? 180 TRP C CH2 1 
ATOM   5334  N N   . GLY C  1 181 ? -2.567  58.218  -0.035  1.00 12.23  ? 181 GLY C N   1 
ATOM   5335  C CA  . GLY C  1 181 ? -1.649  59.053  -0.765  1.00 12.17  ? 181 GLY C CA  1 
ATOM   5336  C C   . GLY C  1 181 ? -2.192  60.438  -0.891  1.00 12.47  ? 181 GLY C C   1 
ATOM   5337  O O   . GLY C  1 181 ? -3.291  60.710  -0.404  1.00 13.27  ? 181 GLY C O   1 
ATOM   5338  N N   . ILE C  1 182 ? -1.442  61.296  -1.557  1.00 12.22  ? 182 ILE C N   1 
ATOM   5339  C CA  . ILE C  1 182 ? -1.823  62.668  -1.743  1.00 12.57  ? 182 ILE C CA  1 
ATOM   5340  C C   . ILE C  1 182 ? -1.526  62.968  -3.196  1.00 14.82  ? 182 ILE C C   1 
ATOM   5341  O O   . ILE C  1 182 ? -0.579  62.378  -3.729  1.00 16.19  ? 182 ILE C O   1 
ATOM   5342  C CB  . ILE C  1 182 ? -1.000  63.515  -0.772  1.00 11.90  ? 182 ILE C CB  1 
ATOM   5343  C CG1 . ILE C  1 182 ? -1.530  64.911  -0.865  1.00 12.53  ? 182 ILE C CG1 1 
ATOM   5344  C CG2 . ILE C  1 182 ? 0.490   63.503  -1.081  1.00 10.92  ? 182 ILE C CG2 1 
ATOM   5345  C CD1 . ILE C  1 182 ? -1.086  65.775  0.320   1.00 13.27  ? 182 ILE C CD1 1 
ATOM   5346  N N   . HIS C  1 183 ? -2.321  63.795  -3.876  1.00 16.44  ? 183 HIS C N   1 
ATOM   5347  C CA  . HIS C  1 183 ? -2.085  64.130  -5.278  1.00 17.93  ? 183 HIS C CA  1 
ATOM   5348  C C   . HIS C  1 183 ? -1.359  65.462  -5.325  1.00 18.77  ? 183 HIS C C   1 
ATOM   5349  O O   . HIS C  1 183 ? -1.750  66.380  -4.594  1.00 19.57  ? 183 HIS C O   1 
ATOM   5350  C CB  . HIS C  1 183 ? -3.413  64.255  -6.037  1.00 18.49  ? 183 HIS C CB  1 
ATOM   5351  C CG  . HIS C  1 183 ? -3.356  64.809  -7.465  1.00 19.41  ? 183 HIS C CG  1 
ATOM   5352  N ND1 . HIS C  1 183 ? -3.741  66.049  -7.727  1.00 19.66  ? 183 HIS C ND1 1 
ATOM   5353  C CD2 . HIS C  1 183 ? -3.143  64.088  -8.597  1.00 20.25  ? 183 HIS C CD2 1 
ATOM   5354  C CE1 . HIS C  1 183 ? -3.792  66.121  -9.040  1.00 20.56  ? 183 HIS C CE1 1 
ATOM   5355  N NE2 . HIS C  1 183 ? -3.436  64.953  -9.538  1.00 21.46  ? 183 HIS C NE2 1 
ATOM   5356  N N   . HIS C  1 184 ? -0.307  65.587  -6.131  1.00 18.83  ? 184 HIS C N   1 
ATOM   5357  C CA  . HIS C  1 184 ? 0.384   66.852  -6.296  1.00 17.83  ? 184 HIS C CA  1 
ATOM   5358  C C   . HIS C  1 184 ? -0.032  67.329  -7.651  1.00 18.84  ? 184 HIS C C   1 
ATOM   5359  O O   . HIS C  1 184 ? 0.288   66.645  -8.627  1.00 19.80  ? 184 HIS C O   1 
ATOM   5360  C CB  . HIS C  1 184 ? 1.883   66.714  -6.337  1.00 17.00  ? 184 HIS C CB  1 
ATOM   5361  C CG  . HIS C  1 184 ? 2.489   66.144  -5.075  1.00 16.52  ? 184 HIS C CG  1 
ATOM   5362  N ND1 . HIS C  1 184 ? 2.498   66.830  -3.949  1.00 15.73  ? 184 HIS C ND1 1 
ATOM   5363  C CD2 . HIS C  1 184 ? 2.994   64.886  -4.972  1.00 16.27  ? 184 HIS C CD2 1 
ATOM   5364  C CE1 . HIS C  1 184 ? 3.021   65.977  -3.099  1.00 16.03  ? 184 HIS C CE1 1 
ATOM   5365  N NE2 . HIS C  1 184 ? 3.306   64.842  -3.715  1.00 16.33  ? 184 HIS C NE2 1 
ATOM   5366  N N   . PRO C  1 185 ? -0.758  68.426  -7.782  1.00 20.02  ? 185 PRO C N   1 
ATOM   5367  C CA  . PRO C  1 185 ? -1.197  68.966  -9.072  1.00 21.62  ? 185 PRO C CA  1 
ATOM   5368  C C   . PRO C  1 185 ? -0.036  69.604  -9.825  1.00 23.20  ? 185 PRO C C   1 
ATOM   5369  O O   . PRO C  1 185 ? 0.983   69.928  -9.200  1.00 23.53  ? 185 PRO C O   1 
ATOM   5370  C CB  . PRO C  1 185 ? -2.272  69.935  -8.687  1.00 21.33  ? 185 PRO C CB  1 
ATOM   5371  C CG  . PRO C  1 185 ? -2.719  69.449  -7.329  1.00 20.93  ? 185 PRO C CG  1 
ATOM   5372  C CD  . PRO C  1 185 ? -1.380  69.134  -6.685  1.00 20.07  ? 185 PRO C CD  1 
ATOM   5373  N N   . SER C  1 186 ? -0.085  69.807  -11.135 1.00 25.53  ? 186 SER C N   1 
ATOM   5374  C CA  . SER C  1 186 ? 1.057   70.417  -11.776 1.00 28.25  ? 186 SER C CA  1 
ATOM   5375  C C   . SER C  1 186 ? 0.862   71.906  -11.931 1.00 29.76  ? 186 SER C C   1 
ATOM   5376  O O   . SER C  1 186 ? 1.841   72.664  -12.001 1.00 30.71  ? 186 SER C O   1 
ATOM   5377  C CB  . SER C  1 186 ? 1.307   69.780  -13.128 1.00 29.07  ? 186 SER C CB  1 
ATOM   5378  O OG  . SER C  1 186 ? 0.338   70.113  -14.115 1.00 30.48  ? 186 SER C OG  1 
ATOM   5379  N N   . THR C  1 187 ? -0.378  72.374  -11.986 1.00 31.39  ? 187 THR C N   1 
ATOM   5380  C CA  . THR C  1 187 ? -0.621  73.794  -12.081 1.00 33.27  ? 187 THR C CA  1 
ATOM   5381  C C   . THR C  1 187 ? -1.574  74.238  -10.986 1.00 34.68  ? 187 THR C C   1 
ATOM   5382  O O   . THR C  1 187 ? -2.392  73.484  -10.464 1.00 34.48  ? 187 THR C O   1 
ATOM   5383  C CB  . THR C  1 187 ? -1.206  74.127  -13.458 1.00 33.25  ? 187 THR C CB  1 
ATOM   5384  O OG1 . THR C  1 187 ? -2.484  73.509  -13.516 1.00 33.94  ? 187 THR C OG1 1 
ATOM   5385  C CG2 . THR C  1 187 ? -0.315  73.651  -14.596 1.00 33.94  ? 187 THR C CG2 1 
ATOM   5386  N N   . ASN C  1 188 ? -1.528  75.510  -10.623 1.00 37.51  ? 188 ASN C N   1 
ATOM   5387  C CA  . ASN C  1 188 ? -2.410  76.049  -9.597  1.00 39.21  ? 188 ASN C CA  1 
ATOM   5388  C C   . ASN C  1 188 ? -3.850  75.959  -10.009 1.00 40.35  ? 188 ASN C C   1 
ATOM   5389  O O   . ASN C  1 188 ? -4.718  75.621  -9.213  1.00 40.05  ? 188 ASN C O   1 
ATOM   5390  C CB  . ASN C  1 188 ? -2.085  77.483  -9.324  1.00 39.93  ? 188 ASN C CB  1 
ATOM   5391  C CG  . ASN C  1 188 ? -1.417  77.565  -7.964  1.00 40.93  ? 188 ASN C CG  1 
ATOM   5392  O OD1 . ASN C  1 188 ? -1.964  77.162  -6.943  1.00 41.58  ? 188 ASN C OD1 1 
ATOM   5393  N ND2 . ASN C  1 188 ? -0.197  78.077  -7.867  1.00 41.42  ? 188 ASN C ND2 1 
ATOM   5394  N N   . GLN C  1 189 ? -4.102  76.208  -11.298 1.00 42.40  ? 189 GLN C N   1 
ATOM   5395  C CA  . GLN C  1 189 ? -5.420  76.038  -11.881 1.00 43.53  ? 189 GLN C CA  1 
ATOM   5396  C C   . GLN C  1 189 ? -5.897  74.583  -11.693 1.00 42.46  ? 189 GLN C C   1 
ATOM   5397  O O   . GLN C  1 189 ? -7.075  74.372  -11.389 1.00 42.48  ? 189 GLN C O   1 
ATOM   5398  C CB  . GLN C  1 189 ? -5.297  76.484  -13.360 1.00 46.29  ? 189 GLN C CB  1 
ATOM   5399  C CG  . GLN C  1 189 ? -6.520  76.435  -14.291 1.00 49.86  ? 189 GLN C CG  1 
ATOM   5400  C CD  . GLN C  1 189 ? -7.016  75.015  -14.603 1.00 52.37  ? 189 GLN C CD  1 
ATOM   5401  O OE1 . GLN C  1 189 ? -6.214  74.105  -14.870 1.00 53.27  ? 189 GLN C OE1 1 
ATOM   5402  N NE2 . GLN C  1 189 ? -8.325  74.762  -14.503 1.00 53.24  ? 189 GLN C NE2 1 
ATOM   5403  N N   . GLU C  1 190 ? -5.004  73.584  -11.791 1.00 40.50  ? 190 GLU C N   1 
ATOM   5404  C CA  . GLU C  1 190 ? -5.376  72.190  -11.604 1.00 38.76  ? 190 GLU C CA  1 
ATOM   5405  C C   . GLU C  1 190 ? -5.772  71.947  -10.150 1.00 37.24  ? 190 GLU C C   1 
ATOM   5406  O O   . GLU C  1 190 ? -6.796  71.327  -9.866  1.00 36.76  ? 190 GLU C O   1 
ATOM   5407  C CB  . GLU C  1 190 ? -4.195  71.324  -11.985 1.00 38.92  ? 190 GLU C CB  1 
ATOM   5408  C CG  . GLU C  1 190 ? -4.452  69.851  -12.144 1.00 39.43  ? 190 GLU C CG  1 
ATOM   5409  C CD  . GLU C  1 190 ? -3.179  69.053  -12.306 1.00 39.84  ? 190 GLU C CD  1 
ATOM   5410  O OE1 . GLU C  1 190 ? -2.983  68.083  -11.576 1.00 39.48  ? 190 GLU C OE1 1 
ATOM   5411  O OE2 . GLU C  1 190 ? -2.355  69.358  -13.164 1.00 40.74  ? 190 GLU C OE2 1 
ATOM   5412  N N   . GLN C  1 191 ? -5.005  72.498  -9.207  1.00 36.18  ? 191 GLN C N   1 
ATOM   5413  C CA  . GLN C  1 191 ? -5.277  72.381  -7.781  1.00 35.48  ? 191 GLN C CA  1 
ATOM   5414  C C   . GLN C  1 191 ? -6.686  72.840  -7.456  1.00 35.67  ? 191 GLN C C   1 
ATOM   5415  O O   . GLN C  1 191 ? -7.517  72.062  -6.988  1.00 35.98  ? 191 GLN C O   1 
ATOM   5416  C CB  . GLN C  1 191 ? -4.256  73.224  -7.007  1.00 34.50  ? 191 GLN C CB  1 
ATOM   5417  C CG  . GLN C  1 191 ? -4.506  73.459  -5.528  1.00 33.47  ? 191 GLN C CG  1 
ATOM   5418  C CD  . GLN C  1 191 ? -4.536  72.210  -4.675  1.00 33.60  ? 191 GLN C CD  1 
ATOM   5419  O OE1 . GLN C  1 191 ? -3.592  71.426  -4.626  1.00 34.29  ? 191 GLN C OE1 1 
ATOM   5420  N NE2 . GLN C  1 191 ? -5.601  71.950  -3.951  1.00 33.49  ? 191 GLN C NE2 1 
ATOM   5421  N N   . THR C  1 192 ? -6.980  74.090  -7.774  1.00 35.97  ? 192 THR C N   1 
ATOM   5422  C CA  . THR C  1 192 ? -8.265  74.703  -7.477  1.00 35.54  ? 192 THR C CA  1 
ATOM   5423  C C   . THR C  1 192 ? -9.403  74.049  -8.237  1.00 34.41  ? 192 THR C C   1 
ATOM   5424  O O   . THR C  1 192 ? -10.483 73.831  -7.678  1.00 33.99  ? 192 THR C O   1 
ATOM   5425  C CB  . THR C  1 192 ? -8.169  76.193  -7.817  1.00 36.43  ? 192 THR C CB  1 
ATOM   5426  O OG1 . THR C  1 192 ? -7.600  76.312  -9.134  1.00 36.70  ? 192 THR C OG1 1 
ATOM   5427  C CG2 . THR C  1 192 ? -7.347  76.930  -6.752  1.00 36.48  ? 192 THR C CG2 1 
ATOM   5428  N N   . SER C  1 193 ? -9.164  73.706  -9.500  1.00 32.94  ? 193 SER C N   1 
ATOM   5429  C CA  . SER C  1 193 ? -10.149 73.010  -10.287 1.00 32.15  ? 193 SER C CA  1 
ATOM   5430  C C   . SER C  1 193 ? -10.626 71.741  -9.572  1.00 30.39  ? 193 SER C C   1 
ATOM   5431  O O   . SER C  1 193 ? -11.834 71.579  -9.334  1.00 30.24  ? 193 SER C O   1 
ATOM   5432  C CB  . SER C  1 193 ? -9.518  72.681  -11.624 1.00 33.59  ? 193 SER C CB  1 
ATOM   5433  O OG  . SER C  1 193 ? -10.426 72.022  -12.494 1.00 36.62  ? 193 SER C OG  1 
ATOM   5434  N N   . LEU C  1 194 ? -9.696  70.900  -9.133  1.00 28.43  ? 194 LEU C N   1 
ATOM   5435  C CA  . LEU C  1 194 ? -10.061 69.651  -8.521  1.00 26.42  ? 194 LEU C CA  1 
ATOM   5436  C C   . LEU C  1 194 ? -10.499 69.745  -7.089  1.00 26.63  ? 194 LEU C C   1 
ATOM   5437  O O   . LEU C  1 194 ? -11.518 69.175  -6.700  1.00 27.11  ? 194 LEU C O   1 
ATOM   5438  C CB  . LEU C  1 194 ? -8.918  68.675  -8.547  1.00 24.86  ? 194 LEU C CB  1 
ATOM   5439  C CG  . LEU C  1 194 ? -8.439  68.182  -9.864  1.00 24.48  ? 194 LEU C CG  1 
ATOM   5440  C CD1 . LEU C  1 194 ? -7.377  67.144  -9.639  1.00 24.61  ? 194 LEU C CD1 1 
ATOM   5441  C CD2 . LEU C  1 194 ? -9.569  67.568  -10.617 1.00 25.10  ? 194 LEU C CD2 1 
ATOM   5442  N N   . TYR C  1 195 ? -9.722  70.423  -6.277  1.00 27.15  ? 195 TYR C N   1 
ATOM   5443  C CA  . TYR C  1 195 ? -9.932  70.353  -4.839  1.00 27.55  ? 195 TYR C CA  1 
ATOM   5444  C C   . TYR C  1 195 ? -10.414 71.656  -4.237  1.00 28.31  ? 195 TYR C C   1 
ATOM   5445  O O   . TYR C  1 195 ? -10.536 71.777  -3.016  1.00 27.33  ? 195 TYR C O   1 
ATOM   5446  C CB  . TYR C  1 195 ? -8.600  69.899  -4.184  1.00 27.42  ? 195 TYR C CB  1 
ATOM   5447  C CG  . TYR C  1 195 ? -7.968  68.677  -4.844  1.00 26.56  ? 195 TYR C CG  1 
ATOM   5448  C CD1 . TYR C  1 195 ? -8.658  67.487  -4.936  1.00 26.35  ? 195 TYR C CD1 1 
ATOM   5449  C CD2 . TYR C  1 195 ? -6.714  68.765  -5.406  1.00 26.35  ? 195 TYR C CD2 1 
ATOM   5450  C CE1 . TYR C  1 195 ? -8.126  66.405  -5.598  1.00 25.59  ? 195 TYR C CE1 1 
ATOM   5451  C CE2 . TYR C  1 195 ? -6.179  67.682  -6.064  1.00 26.11  ? 195 TYR C CE2 1 
ATOM   5452  C CZ  . TYR C  1 195 ? -6.888  66.508  -6.165  1.00 25.44  ? 195 TYR C CZ  1 
ATOM   5453  O OH  . TYR C  1 195 ? -6.377  65.459  -6.883  1.00 25.22  ? 195 TYR C OH  1 
ATOM   5454  N N   . VAL C  1 196 ? -10.698 72.639  -5.097  1.00 30.41  ? 196 VAL C N   1 
ATOM   5455  C CA  . VAL C  1 196 ? -11.215 73.962  -4.733  1.00 31.76  ? 196 VAL C CA  1 
ATOM   5456  C C   . VAL C  1 196 ? -10.234 74.799  -3.941  1.00 32.08  ? 196 VAL C C   1 
ATOM   5457  O O   . VAL C  1 196 ? -9.867  75.864  -4.445  1.00 32.98  ? 196 VAL C O   1 
ATOM   5458  C CB  . VAL C  1 196 ? -12.587 73.804  -3.970  1.00 31.55  ? 196 VAL C CB  1 
ATOM   5459  C CG1 . VAL C  1 196 ? -13.062 75.092  -3.344  1.00 31.12  ? 196 VAL C CG1 1 
ATOM   5460  C CG2 . VAL C  1 196 ? -13.644 73.411  -4.993  1.00 31.49  ? 196 VAL C CG2 1 
ATOM   5461  N N   . GLN C  1 197 ? -9.778  74.380  -2.760  1.00 32.41  ? 197 GLN C N   1 
ATOM   5462  C CA  . GLN C  1 197 ? -8.830  75.184  -1.996  1.00 34.09  ? 197 GLN C CA  1 
ATOM   5463  C C   . GLN C  1 197 ? -7.500  75.330  -2.705  1.00 35.34  ? 197 GLN C C   1 
ATOM   5464  O O   . GLN C  1 197 ? -7.114  74.503  -3.541  1.00 37.21  ? 197 GLN C O   1 
ATOM   5465  C CB  . GLN C  1 197 ? -8.476  74.615  -0.647  1.00 34.47  ? 197 GLN C CB  1 
ATOM   5466  C CG  . GLN C  1 197 ? -9.195  73.370  -0.205  1.00 36.71  ? 197 GLN C CG  1 
ATOM   5467  C CD  . GLN C  1 197 ? -10.680 73.551  0.054   1.00 38.13  ? 197 GLN C CD  1 
ATOM   5468  O OE1 . GLN C  1 197 ? -11.231 74.641  -0.090  1.00 39.40  ? 197 GLN C OE1 1 
ATOM   5469  N NE2 . GLN C  1 197 ? -11.383 72.494  0.416   1.00 38.68  ? 197 GLN C NE2 1 
ATOM   5470  N N   . ALA C  1 198 ? -6.745  76.368  -2.366  1.00 35.94  ? 198 ALA C N   1 
ATOM   5471  C CA  . ALA C  1 198 ? -5.447  76.596  -2.995  1.00 37.09  ? 198 ALA C CA  1 
ATOM   5472  C C   . ALA C  1 198 ? -4.362  75.648  -2.513  1.00 37.42  ? 198 ALA C C   1 
ATOM   5473  O O   . ALA C  1 198 ? -3.355  75.428  -3.179  1.00 37.08  ? 198 ALA C O   1 
ATOM   5474  C CB  . ALA C  1 198 ? -4.966  77.992  -2.715  1.00 37.67  ? 198 ALA C CB  1 
ATOM   5475  N N   . SER C  1 199 ? -4.560  75.094  -1.323  1.00 38.05  ? 199 SER C N   1 
ATOM   5476  C CA  . SER C  1 199 ? -3.600  74.191  -0.723  1.00 38.31  ? 199 SER C CA  1 
ATOM   5477  C C   . SER C  1 199 ? -4.342  73.078  -0.036  1.00 37.97  ? 199 SER C C   1 
ATOM   5478  O O   . SER C  1 199 ? -5.189  73.330  0.836   1.00 38.70  ? 199 SER C O   1 
ATOM   5479  C CB  . SER C  1 199 ? -2.782  74.899  0.318   1.00 39.28  ? 199 SER C CB  1 
ATOM   5480  O OG  . SER C  1 199 ? -2.397  76.181  -0.173  1.00 41.29  ? 199 SER C OG  1 
ATOM   5481  N N   . GLY C  1 200 ? -4.119  71.861  -0.497  1.00 37.12  ? 200 GLY C N   1 
ATOM   5482  C CA  . GLY C  1 200 ? -4.699  70.712  0.176   1.00 35.95  ? 200 GLY C CA  1 
ATOM   5483  C C   . GLY C  1 200 ? -3.893  70.399  1.429   1.00 34.46  ? 200 GLY C C   1 
ATOM   5484  O O   . GLY C  1 200 ? -2.889  71.063  1.731   1.00 33.86  ? 200 GLY C O   1 
ATOM   5485  N N   . ARG C  1 201 ? -4.282  69.334  2.107   1.00 33.23  ? 201 ARG C N   1 
ATOM   5486  C CA  . ARG C  1 201 ? -3.660  68.925  3.344   1.00 32.08  ? 201 ARG C CA  1 
ATOM   5487  C C   . ARG C  1 201 ? -4.197  67.543  3.647   1.00 30.16  ? 201 ARG C C   1 
ATOM   5488  O O   . ARG C  1 201 ? -5.414  67.356  3.541   1.00 30.65  ? 201 ARG C O   1 
ATOM   5489  C CB  . ARG C  1 201 ? -4.065  69.882  4.453   1.00 34.45  ? 201 ARG C CB  1 
ATOM   5490  C CG  . ARG C  1 201 ? -3.612  69.473  5.842   1.00 36.61  ? 201 ARG C CG  1 
ATOM   5491  C CD  . ARG C  1 201 ? -4.116  70.424  6.913   1.00 38.81  ? 201 ARG C CD  1 
ATOM   5492  N NE  . ARG C  1 201 ? -5.531  70.288  7.232   1.00 40.40  ? 201 ARG C NE  1 
ATOM   5493  C CZ  . ARG C  1 201 ? -6.319  71.378  7.376   1.00 41.69  ? 201 ARG C CZ  1 
ATOM   5494  N NH1 . ARG C  1 201 ? -7.608  71.181  7.728   1.00 42.39  ? 201 ARG C NH1 1 
ATOM   5495  N NH2 . ARG C  1 201 ? -5.837  72.629  7.134   1.00 41.31  ? 201 ARG C NH2 1 
ATOM   5496  N N   . VAL C  1 202 ? -3.363  66.578  3.992   1.00 27.49  ? 202 VAL C N   1 
ATOM   5497  C CA  . VAL C  1 202 ? -3.848  65.283  4.403   1.00 25.26  ? 202 VAL C CA  1 
ATOM   5498  C C   . VAL C  1 202 ? -3.164  64.996  5.729   1.00 24.82  ? 202 VAL C C   1 
ATOM   5499  O O   . VAL C  1 202 ? -1.952  65.172  5.816   1.00 23.56  ? 202 VAL C O   1 
ATOM   5500  C CB  . VAL C  1 202 ? -3.471  64.215  3.372   1.00 24.86  ? 202 VAL C CB  1 
ATOM   5501  C CG1 . VAL C  1 202 ? -3.942  62.848  3.855   1.00 24.27  ? 202 VAL C CG1 1 
ATOM   5502  C CG2 . VAL C  1 202 ? -4.132  64.520  2.044   1.00 24.91  ? 202 VAL C CG2 1 
ATOM   5503  N N   . THR C  1 203 ? -3.905  64.657  6.779   1.00 25.19  ? 203 THR C N   1 
ATOM   5504  C CA  . THR C  1 203 ? -3.361  64.252  8.070   1.00 25.13  ? 203 THR C CA  1 
ATOM   5505  C C   . THR C  1 203 ? -3.978  62.902  8.376   1.00 25.43  ? 203 THR C C   1 
ATOM   5506  O O   . THR C  1 203 ? -5.207  62.769  8.370   1.00 27.20  ? 203 THR C O   1 
ATOM   5507  C CB  . THR C  1 203 ? -3.744  65.219  9.201   1.00 25.52  ? 203 THR C CB  1 
ATOM   5508  O OG1 . THR C  1 203 ? -3.163  66.487  8.900   1.00 26.58  ? 203 THR C OG1 1 
ATOM   5509  C CG2 . THR C  1 203 ? -3.252  64.743  10.555  1.00 25.38  ? 203 THR C CG2 1 
ATOM   5510  N N   . VAL C  1 204 ? -3.174  61.866  8.556   1.00 24.67  ? 204 VAL C N   1 
ATOM   5511  C CA  . VAL C  1 204 ? -3.677  60.537  8.851   1.00 23.80  ? 204 VAL C CA  1 
ATOM   5512  C C   . VAL C  1 204 ? -3.088  60.257  10.191  1.00 24.05  ? 204 VAL C C   1 
ATOM   5513  O O   . VAL C  1 204 ? -1.879  60.429  10.357  1.00 24.41  ? 204 VAL C O   1 
ATOM   5514  C CB  . VAL C  1 204 ? -3.169  59.539  7.818   1.00 23.93  ? 204 VAL C CB  1 
ATOM   5515  C CG1 . VAL C  1 204 ? -3.561  58.127  8.167   1.00 23.41  ? 204 VAL C CG1 1 
ATOM   5516  C CG2 . VAL C  1 204 ? -3.802  59.869  6.483   1.00 25.16  ? 204 VAL C CG2 1 
ATOM   5517  N N   . SER C  1 205 ? -3.904  59.881  11.149  1.00 25.24  ? 205 SER C N   1 
ATOM   5518  C CA  . SER C  1 205 ? -3.452  59.709  12.517  1.00 25.41  ? 205 SER C CA  1 
ATOM   5519  C C   . SER C  1 205 ? -4.047  58.495  13.178  1.00 26.38  ? 205 SER C C   1 
ATOM   5520  O O   . SER C  1 205 ? -5.104  57.983  12.770  1.00 26.99  ? 205 SER C O   1 
ATOM   5521  C CB  . SER C  1 205 ? -3.845  60.928  13.328  1.00 25.67  ? 205 SER C CB  1 
ATOM   5522  O OG  . SER C  1 205 ? -4.666  61.900  12.638  1.00 27.34  ? 205 SER C OG  1 
ATOM   5523  N N   . THR C  1 206 ? -3.368  58.009  14.193  1.00 27.41  ? 206 THR C N   1 
ATOM   5524  C CA  . THR C  1 206 ? -3.901  56.965  15.048  1.00 28.66  ? 206 THR C CA  1 
ATOM   5525  C C   . THR C  1 206 ? -3.725  57.482  16.456  1.00 29.65  ? 206 THR C C   1 
ATOM   5526  O O   . THR C  1 206 ? -3.418  58.665  16.626  1.00 30.49  ? 206 THR C O   1 
ATOM   5527  C CB  . THR C  1 206 ? -3.128  55.663  14.833  1.00 28.48  ? 206 THR C CB  1 
ATOM   5528  O OG1 . THR C  1 206 ? -1.751  55.927  15.080  1.00 28.37  ? 206 THR C OG1 1 
ATOM   5529  C CG2 . THR C  1 206 ? -3.403  55.085  13.453  1.00 28.31  ? 206 THR C CG2 1 
ATOM   5530  N N   . ARG C  1 207 ? -3.895  56.721  17.517  1.00 31.83  ? 207 ARG C N   1 
ATOM   5531  C CA  . ARG C  1 207 ? -3.607  57.283  18.819  1.00 35.06  ? 207 ARG C CA  1 
ATOM   5532  C C   . ARG C  1 207 ? -2.120  57.402  18.976  1.00 36.55  ? 207 ARG C C   1 
ATOM   5533  O O   . ARG C  1 207 ? -1.630  58.339  19.601  1.00 37.18  ? 207 ARG C O   1 
ATOM   5534  C CB  . ARG C  1 207 ? -4.096  56.435  19.952  1.00 36.00  ? 207 ARG C CB  1 
ATOM   5535  C CG  . ARG C  1 207 ? -5.582  56.596  20.123  1.00 38.21  ? 207 ARG C CG  1 
ATOM   5536  C CD  . ARG C  1 207 ? -5.941  55.755  21.325  1.00 39.93  ? 207 ARG C CD  1 
ATOM   5537  N NE  . ARG C  1 207 ? -7.383  55.602  21.415  1.00 42.08  ? 207 ARG C NE  1 
ATOM   5538  C CZ  . ARG C  1 207 ? -7.981  54.441  21.089  1.00 42.95  ? 207 ARG C CZ  1 
ATOM   5539  N NH1 . ARG C  1 207 ? -9.313  54.363  21.211  1.00 43.49  ? 207 ARG C NH1 1 
ATOM   5540  N NH2 . ARG C  1 207 ? -7.278  53.388  20.609  1.00 43.31  ? 207 ARG C NH2 1 
ATOM   5541  N N   . ARG C  1 208 ? -1.413  56.477  18.349  1.00 38.38  ? 208 ARG C N   1 
ATOM   5542  C CA  . ARG C  1 208 ? 0.034   56.430  18.438  1.00 40.21  ? 208 ARG C CA  1 
ATOM   5543  C C   . ARG C  1 208 ? 0.814   57.340  17.484  1.00 39.18  ? 208 ARG C C   1 
ATOM   5544  O O   . ARG C  1 208 ? 2.008   57.537  17.697  1.00 38.92  ? 208 ARG C O   1 
ATOM   5545  C CB  . ARG C  1 208 ? 0.459   54.982  18.229  1.00 43.20  ? 208 ARG C CB  1 
ATOM   5546  C CG  . ARG C  1 208 ? -0.105  54.126  19.349  1.00 47.49  ? 208 ARG C CG  1 
ATOM   5547  C CD  . ARG C  1 208 ? 0.126   52.630  19.178  1.00 50.82  ? 208 ARG C CD  1 
ATOM   5548  N NE  . ARG C  1 208 ? 0.108   52.005  20.501  1.00 54.07  ? 208 ARG C NE  1 
ATOM   5549  C CZ  . ARG C  1 208 ? 1.234   51.910  21.260  1.00 56.27  ? 208 ARG C CZ  1 
ATOM   5550  N NH1 . ARG C  1 208 ? 1.176   51.379  22.504  1.00 56.98  ? 208 ARG C NH1 1 
ATOM   5551  N NH2 . ARG C  1 208 ? 2.430   52.326  20.766  1.00 57.37  ? 208 ARG C NH2 1 
ATOM   5552  N N   . SER C  1 209 ? 0.234   57.919  16.433  1.00 37.74  ? 209 SER C N   1 
ATOM   5553  C CA  . SER C  1 209 ? 1.043   58.653  15.483  1.00 36.07  ? 209 SER C CA  1 
ATOM   5554  C C   . SER C  1 209 ? 0.209   59.610  14.669  1.00 35.38  ? 209 SER C C   1 
ATOM   5555  O O   . SER C  1 209 ? -1.021  59.588  14.767  1.00 35.66  ? 209 SER C O   1 
ATOM   5556  C CB  . SER C  1 209 ? 1.707   57.661  14.564  1.00 36.70  ? 209 SER C CB  1 
ATOM   5557  O OG  . SER C  1 209 ? 0.732   56.909  13.834  1.00 37.79  ? 209 SER C OG  1 
ATOM   5558  N N   . GLN C  1 210 ? 0.854   60.413  13.839  1.00 34.25  ? 210 GLN C N   1 
ATOM   5559  C CA  . GLN C  1 210 ? 0.169   61.306  12.921  1.00 33.58  ? 210 GLN C CA  1 
ATOM   5560  C C   . GLN C  1 210 ? 1.100   61.531  11.755  1.00 33.09  ? 210 GLN C C   1 
ATOM   5561  O O   . GLN C  1 210 ? 2.290   61.293  11.922  1.00 34.12  ? 210 GLN C O   1 
ATOM   5562  C CB  . GLN C  1 210 ? -0.112  62.659  13.570  1.00 33.13  ? 210 GLN C CB  1 
ATOM   5563  C CG  . GLN C  1 210 ? 1.126   63.251  14.209  1.00 33.12  ? 210 GLN C CG  1 
ATOM   5564  C CD  . GLN C  1 210 ? 0.925   64.729  14.340  1.00 33.71  ? 210 GLN C CD  1 
ATOM   5565  O OE1 . GLN C  1 210 ? 0.236   65.162  15.250  1.00 33.71  ? 210 GLN C OE1 1 
ATOM   5566  N NE2 . GLN C  1 210 ? 1.282   65.566  13.374  1.00 34.92  ? 210 GLN C NE2 1 
ATOM   5567  N N   . GLN C  1 211 ? 0.638   61.899  10.574  1.00 32.29  ? 211 GLN C N   1 
ATOM   5568  C CA  . GLN C  1 211 ? 1.537   62.400  9.552   1.00 31.39  ? 211 GLN C CA  1 
ATOM   5569  C C   . GLN C  1 211 ? 0.702   63.343  8.750   1.00 30.94  ? 211 GLN C C   1 
ATOM   5570  O O   . GLN C  1 211 ? -0.482  63.078  8.522   1.00 31.52  ? 211 GLN C O   1 
ATOM   5571  C CB  . GLN C  1 211 ? 2.098   61.297  8.665   1.00 31.53  ? 211 GLN C CB  1 
ATOM   5572  C CG  . GLN C  1 211 ? 1.182   60.138  8.374   1.00 32.39  ? 211 GLN C CG  1 
ATOM   5573  C CD  . GLN C  1 211 ? 1.973   58.866  8.104   1.00 32.99  ? 211 GLN C CD  1 
ATOM   5574  O OE1 . GLN C  1 211 ? 2.997   58.841  7.405   1.00 32.56  ? 211 GLN C OE1 1 
ATOM   5575  N NE2 . GLN C  1 211 ? 1.496   57.773  8.690   1.00 33.08  ? 211 GLN C NE2 1 
ATOM   5576  N N   . THR C  1 212 ? 1.249   64.502  8.480   1.00 30.22  ? 212 THR C N   1 
ATOM   5577  C CA  . THR C  1 212 ? 0.523   65.460  7.688   1.00 30.79  ? 212 THR C CA  1 
ATOM   5578  C C   . THR C  1 212 ? 1.390   65.700  6.494   1.00 29.60  ? 212 THR C C   1 
ATOM   5579  O O   . THR C  1 212 ? 2.588   65.904  6.656   1.00 29.38  ? 212 THR C O   1 
ATOM   5580  C CB  . THR C  1 212 ? 0.320   66.750  8.482   1.00 31.33  ? 212 THR C CB  1 
ATOM   5581  O OG1 . THR C  1 212 ? -0.381  66.382  9.688   1.00 32.74  ? 212 THR C OG1 1 
ATOM   5582  C CG2 . THR C  1 212 ? -0.428  67.837  7.686   1.00 30.56  ? 212 THR C CG2 1 
ATOM   5583  N N   . ILE C  1 213 ? 0.831   65.549  5.320   1.00 28.82  ? 213 ILE C N   1 
ATOM   5584  C CA  . ILE C  1 213 ? 1.571   65.801  4.118   1.00 28.45  ? 213 ILE C CA  1 
ATOM   5585  C C   . ILE C  1 213 ? 0.835   66.937  3.456   1.00 28.63  ? 213 ILE C C   1 
ATOM   5586  O O   . ILE C  1 213 ? -0.389  67.010  3.558   1.00 30.05  ? 213 ILE C O   1 
ATOM   5587  C CB  . ILE C  1 213 ? 1.564   64.536  3.231   1.00 28.40  ? 213 ILE C CB  1 
ATOM   5588  C CG1 . ILE C  1 213 ? 2.418   63.399  3.795   1.00 28.33  ? 213 ILE C CG1 1 
ATOM   5589  C CG2 . ILE C  1 213 ? 2.162   64.894  1.889   1.00 28.67  ? 213 ILE C CG2 1 
ATOM   5590  C CD1 . ILE C  1 213 ? 1.860   62.584  4.963   1.00 27.85  ? 213 ILE C CD1 1 
ATOM   5591  N N   . ILE C  1 214 ? 1.546   67.891  2.877   1.00 28.73  ? 214 ILE C N   1 
ATOM   5592  C CA  . ILE C  1 214 ? 0.894   68.925  2.099   1.00 29.20  ? 214 ILE C CA  1 
ATOM   5593  C C   . ILE C  1 214 ? 1.386   68.690  0.683   1.00 28.58  ? 214 ILE C C   1 
ATOM   5594  O O   . ILE C  1 214 ? 2.528   68.261  0.521   1.00 28.61  ? 214 ILE C O   1 
ATOM   5595  C CB  . ILE C  1 214 ? 1.260   70.345  2.636   1.00 29.86  ? 214 ILE C CB  1 
ATOM   5596  C CG1 . ILE C  1 214 ? 2.746   70.531  2.892   1.00 30.53  ? 214 ILE C CG1 1 
ATOM   5597  C CG2 . ILE C  1 214 ? 0.456   70.546  3.915   1.00 29.84  ? 214 ILE C CG2 1 
ATOM   5598  C CD1 . ILE C  1 214 ? 3.155   71.934  3.417   1.00 31.64  ? 214 ILE C CD1 1 
ATOM   5599  N N   . PRO C  1 215 ? 0.549   68.841  -0.345  1.00 28.57  ? 215 PRO C N   1 
ATOM   5600  C CA  . PRO C  1 215 ? 0.911   68.610  -1.728  1.00 28.98  ? 215 PRO C CA  1 
ATOM   5601  C C   . PRO C  1 215 ? 1.878   69.650  -2.243  1.00 29.90  ? 215 PRO C C   1 
ATOM   5602  O O   . PRO C  1 215 ? 2.160   70.648  -1.569  1.00 29.91  ? 215 PRO C O   1 
ATOM   5603  C CB  . PRO C  1 215 ? -0.412  68.604  -2.431  1.00 28.55  ? 215 PRO C CB  1 
ATOM   5604  C CG  . PRO C  1 215 ? -1.161  69.671  -1.696  1.00 28.27  ? 215 PRO C CG  1 
ATOM   5605  C CD  . PRO C  1 215 ? -0.815  69.337  -0.259  1.00 28.46  ? 215 PRO C CD  1 
ATOM   5606  N N   . ASN C  1 216 ? 2.367   69.479  -3.467  1.00 31.27  ? 216 ASN C N   1 
ATOM   5607  C CA  . ASN C  1 216 ? 3.325   70.417  -4.028  1.00 33.14  ? 216 ASN C CA  1 
ATOM   5608  C C   . ASN C  1 216 ? 2.996   70.627  -5.479  1.00 32.10  ? 216 ASN C C   1 
ATOM   5609  O O   . ASN C  1 216 ? 3.144   69.706  -6.296  1.00 31.93  ? 216 ASN C O   1 
ATOM   5610  C CB  . ASN C  1 216 ? 4.717   69.877  -3.976  1.00 37.08  ? 216 ASN C CB  1 
ATOM   5611  C CG  . ASN C  1 216 ? 5.166   69.281  -2.644  1.00 39.87  ? 216 ASN C CG  1 
ATOM   5612  O OD1 . ASN C  1 216 ? 5.623   68.124  -2.607  1.00 40.23  ? 216 ASN C OD1 1 
ATOM   5613  N ND2 . ASN C  1 216 ? 5.081   70.056  -1.549  1.00 41.41  ? 216 ASN C ND2 1 
ATOM   5614  N N   . ILE C  1 217 ? 2.549   71.826  -5.801  1.00 31.05  ? 217 ILE C N   1 
ATOM   5615  C CA  . ILE C  1 217 ? 2.094   72.133  -7.144  1.00 30.10  ? 217 ILE C CA  1 
ATOM   5616  C C   . ILE C  1 217 ? 3.272   72.510  -8.006  1.00 28.53  ? 217 ILE C C   1 
ATOM   5617  O O   . ILE C  1 217 ? 4.017   73.408  -7.617  1.00 28.87  ? 217 ILE C O   1 
ATOM   5618  C CB  . ILE C  1 217 ? 1.083   73.290  -7.063  1.00 30.54  ? 217 ILE C CB  1 
ATOM   5619  C CG1 . ILE C  1 217 ? -0.078  72.926  -6.150  1.00 30.73  ? 217 ILE C CG1 1 
ATOM   5620  C CG2 . ILE C  1 217 ? 0.546   73.585  -8.447  1.00 30.33  ? 217 ILE C CG2 1 
ATOM   5621  C CD1 . ILE C  1 217 ? -0.634  74.189  -5.459  1.00 31.11  ? 217 ILE C CD1 1 
ATOM   5622  N N   . GLY C  1 218 ? 3.460   71.866  -9.137  1.00 27.18  ? 218 GLY C N   1 
ATOM   5623  C CA  . GLY C  1 218 ? 4.553   72.246  -10.012 1.00 27.56  ? 218 GLY C CA  1 
ATOM   5624  C C   . GLY C  1 218 ? 4.684   71.277  -11.165 1.00 27.62  ? 218 GLY C C   1 
ATOM   5625  O O   . GLY C  1 218 ? 4.117   70.186  -11.107 1.00 28.66  ? 218 GLY C O   1 
ATOM   5626  N N   . SER C  1 219 ? 5.420   71.600  -12.217 1.00 27.39  ? 219 SER C N   1 
ATOM   5627  C CA  . SER C  1 219 ? 5.553   70.653  -13.296 1.00 27.33  ? 219 SER C CA  1 
ATOM   5628  C C   . SER C  1 219 ? 6.667   69.640  -13.096 1.00 27.12  ? 219 SER C C   1 
ATOM   5629  O O   . SER C  1 219 ? 7.803   69.955  -12.723 1.00 27.88  ? 219 SER C O   1 
ATOM   5630  C CB  . SER C  1 219 ? 5.785   71.389  -14.574 1.00 27.43  ? 219 SER C CB  1 
ATOM   5631  O OG  . SER C  1 219 ? 4.705   72.285  -14.758 1.00 28.20  ? 219 SER C OG  1 
ATOM   5632  N N   . ARG C  1 220 ? 6.280   68.394  -13.258 1.00 25.82  ? 220 ARG C N   1 
ATOM   5633  C CA  . ARG C  1 220 ? 7.218   67.312  -13.285 1.00 25.44  ? 220 ARG C CA  1 
ATOM   5634  C C   . ARG C  1 220 ? 7.334   66.865  -14.739 1.00 26.18  ? 220 ARG C C   1 
ATOM   5635  O O   . ARG C  1 220 ? 6.654   67.403  -15.609 1.00 25.83  ? 220 ARG C O   1 
ATOM   5636  C CB  . ARG C  1 220 ? 6.706   66.165  -12.431 1.00 24.15  ? 220 ARG C CB  1 
ATOM   5637  C CG  . ARG C  1 220 ? 6.822   66.354  -10.940 1.00 22.30  ? 220 ARG C CG  1 
ATOM   5638  C CD  . ARG C  1 220 ? 5.629   67.012  -10.354 1.00 20.38  ? 220 ARG C CD  1 
ATOM   5639  N NE  . ARG C  1 220 ? 5.921   67.234  -8.967  1.00 19.43  ? 220 ARG C NE  1 
ATOM   5640  C CZ  . ARG C  1 220 ? 5.022   67.790  -8.156  1.00 19.57  ? 220 ARG C CZ  1 
ATOM   5641  N NH1 . ARG C  1 220 ? 5.333   68.035  -6.865  1.00 18.87  ? 220 ARG C NH1 1 
ATOM   5642  N NH2 . ARG C  1 220 ? 3.802   68.097  -8.631  1.00 19.48  ? 220 ARG C NH2 1 
ATOM   5643  N N   . PRO C  1 221 ? 8.229   65.956  -15.102 1.00 27.39  ? 221 PRO C N   1 
ATOM   5644  C CA  . PRO C  1 221 ? 8.312   65.472  -16.453 1.00 28.63  ? 221 PRO C CA  1 
ATOM   5645  C C   . PRO C  1 221 ? 7.084   64.610  -16.761 1.00 30.57  ? 221 PRO C C   1 
ATOM   5646  O O   . PRO C  1 221 ? 6.510   63.891  -15.914 1.00 30.91  ? 221 PRO C O   1 
ATOM   5647  C CB  . PRO C  1 221 ? 9.588   64.683  -16.527 1.00 28.39  ? 221 PRO C CB  1 
ATOM   5648  C CG  . PRO C  1 221 ? 10.436  65.393  -15.543 1.00 28.11  ? 221 PRO C CG  1 
ATOM   5649  C CD  . PRO C  1 221 ? 9.467   65.641  -14.410 1.00 27.87  ? 221 PRO C CD  1 
ATOM   5650  N N   . TRP C  1 222 ? 6.712   64.705  -18.025 1.00 32.23  ? 222 TRP C N   1 
ATOM   5651  C CA  . TRP C  1 222 ? 5.663   63.960  -18.683 1.00 32.76  ? 222 TRP C CA  1 
ATOM   5652  C C   . TRP C  1 222 ? 5.822   62.464  -18.452 1.00 31.12  ? 222 TRP C C   1 
ATOM   5653  O O   . TRP C  1 222 ? 6.821   61.862  -18.867 1.00 31.80  ? 222 TRP C O   1 
ATOM   5654  C CB  . TRP C  1 222 ? 5.773   64.297  -20.158 1.00 35.98  ? 222 TRP C CB  1 
ATOM   5655  C CG  . TRP C  1 222 ? 4.551   64.112  -21.053 1.00 39.36  ? 222 TRP C CG  1 
ATOM   5656  C CD1 . TRP C  1 222 ? 4.405   63.060  -21.946 1.00 39.99  ? 222 TRP C CD1 1 
ATOM   5657  C CD2 . TRP C  1 222 ? 3.516   65.011  -21.126 1.00 40.53  ? 222 TRP C CD2 1 
ATOM   5658  N NE1 . TRP C  1 222 ? 3.278   63.308  -22.587 1.00 40.34  ? 222 TRP C NE1 1 
ATOM   5659  C CE2 . TRP C  1 222 ? 2.722   64.451  -22.131 1.00 40.68  ? 222 TRP C CE2 1 
ATOM   5660  C CE3 . TRP C  1 222 ? 3.180   66.178  -20.470 1.00 41.02  ? 222 TRP C CE3 1 
ATOM   5661  C CZ2 . TRP C  1 222 ? 1.558   65.072  -22.522 1.00 40.81  ? 222 TRP C CZ2 1 
ATOM   5662  C CZ3 . TRP C  1 222 ? 2.011   66.788  -20.868 1.00 41.64  ? 222 TRP C CZ3 1 
ATOM   5663  C CH2 . TRP C  1 222 ? 1.214   66.242  -21.874 1.00 41.47  ? 222 TRP C CH2 1 
ATOM   5664  N N   . VAL C  1 223 ? 4.909   61.845  -17.727 1.00 28.53  ? 223 VAL C N   1 
ATOM   5665  C CA  . VAL C  1 223 ? 4.895   60.409  -17.641 1.00 27.30  ? 223 VAL C CA  1 
ATOM   5666  C C   . VAL C  1 223 ? 3.476   60.061  -17.961 1.00 27.93  ? 223 VAL C C   1 
ATOM   5667  O O   . VAL C  1 223 ? 2.571   60.516  -17.259 1.00 28.45  ? 223 VAL C O   1 
ATOM   5668  C CB  . VAL C  1 223 ? 5.234   59.908  -16.258 1.00 26.16  ? 223 VAL C CB  1 
ATOM   5669  C CG1 . VAL C  1 223 ? 4.904   58.444  -16.094 1.00 25.79  ? 223 VAL C CG1 1 
ATOM   5670  C CG2 . VAL C  1 223 ? 6.727   60.003  -16.090 1.00 26.76  ? 223 VAL C CG2 1 
ATOM   5671  N N   . ARG C  1 224 ? 3.292   59.311  -19.055 1.00 27.65  ? 224 ARG C N   1 
ATOM   5672  C CA  . ARG C  1 224 ? 1.976   58.927  -19.550 1.00 27.08  ? 224 ARG C CA  1 
ATOM   5673  C C   . ARG C  1 224 ? 0.993   60.095  -19.694 1.00 27.11  ? 224 ARG C C   1 
ATOM   5674  O O   . ARG C  1 224 ? -0.168  60.055  -19.277 1.00 27.22  ? 224 ARG C O   1 
ATOM   5675  C CB  . ARG C  1 224 ? 1.406   57.867  -18.631 1.00 27.01  ? 224 ARG C CB  1 
ATOM   5676  C CG  . ARG C  1 224 ? 1.840   56.497  -19.081 1.00 27.23  ? 224 ARG C CG  1 
ATOM   5677  C CD  . ARG C  1 224 ? 1.204   55.471  -18.166 1.00 27.41  ? 224 ARG C CD  1 
ATOM   5678  N NE  . ARG C  1 224 ? 1.706   55.602  -16.811 1.00 27.53  ? 224 ARG C NE  1 
ATOM   5679  C CZ  . ARG C  1 224 ? 2.935   55.181  -16.447 1.00 28.29  ? 224 ARG C CZ  1 
ATOM   5680  N NH1 . ARG C  1 224 ? 3.312   55.306  -15.168 1.00 27.93  ? 224 ARG C NH1 1 
ATOM   5681  N NH2 . ARG C  1 224 ? 3.776   54.635  -17.348 1.00 28.92  ? 224 ARG C NH2 1 
ATOM   5682  N N   . GLY C  1 225 ? 1.473   61.192  -20.286 1.00 26.79  ? 225 GLY C N   1 
ATOM   5683  C CA  . GLY C  1 225 ? 0.633   62.357  -20.501 1.00 26.00  ? 225 GLY C CA  1 
ATOM   5684  C C   . GLY C  1 225 ? 0.487   63.232  -19.269 1.00 25.65  ? 225 GLY C C   1 
ATOM   5685  O O   . GLY C  1 225 ? -0.045  64.337  -19.338 1.00 25.98  ? 225 GLY C O   1 
ATOM   5686  N N   . LEU C  1 226 ? 0.999   62.814  -18.121 1.00 25.42  ? 226 LEU C N   1 
ATOM   5687  C CA  . LEU C  1 226 ? 0.789   63.567  -16.913 1.00 25.02  ? 226 LEU C CA  1 
ATOM   5688  C C   . LEU C  1 226 ? 2.049   64.175  -16.355 1.00 24.95  ? 226 LEU C C   1 
ATOM   5689  O O   . LEU C  1 226 ? 3.150   63.605  -16.387 1.00 24.78  ? 226 LEU C O   1 
ATOM   5690  C CB  . LEU C  1 226 ? 0.156   62.651  -15.905 1.00 24.98  ? 226 LEU C CB  1 
ATOM   5691  C CG  . LEU C  1 226 ? -1.233  62.210  -16.286 1.00 25.56  ? 226 LEU C CG  1 
ATOM   5692  C CD1 . LEU C  1 226 ? -1.660  61.059  -15.419 1.00 25.71  ? 226 LEU C CD1 1 
ATOM   5693  C CD2 . LEU C  1 226 ? -2.186  63.374  -16.132 1.00 25.47  ? 226 LEU C CD2 1 
ATOM   5694  N N   . SER C  1 227 ? 1.850   65.359  -15.803 1.00 24.96  ? 227 SER C N   1 
ATOM   5695  C CA  . SER C  1 227 ? 2.906   66.108  -15.175 1.00 25.55  ? 227 SER C CA  1 
ATOM   5696  C C   . SER C  1 227 ? 2.656   66.116  -13.685 1.00 25.02  ? 227 SER C C   1 
ATOM   5697  O O   . SER C  1 227 ? 3.303   66.832  -12.921 1.00 25.89  ? 227 SER C O   1 
ATOM   5698  C CB  . SER C  1 227 ? 2.896   67.532  -15.746 1.00 26.54  ? 227 SER C CB  1 
ATOM   5699  O OG  . SER C  1 227 ? 3.796   68.486  -15.172 1.00 27.64  ? 227 SER C OG  1 
ATOM   5700  N N   . SER C  1 228 ? 1.726   65.321  -13.221 1.00 24.53  ? 228 SER C N   1 
ATOM   5701  C CA  . SER C  1 228 ? 1.398   65.331  -11.819 1.00 23.98  ? 228 SER C CA  1 
ATOM   5702  C C   . SER C  1 228 ? 1.903   64.033  -11.218 1.00 23.23  ? 228 SER C C   1 
ATOM   5703  O O   . SER C  1 228 ? 2.333   63.135  -11.957 1.00 23.42  ? 228 SER C O   1 
ATOM   5704  C CB  . SER C  1 228 ? -0.104  65.503  -11.756 1.00 23.76  ? 228 SER C CB  1 
ATOM   5705  O OG  . SER C  1 228 ? -0.383  66.605  -12.608 1.00 24.69  ? 228 SER C OG  1 
ATOM   5706  N N   . ARG C  1 229 ? 2.000   63.952  -9.906  1.00 21.93  ? 229 ARG C N   1 
ATOM   5707  C CA  . ARG C  1 229 ? 2.376   62.710  -9.294  1.00 20.92  ? 229 ARG C CA  1 
ATOM   5708  C C   . ARG C  1 229 ? 1.448   62.478  -8.149  1.00 19.59  ? 229 ARG C C   1 
ATOM   5709  O O   . ARG C  1 229 ? 0.714   63.392  -7.764  1.00 18.96  ? 229 ARG C O   1 
ATOM   5710  C CB  . ARG C  1 229 ? 3.774   62.739  -8.727  1.00 21.43  ? 229 ARG C CB  1 
ATOM   5711  C CG  . ARG C  1 229 ? 4.864   62.195  -9.621  1.00 22.98  ? 229 ARG C CG  1 
ATOM   5712  C CD  . ARG C  1 229 ? 5.169   63.190  -10.706 1.00 23.72  ? 229 ARG C CD  1 
ATOM   5713  N NE  . ARG C  1 229 ? 6.139   62.684  -11.659 1.00 24.40  ? 229 ARG C NE  1 
ATOM   5714  C CZ  . ARG C  1 229 ? 5.870   62.649  -12.973 1.00 24.15  ? 229 ARG C CZ  1 
ATOM   5715  N NH1 . ARG C  1 229 ? 6.845   62.268  -13.799 1.00 25.15  ? 229 ARG C NH1 1 
ATOM   5716  N NH2 . ARG C  1 229 ? 4.634   62.867  -13.455 1.00 23.03  ? 229 ARG C NH2 1 
ATOM   5717  N N   . ILE C  1 230 ? 1.361   61.250  -7.691  1.00 18.83  ? 230 ILE C N   1 
ATOM   5718  C CA  . ILE C  1 230 ? 0.770   61.061  -6.398  1.00 19.30  ? 230 ILE C CA  1 
ATOM   5719  C C   . ILE C  1 230 ? 1.871   60.414  -5.568  1.00 19.43  ? 230 ILE C C   1 
ATOM   5720  O O   . ILE C  1 230 ? 2.657   59.645  -6.130  1.00 19.50  ? 230 ILE C O   1 
ATOM   5721  C CB  . ILE C  1 230 ? -0.488  60.177  -6.464  1.00 18.74  ? 230 ILE C CB  1 
ATOM   5722  C CG1 . ILE C  1 230 ? -0.261  58.880  -7.142  1.00 18.90  ? 230 ILE C CG1 1 
ATOM   5723  C CG2 . ILE C  1 230 ? -1.549  60.981  -7.201  1.00 19.20  ? 230 ILE C CG2 1 
ATOM   5724  C CD1 . ILE C  1 230 ? -1.587  58.099  -7.248  1.00 20.17  ? 230 ILE C CD1 1 
ATOM   5725  N N   . SER C  1 231 ? 2.025   60.776  -4.293  1.00 18.30  ? 231 SER C N   1 
ATOM   5726  C CA  . SER C  1 231 ? 3.020   60.146  -3.450  1.00 16.68  ? 231 SER C CA  1 
ATOM   5727  C C   . SER C  1 231 ? 2.263   59.204  -2.515  1.00 15.73  ? 231 SER C C   1 
ATOM   5728  O O   . SER C  1 231 ? 1.189   59.578  -2.029  1.00 14.56  ? 231 SER C O   1 
ATOM   5729  C CB  . SER C  1 231 ? 3.753   61.215  -2.681  1.00 17.05  ? 231 SER C CB  1 
ATOM   5730  O OG  . SER C  1 231 ? 4.222   62.250  -3.529  1.00 17.31  ? 231 SER C OG  1 
ATOM   5731  N N   . ILE C  1 232 ? 2.786   57.984  -2.297  1.00 15.52  ? 232 ILE C N   1 
ATOM   5732  C CA  . ILE C  1 232 ? 2.141   56.895  -1.537  1.00 13.69  ? 232 ILE C CA  1 
ATOM   5733  C C   . ILE C  1 232 ? 2.606   56.850  -0.092  1.00 14.00  ? 232 ILE C C   1 
ATOM   5734  O O   . ILE C  1 232 ? 3.787   57.051  0.195   1.00 16.11  ? 232 ILE C O   1 
ATOM   5735  C CB  . ILE C  1 232 ? 2.453   55.552  -2.235  1.00 12.49  ? 232 ILE C CB  1 
ATOM   5736  C CG1 . ILE C  1 232 ? 1.825   55.498  -3.636  1.00 12.30  ? 232 ILE C CG1 1 
ATOM   5737  C CG2 . ILE C  1 232 ? 1.928   54.420  -1.402  1.00 11.75  ? 232 ILE C CG2 1 
ATOM   5738  C CD1 . ILE C  1 232 ? 0.296   55.712  -3.763  1.00 10.88  ? 232 ILE C CD1 1 
ATOM   5739  N N   . TYR C  1 233 ? 1.729   56.598  0.859   1.00 13.73  ? 233 TYR C N   1 
ATOM   5740  C CA  . TYR C  1 233 ? 2.095   56.558  2.271   1.00 13.82  ? 233 TYR C CA  1 
ATOM   5741  C C   . TYR C  1 233 ? 1.422   55.340  2.891   1.00 13.95  ? 233 TYR C C   1 
ATOM   5742  O O   . TYR C  1 233 ? 0.498   54.757  2.312   1.00 13.68  ? 233 TYR C O   1 
ATOM   5743  C CB  . TYR C  1 233 ? 1.641   57.849  2.969   1.00 13.49  ? 233 TYR C CB  1 
ATOM   5744  C CG  . TYR C  1 233 ? 2.413   59.069  2.508   1.00 14.11  ? 233 TYR C CG  1 
ATOM   5745  C CD1 . TYR C  1 233 ? 1.987   59.825  1.443   1.00 15.05  ? 233 TYR C CD1 1 
ATOM   5746  C CD2 . TYR C  1 233 ? 3.608   59.380  3.104   1.00 15.11  ? 233 TYR C CD2 1 
ATOM   5747  C CE1 . TYR C  1 233 ? 2.766   60.864  0.971   1.00 15.68  ? 233 TYR C CE1 1 
ATOM   5748  C CE2 . TYR C  1 233 ? 4.395   60.422  2.654   1.00 15.50  ? 233 TYR C CE2 1 
ATOM   5749  C CZ  . TYR C  1 233 ? 3.967   61.152  1.583   1.00 15.91  ? 233 TYR C CZ  1 
ATOM   5750  O OH  . TYR C  1 233 ? 4.773   62.166  1.112   1.00 16.94  ? 233 TYR C OH  1 
ATOM   5751  N N   . TRP C  1 234 ? 1.867   54.882  4.043   1.00 14.46  ? 234 TRP C N   1 
ATOM   5752  C CA  . TRP C  1 234 ? 1.272   53.700  4.631   1.00 16.26  ? 234 TRP C CA  1 
ATOM   5753  C C   . TRP C  1 234 ? 1.079   53.947  6.101   1.00 15.98  ? 234 TRP C C   1 
ATOM   5754  O O   . TRP C  1 234 ? 1.880   54.672  6.690   1.00 16.98  ? 234 TRP C O   1 
ATOM   5755  C CB  . TRP C  1 234 ? 2.175   52.465  4.411   1.00 18.39  ? 234 TRP C CB  1 
ATOM   5756  C CG  . TRP C  1 234 ? 3.642   52.553  4.830   1.00 20.25  ? 234 TRP C CG  1 
ATOM   5757  C CD1 . TRP C  1 234 ? 4.642   53.111  4.047   1.00 21.24  ? 234 TRP C CD1 1 
ATOM   5758  C CD2 . TRP C  1 234 ? 4.118   52.124  6.032   1.00 21.09  ? 234 TRP C CD2 1 
ATOM   5759  N NE1 . TRP C  1 234 ? 5.747   53.051  4.765   1.00 21.61  ? 234 TRP C NE1 1 
ATOM   5760  C CE2 . TRP C  1 234 ? 5.456   52.475  5.959   1.00 21.89  ? 234 TRP C CE2 1 
ATOM   5761  C CE3 . TRP C  1 234 ? 3.582   51.528  7.141   1.00 21.81  ? 234 TRP C CE3 1 
ATOM   5762  C CZ2 . TRP C  1 234 ? 6.285   52.207  7.028   1.00 22.40  ? 234 TRP C CZ2 1 
ATOM   5763  C CZ3 . TRP C  1 234 ? 4.422   51.267  8.210   1.00 22.14  ? 234 TRP C CZ3 1 
ATOM   5764  C CH2 . TRP C  1 234 ? 5.754   51.603  8.158   1.00 22.12  ? 234 TRP C CH2 1 
ATOM   5765  N N   . THR C  1 235 ? 0.033   53.432  6.720   1.00 15.37  ? 235 THR C N   1 
ATOM   5766  C CA  . THR C  1 235 ? -0.173  53.608  8.138   1.00 15.60  ? 235 THR C CA  1 
ATOM   5767  C C   . THR C  1 235 ? -0.538  52.259  8.689   1.00 16.30  ? 235 THR C C   1 
ATOM   5768  O O   . THR C  1 235 ? -1.417  51.618  8.111   1.00 17.35  ? 235 THR C O   1 
ATOM   5769  C CB  . THR C  1 235 ? -1.312  54.605  8.375   1.00 15.70  ? 235 THR C CB  1 
ATOM   5770  O OG1 . THR C  1 235 ? -0.875  55.857  7.840   1.00 16.16  ? 235 THR C OG1 1 
ATOM   5771  C CG2 . THR C  1 235 ? -1.692  54.720  9.841   1.00 15.50  ? 235 THR C CG2 1 
ATOM   5772  N N   . ILE C  1 236 ? 0.127   51.742  9.717   1.00 17.00  ? 236 ILE C N   1 
ATOM   5773  C CA  . ILE C  1 236 ? -0.335  50.480  10.279  1.00 18.05  ? 236 ILE C CA  1 
ATOM   5774  C C   . ILE C  1 236 ? -1.170  50.851  11.474  1.00 19.04  ? 236 ILE C C   1 
ATOM   5775  O O   . ILE C  1 236 ? -0.756  51.747  12.204  1.00 20.06  ? 236 ILE C O   1 
ATOM   5776  C CB  . ILE C  1 236 ? 0.854   49.597  10.695  1.00 17.61  ? 236 ILE C CB  1 
ATOM   5777  C CG1 . ILE C  1 236 ? 1.542   49.064  9.417   1.00 16.60  ? 236 ILE C CG1 1 
ATOM   5778  C CG2 . ILE C  1 236 ? 0.364   48.444  11.579  1.00 17.48  ? 236 ILE C CG2 1 
ATOM   5779  C CD1 . ILE C  1 236 ? 2.834   48.254  9.591   1.00 15.36  ? 236 ILE C CD1 1 
ATOM   5780  N N   . VAL C  1 237 ? -2.349  50.269  11.653  1.00 20.18  ? 237 VAL C N   1 
ATOM   5781  C CA  . VAL C  1 237 ? -3.184  50.580  12.795  1.00 21.53  ? 237 VAL C CA  1 
ATOM   5782  C C   . VAL C  1 237 ? -3.249  49.316  13.631  1.00 22.96  ? 237 VAL C C   1 
ATOM   5783  O O   . VAL C  1 237 ? -3.748  48.286  13.172  1.00 22.50  ? 237 VAL C O   1 
ATOM   5784  C CB  . VAL C  1 237 ? -4.575  51.005  12.312  1.00 21.23  ? 237 VAL C CB  1 
ATOM   5785  C CG1 . VAL C  1 237 ? -5.429  51.430  13.491  1.00 20.70  ? 237 VAL C CG1 1 
ATOM   5786  C CG2 . VAL C  1 237 ? -4.447  52.180  11.359  1.00 21.44  ? 237 VAL C CG2 1 
ATOM   5787  N N   . LYS C  1 238 ? -2.735  49.408  14.853  1.00 25.25  ? 238 LYS C N   1 
ATOM   5788  C CA  . LYS C  1 238 ? -2.641  48.283  15.776  1.00 27.73  ? 238 LYS C CA  1 
ATOM   5789  C C   . LYS C  1 238 ? -4.019  47.902  16.291  1.00 29.00  ? 238 LYS C C   1 
ATOM   5790  O O   . LYS C  1 238 ? -4.930  48.745  16.194  1.00 29.74  ? 238 LYS C O   1 
ATOM   5791  C CB  . LYS C  1 238 ? -1.772  48.656  16.962  1.00 29.72  ? 238 LYS C CB  1 
ATOM   5792  C CG  . LYS C  1 238 ? -0.343  49.132  16.701  1.00 32.68  ? 238 LYS C CG  1 
ATOM   5793  C CD  . LYS C  1 238 ? 0.586   48.086  16.061  1.00 34.70  ? 238 LYS C CD  1 
ATOM   5794  C CE  . LYS C  1 238 ? 0.971   46.911  16.964  1.00 35.64  ? 238 LYS C CE  1 
ATOM   5795  N NZ  . LYS C  1 238 ? 1.931   47.313  17.978  1.00 35.88  ? 238 LYS C NZ  1 
ATOM   5796  N N   . PRO C  1 239 ? -4.288  46.706  16.856  1.00 29.58  ? 239 PRO C N   1 
ATOM   5797  C CA  . PRO C  1 239 ? -5.615  46.327  17.344  1.00 29.50  ? 239 PRO C CA  1 
ATOM   5798  C C   . PRO C  1 239 ? -6.014  47.202  18.524  1.00 29.35  ? 239 PRO C C   1 
ATOM   5799  O O   . PRO C  1 239 ? -5.225  47.544  19.402  1.00 27.84  ? 239 PRO C O   1 
ATOM   5800  C CB  . PRO C  1 239 ? -5.505  44.879  17.708  1.00 29.18  ? 239 PRO C CB  1 
ATOM   5801  C CG  . PRO C  1 239 ? -4.217  44.444  17.063  1.00 29.28  ? 239 PRO C CG  1 
ATOM   5802  C CD  . PRO C  1 239 ? -3.354  45.673  17.257  1.00 29.43  ? 239 PRO C CD  1 
ATOM   5803  N N   . GLY C  1 240 ? -7.258  47.619  18.501  1.00 30.23  ? 240 GLY C N   1 
ATOM   5804  C CA  . GLY C  1 240 ? -7.774  48.545  19.491  1.00 30.30  ? 240 GLY C CA  1 
ATOM   5805  C C   . GLY C  1 240 ? -7.601  50.016  19.094  1.00 30.62  ? 240 GLY C C   1 
ATOM   5806  O O   . GLY C  1 240 ? -8.221  50.900  19.712  1.00 30.86  ? 240 GLY C O   1 
ATOM   5807  N N   . ASP C  1 241 ? -6.772  50.331  18.076  1.00 30.49  ? 241 ASP C N   1 
ATOM   5808  C CA  . ASP C  1 241 ? -6.524  51.727  17.757  1.00 29.82  ? 241 ASP C CA  1 
ATOM   5809  C C   . ASP C  1 241 ? -7.543  52.312  16.791  1.00 28.43  ? 241 ASP C C   1 
ATOM   5810  O O   . ASP C  1 241 ? -8.528  51.655  16.438  1.00 28.63  ? 241 ASP C O   1 
ATOM   5811  C CB  . ASP C  1 241 ? -5.106  51.883  17.193  1.00 30.95  ? 241 ASP C CB  1 
ATOM   5812  C CG  . ASP C  1 241 ? -4.475  53.232  17.532  1.00 31.80  ? 241 ASP C CG  1 
ATOM   5813  O OD1 . ASP C  1 241 ? -5.203  54.160  17.918  1.00 32.51  ? 241 ASP C OD1 1 
ATOM   5814  O OD2 . ASP C  1 241 ? -3.243  53.394  17.433  1.00 31.95  ? 241 ASP C OD2 1 
ATOM   5815  N N   . VAL C  1 242 ? -7.408  53.549  16.369  1.00 26.59  ? 242 VAL C N   1 
ATOM   5816  C CA  . VAL C  1 242 ? -8.394  54.126  15.507  1.00 25.94  ? 242 VAL C CA  1 
ATOM   5817  C C   . VAL C  1 242 ? -7.610  54.755  14.393  1.00 25.44  ? 242 VAL C C   1 
ATOM   5818  O O   . VAL C  1 242 ? -6.505  55.230  14.643  1.00 25.80  ? 242 VAL C O   1 
ATOM   5819  C CB  . VAL C  1 242 ? -9.172  55.247  16.193  1.00 25.97  ? 242 VAL C CB  1 
ATOM   5820  C CG1 . VAL C  1 242 ? -10.461 55.422  15.404  1.00 26.02  ? 242 VAL C CG1 1 
ATOM   5821  C CG2 . VAL C  1 242 ? -9.482  54.959  17.651  1.00 25.65  ? 242 VAL C CG2 1 
ATOM   5822  N N   . LEU C  1 243 ? -8.118  54.718  13.169  1.00 24.37  ? 243 LEU C N   1 
ATOM   5823  C CA  . LEU C  1 243 ? -7.518  55.501  12.107  1.00 23.17  ? 243 LEU C CA  1 
ATOM   5824  C C   . LEU C  1 243 ? -8.399  56.736  11.987  1.00 23.25  ? 243 LEU C C   1 
ATOM   5825  O O   . LEU C  1 243 ? -9.634  56.598  12.037  1.00 23.98  ? 243 LEU C O   1 
ATOM   5826  C CB  . LEU C  1 243 ? -7.531  54.748  10.773  1.00 22.13  ? 243 LEU C CB  1 
ATOM   5827  C CG  . LEU C  1 243 ? -6.979  55.463  9.546   1.00 21.93  ? 243 LEU C CG  1 
ATOM   5828  C CD1 . LEU C  1 243 ? -5.492  55.639  9.696   1.00 21.53  ? 243 LEU C CD1 1 
ATOM   5829  C CD2 . LEU C  1 243 ? -7.252  54.657  8.296   1.00 21.71  ? 243 LEU C CD2 1 
ATOM   5830  N N   . VAL C  1 244 ? -7.834  57.938  11.916  1.00 22.46  ? 244 VAL C N   1 
ATOM   5831  C CA  . VAL C  1 244 ? -8.623  59.111  11.595  1.00 22.35  ? 244 VAL C CA  1 
ATOM   5832  C C   . VAL C  1 244 ? -7.990  59.732  10.360  1.00 21.76  ? 244 VAL C C   1 
ATOM   5833  O O   . VAL C  1 244 ? -6.792  60.028  10.397  1.00 21.56  ? 244 VAL C O   1 
ATOM   5834  C CB  . VAL C  1 244 ? -8.626  60.092  12.789  1.00 22.43  ? 244 VAL C CB  1 
ATOM   5835  C CG1 . VAL C  1 244 ? -9.197  61.459  12.396  1.00 22.79  ? 244 VAL C CG1 1 
ATOM   5836  C CG2 . VAL C  1 244 ? -9.567  59.545  13.849  1.00 21.91  ? 244 VAL C CG2 1 
ATOM   5837  N N   . ILE C  1 245 ? -8.720  59.853  9.245   1.00 21.07  ? 245 ILE C N   1 
ATOM   5838  C CA  . ILE C  1 245 ? -8.147  60.479  8.058   1.00 20.75  ? 245 ILE C CA  1 
ATOM   5839  C C   . ILE C  1 245 ? -8.834  61.820  7.980   1.00 21.54  ? 245 ILE C C   1 
ATOM   5840  O O   . ILE C  1 245 ? -10.070 61.852  7.987   1.00 22.26  ? 245 ILE C O   1 
ATOM   5841  C CB  . ILE C  1 245 ? -8.447  59.675  6.787   1.00 20.24  ? 245 ILE C CB  1 
ATOM   5842  C CG1 . ILE C  1 245 ? -7.979  58.255  6.988   1.00 19.95  ? 245 ILE C CG1 1 
ATOM   5843  C CG2 . ILE C  1 245 ? -7.772  60.326  5.570   1.00 19.78  ? 245 ILE C CG2 1 
ATOM   5844  C CD1 . ILE C  1 245 ? -8.399  57.304  5.867   1.00 20.25  ? 245 ILE C CD1 1 
ATOM   5845  N N   . ASN C  1 246 ? -8.085  62.910  7.954   1.00 21.97  ? 246 ASN C N   1 
ATOM   5846  C CA  . ASN C  1 246 ? -8.655  64.238  7.878   1.00 23.02  ? 246 ASN C CA  1 
ATOM   5847  C C   . ASN C  1 246 ? -7.994  64.966  6.732   1.00 23.12  ? 246 ASN C C   1 
ATOM   5848  O O   . ASN C  1 246 ? -6.758  64.981  6.669   1.00 23.11  ? 246 ASN C O   1 
ATOM   5849  C CB  . ASN C  1 246 ? -8.387  64.978  9.165   1.00 24.36  ? 246 ASN C CB  1 
ATOM   5850  C CG  . ASN C  1 246 ? -8.834  66.438  9.187   1.00 26.58  ? 246 ASN C CG  1 
ATOM   5851  O OD1 . ASN C  1 246 ? -8.273  67.358  8.558   1.00 27.75  ? 246 ASN C OD1 1 
ATOM   5852  N ND2 . ASN C  1 246 ? -9.850  66.689  10.010  1.00 27.62  ? 246 ASN C ND2 1 
ATOM   5853  N N   . SER C  1 247 ? -8.759  65.584  5.841   1.00 22.78  ? 247 SER C N   1 
ATOM   5854  C CA  . SER C  1 247 ? -8.162  66.262  4.727   1.00 23.32  ? 247 SER C CA  1 
ATOM   5855  C C   . SER C  1 247 ? -9.067  67.349  4.221   1.00 24.75  ? 247 SER C C   1 
ATOM   5856  O O   . SER C  1 247 ? -10.286 67.205  4.304   1.00 25.43  ? 247 SER C O   1 
ATOM   5857  C CB  . SER C  1 247 ? -7.892  65.277  3.595   1.00 23.06  ? 247 SER C CB  1 
ATOM   5858  O OG  . SER C  1 247 ? -7.595  65.878  2.321   1.00 23.39  ? 247 SER C OG  1 
ATOM   5859  N N   . ASN C  1 248 ? -8.507  68.431  3.677   1.00 25.86  ? 248 ASN C N   1 
ATOM   5860  C CA  . ASN C  1 248 ? -9.357  69.368  2.980   1.00 27.00  ? 248 ASN C CA  1 
ATOM   5861  C C   . ASN C  1 248 ? -8.981  69.373  1.511   1.00 27.48  ? 248 ASN C C   1 
ATOM   5862  O O   . ASN C  1 248 ? -9.358  70.294  0.787   1.00 29.13  ? 248 ASN C O   1 
ATOM   5863  C CB  . ASN C  1 248 ? -9.245  70.794  3.509   1.00 28.34  ? 248 ASN C CB  1 
ATOM   5864  C CG  . ASN C  1 248 ? -7.885  71.455  3.338   1.00 29.96  ? 248 ASN C CG  1 
ATOM   5865  O OD1 . ASN C  1 248 ? -7.202  71.656  4.343   1.00 31.14  ? 248 ASN C OD1 1 
ATOM   5866  N ND2 . ASN C  1 248 ? -7.403  71.817  2.152   1.00 30.14  ? 248 ASN C ND2 1 
ATOM   5867  N N   . GLY C  1 249 ? -8.213  68.412  1.003   1.00 26.97  ? 249 GLY C N   1 
ATOM   5868  C CA  . GLY C  1 249 ? -7.983  68.386  -0.432  1.00 26.88  ? 249 GLY C CA  1 
ATOM   5869  C C   . GLY C  1 249 ? -6.829  67.482  -0.789  1.00 26.56  ? 249 GLY C C   1 
ATOM   5870  O O   . GLY C  1 249 ? -5.983  67.186  0.056   1.00 26.56  ? 249 GLY C O   1 
ATOM   5871  N N   . ASN C  1 250 ? -6.825  67.014  -2.032  1.00 25.67  ? 250 ASN C N   1 
ATOM   5872  C CA  . ASN C  1 250 ? -5.739  66.207  -2.586  1.00 24.51  ? 250 ASN C CA  1 
ATOM   5873  C C   . ASN C  1 250 ? -5.629  64.803  -1.990  1.00 23.63  ? 250 ASN C C   1 
ATOM   5874  O O   . ASN C  1 250 ? -4.659  64.090  -2.294  1.00 24.64  ? 250 ASN C O   1 
ATOM   5875  C CB  . ASN C  1 250 ? -4.368  66.910  -2.418  1.00 23.36  ? 250 ASN C CB  1 
ATOM   5876  C CG  . ASN C  1 250 ? -4.357  68.298  -3.014  1.00 22.45  ? 250 ASN C CG  1 
ATOM   5877  O OD1 . ASN C  1 250 ? -5.094  69.166  -2.553  1.00 20.98  ? 250 ASN C OD1 1 
ATOM   5878  N ND2 . ASN C  1 250 ? -3.590  68.570  -4.052  1.00 22.85  ? 250 ASN C ND2 1 
ATOM   5879  N N   . LEU C  1 251 ? -6.612  64.346  -1.210  1.00 21.34  ? 251 LEU C N   1 
ATOM   5880  C CA  . LEU C  1 251 ? -6.537  63.013  -0.617  1.00 19.05  ? 251 LEU C CA  1 
ATOM   5881  C C   . LEU C  1 251 ? -6.774  61.974  -1.709  1.00 18.56  ? 251 LEU C C   1 
ATOM   5882  O O   . LEU C  1 251 ? -7.601  62.170  -2.610  1.00 18.97  ? 251 LEU C O   1 
ATOM   5883  C CB  . LEU C  1 251 ? -7.616  62.764  0.396   1.00 18.32  ? 251 LEU C CB  1 
ATOM   5884  C CG  . LEU C  1 251 ? -7.475  61.984  1.686   1.00 17.80  ? 251 LEU C CG  1 
ATOM   5885  C CD1 . LEU C  1 251 ? -8.841  61.360  1.915   1.00 18.19  ? 251 LEU C CD1 1 
ATOM   5886  C CD2 . LEU C  1 251 ? -6.410  60.921  1.659   1.00 17.59  ? 251 LEU C CD2 1 
ATOM   5887  N N   . ILE C  1 252 ? -5.983  60.915  -1.647  1.00 16.86  ? 252 ILE C N   1 
ATOM   5888  C CA  . ILE C  1 252 ? -6.191  59.721  -2.430  1.00 15.56  ? 252 ILE C CA  1 
ATOM   5889  C C   . ILE C  1 252 ? -6.548  58.781  -1.291  1.00 15.67  ? 252 ILE C C   1 
ATOM   5890  O O   . ILE C  1 252 ? -5.652  58.391  -0.537  1.00 16.34  ? 252 ILE C O   1 
ATOM   5891  C CB  . ILE C  1 252 ? -4.884  59.292  -3.110  1.00 14.51  ? 252 ILE C CB  1 
ATOM   5892  C CG1 . ILE C  1 252 ? -4.486  60.311  -4.144  1.00 14.50  ? 252 ILE C CG1 1 
ATOM   5893  C CG2 . ILE C  1 252 ? -5.053  57.927  -3.717  1.00 14.11  ? 252 ILE C CG2 1 
ATOM   5894  C CD1 . ILE C  1 252 ? -5.532  60.561  -5.228  1.00 14.51  ? 252 ILE C CD1 1 
ATOM   5895  N N   . ALA C  1 253 ? -7.832  58.487  -1.088  1.00 14.59  ? 253 ALA C N   1 
ATOM   5896  C CA  . ALA C  1 253 ? -8.277  57.697  0.062   1.00 13.37  ? 253 ALA C CA  1 
ATOM   5897  C C   . ALA C  1 253 ? -8.094  56.183  -0.001  1.00 12.25  ? 253 ALA C C   1 
ATOM   5898  O O   . ALA C  1 253 ? -8.118  55.598  -1.089  1.00 11.72  ? 253 ALA C O   1 
ATOM   5899  C CB  . ALA C  1 253 ? -9.725  57.957  0.285   1.00 13.94  ? 253 ALA C CB  1 
ATOM   5900  N N   . PRO C  1 254 ? -7.888  55.508  1.124   1.00 12.07  ? 254 PRO C N   1 
ATOM   5901  C CA  . PRO C  1 254 ? -7.740  54.054  1.160   1.00 13.68  ? 254 PRO C CA  1 
ATOM   5902  C C   . PRO C  1 254 ? -9.088  53.382  0.911   1.00 15.29  ? 254 PRO C C   1 
ATOM   5903  O O   . PRO C  1 254 ? -10.095 53.913  1.394   1.00 17.65  ? 254 PRO C O   1 
ATOM   5904  C CB  . PRO C  1 254 ? -7.173  53.781  2.544   1.00 12.75  ? 254 PRO C CB  1 
ATOM   5905  C CG  . PRO C  1 254 ? -7.732  54.900  3.378   1.00 11.89  ? 254 PRO C CG  1 
ATOM   5906  C CD  . PRO C  1 254 ? -7.556  56.080  2.422   1.00 12.11  ? 254 PRO C CD  1 
ATOM   5907  N N   . ARG C  1 255 ? -9.237  52.253  0.200   1.00 15.12  ? 255 ARG C N   1 
ATOM   5908  C CA  . ARG C  1 255 ? -10.578 51.651  0.150   1.00 15.09  ? 255 ARG C CA  1 
ATOM   5909  C C   . ARG C  1 255 ? -10.758 50.562  1.218   1.00 15.65  ? 255 ARG C C   1 
ATOM   5910  O O   . ARG C  1 255 ? -11.742 49.827  1.237   1.00 15.61  ? 255 ARG C O   1 
ATOM   5911  C CB  . ARG C  1 255 ? -10.847 51.048  -1.220  1.00 15.76  ? 255 ARG C CB  1 
ATOM   5912  C CG  . ARG C  1 255 ? -10.440 51.978  -2.363  1.00 16.83  ? 255 ARG C CG  1 
ATOM   5913  C CD  . ARG C  1 255 ? -10.977 51.570  -3.739  1.00 17.21  ? 255 ARG C CD  1 
ATOM   5914  N NE  . ARG C  1 255 ? -12.207 52.325  -3.959  1.00 16.98  ? 255 ARG C NE  1 
ATOM   5915  C CZ  . ARG C  1 255 ? -12.422 53.090  -5.039  1.00 17.03  ? 255 ARG C CZ  1 
ATOM   5916  N NH1 . ARG C  1 255 ? -13.595 53.708  -5.072  1.00 16.76  ? 255 ARG C NH1 1 
ATOM   5917  N NH2 . ARG C  1 255 ? -11.487 53.294  -6.000  1.00 17.29  ? 255 ARG C NH2 1 
ATOM   5918  N N   . GLY C  1 256 ? -9.836  50.416  2.169   1.00 16.50  ? 256 GLY C N   1 
ATOM   5919  C CA  . GLY C  1 256 ? -9.900  49.407  3.223   1.00 15.66  ? 256 GLY C CA  1 
ATOM   5920  C C   . GLY C  1 256 ? -8.471  49.085  3.661   1.00 15.95  ? 256 GLY C C   1 
ATOM   5921  O O   . GLY C  1 256 ? -7.543  49.891  3.455   1.00 15.78  ? 256 GLY C O   1 
ATOM   5922  N N   . TYR C  1 257 ? -8.225  47.881  4.149   1.00 16.08  ? 257 TYR C N   1 
ATOM   5923  C CA  . TYR C  1 257 ? -6.905  47.537  4.648   1.00 16.39  ? 257 TYR C CA  1 
ATOM   5924  C C   . TYR C  1 257 ? -6.357  46.224  4.129   1.00 16.09  ? 257 TYR C C   1 
ATOM   5925  O O   . TYR C  1 257 ? -7.105  45.314  3.745   1.00 16.75  ? 257 TYR C O   1 
ATOM   5926  C CB  . TYR C  1 257 ? -6.895  47.422  6.160   1.00 17.40  ? 257 TYR C CB  1 
ATOM   5927  C CG  . TYR C  1 257 ? -7.780  46.309  6.717   1.00 18.61  ? 257 TYR C CG  1 
ATOM   5928  C CD1 . TYR C  1 257 ? -7.262  45.061  7.009   1.00 18.72  ? 257 TYR C CD1 1 
ATOM   5929  C CD2 . TYR C  1 257 ? -9.104  46.577  6.971   1.00 19.23  ? 257 TYR C CD2 1 
ATOM   5930  C CE1 . TYR C  1 257 ? -8.060  44.092  7.576   1.00 19.37  ? 257 TYR C CE1 1 
ATOM   5931  C CE2 . TYR C  1 257 ? -9.905  45.615  7.540   1.00 19.98  ? 257 TYR C CE2 1 
ATOM   5932  C CZ  . TYR C  1 257 ? -9.385  44.374  7.833   1.00 20.32  ? 257 TYR C CZ  1 
ATOM   5933  O OH  . TYR C  1 257 ? -10.203 43.404  8.398   1.00 21.30  ? 257 TYR C OH  1 
ATOM   5934  N N   . PHE C  1 258 ? -5.038  46.110  4.184   1.00 14.97  ? 258 PHE C N   1 
ATOM   5935  C CA  . PHE C  1 258 ? -4.359  44.877  3.858   1.00 12.50  ? 258 PHE C CA  1 
ATOM   5936  C C   . PHE C  1 258 ? -4.139  44.214  5.183   1.00 13.48  ? 258 PHE C C   1 
ATOM   5937  O O   . PHE C  1 258 ? -3.942  44.922  6.175   1.00 13.09  ? 258 PHE C O   1 
ATOM   5938  C CB  . PHE C  1 258 ? -3.020  45.149  3.197   1.00 9.64   ? 258 PHE C CB  1 
ATOM   5939  C CG  . PHE C  1 258 ? -3.144  45.696  1.788   1.00 6.35   ? 258 PHE C CG  1 
ATOM   5940  C CD1 . PHE C  1 258 ? -3.187  47.051  1.569   1.00 6.15   ? 258 PHE C CD1 1 
ATOM   5941  C CD2 . PHE C  1 258 ? -3.244  44.834  0.734   1.00 5.59   ? 258 PHE C CD2 1 
ATOM   5942  C CE1 . PHE C  1 258 ? -3.320  47.543  0.290   1.00 5.34   ? 258 PHE C CE1 1 
ATOM   5943  C CE2 . PHE C  1 258 ? -3.379  45.332  -0.545  1.00 5.43   ? 258 PHE C CE2 1 
ATOM   5944  C CZ  . PHE C  1 258 ? -3.424  46.682  -0.769  1.00 4.85   ? 258 PHE C CZ  1 
ATOM   5945  N N   . LYS C  1 259 ? -4.251  42.896  5.255   1.00 16.60  ? 259 LYS C N   1 
ATOM   5946  C CA  . LYS C  1 259 ? -3.963  42.187  6.494   1.00 19.77  ? 259 LYS C CA  1 
ATOM   5947  C C   . LYS C  1 259 ? -2.478  42.003  6.633   1.00 21.96  ? 259 LYS C C   1 
ATOM   5948  O O   . LYS C  1 259 ? -1.791  41.619  5.683   1.00 22.86  ? 259 LYS C O   1 
ATOM   5949  C CB  . LYS C  1 259 ? -4.486  40.790  6.562   1.00 20.55  ? 259 LYS C CB  1 
ATOM   5950  C CG  . LYS C  1 259 ? -5.965  40.690  6.698   1.00 23.83  ? 259 LYS C CG  1 
ATOM   5951  C CD  . LYS C  1 259 ? -6.285  39.243  7.055   1.00 26.49  ? 259 LYS C CD  1 
ATOM   5952  C CE  . LYS C  1 259 ? -6.462  39.039  8.573   1.00 28.89  ? 259 LYS C CE  1 
ATOM   5953  N NZ  . LYS C  1 259 ? -5.411  39.646  9.402   1.00 30.08  ? 259 LYS C NZ  1 
ATOM   5954  N N   . MET C  1 260 ? -1.936  42.217  7.817   1.00 23.98  ? 260 MET C N   1 
ATOM   5955  C CA  . MET C  1 260 ? -0.528  41.933  7.976   1.00 24.86  ? 260 MET C CA  1 
ATOM   5956  C C   . MET C  1 260 ? -0.340  40.563  8.583   1.00 26.17  ? 260 MET C C   1 
ATOM   5957  O O   . MET C  1 260 ? -1.158  40.110  9.388   1.00 26.71  ? 260 MET C O   1 
ATOM   5958  C CB  . MET C  1 260 ? 0.110   42.994  8.844   1.00 23.97  ? 260 MET C CB  1 
ATOM   5959  C CG  . MET C  1 260 ? 0.132   44.224  8.001   1.00 23.19  ? 260 MET C CG  1 
ATOM   5960  S SD  . MET C  1 260 ? 1.430   45.330  8.522   1.00 24.48  ? 260 MET C SD  1 
ATOM   5961  C CE  . MET C  1 260 ? 2.594   44.767  7.311   1.00 23.17  ? 260 MET C CE  1 
ATOM   5962  N N   . ARG C  1 261 ? 0.633   39.831  8.070   1.00 28.33  ? 261 ARG C N   1 
ATOM   5963  C CA  . ARG C  1 261 ? 1.039   38.560  8.627   1.00 30.36  ? 261 ARG C CA  1 
ATOM   5964  C C   . ARG C  1 261 ? 2.476   38.638  9.074   1.00 29.45  ? 261 ARG C C   1 
ATOM   5965  O O   . ARG C  1 261 ? 3.147   39.648  8.848   1.00 30.08  ? 261 ARG C O   1 
ATOM   5966  C CB  . ARG C  1 261 ? 0.890   37.473  7.592   1.00 32.94  ? 261 ARG C CB  1 
ATOM   5967  C CG  . ARG C  1 261 ? -0.562  37.054  7.509   1.00 36.75  ? 261 ARG C CG  1 
ATOM   5968  C CD  . ARG C  1 261 ? -0.767  36.025  6.416   1.00 40.32  ? 261 ARG C CD  1 
ATOM   5969  N NE  . ARG C  1 261 ? -2.082  35.388  6.540   1.00 43.73  ? 261 ARG C NE  1 
ATOM   5970  C CZ  . ARG C  1 261 ? -3.250  35.989  6.215   1.00 45.01  ? 261 ARG C CZ  1 
ATOM   5971  N NH1 . ARG C  1 261 ? -4.419  35.337  6.358   1.00 45.55  ? 261 ARG C NH1 1 
ATOM   5972  N NH2 . ARG C  1 261 ? -3.295  37.253  5.757   1.00 45.82  ? 261 ARG C NH2 1 
ATOM   5973  N N   . THR C  1 262 ? 2.925   37.618  9.787   1.00 28.87  ? 262 THR C N   1 
ATOM   5974  C CA  . THR C  1 262 ? 4.291   37.492  10.259  1.00 29.38  ? 262 THR C CA  1 
ATOM   5975  C C   . THR C  1 262 ? 4.663   36.115  9.812   1.00 29.34  ? 262 THR C C   1 
ATOM   5976  O O   . THR C  1 262 ? 4.084   35.155  10.322  1.00 30.20  ? 262 THR C O   1 
ATOM   5977  C CB  . THR C  1 262 ? 4.334   37.562  11.761  1.00 30.01  ? 262 THR C CB  1 
ATOM   5978  O OG1 . THR C  1 262 ? 4.042   38.913  12.041  1.00 32.16  ? 262 THR C OG1 1 
ATOM   5979  C CG2 . THR C  1 262 ? 5.652   37.172  12.386  1.00 31.01  ? 262 THR C CG2 1 
ATOM   5980  N N   . GLY C  1 263 ? 5.553   35.980  8.844   1.00 29.40  ? 263 GLY C N   1 
ATOM   5981  C CA  . GLY C  1 263 ? 5.872   34.660  8.323   1.00 28.45  ? 263 GLY C CA  1 
ATOM   5982  C C   . GLY C  1 263 ? 7.297   34.656  7.842   1.00 27.49  ? 263 GLY C C   1 
ATOM   5983  O O   . GLY C  1 263 ? 8.119   35.436  8.333   1.00 28.49  ? 263 GLY C O   1 
ATOM   5984  N N   . LYS C  1 264 ? 7.585   33.827  6.854   1.00 25.41  ? 264 LYS C N   1 
ATOM   5985  C CA  . LYS C  1 264 ? 8.938   33.737  6.351   1.00 23.93  ? 264 LYS C CA  1 
ATOM   5986  C C   . LYS C  1 264 ? 8.985   34.245  4.930   1.00 21.01  ? 264 LYS C C   1 
ATOM   5987  O O   . LYS C  1 264 ? 9.770   33.774  4.113   1.00 19.86  ? 264 LYS C O   1 
ATOM   5988  C CB  . LYS C  1 264 ? 9.406   32.271  6.427   1.00 26.01  ? 264 LYS C CB  1 
ATOM   5989  C CG  . LYS C  1 264 ? 8.505   31.309  5.673   1.00 28.41  ? 264 LYS C CG  1 
ATOM   5990  C CD  . LYS C  1 264 ? 9.260   30.150  5.048   1.00 29.72  ? 264 LYS C CD  1 
ATOM   5991  C CE  . LYS C  1 264 ? 8.254   29.393  4.198   1.00 30.93  ? 264 LYS C CE  1 
ATOM   5992  N NZ  . LYS C  1 264 ? 8.832   28.572  3.145   1.00 31.40  ? 264 LYS C NZ  1 
ATOM   5993  N N   . SER C  1 265 ? 8.175   35.227  4.611   1.00 19.32  ? 265 SER C N   1 
ATOM   5994  C CA  . SER C  1 265 ? 8.083   35.622  3.225   1.00 17.44  ? 265 SER C CA  1 
ATOM   5995  C C   . SER C  1 265 ? 9.092   36.687  2.925   1.00 15.91  ? 265 SER C C   1 
ATOM   5996  O O   . SER C  1 265 ? 9.542   37.432  3.817   1.00 16.13  ? 265 SER C O   1 
ATOM   5997  C CB  . SER C  1 265 ? 6.691   36.133  2.906   1.00 17.38  ? 265 SER C CB  1 
ATOM   5998  O OG  . SER C  1 265 ? 5.727   35.340  3.589   1.00 18.13  ? 265 SER C OG  1 
ATOM   5999  N N   . SER C  1 266 ? 9.487   36.687  1.663   1.00 14.09  ? 266 SER C N   1 
ATOM   6000  C CA  . SER C  1 266 ? 10.435  37.622  1.152   1.00 13.20  ? 266 SER C CA  1 
ATOM   6001  C C   . SER C  1 266 ? 10.171  37.901  -0.295  1.00 12.22  ? 266 SER C C   1 
ATOM   6002  O O   . SER C  1 266 ? 9.296   37.297  -0.906  1.00 12.90  ? 266 SER C O   1 
ATOM   6003  C CB  . SER C  1 266 ? 11.813  37.081  1.263   1.00 13.20  ? 266 SER C CB  1 
ATOM   6004  O OG  . SER C  1 266 ? 12.517  38.127  1.919   1.00 14.28  ? 266 SER C OG  1 
ATOM   6005  N N   . ILE C  1 267 ? 10.952  38.792  -0.868  1.00 10.87  ? 267 ILE C N   1 
ATOM   6006  C CA  . ILE C  1 267 ? 10.822  39.122  -2.256  1.00 8.74   ? 267 ILE C CA  1 
ATOM   6007  C C   . ILE C  1 267 ? 12.222  38.968  -2.805  1.00 8.79   ? 267 ILE C C   1 
ATOM   6008  O O   . ILE C  1 267 ? 13.159  39.158  -2.020  1.00 9.08   ? 267 ILE C O   1 
ATOM   6009  C CB  . ILE C  1 267 ? 10.270  40.548  -2.345  1.00 7.18   ? 267 ILE C CB  1 
ATOM   6010  C CG1 . ILE C  1 267 ? 10.006  40.825  -3.781  1.00 7.42   ? 267 ILE C CG1 1 
ATOM   6011  C CG2 . ILE C  1 267 ? 11.213  41.574  -1.782  1.00 6.26   ? 267 ILE C CG2 1 
ATOM   6012  C CD1 . ILE C  1 267 ? 9.052   42.009  -3.887  1.00 8.76   ? 267 ILE C CD1 1 
ATOM   6013  N N   . MET C  1 268 ? 12.394  38.615  -4.082  1.00 8.51   ? 268 MET C N   1 
ATOM   6014  C CA  . MET C  1 268 ? 13.712  38.441  -4.675  1.00 8.31   ? 268 MET C CA  1 
ATOM   6015  C C   . MET C  1 268 ? 13.694  38.875  -6.113  1.00 9.03   ? 268 MET C C   1 
ATOM   6016  O O   . MET C  1 268 ? 12.793  38.474  -6.822  1.00 10.59  ? 268 MET C O   1 
ATOM   6017  C CB  . MET C  1 268 ? 14.127  37.005  -4.661  1.00 6.97   ? 268 MET C CB  1 
ATOM   6018  C CG  . MET C  1 268 ? 15.514  36.873  -5.204  1.00 7.40   ? 268 MET C CG  1 
ATOM   6019  S SD  . MET C  1 268 ? 15.874  35.131  -5.408  1.00 9.17   ? 268 MET C SD  1 
ATOM   6020  C CE  . MET C  1 268 ? 16.156  34.675  -3.713  1.00 9.09   ? 268 MET C CE  1 
ATOM   6021  N N   . ARG C  1 269 ? 14.620  39.684  -6.597  1.00 9.73   ? 269 ARG C N   1 
ATOM   6022  C CA  . ARG C  1 269 ? 14.609  40.051  -8.002  1.00 10.50  ? 269 ARG C CA  1 
ATOM   6023  C C   . ARG C  1 269 ? 15.385  38.974  -8.713  1.00 11.55  ? 269 ARG C C   1 
ATOM   6024  O O   . ARG C  1 269 ? 16.503  38.662  -8.302  1.00 12.03  ? 269 ARG C O   1 
ATOM   6025  C CB  . ARG C  1 269 ? 15.321  41.341  -8.277  1.00 11.88  ? 269 ARG C CB  1 
ATOM   6026  C CG  . ARG C  1 269 ? 14.791  42.435  -7.433  1.00 13.75  ? 269 ARG C CG  1 
ATOM   6027  C CD  . ARG C  1 269 ? 15.686  43.631  -7.428  1.00 15.47  ? 269 ARG C CD  1 
ATOM   6028  N NE  . ARG C  1 269 ? 15.011  44.571  -6.566  1.00 18.33  ? 269 ARG C NE  1 
ATOM   6029  C CZ  . ARG C  1 269 ? 15.664  45.201  -5.582  1.00 21.19  ? 269 ARG C CZ  1 
ATOM   6030  N NH1 . ARG C  1 269 ? 14.950  46.022  -4.786  1.00 23.23  ? 269 ARG C NH1 1 
ATOM   6031  N NH2 . ARG C  1 269 ? 17.010  45.075  -5.426  1.00 22.36  ? 269 ARG C NH2 1 
ATOM   6032  N N   . SER C  1 270 ? 14.825  38.417  -9.770  1.00 12.72  ? 270 SER C N   1 
ATOM   6033  C CA  . SER C  1 270 ? 15.453  37.344  -10.512 1.00 13.11  ? 270 SER C CA  1 
ATOM   6034  C C   . SER C  1 270 ? 14.721  37.172  -11.827 1.00 13.96  ? 270 SER C C   1 
ATOM   6035  O O   . SER C  1 270 ? 13.493  37.330  -11.909 1.00 13.45  ? 270 SER C O   1 
ATOM   6036  C CB  . SER C  1 270 ? 15.382  36.033  -9.722  1.00 12.55  ? 270 SER C CB  1 
ATOM   6037  O OG  . SER C  1 270 ? 15.756  34.935  -10.543 1.00 11.39  ? 270 SER C OG  1 
ATOM   6038  N N   . ASP C  1 271 ? 15.460  36.819  -12.870 1.00 15.27  ? 271 ASP C N   1 
ATOM   6039  C CA  . ASP C  1 271 ? 14.814  36.500  -14.125 1.00 15.99  ? 271 ASP C CA  1 
ATOM   6040  C C   . ASP C  1 271 ? 14.914  35.017  -14.372 1.00 15.69  ? 271 ASP C C   1 
ATOM   6041  O O   . ASP C  1 271 ? 14.519  34.509  -15.417 1.00 16.49  ? 271 ASP C O   1 
