data_5HOO
# 
_entry.id   5HOO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HOO         
WWPDB D_1000217449 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Other complexes of Mos1 Transposase and DNA along the transposition pathway' 3HOS unspecified 
PDB 'Other complexes of Mos1 Transposase and DNA along the transposition pathway' 3HOT unspecified 
PDB 'Other complexes of Mos1 Transposase and DNA along the transposition pathway' 4R79 unspecified 
PDB 'Other complexes of Mos1 Transposase and DNA along the transposition pathway' 4U7B unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HOO 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Richardson, J.M.' 1 
'Morris, E.R.'     2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'A bend, flip and trap mechanism for transposon integration.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.15537 
_citation.pdbx_database_id_PubMed   27223327 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Morris, E.R.'     1 
primary 'Grey, H.'         2 
primary 'McKenzie, G.'     3 
primary 'Jones, A.C.'      4 
primary 'Richardson, J.M.' 5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   94.910 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HOO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     256.340 
_cell.length_a_esd                 ? 
_cell.length_b                     58.830 
_cell.length_b_esd                 ? 
_cell.length_c                     110.140 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HOO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mariner Mos1 transposase'                                        40865.316 2 3.1.-.- T216A 
'full-length Mos1 transposase' ? 
2 polymer     syn 'Mos1 IR DNA NTS'                                                 7768.030  2 ?       ?     'Mos1 IR DNA NTS' ? 
3 polymer     syn 'Mos1 IR TS joined to Target DNA,Mos1 IR TS joined to Target DNA' 11044.139 2 ?       ?     ? ? 
4 polymer     syn 'Target DNA'                                                      3005.969  2 ?       ?     ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                   24.305    2 ?       ?     ? ? 
6 water       nat water                                                             18.015    2 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Transposable element Mos1 transposase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQAL
LDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWI
FFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKR
QHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDE
FYWRGIHKLPERWEKCVASDGKYFE
;
;MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQAL
LDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWI
FFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKR
QHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDE
FYWRGIHKLPERWEKCVASDGKYFE
;
A,B ? 
2 polydeoxyribonucleotide no no 
;(DG)(DG)(DT)(DG)(DT)(DA)(DC)(DA)(DA)(DG)(DT)(DA)(DT)(DG)(DA)(DA)(DA)(DT)(DG)(DT)
(DC)(DG)(DT)(DT)(DT)
;
GGTGTACAAGTATGAAATGTCGTTT C,E ? 
3 polydeoxyribonucleotide no no 