ATOM   6042  C CB  . ASP C  1 271 ? 15.445  37.239  -15.278 1.00 16.65  ? 271 ASP C CB  1 
ATOM   6043  C CG  . ASP C  1 271 ? 15.124  38.714  -15.227 1.00 17.92  ? 271 ASP C CG  1 
ATOM   6044  O OD1 . ASP C  1 271 ? 16.058  39.490  -15.199 1.00 19.23  ? 271 ASP C OD1 1 
ATOM   6045  O OD2 . ASP C  1 271 ? 13.970  39.141  -15.205 1.00 19.02  ? 271 ASP C OD2 1 
ATOM   6046  N N   . ALA C  1 272 ? 15.376  34.264  -13.386 1.00 14.68  ? 272 ALA C N   1 
ATOM   6047  C CA  . ALA C  1 272 ? 15.436  32.837  -13.544 1.00 14.94  ? 272 ALA C CA  1 
ATOM   6048  C C   . ALA C  1 272 ? 14.039  32.267  -13.719 1.00 15.28  ? 272 ALA C C   1 
ATOM   6049  O O   . ALA C  1 272 ? 13.101  32.739  -13.069 1.00 15.46  ? 272 ALA C O   1 
ATOM   6050  C CB  . ALA C  1 272 ? 16.031  32.186  -12.325 1.00 15.65  ? 272 ALA C CB  1 
ATOM   6051  N N   . PRO C  1 273 ? 13.817  31.362  -14.665 1.00 15.77  ? 273 PRO C N   1 
ATOM   6052  C CA  . PRO C  1 273 ? 12.558  30.702  -14.911 1.00 16.21  ? 273 PRO C CA  1 
ATOM   6053  C C   . PRO C  1 273 ? 12.179  29.865  -13.727 1.00 17.42  ? 273 PRO C C   1 
ATOM   6054  O O   . PRO C  1 273 ? 13.069  29.255  -13.126 1.00 17.47  ? 273 PRO C O   1 
ATOM   6055  C CB  . PRO C  1 273 ? 12.800  29.864  -16.112 1.00 16.79  ? 273 PRO C CB  1 
ATOM   6056  C CG  . PRO C  1 273 ? 14.296  29.679  -16.129 1.00 16.48  ? 273 PRO C CG  1 
ATOM   6057  C CD  . PRO C  1 273 ? 14.691  31.103  -15.798 1.00 16.13  ? 273 PRO C CD  1 
ATOM   6058  N N   . ILE C  1 274 ? 10.891  29.843  -13.399 1.00 19.36  ? 274 ILE C N   1 
ATOM   6059  C CA  . ILE C  1 274 ? 10.408  28.975  -12.339 1.00 21.30  ? 274 ILE C CA  1 
ATOM   6060  C C   . ILE C  1 274 ? 10.121  27.648  -13.004 1.00 24.04  ? 274 ILE C C   1 
ATOM   6061  O O   . ILE C  1 274 ? 9.594   27.626  -14.117 1.00 24.64  ? 274 ILE C O   1 
ATOM   6062  C CB  . ILE C  1 274 ? 9.157   29.548  -11.729 1.00 20.18  ? 274 ILE C CB  1 
ATOM   6063  C CG1 . ILE C  1 274 ? 9.577   30.779  -10.958 1.00 20.78  ? 274 ILE C CG1 1 
ATOM   6064  C CG2 . ILE C  1 274 ? 8.456   28.543  -10.845 1.00 19.64  ? 274 ILE C CG2 1 
ATOM   6065  C CD1 . ILE C  1 274 ? 8.381   31.635  -10.546 1.00 21.15  ? 274 ILE C CD1 1 
ATOM   6066  N N   . ASP C  1 275 ? 10.475  26.553  -12.359 1.00 27.21  ? 275 ASP C N   1 
ATOM   6067  C CA  . ASP C  1 275 ? 10.317  25.253  -12.955 1.00 29.41  ? 275 ASP C CA  1 
ATOM   6068  C C   . ASP C  1 275 ? 9.834   24.317  -11.874 1.00 29.38  ? 275 ASP C C   1 
ATOM   6069  O O   . ASP C  1 275 ? 9.897   24.637  -10.671 1.00 29.35  ? 275 ASP C O   1 
ATOM   6070  C CB  . ASP C  1 275 ? 11.660  24.836  -13.521 1.00 31.82  ? 275 ASP C CB  1 
ATOM   6071  C CG  . ASP C  1 275 ? 11.711  23.468  -14.187 1.00 34.71  ? 275 ASP C CG  1 
ATOM   6072  O OD1 . ASP C  1 275 ? 10.677  22.937  -14.616 1.00 35.94  ? 275 ASP C OD1 1 
ATOM   6073  O OD2 . ASP C  1 275 ? 12.822  22.945  -14.304 1.00 36.25  ? 275 ASP C OD2 1 
ATOM   6074  N N   . THR C  1 276 ? 9.286   23.187  -12.272 1.00 29.23  ? 276 THR C N   1 
ATOM   6075  C CA  . THR C  1 276 ? 8.752   22.301  -11.290 1.00 30.00  ? 276 THR C CA  1 
ATOM   6076  C C   . THR C  1 276 ? 9.819   21.346  -10.885 1.00 29.91  ? 276 THR C C   1 
ATOM   6077  O O   . THR C  1 276 ? 10.262  20.538  -11.697 1.00 31.47  ? 276 THR C O   1 
ATOM   6078  C CB  . THR C  1 276 ? 7.577   21.556  -11.842 1.00 30.45  ? 276 THR C CB  1 
ATOM   6079  O OG1 . THR C  1 276 ? 6.726   22.519  -12.469 1.00 32.19  ? 276 THR C OG1 1 
ATOM   6080  C CG2 . THR C  1 276 ? 6.844   20.813  -10.726 1.00 30.59  ? 276 THR C CG2 1 
ATOM   6081  N N   . CYS C  1 277 ? 10.212  21.460  -9.633  1.00 28.92  ? 277 CYS C N   1 
ATOM   6082  C CA  . CYS C  1 277 ? 11.234  20.617  -9.048  1.00 28.52  ? 277 CYS C CA  1 
ATOM   6083  C C   . CYS C  1 277 ? 11.336  21.025  -7.623  1.00 28.43  ? 277 CYS C C   1 
ATOM   6084  O O   . CYS C  1 277 ? 10.760  22.059  -7.265  1.00 29.44  ? 277 CYS C O   1 
ATOM   6085  C CB  . CYS C  1 277 ? 12.588  20.807  -9.688  1.00 28.28  ? 277 CYS C CB  1 
ATOM   6086  S SG  . CYS C  1 277 ? 12.988  22.519  -10.035 1.00 27.86  ? 277 CYS C SG  1 
ATOM   6087  N N   . ILE C  1 278 ? 12.032  20.272  -6.792  1.00 28.17  ? 278 ILE C N   1 
ATOM   6088  C CA  . ILE C  1 278 ? 12.031  20.636  -5.397  1.00 28.05  ? 278 ILE C CA  1 
ATOM   6089  C C   . ILE C  1 278 ? 13.450  20.904  -4.984  1.00 27.58  ? 278 ILE C C   1 
ATOM   6090  O O   . ILE C  1 278 ? 14.336  20.118  -5.305  1.00 27.97  ? 278 ILE C O   1 
ATOM   6091  C CB  . ILE C  1 278 ? 11.311  19.498  -4.577  1.00 27.98  ? 278 ILE C CB  1 
ATOM   6092  C CG1 . ILE C  1 278 ? 11.698  19.640  -3.120  1.00 28.35  ? 278 ILE C CG1 1 
ATOM   6093  C CG2 . ILE C  1 278 ? 11.607  18.118  -5.134  1.00 27.46  ? 278 ILE C CG2 1 
ATOM   6094  C CD1 . ILE C  1 278 ? 10.779  18.803  -2.200  1.00 29.40  ? 278 ILE C CD1 1 
ATOM   6095  N N   . SER C  1 279 ? 13.642  22.083  -4.408  1.00 27.07  ? 279 SER C N   1 
ATOM   6096  C CA  . SER C  1 279 ? 14.928  22.557  -3.956  1.00 26.20  ? 279 SER C CA  1 
ATOM   6097  C C   . SER C  1 279 ? 14.664  23.555  -2.855  1.00 25.28  ? 279 SER C C   1 
ATOM   6098  O O   . SER C  1 279 ? 13.831  24.441  -3.024  1.00 25.34  ? 279 SER C O   1 
ATOM   6099  C CB  . SER C  1 279 ? 15.658  23.240  -5.075  1.00 25.63  ? 279 SER C CB  1 
ATOM   6100  O OG  . SER C  1 279 ? 16.940  23.654  -4.623  1.00 27.52  ? 279 SER C OG  1 
ATOM   6101  N N   . GLU C  1 280 ? 15.358  23.454  -1.729  1.00 24.54  ? 280 GLU C N   1 
ATOM   6102  C CA  . GLU C  1 280 ? 15.074  24.362  -0.640  1.00 24.12  ? 280 GLU C CA  1 
ATOM   6103  C C   . GLU C  1 280 ? 15.874  25.644  -0.675  1.00 21.63  ? 280 GLU C C   1 
ATOM   6104  O O   . GLU C  1 280 ? 15.494  26.618  -0.015  1.00 21.79  ? 280 GLU C O   1 
ATOM   6105  C CB  . GLU C  1 280 ? 15.349  23.707  0.649   1.00 27.21  ? 280 GLU C CB  1 
ATOM   6106  C CG  . GLU C  1 280 ? 14.587  22.421  0.709   1.00 31.22  ? 280 GLU C CG  1 
ATOM   6107  C CD  . GLU C  1 280 ? 14.491  21.991  2.146   1.00 34.66  ? 280 GLU C CD  1 
ATOM   6108  O OE1 . GLU C  1 280 ? 15.449  21.344  2.615   1.00 36.36  ? 280 GLU C OE1 1 
ATOM   6109  O OE2 . GLU C  1 280 ? 13.471  22.341  2.765   1.00 36.19  ? 280 GLU C OE2 1 
ATOM   6110  N N   . CYS C  1 281 ? 16.997  25.645  -1.382  1.00 17.31  ? 281 CYS C N   1 
ATOM   6111  C CA  . CYS C  1 281 ? 17.797  26.826  -1.426  1.00 13.91  ? 281 CYS C CA  1 
ATOM   6112  C C   . CYS C  1 281 ? 17.538  27.530  -2.721  1.00 12.82  ? 281 CYS C C   1 
ATOM   6113  O O   . CYS C  1 281 ? 17.618  26.893  -3.781  1.00 11.59  ? 281 CYS C O   1 
ATOM   6114  C CB  . CYS C  1 281 ? 19.257  26.462  -1.336  1.00 12.96  ? 281 CYS C CB  1 
ATOM   6115  S SG  . CYS C  1 281 ? 20.292  27.943  -1.540  1.00 9.67   ? 281 CYS C SG  1 
ATOM   6116  N N   . ILE C  1 282 ? 17.191  28.812  -2.656  1.00 12.57  ? 282 ILE C N   1 
ATOM   6117  C CA  . ILE C  1 282 ? 16.974  29.604  -3.867  1.00 11.69  ? 282 ILE C CA  1 
ATOM   6118  C C   . ILE C  1 282 ? 17.922  30.787  -3.865  1.00 11.26  ? 282 ILE C C   1 
ATOM   6119  O O   . ILE C  1 282 ? 18.098  31.442  -2.833  1.00 12.42  ? 282 ILE C O   1 
ATOM   6120  C CB  . ILE C  1 282 ? 15.527  30.141  -3.939  1.00 11.24  ? 282 ILE C CB  1 
ATOM   6121  C CG1 . ILE C  1 282 ? 14.569  28.985  -4.011  1.00 11.07  ? 282 ILE C CG1 1 
ATOM   6122  C CG2 . ILE C  1 282 ? 15.343  31.025  -5.165  1.00 10.14  ? 282 ILE C CG2 1 
ATOM   6123  C CD1 . ILE C  1 282 ? 13.175  29.461  -3.589  1.00 11.57  ? 282 ILE C CD1 1 
ATOM   6124  N N   . THR C  1 283 ? 18.570  31.037  -4.983  1.00 9.88   ? 283 THR C N   1 
ATOM   6125  C CA  . THR C  1 283 ? 19.359  32.233  -5.131  1.00 9.98   ? 283 THR C CA  1 
ATOM   6126  C C   . THR C  1 283 ? 18.752  32.885  -6.369  1.00 11.55  ? 283 THR C C   1 
ATOM   6127  O O   . THR C  1 283 ? 17.983  32.225  -7.081  1.00 11.98  ? 283 THR C O   1 
ATOM   6128  C CB  . THR C  1 283 ? 20.852  31.924  -5.402  1.00 9.36   ? 283 THR C CB  1 
ATOM   6129  O OG1 . THR C  1 283 ? 20.953  31.408  -6.726  1.00 8.53   ? 283 THR C OG1 1 
ATOM   6130  C CG2 . THR C  1 283 ? 21.434  30.933  -4.421  1.00 9.54   ? 283 THR C CG2 1 
ATOM   6131  N N   . PRO C  1 284 ? 19.031  34.140  -6.728  1.00 12.14  ? 284 PRO C N   1 
ATOM   6132  C CA  . PRO C  1 284 ? 18.491  34.744  -7.921  1.00 12.25  ? 284 PRO C CA  1 
ATOM   6133  C C   . PRO C  1 284 ? 19.011  34.068  -9.166  1.00 13.47  ? 284 PRO C C   1 
ATOM   6134  O O   . PRO C  1 284 ? 18.450  34.307  -10.238 1.00 13.86  ? 284 PRO C O   1 
ATOM   6135  C CB  . PRO C  1 284 ? 18.870  36.178  -7.834  1.00 11.65  ? 284 PRO C CB  1 
ATOM   6136  C CG  . PRO C  1 284 ? 19.959  36.188  -6.826  1.00 12.47  ? 284 PRO C CG  1 
ATOM   6137  C CD  . PRO C  1 284 ? 19.441  35.190  -5.828  1.00 12.36  ? 284 PRO C CD  1 
ATOM   6138  N N   . ASN C  1 285 ? 20.033  33.213  -9.059  1.00 14.96  ? 285 ASN C N   1 
ATOM   6139  C CA  . ASN C  1 285 ? 20.529  32.494  -10.226 1.00 16.92  ? 285 ASN C CA  1 
ATOM   6140  C C   . ASN C  1 285 ? 19.788  31.202  -10.436 1.00 14.85  ? 285 ASN C C   1 
ATOM   6141  O O   . ASN C  1 285 ? 20.086  30.478  -11.372 1.00 14.73  ? 285 ASN C O   1 
ATOM   6142  C CB  . ASN C  1 285 ? 21.970  32.079  -10.121 1.00 21.34  ? 285 ASN C CB  1 
ATOM   6143  C CG  . ASN C  1 285 ? 22.903  33.211  -9.834  1.00 25.83  ? 285 ASN C CG  1 
ATOM   6144  O OD1 . ASN C  1 285 ? 22.641  34.029  -8.952  1.00 26.63  ? 285 ASN C OD1 1 
ATOM   6145  N ND2 . ASN C  1 285 ? 24.031  33.270  -10.519 1.00 30.37  ? 285 ASN C ND2 1 
ATOM   6146  N N   . GLY C  1 286 ? 18.840  30.862  -9.593  1.00 12.95  ? 286 GLY C N   1 
ATOM   6147  C CA  . GLY C  1 286 ? 18.178  29.592  -9.710  1.00 12.17  ? 286 GLY C CA  1 
ATOM   6148  C C   . GLY C  1 286 ? 18.471  28.841  -8.442  1.00 12.48  ? 286 GLY C C   1 
ATOM   6149  O O   . GLY C  1 286 ? 19.190  29.337  -7.563  1.00 13.29  ? 286 GLY C O   1 
ATOM   6150  N N   . SER C  1 287 ? 17.923  27.661  -8.284  1.00 12.85  ? 287 SER C N   1 
ATOM   6151  C CA  . SER C  1 287 ? 18.132  26.924  -7.062  1.00 14.30  ? 287 SER C CA  1 
ATOM   6152  C C   . SER C  1 287 ? 19.433  26.153  -7.086  1.00 14.13  ? 287 SER C C   1 
ATOM   6153  O O   . SER C  1 287 ? 19.976  25.885  -8.168  1.00 13.89  ? 287 SER C O   1 
ATOM   6154  C CB  . SER C  1 287 ? 16.932  26.037  -6.890  1.00 14.88  ? 287 SER C CB  1 
ATOM   6155  O OG  . SER C  1 287 ? 15.783  26.843  -6.611  1.00 15.17  ? 287 SER C OG  1 
ATOM   6156  N N   . ILE C  1 288 ? 19.975  25.899  -5.900  1.00 14.41  ? 288 ILE C N   1 
ATOM   6157  C CA  . ILE C  1 288 ? 21.253  25.228  -5.754  1.00 15.78  ? 288 ILE C CA  1 
ATOM   6158  C C   . ILE C  1 288 ? 21.096  24.163  -4.672  1.00 17.14  ? 288 ILE C C   1 
ATOM   6159  O O   . ILE C  1 288 ? 20.234  24.305  -3.799  1.00 18.57  ? 288 ILE C O   1 
ATOM   6160  C CB  . ILE C  1 288 ? 22.395  26.212  -5.338  1.00 15.07  ? 288 ILE C CB  1 
ATOM   6161  C CG1 . ILE C  1 288 ? 22.100  26.890  -4.020  1.00 15.15  ? 288 ILE C CG1 1 
ATOM   6162  C CG2 . ILE C  1 288 ? 22.576  27.232  -6.438  1.00 14.23  ? 288 ILE C CG2 1 
ATOM   6163  C CD1 . ILE C  1 288 ? 23.193  27.857  -3.579  1.00 16.54  ? 288 ILE C CD1 1 
ATOM   6164  N N   . PRO C  1 289 ? 21.817  23.048  -4.707  1.00 17.40  ? 289 PRO C N   1 
ATOM   6165  C CA  . PRO C  1 289 ? 21.712  22.019  -3.700  1.00 18.16  ? 289 PRO C CA  1 
ATOM   6166  C C   . PRO C  1 289 ? 22.471  22.342  -2.427  1.00 20.02  ? 289 PRO C C   1 
ATOM   6167  O O   . PRO C  1 289 ? 23.678  22.646  -2.417  1.00 20.60  ? 289 PRO C O   1 
ATOM   6168  C CB  . PRO C  1 289 ? 22.214  20.819  -4.393  1.00 18.10  ? 289 PRO C CB  1 
ATOM   6169  C CG  . PRO C  1 289 ? 23.268  21.392  -5.296  1.00 17.38  ? 289 PRO C CG  1 
ATOM   6170  C CD  . PRO C  1 289 ? 22.517  22.550  -5.876  1.00 16.93  ? 289 PRO C CD  1 
ATOM   6171  N N   . ASN C  1 290 ? 21.760  22.222  -1.316  1.00 20.78  ? 290 ASN C N   1 
ATOM   6172  C CA  . ASN C  1 290 ? 22.365  22.520  -0.043  1.00 21.92  ? 290 ASN C CA  1 
ATOM   6173  C C   . ASN C  1 290 ? 23.065  21.320  0.572   1.00 22.19  ? 290 ASN C C   1 
ATOM   6174  O O   . ASN C  1 290 ? 23.044  21.185  1.799   1.00 23.08  ? 290 ASN C O   1 
ATOM   6175  C CB  . ASN C  1 290 ? 21.304  23.054  0.924   1.00 22.75  ? 290 ASN C CB  1 
ATOM   6176  C CG  . ASN C  1 290 ? 20.156  22.102  1.171   1.00 23.19  ? 290 ASN C CG  1 
ATOM   6177  O OD1 . ASN C  1 290 ? 20.041  21.093  0.478   1.00 23.75  ? 290 ASN C OD1 1 
ATOM   6178  N ND2 . ASN C  1 290 ? 19.226  22.424  2.062   1.00 23.74  ? 290 ASN C ND2 1 
ATOM   6179  N N   . ASP C  1 291 ? 23.662  20.437  -0.231  1.00 21.77  ? 291 ASP C N   1 
ATOM   6180  C CA  . ASP C  1 291 ? 24.429  19.351  0.336   1.00 22.22  ? 291 ASP C CA  1 
ATOM   6181  C C   . ASP C  1 291 ? 25.734  19.905  0.882   1.00 20.16  ? 291 ASP C C   1 
ATOM   6182  O O   . ASP C  1 291 ? 26.160  19.589  1.982   1.00 21.10  ? 291 ASP C O   1 
ATOM   6183  C CB  . ASP C  1 291 ? 24.717  18.257  -0.716  1.00 25.48  ? 291 ASP C CB  1 
ATOM   6184  C CG  . ASP C  1 291 ? 25.083  18.685  -2.149  1.00 28.66  ? 291 ASP C CG  1 
ATOM   6185  O OD1 . ASP C  1 291 ? 26.216  19.080  -2.436  1.00 30.56  ? 291 ASP C OD1 1 
ATOM   6186  O OD2 . ASP C  1 291 ? 24.236  18.601  -3.029  1.00 30.10  ? 291 ASP C OD2 1 
ATOM   6187  N N   . LYS C  1 292 ? 26.415  20.779  0.163   1.00 17.81  ? 292 LYS C N   1 
ATOM   6188  C CA  . LYS C  1 292 ? 27.680  21.313  0.637   1.00 15.32  ? 292 LYS C CA  1 
ATOM   6189  C C   . LYS C  1 292 ? 27.517  22.400  1.692   1.00 13.56  ? 292 LYS C C   1 
ATOM   6190  O O   . LYS C  1 292 ? 26.503  23.090  1.687   1.00 14.44  ? 292 LYS C O   1 
ATOM   6191  C CB  . LYS C  1 292 ? 28.392  21.844  -0.536  1.00 15.79  ? 292 LYS C CB  1 
ATOM   6192  C CG  . LYS C  1 292 ? 28.845  20.704  -1.366  1.00 16.66  ? 292 LYS C CG  1 
ATOM   6193  C CD  . LYS C  1 292 ? 29.098  21.345  -2.697  1.00 17.42  ? 292 LYS C CD  1 
ATOM   6194  C CE  . LYS C  1 292 ? 29.432  20.313  -3.741  1.00 18.66  ? 292 LYS C CE  1 
ATOM   6195  N NZ  . LYS C  1 292 ? 28.363  19.322  -3.811  1.00 21.17  ? 292 LYS C NZ  1 
ATOM   6196  N N   . PRO C  1 293 ? 28.454  22.625  2.613   1.00 11.00  ? 293 PRO C N   1 
ATOM   6197  C CA  . PRO C  1 293 ? 28.329  23.650  3.630   1.00 9.94   ? 293 PRO C CA  1 
ATOM   6198  C C   . PRO C  1 293 ? 28.465  25.084  3.128   1.00 8.56   ? 293 PRO C C   1 
ATOM   6199  O O   . PRO C  1 293 ? 27.976  26.029  3.761   1.00 7.89   ? 293 PRO C O   1 
ATOM   6200  C CB  . PRO C  1 293 ? 29.379  23.304  4.646   1.00 9.52   ? 293 PRO C CB  1 
ATOM   6201  C CG  . PRO C  1 293 ? 30.418  22.671  3.796   1.00 10.07  ? 293 PRO C CG  1 
ATOM   6202  C CD  . PRO C  1 293 ? 29.585  21.781  2.908   1.00 10.40  ? 293 PRO C CD  1 
ATOM   6203  N N   . PHE C  1 294 ? 29.133  25.299  2.019   1.00 7.17   ? 294 PHE C N   1 
ATOM   6204  C CA  . PHE C  1 294 ? 29.401  26.646  1.573   1.00 6.70   ? 294 PHE C CA  1 
ATOM   6205  C C   . PHE C  1 294 ? 29.011  26.745  0.118   1.00 6.65   ? 294 PHE C C   1 
ATOM   6206  O O   . PHE C  1 294 ? 28.881  25.721  -0.540  1.00 6.92   ? 294 PHE C O   1 
ATOM   6207  C CB  . PHE C  1 294 ? 30.898  26.998  1.727   1.00 5.17   ? 294 PHE C CB  1 
ATOM   6208  C CG  . PHE C  1 294 ? 31.372  26.898  3.168   1.00 4.34   ? 294 PHE C CG  1 
ATOM   6209  C CD1 . PHE C  1 294 ? 32.276  25.916  3.521   1.00 3.96   ? 294 PHE C CD1 1 
ATOM   6210  C CD2 . PHE C  1 294 ? 30.910  27.793  4.115   1.00 3.90   ? 294 PHE C CD2 1 
ATOM   6211  C CE1 . PHE C  1 294 ? 32.727  25.833  4.817   1.00 3.20   ? 294 PHE C CE1 1 
ATOM   6212  C CE2 . PHE C  1 294 ? 31.359  27.703  5.416   1.00 3.81   ? 294 PHE C CE2 1 
ATOM   6213  C CZ  . PHE C  1 294 ? 32.271  26.726  5.760   1.00 3.48   ? 294 PHE C CZ  1 
ATOM   6214  N N   . GLN C  1 295 ? 28.808  27.941  -0.415  1.00 6.27   ? 295 GLN C N   1 
ATOM   6215  C CA  . GLN C  1 295 ? 28.412  28.105  -1.790  1.00 5.04   ? 295 GLN C CA  1 
ATOM   6216  C C   . GLN C  1 295 ? 29.015  29.380  -2.288  1.00 5.67   ? 295 GLN C C   1 
ATOM   6217  O O   . GLN C  1 295 ? 29.385  30.271  -1.530  1.00 6.03   ? 295 GLN C O   1 
ATOM   6218  C CB  . GLN C  1 295 ? 26.892  28.184  -1.937  1.00 4.05   ? 295 GLN C CB  1 
ATOM   6219  C CG  . GLN C  1 295 ? 26.223  29.263  -1.116  1.00 3.17   ? 295 GLN C CG  1 
ATOM   6220  C CD  . GLN C  1 295 ? 25.816  30.479  -1.900  1.00 2.21   ? 295 GLN C CD  1 
ATOM   6221  O OE1 . GLN C  1 295 ? 26.149  30.677  -3.061  1.00 2.00   ? 295 GLN C OE1 1 
ATOM   6222  N NE2 . GLN C  1 295 ? 25.056  31.310  -1.235  1.00 2.31   ? 295 GLN C NE2 1 
ATOM   6223  N N   . ASN C  1 296 ? 29.089  29.482  -3.583  1.00 7.13   ? 296 ASN C N   1 
ATOM   6224  C CA  . ASN C  1 296 ? 29.653  30.640  -4.226  1.00 7.29   ? 296 ASN C CA  1 
ATOM   6225  C C   . ASN C  1 296 ? 28.771  31.117  -5.394  1.00 6.62   ? 296 ASN C C   1 
ATOM   6226  O O   . ASN C  1 296 ? 29.154  31.965  -6.195  1.00 5.75   ? 296 ASN C O   1 
ATOM   6227  C CB  . ASN C  1 296 ? 31.016  30.180  -4.614  1.00 7.93   ? 296 ASN C CB  1 
ATOM   6228  C CG  . ASN C  1 296 ? 31.803  31.255  -5.299  1.00 9.71   ? 296 ASN C CG  1 
ATOM   6229  O OD1 . ASN C  1 296 ? 32.183  31.024  -6.428  1.00 10.80  ? 296 ASN C OD1 1 
ATOM   6230  N ND2 . ASN C  1 296 ? 32.112  32.416  -4.729  1.00 11.19  ? 296 ASN C ND2 1 
ATOM   6231  N N   . VAL C  1 297 ? 27.516  30.645  -5.466  1.00 5.55   ? 297 VAL C N   1 
ATOM   6232  C CA  . VAL C  1 297 ? 26.628  31.002  -6.546  1.00 5.08   ? 297 VAL C CA  1 
ATOM   6233  C C   . VAL C  1 297 ? 26.193  32.451  -6.420  1.00 6.33   ? 297 VAL C C   1 
ATOM   6234  O O   . VAL C  1 297 ? 26.343  33.235  -7.351  1.00 6.96   ? 297 VAL C O   1 
ATOM   6235  C CB  . VAL C  1 297 ? 25.444  30.038  -6.524  1.00 4.92   ? 297 VAL C CB  1 
ATOM   6236  C CG1 . VAL C  1 297 ? 24.291  30.472  -7.413  1.00 4.70   ? 297 VAL C CG1 1 
ATOM   6237  C CG2 . VAL C  1 297 ? 25.955  28.725  -7.049  1.00 3.91   ? 297 VAL C CG2 1 
ATOM   6238  N N   . ASN C  1 298 ? 25.674  32.862  -5.273  1.00 7.84   ? 298 ASN C N   1 
ATOM   6239  C CA  . ASN C  1 298 ? 25.203  34.225  -5.099  1.00 8.71   ? 298 ASN C CA  1 
ATOM   6240  C C   . ASN C  1 298 ? 25.068  34.508  -3.604  1.00 9.89   ? 298 ASN C C   1 
ATOM   6241  O O   . ASN C  1 298 ? 24.852  33.583  -2.811  1.00 10.63  ? 298 ASN C O   1 
ATOM   6242  C CB  . ASN C  1 298 ? 23.840  34.421  -5.787  1.00 8.32   ? 298 ASN C CB  1 
ATOM   6243  C CG  . ASN C  1 298 ? 23.569  35.885  -6.062  1.00 8.79   ? 298 ASN C CG  1 
ATOM   6244  O OD1 . ASN C  1 298 ? 23.716  36.724  -5.169  1.00 10.42  ? 298 ASN C OD1 1 
ATOM   6245  N ND2 . ASN C  1 298 ? 23.226  36.309  -7.265  1.00 8.51   ? 298 ASN C ND2 1 
ATOM   6246  N N   . LYS C  1 299 ? 25.247  35.773  -3.196  1.00 10.10  ? 299 LYS C N   1 
ATOM   6247  C CA  . LYS C  1 299 ? 25.158  36.163  -1.802  1.00 10.33  ? 299 LYS C CA  1 
ATOM   6248  C C   . LYS C  1 299 ? 23.719  36.405  -1.432  1.00 10.09  ? 299 LYS C C   1 
ATOM   6249  O O   . LYS C  1 299 ? 23.416  36.644  -0.258  1.00 12.39  ? 299 LYS C O   1 
ATOM   6250  C CB  . LYS C  1 299 ? 25.947  37.437  -1.524  1.00 11.57  ? 299 LYS C CB  1 
ATOM   6251  C CG  . LYS C  1 299 ? 25.326  38.741  -2.030  1.00 13.25  ? 299 LYS C CG  1 
ATOM   6252  C CD  . LYS C  1 299 ? 26.251  39.952  -1.846  1.00 14.16  ? 299 LYS C CD  1 
ATOM   6253  C CE  . LYS C  1 299 ? 26.881  40.394  -3.177  1.00 14.39  ? 299 LYS C CE  1 
ATOM   6254  N NZ  . LYS C  1 299 ? 25.904  40.917  -4.132  1.00 15.97  ? 299 LYS C NZ  1 
ATOM   6255  N N   . ILE C  1 300 ? 22.817  36.443  -2.400  1.00 9.19   ? 300 ILE C N   1 
ATOM   6256  C CA  . ILE C  1 300 ? 21.394  36.641  -2.142  1.00 8.65   ? 300 ILE C CA  1 
ATOM   6257  C C   . ILE C  1 300 ? 20.775  35.258  -2.090  1.00 9.79   ? 300 ILE C C   1 
ATOM   6258  O O   . ILE C  1 300 ? 21.010  34.473  -3.016  1.00 11.08  ? 300 ILE C O   1 
ATOM   6259  C CB  . ILE C  1 300 ? 20.836  37.474  -3.273  1.00 6.63   ? 300 ILE C CB  1 
ATOM   6260  C CG1 . ILE C  1 300 ? 21.392  38.843  -3.109  1.00 6.46   ? 300 ILE C CG1 1 
ATOM   6261  C CG2 . ILE C  1 300 ? 19.349  37.543  -3.249  1.00 6.50   ? 300 ILE C CG2 1 
ATOM   6262  C CD1 . ILE C  1 300 ? 21.471  39.577  -4.423  1.00 5.02   ? 300 ILE C CD1 1 
ATOM   6263  N N   . THR C  1 301 ? 20.027  34.903  -1.046  1.00 9.26   ? 301 THR C N   1 
ATOM   6264  C CA  . THR C  1 301 ? 19.516  33.543  -0.947  1.00 8.30   ? 301 THR C CA  1 
ATOM   6265  C C   . THR C  1 301 ? 18.207  33.567  -0.178  1.00 7.87   ? 301 THR C C   1 
ATOM   6266  O O   . THR C  1 301 ? 17.933  34.568  0.505   1.00 8.67   ? 301 THR C O   1 
ATOM   6267  C CB  . THR C  1 301 ? 20.543  32.617  -0.219  1.00 7.90   ? 301 THR C CB  1 
ATOM   6268  O OG1 . THR C  1 301 ? 20.880  33.321  0.966   1.00 9.28   ? 301 THR C OG1 1 
ATOM   6269  C CG2 . THR C  1 301 ? 21.855  32.347  -0.956  1.00 6.84   ? 301 THR C CG2 1 
ATOM   6270  N N   . TYR C  1 302 ? 17.387  32.528  -0.323  1.00 6.59   ? 302 TYR C N   1 
ATOM   6271  C CA  . TYR C  1 302 ? 16.150  32.383  0.428   1.00 5.72   ? 302 TYR C CA  1 
ATOM   6272  C C   . TYR C  1 302 ? 16.070  30.905  0.775   1.00 5.78   ? 302 TYR C C   1 
ATOM   6273  O O   . TYR C  1 302 ? 16.345  30.075  -0.098  1.00 5.84   ? 302 TYR C O   1 
ATOM   6274  C CB  . TYR C  1 302 ? 14.926  32.792  -0.423  1.00 3.89   ? 302 TYR C CB  1 
ATOM   6275  C CG  . TYR C  1 302 ? 13.618  32.575  0.305   1.00 2.34   ? 302 TYR C CG  1 
ATOM   6276  C CD1 . TYR C  1 302 ? 12.935  31.404  0.106   1.00 2.20   ? 302 TYR C CD1 1 
ATOM   6277  C CD2 . TYR C  1 302 ? 13.145  33.500  1.197   1.00 2.54   ? 302 TYR C CD2 1 
ATOM   6278  C CE1 . TYR C  1 302 ? 11.782  31.133  0.793   1.00 2.55   ? 302 TYR C CE1 1 
ATOM   6279  C CE2 . TYR C  1 302 ? 11.983  33.240  1.893   1.00 3.92   ? 302 TYR C CE2 1 
ATOM   6280  C CZ  . TYR C  1 302 ? 11.315  32.041  1.687   1.00 3.46   ? 302 TYR C CZ  1 
ATOM   6281  O OH  . TYR C  1 302 ? 10.200  31.691  2.417   1.00 2.92   ? 302 TYR C OH  1 
ATOM   6282  N N   . GLY C  1 303 ? 15.731  30.532  2.004   1.00 5.82   ? 303 GLY C N   1 
ATOM   6283  C CA  . GLY C  1 303 ? 15.576  29.113  2.338   1.00 5.47   ? 303 GLY C CA  1 
ATOM   6284  C C   . GLY C  1 303 ? 16.800  28.491  3.000   1.00 4.74   ? 303 GLY C C   1 
ATOM   6285  O O   . GLY C  1 303 ? 17.682  29.205  3.477   1.00 6.52   ? 303 GLY C O   1 
ATOM   6286  N N   . ALA C  1 304 ? 16.886  27.167  3.077   1.00 4.06   ? 304 ALA C N   1 
ATOM   6287  C CA  . ALA C  1 304 ? 18.015  26.488  3.711   1.00 3.77   ? 304 ALA C CA  1 
ATOM   6288  C C   . ALA C  1 304 ? 19.204  26.421  2.783   1.00 3.39   ? 304 ALA C C   1 
ATOM   6289  O O   . ALA C  1 304 ? 19.357  25.462  2.042   1.00 2.84   ? 304 ALA C O   1 
ATOM   6290  C CB  . ALA C  1 304 ? 17.631  25.065  4.087   1.00 3.51   ? 304 ALA C CB  1 
ATOM   6291  N N   . CYS C  1 305 ? 20.102  27.370  2.805   1.00 4.45   ? 305 CYS C N   1 
ATOM   6292  C CA  . CYS C  1 305 ? 21.179  27.403  1.835   1.00 5.68   ? 305 CYS C CA  1 
ATOM   6293  C C   . CYS C  1 305 ? 22.586  27.271  2.382   1.00 5.88   ? 305 CYS C C   1 
ATOM   6294  O O   . CYS C  1 305 ? 22.820  27.413  3.578   1.00 7.52   ? 305 CYS C O   1 
ATOM   6295  C CB  . CYS C  1 305 ? 21.126  28.695  1.103   1.00 7.31   ? 305 CYS C CB  1 
ATOM   6296  S SG  . CYS C  1 305 ? 19.622  28.841  0.145   1.00 9.50   ? 305 CYS C SG  1 
ATOM   6297  N N   . PRO C  1 306 ? 23.574  26.952  1.567   1.00 5.42   ? 306 PRO C N   1 
ATOM   6298  C CA  . PRO C  1 306 ? 24.942  26.896  2.021   1.00 6.45   ? 306 PRO C CA  1 
ATOM   6299  C C   . PRO C  1 306 ? 25.408  28.343  2.280   1.00 7.36   ? 306 PRO C C   1 
ATOM   6300  O O   . PRO C  1 306 ? 24.836  29.305  1.734   1.00 7.20   ? 306 PRO C O   1 
ATOM   6301  C CB  . PRO C  1 306 ? 25.676  26.229  0.906   1.00 6.18   ? 306 PRO C CB  1 
ATOM   6302  C CG  . PRO C  1 306 ? 24.601  25.387  0.295   1.00 5.72   ? 306 PRO C CG  1 
ATOM   6303  C CD  . PRO C  1 306 ? 23.444  26.327  0.266   1.00 5.45   ? 306 PRO C CD  1 
ATOM   6304  N N   . LYS C  1 307 ? 26.461  28.545  3.081   1.00 7.73   ? 307 LYS C N   1 
ATOM   6305  C CA  . LYS C  1 307 ? 26.903  29.877  3.413   1.00 7.69   ? 307 LYS C CA  1 
ATOM   6306  C C   . LYS C  1 307 ? 27.757  30.381  2.284   1.00 7.03   ? 307 LYS C C   1 
ATOM   6307  O O   . LYS C  1 307 ? 28.624  29.689  1.761   1.00 6.47   ? 307 LYS C O   1 
ATOM   6308  C CB  . LYS C  1 307 ? 27.705  29.891  4.688   1.00 9.27   ? 307 LYS C CB  1 
ATOM   6309  C CG  . LYS C  1 307 ? 26.805  29.473  5.812   1.00 11.99  ? 307 LYS C CG  1 
ATOM   6310  C CD  . LYS C  1 307 ? 27.348  29.885  7.153   1.00 14.72  ? 307 LYS C CD  1 
ATOM   6311  C CE  . LYS C  1 307 ? 26.459  29.319  8.275   1.00 16.84  ? 307 LYS C CE  1 
ATOM   6312  N NZ  . LYS C  1 307 ? 26.397  27.848  8.291   1.00 18.50  ? 307 LYS C NZ  1 
ATOM   6313  N N   . TYR C  1 308 ? 27.461  31.582  1.834   1.00 7.20   ? 308 TYR C N   1 
ATOM   6314  C CA  . TYR C  1 308 ? 28.213  32.210  0.766   1.00 5.19   ? 308 TYR C CA  1 
ATOM   6315  C C   . TYR C  1 308 ? 29.620  32.489  1.221   1.00 4.05   ? 308 TYR C C   1 
ATOM   6316  O O   . TYR C  1 308 ? 29.833  33.041  2.287   1.00 3.89   ? 308 TYR C O   1 
ATOM   6317  C CB  . TYR C  1 308 ? 27.591  33.527  0.359   1.00 3.85   ? 308 TYR C CB  1 
ATOM   6318  C CG  . TYR C  1 308 ? 28.275  34.136  -0.822  1.00 2.19   ? 308 TYR C CG  1 
ATOM   6319  C CD1 . TYR C  1 308 ? 29.141  35.175  -0.639  1.00 2.00   ? 308 TYR C CD1 1 
ATOM   6320  C CD2 . TYR C  1 308 ? 28.037  33.613  -2.055  1.00 2.00   ? 308 TYR C CD2 1 
ATOM   6321  C CE1 . TYR C  1 308 ? 29.788  35.713  -1.704  1.00 2.00   ? 308 TYR C CE1 1 
ATOM   6322  C CE2 . TYR C  1 308 ? 28.688  34.149  -3.120  1.00 2.35   ? 308 TYR C CE2 1 
ATOM   6323  C CZ  . TYR C  1 308 ? 29.557  35.196  -2.941  1.00 2.57   ? 308 TYR C CZ  1 
ATOM   6324  O OH  . TYR C  1 308 ? 30.229  35.720  -4.017  1.00 3.64   ? 308 TYR C OH  1 
ATOM   6325  N N   . VAL C  1 309 ? 30.543  32.186  0.353   1.00 3.40   ? 309 VAL C N   1 
ATOM   6326  C CA  . VAL C  1 309 ? 31.925  32.319  0.635   1.00 2.73   ? 309 VAL C CA  1 
ATOM   6327  C C   . VAL C  1 309 ? 32.538  32.912  -0.635  1.00 3.14   ? 309 VAL C C   1 
ATOM   6328  O O   . VAL C  1 309 ? 31.915  32.926  -1.705  1.00 2.39   ? 309 VAL C O   1 
ATOM   6329  C CB  . VAL C  1 309 ? 32.227  30.876  1.040   1.00 2.40   ? 309 VAL C CB  1 
ATOM   6330  C CG1 . VAL C  1 309 ? 33.171  30.181  0.095   1.00 2.32   ? 309 VAL C CG1 1 
ATOM   6331  C CG2 . VAL C  1 309 ? 32.673  30.955  2.472   1.00 2.82   ? 309 VAL C CG2 1 
ATOM   6332  N N   . LYS C  1 310 ? 33.705  33.531  -0.538  1.00 3.70   ? 310 LYS C N   1 
ATOM   6333  C CA  . LYS C  1 310 ? 34.337  34.080  -1.713  1.00 3.94   ? 310 LYS C CA  1 
ATOM   6334  C C   . LYS C  1 310 ? 34.965  32.950  -2.505  1.00 5.11   ? 310 LYS C C   1 
ATOM   6335  O O   . LYS C  1 310 ? 34.923  32.938  -3.735  1.00 4.76   ? 310 LYS C O   1 
ATOM   6336  C CB  . LYS C  1 310 ? 35.400  35.074  -1.304  1.00 4.39   ? 310 LYS C CB  1 
ATOM   6337  C CG  . LYS C  1 310 ? 34.820  36.427  -0.998  1.00 6.30   ? 310 LYS C CG  1 
ATOM   6338  C CD  . LYS C  1 310 ? 35.876  37.332  -0.333  1.00 10.71  ? 310 LYS C CD  1 
ATOM   6339  C CE  . LYS C  1 310 ? 35.673  38.884  -0.551  1.00 15.20  ? 310 LYS C CE  1 
ATOM   6340  N NZ  . LYS C  1 310 ? 34.491  39.568  0.049   1.00 17.49  ? 310 LYS C NZ  1 
ATOM   6341  N N   . GLN C  1 311 ? 35.542  31.959  -1.810  1.00 6.88   ? 311 GLN C N   1 
ATOM   6342  C CA  . GLN C  1 311 ? 36.261  30.861  -2.450  1.00 6.87   ? 311 GLN C CA  1 
ATOM   6343  C C   . GLN C  1 311 ? 35.378  30.107  -3.415  1.00 8.94   ? 311 GLN C C   1 
ATOM   6344  O O   . GLN C  1 311 ? 34.240  29.772  -3.068  1.00 10.19  ? 311 GLN C O   1 
ATOM   6345  C CB  . GLN C  1 311 ? 36.738  29.862  -1.431  1.00 5.15   ? 311 GLN C CB  1 
ATOM   6346  C CG  . GLN C  1 311 ? 37.731  30.405  -0.467  1.00 3.92   ? 311 GLN C CG  1 
ATOM   6347  C CD  . GLN C  1 311 ? 37.131  30.834  0.837   1.00 4.52   ? 311 GLN C CD  1 
ATOM   6348  O OE1 . GLN C  1 311 ? 36.006  31.327  0.886   1.00 4.05   ? 311 GLN C OE1 1 
ATOM   6349  N NE2 . GLN C  1 311 ? 37.872  30.684  1.926   1.00 5.08   ? 311 GLN C NE2 1 
ATOM   6350  N N   . ASN C  1 312 ? 35.845  29.791  -4.605  1.00 10.75  ? 312 ASN C N   1 
ATOM   6351  C CA  . ASN C  1 312 ? 34.975  28.997  -5.460  1.00 13.55  ? 312 ASN C CA  1 
ATOM   6352  C C   . ASN C  1 312 ? 35.304  27.515  -5.349  1.00 12.84  ? 312 ASN C C   1 
ATOM   6353  O O   . ASN C  1 312 ? 34.619  26.679  -5.933  1.00 12.95  ? 312 ASN C O   1 
ATOM   6354  C CB  . ASN C  1 312 ? 35.091  29.438  -6.916  1.00 16.59  ? 312 ASN C CB  1 
ATOM   6355  C CG  . ASN C  1 312 ? 36.470  29.136  -7.452  1.00 19.83  ? 312 ASN C CG  1 
ATOM   6356  O OD1 . ASN C  1 312 ? 37.484  29.476  -6.835  1.00 21.92  ? 312 ASN C OD1 1 
ATOM   6357  N ND2 . ASN C  1 312 ? 36.552  28.432  -8.570  1.00 21.77  ? 312 ASN C ND2 1 
ATOM   6358  N N   . THR C  1 313 ? 36.380  27.154  -4.672  1.00 11.76  ? 313 THR C N   1 
ATOM   6359  C CA  . THR C  1 313 ? 36.622  25.750  -4.403  1.00 11.36  ? 313 THR C CA  1 
ATOM   6360  C C   . THR C  1 313 ? 37.356  25.605  -3.063  1.00 11.20  ? 313 THR C C   1 
ATOM   6361  O O   . THR C  1 313 ? 38.267  26.401  -2.751  1.00 13.49  ? 313 THR C O   1 
ATOM   6362  C CB  . THR C  1 313 ? 37.417  25.194  -5.570  1.00 10.77  ? 313 THR C CB  1 
ATOM   6363  O OG1 . THR C  1 313 ? 37.769  23.847  -5.265  1.00 10.83  ? 313 THR C OG1 1 
ATOM   6364  C CG2 . THR C  1 313 ? 38.619  26.084  -5.861  1.00 11.17  ? 313 THR C CG2 1 
ATOM   6365  N N   . LEU C  1 314 ? 36.973  24.619  -2.252  1.00 8.51   ? 314 LEU C N   1 
ATOM   6366  C CA  . LEU C  1 314 ? 37.580  24.327  -0.963  1.00 7.00   ? 314 LEU C CA  1 
ATOM   6367  C C   . LEU C  1 314 ? 37.481  22.822  -0.783  1.00 7.38   ? 314 LEU C C   1 
ATOM   6368  O O   . LEU C  1 314 ? 36.409  22.279  -0.506  1.00 8.91   ? 314 LEU C O   1 
ATOM   6369  C CB  . LEU C  1 314 ? 36.808  25.065  0.120   1.00 5.07   ? 314 LEU C CB  1 
ATOM   6370  C CG  . LEU C  1 314 ? 37.422  26.125  1.015   1.00 3.92   ? 314 LEU C CG  1 
ATOM   6371  C CD1 . LEU C  1 314 ? 38.560  26.886  0.356   1.00 3.65   ? 314 LEU C CD1 1 
ATOM   6372  C CD2 . LEU C  1 314 ? 36.323  27.085  1.352   1.00 2.75   ? 314 LEU C CD2 1 
ATOM   6373  N N   . LYS C  1 315 ? 38.576  22.101  -0.994  1.00 7.12   ? 315 LYS C N   1 
ATOM   6374  C CA  . LYS C  1 315 ? 38.559  20.644  -0.927  1.00 7.13   ? 315 LYS C CA  1 
ATOM   6375  C C   . LYS C  1 315 ? 38.906  20.089  0.438   1.00 6.74   ? 315 LYS C C   1 
ATOM   6376  O O   . LYS C  1 315 ? 39.932  20.469  1.017   1.00 6.06   ? 315 LYS C O   1 
ATOM   6377  C CB  . LYS C  1 315 ? 39.533  20.069  -1.917  1.00 8.85   ? 315 LYS C CB  1 
ATOM   6378  C CG  . LYS C  1 315 ? 39.033  20.451  -3.273  1.00 10.54  ? 315 LYS C CG  1 
ATOM   6379  C CD  . LYS C  1 315 ? 39.802  19.808  -4.394  1.00 12.39  ? 315 LYS C CD  1 
ATOM   6380  C CE  . LYS C  1 315 ? 39.243  20.332  -5.713  1.00 14.81  ? 315 LYS C CE  1 
ATOM   6381  N NZ  . LYS C  1 315 ? 37.801  20.103  -5.859  1.00 16.98  ? 315 LYS C NZ  1 
ATOM   6382  N N   . LEU C  1 316 ? 38.047  19.219  0.961   1.00 6.10   ? 316 LEU C N   1 
ATOM   6383  C CA  . LEU C  1 316 ? 38.269  18.569  2.232   1.00 4.85   ? 316 LEU C CA  1 
ATOM   6384  C C   . LEU C  1 316 ? 38.877  17.208  1.924   1.00 5.37   ? 316 LEU C C   1 
ATOM   6385  O O   . LEU C  1 316 ? 38.266  16.402  1.220   1.00 6.33   ? 316 LEU C O   1 
ATOM   6386  C CB  . LEU C  1 316 ? 36.945  18.412  2.927   1.00 3.16   ? 316 LEU C CB  1 
ATOM   6387  C CG  . LEU C  1 316 ? 36.958  17.970  4.360   1.00 2.65   ? 316 LEU C CG  1 
ATOM   6388  C CD1 . LEU C  1 316 ? 37.466  19.081  5.248   1.00 2.00   ? 316 LEU C CD1 1 
ATOM   6389  C CD2 . LEU C  1 316 ? 35.548  17.659  4.793   1.00 2.54   ? 316 LEU C CD2 1 
ATOM   6390  N N   . ALA C  1 317 ? 40.103  16.927  2.345   1.00 4.75   ? 317 ALA C N   1 
ATOM   6391  C CA  . ALA C  1 317 ? 40.714  15.628  2.151   1.00 3.73   ? 317 ALA C CA  1 
ATOM   6392  C C   . ALA C  1 317 ? 39.914  14.599  2.914   1.00 3.89   ? 317 ALA C C   1 
ATOM   6393  O O   . ALA C  1 317 ? 39.557  14.810  4.079   1.00 5.15   ? 317 ALA C O   1 
ATOM   6394  C CB  . ALA C  1 317 ? 42.121  15.576  2.697   1.00 3.49   ? 317 ALA C CB  1 
ATOM   6395  N N   . THR C  1 318 ? 39.567  13.545  2.206   1.00 2.99   ? 318 THR C N   1 
ATOM   6396  C CA  . THR C  1 318 ? 38.853  12.441  2.774   1.00 3.26   ? 318 THR C CA  1 
ATOM   6397  C C   . THR C  1 318 ? 39.670  11.184  2.617   1.00 3.40   ? 318 THR C C   1 
ATOM   6398  O O   . THR C  1 318 ? 39.113  10.092  2.479   1.00 3.57   ? 318 THR C O   1 
ATOM   6399  C CB  . THR C  1 318 ? 37.512  12.282  2.084   1.00 3.05   ? 318 THR C CB  1 
ATOM   6400  O OG1 . THR C  1 318 ? 37.649  12.703  0.740   1.00 2.46   ? 318 THR C OG1 1 
ATOM   6401  C CG2 . THR C  1 318 ? 36.453  13.086  2.788   1.00 4.34   ? 318 THR C CG2 1 
ATOM   6402  N N   . GLY C  1 319 ? 40.995  11.316  2.608   1.00 3.14   ? 319 GLY C N   1 
ATOM   6403  C CA  . GLY C  1 319 ? 41.880  10.174  2.500   1.00 3.91   ? 319 GLY C CA  1 
ATOM   6404  C C   . GLY C  1 319 ? 43.290  10.551  2.926   1.00 3.59   ? 319 GLY C C   1 
ATOM   6405  O O   . GLY C  1 319 ? 43.564  11.723  3.117   1.00 3.15   ? 319 GLY C O   1 
ATOM   6406  N N   . MET C  1 320 ? 44.178  9.573   3.069   1.00 3.89   ? 320 MET C N   1 
ATOM   6407  C CA  . MET C  1 320 ? 45.539  9.795   3.494   1.00 4.52   ? 320 MET C CA  1 
ATOM   6408  C C   . MET C  1 320 ? 46.359  10.441  2.430   1.00 4.95   ? 320 MET C C   1 
ATOM   6409  O O   . MET C  1 320 ? 45.878  10.692  1.350   1.00 4.72   ? 320 MET C O   1 
ATOM   6410  C CB  . MET C  1 320 ? 46.229  8.499   3.836   1.00 4.50   ? 320 MET C CB  1 
ATOM   6411  C CG  . MET C  1 320 ? 46.374  7.548   2.677   1.00 4.44   ? 320 MET C CG  1 
ATOM   6412  S SD  . MET C  1 320 ? 47.385  6.147   3.212   1.00 6.36   ? 320 MET C SD  1 
ATOM   6413  C CE  . MET C  1 320 ? 46.123  5.242   4.062   1.00 5.95   ? 320 MET C CE  1 
ATOM   6414  N N   . ARG C  1 321 ? 47.627  10.656  2.713   1.00 7.23   ? 321 ARG C N   1 
ATOM   6415  C CA  . ARG C  1 321 ? 48.570  11.123  1.732   1.00 9.01   ? 321 ARG C CA  1 
ATOM   6416  C C   . ARG C  1 321 ? 48.697  10.135  0.614   1.00 10.29  ? 321 ARG C C   1 
ATOM   6417  O O   . ARG C  1 321 ? 48.652  8.934   0.819   1.00 11.30  ? 321 ARG C O   1 
ATOM   6418  C CB  . ARG C  1 321 ? 49.930  11.265  2.305   1.00 9.57   ? 321 ARG C CB  1 
ATOM   6419  C CG  . ARG C  1 321 ? 50.199  12.626  2.836   1.00 10.30  ? 321 ARG C CG  1 
ATOM   6420  C CD  . ARG C  1 321 ? 51.358  12.988  1.971   1.00 11.32  ? 321 ARG C CD  1 
ATOM   6421  N NE  . ARG C  1 321 ? 52.412  13.492  2.818   1.00 12.72  ? 321 ARG C NE  1 
ATOM   6422  C CZ  . ARG C  1 321 ? 53.588  13.875  2.328   1.00 12.89  ? 321 ARG C CZ  1 
ATOM   6423  N NH1 . ARG C  1 321 ? 54.475  14.307  3.223   1.00 13.41  ? 321 ARG C NH1 1 
ATOM   6424  N NH2 . ARG C  1 321 ? 53.842  13.822  1.006   1.00 12.66  ? 321 ARG C NH2 1 
ATOM   6425  N N   . ASN C  1 322 ? 48.855  10.615  -0.582  1.00 12.86  ? 322 ASN C N   1 
ATOM   6426  C CA  . ASN C  1 322 ? 49.059  9.755   -1.709  1.00 15.06  ? 322 ASN C CA  1 
ATOM   6427  C C   . ASN C  1 322 ? 50.552  9.692   -1.960  1.00 16.70  ? 322 ASN C C   1 
ATOM   6428  O O   . ASN C  1 322 ? 51.151  10.730  -2.267  1.00 18.21  ? 322 ASN C O   1 
ATOM   6429  C CB  . ASN C  1 322 ? 48.335  10.350  -2.887  1.00 15.92  ? 322 ASN C CB  1 
ATOM   6430  C CG  . ASN C  1 322 ? 48.320  9.340   -3.997  1.00 16.19  ? 322 ASN C CG  1 
ATOM   6431  O OD1 . ASN C  1 322 ? 48.072  8.166   -3.731  1.00 16.60  ? 322 ASN C OD1 1 
ATOM   6432  N ND2 . ASN C  1 322 ? 48.593  9.724   -5.226  1.00 16.27  ? 322 ASN C ND2 1 
ATOM   6433  N N   . VAL C  1 323 ? 51.233  8.573   -1.733  1.00 17.75  ? 323 VAL C N   1 
ATOM   6434  C CA  . VAL C  1 323 ? 52.671  8.477   -2.013  1.00 19.22  ? 323 VAL C CA  1 
ATOM   6435  C C   . VAL C  1 323 ? 52.808  7.320   -3.005  1.00 22.25  ? 323 VAL C C   1 
ATOM   6436  O O   . VAL C  1 323 ? 53.129  6.214   -2.587  1.00 21.73  ? 323 VAL C O   1 
ATOM   6437  C CB  . VAL C  1 323 ? 53.440  8.194   -0.693  1.00 18.20  ? 323 VAL C CB  1 
ATOM   6438  C CG1 . VAL C  1 323 ? 54.906  8.414   -0.930  1.00 17.51  ? 323 VAL C CG1 1 
ATOM   6439  C CG2 . VAL C  1 323 ? 53.039  9.145   0.425   1.00 18.41  ? 323 VAL C CG2 1 
ATOM   6440  N N   . PRO C  1 324 ? 52.574  7.483   -4.315  1.00 25.57  ? 324 PRO C N   1 
ATOM   6441  C CA  . PRO C  1 324 ? 52.607  6.424   -5.334  1.00 28.84  ? 324 PRO C CA  1 
ATOM   6442  C C   . PRO C  1 324 ? 53.950  5.761   -5.564  1.00 31.99  ? 324 PRO C C   1 
ATOM   6443  O O   . PRO C  1 324 ? 54.934  6.407   -5.263  1.00 31.67  ? 324 PRO C O   1 
ATOM   6444  C CB  . PRO C  1 324 ? 52.070  7.118   -6.565  1.00 28.16  ? 324 PRO C CB  1 
ATOM   6445  C CG  . PRO C  1 324 ? 52.751  8.440   -6.436  1.00 27.24  ? 324 PRO C CG  1 
ATOM   6446  C CD  . PRO C  1 324 ? 52.493  8.774   -4.978  1.00 26.44  ? 324 PRO C CD  1 
ATOM   6447  N N   . GLU C  1 325 ? 54.133  4.532   -6.074  1.00 36.19  ? 325 GLU C N   1 
ATOM   6448  C CA  . GLU C  1 325 ? 55.517  4.096   -6.304  1.00 40.99  ? 325 GLU C CA  1 
ATOM   6449  C C   . GLU C  1 325 ? 55.877  4.230   -7.773  1.00 45.71  ? 325 GLU C C   1 
ATOM   6450  O O   . GLU C  1 325 ? 56.986  4.630   -8.119  1.00 45.53  ? 325 GLU C O   1 
ATOM   6451  C CB  . GLU C  1 325 ? 55.825  2.645   -5.968  1.00 40.35  ? 325 GLU C CB  1 
ATOM   6452  C CG  . GLU C  1 325 ? 57.365  2.596   -5.814  1.00 40.69  ? 325 GLU C CG  1 
ATOM   6453  C CD  . GLU C  1 325 ? 58.095  1.274   -5.558  1.00 41.36  ? 325 GLU C CD  1 
ATOM   6454  O OE1 . GLU C  1 325 ? 57.703  0.526   -4.652  1.00 41.58  ? 325 GLU C OE1 1 
ATOM   6455  O OE2 . GLU C  1 325 ? 59.086  1.016   -6.259  1.00 41.26  ? 325 GLU C OE2 1 
ATOM   6456  N N   . LYS C  1 326 ? 54.947  3.907   -8.684  1.00 52.07  ? 326 LYS C N   1 
ATOM   6457  C CA  . LYS C  1 326 ? 55.277  4.022   -10.093 1.00 57.69  ? 326 LYS C CA  1 
ATOM   6458  C C   . LYS C  1 326 ? 55.302  5.512   -10.350 1.00 61.80  ? 326 LYS C C   1 
ATOM   6459  O O   . LYS C  1 326 ? 56.379  6.076   -10.587 1.00 62.51  ? 326 LYS C O   1 
ATOM   6460  C CB  . LYS C  1 326 ? 54.226  3.374   -11.005 1.00 58.11  ? 326 LYS C CB  1 
ATOM   6461  C CG  . LYS C  1 326 ? 54.635  3.578   -12.452 1.00 59.42  ? 326 LYS C CG  1 
ATOM   6462  C CD  . LYS C  1 326 ? 53.914  2.586   -13.311 1.00 60.45  ? 326 LYS C CD  1 
ATOM   6463  C CE  . LYS C  1 326 ? 54.030  2.905   -14.789 1.00 61.15  ? 326 LYS C CE  1 
ATOM   6464  N NZ  . LYS C  1 326 ? 53.195  1.958   -15.507 1.00 61.60  ? 326 LYS C NZ  1 
ATOM   6465  N N   . GLN C  1 327 ? 54.084  6.055   -10.260 1.00 66.27  ? 327 GLN C N   1 
ATOM   6466  C CA  . GLN C  1 327 ? 53.686  7.459   -10.420 1.00 70.40  ? 327 GLN C CA  1 
ATOM   6467  C C   . GLN C  1 327 ? 52.194  7.357   -10.673 1.00 72.33  ? 327 GLN C C   1 
ATOM   6468  O O   . GLN C  1 327 ? 51.384  7.877   -9.900  1.00 72.54  ? 327 GLN C O   1 
ATOM   6469  C CB  . GLN C  1 327 ? 54.350  8.220   -11.639 1.00 71.81  ? 327 GLN C CB  1 
ATOM   6470  C CG  . GLN C  1 327 ? 54.835  7.532   -12.952 1.00 73.30  ? 327 GLN C CG  1 
ATOM   6471  C CD  . GLN C  1 327 ? 54.147  7.900   -14.264 1.00 73.93  ? 327 GLN C CD  1 
ATOM   6472  O OE1 . GLN C  1 327 ? 54.141  9.044   -14.723 1.00 74.13  ? 327 GLN C OE1 1 
ATOM   6473  N NE2 . GLN C  1 327 ? 53.520  6.934   -14.901 1.00 74.10  ? 327 GLN C NE2 1 
ATOM   6474  N N   . THR C  1 328 ? 51.957  6.599   -11.730 1.00 74.38  ? 328 THR C N   1 
ATOM   6475  C CA  . THR C  1 328 ? 50.686  6.252   -12.290 1.00 76.79  ? 328 THR C CA  1 
ATOM   6476  C C   . THR C  1 328 ? 51.166  5.131   -13.253 1.00 77.94  ? 328 THR C C   1 
ATOM   6477  O O   . THR C  1 328 ? 51.339  4.009   -12.790 1.00 78.37  ? 328 THR C O   1 
ATOM   6478  C CB  . THR C  1 328 ? 50.025  7.574   -12.953 1.00 77.25  ? 328 THR C CB  1 
ATOM   6479  O OG1 . THR C  1 328 ? 48.921  7.096   -13.707 1.00 77.81  ? 328 THR C OG1 1 
ATOM   6480  C CG2 . THR C  1 328 ? 50.897  8.429   -13.870 1.00 77.00  ? 328 THR C CG2 1 
ATOM   6481  O OXT . THR C  1 328 ? 51.494  5.349   -14.419 1.00 78.75  ? 328 THR C OXT 1 
ATOM   6482  N N   . GLY D  2 1   ? 54.131  14.208  8.341   1.00 21.86  ? 1   GLY D N   1 
ATOM   6483  C CA  . GLY D  2 1   ? 53.180  13.569  9.243   1.00 20.74  ? 1   GLY D CA  1 
ATOM   6484  C C   . GLY D  2 1   ? 53.854  13.471  10.612  1.00 19.19  ? 1   GLY D C   1 
ATOM   6485  O O   . GLY D  2 1   ? 55.069  13.179  10.648  1.00 19.47  ? 1   GLY D O   1 
ATOM   6486  N N   . LEU D  2 2   ? 53.113  13.755  11.683  1.00 16.91  ? 2   LEU D N   1 
ATOM   6487  C CA  . LEU D  2 2   ? 53.645  13.721  13.026  1.00 15.63  ? 2   LEU D CA  1 
ATOM   6488  C C   . LEU D  2 2   ? 54.296  12.392  13.350  1.00 16.24  ? 2   LEU D C   1 
ATOM   6489  O O   . LEU D  2 2   ? 55.348  12.365  13.993  1.00 17.13  ? 2   LEU D O   1 
ATOM   6490  C CB  . LEU D  2 2   ? 52.565  13.964  14.069  1.00 13.81  ? 2   LEU D CB  1 
ATOM   6491  C CG  . LEU D  2 2   ? 51.842  15.284  14.185  1.00 12.97  ? 2   LEU D CG  1 
ATOM   6492  C CD1 . LEU D  2 2   ? 51.008  15.223  15.436  1.00 13.62  ? 2   LEU D CD1 1 
ATOM   6493  C CD2 . LEU D  2 2   ? 52.773  16.453  14.329  1.00 12.33  ? 2   LEU D CD2 1 
ATOM   6494  N N   . PHE D  2 3   ? 53.748  11.288  12.862  1.00 16.04  ? 3   PHE D N   1 
ATOM   6495  C CA  . PHE D  2 3   ? 54.323  10.028  13.272  1.00 15.76  ? 3   PHE D CA  1 
ATOM   6496  C C   . PHE D  2 3   ? 55.433  9.486   12.373  1.00 15.79  ? 3   PHE D C   1 
ATOM   6497  O O   . PHE D  2 3   ? 56.153  8.584   12.788  1.00 16.73  ? 3   PHE D O   1 
ATOM   6498  C CB  . PHE D  2 3   ? 53.172  9.054   13.410  1.00 15.66  ? 3   PHE D CB  1 
ATOM   6499  C CG  . PHE D  2 3   ? 52.205  9.553   14.469  1.00 14.67  ? 3   PHE D CG  1 
ATOM   6500  C CD1 . PHE D  2 3   ? 51.092  10.266  14.103  1.00 14.50  ? 3   PHE D CD1 1 
ATOM   6501  C CD2 . PHE D  2 3   ? 52.469  9.300   15.786  1.00 15.00  ? 3   PHE D CD2 1 
ATOM   6502  C CE1 . PHE D  2 3   ? 50.248  10.739  15.076  1.00 14.73  ? 3   PHE D CE1 1 
ATOM   6503  C CE2 . PHE D  2 3   ? 51.623  9.777   16.760  1.00 14.91  ? 3   PHE D CE2 1 
ATOM   6504  C CZ  . PHE D  2 3   ? 50.508  10.495  16.404  1.00 14.67  ? 3   PHE D CZ  1 
ATOM   6505  N N   . GLY D  2 4   ? 55.638  9.997   11.163  1.00 15.08  ? 4   GLY D N   1 
ATOM   6506  C CA  . GLY D  2 4   ? 56.766  9.534   10.360  1.00 14.67  ? 4   GLY D CA  1 
ATOM   6507  C C   . GLY D  2 4   ? 56.696  8.136   9.734   1.00 14.43  ? 4   GLY D C   1 
ATOM   6508  O O   . GLY D  2 4   ? 57.719  7.609   9.283   1.00 13.73  ? 4   GLY D O   1 
ATOM   6509  N N   . ALA D  2 5   ? 55.509  7.515   9.684   1.00 14.92  ? 5   ALA D N   1 
ATOM   6510  C CA  . ALA D  2 5   ? 55.348  6.232   9.012   1.00 14.11  ? 5   ALA D CA  1 
ATOM   6511  C C   . ALA D  2 5   ? 55.076  6.449   7.525   1.00 13.46  ? 5   ALA D C   1 
ATOM   6512  O O   . ALA D  2 5   ? 55.970  6.172   6.723   1.00 12.90  ? 5   ALA D O   1 
ATOM   6513  C CB  . ALA D  2 5   ? 54.205  5.480   9.649   1.00 13.96  ? 5   ALA D CB  1 
ATOM   6514  N N   . ILE D  2 6   ? 53.902  6.982   7.146   1.00 13.20  ? 6   ILE D N   1 
ATOM   6515  C CA  . ILE D  2 6   ? 53.539  7.265   5.747   1.00 12.22  ? 6   ILE D CA  1 
ATOM   6516  C C   . ILE D  2 6   ? 54.484  8.337   5.257   1.00 12.78  ? 6   ILE D C   1 
ATOM   6517  O O   . ILE D  2 6   ? 54.802  9.258   6.013   1.00 14.22  ? 6   ILE D O   1 
ATOM   6518  C CB  . ILE D  2 6   ? 52.074  7.796   5.648   1.00 10.42  ? 6   ILE D CB  1 
ATOM   6519  C CG1 . ILE D  2 6   ? 51.104  6.656   5.928   1.00 10.53  ? 6   ILE D CG1 1 
ATOM   6520  C CG2 . ILE D  2 6   ? 51.790  8.356   4.275   1.00 9.82   ? 6   ILE D CG2 1 
ATOM   6521  C CD1 . ILE D  2 6   ? 49.640  7.068   6.153   1.00 10.48  ? 6   ILE D CD1 1 
ATOM   6522  N N   . ALA D  2 7   ? 54.987  8.199   4.042   1.00 12.61  ? 7   ALA D N   1 
ATOM   6523  C CA  . ALA D  2 7   ? 55.965  9.126   3.511   1.00 13.64  ? 7   ALA D CA  1 
ATOM   6524  C C   . ALA D  2 7   ? 57.174  9.221   4.424   1.00 15.16  ? 7   ALA D C   1 
ATOM   6525  O O   . ALA D  2 7   ? 57.949  10.178  4.347   1.00 17.30  ? 7   ALA D O   1 
ATOM   6526  C CB  . ALA D  2 7   ? 55.389  10.547  3.352   1.00 13.20  ? 7   ALA D CB  1 
ATOM   6527  N N   . GLY D  2 8   ? 57.359  8.199   5.262   1.00 15.66  ? 8   GLY D N   1 
ATOM   6528  C CA  . GLY D  2 8   ? 58.417  8.197   6.251   1.00 14.55  ? 8   GLY D CA  1 
ATOM   6529  C C   . GLY D  2 8   ? 59.096  6.864   6.129   1.00 13.94  ? 8   GLY D C   1 
ATOM   6530  O O   . GLY D  2 8   ? 59.487  6.486   5.027   1.00 14.18  ? 8   GLY D O   1 
ATOM   6531  N N   . PHE D  2 9   ? 59.143  6.102   7.232   1.00 13.86  ? 9   PHE D N   1 
ATOM   6532  C CA  . PHE D  2 9   ? 59.823  4.820   7.162   1.00 13.92  ? 9   PHE D CA  1 
ATOM   6533  C C   . PHE D  2 9   ? 59.144  3.892   6.193   1.00 14.32  ? 9   PHE D C   1 
ATOM   6534  O O   . PHE D  2 9   ? 59.779  2.988   5.668   1.00 16.40  ? 9   PHE D O   1 
ATOM   6535  C CB  . PHE D  2 9   ? 59.930  4.088   8.516   1.00 13.11  ? 9   PHE D CB  1 
ATOM   6536  C CG  . PHE D  2 9   ? 58.709  3.713   9.323   1.00 12.95  ? 9   PHE D CG  1 
ATOM   6537  C CD1 . PHE D  2 9   ? 58.136  2.474   9.183   1.00 13.80  ? 9   PHE D CD1 1 
ATOM   6538  C CD2 . PHE D  2 9   ? 58.186  4.605   10.212  1.00 12.22  ? 9   PHE D CD2 1 
ATOM   6539  C CE1 . PHE D  2 9   ? 57.046  2.120   9.950   1.00 13.48  ? 9   PHE D CE1 1 
ATOM   6540  C CE2 . PHE D  2 9   ? 57.107  4.256   10.974  1.00 12.14  ? 9   PHE D CE2 1 
ATOM   6541  C CZ  . PHE D  2 9   ? 56.526  3.020   10.842  1.00 13.06  ? 9   PHE D CZ  1 
ATOM   6542  N N   . ILE D  2 10  ? 57.864  4.077   5.937   1.00 14.24  ? 10  ILE D N   1 
ATOM   6543  C CA  . ILE D  2 10  ? 57.239  3.307   4.895   1.00 14.30  ? 10  ILE D CA  1 
ATOM   6544  C C   . ILE D  2 10  ? 57.357  4.191   3.651   1.00 16.69  ? 10  ILE D C   1 
ATOM   6545  O O   . ILE D  2 10  ? 56.517  5.054   3.383   1.00 17.59  ? 10  ILE D O   1 
ATOM   6546  C CB  . ILE D  2 10  ? 55.820  3.029   5.356   1.00 12.14  ? 10  ILE D CB  1 
ATOM   6547  C CG1 . ILE D  2 10  ? 55.918  2.014   6.459   1.00 10.21  ? 10  ILE D CG1 1 
ATOM   6548  C CG2 . ILE D  2 10  ? 54.938  2.560   4.226   1.00 12.48  ? 10  ILE D CG2 1 
ATOM   6549  C CD1 . ILE D  2 10  ? 54.591  1.702   7.137   1.00 10.75  ? 10  ILE D CD1 1 
ATOM   6550  N N   . GLU D  2 11  ? 58.475  4.004   2.974   1.00 18.75  ? 11  GLU D N   1 
ATOM   6551  C CA  . GLU D  2 11  ? 58.852  4.723   1.783   1.00 21.82  ? 11  GLU D CA  1 
ATOM   6552  C C   . GLU D  2 11  ? 57.747  5.197   0.867   1.00 21.24  ? 11  GLU D C   1 
ATOM   6553  O O   . GLU D  2 11  ? 57.624  6.391   0.583   1.00 22.80  ? 11  GLU D O   1 
ATOM   6554  C CB  . GLU D  2 11  ? 59.755  3.876   1.017   1.00 26.08  ? 11  GLU D CB  1 
ATOM   6555  C CG  . GLU D  2 11  ? 61.085  3.932   1.722   1.00 31.93  ? 11  GLU D CG  1 
ATOM   6556  C CD  . GLU D  2 11  ? 62.192  4.114   0.705   1.00 35.07  ? 11  GLU D CD  1 
ATOM   6557  O OE1 . GLU D  2 11  ? 62.159  5.127   -0.025  1.00 36.45  ? 11  GLU D OE1 1 
ATOM   6558  O OE2 . GLU D  2 11  ? 63.074  3.234   0.643   1.00 37.01  ? 11  GLU D OE2 1 
ATOM   6559  N N   . ASN D  2 12  ? 56.861  4.323   0.436   1.00 19.63  ? 12  ASN D N   1 
ATOM   6560  C CA  . ASN D  2 12  ? 55.800  4.754   -0.450  1.00 18.90  ? 12  ASN D CA  1 
ATOM   6561  C C   . ASN D  2 12  ? 54.630  3.845   -0.293  1.00 17.69  ? 12  ASN D C   1 
ATOM   6562  O O   . ASN D  2 12  ? 54.635  2.968   0.570   1.00 18.12  ? 12  ASN D O   1 
ATOM   6563  C CB  . ASN D  2 12  ? 56.253  4.746   -1.881  1.00 20.24  ? 12  ASN D CB  1 
ATOM   6564  C CG  . ASN D  2 12  ? 56.752  3.376   -2.241  1.00 21.45  ? 12  ASN D CG  1 
ATOM   6565  O OD1 . ASN D  2 12  ? 57.844  2.981   -1.845  1.00 22.91  ? 12  ASN D OD1 1 
ATOM   6566  N ND2 . ASN D  2 12  ? 55.946  2.582   -2.900  1.00 22.16  ? 12  ASN D ND2 1 
ATOM   6567  N N   . GLY D  2 13  ? 53.598  4.101   -1.058  1.00 16.43  ? 13  GLY D N   1 
ATOM   6568  C CA  . GLY D  2 13  ? 52.358  3.380   -0.918  1.00 16.16  ? 13  GLY D CA  1 
ATOM   6569  C C   . GLY D  2 13  ? 52.298  2.270   -1.928  1.00 15.63  ? 13  GLY D C   1 
ATOM   6570  O O   . GLY D  2 13  ? 53.180  2.152   -2.764  1.00 16.37  ? 13  GLY D O   1 
ATOM   6571  N N   . TRP D  2 14  ? 51.287  1.446   -1.886  1.00 15.33  ? 14  TRP D N   1 
ATOM   6572  C CA  . TRP D  2 14  ? 51.177  0.379   -2.826  1.00 16.53  ? 14  TRP D CA  1 
ATOM   6573  C C   . TRP D  2 14  ? 49.977  0.713   -3.690  1.00 18.97  ? 14  TRP D C   1 
ATOM   6574  O O   . TRP D  2 14  ? 48.853  0.688   -3.188  1.00 18.41  ? 14  TRP D O   1 
ATOM   6575  C CB  . TRP D  2 14  ? 50.943  -0.960  -2.104  1.00 14.87  ? 14  TRP D CB  1 
ATOM   6576  C CG  . TRP D  2 14  ? 52.031  -1.451  -1.162  1.00 12.96  ? 14  TRP D CG  1 
ATOM   6577  C CD1 . TRP D  2 14  ? 53.326  -1.058  -1.322  1.00 12.26  ? 14  TRP D CD1 1 
ATOM   6578  C CD2 . TRP D  2 14  ? 51.857  -2.280  -0.079  1.00 12.30  ? 14  TRP D CD2 1 
ATOM   6579  N NE1 . TRP D  2 14  ? 53.975  -1.621  -0.340  1.00 11.86  ? 14  TRP D NE1 1 
ATOM   6580  C CE2 . TRP D  2 14  ? 53.150  -2.355  0.416   1.00 11.49  ? 14  TRP D CE2 1 
ATOM   6581  C CE3 . TRP D  2 14  ? 50.847  -2.971  0.556   1.00 11.78  ? 14  TRP D CE3 1 
ATOM   6582  C CZ2 . TRP D  2 14  ? 53.461  -3.087  1.540   1.00 10.26  ? 14  TRP D CZ2 1 
ATOM   6583  C CZ3 . TRP D  2 14  ? 51.165  -3.709  1.692   1.00 11.27  ? 14  TRP D CZ3 1 
ATOM   6584  C CH2 . TRP D  2 14  ? 52.455  -3.770  2.176   1.00 10.18  ? 14  TRP D CH2 1 
ATOM   6585  N N   . GLU D  2 15  ? 50.168  1.020   -4.980  1.00 22.24  ? 15  GLU D N   1 
ATOM   6586  C CA  . GLU D  2 15  ? 49.039  1.280   -5.870  1.00 24.98  ? 15  GLU D CA  1 
ATOM   6587  C C   . GLU D  2 15  ? 48.248  0.003   -6.072  1.00 25.83  ? 15  GLU D C   1 
ATOM   6588  O O   . GLU D  2 15  ? 47.064  -0.002  -6.391  1.00 26.15  ? 15  GLU D O   1 
ATOM   6589  C CB  . GLU D  2 15  ? 49.524  1.781   -7.227  1.00 27.40  ? 15  GLU D CB  1 
ATOM   6590  C CG  . GLU D  2 15  ? 50.209  3.156   -7.150  1.00 30.89  ? 15  GLU D CG  1 
ATOM   6591  C CD  . GLU D  2 15  ? 50.770  3.751   -8.454  1.00 32.57  ? 15  GLU D CD  1 
ATOM   6592  O OE1 . GLU D  2 15  ? 50.032  3.808   -9.454  1.00 33.70  ? 15  GLU D OE1 1 
ATOM   6593  O OE2 . GLU D  2 15  ? 51.952  4.165   -8.430  1.00 31.99  ? 15  GLU D OE2 1 
ATOM   6594  N N   . GLY D  2 16  ? 48.930  -1.124  -5.862  1.00 27.14  ? 16  GLY D N   1 
ATOM   6595  C CA  . GLY D  2 16  ? 48.322  -2.437  -5.997  1.00 28.25  ? 16  GLY D CA  1 
ATOM   6596  C C   . GLY D  2 16  ? 47.348  -2.824  -4.889  1.00 28.54  ? 16  GLY D C   1 
ATOM   6597  O O   . GLY D  2 16  ? 46.578  -3.769  -5.070  1.00 28.88  ? 16  GLY D O   1 
ATOM   6598  N N   . MET D  2 17  ? 47.333  -2.153  -3.734  1.00 28.13  ? 17  MET D N   1 
ATOM   6599  C CA  . MET D  2 17  ? 46.466  -2.635  -2.698  1.00 28.53  ? 17  MET D CA  1 
ATOM   6600  C C   . MET D  2 17  ? 45.099  -2.018  -2.915  1.00 30.11  ? 17  MET D C   1 
ATOM   6601  O O   . MET D  2 17  ? 44.754  -0.947  -2.414  1.00 30.72  ? 17  MET D O   1 
ATOM   6602  C CB  . MET D  2 17  ? 47.048  -2.264  -1.364  1.00 27.72  ? 17  MET D CB  1 
ATOM   6603  C CG  . MET D  2 17  ? 46.144  -2.863  -0.327  1.00 27.59  ? 17  MET D CG  1 
ATOM   6604  S SD  . MET D  2 17  ? 46.971  -2.724  1.244   1.00 26.76  ? 17  MET D SD  1 
ATOM   6605  C CE  . MET D  2 17  ? 47.547  -4.390  1.284   1.00 27.59  ? 17  MET D CE  1 
ATOM   6606  N N   . ILE D  2 18  ? 44.286  -2.704  -3.697  1.00 31.32  ? 18  ILE D N   1 
ATOM   6607  C CA  . ILE D  2 18  ? 42.990  -2.174  -4.068  1.00 31.47  ? 18  ILE D CA  1 
ATOM   6608  C C   . ILE D  2 18  ? 41.896  -2.550  -3.090  1.00 32.06  ? 18  ILE D C   1 
ATOM   6609  O O   . ILE D  2 18  ? 40.757  -2.147  -3.313  1.00 33.66  ? 18  ILE D O   1 
ATOM   6610  C CB  . ILE D  2 18  ? 42.598  -2.682  -5.456  1.00 31.65  ? 18  ILE D CB  1 
ATOM   6611  C CG1 . ILE D  2 18  ? 42.533  -4.212  -5.432  1.00 32.27  ? 18  ILE D CG1 1 
ATOM   6612  C CG2 . ILE D  2 18  ? 43.601  -2.181  -6.486  1.00 31.13  ? 18  ILE D CG2 1 
ATOM   6613  C CD1 . ILE D  2 18  ? 41.726  -4.809  -6.586  1.00 33.36  ? 18  ILE D CD1 1 
ATOM   6614  N N   . ASP D  2 19  ? 42.177  -3.299  -2.027  1.00 31.63  ? 19  ASP D N   1 
ATOM   6615  C CA  . ASP D  2 19  ? 41.138  -3.809  -1.140  1.00 31.59  ? 19  ASP D CA  1 
ATOM   6616  C C   . ASP D  2 19  ? 41.140  -3.276  0.294   1.00 30.26  ? 19  ASP D C   1 
ATOM   6617  O O   . ASP D  2 19  ? 40.383  -3.749  1.155   1.00 31.15  ? 19  ASP D O   1 
ATOM   6618  C CB  . ASP D  2 19  ? 41.247  -5.323  -1.136  1.00 33.95  ? 19  ASP D CB  1 
ATOM   6619  C CG  . ASP D  2 19  ? 42.595  -5.855  -0.653  1.00 36.83  ? 19  ASP D CG  1 
ATOM   6620  O OD1 . ASP D  2 19  ? 42.605  -6.800  0.149   1.00 38.44  ? 19  ASP D OD1 1 
ATOM   6621  O OD2 . ASP D  2 19  ? 43.647  -5.337  -1.078  1.00 37.80  ? 19  ASP D OD2 1 
ATOM   6622  N N   . GLY D  2 20  ? 41.933  -2.250  0.609   1.00 27.49  ? 20  GLY D N   1 
ATOM   6623  C CA  . GLY D  2 20  ? 41.932  -1.666  1.942   1.00 23.94  ? 20  GLY D CA  1 
ATOM   6624  C C   . GLY D  2 20  ? 42.871  -0.476  1.964   1.00 20.91  ? 20  GLY D C   1 
ATOM   6625  O O   . GLY D  2 20  ? 43.484  -0.153  0.938   1.00 21.35  ? 20  GLY D O   1 
ATOM   6626  N N   . TRP D  2 21  ? 42.995  0.227   3.084   1.00 17.06  ? 21  TRP D N   1 
ATOM   6627  C CA  . TRP D  2 21  ? 43.870  1.372   3.093   1.00 13.97  ? 21  TRP D CA  1 
ATOM   6628  C C   . TRP D  2 21  ? 45.210  1.021   3.665   1.00 13.20  ? 21  TRP D C   1 
ATOM   6629  O O   . TRP D  2 21  ? 46.202  1.644   3.278   1.00 14.20  ? 21  TRP D O   1 
ATOM   6630  C CB  . TRP D  2 21  ? 43.328  2.517   3.912   1.00 13.01  ? 21  TRP D CB  1 
ATOM   6631  C CG  . TRP D  2 21  ? 42.115  3.225   3.368   1.00 12.26  ? 21  TRP D CG  1 
ATOM   6632  C CD1 . TRP D  2 21  ? 41.398  2.756   2.314   1.00 12.40  ? 21  TRP D CD1 1 
ATOM   6633  C CD2 . TRP D  2 21  ? 41.636  4.402   3.842   1.00 12.72  ? 21  TRP D CD2 1 
ATOM   6634  N NE1 . TRP D  2 21  ? 40.465  3.640   2.121   1.00 12.72  ? 21  TRP D NE1 1 
ATOM   6635  C CE2 . TRP D  2 21  ? 40.566  4.627   3.010   1.00 12.37  ? 21  TRP D CE2 1 
ATOM   6636  C CE3 . TRP D  2 21  ? 41.923  5.282   4.849   1.00 13.52  ? 21  TRP D CE3 1 
ATOM   6637  C CZ2 . TRP D  2 21  ? 39.786  5.746   3.127   1.00 11.70  ? 21  TRP D CZ2 1 
ATOM   6638  C CZ3 . TRP D  2 21  ? 41.134  6.413   4.971   1.00 13.76  ? 21  TRP D CZ3 1 
ATOM   6639  C CH2 . TRP D  2 21  ? 40.071  6.632   4.129   1.00 12.55  ? 21  TRP D CH2 1 
ATOM   6640  N N   . TYR D  2 22  ? 45.261  0.075   4.590   1.00 11.46  ? 22  TYR D N   1 
ATOM   6641  C CA  . TYR D  2 22  ? 46.505  -0.343  5.214   1.00 9.28   ? 22  TYR D CA  1 
ATOM   6642  C C   . TYR D  2 22  ? 46.574  -1.850  5.031   1.00 9.57   ? 22  TYR D C   1 
ATOM   6643  O O   . TYR D  2 22  ? 45.530  -2.489  4.838   1.00 9.59   ? 22  TYR D O   1 
ATOM   6644  C CB  . TYR D  2 22  ? 46.471  0.008   6.689   1.00 6.74   ? 22  TYR D CB  1 
ATOM   6645  C CG  . TYR D  2 22  ? 46.120  1.466   6.988   1.00 4.95   ? 22  TYR D CG  1 
ATOM   6646  C CD1 . TYR D  2 22  ? 47.073  2.478   6.832   1.00 4.23   ? 22  TYR D CD1 1 
ATOM   6647  C CD2 . TYR D  2 22  ? 44.844  1.766   7.428   1.00 3.65   ? 22  TYR D CD2 1 
ATOM   6648  C CE1 . TYR D  2 22  ? 46.741  3.789   7.101   1.00 2.72   ? 22  TYR D CE1 1 
ATOM   6649  C CE2 . TYR D  2 22  ? 44.513  3.073   7.704   1.00 2.81   ? 22  TYR D CE2 1 
ATOM   6650  C CZ  . TYR D  2 22  ? 45.458  4.059   7.533   1.00 2.96   ? 22  TYR D CZ  1 
ATOM   6651  O OH  . TYR D  2 22  ? 45.068  5.352   7.758   1.00 3.15   ? 22  TYR D OH  1 
ATOM   6652  N N   . GLY D  2 23  ? 47.739  -2.469  5.035   1.00 9.85   ? 23  GLY D N   1 
ATOM   6653  C CA  . GLY D  2 23  ? 47.777  -3.909  4.877   1.00 10.41  ? 23  GLY D CA  1 
ATOM   6654  C C   . GLY D  2 23  ? 49.168  -4.502  4.991   1.00 11.14  ? 23  GLY D C   1 
ATOM   6655  O O   . GLY D  2 23  ? 50.144  -3.812  5.332   1.00 11.73  ? 23  GLY D O   1 
ATOM   6656  N N   . PHE D  2 24  ? 49.230  -5.795  4.676   1.00 10.49  ? 24  PHE D N   1 
ATOM   6657  C CA  . PHE D  2 24  ? 50.422  -6.596  4.797   1.00 9.41   ? 24  PHE D CA  1 
ATOM   6658  C C   . PHE D  2 24  ? 50.845  -7.209  3.486   1.00 10.53  ? 24  PHE D C   1 
ATOM   6659  O O   . PHE D  2 24  ? 50.008  -7.602  2.677   1.00 12.09  ? 24  PHE D O   1 
ATOM   6660  C CB  . PHE D  2 24  ? 50.194  -7.732  5.704   1.00 8.30   ? 24  PHE D CB  1 
ATOM   6661  C CG  . PHE D  2 24  ? 49.743  -7.350  7.090   1.00 7.65   ? 24  PHE D CG  1 
ATOM   6662  C CD1 . PHE D  2 24  ? 48.402  -7.335  7.370   1.00 6.59   ? 24  PHE D CD1 1 
ATOM   6663  C CD2 . PHE D  2 24  ? 50.679  -7.068  8.067   1.00 7.38   ? 24  PHE D CD2 1 
ATOM   6664  C CE1 . PHE D  2 24  ? 48.001  -7.051  8.648   1.00 5.48   ? 24  PHE D CE1 1 
ATOM   6665  C CE2 . PHE D  2 24  ? 50.265  -6.787  9.332   1.00 5.38   ? 24  PHE D CE2 1 
ATOM   6666  C CZ  . PHE D  2 24  ? 48.926  -6.780  9.615   1.00 4.98   ? 24  PHE D CZ  1 
ATOM   6667  N N   . ARG D  2 25  ? 52.132  -7.263  3.219   1.00 10.62  ? 25  ARG D N   1 
ATOM   6668  C CA  . ARG D  2 25  ? 52.669  -8.123  2.179   1.00 10.21  ? 25  ARG D CA  1 
ATOM   6669  C C   . ARG D  2 25  ? 53.617  -9.101  2.898   1.00 11.02  ? 25  ARG D C   1 
ATOM   6670  O O   . ARG D  2 25  ? 54.058  -8.851  4.017   1.00 11.47  ? 25  ARG D O   1 
ATOM   6671  C CB  . ARG D  2 25  ? 53.412  -7.311  1.150   1.00 8.65   ? 25  ARG D CB  1 
ATOM   6672  C CG  . ARG D  2 25  ? 52.480  -6.635  0.155   1.00 8.05   ? 25  ARG D CG  1 
ATOM   6673  C CD  . ARG D  2 25  ? 53.282  -5.850  -0.888  1.00 7.72   ? 25  ARG D CD  1 
ATOM   6674  N NE  . ARG D  2 25  ? 52.467  -5.166  -1.873  1.00 6.99   ? 25  ARG D NE  1 
ATOM   6675  C CZ  . ARG D  2 25  ? 53.011  -4.446  -2.881  1.00 8.37   ? 25  ARG D CZ  1 
ATOM   6676  N NH1 . ARG D  2 25  ? 52.243  -3.898  -3.844  1.00 8.97   ? 25  ARG D NH1 1 
ATOM   6677  N NH2 . ARG D  2 25  ? 54.325  -4.218  -2.963  1.00 9.10   ? 25  ARG D NH2 1 
ATOM   6678  N N   . HIS D  2 26  ? 53.909  -10.276 2.397   1.00 12.63  ? 26  HIS D N   1 
ATOM   6679  C CA  . HIS D  2 26  ? 54.837  -11.149 3.081   1.00 14.03  ? 26  HIS D CA  1 
ATOM   6680  C C   . HIS D  2 26  ? 55.526  -12.031 2.084   1.00 15.16  ? 26  HIS D C   1 
ATOM   6681  O O   . HIS D  2 26  ? 55.030  -12.206 0.973   1.00 16.03  ? 26  HIS D O   1 
ATOM   6682  C CB  . HIS D  2 26  ? 54.141  -12.048 4.076   1.00 14.93  ? 26  HIS D CB  1 
ATOM   6683  C CG  . HIS D  2 26  ? 53.297  -13.193 3.541   1.00 15.41  ? 26  HIS D CG  1 
ATOM   6684  N ND1 . HIS D  2 26  ? 51.996  -13.094 3.286   1.00 15.63  ? 26  HIS D ND1 1 
ATOM   6685  C CD2 . HIS D  2 26  ? 53.686  -14.465 3.280   1.00 15.46  ? 26  HIS D CD2 1 
ATOM   6686  C CE1 . HIS D  2 26  ? 51.609  -14.280 2.880   1.00 15.66  ? 26  HIS D CE1 1 
ATOM   6687  N NE2 . HIS D  2 26  ? 52.623  -15.100 2.877   1.00 15.59  ? 26  HIS D NE2 1 
ATOM   6688  N N   . GLN D  2 27  ? 56.610  -12.643 2.479   1.00 16.33  ? 27  GLN D N   1 
ATOM   6689  C CA  . GLN D  2 27  ? 57.225  -13.638 1.649   1.00 18.05  ? 27  GLN D CA  1 
ATOM   6690  C C   . GLN D  2 27  ? 57.648  -14.637 2.689   1.00 17.68  ? 27  GLN D C   1 
ATOM   6691  O O   . GLN D  2 27  ? 58.477  -14.291 3.520   1.00 17.25  ? 27  GLN D O   1 
ATOM   6692  C CB  . GLN D  2 27  ? 58.426  -13.098 0.918   1.00 20.22  ? 27  GLN D CB  1 
ATOM   6693  C CG  . GLN D  2 27  ? 58.883  -14.235 0.017   1.00 23.56  ? 27  GLN D CG  1 
ATOM   6694  C CD  . GLN D  2 27  ? 60.382  -14.262 -0.203  1.00 25.54  ? 27  GLN D CD  1 
ATOM   6695  O OE1 . GLN D  2 27  ? 60.868  -14.221 -1.328  1.00 25.80  ? 27  GLN D OE1 1 
ATOM   6696  N NE2 . GLN D  2 27  ? 61.159  -14.307 0.876   1.00 27.00  ? 27  GLN D NE2 1 
ATOM   6697  N N   . ASN D  2 28  ? 57.013  -15.805 2.694   1.00 17.73  ? 28  ASN D N   1 
ATOM   6698  C CA  . ASN D  2 28  ? 57.274  -16.826 3.703   1.00 18.43  ? 28  ASN D CA  1 
ATOM   6699  C C   . ASN D  2 28  ? 57.612  -18.169 3.076   1.00 19.83  ? 28  ASN D C   1 
ATOM   6700  O O   . ASN D  2 28  ? 57.678  -18.174 1.848   1.00 21.23  ? 28  ASN D O   1 
ATOM   6701  C CB  . ASN D  2 28  ? 56.075  -16.969 4.530   1.00 17.50  ? 28  ASN D CB  1 
ATOM   6702  C CG  . ASN D  2 28  ? 54.901  -17.648 3.864   1.00 18.30  ? 28  ASN D CG  1 
ATOM   6703  O OD1 . ASN D  2 28  ? 53.942  -17.847 4.577   1.00 19.00  ? 28  ASN D OD1 1 
ATOM   6704  N ND2 . ASN D  2 28  ? 54.701  -17.967 2.596   1.00 18.57  ? 28  ASN D ND2 1 
ATOM   6705  N N   . SER D  2 29  ? 57.722  -19.302 3.815   1.00 20.96  ? 29  SER D N   1 
ATOM   6706  C CA  . SER D  2 29  ? 58.091  -20.593 3.219   1.00 20.98  ? 29  SER D CA  1 
ATOM   6707  C C   . SER D  2 29  ? 57.277  -20.907 1.996   1.00 21.08  ? 29  SER D C   1 
ATOM   6708  O O   . SER D  2 29  ? 57.870  -21.269 0.979   1.00 22.54  ? 29  SER D O   1 
ATOM   6709  C CB  . SER D  2 29  ? 57.918  -21.792 4.158   1.00 21.68  ? 29  SER D CB  1 
ATOM   6710  O OG  . SER D  2 29  ? 56.757  -21.825 4.985   1.00 23.03  ? 29  SER D OG  1 
ATOM   6711  N N   . GLU D  2 30  ? 55.960  -20.710 1.975   1.00 20.40  ? 30  GLU D N   1 
ATOM   6712  C CA  . GLU D  2 30  ? 55.296  -20.947 0.710   1.00 20.05  ? 30  GLU D CA  1 
ATOM   6713  C C   . GLU D  2 30  ? 55.023  -19.738 -0.189  1.00 19.18  ? 30  GLU D C   1 
ATOM   6714  O O   . GLU D  2 30  ? 53.927  -19.576 -0.716  1.00 20.39  ? 30  GLU D O   1 
ATOM   6715  C CB  . GLU D  2 30  ? 54.011  -21.709 0.940   1.00 21.68  ? 30  GLU D CB  1 
ATOM   6716  C CG  . GLU D  2 30  ? 53.216  -21.192 2.081   1.00 24.20  ? 30  GLU D CG  1 
ATOM   6717  C CD  . GLU D  2 30  ? 53.051  -22.193 3.180   1.00 25.46  ? 30  GLU D CD  1 
ATOM   6718  O OE1 . GLU D  2 30  ? 51.900  -22.526 3.502   1.00 25.30  ? 30  GLU D OE1 1 
ATOM   6719  O OE2 . GLU D  2 30  ? 54.093  -22.583 3.730   1.00 27.15  ? 30  GLU D OE2 1 
ATOM   6720  N N   . GLY D  2 31  ? 56.025  -18.886 -0.442  1.00 17.84  ? 31  GLY D N   1 
ATOM   6721  C CA  . GLY D  2 31  ? 55.891  -17.827 -1.441  1.00 16.34  ? 31  GLY D CA  1 
ATOM   6722  C C   . GLY D  2 31  ? 55.404  -16.488 -0.921  1.00 15.65  ? 31  GLY D C   1 
ATOM   6723  O O   . GLY D  2 31  ? 55.212  -16.303 0.294   1.00 16.73  ? 31  GLY D O   1 
ATOM   6724  N N   . THR D  2 32  ? 55.285  -15.521 -1.828  1.00 13.96  ? 32  THR D N   1 
ATOM   6725  C CA  . THR D  2 32  ? 54.815  -14.188 -1.515  1.00 12.74  ? 32  THR D CA  1 
ATOM   6726  C C   . THR D  2 32  ? 53.304  -14.040 -1.502  1.00 13.23  ? 32  THR D C   1 
ATOM   6727  O O   . THR D  2 32  ? 52.633  -14.822 -2.175  1.00 12.63  ? 32  THR D O   1 
ATOM   6728  C CB  . THR D  2 32  ? 55.378  -13.227 -2.516  1.00 11.29  ? 32  THR D CB  1 
ATOM   6729  O OG1 . THR D  2 32  ? 55.161  -13.821 -3.769  1.00 11.24  ? 32  THR D OG1 1 
ATOM   6730  C CG2 . THR D  2 32  ? 56.823  -12.965 -2.337  1.00 10.80  ? 32  THR D CG2 1 
ATOM   6731  N N   . GLY D  2 33  ? 52.779  -13.030 -0.776  1.00 14.08  ? 33  GLY D N   1 
ATOM   6732  C CA  . GLY D  2 33  ? 51.349  -12.729 -0.760  1.00 16.33  ? 33  GLY D CA  1 
ATOM   6733  C C   . GLY D  2 33  ? 51.055  -11.369 -0.136  1.00 17.76  ? 33  GLY D C   1 
ATOM   6734  O O   . GLY D  2 33  ? 51.815  -10.952 0.728   1.00 17.82  ? 33  GLY D O   1 
ATOM   6735  N N   . GLN D  2 34  ? 49.981  -10.674 -0.504  1.00 20.31  ? 34  GLN D N   1 
ATOM   6736  C CA  . GLN D  2 34  ? 49.591  -9.398  0.068   1.00 22.35  ? 34  GLN D CA  1 
ATOM   6737  C C   . GLN D  2 34  ? 48.186  -9.565  0.655   1.00 23.52  ? 34  GLN D C   1 
ATOM   6738  O O   . GLN D  2 34  ? 47.512  -10.515 0.279   1.00 25.82  ? 34  GLN D O   1 
ATOM   6739  C CB  . GLN D  2 34  ? 49.593  -8.378  -1.039  1.00 23.33  ? 34  GLN D CB  1 
ATOM   6740  C CG  . GLN D  2 34  ? 49.208  -6.960  -0.683  1.00 25.15  ? 34  GLN D CG  1 
ATOM   6741  C CD  . GLN D  2 34  ? 48.931  -6.108  -1.907  1.00 25.83  ? 34  GLN D CD  1 
ATOM   6742  O OE1 . GLN D  2 34  ? 49.820  -5.496  -2.507  1.00 25.97  ? 34  GLN D OE1 1 
ATOM   6743  N NE2 . GLN D  2 34  ? 47.661  -6.026  -2.273  1.00 26.51  ? 34  GLN D NE2 1 
ATOM   6744  N N   . ALA D  2 35  ? 47.701  -8.732  1.575   1.00 23.20  ? 35  ALA D N   1 
ATOM   6745  C CA  . ALA D  2 35  ? 46.352  -8.824  2.112   1.00 22.43  ? 35  ALA D CA  1 
ATOM   6746  C C   . ALA D  2 35  ? 46.033  -7.528  2.840   1.00 22.32  ? 35  ALA D C   1 
ATOM   6747  O O   . ALA D  2 35  ? 46.893  -7.101  3.608   1.00 23.22  ? 35  ALA D O   1 
ATOM   6748  C CB  . ALA D  2 35  ? 46.302  -9.946  3.093   1.00 22.86  ? 35  ALA D CB  1 
ATOM   6749  N N   . ALA D  2 36  ? 44.909  -6.841  2.625   1.00 21.73  ? 36  ALA D N   1 