;(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DA)(DT)(DT)(DT)(DC)(DA)(DT)(DA)(DC)(DT)(DT)(DG)(DT)
(DA)(DC)(DA)(DC)(DC)(DT)(DG)(DA)(DT)(DA)(DG)(DC)(DA)(DG)(DT)(DG)
;
AAACGACATTTCATACTTGTACACCTGATAGCAGTG D,F ? 
4 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DC)(DC)(DA)(DC)(DT)(DG)(DC)' GGCCCACTGC G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   PHE n 
1 5   VAL n 
1 6   PRO n 
1 7   ASN n 
1 8   LYS n 
1 9   GLU n 
1 10  GLN n 
1 11  THR n 
1 12  ARG n 
1 13  THR n 
1 14  VAL n 
1 15  LEU n 
1 16  ILE n 
1 17  PHE n 
1 18  CYS n 
1 19  PHE n 
1 20  HIS n 
1 21  LEU n 
1 22  LYS n 
1 23  LYS n 
1 24  THR n 
1 25  ALA n 
1 26  ALA n 
1 27  GLU n 
1 28  SER n 
1 29  HIS n 
1 30  ARG n 
1 31  MET n 
1 32  LEU n 
1 33  VAL n 
1 34  GLU n 
1 35  ALA n 
1 36  PHE n 
1 37  GLY n 
1 38  GLU n 
1 39  GLN n 
1 40  VAL n 
1 41  PRO n 
1 42  THR n 
1 43  VAL n 
1 44  LYS n 
1 45  THR n 
1 46  CYS n 
1 47  GLU n 
1 48  ARG n 
1 49  TRP n 
1 50  PHE n 
1 51  GLN n 
1 52  ARG n 
1 53  PHE n 
1 54  LYS n 
1 55  SER n 
1 56  GLY n 
1 57  ASP n 
1 58  PHE n 
1 59  ASP n 
1 60  VAL n 
1 61  ASP n 
1 62  ASP n 
1 63  LYS n 
1 64  GLU n 
1 65  HIS n 
1 66  GLY n 
1 67  LYS n 
1 68  PRO n 
1 69  PRO n 
1 70  LYS n 
1 71  ARG n 
1 72  TYR n 
1 73  GLU n 
1 74  ASP n 
1 75  ALA n 
1 76  GLU n 
1 77  LEU n 
1 78  GLN n 
1 79  ALA n 
1 80  LEU n 
1 81  LEU n 
1 82  ASP n 
1 83  GLU n 
1 84  ASP n 
1 85  ASP n 
1 86  ALA n 
1 87  GLN n 
1 88  THR n 
1 89  GLN n 
1 90  LYS n 
1 91  GLN n 
1 92  LEU n 
1 93  ALA n 
1 94  GLU n 
1 95  GLN n 
1 96  LEU n 
1 97  GLU n 
1 98  VAL n 
1 99  SER n 
1 100 GLN n 
1 101 GLN n 
1 102 ALA n 
1 103 VAL n 
1 104 SER n 
1 105 ASN n 
1 106 ARG n 
1 107 LEU n 
1 108 ARG n 
1 109 GLU n 
1 110 MET n 
1 111 GLY n 
1 112 LYS n 
1 113 ILE n 
1 114 GLN n 
1 115 LYS n 
1 116 VAL n 
1 117 GLY n 
1 118 ARG n 
1 119 TRP n 
1 120 VAL n 
1 121 PRO n 
1 122 HIS n 
1 123 GLU n 
1 124 LEU n 
1 125 ASN n 
1 126 GLU n 
1 127 ARG n 
1 128 GLN n 
1 129 MET n 
1 130 GLU n 
1 131 ARG n 
1 132 ARG n 
1 133 LYS n 
1 134 ASN n 
1 135 THR n 
1 136 CYS n 
1 137 GLU n 
1 138 ILE n 
1 139 LEU n 
1 140 LEU n 
1 141 SER n 
1 142 ARG n 
1 143 TYR n 
1 144 LYS n 
1 145 ARG n 
1 146 LYS n 
1 147 SER n 
1 148 PHE n 
1 149 LEU n 
1 150 HIS n 
1 151 ARG n 
1 152 ILE n 
1 153 VAL n 
1 154 THR n 
1 155 GLY n 
1 156 ASP n 
1 157 GLU n 
1 158 LYS n 
1 159 TRP n 
1 160 ILE n 
1 161 PHE n 
1 162 PHE n 
1 163 VAL n 
1 164 ASN n 
1 165 PRO n 
1 166 LYS n 
1 167 ARG n 
1 168 LYS n 
1 169 LYS n 
1 170 SER n 
1 171 TYR n 
1 172 VAL n 
1 173 ASP n 
1 174 PRO n 
1 175 GLY n 
1 176 GLN n 
1 177 PRO n 
1 178 ALA n 
1 179 THR n 
1 180 SER n 
1 181 THR n 
1 182 ALA n 
1 183 ARG n 
1 184 PRO n 
1 185 ASN n 
1 186 ARG n 
1 187 PHE n 
1 188 GLY n 
1 189 LYS n 
1 190 LYS n 
1 191 THR n 
1 192 MET n 
1 193 LEU n 
1 194 CYS n 
1 195 VAL n 
1 196 TRP n 
1 197 TRP n 
1 198 ASP n 
1 199 GLN n 
1 200 SER n 
1 201 GLY n 
1 202 VAL n 
1 203 ILE n 
1 204 TYR n 
1 205 TYR n 
1 206 GLU n 
1 207 LEU n 
1 208 LEU n 
1 209 LYS n 
1 210 PRO n 
1 211 GLY n 
1 212 GLU n 
1 213 THR n 
1 214 VAL n 
1 215 ASN n 
1 216 ALA n 
1 217 ALA n 
1 218 ARG n 
1 219 TYR n 