ATOM   6750  C CA  . ALA D  2 36  ? 44.649  -5.595  3.335   1.00 21.50  ? 36  ALA D CA  1 
ATOM   6751  C C   . ALA D  2 36  ? 44.165  -5.819  4.748   1.00 21.85  ? 36  ALA D C   1 
ATOM   6752  O O   . ALA D  2 36  ? 43.581  -6.865  5.025   1.00 22.85  ? 36  ALA D O   1 
ATOM   6753  C CB  . ALA D  2 36  ? 43.592  -4.774  2.649   1.00 20.91  ? 36  ALA D CB  1 
ATOM   6754  N N   . ASP D  2 37  ? 44.430  -4.894  5.673   1.00 21.69  ? 37  ASP D N   1 
ATOM   6755  C CA  . ASP D  2 37  ? 43.932  -5.026  7.031   1.00 22.01  ? 37  ASP D CA  1 
ATOM   6756  C C   . ASP D  2 37  ? 42.624  -4.272  7.170   1.00 22.05  ? 37  ASP D C   1 
ATOM   6757  O O   . ASP D  2 37  ? 42.562  -3.043  7.037   1.00 22.49  ? 37  ASP D O   1 
ATOM   6758  C CB  . ASP D  2 37  ? 44.924  -4.478  8.072   1.00 22.36  ? 37  ASP D CB  1 
ATOM   6759  C CG  . ASP D  2 37  ? 44.349  -4.452  9.488   1.00 22.79  ? 37  ASP D CG  1 
ATOM   6760  O OD1 . ASP D  2 37  ? 43.734  -5.418  9.922   1.00 24.20  ? 37  ASP D OD1 1 
ATOM   6761  O OD2 . ASP D  2 37  ? 44.434  -3.436  10.162  1.00 22.69  ? 37  ASP D OD2 1 
ATOM   6762  N N   . LEU D  2 38  ? 41.538  -4.968  7.474   1.00 21.72  ? 38  LEU D N   1 
ATOM   6763  C CA  . LEU D  2 38  ? 40.282  -4.269  7.541   1.00 21.79  ? 38  LEU D CA  1 
ATOM   6764  C C   . LEU D  2 38  ? 40.019  -3.528  8.817   1.00 21.31  ? 38  LEU D C   1 
ATOM   6765  O O   . LEU D  2 38  ? 39.240  -2.572  8.770   1.00 21.50  ? 38  LEU D O   1 
ATOM   6766  C CB  . LEU D  2 38  ? 39.106  -5.189  7.305   1.00 23.33  ? 38  LEU D CB  1 
ATOM   6767  C CG  . LEU D  2 38  ? 38.757  -5.497  5.829   1.00 24.18  ? 38  LEU D CG  1 
ATOM   6768  C CD1 . LEU D  2 38  ? 39.311  -4.424  4.873   1.00 24.09  ? 38  LEU D CD1 1 
ATOM   6769  C CD2 . LEU D  2 38  ? 39.380  -6.830  5.458   1.00 24.89  ? 38  LEU D CD2 1 
ATOM   6770  N N   . LYS D  2 39  ? 40.666  -3.863  9.933   1.00 20.58  ? 39  LYS D N   1 
ATOM   6771  C CA  . LYS D  2 39  ? 40.379  -3.124  11.147  1.00 20.20  ? 39  LYS D CA  1 
ATOM   6772  C C   . LYS D  2 39  ? 40.959  -1.725  11.129  1.00 18.26  ? 39  LYS D C   1 
ATOM   6773  O O   . LYS D  2 39  ? 40.258  -0.787  11.519  1.00 17.70  ? 39  LYS D O   1 
ATOM   6774  C CB  . LYS D  2 39  ? 40.912  -3.825  12.352  1.00 22.88  ? 39  LYS D CB  1 
ATOM   6775  C CG  . LYS D  2 39  ? 40.004  -4.935  12.868  1.00 27.38  ? 39  LYS D CG  1 
ATOM   6776  C CD  . LYS D  2 39  ? 40.330  -5.208  14.352  1.00 31.10  ? 39  LYS D CD  1 
ATOM   6777  C CE  . LYS D  2 39  ? 40.023  -3.943  15.208  1.00 33.46  ? 39  LYS D CE  1 
ATOM   6778  N NZ  . LYS D  2 39  ? 40.357  -4.096  16.626  1.00 34.92  ? 39  LYS D NZ  1 
ATOM   6779  N N   . SER D  2 40  ? 42.197  -1.523  10.664  1.00 15.84  ? 40  SER D N   1 
ATOM   6780  C CA  . SER D  2 40  ? 42.718  -0.176  10.641  1.00 13.72  ? 40  SER D CA  1 
ATOM   6781  C C   . SER D  2 40  ? 42.069  0.576   9.490   1.00 12.61  ? 40  SER D C   1 
ATOM   6782  O O   . SER D  2 40  ? 41.817  1.779   9.617   1.00 13.25  ? 40  SER D O   1 
ATOM   6783  C CB  . SER D  2 40  ? 44.231  -0.173  10.481  1.00 12.78  ? 40  SER D CB  1 
ATOM   6784  O OG  . SER D  2 40  ? 44.562  -0.778  9.253   1.00 12.56  ? 40  SER D OG  1 
ATOM   6785  N N   . THR D  2 41  ? 41.762  -0.083  8.369   1.00 10.43  ? 41  THR D N   1 
ATOM   6786  C CA  . THR D  2 41  ? 41.052  0.608   7.317   1.00 9.42   ? 41  THR D CA  1 
ATOM   6787  C C   . THR D  2 41  ? 39.707  1.159   7.781   1.00 10.04  ? 41  THR D C   1 
ATOM   6788  O O   . THR D  2 41  ? 39.375  2.300   7.460   1.00 10.26  ? 41  THR D O   1 
ATOM   6789  C CB  . THR D  2 41  ? 40.902  -0.341  6.157   1.00 8.91   ? 41  THR D CB  1 
ATOM   6790  O OG1 . THR D  2 41  ? 42.224  -0.662  5.718   1.00 8.26   ? 41  THR D OG1 1 
ATOM   6791  C CG2 . THR D  2 41  ? 40.151  0.277   5.002   1.00 8.85   ? 41  THR D CG2 1 
ATOM   6792  N N   . GLN D  2 42  ? 38.937  0.438   8.585   1.00 11.62  ? 42  GLN D N   1 
ATOM   6793  C CA  . GLN D  2 42  ? 37.702  1.003   9.100   1.00 13.75  ? 42  GLN D CA  1 
ATOM   6794  C C   . GLN D  2 42  ? 37.980  2.150   10.050  1.00 13.18  ? 42  GLN D C   1 
ATOM   6795  O O   . GLN D  2 42  ? 37.442  3.226   9.832   1.00 11.95  ? 42  GLN D O   1 
ATOM   6796  C CB  . GLN D  2 42  ? 36.853  -0.027  9.853   1.00 16.97  ? 42  GLN D CB  1 
ATOM   6797  C CG  . GLN D  2 42  ? 35.744  -0.640  9.019   1.00 19.90  ? 42  GLN D CG  1 
ATOM   6798  C CD  . GLN D  2 42  ? 34.969  0.390   8.205   1.00 22.00  ? 42  GLN D CD  1 
ATOM   6799  O OE1 . GLN D  2 42  ? 34.893  0.277   6.981   1.00 23.23  ? 42  GLN D OE1 1 
ATOM   6800  N NE2 . GLN D  2 42  ? 34.383  1.430   8.792   1.00 23.38  ? 42  GLN D NE2 1 
ATOM   6801  N N   . ALA D  2 43  ? 38.886  1.977   11.026  1.00 13.25  ? 43  ALA D N   1 
ATOM   6802  C CA  . ALA D  2 43  ? 39.264  3.054   11.938  1.00 12.85  ? 43  ALA D CA  1 
ATOM   6803  C C   . ALA D  2 43  ? 39.570  4.359   11.220  1.00 11.88  ? 43  ALA D C   1 
ATOM   6804  O O   . ALA D  2 43  ? 39.017  5.401   11.572  1.00 11.92  ? 43  ALA D O   1 
ATOM   6805  C CB  . ALA D  2 43  ? 40.511  2.730   12.720  1.00 13.54  ? 43  ALA D CB  1 
ATOM   6806  N N   . ALA D  2 44  ? 40.417  4.324   10.195  1.00 10.79  ? 44  ALA D N   1 
ATOM   6807  C CA  . ALA D  2 44  ? 40.688  5.502   9.400   1.00 10.29  ? 44  ALA D CA  1 
ATOM   6808  C C   . ALA D  2 44  ? 39.424  6.047   8.760   1.00 10.95  ? 44  ALA D C   1 
ATOM   6809  O O   . ALA D  2 44  ? 39.158  7.251   8.909   1.00 12.67  ? 44  ALA D O   1 
ATOM   6810  C CB  . ALA D  2 44  ? 41.649  5.200   8.287   1.00 9.67   ? 44  ALA D CB  1 
ATOM   6811  N N   . ILE D  2 45  ? 38.604  5.180   8.142   1.00 10.46  ? 45  ILE D N   1 
ATOM   6812  C CA  . ILE D  2 45  ? 37.383  5.587   7.452   1.00 10.16  ? 45  ILE D CA  1 
ATOM   6813  C C   . ILE D  2 45  ? 36.329  6.205   8.358   1.00 11.75  ? 45  ILE D C   1 
ATOM   6814  O O   . ILE D  2 45  ? 35.824  7.285   8.020   1.00 12.02  ? 45  ILE D O   1 
ATOM   6815  C CB  . ILE D  2 45  ? 36.860  4.367   6.730   1.00 8.86   ? 45  ILE D CB  1 
ATOM   6816  C CG1 . ILE D  2 45  ? 37.463  4.439   5.390   1.00 7.38   ? 45  ILE D CG1 1 
ATOM   6817  C CG2 . ILE D  2 45  ? 35.363  4.285   6.586   1.00 9.08   ? 45  ILE D CG2 1 
ATOM   6818  C CD1 . ILE D  2 45  ? 37.494  3.036   4.797   1.00 6.80   ? 45  ILE D CD1 1 
ATOM   6819  N N   . ASP D  2 46  ? 36.037  5.591   9.505   1.00 12.73  ? 46  ASP D N   1 
ATOM   6820  C CA  . ASP D  2 46  ? 35.006  6.089   10.382  1.00 14.16  ? 46  ASP D CA  1 
ATOM   6821  C C   . ASP D  2 46  ? 35.348  7.449   10.929  1.00 12.82  ? 46  ASP D C   1 
ATOM   6822  O O   . ASP D  2 46  ? 34.508  8.346   10.911  1.00 14.40  ? 46  ASP D O   1 
ATOM   6823  C CB  . ASP D  2 46  ? 34.782  5.106   11.528  1.00 17.31  ? 46  ASP D CB  1 
ATOM   6824  C CG  . ASP D  2 46  ? 34.230  3.752   11.083  1.00 19.63  ? 46  ASP D CG  1 
ATOM   6825  O OD1 . ASP D  2 46  ? 33.402  3.688   10.164  1.00 21.40  ? 46  ASP D OD1 1 
ATOM   6826  O OD2 . ASP D  2 46  ? 34.653  2.737   11.643  1.00 20.61  ? 46  ASP D OD2 1 
ATOM   6827  N N   . GLN D  2 47  ? 36.580  7.688   11.352  1.00 11.04  ? 47  GLN D N   1 
ATOM   6828  C CA  . GLN D  2 47  ? 36.986  9.025   11.789  1.00 10.25  ? 47  GLN D CA  1 
ATOM   6829  C C   . GLN D  2 47  ? 36.802  10.039  10.669  1.00 8.72   ? 47  GLN D C   1 
ATOM   6830  O O   . GLN D  2 47  ? 36.229  11.122  10.886  1.00 7.68   ? 47  GLN D O   1 
ATOM   6831  C CB  . GLN D  2 47  ? 38.428  9.063   12.183  1.00 10.64  ? 47  GLN D CB  1 
ATOM   6832  C CG  . GLN D  2 47  ? 38.630  8.201   13.385  1.00 13.21  ? 47  GLN D CG  1 
ATOM   6833  C CD  . GLN D  2 47  ? 40.089  8.022   13.732  1.00 14.82  ? 47  GLN D CD  1 
ATOM   6834  O OE1 . GLN D  2 47  ? 40.641  8.814   14.506  1.00 17.38  ? 47  GLN D OE1 1 
ATOM   6835  N NE2 . GLN D  2 47  ? 40.755  6.995   13.211  1.00 14.46  ? 47  GLN D NE2 1 
ATOM   6836  N N   . ILE D  2 48  ? 37.225  9.683   9.450   1.00 7.41   ? 48  ILE D N   1 
ATOM   6837  C CA  . ILE D  2 48  ? 37.054  10.607  8.341   1.00 6.99   ? 48  ILE D CA  1 
ATOM   6838  C C   . ILE D  2 48  ? 35.581  10.841  8.067   1.00 7.20   ? 48  ILE D C   1 
ATOM   6839  O O   . ILE D  2 48  ? 35.186  11.980  7.809   1.00 6.39   ? 48  ILE D O   1 
ATOM   6840  C CB  . ILE D  2 48  ? 37.767  10.088  7.070   1.00 5.87   ? 48  ILE D CB  1 
ATOM   6841  C CG1 . ILE D  2 48  ? 39.234  10.207  7.312   1.00 6.26   ? 48  ILE D CG1 1 
ATOM   6842  C CG2 . ILE D  2 48  ? 37.488  10.941  5.838   1.00 4.43   ? 48  ILE D CG2 1 
ATOM   6843  C CD1 . ILE D  2 48  ? 40.062  9.611   6.177   1.00 6.16   ? 48  ILE D CD1 1 
ATOM   6844  N N   . ASN D  2 49  ? 34.725  9.838   8.220   1.00 8.26   ? 49  ASN D N   1 
ATOM   6845  C CA  . ASN D  2 49  ? 33.309  10.070  8.008   1.00 9.40   ? 49  ASN D CA  1 
ATOM   6846  C C   . ASN D  2 49  ? 32.721  10.922  9.095   1.00 8.65   ? 49  ASN D C   1 
ATOM   6847  O O   . ASN D  2 49  ? 31.906  11.791  8.803   1.00 8.23   ? 49  ASN D O   1 
ATOM   6848  C CB  . ASN D  2 49  ? 32.520  8.798   7.974   1.00 12.80  ? 49  ASN D CB  1 
ATOM   6849  C CG  . ASN D  2 49  ? 32.767  8.013   6.686   1.00 16.02  ? 49  ASN D CG  1 
ATOM   6850  O OD1 . ASN D  2 49  ? 32.759  6.774   6.694   1.00 17.57  ? 49  ASN D OD1 1 
ATOM   6851  N ND2 . ASN D  2 49  ? 32.987  8.624   5.514   1.00 16.50  ? 49  ASN D ND2 1 
ATOM   6852  N N   . GLY D  2 50  ? 33.221  10.762  10.313  1.00 7.42   ? 50  GLY D N   1 
ATOM   6853  C CA  . GLY D  2 50  ? 32.724  11.503  11.433  1.00 7.30   ? 50  GLY D CA  1 
ATOM   6854  C C   . GLY D  2 50  ? 32.919  12.985  11.230  1.00 6.98   ? 50  GLY D C   1 
ATOM   6855  O O   . GLY D  2 50  ? 31.962  13.768  11.286  1.00 6.88   ? 50  GLY D O   1 
ATOM   6856  N N   . LYS D  2 51  ? 34.156  13.368  10.925  1.00 6.87   ? 51  LYS D N   1 
ATOM   6857  C CA  . LYS D  2 51  ? 34.412  14.768  10.725  1.00 6.68   ? 51  LYS D CA  1 
ATOM   6858  C C   . LYS D  2 51  ? 33.663  15.205  9.515   1.00 7.71   ? 51  LYS D C   1 
ATOM   6859  O O   . LYS D  2 51  ? 33.009  16.240  9.544   1.00 8.93   ? 51  LYS D O   1 
ATOM   6860  C CB  . LYS D  2 51  ? 35.881  15.087  10.520  1.00 5.24   ? 51  LYS D CB  1 
ATOM   6861  C CG  . LYS D  2 51  ? 36.623  14.369  9.449   1.00 3.33   ? 51  LYS D CG  1 
ATOM   6862  C CD  . LYS D  2 51  ? 37.922  15.091  9.303   1.00 2.23   ? 51  LYS D CD  1 
ATOM   6863  C CE  . LYS D  2 51  ? 38.890  14.841  10.463  1.00 2.64   ? 51  LYS D CE  1 
ATOM   6864  N NZ  . LYS D  2 51  ? 40.040  15.700  10.298  1.00 2.02   ? 51  LYS D NZ  1 
ATOM   6865  N N   . LEU D  2 52  ? 33.596  14.363  8.500   1.00 9.21   ? 52  LEU D N   1 
ATOM   6866  C CA  . LEU D  2 52  ? 32.891  14.775  7.307   1.00 12.51  ? 52  LEU D CA  1 
ATOM   6867  C C   . LEU D  2 52  ? 31.411  15.031  7.584   1.00 14.85  ? 52  LEU D C   1 
ATOM   6868  O O   . LEU D  2 52  ? 30.847  16.019  7.119   1.00 14.09  ? 52  LEU D O   1 
ATOM   6869  C CB  . LEU D  2 52  ? 33.066  13.708  6.258   1.00 11.77  ? 52  LEU D CB  1 
ATOM   6870  C CG  . LEU D  2 52  ? 32.487  13.889  4.888   1.00 10.58  ? 52  LEU D CG  1 
ATOM   6871  C CD1 . LEU D  2 52  ? 32.904  15.174  4.220   1.00 9.69   ? 52  LEU D CD1 1 
ATOM   6872  C CD2 . LEU D  2 52  ? 32.982  12.717  4.104   1.00 10.84  ? 52  LEU D CD2 1 
ATOM   6873  N N   . ASN D  2 53  ? 30.780  14.248  8.442   1.00 18.31  ? 53  ASN D N   1 
ATOM   6874  C CA  . ASN D  2 53  ? 29.376  14.456  8.722   1.00 21.18  ? 53  ASN D CA  1 
ATOM   6875  C C   . ASN D  2 53  ? 29.153  15.701  9.540   1.00 21.42  ? 53  ASN D C   1 
ATOM   6876  O O   . ASN D  2 53  ? 28.155  16.370  9.327   1.00 22.39  ? 53  ASN D O   1 
ATOM   6877  C CB  . ASN D  2 53  ? 28.753  13.311  9.504   1.00 24.37  ? 53  ASN D CB  1 
ATOM   6878  C CG  . ASN D  2 53  ? 28.619  12.031  8.694   1.00 26.39  ? 53  ASN D CG  1 
ATOM   6879  O OD1 . ASN D  2 53  ? 28.977  10.933  9.137   1.00 27.25  ? 53  ASN D OD1 1 
ATOM   6880  N ND2 . ASN D  2 53  ? 28.102  12.105  7.469   1.00 27.81  ? 53  ASN D ND2 1 
ATOM   6881  N N   . ARG D  2 54  ? 30.063  16.041  10.441  1.00 21.32  ? 54  ARG D N   1 
ATOM   6882  C CA  . ARG D  2 54  ? 29.897  17.195  11.288  1.00 21.64  ? 54  ARG D CA  1 
ATOM   6883  C C   . ARG D  2 54  ? 29.996  18.430  10.417  1.00 22.10  ? 54  ARG D C   1 
ATOM   6884  O O   . ARG D  2 54  ? 29.203  19.333  10.534  1.00 20.84  ? 54  ARG D O   1 
ATOM   6885  C CB  . ARG D  2 54  ? 30.987  17.088  12.335  1.00 22.44  ? 54  ARG D CB  1 
ATOM   6886  C CG  . ARG D  2 54  ? 30.878  17.895  13.607  1.00 24.32  ? 54  ARG D CG  1 
ATOM   6887  C CD  . ARG D  2 54  ? 30.860  17.007  14.882  1.00 26.07  ? 54  ARG D CD  1 
ATOM   6888  N NE  . ARG D  2 54  ? 31.252  17.776  16.069  1.00 27.39  ? 54  ARG D NE  1 
ATOM   6889  C CZ  . ARG D  2 54  ? 30.534  18.831  16.536  1.00 28.21  ? 54  ARG D CZ  1 
ATOM   6890  N NH1 . ARG D  2 54  ? 31.034  19.580  17.553  1.00 29.40  ? 54  ARG D NH1 1 
ATOM   6891  N NH2 . ARG D  2 54  ? 29.302  19.124  16.065  1.00 27.31  ? 54  ARG D NH2 1 
ATOM   6892  N N   . VAL D  2 55  ? 30.920  18.486  9.462   1.00 24.57  ? 55  VAL D N   1 
ATOM   6893  C CA  . VAL D  2 55  ? 31.060  19.669  8.630   1.00 27.41  ? 55  VAL D CA  1 
ATOM   6894  C C   . VAL D  2 55  ? 29.947  19.717  7.582   1.00 31.08  ? 55  VAL D C   1 
ATOM   6895  O O   . VAL D  2 55  ? 29.611  20.786  7.080   1.00 32.08  ? 55  VAL D O   1 
ATOM   6896  C CB  . VAL D  2 55  ? 32.511  19.665  8.001   1.00 25.67  ? 55  VAL D CB  1 
ATOM   6897  C CG1 . VAL D  2 55  ? 32.664  18.577  6.994   1.00 26.33  ? 55  VAL D CG1 1 
ATOM   6898  C CG2 . VAL D  2 55  ? 32.779  20.916  7.238   1.00 23.90  ? 55  VAL D CG2 1 
ATOM   6899  N N   . ILE D  2 56  ? 29.339  18.591  7.221   1.00 35.14  ? 56  ILE D N   1 
ATOM   6900  C CA  . ILE D  2 56  ? 28.284  18.603  6.223   1.00 39.43  ? 56  ILE D CA  1 
ATOM   6901  C C   . ILE D  2 56  ? 26.914  18.844  6.857   1.00 43.39  ? 56  ILE D C   1 
ATOM   6902  O O   . ILE D  2 56  ? 25.909  18.904  6.141   1.00 44.45  ? 56  ILE D O   1 
ATOM   6903  C CB  . ILE D  2 56  ? 28.413  17.238  5.451   1.00 39.52  ? 56  ILE D CB  1 
ATOM   6904  C CG1 . ILE D  2 56  ? 28.464  17.587  4.004   1.00 39.11  ? 56  ILE D CG1 1 
ATOM   6905  C CG2 . ILE D  2 56  ? 27.297  16.228  5.687   1.00 39.60  ? 56  ILE D CG2 1 
ATOM   6906  C CD1 . ILE D  2 56  ? 29.895  17.992  3.637   1.00 38.93  ? 56  ILE D CD1 1 
ATOM   6907  N N   . GLU D  2 57  ? 26.819  18.987  8.189   1.00 47.81  ? 57  GLU D N   1 
ATOM   6908  C CA  . GLU D  2 57  ? 25.540  19.169  8.871   1.00 52.15  ? 57  GLU D CA  1 
ATOM   6909  C C   . GLU D  2 57  ? 25.168  20.644  9.108   1.00 54.18  ? 57  GLU D C   1 
ATOM   6910  O O   . GLU D  2 57  ? 25.876  21.590  8.746   1.00 54.63  ? 57  GLU D O   1 
ATOM   6911  C CB  . GLU D  2 57  ? 25.640  18.313  10.175  1.00 53.79  ? 57  GLU D CB  1 
ATOM   6912  C CG  . GLU D  2 57  ? 25.163  18.691  11.597  1.00 56.38  ? 57  GLU D CG  1 
ATOM   6913  C CD  . GLU D  2 57  ? 26.213  19.257  12.588  1.00 58.50  ? 57  GLU D CD  1 
ATOM   6914  O OE1 . GLU D  2 57  ? 26.725  20.371  12.399  1.00 58.95  ? 57  GLU D OE1 1 
ATOM   6915  O OE2 . GLU D  2 57  ? 26.473  18.663  13.652  1.00 59.70  ? 57  GLU D OE2 1 
ATOM   6916  N N   . LYS D  2 58  ? 23.925  20.838  9.563   1.00 56.08  ? 58  LYS D N   1 
ATOM   6917  C CA  . LYS D  2 58  ? 23.367  22.133  9.971   1.00 57.43  ? 58  LYS D CA  1 
ATOM   6918  C C   . LYS D  2 58  ? 23.300  23.325  8.985   1.00 57.17  ? 58  LYS D C   1 
ATOM   6919  O O   . LYS D  2 58  ? 23.908  24.383  9.245   1.00 58.22  ? 58  LYS D O   1 
ATOM   6920  C CB  . LYS D  2 58  ? 24.101  22.606  11.258  1.00 58.29  ? 58  LYS D CB  1 
ATOM   6921  C CG  . LYS D  2 58  ? 23.791  21.935  12.594  1.00 59.56  ? 58  LYS D CG  1 
ATOM   6922  C CD  . LYS D  2 58  ? 24.778  22.580  13.573  1.00 60.54  ? 58  LYS D CD  1 
ATOM   6923  C CE  . LYS D  2 58  ? 25.135  21.766  14.826  1.00 60.78  ? 58  LYS D CE  1 
ATOM   6924  N NZ  . LYS D  2 58  ? 26.553  21.930  15.083  1.00 60.70  ? 58  LYS D NZ  1 
ATOM   6925  N N   . THR D  2 59  ? 22.563  23.266  7.854   1.00 55.90  ? 59  THR D N   1 
ATOM   6926  C CA  . THR D  2 59  ? 22.372  24.499  7.077   1.00 54.17  ? 59  THR D CA  1 
ATOM   6927  C C   . THR D  2 59  ? 21.374  25.360  7.826   1.00 52.02  ? 59  THR D C   1 
ATOM   6928  O O   . THR D  2 59  ? 20.356  24.896  8.354   1.00 52.73  ? 59  THR D O   1 
ATOM   6929  C CB  . THR D  2 59  ? 21.813  24.291  5.622   1.00 55.04  ? 59  THR D CB  1 
ATOM   6930  O OG1 . THR D  2 59  ? 20.780  23.312  5.639   1.00 55.51  ? 59  THR D OG1 1 
ATOM   6931  C CG2 . THR D  2 59  ? 22.923  23.871  4.667   1.00 55.85  ? 59  THR D CG2 1 
ATOM   6932  N N   . ASN D  2 60  ? 21.713  26.615  7.971   1.00 49.29  ? 60  ASN D N   1 
ATOM   6933  C CA  . ASN D  2 60  ? 20.847  27.539  8.662   1.00 47.09  ? 60  ASN D CA  1 
ATOM   6934  C C   . ASN D  2 60  ? 19.906  28.074  7.584   1.00 43.72  ? 60  ASN D C   1 
ATOM   6935  O O   . ASN D  2 60  ? 20.328  28.326  6.442   1.00 43.07  ? 60  ASN D O   1 
ATOM   6936  C CB  . ASN D  2 60  ? 21.713  28.661  9.326   1.00 49.03  ? 60  ASN D CB  1 
ATOM   6937  C CG  . ASN D  2 60  ? 22.795  29.341  8.460   1.00 51.15  ? 60  ASN D CG  1 
ATOM   6938  O OD1 . ASN D  2 60  ? 23.363  28.762  7.515   1.00 52.28  ? 60  ASN D OD1 1 
ATOM   6939  N ND2 . ASN D  2 60  ? 23.284  30.540  8.781   1.00 51.73  ? 60  ASN D ND2 1 
ATOM   6940  N N   . GLU D  2 61  ? 18.605  28.132  7.875   1.00 38.72  ? 61  GLU D N   1 
ATOM   6941  C CA  . GLU D  2 61  ? 17.670  28.717  6.936   1.00 34.11  ? 61  GLU D CA  1 
ATOM   6942  C C   . GLU D  2 61  ? 17.687  30.203  7.157   1.00 30.22  ? 61  GLU D C   1 
ATOM   6943  O O   . GLU D  2 61  ? 17.833  30.655  8.299   1.00 31.31  ? 61  GLU D O   1 
ATOM   6944  C CB  . GLU D  2 61  ? 16.238  28.330  7.152   1.00 35.45  ? 61  GLU D CB  1 
ATOM   6945  C CG  . GLU D  2 61  ? 15.902  26.870  7.158   1.00 37.00  ? 61  GLU D CG  1 
ATOM   6946  C CD  . GLU D  2 61  ? 14.419  26.656  6.921   1.00 38.30  ? 61  GLU D CD  1 
ATOM   6947  O OE1 . GLU D  2 61  ? 14.000  26.694  5.755   1.00 39.41  ? 61  GLU D OE1 1 
ATOM   6948  O OE2 . GLU D  2 61  ? 13.696  26.472  7.897   1.00 39.02  ? 61  GLU D OE2 1 
ATOM   6949  N N   . LYS D  2 62  ? 17.609  31.011  6.130   1.00 24.75  ? 62  LYS D N   1 
ATOM   6950  C CA  . LYS D  2 62  ? 17.450  32.428  6.342   1.00 20.30  ? 62  LYS D CA  1 
ATOM   6951  C C   . LYS D  2 62  ? 16.375  32.839  5.376   1.00 18.08  ? 62  LYS D C   1 
ATOM   6952  O O   . LYS D  2 62  ? 16.301  32.315  4.262   1.00 17.92  ? 62  LYS D O   1 
ATOM   6953  C CB  . LYS D  2 62  ? 18.709  33.212  6.028   1.00 18.51  ? 62  LYS D CB  1 
ATOM   6954  C CG  . LYS D  2 62  ? 19.833  32.950  7.017   1.00 16.92  ? 62  LYS D CG  1 
ATOM   6955  C CD  . LYS D  2 62  ? 19.580  33.434  8.442   1.00 15.56  ? 62  LYS D CD  1 
ATOM   6956  C CE  . LYS D  2 62  ? 20.532  32.682  9.342   1.00 14.68  ? 62  LYS D CE  1 
ATOM   6957  N NZ  . LYS D  2 62  ? 20.432  33.100  10.721  1.00 15.61  ? 62  LYS D NZ  1 
ATOM   6958  N N   . PHE D  2 63  ? 15.465  33.700  5.793   1.00 15.19  ? 63  PHE D N   1 
ATOM   6959  C CA  . PHE D  2 63  ? 14.441  34.122  4.871   1.00 12.09  ? 63  PHE D CA  1 
ATOM   6960  C C   . PHE D  2 63  ? 14.638  35.599  4.528   1.00 10.99  ? 63  PHE D C   1 
ATOM   6961  O O   . PHE D  2 63  ? 15.636  35.961  3.901   1.00 11.11  ? 63  PHE D O   1 
ATOM   6962  C CB  . PHE D  2 63  ? 13.109  33.805  5.530   1.00 11.52  ? 63  PHE D CB  1 
ATOM   6963  C CG  . PHE D  2 63  ? 12.921  32.313  5.714   1.00 11.34  ? 63  PHE D CG  1 
ATOM   6964  C CD1 . PHE D  2 63  ? 12.864  31.487  4.630   1.00 11.09  ? 63  PHE D CD1 1 
ATOM   6965  C CD2 . PHE D  2 63  ? 12.821  31.782  6.978   1.00 11.87  ? 63  PHE D CD2 1 
ATOM   6966  C CE1 . PHE D  2 63  ? 12.740  30.129  4.797   1.00 10.98  ? 63  PHE D CE1 1 
ATOM   6967  C CE2 . PHE D  2 63  ? 12.690  30.422  7.145   1.00 11.46  ? 63  PHE D CE2 1 
ATOM   6968  C CZ  . PHE D  2 63  ? 12.641  29.599  6.053   1.00 11.32  ? 63  PHE D CZ  1 
ATOM   6969  N N   . HIS D  2 64  ? 13.777  36.520  4.951   1.00 9.05   ? 64  HIS D N   1 
ATOM   6970  C CA  . HIS D  2 64  ? 13.909  37.917  4.581   1.00 7.30   ? 64  HIS D CA  1 
ATOM   6971  C C   . HIS D  2 64  ? 15.137  38.481  5.228   1.00 6.90   ? 64  HIS D C   1 
ATOM   6972  O O   . HIS D  2 64  ? 15.212  38.490  6.450   1.00 7.73   ? 64  HIS D O   1 
ATOM   6973  C CB  . HIS D  2 64  ? 12.681  38.653  5.046   1.00 6.27   ? 64  HIS D CB  1 
ATOM   6974  C CG  . HIS D  2 64  ? 12.547  40.066  4.543   1.00 5.28   ? 64  HIS D CG  1 
ATOM   6975  N ND1 . HIS D  2 64  ? 12.363  40.435  3.283   1.00 4.17   ? 64  HIS D ND1 1 
ATOM   6976  C CD2 . HIS D  2 64  ? 12.508  41.169  5.349   1.00 5.95   ? 64  HIS D CD2 1 
ATOM   6977  C CE1 . HIS D  2 64  ? 12.190  41.737  3.295   1.00 5.72   ? 64  HIS D CE1 1 
ATOM   6978  N NE2 . HIS D  2 64  ? 12.279  42.172  4.530   1.00 6.79   ? 64  HIS D NE2 1 
ATOM   6979  N N   . GLN D  2 65  ? 16.126  38.840  4.440   1.00 6.67   ? 65  GLN D N   1 
ATOM   6980  C CA  . GLN D  2 65  ? 17.313  39.442  5.020   1.00 6.55   ? 65  GLN D CA  1 
ATOM   6981  C C   . GLN D  2 65  ? 17.378  40.942  4.665   1.00 6.25   ? 65  GLN D C   1 
ATOM   6982  O O   . GLN D  2 65  ? 16.357  41.618  4.704   1.00 6.14   ? 65  GLN D O   1 
ATOM   6983  C CB  . GLN D  2 65  ? 18.490  38.652  4.499   1.00 4.96   ? 65  GLN D CB  1 
ATOM   6984  C CG  . GLN D  2 65  ? 18.502  37.261  5.026   1.00 5.44   ? 65  GLN D CG  1 
ATOM   6985  C CD  . GLN D  2 65  ? 19.315  36.365  4.118   1.00 6.62   ? 65  GLN D CD  1 
ATOM   6986  O OE1 . GLN D  2 65  ? 20.561  36.400  4.095   1.00 8.09   ? 65  GLN D OE1 1 
ATOM   6987  N NE2 . GLN D  2 65  ? 18.601  35.590  3.327   1.00 6.96   ? 65  GLN D NE2 1 
ATOM   6988  N N   . ILE D  2 66  ? 18.539  41.511  4.357   1.00 5.03   ? 66  ILE D N   1 
ATOM   6989  C CA  . ILE D  2 66  ? 18.649  42.883  3.928   1.00 3.51   ? 66  ILE D CA  1 
ATOM   6990  C C   . ILE D  2 66  ? 18.873  42.800  2.451   1.00 3.88   ? 66  ILE D C   1 
ATOM   6991  O O   . ILE D  2 66  ? 19.253  41.739  1.952   1.00 2.00   ? 66  ILE D O   1 
ATOM   6992  C CB  . ILE D  2 66  ? 19.838  43.577  4.605   1.00 3.18   ? 66  ILE D CB  1 
ATOM   6993  C CG1 . ILE D  2 66  ? 21.147  42.870  4.450   1.00 2.29   ? 66  ILE D CG1 1 
ATOM   6994  C CG2 . ILE D  2 66  ? 19.503  43.618  6.082   1.00 4.77   ? 66  ILE D CG2 1 
ATOM   6995  C CD1 . ILE D  2 66  ? 22.271  43.794  4.889   1.00 2.00   ? 66  ILE D CD1 1 
ATOM   6996  N N   . GLU D  2 67  ? 18.678  43.899  1.739   1.00 7.06   ? 67  GLU D N   1 
ATOM   6997  C CA  . GLU D  2 67  ? 18.843  43.899  0.292   1.00 9.07   ? 67  GLU D CA  1 
ATOM   6998  C C   . GLU D  2 67  ? 20.323  43.927  0.011   1.00 10.02  ? 67  GLU D C   1 
ATOM   6999  O O   . GLU D  2 67  ? 21.092  44.534  0.747   1.00 11.77  ? 67  GLU D O   1 
ATOM   7000  C CB  . GLU D  2 67  ? 18.179  45.115  -0.309  1.00 10.00  ? 67  GLU D CB  1 
ATOM   7001  C CG  . GLU D  2 67  ? 17.693  44.823  -1.711  1.00 12.92  ? 67  GLU D CG  1 
ATOM   7002  C CD  . GLU D  2 67  ? 16.389  44.021  -1.847  1.00 15.49  ? 67  GLU D CD  1 
ATOM   7003  O OE1 . GLU D  2 67  ? 16.275  43.337  -2.875  1.00 17.37  ? 67  GLU D OE1 1 
ATOM   7004  O OE2 . GLU D  2 67  ? 15.432  44.139  -1.051  1.00 15.61  ? 67  GLU D OE2 1 
ATOM   7005  N N   . LYS D  2 68  ? 20.819  43.264  -1.008  1.00 11.29  ? 68  LYS D N   1 
ATOM   7006  C CA  . LYS D  2 68  ? 22.265  43.237  -1.178  1.00 12.69  ? 68  LYS D CA  1 
ATOM   7007  C C   . LYS D  2 68  ? 22.738  43.745  -2.513  1.00 14.95  ? 68  LYS D C   1 
ATOM   7008  O O   . LYS D  2 68  ? 23.896  43.528  -2.851  1.00 16.41  ? 68  LYS D O   1 
ATOM   7009  C CB  . LYS D  2 68  ? 22.746  41.820  -0.980  1.00 11.57  ? 68  LYS D CB  1 
ATOM   7010  C CG  . LYS D  2 68  ? 22.390  41.357  0.416   1.00 10.56  ? 68  LYS D CG  1 
ATOM   7011  C CD  . LYS D  2 68  ? 22.799  39.934  0.575   1.00 9.17   ? 68  LYS D CD  1 
ATOM   7012  C CE  . LYS D  2 68  ? 22.242  39.429  1.870   1.00 7.51   ? 68  LYS D CE  1 
ATOM   7013  N NZ  . LYS D  2 68  ? 22.839  38.137  2.038   1.00 8.44   ? 68  LYS D NZ  1 
ATOM   7014  N N   . GLU D  2 69  ? 21.868  44.360  -3.297  1.00 17.57  ? 69  GLU D N   1 
ATOM   7015  C CA  . GLU D  2 69  ? 22.177  44.879  -4.607  1.00 20.99  ? 69  GLU D CA  1 
ATOM   7016  C C   . GLU D  2 69  ? 21.318  46.121  -4.776  1.00 22.35  ? 69  GLU D C   1 
ATOM   7017  O O   . GLU D  2 69  ? 20.092  46.085  -4.552  1.00 24.05  ? 69  GLU D O   1 
ATOM   7018  C CB  . GLU D  2 69  ? 21.829  43.849  -5.639  1.00 23.77  ? 69  GLU D CB  1 
ATOM   7019  C CG  . GLU D  2 69  ? 23.081  43.083  -6.037  1.00 28.73  ? 69  GLU D CG  1 
ATOM   7020  C CD  . GLU D  2 69  ? 22.873  41.798  -6.859  1.00 32.42  ? 69  GLU D CD  1 
ATOM   7021  O OE1 . GLU D  2 69  ? 23.676  40.858  -6.630  1.00 34.27  ? 69  GLU D OE1 1 
ATOM   7022  O OE2 . GLU D  2 69  ? 21.930  41.738  -7.678  1.00 33.18  ? 69  GLU D OE2 1 
ATOM   7023  N N   . PHE D  2 70  ? 21.913  47.254  -5.149  1.00 22.14  ? 70  PHE D N   1 
ATOM   7024  C CA  . PHE D  2 70  ? 21.183  48.515  -5.189  1.00 21.60  ? 70  PHE D CA  1 
ATOM   7025  C C   . PHE D  2 70  ? 21.264  49.020  -6.594  1.00 23.11  ? 70  PHE D C   1 
ATOM   7026  O O   . PHE D  2 70  ? 22.128  48.587  -7.340  1.00 22.86  ? 70  PHE D O   1 
ATOM   7027  C CB  . PHE D  2 70  ? 21.811  49.537  -4.241  1.00 19.80  ? 70  PHE D CB  1 
ATOM   7028  C CG  . PHE D  2 70  ? 21.931  48.935  -2.860  1.00 17.88  ? 70  PHE D CG  1 
ATOM   7029  C CD1 . PHE D  2 70  ? 20.903  49.061  -1.978  1.00 16.71  ? 70  PHE D CD1 1 
ATOM   7030  C CD2 . PHE D  2 70  ? 23.061  48.215  -2.533  1.00 17.99  ? 70  PHE D CD2 1 
ATOM   7031  C CE1 . PHE D  2 70  ? 20.969  48.422  -0.771  1.00 17.00  ? 70  PHE D CE1 1 
ATOM   7032  C CE2 . PHE D  2 70  ? 23.124  47.575  -1.327  1.00 17.78  ? 70  PHE D CE2 1 
ATOM   7033  C CZ  . PHE D  2 70  ? 22.080  47.691  -0.439  1.00 17.75  ? 70  PHE D CZ  1 
ATOM   7034  N N   . SER D  2 71  ? 20.415  49.941  -7.006  1.00 26.27  ? 71  SER D N   1 
ATOM   7035  C CA  . SER D  2 71  ? 20.456  50.391  -8.390  1.00 28.05  ? 71  SER D CA  1 
ATOM   7036  C C   . SER D  2 71  ? 20.317  51.893  -8.504  1.00 28.83  ? 71  SER D C   1 
ATOM   7037  O O   . SER D  2 71  ? 20.087  52.448  -9.585  1.00 29.93  ? 71  SER D O   1 
ATOM   7038  C CB  . SER D  2 71  ? 19.341  49.683  -9.113  1.00 28.79  ? 71  SER D CB  1 
ATOM   7039  O OG  . SER D  2 71  ? 18.225  49.540  -8.235  1.00 30.47  ? 71  SER D OG  1 
ATOM   7040  N N   . GLU D  2 72  ? 20.505  52.567  -7.383  1.00 29.42  ? 72  GLU D N   1 
ATOM   7041  C CA  . GLU D  2 72  ? 20.345  53.992  -7.282  1.00 29.73  ? 72  GLU D CA  1 
ATOM   7042  C C   . GLU D  2 72  ? 21.366  54.417  -6.215  1.00 27.02  ? 72  GLU D C   1 
ATOM   7043  O O   . GLU D  2 72  ? 21.747  53.599  -5.370  1.00 27.53  ? 72  GLU D O   1 
ATOM   7044  C CB  . GLU D  2 72  ? 18.876  54.180  -6.915  1.00 33.57  ? 72  GLU D CB  1 
ATOM   7045  C CG  . GLU D  2 72  ? 18.265  55.505  -7.354  1.00 38.53  ? 72  GLU D CG  1 
ATOM   7046  C CD  . GLU D  2 72  ? 18.884  56.754  -6.679  1.00 41.72  ? 72  GLU D CD  1 
ATOM   7047  O OE1 . GLU D  2 72  ? 18.416  57.157  -5.591  1.00 42.51  ? 72  GLU D OE1 1 
ATOM   7048  O OE2 . GLU D  2 72  ? 19.850  57.294  -7.259  1.00 42.91  ? 72  GLU D OE2 1 
ATOM   7049  N N   . VAL D  2 73  ? 21.913  55.613  -6.241  1.00 23.61  ? 73  VAL D N   1 
ATOM   7050  C CA  . VAL D  2 73  ? 22.956  55.949  -5.310  1.00 21.46  ? 73  VAL D CA  1 
ATOM   7051  C C   . VAL D  2 73  ? 22.325  56.655  -4.131  1.00 21.00  ? 73  VAL D C   1 
ATOM   7052  O O   . VAL D  2 73  ? 21.837  57.792  -4.247  1.00 22.10  ? 73  VAL D O   1 
ATOM   7053  C CB  . VAL D  2 73  ? 23.963  56.853  -5.972  1.00 20.85  ? 73  VAL D CB  1 
ATOM   7054  C CG1 . VAL D  2 73  ? 25.114  57.054  -5.031  1.00 21.65  ? 73  VAL D CG1 1 
ATOM   7055  C CG2 . VAL D  2 73  ? 24.431  56.264  -7.267  1.00 21.29  ? 73  VAL D CG2 1 
ATOM   7056  N N   . GLU D  2 74  ? 22.434  56.039  -2.959  1.00 18.24  ? 74  GLU D N   1 
ATOM   7057  C CA  . GLU D  2 74  ? 21.750  56.608  -1.816  1.00 15.94  ? 74  GLU D CA  1 
ATOM   7058  C C   . GLU D  2 74  ? 22.613  57.261  -0.750  1.00 14.63  ? 74  GLU D C   1 
ATOM   7059  O O   . GLU D  2 74  ? 22.163  58.130  -0.004  1.00 15.49  ? 74  GLU D O   1 
ATOM   7060  C CB  . GLU D  2 74  ? 20.941  55.535  -1.181  1.00 15.59  ? 74  GLU D CB  1 
ATOM   7061  C CG  . GLU D  2 74  ? 20.051  54.789  -2.138  1.00 15.87  ? 74  GLU D CG  1 
ATOM   7062  C CD  . GLU D  2 74  ? 19.235  53.814  -1.335  1.00 17.13  ? 74  GLU D CD  1 
ATOM   7063  O OE1 . GLU D  2 74  ? 18.432  54.245  -0.523  1.00 18.45  ? 74  GLU D OE1 1 
ATOM   7064  O OE2 . GLU D  2 74  ? 19.421  52.609  -1.437  1.00 17.53  ? 74  GLU D OE2 1 
ATOM   7065  N N   . GLY D  2 75  ? 23.858  56.836  -0.582  1.00 12.76  ? 75  GLY D N   1 
ATOM   7066  C CA  . GLY D  2 75  ? 24.690  57.405  0.463   1.00 10.27  ? 75  GLY D CA  1 
ATOM   7067  C C   . GLY D  2 75  ? 24.753  56.582  1.761   1.00 8.12   ? 75  GLY D C   1 
ATOM   7068  O O   . GLY D  2 75  ? 24.694  55.355  1.764   1.00 7.35   ? 75  GLY D O   1 
ATOM   7069  N N   . ARG D  2 76  ? 24.670  57.283  2.866   1.00 6.64   ? 76  ARG D N   1 
ATOM   7070  C CA  . ARG D  2 76  ? 24.968  56.726  4.150   1.00 5.69   ? 76  ARG D CA  1 
ATOM   7071  C C   . ARG D  2 76  ? 24.294  55.401  4.490   1.00 6.44   ? 76  ARG D C   1 
ATOM   7072  O O   . ARG D  2 76  ? 24.991  54.436  4.832   1.00 8.76   ? 76  ARG D O   1 
ATOM   7073  C CB  . ARG D  2 76  ? 24.658  57.750  5.206   1.00 3.88   ? 76  ARG D CB  1 
ATOM   7074  C CG  . ARG D  2 76  ? 25.184  57.359  6.556   1.00 3.21   ? 76  ARG D CG  1 
ATOM   7075  C CD  . ARG D  2 76  ? 24.514  58.246  7.551   1.00 3.57   ? 76  ARG D CD  1 
ATOM   7076  N NE  . ARG D  2 76  ? 25.065  57.995  8.861   1.00 3.61   ? 76  ARG D NE  1 
ATOM   7077  C CZ  . ARG D  2 76  ? 25.074  58.913  9.803   1.00 3.54   ? 76  ARG D CZ  1 
ATOM   7078  N NH1 . ARG D  2 76  ? 25.654  58.655  10.953  1.00 4.35   ? 76  ARG D NH1 1 
ATOM   7079  N NH2 . ARG D  2 76  ? 24.468  60.073  9.617   1.00 4.30   ? 76  ARG D NH2 1 
ATOM   7080  N N   . ILE D  2 77  ? 22.969  55.250  4.371   1.00 5.02   ? 77  ILE D N   1 
ATOM   7081  C CA  . ILE D  2 77  ? 22.376  53.975  4.778   1.00 3.81   ? 77  ILE D CA  1 
ATOM   7082  C C   . ILE D  2 77  ? 22.798  52.835  3.853   1.00 2.63   ? 77  ILE D C   1 
ATOM   7083  O O   . ILE D  2 77  ? 23.197  51.785  4.314   1.00 2.00   ? 77  ILE D O   1 
ATOM   7084  C CB  . ILE D  2 77  ? 20.828  54.150  4.860   1.00 4.31   ? 77  ILE D CB  1 
ATOM   7085  C CG1 . ILE D  2 77  ? 20.145  52.843  5.186   1.00 3.31   ? 77  ILE D CG1 1 
ATOM   7086  C CG2 . ILE D  2 77  ? 20.294  54.662  3.547   1.00 6.22   ? 77  ILE D CG2 1 
ATOM   7087  C CD1 . ILE D  2 77  ? 20.267  52.565  6.687   1.00 4.41   ? 77  ILE D CD1 1 
ATOM   7088  N N   . GLN D  2 78  ? 22.901  53.098  2.548   1.00 3.34   ? 78  GLN D N   1 
ATOM   7089  C CA  . GLN D  2 78  ? 23.281  52.058  1.596   1.00 4.04   ? 78  GLN D CA  1 
ATOM   7090  C C   . GLN D  2 78  ? 24.749  51.631  1.797   1.00 5.41   ? 78  GLN D C   1 
ATOM   7091  O O   . GLN D  2 78  ? 25.103  50.445  1.604   1.00 5.03   ? 78  GLN D O   1 
ATOM   7092  C CB  . GLN D  2 78  ? 23.089  52.583  0.206   1.00 3.12   ? 78  GLN D CB  1 
ATOM   7093  C CG  . GLN D  2 78  ? 23.361  51.519  -0.796  1.00 3.31   ? 78  GLN D CG  1 
ATOM   7094  C CD  . GLN D  2 78  ? 23.398  52.003  -2.224  1.00 3.65   ? 78  GLN D CD  1 
ATOM   7095  O OE1 . GLN D  2 78  ? 24.434  51.960  -2.887  1.00 3.82   ? 78  GLN D OE1 1 
ATOM   7096  N NE2 . GLN D  2 78  ? 22.286  52.432  -2.778  1.00 4.37   ? 78  GLN D NE2 1 
ATOM   7097  N N   . ASP D  2 79  ? 25.601  52.613  2.174   1.00 5.42   ? 79  ASP D N   1 
ATOM   7098  C CA  . ASP D  2 79  ? 26.995  52.392  2.522   1.00 4.44   ? 79  ASP D CA  1 
ATOM   7099  C C   . ASP D  2 79  ? 27.081  51.378  3.663   1.00 3.97   ? 79  ASP D C   1 
ATOM   7100  O O   . ASP D  2 79  ? 27.894  50.446  3.664   1.00 4.51   ? 79  ASP D O   1 
ATOM   7101  C CB  . ASP D  2 79  ? 27.644  53.700  2.989   1.00 5.22   ? 79  ASP D CB  1 
ATOM   7102  C CG  . ASP D  2 79  ? 28.111  54.762  2.001   1.00 6.04   ? 79  ASP D CG  1 
ATOM   7103  O OD1 . ASP D  2 79  ? 27.966  54.608  0.790   1.00 7.60   ? 79  ASP D OD1 1 
ATOM   7104  O OD2 . ASP D  2 79  ? 28.669  55.763  2.456   1.00 5.39   ? 79  ASP D OD2 1 
ATOM   7105  N N   . LEU D  2 80  ? 26.216  51.518  4.666   1.00 3.19   ? 80  LEU D N   1 
ATOM   7106  C CA  . LEU D  2 80  ? 26.197  50.629  5.808   1.00 3.18   ? 80  LEU D CA  1 
ATOM   7107  C C   . LEU D  2 80  ? 25.715  49.247  5.411   1.00 3.77   ? 80  LEU D C   1 
ATOM   7108  O O   . LEU D  2 80  ? 26.310  48.239  5.831   1.00 2.95   ? 80  LEU D O   1 
ATOM   7109  C CB  . LEU D  2 80  ? 25.299  51.235  6.863   1.00 2.65   ? 80  LEU D CB  1 
ATOM   7110  C CG  . LEU D  2 80  ? 25.063  50.544  8.173   1.00 2.00   ? 80  LEU D CG  1 
ATOM   7111  C CD1 . LEU D  2 80  ? 26.323  50.304  8.982   1.00 2.00   ? 80  LEU D CD1 1 
ATOM   7112  C CD2 . LEU D  2 80  ? 24.140  51.469  8.919   1.00 2.00   ? 80  LEU D CD2 1 
ATOM   7113  N N   . GLU D  2 81  ? 24.671  49.176  4.565   1.00 4.34   ? 81  GLU D N   1 
ATOM   7114  C CA  . GLU D  2 81  ? 24.158  47.885  4.103   1.00 4.42   ? 81  GLU D CA  1 
ATOM   7115  C C   . GLU D  2 81  ? 25.229  47.108  3.392   1.00 4.11   ? 81  GLU D C   1 
ATOM   7116  O O   . GLU D  2 81  ? 25.457  45.948  3.714   1.00 4.27   ? 81  GLU D O   1 
ATOM   7117  C CB  . GLU D  2 81  ? 23.010  48.058  3.162   1.00 4.19   ? 81  GLU D CB  1 
ATOM   7118  C CG  . GLU D  2 81  ? 21.856  48.522  3.990   1.00 5.79   ? 81  GLU D CG  1 
ATOM   7119  C CD  . GLU D  2 81  ? 20.747  49.161  3.185   1.00 7.22   ? 81  GLU D CD  1 
ATOM   7120  O OE1 . GLU D  2 81  ? 21.012  49.826  2.185   1.00 7.21   ? 81  GLU D OE1 1 
ATOM   7121  O OE2 . GLU D  2 81  ? 19.587  49.035  3.576   1.00 8.62   ? 81  GLU D OE2 1 
ATOM   7122  N N   . LYS D  2 82  ? 25.972  47.756  2.503   1.00 4.59   ? 82  LYS D N   1 
ATOM   7123  C CA  . LYS D  2 82  ? 27.051  47.065  1.827   1.00 4.91   ? 82  LYS D CA  1 
ATOM   7124  C C   . LYS D  2 82  ? 28.170  46.678  2.786   1.00 5.16   ? 82  LYS D C   1 
ATOM   7125  O O   . LYS D  2 82  ? 28.699  45.576  2.652   1.00 6.52   ? 82  LYS D O   1 
ATOM   7126  C CB  . LYS D  2 82  ? 27.618  47.914  0.761   1.00 5.49   ? 82  LYS D CB  1 
ATOM   7127  C CG  . LYS D  2 82  ? 26.569  48.248  -0.255  1.00 7.61   ? 82  LYS D CG  1 
ATOM   7128  C CD  . LYS D  2 82  ? 27.293  48.838  -1.439  1.00 10.02  ? 82  LYS D CD  1 
ATOM   7129  C CE  . LYS D  2 82  ? 26.266  49.593  -2.218  1.00 11.69  ? 82  LYS D CE  1 
ATOM   7130  N NZ  . LYS D  2 82  ? 26.865  50.404  -3.255  1.00 13.75  ? 82  LYS D NZ  1 
ATOM   7131  N N   . TYR D  2 83  ? 28.502  47.483  3.812   1.00 3.84   ? 83  TYR D N   1 
ATOM   7132  C CA  . TYR D  2 83  ? 29.544  47.135  4.749   1.00 2.00   ? 83  TYR D CA  1 
ATOM   7133  C C   . TYR D  2 83  ? 29.171  45.938  5.596   1.00 2.18   ? 83  TYR D C   1 
ATOM   7134  O O   . TYR D  2 83  ? 29.991  45.042  5.809   1.00 2.45   ? 83  TYR D O   1 
ATOM   7135  C CB  . TYR D  2 83  ? 29.815  48.282  5.642   1.00 2.00   ? 83  TYR D CB  1 
ATOM   7136  C CG  . TYR D  2 83  ? 31.088  48.196  6.455   1.00 2.00   ? 83  TYR D CG  1 
ATOM   7137  C CD1 . TYR D  2 83  ? 31.078  47.925  7.810   1.00 2.45   ? 83  TYR D CD1 1 
ATOM   7138  C CD2 . TYR D  2 83  ? 32.259  48.443  5.815   1.00 2.00   ? 83  TYR D CD2 1 
ATOM   7139  C CE1 . TYR D  2 83  ? 32.241  47.920  8.541   1.00 2.31   ? 83  TYR D CE1 1 
ATOM   7140  C CE2 . TYR D  2 83  ? 33.413  48.434  6.524   1.00 2.30   ? 83  TYR D CE2 1 
ATOM   7141  C CZ  . TYR D  2 83  ? 33.387  48.177  7.857   1.00 2.05   ? 83  TYR D CZ  1 
ATOM   7142  O OH  . TYR D  2 83  ? 34.597  48.221  8.456   1.00 2.00   ? 83  TYR D OH  1 
ATOM   7143  N N   . VAL D  2 84  ? 27.938  45.867  6.086   1.00 2.53   ? 84  VAL D N   1 
ATOM   7144  C CA  . VAL D  2 84  ? 27.520  44.731  6.899   1.00 2.51   ? 84  VAL D CA  1 
ATOM   7145  C C   . VAL D  2 84  ? 27.685  43.442  6.117   1.00 2.66   ? 84  VAL D C   1 
ATOM   7146  O O   . VAL D  2 84  ? 28.329  42.535  6.664   1.00 2.33   ? 84  VAL D O   1 
ATOM   7147  C CB  . VAL D  2 84  ? 26.087  44.934  7.325   1.00 2.00   ? 84  VAL D CB  1 
ATOM   7148  C CG1 . VAL D  2 84  ? 25.446  43.722  7.943   1.00 2.00   ? 84  VAL D CG1 1 
ATOM   7149  C CG2 . VAL D  2 84  ? 26.156  46.026  8.356   1.00 2.00   ? 84  VAL D CG2 1 
ATOM   7150  N N   . GLU D  2 85  ? 27.268  43.415  4.836   1.00 2.00   ? 85  GLU D N   1 
ATOM   7151  C CA  . GLU D  2 85  ? 27.361  42.185  4.100   1.00 2.00   ? 85  GLU D CA  1 
ATOM   7152  C C   . GLU D  2 85  ? 28.780  41.872  3.724   1.00 3.25   ? 85  GLU D C   1 
ATOM   7153  O O   . GLU D  2 85  ? 29.203  40.707  3.833   1.00 3.19   ? 85  GLU D O   1 
ATOM   7154  C CB  . GLU D  2 85  ? 26.538  42.227  2.852   1.00 2.00   ? 85  GLU D CB  1 
ATOM   7155  C CG  . GLU D  2 85  ? 26.351  40.884  2.126   1.00 2.00   ? 85  GLU D CG  1 
ATOM   7156  C CD  . GLU D  2 85  ? 25.608  39.776  2.852   1.00 3.81   ? 85  GLU D CD  1 
ATOM   7157  O OE1 . GLU D  2 85  ? 25.019  39.974  3.924   1.00 4.02   ? 85  GLU D OE1 1 
ATOM   7158  O OE2 . GLU D  2 85  ? 25.560  38.663  2.311   1.00 5.05   ? 85  GLU D OE2 1 
ATOM   7159  N N   . ASP D  2 86  ? 29.584  42.881  3.380   1.00 4.05   ? 86  ASP D N   1 
ATOM   7160  C CA  . ASP D  2 86  ? 30.944  42.574  2.960   1.00 4.68   ? 86  ASP D CA  1 
ATOM   7161  C C   . ASP D  2 86  ? 31.714  42.060  4.129   1.00 3.24   ? 86  ASP D C   1 
ATOM   7162  O O   . ASP D  2 86  ? 32.371  41.032  3.999   1.00 2.58   ? 86  ASP D O   1 
ATOM   7163  C CB  . ASP D  2 86  ? 31.676  43.780  2.409   1.00 7.80   ? 86  ASP D CB  1 
ATOM   7164  C CG  . ASP D  2 86  ? 33.144  43.549  2.033   1.00 11.10  ? 86  ASP D CG  1 
ATOM   7165  O OD1 . ASP D  2 86  ? 33.516  42.664  1.215   1.00 12.04  ? 86  ASP D OD1 1 
ATOM   7166  O OD2 . ASP D  2 86  ? 33.946  44.312  2.593   1.00 12.78  ? 86  ASP D OD2 1 
ATOM   7167  N N   . THR D  2 87  ? 31.506  42.634  5.309   1.00 3.01   ? 87  THR D N   1 
ATOM   7168  C CA  . THR D  2 87  ? 32.243  42.104  6.436   1.00 3.75   ? 87  THR D CA  1 
ATOM   7169  C C   . THR D  2 87  ? 31.716  40.733  6.835   1.00 3.30   ? 87  THR D C   1 
ATOM   7170  O O   . THR D  2 87  ? 32.482  39.881  7.292   1.00 4.68   ? 87  THR D O   1 
ATOM   7171  C CB  . THR D  2 87  ? 32.241  43.077  7.674   1.00 3.01   ? 87  THR D CB  1 
ATOM   7172  O OG1 . THR D  2 87  ? 30.985  43.183  8.234   1.00 2.75   ? 87  THR D OG1 1 
ATOM   7173  C CG2 . THR D  2 87  ? 32.668  44.465  7.234   1.00 3.37   ? 87  THR D CG2 1 
ATOM   7174  N N   . LYS D  2 88  ? 30.451  40.434  6.586   1.00 2.83   ? 88  LYS D N   1 
ATOM   7175  C CA  . LYS D  2 88  ? 29.931  39.126  6.884   1.00 2.40   ? 88  LYS D CA  1 
ATOM   7176  C C   . LYS D  2 88  ? 30.594  38.091  6.002   1.00 3.43   ? 88  LYS D C   1 
ATOM   7177  O O   . LYS D  2 88  ? 31.103  37.068  6.497   1.00 4.20   ? 88  LYS D O   1 
ATOM   7178  C CB  . LYS D  2 88  ? 28.486  39.169  6.653   1.00 2.00   ? 88  LYS D CB  1 
ATOM   7179  C CG  . LYS D  2 88  ? 27.854  37.867  6.927   1.00 3.14   ? 88  LYS D CG  1 
ATOM   7180  C CD  . LYS D  2 88  ? 26.425  38.095  6.548   1.00 3.86   ? 88  LYS D CD  1 
ATOM   7181  C CE  . LYS D  2 88  ? 25.948  36.748  6.060   1.00 4.76   ? 88  LYS D CE  1 
ATOM   7182  N NZ  . LYS D  2 88  ? 24.512  36.703  6.178   1.00 5.70   ? 88  LYS D NZ  1 
ATOM   7183  N N   . ILE D  2 89  ? 30.650  38.382  4.694   1.00 4.19   ? 89  ILE D N   1 
ATOM   7184  C CA  . ILE D  2 89  ? 31.253  37.490  3.698   1.00 2.88   ? 89  ILE D CA  1 
ATOM   7185  C C   . ILE D  2 89  ? 32.731  37.278  3.977   1.00 2.00   ? 89  ILE D C   1 
ATOM   7186  O O   . ILE D  2 89  ? 33.247  36.183  3.843   1.00 2.00   ? 89  ILE D O   1 
ATOM   7187  C CB  . ILE D  2 89  ? 31.062  38.087  2.297   1.00 2.23   ? 89  ILE D CB  1 
ATOM   7188  C CG1 . ILE D  2 89  ? 29.613  37.994  1.938   1.00 2.00   ? 89  ILE D CG1 1 
ATOM   7189  C CG2 . ILE D  2 89  ? 31.907  37.369  1.273   1.00 2.32   ? 89  ILE D CG2 1 
ATOM   7190  C CD1 . ILE D  2 89  ? 29.198  38.735  0.657   1.00 2.00   ? 89  ILE D CD1 1 
ATOM   7191  N N   . ASP D  2 90  ? 33.466  38.278  4.355   1.00 2.15   ? 90  ASP D N   1 
ATOM   7192  C CA  . ASP D  2 90  ? 34.865  38.043  4.609   1.00 4.08   ? 90  ASP D CA  1 
ATOM   7193  C C   . ASP D  2 90  ? 35.064  37.203  5.857   1.00 4.10   ? 90  ASP D C   1 
ATOM   7194  O O   . ASP D  2 90  ? 35.970  36.356  5.883   1.00 5.53   ? 90  ASP D O   1 
ATOM   7195  C CB  . ASP D  2 90  ? 35.625  39.361  4.786   1.00 5.80   ? 90  ASP D CB  1 
ATOM   7196  C CG  . ASP D  2 90  ? 35.886  40.174  3.536   1.00 5.94   ? 90  ASP D CG  1 
ATOM   7197  O OD1 . ASP D  2 90  ? 35.618  39.763  2.426   1.00 5.13   ? 90  ASP D OD1 1 
ATOM   7198  O OD2 . ASP D  2 90  ? 36.414  41.265  3.663   1.00 7.75   ? 90  ASP D OD2 1 
ATOM   7199  N N   . LEU D  2 91  ? 34.219  37.367  6.885   1.00 2.42   ? 91  LEU D N   1 
ATOM   7200  C CA  . LEU D  2 91  ? 34.389  36.593  8.081   1.00 2.00   ? 91  LEU D CA  1 
ATOM   7201  C C   . LEU D  2 91  ? 34.062  35.144  7.799   1.00 3.04   ? 91  LEU D C   1 
ATOM   7202  O O   . LEU D  2 91  ? 34.852  34.246  8.171   1.00 4.31   ? 91  LEU D O   1 
ATOM   7203  C CB  . LEU D  2 91  ? 33.509  37.140  9.167   1.00 2.00   ? 91  LEU D CB  1 
ATOM   7204  C CG  . LEU D  2 91  ? 34.071  38.321  9.903   1.00 2.00   ? 91  LEU D CG  1 
ATOM   7205  C CD1 . LEU D  2 91  ? 33.061  38.824  10.860  1.00 2.00   ? 91  LEU D CD1 1 
ATOM   7206  C CD2 . LEU D  2 91  ? 35.257  37.924  10.716  1.00 2.05   ? 91  LEU D CD2 1 
ATOM   7207  N N   . TRP D  2 92  ? 32.966  34.876  7.063   1.00 2.36   ? 92  TRP D N   1 
ATOM   7208  C CA  . TRP D  2 92  ? 32.683  33.497  6.741   1.00 2.63   ? 92  TRP D CA  1 
ATOM   7209  C C   . TRP D  2 92  ? 33.715  32.907  5.798   1.00 3.60   ? 92  TRP D C   1 
ATOM   7210  O O   . TRP D  2 92  ? 34.050  31.728  5.943   1.00 5.63   ? 92  TRP D O   1 
ATOM   7211  C CB  . TRP D  2 92  ? 31.300  33.350  6.142   1.00 2.00   ? 92  TRP D CB  1 
ATOM   7212  C CG  . TRP D  2 92  ? 30.323  33.102  7.277   1.00 2.00   ? 92  TRP D CG  1 
ATOM   7213  C CD1 . TRP D  2 92  ? 29.449  34.069  7.647   1.00 2.00   ? 92  TRP D CD1 1 
ATOM   7214  C CD2 . TRP D  2 92  ? 30.256  31.985  8.074   1.00 2.00   ? 92  TRP D CD2 1 
ATOM   7215  N NE1 . TRP D  2 92  ? 28.845  33.573  8.688   1.00 2.00   ? 92  TRP D NE1 1 
ATOM   7216  C CE2 . TRP D  2 92  ? 29.288  32.350  8.970   1.00 2.00   ? 92  TRP D CE2 1 
ATOM   7217  C CE3 . TRP D  2 92  ? 30.848  30.743  8.192   1.00 2.74   ? 92  TRP D CE3 1 
ATOM   7218  C CZ2 . TRP D  2 92  ? 28.893  31.512  9.991   1.00 2.59   ? 92  TRP D CZ2 1 
ATOM   7219  C CZ3 . TRP D  2 92  ? 30.458  29.890  9.210   1.00 3.40   ? 92  TRP D CZ3 1 
ATOM   7220  C CH2 . TRP D  2 92  ? 29.484  30.270  10.112  1.00 3.08   ? 92  TRP D CH2 1 
ATOM   7221  N N   . SER D  2 93  ? 34.320  33.669  4.889   1.00 2.87   ? 93  SER D N   1 
ATOM   7222  C CA  . SER D  2 93  ? 35.340  33.101  4.036   1.00 2.18   ? 93  SER D CA  1 
ATOM   7223  C C   . SER D  2 93  ? 36.556  32.706  4.818   1.00 2.43   ? 93  SER D C   1 
ATOM   7224  O O   . SER D  2 93  ? 37.076  31.613  4.554   1.00 3.01   ? 93  SER D O   1 
ATOM   7225  C CB  . SER D  2 93  ? 35.709  34.089  2.968   1.00 2.45   ? 93  SER D CB  1 
ATOM   7226  O OG  . SER D  2 93  ? 34.594  34.199  2.075   1.00 3.63   ? 93  SER D OG  1 
ATOM   7227  N N   . TYR D  2 94  ? 36.938  33.515  5.818   1.00 2.00   ? 94  TYR D N   1 
ATOM   7228  C CA  . TYR D  2 94  ? 38.075  33.207  6.664   1.00 2.00   ? 94  TYR D CA  1 
ATOM   7229  C C   . TYR D  2 94  ? 37.770  31.911  7.354   1.00 2.34   ? 94  TYR D C   1 
ATOM   7230  O O   . TYR D  2 94  ? 38.596  31.002  7.317   1.00 2.00   ? 94  TYR D O   1 
ATOM   7231  C CB  . TYR D  2 94  ? 38.306  34.273  7.718   1.00 2.00   ? 94  TYR D CB  1 
ATOM   7232  C CG  . TYR D  2 94  ? 39.379  33.935  8.741   1.00 2.00   ? 94  TYR D CG  1 
ATOM   7233  C CD1 . TYR D  2 94  ? 39.013  33.627  10.016  1.00 2.99   ? 94  TYR D CD1 1 
ATOM   7234  C CD2 . TYR D  2 94  ? 40.694  33.856  8.413   1.00 2.33   ? 94  TYR D CD2 1 
ATOM   7235  C CE1 . TYR D  2 94  ? 39.945  33.233  10.944  1.00 4.15   ? 94  TYR D CE1 1 
ATOM   7236  C CE2 . TYR D  2 94  ? 41.638  33.454  9.334   1.00 3.26   ? 94  TYR D CE2 1 
ATOM   7237  C CZ  . TYR D  2 94  ? 41.265  33.137  10.603  1.00 3.86   ? 94  TYR D CZ  1 
ATOM   7238  O OH  . TYR D  2 94  ? 42.189  32.685  11.530  1.00 4.47   ? 94  TYR D OH  1 
ATOM   7239  N N   . ASN D  2 95  ? 36.567  31.796  7.905   1.00 3.21   ? 95  ASN D N   1 
ATOM   7240  C CA  . ASN D  2 95  ? 36.175  30.553  8.555   1.00 5.17   ? 95  ASN D CA  1 
ATOM   7241  C C   . ASN D  2 95  ? 36.238  29.346  7.619   1.00 4.54   ? 95  ASN D C   1 
ATOM   7242  O O   . ASN D  2 95  ? 36.814  28.335  8.017   1.00 4.66   ? 95  ASN D O   1 
ATOM   7243  C CB  . ASN D  2 95  ? 34.746  30.599  9.120   1.00 6.38   ? 95  ASN D CB  1 
ATOM   7244  C CG  . ASN D  2 95  ? 34.565  31.558  10.264  1.00 7.25   ? 95  ASN D CG  1 
ATOM   7245  O OD1 . ASN D  2 95  ? 35.513  32.173  10.731  1.00 9.09   ? 95  ASN D OD1 1 
ATOM   7246  N ND2 . ASN D  2 95  ? 33.370  31.816  10.754  1.00 7.17   ? 95  ASN D ND2 1 
ATOM   7247  N N   . ALA D  2 96  ? 35.731  29.389  6.383   1.00 2.71   ? 96  ALA D N   1 
ATOM   7248  C CA  . ALA D  2 96  ? 35.787  28.213  5.566   1.00 2.77   ? 96  ALA D CA  1 
ATOM   7249  C C   . ALA D  2 96  ? 37.231  27.821  5.257   1.00 3.99   ? 96  ALA D C   1 
ATOM   7250  O O   . ALA D  2 96  ? 37.627  26.645  5.313   1.00 3.83   ? 96  ALA D O   1 
ATOM   7251  C CB  . ALA D  2 96  ? 35.066  28.450  4.281   1.00 2.31   ? 96  ALA D CB  1 
ATOM   7252  N N   . GLU D  2 97  ? 38.088  28.808  5.033   1.00 5.15   ? 97  GLU D N   1 
ATOM   7253  C CA  . GLU D  2 97  ? 39.473  28.532  4.682   1.00 5.39   ? 97  GLU D CA  1 
ATOM   7254  C C   . GLU D  2 97  ? 40.269  27.979  5.859   1.00 4.55   ? 97  GLU D C   1 
ATOM   7255  O O   . GLU D  2 97  ? 40.986  26.972  5.712   1.00 6.69   ? 97  GLU D O   1 
ATOM   7256  C CB  . GLU D  2 97  ? 40.045  29.810  4.165   1.00 6.44   ? 97  GLU D CB  1 
ATOM   7257  C CG  . GLU D  2 97  ? 41.489  29.769  3.765   1.00 9.22   ? 97  GLU D CG  1 
ATOM   7258  C CD  . GLU D  2 97  ? 41.870  29.304  2.380   1.00 10.98  ? 97  GLU D CD  1 
ATOM   7259  O OE1 . GLU D  2 97  ? 42.902  28.646  2.276   1.00 13.22  ? 97  GLU D OE1 1 
ATOM   7260  O OE2 . GLU D  2 97  ? 41.291  29.686  1.361   1.00 11.65  ? 97  GLU D OE2 1 
ATOM   7261  N N   . LEU D  2 98  ? 40.142  28.543  7.052   1.00 2.26   ? 98  LEU D N   1 
ATOM   7262  C CA  . LEU D  2 98  ? 40.843  27.975  8.182   1.00 2.00   ? 98  LEU D CA  1 
ATOM   7263  C C   . LEU D  2 98  ? 40.282  26.605  8.493   1.00 2.25   ? 98  LEU D C   1 
ATOM   7264  O O   . LEU D  2 98  ? 41.059  25.723  8.833   1.00 3.06   ? 98  LEU D O   1 
ATOM   7265  C CB  . LEU D  2 98  ? 40.707  28.827  9.430   1.00 2.00   ? 98  LEU D CB  1 
ATOM   7266  C CG  . LEU D  2 98  ? 41.215  28.337  10.779  1.00 2.00   ? 98  LEU D CG  1 
ATOM   7267  C CD1 . LEU D  2 98  ? 42.710  28.163  10.843  1.00 2.04   ? 98  LEU D CD1 1 
ATOM   7268  C CD2 . LEU D  2 98  ? 40.874  29.403  11.760  1.00 2.66   ? 98  LEU D CD2 1 
ATOM   7269  N N   . LEU D  2 99  ? 38.975  26.376  8.347   1.00 2.31   ? 99  LEU D N   1 
ATOM   7270  C CA  . LEU D  2 99  ? 38.380  25.091  8.659   1.00 2.42   ? 99  LEU D CA  1 
ATOM   7271  C C   . LEU D  2 99  ? 38.951  24.012  7.786   1.00 2.47   ? 99  LEU D C   1 
ATOM   7272  O O   . LEU D  2 99  ? 39.456  23.057  8.352   1.00 3.31   ? 99  LEU D O   1 
ATOM   7273  C CB  . LEU D  2 99  ? 36.868  25.078  8.456   1.00 2.45   ? 99  LEU D CB  1 
ATOM   7274  C CG  . LEU D  2 99  ? 36.104  23.787  8.595   1.00 2.00   ? 99  LEU D CG  1 
ATOM   7275  C CD1 . LEU D  2 99  ? 36.088  23.341  10.024  1.00 2.00   ? 99  LEU D CD1 1 
ATOM   7276  C CD2 . LEU D  2 99  ? 34.713  24.019  8.085   1.00 2.00   ? 99  LEU D CD2 1 
ATOM   7277  N N   . VAL D  2 100 ? 38.970  24.122  6.455   1.00 2.45   ? 100 VAL D N   1 
ATOM   7278  C CA  . VAL D  2 100 ? 39.481  22.995  5.689   1.00 2.73   ? 100 VAL D CA  1 
ATOM   7279  C C   . VAL D  2 100 ? 40.972  22.844  5.885   1.00 3.84   ? 100 VAL D C   1 
ATOM   7280  O O   . VAL D  2 100 ? 41.477  21.722  5.866   1.00 4.85   ? 100 VAL D O   1 
ATOM   7281  C CB  . VAL D  2 100 ? 39.195  23.080  4.159   1.00 2.00   ? 100 VAL D CB  1 
ATOM   7282  C CG1 . VAL D  2 100 ? 37.778  23.571  4.025   1.00 2.36   ? 100 VAL D CG1 1 
ATOM   7283  C CG2 . VAL D  2 100 ? 40.170  23.926  3.397   1.00 2.17   ? 100 VAL D CG2 1 
ATOM   7284  N N   . ALA D  2 101 ? 41.717  23.918  6.153   1.00 4.49   ? 101 ALA D N   1 
ATOM   7285  C CA  . ALA D  2 101 ? 43.148  23.751  6.382   1.00 4.62   ? 101 ALA D CA  1 
ATOM   7286  C C   . ALA D  2 101 ? 43.410  22.931  7.652   1.00 4.43   ? 101 ALA D C   1 
ATOM   7287  O O   . ALA D  2 101 ? 44.050  21.885  7.608   1.00 3.74   ? 101 ALA D O   1 
ATOM   7288  C CB  . ALA D  2 101 ? 43.761  25.126  6.487   1.00 4.44   ? 101 ALA D CB  1 
ATOM   7289  N N   . LEU D  2 102 ? 42.838  23.378  8.767   1.00 4.82   ? 102 LEU D N   1 
ATOM   7290  C CA  . LEU D  2 102 ? 42.888  22.734  10.063  1.00 5.03   ? 102 LEU D CA  1 
ATOM   7291  C C   . LEU D  2 102 ? 42.490  21.267  9.914   1.00 5.34   ? 102 LEU D C   1 
ATOM   7292  O O   . LEU D  2 102 ? 43.210  20.341  10.297  1.00 6.51   ? 102 LEU D O   1 
ATOM   7293  C CB  . LEU D  2 102 ? 41.923  23.480  10.945  1.00 4.75   ? 102 LEU D CB  1 
ATOM   7294  C CG  . LEU D  2 102 ? 42.269  23.862  12.328  1.00 5.63   ? 102 LEU D CG  1 
ATOM   7295  C CD1 . LEU D  2 102 ? 43.540  24.669  12.373  1.00 6.10   ? 102 LEU D CD1 1 
ATOM   7296  C CD2 . LEU D  2 102 ? 41.160  24.744  12.839  1.00 6.97   ? 102 LEU D CD2 1 
ATOM   7297  N N   . GLU D  2 103 ? 41.358  21.030  9.281   1.00 4.59   ? 103 GLU D N   1 
ATOM   7298  C CA  . GLU D  2 103 ? 40.863  19.705  9.048   1.00 4.66   ? 103 GLU D CA  1 
ATOM   7299  C C   . GLU D  2 103 ? 41.827  18.842  8.273   1.00 5.57   ? 103 GLU D C   1 
ATOM   7300  O O   . GLU D  2 103 ? 42.228  17.773  8.759   1.00 5.99   ? 103 GLU D O   1 
ATOM   7301  C CB  . GLU D  2 103 ? 39.551  19.791  8.302   1.00 4.84   ? 103 GLU D CB  1 
ATOM   7302  C CG  . GLU D  2 103 ? 38.344  20.159  9.146   1.00 4.42   ? 103 GLU D CG  1 
ATOM   7303  C CD  . GLU D  2 103 ? 37.873  19.029  10.026  1.00 4.98   ? 103 GLU D CD  1 
ATOM   7304  O OE1 . GLU D  2 103 ? 36.742  19.061  10.471  1.00 6.01   ? 103 GLU D OE1 1 
ATOM   7305  O OE2 . GLU D  2 103 ? 38.615  18.082  10.268  1.00 6.01   ? 103 GLU D OE2 1 
ATOM   7306  N N   . ASN D  2 104 ? 42.275  19.306  7.102   1.00 6.07   ? 104 ASN D N   1 
ATOM   7307  C CA  . ASN D  2 104 ? 43.147  18.530  6.206   1.00 5.68   ? 104 ASN D CA  1 
ATOM   7308  C C   . ASN D  2 104 ? 44.431  18.127  6.853   1.00 4.86   ? 104 ASN D C   1 
ATOM   7309  O O   . ASN D  2 104 ? 44.866  16.982  6.755   1.00 4.90   ? 104 ASN D O   1 
ATOM   7310  C CB  . ASN D  2 104 ? 43.501  19.292  4.954   1.00 5.04   ? 104 ASN D CB  1 
ATOM   7311  C CG  . ASN D  2 104 ? 42.308  19.376  4.026   1.00 6.09   ? 104 ASN D CG  1 
ATOM   7312  O OD1 . ASN D  2 104 ? 41.324  18.639  4.168   1.00 7.57   ? 104 ASN D OD1 1 
ATOM   7313  N ND2 . ASN D  2 104 ? 42.303  20.251  3.038   1.00 6.10   ? 104 ASN D ND2 1 
ATOM   7314  N N   . GLN D  2 105 ? 44.934  19.042  7.651   1.00 5.28   ? 105 GLN D N   1 
ATOM   7315  C CA  . GLN D  2 105 ? 46.121  18.821  8.424   1.00 5.54   ? 105 GLN D CA  1 
ATOM   7316  C C   . GLN D  2 105 ? 45.869  17.650  9.348   1.00 5.06   ? 105 GLN D C   1 
ATOM   7317  O O   . GLN D  2 105 ? 46.648  16.693  9.338   1.00 4.41   ? 105 GLN D O   1 
ATOM   7318  C CB  . GLN D  2 105 ? 46.391  20.086  9.173   1.00 6.58   ? 105 GLN D CB  1 
ATOM   7319  C CG  . GLN D  2 105 ? 47.599  20.020  10.029  1.00 8.84   ? 105 GLN D CG  1 
ATOM   7320  C CD  . GLN D  2 105 ? 48.833  19.982  9.170   1.00 10.61  ? 105 GLN D CD  1 
ATOM   7321  O OE1 . GLN D  2 105 ? 49.282  21.027  8.683   1.00 11.32  ? 105 GLN D OE1 1 
ATOM   7322  N NE2 . GLN D  2 105 ? 49.381  18.787  8.981   1.00 11.24  ? 105 GLN D NE2 1 
ATOM   7323  N N   . HIS D  2 106 ? 44.723  17.691  10.044  1.00 4.41   ? 106 HIS D N   1 
ATOM   7324  C CA  . HIS D  2 106 ? 44.375  16.656  10.997  1.00 4.86   ? 106 HIS D CA  1 
ATOM   7325  C C   . HIS D  2 106 ? 44.086  15.322  10.332  1.00 5.81   ? 106 HIS D C   1 
ATOM   7326  O O   . HIS D  2 106 ? 44.357  14.278  10.933  1.00 5.84   ? 106 HIS D O   1 
ATOM   7327  C CB  . HIS D  2 106 ? 43.152  17.067  11.816  1.00 4.12   ? 106 HIS D CB  1 
ATOM   7328  C CG  . HIS D  2 106 ? 42.597  16.003  12.765  1.00 2.52   ? 106 HIS D CG  1 
ATOM   7329  N ND1 . HIS D  2 106 ? 41.374  15.556  12.637  1.00 2.00   ? 106 HIS D ND1 1 
ATOM   7330  C CD2 . HIS D  2 106 ? 43.257  15.453  13.804  1.00 2.16   ? 106 HIS D CD2 1 
ATOM   7331  C CE1 . HIS D  2 106 ? 41.262  14.709  13.623  1.00 2.42   ? 106 HIS D CE1 1 
ATOM   7332  N NE2 . HIS D  2 106 ? 42.376  14.655  14.302  1.00 2.00   ? 106 HIS D NE2 1 
ATOM   7333  N N   . THR D  2 107 ? 43.511  15.301  9.121   1.00 6.51   ? 107 THR D N   1 
ATOM   7334  C CA  . THR D  2 107 ? 43.205  14.050  8.433   1.00 6.51   ? 107 THR D CA  1 
ATOM   7335  C C   . THR D  2 107 ? 44.492  13.353  8.039   1.00 6.62   ? 107 THR D C   1 
ATOM   7336  O O   . THR D  2 107 ? 44.605  12.131  8.219   1.00 8.19   ? 107 THR D O   1 
ATOM   7337  C CB  . THR D  2 107 ? 42.347  14.332  7.203   1.00 6.16   ? 107 THR D CB  1 
ATOM   7338  O OG1 . THR D  2 107 ? 41.190  15.031  7.695   1.00 6.74   ? 107 THR D OG1 1 
ATOM   7339  C CG2 . THR D  2 107 ? 42.021  13.067  6.409   1.00 5.64   ? 107 THR D CG2 1 
ATOM   7340  N N   . ILE D  2 108 ? 45.494  14.106  7.561   1.00 5.87   ? 108 ILE D N   1 
ATOM   7341  C CA  . ILE D  2 108 ? 46.778  13.500  7.236   1.00 4.43   ? 108 ILE D CA  1 
ATOM   7342  C C   . ILE D  2 108 ? 47.434  12.931  8.507   1.00 4.62   ? 108 ILE D C   1 
ATOM   7343  O O   . ILE D  2 108 ? 48.036  11.851  8.411   1.00 5.40   ? 108 ILE D O   1 
ATOM   7344  C CB  . ILE D  2 108 ? 47.654  14.565  6.525   1.00 2.35   ? 108 ILE D CB  1 
ATOM   7345  C CG1 . ILE D  2 108 ? 47.090  14.790  5.173   1.00 2.00   ? 108 ILE D CG1 1 
ATOM   7346  C CG2 . ILE D  2 108 ? 49.066  14.120  6.320   1.00 2.00   ? 108 ILE D CG2 1 
ATOM   7347  C CD1 . ILE D  2 108 ? 47.612  16.073  4.550   1.00 2.23   ? 108 ILE D CD1 1 
ATOM   7348  N N   . ASP D  2 109 ? 47.298  13.552  9.683   1.00 4.25   ? 109 ASP D N   1 
ATOM   7349  C CA  . ASP D  2 109 ? 47.928  12.982  10.851  1.00 5.06   ? 109 ASP D CA  1 
ATOM   7350  C C   . ASP D  2 109 ? 47.181  11.784  11.382  1.00 5.54   ? 109 ASP D C   1 
ATOM   7351  O O   . ASP D  2 109 ? 47.781  10.783  11.793  1.00 5.87   ? 109 ASP D O   1 
ATOM   7352  C CB  . ASP D  2 109 ? 48.063  14.055  11.905  1.00 6.26   ? 109 ASP D CB  1 
ATOM   7353  C CG  . ASP D  2 109 ? 49.201  15.022  11.585  1.00 8.44   ? 109 ASP D CG  1 
ATOM   7354  O OD1 . ASP D  2 109 ? 50.226  14.638  10.993  1.00 10.08  ? 109 ASP D OD1 1 
ATOM   7355  O OD2 . ASP D  2 109 ? 49.099  16.189  11.945  1.00 9.64   ? 109 ASP D OD2 1 
ATOM   7356  N N   . LEU D  2 110 ? 45.857  11.828  11.296  1.00 5.19   ? 110 LEU D N   1 
ATOM   7357  C CA  . LEU D  2 110 ? 44.975  10.743  11.691  1.00 4.37   ? 110 LEU D CA  1 
ATOM   7358  C C   . LEU D  2 110 ? 45.232  9.495   10.854  1.00 4.41   ? 110 LEU D C   1 
ATOM   7359  O O   . LEU D  2 110 ? 45.462  8.428   11.416  1.00 5.52   ? 110 LEU D O   1 
ATOM   7360  C CB  . LEU D  2 110 ? 43.593  11.303  11.527  1.00 4.31   ? 110 LEU D CB  1 
ATOM   7361  C CG  . LEU D  2 110 ? 42.276  10.616  11.669  1.00 4.69   ? 110 LEU D CG  1 
ATOM   7362  C CD1 . LEU D  2 110 ? 41.229  11.708  11.600  1.00 4.28   ? 110 LEU D CD1 1 
ATOM   7363  C CD2 . LEU D  2 110 ? 42.005  9.628   10.552  1.00 5.26   ? 110 LEU D CD2 1 
ATOM   7364  N N   . THR D  2 111 ? 45.251  9.564   9.522   1.00 3.75   ? 111 THR D N   1 
ATOM   7365  C CA  . THR D  2 111 ? 45.522  8.388   8.719   1.00 2.97   ? 111 THR D CA  1 
ATOM   7366  C C   . THR D  2 111 ? 46.950  7.905   8.944   1.00 3.86   ? 111 THR D C   1 
ATOM   7367  O O   . THR D  2 111 ? 47.237  6.715   9.054   1.00 6.13   ? 111 THR D O   1 
ATOM   7368  C CB  . THR D  2 111 ? 45.265  8.725   7.263   1.00 2.32   ? 111 THR D CB  1 
ATOM   7369  O OG1 . THR D  2 111 ? 46.019  9.877   6.913   1.00 2.00   ? 111 THR D OG1 1 
ATOM   7370  C CG2 . THR D  2 111 ? 43.789  9.002   7.039   1.00 2.00   ? 111 THR D CG2 1 
ATOM   7371  N N   . GLY D  2 112 ? 47.878  8.837   9.131   1.00 4.66   ? 112 GLY D N   1 
ATOM   7372  C CA  . GLY D  2 112 ? 49.266  8.484   9.467   1.00 6.15   ? 112 GLY D CA  1 
ATOM   7373  C C   . GLY D  2 112 ? 49.374  7.757   10.812  1.00 6.63   ? 112 GLY D C   1 
ATOM   7374  O O   . GLY D  2 112 ? 50.211  6.848   11.013  1.00 5.59   ? 112 GLY D O   1 
ATOM   7375  N N   . SER D  2 113 ? 48.546  8.134   11.781  1.00 6.96   ? 113 SER D N   1 
ATOM   7376  C CA  . SER D  2 113 ? 48.531  7.551   13.067  1.00 7.65   ? 113 SER D CA  1 
ATOM   7377  C C   . SER D  2 113 ? 48.138  6.096   12.930  1.00 7.69   ? 113 SER D C   1 
ATOM   7378  O O   . SER D  2 113 ? 48.877  5.246   13.416  1.00 8.29   ? 113 SER D O   1 
ATOM   7379  C CB  . SER D  2 113 ? 47.510  8.299   13.943  1.00 8.63   ? 113 SER D CB  1 
ATOM   7380  O OG  . SER D  2 113 ? 47.128  7.707   15.176  1.00 8.99   ? 113 SER D OG  1 
ATOM   7381  N N   . GLU D  2 114 ? 47.056  5.829   12.197  1.00 7.71   ? 114 GLU D N   1 
ATOM   7382  C CA  . GLU D  2 114 ? 46.588  4.482   12.015  1.00 8.24   ? 114 GLU D CA  1 
ATOM   7383  C C   . GLU D  2 114 ? 47.629  3.601   11.400  1.00 7.71   ? 114 GLU D C   1 
ATOM   7384  O O   . GLU D  2 114 ? 47.765  2.450   11.825  1.00 8.07   ? 114 GLU D O   1 
ATOM   7385  C CB  . GLU D  2 114 ? 45.341  4.476   11.159  1.00 10.08  ? 114 GLU D CB  1 
ATOM   7386  C CG  . GLU D  2 114 ? 44.140  5.133   11.863  1.00 11.99  ? 114 GLU D CG  1 
ATOM   7387  C CD  . GLU D  2 114 ? 43.812  4.597   13.258  1.00 12.75  ? 114 GLU D CD  1 
ATOM   7388  O OE1 . GLU D  2 114 ? 43.487  5.408   14.124  1.00 14.32  ? 114 GLU D OE1 1 
ATOM   7389  O OE2 . GLU D  2 114 ? 43.910  3.402   13.538  1.00 12.51  ? 114 GLU D OE2 1 
ATOM   7390  N N   . MET D  2 115 ? 48.447  4.142   10.481  1.00 6.75   ? 115 MET D N   1 
ATOM   7391  C CA  . MET D  2 115 ? 49.527  3.351   9.882   1.00 5.94   ? 115 MET D CA  1 
ATOM   7392  C C   . MET D  2 115 ? 50.461  2.903   10.975  1.00 5.56   ? 115 MET D C   1 
ATOM   7393  O O   . MET D  2 115 ? 50.641  1.714   11.219  1.00 6.17   ? 115 MET D O   1 
ATOM   7394  C CB  . MET D  2 115 ? 50.384  4.130   8.884   1.00 5.47   ? 115 MET D CB  1 
ATOM   7395  C CG  . MET D  2 115 ? 51.510  3.323   8.236   1.00 4.90   ? 115 MET D CG  1 
ATOM   7396  S SD  . MET D  2 115 ? 50.898  2.055   7.100   1.00 5.57   ? 115 MET D SD  1 
ATOM   7397  C CE  . MET D  2 115 ? 51.124  0.623   8.121   1.00 6.33   ? 115 MET D CE  1 
ATOM   7398  N N   . ASN D  2 116 ? 50.960  3.867   11.717  1.00 5.98   ? 116 ASN D N   1 
ATOM   7399  C CA  . ASN D  2 116 ? 51.928  3.607   12.761  1.00 5.74   ? 116 ASN D CA  1 
ATOM   7400  C C   . ASN D  2 116 ? 51.344  2.739   13.848  1.00 5.27   ? 116 ASN D C   1 
ATOM   7401  O O   . ASN D  2 116 ? 51.995  1.832   14.316  1.00 4.67   ? 116 ASN D O   1 
ATOM   7402  C CB  . ASN D  2 116 ? 52.372  4.934   13.287  1.00 6.66   ? 116 ASN D CB  1 
ATOM   7403  C CG  . ASN D  2 116 ? 53.414  4.799   14.345  1.00 7.19   ? 116 ASN D CG  1 
ATOM   7404  O OD1 . ASN D  2 116 ? 54.591  4.548   14.099  1.00 8.43   ? 116 ASN D OD1 1 
ATOM   7405  N ND2 . ASN D  2 116 ? 52.957  4.995   15.561  1.00 7.57   ? 116 ASN D ND2 1 
ATOM   7406  N N   . LYS D  2 117 ? 50.081  2.895   14.192  1.00 6.15   ? 117 LYS D N   1 
ATOM   7407  C CA  . LYS D  2 117 ? 49.463  2.016   15.157  1.00 7.31   ? 117 LYS D CA  1 
ATOM   7408  C C   . LYS D  2 117 ? 49.461  0.567   14.673  1.00 8.50   ? 117 LYS D C   1 
ATOM   7409  O O   . LYS D  2 117 ? 49.823  -0.312  15.462  1.00 9.64   ? 117 LYS D O   1 
ATOM   7410  C CB  . LYS D  2 117 ? 48.044  2.502   15.426  1.00 6.77   ? 117 LYS D CB  1 
ATOM   7411  C CG  . LYS D  2 117 ? 48.163  3.685   16.357  1.00 6.99   ? 117 LYS D CG  1 
ATOM   7412  C CD  . LYS D  2 117 ? 47.015  4.643   16.299  1.00 6.98   ? 117 LYS D CD  1 
ATOM   7413  C CE  . LYS D  2 117 ? 45.742  4.161   16.937  1.00 7.17   ? 117 LYS D CE  1 
ATOM   7414  N NZ  . LYS D  2 117 ? 44.740  5.096   16.480  1.00 8.70   ? 117 LYS D NZ  1 
ATOM   7415  N N   . LEU D  2 118 ? 49.129  0.286   13.399  1.00 8.85   ? 118 LEU D N   1 
ATOM   7416  C CA  . LEU D  2 118 ? 49.126  -1.083  12.880  1.00 8.48   ? 118 LEU D CA  1 
ATOM   7417  C C   . LEU D  2 118 ? 50.527  -1.633  13.028  1.00 8.80   ? 118 LEU D C   1 
ATOM   7418  O O   . LEU D  2 118 ? 50.681  -2.773  13.467  1.00 8.28   ? 118 LEU D O   1 
ATOM   7419  C CB  . LEU D  2 118 ? 48.783  -1.157  11.386  1.00 8.03   ? 118 LEU D CB  1 
ATOM   7420  C CG  . LEU D  2 118 ? 47.868  -2.231  10.782  1.00 7.12   ? 118 LEU D CG  1 
ATOM   7421  C CD1 . LEU D  2 118 ? 48.025  -2.227  9.278   1.00 7.15   ? 118 LEU D CD1 1 
ATOM   7422  C CD2 . LEU D  2 118 ? 48.258  -3.591  11.209  1.00 6.53   ? 118 LEU D CD2 1 
ATOM   7423  N N   . PHE D  2 119 ? 51.536  -0.806  12.727  1.00 9.22   ? 119 PHE D N   1 
ATOM   7424  C CA  . PHE D  2 119 ? 52.914  -1.239  12.793  1.00 10.38  ? 119 PHE D CA  1 
ATOM   7425  C C   . PHE D  2 119 ? 53.261  -1.640  14.209  1.00 11.76  ? 119 PHE D C   1 
ATOM   7426  O O   . PHE D  2 119 ? 53.666  -2.779  14.442  1.00 12.98  ? 119 PHE D O   1 
ATOM   7427  C CB  . PHE D  2 119 ? 53.858  -0.128  12.332  1.00 9.51   ? 119 PHE D CB  1 
ATOM   7428  C CG  . PHE D  2 119 ? 55.289  -0.605  12.227  1.00 8.35   ? 119 PHE D CG  1 
ATOM   7429  C CD1 . PHE D  2 119 ? 55.723  -1.106  11.032  1.00 8.62   ? 119 PHE D CD1 1 
ATOM   7430  C CD2 . PHE D  2 119 ? 56.106  -0.613  13.332  1.00 7.99   ? 119 PHE D CD2 1 
ATOM   7431  C CE1 . PHE D  2 119 ? 56.995  -1.605  10.934  1.00 8.87   ? 119 PHE D CE1 1 
ATOM   7432  C CE2 . PHE D  2 119 ? 57.375  -1.111  13.229  1.00 7.93   ? 119 PHE D CE2 1 
ATOM   7433  C CZ  . PHE D  2 119 ? 57.811  -1.619  12.035  1.00 8.44   ? 119 PHE D CZ  1 
ATOM   7434  N N   . GLU D  2 120 ? 53.107  -0.733  15.152  1.00 13.49  ? 120 GLU D N   1 
ATOM   7435  C CA  . GLU D  2 120 ? 53.390  -0.988  16.547  1.00 15.20  ? 120 GLU D CA  1 
ATOM   7436  C C   . GLU D  2 120 ? 52.677  -2.195  17.071  1.00 15.00  ? 120 GLU D C   1 
ATOM   7437  O O   . GLU D  2 120 ? 53.212  -2.967  17.861  1.00 15.37  ? 120 GLU D O   1 
ATOM   7438  C CB  . GLU D  2 120 ? 52.992  0.210   17.362  1.00 17.35  ? 120 GLU D CB  1 
ATOM   7439  C CG  . GLU D  2 120 ? 54.095  1.247   17.324  1.00 20.80  ? 120 GLU D CG  1 
ATOM   7440  C CD  . GLU D  2 120 ? 55.278  0.738   18.121  1.00 23.58  ? 120 GLU D CD  1 
ATOM   7441  O OE1 . GLU D  2 120 ? 55.119  0.543   19.343  1.00 24.49  ? 120 GLU D OE1 1 
ATOM   7442  O OE2 . GLU D  2 120 ? 56.329  0.466   17.527  1.00 24.89  ? 120 GLU D OE2 1 
ATOM   7443  N N   . LYS D  2 121 ? 51.467  -2.402  16.614  1.00 16.25  ? 121 LYS D N   1 
ATOM   7444  C CA  . LYS D  2 121 ? 50.695  -3.543  17.038  1.00 17.90  ? 121 LYS D CA  1 
ATOM   7445  C C   . LYS D  2 121 ? 51.327  -4.825  16.527  1.00 17.12  ? 121 LYS D C   1 
ATOM   7446  O O   . LYS D  2 121 ? 51.540  -5.764  17.305  1.00 16.40  ? 121 LYS D O   1 
ATOM   7447  C CB  . LYS D  2 121 ? 49.276  -3.405  16.514  1.00 19.11  ? 121 LYS D CB  1 
ATOM   7448  C CG  . LYS D  2 121 ? 48.405  -4.552  16.941  1.00 20.80  ? 121 LYS D CG  1 
ATOM   7449  C CD  . LYS D  2 121 ? 47.026  -4.330  16.398  1.00 22.81  ? 121 LYS D CD  1 
ATOM   7450  C CE  . LYS D  2 121 ? 46.352  -5.690  16.474  1.00 25.49  ? 121 LYS D CE  1 
ATOM   7451  N NZ  . LYS D  2 121 ? 44.976  -5.578  16.038  1.00 27.18  ? 121 LYS D NZ  1 
ATOM   7452  N N   . THR D  2 122 ? 51.659  -4.861  15.242  1.00 16.74  ? 122 THR D N   1 
ATOM   7453  C CA  . THR D  2 122 ? 52.294  -6.029  14.683  1.00 15.81  ? 122 THR D CA  1 
ATOM   7454  C C   . THR D  2 122 ? 53.622  -6.276  15.386  1.00 15.98  ? 122 THR D C   1 
ATOM   7455  O O   . THR D  2 122 ? 53.919  -7.429  15.734  1.00 16.45  ? 122 THR D O   1 
ATOM   7456  C CB  . THR D  2 122 ? 52.439  -5.796  13.187  1.00 14.60  ? 122 THR D CB  1 
ATOM   7457  O OG1 . THR D  2 122 ? 51.092  -5.704  12.742  1.00 13.80  ? 122 THR D OG1 1 