1 220 GLN n 
1 221 GLN n 
1 222 GLN n 
1 223 LEU n 
1 224 ILE n 
1 225 ASN n 
1 226 LEU n 
1 227 ASN n 
1 228 ARG n 
1 229 ALA n 
1 230 LEU n 
1 231 GLN n 
1 232 ARG n 
1 233 LYS n 
1 234 ARG n 
1 235 PRO n 
1 236 GLU n 
1 237 TYR n 
1 238 GLN n 
1 239 LYS n 
1 240 ARG n 
1 241 GLN n 
1 242 HIS n 
1 243 ARG n 
1 244 VAL n 
1 245 ILE n 
1 246 PHE n 
1 247 LEU n 
1 248 HIS n 
1 249 ASP n 
1 250 ASN n 
1 251 ALA n 
1 252 PRO n 
1 253 SER n 
1 254 HIS n 
1 255 THR n 
1 256 ALA n 
1 257 ARG n 
1 258 ALA n 
1 259 VAL n 
1 260 ARG n 
1 261 ASP n 
1 262 THR n 
1 263 LEU n 
1 264 GLU n 
1 265 THR n 
1 266 LEU n 
1 267 ASN n 
1 268 TRP n 
1 269 GLU n 
1 270 VAL n 
1 271 LEU n 
1 272 PRO n 
1 273 HIS n 
1 274 ALA n 
1 275 ALA n 
1 276 TYR n 
1 277 SER n 
1 278 PRO n 
1 279 ASP n 
1 280 LEU n 
1 281 ALA n 
1 282 PRO n 
1 283 SER n 
1 284 ASP n 
1 285 TYR n 
1 286 HIS n 
1 287 LEU n 
1 288 PHE n 
1 289 ALA n 
1 290 SER n 
1 291 MET n 
1 292 GLY n 
1 293 HIS n 
1 294 ALA n 
1 295 LEU n 
1 296 ALA n 
1 297 GLU n 
1 298 GLN n 
1 299 ARG n 
1 300 PHE n 
1 301 ASP n 
1 302 SER n 
1 303 TYR n 
1 304 GLU n 
1 305 SER n 
1 306 VAL n 
1 307 LYS n 
1 308 LYS n 
1 309 TRP n 
1 310 LEU n 
1 311 ASP n 
1 312 GLU n 
1 313 TRP n 
1 314 PHE n 
1 315 ALA n 
1 316 ALA n 
1 317 LYS n 
1 318 ASP n 
1 319 ASP n 
1 320 GLU n 
1 321 PHE n 
1 322 TYR n 
1 323 TRP n 
1 324 ARG n 
1 325 GLY n 
1 326 ILE n 
1 327 HIS n 
1 328 LYS n 
1 329 LEU n 
1 330 PRO n 
1 331 GLU n 
1 332 ARG n 
1 333 TRP n 
1 334 GLU n 
1 335 LYS n 
1 336 CYS n 
1 337 VAL n 
1 338 ALA n 
1 339 SER n 
1 340 ASP n 
1 341 GLY n 
1 342 LYS n 
1 343 TYR n 
1 344 PHE n 
1 345 GLU n 
2 1   DG  n 
2 2   DG  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DA  n 
2 10  DG  n 
2 11  DT  n 
2 12  DA  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
2 16  DA  n 
2 17  DA  n 
2 18  DT  n 
2 19  DG  n 
2 20  DT  n 
2 21  DC  n 
2 22  DG  n 
2 23  DT  n 
2 24  DT  n 
2 25  DT  n 
3 1   DA  n 
3 2   DA  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DA  n 
3 7   DC  n 
3 8   DA  n 
3 9   DT  n 
3 10  DT  n 
3 11  DT  n 
3 12  DC  n 
3 13  DA  n 
3 14  DT  n 
3 15  DA  n 
3 16  DC  n 
3 17  DT  n 
3 18  DT  n 
3 19  DG  n 
3 20  DT  n 
3 21  DA  n 
3 22  DC  n 
3 23  DA  n 
3 24  DC  n 
3 25  DC  n 
3 26  DT  n 
3 27  DG  n 
3 28  DA  n 
3 29  DT  n 
3 30  DA  n 
3 31  DG  n 
3 32  DC  n 
3 33  DA  n 
3 34  DG  n 
3 35  DT  n 
3 36  DG  n 
4 1   DG  n 
4 2   DG  n 
4 3   DC  n 
4 4   DC  n 
4 5   DC  n 
4 6   DA  n 
4 7   DC  n 
4 8   DT  n 
4 9   DG  n 
4 10  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   345 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 mariner 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila mauritiana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7226 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 25 'synthetic construct'   ?           32630 'synthetic DNA' 
3 1 sample 1 36 'synthetic construct'   ?           32630 'synthetic DNA' 
3 2 sample 1 36 'Drosophila mauritiana' 'Fruit fly' 7226  'synthetic DNA' 
4 1 sample 1 10 'synthetic construct'   ?           32630 ?               
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MOS1T_DROMA Q7JQ07 ? 1 
;MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQAL
LDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWI
FFVSPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKR
QHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDE
FYWRGIHKLPERWEKCVASDGKYLE
;
1 
2 PDB 5HOO        5HOO   ? 2 ? 1 
3 PDB 5HOO        5HOO   ? 3 ? 1 
4 PDB 5HOO        5HOO   ? 4 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5HOO A 1 ? 345 ? Q7JQ07 1   ? 345 ? 1   345 
2  1 5HOO B 1 ? 345 ? Q7JQ07 1   ? 345 ? 1   345 
3  2 5HOO C 1 ? 25  ? 5HOO   4   ? 28  ? 4   28  
4  3 5HOO D 1 ? 36  ? 5HOO   29  ? 7   ? 29  7   
5  3 5HOO D 1 ? 36  ? 5HOO   29  ? 7   ? 29  7   
6  2 5HOO E 1 ? 25  ? 5HOO   4   ? 28  ? 4   28  
7  3 5HOO F 1 ? 36  ? 5HOO   29  ? 7   ? 29  7   
8  3 5HOO F 1 ? 36  ? 5HOO   29  ? 7   ? 29  7   
9  4 5HOO G 1 ? 10  ? 5HOO   -10 ? -1  ? -10 -1  
10 4 5HOO H 1 ? 10  ? 5HOO   -10 ? -1  ? -10 -1  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HOO THR A 45  ? UNP Q7JQ07 LYS 45  conflict              45  1  
1 5HOO ASN A 164 ? UNP Q7JQ07 SER 164 conflict              164 2  
1 5HOO PRO A 210 ? UNP Q7JQ07 ARG 210 conflict              210 3  
1 5HOO ALA A 216 ? UNP Q7JQ07 THR 216 'engineered mutation' 216 4  
1 5HOO PHE A 344 ? UNP Q7JQ07 LEU 344 conflict              344 5  
2 5HOO THR B 45  ? UNP Q7JQ07 LYS 45  conflict              45  6  
2 5HOO ASN B 164 ? UNP Q7JQ07 SER 164 conflict              164 7  
2 5HOO PRO B 210 ? UNP Q7JQ07 ARG 210 conflict              210 8  
2 5HOO ALA B 216 ? UNP Q7JQ07 THR 216 'engineered mutation' 216 9  
2 5HOO PHE B 344 ? UNP Q7JQ07 LEU 344 conflict              344 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HOO 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.30 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         62.73 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% (v/v) MPD, 0.1 M sodium cacodylate pH 6.5,0.2 M magnesium acetate tetrahydrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-10-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5HOO 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.29 
_reflns.d_resolution_low                 86.99 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       25201 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.1 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.077 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.29 
_reflns_shell.d_res_low                   3.52 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.pdbx_Rsym_value             0.152 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -1.0100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -9.4300 
_refine.aniso_B[2][2]                            10.8200 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            -8.0600 
_refine.B_iso_max                                145.000 
_refine.B_iso_mean                               73.0340 
_refine.B_iso_min                                20.000 
_refine.correlation_coeff_Fo_to_Fc               0.9390 
_refine.correlation_coeff_Fo_to_Fc_free          0.9430 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HOO 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.3000 
_refine.ls_d_res_low                             60.0100 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23767 