ATOM   7458  C CG2 . THR D  2 122 ? 53.160  -6.889  12.432  1.00 14.64  ? 122 THR D CG2 1 
ATOM   7459  N N   . ARG D  2 123 ? 54.345  -5.200  15.720  1.00 16.08  ? 123 ARG D N   1 
ATOM   7460  C CA  . ARG D  2 123 ? 55.608  -5.285  16.435  1.00 15.55  ? 123 ARG D CA  1 
ATOM   7461  C C   . ARG D  2 123 ? 55.413  -6.008  17.757  1.00 14.91  ? 123 ARG D C   1 
ATOM   7462  O O   . ARG D  2 123 ? 56.055  -7.037  18.002  1.00 15.83  ? 123 ARG D O   1 
ATOM   7463  C CB  . ARG D  2 123 ? 56.141  -3.894  16.683  1.00 15.11  ? 123 ARG D CB  1 
ATOM   7464  C CG  . ARG D  2 123 ? 57.362  -3.846  17.550  1.00 16.05  ? 123 ARG D CG  1 
ATOM   7465  C CD  . ARG D  2 123 ? 57.649  -2.384  17.846  1.00 17.58  ? 123 ARG D CD  1 
ATOM   7466  N NE  . ARG D  2 123 ? 57.823  -2.200  19.279  1.00 20.30  ? 123 ARG D NE  1 
ATOM   7467  C CZ  . ARG D  2 123 ? 56.796  -2.151  20.142  1.00 20.78  ? 123 ARG D CZ  1 
ATOM   7468  N NH1 . ARG D  2 123 ? 56.989  -2.098  21.473  1.00 21.85  ? 123 ARG D NH1 1 
ATOM   7469  N NH2 . ARG D  2 123 ? 55.589  -2.012  19.648  1.00 21.28  ? 123 ARG D NH2 1 
ATOM   7470  N N   . ARG D  2 124 ? 54.479  -5.531  18.563  1.00 12.98  ? 124 ARG D N   1 
ATOM   7471  C CA  . ARG D  2 124 ? 54.277  -6.129  19.860  1.00 13.28  ? 124 ARG D CA  1 
ATOM   7472  C C   . ARG D  2 124 ? 53.909  -7.590  19.828  1.00 13.72  ? 124 ARG D C   1 
ATOM   7473  O O   . ARG D  2 124 ? 54.318  -8.375  20.683  1.00 15.79  ? 124 ARG D O   1 
ATOM   7474  C CB  . ARG D  2 124 ? 53.206  -5.423  20.574  1.00 13.57  ? 124 ARG D CB  1 
ATOM   7475  C CG  . ARG D  2 124 ? 53.856  -4.357  21.365  1.00 13.05  ? 124 ARG D CG  1 
ATOM   7476  C CD  . ARG D  2 124 ? 52.820  -3.278  21.343  1.00 13.00  ? 124 ARG D CD  1 
ATOM   7477  N NE  . ARG D  2 124 ? 53.472  -2.212  22.031  1.00 13.83  ? 124 ARG D NE  1 
ATOM   7478  C CZ  . ARG D  2 124 ? 53.089  -0.949  21.987  1.00 15.44  ? 124 ARG D CZ  1 
ATOM   7479  N NH1 . ARG D  2 124 ? 53.808  -0.041  22.684  1.00 16.24  ? 124 ARG D NH1 1 
ATOM   7480  N NH2 . ARG D  2 124 ? 51.951  -0.648  21.343  1.00 16.80  ? 124 ARG D NH2 1 
ATOM   7481  N N   . GLN D  2 125 ? 53.139  -7.980  18.837  1.00 13.70  ? 125 GLN D N   1 
ATOM   7482  C CA  . GLN D  2 125 ? 52.696  -9.353  18.693  1.00 12.56  ? 125 GLN D CA  1 
ATOM   7483  C C   . GLN D  2 125 ? 53.857  -10.283 18.452  1.00 11.11  ? 125 GLN D C   1 
ATOM   7484  O O   . GLN D  2 125 ? 53.955  -11.320 19.093  1.00 10.14  ? 125 GLN D O   1 
ATOM   7485  C CB  . GLN D  2 125 ? 51.739  -9.373  17.556  1.00 13.45  ? 125 GLN D CB  1 
ATOM   7486  C CG  . GLN D  2 125 ? 51.162  -10.700 17.325  1.00 14.92  ? 125 GLN D CG  1 
ATOM   7487  C CD  . GLN D  2 125 ? 49.786  -10.499 16.748  1.00 16.34  ? 125 GLN D CD  1 
ATOM   7488  O OE1 . GLN D  2 125 ? 48.822  -10.923 17.367  1.00 17.82  ? 125 GLN D OE1 1 
ATOM   7489  N NE2 . GLN D  2 125 ? 49.605  -9.867  15.590  1.00 16.88  ? 125 GLN D NE2 1 
ATOM   7490  N N   . LEU D  2 126 ? 54.781  -9.867  17.584  1.00 10.52  ? 126 LEU D N   1 
ATOM   7491  C CA  . LEU D  2 126 ? 55.891  -10.713 17.216  1.00 9.85   ? 126 LEU D CA  1 
ATOM   7492  C C   . LEU D  2 126 ? 56.920  -10.918 18.311  1.00 10.51  ? 126 LEU D C   1 
ATOM   7493  O O   . LEU D  2 126 ? 57.848  -11.721 18.104  1.00 12.50  ? 126 LEU D O   1 
ATOM   7494  C CB  . LEU D  2 126 ? 56.596  -10.148 15.999  1.00 8.08   ? 126 LEU D CB  1 
ATOM   7495  C CG  . LEU D  2 126 ? 55.785  -10.146 14.761  1.00 7.07   ? 126 LEU D CG  1 
ATOM   7496  C CD1 . LEU D  2 126 ? 56.489  -9.350  13.688  1.00 6.53   ? 126 LEU D CD1 1 
ATOM   7497  C CD2 . LEU D  2 126 ? 55.531  -11.579 14.373  1.00 7.98   ? 126 LEU D CD2 1 
ATOM   7498  N N   . ARG D  2 127 ? 56.771  -10.216 19.436  1.00 9.76   ? 127 ARG D N   1 
ATOM   7499  C CA  . ARG D  2 127 ? 57.708  -10.236 20.545  1.00 10.67  ? 127 ARG D CA  1 
ATOM   7500  C C   . ARG D  2 127 ? 59.193  -10.479 20.250  1.00 12.11  ? 127 ARG D C   1 
ATOM   7501  O O   . ARG D  2 127 ? 59.743  -9.695  19.481  1.00 14.95  ? 127 ARG D O   1 
ATOM   7502  C CB  . ARG D  2 127 ? 57.170  -11.218 21.507  1.00 10.04  ? 127 ARG D CB  1 
ATOM   7503  C CG  . ARG D  2 127 ? 56.591  -10.253 22.504  1.00 10.64  ? 127 ARG D CG  1 
ATOM   7504  C CD  . ARG D  2 127 ? 57.173  -10.440 23.876  1.00 11.05  ? 127 ARG D CD  1 
ATOM   7505  N NE  . ARG D  2 127 ? 56.229  -11.212 24.656  1.00 11.71  ? 127 ARG D NE  1 
ATOM   7506  C CZ  . ARG D  2 127 ? 56.486  -11.525 25.919  1.00 12.36  ? 127 ARG D CZ  1 
ATOM   7507  N NH1 . ARG D  2 127 ? 55.578  -12.217 26.601  1.00 13.44  ? 127 ARG D NH1 1 
ATOM   7508  N NH2 . ARG D  2 127 ? 57.657  -11.201 26.472  1.00 12.45  ? 127 ARG D NH2 1 
ATOM   7509  N N   . GLU D  2 128 ? 59.882  -11.531 20.677  1.00 11.58  ? 128 GLU D N   1 
ATOM   7510  C CA  . GLU D  2 128 ? 61.306  -11.614 20.433  1.00 11.36  ? 128 GLU D CA  1 
ATOM   7511  C C   . GLU D  2 128 ? 61.657  -12.314 19.151  1.00 9.75   ? 128 GLU D C   1 
ATOM   7512  O O   . GLU D  2 128 ? 62.848  -12.548 18.900  1.00 10.10  ? 128 GLU D O   1 
ATOM   7513  C CB  . GLU D  2 128 ? 61.914  -12.329 21.609  1.00 12.77  ? 128 GLU D CB  1 
ATOM   7514  C CG  . GLU D  2 128 ? 62.976  -11.608 22.373  1.00 15.38  ? 128 GLU D CG  1 
ATOM   7515  C CD  . GLU D  2 128 ? 62.764  -10.121 22.587  1.00 16.61  ? 128 GLU D CD  1 
ATOM   7516  O OE1 . GLU D  2 128 ? 63.662  -9.352  22.206  1.00 18.29  ? 128 GLU D OE1 1 
ATOM   7517  O OE2 . GLU D  2 128 ? 61.738  -9.712  23.122  1.00 16.43  ? 128 GLU D OE2 1 
ATOM   7518  N N   . ASN D  2 129 ? 60.655  -12.573 18.317  1.00 7.42   ? 129 ASN D N   1 
ATOM   7519  C CA  . ASN D  2 129 ? 60.866  -13.439 17.207  1.00 7.32   ? 129 ASN D CA  1 
ATOM   7520  C C   . ASN D  2 129 ? 61.091  -12.687 15.942  1.00 8.77   ? 129 ASN D C   1 
ATOM   7521  O O   . ASN D  2 129 ? 61.310  -13.296 14.880  1.00 10.77  ? 129 ASN D O   1 
ATOM   7522  C CB  . ASN D  2 129 ? 59.693  -14.346 17.015  1.00 7.00   ? 129 ASN D CB  1 
ATOM   7523  C CG  . ASN D  2 129 ? 59.242  -15.062 18.279  1.00 7.88   ? 129 ASN D CG  1 
ATOM   7524  O OD1 . ASN D  2 129 ? 59.716  -14.868 19.407  1.00 7.26   ? 129 ASN D OD1 1 
ATOM   7525  N ND2 . ASN D  2 129 ? 58.222  -15.874 18.146  1.00 8.65   ? 129 ASN D ND2 1 
ATOM   7526  N N   . ALA D  2 130 ? 61.087  -11.370 15.989  1.00 9.10   ? 130 ALA D N   1 
ATOM   7527  C CA  . ALA D  2 130 ? 61.290  -10.646 14.764  1.00 9.63   ? 130 ALA D CA  1 
ATOM   7528  C C   . ALA D  2 130 ? 62.065  -9.400  15.033  1.00 10.59  ? 130 ALA D C   1 
ATOM   7529  O O   . ALA D  2 130 ? 62.071  -8.896  16.150  1.00 10.57  ? 130 ALA D O   1 
ATOM   7530  C CB  . ALA D  2 130 ? 59.973  -10.251 14.169  1.00 9.09   ? 130 ALA D CB  1 
ATOM   7531  N N   . GLU D  2 131 ? 62.741  -8.913  14.021  1.00 12.63  ? 131 GLU D N   1 
ATOM   7532  C CA  . GLU D  2 131 ? 63.449  -7.670  14.124  1.00 14.35  ? 131 GLU D CA  1 
ATOM   7533  C C   . GLU D  2 131 ? 62.883  -6.741  13.071  1.00 16.46  ? 131 GLU D C   1 
ATOM   7534  O O   . GLU D  2 131 ? 62.477  -7.140  11.968  1.00 16.04  ? 131 GLU D O   1 
ATOM   7535  C CB  . GLU D  2 131 ? 64.931  -7.880  13.882  1.00 14.41  ? 131 GLU D CB  1 
ATOM   7536  C CG  . GLU D  2 131 ? 65.610  -8.499  15.086  1.00 15.35  ? 131 GLU D CG  1 
ATOM   7537  C CD  . GLU D  2 131 ? 67.108  -8.722  15.041  1.00 16.21  ? 131 GLU D CD  1 
ATOM   7538  O OE1 . GLU D  2 131 ? 67.821  -8.136  14.223  1.00 17.25  ? 131 GLU D OE1 1 
ATOM   7539  O OE2 . GLU D  2 131 ? 67.578  -9.532  15.833  1.00 15.80  ? 131 GLU D OE2 1 
ATOM   7540  N N   . GLU D  2 132 ? 62.829  -5.469  13.426  1.00 18.61  ? 132 GLU D N   1 
ATOM   7541  C CA  . GLU D  2 132 ? 62.366  -4.452  12.505  1.00 20.19  ? 132 GLU D CA  1 
ATOM   7542  C C   . GLU D  2 132 ? 63.498  -4.135  11.551  1.00 20.54  ? 132 GLU D C   1 
ATOM   7543  O O   . GLU D  2 132 ? 64.597  -3.859  12.021  1.00 21.73  ? 132 GLU D O   1 
ATOM   7544  C CB  . GLU D  2 132 ? 61.988  -3.209  13.262  1.00 20.27  ? 132 GLU D CB  1 
ATOM   7545  C CG  . GLU D  2 132 ? 61.322  -2.295  12.295  1.00 21.08  ? 132 GLU D CG  1 
ATOM   7546  C CD  . GLU D  2 132 ? 61.044  -0.895  12.766  1.00 22.44  ? 132 GLU D CD  1 
ATOM   7547  O OE1 . GLU D  2 132 ? 60.846  -0.073  11.870  1.00 24.32  ? 132 GLU D OE1 1 
ATOM   7548  O OE2 . GLU D  2 132 ? 61.019  -0.576  13.972  1.00 21.62  ? 132 GLU D OE2 1 
ATOM   7549  N N   . MET D  2 133 ? 63.329  -4.245  10.242  1.00 21.19  ? 133 MET D N   1 
ATOM   7550  C CA  . MET D  2 133 ? 64.413  -3.817  9.408   1.00 22.14  ? 133 MET D CA  1 
ATOM   7551  C C   . MET D  2 133 ? 64.247  -2.358  9.014   1.00 22.79  ? 133 MET D C   1 
ATOM   7552  O O   . MET D  2 133 ? 64.864  -1.853  8.075   1.00 23.01  ? 133 MET D O   1 
ATOM   7553  C CB  . MET D  2 133 ? 64.569  -4.770  8.224   1.00 22.71  ? 133 MET D CB  1 
ATOM   7554  C CG  . MET D  2 133 ? 63.416  -5.229  7.414   1.00 23.24  ? 133 MET D CG  1 
ATOM   7555  S SD  . MET D  2 133 ? 63.375  -7.025  7.535   1.00 23.96  ? 133 MET D SD  1 
ATOM   7556  C CE  . MET D  2 133 ? 64.167  -7.411  6.003   1.00 23.99  ? 133 MET D CE  1 
ATOM   7557  N N   . GLY D  2 134 ? 63.382  -1.646  9.741   1.00 23.26  ? 134 GLY D N   1 
ATOM   7558  C CA  . GLY D  2 134 ? 63.266  -0.196  9.642   1.00 24.46  ? 134 GLY D CA  1 
ATOM   7559  C C   . GLY D  2 134 ? 62.734  0.416   8.356   1.00 24.46  ? 134 GLY D C   1 
ATOM   7560  O O   . GLY D  2 134 ? 62.825  1.623   8.114   1.00 26.19  ? 134 GLY D O   1 
ATOM   7561  N N   . ASN D  2 135 ? 62.146  -0.391  7.520   1.00 22.54  ? 135 ASN D N   1 
ATOM   7562  C CA  . ASN D  2 135 ? 61.590  0.083   6.287   1.00 20.57  ? 135 ASN D CA  1 
ATOM   7563  C C   . ASN D  2 135 ? 60.131  -0.307  6.312   1.00 19.92  ? 135 ASN D C   1 
ATOM   7564  O O   . ASN D  2 135 ? 59.532  -0.461  5.245   1.00 20.66  ? 135 ASN D O   1 
ATOM   7565  C CB  . ASN D  2 135 ? 62.310  -0.619  5.186   1.00 20.62  ? 135 ASN D CB  1 
ATOM   7566  C CG  . ASN D  2 135 ? 62.147  -2.142  5.314   1.00 21.21  ? 135 ASN D CG  1 
ATOM   7567  O OD1 . ASN D  2 135 ? 61.923  -2.699  6.402   1.00 21.07  ? 135 ASN D OD1 1 
ATOM   7568  N ND2 . ASN D  2 135 ? 62.221  -2.964  4.275   1.00 21.76  ? 135 ASN D ND2 1 
ATOM   7569  N N   . GLY D  2 136 ? 59.559  -0.531  7.505   1.00 18.37  ? 136 GLY D N   1 
ATOM   7570  C CA  . GLY D  2 136 ? 58.191  -1.015  7.595   1.00 15.68  ? 136 GLY D CA  1 
ATOM   7571  C C   . GLY D  2 136 ? 58.097  -2.527  7.469   1.00 14.22  ? 136 GLY D C   1 
ATOM   7572  O O   . GLY D  2 136 ? 56.989  -3.052  7.551   1.00 15.01  ? 136 GLY D O   1 
ATOM   7573  N N   . CYS D  2 137 ? 59.191  -3.263  7.256   1.00 12.57  ? 137 CYS D N   1 
ATOM   7574  C CA  . CYS D  2 137 ? 59.147  -4.712  7.242   1.00 10.79  ? 137 CYS D CA  1 
ATOM   7575  C C   . CYS D  2 137 ? 59.800  -5.298  8.473   1.00 11.34  ? 137 CYS D C   1 
ATOM   7576  O O   . CYS D  2 137 ? 60.793  -4.784  8.985   1.00 11.25  ? 137 CYS D O   1 
ATOM   7577  C CB  . CYS D  2 137 ? 59.901  -5.320  6.137   1.00 8.74   ? 137 CYS D CB  1 
ATOM   7578  S SG  . CYS D  2 137 ? 59.406  -4.605  4.617   1.00 7.26   ? 137 CYS D SG  1 
ATOM   7579  N N   . PHE D  2 138 ? 59.243  -6.373  8.973   1.00 12.22  ? 138 PHE D N   1 
ATOM   7580  C CA  . PHE D  2 138 ? 59.828  -7.159  10.032  1.00 13.22  ? 138 PHE D CA  1 
ATOM   7581  C C   . PHE D  2 138 ? 60.476  -8.408  9.433   1.00 15.16  ? 138 PHE D C   1 
ATOM   7582  O O   . PHE D  2 138 ? 59.894  -9.046  8.539   1.00 16.40  ? 138 PHE D O   1 
ATOM   7583  C CB  . PHE D  2 138 ? 58.784  -7.653  10.989  1.00 11.62  ? 138 PHE D CB  1 
ATOM   7584  C CG  . PHE D  2 138 ? 58.119  -6.572  11.790  1.00 10.06  ? 138 PHE D CG  1 
ATOM   7585  C CD1 . PHE D  2 138 ? 56.887  -6.104  11.399  1.00 9.40   ? 138 PHE D CD1 1 
ATOM   7586  C CD2 . PHE D  2 138 ? 58.760  -6.077  12.899  1.00 9.45   ? 138 PHE D CD2 1 
ATOM   7587  C CE1 . PHE D  2 138 ? 56.281  -5.128  12.149  1.00 8.88   ? 138 PHE D CE1 1 
ATOM   7588  C CE2 . PHE D  2 138 ? 58.140  -5.102  13.642  1.00 8.82   ? 138 PHE D CE2 1 
ATOM   7589  C CZ  . PHE D  2 138 ? 56.908  -4.627  13.264  1.00 8.89   ? 138 PHE D CZ  1 
ATOM   7590  N N   . LYS D  2 139 ? 61.672  -8.762  9.883   1.00 15.92  ? 139 LYS D N   1 
ATOM   7591  C CA  . LYS D  2 139 ? 62.235  -10.034 9.534   1.00 16.98  ? 139 LYS D CA  1 
ATOM   7592  C C   . LYS D  2 139 ? 61.767  -10.988 10.605  1.00 16.66  ? 139 LYS D C   1 
ATOM   7593  O O   . LYS D  2 139 ? 62.101  -10.786 11.769  1.00 16.56  ? 139 LYS D O   1 
ATOM   7594  C CB  . LYS D  2 139 ? 63.732  -10.023 9.563   1.00 18.95  ? 139 LYS D CB  1 
ATOM   7595  C CG  . LYS D  2 139 ? 64.291  -11.378 9.171   1.00 21.24  ? 139 LYS D CG  1 
ATOM   7596  C CD  . LYS D  2 139 ? 65.772  -11.164 9.035   1.00 24.55  ? 139 LYS D CD  1 
ATOM   7597  C CE  . LYS D  2 139 ? 66.493  -12.414 8.544   1.00 26.84  ? 139 LYS D CE  1 
ATOM   7598  N NZ  . LYS D  2 139 ? 67.933  -12.258 8.705   1.00 28.77  ? 139 LYS D NZ  1 
ATOM   7599  N N   . ILE D  2 140 ? 60.993  -12.009 10.263  1.00 16.62  ? 140 ILE D N   1 
ATOM   7600  C CA  . ILE D  2 140 ? 60.555  -12.997 11.234  1.00 16.22  ? 140 ILE D CA  1 
ATOM   7601  C C   . ILE D  2 140 ? 61.616  -14.077 11.271  1.00 18.19  ? 140 ILE D C   1 
ATOM   7602  O O   . ILE D  2 140 ? 61.906  -14.710 10.243  1.00 19.08  ? 140 ILE D O   1 
ATOM   7603  C CB  . ILE D  2 140 ? 59.210  -13.563 10.812  1.00 14.68  ? 140 ILE D CB  1 
ATOM   7604  C CG1 . ILE D  2 140 ? 58.201  -12.433 10.679  1.00 13.90  ? 140 ILE D CG1 1 
ATOM   7605  C CG2 . ILE D  2 140 ? 58.740  -14.539 11.859  1.00 13.67  ? 140 ILE D CG2 1 
ATOM   7606  C CD1 . ILE D  2 140 ? 56.796  -12.818 10.214  1.00 13.32  ? 140 ILE D CD1 1 
ATOM   7607  N N   . TYR D  2 141 ? 62.251  -14.254 12.431  1.00 19.23  ? 141 TYR D N   1 
ATOM   7608  C CA  . TYR D  2 141 ? 63.374  -15.170 12.583  1.00 20.04  ? 141 TYR D CA  1 
ATOM   7609  C C   . TYR D  2 141 ? 63.001  -16.615 12.847  1.00 20.99  ? 141 TYR D C   1 
ATOM   7610  O O   . TYR D  2 141 ? 63.652  -17.289 13.639  1.00 20.81  ? 141 TYR D O   1 
ATOM   7611  C CB  . TYR D  2 141 ? 64.301  -14.673 13.705  1.00 19.15  ? 141 TYR D CB  1 
ATOM   7612  C CG  . TYR D  2 141 ? 65.248  -13.595 13.210  1.00 20.01  ? 141 TYR D CG  1 
ATOM   7613  C CD1 . TYR D  2 141 ? 64.927  -12.258 13.327  1.00 20.48  ? 141 TYR D CD1 1 
ATOM   7614  C CD2 . TYR D  2 141 ? 66.438  -13.965 12.615  1.00 20.74  ? 141 TYR D CD2 1 
ATOM   7615  C CE1 . TYR D  2 141 ? 65.797  -11.287 12.861  1.00 20.73  ? 141 TYR D CE1 1 
ATOM   7616  C CE2 . TYR D  2 141 ? 67.315  -13.002 12.153  1.00 21.05  ? 141 TYR D CE2 1 
ATOM   7617  C CZ  . TYR D  2 141 ? 66.985  -11.666 12.270  1.00 20.94  ? 141 TYR D CZ  1 
ATOM   7618  O OH  . TYR D  2 141 ? 67.876  -10.722 11.773  1.00 21.06  ? 141 TYR D OH  1 
ATOM   7619  N N   . HIS D  2 142 ? 61.962  -17.151 12.221  1.00 22.53  ? 142 HIS D N   1 
ATOM   7620  C CA  . HIS D  2 142 ? 61.649  -18.566 12.358  1.00 23.60  ? 142 HIS D CA  1 
ATOM   7621  C C   . HIS D  2 142 ? 60.822  -18.989 11.145  1.00 25.97  ? 142 HIS D C   1 
ATOM   7622  O O   . HIS D  2 142 ? 60.337  -18.129 10.401  1.00 26.41  ? 142 HIS D O   1 
ATOM   7623  C CB  . HIS D  2 142 ? 60.877  -18.824 13.641  1.00 21.61  ? 142 HIS D CB  1 
ATOM   7624  C CG  . HIS D  2 142 ? 59.478  -18.289 13.669  1.00 21.27  ? 142 HIS D CG  1 
ATOM   7625  N ND1 . HIS D  2 142 ? 58.479  -18.812 12.981  1.00 21.39  ? 142 HIS D ND1 1 
ATOM   7626  C CD2 . HIS D  2 142 ? 59.059  -17.188 14.363  1.00 21.64  ? 142 HIS D CD2 1 
ATOM   7627  C CE1 . HIS D  2 142 ? 57.443  -18.045 13.221  1.00 22.09  ? 142 HIS D CE1 1 
ATOM   7628  N NE2 . HIS D  2 142 ? 57.796  -17.083 14.051  1.00 21.65  ? 142 HIS D NE2 1 
ATOM   7629  N N   . LYS D  2 143 ? 60.638  -20.277 10.894  1.00 29.14  ? 143 LYS D N   1 
ATOM   7630  C CA  . LYS D  2 143 ? 59.913  -20.754 9.732   1.00 31.99  ? 143 LYS D CA  1 
ATOM   7631  C C   . LYS D  2 143 ? 58.465  -20.334 9.910   1.00 32.24  ? 143 LYS D C   1 
ATOM   7632  O O   . LYS D  2 143 ? 57.779  -20.777 10.828  1.00 31.88  ? 143 LYS D O   1 
ATOM   7633  C CB  . LYS D  2 143 ? 60.101  -22.299 9.653   1.00 33.85  ? 143 LYS D CB  1 
ATOM   7634  C CG  . LYS D  2 143 ? 59.510  -23.051 8.442   1.00 36.72  ? 143 LYS D CG  1 
ATOM   7635  C CD  . LYS D  2 143 ? 58.114  -23.641 8.733   1.00 38.81  ? 143 LYS D CD  1 
ATOM   7636  C CE  . LYS D  2 143 ? 57.465  -24.395 7.560   1.00 39.84  ? 143 LYS D CE  1 
ATOM   7637  N NZ  . LYS D  2 143 ? 56.041  -24.619 7.801   1.00 41.40  ? 143 LYS D NZ  1 
ATOM   7638  N N   . CYS D  2 144 ? 57.961  -19.451 9.067   1.00 33.31  ? 144 CYS D N   1 
ATOM   7639  C CA  . CYS D  2 144 ? 56.594  -18.978 9.231   1.00 33.67  ? 144 CYS D CA  1 
ATOM   7640  C C   . CYS D  2 144 ? 55.820  -19.141 7.941   1.00 35.33  ? 144 CYS D C   1 
ATOM   7641  O O   . CYS D  2 144 ? 55.939  -18.338 7.013   1.00 35.35  ? 144 CYS D O   1 
ATOM   7642  C CB  . CYS D  2 144 ? 56.661  -17.525 9.667   1.00 32.08  ? 144 CYS D CB  1 
ATOM   7643  S SG  . CYS D  2 144 ? 55.082  -16.693 9.904   1.00 30.45  ? 144 CYS D SG  1 
ATOM   7644  N N   . ASP D  2 145 ? 55.083  -20.242 7.852   1.00 37.54  ? 145 ASP D N   1 
ATOM   7645  C CA  . ASP D  2 145 ? 54.304  -20.560 6.650   1.00 39.71  ? 145 ASP D CA  1 
ATOM   7646  C C   . ASP D  2 145 ? 53.058  -19.691 6.528   1.00 39.07  ? 145 ASP D C   1 
ATOM   7647  O O   . ASP D  2 145 ? 52.787  -18.853 7.404   1.00 39.36  ? 145 ASP D O   1 
ATOM   7648  C CB  . ASP D  2 145 ? 53.870  -22.030 6.657   1.00 41.52  ? 145 ASP D CB  1 
ATOM   7649  C CG  . ASP D  2 145 ? 53.221  -22.453 7.948   1.00 43.52  ? 145 ASP D CG  1 
ATOM   7650  O OD1 . ASP D  2 145 ? 53.925  -23.164 8.676   1.00 45.39  ? 145 ASP D OD1 1 
ATOM   7651  O OD2 . ASP D  2 145 ? 52.094  -22.047 8.253   1.00 43.35  ? 145 ASP D OD2 1 
ATOM   7652  N N   . ASN D  2 146 ? 52.241  -19.929 5.503   1.00 37.58  ? 146 ASN D N   1 
ATOM   7653  C CA  . ASN D  2 146 ? 51.103  -19.074 5.272   1.00 36.18  ? 146 ASN D CA  1 
ATOM   7654  C C   . ASN D  2 146 ? 50.127  -19.013 6.415   1.00 34.83  ? 146 ASN D C   1 
ATOM   7655  O O   . ASN D  2 146 ? 49.525  -17.964 6.640   1.00 35.13  ? 146 ASN D O   1 
ATOM   7656  C CB  . ASN D  2 146 ? 50.333  -19.492 4.046   1.00 36.44  ? 146 ASN D CB  1 
ATOM   7657  C CG  . ASN D  2 146 ? 50.946  -18.958 2.761   1.00 37.25  ? 146 ASN D CG  1 
ATOM   7658  O OD1 . ASN D  2 146 ? 51.811  -18.066 2.687   1.00 37.19  ? 146 ASN D OD1 1 
ATOM   7659  N ND2 . ASN D  2 146 ? 50.468  -19.530 1.668   1.00 37.91  ? 146 ASN D ND2 1 
ATOM   7660  N N   . ALA D  2 147 ? 49.986  -20.054 7.221   1.00 33.37  ? 147 ALA D N   1 
ATOM   7661  C CA  . ALA D  2 147 ? 49.007  -19.984 8.298   1.00 32.40  ? 147 ALA D CA  1 
ATOM   7662  C C   . ALA D  2 147 ? 49.558  -19.169 9.434   1.00 31.73  ? 147 ALA D C   1 
ATOM   7663  O O   . ALA D  2 147 ? 48.806  -18.517 10.153  1.00 31.34  ? 147 ALA D O   1 
ATOM   7664  C CB  . ALA D  2 147 ? 48.681  -21.327 8.870   1.00 32.99  ? 147 ALA D CB  1 
ATOM   7665  N N   . CYS D  2 148 ? 50.879  -19.215 9.602   1.00 31.14  ? 148 CYS D N   1 
ATOM   7666  C CA  . CYS D  2 148 ? 51.556  -18.391 10.589  1.00 29.26  ? 148 CYS D CA  1 
ATOM   7667  C C   . CYS D  2 148 ? 51.338  -16.947 10.186  1.00 28.80  ? 148 CYS D C   1 
ATOM   7668  O O   . CYS D  2 148 ? 50.848  -16.162 10.996  1.00 29.27  ? 148 CYS D O   1 
ATOM   7669  C CB  . CYS D  2 148 ? 53.036  -18.751 10.602  1.00 29.35  ? 148 CYS D CB  1 
ATOM   7670  S SG  . CYS D  2 148 ? 54.128  -17.589 11.455  1.00 27.74  ? 148 CYS D SG  1 
ATOM   7671  N N   . ILE D  2 149 ? 51.568  -16.582 8.911   1.00 28.33  ? 149 ILE D N   1 
ATOM   7672  C CA  . ILE D  2 149 ? 51.326  -15.221 8.453   1.00 27.32  ? 149 ILE D CA  1 
ATOM   7673  C C   . ILE D  2 149 ? 49.863  -14.871 8.678   1.00 27.85  ? 149 ILE D C   1 
ATOM   7674  O O   . ILE D  2 149 ? 49.585  -13.780 9.154   1.00 27.73  ? 149 ILE D O   1 
ATOM   7675  C CB  . ILE D  2 149 ? 51.715  -15.106 6.966   1.00 26.67  ? 149 ILE D CB  1 
ATOM   7676  C CG1 . ILE D  2 149 ? 53.219  -15.267 6.827   1.00 25.45  ? 149 ILE D CG1 1 
ATOM   7677  C CG2 . ILE D  2 149 ? 51.264  -13.761 6.399   1.00 26.75  ? 149 ILE D CG2 1 
ATOM   7678  C CD1 . ILE D  2 149 ? 54.059  -14.132 7.444   1.00 24.57  ? 149 ILE D CD1 1 
ATOM   7679  N N   . GLU D  2 150 ? 48.916  -15.777 8.436   1.00 29.69  ? 150 GLU D N   1 
ATOM   7680  C CA  . GLU D  2 150 ? 47.504  -15.509 8.697   1.00 31.05  ? 150 GLU D CA  1 
ATOM   7681  C C   . GLU D  2 150 ? 47.272  -15.235 10.170  1.00 29.41  ? 150 GLU D C   1 
ATOM   7682  O O   . GLU D  2 150 ? 46.540  -14.314 10.513  1.00 28.84  ? 150 GLU D O   1 
ATOM   7683  C CB  . GLU D  2 150 ? 46.603  -16.697 8.283   1.00 33.83  ? 150 GLU D CB  1 
ATOM   7684  C CG  . GLU D  2 150 ? 45.380  -16.344 7.392   1.00 38.10  ? 150 GLU D CG  1 
ATOM   7685  C CD  . GLU D  2 150 ? 44.393  -15.248 7.886   1.00 40.79  ? 150 GLU D CD  1 
ATOM   7686  O OE1 . GLU D  2 150 ? 44.647  -14.046 7.612   1.00 41.55  ? 150 GLU D OE1 1 
ATOM   7687  O OE2 . GLU D  2 150 ? 43.356  -15.594 8.489   1.00 41.68  ? 150 GLU D OE2 1 
ATOM   7688  N N   . SER D  2 151 ? 47.944  -15.912 11.094  1.00 29.11  ? 151 SER D N   1 
ATOM   7689  C CA  . SER D  2 151 ? 47.689  -15.649 12.502  1.00 28.35  ? 151 SER D CA  1 
ATOM   7690  C C   . SER D  2 151 ? 48.316  -14.361 12.988  1.00 27.01  ? 151 SER D C   1 
ATOM   7691  O O   . SER D  2 151 ? 47.819  -13.786 13.949  1.00 26.32  ? 151 SER D O   1 
ATOM   7692  C CB  . SER D  2 151 ? 48.180  -16.809 13.365  1.00 29.17  ? 151 SER D CB  1 
ATOM   7693  O OG  . SER D  2 151 ? 49.556  -17.154 13.217  1.00 31.33  ? 151 SER D OG  1 
ATOM   7694  N N   . ILE D  2 152 ? 49.411  -13.873 12.382  1.00 26.10  ? 152 ILE D N   1 
ATOM   7695  C CA  . ILE D  2 152 ? 49.957  -12.573 12.769  1.00 24.74  ? 152 ILE D CA  1 
ATOM   7696  C C   . ILE D  2 152 ? 48.965  -11.511 12.321  1.00 24.69  ? 152 ILE D C   1 
ATOM   7697  O O   . ILE D  2 152 ? 48.592  -10.624 13.083  1.00 23.34  ? 152 ILE D O   1 
ATOM   7698  C CB  . ILE D  2 152 ? 51.329  -12.310 12.112  1.00 23.66  ? 152 ILE D CB  1 
ATOM   7699  C CG1 . ILE D  2 152 ? 52.298  -13.384 12.533  1.00 23.15  ? 152 ILE D CG1 1 
ATOM   7700  C CG2 . ILE D  2 152 ? 51.879  -10.962 12.555  1.00 22.71  ? 152 ILE D CG2 1 
ATOM   7701  C CD1 . ILE D  2 152 ? 53.699  -13.321 11.919  1.00 23.84  ? 152 ILE D CD1 1 
ATOM   7702  N N   . ARG D  2 153 ? 48.462  -11.673 11.107  1.00 25.66  ? 153 ARG D N   1 
ATOM   7703  C CA  . ARG D  2 153 ? 47.493  -10.766 10.562  1.00 27.24  ? 153 ARG D CA  1 
ATOM   7704  C C   . ARG D  2 153 ? 46.169  -10.820 11.294  1.00 29.59  ? 153 ARG D C   1 
ATOM   7705  O O   . ARG D  2 153 ? 45.485  -9.808  11.350  1.00 30.14  ? 153 ARG D O   1 
ATOM   7706  C CB  . ARG D  2 153 ? 47.176  -11.055 9.126   1.00 26.62  ? 153 ARG D CB  1 
ATOM   7707  C CG  . ARG D  2 153 ? 48.326  -10.997 8.177   1.00 26.30  ? 153 ARG D CG  1 
ATOM   7708  C CD  . ARG D  2 153 ? 47.624  -10.714 6.891   1.00 26.16  ? 153 ARG D CD  1 
ATOM   7709  N NE  . ARG D  2 153 ? 48.156  -11.504 5.809   1.00 25.34  ? 153 ARG D NE  1 
ATOM   7710  C CZ  . ARG D  2 153 ? 47.472  -12.554 5.365   1.00 25.31  ? 153 ARG D CZ  1 
ATOM   7711  N NH1 . ARG D  2 153 ? 47.968  -13.234 4.333   1.00 25.81  ? 153 ARG D NH1 1 
ATOM   7712  N NH2 . ARG D  2 153 ? 46.303  -12.889 5.944   1.00 24.84  ? 153 ARG D NH2 1 
ATOM   7713  N N   . ASN D  2 154 ? 45.711  -11.948 11.834  1.00 32.23  ? 154 ASN D N   1 
ATOM   7714  C CA  . ASN D  2 154 ? 44.438  -11.913 12.529  1.00 34.16  ? 154 ASN D CA  1 
ATOM   7715  C C   . ASN D  2 154 ? 44.621  -11.893 14.037  1.00 33.47  ? 154 ASN D C   1 
ATOM   7716  O O   . ASN D  2 154 ? 43.726  -12.250 14.802  1.00 33.48  ? 154 ASN D O   1 
ATOM   7717  C CB  . ASN D  2 154 ? 43.570  -13.107 12.097  1.00 38.06  ? 154 ASN D CB  1 
ATOM   7718  C CG  . ASN D  2 154 ? 44.069  -14.478 12.493  1.00 41.93  ? 154 ASN D CG  1 
ATOM   7719  O OD1 . ASN D  2 154 ? 44.936  -14.599 13.364  1.00 41.71  ? 154 ASN D OD1 1 
ATOM   7720  N ND2 . ASN D  2 154 ? 43.567  -15.545 11.864  1.00 46.22  ? 154 ASN D ND2 1 
ATOM   7721  N N   . GLY D  2 155 ? 45.819  -11.532 14.481  1.00 32.75  ? 155 GLY D N   1 
ATOM   7722  C CA  . GLY D  2 155 ? 46.083  -11.292 15.884  1.00 31.38  ? 155 GLY D CA  1 
ATOM   7723  C C   . GLY D  2 155 ? 46.046  -12.489 16.801  1.00 30.58  ? 155 GLY D C   1 
ATOM   7724  O O   . GLY D  2 155 ? 45.833  -12.337 17.999  1.00 30.28  ? 155 GLY D O   1 
ATOM   7725  N N   . THR D  2 156 ? 46.244  -13.690 16.287  1.00 30.76  ? 156 THR D N   1 
ATOM   7726  C CA  . THR D  2 156 ? 46.255  -14.844 17.167  1.00 30.19  ? 156 THR D CA  1 
ATOM   7727  C C   . THR D  2 156 ? 47.650  -15.442 17.281  1.00 29.16  ? 156 THR D C   1 
ATOM   7728  O O   . THR D  2 156 ? 47.810  -16.532 17.828  1.00 28.49  ? 156 THR D O   1 
ATOM   7729  C CB  . THR D  2 156 ? 45.232  -15.882 16.630  1.00 30.19  ? 156 THR D CB  1 
ATOM   7730  O OG1 . THR D  2 156 ? 45.645  -16.306 15.337  1.00 31.46  ? 156 THR D OG1 1 
ATOM   7731  C CG2 . THR D  2 156 ? 43.854  -15.280 16.459  1.00 29.74  ? 156 THR D CG2 1 
ATOM   7732  N N   . TYR D  2 157 ? 48.674  -14.766 16.759  1.00 28.61  ? 157 TYR D N   1 
ATOM   7733  C CA  . TYR D  2 157 ? 50.012  -15.342 16.713  1.00 29.40  ? 157 TYR D CA  1 
ATOM   7734  C C   . TYR D  2 157 ? 50.563  -15.652 18.103  1.00 30.47  ? 157 TYR D C   1 
ATOM   7735  O O   . TYR D  2 157 ? 50.761  -14.724 18.892  1.00 31.43  ? 157 TYR D O   1 
ATOM   7736  C CB  . TYR D  2 157 ? 50.941  -14.361 15.970  1.00 27.61  ? 157 TYR D CB  1 
ATOM   7737  C CG  . TYR D  2 157 ? 52.439  -14.673 15.972  1.00 25.17  ? 157 TYR D CG  1 
ATOM   7738  C CD1 . TYR D  2 157 ? 53.278  -14.071 16.877  1.00 23.62  ? 157 TYR D CD1 1 
ATOM   7739  C CD2 . TYR D  2 157 ? 52.939  -15.564 15.063  1.00 24.76  ? 157 TYR D CD2 1 
ATOM   7740  C CE1 . TYR D  2 157 ? 54.616  -14.370 16.876  1.00 22.97  ? 157 TYR D CE1 1 
ATOM   7741  C CE2 . TYR D  2 157 ? 54.278  -15.855 15.061  1.00 24.20  ? 157 TYR D CE2 1 
ATOM   7742  C CZ  . TYR D  2 157 ? 55.110  -15.263 15.969  1.00 23.10  ? 157 TYR D CZ  1 
ATOM   7743  O OH  . TYR D  2 157 ? 56.443  -15.607 15.969  1.00 22.66  ? 157 TYR D OH  1 
ATOM   7744  N N   . ASP D  2 158 ? 50.827  -16.917 18.445  1.00 31.09  ? 158 ASP D N   1 
ATOM   7745  C CA  . ASP D  2 158 ? 51.413  -17.168 19.747  1.00 31.35  ? 158 ASP D CA  1 
ATOM   7746  C C   . ASP D  2 158 ? 52.916  -17.107 19.578  1.00 30.95  ? 158 ASP D C   1 
ATOM   7747  O O   . ASP D  2 158 ? 53.526  -17.926 18.864  1.00 31.67  ? 158 ASP D O   1 
ATOM   7748  C CB  . ASP D  2 158 ? 51.059  -18.529 20.288  1.00 33.98  ? 158 ASP D CB  1 
ATOM   7749  C CG  . ASP D  2 158 ? 51.412  -18.659 21.766  1.00 36.50  ? 158 ASP D CG  1 
ATOM   7750  O OD1 . ASP D  2 158 ? 50.645  -19.282 22.502  1.00 37.93  ? 158 ASP D OD1 1 
ATOM   7751  O OD2 . ASP D  2 158 ? 52.451  -18.153 22.204  1.00 37.87  ? 158 ASP D OD2 1 
ATOM   7752  N N   . HIS D  2 159 ? 53.550  -16.155 20.253  1.00 29.21  ? 159 HIS D N   1 
ATOM   7753  C CA  . HIS D  2 159 ? 54.967  -15.972 20.043  1.00 28.04  ? 159 HIS D CA  1 
ATOM   7754  C C   . HIS D  2 159 ? 55.765  -17.060 20.707  1.00 29.22  ? 159 HIS D C   1 
ATOM   7755  O O   . HIS D  2 159 ? 56.827  -17.424 20.183  1.00 30.20  ? 159 HIS D O   1 
ATOM   7756  C CB  . HIS D  2 159 ? 55.420  -14.624 20.567  1.00 26.10  ? 159 HIS D CB  1 
ATOM   7757  C CG  . HIS D  2 159 ? 55.717  -14.572 22.050  1.00 24.24  ? 159 HIS D CG  1 
ATOM   7758  N ND1 . HIS D  2 159 ? 56.963  -14.571 22.453  1.00 23.59  ? 159 HIS D ND1 1 
ATOM   7759  C CD2 . HIS D  2 159 ? 54.833  -14.649 23.066  1.00 23.65  ? 159 HIS D CD2 1 
ATOM   7760  C CE1 . HIS D  2 159 ? 56.871  -14.659 23.751  1.00 22.74  ? 159 HIS D CE1 1 
ATOM   7761  N NE2 . HIS D  2 159 ? 55.613  -14.708 24.116  1.00 22.85  ? 159 HIS D NE2 1 
ATOM   7762  N N   . ASP D  2 160 ? 55.251  -17.620 21.805  1.00 29.92  ? 160 ASP D N   1 
ATOM   7763  C CA  . ASP D  2 160 ? 55.974  -18.650 22.522  1.00 30.78  ? 160 ASP D CA  1 
ATOM   7764  C C   . ASP D  2 160 ? 56.217  -19.878 21.682  1.00 30.41  ? 160 ASP D C   1 
ATOM   7765  O O   . ASP D  2 160 ? 57.334  -20.409 21.637  1.00 30.85  ? 160 ASP D O   1 
ATOM   7766  C CB  . ASP D  2 160 ? 55.237  -19.069 23.763  1.00 31.77  ? 160 ASP D CB  1 
ATOM   7767  C CG  . ASP D  2 160 ? 56.020  -18.450 24.884  1.00 33.92  ? 160 ASP D CG  1 
ATOM   7768  O OD1 . ASP D  2 160 ? 57.156  -18.896 25.127  1.00 34.83  ? 160 ASP D OD1 1 
ATOM   7769  O OD2 . ASP D  2 160 ? 55.513  -17.481 25.470  1.00 35.14  ? 160 ASP D OD2 1 
ATOM   7770  N N   . VAL D  2 161 ? 55.209  -20.214 20.880  1.00 28.94  ? 161 VAL D N   1 
ATOM   7771  C CA  . VAL D  2 161 ? 55.288  -21.323 19.967  1.00 28.77  ? 161 VAL D CA  1 
ATOM   7772  C C   . VAL D  2 161 ? 56.577  -21.322 19.152  1.00 30.00  ? 161 VAL D C   1 
ATOM   7773  O O   . VAL D  2 161 ? 57.133  -22.389 18.867  1.00 32.08  ? 161 VAL D O   1 
ATOM   7774  C CB  . VAL D  2 161 ? 54.075  -21.269 19.052  1.00 28.42  ? 161 VAL D CB  1 
ATOM   7775  C CG1 . VAL D  2 161 ? 54.111  -22.325 17.966  1.00 29.12  ? 161 VAL D CG1 1 
ATOM   7776  C CG2 . VAL D  2 161 ? 52.867  -21.571 19.901  1.00 28.45  ? 161 VAL D CG2 1 
ATOM   7777  N N   . TYR D  2 162 ? 57.132  -20.149 18.829  1.00 29.40  ? 162 TYR D N   1 
ATOM   7778  C CA  . TYR D  2 162 ? 58.334  -20.100 18.016  1.00 27.93  ? 162 TYR D CA  1 
ATOM   7779  C C   . TYR D  2 162 ? 59.484  -19.412 18.709  1.00 27.84  ? 162 TYR D C   1 
ATOM   7780  O O   . TYR D  2 162 ? 60.546  -19.230 18.094  1.00 28.42  ? 162 TYR D O   1 
ATOM   7781  C CB  . TYR D  2 162 ? 58.094  -19.352 16.742  1.00 26.67  ? 162 TYR D CB  1 
ATOM   7782  C CG  . TYR D  2 162 ? 56.806  -19.686 16.059  1.00 25.70  ? 162 TYR D CG  1 
ATOM   7783  C CD1 . TYR D  2 162 ? 56.776  -20.619 15.057  1.00 25.88  ? 162 TYR D CD1 1 
ATOM   7784  C CD2 . TYR D  2 162 ? 55.690  -18.982 16.425  1.00 25.83  ? 162 TYR D CD2 1 
ATOM   7785  C CE1 . TYR D  2 162 ? 55.594  -20.846 14.384  1.00 26.25  ? 162 TYR D CE1 1 
ATOM   7786  C CE2 . TYR D  2 162 ? 54.509  -19.207 15.768  1.00 26.48  ? 162 TYR D CE2 1 
ATOM   7787  C CZ  . TYR D  2 162 ? 54.466  -20.129 14.746  1.00 26.55  ? 162 TYR D CZ  1 
ATOM   7788  O OH  . TYR D  2 162 ? 53.272  -20.287 14.062  1.00 26.32  ? 162 TYR D OH  1 
ATOM   7789  N N   . ARG D  2 163 ? 59.324  -19.048 19.977  1.00 27.59  ? 163 ARG D N   1 
ATOM   7790  C CA  . ARG D  2 163 ? 60.353  -18.310 20.673  1.00 29.09  ? 163 ARG D CA  1 
ATOM   7791  C C   . ARG D  2 163 ? 61.713  -18.981 20.632  1.00 30.76  ? 163 ARG D C   1 
ATOM   7792  O O   . ARG D  2 163 ? 62.656  -18.344 20.169  1.00 31.31  ? 163 ARG D O   1 
ATOM   7793  C CB  . ARG D  2 163 ? 59.951  -18.109 22.105  1.00 28.18  ? 163 ARG D CB  1 
ATOM   7794  C CG  . ARG D  2 163 ? 60.804  -17.037 22.746  1.00 27.41  ? 163 ARG D CG  1 
ATOM   7795  C CD  . ARG D  2 163 ? 60.024  -16.583 23.965  1.00 26.75  ? 163 ARG D CD  1 
ATOM   7796  N NE  . ARG D  2 163 ? 60.354  -15.215 24.314  1.00 26.55  ? 163 ARG D NE  1 
ATOM   7797  C CZ  . ARG D  2 163 ? 61.439  -14.902 25.007  1.00 27.47  ? 163 ARG D CZ  1 
ATOM   7798  N NH1 . ARG D  2 163 ? 61.643  -13.623 25.282  1.00 27.53  ? 163 ARG D NH1 1 
ATOM   7799  N NH2 . ARG D  2 163 ? 62.308  -15.855 25.393  1.00 28.54  ? 163 ARG D NH2 1 
ATOM   7800  N N   . ASP D  2 164 ? 61.827  -20.260 21.008  1.00 32.78  ? 164 ASP D N   1 
ATOM   7801  C CA  . ASP D  2 164 ? 63.120  -20.935 21.024  1.00 34.45  ? 164 ASP D CA  1 
ATOM   7802  C C   . ASP D  2 164 ? 63.767  -20.975 19.663  1.00 34.08  ? 164 ASP D C   1 
ATOM   7803  O O   . ASP D  2 164 ? 64.915  -20.546 19.528  1.00 34.35  ? 164 ASP D O   1 
ATOM   7804  C CB  . ASP D  2 164 ? 62.993  -22.374 21.550  1.00 37.05  ? 164 ASP D CB  1 
ATOM   7805  C CG  . ASP D  2 164 ? 62.786  -22.490 23.071  1.00 39.39  ? 164 ASP D CG  1 
ATOM   7806  O OD1 . ASP D  2 164 ? 63.729  -22.222 23.828  1.00 40.13  ? 164 ASP D OD1 1 
ATOM   7807  O OD2 . ASP D  2 164 ? 61.674  -22.828 23.498  1.00 40.58  ? 164 ASP D OD2 1 
ATOM   7808  N N   . GLU D  2 165 ? 62.992  -21.357 18.636  1.00 33.89  ? 165 GLU D N   1 
ATOM   7809  C CA  . GLU D  2 165 ? 63.490  -21.460 17.271  1.00 33.72  ? 165 GLU D CA  1 
ATOM   7810  C C   . GLU D  2 165 ? 64.064  -20.141 16.851  1.00 32.64  ? 165 GLU D C   1 
ATOM   7811  O O   . GLU D  2 165 ? 65.266  -20.070 16.569  1.00 32.61  ? 165 GLU D O   1 
ATOM   7812  C CB  . GLU D  2 165 ? 62.386  -21.833 16.286  1.00 34.86  ? 165 GLU D CB  1 
ATOM   7813  C CG  . GLU D  2 165 ? 62.968  -21.991 14.877  1.00 36.88  ? 165 GLU D CG  1 
ATOM   7814  C CD  . GLU D  2 165 ? 62.005  -22.199 13.717  1.00 38.35  ? 165 GLU D CD  1 
ATOM   7815  O OE1 . GLU D  2 165 ? 60.826  -22.539 13.934  1.00 38.17  ? 165 GLU D OE1 1 
ATOM   7816  O OE2 . GLU D  2 165 ? 62.462  -21.987 12.580  1.00 39.74  ? 165 GLU D OE2 1 
ATOM   7817  N N   . ALA D  2 166 ? 63.213  -19.126 16.928  1.00 31.95  ? 166 ALA D N   1 
ATOM   7818  C CA  . ALA D  2 166 ? 63.581  -17.788 16.557  1.00 32.89  ? 166 ALA D CA  1 
ATOM   7819  C C   . ALA D  2 166 ? 64.819  -17.317 17.283  1.00 33.55  ? 166 ALA D C   1 
ATOM   7820  O O   . ALA D  2 166 ? 65.886  -17.164 16.672  1.00 34.43  ? 166 ALA D O   1 
ATOM   7821  C CB  . ALA D  2 166 ? 62.451  -16.854 16.874  1.00 32.81  ? 166 ALA D CB  1 
ATOM   7822  N N   . LEU D  2 167 ? 64.704  -17.240 18.608  1.00 33.85  ? 167 LEU D N   1 
ATOM   7823  C CA  . LEU D  2 167 ? 65.728  -16.758 19.514  1.00 34.35  ? 167 LEU D CA  1 
ATOM   7824  C C   . LEU D  2 167 ? 67.070  -17.387 19.231  1.00 36.52  ? 167 LEU D C   1 
ATOM   7825  O O   . LEU D  2 167 ? 68.078  -16.680 19.127  1.00 37.86  ? 167 LEU D O   1 
ATOM   7826  C CB  . LEU D  2 167 ? 65.299  -17.060 20.923  1.00 32.16  ? 167 LEU D CB  1 
ATOM   7827  C CG  . LEU D  2 167 ? 65.538  -16.054 22.010  1.00 30.84  ? 167 LEU D CG  1 
ATOM   7828  C CD1 . LEU D  2 167 ? 65.045  -14.696 21.605  1.00 30.64  ? 167 LEU D CD1 1 
ATOM   7829  C CD2 . LEU D  2 167 ? 64.789  -16.498 23.235  1.00 30.66  ? 167 LEU D CD2 1 
ATOM   7830  N N   . ASN D  2 168 ? 67.086  -18.687 18.978  1.00 38.64  ? 168 ASN D N   1 
ATOM   7831  C CA  . ASN D  2 168 ? 68.324  -19.358 18.652  1.00 40.79  ? 168 ASN D CA  1 
ATOM   7832  C C   . ASN D  2 168 ? 68.941  -18.821 17.359  1.00 41.47  ? 168 ASN D C   1 
ATOM   7833  O O   . ASN D  2 168 ? 70.077  -18.332 17.354  1.00 41.59  ? 168 ASN D O   1 
ATOM   7834  C CB  . ASN D  2 168 ? 68.075  -20.872 18.535  1.00 42.12  ? 168 ASN D CB  1 
ATOM   7835  C CG  . ASN D  2 168 ? 69.156  -21.575 17.723  1.00 43.90  ? 168 ASN D CG  1 
ATOM   7836  O OD1 . ASN D  2 168 ? 68.919  -22.027 16.602  1.00 44.94  ? 168 ASN D OD1 1 
ATOM   7837  N ND2 . ASN D  2 168 ? 70.404  -21.630 18.169  1.00 45.01  ? 168 ASN D ND2 1 
ATOM   7838  N N   . ASN D  2 169 ? 68.218  -18.834 16.251  1.00 42.60  ? 169 ASN D N   1 
ATOM   7839  C CA  . ASN D  2 169 ? 68.866  -18.436 15.032  1.00 44.26  ? 169 ASN D CA  1 
ATOM   7840  C C   . ASN D  2 169 ? 68.804  -16.927 14.829  1.00 45.21  ? 169 ASN D C   1 
ATOM   7841  O O   . ASN D  2 169 ? 69.280  -16.369 13.837  1.00 45.55  ? 169 ASN D O   1 
ATOM   7842  C CB  . ASN D  2 169 ? 68.246  -19.260 13.898  1.00 45.32  ? 169 ASN D CB  1 
ATOM   7843  C CG  . ASN D  2 169 ? 66.934  -18.815 13.304  1.00 46.80  ? 169 ASN D CG  1 
ATOM   7844  O OD1 . ASN D  2 169 ? 66.934  -18.072 12.331  1.00 48.64  ? 169 ASN D OD1 1 
ATOM   7845  N ND2 . ASN D  2 169 ? 65.783  -19.272 13.765  1.00 47.23  ? 169 ASN D ND2 1 
ATOM   7846  N N   . ARG D  2 170 ? 68.334  -16.207 15.846  1.00 45.78  ? 170 ARG D N   1 
ATOM   7847  C CA  . ARG D  2 170 ? 68.371  -14.763 15.837  1.00 46.57  ? 170 ARG D CA  1 
ATOM   7848  C C   . ARG D  2 170 ? 69.696  -14.358 16.433  1.00 49.19  ? 170 ARG D C   1 
ATOM   7849  O O   . ARG D  2 170 ? 70.440  -13.545 15.869  1.00 49.95  ? 170 ARG D O   1 
ATOM   7850  C CB  . ARG D  2 170 ? 67.213  -14.221 16.670  1.00 44.22  ? 170 ARG D CB  1 
ATOM   7851  C CG  . ARG D  2 170 ? 66.976  -12.735 16.631  1.00 42.31  ? 170 ARG D CG  1 
ATOM   7852  C CD  . ARG D  2 170 ? 65.797  -12.324 17.490  1.00 40.28  ? 170 ARG D CD  1 
ATOM   7853  N NE  . ARG D  2 170 ? 65.987  -10.913 17.785  1.00 39.19  ? 170 ARG D NE  1 
ATOM   7854  C CZ  . ARG D  2 170 ? 65.560  -10.267 18.880  1.00 38.04  ? 170 ARG D CZ  1 
ATOM   7855  N NH1 . ARG D  2 170 ? 65.946  -8.975  19.007  1.00 37.27  ? 170 ARG D NH1 1 
ATOM   7856  N NH2 . ARG D  2 170 ? 64.736  -10.863 19.762  1.00 36.19  ? 170 ARG D NH2 1 
ATOM   7857  N N   . PHE D  2 171 ? 70.034  -14.917 17.587  1.00 52.97  ? 171 PHE D N   1 
ATOM   7858  C CA  . PHE D  2 171 ? 71.280  -14.568 18.246  1.00 57.12  ? 171 PHE D CA  1 
ATOM   7859  C C   . PHE D  2 171 ? 72.376  -15.615 18.051  1.00 61.90  ? 171 PHE D C   1 
ATOM   7860  O O   . PHE D  2 171 ? 73.256  -15.750 18.905  1.00 62.80  ? 171 PHE D O   1 
ATOM   7861  C CB  . PHE D  2 171 ? 71.024  -14.354 19.746  1.00 54.49  ? 171 PHE D CB  1 
ATOM   7862  C CG  . PHE D  2 171 ? 70.136  -13.170 20.088  1.00 52.92  ? 171 PHE D CG  1 
ATOM   7863  C CD1 . PHE D  2 171 ? 70.317  -11.943 19.478  1.00 52.65  ? 171 PHE D CD1 1 
ATOM   7864  C CD2 . PHE D  2 171 ? 69.137  -13.338 21.019  1.00 51.82  ? 171 PHE D CD2 1 
ATOM   7865  C CE1 . PHE D  2 171 ? 69.497  -10.889 19.817  1.00 52.00  ? 171 PHE D CE1 1 
ATOM   7866  C CE2 . PHE D  2 171 ? 68.324  -12.281 21.348  1.00 51.15  ? 171 PHE D CE2 1 
ATOM   7867  C CZ  . PHE D  2 171 ? 68.499  -11.060 20.749  1.00 51.49  ? 171 PHE D CZ  1 
ATOM   7868  N N   . GLN D  2 172 ? 72.411  -16.379 16.943  1.00 67.64  ? 172 GLN D N   1 
ATOM   7869  C CA  . GLN D  2 172 ? 73.509  -17.319 16.753  1.00 72.59  ? 172 GLN D CA  1 
ATOM   7870  C C   . GLN D  2 172 ? 74.743  -16.539 16.282  1.00 75.80  ? 172 GLN D C   1 
ATOM   7871  O O   . GLN D  2 172 ? 75.034  -16.334 15.105  1.00 75.76  ? 172 GLN D O   1 
ATOM   7872  C CB  . GLN D  2 172 ? 73.075  -18.472 15.776  1.00 72.97  ? 172 GLN D CB  1 
ATOM   7873  C CG  . GLN D  2 172 ? 73.050  -18.449 14.242  1.00 74.20  ? 172 GLN D CG  1 
ATOM   7874  C CD  . GLN D  2 172 ? 74.346  -18.890 13.541  1.00 75.41  ? 172 GLN D CD  1 
ATOM   7875  O OE1 . GLN D  2 172 ? 74.784  -20.058 13.567  1.00 76.02  ? 172 GLN D OE1 1 
ATOM   7876  N NE2 . GLN D  2 172 ? 75.081  -17.965 12.940  1.00 75.92  ? 172 GLN D NE2 1 
ATOM   7877  N N   . ILE D  2 173 ? 75.434  -15.980 17.275  1.00 80.23  ? 173 ILE D N   1 
ATOM   7878  C CA  . ILE D  2 173 ? 76.667  -15.223 17.073  1.00 84.49  ? 173 ILE D CA  1 
ATOM   7879  C C   . ILE D  2 173 ? 77.722  -16.233 16.661  1.00 87.02  ? 173 ILE D C   1 
ATOM   7880  O O   . ILE D  2 173 ? 78.367  -16.891 17.483  1.00 87.38  ? 173 ILE D O   1 
ATOM   7881  C CB  . ILE D  2 173 ? 77.159  -14.459 18.371  1.00 84.95  ? 173 ILE D CB  1 
ATOM   7882  C CG1 . ILE D  2 173 ? 76.417  -14.827 19.678  1.00 85.53  ? 173 ILE D CG1 1 
ATOM   7883  C CG2 . ILE D  2 173 ? 77.018  -12.989 18.023  1.00 85.06  ? 173 ILE D CG2 1 
ATOM   7884  C CD1 . ILE D  2 173 ? 76.800  -14.086 20.985  1.00 85.80  ? 173 ILE D CD1 1 
ATOM   7885  N N   . LYS D  2 174 ? 77.814  -16.418 15.353  1.00 89.97  ? 174 LYS D N   1 
ATOM   7886  C CA  . LYS D  2 174 ? 78.678  -17.412 14.764  1.00 92.69  ? 174 LYS D CA  1 
ATOM   7887  C C   . LYS D  2 174 ? 78.753  -17.103 13.276  1.00 94.35  ? 174 LYS D C   1 
ATOM   7888  O O   . LYS D  2 174 ? 78.005  -17.711 12.484  1.00 94.60  ? 174 LYS D O   1 
ATOM   7889  C CB  . LYS D  2 174 ? 78.070  -18.811 15.019  1.00 93.11  ? 174 LYS D CB  1 
ATOM   7890  C CG  . LYS D  2 174 ? 79.076  -19.953 15.094  1.00 93.93  ? 174 LYS D CG  1 
ATOM   7891  C CD  . LYS D  2 174 ? 78.413  -21.283 15.467  1.00 94.36  ? 174 LYS D CD  1 
ATOM   7892  C CE  . LYS D  2 174 ? 77.984  -22.141 14.266  1.00 94.59  ? 174 LYS D CE  1 
ATOM   7893  N NZ  . LYS D  2 174 ? 76.912  -21.563 13.468  1.00 94.73  ? 174 LYS D NZ  1 
ATOM   7894  N N   . GLY D  2 175 ? 79.639  -16.174 12.924  1.00 96.00  ? 175 GLY D N   1 
ATOM   7895  C CA  . GLY D  2 175 ? 79.875  -15.773 11.548  1.00 98.04  ? 175 GLY D CA  1 
ATOM   7896  C C   . GLY D  2 175 ? 81.240  -15.077 11.408  1.00 99.37  ? 175 GLY D C   1 
ATOM   7897  O O   . GLY D  2 175 ? 82.033  -15.096 12.357  1.00 99.82  ? 175 GLY D O   1 
ATOM   7898  O OXT . GLY D  2 175 ? 81.517  -14.500 10.345  1.00 100.11 ? 175 GLY D OXT 1 
ATOM   7899  N N   . GLN E  1 1   ? 81.523  -11.967 9.730   1.00 129.86 ? 1   GLN E N   1 
ATOM   7900  C CA  . GLN E  1 1   ? 81.806  -11.363 8.430   1.00 129.86 ? 1   GLN E CA  1 
ATOM   7901  C C   . GLN E  1 1   ? 83.301  -11.099 8.447   1.00 129.96 ? 1   GLN E C   1 
ATOM   7902  O O   . GLN E  1 1   ? 84.038  -11.781 7.744   1.00 129.57 ? 1   GLN E O   1 
ATOM   7903  C CB  . GLN E  1 1   ? 81.033  -10.022 8.205   1.00 129.76 ? 1   GLN E CB  1 
ATOM   7904  C CG  . GLN E  1 1   ? 81.172  -9.289  6.833   1.00 129.73 ? 1   GLN E CG  1 
ATOM   7905  C CD  . GLN E  1 1   ? 82.422  -8.431  6.619   1.00 129.76 ? 1   GLN E CD  1 
ATOM   7906  O OE1 . GLN E  1 1   ? 82.646  -7.484  7.361   1.00 129.42 ? 1   GLN E OE1 1 
ATOM   7907  N NE2 . GLN E  1 1   ? 83.277  -8.717  5.641   1.00 130.07 ? 1   GLN E NE2 1 
ATOM   7908  N N   . ASP E  1 2   ? 83.727  -10.071 9.184   1.00 130.38 ? 2   ASP E N   1 
ATOM   7909  C CA  . ASP E  1 2   ? 85.135  -9.809  9.388   1.00 130.66 ? 2   ASP E CA  1 
ATOM   7910  C C   . ASP E  1 2   ? 85.638  -10.742 10.489  1.00 130.26 ? 2   ASP E C   1 
ATOM   7911  O O   . ASP E  1 2   ? 84.848  -11.533 11.032  1.00 130.37 ? 2   ASP E O   1 
ATOM   7912  C CB  . ASP E  1 2   ? 85.298  -8.361  9.796   1.00 131.65 ? 2   ASP E CB  1 
ATOM   7913  C CG  . ASP E  1 2   ? 86.560  -7.717  9.248   1.00 132.48 ? 2   ASP E CG  1 
ATOM   7914  O OD1 . ASP E  1 2   ? 86.427  -6.644  8.659   1.00 133.00 ? 2   ASP E OD1 1 
ATOM   7915  O OD2 . ASP E  1 2   ? 87.656  -8.272  9.401   1.00 132.78 ? 2   ASP E OD2 1 
ATOM   7916  N N   . LEU E  1 3   ? 86.899  -10.619 10.885  1.00 129.49 ? 3   LEU E N   1 
ATOM   7917  C CA  . LEU E  1 3   ? 87.535  -11.519 11.830  1.00 128.46 ? 3   LEU E CA  1 
ATOM   7918  C C   . LEU E  1 3   ? 87.522  -11.010 13.278  1.00 127.51 ? 3   LEU E C   1 
ATOM   7919  O O   . LEU E  1 3   ? 87.350  -9.805  13.514  1.00 127.27 ? 3   LEU E O   1 
ATOM   7920  C CB  . LEU E  1 3   ? 88.965  -11.732 11.342  1.00 128.45 ? 3   LEU E CB  1 
ATOM   7921  C CG  . LEU E  1 3   ? 89.554  -13.129 11.399  1.00 128.42 ? 3   LEU E CG  1 
ATOM   7922  C CD1 . LEU E  1 3   ? 88.815  -14.053 10.434  1.00 128.25 ? 3   LEU E CD1 1 
ATOM   7923  C CD2 . LEU E  1 3   ? 91.031  -13.044 11.060  1.00 128.62 ? 3   LEU E CD2 1 
ATOM   7924  N N   . PRO E  1 4   ? 87.636  -11.904 14.289  1.00 126.61 ? 4   PRO E N   1 
ATOM   7925  C CA  . PRO E  1 4   ? 87.680  -11.543 15.702  1.00 125.69 ? 4   PRO E CA  1 
ATOM   7926  C C   . PRO E  1 4   ? 88.797  -10.547 15.989  1.00 124.53 ? 4   PRO E C   1 
ATOM   7927  O O   . PRO E  1 4   ? 89.928  -10.668 15.496  1.00 124.77 ? 4   PRO E O   1 
ATOM   7928  C CB  . PRO E  1 4   ? 87.852  -12.861 16.447  1.00 125.93 ? 4   PRO E CB  1 
ATOM   7929  C CG  . PRO E  1 4   ? 88.211  -13.862 15.376  1.00 126.36 ? 4   PRO E CG  1 
ATOM   7930  C CD  . PRO E  1 4   ? 87.386  -13.341 14.206  1.00 126.54 ? 4   PRO E CD  1 
ATOM   7931  N N   . GLY E  1 5   ? 88.434  -9.541  16.776  1.00 122.85 ? 5   GLY E N   1 
ATOM   7932  C CA  . GLY E  1 5   ? 89.338  -8.459  17.109  1.00 120.13 ? 5   GLY E CA  1 
ATOM   7933  C C   . GLY E  1 5   ? 90.018  -8.609  18.459  1.00 117.75 ? 5   GLY E C   1 
ATOM   7934  O O   . GLY E  1 5   ? 89.636  -9.393  19.329  1.00 117.67 ? 5   GLY E O   1 
ATOM   7935  N N   . ASN E  1 6   ? 91.050  -7.803  18.606  1.00 115.26 ? 6   ASN E N   1 
ATOM   7936  C CA  . ASN E  1 6   ? 91.857  -7.750  19.810  1.00 112.94 ? 6   ASN E CA  1 
ATOM   7937  C C   . ASN E  1 6   ? 91.366  -6.676  20.780  1.00 110.72 ? 6   ASN E C   1 
ATOM   7938  O O   . ASN E  1 6   ? 91.597  -6.763  21.989  1.00 111.00 ? 6   ASN E O   1 
ATOM   7939  C CB  . ASN E  1 6   ? 93.304  -7.447  19.435  1.00 113.60 ? 6   ASN E CB  1 
ATOM   7940  C CG  . ASN E  1 6   ? 93.431  -6.085  18.752  1.00 113.97 ? 6   ASN E CG  1 
ATOM   7941  O OD1 . ASN E  1 6   ? 92.849  -5.857  17.690  1.00 114.23 ? 6   ASN E OD1 1 
ATOM   7942  N ND2 . ASN E  1 6   ? 94.088  -5.094  19.324  1.00 113.92 ? 6   ASN E ND2 1 
ATOM   7943  N N   . ASP E  1 7   ? 90.756  -5.610  20.256  1.00 107.34 ? 7   ASP E N   1 
ATOM   7944  C CA  . ASP E  1 7   ? 90.287  -4.510  21.079  1.00 103.37 ? 7   ASP E CA  1 
ATOM   7945  C C   . ASP E  1 7   ? 88.782  -4.661  21.250  1.00 99.48  ? 7   ASP E C   1 
ATOM   7946  O O   . ASP E  1 7   ? 88.106  -5.312  20.435  1.00 99.30  ? 7   ASP E O   1 
ATOM   7947  C CB  . ASP E  1 7   ? 90.630  -3.166  20.404  1.00 104.39 ? 7   ASP E CB  1 
ATOM   7948  C CG  . ASP E  1 7   ? 89.964  -1.948  21.048  1.00 105.07 ? 7   ASP E CG  1 
ATOM   7949  O OD1 . ASP E  1 7   ? 89.961  -1.840  22.278  1.00 105.30 ? 7   ASP E OD1 1 
ATOM   7950  O OD2 . ASP E  1 7   ? 89.403  -1.130  20.319  1.00 105.55 ? 7   ASP E OD2 1 
ATOM   7951  N N   . ASN E  1 8   ? 88.261  -4.124  22.344  1.00 94.26  ? 8   ASN E N   1 
ATOM   7952  C CA  . ASN E  1 8   ? 86.843  -4.208  22.597  1.00 88.99  ? 8   ASN E CA  1 
ATOM   7953  C C   . ASN E  1 8   ? 86.447  -2.982  23.400  1.00 83.73  ? 8   ASN E C   1 
ATOM   7954  O O   . ASN E  1 8   ? 87.047  -2.649  24.427  1.00 83.19  ? 8   ASN E O   1 
ATOM   7955  C CB  . ASN E  1 8   ? 86.522  -5.503  23.357  1.00 90.50  ? 8   ASN E CB  1 
ATOM   7956  C CG  . ASN E  1 8   ? 86.884  -5.540  24.837  1.00 91.37  ? 8   ASN E CG  1 
ATOM   7957  O OD1 . ASN E  1 8   ? 86.035  -5.217  25.673  1.00 92.20  ? 8   ASN E OD1 1 
ATOM   7958  N ND2 . ASN E  1 8   ? 88.090  -5.947  25.226  1.00 91.60  ? 8   ASN E ND2 1 
ATOM   7959  N N   . SER E  1 9   ? 85.461  -2.267  22.887  1.00 77.00  ? 9   SER E N   1 
ATOM   7960  C CA  . SER E  1 9   ? 85.020  -1.035  23.509  1.00 70.01  ? 9   SER E CA  1 
ATOM   7961  C C   . SER E  1 9   ? 83.697  -0.613  22.893  1.00 65.09  ? 9   SER E C   1 
ATOM   7962  O O   . SER E  1 9   ? 83.308  -1.150  21.850  1.00 65.44  ? 9   SER E O   1 
ATOM   7963  C CB  . SER E  1 9   ? 86.094  0.053   23.308  1.00 69.77  ? 9   SER E CB  1 
ATOM   7964  O OG  . SER E  1 9   ? 86.450  0.336   21.960  1.00 69.14  ? 9   SER E OG  1 
ATOM   7965  N N   . THR E  1 10  ? 82.981  0.288   23.556  1.00 58.19  ? 10  THR E N   1 
ATOM   7966  C CA  . THR E  1 10  ? 81.698  0.769   23.087  1.00 51.50  ? 10  THR E CA  1 
ATOM   7967  C C   . THR E  1 10  ? 81.807  2.223   22.604  1.00 47.17  ? 10  THR E C   1 
ATOM   7968  O O   . THR E  1 10  ? 82.925  2.760   22.539  1.00 47.87  ? 10  THR E O   1 
ATOM   7969  C CB  . THR E  1 10  ? 80.726  0.615   24.260  1.00 51.04  ? 10  THR E CB  1 
ATOM   7970  O OG1 . THR E  1 10  ? 81.414  1.049   25.420  1.00 50.30  ? 10  THR E OG1 1 
ATOM   7971  C CG2 . THR E  1 10  ? 80.256  -0.814  24.462  1.00 51.11  ? 10  THR E CG2 1 
ATOM   7972  N N   . ALA E  1 11  ? 80.695  2.886   22.269  1.00 40.21  ? 11  ALA E N   1 
ATOM   7973  C CA  . ALA E  1 11  ? 80.687  4.285   21.872  1.00 33.72  ? 11  ALA E CA  1 
ATOM   7974  C C   . ALA E  1 11  ? 79.395  4.855   22.386  1.00 29.06  ? 11  ALA E C   1 
ATOM   7975  O O   . ALA E  1 11  ? 78.548  4.072   22.805  1.00 28.45  ? 11  ALA E O   1 
ATOM   7976  C CB  . ALA E  1 11  ? 80.695  4.455   20.365  1.00 34.06  ? 11  ALA E CB  1 
ATOM   7977  N N   . THR E  1 12  ? 79.213  6.165   22.383  1.00 24.19  ? 12  THR E N   1 
ATOM   7978  C CA  . THR E  1 12  ? 77.967  6.782   22.807  1.00 20.14  ? 12  THR E CA  1 
ATOM   7979  C C   . THR E  1 12  ? 77.516  7.839   21.813  1.00 17.91  ? 12  THR E C   1 
ATOM   7980  O O   . THR E  1 12  ? 78.313  8.719   21.439  1.00 17.03  ? 12  THR E O   1 
ATOM   7981  C CB  . THR E  1 12  ? 78.115  7.486   24.128  1.00 20.13  ? 12  THR E CB  1 
ATOM   7982  O OG1 . THR E  1 12  ? 78.758  6.615   25.041  1.00 20.77  ? 12  THR E OG1 1 
ATOM   7983  C CG2 . THR E  1 12  ? 76.763  7.881   24.678  1.00 20.38  ? 12  THR E CG2 1 
ATOM   7984  N N   . LEU E  1 13  ? 76.252  7.785   21.388  1.00 14.90  ? 13  LEU E N   1 
ATOM   7985  C CA  . LEU E  1 13  ? 75.711  8.785   20.482  1.00 11.66  ? 13  LEU E CA  1 
ATOM   7986  C C   . LEU E  1 13  ? 74.582  9.448   21.233  1.00 10.72  ? 13  LEU E C   1 
ATOM   7987  O O   . LEU E  1 13  ? 73.811  8.725   21.866  1.00 9.79   ? 13  LEU E O   1 
ATOM   7988  C CB  . LEU E  1 13  ? 75.104  8.179   19.261  1.00 9.79   ? 13  LEU E CB  1 
ATOM   7989  C CG  . LEU E  1 13  ? 75.568  8.538   17.900  1.00 8.64   ? 13  LEU E CG  1 
ATOM   7990  C CD1 . LEU E  1 13  ? 74.450  8.131   16.991  1.00 9.45   ? 13  LEU E CD1 1 
ATOM   7991  C CD2 . LEU E  1 13  ? 75.792  10.009  17.709  1.00 8.26   ? 13  LEU E CD2 1 
ATOM   7992  N N   . CYS E  1 14  ? 74.434  10.764  21.205  1.00 9.35   ? 14  CYS E N   1 
ATOM   7993  C CA  . CYS E  1 14  ? 73.311  11.380  21.863  1.00 8.04   ? 14  CYS E CA  1 
ATOM   7994  C C   . CYS E  1 14  ? 72.647  12.296  20.898  1.00 8.31   ? 14  CYS E C   1 
ATOM   7995  O O   . CYS E  1 14  ? 73.349  13.003  20.168  1.00 8.91   ? 14  CYS E O   1 
ATOM   7996  C CB  . CYS E  1 14  ? 73.732  12.195  23.025  1.00 7.65   ? 14  CYS E CB  1 
ATOM   7997  S SG  . CYS E  1 14  ? 74.462  11.136  24.302  1.00 5.63   ? 14  CYS E SG  1 
ATOM   7998  N N   . LEU E  1 15  ? 71.329  12.226  20.834  1.00 8.79   ? 15  LEU E N   1 
ATOM   7999  C CA  . LEU E  1 15  ? 70.595  13.157  20.014  1.00 11.07  ? 15  LEU E CA  1 
ATOM   8000  C C   . LEU E  1 15  ? 70.117  14.323  20.872  1.00 11.45  ? 15  LEU E C   1 
ATOM   8001  O O   . LEU E  1 15  ? 69.978  14.184  22.101  1.00 10.57  ? 15  LEU E O   1 
ATOM   8002  C CB  . LEU E  1 15  ? 69.423  12.471  19.398  1.00 11.66  ? 15  LEU E CB  1 
ATOM   8003  C CG  . LEU E  1 15  ? 69.844  11.574  18.271  1.00 12.72  ? 15  LEU E CG  1 
ATOM   8004  C CD1 . LEU E  1 15  ? 69.816  10.153  18.787  1.00 13.11  ? 15  LEU E CD1 1 
ATOM   8005  C CD2 . LEU E  1 15  ? 68.909  11.731  17.075  1.00 12.88  ? 15  LEU E CD2 1 
ATOM   8006  N N   . GLY E  1 16  ? 69.911  15.481  20.246  1.00 10.89  ? 16  GLY E N   1 
ATOM   8007  C CA  . GLY E  1 16  ? 69.483  16.654  20.979  1.00 10.96  ? 16  GLY E CA  1 
ATOM   8008  C C   . GLY E  1 16  ? 69.073  17.721  19.989  1.00 11.10  ? 16  GLY E C   1 
ATOM   8009  O O   . GLY E  1 16  ? 69.106  17.491  18.761  1.00 11.29  ? 16  GLY E O   1 
ATOM   8010  N N   . HIS E  1 17  ? 68.730  18.898  20.525  1.00 9.80   ? 17  HIS E N   1 
ATOM   8011  C CA  . HIS E  1 17  ? 68.234  20.002  19.697  1.00 9.02   ? 17  HIS E CA  1 
ATOM   8012  C C   . HIS E  1 17  ? 68.822  21.285  20.209  1.00 8.94   ? 17  HIS E C   1 
ATOM   8013  O O   . HIS E  1 17  ? 69.064  21.345  21.402  1.00 10.56  ? 17  HIS E O   1 
ATOM   8014  C CB  . HIS E  1 17  ? 66.702  20.117  19.764  1.00 7.53   ? 17  HIS E CB  1 
ATOM   8015  C CG  . HIS E  1 17  ? 66.200  20.197  21.191  1.00 6.12   ? 17  HIS E CG  1 
ATOM   8016  N ND1 . HIS E  1 17  ? 66.086  21.300  21.925  1.00 5.20   ? 17  HIS E ND1 1 
ATOM   8017  C CD2 . HIS E  1 17  ? 65.834  19.129  21.944  1.00 6.17   ? 17  HIS E CD2 1 
ATOM   8018  C CE1 . HIS E  1 17  ? 65.672  20.944  23.103  1.00 4.97   ? 17  HIS E CE1 1 
ATOM   8019  N NE2 . HIS E  1 17  ? 65.524  19.647  23.097  1.00 5.60   ? 17  HIS E NE2 1 
ATOM   8020  N N   . HIS E  1 18  ? 69.048  22.304  19.406  1.00 8.55   ? 18  HIS E N   1 
ATOM   8021  C CA  . HIS E  1 18  ? 69.617  23.556  19.883  1.00 9.22   ? 18  HIS E CA  1 
ATOM   8022  C C   . HIS E  1 18  ? 68.756  24.290  20.904  1.00 9.21   ? 18  HIS E C   1 
ATOM   8023  O O   . HIS E  1 18  ? 67.565  23.980  21.020  1.00 9.74   ? 18  HIS E O   1 
ATOM   8024  C CB  . HIS E  1 18  ? 69.839  24.448  18.687  1.00 11.19  ? 18  HIS E CB  1 
ATOM   8025  C CG  . HIS E  1 18  ? 68.594  25.088  18.123  1.00 12.83  ? 18  HIS E CG  1 
ATOM   8026  N ND1 . HIS E  1 18  ? 67.357  24.640  18.282  1.00 14.49  ? 18  HIS E ND1 1 
ATOM   8027  C CD2 . HIS E  1 18  ? 68.537  26.225  17.391  1.00 14.61  ? 18  HIS E CD2 1 
ATOM   8028  C CE1 . HIS E  1 18  ? 66.524  25.454  17.685  1.00 15.40  ? 18  HIS E CE1 1 
ATOM   8029  N NE2 . HIS E  1 18  ? 67.251  26.401  17.155  1.00 16.44  ? 18  HIS E NE2 1 
ATOM   8030  N N   . ALA E  1 19  ? 69.279  25.290  21.582  1.00 8.90   ? 19  ALA E N   1 
ATOM   8031  C CA  . ALA E  1 19  ? 68.513  26.136  22.485  1.00 9.81   ? 19  ALA E CA  1 
ATOM   8032  C C   . ALA E  1 19  ? 69.172  27.489  22.424  1.00 10.93  ? 19  ALA E C   1 
ATOM   8033  O O   . ALA E  1 19  ? 70.344  27.559  22.055  1.00 11.31  ? 19  ALA E O   1 
ATOM   8034  C CB  . ALA E  1 19  ? 68.585  25.650  23.906  1.00 9.73   ? 19  ALA E CB  1 
ATOM   8035  N N   . VAL E  1 20  ? 68.468  28.580  22.650  1.00 12.82  ? 20  VAL E N   1 
ATOM   8036  C CA  . VAL E  1 20  ? 69.075  29.903  22.561  1.00 14.76  ? 20  VAL E CA  1 
ATOM   8037  C C   . VAL E  1 20  ? 69.121  30.497  23.944  1.00 16.86  ? 20  VAL E C   1 
ATOM   8038  O O   . VAL E  1 20  ? 68.247  30.191  24.747  1.00 17.81  ? 20  VAL E O   1 
ATOM   8039  C CB  . VAL E  1 20  ? 68.282  30.835  21.655  1.00 13.53  ? 20  VAL E CB  1 
ATOM   8040  C CG1 . VAL E  1 20  ? 68.399  30.300  20.276  1.00 13.24  ? 20  VAL E CG1 1 
ATOM   8041  C CG2 . VAL E  1 20  ? 66.833  30.947  22.086  1.00 14.07  ? 20  VAL E CG2 1 
ATOM   8042  N N   . PRO E  1 21  ? 70.054  31.395  24.241  1.00 18.40  ? 21  PRO E N   1 
ATOM   8043  C CA  . PRO E  1 21  ? 70.172  31.980  25.557  1.00 20.32  ? 21  PRO E CA  1 
ATOM   8044  C C   . PRO E  1 21  ? 69.021  32.923  25.909  1.00 22.93  ? 21  PRO E C   1 
ATOM   8045  O O   . PRO E  1 21  ? 68.571  33.000  27.048  1.00 23.51  ? 21  PRO E O   1 
ATOM   8046  C CB  . PRO E  1 21  ? 71.515  32.605  25.457  1.00 20.15  ? 21  PRO E CB  1 
ATOM   8047  C CG  . PRO E  1 21  ? 71.540  33.133  24.035  1.00 19.89  ? 21  PRO E CG  1 
ATOM   8048  C CD  . PRO E  1 21  ? 71.025  31.933  23.304  1.00 18.77  ? 21  PRO E CD  1 
ATOM   8049  N N   . ASN E  1 22  ? 68.576  33.649  24.891  1.00 25.58  ? 22  ASN E N   1 
ATOM   8050  C CA  . ASN E  1 22  ? 67.522  34.647  24.981  1.00 28.39  ? 22  ASN E CA  1 
ATOM   8051  C C   . ASN E  1 22  ? 66.138  34.032  24.741  1.00 27.48  ? 22  ASN E C   1 
ATOM   8052  O O   . ASN E  1 22  ? 65.558  33.726  25.774  1.00 28.54  ? 22  ASN E O   1 
ATOM   8053  C CB  . ASN E  1 22  ? 67.812  35.787  23.981  1.00 32.08  ? 22  ASN E CB  1 
ATOM   8054  C CG  . ASN E  1 22  ? 68.316  35.362  22.599  1.00 34.77  ? 22  ASN E CG  1 
ATOM   8055  O OD1 . ASN E  1 22  ? 68.458  34.168  22.314  1.00 36.10  ? 22  ASN E OD1 1 
ATOM   8056  N ND2 . ASN E  1 22  ? 68.628  36.301  21.701  1.00 35.38  ? 22  ASN E ND2 1 
ATOM   8057  N N   . GLY E  1 23  ? 65.546  33.848  23.551  1.00 24.87  ? 23  GLY E N   1 
ATOM   8058  C CA  . GLY E  1 23  ? 64.259  33.137  23.513  1.00 23.03  ? 23  GLY E CA  1 
ATOM   8059  C C   . GLY E  1 23  ? 63.022  33.953  23.866  1.00 21.41  ? 23  GLY E C   1 
ATOM   8060  O O   . GLY E  1 23  ? 63.014  34.712  24.826  1.00 22.61  ? 23  GLY E O   1 
ATOM   8061  N N   . THR E  1 24  ? 61.953  33.835  23.081  1.00 19.51  ? 24  THR E N   1 
ATOM   8062  C CA  . THR E  1 24  ? 60.772  34.698  23.211  1.00 17.64  ? 24  THR E CA  1 
ATOM   8063  C C   . THR E  1 24  ? 59.597  34.022  23.846  1.00 15.33  ? 24  THR E C   1 
ATOM   8064  O O   . THR E  1 24  ? 59.448  32.832  23.640  1.00 16.43  ? 24  THR E O   1 
ATOM   8065  C CB  . THR E  1 24  ? 60.342  35.174  21.845  1.00 18.71  ? 24  THR E CB  1 
ATOM   8066  O OG1 . THR E  1 24  ? 61.513  35.602  21.144  1.00 20.17  ? 24  THR E OG1 1 
ATOM   8067  C CG2 . THR E  1 24  ? 59.390  36.350  21.938  1.00 20.26  ? 24  THR E CG2 1 
ATOM   8068  N N   . LEU E  1 25  ? 58.728  34.703  24.577  1.00 13.50  ? 25  LEU E N   1 
ATOM   8069  C CA  . LEU E  1 25  ? 57.583  33.981  25.120  1.00 12.47  ? 25  LEU E CA  1 
ATOM   8070  C C   . LEU E  1 25  ? 56.426  33.998  24.121  1.00 12.01  ? 25  LEU E C   1 
ATOM   8071  O O   . LEU E  1 25  ? 56.305  34.967  23.371  1.00 12.45  ? 25  LEU E O   1 
ATOM   8072  C CB  . LEU E  1 25  ? 57.146  34.594  26.429  1.00 11.53  ? 25  LEU E CB  1 
ATOM   8073  C CG  . LEU E  1 25  ? 58.047  34.387  27.598  1.00 11.13  ? 25  LEU E CG  1 
ATOM   8074  C CD1 . LEU E  1 25  ? 57.406  34.978  28.818  1.00 12.44  ? 25  LEU E CD1 1 
ATOM   8075  C CD2 . LEU E  1 25  ? 58.209  32.935  27.891  1.00 11.61  ? 25  LEU E CD2 1 
ATOM   8076  N N   . VAL E  1 26  ? 55.576  32.972  24.092  1.00 10.78  ? 26  VAL E N   1 
ATOM   8077  C CA  . VAL E  1 26  ? 54.495  32.877  23.136  1.00 10.11  ? 26  VAL E CA  1 
ATOM   8078  C C   . VAL E  1 26  ? 53.233  32.261  23.763  1.00 10.44  ? 26  VAL E C   1 
ATOM   8079  O O   . VAL E  1 26  ? 53.357  31.624  24.809  1.00 11.40  ? 26  VAL E O   1 
ATOM   8080  C CB  . VAL E  1 26  ? 55.163  32.096  22.009  1.00 9.89   ? 26  VAL E CB  1 
ATOM   8081  C CG1 . VAL E  1 26  ? 54.592  30.707  21.769  1.00 10.28  ? 26  VAL E CG1 1 
ATOM   8082  C CG2 . VAL E  1 26  ? 55.064  33.014  20.821  1.00 9.83   ? 26  VAL E CG2 1 
ATOM   8083  N N   . LYS E  1 27  ? 52.007  32.469  23.252  1.00 10.07  ? 27  LYS E N   1 
ATOM   8084  C CA  . LYS E  1 27  ? 50.800  31.857  23.834  1.00 10.09  ? 27  LYS E CA  1 
ATOM   8085  C C   . LYS E  1 27  ? 50.516  30.537  23.152  1.00 9.70   ? 27  LYS E C   1 
ATOM   8086  O O   . LYS E  1 27  ? 50.805  30.375  21.977  1.00 9.97   ? 27  LYS E O   1 
ATOM   8087  C CB  . LYS E  1 27  ? 49.560  32.679  23.616  1.00 11.68  ? 27  LYS E CB  1 
ATOM   8088  C CG  . LYS E  1 27  ? 49.395  33.861  24.500  1.00 14.23  ? 27  LYS E CG  1 
ATOM   8089  C CD  . LYS E  1 27  ? 48.498  34.859  23.778  1.00 16.82  ? 27  LYS E CD  1 
ATOM   8090  C CE  . LYS E  1 27  ? 48.023  35.954  24.771  1.00 19.67  ? 27  LYS E CE  1 
ATOM   8091  N NZ  . LYS E  1 27  ? 47.286  37.024  24.093  1.00 21.60  ? 27  LYS E NZ  1 
ATOM   8092  N N   . THR E  1 28  ? 49.862  29.610  23.790  1.00 9.51   ? 28  THR E N   1 
ATOM   8093  C CA  . THR E  1 28  ? 49.579  28.319  23.219  1.00 10.30  ? 28  THR E CA  1 
ATOM   8094  C C   . THR E  1 28  ? 48.115  28.003  23.517  1.00 12.05  ? 28  THR E C   1 
ATOM   8095  O O   . THR E  1 28  ? 47.386  28.888  23.983  1.00 13.49  ? 28  THR E O   1 
ATOM   8096  C CB  . THR E  1 28  ? 50.662  27.469  23.895  1.00 10.03  ? 28  THR E CB  1 
ATOM   8097  O OG1 . THR E  1 28  ? 51.629  27.483  22.866  1.00 10.85  ? 28  THR E OG1 1 
ATOM   8098  C CG2 . THR E  1 28  ? 50.387  26.053  24.282  1.00 10.05  ? 28  THR E CG2 1 
ATOM   8099  N N   . ILE E  1 29  ? 47.586  26.827  23.190  1.00 12.77  ? 29  ILE E N   1 
ATOM   8100  C CA  . ILE E  1 29  ? 46.243  26.478  23.609  1.00 13.57  ? 29  ILE E CA  1 
ATOM   8101  C C   . ILE E  1 29  ? 46.271  26.230  25.098  1.00 14.34  ? 29  ILE E C   1 
ATOM   8102  O O   . ILE E  1 29  ? 45.411  26.720  25.793  1.00 13.56  ? 29  ILE E O   1 
ATOM   8103  C CB  . ILE E  1 29  ? 45.788  25.210  22.848  1.00 14.83  ? 29  ILE E CB  1 
ATOM   8104  C CG1 . ILE E  1 29  ? 45.338  25.634  21.456  1.00 14.94  ? 29  ILE E CG1 1 
ATOM   8105  C CG2 . ILE E  1 29  ? 44.634  24.483  23.536  1.00 15.68  ? 29  ILE E CG2 1 
ATOM   8106  C CD1 . ILE E  1 29  ? 44.950  24.389  20.653  1.00 15.56  ? 29  ILE E CD1 1 
ATOM   8107  N N   . THR E  1 30  ? 47.274  25.510  25.601  1.00 17.11  ? 30  THR E N   1 
ATOM   8108  C CA  . THR E  1 30  ? 47.343  25.142  26.999  1.00 19.11  ? 30  THR E CA  1 
ATOM   8109  C C   . THR E  1 30  ? 48.151  26.014  27.924  1.00 21.30  ? 30  THR E C   1 
ATOM   8110  O O   . THR E  1 30  ? 47.958  25.879  29.128  1.00 22.41  ? 30  THR E O   1 
ATOM   8111  C CB  . THR E  1 30  ? 47.856  23.713  27.113  1.00 19.06  ? 30  THR E CB  1 
ATOM   8112  O OG1 . THR E  1 30  ? 48.984  23.579  26.265  1.00 18.09  ? 30  THR E OG1 1 
ATOM   8113  C CG2 . THR E  1 30  ? 46.774  22.711  26.709  1.00 19.19  ? 30  THR E CG2 1 
ATOM   8114  N N   . ASP E  1 31  ? 49.016  26.903  27.451  1.00 24.33  ? 31  ASP E N   1 
ATOM   8115  C CA  . ASP E  1 31  ? 49.781  27.813  28.334  1.00 27.72  ? 31  ASP E CA  1 
ATOM   8116  C C   . ASP E  1 31  ? 49.754  29.158  27.682  1.00 27.91  ? 31  ASP E C   1 
ATOM   8117  O O   . ASP E  1 31  ? 49.554  29.223  26.471  1.00 28.90  ? 31  ASP E O   1 
ATOM   8118  C CB  . ASP E  1 31  ? 51.277  27.529  28.460  1.00 29.37  ? 31  ASP E CB  1 
ATOM   8119  C CG  . ASP E  1 31  ? 51.591  26.056  28.481  1.00 31.33  ? 31  ASP E CG  1 
ATOM   8120  O OD1 . ASP E  1 31  ? 51.828  25.521  29.571  1.00 31.22  ? 31  ASP E OD1 1 
ATOM   8121  O OD2 . ASP E  1 31  ? 51.570  25.453  27.395  1.00 33.32  ? 31  ASP E OD2 1 
ATOM   8122  N N   . ASP E  1 32  ? 49.959  30.246  28.383  1.00 28.36  ? 32  ASP E N   1 
ATOM   8123  C CA  . ASP E  1 32  ? 49.968  31.532  27.713  1.00 29.82  ? 32  ASP E CA  1 
ATOM   8124  C C   . ASP E  1 32  ? 51.324  32.208  27.812  1.00 28.98  ? 32  ASP E C   1 
ATOM   8125  O O   . ASP E  1 32  ? 51.561  33.310  27.321  1.00 29.09  ? 32  ASP E O   1 
ATOM   8126  C CB  . ASP E  1 32  ? 48.879  32.390  28.318  1.00 32.81  ? 32  ASP E CB  1 
ATOM   8127  C CG  . ASP E  1 32  ? 49.180  32.725  29.762  1.00 35.02  ? 32  ASP E CG  1 
ATOM   8128  O OD1 . ASP E  1 32  ? 49.446  31.798  30.540  1.00 36.19  ? 32  ASP E OD1 1 
ATOM   8129  O OD2 . ASP E  1 32  ? 49.174  33.909  30.099  1.00 36.55  ? 32  ASP E OD2 1 
ATOM   8130  N N   . GLN E  1 33  ? 52.255  31.575  28.480  1.00 28.83  ? 33  GLN E N   1 
ATOM   8131  C CA  . GLN E  1 33  ? 53.629  32.020  28.394  1.00 28.85  ? 33  GLN E CA  1 
ATOM   8132  C C   . GLN E  1 33  ? 54.491  30.782  28.299  1.00 26.57  ? 33  GLN E C   1 
ATOM   8133  O O   . GLN E  1 33  ? 54.733  30.110  29.297  1.00 26.37  ? 33  GLN E O   1 
ATOM   8134  C CB  . GLN E  1 33  ? 54.069  32.785  29.607  1.00 32.32  ? 33  GLN E CB  1 
ATOM   8135  C CG  . GLN E  1 33  ? 53.480  34.172  29.736  1.00 37.12  ? 33  GLN E CG  1 
ATOM   8136  C CD  . GLN E  1 33  ? 54.134  34.922  30.894  1.00 40.16  ? 33  GLN E CD  1 
ATOM   8137  O OE1 . GLN E  1 33  ? 54.319  34.414  32.016  1.00 41.91  ? 33  GLN E OE1 1 
ATOM   8138  N NE2 . GLN E  1 33  ? 54.554  36.161  30.642  1.00 41.35  ? 33  GLN E NE2 1 
ATOM   8139  N N   . ILE E  1 34  ? 54.868  30.389  27.097  1.00 23.30  ? 34  ILE E N   1 
ATOM   8140  C CA  . ILE E  1 34  ? 55.786  29.300  26.947  1.00 21.30  ? 34  ILE E CA  1 
ATOM   8141  C C   . ILE E  1 34  ? 56.937  29.862  26.123  1.00 20.99  ? 34  ILE E C   1 
ATOM   8142  O O   . ILE E  1 34  ? 56.717  30.652  25.209  1.00 21.88  ? 34  ILE E O   1 
ATOM   8143  C CB  . ILE E  1 34  ? 55.043  28.138  26.294  1.00 20.87  ? 34  ILE E CB  1 
ATOM   8144  C CG1 . ILE E  1 34  ? 55.917  26.920  26.469  1.00 22.05  ? 34  ILE E CG1 1 
ATOM   8145  C CG2 . ILE E  1 34  ? 54.775  28.351  24.824  1.00 20.73  ? 34  ILE E CG2 1 
ATOM   8146  C CD1 . ILE E  1 34  ? 55.216  25.601  26.098  1.00 23.74  ? 34  ILE E CD1 1 
ATOM   8147  N N   . GLU E  1 35  ? 58.181  29.546  26.436  1.00 19.92  ? 35  GLU E N   1 
ATOM   8148  C CA  . GLU E  1 35  ? 59.312  30.190  25.797  1.00 19.51  ? 35  GLU E CA  1 
ATOM   8149  C C   . GLU E  1 35  ? 59.805  29.440  24.587  1.00 18.33  ? 35  GLU E C   1 
ATOM   8150  O O   . GLU E  1 35  ? 60.158  28.263  24.678  1.00 19.77  ? 35  GLU E O   1 
ATOM   8151  C CB  . GLU E  1 35  ? 60.437  30.289  26.783  1.00 21.61  ? 35  GLU E CB  1 
ATOM   8152  C CG  . GLU E  1 35  ? 61.366  31.467  26.538  1.00 23.39  ? 35  GLU E CG  1 
ATOM   8153  C CD  . GLU E  1 35  ? 62.762  31.250  27.111  1.00 24.81  ? 35  GLU E CD  1 
ATOM   8154  O OE1 . GLU E  1 35  ? 63.707  31.519  26.370  1.00 25.26  ? 35  GLU E OE1 1 
ATOM   8155  O OE2 . GLU E  1 35  ? 62.911  30.770  28.246  1.00 25.09  ? 35  GLU E OE2 1 
ATOM   8156  N N   . VAL E  1 36  ? 59.829  30.047  23.426  1.00 16.00  ? 36  VAL E N   1 
ATOM   8157  C CA  . VAL E  1 36  ? 60.305  29.373  22.246  1.00 14.67  ? 36  VAL E CA  1 
ATOM   8158  C C   . VAL E  1 36  ? 61.609  30.008  21.802  1.00 15.94  ? 36  VAL E C   1 
ATOM   8159  O O   . VAL E  1 36  ? 61.991  31.091  22.231  1.00 17.23  ? 36  VAL E O   1 
ATOM   8160  C CB  . VAL E  1 36  ? 59.273  29.441  21.082  1.00 13.37  ? 36  VAL E CB  1 
ATOM   8161  C CG1 . VAL E  1 36  ? 58.047  28.610  21.462  1.00 12.93  ? 36  VAL E CG1 1 
ATOM   8162  C CG2 . VAL E  1 36  ? 58.892  30.868  20.766  1.00 12.08  ? 36  VAL E CG2 1 
ATOM   8163  N N   . THR E  1 37  ? 62.334  29.334  20.932  1.00 15.99  ? 37  THR E N   1 
ATOM   8164  C CA  . THR E  1 37  ? 63.570  29.772  20.343  1.00 15.17  ? 37  THR E CA  1 
ATOM   8165  C C   . THR E  1 37  ? 63.409  31.034  19.561  1.00 16.64  ? 37  THR E C   1 
ATOM   8166  O O   . THR E  1 37  ? 64.365  31.775  19.433  1.00 16.82  ? 37  THR E O   1 
ATOM   8167  C CB  . THR E  1 37  ? 64.022  28.629  19.487  1.00 14.95  ? 37  THR E CB  1 
ATOM   8168  O OG1 . THR E  1 37  ? 64.771  27.887  20.419  1.00 15.71  ? 37  THR E OG1 1 
ATOM   8169  C CG2 . THR E  1 37  ? 64.812  28.916  18.234  1.00 14.64  ? 37  THR E CG2 1 
ATOM   8170  N N   . ASN E  1 38  ? 62.238  31.311  19.010  1.00 19.67  ? 38  ASN E N   1 
ATOM   8171  C CA  . ASN E  1 38  ? 62.104  32.441  18.089  1.00 21.83  ? 38  ASN E CA  1 
ATOM   8172  C C   . ASN E  1 38  ? 60.655  32.708  17.733  1.00 19.69  ? 38  ASN E C   1 
ATOM   8173  O O   . ASN E  1 38  ? 59.881  31.759  17.601  1.00 20.26  ? 38  ASN E O   1 
ATOM   8174  C CB  . ASN E  1 38  ? 62.870  32.125  16.827  1.00 26.01  ? 38  ASN E CB  1 
ATOM   8175  C CG  . ASN E  1 38  ? 62.869  33.247  15.844  1.00 30.58  ? 38  ASN E CG  1 
ATOM   8176  O OD1 . ASN E  1 38  ? 63.203  34.392  16.174  1.00 31.58  ? 38  ASN E OD1 1 
ATOM   8177  N ND2 . ASN E  1 38  ? 62.538  32.931  14.597  1.00 34.86  ? 38  ASN E ND2 1 
ATOM   8178  N N   . ALA E  1 39  ? 60.259  33.941  17.543  1.00 17.22  ? 39  ALA E N   1 
ATOM   8179  C CA  . ALA E  1 39  ? 58.891  34.236  17.217  1.00 15.67  ? 39  ALA E CA  1 
ATOM   8180  C C   . ALA E  1 39  ? 58.884  35.334  16.181  1.00 15.07  ? 39  ALA E C   1 
ATOM   8181  O O   . ALA E  1 39  ? 59.924  35.903  15.890  1.00 15.43  ? 39  ALA E O   1 
ATOM   8182  C CB  . ALA E  1 39  ? 58.165  34.703  18.466  1.00 16.35  ? 39  ALA E CB  1 
ATOM   8183  N N   . THR E  1 40  ? 57.758  35.633  15.569  1.00 15.43  ? 40  THR E N   1 
ATOM   8184  C CA  . THR E  1 40  ? 57.631  36.778  14.684  1.00 15.63  ? 40  THR E CA  1 
ATOM   8185  C C   . THR E  1 40  ? 56.345  37.518  15.069  1.00 15.52  ? 40  THR E C   1 
ATOM   8186  O O   . THR E  1 40  ? 55.360  36.907  15.493  1.00 16.17  ? 40  THR E O   1 
ATOM   8187  C CB  . THR E  1 40  ? 57.658  36.259  13.217  1.00 15.15  ? 40  THR E CB  1 
ATOM   8188  O OG1 . THR E  1 40  ? 57.452  37.424  12.447  1.00 14.84  ? 40  THR E OG1 1 
ATOM   8189  C CG2 . THR E  1 40  ? 56.642  35.213  12.840  1.00 14.90  ? 40  THR E CG2 1 
ATOM   8190  N N   . GLU E  1 41  ? 56.367  38.849  15.019  1.00 15.21  ? 41  GLU E N   1 
ATOM   8191  C CA  . GLU E  1 41  ? 55.245  39.681  15.424  1.00 14.31  ? 41  GLU E CA  1 
ATOM   8192  C C   . GLU E  1 41  ? 54.188  39.800  14.348  1.00 12.75  ? 41  GLU E C   1 
ATOM   8193  O O   . GLU E  1 41  ? 54.501  40.260  13.254  1.00 12.66  ? 41  GLU E O   1 
ATOM   8194  C CB  . GLU E  1 41  ? 55.761  41.041  15.761  1.00 14.74  ? 41  GLU E CB  1 
ATOM   8195  C CG  . GLU E  1 41  ? 54.688  41.995  16.148  1.00 17.30  ? 41  GLU E CG  1 
ATOM   8196  C CD  . GLU E  1 41  ? 53.948  41.561  17.390  1.00 19.72  ? 41  GLU E CD  1 
ATOM   8197  O OE1 . GLU E  1 41  ? 52.753  41.261  17.279  1.00 20.68  ? 41  GLU E OE1 1 
ATOM   8198  O OE2 . GLU E  1 41  ? 54.575  41.454  18.464  1.00 20.67  ? 41  GLU E OE2 1 
ATOM   8199  N N   . LEU E  1 42  ? 52.957  39.411  14.634  1.00 11.68  ? 42  LEU E N   1 
ATOM   8200  C CA  . LEU E  1 42  ? 51.912  39.481  13.630  1.00 9.82   ? 42  LEU E CA  1 
ATOM   8201  C C   . LEU E  1 42  ? 51.089  40.780  13.657  1.00 9.90   ? 42  LEU E C   1 
ATOM   8202  O O   . LEU E  1 42  ? 50.266  40.968  12.744  1.00 9.38   ? 42  LEU E O   1 
ATOM   8203  C CB  . LEU E  1 42  ? 50.990  38.272  13.781  1.00 8.30   ? 42  LEU E CB  1 
ATOM   8204  C CG  . LEU E  1 42  ? 51.513  36.902  13.410  1.00 7.90   ? 42  LEU E CG  1 
ATOM   8205  C CD1 . LEU E  1 42  ? 50.400  35.892  13.512  1.00 7.74   ? 42  LEU E CD1 1 
ATOM   8206  C CD2 . LEU E  1 42  ? 51.960  36.869  11.969  1.00 7.74   ? 42  LEU E CD2 1 
ATOM   8207  N N   . VAL E  1 43  ? 51.256  41.695  14.634  1.00 9.03   ? 43  VAL E N   1 
ATOM   8208  C CA  . VAL E  1 43  ? 50.440  42.901  14.701  1.00 8.69   ? 43  VAL E CA  1 
ATOM   8209  C C   . VAL E  1 43  ? 51.273  44.116  14.339  1.00 9.90   ? 43  VAL E C   1 
ATOM   8210  O O   . VAL E  1 43  ? 52.261  44.441  14.998  1.00 9.71   ? 43  VAL E O   1 
ATOM   8211  C CB  . VAL E  1 43  ? 49.845  43.087  16.106  1.00 7.88   ? 43  VAL E CB  1 
ATOM   8212  C CG1 . VAL E  1 43  ? 48.891  44.263  16.140  1.00 7.48   ? 43  VAL E CG1 1 
ATOM   8213  C CG2 . VAL E  1 43  ? 49.014  41.908  16.505  1.00 6.81   ? 43  VAL E CG2 1 
ATOM   8214  N N   . GLN E  1 44  ? 50.924  44.830  13.284  1.00 11.58  ? 44  GLN E N   1 
ATOM   8215  C CA  . GLN E  1 44  ? 51.601  46.057  12.910  1.00 13.60  ? 44  GLN E CA  1 
ATOM   8216  C C   . GLN E  1 44  ? 51.105  47.102  13.859  1.00 16.10  ? 44  GLN E C   1 
ATOM   8217  O O   . GLN E  1 44  ? 49.889  47.318  13.945  1.00 17.54  ? 44  GLN E O   1 
ATOM   8218  C CB  . GLN E  1 44  ? 51.250  46.439  11.500  1.00 13.79  ? 44  GLN E CB  1 
ATOM   8219  C CG  . GLN E  1 44  ? 51.871  47.742  11.050  1.00 14.83  ? 44  GLN E CG  1 
ATOM   8220  C CD  . GLN E  1 44  ? 53.385  47.715  11.020  1.00 15.30  ? 44  GLN E CD  1 
ATOM   8221  O OE1 . GLN E  1 44  ? 54.047  46.731  10.673  1.00 16.13  ? 44  GLN E OE1 1 
ATOM   8222  N NE2 . GLN E  1 44  ? 53.979  48.838  11.367  1.00 15.16  ? 44  GLN E NE2 1 
ATOM   8223  N N   . SER E  1 45  ? 51.991  47.801  14.538  1.00 18.35  ? 45  SER E N   1 
ATOM   8224  C CA  . SER E  1 45  ? 51.516  48.677  15.594  1.00 20.82  ? 45  SER E CA  1 
ATOM   8225  C C   . SER E  1 45  ? 52.044  50.078  15.539  1.00 21.89  ? 45  SER E C   1 
ATOM   8226  O O   . SER E  1 45  ? 51.932  50.818  16.518  1.00 23.34  ? 45  SER E O   1 
ATOM   8227  C CB  . SER E  1 45  ? 51.871  48.024  16.923  1.00 21.73  ? 45  SER E CB  1 
ATOM   8228  O OG  . SER E  1 45  ? 53.156  47.410  16.793  1.00 23.55  ? 45  SER E OG  1 
ATOM   8229  N N   . SER E  1 46  ? 52.588  50.515  14.417  1.00 22.74  ? 46  SER E N   1 
ATOM   8230  C CA  . SER E  1 46  ? 53.112  51.872  14.366  1.00 24.00  ? 46  SER E CA  1 
ATOM   8231  C C   . SER E  1 46  ? 53.115  52.416  12.956  1.00 24.50  ? 46  SER E C   1 
ATOM   8232  O O   . SER E  1 46  ? 53.351  51.677  11.983  1.00 24.06  ? 46  SER E O   1 
ATOM   8233  C CB  . SER E  1 46  ? 54.507  51.871  14.929  1.00 23.86  ? 46  SER E CB  1 
ATOM   8234  O OG  . SER E  1 46  ? 55.157  50.753  14.353  1.00 24.93  ? 46  SER E OG  1 
ATOM   8235  N N   . SER E  1 47  ? 52.783  53.696  12.864  1.00 25.28  ? 47  SER E N   1 
ATOM   8236  C CA  . SER E  1 47  ? 52.721  54.351  11.585  1.00 25.29  ? 47  SER E CA  1 
ATOM   8237  C C   . SER E  1 47  ? 54.003  55.110  11.391  1.00 25.82  ? 47  SER E C   1 
ATOM   8238  O O   . SER E  1 47  ? 54.699  55.464  12.347  1.00 26.43  ? 47  SER E O   1 
ATOM   8239  C CB  . SER E  1 47  ? 51.577  55.315  11.566  1.00 24.99  ? 47  SER E CB  1 
ATOM   8240  O OG  . SER E  1 47  ? 51.402  55.844  10.270  1.00 24.88  ? 47  SER E OG  1 
ATOM   8241  N N   . THR E  1 48  ? 54.296  55.399  10.144  1.00 26.17  ? 48  THR E N   1 
ATOM   8242  C CA  . THR E  1 48  ? 55.402  56.270  9.829   1.00 27.25  ? 48  THR E CA  1 
ATOM   8243  C C   . THR E  1 48  ? 55.005  57.697  10.187  1.00 27.76  ? 48  THR E C   1 
ATOM   8244  O O   . THR E  1 48  ? 55.845  58.584  10.272  1.00 29.47  ? 48  THR E O   1 
ATOM   8245  C CB  . THR E  1 48  ? 55.700  56.157  8.349   1.00 28.32  ? 48  THR E CB  1 
ATOM   8246  O OG1 . THR E  1 48  ? 54.538  56.576  7.627   1.00 29.69  ? 48  THR E OG1 1 
ATOM   8247  C CG2 . THR E  1 48  ? 56.034  54.709  7.969   1.00 29.84  ? 48  THR E CG2 1 
ATOM   8248  N N   . GLY E  1 49  ? 53.699  57.966  10.310  1.00 27.62  ? 49  GLY E N   1 
ATOM   8249  C CA  . GLY E  1 49  ? 53.187  59.275  10.658  1.00 25.32  ? 49  GLY E CA  1 
ATOM   8250  C C   . GLY E  1 49  ? 53.008  60.135  9.435   1.00 23.72  ? 49  GLY E C   1 
ATOM   8251  O O   . GLY E  1 49  ? 52.744  61.325  9.558   1.00 23.72  ? 49  GLY E O   1 
ATOM   8252  N N   . LYS E  1 50  ? 53.141  59.573  8.243   1.00 22.73  ? 50  LYS E N   1 
ATOM   8253  C CA  . LYS E  1 50  ? 53.040  60.354  7.036   1.00 23.60  ? 50  LYS E CA  1 
ATOM   8254  C C   . LYS E  1 50  ? 52.220  59.597  6.023   1.00 23.35  ? 50  LYS E C   1 
ATOM   8255  O O   . LYS E  1 50  ? 52.314  58.364  5.958   1.00 24.21  ? 50  LYS E O   1 
ATOM   8256  C CB  . LYS E  1 50  ? 54.404  60.587  6.491   1.00 25.83  ? 50  LYS E CB  1 
ATOM   8257  C CG  . LYS E  1 50  ? 55.211  61.538  7.352   1.00 29.67  ? 50  LYS E CG  1 
ATOM   8258  C CD  . LYS E  1 50  ? 56.711  61.327  7.139   1.00 32.26  ? 50  LYS E CD  1 
ATOM   8259  C CE  . LYS E  1 50  ? 57.402  62.669  6.954   1.00 33.86  ? 50  LYS E CE  1 
ATOM   8260  N NZ  . LYS E  1 50  ? 57.218  63.499  8.132   1.00 35.23  ? 50  LYS E NZ  1 
ATOM   8261  N N   . ILE E  1 51  ? 51.363  60.276  5.266   1.00 21.76  ? 51  ILE E N   1 
ATOM   8262  C CA  . ILE E  1 51  ? 50.561  59.622  4.247   1.00 19.49  ? 51  ILE E CA  1 
ATOM   8263  C C   . ILE E  1 51  ? 51.425  59.595  3.002   1.00 19.77  ? 51  ILE E C   1 
ATOM   8264  O O   . ILE E  1 51  ? 51.739  60.637  2.436   1.00 19.82  ? 51  ILE E O   1 
ATOM   8265  C CB  . ILE E  1 51  ? 49.249  60.413  4.005   1.00 17.01  ? 51  ILE E CB  1 
ATOM   8266  C CG1 . ILE E  1 51  ? 48.415  60.409  5.269   1.00 15.62  ? 51  ILE E CG1 1 
ATOM   8267  C CG2 . ILE E  1 51  ? 48.469  59.801  2.860   1.00 15.55  ? 51  ILE E CG2 1 
ATOM   8268  C CD1 . ILE E  1 51  ? 47.131  61.248  5.154   1.00 15.59  ? 51  ILE E CD1 1 
ATOM   8269  N N   . CYS E  1 52  ? 51.876  58.425  2.613   1.00 20.64  ? 52  CYS E N   1 
ATOM   8270  C CA  . CYS E  1 52  ? 52.651  58.294  1.408   1.00 23.06  ? 52  CYS E CA  1 
ATOM   8271  C C   . CYS E  1 52  ? 51.817  58.623  0.210   1.00 23.37  ? 52  CYS E C   1 
ATOM   8272  O O   . CYS E  1 52  ? 50.759  58.040  0.033   1.00 24.27  ? 52  CYS E O   1 
ATOM   8273  C CB  . CYS E  1 52  ? 53.157  56.890  1.236   1.00 25.05  ? 52  CYS E CB  1 
ATOM   8274  S SG  . CYS E  1 52  ? 54.598  56.547  2.274   1.00 27.36  ? 52  CYS E SG  1 
ATOM   8275  N N   . ASN E  1 53  ? 52.297  59.488  -0.653  1.00 24.72  ? 53  ASN E N   1 
ATOM   8276  C CA  . ASN E  1 53  ? 51.551  59.923  -1.821  1.00 26.99  ? 53  ASN E CA  1 
ATOM   8277  C C   . ASN E  1 53  ? 51.639  58.987  -3.012  1.00 27.49  ? 53  ASN E C   1 
ATOM   8278  O O   . ASN E  1 53  ? 51.467  59.412  -4.163  1.00 27.36  ? 53  ASN E O   1 
ATOM   8279  C CB  . ASN E  1 53  ? 52.040  61.287  -2.272  1.00 29.07  ? 53  ASN E CB  1 
ATOM   8280  C CG  . ASN E  1 53  ? 53.487  61.322  -2.755  1.00 30.39  ? 53  ASN E CG  1 
ATOM   8281  O OD1 . ASN E  1 53  ? 54.211  60.321  -2.871  1.00 30.86  ? 53  ASN E OD1 1 
ATOM   8282  N ND2 . ASN E  1 53  ? 53.945  62.545  -3.029  1.00 31.38  ? 53  ASN E ND2 1 
ATOM   8283  N N   . ASN E  1 54  ? 51.911  57.714  -2.786  1.00 28.10  ? 54  ASN E N   1 
ATOM   8284  C CA  . ASN E  1 54  ? 52.068  56.782  -3.874  1.00 27.87  ? 54  ASN E CA  1 
ATOM   8285  C C   . ASN E  1 54  ? 51.760  55.423  -3.310  1.00 25.73  ? 54  ASN E C   1 
ATOM   8286  O O   . ASN E  1 54  ? 52.191  55.142  -2.196  1.00 26.66  ? 54  ASN E O   1 
ATOM   8287  C CB  . ASN E  1 54  ? 53.496  56.874  -4.385  1.00 30.70  ? 54  ASN E CB  1 
ATOM   8288  C CG  . ASN E  1 54  ? 53.537  56.405  -5.830  1.00 33.62  ? 54  ASN E CG  1 
ATOM   8289  O OD1 . ASN E  1 54  ? 53.832  55.240  -6.126  1.00 36.14  ? 54  ASN E OD1 1 
ATOM   8290  N ND2 . ASN E  1 54  ? 53.183  57.256  -6.792  1.00 33.74  ? 54  ASN E ND2 1 
ATOM   8291  N N   . PRO E  1 55  ? 51.058  54.519  -3.976  1.00 23.52  ? 55  PRO E N   1 
ATOM   8292  C CA  . PRO E  1 55  ? 50.498  54.684  -5.300  1.00 22.25  ? 55  PRO E CA  1 
ATOM   8293  C C   . PRO E  1 55  ? 49.129  55.317  -5.428  1.00 21.41  ? 55  PRO E C   1 
ATOM   8294  O O   . PRO E  1 55  ? 48.644  55.421  -6.545  1.00 21.23  ? 55  PRO E O   1 
ATOM   8295  C CB  . PRO E  1 55  ? 50.543  53.301  -5.838  1.00 21.96  ? 55  PRO E CB  1 
ATOM   8296  C CG  . PRO E  1 55  ? 50.072  52.541  -4.637  1.00 22.45  ? 55  PRO E CG  1 
ATOM   8297  C CD  . PRO E  1 55  ? 50.879  53.154  -3.514  1.00 22.73  ? 55  PRO E CD  1 
ATOM   8298  N N   . HIS E  1 56  ? 48.445  55.726  -4.368  1.00 20.61  ? 56  HIS E N   1 
ATOM   8299  C CA  . HIS E  1 56  ? 47.081  56.199  -4.564  1.00 18.95  ? 56  HIS E CA  1 
ATOM   8300  C C   . HIS E  1 56  ? 47.093  57.684  -4.872  1.00 20.00  ? 56  HIS E C   1 
ATOM   8301  O O   . HIS E  1 56  ? 48.046  58.357  -4.465  1.00 20.98  ? 56  HIS E O   1 
ATOM   8302  C CB  . HIS E  1 56  ? 46.227  55.971  -3.318  1.00 16.67  ? 56  HIS E CB  1 
ATOM   8303  C CG  . HIS E  1 56  ? 46.061  54.523  -2.931  1.00 14.22  ? 56  HIS E CG  1 
ATOM   8304  N ND1 . HIS E  1 56  ? 45.453  53.651  -3.713  1.00 13.19  ? 56  HIS E ND1 1 
ATOM   8305  C CD2 . HIS E  1 56  ? 46.524  53.994  -1.772  1.00 14.02  ? 56  HIS E CD2 1 
ATOM   8306  C CE1 . HIS E  1 56  ? 45.545  52.546  -3.010  1.00 14.06  ? 56  HIS E CE1 1 
ATOM   8307  N NE2 . HIS E  1 56  ? 46.178  52.749  -1.865  1.00 13.91  ? 56  HIS E NE2 1 
ATOM   8308  N N   . ARG E  1 57  ? 46.093  58.218  -5.593  1.00 20.48  ? 57  ARG E N   1 
ATOM   8309  C CA  . ARG E  1 57  ? 46.029  59.641  -5.844  1.00 20.46  ? 57  ARG E CA  1 
ATOM   8310  C C   . ARG E  1 57  ? 45.540  60.330  -4.601  1.00 18.83  ? 57  ARG E C   1 
ATOM   8311  O O   . ARG E  1 57  ? 44.360  60.281  -4.287  1.00 19.02  ? 57  ARG E O   1 
ATOM   8312  C CB  . ARG E  1 57  ? 45.080  59.969  -6.974  1.00 22.48  ? 57  ARG E CB  1 
ATOM   8313  C CG  . ARG E  1 57  ? 45.866  60.624  -8.101  1.00 25.66  ? 57  ARG E CG  1 
ATOM   8314  C CD  . ARG E  1 57  ? 45.012  61.295  -9.178  1.00 28.68  ? 57  ARG E CD  1 
ATOM   8315  N NE  . ARG E  1 57  ? 44.570  62.650  -8.790  1.00 31.93  ? 57  ARG E NE  1 
ATOM   8316  C CZ  . ARG E  1 57  ? 45.297  63.777  -9.006  1.00 32.62  ? 57  ARG E CZ  1 
ATOM   8317  N NH1 . ARG E  1 57  ? 44.809  64.988  -8.669  1.00 32.08  ? 57  ARG E NH1 1 
ATOM   8318  N NH2 . ARG E  1 57  ? 46.518  63.658  -9.552  1.00 33.33  ? 57  ARG E NH2 1 
ATOM   8319  N N   . ILE E  1 58  ? 46.395  60.956  -3.832  1.00 17.55  ? 58  ILE E N   1 
ATOM   8320  C CA  . ILE E  1 58  ? 45.915  61.597  -2.627  1.00 17.09  ? 58  ILE E CA  1 
ATOM   8321  C C   . ILE E  1 58  ? 45.756  63.091  -2.834  1.00 17.44  ? 58  ILE E C   1 
ATOM   8322  O O   . ILE E  1 58  ? 46.715  63.808  -3.128  1.00 18.65  ? 58  ILE E O   1 
ATOM   8323  C CB  . ILE E  1 58  ? 46.904  61.208  -1.527  1.00 16.29  ? 58  ILE E CB  1 
ATOM   8324  C CG1 . ILE E  1 58  ? 46.530  59.786  -1.193  1.00 15.59  ? 58  ILE E CG1 1 
ATOM   8325  C CG2 . ILE E  1 58  ? 46.857  62.069  -0.289  1.00 14.98  ? 58  ILE E CG2 1 
ATOM   8326  C CD1 . ILE E  1 58  ? 47.743  59.055  -0.702  1.00 16.02  ? 58  ILE E CD1 1 
ATOM   8327  N N   . LEU E  1 59  ? 44.542  63.602  -2.728  1.00 16.91  ? 59  LEU E N   1 
ATOM   8328  C CA  . LEU E  1 59  ? 44.303  65.024  -2.922  1.00 15.99  ? 59  LEU E CA  1 
ATOM   8329  C C   . LEU E  1 59  ? 44.227  65.652  -1.546  1.00 16.53  ? 59  LEU E C   1 
ATOM   8330  O O   . LEU E  1 59  ? 43.362  65.224  -0.762  1.00 18.14  ? 59  LEU E O   1 
ATOM   8331  C CB  . LEU E  1 59  ? 43.005  65.211  -3.629  1.00 15.27  ? 59  LEU E CB  1 
ATOM   8332  C CG  . LEU E  1 59  ? 42.695  66.599  -4.071  1.00 15.50  ? 59  LEU E CG  1 
ATOM   8333  C CD1 . LEU E  1 59  ? 43.634  66.967  -5.191  1.00 16.47  ? 59  LEU E CD1 1 
ATOM   8334  C CD2 . LEU E  1 59  ? 41.272  66.673  -4.572  1.00 16.27  ? 59  LEU E CD2 1 
ATOM   8335  N N   . ASP E  1 60  ? 45.109  66.592  -1.186  1.00 15.34  ? 60  ASP E N   1 
ATOM   8336  C CA  . ASP E  1 60  ? 45.063  67.188  0.135   1.00 14.10  ? 60  ASP E CA  1 
ATOM   8337  C C   . ASP E  1 60  ? 44.062  68.304  0.056   1.00 14.52  ? 60  ASP E C   1 
ATOM   8338  O O   . ASP E  1 60  ? 44.176  69.161  -0.820  1.00 15.83  ? 60  ASP E O   1 
ATOM   8339  C CB  . ASP E  1 60  ? 46.391  67.758  0.512   1.00 14.03  ? 60  ASP E CB  1 
ATOM   8340  C CG  . ASP E  1 60  ? 46.484  68.317  1.918   1.00 14.92  ? 60  ASP E CG  1 
ATOM   8341  O OD1 . ASP E  1 60  ? 47.580  68.398  2.435   1.00 16.62  ? 60  ASP E OD1 1 
ATOM   8342  O OD2 . ASP E  1 60  ? 45.510  68.646  2.571   1.00 14.83  ? 60  ASP E OD2 1 
ATOM   8343  N N   . GLY E  1 61  ? 43.100  68.338  0.967   1.00 14.30  ? 61  GLY E N   1 
ATOM   8344  C CA  . GLY E  1 61  ? 42.030  69.314  0.896   1.00 13.65  ? 61  GLY E CA  1 
ATOM   8345  C C   . GLY E  1 61  ? 42.470  70.674  1.345   1.00 14.04  ? 61  GLY E C   1 
ATOM   8346  O O   . GLY E  1 61  ? 41.743  71.648  1.147   1.00 12.91  ? 61  GLY E O   1 
ATOM   8347  N N   . ILE E  1 62  ? 43.669  70.743  1.926   1.00 15.45  ? 62  ILE E N   1 
ATOM   8348  C CA  . ILE E  1 62  ? 44.260  71.921  2.551   1.00 16.82  ? 62  ILE E CA  1 
ATOM   8349  C C   . ILE E  1 62  ? 43.216  72.536  3.482   1.00 17.06  ? 62  ILE E C   1 
ATOM   8350  O O   . ILE E  1 62  ? 42.781  71.845  4.397   1.00 16.47  ? 62  ILE E O   1 
ATOM   8351  C CB  . ILE E  1 62  ? 44.724  72.966  1.501   1.00 17.54  ? 62  ILE E CB  1 
ATOM   8352  C CG1 . ILE E  1 62  ? 45.253  72.396  0.194   1.00 17.87  ? 62  ILE E CG1 1 
ATOM   8353  C CG2 . ILE E  1 62  ? 45.820  73.756  2.216   1.00 17.47  ? 62  ILE E CG2 1 
ATOM   8354  C CD1 . ILE E  1 62  ? 46.580  71.636  0.315   1.00 19.70  ? 62  ILE E CD1 1 
ATOM   8355  N N   . ASP E  1 63  ? 42.699  73.745  3.294   1.00 18.21  ? 63  ASP E N   1 
ATOM   8356  C CA  . ASP E  1 63  ? 41.701  74.246  4.218   1.00 20.14  ? 63  ASP E CA  1 
ATOM   8357  C C   . ASP E  1 63  ? 40.309  74.243  3.608   1.00 19.59  ? 63  ASP E C   1 
ATOM   8358  O O   . ASP E  1 63  ? 39.423  75.036  3.972   1.00 19.95  ? 63  ASP E O   1 
ATOM   8359  C CB  . ASP E  1 63  ? 42.079  75.662  4.690   1.00 22.53  ? 63  ASP E CB  1 
ATOM   8360  C CG  . ASP E  1 63  ? 42.638  76.611  3.636   1.00 25.39  ? 63  ASP E CG  1 
ATOM   8361  O OD1 . ASP E  1 63  ? 42.415  76.397  2.427   1.00 27.08  ? 63  ASP E OD1 1 
ATOM   8362  O OD2 . ASP E  1 63  ? 43.331  77.548  4.038   1.00 25.98  ? 63  ASP E OD2 1 
ATOM   8363  N N   . CYS E  1 64  ? 40.058  73.320  2.684   1.00 18.40  ? 64  CYS E N   1 
ATOM   8364  C CA  . CYS E  1 64  ? 38.725  73.141  2.137   1.00 17.08  ? 64  CYS E CA  1 
ATOM   8365  C C   . CYS E  1 64  ? 38.108  71.833  2.547   1.00 15.87  ? 64  CYS E C   1 
ATOM   8366  O O   . CYS E  1 64  ? 38.793  70.831  2.659   1.00 16.11  ? 64  CYS E O   1 
ATOM   8367  C CB  . CYS E  1 64  ? 38.751  73.150  0.651   1.00 17.49  ? 64  CYS E CB  1 
ATOM   8368  S SG  . CYS E  1 64  ? 39.064  74.823  0.136   1.00 18.85  ? 64  CYS E SG  1 
ATOM   8369  N N   . THR E  1 65  ? 36.826  71.802  2.772   1.00 15.05  ? 65  THR E N   1 
ATOM   8370  C CA  . THR E  1 65  ? 36.093  70.567  3.011   1.00 14.82  ? 65  THR E CA  1 
ATOM   8371  C C   . THR E  1 65  ? 35.722  70.025  1.643   1.00 14.24  ? 65  THR E C   1 
ATOM   8372  O O   . THR E  1 65  ? 35.533  70.860  0.756   1.00 14.46  ? 65  THR E O   1 
ATOM   8373  C CB  . THR E  1 65  ? 34.856  70.929  3.740   1.00 14.99  ? 65  THR E CB  1 
ATOM   8374  O OG1 . THR E  1 65  ? 35.335  71.660  4.855   1.00 16.51  ? 65  THR E OG1 1 
ATOM   8375  C CG2 . THR E  1 65  ? 33.958  69.766  4.061   1.00 15.49  ? 65  THR E CG2 1 
ATOM   8376  N N   . LEU E  1 66  ? 35.544  68.715  1.397   1.00 13.56  ? 66  LEU E N   1 
ATOM   8377  C CA  . LEU E  1 66  ? 35.094  68.286  0.058   1.00 12.16  ? 66  LEU E CA  1 
ATOM   8378  C C   . LEU E  1 66  ? 33.787  68.973  -0.350  1.00 12.17  ? 66  LEU E C   1 
ATOM   8379  O O   . LEU E  1 66  ? 33.745  69.490  -1.462  1.00 12.45  ? 66  LEU E O   1 
ATOM   8380  C CB  . LEU E  1 66  ? 34.870  66.788  -0.006  1.00 10.70  ? 66  LEU E CB  1 
ATOM   8381  C CG  . LEU E  1 66  ? 34.258  66.169  -1.245  1.00 9.98   ? 66  LEU E CG  1 
ATOM   8382  C CD1 . LEU E  1 66  ? 35.142  66.387  -2.456  1.00 9.83   ? 66  LEU E CD1 1 
ATOM   8383  C CD2 . LEU E  1 66  ? 34.064  64.693  -0.984  1.00 9.32   ? 66  LEU E CD2 1 
ATOM   8384  N N   . ILE E  1 67  ? 32.745  69.072  0.499   1.00 11.87  ? 67  ILE E N   1 
ATOM   8385  C CA  . ILE E  1 67  ? 31.506  69.781  0.135   1.00 11.72  ? 67  ILE E CA  1 
ATOM   8386  C C   . ILE E  1 67  ? 31.779  71.244  -0.286  1.00 12.48  ? 67  ILE E C   1 
ATOM   8387  O O   . ILE E  1 67  ? 31.219  71.681  -1.300  1.00 13.12  ? 67  ILE E O   1 
ATOM   8388  C CB  . ILE E  1 67  ? 30.484  69.729  1.337   1.00 10.93  ? 67  ILE E CB  1 
ATOM   8389  C CG1 . ILE E  1 67  ? 30.053  68.276  1.569   1.00 10.12  ? 67  ILE E CG1 1 
ATOM   8390  C CG2 . ILE E  1 67  ? 29.245  70.585  1.077   1.00 10.04  ? 67  ILE E CG2 1 
ATOM   8391  C CD1 . ILE E  1 67  ? 29.208  67.649  0.463   1.00 9.41   ? 67  ILE E CD1 1 
ATOM   8392  N N   . ASP E  1 68  ? 32.656  72.010  0.393   1.00 12.08  ? 68  ASP E N   1 
ATOM   8393  C CA  . ASP E  1 68  ? 32.964  73.360  -0.077  1.00 10.85  ? 68  ASP E CA  1 
ATOM   8394  C C   . ASP E  1 68  ? 33.684  73.309  -1.402  1.00 10.17  ? 68  ASP E C   1 
ATOM   8395  O O   . ASP E  1 68  ? 33.413  74.142  -2.260  1.00 10.35  ? 68  ASP E O   1 
ATOM   8396  C CB  . ASP E  1 68  ? 33.869  74.138  0.843   1.00 11.17  ? 68  ASP E CB  1 
ATOM   8397  C CG  . ASP E  1 68  ? 33.263  74.452  2.194   1.00 12.42  ? 68  ASP E CG  1 
ATOM   8398  O OD1 . ASP E  1 68  ? 33.899  74.097  3.211   1.00 13.11  ? 68  ASP E OD1 1 
ATOM   8399  O OD2 . ASP E  1 68  ? 32.165  75.031  2.237   1.00 12.56  ? 68  ASP E OD2 1 
ATOM   8400  N N   . ALA E  1 69  ? 34.576  72.342  -1.632  1.00 9.33   ? 69  ALA E N   1 
ATOM   8401  C CA  . ALA E  1 69  ? 35.222  72.193  -2.923  1.00 8.83   ? 69  ALA E CA  1 
ATOM   8402  C C   . ALA E  1 69  ? 34.171  71.971  -4.011  1.00 9.07   ? 69  ALA E C   1 
ATOM   8403  O O   . ALA E  1 69  ? 34.217  72.567  -5.099  1.00 9.21   ? 69  ALA E O   1 
ATOM   8404  C CB  . ALA E  1 69  ? 36.162  71.005  -2.878  1.00 8.51   ? 69  ALA E CB  1 
ATOM   8405  N N   . LEU E  1 70  ? 33.172  71.145  -3.702  1.00 9.46   ? 70  LEU E N   1 
ATOM   8406  C CA  . LEU E  1 70  ? 32.059  70.871  -4.602  1.00 9.12   ? 70  LEU E CA  1 
ATOM   8407  C C   . LEU E  1 70  ? 31.253  72.151  -4.885  1.00 8.84   ? 70  LEU E C   1 
ATOM   8408  O O   . LEU E  1 70  ? 31.171  72.559  -6.050  1.00 8.78   ? 70  LEU E O   1 
ATOM   8409  C CB  . LEU E  1 70  ? 31.139  69.818  -3.976  1.00 8.34   ? 70  LEU E CB  1 
ATOM   8410  C CG  . LEU E  1 70  ? 29.886  69.395  -4.702  1.00 7.09   ? 70  LEU E CG  1 
ATOM   8411  C CD1 . LEU E  1 70  ? 30.234  68.329  -5.707  1.00 7.03   ? 70  LEU E CD1 1 
ATOM   8412  C CD2 . LEU E  1 70  ? 28.894  68.838  -3.723  1.00 6.25   ? 70  LEU E CD2 1 
ATOM   8413  N N   . LEU E  1 71  ? 30.711  72.813  -3.841  1.00 7.38   ? 71  LEU E N   1 
ATOM   8414  C CA  . LEU E  1 71  ? 29.863  73.984  -4.024  1.00 6.68   ? 71  LEU E CA  1 
ATOM   8415  C C   . LEU E  1 71  ? 30.627  75.128  -4.643  1.00 7.78   ? 71  LEU E C   1 
ATOM   8416  O O   . LEU E  1 71  ? 30.116  75.890  -5.482  1.00 7.54   ? 71  LEU E O   1 
ATOM   8417  C CB  . LEU E  1 71  ? 29.281  74.439  -2.700  1.00 4.39   ? 71  LEU E CB  1 
ATOM   8418  C CG  . LEU E  1 71  ? 28.282  73.477  -2.069  1.00 2.69   ? 71  LEU E CG  1 
ATOM   8419  C CD1 . LEU E  1 71  ? 27.821  73.982  -0.733  1.00 2.00   ? 71  LEU E CD1 1 
ATOM   8420  C CD2 . LEU E  1 71  ? 27.092  73.340  -2.966  1.00 2.10   ? 71  LEU E CD2 1 
ATOM   8421  N N   . GLY E  1 72  ? 31.890  75.211  -4.265  1.00 8.75   ? 72  GLY E N   1 
ATOM   8422  C CA  . GLY E  1 72  ? 32.765  76.190  -4.867  1.00 9.13   ? 72  GLY E CA  1 
ATOM   8423  C C   . GLY E  1 72  ? 32.859  77.468  -4.077  1.00 9.06   ? 72  GLY E C   1 
ATOM   8424  O O   . GLY E  1 72  ? 32.659  78.563  -4.608  1.00 8.06   ? 72  GLY E O   1 
ATOM   8425  N N   . ASP E  1 73  ? 33.124  77.299  -2.783  1.00 10.15  ? 73  ASP E N   1 
ATOM   8426  C CA  . ASP E  1 73  ? 33.476  78.380  -1.879  1.00 10.75  ? 73  ASP E CA  1 
ATOM   8427  C C   . ASP E  1 73  ? 34.663  79.053  -2.546  1.00 11.34  ? 73  ASP E C   1 
ATOM   8428  O O   . ASP E  1 73  ? 35.578  78.340  -2.940  1.00 10.66  ? 73  ASP E O   1 
ATOM   8429  C CB  . ASP E  1 73  ? 33.883  77.774  -0.560  1.00 12.16  ? 73  ASP E CB  1 
ATOM   8430  C CG  . ASP E  1 73  ? 34.418  78.732  0.474   1.00 13.68  ? 73  ASP E CG  1 
ATOM   8431  O OD1 . ASP E  1 73  ? 33.902  78.773  1.581   1.00 14.57  ? 73  ASP E OD1 1 
ATOM   8432  O OD2 . ASP E  1 73  ? 35.382  79.440  0.215   1.00 15.65  ? 73  ASP E OD2 1 
ATOM   8433  N N   . PRO E  1 74  ? 34.733  80.370  -2.689  1.00 12.40  ? 74  PRO E N   1 
ATOM   8434  C CA  . PRO E  1 74  ? 35.825  81.075  -3.340  1.00 12.23  ? 74  PRO E CA  1 
ATOM   8435  C C   . PRO E  1 74  ? 37.175  80.577  -2.906  1.00 13.72  ? 74  PRO E C   1 
ATOM   8436  O O   . PRO E  1 74  ? 38.010  80.170  -3.707  1.00 15.41  ? 74  PRO E O   1 
ATOM   8437  C CB  . PRO E  1 74  ? 35.616  82.498  -2.976  1.00 12.87  ? 74  PRO E CB  1 
ATOM   8438  C CG  . PRO E  1 74  ? 34.125  82.589  -2.778  1.00 13.19  ? 74  PRO E CG  1 
ATOM   8439  C CD  . PRO E  1 74  ? 33.857  81.310  -2.005  1.00 12.87  ? 74  PRO E CD  1 
ATOM   8440  N N   . HIS E  1 75  ? 37.406  80.442  -1.605  1.00 14.59  ? 75  HIS E N   1 
ATOM   8441  C CA  . HIS E  1 75  ? 38.711  80.022  -1.143  1.00 14.55  ? 75  HIS E CA  1 
ATOM   8442  C C   . HIS E  1 75  ? 39.080  78.588  -1.529  1.00 15.06  ? 75  HIS E C   1 
ATOM   8443  O O   . HIS E  1 75  ? 40.165  78.125  -1.220  1.00 15.46  ? 75  HIS E O   1 
ATOM   8444  C CB  . HIS E  1 75  ? 38.727  80.266  0.366   1.00 14.97  ? 75  HIS E CB  1 
ATOM   8445  C CG  . HIS E  1 75  ? 38.533  79.107  1.324   1.00 15.47  ? 75  HIS E CG  1 
ATOM   8446  N ND1 . HIS E  1 75  ? 37.371  78.779  1.861   1.00 15.32  ? 75  HIS E ND1 1 
ATOM   8447  C CD2 . HIS E  1 75  ? 39.508  78.286  1.822   1.00 15.90  ? 75  HIS E CD2 1 
ATOM   8448  C CE1 . HIS E  1 75  ? 37.587  77.789  2.671   1.00 16.15  ? 75  HIS E CE1 1 
ATOM   8449  N NE2 . HIS E  1 75  ? 38.869  77.503  2.645   1.00 16.65  ? 75  HIS E NE2 1 
ATOM   8450  N N   . CYS E  1 76  ? 38.231  77.866  -2.238  1.00 15.74  ? 76  CYS E N   1 
ATOM   8451  C CA  . CYS E  1 76  ? 38.479  76.509  -2.649  1.00 16.55  ? 76  CYS E CA  1 
ATOM   8452  C C   . CYS E  1 76  ? 38.414  76.406  -4.148  1.00 17.42  ? 76  CYS E C   1 
ATOM   8453  O O   . CYS E  1 76  ? 38.376  75.287  -4.683  1.00 17.98  ? 76  CYS E O   1 
ATOM   8454  C CB  . CYS E  1 76  ? 37.438  75.564  -2.072  1.00 16.79  ? 76  CYS E CB  1 
ATOM   8455  S SG  . CYS E  1 76  ? 37.353  75.761  -0.291  1.00 17.42  ? 76  CYS E SG  1 
ATOM   8456  N N   . ASP E  1 77  ? 38.474  77.510  -4.893  1.00 18.69  ? 77  ASP E N   1 
ATOM   8457  C CA  . ASP E  1 77  ? 38.329  77.382  -6.335  1.00 20.63  ? 77  ASP E CA  1 
ATOM   8458  C C   . ASP E  1 77  ? 39.462  76.607  -6.947  1.00 20.83  ? 77  ASP E C   1 
ATOM   8459  O O   . ASP E  1 77  ? 39.366  76.104  -8.063  1.00 22.54  ? 77  ASP E O   1 
ATOM   8460  C CB  . ASP E  1 77  ? 38.245  78.730  -7.012  1.00 22.45  ? 77  ASP E CB  1 
ATOM   8461  C CG  . ASP E  1 77  ? 36.874  79.366  -6.801  1.00 24.57  ? 77  ASP E CG  1 
ATOM   8462  O OD1 . ASP E  1 77  ? 36.856  80.524  -6.384  1.00 26.12  ? 77  ASP E OD1 1 
ATOM   8463  O OD2 . ASP E  1 77  ? 35.811  78.766  -7.059  1.00 24.65  ? 77  ASP E OD2 1 
ATOM   8464  N N   . VAL E  1 78  ? 40.509  76.406  -6.155  1.00 19.73  ? 78  VAL E N   1 
ATOM   8465  C CA  . VAL E  1 78  ? 41.644  75.580  -6.506  1.00 18.27  ? 78  VAL E CA  1 
ATOM   8466  C C   . VAL E  1 78  ? 41.197  74.205  -6.953  1.00 17.96  ? 78  VAL E C   1 
ATOM   8467  O O   . VAL E  1 78  ? 41.712  73.720  -7.953  1.00 19.46  ? 78  VAL E O   1 
ATOM   8468  C CB  . VAL E  1 78  ? 42.576  75.339  -5.338  1.00 18.45  ? 78  VAL E CB  1 
ATOM   8469  C CG1 . VAL E  1 78  ? 43.872  74.868  -5.962  1.00 19.21  ? 78  VAL E CG1 1 
ATOM   8470  C CG2 . VAL E  1 78  ? 42.760  76.556  -4.441  1.00 18.94  ? 78  VAL E CG2 1 
ATOM   8471  N N   . PHE E  1 79  ? 40.206  73.610  -6.272  1.00 16.55  ? 79  PHE E N   1 
ATOM   8472  C CA  . PHE E  1 79  ? 39.820  72.224  -6.530  1.00 15.05  ? 79  PHE E CA  1 
ATOM   8473  C C   . PHE E  1 79  ? 38.934  71.974  -7.739  1.00 15.74  ? 79  PHE E C   1 
ATOM   8474  O O   . PHE E  1 79  ? 38.542  70.818  -7.945  1.00 16.26  ? 79  PHE E O   1 
ATOM   8475  C CB  . PHE E  1 79  ? 39.123  71.656  -5.289  1.00 12.10  ? 79  PHE E CB  1 
ATOM   8476  C CG  . PHE E  1 79  ? 40.087  71.623  -4.135  1.00 9.98   ? 79  PHE E CG  1 
ATOM   8477  C CD1 . PHE E  1 79  ? 40.885  70.513  -3.954  1.00 9.81   ? 79  PHE E CD1 1 
ATOM   8478  C CD2 . PHE E  1 79  ? 40.199  72.730  -3.325  1.00 8.96   ? 79  PHE E CD2 1 
ATOM   8479  C CE1 . PHE E  1 79  ? 41.819  70.534  -2.946  1.00 9.70   ? 79  PHE E CE1 1 
ATOM   8480  C CE2 . PHE E  1 79  ? 41.134  72.744  -2.325  1.00 8.53   ? 79  PHE E CE2 1 
ATOM   8481  C CZ  . PHE E  1 79  ? 41.942  71.648  -2.136  1.00 9.36   ? 79  PHE E CZ  1 
ATOM   8482  N N   . GLN E  1 80  ? 38.621  72.975  -8.566  1.00 16.35  ? 80  GLN E N   1 
ATOM   8483  C CA  . GLN E  1 80  ? 37.663  72.749  -9.615  1.00 19.07  ? 80  GLN E CA  1 
ATOM   8484  C C   . GLN E  1 80  ? 38.153  71.678  -10.558 1.00 20.05  ? 80  GLN E C   1 
ATOM   8485  O O   . GLN E  1 80  ? 39.324  71.698  -10.923 1.00 19.13  ? 80  GLN E O   1 
ATOM   8486  C CB  . GLN E  1 80  ? 37.423  73.984  -10.417 1.00 20.72  ? 80  GLN E CB  1 
ATOM   8487  C CG  . GLN E  1 80  ? 36.975  75.170  -9.597  1.00 23.28  ? 80  GLN E CG  1 
ATOM   8488  C CD  . GLN E  1 80  ? 36.418  76.289  -10.459 1.00 25.18  ? 80  GLN E CD  1 
ATOM   8489  O OE1 . GLN E  1 80  ? 35.384  76.864  -10.109 1.00 26.67  ? 80  GLN E OE1 1 
ATOM   8490  N NE2 . GLN E  1 80  ? 36.957  76.610  -11.643 1.00 25.21  ? 80  GLN E NE2 1 
ATOM   8491  N N   . ASN E  1 81  ? 37.275  70.723  -10.895 1.00 21.31  ? 81  ASN E N   1 
ATOM   8492  C CA  . ASN E  1 81  ? 37.611  69.631  -11.789 1.00 22.80  ? 81  ASN E CA  1 
ATOM   8493  C C   . ASN E  1 81  ? 38.719  68.715  -11.259 1.00 21.79  ? 81  ASN E C   1 
ATOM   8494  O O   . ASN E  1 81  ? 39.351  67.997  -12.045 1.00 22.20  ? 81  ASN E O   1 
ATOM   8495  C CB  . ASN E  1 81  ? 38.039  70.152  -13.186 1.00 26.73  ? 81  ASN E CB  1 
ATOM   8496  C CG  . ASN E  1 81  ? 36.929  70.636  -14.108 1.00 30.75  ? 81  ASN E CG  1 
ATOM   8497  O OD1 . ASN E  1 81  ? 35.788  70.845  -13.667 1.00 30.95  ? 81  ASN E OD1 1 
ATOM   8498  N ND2 . ASN E  1 81  ? 37.227  70.878  -15.399 1.00 34.48  ? 81  ASN E ND2 1 
ATOM   8499  N N   . GLU E  1 82  ? 38.980  68.691  -9.943  1.00 20.22  ? 82  GLU E N   1 
ATOM   8500  C CA  . GLU E  1 82  ? 39.984  67.790  -9.410  1.00 18.97  ? 82  GLU E CA  1 
ATOM   8501  C C   . GLU E  1 82  ? 39.502  66.357  -9.286  1.00 17.50  ? 82  GLU E C   1 
ATOM   8502  O O   . GLU E  1 82  ? 38.306  66.046  -9.356  1.00 17.35  ? 82  GLU E O   1 
ATOM   8503  C CB  . GLU E  1 82  ? 40.476  68.257  -8.045  1.00 19.54  ? 82  GLU E CB  1 
ATOM   8504  C CG  . GLU E  1 82  ? 41.838  68.934  -8.120  1.00 21.31  ? 82  GLU E CG  1 
ATOM   8505  C CD  . GLU E  1 82  ? 43.015  68.106  -8.658  1.00 23.87  ? 82  GLU E CD  1 
ATOM   8506  O OE1 . GLU E  1 82  ? 42.925  66.877  -8.819  1.00 25.38  ? 82  GLU E OE1 1 
ATOM   8507  O OE2 . GLU E  1 82  ? 44.084  68.671  -8.893  1.00 25.17  ? 82  GLU E OE2 1 
ATOM   8508  N N   . THR E  1 83  ? 40.453  65.489  -8.989  1.00 15.88  ? 83  THR E N   1 
ATOM   8509  C CA  . THR E  1 83  ? 40.290  64.061  -9.021  1.00 14.06  ? 83  THR E CA  1 
ATOM   8510  C C   . THR E  1 83  ? 41.130  63.394  -7.950  1.00 12.49  ? 83  THR E C   1 
ATOM   8511  O O   . THR E  1 83  ? 42.260  63.834  -7.705  1.00 11.45  ? 83  THR E O   1 
ATOM   8512  C CB  . THR E  1 83  ? 40.664  63.765  -10.449 1.00 14.52  ? 83  THR E CB  1 
ATOM   8513  O OG1 . THR E  1 83  ? 39.398  63.481  -11.006 1.00 15.23  ? 83  THR E OG1 1 
ATOM   8514  C CG2 . THR E  1 83  ? 41.736  62.710  -10.684 1.00 15.24  ? 83  THR E CG2 1 
ATOM   8515  N N   . TRP E  1 84  ? 40.655  62.317  -7.337  1.00 11.48  ? 84  TRP E N   1 
ATOM   8516  C CA  . TRP E  1 84  ? 41.381  61.717  -6.230  1.00 11.67  ? 84  TRP E CA  1 
ATOM   8517  C C   . TRP E  1 84  ? 41.038  60.264  -6.058  1.00 11.75  ? 84  TRP E C   1 
ATOM   8518  O O   . TRP E  1 84  ? 39.990  59.852  -6.548  1.00 12.35  ? 84  TRP E O   1 
ATOM   8519  C CB  . TRP E  1 84  ? 41.061  62.429  -4.894  1.00 11.86  ? 84  TRP E CB  1 
ATOM   8520  C CG  . TRP E  1 84  ? 39.594  62.353  -4.493  1.00 11.67  ? 84  TRP E CG  1 
ATOM   8521  C CD1 . TRP E  1 84  ? 39.136  61.316  -3.727  1.00 11.80  ? 84  TRP E CD1 1 
ATOM   8522  C CD2 . TRP E  1 84  ? 38.595  63.199  -4.901  1.00 11.10  ? 84  TRP E CD2 1 
ATOM   8523  N NE1 . TRP E  1 84  ? 37.845  61.479  -3.681  1.00 12.18  ? 84  TRP E NE1 1 
ATOM   8524  C CE2 . TRP E  1 84  ? 37.481  62.578  -4.366  1.00 11.38  ? 84  TRP E CE2 1 
ATOM   8525  C CE3 . TRP E  1 84  ? 38.455  64.340  -5.644  1.00 10.36  ? 84  TRP E CE3 1 
ATOM   8526  C CZ2 . TRP E  1 84  ? 36.211  63.094  -4.536  1.00 10.79  ? 84  TRP E CZ2 1 
ATOM   8527  C CZ3 . TRP E  1 84  ? 37.184  64.852  -5.814  1.00 10.79  ? 84  TRP E CZ3 1 
ATOM   8528  C CH2 . TRP E  1 84  ? 36.069  64.238  -5.284  1.00 10.16  ? 84  TRP E CH2 1 
ATOM   8529  N N   . ASP E  1 85  ? 41.906  59.548  -5.350  1.00 11.83  ? 85  ASP E N   1 
ATOM   8530  C CA  . ASP E  1 85  ? 41.645  58.208  -4.866  1.00 12.10  ? 85  ASP E CA  1 
ATOM   8531  C C   . ASP E  1 85  ? 41.256  58.375  -3.423  1.00 11.37  ? 85  ASP E C   1 
ATOM   8532  O O   . ASP E  1 85  ? 40.351  57.711  -2.892  1.00 13.11  ? 85  ASP E O   1 
ATOM   8533  C CB  . ASP E  1 85  ? 42.841  57.325  -4.826  1.00 13.37  ? 85  ASP E CB  1 
ATOM   8534  C CG  . ASP E  1 85  ? 43.273  56.726  -6.132  1.00 15.74  ? 85  ASP E CG  1 
ATOM   8535  O OD1 . ASP E  1 85  ? 42.651  56.900  -7.165  1.00 17.03  ? 85  ASP E OD1 1 
ATOM   8536  O OD2 . ASP E  1 85  ? 44.278  56.020  -6.117  1.00 17.99  ? 85  ASP E OD2 1 
ATOM   8537  N N   . LEU E  1 86  ? 41.955  59.266  -2.735  1.00 8.91   ? 86  LEU E N   1 
ATOM   8538  C CA  . LEU E  1 86  ? 41.641  59.531  -1.363  1.00 6.58   ? 86  LEU E CA  1 
ATOM   8539  C C   . LEU E  1 86  ? 41.623  61.021  -1.228  1.00 5.90   ? 86  LEU E C   1 
ATOM   8540  O O   . LEU E  1 86  ? 42.583  61.669  -1.636  1.00 7.24   ? 86  LEU E O   1 
ATOM   8541  C CB  . LEU E  1 86  ? 42.699  58.936  -0.478  1.00 5.85   ? 86  LEU E CB  1 
ATOM   8542  C CG  . LEU E  1 86  ? 42.402  59.024  0.970   1.00 5.40   ? 86  LEU E CG  1 
ATOM   8543  C CD1 . LEU E  1 86  ? 41.158  58.209  1.286   1.00 4.96   ? 86  LEU E CD1 1 
ATOM   8544  C CD2 . LEU E  1 86  ? 43.598  58.524  1.731   1.00 6.05   ? 86  LEU E CD2 1 
ATOM   8545  N N   . PHE E  1 87  ? 40.538  61.609  -0.773  1.00 4.47   ? 87  PHE E N   1 
ATOM   8546  C CA  . PHE E  1 87  ? 40.538  63.026  -0.511  1.00 3.51   ? 87  PHE E CA  1 
ATOM   8547  C C   . PHE E  1 87  ? 40.901  63.152  0.962   1.00 3.30   ? 87  PHE E C   1 
ATOM   8548  O O   . PHE E  1 87  ? 40.268  62.461  1.764   1.00 3.05   ? 87  PHE E O   1 
ATOM   8549  C CB  . PHE E  1 87  ? 39.149  63.548  -0.799  1.00 3.27   ? 87  PHE E CB  1 
ATOM   8550  C CG  . PHE E  1 87  ? 39.022  65.064  -0.734  1.00 3.05   ? 87  PHE E CG  1 
ATOM   8551  C CD1 . PHE E  1 87  ? 38.945  65.774  -1.915  1.00 2.96   ? 87  PHE E CD1 1 
ATOM   8552  C CD2 . PHE E  1 87  ? 39.041  65.729  0.486   1.00 2.56   ? 87  PHE E CD2 1 
ATOM   8553  C CE1 . PHE E  1 87  ? 38.837  67.147  -1.864  1.00 3.44   ? 87  PHE E CE1 1 
ATOM   8554  C CE2 . PHE E  1 87  ? 38.938  67.095  0.515   1.00 2.49   ? 87  PHE E CE2 1 
ATOM   8555  C CZ  . PHE E  1 87  ? 38.860  67.810  -0.662  1.00 2.70   ? 87  PHE E CZ  1 
ATOM   8556  N N   . VAL E  1 88  ? 41.895  63.945  1.375   1.00 3.00   ? 88  VAL E N   1 
ATOM   8557  C CA  . VAL E  1 88  ? 42.179  64.061  2.803   1.00 3.88   ? 88  VAL E CA  1 
ATOM   8558  C C   . VAL E  1 88  ? 41.588  65.349  3.331   1.00 5.18   ? 88  VAL E C   1 
ATOM   8559  O O   . VAL E  1 88  ? 41.902  66.417  2.810   1.00 6.27   ? 88  VAL E O   1 
ATOM   8560  C CB  . VAL E  1 88  ? 43.688  64.053  3.086   1.00 2.12   ? 88  VAL E CB  1 
ATOM   8561  C CG1 . VAL E  1 88  ? 43.922  64.199  4.573   1.00 2.00   ? 88  VAL E CG1 1 
ATOM   8562  C CG2 . VAL E  1 88  ? 44.287  62.729  2.650   1.00 2.35   ? 88  VAL E CG2 1 
ATOM   8563  N N   . GLU E  1 89  ? 40.703  65.257  4.311   1.00 6.21   ? 89  GLU E N   1 
ATOM   8564  C CA  . GLU E  1 89  ? 40.052  66.403  4.908   1.00 6.92   ? 89  GLU E CA  1 
ATOM   8565  C C   . GLU E  1 89  ? 40.801  66.796  6.172   1.00 7.60   ? 89  GLU E C   1 
ATOM   8566  O O   . GLU E  1 89  ? 41.013  65.975  7.082   1.00 8.12   ? 89  GLU E O   1 
ATOM   8567  C CB  . GLU E  1 89  ? 38.654  66.013  5.216   1.00 7.48   ? 89  GLU E CB  1 
ATOM   8568  C CG  . GLU E  1 89  ? 37.639  66.762  4.386   1.00 8.20   ? 89  GLU E CG  1 
ATOM   8569  C CD  . GLU E  1 89  ? 36.199  66.461  4.773   1.00 8.77   ? 89  GLU E CD  1 
ATOM   8570  O OE1 . GLU E  1 89  ? 35.323  66.619  3.913   1.00 9.02   ? 89  GLU E OE1 1 
ATOM   8571  O OE2 . GLU E  1 89  ? 35.929  66.000  5.897   1.00 8.94   ? 89  GLU E OE2 1 
ATOM   8572  N N   . ARG E  1 90  ? 41.202  68.043  6.265   1.00 8.60   ? 90  ARG E N   1 
ATOM   8573  C CA  . ARG E  1 90  ? 42.044  68.501  7.350   1.00 10.91  ? 90  ARG E CA  1 
ATOM   8574  C C   . ARG E  1 90  ? 41.235  69.121  8.436   1.00 13.21  ? 90  ARG E C   1 
ATOM   8575  O O   . ARG E  1 90  ? 40.280  69.841  8.146   1.00 13.78  ? 90  ARG E O   1 
ATOM   8576  C CB  . ARG E  1 90  ? 43.020  69.549  6.908   1.00 10.04  ? 90  ARG E CB  1 
ATOM   8577  C CG  . ARG E  1 90  ? 43.905  69.122  5.745   1.00 9.21   ? 90  ARG E CG  1 
ATOM   8578  C CD  . ARG E  1 90  ? 44.730  67.953  6.168   1.00 7.16   ? 90  ARG E CD  1 
ATOM   8579  N NE  . ARG E  1 90  ? 45.719  67.658  5.172   1.00 5.06   ? 90  ARG E NE  1 
ATOM   8580  C CZ  . ARG E  1 90  ? 46.563  66.661  5.356   1.00 5.49   ? 90  ARG E CZ  1 
ATOM   8581  N NH1 . ARG E  1 90  ? 47.465  66.423  4.428   1.00 5.89   ? 90  ARG E NH1 1 
ATOM   8582  N NH2 . ARG E  1 90  ? 46.495  65.888  6.440   1.00 5.83   ? 90  ARG E NH2 1 
ATOM   8583  N N   . SER E  1 91  ? 41.650  68.965  9.690   1.00 15.38  ? 91  SER E N   1 
ATOM   8584  C CA  . SER E  1 91  ? 40.892  69.483  10.817  1.00 17.29  ? 91  SER E CA  1 
ATOM   8585  C C   . SER E  1 91  ? 40.751  71.008  10.756  1.00 19.60  ? 91  SER E C   1 
ATOM   8586  O O   . SER E  1 91  ? 39.907  71.637  11.407  1.00 19.88  ? 91  SER E O   1 
ATOM   8587  C CB  . SER E  1 91  ? 41.602  69.093  12.098  1.00 16.59  ? 91  SER E CB  1 
ATOM   8588  O OG  . SER E  1 91  ? 42.849  69.810  12.221  1.00 17.24  ? 91  SER E OG  1 
ATOM   8589  N N   . LYS E  1 92  ? 41.682  71.635  10.038  1.00 21.70  ? 92  LYS E N   1 
ATOM   8590  C CA  . LYS E  1 92  ? 41.763  73.072  9.977   1.00 23.27  ? 92  LYS E CA  1 
ATOM   8591  C C   . LYS E  1 92  ? 40.976  73.602  8.825   1.00 23.08  ? 92  LYS E C   1 
ATOM   8592  O O   . LYS E  1 92  ? 41.241  74.736  8.453   1.00 23.97  ? 92  LYS E O   1 
ATOM   8593  C CB  . LYS E  1 92  ? 43.225  73.459  9.821   1.00 26.25  ? 92  LYS E CB  1 
ATOM   8594  C CG  . LYS E  1 92  ? 44.207  72.784  10.810  1.00 29.55  ? 92  LYS E CG  1 
ATOM   8595  C CD  . LYS E  1 92  ? 44.581  73.654  12.036  1.00 31.69  ? 92  LYS E CD  1 
ATOM   8596  C CE  . LYS E  1 92  ? 43.391  73.977  12.962  1.00 33.14  ? 92  LYS E CE  1 
ATOM   8597  N NZ  . LYS E  1 92  ? 42.844  72.782  13.592  1.00 33.40  ? 92  LYS E NZ  1 
ATOM   8598  N N   . ALA E  1 93  ? 40.082  72.814  8.222   1.00 22.95  ? 93  ALA E N   1 
ATOM   8599  C CA  . ALA E  1 93  ? 39.370  73.269  7.034   1.00 22.86  ? 93  ALA E CA  1 
ATOM   8600  C C   . ALA E  1 93  ? 38.349  74.279  7.478   1.00 22.78  ? 93  ALA E C   1 
ATOM   8601  O O   . ALA E  1 93  ? 37.840  74.152  8.582   1.00 23.73  ? 93  ALA E O   1 
ATOM   8602  C CB  . ALA E  1 93  ? 38.622  72.142  6.343   1.00 22.44  ? 93  ALA E CB  1 
ATOM   8603  N N   . PHE E  1 94  ? 38.036  75.296  6.702   1.00 23.07  ? 94  PHE E N   1 
ATOM   8604  C CA  . PHE E  1 94  ? 37.056  76.263  7.142   1.00 22.89  ? 94  PHE E CA  1 
ATOM   8605  C C   . PHE E  1 94  ? 36.235  76.623  5.935   1.00 23.95  ? 94  PHE E C   1 
ATOM   8606  O O   . PHE E  1 94  ? 36.534  76.168  4.827   1.00 23.69  ? 94  PHE E O   1 
ATOM   8607  C CB  . PHE E  1 94  ? 37.743  77.517  7.708   1.00 22.48  ? 94  PHE E CB  1 
ATOM   8608  C CG  . PHE E  1 94  ? 38.463  78.407  6.709   1.00 22.47  ? 94  PHE E CG  1 
ATOM   8609  C CD1 . PHE E  1 94  ? 37.851  79.540  6.245   1.00 22.85  ? 94  PHE E CD1 1 
ATOM   8610  C CD2 . PHE E  1 94  ? 39.713  78.082  6.247   1.00 22.81  ? 94  PHE E CD2 1 
ATOM   8611  C CE1 . PHE E  1 94  ? 38.483  80.335  5.318   1.00 22.82  ? 94  PHE E CE1 1 
ATOM   8612  C CE2 . PHE E  1 94  ? 40.349  78.875  5.319   1.00 22.60  ? 94  PHE E CE2 1 
ATOM   8613  C CZ  . PHE E  1 94  ? 39.732  80.007  4.850   1.00 22.74  ? 94  PHE E CZ  1 
ATOM   8614  N N   . SER E  1 95  ? 35.244  77.466  6.114   1.00 25.32  ? 95  SER E N   1 
ATOM   8615  C CA  . SER E  1 95  ? 34.500  77.921  4.960   1.00 26.94  ? 95  SER E CA  1 
ATOM   8616  C C   . SER E  1 95  ? 34.190  79.367  5.236   1.00 27.29  ? 95  SER E C   1 
ATOM   8617  O O   . SER E  1 95  ? 34.100  79.805  6.393   1.00 26.89  ? 95  SER E O   1 
ATOM   8618  C CB  . SER E  1 95  ? 33.213  77.139  4.802   1.00 27.65  ? 95  SER E CB  1 
ATOM   8619  O OG  . SER E  1 95  ? 33.188  76.214  5.868   1.00 28.78  ? 95  SER E OG  1 
ATOM   8620  N N   . ASN E  1 96  ? 34.113  80.140  4.184   1.00 27.82  ? 96  ASN E N   1 
ATOM   8621  C CA  . ASN E  1 96  ? 33.776  81.519  4.303   1.00 28.57  ? 96  ASN E CA  1 
ATOM   8622  C C   . ASN E  1 96  ? 33.126  81.830  2.985   1.00 27.30  ? 96  ASN E C   1 
ATOM   8623  O O   . ASN E  1 96  ? 33.732  82.074  1.959   1.00 27.62  ? 96  ASN E O   1 
ATOM   8624  C CB  . ASN E  1 96  ? 35.024  82.386  4.555   1.00 31.71  ? 96  ASN E CB  1 
ATOM   8625  C CG  . ASN E  1 96  ? 36.111  82.304  3.484   1.00 34.74  ? 96  ASN E CG  1 
ATOM   8626  O OD1 . ASN E  1 96  ? 36.581  81.220  3.088   1.00 35.98  ? 96  ASN E OD1 1 
ATOM   8627  N ND2 . ASN E  1 96  ? 36.549  83.460  2.994   1.00 35.74  ? 96  ASN E ND2 1 
ATOM   8628  N N   . CYS E  1 97  ? 31.823  81.661  3.023   1.00 26.44  ? 97  CYS E N   1 
ATOM   8629  C CA  . CYS E  1 97  ? 30.945  81.996  1.925   1.00 24.88  ? 97  CYS E CA  1 
ATOM   8630  C C   . CYS E  1 97  ? 29.568  82.024  2.553   1.00 23.20  ? 97  CYS E C   1 
ATOM   8631  O O   . CYS E  1 97  ? 29.459  81.984  3.790   1.00 22.81  ? 97  CYS E O   1 
ATOM   8632  C CB  . CYS E  1 97  ? 31.045  80.949  0.803   1.00 25.73  ? 97  CYS E CB  1 
ATOM   8633  S SG  . CYS E  1 97  ? 30.138  81.337  -0.734  1.00 25.09  ? 97  CYS E SG  1 
ATOM   8634  N N   . TYR E  1 98  ? 28.506  82.114  1.771   1.00 21.74  ? 98  TYR E N   1 
ATOM   8635  C CA  . TYR E  1 98  ? 27.160  82.242  2.318   1.00 20.08  ? 98  TYR E CA  1 
ATOM   8636  C C   . TYR E  1 98  ? 26.872  81.093  3.265   1.00 19.20  ? 98  TYR E C   1 
ATOM   8637  O O   . TYR E  1 98  ? 27.345  79.982  2.995   1.00 20.48  ? 98  TYR E O   1 
ATOM   8638  C CB  . TYR E  1 98  ? 26.168  82.232  1.180   1.00 19.17  ? 98  TYR E CB  1 
ATOM   8639  C CG  . TYR E  1 98  ? 24.945  83.047  1.520   1.00 19.02  ? 98  TYR E CG  1 
ATOM   8640  C CD1 . TYR E  1 98  ? 24.725  84.253  0.905   1.00 18.75  ? 98  TYR E CD1 1 
ATOM   8641  C CD2 . TYR E  1 98  ? 24.018  82.567  2.408   1.00 19.23  ? 98  TYR E CD2 1 
ATOM   8642  C CE1 . TYR E  1 98  ? 23.582  84.968  1.170   1.00 19.09  ? 98  TYR E CE1 1 
ATOM   8643  C CE2 . TYR E  1 98  ? 22.876  83.279  2.673   1.00 19.36  ? 98  TYR E CE2 1 
ATOM   8644  C CZ  . TYR E  1 98  ? 22.647  84.477  2.048   1.00 19.22  ? 98  TYR E CZ  1 
ATOM   8645  O OH  . TYR E  1 98  ? 21.457  85.137  2.265   1.00 19.10  ? 98  TYR E OH  1 
ATOM   8646  N N   . PRO E  1 99  ? 26.292  81.330  4.451   1.00 17.39  ? 99  PRO E N   1 
ATOM   8647  C CA  . PRO E  1 99  ? 25.973  80.257  5.379   1.00 16.35  ? 99  PRO E CA  1 
ATOM   8648  C C   . PRO E  1 99  ? 25.016  79.263  4.748   1.00 16.20  ? 99  PRO E C   1 
ATOM   8649  O O   . PRO E  1 99  ? 23.934  79.648  4.299   1.00 17.41  ? 99  PRO E O   1 
ATOM   8650  C CB  . PRO E  1 99  ? 25.414  80.959  6.590   1.00 15.52  ? 99  PRO E CB  1 
ATOM   8651  C CG  . PRO E  1 99  ? 25.303  82.398  6.220   1.00 15.68  ? 99  PRO E CG  1 
ATOM   8652  C CD  . PRO E  1 99  ? 26.375  82.578  5.183   1.00 16.34  ? 99  PRO E CD  1 
ATOM   8653  N N   . TYR E  1 100 ? 25.397  77.995  4.653   1.00 15.34  ? 100 TYR E N   1 
ATOM   8654  C CA  . TYR E  1 100 ? 24.527  76.993  4.057   1.00 14.94  ? 100 TYR E CA  1 
ATOM   8655  C C   . TYR E  1 100 ? 24.381  75.845  5.014   1.00 15.29  ? 100 TYR E C   1 
ATOM   8656  O O   . TYR E  1 100 ? 25.168  75.782  5.967   1.00 15.36  ? 100 TYR E O   1 
ATOM   8657  C CB  . TYR E  1 100 ? 25.093  76.426  2.743   1.00 13.89  ? 100 TYR E CB  1 
ATOM   8658  C CG  . TYR E  1 100 ? 26.353  75.595  2.879   1.00 13.06  ? 100 TYR E CG  1 
ATOM   8659  C CD1 . TYR E  1 100 ? 27.585  76.201  2.933   1.00 13.85  ? 100 TYR E CD1 1 
ATOM   8660  C CD2 . TYR E  1 100 ? 26.256  74.241  2.989   1.00 11.82  ? 100 TYR E CD2 1 
ATOM   8661  C CE1 . TYR E  1 100 ? 28.723  75.440  3.102   1.00 13.83  ? 100 TYR E CE1 1 
ATOM   8662  C CE2 . TYR E  1 100 ? 27.383  73.491  3.167   1.00 12.38  ? 100 TYR E CE2 1 
ATOM   8663  C CZ  . TYR E  1 100 ? 28.616  74.077  3.223   1.00 12.95  ? 100 TYR E CZ  1 
ATOM   8664  O OH  . TYR E  1 100 ? 29.733  73.273  3.397   1.00 13.16  ? 100 TYR E OH  1 
ATOM   8665  N N   . ASP E  1 101 ? 23.437  74.945  4.770   1.00 15.71  ? 101 ASP E N   1 
ATOM   8666  C CA  . ASP E  1 101 ? 23.395  73.699  5.505   1.00 16.03  ? 101 ASP E CA  1 
ATOM   8667  C C   . ASP E  1 101 ? 23.017  72.631  4.506   1.00 14.70  ? 101 ASP E C   1 
ATOM   8668  O O   . ASP E  1 101 ? 22.387  72.902  3.481   1.00 14.54  ? 101 ASP E O   1 
ATOM   8669  C CB  . ASP E  1 101 ? 22.377  73.745  6.667   1.00 17.97  ? 101 ASP E CB  1 
ATOM   8670  C CG  . ASP E  1 101 ? 20.906  73.768  6.316   1.00 19.93  ? 101 ASP E CG  1 
ATOM   8671  O OD1 . ASP E  1 101 ? 20.315  72.704  6.153   1.00 20.91  ? 101 ASP E OD1 1 
ATOM   8672  O OD2 . ASP E  1 101 ? 20.339  74.847  6.211   1.00 21.58  ? 101 ASP E OD2 1 
ATOM   8673  N N   . VAL E  1 102 ? 23.500  71.416  4.685   1.00 13.47  ? 102 VAL E N   1 
ATOM   8674  C CA  . VAL E  1 102 ? 23.155  70.364  3.745   1.00 12.66  ? 102 VAL E CA  1 
ATOM   8675  C C   . VAL E  1 102 ? 22.355  69.317  4.501   1.00 12.08  ? 102 VAL E C   1 
ATOM   8676  O O   . VAL E  1 102 ? 22.928  68.598  5.333   1.00 11.82  ? 102 VAL E O   1 
ATOM   8677  C CB  . VAL E  1 102 ? 24.382  69.661  3.161   1.00 12.94  ? 102 VAL E CB  1 
ATOM   8678  C CG1 . VAL E  1 102 ? 23.931  68.744  2.053   1.00 13.23  ? 102 VAL E CG1 1 
ATOM   8679  C CG2 . VAL E  1 102 ? 25.358  70.627  2.570   1.00 13.20  ? 102 VAL E CG2 1 
ATOM   8680  N N   . PRO E  1 103 ? 21.039  69.222  4.351   1.00 11.54  ? 103 PRO E N   1 
ATOM   8681  C CA  . PRO E  1 103 ? 20.251  68.214  5.025   1.00 11.41  ? 103 PRO E CA  1 
ATOM   8682  C C   . PRO E  1 103 ? 20.837  66.940  4.453   1.00 11.92  ? 103 PRO E C   1 
ATOM   8683  O O   . PRO E  1 103 ? 20.962  66.832  3.233   1.00 13.52  ? 103 PRO E O   1 
ATOM   8684  C CB  . PRO E  1 103 ? 18.845  68.489  4.587   1.00 11.11  ? 103 PRO E CB  1 
ATOM   8685  C CG  . PRO E  1 103 ? 18.854  69.924  4.120   1.00 10.89  ? 103 PRO E CG  1 
ATOM   8686  C CD  . PRO E  1 103 ? 20.213  70.051  3.485   1.00 11.64  ? 103 PRO E CD  1 
ATOM   8687  N N   . ASP E  1 104 ? 21.263  66.034  5.310   1.00 11.62  ? 104 ASP E N   1 
ATOM   8688  C CA  . ASP E  1 104 ? 21.957  64.810  4.929   1.00 12.61  ? 104 ASP E CA  1 
ATOM   8689  C C   . ASP E  1 104 ? 23.267  65.032  4.160   1.00 11.38  ? 104 ASP E C   1 
ATOM   8690  O O   . ASP E  1 104 ? 23.665  64.476  3.129   1.00 10.86  ? 104 ASP E O   1 
ATOM   8691  C CB  . ASP E  1 104 ? 21.077  63.854  4.112   1.00 15.38  ? 104 ASP E CB  1 
ATOM   8692  C CG  . ASP E  1 104 ? 21.670  62.434  4.030   1.00 18.89  ? 104 ASP E CG  1 
ATOM   8693  O OD1 . ASP E  1 104 ? 22.553  62.032  4.821   1.00 20.33  ? 104 ASP E OD1 1 
ATOM   8694  O OD2 . ASP E  1 104 ? 21.256  61.700  3.133   1.00 20.57  ? 104 ASP E OD2 1 
ATOM   8695  N N   . TYR E  1 105 ? 24.031  65.882  4.822   1.00 10.47  ? 105 TYR E N   1 
ATOM   8696  C CA  . TYR E  1 105 ? 25.411  66.176  4.529   1.00 8.72   ? 105 TYR E CA  1 
ATOM   8697  C C   . TYR E  1 105 ? 26.178  64.892  4.412   1.00 7.38   ? 105 TYR E C   1 
ATOM   8698  O O   . TYR E  1 105 ? 27.009  64.710  3.534   1.00 8.23   ? 105 TYR E O   1 
ATOM   8699  C CB  . TYR E  1 105 ? 25.914  66.992  5.663   1.00 9.37   ? 105 TYR E CB  1 
ATOM   8700  C CG  . TYR E  1 105 ? 27.270  67.574  5.457   1.00 9.74   ? 105 TYR E CG  1 
ATOM   8701  C CD1 . TYR E  1 105 ? 28.387  66.952  5.928   1.00 9.98   ? 105 TYR E CD1 1 
ATOM   8702  C CD2 . TYR E  1 105 ? 27.329  68.767  4.826   1.00 10.51  ? 105 TYR E CD2 1 
ATOM   8703  C CE1 . TYR E  1 105 ? 29.602  67.533  5.729   1.00 10.94  ? 105 TYR E CE1 1 
ATOM   8704  C CE2 . TYR E  1 105 ? 28.538  69.347  4.630   1.00 11.76  ? 105 TYR E CE2 1 
ATOM   8705  C CZ  . TYR E  1 105 ? 29.662  68.736  5.098   1.00 11.55  ? 105 TYR E CZ  1 
ATOM   8706  O OH  . TYR E  1 105 ? 30.862  69.379  4.918   1.00 13.67  ? 105 TYR E OH  1 
ATOM   8707  N N   . ALA E  1 106 ? 25.884  64.008  5.329   1.00 6.30   ? 106 ALA E N   1 
ATOM   8708  C CA  . ALA E  1 106 ? 26.496  62.714  5.366   1.00 6.30   ? 106 ALA E CA  1 
ATOM   8709  C C   . ALA E  1 106 ? 26.394  61.958  4.049   1.00 5.53   ? 106 ALA E C   1 
ATOM   8710  O O   . ALA E  1 106 ? 27.426  61.459  3.581   1.00 5.90   ? 106 ALA E O   1 
ATOM   8711  C CB  . ALA E  1 106 ? 25.826  61.925  6.439   1.00 8.09   ? 106 ALA E CB  1 
ATOM   8712  N N   . SER E  1 107 ? 25.233  61.861  3.409   1.00 3.43   ? 107 SER E N   1 
ATOM   8713  C CA  . SER E  1 107 ? 25.250  61.160  2.167   1.00 3.04   ? 107 SER E CA  1 
ATOM   8714  C C   . SER E  1 107 ? 25.905  61.943  1.051   1.00 3.76   ? 107 SER E C   1 
ATOM   8715  O O   . SER E  1 107 ? 26.640  61.288  0.306   1.00 4.42   ? 107 SER E O   1 
ATOM   8716  C CB  . SER E  1 107 ? 23.861  60.790  1.800   1.00 2.18   ? 107 SER E CB  1 
ATOM   8717  O OG  . SER E  1 107 ? 23.513  59.884  2.815   1.00 2.11   ? 107 SER E OG  1 
ATOM   8718  N N   . LEU E  1 108 ? 25.723  63.280  0.932   1.00 3.25   ? 108 LEU E N   1 
ATOM   8719  C CA  . LEU E  1 108 ? 26.344  64.050  -0.146  1.00 3.28   ? 108 LEU E CA  1 
ATOM   8720  C C   . LEU E  1 108 ? 27.868  63.894  -0.089  1.00 4.84   ? 108 LEU E C   1 
ATOM   8721  O O   . LEU E  1 108 ? 28.483  63.563  -1.123  1.00 6.43   ? 108 LEU E O   1 
ATOM   8722  C CB  . LEU E  1 108 ? 26.076  65.554  -0.057  1.00 3.57   ? 108 LEU E CB  1 
ATOM   8723  C CG  . LEU E  1 108 ? 25.641  66.419  -1.271  1.00 3.19   ? 108 LEU E CG  1 
ATOM   8724  C CD1 . LEU E  1 108 ? 25.928  67.870  -0.950  1.00 2.16   ? 108 LEU E CD1 1 
ATOM   8725  C CD2 . LEU E  1 108 ? 26.403  66.094  -2.518  1.00 2.82   ? 108 LEU E CD2 1 
ATOM   8726  N N   . ARG E  1 109 ? 28.503  64.052  1.094   1.00 3.79   ? 109 ARG E N   1 
ATOM   8727  C CA  . ARG E  1 109 ? 29.945  63.871  1.220   1.00 2.08   ? 109 ARG E CA  1 
ATOM   8728  C C   . ARG E  1 109 ? 30.309  62.480  0.782   1.00 2.00   ? 109 ARG E C   1 
ATOM   8729  O O   . ARG E  1 109 ? 31.303  62.349  0.078   1.00 2.64   ? 109 ARG E O   1 
ATOM   8730  C CB  . ARG E  1 109 ? 30.410  64.049  2.646   1.00 2.00   ? 109 ARG E CB  1 
ATOM   8731  C CG  . ARG E  1 109 ? 31.922  64.025  2.835   1.00 2.07   ? 109 ARG E CG  1 
ATOM   8732  C CD  . ARG E  1 109 ? 32.299  64.295  4.288   1.00 2.28   ? 109 ARG E CD  1 
ATOM   8733  N NE  . ARG E  1 109 ? 32.774  63.099  4.969   1.00 2.81   ? 109 ARG E NE  1 
ATOM   8734  C CZ  . ARG E  1 109 ? 34.075  62.955  5.282   1.00 2.90   ? 109 ARG E CZ  1 
ATOM   8735  N NH1 . ARG E  1 109 ? 34.519  61.873  5.949   1.00 2.90   ? 109 ARG E NH1 1 
ATOM   8736  N NH2 . ARG E  1 109 ? 34.933  63.885  4.894   1.00 2.17   ? 109 ARG E NH2 1 
ATOM   8737  N N   . SER E  1 110 ? 29.504  61.452  1.144   1.00 2.57   ? 110 SER E N   1 
ATOM   8738  C CA  . SER E  1 110 ? 29.813  60.073  0.739   1.00 2.63   ? 110 SER E CA  1 
ATOM   8739  C C   . SER E  1 110 ? 29.767  59.929  -0.762  1.00 3.49   ? 110 SER E C   1 
ATOM   8740  O O   . SER E  1 110 ? 30.783  59.536  -1.356  1.00 3.10   ? 110 SER E O   1 
ATOM   8741  C CB  . SER E  1 110 ? 28.850  58.969  1.230   1.00 2.28   ? 110 SER E CB  1 
ATOM   8742  O OG  . SER E  1 110 ? 29.134  57.682  0.658   1.00 2.08   ? 110 SER E OG  1 
ATOM   8743  N N   . LEU E  1 111 ? 28.642  60.290  -1.408  1.00 3.85   ? 111 LEU E N   1 
ATOM   8744  C CA  . LEU E  1 111 ? 28.557  59.923  -2.795  1.00 3.52   ? 111 LEU E CA  1 
ATOM   8745  C C   . LEU E  1 111 ? 29.460  60.750  -3.660  1.00 4.38   ? 111 LEU E C   1 
ATOM   8746  O O   . LEU E  1 111 ? 29.885  60.212  -4.694  1.00 4.82   ? 111 LEU E O   1 
ATOM   8747  C CB  . LEU E  1 111 ? 27.129  59.993  -3.281  1.00 2.49   ? 111 LEU E CB  1 
ATOM   8748  C CG  . LEU E  1 111 ? 26.303  61.204  -3.210  1.00 2.57   ? 111 LEU E CG  1 
ATOM   8749  C CD1 . LEU E  1 111 ? 26.235  61.915  -4.544  1.00 2.99   ? 111 LEU E CD1 1 
ATOM   8750  C CD2 . LEU E  1 111 ? 24.921  60.744  -2.809  1.00 2.97   ? 111 LEU E CD2 1 
ATOM   8751  N N   . VAL E  1 112 ? 29.834  61.972  -3.231  1.00 3.84   ? 112 VAL E N   1 
ATOM   8752  C CA  . VAL E  1 112 ? 30.824  62.730  -3.981  1.00 4.13   ? 112 VAL E CA  1 
ATOM   8753  C C   . VAL E  1 112 ? 32.174  62.046  -3.807  1.00 4.71   ? 112 VAL E C   1 
ATOM   8754  O O   . VAL E  1 112 ? 32.844  61.714  -4.794  1.00 4.40   ? 112 VAL E O   1 
ATOM   8755  C CB  . VAL E  1 112 ? 30.872  64.151  -3.455  1.00 3.79   ? 112 VAL E CB  1 
ATOM   8756  C CG1 . VAL E  1 112 ? 31.980  64.946  -4.104  1.00 3.68   ? 112 VAL E CG1 1 
ATOM   8757  C CG2 . VAL E  1 112 ? 29.576  64.833  -3.829  1.00 4.22   ? 112 VAL E CG2 1 
ATOM   8758  N N   . ALA E  1 113 ? 32.515  61.718  -2.560  1.00 5.33   ? 113 ALA E N   1 
ATOM   8759  C CA  . ALA E  1 113 ? 33.781  61.098  -2.237  1.00 6.45   ? 113 ALA E CA  1 
ATOM   8760  C C   . ALA E  1 113 ? 34.019  59.764  -2.903  1.00 7.50   ? 113 ALA E C   1 
ATOM   8761  O O   . ALA E  1 113 ? 35.184  59.438  -3.120  1.00 7.70   ? 113 ALA E O   1 
ATOM   8762  C CB  . ALA E  1 113 ? 33.923  60.847  -0.753  1.00 6.73   ? 113 ALA E CB  1 
ATOM   8763  N N   . SER E  1 114 ? 32.997  58.958  -3.185  1.00 9.38   ? 114 SER E N   1 
ATOM   8764  C CA  . SER E  1 114 ? 33.237  57.710  -3.884  1.00 11.84  ? 114 SER E CA  1 
ATOM   8765  C C   . SER E  1 114 ? 33.312  57.969  -5.366  1.00 12.96  ? 114 SER E C   1 
ATOM   8766  O O   . SER E  1 114 ? 34.051  57.266  -6.062  1.00 16.13  ? 114 SER E O   1 
ATOM   8767  C CB  . SER E  1 114 ? 32.144  56.714  -3.685  1.00 12.81  ? 114 SER E CB  1 
ATOM   8768  O OG  . SER E  1 114 ? 31.689  56.751  -2.333  1.00 15.58  ? 114 SER E OG  1 
ATOM   8769  N N   . SER E  1 115 ? 32.594  58.962  -5.887  1.00 12.44  ? 115 SER E N   1 
ATOM   8770  C CA  . SER E  1 115 ? 32.657  59.271  -7.298  1.00 12.57  ? 115 SER E CA  1 
ATOM   8771  C C   . SER E  1 115 ? 34.076  59.597  -7.633  1.00 12.45  ? 115 SER E C   1 
ATOM   8772  O O   . SER E  1 115 ? 34.558  59.181  -8.673  1.00 13.54  ? 115 SER E O   1 
ATOM   8773  C CB  . SER E  1 115 ? 31.813  60.452  -7.615  1.00 14.38  ? 115 SER E CB  1 
ATOM   8774  O OG  . SER E  1 115 ? 31.593  60.639  -9.008  1.00 15.62  ? 115 SER E OG  1 
ATOM   8775  N N   . GLY E  1 116 ? 34.764  60.331  -6.770  1.00 12.61  ? 116 GLY E N   1 
ATOM   8776  C CA  . GLY E  1 116 ? 36.185  60.571  -6.965  1.00 13.62  ? 116 GLY E CA  1 
ATOM   8777  C C   . GLY E  1 116 ? 36.536  61.709  -7.917  1.00 14.35  ? 116 GLY E C   1 
ATOM   8778  O O   . GLY E  1 116 ? 37.718  62.035  -8.106  1.00 15.11  ? 116 GLY E O   1 
ATOM   8779  N N   . THR E  1 117 ? 35.542  62.384  -8.490  1.00 13.93  ? 117 THR E N   1 
ATOM   8780  C CA  . THR E  1 117 ? 35.790  63.432  -9.452  1.00 13.31  ? 117 THR E CA  1 
ATOM   8781  C C   . THR E  1 117 ? 34.928  64.602  -9.060  1.00 13.77  ? 117 THR E C   1 
ATOM   8782  O O   . THR E  1 117 ? 33.907  64.433  -8.399  1.00 14.29  ? 117 THR E O   1 
ATOM   8783  C CB  . THR E  1 117 ? 35.423  62.935  -10.861 1.00 13.41  ? 117 THR E CB  1 
ATOM   8784  O OG1 . THR E  1 117 ? 35.640  64.003  -11.764 1.00 11.73  ? 117 THR E OG1 1 
ATOM   8785  C CG2 . THR E  1 117 ? 33.974  62.455  -10.932 1.00 14.08  ? 117 THR E CG2 1 
ATOM   8786  N N   . LEU E  1 118 ? 35.365  65.776  -9.457  1.00 14.65  ? 118 LEU E N   1 
ATOM   8787  C CA  . LEU E  1 118 ? 34.656  67.011  -9.212  1.00 15.09  ? 118 LEU E CA  1 
ATOM   8788  C C   . LEU E  1 118 ? 34.492  67.759  -10.553 1.00 16.89  ? 118 LEU E C   1 
ATOM   8789  O O   . LEU E  1 118 ? 34.288  68.981  -10.575 1.00 16.81  ? 118 LEU E O   1 
ATOM   8790  C CB  . LEU E  1 118 ? 35.508  67.744  -8.178  1.00 13.98  ? 118 LEU E CB  1 
ATOM   8791  C CG  . LEU E  1 118 ? 34.906  68.441  -6.981  1.00 13.25  ? 118 LEU E CG  1 
ATOM   8792  C CD1 . LEU E  1 118 ? 33.951  67.506  -6.303  1.00 13.40  ? 118 LEU E CD1 1 
ATOM   8793  C CD2 . LEU E  1 118 ? 35.993  68.839  -5.987  1.00 12.73  ? 118 LEU E CD2 1 
ATOM   8794  N N   . GLU E  1 119 ? 34.679  67.008  -11.667 1.00 18.66  ? 119 GLU E N   1 
ATOM   8795  C CA  . GLU E  1 119 ? 34.560  67.476  -13.050 1.00 20.27  ? 119 GLU E CA  1 
ATOM   8796  C C   . GLU E  1 119 ? 33.235  68.115  -13.334 1.00 19.71  ? 119 GLU E C   1 
ATOM   8797  O O   . GLU E  1 119 ? 32.209  67.434  -13.319 1.00 19.76  ? 119 GLU E O   1 
ATOM   8798  C CB  . GLU E  1 119 ? 34.674  66.356  -14.039 1.00 23.63  ? 119 GLU E CB  1 
ATOM   8799  C CG  . GLU E  1 119 ? 36.062  65.827  -14.255 1.00 27.63  ? 119 GLU E CG  1 
ATOM   8800  C CD  . GLU E  1 119 ? 36.078  64.472  -14.931 1.00 29.88  ? 119 GLU E CD  1 
ATOM   8801  O OE1 . GLU E  1 119 ? 36.823  63.590  -14.481 1.00 30.35  ? 119 GLU E OE1 1 
ATOM   8802  O OE2 . GLU E  1 119 ? 35.282  64.213  -15.865 1.00 31.80  ? 119 GLU E OE2 1 
ATOM   8803  N N   . PHE E  1 120 ? 33.248  69.390  -13.657 1.00 20.09  ? 120 PHE E N   1 
ATOM   8804  C CA  . PHE E  1 120 ? 32.000  70.098  -13.859 1.00 20.16  ? 120 PHE E CA  1 
ATOM   8805  C C   . PHE E  1 120 ? 31.767  70.494  -15.295 1.00 19.89  ? 120 PHE E C   1 
ATOM   8806  O O   . PHE E  1 120 ? 32.628  71.050  -15.988 1.00 20.25  ? 120 PHE E O   1 
ATOM   8807  C CB  . PHE E  1 120 ? 31.971  71.345  -12.984 1.00 20.17  ? 120 PHE E CB  1 
ATOM   8808  C CG  . PHE E  1 120 ? 30.596  71.968  -12.879 1.00 20.82  ? 120 PHE E CG  1 
ATOM   8809  C CD1 . PHE E  1 120 ? 29.563  71.274  -12.300 1.00 21.23  ? 120 PHE E CD1 1 
ATOM   8810  C CD2 . PHE E  1 120 ? 30.377  73.231  -13.371 1.00 21.00  ? 120 PHE E CD2 1 
ATOM   8811  C CE1 . PHE E  1 120 ? 28.315  71.847  -12.219 1.00 21.39  ? 120 PHE E CE1 1 
ATOM   8812  C CE2 . PHE E  1 120 ? 29.127  73.802  -13.288 1.00 20.70  ? 120 PHE E CE2 1 
ATOM   8813  C CZ  . PHE E  1 120 ? 28.094  73.112  -12.713 1.00 20.94  ? 120 PHE E CZ  1 
ATOM   8814  N N   . ILE E  1 121 ? 30.568  70.220  -15.749 1.00 19.65  ? 121 ILE E N   1 
ATOM   8815  C CA  . ILE E  1 121 ? 30.165  70.590  -17.087 1.00 19.84  ? 121 ILE E CA  1 
ATOM   8816  C C   . ILE E  1 121 ? 29.125  71.695  -16.939 1.00 20.11  ? 121 ILE E C   1 
ATOM   8817  O O   . ILE E  1 121 ? 28.117  71.500  -16.254 1.00 20.40  ? 121 ILE E O   1 
ATOM   8818  C CB  . ILE E  1 121 ? 29.562  69.352  -17.789 1.00 19.64  ? 121 ILE E CB  1 
ATOM   8819  C CG1 . ILE E  1 121 ? 30.501  68.159  -17.758 1.00 19.68  ? 121 ILE E CG1 1 
ATOM   8820  C CG2 . ILE E  1 121 ? 29.237  69.737  -19.206 1.00 19.01  ? 121 ILE E CG2 1 
ATOM   8821  C CD1 . ILE E  1 121 ? 31.916  68.409  -18.308 1.00 20.57  ? 121 ILE E CD1 1 
ATOM   8822  N N   . THR E  1 122 ? 29.339  72.877  -17.494 1.00 20.44  ? 122 THR E N   1 
ATOM   8823  C CA  . THR E  1 122 ? 28.341  73.921  -17.383 1.00 20.51  ? 122 THR E CA  1 
ATOM   8824  C C   . THR E  1 122 ? 27.237  73.699  -18.402 1.00 21.65  ? 122 THR E C   1 
ATOM   8825  O O   . THR E  1 122 ? 27.534  73.366  -19.549 1.00 23.12  ? 122 THR E O   1 
ATOM   8826  C CB  . THR E  1 122 ? 29.004  75.265  -17.617 1.00 19.90  ? 122 THR E CB  1 
ATOM   8827  O OG1 . THR E  1 122 ? 30.025  75.418  -16.651 1.00 19.53  ? 122 THR E OG1 1 
ATOM   8828  C CG2 . THR E  1 122 ? 28.039  76.404  -17.452 1.00 20.28  ? 122 THR E CG2 1 
ATOM   8829  N N   . GLU E  1 123 ? 25.976  73.861  -18.047 1.00 22.40  ? 123 GLU E N   1 
ATOM   8830  C CA  . GLU E  1 123 ? 24.929  73.654  -19.021 1.00 23.78  ? 123 GLU E CA  1 
ATOM   8831  C C   . GLU E  1 123 ? 24.233  74.953  -19.307 1.00 25.02  ? 123 GLU E C   1 
ATOM   8832  O O   . GLU E  1 123 ? 24.169  75.855  -18.467 1.00 26.24  ? 123 GLU E O   1 
ATOM   8833  C CB  . GLU E  1 123 ? 23.909  72.636  -18.525 1.00 23.28  ? 123 GLU E CB  1 
ATOM   8834  C CG  . GLU E  1 123 ? 24.469  71.264  -18.769 1.00 23.86  ? 123 GLU E CG  1 
ATOM   8835  C CD  . GLU E  1 123 ? 23.561  70.124  -18.425 1.00 23.90  ? 123 GLU E CD  1 
ATOM   8836  O OE1 . GLU E  1 123 ? 23.379  69.254  -19.269 1.00 24.64  ? 123 GLU E OE1 1 
ATOM   8837  O OE2 . GLU E  1 123 ? 23.079  70.047  -17.311 1.00 23.70  ? 123 GLU E OE2 1 
ATOM   8838  N N   . GLY E  1 124 ? 23.670  75.062  -20.496 1.00 25.85  ? 124 GLY E N   1 
ATOM   8839  C CA  . GLY E  1 124 ? 23.003  76.278  -20.910 1.00 26.81  ? 124 GLY E CA  1 
ATOM   8840  C C   . GLY E  1 124 ? 21.622  76.438  -20.309 1.00 27.78  ? 124 GLY E C   1 
ATOM   8841  O O   . GLY E  1 124 ? 20.622  76.296  -21.012 1.00 29.45  ? 124 GLY E O   1 
ATOM   8842  N N   . PHE E  1 125 ? 21.516  76.677  -19.011 1.00 28.13  ? 125 PHE E N   1 
ATOM   8843  C CA  . PHE E  1 125 ? 20.217  76.924  -18.413 1.00 28.62  ? 125 PHE E CA  1 
ATOM   8844  C C   . PHE E  1 125 ? 19.808  78.330  -18.781 1.00 29.04  ? 125 PHE E C   1 
ATOM   8845  O O   . PHE E  1 125 ? 20.660  79.211  -18.843 1.00 29.41  ? 125 PHE E O   1 
ATOM   8846  C CB  . PHE E  1 125 ? 20.294  76.783  -16.902 1.00 28.15  ? 125 PHE E CB  1 
ATOM   8847  C CG  . PHE E  1 125 ? 20.264  75.337  -16.470 1.00 27.47  ? 125 PHE E CG  1 
ATOM   8848  C CD1 . PHE E  1 125 ? 21.428  74.720  -16.105 1.00 27.32  ? 125 PHE E CD1 1 
ATOM   8849  C CD2 . PHE E  1 125 ? 19.070  74.662  -16.470 1.00 27.55  ? 125 PHE E CD2 1 
ATOM   8850  C CE1 . PHE E  1 125 ? 21.404  73.403  -15.742 1.00 27.84  ? 125 PHE E CE1 1 
ATOM   8851  C CE2 . PHE E  1 125 ? 19.057  73.348  -16.100 1.00 27.79  ? 125 PHE E CE2 1 
ATOM   8852  C CZ  . PHE E  1 125 ? 20.220  72.719  -15.738 1.00 27.99  ? 125 PHE E CZ  1 
ATOM   8853  N N   . THR E  1 126 ? 18.542  78.595  -19.064 1.00 30.12  ? 126 THR E N   1 
ATOM   8854  C CA  . THR E  1 126 ? 18.160  79.946  -19.439 1.00 31.14  ? 126 THR E CA  1 
ATOM   8855  C C   . THR E  1 126 ? 17.067  80.434  -18.530 1.00 29.86  ? 126 THR E C   1 
ATOM   8856  O O   . THR E  1 126 ? 15.917  80.014  -18.601 1.00 29.44  ? 126 THR E O   1 
ATOM   8857  C CB  . THR E  1 126 ? 17.742  79.935  -20.936 1.00 32.85  ? 126 THR E CB  1 
ATOM   8858  O OG1 . THR E  1 126 ? 17.025  78.714  -21.127 1.00 35.50  ? 126 THR E OG1 1 
ATOM   8859  C CG2 . THR E  1 126 ? 18.936  80.002  -21.917 1.00 32.91  ? 126 THR E CG2 1 
ATOM   8860  N N   . TRP E  1 127 ? 17.425  81.290  -17.602 1.00 29.85  ? 127 TRP E N   1 
ATOM   8861  C CA  . TRP E  1 127 ? 16.470  81.762  -16.628 1.00 30.37  ? 127 TRP E CA  1 
ATOM   8862  C C   . TRP E  1 127 ? 15.750  82.989  -17.169 1.00 31.56  ? 127 TRP E C   1 
ATOM   8863  O O   . TRP E  1 127 ? 16.256  84.113  -17.152 1.00 31.96  ? 127 TRP E O   1 
ATOM   8864  C CB  . TRP E  1 127 ? 17.252  82.025  -15.333 1.00 29.50  ? 127 TRP E CB  1 
ATOM   8865  C CG  . TRP E  1 127 ? 17.971  80.761  -14.909 1.00 28.98  ? 127 TRP E CG  1 
ATOM   8866  C CD1 . TRP E  1 127 ? 19.320  80.639  -15.081 1.00 29.25  ? 127 TRP E CD1 1 
ATOM   8867  C CD2 . TRP E  1 127 ? 17.388  79.610  -14.451 1.00 28.80  ? 127 TRP E CD2 1 
ATOM   8868  N NE1 . TRP E  1 127 ? 19.597  79.407  -14.758 1.00 29.48  ? 127 TRP E NE1 1 
ATOM   8869  C CE2 . TRP E  1 127 ? 18.479  78.760  -14.379 1.00 29.28  ? 127 TRP E CE2 1 
ATOM   8870  C CE3 . TRP E  1 127 ? 16.135  79.160  -14.107 1.00 28.03  ? 127 TRP E CE3 1 
ATOM   8871  C CZ2 . TRP E  1 127 ? 18.327  77.452  -13.973 1.00 28.74  ? 127 TRP E CZ2 1 
ATOM   8872  C CZ3 . TRP E  1 127 ? 15.986  77.856  -13.703 1.00 27.86  ? 127 TRP E CZ3 1 
ATOM   8873  C CH2 . TRP E  1 127 ? 17.070  77.011  -13.637 1.00 28.25  ? 127 TRP E CH2 1 