_refine.ls_number_reflns_R_free                  1239 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.4900 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2339 
_refine.ls_R_factor_R_free                       0.2739 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2319 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3HOS 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.5500 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             90.6350 
_refine.overall_SU_ML                            0.5820 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.3000 
_refine_hist.d_res_low                        60.0100 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               8490 
_refine_hist.pdbx_number_residues_total       813 
_refine_hist.pdbx_B_iso_mean_ligand           145.00 
_refine_hist.pdbx_B_iso_mean_solvent          145.00 
_refine_hist.pdbx_number_atoms_protein        5591 
_refine_hist.pdbx_number_atoms_nucleic_acid   2895 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.016  8991  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  7003  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.255  1.640  12743 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.467  3.000  16217 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.449  5.000  667   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 36.690 23.333 309   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 17.031 15.000 1026  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 14.158 15.000 54    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.079  0.200  1216  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  8152  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  2120  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.3000 
_refine_ls_shell.d_res_low                        3.3850 
_refine_ls_shell.number_reflns_all                1809 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             108 
_refine_ls_shell.number_reflns_R_work             1701 
_refine_ls_shell.percent_reflns_obs               99.2900 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3290 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3180 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5HOO 
_struct.title                        'Crystal structure of the Mos1 Strand Transfer Complex' 
_struct.pdbx_descriptor              'Mariner Mos1 transposase/DNA Complex' 
_struct.pdbx_model_details           'represents the Mos1 transposition machinery after transposon integration into target DNA' 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HOO 
_struct_keywords.text            
'protein-DNA complex, DNA transposase, recombinase, integrase, helix-turn-helix, base flipping, DNA' 
_struct_keywords.pdbx_keywords   DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 7   ? LEU A 21  ? ASN A 7   LEU A 21  1 ? 15 
HELX_P HELX_P2  AA2 THR A 24  ? GLY A 37  ? THR A 24  GLY A 37  1 ? 14 
HELX_P HELX_P3  AA3 GLU A 38  ? VAL A 40  ? GLU A 38  VAL A 40  5 ? 3  
HELX_P HELX_P4  AA4 THR A 42  ? SER A 55  ? THR A 42  SER A 55  1 ? 14 
HELX_P HELX_P5  AA5 GLU A 73  ? ASP A 84  ? GLU A 73  ASP A 84  1 ? 12 
HELX_P HELX_P6  AA6 THR A 88  ? GLU A 97  ? THR A 88  GLU A 97  1 ? 10 
HELX_P HELX_P7  AA7 SER A 99  ? MET A 110 ? SER A 99  MET A 110 1 ? 12 
HELX_P HELX_P8  AA8 ASN A 125 ? LYS A 146 ? ASN A 125 LYS A 146 1 ? 22 
HELX_P HELX_P9  AA9 PHE A 148 ? HIS A 150 ? PHE A 148 HIS A 150 5 ? 3  
HELX_P HELX_P10 AB1 ASN A 215 ? ARG A 234 ? ASN A 215 ARG A 234 1 ? 20 