ATOM   8874  N N   . THR E  1 128 ? 14.572  82.805  -17.754 1.00 32.81  ? 128 THR E N   1 
ATOM   8875  C CA  . THR E  1 128 ? 13.822  83.919  -18.335 1.00 33.19  ? 128 THR E CA  1 
ATOM   8876  C C   . THR E  1 128 ? 12.989  84.712  -17.360 1.00 32.41  ? 128 THR E C   1 
ATOM   8877  O O   . THR E  1 128 ? 12.029  84.205  -16.782 1.00 32.15  ? 128 THR E O   1 
ATOM   8878  C CB  . THR E  1 128 ? 12.879  83.452  -19.448 1.00 33.80  ? 128 THR E CB  1 
ATOM   8879  O OG1 . THR E  1 128 ? 12.817  82.035  -19.427 1.00 35.86  ? 128 THR E OG1 1 
ATOM   8880  C CG2 . THR E  1 128 ? 13.343  83.945  -20.774 1.00 34.47  ? 128 THR E CG2 1 
ATOM   8881  N N   . GLY E  1 129 ? 13.358  85.955  -17.144 1.00 32.21  ? 129 GLY E N   1 
ATOM   8882  C CA  . GLY E  1 129 ? 12.534  86.813  -16.322 1.00 31.37  ? 129 GLY E CA  1 
ATOM   8883  C C   . GLY E  1 129 ? 13.022  86.980  -14.902 1.00 31.01  ? 129 GLY E C   1 
ATOM   8884  O O   . GLY E  1 129 ? 12.284  87.483  -14.067 1.00 30.27  ? 129 GLY E O   1 
ATOM   8885  N N   . VAL E  1 130 ? 14.258  86.603  -14.598 1.00 31.28  ? 130 VAL E N   1 
ATOM   8886  C CA  . VAL E  1 130 ? 14.818  86.791  -13.280 1.00 30.35  ? 130 VAL E CA  1 
ATOM   8887  C C   . VAL E  1 130 ? 16.224  87.310  -13.447 1.00 30.76  ? 130 VAL E C   1 
ATOM   8888  O O   . VAL E  1 130 ? 16.785  87.243  -14.547 1.00 30.68  ? 130 VAL E O   1 
ATOM   8889  C CB  . VAL E  1 130 ? 14.885  85.481  -12.463 1.00 29.92  ? 130 VAL E CB  1 
ATOM   8890  C CG1 . VAL E  1 130 ? 13.494  85.090  -12.021 1.00 29.69  ? 130 VAL E CG1 1 
ATOM   8891  C CG2 . VAL E  1 130 ? 15.515  84.378  -13.269 1.00 29.74  ? 130 VAL E CG2 1 
ATOM   8892  N N   . THR E  1 131 ? 16.746  87.898  -12.390 1.00 31.32  ? 131 THR E N   1 
ATOM   8893  C CA  . THR E  1 131 ? 18.114  88.342  -12.340 1.00 32.65  ? 131 THR E CA  1 
ATOM   8894  C C   . THR E  1 131 ? 19.041  87.224  -11.874 1.00 32.87  ? 131 THR E C   1 
ATOM   8895  O O   . THR E  1 131 ? 18.788  86.522  -10.892 1.00 32.57  ? 131 THR E O   1 
ATOM   8896  C CB  . THR E  1 131 ? 18.154  89.523  -11.422 1.00 33.14  ? 131 THR E CB  1 
ATOM   8897  O OG1 . THR E  1 131 ? 17.251  90.436  -12.021 1.00 33.76  ? 131 THR E OG1 1 
ATOM   8898  C CG2 . THR E  1 131 ? 19.549  90.104  -11.211 1.00 34.75  ? 131 THR E CG2 1 
ATOM   8899  N N   . GLN E  1 132 ? 20.124  87.035  -12.614 1.00 33.56  ? 132 GLN E N   1 
ATOM   8900  C CA  . GLN E  1 132 ? 21.088  85.993  -12.363 1.00 33.66  ? 132 GLN E CA  1 
ATOM   8901  C C   . GLN E  1 132 ? 22.307  86.524  -11.681 1.00 32.56  ? 132 GLN E C   1 
ATOM   8902  O O   . GLN E  1 132 ? 22.449  87.718  -11.480 1.00 32.93  ? 132 GLN E O   1 
ATOM   8903  C CB  . GLN E  1 132 ? 21.561  85.367  -13.633 1.00 35.67  ? 132 GLN E CB  1 
ATOM   8904  C CG  . GLN E  1 132 ? 20.800  84.147  -14.012 1.00 38.19  ? 132 GLN E CG  1 
ATOM   8905  C CD  . GLN E  1 132 ? 21.345  83.605  -15.311 1.00 40.29  ? 132 GLN E CD  1 
ATOM   8906  O OE1 . GLN E  1 132 ? 20.571  83.254  -16.205 1.00 42.64  ? 132 GLN E OE1 1 
ATOM   8907  N NE2 . GLN E  1 132 ? 22.661  83.562  -15.529 1.00 40.31  ? 132 GLN E NE2 1 
ATOM   8908  N N   . ASN E  1 133 ? 23.158  85.591  -11.299 1.00 31.26  ? 133 ASN E N   1 
ATOM   8909  C CA  . ASN E  1 133 ? 24.467  85.869  -10.772 1.00 30.89  ? 133 ASN E CA  1 
ATOM   8910  C C   . ASN E  1 133 ? 24.556  86.634  -9.496  1.00 30.43  ? 133 ASN E C   1 
ATOM   8911  O O   . ASN E  1 133 ? 25.632  87.148  -9.201  1.00 30.35  ? 133 ASN E O   1 
ATOM   8912  C CB  . ASN E  1 133 ? 25.285  86.580  -11.806 1.00 32.25  ? 133 ASN E CB  1 
ATOM   8913  C CG  . ASN E  1 133 ? 25.825  85.546  -12.741 1.00 34.40  ? 133 ASN E CG  1 
ATOM   8914  O OD1 . ASN E  1 133 ? 25.066  84.740  -13.294 1.00 36.44  ? 133 ASN E OD1 1 
ATOM   8915  N ND2 . ASN E  1 133 ? 27.139  85.381  -12.840 1.00 34.88  ? 133 ASN E ND2 1 
ATOM   8916  N N   . GLY E  1 134 ? 23.477  86.650  -8.703  1.00 30.46  ? 134 GLY E N   1 
ATOM   8917  C CA  . GLY E  1 134 ? 23.487  87.292  -7.391  1.00 29.81  ? 134 GLY E CA  1 
ATOM   8918  C C   . GLY E  1 134 ? 24.602  86.723  -6.510  1.00 29.15  ? 134 GLY E C   1 
ATOM   8919  O O   . GLY E  1 134 ? 24.953  85.538  -6.615  1.00 29.89  ? 134 GLY E O   1 
ATOM   8920  N N   . GLY E  1 135 ? 25.147  87.559  -5.644  1.00 27.65  ? 135 GLY E N   1 
ATOM   8921  C CA  . GLY E  1 135 ? 26.232  87.156  -4.792  1.00 27.79  ? 135 GLY E CA  1 
ATOM   8922  C C   . GLY E  1 135 ? 26.028  87.805  -3.440  1.00 27.82  ? 135 GLY E C   1 
ATOM   8923  O O   . GLY E  1 135 ? 25.027  88.483  -3.220  1.00 26.83  ? 135 GLY E O   1 
ATOM   8924  N N   . SER E  1 136 ? 26.996  87.650  -2.559  1.00 28.68  ? 136 SER E N   1 
ATOM   8925  C CA  . SER E  1 136 ? 26.913  88.104  -1.203  1.00 29.78  ? 136 SER E CA  1 
ATOM   8926  C C   . SER E  1 136 ? 28.237  88.657  -0.778  1.00 31.87  ? 136 SER E C   1 
ATOM   8927  O O   . SER E  1 136 ? 29.303  88.235  -1.228  1.00 32.02  ? 136 SER E O   1 
ATOM   8928  C CB  . SER E  1 136 ? 26.580  86.980  -0.254  1.00 29.46  ? 136 SER E CB  1 
ATOM   8929  O OG  . SER E  1 136 ? 26.527  87.329  1.129   1.00 28.66  ? 136 SER E OG  1 
ATOM   8930  N N   . ASN E  1 137 ? 28.159  89.585  0.147   1.00 34.85  ? 137 ASN E N   1 
ATOM   8931  C CA  . ASN E  1 137 ? 29.343  90.198  0.659   1.00 36.85  ? 137 ASN E CA  1 
ATOM   8932  C C   . ASN E  1 137 ? 29.938  89.287  1.705   1.00 36.76  ? 137 ASN E C   1 
ATOM   8933  O O   . ASN E  1 137 ? 31.039  89.557  2.187   1.00 38.29  ? 137 ASN E O   1 
ATOM   8934  C CB  . ASN E  1 137 ? 28.999  91.549  1.241   1.00 39.99  ? 137 ASN E CB  1 
ATOM   8935  C CG  . ASN E  1 137 ? 30.236  92.442  1.268   1.00 42.76  ? 137 ASN E CG  1 
ATOM   8936  O OD1 . ASN E  1 137 ? 30.670  93.017  0.251   1.00 43.99  ? 137 ASN E OD1 1 
ATOM   8937  N ND2 . ASN E  1 137 ? 30.944  92.526  2.400   1.00 44.27  ? 137 ASN E ND2 1 
ATOM   8938  N N   . ALA E  1 138 ? 29.245  88.208  2.076   1.00 35.54  ? 138 ALA E N   1 
ATOM   8939  C CA  . ALA E  1 138 ? 29.824  87.193  2.947   1.00 34.28  ? 138 ALA E CA  1 
ATOM   8940  C C   . ALA E  1 138 ? 30.600  86.145  2.169   1.00 33.56  ? 138 ALA E C   1 
ATOM   8941  O O   . ALA E  1 138 ? 31.261  85.289  2.755   1.00 34.22  ? 138 ALA E O   1 
ATOM   8942  C CB  . ALA E  1 138 ? 28.767  86.453  3.719   1.00 33.59  ? 138 ALA E CB  1 
ATOM   8943  N N   . CYS E  1 139 ? 30.498  86.134  0.843   1.00 32.87  ? 139 CYS E N   1 
ATOM   8944  C CA  . CYS E  1 139 ? 31.204  85.176  0.025   1.00 32.67  ? 139 CYS E CA  1 
ATOM   8945  C C   . CYS E  1 139 ? 31.996  85.956  -0.988  1.00 34.49  ? 139 CYS E C   1 
ATOM   8946  O O   . CYS E  1 139 ? 31.548  86.127  -2.112  1.00 34.94  ? 139 CYS E O   1 
ATOM   8947  C CB  . CYS E  1 139 ? 30.207  84.288  -0.682  1.00 29.93  ? 139 CYS E CB  1 
ATOM   8948  S SG  . CYS E  1 139 ? 31.019  82.931  -1.563  1.00 26.75  ? 139 CYS E SG  1 
ATOM   8949  N N   . LYS E  1 140 ? 33.175  86.466  -0.655  1.00 36.77  ? 140 LYS E N   1 
ATOM   8950  C CA  . LYS E  1 140 ? 33.816  87.370  -1.585  1.00 39.57  ? 140 LYS E CA  1 
ATOM   8951  C C   . LYS E  1 140 ? 34.617  86.726  -2.689  1.00 41.16  ? 140 LYS E C   1 
ATOM   8952  O O   . LYS E  1 140 ? 35.390  85.798  -2.483  1.00 41.50  ? 140 LYS E O   1 
ATOM   8953  C CB  . LYS E  1 140 ? 34.703  88.330  -0.819  1.00 40.07  ? 140 LYS E CB  1 
ATOM   8954  C CG  . LYS E  1 140 ? 33.826  89.342  -0.116  1.00 40.83  ? 140 LYS E CG  1 
ATOM   8955  C CD  . LYS E  1 140 ? 34.615  90.527  0.391   1.00 42.19  ? 140 LYS E CD  1 
ATOM   8956  C CE  . LYS E  1 140 ? 33.685  91.734  0.434   1.00 43.02  ? 140 LYS E CE  1 
ATOM   8957  N NZ  . LYS E  1 140 ? 33.223  92.155  -0.896  1.00 43.78  ? 140 LYS E NZ  1 
ATOM   8958  N N   . ARG E  1 141 ? 34.367  87.156  -3.914  1.00 43.10  ? 141 ARG E N   1 
ATOM   8959  C CA  . ARG E  1 141 ? 35.196  86.735  -5.007  1.00 45.47  ? 141 ARG E CA  1 
ATOM   8960  C C   . ARG E  1 141 ? 36.148  87.902  -5.110  1.00 47.83  ? 141 ARG E C   1 
ATOM   8961  O O   . ARG E  1 141 ? 35.831  88.988  -5.615  1.00 48.63  ? 141 ARG E O   1 
ATOM   8962  C CB  . ARG E  1 141 ? 34.413  86.588  -6.306  1.00 45.63  ? 141 ARG E CB  1 
ATOM   8963  C CG  . ARG E  1 141 ? 33.640  85.286  -6.453  1.00 45.02  ? 141 ARG E CG  1 
ATOM   8964  C CD  . ARG E  1 141 ? 34.527  84.088  -6.701  1.00 43.63  ? 141 ARG E CD  1 
ATOM   8965  N NE  . ARG E  1 141 ? 33.830  82.940  -6.151  1.00 42.96  ? 141 ARG E NE  1 
ATOM   8966  C CZ  . ARG E  1 141 ? 34.055  81.701  -6.574  1.00 42.65  ? 141 ARG E CZ  1 
ATOM   8967  N NH1 . ARG E  1 141 ? 33.484  80.668  -5.965  1.00 42.36  ? 141 ARG E NH1 1 
ATOM   8968  N NH2 . ARG E  1 141 ? 34.769  81.469  -7.667  1.00 42.82  ? 141 ARG E NH2 1 
ATOM   8969  N N   . GLY E  1 142 ? 37.294  87.708  -4.483  1.00 50.11  ? 142 GLY E N   1 
ATOM   8970  C CA  . GLY E  1 142 ? 38.330  88.725  -4.462  1.00 52.77  ? 142 GLY E CA  1 
ATOM   8971  C C   . GLY E  1 142 ? 37.853  89.997  -3.752  1.00 54.15  ? 142 GLY E C   1 
ATOM   8972  O O   . GLY E  1 142 ? 37.427  89.961  -2.596  1.00 54.87  ? 142 GLY E O   1 
ATOM   8973  N N   . PRO E  1 143 ? 37.868  91.147  -4.422  1.00 54.66  ? 143 PRO E N   1 
ATOM   8974  C CA  . PRO E  1 143 ? 37.438  92.409  -3.835  1.00 54.42  ? 143 PRO E CA  1 
ATOM   8975  C C   . PRO E  1 143 ? 35.928  92.452  -3.619  1.00 53.91  ? 143 PRO E C   1 
ATOM   8976  O O   . PRO E  1 143 ? 35.403  92.938  -2.599  1.00 54.29  ? 143 PRO E O   1 
ATOM   8977  C CB  . PRO E  1 143 ? 37.954  93.409  -4.837  1.00 54.96  ? 143 PRO E CB  1 
ATOM   8978  C CG  . PRO E  1 143 ? 37.772  92.689  -6.173  1.00 54.92  ? 143 PRO E CG  1 
ATOM   8979  C CD  . PRO E  1 143 ? 38.253  91.291  -5.831  1.00 54.81  ? 143 PRO E CD  1 
ATOM   8980  N N   . GLY E  1 144 ? 35.209  91.870  -4.581  1.00 52.81  ? 144 GLY E N   1 
ATOM   8981  C CA  . GLY E  1 144 ? 33.771  92.004  -4.626  1.00 50.74  ? 144 GLY E CA  1 
ATOM   8982  C C   . GLY E  1 144 ? 32.999  90.970  -3.842  1.00 47.94  ? 144 GLY E C   1 
ATOM   8983  O O   . GLY E  1 144 ? 33.523  90.188  -3.047  1.00 46.84  ? 144 GLY E O   1 
ATOM   8984  N N   . SER E  1 145 ? 31.703  91.119  -3.936  1.00 45.94  ? 145 SER E N   1 
ATOM   8985  C CA  . SER E  1 145 ? 30.802  90.128  -3.420  1.00 44.31  ? 145 SER E CA  1 
ATOM   8986  C C   . SER E  1 145 ? 30.809  88.949  -4.371  1.00 42.00  ? 145 SER E C   1 
ATOM   8987  O O   . SER E  1 145 ? 31.251  89.102  -5.521  1.00 43.40  ? 145 SER E O   1 
ATOM   8988  C CB  . SER E  1 145 ? 29.478  90.789  -3.333  1.00 45.22  ? 145 SER E CB  1 
ATOM   8989  O OG  . SER E  1 145 ? 29.708  91.747  -2.307  1.00 47.55  ? 145 SER E OG  1 
ATOM   8990  N N   . GLY E  1 146 ? 30.410  87.763  -3.931  1.00 38.09  ? 146 GLY E N   1 
ATOM   8991  C CA  . GLY E  1 146 ? 30.390  86.619  -4.823  1.00 33.55  ? 146 GLY E CA  1 
ATOM   8992  C C   . GLY E  1 146 ? 29.571  85.500  -4.232  1.00 30.13  ? 146 GLY E C   1 
ATOM   8993  O O   . GLY E  1 146 ? 28.841  85.702  -3.258  1.00 30.09  ? 146 GLY E O   1 
ATOM   8994  N N   . PHE E  1 147 ? 29.686  84.316  -4.804  1.00 26.62  ? 147 PHE E N   1 
ATOM   8995  C CA  . PHE E  1 147 ? 28.910  83.189  -4.354  1.00 23.06  ? 147 PHE E CA  1 
ATOM   8996  C C   . PHE E  1 147 ? 29.708  81.960  -4.672  1.00 21.63  ? 147 PHE E C   1 
ATOM   8997  O O   . PHE E  1 147 ? 30.862  82.031  -5.124  1.00 23.15  ? 147 PHE E O   1 
ATOM   8998  C CB  . PHE E  1 147 ? 27.609  83.183  -5.098  1.00 21.71  ? 147 PHE E CB  1 
ATOM   8999  C CG  . PHE E  1 147 ? 26.419  82.616  -4.357  1.00 20.32  ? 147 PHE E CG  1 
ATOM   9000  C CD1 . PHE E  1 147 ? 25.970  83.217  -3.211  1.00 19.06  ? 147 PHE E CD1 1 
ATOM   9001  C CD2 . PHE E  1 147 ? 25.773  81.501  -4.863  1.00 20.80  ? 147 PHE E CD2 1 
ATOM   9002  C CE1 . PHE E  1 147 ? 24.869  82.704  -2.583  1.00 19.25  ? 147 PHE E CE1 1 
ATOM   9003  C CE2 . PHE E  1 147 ? 24.660  80.990  -4.224  1.00 19.85  ? 147 PHE E CE2 1 
ATOM   9004  C CZ  . PHE E  1 147 ? 24.214  81.595  -3.080  1.00 19.60  ? 147 PHE E CZ  1 
ATOM   9005  N N   . PHE E  1 148 ? 29.106  80.826  -4.412  1.00 19.42  ? 148 PHE E N   1 
ATOM   9006  C CA  . PHE E  1 148 ? 29.692  79.556  -4.760  1.00 19.08  ? 148 PHE E CA  1 
ATOM   9007  C C   . PHE E  1 148 ? 29.882  79.509  -6.281  1.00 18.50  ? 148 PHE E C   1 
ATOM   9008  O O   . PHE E  1 148 ? 28.966  79.912  -6.986  1.00 19.01  ? 148 PHE E O   1 
ATOM   9009  C CB  . PHE E  1 148 ? 28.748  78.451  -4.300  1.00 18.43  ? 148 PHE E CB  1 
ATOM   9010  C CG  . PHE E  1 148 ? 28.485  78.446  -2.801  1.00 17.61  ? 148 PHE E CG  1 
ATOM   9011  C CD1 . PHE E  1 148 ? 27.350  79.047  -2.296  1.00 17.11  ? 148 PHE E CD1 1 
ATOM   9012  C CD2 . PHE E  1 148 ? 29.379  77.836  -1.957  1.00 17.09  ? 148 PHE E CD2 1 
ATOM   9013  C CE1 . PHE E  1 148 ? 27.100  79.034  -0.950  1.00 16.29  ? 148 PHE E CE1 1 
ATOM   9014  C CE2 . PHE E  1 148 ? 29.115  77.828  -0.608  1.00 16.83  ? 148 PHE E CE2 1 
ATOM   9015  C CZ  . PHE E  1 148 ? 27.985  78.427  -0.108  1.00 16.30  ? 148 PHE E CZ  1 
ATOM   9016  N N   . SER E  1 149 ? 31.004  79.054  -6.835  1.00 17.30  ? 149 SER E N   1 
ATOM   9017  C CA  . SER E  1 149 ? 31.182  79.018  -8.272  1.00 16.30  ? 149 SER E CA  1 
ATOM   9018  C C   . SER E  1 149 ? 30.176  78.132  -8.993  1.00 16.34  ? 149 SER E C   1 
ATOM   9019  O O   . SER E  1 149 ? 29.811  78.385  -10.142 1.00 16.87  ? 149 SER E O   1 
ATOM   9020  C CB  . SER E  1 149 ? 32.595  78.528  -8.605  1.00 15.88  ? 149 SER E CB  1 
ATOM   9021  O OG  . SER E  1 149 ? 33.072  77.586  -7.653  1.00 15.39  ? 149 SER E OG  1 
ATOM   9022  N N   . ARG E  1 150 ? 29.693  77.062  -8.376  1.00 15.73  ? 150 ARG E N   1 
ATOM   9023  C CA  . ARG E  1 150 ? 28.821  76.196  -9.117  1.00 15.49  ? 150 ARG E CA  1 
ATOM   9024  C C   . ARG E  1 150 ? 27.329  76.457  -8.922  1.00 15.06  ? 150 ARG E C   1 
ATOM   9025  O O   . ARG E  1 150 ? 26.474  75.716  -9.447  1.00 15.83  ? 150 ARG E O   1 
ATOM   9026  C CB  . ARG E  1 150 ? 29.219  74.765  -8.755  1.00 16.00  ? 150 ARG E CB  1 
ATOM   9027  C CG  . ARG E  1 150 ? 30.149  74.183  -9.802  1.00 16.52  ? 150 ARG E CG  1 
ATOM   9028  C CD  . ARG E  1 150 ? 31.534  74.758  -9.740  1.00 17.30  ? 150 ARG E CD  1 
ATOM   9029  N NE  . ARG E  1 150 ? 32.116  74.918  -11.071 1.00 18.43  ? 150 ARG E NE  1 
ATOM   9030  C CZ  . ARG E  1 150 ? 33.235  74.252  -11.443 1.00 19.36  ? 150 ARG E CZ  1 
ATOM   9031  N NH1 . ARG E  1 150 ? 33.777  74.475  -12.649 1.00 19.87  ? 150 ARG E NH1 1 
ATOM   9032  N NH2 . ARG E  1 150 ? 33.816  73.347  -10.636 1.00 19.90  ? 150 ARG E NH2 1 
ATOM   9033  N N   . LEU E  1 151 ? 26.950  77.512  -8.216  1.00 13.59  ? 151 LEU E N   1 
ATOM   9034  C CA  . LEU E  1 151 ? 25.536  77.738  -7.954  1.00 13.20  ? 151 LEU E CA  1 
ATOM   9035  C C   . LEU E  1 151 ? 25.113  79.059  -8.552  1.00 14.39  ? 151 LEU E C   1 
ATOM   9036  O O   . LEU E  1 151 ? 25.947  79.939  -8.808  1.00 16.83  ? 151 LEU E O   1 
ATOM   9037  C CB  . LEU E  1 151 ? 25.291  77.706  -6.437  1.00 11.34  ? 151 LEU E CB  1 
ATOM   9038  C CG  . LEU E  1 151 ? 25.366  76.330  -5.733  1.00 9.44   ? 151 LEU E CG  1 
ATOM   9039  C CD1 . LEU E  1 151 ? 25.277  76.455  -4.219  1.00 8.09   ? 151 LEU E CD1 1 
ATOM   9040  C CD2 . LEU E  1 151 ? 24.241  75.476  -6.264  1.00 8.69   ? 151 LEU E CD2 1 
ATOM   9041  N N   . ASN E  1 152 ? 23.839  79.267  -8.848  1.00 14.44  ? 152 ASN E N   1 
ATOM   9042  C CA  . ASN E  1 152 ? 23.411  80.498  -9.490  1.00 14.52  ? 152 ASN E CA  1 
ATOM   9043  C C   . ASN E  1 152 ? 22.247  81.099  -8.741  1.00 14.09  ? 152 ASN E C   1 
ATOM   9044  O O   . ASN E  1 152 ? 21.152  80.568  -8.815  1.00 13.47  ? 152 ASN E O   1 
ATOM   9045  C CB  . ASN E  1 152 ? 23.038  80.165  -10.915 1.00 14.80  ? 152 ASN E CB  1 
ATOM   9046  C CG  . ASN E  1 152 ? 22.698  81.343  -11.791 1.00 14.90  ? 152 ASN E CG  1 
ATOM   9047  O OD1 . ASN E  1 152 ? 22.349  81.163  -12.946 1.00 15.98  ? 152 ASN E OD1 1 
ATOM   9048  N ND2 . ASN E  1 152 ? 22.811  82.609  -11.442 1.00 14.68  ? 152 ASN E ND2 1 
ATOM   9049  N N   . TRP E  1 153 ? 22.466  82.173  -7.976  1.00 14.63  ? 153 TRP E N   1 
ATOM   9050  C CA  . TRP E  1 153 ? 21.402  82.787  -7.169  1.00 15.03  ? 153 TRP E CA  1 
ATOM   9051  C C   . TRP E  1 153 ? 20.508  83.726  -7.971  1.00 16.45  ? 153 TRP E C   1 
ATOM   9052  O O   . TRP E  1 153 ? 20.927  84.772  -8.475  1.00 17.36  ? 153 TRP E O   1 
ATOM   9053  C CB  . TRP E  1 153 ? 22.051  83.541  -6.011  1.00 13.17  ? 153 TRP E CB  1 
ATOM   9054  C CG  . TRP E  1 153 ? 21.161  84.128  -4.915  1.00 11.00  ? 153 TRP E CG  1 
ATOM   9055  C CD1 . TRP E  1 153 ? 19.803  83.960  -4.863  1.00 10.66  ? 153 TRP E CD1 1 
ATOM   9056  C CD2 . TRP E  1 153 ? 21.628  84.832  -3.839  1.00 8.96   ? 153 TRP E CD2 1 
ATOM   9057  N NE1 . TRP E  1 153 ? 19.437  84.543  -3.751  1.00 9.96   ? 153 TRP E NE1 1 
ATOM   9058  C CE2 . TRP E  1 153 ? 20.482  85.074  -3.120  1.00 8.30   ? 153 TRP E CE2 1 
ATOM   9059  C CE3 . TRP E  1 153 ? 22.845  85.285  -3.417  1.00 7.87   ? 153 TRP E CE3 1 
ATOM   9060  C CZ2 . TRP E  1 153 ? 20.521  85.756  -1.943  1.00 7.44   ? 153 TRP E CZ2 1 
ATOM   9061  C CZ3 . TRP E  1 153 ? 22.895  85.977  -2.238  1.00 7.52   ? 153 TRP E CZ3 1 
ATOM   9062  C CH2 . TRP E  1 153 ? 21.747  86.212  -1.516  1.00 7.71   ? 153 TRP E CH2 1 
ATOM   9063  N N   . LEU E  1 154 ? 19.250  83.360  -8.061  1.00 18.00  ? 154 LEU E N   1 
ATOM   9064  C CA  . LEU E  1 154 ? 18.301  84.067  -8.881  1.00 19.50  ? 154 LEU E CA  1 
ATOM   9065  C C   . LEU E  1 154 ? 17.412  84.915  -8.009  1.00 21.49  ? 154 LEU E C   1 
ATOM   9066  O O   . LEU E  1 154 ? 16.896  84.461  -6.981  1.00 21.88  ? 154 LEU E O   1 
ATOM   9067  C CB  . LEU E  1 154 ? 17.460  83.079  -9.668  1.00 17.55  ? 154 LEU E CB  1 
ATOM   9068  C CG  . LEU E  1 154 ? 17.895  82.568  -11.013 1.00 16.96  ? 154 LEU E CG  1 
ATOM   9069  C CD1 . LEU E  1 154 ? 19.356  82.229  -11.091 1.00 16.73  ? 154 LEU E CD1 1 
ATOM   9070  C CD2 . LEU E  1 154 ? 17.097  81.320  -11.237 1.00 17.71  ? 154 LEU E CD2 1 
ATOM   9071  N N   . THR E  1 155 ? 17.235  86.150  -8.447  1.00 23.50  ? 155 THR E N   1 
ATOM   9072  C CA  . THR E  1 155 ? 16.391  87.116  -7.786  1.00 25.49  ? 155 THR E CA  1 
ATOM   9073  C C   . THR E  1 155 ? 15.470  87.789  -8.789  1.00 26.59  ? 155 THR E C   1 
ATOM   9074  O O   . THR E  1 155 ? 15.611  87.559  -10.001 1.00 28.02  ? 155 THR E O   1 
ATOM   9075  C CB  . THR E  1 155 ? 17.286  88.107  -7.104  1.00 26.19  ? 155 THR E CB  1 
ATOM   9076  O OG1 . THR E  1 155 ? 18.430  88.344  -7.935  1.00 27.57  ? 155 THR E OG1 1 
ATOM   9077  C CG2 . THR E  1 155 ? 17.631  87.583  -5.730  1.00 26.51  ? 155 THR E CG2 1 
ATOM   9078  N N   . LYS E  1 156 ? 14.514  88.575  -8.295  1.00 25.00  ? 156 LYS E N   1 
ATOM   9079  C CA  . LYS E  1 156 ? 13.584  89.224  -9.196  1.00 24.41  ? 156 LYS E CA  1 
ATOM   9080  C C   . LYS E  1 156 ? 14.222  90.177  -10.211 1.00 24.72  ? 156 LYS E C   1 
ATOM   9081  O O   . LYS E  1 156 ? 15.361  90.649  -10.067 1.00 25.23  ? 156 LYS E O   1 
ATOM   9082  C CB  . LYS E  1 156 ? 12.575  90.003  -8.415  1.00 23.57  ? 156 LYS E CB  1 
ATOM   9083  C CG  . LYS E  1 156 ? 13.170  91.267  -7.874  1.00 23.21  ? 156 LYS E CG  1 
ATOM   9084  C CD  . LYS E  1 156 ? 12.177  91.889  -6.982  1.00 23.53  ? 156 LYS E CD  1 
ATOM   9085  C CE  . LYS E  1 156 ? 12.761  93.169  -6.498  1.00 23.68  ? 156 LYS E CE  1 
ATOM   9086  N NZ  . LYS E  1 156 ? 11.807  93.551  -5.502  1.00 24.72  ? 156 LYS E NZ  1 
ATOM   9087  N N   . SER E  1 157 ? 13.464  90.443  -11.265 1.00 24.67  ? 157 SER E N   1 
ATOM   9088  C CA  . SER E  1 157 ? 13.836  91.439  -12.216 1.00 24.13  ? 157 SER E CA  1 
ATOM   9089  C C   . SER E  1 157 ? 12.771  92.478  -12.015 1.00 23.75  ? 157 SER E C   1 
ATOM   9090  O O   . SER E  1 157 ? 11.571  92.228  -12.210 1.00 22.33  ? 157 SER E O   1 
ATOM   9091  C CB  . SER E  1 157 ? 13.768  90.935  -13.628 1.00 24.54  ? 157 SER E CB  1 
ATOM   9092  O OG  . SER E  1 157 ? 14.340  91.915  -14.496 1.00 25.27  ? 157 SER E OG  1 
ATOM   9093  N N   . GLY E  1 158 ? 13.228  93.613  -11.531 1.00 23.93  ? 158 GLY E N   1 
ATOM   9094  C CA  . GLY E  1 158 ? 12.399  94.741  -11.291 1.00 24.92  ? 158 GLY E CA  1 
ATOM   9095  C C   . GLY E  1 158 ? 11.311  94.409  -10.310 1.00 26.52  ? 158 GLY E C   1 
ATOM   9096  O O   . GLY E  1 158 ? 11.488  94.413  -9.091  1.00 27.35  ? 158 GLY E O   1 
ATOM   9097  N N   . SER E  1 159 ? 10.204  93.987  -10.878 1.00 27.80  ? 159 SER E N   1 
ATOM   9098  C CA  . SER E  1 159 ? 8.942   93.906  -10.183 1.00 28.96  ? 159 SER E CA  1 
ATOM   9099  C C   . SER E  1 159 ? 8.354   92.520  -10.080 1.00 29.01  ? 159 SER E C   1 
ATOM   9100  O O   . SER E  1 159 ? 7.270   92.374  -9.503  1.00 29.27  ? 159 SER E O   1 
ATOM   9101  C CB  . SER E  1 159 ? 8.001   94.842  -10.942 1.00 30.47  ? 159 SER E CB  1 
ATOM   9102  O OG  . SER E  1 159 ? 8.248   94.849  -12.371 1.00 30.93  ? 159 SER E OG  1 
ATOM   9103  N N   . THR E  1 160 ? 9.057   91.503  -10.579 1.00 28.86  ? 160 THR E N   1 
ATOM   9104  C CA  . THR E  1 160 ? 8.406   90.225  -10.756 1.00 29.18  ? 160 THR E CA  1 
ATOM   9105  C C   . THR E  1 160 ? 9.350   89.048  -10.611 1.00 29.38  ? 160 THR E C   1 
ATOM   9106  O O   . THR E  1 160 ? 10.509  89.147  -11.018 1.00 30.16  ? 160 THR E O   1 
ATOM   9107  C CB  . THR E  1 160 ? 7.763   90.171  -12.177 1.00 29.46  ? 160 THR E CB  1 
ATOM   9108  O OG1 . THR E  1 160 ? 7.815   91.475  -12.766 1.00 29.34  ? 160 THR E OG1 1 
ATOM   9109  C CG2 . THR E  1 160 ? 6.344   89.655  -12.103 1.00 30.34  ? 160 THR E CG2 1 
ATOM   9110  N N   . TYR E  1 161 ? 8.909   87.938  -10.029 1.00 28.72  ? 161 TYR E N   1 
ATOM   9111  C CA  . TYR E  1 161 ? 9.671   86.718  -10.144 1.00 27.99  ? 161 TYR E CA  1 
ATOM   9112  C C   . TYR E  1 161 ? 8.712   85.779  -10.867 1.00 30.55  ? 161 TYR E C   1 
ATOM   9113  O O   . TYR E  1 161 ? 7.634   85.574  -10.314 1.00 31.60  ? 161 TYR E O   1 
ATOM   9114  C CB  . TYR E  1 161 ? 9.969   86.226  -8.793  1.00 24.86  ? 161 TYR E CB  1 
ATOM   9115  C CG  . TYR E  1 161 ? 11.021  85.145  -8.763  1.00 23.53  ? 161 TYR E CG  1 
ATOM   9116  C CD1 . TYR E  1 161 ? 10.762  83.865  -9.189  1.00 22.06  ? 161 TYR E CD1 1 
ATOM   9117  C CD2 . TYR E  1 161 ? 12.244  85.433  -8.208  1.00 22.94  ? 161 TYR E CD2 1 
ATOM   9118  C CE1 . TYR E  1 161 ? 11.702  82.889  -9.063  1.00 21.42  ? 161 TYR E CE1 1 
ATOM   9119  C CE2 . TYR E  1 161 ? 13.182  84.455  -8.074  1.00 22.04  ? 161 TYR E CE2 1 
ATOM   9120  C CZ  . TYR E  1 161 ? 12.900  83.194  -8.498  1.00 21.90  ? 161 TYR E CZ  1 
ATOM   9121  O OH  . TYR E  1 161 ? 13.831  82.219  -8.288  1.00 23.58  ? 161 TYR E OH  1 
ATOM   9122  N N   . PRO E  1 162 ? 8.935   85.282  -12.098 1.00 33.07  ? 162 PRO E N   1 
ATOM   9123  C CA  . PRO E  1 162 ? 8.021   84.379  -12.793 1.00 33.81  ? 162 PRO E CA  1 
ATOM   9124  C C   . PRO E  1 162 ? 8.102   82.948  -12.286 1.00 33.34  ? 162 PRO E C   1 
ATOM   9125  O O   . PRO E  1 162 ? 9.027   82.591  -11.564 1.00 34.18  ? 162 PRO E O   1 
ATOM   9126  C CB  . PRO E  1 162 ? 8.414   84.514  -14.247 1.00 34.51  ? 162 PRO E CB  1 
ATOM   9127  C CG  . PRO E  1 162 ? 9.898   84.745  -14.163 1.00 34.89  ? 162 PRO E CG  1 
ATOM   9128  C CD  . PRO E  1 162 ? 9.957   85.752  -13.021 1.00 34.54  ? 162 PRO E CD  1 
ATOM   9129  N N   . VAL E  1 163 ? 7.160   82.093  -12.640 1.00 31.73  ? 163 VAL E N   1 
ATOM   9130  C CA  . VAL E  1 163 ? 7.321   80.705  -12.296 1.00 30.46  ? 163 VAL E CA  1 
ATOM   9131  C C   . VAL E  1 163 ? 8.336   80.140  -13.262 1.00 29.72  ? 163 VAL E C   1 
ATOM   9132  O O   . VAL E  1 163 ? 8.052   80.021  -14.451 1.00 30.58  ? 163 VAL E O   1 
ATOM   9133  C CB  . VAL E  1 163 ? 5.993   79.967  -12.430 1.00 30.67  ? 163 VAL E CB  1 
ATOM   9134  C CG1 . VAL E  1 163 ? 6.158   78.464  -12.286 1.00 30.87  ? 163 VAL E CG1 1 
ATOM   9135  C CG2 . VAL E  1 163 ? 5.091   80.451  -11.322 1.00 31.19  ? 163 VAL E CG2 1 
ATOM   9136  N N   . LEU E  1 164 ? 9.546   79.914  -12.783 1.00 28.38  ? 164 LEU E N   1 
ATOM   9137  C CA  . LEU E  1 164 ? 10.574  79.265  -13.565 1.00 27.38  ? 164 LEU E CA  1 
ATOM   9138  C C   . LEU E  1 164 ? 10.162  77.825  -13.836 1.00 26.85  ? 164 LEU E C   1 
ATOM   9139  O O   . LEU E  1 164 ? 9.650   77.121  -12.956 1.00 27.13  ? 164 LEU E O   1 
ATOM   9140  C CB  . LEU E  1 164 ? 11.885  79.338  -12.780 1.00 26.78  ? 164 LEU E CB  1 
ATOM   9141  C CG  . LEU E  1 164 ? 12.910  80.485  -12.949 1.00 26.14  ? 164 LEU E CG  1 
ATOM   9142  C CD1 . LEU E  1 164 ? 12.281  81.714  -13.544 1.00 26.66  ? 164 LEU E CD1 1 
ATOM   9143  C CD2 . LEU E  1 164 ? 13.487  80.834  -11.602 1.00 25.17  ? 164 LEU E CD2 1 
ATOM   9144  N N   . ASN E  1 165 ? 10.334  77.383  -15.062 1.00 26.41  ? 165 ASN E N   1 
ATOM   9145  C CA  . ASN E  1 165 ? 10.016  76.025  -15.417 1.00 27.77  ? 165 ASN E CA  1 
ATOM   9146  C C   . ASN E  1 165 ? 11.000  75.616  -16.500 1.00 27.63  ? 165 ASN E C   1 
ATOM   9147  O O   . ASN E  1 165 ? 10.748  75.845  -17.681 1.00 28.25  ? 165 ASN E O   1 
ATOM   9148  C CB  . ASN E  1 165 ? 8.601   76.005  -15.921 1.00 30.01  ? 165 ASN E CB  1 
ATOM   9149  C CG  . ASN E  1 165 ? 8.071   74.624  -16.234 1.00 32.28  ? 165 ASN E CG  1 
ATOM   9150  O OD1 . ASN E  1 165 ? 7.796   73.876  -15.302 1.00 33.09  ? 165 ASN E OD1 1 
ATOM   9151  N ND2 . ASN E  1 165 ? 7.848   74.256  -17.496 1.00 34.55  ? 165 ASN E ND2 1 
ATOM   9152  N N   . VAL E  1 166 ? 12.174  75.091  -16.165 1.00 26.30  ? 166 VAL E N   1 
ATOM   9153  C CA  . VAL E  1 166 ? 13.161  74.770  -17.172 1.00 25.75  ? 166 VAL E CA  1 
ATOM   9154  C C   . VAL E  1 166 ? 13.363  73.280  -17.238 1.00 25.37  ? 166 VAL E C   1 
ATOM   9155  O O   . VAL E  1 166 ? 12.987  72.597  -16.292 1.00 25.89  ? 166 VAL E O   1 
ATOM   9156  C CB  . VAL E  1 166 ? 14.500  75.454  -16.852 1.00 26.42  ? 166 VAL E CB  1 
ATOM   9157  C CG1 . VAL E  1 166 ? 14.312  76.944  -16.775 1.00 26.27  ? 166 VAL E CG1 1 
ATOM   9158  C CG2 . VAL E  1 166 ? 15.034  74.976  -15.523 1.00 28.07  ? 166 VAL E CG2 1 
ATOM   9159  N N   . THR E  1 167 ? 14.032  72.767  -18.263 1.00 25.22  ? 167 THR E N   1 
ATOM   9160  C CA  . THR E  1 167 ? 14.247  71.346  -18.389 1.00 26.20  ? 167 THR E CA  1 
ATOM   9161  C C   . THR E  1 167 ? 15.625  71.093  -18.957 1.00 25.98  ? 167 THR E C   1 
ATOM   9162  O O   . THR E  1 167 ? 16.166  71.922  -19.664 1.00 25.66  ? 167 THR E O   1 
ATOM   9163  C CB  . THR E  1 167 ? 13.128  70.791  -19.289 1.00 26.92  ? 167 THR E CB  1 
ATOM   9164  O OG1 . THR E  1 167 ? 13.086  69.367  -19.149 1.00 26.00  ? 167 THR E OG1 1 
ATOM   9165  C CG2 . THR E  1 167 ? 13.326  71.204  -20.735 1.00 27.90  ? 167 THR E CG2 1 
ATOM   9166  N N   . MET E  1 168 ? 16.223  69.961  -18.678 1.00 27.41  ? 168 MET E N   1 
ATOM   9167  C CA  . MET E  1 168 ? 17.552  69.675  -19.162 1.00 28.97  ? 168 MET E CA  1 
ATOM   9168  C C   . MET E  1 168 ? 17.661  68.165  -19.253 1.00 29.74  ? 168 MET E C   1 
ATOM   9169  O O   . MET E  1 168 ? 17.737  67.459  -18.237 1.00 29.76  ? 168 MET E O   1 
ATOM   9170  C CB  . MET E  1 168 ? 18.516  70.256  -18.164 1.00 30.32  ? 168 MET E CB  1 
ATOM   9171  C CG  . MET E  1 168 ? 19.949  70.205  -18.585 1.00 31.11  ? 168 MET E CG  1 
ATOM   9172  S SD  . MET E  1 168 ? 20.153  71.203  -20.070 1.00 31.58  ? 168 MET E SD  1 
ATOM   9173  C CE  . MET E  1 168 ? 20.153  72.827  -19.403 1.00 31.44  ? 168 MET E CE  1 
ATOM   9174  N N   . PRO E  1 169 ? 17.547  67.603  -20.448 1.00 30.47  ? 169 PRO E N   1 
ATOM   9175  C CA  . PRO E  1 169 ? 17.610  66.180  -20.673 1.00 32.13  ? 169 PRO E CA  1 
ATOM   9176  C C   . PRO E  1 169 ? 18.956  65.565  -20.413 1.00 33.87  ? 169 PRO E C   1 
ATOM   9177  O O   . PRO E  1 169 ? 20.013  66.206  -20.396 1.00 35.16  ? 169 PRO E O   1 
ATOM   9178  C CB  . PRO E  1 169 ? 17.170  66.005  -22.083 1.00 31.60  ? 169 PRO E CB  1 
ATOM   9179  C CG  . PRO E  1 169 ? 17.696  67.260  -22.695 1.00 31.01  ? 169 PRO E CG  1 
ATOM   9180  C CD  . PRO E  1 169 ? 17.255  68.288  -21.683 1.00 30.41  ? 169 PRO E CD  1 
ATOM   9181  N N   . ASN E  1 170 ? 18.926  64.276  -20.161 1.00 35.16  ? 170 ASN E N   1 
ATOM   9182  C CA  . ASN E  1 170 ? 20.148  63.573  -20.006 1.00 35.98  ? 170 ASN E CA  1 
ATOM   9183  C C   . ASN E  1 170 ? 20.175  62.740  -21.240 1.00 38.09  ? 170 ASN E C   1 
ATOM   9184  O O   . ASN E  1 170 ? 19.679  61.619  -21.265 1.00 38.81  ? 170 ASN E O   1 
ATOM   9185  C CB  . ASN E  1 170 ? 20.181  62.649  -18.816 1.00 34.84  ? 170 ASN E CB  1 
ATOM   9186  C CG  . ASN E  1 170 ? 21.619  62.270  -18.588 1.00 33.79  ? 170 ASN E CG  1 
ATOM   9187  O OD1 . ASN E  1 170 ? 22.483  62.694  -19.342 1.00 33.45  ? 170 ASN E OD1 1 
ATOM   9188  N ND2 . ASN E  1 170 ? 21.970  61.578  -17.535 1.00 33.87  ? 170 ASN E ND2 1 
ATOM   9189  N N   . ASN E  1 171 ? 20.630  63.337  -22.320 1.00 40.73  ? 171 ASN E N   1 
ATOM   9190  C CA  . ASN E  1 171 ? 20.752  62.568  -23.542 1.00 43.17  ? 171 ASN E CA  1 
ATOM   9191  C C   . ASN E  1 171 ? 22.088  61.863  -23.605 1.00 44.33  ? 171 ASN E C   1 
ATOM   9192  O O   . ASN E  1 171 ? 22.380  61.165  -24.575 1.00 45.61  ? 171 ASN E O   1 
ATOM   9193  C CB  . ASN E  1 171 ? 20.598  63.458  -24.763 1.00 44.01  ? 171 ASN E CB  1 
ATOM   9194  C CG  . ASN E  1 171 ? 19.127  63.700  -25.080 1.00 45.10  ? 171 ASN E CG  1 
ATOM   9195  O OD1 . ASN E  1 171 ? 18.720  64.821  -25.389 1.00 45.62  ? 171 ASN E OD1 1 
ATOM   9196  N ND2 . ASN E  1 171 ? 18.251  62.707  -24.993 1.00 45.43  ? 171 ASN E ND2 1 
ATOM   9197  N N   . ASP E  1 172 ? 22.856  62.015  -22.525 1.00 44.35  ? 172 ASP E N   1 
ATOM   9198  C CA  . ASP E  1 172 ? 24.181  61.502  -22.436 1.00 43.88  ? 172 ASP E CA  1 
ATOM   9199  C C   . ASP E  1 172 ? 24.269  60.050  -22.082 1.00 43.49  ? 172 ASP E C   1 
ATOM   9200  O O   . ASP E  1 172 ? 23.287  59.358  -21.799 1.00 43.20  ? 172 ASP E O   1 
ATOM   9201  C CB  . ASP E  1 172 ? 24.915  62.300  -21.419 1.00 44.67  ? 172 ASP E CB  1 
ATOM   9202  C CG  . ASP E  1 172 ? 26.007  63.049  -22.097 1.00 45.26  ? 172 ASP E CG  1 
ATOM   9203  O OD1 . ASP E  1 172 ? 26.834  62.364  -22.715 1.00 45.57  ? 172 ASP E OD1 1 
ATOM   9204  O OD2 . ASP E  1 172 ? 26.007  64.286  -21.993 1.00 45.89  ? 172 ASP E OD2 1 
ATOM   9205  N N   . ASN E  1 173 ? 25.506  59.616  -22.009 1.00 43.65  ? 173 ASN E N   1 
ATOM   9206  C CA  . ASN E  1 173 ? 25.772  58.242  -21.710 1.00 43.76  ? 173 ASN E CA  1 
ATOM   9207  C C   . ASN E  1 173 ? 25.851  57.945  -20.224 1.00 41.83  ? 173 ASN E C   1 
ATOM   9208  O O   . ASN E  1 173 ? 25.890  56.798  -19.794 1.00 41.88  ? 173 ASN E O   1 
ATOM   9209  C CB  . ASN E  1 173 ? 27.067  57.880  -22.380 1.00 46.82  ? 173 ASN E CB  1 
ATOM   9210  C CG  . ASN E  1 173 ? 27.248  56.372  -22.335 1.00 49.82  ? 173 ASN E CG  1 
ATOM   9211  O OD1 . ASN E  1 173 ? 26.323  55.616  -22.657 1.00 51.50  ? 173 ASN E OD1 1 
ATOM   9212  N ND2 . ASN E  1 173 ? 28.418  55.877  -21.937 1.00 50.71  ? 173 ASN E ND2 1 
ATOM   9213  N N   . PHE E  1 174 ? 25.861  58.947  -19.364 1.00 39.49  ? 174 PHE E N   1 
ATOM   9214  C CA  . PHE E  1 174 ? 26.168  58.709  -17.962 1.00 37.80  ? 174 PHE E CA  1 
ATOM   9215  C C   . PHE E  1 174 ? 25.222  59.398  -17.015 1.00 36.80  ? 174 PHE E C   1 
ATOM   9216  O O   . PHE E  1 174 ? 24.471  60.260  -17.468 1.00 37.28  ? 174 PHE E O   1 
ATOM   9217  C CB  . PHE E  1 174 ? 27.585  59.188  -17.690 1.00 37.61  ? 174 PHE E CB  1 
ATOM   9218  C CG  . PHE E  1 174 ? 27.851  60.546  -18.315 1.00 36.82  ? 174 PHE E CG  1 
ATOM   9219  C CD1 . PHE E  1 174 ? 27.464  61.697  -17.670 1.00 36.87  ? 174 PHE E CD1 1 
ATOM   9220  C CD2 . PHE E  1 174 ? 28.472  60.602  -19.534 1.00 36.24  ? 174 PHE E CD2 1 
ATOM   9221  C CE1 . PHE E  1 174 ? 27.693  62.911  -18.253 1.00 36.28  ? 174 PHE E CE1 1 
ATOM   9222  C CE2 . PHE E  1 174 ? 28.696  61.825  -20.099 1.00 36.04  ? 174 PHE E CE2 1 
ATOM   9223  C CZ  . PHE E  1 174 ? 28.311  62.975  -19.466 1.00 36.03  ? 174 PHE E CZ  1 
ATOM   9224  N N   . ASP E  1 175 ? 25.278  59.048  -15.730 1.00 34.92  ? 175 ASP E N   1 
ATOM   9225  C CA  . ASP E  1 175 ? 24.500  59.747  -14.730 1.00 33.16  ? 175 ASP E CA  1 
ATOM   9226  C C   . ASP E  1 175 ? 25.124  61.112  -14.468 1.00 30.92  ? 175 ASP E C   1 
ATOM   9227  O O   . ASP E  1 175 ? 26.361  61.303  -14.528 1.00 30.58  ? 175 ASP E O   1 
ATOM   9228  C CB  . ASP E  1 175 ? 24.459  58.935  -13.437 1.00 35.06  ? 175 ASP E CB  1 
ATOM   9229  C CG  . ASP E  1 175 ? 23.604  57.662  -13.457 1.00 36.61  ? 175 ASP E CG  1 
ATOM   9230  O OD1 . ASP E  1 175 ? 22.819  57.463  -14.384 1.00 36.51  ? 175 ASP E OD1 1 
ATOM   9231  O OD2 . ASP E  1 175 ? 23.685  56.851  -12.524 1.00 37.57  ? 175 ASP E OD2 1 
ATOM   9232  N N   . LYS E  1 176 ? 24.251  62.088  -14.231 1.00 27.76  ? 176 LYS E N   1 
ATOM   9233  C CA  . LYS E  1 176 ? 24.661  63.465  -13.985 1.00 24.32  ? 176 LYS E CA  1 
ATOM   9234  C C   . LYS E  1 176 ? 24.220  63.817  -12.577 1.00 22.12  ? 176 LYS E C   1 
ATOM   9235  O O   . LYS E  1 176 ? 23.082  63.499  -12.236 1.00 22.82  ? 176 LYS E O   1 
ATOM   9236  C CB  . LYS E  1 176 ? 23.977  64.404  -14.944 1.00 23.31  ? 176 LYS E CB  1 
ATOM   9237  C CG  . LYS E  1 176 ? 24.296  64.255  -16.419 1.00 23.82  ? 176 LYS E CG  1 
ATOM   9238  C CD  . LYS E  1 176 ? 23.405  65.310  -17.038 1.00 24.75  ? 176 LYS E CD  1 
ATOM   9239  C CE  . LYS E  1 176 ? 23.590  65.644  -18.506 1.00 25.06  ? 176 LYS E CE  1 
ATOM   9240  N NZ  . LYS E  1 176 ? 22.742  66.787  -18.823 1.00 25.55  ? 176 LYS E NZ  1 
ATOM   9241  N N   . LEU E  1 177 ? 25.055  64.423  -11.739 1.00 18.81  ? 177 LEU E N   1 
ATOM   9242  C CA  . LEU E  1 177 ? 24.676  64.792  -10.377 1.00 15.93  ? 177 LEU E CA  1 
ATOM   9243  C C   . LEU E  1 177 ? 24.460  66.301  -10.378 1.00 16.00  ? 177 LEU E C   1 
ATOM   9244  O O   . LEU E  1 177 ? 25.416  67.021  -10.716 1.00 17.85  ? 177 LEU E O   1 
ATOM   9245  C CB  . LEU E  1 177 ? 25.831  64.343  -9.462  1.00 14.46  ? 177 LEU E CB  1 
ATOM   9246  C CG  . LEU E  1 177 ? 26.050  64.498  -7.947  1.00 13.10  ? 177 LEU E CG  1 
ATOM   9247  C CD1 . LEU E  1 177 ? 26.851  65.726  -7.679  1.00 12.56  ? 177 LEU E CD1 1 
ATOM   9248  C CD2 . LEU E  1 177 ? 24.748  64.578  -7.217  1.00 13.20  ? 177 LEU E CD2 1 
ATOM   9249  N N   . TYR E  1 178 ? 23.252  66.828  -10.124 1.00 13.53  ? 178 TYR E N   1 
ATOM   9250  C CA  . TYR E  1 178 ? 23.050  68.274  -10.060 1.00 11.76  ? 178 TYR E CA  1 
ATOM   9251  C C   . TYR E  1 178 ? 22.928  68.703  -8.608  1.00 11.59  ? 178 TYR E C   1 
ATOM   9252  O O   . TYR E  1 178 ? 22.172  68.079  -7.859  1.00 11.60  ? 178 TYR E O   1 
ATOM   9253  C CB  . TYR E  1 178 ? 21.770  68.768  -10.737 1.00 10.80  ? 178 TYR E CB  1 
ATOM   9254  C CG  . TYR E  1 178 ? 21.704  68.616  -12.242 1.00 10.24  ? 178 TYR E CG  1 
ATOM   9255  C CD1 . TYR E  1 178 ? 22.080  69.630  -13.096 1.00 10.25  ? 178 TYR E CD1 1 
ATOM   9256  C CD2 . TYR E  1 178 ? 21.294  67.409  -12.756 1.00 11.03  ? 178 TYR E CD2 1 
ATOM   9257  C CE1 . TYR E  1 178 ? 22.015  69.449  -14.474 1.00 10.86  ? 178 TYR E CE1 1 
ATOM   9258  C CE2 . TYR E  1 178 ? 21.218  67.221  -14.121 1.00 11.93  ? 178 TYR E CE2 1 
ATOM   9259  C CZ  . TYR E  1 178 ? 21.599  68.224  -14.998 1.00 11.73  ? 178 TYR E CZ  1 
ATOM   9260  O OH  . TYR E  1 178 ? 21.497  67.928  -16.369 1.00 10.98  ? 178 TYR E OH  1 
ATOM   9261  N N   . ILE E  1 179 ? 23.682  69.731  -8.170  1.00 11.08  ? 179 ILE E N   1 
ATOM   9262  C CA  . ILE E  1 179 ? 23.590  70.306  -6.828  1.00 8.12   ? 179 ILE E CA  1 
ATOM   9263  C C   . ILE E  1 179 ? 22.804  71.592  -6.950  1.00 7.19   ? 179 ILE E C   1 
ATOM   9264  O O   . ILE E  1 179 ? 23.153  72.447  -7.752  1.00 7.16   ? 179 ILE E O   1 
ATOM   9265  C CB  . ILE E  1 179 ? 24.976  70.640  -6.245  1.00 6.54   ? 179 ILE E CB  1 
ATOM   9266  C CG1 . ILE E  1 179 ? 25.827  69.417  -6.165  1.00 6.04   ? 179 ILE E CG1 1 
ATOM   9267  C CG2 . ILE E  1 179 ? 24.815  71.225  -4.859  1.00 6.18   ? 179 ILE E CG2 1 
ATOM   9268  C CD1 . ILE E  1 179 ? 25.286  68.336  -5.219  1.00 6.84   ? 179 ILE E CD1 1 
ATOM   9269  N N   . TRP E  1 180 ? 21.750  71.744  -6.189  1.00 7.76   ? 180 TRP E N   1 
ATOM   9270  C CA  . TRP E  1 180 ? 20.959  72.955  -6.202  1.00 8.22   ? 180 TRP E CA  1 
ATOM   9271  C C   . TRP E  1 180 ? 20.596  73.337  -4.773  1.00 9.30   ? 180 TRP E C   1 
ATOM   9272  O O   . TRP E  1 180 ? 21.070  72.721  -3.809  1.00 9.87   ? 180 TRP E O   1 
ATOM   9273  C CB  . TRP E  1 180 ? 19.723  72.727  -7.024  1.00 7.83   ? 180 TRP E CB  1 
ATOM   9274  C CG  . TRP E  1 180 ? 18.908  71.502  -6.658  1.00 8.62   ? 180 TRP E CG  1 
ATOM   9275  C CD1 . TRP E  1 180 ? 19.161  70.282  -7.234  1.00 8.97   ? 180 TRP E CD1 1 
ATOM   9276  C CD2 . TRP E  1 180 ? 17.834  71.473  -5.807  1.00 9.22   ? 180 TRP E CD2 1 
ATOM   9277  N NE1 . TRP E  1 180 ? 18.239  69.486  -6.755  1.00 9.27   ? 180 TRP E NE1 1 
ATOM   9278  C CE2 . TRP E  1 180 ? 17.443  70.152  -5.906  1.00 9.22   ? 180 TRP E CE2 1 
ATOM   9279  C CE3 . TRP E  1 180 ? 17.137  72.332  -4.982  1.00 9.34   ? 180 TRP E CE3 1 
ATOM   9280  C CZ2 . TRP E  1 180 ? 16.364  69.681  -5.199  1.00 8.58   ? 180 TRP E CZ2 1 
ATOM   9281  C CZ3 . TRP E  1 180 ? 16.055  71.851  -4.274  1.00 8.29   ? 180 TRP E CZ3 1 
ATOM   9282  C CH2 . TRP E  1 180 ? 15.675  70.543  -4.381  1.00 7.83   ? 180 TRP E CH2 1 
ATOM   9283  N N   . GLY E  1 181 ? 19.768  74.340  -4.551  1.00 9.84   ? 181 GLY E N   1 
ATOM   9284  C CA  . GLY E  1 181 ? 19.430  74.701  -3.192  1.00 9.59   ? 181 GLY E CA  1 
ATOM   9285  C C   . GLY E  1 181 ? 18.279  75.664  -3.158  1.00 9.10   ? 181 GLY E C   1 
ATOM   9286  O O   . GLY E  1 181 ? 17.744  76.036  -4.194  1.00 9.38   ? 181 GLY E O   1 
ATOM   9287  N N   . ILE E  1 182 ? 17.921  76.079  -1.976  1.00 9.58   ? 182 ILE E N   1 
ATOM   9288  C CA  . ILE E  1 182 ? 16.845  77.003  -1.781  1.00 11.85  ? 182 ILE E CA  1 
ATOM   9289  C C   . ILE E  1 182 ? 17.348  78.025  -0.765  1.00 14.01  ? 182 ILE E C   1 
ATOM   9290  O O   . ILE E  1 182 ? 18.171  77.641  0.081   1.00 15.26  ? 182 ILE E O   1 
ATOM   9291  C CB  . ILE E  1 182 ? 15.630  76.202  -1.282  1.00 11.52  ? 182 ILE E CB  1 
ATOM   9292  C CG1 . ILE E  1 182 ? 14.471  77.141  -1.228  1.00 11.88  ? 182 ILE E CG1 1 
ATOM   9293  C CG2 . ILE E  1 182 ? 15.837  75.608  0.108   1.00 11.56  ? 182 ILE E CG2 1 
ATOM   9294  C CD1 . ILE E  1 182 ? 13.151  76.413  -1.150  1.00 11.57  ? 182 ILE E CD1 1 
ATOM   9295  N N   . HIS E  1 183 ? 16.948  79.299  -0.845  1.00 15.44  ? 183 HIS E N   1 
ATOM   9296  C CA  . HIS E  1 183 ? 17.407  80.321  0.098   1.00 16.83  ? 183 HIS E CA  1 
ATOM   9297  C C   . HIS E  1 183 ? 16.324  80.509  1.121   1.00 17.41  ? 183 HIS E C   1 
ATOM   9298  O O   . HIS E  1 183 ? 15.150  80.585  0.718   1.00 18.16  ? 183 HIS E O   1 
ATOM   9299  C CB  . HIS E  1 183 ? 17.648  81.658  -0.612  1.00 17.86  ? 183 HIS E CB  1 
ATOM   9300  C CG  . HIS E  1 183 ? 17.924  82.884  0.250   1.00 18.48  ? 183 HIS E CG  1 
ATOM   9301  N ND1 . HIS E  1 183 ? 16.992  83.800  0.428   1.00 19.05  ? 183 HIS E ND1 1 
ATOM   9302  C CD2 . HIS E  1 183 ? 19.127  83.280  0.740   1.00 19.88  ? 183 HIS E CD2 1 
ATOM   9303  C CE1 . HIS E  1 183 ? 17.611  84.798  1.032   1.00 20.09  ? 183 HIS E CE1 1 
ATOM   9304  N NE2 . HIS E  1 183 ? 18.876  84.479  1.210   1.00 20.45  ? 183 HIS E NE2 1 
ATOM   9305  N N   . HIS E  1 184 ? 16.673  80.548  2.410   1.00 17.28  ? 184 HIS E N   1 
ATOM   9306  C CA  . HIS E  1 184 ? 15.707  80.813  3.461   1.00 16.31  ? 184 HIS E CA  1 
ATOM   9307  C C   . HIS E  1 184 ? 15.982  82.226  3.897   1.00 17.63  ? 184 HIS E C   1 
ATOM   9308  O O   . HIS E  1 184 ? 17.078  82.471  4.409   1.00 17.73  ? 184 HIS E O   1 
ATOM   9309  C CB  . HIS E  1 184 ? 15.891  79.954  4.674   1.00 15.31  ? 184 HIS E CB  1 
ATOM   9310  C CG  . HIS E  1 184 ? 15.737  78.476  4.425   1.00 15.03  ? 184 HIS E CG  1 
ATOM   9311  N ND1 . HIS E  1 184 ? 14.575  77.944  4.127   1.00 14.21  ? 184 HIS E ND1 1 
ATOM   9312  C CD2 . HIS E  1 184 ? 16.770  77.593  4.414   1.00 15.10  ? 184 HIS E CD2 1 
ATOM   9313  C CE1 . HIS E  1 184 ? 14.880  76.686  3.911   1.00 14.62  ? 184 HIS E CE1 1 
ATOM   9314  N NE2 . HIS E  1 184 ? 16.167  76.495  4.084   1.00 14.64  ? 184 HIS E NE2 1 
ATOM   9315  N N   . PRO E  1 185 ? 15.080  83.186  3.686   1.00 18.78  ? 185 PRO E N   1 
ATOM   9316  C CA  . PRO E  1 185 ? 15.273  84.573  4.074   1.00 19.83  ? 185 PRO E CA  1 
ATOM   9317  C C   . PRO E  1 185 ? 15.174  84.731  5.583   1.00 21.81  ? 185 PRO E C   1 
ATOM   9318  O O   . PRO E  1 185 ? 14.627  83.845  6.247   1.00 22.09  ? 185 PRO E O   1 
ATOM   9319  C CB  . PRO E  1 185 ? 14.202  85.278  3.307   1.00 19.42  ? 185 PRO E CB  1 
ATOM   9320  C CG  . PRO E  1 185 ? 13.911  84.361  2.155   1.00 19.44  ? 185 PRO E CG  1 
ATOM   9321  C CD  . PRO E  1 185 ? 13.883  83.039  2.874   1.00 18.86  ? 185 PRO E CD  1 
ATOM   9322  N N   . SER E  1 186 ? 15.673  85.788  6.215   1.00 24.48  ? 186 SER E N   1 
ATOM   9323  C CA  . SER E  1 186 ? 15.503  85.866  7.645   1.00 27.05  ? 186 SER E CA  1 
ATOM   9324  C C   . SER E  1 186 ? 14.294  86.702  8.004   1.00 28.83  ? 186 SER E C   1 
ATOM   9325  O O   . SER E  1 186 ? 13.704  86.511  9.068   1.00 29.18  ? 186 SER E O   1 
ATOM   9326  C CB  . SER E  1 186 ? 16.747  86.428  8.278   1.00 27.44  ? 186 SER E CB  1 
ATOM   9327  O OG  . SER E  1 186 ? 16.949  87.794  7.986   1.00 30.92  ? 186 SER E OG  1 
ATOM   9328  N N   . THR E  1 187 ? 13.880  87.634  7.148   1.00 30.74  ? 187 THR E N   1 
ATOM   9329  C CA  . THR E  1 187 ? 12.715  88.427  7.437   1.00 32.88  ? 187 THR E CA  1 
ATOM   9330  C C   . THR E  1 187 ? 11.737  88.362  6.283   1.00 34.56  ? 187 THR E C   1 
ATOM   9331  O O   . THR E  1 187 ? 12.094  88.134  5.127   1.00 35.56  ? 187 THR E O   1 
ATOM   9332  C CB  . THR E  1 187 ? 13.139  89.874  7.690   1.00 33.91  ? 187 THR E CB  1 
ATOM   9333  O OG1 . THR E  1 187 ? 13.673  90.339  6.457   1.00 35.46  ? 187 THR E OG1 1 
ATOM   9334  C CG2 . THR E  1 187 ? 14.168  90.026  8.808   1.00 34.00  ? 187 THR E CG2 1 
ATOM   9335  N N   . ASN E  1 188 ? 10.465  88.615  6.545   1.00 36.69  ? 188 ASN E N   1 
ATOM   9336  C CA  . ASN E  1 188 ? 9.457   88.581  5.499   1.00 38.37  ? 188 ASN E CA  1 
ATOM   9337  C C   . ASN E  1 188 ? 9.707   89.638  4.465   1.00 39.34  ? 188 ASN E C   1 
ATOM   9338  O O   . ASN E  1 188 ? 9.564   89.406  3.272   1.00 39.94  ? 188 ASN E O   1 
ATOM   9339  C CB  . ASN E  1 188 ? 8.105   88.791  6.078   1.00 39.51  ? 188 ASN E CB  1 
ATOM   9340  C CG  . ASN E  1 188 ? 7.343   87.479  6.033   1.00 40.56  ? 188 ASN E CG  1 
ATOM   9341  O OD1 . ASN E  1 188 ? 7.143   86.879  4.984   1.00 41.16  ? 188 ASN E OD1 1 
ATOM   9342  N ND2 . ASN E  1 188 ? 6.880   86.957  7.158   1.00 40.87  ? 188 ASN E ND2 1 
ATOM   9343  N N   . GLN E  1 189 ? 10.174  90.796  4.926   1.00 40.70  ? 189 GLN E N   1 
ATOM   9344  C CA  . GLN E  1 189 ? 10.577  91.874  4.044   1.00 42.29  ? 189 GLN E CA  1 
ATOM   9345  C C   . GLN E  1 189 ? 11.687  91.403  3.113   1.00 41.24  ? 189 GLN E C   1 
ATOM   9346  O O   . GLN E  1 189 ? 11.673  91.744  1.940   1.00 42.32  ? 189 GLN E O   1 
ATOM   9347  C CB  . GLN E  1 189 ? 11.052  93.111  4.874   1.00 44.85  ? 189 GLN E CB  1 
ATOM   9348  C CG  . GLN E  1 189 ? 12.472  93.251  5.508   1.00 48.16  ? 189 GLN E CG  1 
ATOM   9349  C CD  . GLN E  1 189 ? 12.556  93.954  6.891   1.00 50.17  ? 189 GLN E CD  1 
ATOM   9350  O OE1 . GLN E  1 189 ? 12.675  93.293  7.937   1.00 50.38  ? 189 GLN E OE1 1 
ATOM   9351  N NE2 . GLN E  1 189 ? 12.464  95.285  6.989   1.00 50.95  ? 189 GLN E NE2 1 
ATOM   9352  N N   . GLU E  1 190 ? 12.605  90.558  3.579   1.00 39.39  ? 190 GLU E N   1 
ATOM   9353  C CA  . GLU E  1 190 ? 13.692  90.056  2.758   1.00 37.92  ? 190 GLU E CA  1 
ATOM   9354  C C   . GLU E  1 190 ? 13.133  89.127  1.691   1.00 36.72  ? 190 GLU E C   1 
ATOM   9355  O O   . GLU E  1 190 ? 13.497  89.232  0.517   1.00 37.48  ? 190 GLU E O   1 
ATOM   9356  C CB  . GLU E  1 190 ? 14.672  89.319  3.649   1.00 38.22  ? 190 GLU E CB  1 
ATOM   9357  C CG  . GLU E  1 190 ? 16.011  88.972  3.065   1.00 39.04  ? 190 GLU E CG  1 
ATOM   9358  C CD  . GLU E  1 190 ? 16.822  88.053  3.956   1.00 39.27  ? 190 GLU E CD  1 
ATOM   9359  O OE1 . GLU E  1 190 ? 17.295  87.017  3.487   1.00 39.88  ? 190 GLU E OE1 1 
ATOM   9360  O OE2 . GLU E  1 190 ? 17.009  88.329  5.131   1.00 38.94  ? 190 GLU E OE2 1 
ATOM   9361  N N   . GLN E  1 191 ? 12.187  88.263  2.066   1.00 35.32  ? 191 GLN E N   1 
ATOM   9362  C CA  . GLN E  1 191 ? 11.548  87.337  1.146   1.00 34.68  ? 191 GLN E CA  1 
ATOM   9363  C C   . GLN E  1 191 ? 10.949  88.077  -0.037  1.00 34.83  ? 191 GLN E C   1 
ATOM   9364  O O   . GLN E  1 191 ? 11.354  87.895  -1.191  1.00 35.58  ? 191 GLN E O   1 
ATOM   9365  C CB  . GLN E  1 191 ? 10.467  86.559  1.892   1.00 33.45  ? 191 GLN E CB  1 
ATOM   9366  C CG  . GLN E  1 191 ? 9.500   85.730  1.069   1.00 32.60  ? 191 GLN E CG  1 
ATOM   9367  C CD  . GLN E  1 191 ? 10.124  84.608  0.277   1.00 32.66  ? 191 GLN E CD  1 
ATOM   9368  O OE1 . GLN E  1 191 ? 10.789  83.724  0.795   1.00 33.35  ? 191 GLN E OE1 1 
ATOM   9369  N NE2 . GLN E  1 191 ? 9.943   84.559  -1.017  1.00 33.37  ? 191 GLN E NE2 1 
ATOM   9370  N N   . THR E  1 192 ? 10.046  88.990  0.253   1.00 34.69  ? 192 THR E N   1 
ATOM   9371  C CA  . THR E  1 192 ? 9.330   89.733  -0.762  1.00 34.34  ? 192 THR E CA  1 
ATOM   9372  C C   . THR E  1 192 ? 10.243  90.628  -1.563  1.00 33.62  ? 192 THR E C   1 
ATOM   9373  O O   . THR E  1 192 ? 10.100  90.743  -2.785  1.00 34.76  ? 192 THR E O   1 
ATOM   9374  C CB  . THR E  1 192 ? 8.234   90.539  -0.074  1.00 35.19  ? 192 THR E CB  1 
ATOM   9375  O OG1 . THR E  1 192 ? 8.825   91.218  1.049   1.00 35.55  ? 192 THR E OG1 1 
ATOM   9376  C CG2 . THR E  1 192 ? 7.076   89.630  0.349   1.00 35.34  ? 192 THR E CG2 1 
ATOM   9377  N N   . SER E  1 193 ? 11.207  91.254  -0.900  1.00 32.28  ? 193 SER E N   1 
ATOM   9378  C CA  . SER E  1 193 ? 12.178  92.089  -1.568  1.00 30.61  ? 193 SER E CA  1 
ATOM   9379  C C   . SER E  1 193 ? 12.878  91.308  -2.672  1.00 29.02  ? 193 SER E C   1 
ATOM   9380  O O   . SER E  1 193 ? 12.851  91.741  -3.834  1.00 29.25  ? 193 SER E O   1 
ATOM   9381  C CB  . SER E  1 193 ? 13.170  92.571  -0.546  1.00 31.43  ? 193 SER E CB  1 
ATOM   9382  O OG  . SER E  1 193 ? 14.147  93.427  -1.100  1.00 33.36  ? 193 SER E OG  1 
ATOM   9383  N N   . LEU E  1 194 ? 13.392  90.126  -2.359  1.00 26.70  ? 194 LEU E N   1 
ATOM   9384  C CA  . LEU E  1 194 ? 14.127  89.375  -3.330  1.00 25.08  ? 194 LEU E CA  1 
ATOM   9385  C C   . LEU E  1 194 ? 13.281  88.618  -4.328  1.00 25.88  ? 194 LEU E C   1 
ATOM   9386  O O   . LEU E  1 194 ? 13.543  88.668  -5.542  1.00 27.20  ? 194 LEU E O   1 
ATOM   9387  C CB  . LEU E  1 194 ? 15.010  88.371  -2.669  1.00 23.52  ? 194 LEU E CB  1 
ATOM   9388  C CG  . LEU E  1 194 ? 16.126  88.842  -1.829  1.00 22.86  ? 194 LEU E CG  1 
ATOM   9389  C CD1 . LEU E  1 194 ? 16.916  87.649  -1.380  1.00 23.15  ? 194 LEU E CD1 1 
ATOM   9390  C CD2 . LEU E  1 194 ? 17.012  89.753  -2.616  1.00 23.34  ? 194 LEU E CD2 1 
ATOM   9391  N N   . TYR E  1 195 ? 12.296  87.881  -3.842  1.00 25.05  ? 195 TYR E N   1 
ATOM   9392  C CA  . TYR E  1 195 ? 11.613  86.936  -4.694  1.00 24.84  ? 195 TYR E CA  1 
ATOM   9393  C C   . TYR E  1 195 ? 10.184  87.314  -4.962  1.00 25.79  ? 195 TYR E C   1 
ATOM   9394  O O   . TYR E  1 195 ? 9.446   86.546  -5.563  1.00 25.79  ? 195 TYR E O   1 
ATOM   9395  C CB  . TYR E  1 195 ? 11.708  85.553  -4.038  1.00 24.21  ? 195 TYR E CB  1 
ATOM   9396  C CG  . TYR E  1 195 ? 13.115  85.167  -3.599  1.00 23.99  ? 195 TYR E CG  1 
ATOM   9397  C CD1 . TYR E  1 195 ? 14.160  85.116  -4.500  1.00 24.46  ? 195 TYR E CD1 1 
ATOM   9398  C CD2 . TYR E  1 195 ? 13.374  84.920  -2.272  1.00 24.11  ? 195 TYR E CD2 1 
ATOM   9399  C CE1 . TYR E  1 195 ? 15.448  84.849  -4.089  1.00 24.34  ? 195 TYR E CE1 1 
ATOM   9400  C CE2 . TYR E  1 195 ? 14.659  84.654  -1.852  1.00 24.52  ? 195 TYR E CE2 1 
ATOM   9401  C CZ  . TYR E  1 195 ? 15.697  84.625  -2.758  1.00 24.34  ? 195 TYR E CZ  1 
ATOM   9402  O OH  . TYR E  1 195 ? 16.981  84.408  -2.323  1.00 24.11  ? 195 TYR E OH  1 
ATOM   9403  N N   . VAL E  1 196 ? 9.782   88.513  -4.543  1.00 27.88  ? 196 VAL E N   1 
ATOM   9404  C CA  . VAL E  1 196 ? 8.447   89.090  -4.721  1.00 29.13  ? 196 VAL E CA  1 
ATOM   9405  C C   . VAL E  1 196 ? 7.354   88.319  -4.012  1.00 30.20  ? 196 VAL E C   1 
ATOM   9406  O O   . VAL E  1 196 ? 6.701   88.921  -3.159  1.00 30.60  ? 196 VAL E O   1 
ATOM   9407  C CB  . VAL E  1 196 ? 8.148   89.236  -6.236  1.00 29.50  ? 196 VAL E CB  1 
ATOM   9408  C CG1 . VAL E  1 196 ? 6.707   89.584  -6.534  1.00 29.76  ? 196 VAL E CG1 1 
ATOM   9409  C CG2 . VAL E  1 196 ? 8.993   90.378  -6.757  1.00 29.84  ? 196 VAL E CG2 1 
ATOM   9410  N N   . GLN E  1 197 ? 7.126   87.037  -4.297  1.00 31.12  ? 197 GLN E N   1 
ATOM   9411  C CA  . GLN E  1 197 ? 6.069   86.305  -3.619  1.00 33.76  ? 197 GLN E CA  1 
ATOM   9412  C C   . GLN E  1 197 ? 6.353   86.138  -2.129  1.00 35.10  ? 197 GLN E C   1 
ATOM   9413  O O   . GLN E  1 197 ? 7.502   86.193  -1.674  1.00 35.41  ? 197 GLN E O   1 
ATOM   9414  C CB  . GLN E  1 197 ? 5.856   84.893  -4.134  1.00 34.42  ? 197 GLN E CB  1 
ATOM   9415  C CG  . GLN E  1 197 ? 6.663   84.459  -5.320  1.00 36.23  ? 197 GLN E CG  1 
ATOM   9416  C CD  . GLN E  1 197 ? 6.332   85.173  -6.612  1.00 36.86  ? 197 GLN E CD  1 
ATOM   9417  O OE1 . GLN E  1 197 ? 5.449   86.015  -6.678  1.00 37.28  ? 197 GLN E OE1 1 
ATOM   9418  N NE2 . GLN E  1 197 ? 7.039   84.876  -7.683  1.00 37.82  ? 197 GLN E NE2 1 
ATOM   9419  N N   . ALA E  1 198 ? 5.309   85.895  -1.333  1.00 35.94  ? 198 ALA E N   1 
ATOM   9420  C CA  . ALA E  1 198 ? 5.477   85.729  0.099   1.00 36.35  ? 198 ALA E CA  1 
ATOM   9421  C C   . ALA E  1 198 ? 6.060   84.388  0.469   1.00 36.87  ? 198 ALA E C   1 
ATOM   9422  O O   . ALA E  1 198 ? 6.625   84.223  1.551   1.00 37.02  ? 198 ALA E O   1 
ATOM   9423  C CB  . ALA E  1 198 ? 4.158   85.846  0.798   1.00 36.98  ? 198 ALA E CB  1 
ATOM   9424  N N   . SER E  1 199 ? 5.902   83.408  -0.420  1.00 37.15  ? 199 SER E N   1 
ATOM   9425  C CA  . SER E  1 199 ? 6.398   82.073  -0.181  1.00 37.68  ? 199 SER E CA  1 
ATOM   9426  C C   . SER E  1 199 ? 6.976   81.534  -1.463  1.00 36.97  ? 199 SER E C   1 
ATOM   9427  O O   . SER E  1 199 ? 6.290   81.500  -2.488  1.00 36.45  ? 199 SER E O   1 
ATOM   9428  C CB  . SER E  1 199 ? 5.275   81.155  0.250   1.00 38.39  ? 199 SER E CB  1 
ATOM   9429  O OG  . SER E  1 199 ? 4.438   81.827  1.181   1.00 39.73  ? 199 SER E OG  1 
ATOM   9430  N N   . GLY E  1 200 ? 8.261   81.227  -1.438  1.00 36.37  ? 200 GLY E N   1 
ATOM   9431  C CA  . GLY E  1 200 ? 8.883   80.577  -2.573  1.00 34.84  ? 200 GLY E CA  1 
ATOM   9432  C C   . GLY E  1 200 ? 8.530   79.098  -2.574  1.00 32.79  ? 200 GLY E C   1 
ATOM   9433  O O   . GLY E  1 200 ? 7.848   78.610  -1.676  1.00 31.97  ? 200 GLY E O   1 
ATOM   9434  N N   . ARG E  1 201 ? 9.063   78.374  -3.536  1.00 31.90  ? 201 ARG E N   1 
ATOM   9435  C CA  . ARG E  1 201 ? 8.793   76.970  -3.716  1.00 30.94  ? 201 ARG E CA  1 
ATOM   9436  C C   . ARG E  1 201 ? 9.804   76.469  -4.718  1.00 28.92  ? 201 ARG E C   1 
ATOM   9437  O O   . ARG E  1 201 ? 9.971   77.131  -5.746  1.00 29.33  ? 201 ARG E O   1 
ATOM   9438  C CB  . ARG E  1 201 ? 7.400   76.810  -4.273  1.00 33.22  ? 201 ARG E CB  1 
ATOM   9439  C CG  . ARG E  1 201 ? 7.036   75.390  -4.635  1.00 36.39  ? 201 ARG E CG  1 
ATOM   9440  C CD  . ARG E  1 201 ? 5.645   75.299  -5.259  1.00 38.39  ? 201 ARG E CD  1 
ATOM   9441  N NE  . ARG E  1 201 ? 5.560   75.787  -6.630  1.00 39.85  ? 201 ARG E NE  1 
ATOM   9442  C CZ  . ARG E  1 201 ? 4.534   76.567  -7.021  1.00 40.72  ? 201 ARG E CZ  1 
ATOM   9443  N NH1 . ARG E  1 201 ? 4.475   76.942  -8.314  1.00 40.90  ? 201 ARG E NH1 1 
ATOM   9444  N NH2 . ARG E  1 201 ? 3.613   76.986  -6.121  1.00 40.43  ? 201 ARG E NH2 1 
ATOM   9445  N N   . VAL E  1 202 ? 10.490  75.371  -4.471  1.00 26.25  ? 202 VAL E N   1 
ATOM   9446  C CA  . VAL E  1 202 ? 11.366  74.806  -5.470  1.00 24.84  ? 202 VAL E CA  1 
ATOM   9447  C C   . VAL E  1 202 ? 10.950  73.352  -5.619  1.00 25.04  ? 202 VAL E C   1 
ATOM   9448  O O   . VAL E  1 202 ? 10.809  72.684  -4.592  1.00 24.72  ? 202 VAL E O   1 
ATOM   9449  C CB  . VAL E  1 202 ? 12.819  74.893  -5.015  1.00 24.08  ? 202 VAL E CB  1 
ATOM   9450  C CG1 . VAL E  1 202 ? 13.730  74.238  -6.047  1.00 24.20  ? 202 VAL E CG1 1 
ATOM   9451  C CG2 . VAL E  1 202 ? 13.218  76.337  -4.866  1.00 23.17  ? 202 VAL E CG2 1 
ATOM   9452  N N   . THR E  1 203 ? 10.652  72.872  -6.834  1.00 24.82  ? 203 THR E N   1 
ATOM   9453  C CA  . THR E  1 203 ? 10.360  71.469  -7.099  1.00 24.76  ? 203 THR E CA  1 
ATOM   9454  C C   . THR E  1 203 ? 11.344  71.019  -8.168  1.00 24.62  ? 203 THR E C   1 
ATOM   9455  O O   . THR E  1 203 ? 11.419  71.646  -9.227  1.00 25.22  ? 203 THR E O   1 
ATOM   9456  C CB  . THR E  1 203 ? 8.920   71.280  -7.625  1.00 25.16  ? 203 THR E CB  1 
ATOM   9457  O OG1 . THR E  1 203 ? 8.014   71.691  -6.601  1.00 25.08  ? 203 THR E OG1 1 
ATOM   9458  C CG2 . THR E  1 203 ? 8.635   69.827  -7.994  1.00 25.90  ? 203 THR E CG2 1 
ATOM   9459  N N   . VAL E  1 204 ? 12.165  70.010  -7.897  1.00 23.62  ? 204 VAL E N   1 
ATOM   9460  C CA  . VAL E  1 204 ? 13.130  69.525  -8.861  1.00 22.51  ? 204 VAL E CA  1 
ATOM   9461  C C   . VAL E  1 204 ? 12.689  68.117  -9.080  1.00 22.68  ? 204 VAL E C   1 
ATOM   9462  O O   . VAL E  1 204 ? 12.497  67.405  -8.091  1.00 23.56  ? 204 VAL E O   1 
ATOM   9463  C CB  . VAL E  1 204 ? 14.530  69.583  -8.261  1.00 22.38  ? 204 VAL E CB  1 
ATOM   9464  C CG1 . VAL E  1 204 ? 15.540  68.946  -9.172  1.00 22.70  ? 204 VAL E CG1 1 
ATOM   9465  C CG2 . VAL E  1 204 ? 14.920  71.025  -8.068  1.00 22.00  ? 204 VAL E CG2 1 
ATOM   9466  N N   . SER E  1 205 ? 12.501  67.723  -10.320 1.00 23.29  ? 205 SER E N   1 
ATOM   9467  C CA  . SER E  1 205 ? 11.955  66.427  -10.629 1.00 24.18  ? 205 SER E CA  1 
ATOM   9468  C C   . SER E  1 205 ? 12.620  65.764  -11.794 1.00 25.11  ? 205 SER E C   1 
ATOM   9469  O O   . SER E  1 205 ? 13.236  66.427  -12.623 1.00 25.44  ? 205 SER E O   1 
ATOM   9470  C CB  . SER E  1 205 ? 10.486  66.563  -10.943 1.00 24.45  ? 205 SER E CB  1 
ATOM   9471  O OG  . SER E  1 205 ? 9.983   67.903  -10.991 1.00 25.66  ? 205 SER E OG  1 
ATOM   9472  N N   . THR E  1 206 ? 12.538  64.454  -11.855 1.00 27.25  ? 206 THR E N   1 
ATOM   9473  C CA  . THR E  1 206 ? 12.970  63.692  -13.010 1.00 28.49  ? 206 THR E CA  1 
ATOM   9474  C C   . THR E  1 206 ? 11.792  62.790  -13.348 1.00 30.11  ? 206 THR E C   1 
ATOM   9475  O O   . THR E  1 206 ? 10.692  62.988  -12.803 1.00 30.37  ? 206 THR E O   1 
ATOM   9476  C CB  . THR E  1 206 ? 14.209  62.874  -12.671 1.00 28.23  ? 206 THR E CB  1 
ATOM   9477  O OG1 . THR E  1 206 ? 13.922  62.047  -11.540 1.00 28.77  ? 206 THR E OG1 1 
ATOM   9478  C CG2 . THR E  1 206 ? 15.397  63.790  -12.445 1.00 28.01  ? 206 THR E CG2 1 
ATOM   9479  N N   . ARG E  1 207 ? 11.886  61.802  -14.221 1.00 32.29  ? 207 ARG E N   1 
ATOM   9480  C CA  . ARG E  1 207 ? 10.732  60.952  -14.400 1.00 34.95  ? 207 ARG E CA  1 
ATOM   9481  C C   . ARG E  1 207 ? 10.611  60.059  -13.195 1.00 36.20  ? 207 ARG E C   1 
ATOM   9482  O O   . ARG E  1 207 ? 9.495   59.736  -12.796 1.00 36.84  ? 207 ARG E O   1 
ATOM   9483  C CB  . ARG E  1 207 ? 10.850  60.073  -15.587 1.00 36.24  ? 207 ARG E CB  1 
ATOM   9484  C CG  . ARG E  1 207 ? 10.600  60.839  -16.847 1.00 37.71  ? 207 ARG E CG  1 
ATOM   9485  C CD  . ARG E  1 207 ? 10.686  59.821  -17.964 1.00 39.83  ? 207 ARG E CD  1 
ATOM   9486  N NE  . ARG E  1 207 ? 10.723  60.496  -19.246 1.00 40.70  ? 207 ARG E NE  1 
ATOM   9487  C CZ  . ARG E  1 207 ? 11.867  60.553  -19.949 1.00 41.92  ? 207 ARG E CZ  1 
ATOM   9488  N NH1 . ARG E  1 207 ? 11.839  61.161  -21.135 1.00 42.93  ? 207 ARG E NH1 1 
ATOM   9489  N NH2 . ARG E  1 207 ? 13.035  60.054  -19.480 1.00 42.35  ? 207 ARG E NH2 1 
ATOM   9490  N N   . ARG E  1 208 ? 11.750  59.736  -12.590 1.00 37.23  ? 208 ARG E N   1 
ATOM   9491  C CA  . ARG E  1 208 ? 11.790  58.850  -11.458 1.00 39.22  ? 208 ARG E CA  1 
ATOM   9492  C C   . ARG E  1 208 ? 11.536  59.483  -10.092 1.00 38.06  ? 208 ARG E C   1 
ATOM   9493  O O   . ARG E  1 208 ? 11.306  58.757  -9.129  1.00 38.21  ? 208 ARG E O   1 
ATOM   9494  C CB  . ARG E  1 208 ? 13.143  58.160  -11.461 1.00 42.85  ? 208 ARG E CB  1 
ATOM   9495  C CG  . ARG E  1 208 ? 13.275  57.303  -12.709 1.00 47.27  ? 208 ARG E CG  1 
ATOM   9496  C CD  . ARG E  1 208 ? 14.656  56.664  -12.888 1.00 51.20  ? 208 ARG E CD  1 
ATOM   9497  N NE  . ARG E  1 208 ? 14.509  55.464  -13.706 1.00 54.51  ? 208 ARG E NE  1 
ATOM   9498  C CZ  . ARG E  1 208 ? 14.229  54.255  -13.141 1.00 56.68  ? 208 ARG E CZ  1 
ATOM   9499  N NH1 . ARG E  1 208 ? 14.026  53.166  -13.917 1.00 57.58  ? 208 ARG E NH1 1 
ATOM   9500  N NH2 . ARG E  1 208 ? 14.169  54.121  -11.792 1.00 57.26  ? 208 ARG E NH2 1 
ATOM   9501  N N   . SER E  1 209 ? 11.561  60.796  -9.909  1.00 36.81  ? 209 SER E N   1 
ATOM   9502  C CA  . SER E  1 209 ? 11.451  61.342  -8.566  1.00 35.82  ? 209 SER E CA  1 
ATOM   9503  C C   . SER E  1 209 ? 11.034  62.793  -8.583  1.00 34.70  ? 209 SER E C   1 
ATOM   9504  O O   . SER E  1 209 ? 10.955  63.391  -9.648  1.00 34.76  ? 209 SER E O   1 
ATOM   9505  C CB  . SER E  1 209 ? 12.790  61.225  -7.884  1.00 36.38  ? 209 SER E CB  1 
ATOM   9506  O OG  . SER E  1 209 ? 13.760  61.978  -8.605  1.00 37.17  ? 209 SER E OG  1 
ATOM   9507  N N   . GLN E  1 210 ? 10.786  63.368  -7.427  1.00 33.61  ? 210 GLN E N   1 
ATOM   9508  C CA  . GLN E  1 210 ? 10.470  64.779  -7.300  1.00 32.97  ? 210 GLN E CA  1 
ATOM   9509  C C   . GLN E  1 210 ? 10.906  65.198  -5.912  1.00 33.32  ? 210 GLN E C   1 
ATOM   9510  O O   . GLN E  1 210 ? 11.047  64.324  -5.059  1.00 34.70  ? 210 GLN E O   1 
ATOM   9511  C CB  . GLN E  1 210 ? 8.986   65.030  -7.406  1.00 31.91  ? 210 GLN E CB  1 
ATOM   9512  C CG  . GLN E  1 210 ? 8.192   64.138  -6.472  1.00 32.59  ? 210 GLN E CG  1 
ATOM   9513  C CD  . GLN E  1 210 ? 6.850   64.759  -6.239  1.00 33.25  ? 210 GLN E CD  1 
ATOM   9514  O OE1 . GLN E  1 210 ? 5.977   64.658  -7.094  1.00 34.63  ? 210 GLN E OE1 1 
ATOM   9515  N NE2 . GLN E  1 210 ? 6.647   65.606  -5.246  1.00 33.76  ? 210 GLN E NE2 1 
ATOM   9516  N N   . GLN E  1 211 ? 11.207  66.458  -5.645  1.00 32.49  ? 211 GLN E N   1 
ATOM   9517  C CA  . GLN E  1 211 ? 11.340  66.907  -4.269  1.00 31.42  ? 211 GLN E CA  1 
ATOM   9518  C C   . GLN E  1 211 ? 10.918  68.344  -4.306  1.00 30.33  ? 211 GLN E C   1 
ATOM   9519  O O   . GLN E  1 211 ? 11.212  69.046  -5.271  1.00 30.06  ? 211 GLN E O   1 
ATOM   9520  C CB  . GLN E  1 211 ? 12.759  66.781  -3.735  1.00 31.15  ? 211 GLN E CB  1 
ATOM   9521  C CG  . GLN E  1 211 ? 13.859  66.999  -4.723  1.00 31.46  ? 211 GLN E CG  1 
ATOM   9522  C CD  . GLN E  1 211 ? 15.110  66.237  -4.330  1.00 32.39  ? 211 GLN E CD  1 
ATOM   9523  O OE1 . GLN E  1 211 ? 15.524  66.180  -3.159  1.00 32.54  ? 211 GLN E OE1 1 
ATOM   9524  N NE2 . GLN E  1 211 ? 15.721  65.629  -5.340  1.00 32.35  ? 211 GLN E NE2 1 
ATOM   9525  N N   . THR E  1 212 ? 10.082  68.728  -3.371  1.00 29.43  ? 212 THR E N   1 
ATOM   9526  C CA  . THR E  1 212 ? 9.647   70.092  -3.322  1.00 28.86  ? 212 THR E CA  1 
ATOM   9527  C C   . THR E  1 212 ? 10.082  70.564  -1.969  1.00 28.62  ? 212 THR E C   1 
ATOM   9528  O O   . THR E  1 212 ? 9.848   69.866  -0.988  1.00 29.13  ? 212 THR E O   1 
ATOM   9529  C CB  . THR E  1 212 ? 8.142   70.163  -3.457  1.00 28.78  ? 212 THR E CB  1 
ATOM   9530  O OG1 . THR E  1 212 ? 7.820   69.525  -4.701  1.00 29.34  ? 212 THR E OG1 1 
ATOM   9531  C CG2 . THR E  1 212 ? 7.594   71.597  -3.361  1.00 28.13  ? 212 THR E CG2 1 
ATOM   9532  N N   . ILE E  1 213 ? 10.819  71.654  -1.927  1.00 27.76  ? 213 ILE E N   1 
ATOM   9533  C CA  . ILE E  1 213 ? 11.246  72.222  -0.682  1.00 26.69  ? 213 ILE E CA  1 
ATOM   9534  C C   . ILE E  1 213 ? 10.593  73.579  -0.639  1.00 26.62  ? 213 ILE E C   1 
ATOM   9535  O O   . ILE E  1 213 ? 10.429  74.219  -1.677  1.00 27.43  ? 213 ILE E O   1 
ATOM   9536  C CB  . ILE E  1 213 ? 12.781  72.332  -0.677  1.00 26.56  ? 213 ILE E CB  1 
ATOM   9537  C CG1 . ILE E  1 213 ? 13.489  70.995  -0.574  1.00 26.42  ? 213 ILE E CG1 1 
ATOM   9538  C CG2 . ILE E  1 213 ? 13.189  73.109  0.556   1.00 27.37  ? 213 ILE E CG2 1 
ATOM   9539  C CD1 . ILE E  1 213 ? 13.560  70.127  -1.819  1.00 27.09  ? 213 ILE E CD1 1 
ATOM   9540  N N   . ILE E  1 214 ? 10.100  73.998  0.510   1.00 27.41  ? 214 ILE E N   1 
ATOM   9541  C CA  . ILE E  1 214 ? 9.585   75.353  0.650   1.00 28.29  ? 214 ILE E CA  1 
ATOM   9542  C C   . ILE E  1 214 ? 10.529  76.002  1.650   1.00 28.25  ? 214 ILE E C   1 
ATOM   9543  O O   . ILE E  1 214 ? 11.003  75.304  2.552   1.00 28.14  ? 214 ILE E O   1 
ATOM   9544  C CB  . ILE E  1 214 ? 8.103   75.364  1.150   1.00 28.51  ? 214 ILE E CB  1 
ATOM   9545  C CG1 . ILE E  1 214 ? 7.864   74.448  2.327   1.00 30.11  ? 214 ILE E CG1 1 
ATOM   9546  C CG2 . ILE E  1 214 ? 7.242   74.958  -0.036  1.00 28.33  ? 214 ILE E CG2 1 
ATOM   9547  C CD1 . ILE E  1 214 ? 6.408   74.424  2.861   1.00 32.14  ? 214 ILE E CD1 1 
ATOM   9548  N N   . PRO E  1 215 ? 10.915  77.270  1.470   1.00 28.24  ? 215 PRO E N   1 
ATOM   9549  C CA  . PRO E  1 215 ? 11.836  77.969  2.334   1.00 28.47  ? 215 PRO E CA  1 
ATOM   9550  C C   . PRO E  1 215 ? 11.257  78.240  3.691   1.00 29.25  ? 215 PRO E C   1 
ATOM   9551  O O   . PRO E  1 215 ? 10.074  78.019  3.918   1.00 30.61  ? 215 PRO E O   1 
ATOM   9552  C CB  . PRO E  1 215 ? 12.162  79.199  1.554   1.00 28.60  ? 215 PRO E CB  1 
ATOM   9553  C CG  . PRO E  1 215 ? 10.844  79.527  0.935   1.00 28.62  ? 215 PRO E CG  1 
ATOM   9554  C CD  . PRO E  1 215 ? 10.405  78.166  0.447   1.00 28.38  ? 215 PRO E CD  1 
ATOM   9555  N N   . ASN E  1 216 ? 12.042  78.768  4.616   1.00 30.50  ? 216 ASN E N   1 
ATOM   9556  C CA  . ASN E  1 216 ? 11.558  79.032  5.963   1.00 31.82  ? 216 ASN E CA  1 
ATOM   9557  C C   . ASN E  1 216 ? 12.114  80.352  6.426   1.00 30.82  ? 216 ASN E C   1 
ATOM   9558  O O   . ASN E  1 216 ? 13.327  80.482  6.649   1.00 30.76  ? 216 ASN E O   1 
ATOM   9559  C CB  . ASN E  1 216 ? 12.030  78.003  6.933   1.00 34.66  ? 216 ASN E CB  1 
ATOM   9560  C CG  . ASN E  1 216 ? 11.856  76.556  6.514   1.00 37.09  ? 216 ASN E CG  1 
ATOM   9561  O OD1 . ASN E  1 216 ? 12.840  75.799  6.524   1.00 38.58  ? 216 ASN E OD1 1 
ATOM   9562  N ND2 . ASN E  1 216 ? 10.639  76.133  6.170   1.00 37.94  ? 216 ASN E ND2 1 
ATOM   9563  N N   . ILE E  1 217 ? 11.239  81.327  6.566   1.00 29.50  ? 217 ILE E N   1 
ATOM   9564  C CA  . ILE E  1 217 ? 11.651  82.671  6.902   1.00 29.67  ? 217 ILE E CA  1 
ATOM   9565  C C   . ILE E  1 217 ? 11.820  82.804  8.397   1.00 28.84  ? 217 ILE E C   1 
ATOM   9566  O O   . ILE E  1 217 ? 10.871  82.508  9.118   1.00 28.88  ? 217 ILE E O   1 
ATOM   9567  C CB  . ILE E  1 217 ? 10.585  83.659  6.387   1.00 30.29  ? 217 ILE E CB  1 
ATOM   9568  C CG1 . ILE E  1 217 ? 10.405  83.507  4.889   1.00 30.96  ? 217 ILE E CG1 1 
ATOM   9569  C CG2 . ILE E  1 217 ? 11.020  85.085  6.671   1.00 30.18  ? 217 ILE E CG2 1 
ATOM   9570  C CD1 . ILE E  1 217 ? 8.948   83.824  4.505   1.00 31.74  ? 217 ILE E CD1 1 
ATOM   9571  N N   . GLY E  1 218 ? 12.970  83.239  8.884   1.00 28.13  ? 218 GLY E N   1 
ATOM   9572  C CA  . GLY E  1 218 ? 13.135  83.423  10.313  1.00 27.47  ? 218 GLY E CA  1 
ATOM   9573  C C   . GLY E  1 218 ? 14.562  83.778  10.647  1.00 26.97  ? 218 GLY E C   1 
ATOM   9574  O O   . GLY E  1 218 ? 15.439  83.585  9.808   1.00 27.32  ? 218 GLY E O   1 
ATOM   9575  N N   . SER E  1 219 ? 14.845  84.262  11.846  1.00 26.86  ? 219 SER E N   1 
ATOM   9576  C CA  . SER E  1 219 ? 16.215  84.572  12.170  1.00 28.09  ? 219 SER E CA  1 
ATOM   9577  C C   . SER E  1 219 ? 17.023  83.399  12.690  1.00 27.78  ? 219 SER E C   1 
ATOM   9578  O O   . SER E  1 219 ? 16.603  82.637  13.561  1.00 28.78  ? 219 SER E O   1 
ATOM   9579  C CB  . SER E  1 219 ? 16.253  85.678  13.183  1.00 28.76  ? 219 SER E CB  1 
ATOM   9580  O OG  . SER E  1 219 ? 15.535  86.798  12.663  1.00 30.50  ? 219 SER E OG  1 
ATOM   9581  N N   . ARG E  1 220 ? 18.160  83.209  12.057  1.00 26.81  ? 220 ARG E N   1 
ATOM   9582  C CA  . ARG E  1 220 ? 19.122  82.251  12.509  1.00 26.40  ? 220 ARG E CA  1 
ATOM   9583  C C   . ARG E  1 220 ? 20.258  83.051  13.137  1.00 27.87  ? 220 ARG E C   1 
ATOM   9584  O O   . ARG E  1 220 ? 20.224  84.285  13.143  1.00 29.00  ? 220 ARG E O   1 
ATOM   9585  C CB  . ARG E  1 220 ? 19.647  81.456  11.328  1.00 25.16  ? 220 ARG E CB  1 
ATOM   9586  C CG  . ARG E  1 220 ? 18.718  80.401  10.795  1.00 22.83  ? 220 ARG E CG  1 
ATOM   9587  C CD  . ARG E  1 220 ? 17.808  80.916  9.743   1.00 20.42  ? 220 ARG E CD  1 
ATOM   9588  N NE  . ARG E  1 220 ? 16.919  79.842  9.403   1.00 19.38  ? 220 ARG E NE  1 
ATOM   9589  C CZ  . ARG E  1 220 ? 16.003  79.987  8.453   1.00 19.54  ? 220 ARG E CZ  1 
ATOM   9590  N NH1 . ARG E  1 220 ? 15.146  78.990  8.182   1.00 19.76  ? 220 ARG E NH1 1 
ATOM   9591  N NH2 . ARG E  1 220 ? 15.932  81.134  7.765   1.00 19.47  ? 220 ARG E NH2 1 
ATOM   9592  N N   . PRO E  1 221 ? 21.262  82.442  13.755  1.00 28.89  ? 221 PRO E N   1 
ATOM   9593  C CA  . PRO E  1 221 ? 22.382  83.175  14.302  1.00 29.73  ? 221 PRO E CA  1 
ATOM   9594  C C   . PRO E  1 221 ? 23.244  83.710  13.165  1.00 30.95  ? 221 PRO E C   1 
ATOM   9595  O O   . PRO E  1 221 ? 23.408  83.095  12.087  1.00 30.69  ? 221 PRO E O   1 
ATOM   9596  C CB  . PRO E  1 221 ? 23.136  82.190  15.157  1.00 30.12  ? 221 PRO E CB  1 
ATOM   9597  C CG  . PRO E  1 221 ? 22.040  81.293  15.633  1.00 29.44  ? 221 PRO E CG  1 
ATOM   9598  C CD  . PRO E  1 221 ? 21.211  81.123  14.370  1.00 29.18  ? 221 PRO E CD  1 
ATOM   9599  N N   . TRP E  1 222 ? 23.801  84.867  13.474  1.00 32.18  ? 222 TRP E N   1 
ATOM   9600  C CA  . TRP E  1 222 ? 24.735  85.617  12.668  1.00 33.23  ? 222 TRP E CA  1 
ATOM   9601  C C   . TRP E  1 222 ? 25.900  84.735  12.227  1.00 31.94  ? 222 TRP E C   1 
ATOM   9602  O O   . TRP E  1 222 ? 26.650  84.209  13.057  1.00 33.05  ? 222 TRP E O   1 
ATOM   9603  C CB  . TRP E  1 222 ? 25.208  86.767  13.534  1.00 36.08  ? 222 TRP E CB  1 
ATOM   9604  C CG  . TRP E  1 222 ? 25.793  88.007  12.868  1.00 39.58  ? 222 TRP E CG  1 
ATOM   9605  C CD1 . TRP E  1 222 ? 27.156  88.289  12.830  1.00 40.76  ? 222 TRP E CD1 1 
ATOM   9606  C CD2 . TRP E  1 222 ? 25.033  89.002  12.320  1.00 40.52  ? 222 TRP E CD2 1 
ATOM   9607  N NE1 . TRP E  1 222 ? 27.243  89.477  12.263  1.00 41.29  ? 222 TRP E NE1 1 
ATOM   9608  C CE2 . TRP E  1 222 ? 26.007  89.929  11.950  1.00 41.45  ? 222 TRP E CE2 1 
ATOM   9609  C CE3 . TRP E  1 222 ? 23.692  89.203  12.104  1.00 40.79  ? 222 TRP E CE3 1 
ATOM   9610  C CZ2 . TRP E  1 222 ? 25.646  91.119  11.355  1.00 42.09  ? 222 TRP E CZ2 1 
ATOM   9611  C CZ3 . TRP E  1 222 ? 23.338  90.388  11.503  1.00 41.69  ? 222 TRP E CZ3 1 
ATOM   9612  C CH2 . TRP E  1 222 ? 24.296  91.328  11.132  1.00 42.46  ? 222 TRP E CH2 1 
ATOM   9613  N N   . VAL E  1 223 ? 26.036  84.470  10.939  1.00 29.69  ? 223 VAL E N   1 
ATOM   9614  C CA  . VAL E  1 223 ? 27.222  83.819  10.445  1.00 28.16  ? 223 VAL E CA  1 
ATOM   9615  C C   . VAL E  1 223 ? 27.638  84.696  9.297   1.00 28.40  ? 223 VAL E C   1 
ATOM   9616  O O   . VAL E  1 223 ? 26.860  84.886  8.362   1.00 28.63  ? 223 VAL E O   1 
ATOM   9617  C CB  . VAL E  1 223 ? 26.948  82.413  9.950   1.00 26.62  ? 223 VAL E CB  1 
ATOM   9618  C CG1 . VAL E  1 223 ? 28.121  81.875  9.153   1.00 26.36  ? 223 VAL E CG1 1 
ATOM   9619  C CG2 . VAL E  1 223 ? 26.818  81.512  11.130  1.00 26.23  ? 223 VAL E CG2 1 
ATOM   9620  N N   . ARG E  1 224 ? 28.839  85.270  9.413   1.00 27.64  ? 224 ARG E N   1 
ATOM   9621  C CA  . ARG E  1 224 ? 29.380  86.190  8.433   1.00 26.84  ? 224 ARG E CA  1 
ATOM   9622  C C   . ARG E  1 224 ? 28.428  87.318  8.052   1.00 26.71  ? 224 ARG E C   1 
ATOM   9623  O O   . ARG E  1 224 ? 28.213  87.645  6.888   1.00 27.24  ? 224 ARG E O   1 
ATOM   9624  C CB  . ARG E  1 224 ? 29.787  85.403  7.214   1.00 26.67  ? 224 ARG E CB  1 
ATOM   9625  C CG  . ARG E  1 224 ? 31.206  84.925  7.357   1.00 27.25  ? 224 ARG E CG  1 
ATOM   9626  C CD  . ARG E  1 224 ? 31.606  84.177  6.097   1.00 27.39  ? 224 ARG E CD  1 
ATOM   9627  N NE  . ARG E  1 224 ? 30.808  82.974  5.932   1.00 27.43  ? 224 ARG E NE  1 
ATOM   9628  C CZ  . ARG E  1 224 ? 31.004  81.866  6.654   1.00 27.79  ? 224 ARG E CZ  1 
ATOM   9629  N NH1 . ARG E  1 224 ? 30.241  80.799  6.413   1.00 27.93  ? 224 ARG E NH1 1 
ATOM   9630  N NH2 . ARG E  1 224 ? 31.955  81.823  7.599   1.00 28.69  ? 224 ARG E NH2 1 
ATOM   9631  N N   . GLY E  1 225 ? 27.809  87.929  9.062   1.00 26.59  ? 225 GLY E N   1 
ATOM   9632  C CA  . GLY E  1 225 ? 26.893  89.035  8.827   1.00 26.37  ? 225 GLY E CA  1 
ATOM   9633  C C   . GLY E  1 225 ? 25.494  88.595  8.418   1.00 25.94  ? 225 GLY E C   1 
ATOM   9634  O O   . GLY E  1 225 ? 24.562  89.392  8.362   1.00 26.38  ? 225 GLY E O   1 
ATOM   9635  N N   . LEU E  1 226 ? 25.270  87.318  8.171   1.00 25.42  ? 226 LEU E N   1 
ATOM   9636  C CA  . LEU E  1 226 ? 24.002  86.888  7.664   1.00 24.05  ? 226 LEU E CA  1 
ATOM   9637  C C   . LEU E  1 226 ? 23.242  86.048  8.640   1.00 24.18  ? 226 LEU E C   1 
ATOM   9638  O O   . LEU E  1 226 ? 23.785  85.222  9.375   1.00 24.63  ? 226 LEU E O   1 
ATOM   9639  C CB  . LEU E  1 226 ? 24.256  86.136  6.405   1.00 24.15  ? 226 LEU E CB  1 
ATOM   9640  C CG  . LEU E  1 226 ? 24.803  86.990  5.299   1.00 24.57  ? 226 LEU E CG  1 
ATOM   9641  C CD1 . LEU E  1 226 ? 25.326  86.125  4.180   1.00 25.27  ? 226 LEU E CD1 1 
ATOM   9642  C CD2 . LEU E  1 226 ? 23.696  87.893  4.801   1.00 25.55  ? 226 LEU E CD2 1 
ATOM   9643  N N   . SER E  1 227 ? 21.941  86.250  8.620   1.00 24.37  ? 227 SER E N   1 
ATOM   9644  C CA  . SER E  1 227 ? 21.007  85.505  9.442   1.00 23.87  ? 227 SER E CA  1 
ATOM   9645  C C   . SER E  1 227 ? 20.220  84.563  8.541   1.00 23.40  ? 227 SER E C   1 
ATOM   9646  O O   . SER E  1 227 ? 19.257  83.940  8.956   1.00 23.25  ? 227 SER E O   1 
ATOM   9647  C CB  . SER E  1 227 ? 20.098  86.511  10.130  1.00 24.44  ? 227 SER E CB  1 
ATOM   9648  O OG  . SER E  1 227 ? 19.006  85.998  10.882  1.00 24.94  ? 227 SER E OG  1 
ATOM   9649  N N   . SER E  1 228 ? 20.608  84.419  7.293   1.00 23.37  ? 228 SER E N   1 
ATOM   9650  C CA  . SER E  1 228 ? 19.876  83.598  6.373   1.00 22.86  ? 228 SER E CA  1 
ATOM   9651  C C   . SER E  1 228 ? 20.695  82.354  6.113   1.00 22.37  ? 228 SER E C   1 
ATOM   9652  O O   . SER E  1 228 ? 21.858  82.272  6.537   1.00 22.86  ? 228 SER E O   1 
ATOM   9653  C CB  . SER E  1 228 ? 19.657  84.456  5.153   1.00 23.36  ? 228 SER E CB  1 
ATOM   9654  O OG  . SER E  1 228 ? 19.142  85.691  5.639   1.00 24.19  ? 228 SER E OG  1 
ATOM   9655  N N   . ARG E  1 229 ? 20.097  81.329  5.554   1.00 21.33  ? 229 ARG E N   1 
ATOM   9656  C CA  . ARG E  1 229 ? 20.856  80.157  5.207   1.00 21.12  ? 229 ARG E CA  1 
ATOM   9657  C C   . ARG E  1 229 ? 20.427  79.739  3.838   1.00 20.11  ? 229 ARG E C   1 
ATOM   9658  O O   . ARG E  1 229 ? 19.417  80.239  3.334   1.00 20.73  ? 229 ARG E O   1 
ATOM   9659  C CB  . ARG E  1 229 ? 20.587  78.983  6.124   1.00 22.14  ? 229 ARG E CB  1 
ATOM   9660  C CG  . ARG E  1 229 ? 21.546  78.794  7.277   1.00 23.31  ? 229 ARG E CG  1 
ATOM   9661  C CD  . ARG E  1 229 ? 21.257  79.815  8.338   1.00 23.82  ? 229 ARG E CD  1 
ATOM   9662  N NE  . ARG E  1 229 ? 22.217  79.743  9.417   1.00 25.12  ? 229 ARG E NE  1 
ATOM   9663  C CZ  . ARG E  1 229 ? 22.928  80.826  9.788   1.00 25.89  ? 229 ARG E CZ  1 
ATOM   9664  N NH1 . ARG E  1 229 ? 23.712  80.738  10.873  1.00 26.37  ? 229 ARG E NH1 1 
ATOM   9665  N NH2 . ARG E  1 229 ? 22.960  81.945  9.035   1.00 25.49  ? 229 ARG E NH2 1 
ATOM   9666  N N   . ILE E  1 230 ? 21.227  78.941  3.170   1.00 18.30  ? 230 ILE E N   1 
ATOM   9667  C CA  . ILE E  1 230 ? 20.700  78.267  2.024   1.00 17.67  ? 230 ILE E CA  1 
ATOM   9668  C C   . ILE E  1 230 ? 20.855  76.795  2.355   1.00 17.89  ? 230 ILE E C   1 
ATOM   9669  O O   . ILE E  1 230 ? 21.820  76.437  3.032   1.00 18.48  ? 230 ILE E O   1 
ATOM   9670  C CB  . ILE E  1 230 ? 21.455  78.645  0.738   1.00 17.02  ? 230 ILE E CB  1 
ATOM   9671  C CG1 . ILE E  1 230 ? 22.925  78.464  0.832   1.00 17.19  ? 230 ILE E CG1 1 
ATOM   9672  C CG2 . ILE E  1 230 ? 21.122  80.090  0.455   1.00 17.00  ? 230 ILE E CG2 1 
ATOM   9673  C CD1 . ILE E  1 230 ? 23.613  78.943  -0.449  1.00 18.16  ? 230 ILE E CD1 1 
ATOM   9674  N N   . SER E  1 231 ? 19.899  75.939  2.002   1.00 17.17  ? 231 SER E N   1 
ATOM   9675  C CA  . SER E  1 231 ? 20.033  74.518  2.253   1.00 15.90  ? 231 SER E CA  1 
ATOM   9676  C C   . SER E  1 231 ? 20.333  73.858  0.916   1.00 14.76  ? 231 SER E C   1 
ATOM   9677  O O   . SER E  1 231 ? 19.737  74.256  -0.084  1.00 14.07  ? 231 SER E O   1 
ATOM   9678  C CB  . SER E  1 231 ? 18.746  74.016  2.856   1.00 16.47  ? 231 SER E CB  1 
ATOM   9679  O OG  . SER E  1 231 ? 18.340  74.803  3.974   1.00 16.68  ? 231 SER E OG  1 
ATOM   9680  N N   . ILE E  1 232 ? 21.278  72.911  0.884   1.00 14.02  ? 232 ILE E N   1 
ATOM   9681  C CA  . ILE E  1 232 ? 21.785  72.269  -0.328  1.00 13.51  ? 232 ILE E CA  1 
ATOM   9682  C C   . ILE E  1 232 ? 21.081  70.943  -0.625  1.00 13.83  ? 232 ILE E C   1 
ATOM   9683  O O   . ILE E  1 232 ? 20.792  70.161  0.283   1.00 13.71  ? 232 ILE E O   1 
ATOM   9684  C CB  . ILE E  1 232 ? 23.316  72.043  -0.166  1.00 12.31  ? 232 ILE E CB  1 
ATOM   9685  C CG1 . ILE E  1 232 ? 24.057  73.374  -0.074  1.00 12.32  ? 232 ILE E CG1 1 
ATOM   9686  C CG2 . ILE E  1 232 ? 23.850  71.253  -1.338  1.00 12.32  ? 232 ILE E CG2 1 
ATOM   9687  C CD1 . ILE E  1 232 ? 23.907  74.389  -1.224  1.00 12.05  ? 232 ILE E CD1 1 
ATOM   9688  N N   . TYR E  1 233 ? 20.796  70.640  -1.889  1.00 14.06  ? 233 TYR E N   1 
ATOM   9689  C CA  . TYR E  1 233 ? 20.116  69.410  -2.260  1.00 14.15  ? 233 TYR E CA  1 
ATOM   9690  C C   . TYR E  1 233 ? 20.813  68.828  -3.474  1.00 13.87  ? 233 TYR E C   1 
ATOM   9691  O O   . TYR E  1 233 ? 21.568  69.527  -4.151  1.00 13.19  ? 233 TYR E O   1 
ATOM   9692  C CB  . TYR E  1 233 ? 18.629  69.702  -2.565  1.00 14.34  ? 233 TYR E CB  1 
ATOM   9693  C CG  . TYR E  1 233 ? 17.829  70.115  -1.319  1.00 14.56  ? 233 TYR E CG  1 
ATOM   9694  C CD1 . TYR E  1 233 ? 17.732  71.429  -0.938  1.00 14.30  ? 233 TYR E CD1 1 
ATOM   9695  C CD2 . TYR E  1 233 ? 17.281  69.150  -0.508  1.00 14.80  ? 233 TYR E CD2 1 
ATOM   9696  C CE1 . TYR E  1 233 ? 17.115  71.764  0.237   1.00 14.34  ? 233 TYR E CE1 1 
ATOM   9697  C CE2 . TYR E  1 233 ? 16.661  69.475  0.670   1.00 14.38  ? 233 TYR E CE2 1 
ATOM   9698  C CZ  . TYR E  1 233 ? 16.590  70.781  1.037   1.00 14.59  ? 233 TYR E CZ  1 
ATOM   9699  O OH  . TYR E  1 233 ? 16.005  71.095  2.249   1.00 15.14  ? 233 TYR E OH  1 
ATOM   9700  N N   . TRP E  1 234 ? 20.624  67.556  -3.776  1.00 14.52  ? 234 TRP E N   1 
ATOM   9701  C CA  . TRP E  1 234 ? 21.311  66.972  -4.911  1.00 15.47  ? 234 TRP E CA  1 
ATOM   9702  C C   . TRP E  1 234 ? 20.316  66.130  -5.668  1.00 15.51  ? 234 TRP E C   1 
ATOM   9703  O O   . TRP E  1 234 ? 19.415  65.568  -5.051  1.00 16.86  ? 234 TRP E O   1 
ATOM   9704  C CB  . TRP E  1 234 ? 22.500  66.109  -4.443  1.00 17.43  ? 234 TRP E CB  1 
ATOM   9705  C CG  . TRP E  1 234 ? 22.244  65.035  -3.383  1.00 19.16  ? 234 TRP E CG  1 
ATOM   9706  C CD1 . TRP E  1 234 ? 22.203  65.278  -2.014  1.00 19.81  ? 234 TRP E CD1 1 
ATOM   9707  C CD2 . TRP E  1 234 ? 22.004  63.738  -3.674  1.00 19.96  ? 234 TRP E CD2 1 
ATOM   9708  N NE1 . TRP E  1 234 ? 21.924  64.131  -1.445  1.00 19.83  ? 234 TRP E NE1 1 
ATOM   9709  C CE2 . TRP E  1 234 ? 21.793  63.195  -2.414  1.00 20.77  ? 234 TRP E CE2 1 
ATOM   9710  C CE3 . TRP E  1 234 ? 21.921  62.992  -4.819  1.00 21.05  ? 234 TRP E CE3 1 
ATOM   9711  C CZ2 . TRP E  1 234 ? 21.493  61.851  -2.298  1.00 22.64  ? 234 TRP E CZ2 1 
ATOM   9712  C CZ3 . TRP E  1 234 ? 21.615  61.644  -4.689  1.00 22.88  ? 234 TRP E CZ3 1 
ATOM   9713  C CH2 . TRP E  1 234 ? 21.400  61.071  -3.451  1.00 23.08  ? 234 TRP E CH2 1 
ATOM   9714  N N   . THR E  1 235 ? 20.387  66.058  -6.982  1.00 15.06  ? 235 THR E N   1 
ATOM   9715  C CA  . THR E  1 235 ? 19.505  65.215  -7.762  1.00 14.60  ? 235 THR E CA  1 
ATOM   9716  C C   . THR E  1 235 ? 20.366  64.448  -8.738  1.00 15.21  ? 235 THR E C   1 
ATOM   9717  O O   . THR E  1 235 ? 21.163  65.076  -9.422  1.00 16.18  ? 235 THR E O   1 
ATOM   9718  C CB  . THR E  1 235 ? 18.520  66.083  -8.506  1.00 14.29  ? 235 THR E CB  1 
ATOM   9719  O OG1 . THR E  1 235 ? 17.739  66.738  -7.510  1.00 14.43  ? 235 THR E OG1 1 
ATOM   9720  C CG2 . THR E  1 235 ? 17.654  65.295  -9.466  1.00 14.50  ? 235 THR E CG2 1 
ATOM   9721  N N   . ILE E  1 236 ? 20.334  63.128  -8.801  1.00 16.17  ? 236 ILE E N   1 
ATOM   9722  C CA  . ILE E  1 236 ? 21.101  62.451  -9.834  1.00 17.23  ? 236 ILE E CA  1 
ATOM   9723  C C   . ILE E  1 236 ? 20.124  62.218  -10.967 1.00 19.12  ? 236 ILE E C   1 
ATOM   9724  O O   . ILE E  1 236 ? 18.979  61.845  -10.692 1.00 20.43  ? 236 ILE E O   1 
ATOM   9725  C CB  . ILE E  1 236 ? 21.676  61.119  -9.316  1.00 15.81  ? 236 ILE E CB  1 
ATOM   9726  C CG1 . ILE E  1 236 ? 22.782  61.427  -8.327  1.00 15.02  ? 236 ILE E CG1 1 
ATOM   9727  C CG2 . ILE E  1 236 ? 22.182  60.278  -10.477 1.00 15.29  ? 236 ILE E CG2 1 
ATOM   9728  C CD1 . ILE E  1 236 ? 23.419  60.253  -7.581  1.00 14.60  ? 236 ILE E CD1 1 
ATOM   9729  N N   . VAL E  1 237 ? 20.490  62.501  -12.212 1.00 20.71  ? 237 VAL E N   1 
ATOM   9730  C CA  . VAL E  1 237 ? 19.612  62.273  -13.349 1.00 22.09  ? 237 VAL E CA  1 
ATOM   9731  C C   . VAL E  1 237 ? 20.257  61.174  -14.185 1.00 24.27  ? 237 VAL E C   1 
ATOM   9732  O O   . VAL E  1 237 ? 21.374  61.358  -14.691 1.00 23.52  ? 237 VAL E O   1 
ATOM   9733  C CB  . VAL E  1 237 ? 19.468  63.563  -14.144 1.00 20.66  ? 237 VAL E CB  1 
ATOM   9734  C CG1 . VAL E  1 237 ? 18.478  63.360  -15.260 1.00 20.69  ? 237 VAL E CG1 1 
ATOM   9735  C CG2 . VAL E  1 237 ? 18.954  64.662  -13.245 1.00 20.24  ? 237 VAL E CG2 1 
ATOM   9736  N N   . LYS E  1 238 ? 19.546  60.041  -14.301 1.00 26.47  ? 238 LYS E N   1 
ATOM   9737  C CA  . LYS E  1 238 ? 20.047  58.849  -14.975 1.00 28.26  ? 238 LYS E CA  1 
ATOM   9738  C C   . LYS E  1 238 ? 20.070  59.082  -16.475 1.00 29.10  ? 238 LYS E C   1 
ATOM   9739  O O   . LYS E  1 238 ? 19.370  60.001  -16.928 1.00 30.11  ? 238 LYS E O   1 
ATOM   9740  C CB  . LYS E  1 238 ? 19.138  57.666  -14.676 1.00 30.36  ? 238 LYS E CB  1 
ATOM   9741  C CG  . LYS E  1 238 ? 18.917  57.266  -13.215 1.00 33.11  ? 238 LYS E CG  1 
ATOM   9742  C CD  . LYS E  1 238 ? 20.187  56.782  -12.487 1.00 35.08  ? 238 LYS E CD  1 
ATOM   9743  C CE  . LYS E  1 238 ? 20.743  55.424  -12.951 1.00 35.77  ? 238 LYS E CE  1 
ATOM   9744  N NZ  . LYS E  1 238 ? 19.905  54.322  -12.496 1.00 37.22  ? 238 LYS E NZ  1 
ATOM   9745  N N   . PRO E  1 239 ? 20.794  58.334  -17.330 1.00 29.35  ? 239 PRO E N   1 
ATOM   9746  C CA  . PRO E  1 239 ? 20.816  58.560  -18.771 1.00 28.62  ? 239 PRO E CA  1 
ATOM   9747  C C   . PRO E  1 239 ? 19.445  58.308  -19.369 1.00 28.12  ? 239 PRO E C   1 
ATOM   9748  O O   . PRO E  1 239 ? 18.730  57.374  -19.012 1.00 28.27  ? 239 PRO E O   1 
ATOM   9749  C CB  . PRO E  1 239 ? 21.869  57.624  -19.294 1.00 28.76  ? 239 PRO E CB  1 
ATOM   9750  C CG  . PRO E  1 239 ? 22.623  57.188  -18.056 1.00 29.09  ? 239 PRO E CG  1 
ATOM   9751  C CD  . PRO E  1 239 ? 21.504  57.093  -17.051 1.00 29.48  ? 239 PRO E CD  1 
ATOM   9752  N N   . GLY E  1 240 ? 19.060  59.189  -20.256 1.00 27.96  ? 240 GLY E N   1 
ATOM   9753  C CA  . GLY E  1 240 ? 17.758  59.151  -20.873 1.00 28.74  ? 240 GLY E CA  1 
ATOM   9754  C C   . GLY E  1 240 ? 16.706  59.944  -20.093 1.00 29.15  ? 240 GLY E C   1 
ATOM   9755  O O   . GLY E  1 240 ? 15.606  60.215  -20.616 1.00 29.37  ? 240 GLY E O   1 
ATOM   9756  N N   . ASP E  1 241 ? 16.987  60.332  -18.835 1.00 28.67  ? 241 ASP E N   1 
ATOM   9757  C CA  . ASP E  1 241 ? 15.962  61.002  -18.048 1.00 28.29  ? 241 ASP E CA  1 
ATOM   9758  C C   . ASP E  1 241 ? 15.923  62.503  -18.270 1.00 27.08  ? 241 ASP E C   1 
ATOM   9759  O O   . ASP E  1 241 ? 16.628  63.019  -19.138 1.00 27.83  ? 241 ASP E O   1 
ATOM   9760  C CB  . ASP E  1 241 ? 16.161  60.697  -16.559 1.00 29.47  ? 241 ASP E CB  1 
ATOM   9761  C CG  . ASP E  1 241 ? 14.851  60.680  -15.774 1.00 30.21  ? 241 ASP E CG  1 
ATOM   9762  O OD1 . ASP E  1 241 ? 13.829  61.197  -16.260 1.00 29.50  ? 241 ASP E OD1 1 
ATOM   9763  O OD2 . ASP E  1 241 ? 14.818  60.144  -14.652 1.00 31.14  ? 241 ASP E OD2 1 
ATOM   9764  N N   . VAL E  1 242 ? 15.089  63.255  -17.586 1.00 25.25  ? 242 VAL E N   1 
ATOM   9765  C CA  . VAL E  1 242 ? 15.005  64.662  -17.835 1.00 24.28  ? 242 VAL E CA  1 
ATOM   9766  C C   . VAL E  1 242 ? 15.071  65.296  -16.476 1.00 24.37  ? 242 VAL E C   1 
ATOM   9767  O O   . VAL E  1 242 ? 14.572  64.701  -15.521 1.00 25.43  ? 242 VAL E O   1 
ATOM   9768  C CB  . VAL E  1 242 ? 13.672  65.062  -18.435 1.00 24.03  ? 242 VAL E CB  1 
ATOM   9769  C CG1 . VAL E  1 242 ? 13.890  66.392  -19.108 1.00 24.78  ? 242 VAL E CG1 1 
ATOM   9770  C CG2 . VAL E  1 242 ? 13.158  64.098  -19.461 1.00 24.68  ? 242 VAL E CG2 1 
ATOM   9771  N N   . LEU E  1 243 ? 15.722  66.447  -16.347 1.00 23.51  ? 243 LEU E N   1 
ATOM   9772  C CA  . LEU E  1 243 ? 15.622  67.214  -15.118 1.00 22.21  ? 243 LEU E CA  1 
ATOM   9773  C C   . LEU E  1 243 ? 14.611  68.302  -15.409 1.00 21.10  ? 243 LEU E C   1 
ATOM   9774  O O   . LEU E  1 243 ? 14.676  68.892  -16.485 1.00 20.88  ? 243 LEU E O   1 
ATOM   9775  C CB  . LEU E  1 243 ? 16.954  67.875  -14.744 1.00 21.70  ? 243 LEU E CB  1 
ATOM   9776  C CG  . LEU E  1 243 ? 16.991  68.745  -13.492 1.00 21.18  ? 243 LEU E CG  1 
ATOM   9777  C CD1 . LEU E  1 243 ? 16.809  67.888  -12.271 1.00 20.90  ? 243 LEU E CD1 1 
ATOM   9778  C CD2 . LEU E  1 243 ? 18.311  69.460  -13.402 1.00 21.26  ? 243 LEU E CD2 1 
ATOM   9779  N N   . VAL E  1 244 ? 13.643  68.548  -14.545 1.00 20.46  ? 244 VAL E N   1 
ATOM   9780  C CA  . VAL E  1 244 ? 12.769  69.695  -14.693 1.00 20.30  ? 244 VAL E CA  1 
ATOM   9781  C C   . VAL E  1 244 ? 12.896  70.482  -13.397 1.00 21.08  ? 244 VAL E C   1 
ATOM   9782  O O   . VAL E  1 244 ? 12.665  69.915  -12.322 1.00 22.43  ? 244 VAL E O   1 
ATOM   9783  C CB  . VAL E  1 244 ? 11.314  69.257  -14.926 1.00 19.58  ? 244 VAL E CB  1 
ATOM   9784  C CG1 . VAL E  1 244 ? 10.330  70.398  -14.785 1.00 19.25  ? 244 VAL E CG1 1 
ATOM   9785  C CG2 . VAL E  1 244 ? 11.203  68.799  -16.357 1.00 19.89  ? 244 VAL E CG2 1 
ATOM   9786  N N   . ILE E  1 245 ? 13.350  71.741  -13.447 1.00 20.63  ? 245 ILE E N   1 
ATOM   9787  C CA  . ILE E  1 245 ? 13.442  72.555  -12.238 1.00 19.78  ? 245 ILE E CA  1 
ATOM   9788  C C   . ILE E  1 245 ? 12.310  73.548  -12.349 1.00 19.05  ? 245 ILE E C   1 
ATOM   9789  O O   . ILE E  1 245 ? 12.226  74.236  -13.356 1.00 18.24  ? 245 ILE E O   1 
ATOM   9790  C CB  . ILE E  1 245 ? 14.795  73.317  -12.153 1.00 19.70  ? 245 ILE E CB  1 
ATOM   9791  C CG1 . ILE E  1 245 ? 15.913  72.302  -12.300 1.00 19.70  ? 245 ILE E CG1 1 
ATOM   9792  C CG2 . ILE E  1 245 ? 14.906  74.112  -10.839 1.00 18.44  ? 245 ILE E CG2 1 
ATOM   9793  C CD1 . ILE E  1 245 ? 17.275  72.948  -12.417 1.00 20.22  ? 245 ILE E CD1 1 
ATOM   9794  N N   . ASN E  1 246 ? 11.421  73.617  -11.383 1.00 19.61  ? 246 ASN E N   1 
ATOM   9795  C CA  . ASN E  1 246 ? 10.305  74.537  -11.416 1.00 20.26  ? 246 ASN E CA  1 
ATOM   9796  C C   . ASN E  1 246 ? 10.289  75.273  -10.108 1.00 20.73  ? 246 ASN E C   1 
ATOM   9797  O O   . ASN E  1 246 ? 10.363  74.628  -9.047  1.00 20.22  ? 246 ASN E O   1 
ATOM   9798  C CB  . ASN E  1 246 ? 9.021   73.786  -11.567 1.00 21.85  ? 246 ASN E CB  1 
ATOM   9799  C CG  . ASN E  1 246 ? 7.758   74.627  -11.495 1.00 22.88  ? 246 ASN E CG  1 
ATOM   9800  O OD1 . ASN E  1 246 ? 7.322   75.157  -10.459 1.00 24.07  ? 246 ASN E OD1 1 
ATOM   9801  N ND2 . ASN E  1 246 ? 7.087   74.697  -12.630 1.00 23.16  ? 246 ASN E ND2 1 
ATOM   9802  N N   . SER E  1 247 ? 10.191  76.598  -10.145 1.00 21.32  ? 247 SER E N   1 
ATOM   9803  C CA  . SER E  1 247 ? 10.229  77.379  -8.921  1.00 21.96  ? 247 SER E CA  1 
ATOM   9804  C C   . SER E  1 247 ? 9.558   78.698  -9.096  1.00 22.30  ? 247 SER E C   1 
ATOM   9805  O O   . SER E  1 247 ? 9.588   79.236  -10.195 1.00 22.62  ? 247 SER E O   1 
ATOM   9806  C CB  . SER E  1 247 ? 11.657  77.651  -8.488  1.00 21.52  ? 247 SER E CB  1 
ATOM   9807  O OG  . SER E  1 247 ? 11.797  78.642  -7.480  1.00 20.45  ? 247 SER E OG  1 
ATOM   9808  N N   . ASN E  1 248 ? 8.933   79.218  -8.047  1.00 23.59  ? 248 ASN E N   1 
ATOM   9809  C CA  . ASN E  1 248 ? 8.443   80.578  -8.141  1.00 25.27  ? 248 ASN E CA  1 
ATOM   9810  C C   . ASN E  1 248 ? 9.197   81.442  -7.149  1.00 25.42  ? 248 ASN E C   1 
ATOM   9811  O O   . ASN E  1 248 ? 8.773   82.554  -6.847  1.00 25.03  ? 248 ASN E O   1 
ATOM   9812  C CB  . ASN E  1 248 ? 6.946   80.740  -7.850  1.00 26.33  ? 248 ASN E CB  1 
ATOM   9813  C CG  . ASN E  1 248 ? 6.512   80.382  -6.446  1.00 28.20  ? 248 ASN E CG  1 
ATOM   9814  O OD1 . ASN E  1 248 ? 5.859   79.360  -6.263  1.00 30.04  ? 248 ASN E OD1 1 
ATOM   9815  N ND2 . ASN E  1 248 ? 6.818   81.122  -5.397  1.00 29.17  ? 248 ASN E ND2 1 
ATOM   9816  N N   . GLY E  1 249 ? 10.311  80.996  -6.583  1.00 25.57  ? 249 GLY E N   1 
ATOM   9817  C CA  . GLY E  1 249 ? 11.070  81.870  -5.709  1.00 24.68  ? 249 GLY E CA  1 
ATOM   9818  C C   . GLY E  1 249 ? 12.064  81.115  -4.863  1.00 23.47  ? 249 GLY E C   1 
ATOM   9819  O O   . GLY E  1 249 ? 11.906  79.936  -4.616  1.00 23.67  ? 249 GLY E O   1 
ATOM   9820  N N   . ASN E  1 250 ? 13.112  81.785  -4.442  1.00 22.89  ? 250 ASN E N   1 
ATOM   9821  C CA  . ASN E  1 250 ? 14.133  81.253  -3.544  1.00 22.05  ? 250 ASN E CA  1 
ATOM   9822  C C   . ASN E  1 250 ? 15.041  80.194  -4.159  1.00 20.98  ? 250 ASN E C   1 
ATOM   9823  O O   . ASN E  1 250 ? 15.837  79.592  -3.428  1.00 20.33  ? 250 ASN E O   1 
ATOM   9824  C CB  . ASN E  1 250 ? 13.498  80.669  -2.268  1.00 22.04  ? 250 ASN E CB  1 
ATOM   9825  C CG  . ASN E  1 250 ? 12.619  81.671  -1.548  1.00 22.35  ? 250 ASN E CG  1 
ATOM   9826  O OD1 . ASN E  1 250 ? 11.617  82.116  -2.116  1.00 22.12  ? 250 ASN E OD1 1 
ATOM   9827  N ND2 . ASN E  1 250 ? 12.944  82.103  -0.336  1.00 21.87  ? 250 ASN E ND2 1 
ATOM   9828  N N   . LEU E  1 251 ? 15.006  80.000  -5.487  1.00 19.13  ? 251 LEU E N   1 
ATOM   9829  C CA  . LEU E  1 251 ? 15.824  78.979  -6.112  1.00 17.42  ? 251 LEU E CA  1 
ATOM   9830  C C   . LEU E  1 251 ? 17.268  79.446  -6.119  1.00 17.24  ? 251 LEU E C   1 
ATOM   9831  O O   . LEU E  1 251 ? 17.541  80.622  -6.342  1.00 17.94  ? 251 LEU E O   1 
ATOM   9832  C CB  . LEU E  1 251 ? 15.468  78.748  -7.561  1.00 16.69  ? 251 LEU E CB  1 
ATOM   9833  C CG  . LEU E  1 251 ? 15.475  77.400  -8.277  1.00 16.18  ? 251 LEU E CG  1 
ATOM   9834  C CD1 . LEU E  1 251 ? 15.830  77.715  -9.708  1.00 15.40  ? 251 LEU E CD1 1 
ATOM   9835  C CD2 . LEU E  1 251 ? 16.436  76.384  -7.687  1.00 16.04  ? 251 LEU E CD2 1 
ATOM   9836  N N   . ILE E  1 252 ? 18.176  78.531  -5.816  1.00 15.91  ? 252 ILE E N   1 
ATOM   9837  C CA  . ILE E  1 252 ? 19.594  78.710  -6.002  1.00 13.62  ? 252 ILE E CA  1 
ATOM   9838  C C   . ILE E  1 252 ? 19.793  77.697  -7.111  1.00 13.57  ? 252 ILE E C   1 
ATOM   9839  O O   . ILE E  1 252 ? 19.765  76.501  -6.825  1.00 15.18  ? 252 ILE E O   1 
ATOM   9840  C CB  . ILE E  1 252 ? 20.333  78.285  -4.736  1.00 12.82  ? 252 ILE E CB  1 
ATOM   9841  C CG1 . ILE E  1 252 ? 20.004  79.237  -3.603  1.00 12.44  ? 252 ILE E CG1 1 
ATOM   9842  C CG2 . ILE E  1 252 ? 21.809  78.216  -5.016  1.00 13.23  ? 252 ILE E CG2 1 
ATOM   9843  C CD1 . ILE E  1 252 ? 20.326  80.696  -3.878  1.00 12.78  ? 252 ILE E CD1 1 
ATOM   9844  N N   . ALA E  1 253 ? 19.898  78.127  -8.367  1.00 11.95  ? 253 ALA E N   1 
ATOM   9845  C CA  . ALA E  1 253 ? 19.955  77.217  -9.513  1.00 10.46  ? 253 ALA E CA  1 
ATOM   9846  C C   . ALA E  1 253 ? 21.277  76.519  -9.801  1.00 10.33  ? 253 ALA E C   1 
ATOM   9847  O O   . ALA E  1 253 ? 22.349  77.062  -9.505  1.00 11.31  ? 253 ALA E O   1 
ATOM   9848  C CB  . ALA E  1 253 ? 19.572  77.970  -10.750 1.00 10.05  ? 253 ALA E CB  1 
ATOM   9849  N N   . PRO E  1 254 ? 21.279  75.312  -10.350 1.00 10.23  ? 254 PRO E N   1 
ATOM   9850  C CA  . PRO E  1 254 ? 22.520  74.613  -10.685 1.00 12.41  ? 254 PRO E CA  1 
ATOM   9851  C C   . PRO E  1 254 ? 23.183  75.276  -11.907 1.00 14.70  ? 254 PRO E C   1 
ATOM   9852  O O   . PRO E  1 254 ? 22.456  75.731  -12.802 1.00 16.97  ? 254 PRO E O   1 
ATOM   9853  C CB  . PRO E  1 254 ? 22.050  73.192  -10.936 1.00 11.96  ? 254 PRO E CB  1 
ATOM   9854  C CG  . PRO E  1 254 ? 20.635  73.366  -11.441 1.00 9.71   ? 254 PRO E CG  1 
ATOM   9855  C CD  . PRO E  1 254 ? 20.131  74.433  -10.491 1.00 9.26   ? 254 PRO E CD  1 
ATOM   9856  N N   . ARG E  1 255 ? 24.508  75.392  -12.068 1.00 14.35  ? 255 ARG E N   1 
ATOM   9857  C CA  . ARG E  1 255 ? 25.004  75.913  -13.343 1.00 12.98  ? 255 ARG E CA  1 
ATOM   9858  C C   . ARG E  1 255 ? 25.368  74.782  -14.309 1.00 12.56  ? 255 ARG E C   1 
ATOM   9859  O O   . ARG E  1 255 ? 25.950  75.009  -15.366 1.00 12.44  ? 255 ARG E O   1 
ATOM   9860  C CB  . ARG E  1 255 ? 26.223  76.802  -13.109 1.00 13.63  ? 255 ARG E CB  1 
ATOM   9861  C CG  . ARG E  1 255 ? 26.034  77.796  -11.964 1.00 13.75  ? 255 ARG E CG  1 
ATOM   9862  C CD  . ARG E  1 255 ? 27.068  78.902  -11.885 1.00 13.21  ? 255 ARG E CD  1 
ATOM   9863  N NE  . ARG E  1 255 ? 26.493  80.050  -12.551 1.00 12.81  ? 255 ARG E NE  1 
ATOM   9864  C CZ  . ARG E  1 255 ? 26.393  81.266  -12.003 1.00 12.09  ? 255 ARG E CZ  1 
ATOM   9865  N NH1 . ARG E  1 255 ? 25.840  82.196  -12.761 1.00 12.81  ? 255 ARG E NH1 1 
ATOM   9866  N NH2 . ARG E  1 255 ? 26.746  81.530  -10.744 1.00 11.31  ? 255 ARG E NH2 1 
ATOM   9867  N N   . GLY E  1 256 ? 25.037  73.529  -14.004 1.00 12.37  ? 256 GLY E N   1 
ATOM   9868  C CA  . GLY E  1 256 ? 25.350  72.394  -14.850 1.00 13.38  ? 256 GLY E CA  1 
ATOM   9869  C C   . GLY E  1 256 ? 25.452  71.159  -13.983 1.00 13.45  ? 256 GLY E C   1 
ATOM   9870  O O   . GLY E  1 256 ? 24.885  71.172  -12.883 1.00 13.27  ? 256 GLY E O   1 
ATOM   9871  N N   . TYR E  1 257 ? 26.239  70.159  -14.387 1.00 14.21  ? 257 TYR E N   1 
ATOM   9872  C CA  . TYR E  1 257 ? 26.313  68.917  -13.620 1.00 15.33  ? 257 TYR E CA  1 
ATOM   9873  C C   . TYR E  1 257 ? 27.720  68.445  -13.319 1.00 14.71  ? 257 TYR E C   1 
ATOM   9874  O O   . TYR E  1 257 ? 28.680  68.768  -14.038 1.00 15.07  ? 257 TYR E O   1 
ATOM   9875  C CB  . TYR E  1 257 ? 25.621  67.769  -14.348 1.00 16.09  ? 257 TYR E CB  1 
ATOM   9876  C CG  . TYR E  1 257 ? 26.259  67.412  -15.690 1.00 16.95  ? 257 TYR E CG  1 
ATOM   9877  C CD1 . TYR E  1 257 ? 27.180  66.397  -15.791 1.00 17.63  ? 257 TYR E CD1 1 
ATOM   9878  C CD2 . TYR E  1 257 ? 25.854  68.057  -16.815 1.00 17.03  ? 257 TYR E CD2 1 
ATOM   9879  C CE1 . TYR E  1 257 ? 27.715  66.043  -17.005 1.00 17.62  ? 257 TYR E CE1 1 
ATOM   9880  C CE2 . TYR E  1 257 ? 26.382  67.702  -18.027 1.00 17.96  ? 257 TYR E CE2 1 
ATOM   9881  C CZ  . TYR E  1 257 ? 27.295  66.690  -18.125 1.00 17.82  ? 257 TYR E CZ  1 
ATOM   9882  O OH  . TYR E  1 257 ? 27.815  66.347  -19.362 1.00 19.01  ? 257 TYR E OH  1 
ATOM   9883  N N   . PHE E  1 258 ? 27.821  67.635  -12.279 1.00 12.86  ? 258 PHE E N   1 
ATOM   9884  C CA  . PHE E  1 258 ? 29.061  66.979  -11.961 1.00 11.82  ? 258 PHE E CA  1 
ATOM   9885  C C   . PHE E  1 258 ? 28.966  65.629  -12.613 1.00 12.99  ? 258 PHE E C   1 
ATOM   9886  O O   . PHE E  1 258 ? 27.863  65.082  -12.684 1.00 13.26  ? 258 PHE E O   1 
ATOM   9887  C CB  . PHE E  1 258 ? 29.215  66.820  -10.447 1.00 8.78   ? 258 PHE E CB  1 
ATOM   9888  C CG  . PHE E  1 258 ? 29.477  68.134  -9.745  1.00 5.96   ? 258 PHE E CG  1 
ATOM   9889  C CD1 . PHE E  1 258 ? 28.425  68.883  -9.281  1.00 5.04   ? 258 PHE E CD1 1 
ATOM   9890  C CD2 . PHE E  1 258 ? 30.764  68.598  -9.620  1.00 4.78   ? 258 PHE E CD2 1 
ATOM   9891  C CE1 . PHE E  1 258 ? 28.675  70.076  -8.661  1.00 4.07   ? 258 PHE E CE1 1 
ATOM   9892  C CE2 . PHE E  1 258 ? 31.001  69.796  -8.993  1.00 3.88   ? 258 PHE E CE2 1 
ATOM   9893  C CZ  . PHE E  1 258 ? 29.958  70.539  -8.530  1.00 3.65   ? 258 PHE E CZ  1 
ATOM   9894  N N   . LYS E  1 259 ? 30.052  65.093  -13.148 1.00 15.57  ? 259 LYS E N   1 
ATOM   9895  C CA  . LYS E  1 259 ? 30.021  63.737  -13.675 1.00 19.33  ? 259 LYS E CA  1 
ATOM   9896  C C   . LYS E  1 259 ? 30.141  62.723  -12.559 1.00 20.68  ? 259 LYS E C   1 
ATOM   9897  O O   . LYS E  1 259 ? 30.981  62.868  -11.663 1.00 21.21  ? 259 LYS E O   1 
ATOM   9898  C CB  . LYS E  1 259 ? 31.162  63.396  -14.587 1.00 20.63  ? 259 LYS E CB  1 
ATOM   9899  C CG  . LYS E  1 259 ? 31.116  64.070  -15.919 1.00 23.11  ? 259 LYS E CG  1 
ATOM   9900  C CD  . LYS E  1 259 ? 32.160  63.384  -16.783 1.00 25.88  ? 259 LYS E CD  1 
ATOM   9901  C CE  . LYS E  1 259 ? 31.547  62.321  -17.694 1.00 27.46  ? 259 LYS E CE  1 
ATOM   9902  N NZ  . LYS E  1 259 ? 30.645  61.411  -17.003 1.00 28.84  ? 259 LYS E NZ  1 
ATOM   9903  N N   . MET E  1 260 ? 29.351  61.667  -12.589 1.00 22.20  ? 260 MET E N   1 
ATOM   9904  C CA  . MET E  1 260 ? 29.563  60.652  -11.590 1.00 24.18  ? 260 MET E CA  1 
ATOM   9905  C C   . MET E  1 260 ? 30.442  59.541  -12.128 1.00 26.10  ? 260 MET E C   1 
ATOM   9906  O O   . MET E  1 260 ? 30.406  59.229  -13.325 1.00 27.24  ? 260 MET E O   1 
ATOM   9907  C CB  . MET E  1 260 ? 28.233  60.123  -11.139 1.00 22.84  ? 260 MET E CB  1 
ATOM   9908  C CG  . MET E  1 260 ? 27.617  61.224  -10.341 1.00 22.38  ? 260 MET E CG  1 
ATOM   9909  S SD  . MET E  1 260 ? 26.451  60.584  -9.128  1.00 21.88  ? 260 MET E SD  1 
ATOM   9910  C CE  . MET E  1 260 ? 27.595  60.574  -7.787  1.00 22.40  ? 260 MET E CE  1 
ATOM   9911  N N   . ARG E  1 261 ? 31.355  59.047  -11.302 1.00 27.80  ? 261 ARG E N   1 
ATOM   9912  C CA  . ARG E  1 261 ? 32.173  57.912  -11.629 1.00 29.43  ? 261 ARG E CA  1 
ATOM   9913  C C   . ARG E  1 261 ? 31.916  56.822  -10.609 1.00 28.88  ? 261 ARG E C   1 
ATOM   9914  O O   . ARG E  1 261 ? 31.196  57.031  -9.636  1.00 29.21  ? 261 ARG E O   1 
ATOM   9915  C CB  . ARG E  1 261 ? 33.626  58.307  -11.606 1.00 32.24  ? 261 ARG E CB  1 
ATOM   9916  C CG  . ARG E  1 261 ? 33.983  58.985  -12.902 1.00 35.97  ? 261 ARG E CG  1 
ATOM   9917  C CD  . ARG E  1 261 ? 35.428  59.450  -12.879 1.00 39.84  ? 261 ARG E CD  1 
ATOM   9918  N NE  . ARG E  1 261 ? 35.872  59.823  -14.227 1.00 43.81  ? 261 ARG E NE  1 
ATOM   9919  C CZ  . ARG E  1 261 ? 35.493  60.957  -14.872 1.00 45.35  ? 261 ARG E CZ  1 
ATOM   9920  N NH1 . ARG E  1 261 ? 35.951  61.232  -16.114 1.00 45.65  ? 261 ARG E NH1 1 
ATOM   9921  N NH2 . ARG E  1 261 ? 34.654  61.846  -14.305 1.00 45.83  ? 261 ARG E NH2 1 
ATOM   9922  N N   . THR E  1 262 ? 32.423  55.629  -10.870 1.00 28.38  ? 262 THR E N   1 
ATOM   9923  C CA  . THR E  1 262 ? 32.340  54.492  -9.983  1.00 28.33  ? 262 THR E CA  1 
ATOM   9924  C C   . THR E  1 262 ? 33.763  54.038  -9.897  1.00 28.20  ? 262 THR E C   1 
ATOM   9925  O O   . THR E  1 262 ? 34.292  53.590  -10.917 1.00 28.75  ? 262 THR E O   1 
ATOM   9926  C CB  . THR E  1 262 ? 31.516  53.426  -10.617 1.00 29.47  ? 262 THR E CB  1 
ATOM   9927  O OG1 . THR E  1 262 ? 30.218  53.973  -10.596 1.00 31.49  ? 262 THR E OG1 1 
ATOM   9928  C CG2 . THR E  1 262 ? 31.564  52.071  -9.933  1.00 30.63  ? 262 THR E CG2 1 
ATOM   9929  N N   . GLY E  1 263 ? 34.405  54.186  -8.752  1.00 27.53  ? 263 GLY E N   1 
ATOM   9930  C CA  . GLY E  1 263 ? 35.804  53.843  -8.657  1.00 26.71  ? 263 GLY E CA  1 
ATOM   9931  C C   . GLY E  1 263 ? 36.102  53.386  -7.259  1.00 26.19  ? 263 GLY E C   1 
ATOM   9932  O O   . GLY E  1 263 ? 35.208  52.895  -6.572  1.00 26.60  ? 263 GLY E O   1 
ATOM   9933  N N   . LYS E  1 264 ? 37.336  53.582  -6.818  1.00 25.29  ? 264 LYS E N   1 
ATOM   9934  C CA  . LYS E  1 264 ? 37.720  53.155  -5.490  1.00 24.24  ? 264 LYS E CA  1 
ATOM   9935  C C   . LYS E  1 264 ? 38.026  54.383  -4.637  1.00 22.06  ? 264 LYS E C   1 
ATOM   9936  O O   . LYS E  1 264 ? 38.883  54.349  -3.741  1.00 21.21  ? 264 LYS E O   1 
ATOM   9937  C CB  . LYS E  1 264 ? 38.946  52.230  -5.605  1.00 26.05  ? 264 LYS E CB  1 
ATOM   9938  C CG  . LYS E  1 264 ? 40.130  52.883  -6.309  1.00 28.23  ? 264 LYS E CG  1 
ATOM   9939  C CD  . LYS E  1 264 ? 41.468  52.440  -5.731  1.00 30.04  ? 264 LYS E CD  1 
ATOM   9940  C CE  . LYS E  1 264 ? 42.530  53.295  -6.410  1.00 31.45  ? 264 LYS E CE  1 
ATOM   9941  N NZ  . LYS E  1 264 ? 43.795  53.383  -5.700  1.00 32.37  ? 264 LYS E NZ  1 
ATOM   9942  N N   . SER E  1 265 ? 37.324  55.484  -4.876  1.00 19.30  ? 265 SER E N   1 
ATOM   9943  C CA  . SER E  1 265 ? 37.687  56.694  -4.182  1.00 17.10  ? 265 SER E CA  1 
ATOM   9944  C C   . SER E  1 265 ? 36.969  56.795  -2.870  1.00 15.22  ? 265 SER E C   1 
ATOM   9945  O O   . SER E  1 265 ? 35.885  56.211  -2.667  1.00 14.55  ? 265 SER E O   1 
ATOM   9946  C CB  . SER E  1 265 ? 37.361  57.894  -5.027  1.00 17.43  ? 265 SER E CB  1 
ATOM   9947  O OG  . SER E  1 265 ? 37.653  57.596  -6.389  1.00 18.59  ? 265 SER E OG  1 
ATOM   9948  N N   . SER E  1 266 ? 37.633  57.492  -1.965  1.00 13.06  ? 266 SER E N   1 
ATOM   9949  C CA  . SER E  1 266 ? 37.124  57.710  -0.647  1.00 12.31  ? 266 SER E CA  1 
ATOM   9950  C C   . SER E  1 266 ? 37.626  59.017  -0.108  1.00 11.20  ? 266 SER E C   1 
ATOM   9951  O O   . SER E  1 266 ? 38.424  59.689  -0.756  1.00 12.62  ? 266 SER E O   1 
ATOM   9952  C CB  . SER E  1 266 ? 37.575  56.644  0.282   1.00 12.39  ? 266 SER E CB  1 
ATOM   9953  O OG  . SER E  1 266 ? 36.367  56.220  0.882   1.00 13.14  ? 266 SER E OG  1 
ATOM   9954  N N   . ILE E  1 267 ? 37.189  59.372  1.080   1.00 8.73   ? 267 ILE E N   1 
ATOM   9955  C CA  . ILE E  1 267 ? 37.633  60.569  1.706   1.00 7.10   ? 267 ILE E CA  1 
ATOM   9956  C C   . ILE E  1 267 ? 38.094  60.135  3.058   1.00 7.09   ? 267 ILE E C   1 
ATOM   9957  O O   . ILE E  1 267 ? 37.553  59.144  3.541   1.00 8.99   ? 267 ILE E O   1 
ATOM   9958  C CB  . ILE E  1 267 ? 36.449  61.526  1.734   1.00 7.69   ? 267 ILE E CB  1 
ATOM   9959  C CG1 . ILE E  1 267 ? 36.946  62.840  2.268   1.00 8.58   ? 267 ILE E CG1 1 
ATOM   9960  C CG2 . ILE E  1 267 ? 35.306  61.030  2.583   1.00 7.30   ? 267 ILE E CG2 1 
ATOM   9961  C CD1 . ILE E  1 267 ? 35.966  63.946  1.918   1.00 8.84   ? 267 ILE E CD1 1 
ATOM   9962  N N   . MET E  1 268 ? 39.050  60.814  3.682   1.00 7.49   ? 268 MET E N   1 
ATOM   9963  C CA  . MET E  1 268 ? 39.546  60.448  5.012   1.00 8.05   ? 268 MET E CA  1 
ATOM   9964  C C   . MET E  1 268 ? 39.928  61.687  5.791   1.00 7.90   ? 268 MET E C   1 
ATOM   9965  O O   . MET E  1 268 ? 40.607  62.542  5.247   1.00 7.43   ? 268 MET E O   1 
ATOM   9966  C CB  . MET E  1 268 ? 40.783  59.564  4.913   1.00 7.17   ? 268 MET E CB  1 
ATOM   9967  C CG  . MET E  1 268 ? 41.241  59.148  6.274   1.00 6.31   ? 268 MET E CG  1 
ATOM   9968  S SD  . MET E  1 268 ? 42.839  58.355  6.107   1.00 5.11   ? 268 MET E SD  1 
ATOM   9969  C CE  . MET E  1 268 ? 42.345  56.806  5.436   1.00 5.79   ? 268 MET E CE  1 
ATOM   9970  N N   . ARG E  1 269 ? 39.518  61.834  7.038   1.00 9.30   ? 269 ARG E N   1 
ATOM   9971  C CA  . ARG E  1 269 ? 39.929  63.004  7.800   1.00 11.43  ? 269 ARG E CA  1 
ATOM   9972  C C   . ARG E  1 269 ? 41.245  62.636  8.448   1.00 12.35  ? 269 ARG E C   1 
ATOM   9973  O O   . ARG E  1 269 ? 41.322  61.576  9.084   1.00 12.33  ? 269 ARG E O   1 
ATOM   9974  C CB  . ARG E  1 269 ? 38.994  63.344  8.921   1.00 12.84  ? 269 ARG E CB  1 
ATOM   9975  C CG  . ARG E  1 269 ? 37.599  63.486  8.415   1.00 15.14  ? 269 ARG E CG  1 
ATOM   9976  C CD  . ARG E  1 269 ? 36.596  63.490  9.527   1.00 16.51  ? 269 ARG E CD  1 
ATOM   9977  N NE  . ARG E  1 269 ? 35.326  63.629  8.858   1.00 18.75  ? 269 ARG E NE  1 
ATOM   9978  C CZ  . ARG E  1 269 ? 34.293  62.829  9.151   1.00 20.49  ? 269 ARG E CZ  1 
ATOM   9979  N NH1 . ARG E  1 269 ? 33.163  62.986  8.457   1.00 21.84  ? 269 ARG E NH1 1 
ATOM   9980  N NH2 . ARG E  1 269 ? 34.345  61.941  10.160  1.00 21.68  ? 269 ARG E NH2 1 
ATOM   9981  N N   . SER E  1 270 ? 42.253  63.486  8.295   1.00 12.83  ? 270 SER E N   1 
ATOM   9982  C CA  . SER E  1 270 ? 43.571  63.222  8.810   1.00 13.34  ? 270 SER E CA  1 
ATOM   9983  C C   . SER E  1 270 ? 44.389  64.501  8.760   1.00 14.15  ? 270 SER E C   1 
ATOM   9984  O O   . SER E  1 270 ? 44.265  65.305  7.829   1.00 14.13  ? 270 SER E O   1 
ATOM   9985  C CB  . SER E  1 270 ? 44.272  62.150  7.967   1.00 13.02  ? 270 SER E CB  1 
ATOM   9986  O OG  . SER E  1 270 ? 45.652  62.051  8.307   1.00 13.39  ? 270 SER E OG  1 
ATOM   9987  N N   . ASP E  1 271 ? 45.254  64.704  9.751   1.00 14.85  ? 271 ASP E N   1 
ATOM   9988  C CA  . ASP E  1 271 ? 46.148  65.826  9.692   1.00 15.14  ? 271 ASP E CA  1 
ATOM   9989  C C   . ASP E  1 271 ? 47.540  65.338  9.434   1.00 15.50  ? 271 ASP E C   1 
ATOM   9990  O O   . ASP E  1 271 ? 48.507  66.095  9.426   1.00 16.32  ? 271 ASP E O   1 
ATOM   9991  C CB  . ASP E  1 271 ? 46.123  66.598  10.972  1.00 16.54  ? 271 ASP E CB  1 
ATOM   9992  C CG  . ASP E  1 271 ? 44.823  67.358  11.139  1.00 18.52  ? 271 ASP E CG  1 
ATOM   9993  O OD1 . ASP E  1 271 ? 44.158  67.118  12.133  1.00 19.15  ? 271 ASP E OD1 1 
ATOM   9994  O OD2 . ASP E  1 271 ? 44.424  68.187  10.307  1.00 20.21  ? 271 ASP E OD2 1 
ATOM   9995  N N   . ALA E  1 272 ? 47.695  64.057  9.133   1.00 15.23  ? 272 ALA E N   1 
ATOM   9996  C CA  . ALA E  1 272 ? 49.003  63.537  8.811   1.00 14.39  ? 272 ALA E CA  1 
ATOM   9997  C C   . ALA E  1 272 ? 49.528  64.198  7.550   1.00 14.76  ? 272 ALA E C   1 
ATOM   9998  O O   . ALA E  1 272 ? 48.763  64.457  6.608   1.00 14.89  ? 272 ALA E O   1 
ATOM   9999  C CB  . ALA E  1 272 ? 48.936  62.056  8.554   1.00 14.28  ? 272 ALA E CB  1 
ATOM   10000 N N   . PRO E  1 273 ? 50.781  64.618  7.521   1.00 15.62  ? 273 PRO E N   1 
ATOM   10001 C CA  . PRO E  1 273 ? 51.443  65.220  6.374   1.00 16.07  ? 273 PRO E CA  1 
ATOM   10002 C C   . PRO E  1 273 ? 51.540  64.236  5.252   1.00 16.35  ? 273 PRO E C   1 
ATOM   10003 O O   . PRO E  1 273 ? 51.771  63.058  5.511   1.00 15.93  ? 273 PRO E O   1 
ATOM   10004 C CB  . PRO E  1 273 ? 52.793  65.605  6.863   1.00 16.77  ? 273 PRO E CB  1 
ATOM   10005 C CG  . PRO E  1 273 ? 53.001  64.715  8.071   1.00 16.86  ? 273 PRO E CG  1 
ATOM   10006 C CD  . PRO E  1 273 ? 51.612  64.838  8.691   1.00 16.24  ? 273 PRO E CD  1 
ATOM   10007 N N   . ILE E  1 274 ? 51.349  64.699  4.033   1.00 18.33  ? 274 ILE E N   1 
ATOM   10008 C CA  . ILE E  1 274 ? 51.523  63.839  2.879   1.00 21.15  ? 274 ILE E CA  1 
ATOM   10009 C C   . ILE E  1 274 ? 52.990  63.919  2.537   1.00 24.00  ? 274 ILE E C   1 
ATOM   10010 O O   . ILE E  1 274 ? 53.579  64.999  2.595   1.00 25.43  ? 274 ILE E O   1 
ATOM   10011 C CB  . ILE E  1 274 ? 50.681  64.339  1.728   1.00 20.64  ? 274 ILE E CB  1 
ATOM   10012 C CG1 . ILE E  1 274 ? 49.239  64.067  2.107   1.00 21.76  ? 274 ILE E CG1 1 
ATOM   10013 C CG2 . ILE E  1 274 ? 51.055  63.671  0.417   1.00 19.68  ? 274 ILE E CG2 1 
ATOM   10014 C CD1 . ILE E  1 274 ? 48.248  64.789  1.190   1.00 22.53  ? 274 ILE E CD1 1 
ATOM   10015 N N   . ASP E  1 275 ? 53.598  62.810  2.188   1.00 26.85  ? 275 ASP E N   1 
ATOM   10016 C CA  . ASP E  1 275 ? 55.016  62.787  1.931   1.00 29.06  ? 275 ASP E CA  1 
ATOM   10017 C C   . ASP E  1 275 ? 55.255  61.877  0.752   1.00 28.82  ? 275 ASP E C   1 
ATOM   10018 O O   . ASP E  1 275 ? 54.377  61.096  0.353   1.00 28.80  ? 275 ASP E O   1 
ATOM   10019 C CB  . ASP E  1 275 ? 55.705  62.281  3.168   1.00 32.26  ? 275 ASP E CB  1 
ATOM   10020 C CG  . ASP E  1 275 ? 57.221  62.174  3.111   1.00 35.53  ? 275 ASP E CG  1 
ATOM   10021 O OD1 . ASP E  1 275 ? 57.860  62.841  2.284   1.00 36.82  ? 275 ASP E OD1 1 
ATOM   10022 O OD2 . ASP E  1 275 ? 57.760  61.432  3.944   1.00 37.18  ? 275 ASP E OD2 1 
ATOM   10023 N N   . THR E  1 276 ? 56.399  62.004  0.123   1.00 28.41  ? 276 THR E N   1 
ATOM   10024 C CA  . THR E  1 276 ? 56.627  61.225  -1.046  1.00 29.00  ? 276 THR E CA  1 
ATOM   10025 C C   . THR E  1 276 ? 57.269  59.941  -0.650  1.00 28.89  ? 276 THR E C   1 
ATOM   10026 O O   . THR E  1 276 ? 58.392  59.928  -0.163  1.00 30.17  ? 276 THR E O   1 
ATOM   10027 C CB  . THR E  1 276 ? 57.511  61.969  -2.001  1.00 29.42  ? 276 THR E CB  1 
ATOM   10028 O OG1 . THR E  1 276 ? 56.984  63.288  -2.109  1.00 30.48  ? 276 THR E OG1 1 
ATOM   10029 C CG2 . THR E  1 276 ? 57.558  61.267  -3.357  1.00 29.59  ? 276 THR E CG2 1 
ATOM   10030 N N   . CYS E  1 277 ? 56.547  58.870  -0.865  1.00 28.13  ? 277 CYS E N   1 
ATOM   10031 C CA  . CYS E  1 277 ? 56.998  57.533  -0.544  1.00 27.93  ? 277 CYS E CA  1 
ATOM   10032 C C   . CYS E  1 277 ? 55.902  56.617  -0.982  1.00 27.95  ? 277 CYS E C   1 
ATOM   10033 O O   . CYS E  1 277 ? 54.813  57.096  -1.297  1.00 29.08  ? 277 CYS E O   1 
ATOM   10034 C CB  . CYS E  1 277 ? 57.208  57.329  0.940   1.00 28.16  ? 277 CYS E CB  1 
ATOM   10035 S SG  . CYS E  1 277 ? 55.887  58.065  1.937   1.00 28.50  ? 277 CYS E SG  1 
ATOM   10036 N N   . ILE E  1 278 ? 56.121  55.321  -1.024  1.00 27.60  ? 278 ILE E N   1 
ATOM   10037 C CA  . ILE E  1 278 ? 55.091  54.475  -1.556  1.00 27.40  ? 278 ILE E CA  1 
ATOM   10038 C C   . ILE E  1 278 ? 54.699  53.507  -0.483  1.00 27.68  ? 278 ILE E C   1 
ATOM   10039 O O   . ILE E  1 278 ? 55.571  52.922  0.163   1.00 28.82  ? 278 ILE E O   1 
ATOM   10040 C CB  . ILE E  1 278 ? 55.615  53.814  -2.879  1.00 27.25  ? 278 ILE E CB  1 
ATOM   10041 C CG1 . ILE E  1 278 ? 54.751  52.612  -3.190  1.00 27.46  ? 278 ILE E CG1 1 
ATOM   10042 C CG2 . ILE E  1 278 ? 57.093  53.478  -2.799  1.00 27.75  ? 278 ILE E CG2 1 
ATOM   10043 C CD1 . ILE E  1 278 ? 54.957  52.101  -4.630  1.00 28.48  ? 278 ILE E CD1 1 
ATOM   10044 N N   . SER E  1 279 ? 53.396  53.459  -0.231  1.00 27.23  ? 279 SER E N   1 
ATOM   10045 C CA  . SER E  1 279 ? 52.801  52.613  0.780   1.00 26.29  ? 279 SER E CA  1 
ATOM   10046 C C   . SER E  1 279 ? 51.382  52.388  0.368   1.00 24.66  ? 279 SER E C   1 
ATOM   10047 O O   . SER E  1 279 ? 50.706  53.346  0.033   1.00 24.72  ? 279 SER E O   1 
ATOM   10048 C CB  . SER E  1 279 ? 52.806  53.299  2.118   1.00 27.02  ? 279 SER E CB  1 
ATOM   10049 O OG  . SER E  1 279 ? 52.281  52.433  3.119   1.00 28.57  ? 279 SER E OG  1 
ATOM   10050 N N   . GLU E  1 280 ? 50.905  51.158  0.397   1.00 24.13  ? 280 GLU E N   1 
ATOM   10051 C CA  . GLU E  1 280 ? 49.548  50.902  -0.052  1.00 23.48  ? 280 GLU E CA  1 
ATOM   10052 C C   . GLU E  1 280 ? 48.495  51.016  1.022   1.00 20.42  ? 280 GLU E C   1 
ATOM   10053 O O   . GLU E  1 280 ? 47.319  51.163  0.697   1.00 20.82  ? 280 GLU E O   1 
ATOM   10054 C CB  . GLU E  1 280 ? 49.441  49.544  -0.622  1.00 26.58  ? 280 GLU E CB  1 
ATOM   10055 C CG  . GLU E  1 280 ? 50.477  49.390  -1.682  1.00 30.99  ? 280 GLU E CG  1 
ATOM   10056 C CD  . GLU E  1 280 ? 50.088  48.231  -2.559  1.00 34.33  ? 280 GLU E CD  1 
ATOM   10057 O OE1 . GLU E  1 280 ? 50.428  47.094  -2.185  1.00 36.72  ? 280 GLU E OE1 1 
ATOM   10058 O OE2 . GLU E  1 280 ? 49.435  48.489  -3.581  1.00 35.37  ? 280 GLU E OE2 1 
ATOM   10059 N N   . CYS E  1 281 ? 48.879  50.917  2.279   1.00 15.95  ? 281 CYS E N   1 
ATOM   10060 C CA  . CYS E  1 281 ? 47.914  50.985  3.324   1.00 12.35  ? 281 CYS E CA  1 
ATOM   10061 C C   . CYS E  1 281 ? 47.973  52.362  3.913   1.00 11.25  ? 281 CYS E C   1 
ATOM   10062 O O   . CYS E  1 281 ? 49.070  52.828  4.261   1.00 11.57  ? 281 CYS E O   1 
ATOM   10063 C CB  . CYS E  1 281 ? 48.247  49.962  4.361   1.00 11.26  ? 281 CYS E CB  1 
ATOM   10064 S SG  . CYS E  1 281 ? 47.118  50.105  5.764   1.00 9.49   ? 281 CYS E SG  1 
ATOM   10065 N N   . ILE E  1 282 ? 46.834  53.039  3.990   1.00 9.75   ? 282 ILE E N   1 
ATOM   10066 C CA  . ILE E  1 282 ? 46.785  54.350  4.618   1.00 9.78   ? 282 ILE E CA  1 
ATOM   10067 C C   . ILE E  1 282 ? 45.814  54.320  5.782   1.00 9.85   ? 282 ILE E C   1 
ATOM   10068 O O   . ILE E  1 282 ? 44.728  53.752  5.665   1.00 11.13  ? 282 ILE E O   1 
ATOM   10069 C CB  . ILE E  1 282 ? 46.329  55.433  3.617   1.00 9.60   ? 282 ILE E CB  1 
ATOM   10070 C CG1 . ILE E  1 282 ? 47.336  55.553  2.506   1.00 9.78   ? 282 ILE E CG1 1 
ATOM   10071 C CG2 . ILE E  1 282 ? 46.216  56.783  4.294   1.00 8.68   ? 282 ILE E CG2 1 
ATOM   10072 C CD1 . ILE E  1 282 ? 46.699  56.211  1.290   1.00 10.71  ? 282 ILE E CD1 1 
ATOM   10073 N N   . THR E  1 283 ? 46.205  54.855  6.928   1.00 9.16   ? 283 THR E N   1 
ATOM   10074 C CA  . THR E  1 283 ? 45.288  55.047  8.013   1.00 9.28   ? 283 THR E CA  1 
ATOM   10075 C C   . THR E  1 283 ? 45.332  56.550  8.279   1.00 10.57  ? 283 THR E C   1 
ATOM   10076 O O   . THR E  1 283 ? 46.228  57.229  7.780   1.00 11.50  ? 283 THR E O   1 
ATOM   10077 C CB  . THR E  1 283 ? 45.754  54.292  9.256   1.00 8.93   ? 283 THR E CB  1 
ATOM   10078 O OG1 . THR E  1 283 ? 46.899  54.965  9.773   1.00 7.83   ? 283 THR E OG1 1 
ATOM   10079 C CG2 . THR E  1 283 ? 46.096  52.854  8.959   1.00 8.97   ? 283 THR E CG2 1 
ATOM   10080 N N   . PRO E  1 284 ? 44.452  57.179  9.041   1.00 11.07  ? 284 PRO E N   1 
ATOM   10081 C CA  . PRO E  1 284 ? 44.547  58.589  9.326   1.00 12.06  ? 284 PRO E CA  1 
ATOM   10082 C C   . PRO E  1 284 ? 45.797  58.926  10.117  1.00 13.94  ? 284 PRO E C   1 
ATOM   10083 O O   . PRO E  1 284 ? 46.147  60.103  10.221  1.00 14.72  ? 284 PRO E O   1 
ATOM   10084 C CB  . PRO E  1 284 ? 43.278  58.904  10.063  1.00 12.10  ? 284 PRO E CB  1 
ATOM   10085 C CG  . PRO E  1 284 ? 42.771  57.574  10.511  1.00 11.40  ? 284 PRO E CG  1 
ATOM   10086 C CD  . PRO E  1 284 ? 43.104  56.740  9.302   1.00 10.91  ? 284 PRO E CD  1 
ATOM   10087 N N   . ASN E  1 285 ? 46.500  57.937  10.676  1.00 16.40  ? 285 ASN E N   1 
ATOM   10088 C CA  . ASN E  1 285 ? 47.731  58.200  11.413  1.00 17.96  ? 285 ASN E CA  1 
ATOM   10089 C C   . ASN E  1 285 ? 48.921  58.210  10.487  1.00 15.88  ? 285 ASN E C   1 
ATOM   10090 O O   . ASN E  1 285 ? 50.052  58.384  10.919  1.00 15.74  ? 285 ASN E O   1 
ATOM   10091 C CB  . ASN E  1 285 ? 48.064  57.146  12.437  1.00 22.47  ? 285 ASN E CB  1 
ATOM   10092 C CG  . ASN E  1 285 ? 46.975  56.888  13.427  1.00 26.93  ? 285 ASN E CG  1 
ATOM   10093 O OD1 . ASN E  1 285 ? 45.813  56.725  13.055  1.00 27.35  ? 285 ASN E OD1 1 
ATOM   10094 N ND2 . ASN E  1 285 ? 47.316  56.774  14.699  1.00 31.63  ? 285 ASN E ND2 1 
ATOM   10095 N N   . GLY E  1 286 ? 48.746  57.970  9.216   1.00 14.64  ? 286 GLY E N   1 
ATOM   10096 C CA  . GLY E  1 286 ? 49.865  57.901  8.308   1.00 13.71  ? 286 GLY E CA  1 
ATOM   10097 C C   . GLY E  1 286 ? 49.845  56.497  7.740   1.00 13.45  ? 286 GLY E C   1 
ATOM   10098 O O   . GLY E  1 286 ? 48.990  55.672  8.116   1.00 12.84  ? 286 GLY E O   1 
ATOM   10099 N N   . SER E  1 287 ? 50.754  56.200  6.834   1.00 12.94  ? 287 SER E N   1 
ATOM   10100 C CA  . SER E  1 287 ? 50.759  54.903  6.228   1.00 13.37  ? 287 SER E CA  1 
ATOM   10101 C C   . SER E  1 287 ? 51.480  53.893  7.094   1.00 14.24  ? 287 SER E C   1 
ATOM   10102 O O   . SER E  1 287 ? 52.287  54.249  7.965   1.00 14.30  ? 287 SER E O   1 
ATOM   10103 C CB  . SER E  1 287 ? 51.387  55.057  4.891   1.00 13.69  ? 287 SER E CB  1 
ATOM   10104 O OG  . SER E  1 287 ? 50.545  55.823  4.040   1.00 14.34  ? 287 SER E OG  1 
ATOM   10105 N N   . ILE E  1 288 ? 51.109  52.625  6.921   1.00 14.91  ? 288 ILE E N   1 
ATOM   10106 C CA  . ILE E  1 288 ? 51.650  51.527  7.704   1.00 15.70  ? 288 ILE E CA  1 
ATOM   10107 C C   . ILE E  1 288 ? 52.002  50.393  6.751   1.00 16.42  ? 288 ILE E C   1 
ATOM   10108 O O   . ILE E  1 288 ? 51.418  50.299  5.678   1.00 18.01  ? 288 ILE E O   1 
ATOM   10109 C CB  . ILE E  1 288 ? 50.625  51.008  8.765   1.00 15.25  ? 288 ILE E CB  1 
ATOM   10110 C CG1 . ILE E  1 288 ? 49.353  50.503  8.122   1.00 15.15  ? 288 ILE E CG1 1 
ATOM   10111 C CG2 . ILE E  1 288 ? 50.343  52.130  9.741   1.00 14.44  ? 288 ILE E CG2 1 
ATOM   10112 C CD1 . ILE E  1 288 ? 48.341  49.972  9.135   1.00 16.71  ? 288 ILE E CD1 1 
ATOM   10113 N N   . PRO E  1 289 ? 52.982  49.557  7.018   1.00 16.74  ? 289 PRO E N   1 
ATOM   10114 C CA  . PRO E  1 289 ? 53.342  48.460  6.150   1.00 18.11  ? 289 PRO E CA  1 
ATOM   10115 C C   . PRO E  1 289 ? 52.437  47.255  6.289   1.00 19.96  ? 289 PRO E C   1 
ATOM   10116 O O   . PRO E  1 289 ? 52.204  46.707  7.380   1.00 21.13  ? 289 PRO E O   1 
ATOM   10117 C CB  . PRO E  1 289 ? 54.743  48.175  6.512   1.00 17.97  ? 289 PRO E CB  1 
ATOM   10118 C CG  . PRO E  1 289 ? 54.755  48.485  7.980   1.00 17.74  ? 289 PRO E CG  1 
ATOM   10119 C CD  . PRO E  1 289 ? 54.032  49.806  7.982   1.00 17.15  ? 289 PRO E CD  1 
ATOM   10120 N N   . ASN E  1 290 ? 51.949  46.789  5.149   1.00 20.95  ? 290 ASN E N   1 
ATOM   10121 C CA  . ASN E  1 290 ? 51.043  45.663  5.165   1.00 22.21  ? 290 ASN E CA  1 
ATOM   10122 C C   . ASN E  1 290 ? 51.770  44.337  5.090   1.00 22.30  ? 290 ASN E C   1 
ATOM   10123 O O   . ASN E  1 290 ? 51.265  43.409  4.465   1.00 23.25  ? 290 ASN E O   1 
ATOM   10124 C CB  . ASN E  1 290 ? 50.050  45.774  4.007   1.00 22.96  ? 290 ASN E CB  1 
ATOM   10125 C CG  . ASN E  1 290 ? 50.707  45.838  2.639   1.00 23.87  ? 290 ASN E CG  1 
ATOM   10126 O OD1 . ASN E  1 290 ? 51.928  45.974  2.558   1.00 24.47  ? 290 ASN E OD1 1 
ATOM   10127 N ND2 . ASN E  1 290 ? 49.943  45.835  1.547   1.00 24.57  ? 290 ASN E ND2 1 
ATOM   10128 N N   . ASP E  1 291 ? 52.953  44.213  5.678   1.00 22.01  ? 291 ASP E N   1 
ATOM   10129 C CA  . ASP E  1 291 ? 53.611  42.924  5.709   1.00 22.50  ? 291 ASP E CA  1 
ATOM   10130 C C   . ASP E  1 291 ? 52.875  42.045  6.722   1.00 20.93  ? 291 ASP E C   1 
ATOM   10131 O O   . ASP E  1 291 ? 52.563  40.885  6.473   1.00 21.23  ? 291 ASP E O   1 
ATOM   10132 C CB  . ASP E  1 291 ? 55.116  43.059  6.105   1.00 25.57  ? 291 ASP E CB  1 
ATOM   10133 C CG  . ASP E  1 291 ? 55.507  44.070  7.204   1.00 29.96  ? 291 ASP E CG  1 
ATOM   10134 O OD1 . ASP E  1 291 ? 55.341  43.807  8.410   1.00 32.38  ? 291 ASP E OD1 1 
ATOM   10135 O OD2 . ASP E  1 291 ? 56.015  45.149  6.875   1.00 31.66  ? 291 ASP E OD2 1 
ATOM   10136 N N   . LYS E  1 292 ? 52.521  42.554  7.896   1.00 18.27  ? 292 LYS E N   1 
ATOM   10137 C CA  . LYS E  1 292 ? 51.884  41.725  8.897   1.00 15.22  ? 292 LYS E CA  1 
ATOM   10138 C C   . LYS E  1 292 ? 50.413  41.508  8.611   1.00 13.85  ? 292 LYS E C   1 
ATOM   10139 O O   . LYS E  1 292 ? 49.800  42.374  7.997   1.00 16.02  ? 292 LYS E O   1 
ATOM   10140 C CB  . LYS E  1 292 ? 52.064  42.397  10.196  1.00 15.74  ? 292 LYS E CB  1 
ATOM   10141 C CG  . LYS E  1 292 ? 53.486  42.271  10.595  1.00 16.31  ? 292 LYS E CG  1 
ATOM   10142 C CD  . LYS E  1 292 ? 53.625  43.359  11.604  1.00 17.77  ? 292 LYS E CD  1 
ATOM   10143 C CE  . LYS E  1 292 ? 55.056  43.499  12.046  1.00 19.33  ? 292 LYS E CE  1 
ATOM   10144 N NZ  . LYS E  1 292 ? 55.890  43.736  10.886  1.00 21.16  ? 292 LYS E NZ  1 
ATOM   10145 N N   . PRO E  1 293 ? 49.763  40.421  9.030   1.00 11.12  ? 293 PRO E N   1 
ATOM   10146 C CA  . PRO E  1 293 ? 48.354  40.189  8.781   1.00 9.20   ? 293 PRO E CA  1 
ATOM   10147 C C   . PRO E  1 293 ? 47.409  41.078  9.567   1.00 7.72   ? 293 PRO E C   1 
ATOM   10148 O O   . PRO E  1 293 ? 46.272  41.310  9.161   1.00 8.33   ? 293 PRO E O   1 
ATOM   10149 C CB  . PRO E  1 293 ? 48.150  38.730  9.087   1.00 8.73   ? 293 PRO E CB  1 
ATOM   10150 C CG  . PRO E  1 293 ? 49.170  38.483  10.132  1.00 9.27   ? 293 PRO E CG  1 
ATOM   10151 C CD  . PRO E  1 293 ? 50.363  39.219  9.570   1.00 10.35  ? 293 PRO E CD  1 
ATOM   10152 N N   . PHE E  1 294 ? 47.810  41.584  10.704  1.00 6.63   ? 294 PHE E N   1 
ATOM   10153 C CA  . PHE E  1 294 ? 46.892  42.325  11.542  1.00 6.51   ? 294 PHE E CA  1 
ATOM   10154 C C   . PHE E  1 294 ? 47.546  43.642  11.922  1.00 6.03   ? 294 PHE E C   1 
ATOM   10155 O O   . PHE E  1 294 ? 48.765  43.756  11.810  1.00 6.42   ? 294 PHE E O   1 
ATOM   10156 C CB  . PHE E  1 294 ? 46.551  41.524  12.817  1.00 5.44   ? 294 PHE E CB  1 
ATOM   10157 C CG  . PHE E  1 294 ? 45.906  40.192  12.527  1.00 4.26   ? 294 PHE E CG  1 
ATOM   10158 C CD1 . PHE E  1 294 ? 46.604  39.026  12.811  1.00 4.29   ? 294 PHE E CD1 1 
ATOM   10159 C CD2 . PHE E  1 294 ? 44.642  40.149  11.976  1.00 3.49   ? 294 PHE E CD2 1 
ATOM   10160 C CE1 . PHE E  1 294 ? 46.022  37.797  12.555  1.00 3.72   ? 294 PHE E CE1 1 
ATOM   10161 C CE2 . PHE E  1 294 ? 44.075  38.916  11.724  1.00 3.74   ? 294 PHE E CE2 1 
ATOM   10162 C CZ  . PHE E  1 294 ? 44.755  37.743  12.007  1.00 3.45   ? 294 PHE E CZ  1 
ATOM   10163 N N   . GLN E  1 295 ? 46.786  44.646  12.350  1.00 4.47   ? 295 GLN E N   1 
ATOM   10164 C CA  . GLN E  1 295 ? 47.336  45.918  12.711  1.00 3.79   ? 295 GLN E CA  1 
ATOM   10165 C C   . GLN E  1 295 ? 46.538  46.489  13.829  1.00 4.47   ? 295 GLN E C   1 
ATOM   10166 O O   . GLN E  1 295 ? 45.398  46.105  14.062  1.00 5.23   ? 295 GLN E O   1 
ATOM   10167 C CB  . GLN E  1 295 ? 47.306  46.878  11.556  1.00 3.41   ? 295 GLN E CB  1 
ATOM   10168 C CG  . GLN E  1 295 ? 45.959  47.112  10.937  1.00 3.78   ? 295 GLN E CG  1 
ATOM   10169 C CD  . GLN E  1 295 ? 45.306  48.420  11.314  1.00 4.40   ? 295 GLN E CD  1 
ATOM   10170 O OE1 . GLN E  1 295 ? 45.753  49.161  12.203  1.00 6.02   ? 295 GLN E OE1 1 
ATOM   10171 N NE2 . GLN E  1 295 ? 44.230  48.713  10.611  1.00 3.30   ? 295 GLN E NE2 1 
ATOM   10172 N N   . ASN E  1 296 ? 47.123  47.433  14.518  1.00 5.48   ? 296 ASN E N   1 
ATOM   10173 C CA  . ASN E  1 296 ? 46.481  48.037  15.648  1.00 6.05   ? 296 ASN E CA  1 
ATOM   10174 C C   . ASN E  1 296 ? 46.675  49.554  15.605  1.00 5.89   ? 296 ASN E C   1 
ATOM   10175 O O   . ASN E  1 296 ? 46.402  50.289  16.555  1.00 5.85   ? 296 ASN E O   1 
ATOM   10176 C CB  . ASN E  1 296 ? 47.096  47.352  16.827  1.00 7.52   ? 296 ASN E CB  1 
ATOM   10177 C CG  . ASN E  1 296 ? 46.564  47.848  18.145  1.00 9.83   ? 296 ASN E CG  1 
ATOM   10178 O OD1 . ASN E  1 296 ? 47.352  48.354  18.944  1.00 11.98  ? 296 ASN E OD1 1 
ATOM   10179 N ND2 . ASN E  1 296 ? 45.285  47.733  18.466  1.00 10.07  ? 296 ASN E ND2 1 
ATOM   10180 N N   . VAL E  1 297 ? 47.069  50.082  14.446  1.00 5.31   ? 297 VAL E N   1 
ATOM   10181 C CA  . VAL E  1 297 ? 47.277  51.506  14.317  1.00 6.33   ? 297 VAL E CA  1 
ATOM   10182 C C   . VAL E  1 297 ? 45.959  52.281  14.348  1.00 7.64   ? 297 VAL E C   1 
ATOM   10183 O O   . VAL E  1 297 ? 45.795  53.219  15.150  1.00 8.45   ? 297 VAL E O   1 
ATOM   10184 C CB  . VAL E  1 297 ? 48.047  51.763  13.017  1.00 5.74   ? 297 VAL E CB  1 
ATOM   10185 C CG1 . VAL E  1 297 ? 48.109  53.225  12.607  1.00 5.05   ? 297 VAL E CG1 1 
ATOM   10186 C CG2 . VAL E  1 297 ? 49.462  51.331  13.302  1.00 6.08   ? 297 VAL E CG2 1 
ATOM   10187 N N   . ASN E  1 298 ? 45.000  51.911  13.500  1.00 7.79   ? 298 ASN E N   1 
ATOM   10188 C CA  . ASN E  1 298 ? 43.742  52.616  13.452  1.00 8.13   ? 298 ASN E CA  1 
ATOM   10189 C C   . ASN E  1 298 ? 42.734  51.726  12.736  1.00 9.74   ? 298 ASN E C   1 
ATOM   10190 O O   . ASN E  1 298 ? 43.108  50.895  11.913  1.00 8.76   ? 298 ASN E O   1 
ATOM   10191 C CB  . ASN E  1 298 ? 43.888  53.943  12.700  1.00 7.48   ? 298 ASN E CB  1 
ATOM   10192 C CG  . ASN E  1 298 ? 42.770  54.912  13.059  1.00 8.78   ? 298 ASN E CG  1 
ATOM   10193 O OD1 . ASN E  1 298 ? 41.588  54.552  13.022  1.00 10.31  ? 298 ASN E OD1 1 
ATOM   10194 N ND2 . ASN E  1 298 ? 43.012  56.145  13.463  1.00 8.85   ? 298 ASN E ND2 1 
ATOM   10195 N N   . LYS E  1 299 ? 41.441  51.842  13.097  1.00 11.46  ? 299 LYS E N   1 
ATOM   10196 C CA  . LYS E  1 299 ? 40.374  51.056  12.506  1.00 10.17  ? 299 LYS E CA  1 
ATOM   10197 C C   . LYS E  1 299 ? 39.939  51.700  11.214  1.00 9.63   ? 299 LYS E C   1 
ATOM   10198 O O   . LYS E  1 299 ? 39.123  51.119  10.495  1.00 12.29  ? 299 LYS E O   1 
ATOM   10199 C CB  . LYS E  1 299 ? 39.161  50.958  13.442  1.00 10.89  ? 299 LYS E CB  1 
ATOM   10200 C CG  . LYS E  1 299 ? 38.301  52.209  13.568  1.00 12.46  ? 299 LYS E CG  1 
ATOM   10201 C CD  . LYS E  1 299 ? 37.199  52.066  14.613  1.00 13.68  ? 299 LYS E CD  1 
ATOM   10202 C CE  . LYS E  1 299 ? 37.533  52.881  15.878  1.00 15.31  ? 299 LYS E CE  1 
ATOM   10203 N NZ  . LYS E  1 299 ? 37.554  54.341  15.671  1.00 16.82  ? 299 LYS E NZ  1 
ATOM   10204 N N   . ILE E  1 300 ? 40.369  52.921  10.922  1.00 7.96   ? 300 ILE E N   1 
ATOM   10205 C CA  . ILE E  1 300 ? 40.020  53.593  9.681   1.00 7.61   ? 300 ILE E CA  1 
ATOM   10206 C C   . ILE E  1 300 ? 41.152  53.321  8.723   1.00 8.28   ? 300 ILE E C   1 
ATOM   10207 O O   . ILE E  1 300 ? 42.303  53.519  9.098   1.00 10.03  ? 300 ILE E O   1 
ATOM   10208 C CB  . ILE E  1 300 ? 39.867  55.053  9.998   1.00 6.47   ? 300 ILE E CB  1 
ATOM   10209 C CG1 . ILE E  1 300 ? 38.628  55.193  10.817  1.00 6.48   ? 300 ILE E CG1 1 
ATOM   10210 C CG2 . ILE E  1 300 ? 39.760  55.880  8.762   1.00 6.29   ? 300 ILE E CG2 1 
ATOM   10211 C CD1 . ILE E  1 300 ? 38.653  56.416  11.704  1.00 7.13   ? 300 ILE E CD1 1 
ATOM   10212 N N   . THR E  1 301 ? 40.908  52.856  7.517   1.00 8.44   ? 301 THR E N   1 
ATOM   10213 C CA  . THR E  1 301 ? 41.994  52.500  6.614   1.00 8.20   ? 301 THR E CA  1 
ATOM   10214 C C   . THR E  1 301 ? 41.530  52.671  5.174   1.00 7.44   ? 301 THR E C   1 
ATOM   10215 O O   . THR E  1 301 ? 40.317  52.720  4.913   1.00 8.04   ? 301 THR E O   1 
ATOM   10216 C CB  . THR E  1 301 ? 42.444  51.014  6.838   1.00 9.04   ? 301 THR E CB  1 
ATOM   10217 O OG1 . THR E  1 301 ? 41.248  50.248  6.782   1.00 10.49  ? 301 THR E OG1 1 
ATOM   10218 C CG2 . THR E  1 301 ? 43.089  50.692  8.187   1.00 9.48   ? 301 THR E CG2 1 
ATOM   10219 N N   . TYR E  1 302 ? 42.459  52.795  4.241   1.00 6.56   ? 302 TYR E N   1 
ATOM   10220 C CA  . TYR E  1 302 ? 42.165  52.878  2.818   1.00 5.21   ? 302 TYR E CA  1 
ATOM   10221 C C   . TYR E  1 302 ? 43.235  52.054  2.122   1.00 4.29   ? 302 TYR E C   1 
ATOM   10222 O O   . TYR E  1 302 ? 44.395  52.192  2.502   1.00 5.73   ? 302 TYR E O   1 
ATOM   10223 C CB  . TYR E  1 302 ? 42.230  54.340  2.328   1.00 4.06   ? 302 TYR E CB  1 
ATOM   10224 C CG  . TYR E  1 302 ? 41.989  54.449  0.826   1.00 3.57   ? 302 TYR E CG  1 
ATOM   10225 C CD1 . TYR E  1 302 ? 43.074  54.492  -0.013  1.00 3.04   ? 302 TYR E CD1 1 
ATOM   10226 C CD2 . TYR E  1 302 ? 40.711  54.451  0.294   1.00 2.87   ? 302 TYR E CD2 1 
ATOM   10227 C CE1 . TYR E  1 302 ? 42.895  54.504  -1.369  1.00 2.33   ? 302 TYR E CE1 1 
ATOM   10228 C CE2 . TYR E  1 302 ? 40.532  54.470  -1.069  1.00 2.00   ? 302 TYR E CE2 1 
ATOM   10229 C CZ  . TYR E  1 302 ? 41.632  54.491  -1.885  1.00 2.08   ? 302 TYR E CZ  1 
ATOM   10230 O OH  . TYR E  1 302 ? 41.491  54.406  -3.246  1.00 2.39   ? 302 TYR E OH  1 
ATOM   10231 N N   . GLY E  1 303 ? 42.911  51.210  1.153   1.00 3.07   ? 303 GLY E N   1 
ATOM   10232 C CA  . GLY E  1 303 ? 43.932  50.464  0.436   1.00 3.71   ? 303 GLY E CA  1 
ATOM   10233 C C   . GLY E  1 303 ? 44.166  49.038  0.947   1.00 4.78   ? 303 GLY E C   1 
ATOM   10234 O O   . GLY E  1 303 ? 43.323  48.495  1.671   1.00 6.86   ? 303 GLY E O   1 
ATOM   10235 N N   . ALA E  1 304 ? 45.274  48.376  0.580   1.00 4.23   ? 304 ALA E N   1 
ATOM   10236 C CA  . ALA E  1 304 ? 45.563  47.018  1.028   1.00 4.10   ? 304 ALA E CA  1 
ATOM   10237 C C   . ALA E  1 304 ? 46.130  46.996  2.431   1.00 4.52   ? 304 ALA E C   1 
ATOM   10238 O O   . ALA E  1 304 ? 47.339  47.056  2.588   1.00 5.17   ? 304 ALA E O   1 
ATOM   10239 C CB  . ALA E  1 304 ? 46.574  46.385  0.113   1.00 4.00   ? 304 ALA E CB  1 
ATOM   10240 N N   . CYS E  1 305 ? 45.337  46.871  3.474   1.00 4.78   ? 305 CYS E N   1 
ATOM   10241 C CA  . CYS E  1 305 ? 45.843  47.013  4.825   1.00 5.56   ? 305 CYS E CA  1 
ATOM   10242 C C   . CYS E  1 305 ? 45.721  45.794  5.703   1.00 6.67   ? 305 CYS E C   1 
ATOM   10243 O O   . CYS E  1 305 ? 44.975  44.868  5.384   1.00 9.76   ? 305 CYS E O   1 
ATOM   10244 C CB  . CYS E  1 305 ? 45.115  48.096  5.508   1.00 6.12   ? 305 CYS E CB  1 
ATOM   10245 S SG  . CYS E  1 305 ? 45.451  49.677  4.745   1.00 6.75   ? 305 CYS E SG  1 
ATOM   10246 N N   . PRO E  1 306 ? 46.446  45.697  6.810   1.00 6.35   ? 306 PRO E N   1 
ATOM   10247 C CA  . PRO E  1 306 ? 46.303  44.572  7.710   1.00 7.02   ? 306 PRO E CA  1 
ATOM   10248 C C   . PRO E  1 306 ? 44.944  44.719  8.412   1.00 7.82   ? 306 PRO E C   1 
ATOM   10249 O O   . PRO E  1 306 ? 44.379  45.825  8.478   1.00 9.21   ? 306 PRO E O   1 
ATOM   10250 C CB  . PRO E  1 306 ? 47.483  44.692  8.623   1.00 6.83   ? 306 PRO E CB  1 
ATOM   10251 C CG  . PRO E  1 306 ? 48.486  45.370  7.753   1.00 6.70   ? 306 PRO E CG  1 
ATOM   10252 C CD  . PRO E  1 306 ? 47.648  46.440  7.112   1.00 6.67   ? 306 PRO E CD  1 
ATOM   10253 N N   . LYS E  1 307 ? 44.389  43.651  8.985   1.00 7.55   ? 307 LYS E N   1 
ATOM   10254 C CA  . LYS E  1 307 ? 43.096  43.732  9.614   1.00 7.01   ? 307 LYS E CA  1 
ATOM   10255 C C   . LYS E  1 307 ? 43.265  44.278  11.001  1.00 5.86   ? 307 LYS E C   1 
ATOM   10256 O O   . LYS E  1 307 ? 44.139  43.851  11.749  1.00 5.88   ? 307 LYS E O   1 
ATOM   10257 C CB  . LYS E  1 307 ? 42.459  42.375  9.701   1.00 9.17   ? 307 LYS E CB  1 
ATOM   10258 C CG  . LYS E  1 307 ? 42.216  41.870  8.319   1.00 11.58  ? 307 LYS E CG  1 
ATOM   10259 C CD  . LYS E  1 307 ? 41.174  40.782  8.275   1.00 14.14  ? 307 LYS E CD  1 
ATOM   10260 C CE  . LYS E  1 307 ? 41.054  40.237  6.837   1.00 16.61  ? 307 LYS E CE  1 
ATOM   10261 N NZ  . LYS E  1 307 ? 42.306  39.663  6.318   1.00 17.69  ? 307 LYS E NZ  1 
ATOM   10262 N N   . TYR E  1 308 ? 42.472  45.275  11.329  1.00 4.61   ? 308 TYR E N   1 
ATOM   10263 C CA  . TYR E  1 308 ? 42.517  45.882  12.648  1.00 3.48   ? 308 TYR E CA  1 
ATOM   10264 C C   . TYR E  1 308 ? 42.106  44.895  13.699  1.00 2.79   ? 308 TYR E C   1 
ATOM   10265 O O   . TYR E  1 308 ? 41.105  44.221  13.569  1.00 3.71   ? 308 TYR E O   1 
ATOM   10266 C CB  . TYR E  1 308 ? 41.584  47.060  12.730  1.00 3.19   ? 308 TYR E CB  1 
ATOM   10267 C CG  . TYR E  1 308 ? 41.685  47.800  14.019  1.00 2.21   ? 308 TYR E CG  1 
ATOM   10268 C CD1 . TYR E  1 308 ? 40.724  47.617  14.981  1.00 2.66   ? 308 TYR E CD1 1 
ATOM   10269 C CD2 . TYR E  1 308 ? 42.761  48.599  14.229  1.00 2.00   ? 308 TYR E CD2 1 
ATOM   10270 C CE1 . TYR E  1 308 ? 40.837  48.250  16.185  1.00 3.11   ? 308 TYR E CE1 1 
ATOM   10271 C CE2 . TYR E  1 308 ? 42.871  49.235  15.435  1.00 3.10   ? 308 TYR E CE2 1 
ATOM   10272 C CZ  . TYR E  1 308 ? 41.919  49.055  16.410  1.00 3.12   ? 308 TYR E CZ  1 
ATOM   10273 O OH  . TYR E  1 308 ? 42.063  49.646  17.639  1.00 3.27   ? 308 TYR E OH  1 
ATOM   10274 N N   . VAL E  1 309 ? 42.834  44.893  14.772  1.00 2.45   ? 309 VAL E N   1 
ATOM   10275 C CA  . VAL E  1 309 ? 42.616  43.975  15.833  1.00 2.80   ? 309 VAL E CA  1 
ATOM   10276 C C   . VAL E  1 309 ? 42.781  44.788  17.106  1.00 2.43   ? 309 VAL E C   1 
ATOM   10277 O O   . VAL E  1 309 ? 43.308  45.901  17.087  1.00 2.84   ? 309 VAL E O   1 
ATOM   10278 C CB  . VAL E  1 309 ? 43.653  42.918  15.439  1.00 3.54   ? 309 VAL E CB  1 
ATOM   10279 C CG1 . VAL E  1 309 ? 44.774  42.788  16.436  1.00 3.52   ? 309 VAL E CG1 1 
ATOM   10280 C CG2 . VAL E  1 309 ? 42.860  41.656  15.169  1.00 4.92   ? 309 VAL E CG2 1 
ATOM   10281 N N   . LYS E  1 310 ? 42.250  44.326  18.220  1.00 2.86   ? 310 LYS E N   1 
ATOM   10282 C CA  . LYS E  1 310 ? 42.400  45.052  19.467  1.00 3.45   ? 310 LYS E CA  1 
ATOM   10283 C C   . LYS E  1 310 ? 43.795  44.807  20.005  1.00 3.43   ? 310 LYS E C   1 
ATOM   10284 O O   . LYS E  1 310 ? 44.437  45.708  20.536  1.00 2.75   ? 310 LYS E O   1 
ATOM   10285 C CB  . LYS E  1 310 ? 41.374  44.578  20.482  1.00 4.41   ? 310 LYS E CB  1 
ATOM   10286 C CG  . LYS E  1 310 ? 40.034  45.252  20.275  1.00 8.16   ? 310 LYS E CG  1 
ATOM   10287 C CD  . LYS E  1 310 ? 38.915  44.553  21.092  1.00 11.98  ? 310 LYS E CD  1 
ATOM   10288 C CE  . LYS E  1 310 ? 37.710  45.481  21.513  1.00 15.11  ? 310 LYS E CE  1 
ATOM   10289 N NZ  . LYS E  1 310 ? 36.790  45.982  20.465  1.00 16.03  ? 310 LYS E NZ  1 