HELX_P HELX_P11 AB2 ALA A 251 ? ALA A 256 ? ALA A 251 ALA A 256 1 ? 6  
HELX_P HELX_P12 AB3 ALA A 256 ? ASN A 267 ? ALA A 256 ASN A 267 1 ? 12 
HELX_P HELX_P13 AB4 SER A 277 ? LEU A 280 ? SER A 277 LEU A 280 5 ? 4  
HELX_P HELX_P14 AB5 ALA A 281 ? HIS A 286 ? ALA A 281 HIS A 286 1 ? 6  
HELX_P HELX_P15 AB6 HIS A 286 ? ALA A 296 ? HIS A 286 ALA A 296 1 ? 11 
HELX_P HELX_P16 AB7 SER A 302 ? LYS A 317 ? SER A 302 LYS A 317 1 ? 16 
HELX_P HELX_P17 AB8 ASP A 318 ? LYS A 328 ? ASP A 318 LYS A 328 1 ? 11 
HELX_P HELX_P18 AB9 LYS A 328 ? SER A 339 ? LYS A 328 SER A 339 1 ? 12 
HELX_P HELX_P19 AC1 ASN B 7   ? LEU B 21  ? ASN B 7   LEU B 21  1 ? 15 
HELX_P HELX_P20 AC2 THR B 24  ? GLY B 37  ? THR B 24  GLY B 37  1 ? 14 
HELX_P HELX_P21 AC3 GLU B 38  ? VAL B 40  ? GLU B 38  VAL B 40  5 ? 3  
HELX_P HELX_P22 AC4 THR B 42  ? SER B 55  ? THR B 42  SER B 55  1 ? 14 
HELX_P HELX_P23 AC5 GLU B 73  ? ASP B 84  ? GLU B 73  ASP B 84  1 ? 12 
HELX_P HELX_P24 AC6 THR B 88  ? GLU B 97  ? THR B 88  GLU B 97  1 ? 10 
HELX_P HELX_P25 AC7 SER B 99  ? MET B 110 ? SER B 99  MET B 110 1 ? 12 
HELX_P HELX_P26 AC8 ASN B 125 ? LYS B 146 ? ASN B 125 LYS B 146 1 ? 22 
HELX_P HELX_P27 AC9 PHE B 148 ? HIS B 150 ? PHE B 148 HIS B 150 5 ? 3  
HELX_P HELX_P28 AD1 ASN B 215 ? ARG B 232 ? ASN B 215 ARG B 232 1 ? 18 
HELX_P HELX_P29 AD2 ALA B 251 ? ALA B 256 ? ALA B 251 ALA B 256 1 ? 6  
HELX_P HELX_P30 AD3 ALA B 256 ? ASN B 267 ? ALA B 256 ASN B 267 1 ? 12 
HELX_P HELX_P31 AD4 SER B 277 ? LEU B 280 ? SER B 277 LEU B 280 5 ? 4  
HELX_P HELX_P32 AD5 ALA B 281 ? HIS B 286 ? ALA B 281 HIS B 286 1 ? 6  
HELX_P HELX_P33 AD6 HIS B 286 ? ALA B 296 ? HIS B 286 ALA B 296 1 ? 11 
HELX_P HELX_P34 AD7 SER B 302 ? LYS B 317 ? SER B 302 LYS B 317 1 ? 16 
HELX_P HELX_P35 AD8 ASP B 318 ? LYS B 328 ? ASP B 318 LYS B 328 1 ? 11 
HELX_P HELX_P36 AD9 LYS B 328 ? SER B 339 ? LYS B 328 SER B 339 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? A CYS 136 SG    ? ? ? 1_555 A CYS 336 SG ? ? A CYS 136 A CYS 336 1_555 ? ? ? ? ? ? ?               2.874 ? 
disulf2   disulf ? ? B CYS 136 SG    ? ? ? 1_555 B CYS 336 SG ? ? B CYS 136 B CYS 336 1_555 ? ? ? ? ? ? ?               2.145 ? 
metalc1   metalc ? ? A ASP 156 OD1   ? ? ? 1_555 I MG  .   MG ? ? A ASP 156 A MG  401 1_555 ? ? ? ? ? ? ?               2.175 ? 
metalc2   metalc ? ? A ASP 156 OD2   ? ? ? 1_555 I MG  .   MG ? ? A ASP 156 A MG  401 1_555 ? ? ? ? ? ? ?               2.913 ? 
metalc3   metalc ? ? A ASP 249 OD2   ? ? ? 1_555 I MG  .   MG ? ? A ASP 249 A MG  401 1_555 ? ? ? ? ? ? ?               2.189 ? 
metalc4   metalc ? ? B ASP 156 OD1   ? ? ? 1_555 J MG  .   MG ? ? B ASP 156 B MG  401 1_555 ? ? ? ? ? ? ?               2.174 ? 
metalc5   metalc ? ? B ASP 156 OD2   ? ? ? 1_555 J MG  .   MG ? ? B ASP 156 B MG  401 1_555 ? ? ? ? ? ? ?               2.831 ? 
metalc6   metalc ? ? B ASP 249 OD2   ? ? ? 1_555 J MG  .   MG ? ? B ASP 249 B MG  401 1_555 ? ? ? ? ? ? ?               2.192 ? 
metalc7   metalc ? ? G DC  10  "O3'" ? ? ? 1_555 I MG  .   MG ? ? G DC  -1  A MG  401 1_555 ? ? ? ? ? ? ?               2.169 ? 
metalc8   metalc ? ? H DC  10  "O3'" ? ? ? 1_555 J MG  .   MG ? ? H DC  -1  B MG  401 1_555 ? ? ? ? ? ? ?               2.169 ? 
metalc9   metalc ? ? I MG  .   MG    ? ? ? 1_555 K HOH .   O  ? ? A MG  401 A HOH 501 1_555 ? ? ? ? ? ? ?               2.222 ? 
metalc10  metalc ? ? J MG  .   MG    ? ? ? 1_555 L HOH .   O  ? ? B MG  401 B HOH 501 1_555 ? ? ? ? ? ? ?               2.201 ? 