ATOM   10290 N N   . GLN E  1 311 ? 44.301  43.592  19.843  1.00 4.34   ? 311 GLN E N   1 
ATOM   10291 C CA  . GLN E  1 311 ? 45.586  43.196  20.390  1.00 5.83   ? 311 GLN E CA  1 
ATOM   10292 C C   . GLN E  1 311 ? 46.704  44.061  19.873  1.00 7.52   ? 311 GLN E C   1 
ATOM   10293 O O   . GLN E  1 311 ? 46.769  44.307  18.677  1.00 8.44   ? 311 GLN E O   1 
ATOM   10294 C CB  . GLN E  1 311 ? 45.940  41.764  20.019  1.00 4.53   ? 311 GLN E CB  1 
ATOM   10295 C CG  . GLN E  1 311 ? 45.010  40.735  20.580  1.00 4.67   ? 311 GLN E CG  1 
ATOM   10296 C CD  . GLN E  1 311 ? 43.929  40.311  19.624  1.00 5.29   ? 311 GLN E CD  1 
ATOM   10297 O OE1 . GLN E  1 311 ? 43.454  41.088  18.811  1.00 5.58   ? 311 GLN E OE1 1 
ATOM   10298 N NE2 . GLN E  1 311 ? 43.500  39.065  19.691  1.00 6.45   ? 311 GLN E NE2 1 
ATOM   10299 N N   . ASN E  1 312 ? 47.615  44.522  20.706  1.00 9.68   ? 312 ASN E N   1 
ATOM   10300 C CA  . ASN E  1 312 ? 48.702  45.293  20.147  1.00 12.17  ? 312 ASN E CA  1 
ATOM   10301 C C   . ASN E  1 312 ? 49.919  44.412  19.926  1.00 12.02  ? 312 ASN E C   1 
ATOM   10302 O O   . ASN E  1 312 ? 50.929  44.865  19.377  1.00 12.55  ? 312 ASN E O   1 
ATOM   10303 C CB  . ASN E  1 312 ? 49.082  46.456  21.054  1.00 15.45  ? 312 ASN E CB  1 
ATOM   10304 C CG  . ASN E  1 312 ? 49.659  45.942  22.357  1.00 18.60  ? 312 ASN E CG  1 
ATOM   10305 O OD1 . ASN E  1 312 ? 49.084  45.072  23.027  1.00 19.24  ? 312 ASN E OD1 1 
ATOM   10306 N ND2 . ASN E  1 312 ? 50.846  46.414  22.710  1.00 20.42  ? 312 ASN E ND2 1 
ATOM   10307 N N   . THR E  1 313 ? 49.904  43.168  20.385  1.00 10.73  ? 313 THR E N   1 
ATOM   10308 C CA  . THR E  1 313 ? 50.975  42.252  20.035  1.00 10.25  ? 313 THR E CA  1 
ATOM   10309 C C   . THR E  1 313 ? 50.437  40.829  19.990  1.00 10.35  ? 313 THR E C   1 
ATOM   10310 O O   . THR E  1 313 ? 49.611  40.441  20.841  1.00 12.37  ? 313 THR E O   1 
ATOM   10311 C CB  . THR E  1 313 ? 52.085  42.402  21.058  1.00 10.70  ? 313 THR E CB  1 
ATOM   10312 O OG1 . THR E  1 313 ? 53.076  41.418  20.758  1.00 9.63   ? 313 THR E OG1 1 
ATOM   10313 C CG2 . THR E  1 313 ? 51.527  42.341  22.489  1.00 11.41  ? 313 THR E CG2 1 
ATOM   10314 N N   . LEU E  1 314 ? 50.832  40.054  18.974  1.00 8.52   ? 314 LEU E N   1 
ATOM   10315 C CA  . LEU E  1 314 ? 50.431  38.663  18.788  1.00 6.62   ? 314 LEU E CA  1 
ATOM   10316 C C   . LEU E  1 314 ? 51.624  37.954  18.145  1.00 7.21   ? 314 LEU E C   1 
ATOM   10317 O O   . LEU E  1 314 ? 51.903  38.112  16.958  1.00 5.62   ? 314 LEU E O   1 
ATOM   10318 C CB  . LEU E  1 314 ? 49.220  38.622  17.895  1.00 3.79   ? 314 LEU E CB  1 
ATOM   10319 C CG  . LEU E  1 314 ? 47.898  38.065  18.314  1.00 2.97   ? 314 LEU E CG  1 
ATOM   10320 C CD1 . LEU E  1 314 ? 47.619  38.209  19.789  1.00 3.66   ? 314 LEU E CD1 1 
ATOM   10321 C CD2 . LEU E  1 314 ? 46.872  38.834  17.535  1.00 3.11   ? 314 LEU E CD2 1 
ATOM   10322 N N   . LYS E  1 315 ? 52.393  37.190  18.945  1.00 8.31   ? 315 LYS E N   1 
ATOM   10323 C CA  . LYS E  1 315 ? 53.607  36.548  18.456  1.00 7.47   ? 315 LYS E CA  1 
ATOM   10324 C C   . LYS E  1 315 ? 53.381  35.151  17.949  1.00 6.28   ? 315 LYS E C   1 
ATOM   10325 O O   . LYS E  1 315 ? 52.788  34.326  18.653  1.00 6.71   ? 315 LYS E O   1 
ATOM   10326 C CB  . LYS E  1 315 ? 54.635  36.491  19.549  1.00 8.69   ? 315 LYS E CB  1 
ATOM   10327 C CG  . LYS E  1 315 ? 55.010  37.904  19.848  1.00 10.51  ? 315 LYS E CG  1 
ATOM   10328 C CD  . LYS E  1 315 ? 56.159  38.023  20.811  1.00 12.69  ? 315 LYS E CD  1 
ATOM   10329 C CE  . LYS E  1 315 ? 56.355  39.511  21.125  1.00 15.04  ? 315 LYS E CE  1 
ATOM   10330 N NZ  . LYS E  1 315 ? 56.603  40.302  19.915  1.00 16.23  ? 315 LYS E NZ  1 
ATOM   10331 N N   . LEU E  1 316 ? 53.841  34.895  16.740  1.00 4.84   ? 316 LEU E N   1 
ATOM   10332 C CA  . LEU E  1 316 ? 53.753  33.592  16.126  1.00 4.72   ? 316 LEU E CA  1 
ATOM   10333 C C   . LEU E  1 316 ? 55.079  32.906  16.345  1.00 5.55   ? 316 LEU E C   1 
ATOM   10334 O O   . LEU E  1 316 ? 56.108  33.423  15.915  1.00 5.78   ? 316 LEU E O   1 
ATOM   10335 C CB  . LEU E  1 316 ? 53.505  33.734  14.638  1.00 3.11   ? 316 LEU E CB  1 
ATOM   10336 C CG  . LEU E  1 316 ? 53.136  32.498  13.863  1.00 2.00   ? 316 LEU E CG  1 
ATOM   10337 C CD1 . LEU E  1 316 ? 51.738  32.023  14.212  1.00 2.38   ? 316 LEU E CD1 1 
ATOM   10338 C CD2 . LEU E  1 316 ? 53.139  32.851  12.411  1.00 2.64   ? 316 LEU E CD2 1 
ATOM   10339 N N   . ALA E  1 317 ? 55.118  31.789  17.066  1.00 6.49   ? 317 ALA E N   1 
ATOM   10340 C CA  . ALA E  1 317 ? 56.358  31.047  17.273  1.00 6.08   ? 317 ALA E CA  1 
ATOM   10341 C C   . ALA E  1 317 ? 56.803  30.506  15.939  1.00 5.25   ? 317 ALA E C   1 
ATOM   10342 O O   . ALA E  1 317 ? 55.997  29.958  15.169  1.00 4.47   ? 317 ALA E O   1 
ATOM   10343 C CB  . ALA E  1 317 ? 56.178  29.847  18.196  1.00 6.28   ? 317 ALA E CB  1 
ATOM   10344 N N   . THR E  1 318 ? 58.064  30.778  15.655  1.00 5.14   ? 318 THR E N   1 
ATOM   10345 C CA  . THR E  1 318 ? 58.708  30.299  14.451  1.00 4.54   ? 318 THR E CA  1 
ATOM   10346 C C   . THR E  1 318 ? 59.894  29.430  14.822  1.00 3.97   ? 318 THR E C   1 
ATOM   10347 O O   . THR E  1 318 ? 60.873  29.377  14.083  1.00 3.72   ? 318 THR E O   1 
ATOM   10348 C CB  . THR E  1 318 ? 59.168  31.477  13.606  1.00 4.52   ? 318 THR E CB  1 
ATOM   10349 O OG1 . THR E  1 318 ? 59.522  32.553  14.483  1.00 5.65   ? 318 THR E OG1 1 
ATOM   10350 C CG2 . THR E  1 318 ? 58.092  31.889  12.645  1.00 5.12   ? 318 THR E CG2 1 
ATOM   10351 N N   . GLY E  1 319 ? 59.834  28.749  15.968  1.00 3.28   ? 319 GLY E N   1 
ATOM   10352 C CA  . GLY E  1 319 ? 60.898  27.870  16.395  1.00 3.07   ? 319 GLY E CA  1 
ATOM   10353 C C   . GLY E  1 319 ? 60.383  26.945  17.483  1.00 3.87   ? 319 GLY E C   1 
ATOM   10354 O O   . GLY E  1 319 ? 59.265  27.160  17.964  1.00 4.59   ? 319 GLY E O   1 
ATOM   10355 N N   . MET E  1 320 ? 61.173  25.934  17.858  1.00 2.98   ? 320 MET E N   1 
ATOM   10356 C CA  . MET E  1 320 ? 60.801  24.976  18.875  1.00 2.89   ? 320 MET E CA  1 
ATOM   10357 C C   . MET E  1 320 ? 60.834  25.560  20.254  1.00 4.24   ? 320 MET E C   1 
ATOM   10358 O O   . MET E  1 320 ? 61.166  26.719  20.451  1.00 3.67   ? 320 MET E O   1 
ATOM   10359 C CB  . MET E  1 320 ? 61.740  23.820  18.889  1.00 3.38   ? 320 MET E CB  1 
ATOM   10360 C CG  . MET E  1 320 ? 63.176  24.177  19.249  1.00 3.05   ? 320 MET E CG  1 
ATOM   10361 S SD  . MET E  1 320 ? 64.161  22.680  19.399  1.00 2.00   ? 320 MET E SD  1 
ATOM   10362 C CE  . MET E  1 320 ? 64.415  22.398  17.677  1.00 2.23   ? 320 MET E CE  1 
ATOM   10363 N N   . ARG E  1 321 ? 60.536  24.738  21.245  1.00 7.17   ? 321 ARG E N   1 
ATOM   10364 C CA  . ARG E  1 321 ? 60.672  25.125  22.626  1.00 9.25   ? 321 ARG E CA  1 
ATOM   10365 C C   . ARG E  1 321 ? 62.099  25.460  22.944  1.00 11.36  ? 321 ARG E C   1 
ATOM   10366 O O   . ARG E  1 321 ? 63.028  24.812  22.463  1.00 12.61  ? 321 ARG E O   1 
ATOM   10367 C CB  . ARG E  1 321 ? 60.291  24.014  23.526  1.00 9.22   ? 321 ARG E CB  1 
ATOM   10368 C CG  . ARG E  1 321 ? 58.878  24.038  23.946  1.00 9.81   ? 321 ARG E CG  1 
ATOM   10369 C CD  . ARG E  1 321 ? 59.054  24.176  25.417  1.00 10.65  ? 321 ARG E CD  1 
ATOM   10370 N NE  . ARG E  1 321 ? 58.204  23.205  26.044  1.00 12.02  ? 321 ARG E NE  1 
ATOM   10371 C CZ  . ARG E  1 321 ? 58.162  23.070  27.370  1.00 13.70  ? 321 ARG E CZ  1 
ATOM   10372 N NH1 . ARG E  1 321 ? 57.330  22.129  27.855  1.00 14.43  ? 321 ARG E NH1 1 
ATOM   10373 N NH2 . ARG E  1 321 ? 58.915  23.857  28.170  1.00 13.58  ? 321 ARG E NH2 1 
ATOM   10374 N N   . ASN E  1 322 ? 62.302  26.450  23.777  1.00 13.88  ? 322 ASN E N   1 
ATOM   10375 C CA  . ASN E  1 322 ? 63.632  26.788  24.198  1.00 15.42  ? 322 ASN E CA  1 
ATOM   10376 C C   . ASN E  1 322 ? 63.858  26.090  25.524  1.00 16.37  ? 322 ASN E C   1 
ATOM   10377 O O   . ASN E  1 322 ? 63.133  26.394  26.457  1.00 17.74  ? 322 ASN E O   1 
ATOM   10378 C CB  . ASN E  1 322 ? 63.697  28.281  24.334  1.00 15.51  ? 322 ASN E CB  1 
ATOM   10379 C CG  . ASN E  1 322 ? 65.133  28.667  24.485  1.00 16.80  ? 322 ASN E CG  1 
ATOM   10380 O OD1 . ASN E  1 322 ? 65.980  28.105  23.773  1.00 16.84  ? 322 ASN E OD1 1 
ATOM   10381 N ND2 . ASN E  1 322 ? 65.437  29.578  25.399  1.00 17.30  ? 322 ASN E ND2 1 
ATOM   10382 N N   . VAL E  1 323 ? 64.715  25.079  25.650  1.00 17.50  ? 323 VAL E N   1 
ATOM   10383 C CA  . VAL E  1 323 ? 64.987  24.462  26.950  1.00 19.20  ? 323 VAL E CA  1 
ATOM   10384 C C   . VAL E  1 323 ? 66.500  24.625  27.148  1.00 22.49  ? 323 VAL E C   1 
ATOM   10385 O O   . VAL E  1 323 ? 67.247  23.697  26.866  1.00 22.35  ? 323 VAL E O   1 
ATOM   10386 C CB  . VAL E  1 323 ? 64.571  22.974  26.901  1.00 18.36  ? 323 VAL E CB  1 
ATOM   10387 C CG1 . VAL E  1 323 ? 64.551  22.442  28.291  1.00 18.10  ? 323 VAL E CG1 1 
ATOM   10388 C CG2 . VAL E  1 323 ? 63.184  22.774  26.339  1.00 18.18  ? 323 VAL E CG2 1 
ATOM   10389 N N   . PRO E  1 324 ? 67.032  25.773  27.603  1.00 26.25  ? 324 PRO E N   1 
ATOM   10390 C CA  . PRO E  1 324 ? 68.463  26.053  27.768  1.00 30.06  ? 324 PRO E CA  1 
ATOM   10391 C C   . PRO E  1 324 ? 69.209  25.219  28.773  1.00 34.35  ? 324 PRO E C   1 
ATOM   10392 O O   . PRO E  1 324 ? 68.578  24.693  29.694  1.00 34.78  ? 324 PRO E O   1 
ATOM   10393 C CB  . PRO E  1 324 ? 68.498  27.508  28.104  1.00 29.18  ? 324 PRO E CB  1 
ATOM   10394 C CG  . PRO E  1 324 ? 67.310  27.583  29.033  1.00 28.24  ? 324 PRO E CG  1 
ATOM   10395 C CD  . PRO E  1 324 ? 66.270  26.825  28.258  1.00 26.86  ? 324 PRO E CD  1 
ATOM   10396 N N   . GLU E  1 325 ? 70.527  25.246  28.590  1.00 39.56  ? 325 GLU E N   1 
ATOM   10397 C CA  . GLU E  1 325 ? 71.432  24.493  29.422  1.00 46.07  ? 325 GLU E CA  1 
ATOM   10398 C C   . GLU E  1 325 ? 71.329  24.967  30.869  1.00 51.16  ? 325 GLU E C   1 
ATOM   10399 O O   . GLU E  1 325 ? 71.430  24.168  31.810  1.00 51.99  ? 325 GLU E O   1 
ATOM   10400 C CB  . GLU E  1 325 ? 72.861  24.668  28.896  1.00 45.22  ? 325 GLU E CB  1 
ATOM   10401 C CG  . GLU E  1 325 ? 73.157  24.023  27.542  1.00 44.50  ? 325 GLU E CG  1 
ATOM   10402 C CD  . GLU E  1 325 ? 73.974  22.735  27.619  1.00 44.68  ? 325 GLU E CD  1 
ATOM   10403 O OE1 . GLU E  1 325 ? 73.762  21.919  28.531  1.00 44.06  ? 325 GLU E OE1 1 
ATOM   10404 O OE2 . GLU E  1 325 ? 74.817  22.540  26.727  1.00 45.04  ? 325 GLU E OE2 1 
ATOM   10405 N N   . LYS E  1 326 ? 71.073  26.255  31.103  1.00 56.83  ? 326 LYS E N   1 
ATOM   10406 C CA  . LYS E  1 326 ? 70.964  26.690  32.478  1.00 63.26  ? 326 LYS E CA  1 
ATOM   10407 C C   . LYS E  1 326 ? 69.975  27.817  32.759  1.00 68.24  ? 326 LYS E C   1 
ATOM   10408 O O   . LYS E  1 326 ? 70.132  28.964  32.286  1.00 69.83  ? 326 LYS E O   1 
ATOM   10409 C CB  . LYS E  1 326 ? 72.339  27.108  32.975  1.00 63.00  ? 326 LYS E CB  1 
ATOM   10410 C CG  . LYS E  1 326 ? 73.073  28.093  32.076  1.00 63.32  ? 326 LYS E CG  1 
ATOM   10411 C CD  . LYS E  1 326 ? 73.812  29.088  32.952  1.00 63.92  ? 326 LYS E CD  1 
ATOM   10412 C CE  . LYS E  1 326 ? 72.868  29.990  33.760  1.00 64.30  ? 326 LYS E CE  1 
ATOM   10413 N NZ  . LYS E  1 326 ? 71.986  30.774  32.908  1.00 64.61  ? 326 LYS E NZ  1 
ATOM   10414 N N   . GLN E  1 327 ? 68.968  27.536  33.590  1.00 73.03  ? 327 GLN E N   1 
ATOM   10415 C CA  . GLN E  1 327 ? 68.058  28.571  34.045  1.00 77.05  ? 327 GLN E CA  1 
ATOM   10416 C C   . GLN E  1 327 ? 68.663  29.011  35.387  1.00 79.23  ? 327 GLN E C   1 
ATOM   10417 O O   . GLN E  1 327 ? 69.276  28.202  36.101  1.00 79.44  ? 327 GLN E O   1 
ATOM   10418 C CB  . GLN E  1 327 ? 66.649  27.955  34.153  1.00 78.03  ? 327 GLN E CB  1 
ATOM   10419 C CG  . GLN E  1 327 ? 65.893  27.997  35.496  1.00 79.37  ? 327 GLN E CG  1 
ATOM   10420 C CD  . GLN E  1 327 ? 65.046  29.242  35.737  1.00 79.88  ? 327 GLN E CD  1 
ATOM   10421 O OE1 . GLN E  1 327 ? 64.159  29.571  34.951  1.00 80.30  ? 327 GLN E OE1 1 
ATOM   10422 N NE2 . GLN E  1 327 ? 65.264  29.979  36.809  1.00 79.84  ? 327 GLN E NE2 1 
ATOM   10423 N N   . THR E  1 328 ? 68.593  30.316  35.627  1.00 81.33  ? 328 THR E N   1 
ATOM   10424 C CA  . THR E  1 328 ? 69.172  31.031  36.761  1.00 82.83  ? 328 THR E CA  1 
ATOM   10425 C C   . THR E  1 328 ? 68.289  31.094  38.002  1.00 82.93  ? 328 THR E C   1 
ATOM   10426 O O   . THR E  1 328 ? 68.754  30.739  39.081  1.00 83.33  ? 328 THR E O   1 
ATOM   10427 C CB  . THR E  1 328 ? 69.510  32.482  36.320  1.00 83.70  ? 328 THR E CB  1 
ATOM   10428 O OG1 . THR E  1 328 ? 68.679  32.721  35.178  1.00 84.09  ? 328 THR E OG1 1 
ATOM   10429 C CG2 . THR E  1 328 ? 71.017  32.750  36.176  1.00 84.32  ? 328 THR E CG2 1 
ATOM   10430 O OXT . THR E  1 328 ? 67.157  31.552  37.882  1.00 82.85  ? 328 THR E OXT 1 
ATOM   10431 N N   . GLY F  2 1   ? 54.762  18.594  25.158  1.00 20.65  ? 1   GLY F N   1 
ATOM   10432 C CA  . GLY F  2 1   ? 54.815  18.202  23.765  1.00 21.03  ? 1   GLY F CA  1 
ATOM   10433 C C   . GLY F  2 1   ? 54.231  16.800  23.668  1.00 20.85  ? 1   GLY F C   1 
ATOM   10434 O O   . GLY F  2 1   ? 54.511  15.988  24.585  1.00 22.26  ? 1   GLY F O   1 
ATOM   10435 N N   . LEU F  2 2   ? 53.416  16.543  22.630  1.00 18.78  ? 2   LEU F N   1 
ATOM   10436 C CA  . LEU F  2 2   ? 52.769  15.253  22.444  1.00 16.11  ? 2   LEU F CA  1 
ATOM   10437 C C   . LEU F  2 2   ? 53.761  14.103  22.421  1.00 14.69  ? 2   LEU F C   1 
ATOM   10438 O O   . LEU F  2 2   ? 53.472  13.054  22.990  1.00 14.05  ? 2   LEU F O   1 
ATOM   10439 C CB  . LEU F  2 2   ? 51.980  15.202  21.149  1.00 15.00  ? 2   LEU F CB  1 
ATOM   10440 C CG  . LEU F  2 2   ? 50.771  16.076  20.897  1.00 14.06  ? 2   LEU F CG  1 
ATOM   10441 C CD1 . LEU F  2 2   ? 50.141  15.597  19.616  1.00 14.73  ? 2   LEU F CD1 1 
ATOM   10442 C CD2 . LEU F  2 2   ? 49.730  15.953  21.956  1.00 13.97  ? 2   LEU F CD2 1 
ATOM   10443 N N   . PHE F  2 3   ? 54.945  14.316  21.867  1.00 13.30  ? 3   PHE F N   1 
ATOM   10444 C CA  . PHE F  2 3   ? 55.822  13.181  21.762  1.00 14.63  ? 3   PHE F CA  1 
ATOM   10445 C C   . PHE F  2 3   ? 56.787  12.983  22.921  1.00 15.31  ? 3   PHE F C   1 
ATOM   10446 O O   . PHE F  2 3   ? 57.382  11.918  23.043  1.00 15.87  ? 3   PHE F O   1 
ATOM   10447 C CB  . PHE F  2 3   ? 56.550  13.297  20.442  1.00 15.09  ? 3   PHE F CB  1 
ATOM   10448 C CG  . PHE F  2 3   ? 55.556  13.275  19.288  1.00 15.31  ? 3   PHE F CG  1 
ATOM   10449 C CD1 . PHE F  2 3   ? 55.084  14.461  18.762  1.00 15.04  ? 3   PHE F CD1 1 
ATOM   10450 C CD2 . PHE F  2 3   ? 55.092  12.064  18.826  1.00 14.97  ? 3   PHE F CD2 1 
ATOM   10451 C CE1 . PHE F  2 3   ? 54.146  14.427  17.764  1.00 14.38  ? 3   PHE F CE1 1 
ATOM   10452 C CE2 . PHE F  2 3   ? 54.152  12.035  17.830  1.00 14.58  ? 3   PHE F CE2 1 
ATOM   10453 C CZ  . PHE F  2 3   ? 53.678  13.215  17.307  1.00 15.03  ? 3   PHE F CZ  1 
ATOM   10454 N N   . GLY F  2 4   ? 56.983  13.958  23.805  1.00 15.45  ? 4   GLY F N   1 
ATOM   10455 C CA  . GLY F  2 4   ? 57.825  13.717  24.980  1.00 15.02  ? 4   GLY F CA  1 
ATOM   10456 C C   . GLY F  2 4   ? 59.343  13.630  24.780  1.00 14.25  ? 4   GLY F C   1 
ATOM   10457 O O   . GLY F  2 4   ? 60.056  13.188  25.685  1.00 13.30  ? 4   GLY F O   1 
ATOM   10458 N N   . ALA F  2 5   ? 59.853  14.060  23.623  1.00 13.87  ? 5   ALA F N   1 
ATOM   10459 C CA  . ALA F  2 5   ? 61.283  14.100  23.404  1.00 13.59  ? 5   ALA F CA  1 
ATOM   10460 C C   . ALA F  2 5   ? 61.865  15.402  23.925  1.00 13.21  ? 5   ALA F C   1 
ATOM   10461 O O   . ALA F  2 5   ? 62.563  15.343  24.945  1.00 13.77  ? 5   ALA F O   1 
ATOM   10462 C CB  . ALA F  2 5   ? 61.579  13.966  21.927  1.00 14.13  ? 5   ALA F CB  1 
ATOM   10463 N N   . ILE F  2 6   ? 61.563  16.556  23.297  1.00 12.45  ? 6   ILE F N   1 
ATOM   10464 C CA  . ILE F  2 6   ? 62.049  17.882  23.718  1.00 11.01  ? 6   ILE F CA  1 
ATOM   10465 C C   . ILE F  2 6   ? 61.408  18.171  25.057  1.00 11.27  ? 6   ILE F C   1 
ATOM   10466 O O   . ILE F  2 6   ? 60.243  17.854  25.242  1.00 12.71  ? 6   ILE F O   1 
ATOM   10467 C CB  . ILE F  2 6   ? 61.623  18.979  22.706  1.00 10.50  ? 6   ILE F CB  1 
ATOM   10468 C CG1 . ILE F  2 6   ? 62.423  18.870  21.421  1.00 10.57  ? 6   ILE F CG1 1 
ATOM   10469 C CG2 . ILE F  2 6   ? 61.865  20.350  23.273  1.00 10.81  ? 6   ILE F CG2 1 
ATOM   10470 C CD1 . ILE F  2 6   ? 61.902  19.676  20.255  1.00 10.02  ? 6   ILE F CD1 1 
ATOM   10471 N N   . ALA F  2 7   ? 62.161  18.709  26.004  1.00 11.84  ? 7   ALA F N   1 
ATOM   10472 C CA  . ALA F  2 7   ? 61.692  18.938  27.351  1.00 12.64  ? 7   ALA F CA  1 
ATOM   10473 C C   . ALA F  2 7   ? 61.164  17.642  27.949  1.00 13.82  ? 7   ALA F C   1 
ATOM   10474 O O   . ALA F  2 7   ? 60.386  17.676  28.911  1.00 15.39  ? 7   ALA F O   1 
ATOM   10475 C CB  . ALA F  2 7   ? 60.563  19.972  27.384  1.00 12.44  ? 7   ALA F CB  1 
ATOM   10476 N N   . GLY F  2 8   ? 61.635  16.513  27.414  1.00 14.07  ? 8   GLY F N   1 
ATOM   10477 C CA  . GLY F  2 8   ? 61.162  15.207  27.822  1.00 14.16  ? 8   GLY F CA  1 
ATOM   10478 C C   . GLY F  2 8   ? 62.388  14.363  28.043  1.00 13.25  ? 8   GLY F C   1 
ATOM   10479 O O   . GLY F  2 8   ? 63.299  14.774  28.753  1.00 11.67  ? 8   GLY F O   1 
ATOM   10480 N N   . PHE F  2 9   ? 62.453  13.216  27.342  1.00 13.84  ? 9   PHE F N   1 
ATOM   10481 C CA  . PHE F  2 9   ? 63.596  12.349  27.547  1.00 13.58  ? 9   PHE F CA  1 
ATOM   10482 C C   . PHE F  2 9   ? 64.869  13.043  27.145  1.00 14.76  ? 9   PHE F C   1 
ATOM   10483 O O   . PHE F  2 9   ? 65.940  12.704  27.652  1.00 16.65  ? 9   PHE F O   1 
ATOM   10484 C CB  . PHE F  2 9   ? 63.515  11.027  26.785  1.00 11.59  ? 9   PHE F CB  1 
ATOM   10485 C CG  . PHE F  2 9   ? 63.391  10.974  25.287  1.00 11.47  ? 9   PHE F CG  1 
ATOM   10486 C CD1 . PHE F  2 9   ? 64.504  10.877  24.484  1.00 12.49  ? 9   PHE F CD1 1 
ATOM   10487 C CD2 . PHE F  2 9   ? 62.151  10.975  24.721  1.00 11.30  ? 9   PHE F CD2 1 
ATOM   10488 C CE1 . PHE F  2 9   ? 64.383  10.791  23.112  1.00 11.95  ? 9   PHE F CE1 1 
ATOM   10489 C CE2 . PHE F  2 9   ? 62.021  10.887  23.357  1.00 11.47  ? 9   PHE F CE2 1 
ATOM   10490 C CZ  . PHE F  2 9   ? 63.135  10.793  22.547  1.00 12.10  ? 9   PHE F CZ  1 
ATOM   10491 N N   . ILE F  2 10  ? 64.795  14.021  26.247  1.00 14.63  ? 10  ILE F N   1 
ATOM   10492 C CA  . ILE F  2 10  ? 65.968  14.811  25.965  1.00 14.66  ? 10  ILE F CA  1 
ATOM   10493 C C   . ILE F  2 10  ? 65.867  15.997  26.918  1.00 16.03  ? 10  ILE F C   1 
ATOM   10494 O O   . ILE F  2 10  ? 65.250  17.009  26.603  1.00 15.85  ? 10  ILE F O   1 
ATOM   10495 C CB  . ILE F  2 10  ? 65.920  15.160  24.482  1.00 12.51  ? 10  ILE F CB  1 
ATOM   10496 C CG1 . ILE F  2 10  ? 66.226  13.878  23.736  1.00 11.76  ? 10  ILE F CG1 1 
ATOM   10497 C CG2 . ILE F  2 10  ? 66.888  16.256  24.116  1.00 11.92  ? 10  ILE F CG2 1 
ATOM   10498 C CD1 . ILE F  2 10  ? 66.109  13.969  22.231  1.00 11.98  ? 10  ILE F CD1 1 
ATOM   10499 N N   . GLU F  2 11  ? 66.411  15.780  28.113  1.00 17.82  ? 11  GLU F N   1 
ATOM   10500 C CA  . GLU F  2 11  ? 66.428  16.720  29.216  1.00 19.68  ? 11  GLU F CA  1 
ATOM   10501 C C   . GLU F  2 11  ? 66.473  18.199  28.853  1.00 19.27  ? 11  GLU F C   1 
ATOM   10502 O O   . GLU F  2 11  ? 65.594  18.968  29.236  1.00 19.42  ? 11  GLU F O   1 
ATOM   10503 C CB  . GLU F  2 11  ? 67.600  16.353  30.104  1.00 22.38  ? 11  GLU F CB  1 
ATOM   10504 C CG  . GLU F  2 11  ? 67.597  16.989  31.475  1.00 25.72  ? 11  GLU F CG  1 
ATOM   10505 C CD  . GLU F  2 11  ? 67.029  16.118  32.599  1.00 28.48  ? 11  GLU F CD  1 
ATOM   10506 O OE1 . GLU F  2 11  ? 65.891  15.608  32.520  1.00 29.30  ? 11  GLU F OE1 1 
ATOM   10507 O OE2 . GLU F  2 11  ? 67.753  15.915  33.592  1.00 30.48  ? 11  GLU F OE2 1 
ATOM   10508 N N   . ASN F  2 12  ? 67.420  18.649  28.045  1.00 18.63  ? 12  ASN F N   1 
ATOM   10509 C CA  . ASN F  2 12  ? 67.478  20.056  27.688  1.00 18.09  ? 12  ASN F CA  1 
ATOM   10510 C C   . ASN F  2 12  ? 68.140  20.208  26.363  1.00 17.12  ? 12  ASN F C   1 
ATOM   10511 O O   . ASN F  2 12  ? 68.455  19.223  25.701  1.00 18.03  ? 12  ASN F O   1 
ATOM   10512 C CB  . ASN F  2 12  ? 68.240  20.839  28.714  1.00 19.56  ? 12  ASN F CB  1 
ATOM   10513 C CG  . ASN F  2 12  ? 69.598  20.248  28.875  1.00 21.34  ? 12  ASN F CG  1 
ATOM   10514 O OD1 . ASN F  2 12  ? 69.742  19.172  29.468  1.00 22.66  ? 12  ASN F OD1 1 
ATOM   10515 N ND2 . ASN F  2 12  ? 70.582  20.887  28.273  1.00 22.16  ? 12  ASN F ND2 1 
ATOM   10516 N N   . GLY F  2 13  ? 68.293  21.430  25.936  1.00 16.18  ? 13  GLY F N   1 
ATOM   10517 C CA  . GLY F  2 13  ? 68.792  21.705  24.615  1.00 15.78  ? 13  GLY F CA  1 
ATOM   10518 C C   . GLY F  2 13  ? 70.252  22.006  24.698  1.00 15.31  ? 13  GLY F C   1 
ATOM   10519 O O   . GLY F  2 13  ? 70.789  22.069  25.781  1.00 15.32  ? 13  GLY F O   1 
ATOM   10520 N N   . TRP F  2 14  ? 70.913  22.202  23.585  1.00 16.17  ? 14  TRP F N   1 
ATOM   10521 C CA  . TRP F  2 14  ? 72.315  22.500  23.584  1.00 16.53  ? 14  TRP F CA  1 
ATOM   10522 C C   . TRP F  2 14  ? 72.442  23.919  23.085  1.00 18.37  ? 14  TRP F C   1 
ATOM   10523 O O   . TRP F  2 14  ? 72.160  24.162  21.910  1.00 17.68  ? 14  TRP F O   1 
ATOM   10524 C CB  . TRP F  2 14  ? 73.073  21.547  22.634  1.00 14.46  ? 14  TRP F CB  1 
ATOM   10525 C CG  . TRP F  2 14  ? 73.038  20.065  22.962  1.00 12.17  ? 14  TRP F CG  1 
ATOM   10526 C CD1 . TRP F  2 14  ? 72.818  19.636  24.234  1.00 11.54  ? 14  TRP F CD1 1 
ATOM   10527 C CD2 . TRP F  2 14  ? 73.182  19.033  22.068  1.00 11.83  ? 14  TRP F CD2 1 
ATOM   10528 N NE1 . TRP F  2 14  ? 72.802  18.336  24.144  1.00 11.87  ? 14  TRP F NE1 1 
ATOM   10529 C CE2 . TRP F  2 14  ? 73.015  17.931  22.882  1.00 11.18  ? 14  TRP F CE2 1 
ATOM   10530 C CE3 . TRP F  2 14  ? 73.420  18.841  20.726  1.00 12.35  ? 14  TRP F CE3 1 
ATOM   10531 C CZ2 . TRP F  2 14  ? 73.072  16.643  22.398  1.00 9.69   ? 14  TRP F CZ2 1 
ATOM   10532 C CZ3 . TRP F  2 14  ? 73.472  17.540  20.238  1.00 11.53  ? 14  TRP F CZ3 1 
ATOM   10533 C CH2 . TRP F  2 14  ? 73.307  16.453  21.068  1.00 9.75   ? 14  TRP F CH2 1 
ATOM   10534 N N   . GLU F  2 15  ? 72.860  24.860  23.929  1.00 21.62  ? 15  GLU F N   1 
ATOM   10535 C CA  . GLU F  2 15  ? 73.055  26.244  23.480  1.00 25.19  ? 15  GLU F CA  1 
ATOM   10536 C C   . GLU F  2 15  ? 74.226  26.302  22.527  1.00 25.63  ? 15  GLU F C   1 
ATOM   10537 O O   . GLU F  2 15  ? 74.369  27.194  21.700  1.00 26.33  ? 15  GLU F O   1 
ATOM   10538 C CB  . GLU F  2 15  ? 73.337  27.187  24.663  1.00 27.53  ? 15  GLU F CB  1 
ATOM   10539 C CG  . GLU F  2 15  ? 72.125  27.327  25.616  1.00 30.57  ? 15  GLU F CG  1 
ATOM   10540 C CD  . GLU F  2 15  ? 72.312  28.202  26.857  1.00 32.29  ? 15  GLU F CD  1 
ATOM   10541 O OE1 . GLU F  2 15  ? 72.775  29.347  26.726  1.00 32.63  ? 15  GLU F OE1 1 
ATOM   10542 O OE2 . GLU F  2 15  ? 71.962  27.725  27.955  1.00 33.58  ? 15  GLU F OE2 1 
ATOM   10543 N N   . GLY F  2 16  ? 75.082  25.288  22.635  1.00 26.30  ? 16  GLY F N   1 
ATOM   10544 C CA  . GLY F  2 16  ? 76.250  25.184  21.794  1.00 27.44  ? 16  GLY F CA  1 
ATOM   10545 C C   . GLY F  2 16  ? 75.981  24.780  20.356  1.00 27.96  ? 16  GLY F C   1 
ATOM   10546 O O   . GLY F  2 16  ? 76.852  24.943  19.503  1.00 29.12  ? 16  GLY F O   1 
ATOM   10547 N N   . MET F  2 17  ? 74.820  24.235  20.011  1.00 28.09  ? 17  MET F N   1 
ATOM   10548 C CA  . MET F  2 17  ? 74.677  23.757  18.656  1.00 27.96  ? 17  MET F CA  1 
ATOM   10549 C C   . MET F  2 17  ? 74.220  24.917  17.815  1.00 28.77  ? 17  MET F C   1 
ATOM   10550 O O   . MET F  2 17  ? 73.037  25.175  17.639  1.00 29.58  ? 17  MET F O   1 
ATOM   10551 C CB  . MET F  2 17  ? 73.696  22.627  18.640  1.00 27.10  ? 17  MET F CB  1 
ATOM   10552 C CG  . MET F  2 17  ? 73.650  22.137  17.234  1.00 26.92  ? 17  MET F CG  1 
ATOM   10553 S SD  . MET F  2 17  ? 72.756  20.592  17.269  1.00 26.58  ? 17  MET F SD  1 
ATOM   10554 C CE  . MET F  2 17  ? 74.152  19.550  17.198  1.00 27.51  ? 17  MET F CE  1 
ATOM   10555 N N   . ILE F  2 18  ? 75.180  25.656  17.301  1.00 30.00  ? 18  ILE F N   1 
ATOM   10556 C CA  . ILE F  2 18  ? 74.883  26.860  16.546  1.00 30.86  ? 18  ILE F CA  1 
ATOM   10557 C C   . ILE F  2 18  ? 74.664  26.614  15.062  1.00 31.35  ? 18  ILE F C   1 
ATOM   10558 O O   . ILE F  2 18  ? 74.394  27.569  14.340  1.00 32.43  ? 18  ILE F O   1 
ATOM   10559 C CB  . ILE F  2 18  ? 76.018  27.875  16.705  1.00 31.09  ? 18  ILE F CB  1 
ATOM   10560 C CG1 . ILE F  2 18  ? 77.306  27.267  16.165  1.00 32.17  ? 18  ILE F CG1 1 
ATOM   10561 C CG2 . ILE F  2 18  ? 76.154  28.266  18.171  1.00 31.04  ? 18  ILE F CG2 1 
ATOM   10562 C CD1 . ILE F  2 18  ? 78.384  28.302  15.841  1.00 32.95  ? 18  ILE F CD1 1 
ATOM   10563 N N   . ASP F  2 19  ? 74.757  25.382  14.573  1.00 31.14  ? 19  ASP F N   1 
ATOM   10564 C CA  . ASP F  2 19  ? 74.699  25.100  13.148  1.00 30.77  ? 19  ASP F CA  1 
ATOM   10565 C C   . ASP F  2 19  ? 73.503  24.286  12.658  1.00 29.26  ? 19  ASP F C   1 
ATOM   10566 O O   . ASP F  2 19  ? 73.452  23.875  11.490  1.00 29.99  ? 19  ASP F O   1 
ATOM   10567 C CB  . ASP F  2 19  ? 75.991  24.402  12.770  1.00 33.29  ? 19  ASP F CB  1 
ATOM   10568 C CG  . ASP F  2 19  ? 76.244  23.088  13.499  1.00 35.80  ? 19  ASP F CG  1 
ATOM   10569 O OD1 . ASP F  2 19  ? 76.636  22.121  12.837  1.00 36.40  ? 19  ASP F OD1 1 
ATOM   10570 O OD2 . ASP F  2 19  ? 76.060  23.025  14.733  1.00 37.80  ? 19  ASP F OD2 1 
ATOM   10571 N N   . GLY F  2 20  ? 72.484  24.050  13.482  1.00 26.52  ? 20  GLY F N   1 
ATOM   10572 C CA  . GLY F  2 20  ? 71.294  23.337  13.046  1.00 23.51  ? 20  GLY F CA  1 
ATOM   10573 C C   . GLY F  2 20  ? 70.297  23.282  14.184  1.00 21.28  ? 20  GLY F C   1 
ATOM   10574 O O   . GLY F  2 20  ? 70.571  23.793  15.276  1.00 22.53  ? 20  GLY F O   1 
ATOM   10575 N N   . TRP F  2 21  ? 69.117  22.707  13.986  1.00 17.79  ? 21  TRP F N   1 
ATOM   10576 C CA  . TRP F  2 21  ? 68.161  22.682  15.071  1.00 15.06  ? 21  TRP F CA  1 
ATOM   10577 C C   . TRP F  2 21  ? 68.211  21.376  15.824  1.00 13.79  ? 21  TRP F C   1 
ATOM   10578 O O   . TRP F  2 21  ? 67.919  21.357  17.027  1.00 13.55  ? 21  TRP F O   1 
ATOM   10579 C CB  . TRP F  2 21  ? 66.739  22.863  14.593  1.00 14.28  ? 21  TRP F CB  1 
ATOM   10580 C CG  . TRP F  2 21  ? 66.381  24.229  14.039  1.00 13.92  ? 21  TRP F CG  1 
ATOM   10581 C CD1 . TRP F  2 21  ? 67.312  25.195  13.773  1.00 13.84  ? 21  TRP F CD1 1 
ATOM   10582 C CD2 . TRP F  2 21  ? 65.110  24.648  13.771  1.00 13.46  ? 21  TRP F CD2 1 
ATOM   10583 N NE1 . TRP F  2 21  ? 66.621  26.215  13.350  1.00 13.63  ? 21  TRP F NE1 1 
ATOM   10584 C CE2 . TRP F  2 21  ? 65.321  25.930  13.343  1.00 13.18  ? 21  TRP F CE2 1 
ATOM   10585 C CE3 . TRP F  2 21  ? 63.845  24.139  13.842  1.00 13.70  ? 21  TRP F CE3 1 
ATOM   10586 C CZ2 . TRP F  2 21  ? 64.284  26.733  12.973  1.00 13.24  ? 21  TRP F CZ2 1 
ATOM   10587 C CZ3 . TRP F  2 21  ? 62.789  24.940  13.470  1.00 13.59  ? 21  TRP F CZ3 1 
ATOM   10588 C CH2 . TRP F  2 21  ? 63.007  26.224  13.046  1.00 13.62  ? 21  TRP F CH2 1 
ATOM   10589 N N   . TYR F  2 22  ? 68.563  20.296  15.143  1.00 11.03  ? 22  TYR F N   1 
ATOM   10590 C CA  . TYR F  2 22  ? 68.618  18.989  15.767  1.00 9.11   ? 22  TYR F CA  1 
ATOM   10591 C C   . TYR F  2 22  ? 69.993  18.459  15.432  1.00 9.31   ? 22  TYR F C   1 
ATOM   10592 O O   . TYR F  2 22  ? 70.607  18.936  14.468  1.00 8.72   ? 22  TYR F O   1 
ATOM   10593 C CB  . TYR F  2 22  ? 67.544  18.069  15.185  1.00 7.76   ? 22  TYR F CB  1 
ATOM   10594 C CG  . TYR F  2 22  ? 66.127  18.660  15.188  1.00 6.48   ? 22  TYR F CG  1 
ATOM   10595 C CD1 . TYR F  2 22  ? 65.371  18.653  16.345  1.00 5.45   ? 22  TYR F CD1 1 
ATOM   10596 C CD2 . TYR F  2 22  ? 65.611  19.214  14.025  1.00 5.30   ? 22  TYR F CD2 1 
ATOM   10597 C CE1 . TYR F  2 22  ? 64.109  19.197  16.345  1.00 4.61   ? 22  TYR F CE1 1 
ATOM   10598 C CE2 . TYR F  2 22  ? 64.354  19.759  14.024  1.00 4.22   ? 22  TYR F CE2 1 
ATOM   10599 C CZ  . TYR F  2 22  ? 63.620  19.746  15.184  1.00 4.10   ? 22  TYR F CZ  1 
ATOM   10600 O OH  . TYR F  2 22  ? 62.379  20.324  15.179  1.00 3.72   ? 22  TYR F OH  1 
ATOM   10601 N N   . GLY F  2 23  ? 70.553  17.536  16.199  1.00 10.13  ? 23  GLY F N   1 
ATOM   10602 C CA  . GLY F  2 23  ? 71.873  17.028  15.868  1.00 10.16  ? 23  GLY F CA  1 
ATOM   10603 C C   . GLY F  2 23  ? 72.371  15.951  16.807  1.00 10.76  ? 23  GLY F C   1 
ATOM   10604 O O   . GLY F  2 23  ? 71.642  15.449  17.681  1.00 10.31  ? 23  GLY F O   1 
ATOM   10605 N N   . PHE F  2 24  ? 73.650  15.625  16.609  1.00 11.29  ? 24  PHE F N   1 
ATOM   10606 C CA  . PHE F  2 24  ? 74.316  14.519  17.281  1.00 10.79  ? 24  PHE F CA  1 
ATOM   10607 C C   . PHE F  2 24  ? 75.542  14.949  18.039  1.00 12.35  ? 24  PHE F C   1 
ATOM   10608 O O   . PHE F  2 24  ? 76.256  15.846  17.584  1.00 13.20  ? 24  PHE F O   1 
ATOM   10609 C CB  . PHE F  2 24  ? 74.814  13.492  16.326  1.00 8.75   ? 24  PHE F CB  1 
ATOM   10610 C CG  . PHE F  2 24  ? 73.759  12.898  15.432  1.00 8.13   ? 24  PHE F CG  1 
ATOM   10611 C CD1 . PHE F  2 24  ? 73.554  13.453  14.193  1.00 7.74   ? 24  PHE F CD1 1 
ATOM   10612 C CD2 . PHE F  2 24  ? 73.045  11.797  15.857  1.00 7.71   ? 24  PHE F CD2 1 
ATOM   10613 C CE1 . PHE F  2 24  ? 72.612  12.896  13.365  1.00 7.70   ? 24  PHE F CE1 1 
ATOM   10614 C CE2 . PHE F  2 24  ? 72.108  11.250  15.022  1.00 7.39   ? 24  PHE F CE2 1 
ATOM   10615 C CZ  . PHE F  2 24  ? 71.900  11.798  13.777  1.00 7.79   ? 24  PHE F CZ  1 
ATOM   10616 N N   . ARG F  2 25  ? 75.856  14.228  19.128  1.00 13.83  ? 25  ARG F N   1 
ATOM   10617 C CA  . ARG F  2 25  ? 77.024  14.404  19.990  1.00 13.85  ? 25  ARG F CA  1 
ATOM   10618 C C   . ARG F  2 25  ? 77.495  13.013  20.295  1.00 15.34  ? 25  ARG F C   1 
ATOM   10619 O O   . ARG F  2 25  ? 76.664  12.158  20.576  1.00 15.09  ? 25  ARG F O   1 
ATOM   10620 C CB  . ARG F  2 25  ? 76.684  15.013  21.289  1.00 13.61  ? 25  ARG F CB  1 
ATOM   10621 C CG  . ARG F  2 25  ? 77.084  16.454  21.286  1.00 15.68  ? 25  ARG F CG  1 
ATOM   10622 C CD  . ARG F  2 25  ? 76.735  17.150  22.604  1.00 16.49  ? 25  ARG F CD  1 
ATOM   10623 N NE  . ARG F  2 25  ? 76.826  18.599  22.443  1.00 16.20  ? 25  ARG F NE  1 
ATOM   10624 C CZ  . ARG F  2 25  ? 76.586  19.442  23.452  1.00 16.47  ? 25  ARG F CZ  1 
ATOM   10625 N NH1 . ARG F  2 25  ? 76.670  20.739  23.200  1.00 16.68  ? 25  ARG F NH1 1 
ATOM   10626 N NH2 . ARG F  2 25  ? 76.282  19.022  24.692  1.00 17.23  ? 25  ARG F NH2 1 
ATOM   10627 N N   . HIS F  2 26  ? 78.785  12.726  20.266  1.00 18.22  ? 26  HIS F N   1 
ATOM   10628 C CA  . HIS F  2 26  ? 79.254  11.352  20.484  1.00 19.79  ? 26  HIS F CA  1 
ATOM   10629 C C   . HIS F  2 26  ? 80.533  11.305  21.329  1.00 20.58  ? 26  HIS F C   1 
ATOM   10630 O O   . HIS F  2 26  ? 81.373  12.218  21.250  1.00 20.78  ? 26  HIS F O   1 
ATOM   10631 C CB  . HIS F  2 26  ? 79.552  10.661  19.144  1.00 20.17  ? 26  HIS F CB  1 
ATOM   10632 C CG  . HIS F  2 26  ? 80.848  11.179  18.558  1.00 20.35  ? 26  HIS F CG  1 
ATOM   10633 N ND1 . HIS F  2 26  ? 80.973  12.393  18.048  1.00 20.38  ? 26  HIS F ND1 1 
ATOM   10634 C CD2 . HIS F  2 26  ? 82.075  10.586  18.564  1.00 20.92  ? 26  HIS F CD2 1 
ATOM   10635 C CE1 . HIS F  2 26  ? 82.247  12.536  17.763  1.00 20.97  ? 26  HIS F CE1 1 
ATOM   10636 N NE2 . HIS F  2 26  ? 82.911  11.459  18.071  1.00 20.91  ? 26  HIS F NE2 1 
ATOM   10637 N N   . GLN F  2 27  ? 80.747  10.202  22.015  1.00 20.11  ? 27  GLN F N   1 
ATOM   10638 C CA  . GLN F  2 27  ? 81.977  9.990   22.740  1.00 19.72  ? 27  GLN F CA  1 
ATOM   10639 C C   . GLN F  2 27  ? 82.358  8.645   22.187  1.00 20.63  ? 27  GLN F C   1 
ATOM   10640 O O   . GLN F  2 27  ? 81.521  7.740   22.215  1.00 20.55  ? 27  GLN F O   1 
ATOM   10641 C CB  . GLN F  2 27  ? 81.714  9.892   24.243  1.00 19.69  ? 27  GLN F CB  1 
ATOM   10642 C CG  . GLN F  2 27  ? 82.975  9.861   25.101  1.00 20.41  ? 27  GLN F CG  1 
ATOM   10643 C CD  . GLN F  2 27  ? 82.833  10.324  26.557  1.00 21.36  ? 27  GLN F CD  1 
ATOM   10644 O OE1 . GLN F  2 27  ? 83.010  9.512   27.458  1.00 21.94  ? 27  GLN F OE1 1 
ATOM   10645 N NE2 . GLN F  2 27  ? 82.660  11.593  26.944  1.00 21.04  ? 27  GLN F NE2 1 
ATOM   10646 N N   . ASN F  2 28  ? 83.517  8.496   21.572  1.00 21.84  ? 28  ASN F N   1 
ATOM   10647 C CA  . ASN F  2 28  ? 83.970  7.177   21.164  1.00 22.73  ? 28  ASN F CA  1 
ATOM   10648 C C   . ASN F  2 28  ? 85.429  7.034   21.564  1.00 24.94  ? 28  ASN F C   1 
ATOM   10649 O O   . ASN F  2 28  ? 86.053  7.924   22.147  1.00 24.39  ? 28  ASN F O   1 
ATOM   10650 C CB  . ASN F  2 28  ? 83.842  6.965   19.653  1.00 20.90  ? 28  ASN F CB  1 
ATOM   10651 C CG  . ASN F  2 28  ? 84.614  7.928   18.777  1.00 19.99  ? 28  ASN F CG  1 
ATOM   10652 O OD1 . ASN F  2 28  ? 85.378  8.757   19.246  1.00 20.09  ? 28  ASN F OD1 1 
ATOM   10653 N ND2 . ASN F  2 28  ? 84.436  7.903   17.479  1.00 20.08  ? 28  ASN F ND2 1 
ATOM   10654 N N   . SER F  2 29  ? 86.019  5.921   21.186  1.00 28.50  ? 29  SER F N   1 
ATOM   10655 C CA  . SER F  2 29  ? 87.391  5.539   21.520  1.00 31.06  ? 29  SER F CA  1 
ATOM   10656 C C   . SER F  2 29  ? 88.491  6.432   20.944  1.00 31.22  ? 29  SER F C   1 
ATOM   10657 O O   . SER F  2 29  ? 89.668  6.238   21.222  1.00 30.72  ? 29  SER F O   1 
ATOM   10658 C CB  . SER F  2 29  ? 87.514  4.081   21.051  1.00 32.73  ? 29  SER F CB  1 
ATOM   10659 O OG  . SER F  2 29  ? 86.220  3.426   21.046  1.00 35.12  ? 29  SER F OG  1 
ATOM   10660 N N   . GLU F  2 30  ? 88.110  7.436   20.165  1.00 32.48  ? 30  GLU F N   1 
ATOM   10661 C CA  . GLU F  2 30  ? 89.028  8.291   19.450  1.00 33.42  ? 30  GLU F CA  1 
ATOM   10662 C C   . GLU F  2 30  ? 88.888  9.712   20.006  1.00 33.61  ? 30  GLU F C   1 
ATOM   10663 O O   . GLU F  2 30  ? 89.908  10.406  20.181  1.00 34.64  ? 30  GLU F O   1 
ATOM   10664 C CB  . GLU F  2 30  ? 88.622  8.121   18.002  1.00 33.85  ? 30  GLU F CB  1 
ATOM   10665 C CG  . GLU F  2 30  ? 89.415  8.653   16.851  1.00 35.41  ? 30  GLU F CG  1 
ATOM   10666 C CD  . GLU F  2 30  ? 88.901  8.027   15.560  1.00 37.16  ? 30  GLU F CD  1 
ATOM   10667 O OE1 . GLU F  2 30  ? 88.256  8.707   14.762  1.00 37.45  ? 30  GLU F OE1 1 
ATOM   10668 O OE2 . GLU F  2 30  ? 89.103  6.828   15.326  1.00 38.59  ? 30  GLU F OE2 1 
ATOM   10669 N N   . GLY F  2 31  ? 87.655  10.135  20.356  1.00 32.04  ? 31  GLY F N   1 
ATOM   10670 C CA  . GLY F  2 31  ? 87.439  11.445  20.934  1.00 29.13  ? 31  GLY F CA  1 
ATOM   10671 C C   . GLY F  2 31  ? 85.966  11.704  21.146  1.00 27.25  ? 31  GLY F C   1 
ATOM   10672 O O   . GLY F  2 31  ? 85.137  10.813  21.328  1.00 26.97  ? 31  GLY F O   1 
ATOM   10673 N N   . THR F  2 32  ? 85.616  12.968  21.097  1.00 26.04  ? 32  THR F N   1 
ATOM   10674 C CA  . THR F  2 32  ? 84.257  13.416  21.280  1.00 24.90  ? 32  THR F CA  1 
ATOM   10675 C C   . THR F  2 32  ? 83.969  14.395  20.167  1.00 24.42  ? 32  THR F C   1 
ATOM   10676 O O   . THR F  2 32  ? 84.827  14.574  19.296  1.00 23.88  ? 32  THR F O   1 
ATOM   10677 C CB  . THR F  2 32  ? 84.116  14.083  22.645  1.00 24.51  ? 32  THR F CB  1 
ATOM   10678 O OG1 . THR F  2 32  ? 85.315  14.833  22.821  1.00 24.87  ? 32  THR F OG1 1 
ATOM   10679 C CG2 . THR F  2 32  ? 83.894  13.122  23.778  1.00 24.38  ? 32  THR F CG2 1 
ATOM   10680 N N   . GLY F  2 33  ? 82.780  15.000  20.111  1.00 24.01  ? 33  GLY F N   1 
ATOM   10681 C CA  . GLY F  2 33  ? 82.452  15.926  19.040  1.00 23.12  ? 33  GLY F CA  1 
ATOM   10682 C C   . GLY F  2 33  ? 80.955  15.943  18.810  1.00 22.87  ? 33  GLY F C   1 
ATOM   10683 O O   . GLY F  2 33  ? 80.219  15.024  19.177  1.00 23.35  ? 33  GLY F O   1 
ATOM   10684 N N   . GLN F  2 34  ? 80.502  16.926  18.088  1.00 22.98  ? 34  GLN F N   1 
ATOM   10685 C CA  . GLN F  2 34  ? 79.102  17.221  17.899  1.00 23.56  ? 34  GLN F CA  1 
ATOM   10686 C C   . GLN F  2 34  ? 78.919  17.510  16.412  1.00 24.79  ? 34  GLN F C   1 
ATOM   10687 O O   . GLN F  2 34  ? 79.917  17.796  15.746  1.00 25.76  ? 34  GLN F O   1 
ATOM   10688 C CB  . GLN F  2 34  ? 78.791  18.433  18.735  1.00 23.38  ? 34  GLN F CB  1 
ATOM   10689 C CG  . GLN F  2 34  ? 77.398  18.976  18.696  1.00 23.75  ? 34  GLN F CG  1 
ATOM   10690 C CD  . GLN F  2 34  ? 77.318  20.366  19.286  1.00 24.72  ? 34  GLN F CD  1 
ATOM   10691 O OE1 . GLN F  2 34  ? 77.191  20.546  20.502  1.00 24.46  ? 34  GLN F OE1 1 
ATOM   10692 N NE2 . GLN F  2 34  ? 77.362  21.383  18.426  1.00 25.66  ? 34  GLN F NE2 1 
ATOM   10693 N N   . ALA F  2 35  ? 77.710  17.447  15.845  1.00 24.77  ? 35  ALA F N   1 
ATOM   10694 C CA  . ALA F  2 35  ? 77.467  17.770  14.446  1.00 23.75  ? 35  ALA F CA  1 
ATOM   10695 C C   . ALA F  2 35  ? 75.963  17.954  14.250  1.00 23.57  ? 35  ALA F C   1 
ATOM   10696 O O   . ALA F  2 35  ? 75.219  17.099  14.749  1.00 23.16  ? 35  ALA F O   1 
ATOM   10697 C CB  . ALA F  2 35  ? 77.939  16.626  13.602  1.00 22.86  ? 35  ALA F CB  1 
ATOM   10698 N N   . ALA F  2 36  ? 75.456  19.025  13.626  1.00 23.20  ? 36  ALA F N   1 
ATOM   10699 C CA  . ALA F  2 36  ? 74.011  19.171  13.466  1.00 22.83  ? 36  ALA F CA  1 
ATOM   10700 C C   . ALA F  2 36  ? 73.466  18.323  12.335  1.00 22.79  ? 36  ALA F C   1 
ATOM   10701 O O   . ALA F  2 36  ? 74.215  17.997  11.405  1.00 22.90  ? 36  ALA F O   1 
ATOM   10702 C CB  . ALA F  2 36  ? 73.623  20.596  13.158  1.00 22.80  ? 36  ALA F CB  1 
ATOM   10703 N N   . ASP F  2 37  ? 72.193  17.914  12.413  1.00 22.12  ? 37  ASP F N   1 
ATOM   10704 C CA  . ASP F  2 37  ? 71.586  17.154  11.336  1.00 21.66  ? 37  ASP F CA  1 
ATOM   10705 C C   . ASP F  2 37  ? 70.828  18.091  10.422  1.00 21.02  ? 37  ASP F C   1 
ATOM   10706 O O   . ASP F  2 37  ? 69.847  18.733  10.805  1.00 20.45  ? 37  ASP F O   1 
ATOM   10707 C CB  . ASP F  2 37  ? 70.620  16.093  11.857  1.00 22.69  ? 37  ASP F CB  1 
ATOM   10708 C CG  . ASP F  2 37  ? 69.854  15.394  10.729  1.00 24.49  ? 37  ASP F CG  1 
ATOM   10709 O OD1 . ASP F  2 37  ? 70.435  15.014  9.712   1.00 25.83  ? 37  ASP F OD1 1 
ATOM   10710 O OD2 . ASP F  2 37  ? 68.632  15.283  10.803  1.00 25.26  ? 37  ASP F OD2 1 
ATOM   10711 N N   . LEU F  2 38  ? 71.239  18.178  9.164   1.00 21.13  ? 38  LEU F N   1 
ATOM   10712 C CA  . LEU F  2 38  ? 70.572  19.122  8.308   1.00 21.62  ? 38  LEU F CA  1 
ATOM   10713 C C   . LEU F  2 38  ? 69.266  18.662  7.739   1.00 21.59  ? 38  LEU F C   1 
ATOM   10714 O O   . LEU F  2 38  ? 68.448  19.521  7.412   1.00 22.60  ? 38  LEU F O   1 
ATOM   10715 C CB  . LEU F  2 38  ? 71.444  19.560  7.148   1.00 22.80  ? 38  LEU F CB  1 
ATOM   10716 C CG  . LEU F  2 38  ? 72.451  20.682  7.440   1.00 23.77  ? 38  LEU F CG  1 
ATOM   10717 C CD1 . LEU F  2 38  ? 72.060  21.515  8.676   1.00 24.31  ? 38  LEU F CD1 1 
ATOM   10718 C CD2 . LEU F  2 38  ? 73.787  20.048  7.734   1.00 24.88  ? 38  LEU F CD2 1 
ATOM   10719 N N   . LYS F  2 39  ? 68.988  17.365  7.652   1.00 21.20  ? 39  LYS F N   1 
ATOM   10720 C CA  . LYS F  2 39  ? 67.723  16.955  7.077   1.00 20.29  ? 39  LYS F CA  1 
ATOM   10721 C C   . LYS F  2 39  ? 66.564  17.226  8.007   1.00 17.89  ? 39  LYS F C   1 
ATOM   10722 O O   . LYS F  2 39  ? 65.539  17.730  7.534   1.00 18.29  ? 39  LYS F O   1 
ATOM   10723 C CB  . LYS F  2 39  ? 67.720  15.489  6.742   1.00 23.86  ? 39  LYS F CB  1 
ATOM   10724 C CG  . LYS F  2 39  ? 68.373  15.150  5.402   1.00 27.59  ? 39  LYS F CG  1 
ATOM   10725 C CD  . LYS F  2 39  ? 67.848  13.789  4.923   1.00 30.68  ? 39  LYS F CD  1 
ATOM   10726 C CE  . LYS F  2 39  ? 66.318  13.885  4.661   1.00 33.31  ? 39  LYS F CE  1 
ATOM   10727 N NZ  . LYS F  2 39  ? 65.713  12.627  4.237   1.00 35.70  ? 39  LYS F NZ  1 
ATOM   10728 N N   . SER F  2 40  ? 66.669  16.948  9.310   1.00 14.59  ? 40  SER F N   1 
ATOM   10729 C CA  . SER F  2 40  ? 65.554  17.244  10.170  1.00 12.57  ? 40  SER F CA  1 
ATOM   10730 C C   . SER F  2 40  ? 65.482  18.746  10.404  1.00 11.65  ? 40  SER F C   1 
ATOM   10731 O O   . SER F  2 40  ? 64.393  19.321  10.506  1.00 12.17  ? 40  SER F O   1 
ATOM   10732 C CB  . SER F  2 40  ? 65.685  16.524  11.483  1.00 11.86  ? 40  SER F CB  1 
ATOM   10733 O OG  . SER F  2 40  ? 66.846  16.978  12.127  1.00 11.10  ? 40  SER F OG  1 
ATOM   10734 N N   . THR F  2 41  ? 66.612  19.439  10.462  1.00 10.52  ? 41  THR F N   1 
ATOM   10735 C CA  . THR F  2 41  ? 66.547  20.879  10.547  1.00 10.21  ? 41  THR F CA  1 
ATOM   10736 C C   . THR F  2 41  ? 65.785  21.523  9.386   1.00 11.01  ? 41  THR F C   1 
ATOM   10737 O O   . THR F  2 41  ? 64.952  22.410  9.621   1.00 11.62  ? 41  THR F O   1 
ATOM   10738 C CB  . THR F  2 41  ? 67.956  21.398  10.658  1.00 8.75   ? 41  THR F CB  1 
ATOM   10739 O OG1 . THR F  2 41  ? 68.456  20.873  11.884  1.00 8.72   ? 41  THR F OG1 1 
ATOM   10740 C CG2 . THR F  2 41  ? 68.030  22.896  10.752  1.00 9.26   ? 41  THR F CG2 1 
ATOM   10741 N N   . GLN F  2 42  ? 65.961  21.051  8.148   1.00 11.99  ? 42  GLN F N   1 
ATOM   10742 C CA  . GLN F  2 42  ? 65.175  21.593  7.055   1.00 13.44  ? 42  GLN F CA  1 
ATOM   10743 C C   . GLN F  2 42  ? 63.712  21.227  7.202   1.00 12.74  ? 42  GLN F C   1 
ATOM   10744 O O   . GLN F  2 42  ? 62.868  22.119  7.181   1.00 12.91  ? 42  GLN F O   1 
ATOM   10745 C CB  . GLN F  2 42  ? 65.659  21.105  5.694   1.00 15.70  ? 42  GLN F CB  1 
ATOM   10746 C CG  . GLN F  2 42  ? 66.573  22.066  4.958   1.00 19.21  ? 42  GLN F CG  1 
ATOM   10747 C CD  . GLN F  2 42  ? 66.075  23.521  4.994   1.00 22.82  ? 42  GLN F CD  1 
ATOM   10748 O OE1 . GLN F  2 42  ? 66.810  24.413  5.447   1.00 25.21  ? 42  GLN F OE1 1 
ATOM   10749 N NE2 . GLN F  2 42  ? 64.856  23.866  4.571   1.00 23.36  ? 42  GLN F NE2 1 
ATOM   10750 N N   . ALA F  2 43  ? 63.392  19.962  7.460   1.00 11.85  ? 43  ALA F N   1 
ATOM   10751 C CA  . ALA F  2 43  ? 62.014  19.560  7.687   1.00 12.14  ? 43  ALA F CA  1 
ATOM   10752 C C   . ALA F  2 43  ? 61.280  20.462  8.672   1.00 12.03  ? 43  ALA F C   1 
ATOM   10753 O O   . ALA F  2 43  ? 60.190  20.954  8.364   1.00 12.72  ? 43  ALA F O   1 
ATOM   10754 C CB  . ALA F  2 43  ? 61.927  18.179  8.269   1.00 12.37  ? 43  ALA F CB  1 
ATOM   10755 N N   . ALA F  2 44  ? 61.874  20.723  9.840   1.00 10.81  ? 44  ALA F N   1 
ATOM   10756 C CA  . ALA F  2 44  ? 61.286  21.631  10.796  1.00 10.04  ? 44  ALA F CA  1 
ATOM   10757 C C   . ALA F  2 44  ? 61.088  23.013  10.199  1.00 10.01  ? 44  ALA F C   1 
ATOM   10758 O O   . ALA F  2 44  ? 59.972  23.548  10.271  1.00 10.87  ? 44  ALA F O   1 
ATOM   10759 C CB  . ALA F  2 44  ? 62.165  21.772  12.003  1.00 9.04   ? 44  ALA F CB  1 
ATOM   10760 N N   . ILE F  2 45  ? 62.123  23.546  9.542   1.00 9.25   ? 45  ILE F N   1 
ATOM   10761 C CA  . ILE F  2 45  ? 62.098  24.891  8.969   1.00 9.07   ? 45  ILE F CA  1 
ATOM   10762 C C   . ILE F  2 45  ? 61.077  25.081  7.863   1.00 10.76  ? 45  ILE F C   1 
ATOM   10763 O O   . ILE F  2 45  ? 60.319  26.055  7.923   1.00 11.64  ? 45  ILE F O   1 
ATOM   10764 C CB  . ILE F  2 45  ? 63.521  25.197  8.489   1.00 7.14   ? 45  ILE F CB  1 
ATOM   10765 C CG1 . ILE F  2 45  ? 64.166  25.860  9.612   1.00 6.60   ? 45  ILE F CG1 1 
ATOM   10766 C CG2 . ILE F  2 45  ? 63.620  26.086  7.309   1.00 7.62   ? 45  ILE F CG2 1 
ATOM   10767 C CD1 . ILE F  2 45  ? 65.653  25.667  9.466   1.00 6.54   ? 45  ILE F CD1 1 
ATOM   10768 N N   . ASP F  2 46  ? 60.991  24.161  6.908   1.00 12.25  ? 46  ASP F N   1 
ATOM   10769 C CA  . ASP F  2 46  ? 60.088  24.313  5.797   1.00 13.97  ? 46  ASP F CA  1 
ATOM   10770 C C   . ASP F  2 46  ? 58.643  24.302  6.247   1.00 13.56  ? 46  ASP F C   1 
ATOM   10771 O O   . ASP F  2 46  ? 57.860  25.169  5.849   1.00 14.70  ? 46  ASP F O   1 
ATOM   10772 C CB  . ASP F  2 46  ? 60.327  23.212  4.779   1.00 16.47  ? 46  ASP F CB  1 
ATOM   10773 C CG  . ASP F  2 46  ? 61.695  23.277  4.110   1.00 18.60  ? 46  ASP F CG  1 
ATOM   10774 O OD1 . ASP F  2 46  ? 62.202  24.365  3.835   1.00 20.06  ? 46  ASP F OD1 1 
ATOM   10775 O OD2 . ASP F  2 46  ? 62.291  22.225  3.871   1.00 20.23  ? 46  ASP F OD2 1 
ATOM   10776 N N   . GLN F  2 47  ? 58.249  23.400  7.143   1.00 12.27  ? 47  GLN F N   1 
ATOM   10777 C CA  . GLN F  2 47  ? 56.891  23.423  7.694   1.00 11.05  ? 47  GLN F CA  1 
ATOM   10778 C C   . GLN F  2 47  ? 56.609  24.771  8.381   1.00 10.18  ? 47  GLN F C   1 
ATOM   10779 O O   . GLN F  2 47  ? 55.548  25.385  8.157   1.00 9.39   ? 47  GLN F O   1 
ATOM   10780 C CB  . GLN F  2 47  ? 56.698  22.339  8.727   1.00 11.20  ? 47  GLN F CB  1 
ATOM   10781 C CG  . GLN F  2 47  ? 56.844  21.001  8.078   1.00 12.14  ? 47  GLN F CG  1 
ATOM   10782 C CD  . GLN F  2 47  ? 56.853  19.876  9.077   1.00 13.12  ? 47  GLN F CD  1 
ATOM   10783 O OE1 . GLN F  2 47  ? 55.799  19.355  9.434   1.00 15.44  ? 47  GLN F OE1 1 
ATOM   10784 N NE2 . GLN F  2 47  ? 58.008  19.455  9.553   1.00 12.97  ? 47  GLN F NE2 1 
ATOM   10785 N N   . ILE F  2 48  ? 57.567  25.277  9.190   1.00 8.24   ? 48  ILE F N   1 
ATOM   10786 C CA  . ILE F  2 48  ? 57.348  26.531  9.848   1.00 6.27   ? 48  ILE F CA  1 
ATOM   10787 C C   . ILE F  2 48  ? 57.252  27.615  8.807   1.00 6.95   ? 48  ILE F C   1 
ATOM   10788 O O   . ILE F  2 48  ? 56.400  28.496  8.937   1.00 8.67   ? 48  ILE F O   1 
ATOM   10789 C CB  . ILE F  2 48  ? 58.458  26.815  10.854  1.00 4.97   ? 48  ILE F CB  1 
ATOM   10790 C CG1 . ILE F  2 48  ? 58.259  25.878  11.994  1.00 4.26   ? 48  ILE F CG1 1 
ATOM   10791 C CG2 . ILE F  2 48  ? 58.378  28.216  11.450  1.00 5.29   ? 48  ILE F CG2 1 
ATOM   10792 C CD1 . ILE F  2 48  ? 59.388  25.998  13.019  1.00 5.29   ? 48  ILE F CD1 1 
ATOM   10793 N N   . ASN F  2 49  ? 57.986  27.553  7.712   1.00 7.28   ? 49  ASN F N   1 
ATOM   10794 C CA  . ASN F  2 49  ? 57.857  28.600  6.708   1.00 9.29   ? 49  ASN F CA  1 
ATOM   10795 C C   . ASN F  2 49  ? 56.540  28.515  5.980   1.00 8.70   ? 49  ASN F C   1 
ATOM   10796 O O   . ASN F  2 49  ? 55.905  29.537  5.705   1.00 7.33   ? 49  ASN F O   1 
ATOM   10797 C CB  . ASN F  2 49  ? 58.937  28.538  5.666   1.00 11.94  ? 49  ASN F CB  1 
ATOM   10798 C CG  . ASN F  2 49  ? 60.265  29.025  6.207   1.00 14.99  ? 49  ASN F CG  1 
ATOM   10799 O OD1 . ASN F  2 49  ? 61.311  28.500  5.816   1.00 16.63  ? 49  ASN F OD1 1 
ATOM   10800 N ND2 . ASN F  2 49  ? 60.340  30.021  7.100   1.00 16.32  ? 49  ASN F ND2 1 
ATOM   10801 N N   . GLY F  2 50  ? 56.071  27.293  5.784   1.00 8.22   ? 50  GLY F N   1 
ATOM   10802 C CA  . GLY F  2 50  ? 54.831  27.058  5.076   1.00 8.20   ? 50  GLY F CA  1 
ATOM   10803 C C   . GLY F  2 50  ? 53.668  27.712  5.791   1.00 7.98   ? 50  GLY F C   1 
ATOM   10804 O O   . GLY F  2 50  ? 52.929  28.522  5.213   1.00 7.50   ? 50  GLY F O   1 
ATOM   10805 N N   . LYS F  2 51  ? 53.545  27.410  7.092   1.00 7.88   ? 51  LYS F N   1 
ATOM   10806 C CA  . LYS F  2 51  ? 52.466  28.004  7.839   1.00 7.02   ? 51  LYS F CA  1 
ATOM   10807 C C   . LYS F  2 51  ? 52.692  29.485  7.900   1.00 7.51   ? 51  LYS F C   1 
ATOM   10808 O O   . LYS F  2 51  ? 51.769  30.253  7.650   1.00 7.69   ? 51  LYS F O   1 
ATOM   10809 C CB  . LYS F  2 51  ? 52.366  27.452  9.245   1.00 4.61   ? 51  LYS F CB  1 
ATOM   10810 C CG  . LYS F  2 51  ? 53.548  27.514  10.127  1.00 2.00   ? 51  LYS F CG  1 
ATOM   10811 C CD  . LYS F  2 51  ? 53.045  27.210  11.503  1.00 2.00   ? 51  LYS F CD  1 
ATOM   10812 C CE  . LYS F  2 51  ? 52.691  25.741  11.699  1.00 2.09   ? 51  LYS F CE  1 
ATOM   10813 N NZ  . LYS F  2 51  ? 52.057  25.586  12.985  1.00 2.06   ? 51  LYS F NZ  1 
ATOM   10814 N N   . LEU F  2 52  ? 53.931  29.903  8.052   1.00 9.16   ? 52  LEU F N   1 
ATOM   10815 C CA  . LEU F  2 52  ? 54.185  31.313  8.138   1.00 12.59  ? 52  LEU F CA  1 
ATOM   10816 C C   . LEU F  2 52  ? 53.782  32.024  6.852   1.00 14.82  ? 52  LEU F C   1 
ATOM   10817 O O   . LEU F  2 52  ? 53.173  33.094  6.898   1.00 15.73  ? 52  LEU F O   1 
ATOM   10818 C CB  . LEU F  2 52  ? 55.642  31.525  8.434   1.00 12.10  ? 52  LEU F CB  1 
ATOM   10819 C CG  . LEU F  2 52  ? 56.183  32.914  8.637   1.00 11.58  ? 52  LEU F CG  1 
ATOM   10820 C CD1 . LEU F  2 52  ? 55.427  33.712  9.684   1.00 11.00  ? 52  LEU F CD1 1 
ATOM   10821 C CD2 . LEU F  2 52  ? 57.615  32.709  9.054   1.00 11.65  ? 52  LEU F CD2 1 
ATOM   10822 N N   . ASN F  2 53  ? 53.972  31.414  5.696   1.00 16.99  ? 53  ASN F N   1 
ATOM   10823 C CA  . ASN F  2 53  ? 53.611  32.085  4.468   1.00 20.17  ? 53  ASN F CA  1 
ATOM   10824 C C   . ASN F  2 53  ? 52.125  32.147  4.293   1.00 20.83  ? 53  ASN F C   1 
ATOM   10825 O O   . ASN F  2 53  ? 51.621  33.138  3.785   1.00 22.43  ? 53  ASN F O   1 
ATOM   10826 C CB  . ASN F  2 53  ? 54.152  31.408  3.227   1.00 23.15  ? 53  ASN F CB  1 
ATOM   10827 C CG  . ASN F  2 53  ? 55.660  31.551  3.090   1.00 26.36  ? 53  ASN F CG  1 
ATOM   10828 O OD1 . ASN F  2 53  ? 56.378  30.567  2.869   1.00 28.00  ? 53  ASN F OD1 1 
ATOM   10829 N ND2 . ASN F  2 53  ? 56.229  32.759  3.215   1.00 27.35  ? 53  ASN F ND2 1 
ATOM   10830 N N   . ARG F  2 54  ? 51.398  31.140  4.743   1.00 21.27  ? 54  ARG F N   1 
ATOM   10831 C CA  . ARG F  2 54  ? 49.962  31.112  4.573   1.00 21.54  ? 54  ARG F CA  1 
ATOM   10832 C C   . ARG F  2 54  ? 49.357  32.201  5.437   1.00 21.74  ? 54  ARG F C   1 
ATOM   10833 O O   . ARG F  2 54  ? 48.496  32.934  5.001   1.00 20.60  ? 54  ARG F O   1 
ATOM   10834 C CB  . ARG F  2 54  ? 49.545  29.708  4.954   1.00 22.51  ? 54  ARG F CB  1 
ATOM   10835 C CG  . ARG F  2 54  ? 48.192  29.177  4.536   1.00 24.17  ? 54  ARG F CG  1 
ATOM   10836 C CD  . ARG F  2 54  ? 48.290  27.895  3.656   1.00 25.53  ? 54  ARG F CD  1 
ATOM   10837 N NE  . ARG F  2 54  ? 47.026  27.145  3.677   1.00 26.63  ? 54  ARG F NE  1 
ATOM   10838 C CZ  . ARG F  2 54  ? 45.857  27.645  3.190   1.00 27.11  ? 54  ARG F CZ  1 
ATOM   10839 N NH1 . ARG F  2 54  ? 44.716  26.940  3.384   1.00 26.76  ? 54  ARG F NH1 1 
ATOM   10840 N NH2 . ARG F  2 54  ? 45.804  28.796  2.466   1.00 26.59  ? 54  ARG F NH2 1 
ATOM   10841 N N   . VAL F  2 55  ? 49.830  32.398  6.666   1.00 23.97  ? 55  VAL F N   1 
ATOM   10842 C CA  . VAL F  2 55  ? 49.262  33.418  7.525   1.00 26.33  ? 55  VAL F CA  1 
ATOM   10843 C C   . VAL F  2 55  ? 49.727  34.803  7.090   1.00 29.81  ? 55  VAL F C   1 
ATOM   10844 O O   . VAL F  2 55  ? 49.066  35.797  7.362   1.00 30.51  ? 55  VAL F O   1 
ATOM   10845 C CB  . VAL F  2 55  ? 49.646  33.062  8.997   1.00 25.12  ? 55  VAL F CB  1 
ATOM   10846 C CG1 . VAL F  2 55  ? 51.100  33.263  9.257   1.00 25.14  ? 55  VAL F CG1 1 
ATOM   10847 C CG2 . VAL F  2 55  ? 48.964  33.972  9.963   1.00 25.28  ? 55  VAL F CG2 1 
ATOM   10848 N N   . ILE F  2 56  ? 50.855  34.930  6.405   1.00 34.06  ? 56  ILE F N   1 
ATOM   10849 C CA  . ILE F  2 56  ? 51.331  36.236  5.989   1.00 38.85  ? 56  ILE F CA  1 
ATOM   10850 C C   . ILE F  2 56  ? 50.756  36.647  4.629   1.00 43.17  ? 56  ILE F C   1 
ATOM   10851 O O   . ILE F  2 56  ? 51.043  37.740  4.130   1.00 43.94  ? 56  ILE F O   1 
ATOM   10852 C CB  . ILE F  2 56  ? 52.897  36.155  6.029   1.00 38.30  ? 56  ILE F CB  1 
ATOM   10853 C CG1 . ILE F  2 56  ? 53.350  37.314  6.848   1.00 38.11  ? 56  ILE F CG1 1 
ATOM   10854 C CG2 . ILE F  2 56  ? 53.595  36.194  4.681   1.00 38.62  ? 56  ILE F CG2 1 
ATOM   10855 C CD1 . ILE F  2 56  ? 53.237  36.963  8.335   1.00 38.58  ? 56  ILE F CD1 1 
ATOM   10856 N N   . GLU F  2 57  ? 49.940  35.804  3.986   1.00 47.94  ? 57  GLU F N   1 
ATOM   10857 C CA  . GLU F  2 57  ? 49.391  36.090  2.664   1.00 52.20  ? 57  GLU F CA  1 
ATOM   10858 C C   . GLU F  2 57  ? 47.995  36.735  2.704   1.00 54.20  ? 57  GLU F C   1 
ATOM   10859 O O   . GLU F  2 57  ? 47.393  36.983  3.754   1.00 54.66  ? 57  GLU F O   1 
ATOM   10860 C CB  . GLU F  2 57  ? 49.453  34.734  1.881   1.00 53.46  ? 57  GLU F CB  1 
ATOM   10861 C CG  . GLU F  2 57  ? 48.374  34.126  0.950   1.00 55.77  ? 57  GLU F CG  1 
ATOM   10862 C CD  . GLU F  2 57  ? 47.413  33.066  1.543   1.00 57.63  ? 57  GLU F CD  1 
ATOM   10863 O OE1 . GLU F  2 57  ? 46.580  33.381  2.405   1.00 58.55  ? 57  GLU F OE1 1 
ATOM   10864 O OE2 . GLU F  2 57  ? 47.372  31.906  1.093   1.00 58.35  ? 57  GLU F OE2 1 
ATOM   10865 N N   . LYS F  2 58  ? 47.556  37.181  1.520   1.00 56.30  ? 58  LYS F N   1 
ATOM   10866 C CA  . LYS F  2 58  ? 46.219  37.738  1.266   1.00 58.05  ? 58  LYS F CA  1 
ATOM   10867 C C   . LYS F  2 58  ? 45.702  38.986  2.029   1.00 57.55  ? 58  LYS F C   1 
ATOM   10868 O O   . LYS F  2 58  ? 44.682  38.904  2.748   1.00 58.25  ? 58  LYS F O   1 
ATOM   10869 C CB  . LYS F  2 58  ? 45.166  36.593  1.431   1.00 59.12  ? 58  LYS F CB  1 
ATOM   10870 C CG  . LYS F  2 58  ? 45.040  35.520  0.344   1.00 60.14  ? 58  LYS F CG  1 
ATOM   10871 C CD  . LYS F  2 58  ? 44.005  34.545  0.918   1.00 60.98  ? 58  LYS F CD  1 
ATOM   10872 C CE  . LYS F  2 58  ? 44.067  33.107  0.391   1.00 61.43  ? 58  LYS F CE  1 
ATOM   10873 N NZ  . LYS F  2 58  ? 43.841  32.212  1.514   1.00 61.65  ? 58  LYS F NZ  1 
ATOM   10874 N N   . THR F  2 59  ? 46.317  40.183  1.905   1.00 56.05  ? 59  THR F N   1 
ATOM   10875 C CA  . THR F  2 59  ? 45.663  41.355  2.494   1.00 54.74  ? 59  THR F CA  1 
ATOM   10876 C C   . THR F  2 59  ? 44.509  41.724  1.579   1.00 52.67  ? 59  THR F C   1 
ATOM   10877 O O   . THR F  2 59  ? 44.611  41.711  0.349   1.00 52.70  ? 59  THR F O   1 
ATOM   10878 C CB  . THR F  2 59  ? 46.572  42.629  2.643   1.00 55.46  ? 59  THR F CB  1 
ATOM   10879 O OG1 . THR F  2 59  ? 47.355  42.789  1.465   1.00 56.02  ? 59  THR F OG1 1 
ATOM   10880 C CG2 . THR F  2 59  ? 47.453  42.528  3.884   1.00 55.92  ? 59  THR F CG2 1 
ATOM   10881 N N   . ASN F  2 60  ? 43.360  41.951  2.179   1.00 50.14  ? 60  ASN F N   1 
ATOM   10882 C CA  . ASN F  2 60  ? 42.184  42.323  1.434   1.00 47.07  ? 60  ASN F CA  1 
ATOM   10883 C C   . ASN F  2 60  ? 42.256  43.845  1.315   1.00 43.45  ? 60  ASN F C   1 
ATOM   10884 O O   . ASN F  2 60  ? 42.645  44.535  2.267   1.00 43.21  ? 60  ASN F O   1 
ATOM   10885 C CB  . ASN F  2 60  ? 40.914  41.831  2.199   1.00 49.08  ? 60  ASN F CB  1 
ATOM   10886 C CG  . ASN F  2 60  ? 40.812  42.137  3.716   1.00 51.20  ? 60  ASN F CG  1 
ATOM   10887 O OD1 . ASN F  2 60  ? 41.815  42.254  4.443   1.00 52.06  ? 60  ASN F OD1 1 
ATOM   10888 N ND2 . ASN F  2 60  ? 39.640  42.140  4.359   1.00 51.26  ? 60  ASN F ND2 1 
ATOM   10889 N N   . GLU F  2 61  ? 42.017  44.381  0.118   1.00 38.42  ? 61  GLU F N   1 
ATOM   10890 C CA  . GLU F  2 61  ? 41.973  45.813  -0.053  1.00 34.09  ? 61  GLU F CA  1 
ATOM   10891 C C   . GLU F  2 61  ? 40.595  46.269  0.312   1.00 29.69  ? 61  GLU F C   1 
ATOM   10892 O O   . GLU F  2 61  ? 39.636  45.550  0.024   1.00 29.65  ? 61  GLU F O   1 
ATOM   10893 C CB  . GLU F  2 61  ? 42.136  46.282  -1.459  1.00 36.23  ? 61  GLU F CB  1 
ATOM   10894 C CG  . GLU F  2 61  ? 43.387  45.869  -2.187  1.00 38.77  ? 61  GLU F CG  1 
ATOM   10895 C CD  . GLU F  2 61  ? 43.649  46.778  -3.382  1.00 40.12  ? 61  GLU F CD  1 
ATOM   10896 O OE1 . GLU F  2 61  ? 44.206  47.869  -3.172  1.00 40.71  ? 61  GLU F OE1 1 
ATOM   10897 O OE2 . GLU F  2 61  ? 43.277  46.397  -4.499  1.00 40.81  ? 61  GLU F OE2 1 
ATOM   10898 N N   . LYS F  2 62  ? 40.431  47.395  0.974   1.00 24.31  ? 62  LYS F N   1 
ATOM   10899 C CA  . LYS F  2 62  ? 39.102  47.921  1.187   1.00 19.68  ? 62  LYS F CA  1 
ATOM   10900 C C   . LYS F  2 62  ? 39.221  49.370  0.862   1.00 17.53  ? 62  LYS F C   1 
ATOM   10901 O O   . LYS F  2 62  ? 40.249  49.986  1.141   1.00 18.17  ? 62  LYS F O   1 
ATOM   10902 C CB  . LYS F  2 62  ? 38.624  47.786  2.627   1.00 18.47  ? 62  LYS F CB  1 
ATOM   10903 C CG  . LYS F  2 62  ? 38.369  46.342  3.051   1.00 17.13  ? 62  LYS F CG  1 
ATOM   10904 C CD  . LYS F  2 62  ? 37.210  45.641  2.327   1.00 15.30  ? 62  LYS F CD  1 
ATOM   10905 C CE  . LYS F  2 62  ? 37.423  44.140  2.476   1.00 13.78  ? 62  LYS F CE  1 
ATOM   10906 N NZ  . LYS F  2 62  ? 36.368  43.365  1.888   1.00 13.85  ? 62  LYS F NZ  1 
ATOM   10907 N N   . PHE F  2 63  ? 38.243  49.932  0.184   1.00 14.52  ? 63  PHE F N   1 
ATOM   10908 C CA  . PHE F  2 63  ? 38.322  51.343  -0.115  1.00 11.67  ? 63  PHE F CA  1 
ATOM   10909 C C   . PHE F  2 63  ? 37.254  52.109  0.653   1.00 10.23  ? 63  PHE F C   1 
ATOM   10910 O O   . PHE F  2 63  ? 37.325  52.161  1.882   1.00 11.32  ? 63  PHE F O   1 
ATOM   10911 C CB  . PHE F  2 63  ? 38.208  51.469  -1.622  1.00 11.54  ? 63  PHE F CB  1 
ATOM   10912 C CG  . PHE F  2 63  ? 39.381  50.821  -2.329  1.00 11.48  ? 63  PHE F CG  1 
ATOM   10913 C CD1 . PHE F  2 63  ? 40.655  51.286  -2.119  1.00 12.29  ? 63  PHE F CD1 1 
ATOM   10914 C CD2 . PHE F  2 63  ? 39.180  49.741  -3.147  1.00 11.50  ? 63  PHE F CD2 1 
ATOM   10915 C CE1 . PHE F  2 63  ? 41.727  50.675  -2.725  1.00 12.36  ? 63  PHE F CE1 1 
ATOM   10916 C CE2 . PHE F  2 63  ? 40.255  49.130  -3.752  1.00 11.85  ? 63  PHE F CE2 1 
ATOM   10917 C CZ  . PHE F  2 63  ? 41.527  49.590  -3.537  1.00 12.09  ? 63  PHE F CZ  1 
ATOM   10918 N N   . HIS F  2 64  ? 36.217  52.663  0.027   1.00 7.50   ? 64  HIS F N   1 
ATOM   10919 C CA  . HIS F  2 64  ? 35.222  53.431  0.747   1.00 5.90   ? 64  HIS F CA  1 
ATOM   10920 C C   . HIS F  2 64  ? 34.433  52.520  1.654   1.00 5.76   ? 64  HIS F C   1 
ATOM   10921 O O   . HIS F  2 64  ? 33.806  51.585  1.167   1.00 6.05   ? 64  HIS F O   1 
ATOM   10922 C CB  . HIS F  2 64  ? 34.318  54.082  -0.252  1.00 4.94   ? 64  HIS F CB  1 
ATOM   10923 C CG  . HIS F  2 64  ? 33.348  55.107  0.298   1.00 4.16   ? 64  HIS F CG  1 
ATOM   10924 N ND1 . HIS F  2 64  ? 33.677  56.276  0.836   1.00 3.74   ? 64  HIS F ND1 1 
ATOM   10925 C CD2 . HIS F  2 64  ? 31.983  55.006  0.240   1.00 4.13   ? 64  HIS F CD2 1 
ATOM   10926 C CE1 . HIS F  2 64  ? 32.550  56.890  1.103   1.00 4.70   ? 64  HIS F CE1 1 
ATOM   10927 N NE2 . HIS F  2 64  ? 31.542  56.125  0.744   1.00 5.32   ? 64  HIS F NE2 1 
ATOM   10928 N N   . GLN F  2 65  ? 34.549  52.707  2.957   1.00 5.08   ? 65  GLN F N   1 
ATOM   10929 C CA  . GLN F  2 65  ? 33.788  51.875  3.853   1.00 5.20   ? 65  GLN F CA  1 
ATOM   10930 C C   . GLN F  2 65  ? 32.701  52.704  4.537   1.00 5.29   ? 65  GLN F C   1 
ATOM   10931 O O   . GLN F  2 65  ? 32.068  53.517  3.876   1.00 5.86   ? 65  GLN F O   1 
ATOM   10932 C CB  . GLN F  2 65  ? 34.776  51.270  4.818   1.00 4.91   ? 65  GLN F CB  1 
ATOM   10933 C CG  . GLN F  2 65  ? 35.696  50.273  4.161   1.00 5.01   ? 65  GLN F CG  1 
ATOM   10934 C CD  . GLN F  2 65  ? 36.953  50.106  4.972   1.00 6.00   ? 65  GLN F CD  1 
ATOM   10935 O OE1 . GLN F  2 65  ? 36.975  49.445  6.021   1.00 7.10   ? 65  GLN F OE1 1 
ATOM   10936 N NE2 . GLN F  2 65  ? 37.994  50.767  4.498   1.00 6.72   ? 65  GLN F NE2 1 
ATOM   10937 N N   . ILE F  2 66  ? 32.405  52.507  5.821   1.00 4.45   ? 66  ILE F N   1 
ATOM   10938 C CA  . ILE F  2 66  ? 31.461  53.323  6.541   1.00 3.32   ? 66  ILE F CA  1 
ATOM   10939 C C   . ILE F  2 66  ? 32.285  54.242  7.390   1.00 3.72   ? 66  ILE F C   1 
ATOM   10940 O O   . ILE F  2 66  ? 33.454  53.938  7.605   1.00 3.29   ? 66  ILE F O   1 
ATOM   10941 C CB  . ILE F  2 66  ? 30.561  52.463  7.421   1.00 2.81   ? 66  ILE F CB  1 
ATOM   10942 C CG1 . ILE F  2 66  ? 31.288  51.577  8.373   1.00 2.00   ? 66  ILE F CG1 1 
ATOM   10943 C CG2 . ILE F  2 66  ? 29.747  51.625  6.480   1.00 2.40   ? 66  ILE F CG2 1 
ATOM   10944 C CD1 . ILE F  2 66  ? 30.310  51.015  9.393   1.00 2.00   ? 66  ILE F CD1 1 
ATOM   10945 N N   . GLU F  2 67  ? 31.715  55.337  7.865   1.00 6.21   ? 67  GLU F N   1 
ATOM   10946 C CA  . GLU F  2 67  ? 32.469  56.280  8.674   1.00 9.97   ? 67  GLU F CA  1 
ATOM   10947 C C   . GLU F  2 67  ? 32.636  55.676  10.063  1.00 10.91  ? 67  GLU F C   1 
ATOM   10948 O O   . GLU F  2 67  ? 31.759  54.969  10.551  1.00 11.31  ? 67  GLU F O   1 
ATOM   10949 C CB  . GLU F  2 67  ? 31.729  57.597  8.763   1.00 11.12  ? 67  GLU F CB  1 
ATOM   10950 C CG  . GLU F  2 67  ? 32.698  58.744  8.929   1.00 13.11  ? 67  GLU F CG  1 
ATOM   10951 C CD  . GLU F  2 67  ? 33.408  59.222  7.655   1.00 15.51  ? 67  GLU F CD  1 
ATOM   10952 O OE1 . GLU F  2 67  ? 34.530  59.739  7.800   1.00 18.51  ? 67  GLU F OE1 1 
ATOM   10953 O OE2 . GLU F  2 67  ? 32.859  59.225  6.538   1.00 14.82  ? 67  GLU F OE2 1 
ATOM   10954 N N   . LYS F  2 68  ? 33.752  55.875  10.741  1.00 11.74  ? 68  LYS F N   1 
ATOM   10955 C CA  . LYS F  2 68  ? 33.921  55.175  11.999  1.00 13.07  ? 68  LYS F CA  1 
ATOM   10956 C C   . LYS F  2 68  ? 34.186  56.082  13.170  1.00 15.81  ? 68  LYS F C   1 
ATOM   10957 O O   . LYS F  2 68  ? 34.582  55.588  14.226  1.00 16.86  ? 68  LYS F O   1 
ATOM   10958 C CB  . LYS F  2 68  ? 35.056  54.192  11.859  1.00 10.86  ? 68  LYS F CB  1 
ATOM   10959 C CG  . LYS F  2 68  ? 34.720  53.188  10.793  1.00 9.42   ? 68  LYS F CG  1 
ATOM   10960 C CD  . LYS F  2 68  ? 35.840  52.229  10.638  1.00 7.93   ? 68  LYS F CD  1 
ATOM   10961 C CE  . LYS F  2 68  ? 35.591  51.393  9.421   1.00 7.67   ? 68  LYS F CE  1 
ATOM   10962 N NZ  . LYS F  2 68  ? 36.628  50.407  9.451   1.00 8.49   ? 68  LYS F NZ  1 
ATOM   10963 N N   . GLU F  2 69  ? 34.027  57.390  12.989  1.00 18.71  ? 69  GLU F N   1 
ATOM   10964 C CA  . GLU F  2 69  ? 34.277  58.387  14.014  1.00 21.53  ? 69  GLU F CA  1 
ATOM   10965 C C   . GLU F  2 69  ? 33.273  59.496  13.766  1.00 22.25  ? 69  GLU F C   1 
ATOM   10966 O O   . GLU F  2 69  ? 33.153  60.001  12.637  1.00 23.91  ? 69  GLU F O   1 
ATOM   10967 C CB  . GLU F  2 69  ? 35.691  58.899  13.883  1.00 23.79  ? 69  GLU F CB  1 
ATOM   10968 C CG  . GLU F  2 69  ? 36.583  58.166  14.863  1.00 29.06  ? 69  GLU F CG  1 
ATOM   10969 C CD  . GLU F  2 69  ? 38.096  58.324  14.660  1.00 32.93  ? 69  GLU F CD  1 
ATOM   10970 O OE1 . GLU F  2 69  ? 38.811  57.323  14.939  1.00 35.00  ? 69  GLU F OE1 1 
ATOM   10971 O OE2 . GLU F  2 69  ? 38.535  59.406  14.225  1.00 33.81  ? 69  GLU F OE2 1 
ATOM   10972 N N   . PHE F  2 70  ? 32.503  59.882  14.776  1.00 21.87  ? 70  PHE F N   1 
ATOM   10973 C CA  . PHE F  2 70  ? 31.433  60.847  14.584  1.00 21.96  ? 70  PHE F CA  1 
ATOM   10974 C C   . PHE F  2 70  ? 31.727  62.051  15.448  1.00 24.24  ? 70  PHE F C   1 
ATOM   10975 O O   . PHE F  2 70  ? 32.505  61.933  16.392  1.00 25.88  ? 70  PHE F O   1 
ATOM   10976 C CB  . PHE F  2 70  ? 30.111  60.226  14.996  1.00 19.22  ? 70  PHE F CB  1 
ATOM   10977 C CG  . PHE F  2 70  ? 29.902  58.927  14.278  1.00 16.70  ? 70  PHE F CG  1 
ATOM   10978 C CD1 . PHE F  2 70  ? 29.299  58.920  13.048  1.00 16.76  ? 70  PHE F CD1 1 
ATOM   10979 C CD2 . PHE F  2 70  ? 30.386  57.787  14.837  1.00 15.86  ? 70  PHE F CD2 1 
ATOM   10980 C CE1 . PHE F  2 70  ? 29.218  57.751  12.344  1.00 16.50  ? 70  PHE F CE1 1 
ATOM   10981 C CE2 . PHE F  2 70  ? 30.305  56.628  14.132  1.00 16.60  ? 70  PHE F CE2 1 
ATOM   10982 C CZ  . PHE F  2 70  ? 29.716  56.603  12.889  1.00 16.74  ? 70  PHE F CZ  1 
ATOM   10983 N N   . SER F  2 71  ? 31.126  63.202  15.211  1.00 25.65  ? 71  SER F N   1 
ATOM   10984 C CA  . SER F  2 71  ? 31.460  64.351  16.020  1.00 27.72  ? 71  SER F CA  1 
ATOM   10985 C C   . SER F  2 71  ? 30.243  65.136  16.424  1.00 29.20  ? 71  SER F C   1 
ATOM   10986 O O   . SER F  2 71  ? 30.330  66.289  16.893  1.00 30.46  ? 71  SER F O   1 
ATOM   10987 C CB  . SER F  2 71  ? 32.398  65.198  15.213  1.00 28.71  ? 71  SER F CB  1 
ATOM   10988 O OG  . SER F  2 71  ? 32.029  65.111  13.841  1.00 30.38  ? 71  SER F OG  1 
ATOM   10989 N N   . GLU F  2 72  ? 29.092  64.493  16.284  1.00 30.14  ? 72  GLU F N   1 
ATOM   10990 C CA  . GLU F  2 72  ? 27.810  65.106  16.538  1.00 30.13  ? 72  GLU F CA  1 
ATOM   10991 C C   . GLU F  2 72  ? 26.935  63.950  17.031  1.00 27.28  ? 72  GLU F C   1 
ATOM   10992 O O   . GLU F  2 72  ? 27.209  62.789  16.702  1.00 26.78  ? 72  GLU F O   1 
ATOM   10993 C CB  . GLU F  2 72  ? 27.405  65.727  15.194  1.00 33.60  ? 72  GLU F CB  1 
ATOM   10994 C CG  . GLU F  2 72  ? 26.492  66.944  15.302  1.00 38.90  ? 72  GLU F CG  1 
ATOM   10995 C CD  . GLU F  2 72  ? 25.101  66.634  15.897  1.00 42.33  ? 72  GLU F CD  1 
ATOM   10996 O OE1 . GLU F  2 72  ? 24.184  66.274  15.127  1.00 43.39  ? 72  GLU F OE1 1 
ATOM   10997 O OE2 . GLU F  2 72  ? 24.964  66.737  17.138  1.00 43.95  ? 72  GLU F OE2 1