hydrog1   hydrog ? ? C DG  1   N2    ? ? ? 1_555 D DC  25  O2 ? ? C DG  4   D DC  53  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog2   hydrog ? ? C DG  2   N1    ? ? ? 1_555 D DC  24  N3 ? ? C DG  5   D DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? C DG  2   N2    ? ? ? 1_555 D DC  24  O2 ? ? C DG  5   D DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? C DG  2   O6    ? ? ? 1_555 D DC  24  N4 ? ? C DG  5   D DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? C DT  3   N3    ? ? ? 1_555 D DA  23  N1 ? ? C DT  6   D DA  51  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog6   hydrog ? ? C DG  4   N1    ? ? ? 1_555 D DC  22  N3 ? ? C DG  7   D DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? C DG  4   N2    ? ? ? 1_555 D DC  22  O2 ? ? C DG  7   D DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? C DG  4   O6    ? ? ? 1_555 D DC  22  N4 ? ? C DG  7   D DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? C DT  5   N3    ? ? ? 1_555 D DA  21  N1 ? ? C DT  8   D DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? C DT  5   O4    ? ? ? 1_555 D DA  21  N6 ? ? C DT  8   D DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? C DA  6   N1    ? ? ? 1_555 D DT  20  N3 ? ? C DA  9   D DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? C DA  6   N6    ? ? ? 1_555 D DT  20  O4 ? ? C DA  9   D DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? C DC  7   N3    ? ? ? 1_555 D DG  19  N1 ? ? C DC  10  D DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? C DC  7   N4    ? ? ? 1_555 D DG  19  O6 ? ? C DC  10  D DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? C DC  7   O2    ? ? ? 1_555 D DG  19  N2 ? ? C DC  10  D DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? C DA  8   N6    ? ? ? 1_555 D DT  17  O4 ? ? C DA  11  D DT  45  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog17  hydrog ? ? C DA  8   N1    ? ? ? 1_555 D DT  18  N3 ? ? C DA  11  D DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? C DA  8   N6    ? ? ? 1_555 D DT  18  O4 ? ? C DA  11  D DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? C DA  9   N1    ? ? ? 1_555 D DT  17  N3 ? ? C DA  12  D DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? C DA  9   N6    ? ? ? 1_555 D DT  17  O4 ? ? C DA  12  D DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? C DG  10  N1    ? ? ? 1_555 D DC  16  N3 ? ? C DG  13  D DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? C DG  10  N2    ? ? ? 1_555 D DC  16  O2 ? ? C DG  13  D DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? C DG  10  O6    ? ? ? 1_555 D DC  16  N4 ? ? C DG  13  D DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? C DT  11  N3    ? ? ? 1_555 D DA  15  N1 ? ? C DT  14  D DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? C DT  11  O4    ? ? ? 1_555 D DA  15  N6 ? ? C DT  14  D DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? C DA  12  N1    ? ? ? 1_555 D DT  14  N3 ? ? C DA  15  D DT  42  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog27  hydrog ? ? C DT  13  N3    ? ? ? 1_555 D DA  13  N1 ? ? C DT  16  D DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? C DT  13  O4    ? ? ? 1_555 D DA  13  N6 ? ? C DT  16  D DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? C DG  14  N1    ? ? ? 1_555 D DC  12  N3 ? ? C DG  17  D DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? C DG  14  N2    ? ? ? 1_555 D DC  12  O2 ? ? C DG  17  D DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? C DG  14  O6    ? ? ? 1_555 D DC  12  N4 ? ? C DG  17  D DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? C DA  15  N1    ? ? ? 1_555 D DT  11  N3 ? ? C DA  18  D DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? C DA  15  N6    ? ? ? 1_555 D DT  11  O4 ? ? C DA  18  D DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? C DA  16  N1    ? ? ? 1_555 D DT  10  N3 ? ? C DA  19  D DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? C DA  16  N6    ? ? ? 1_555 D DT  10  O4 ? ? C DA  19  D DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? C DA  17  N1    ? ? ? 1_555 D DT  9   N3 ? ? C DA  20  D DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? C DA  17  N6    ? ? ? 1_555 D DT  9   O4 ? ? C DA  20  D DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? C DT  18  N3    ? ? ? 1_555 D DA  8   N1 ? ? C DT  21  D DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? C DT  18  O4    ? ? ? 1_555 D DA  8   N6 ? ? C DT  21  D DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? C DG  19  N1    ? ? ? 1_555 D DC  7   O2 ? ? C DG  22  D DC  35  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog41  hydrog ? ? C DT  20  N3    ? ? ? 1_555 D DA  6   N1 ? ? C DT  23  D DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? C DT  20  O4    ? ? ? 1_555 D DA  6   N6 ? ? C DT  23  D DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? C DC  21  N3    ? ? ? 1_555 D DG  5   N1 ? ? C DC  24  D DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? C DC  21  N4    ? ? ? 1_555 D DG  5   O6 ? ? C DC  24  D DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? C DC  21  O2    ? ? ? 1_555 D DG  5   N2 ? ? C DC  24  D DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? C DG  22  N1    ? ? ? 1_555 D DC  4   N3 ? ? C DG  25  D DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? C DG  22  N2    ? ? ? 1_555 D DC  4   O2 ? ? C DG  25  D DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? C DG  22  O6    ? ? ? 1_555 D DC  4   N4 ? ? C DG  25  D DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? C DT  23  O4    ? ? ? 1_555 D DA  2   N6 ? ? C DT  26  D DA  30  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog50  hydrog ? ? C DT  23  N3    ? ? ? 1_555 D DA  3   N1 ? ? C DT  26  D DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? C DT  23  O4    ? ? ? 1_555 D DA  3   N6 ? ? C DT  26  D DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? C DT  24  N3    ? ? ? 1_555 D DA  2   N1 ? ? C DT  27  D DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? C DT  24  O4    ? ? ? 1_555 D DA  2   N6 ? ? C DT  27  D DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? C DT  25  N3    ? ? ? 1_555 D DA  1   N1 ? ? C DT  28  D DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? C DT  25  O4    ? ? ? 1_555 D DA  1   N6 ? ? C DT  28  D DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? D DG  31  N1    ? ? ? 1_555 G DC  10  N3 ? ? D DG  2   G DC  -1  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog57  hydrog ? ? D DC  32  N3    ? ? ? 1_555 G DG  9   N1 ? ? D DC  3   G DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? D DC  32  N4    ? ? ? 1_555 G DG  9   O6 ? ? D DC  3   G DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? D DC  32  O2    ? ? ? 1_555 G DG  9   N2 ? ? D DC  3   G DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? D DA  33  N1    ? ? ? 1_555 G DT  8   N3 ? ? D DA  4   G DT  -3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog61  hydrog ? ? D DG  34  N1    ? ? ? 1_555 G DC  7   N3 ? ? D DG  5   G DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? D DG  34  N2    ? ? ? 1_555 G DC  7   O2 ? ? D DG  5   G DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? D DG  34  O6    ? ? ? 1_555 G DC  7   N4 ? ? D DG  5   G DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? D DT  35  N3    ? ? ? 1_555 G DA  6   N1 ? ? D DT  6   G DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? D DT  35  O4    ? ? ? 1_555 G DA  6   N6 ? ? D DT  6   G DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? D DG  36  N1    ? ? ? 1_555 G DC  5   N3 ? ? D DG  7   G DC  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? D DG  36  N2    ? ? ? 1_555 G DC  5   O2 ? ? D DG  7   G DC  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? D DG  36  O6    ? ? ? 1_555 G DC  5   N4 ? ? D DG  7   G DC  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? E DG  1   N2    ? ? ? 1_555 F DC  25  O2 ? ? E DG  4   F DC  53  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog70  hydrog ? ? E DG  2   N1    ? ? ? 1_555 F DC  24  N3 ? ? E DG  5   F DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? E DG  2   N2    ? ? ? 1_555 F DC  24  O2 ? ? E DG  5   F DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? E DG  2   O6    ? ? ? 1_555 F DC  24  N4 ? ? E DG  5   F DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? E DT  3   N3    ? ? ? 1_555 F DA  23  N1 ? ? E DT  6   F DA  51  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog74  hydrog ? ? E DG  4   N1    ? ? ? 1_555 F DC  22  N3 ? ? E DG  7   F DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? E DG  4   N2    ? ? ? 1_555 F DC  22  O2 ? ? E DG  7   F DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? E DG  4   O6    ? ? ? 1_555 F DC  22  N4 ? ? E DG  7   F DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? E DT  5   N3    ? ? ? 1_555 F DA  21  N1 ? ? E DT  8   F DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? E DT  5   O4    ? ? ? 1_555 F DA  21  N6 ? ? E DT  8   F DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? E DA  6   N1    ? ? ? 1_555 F DT  20  N3 ? ? E DA  9   F DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? E DA  6   N6    ? ? ? 1_555 F DT  20  O4 ? ? E DA  9   F DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? E DC  7   N3    ? ? ? 1_555 F DG  19  N1 ? ? E DC  10  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? E DC  7   N4    ? ? ? 1_555 F DG  19  O6 ? ? E DC  10  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? E DC  7   O2    ? ? ? 1_555 F DG  19  N2 ? ? E DC  10  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? E DA  8   N6    ? ? ? 1_555 F DT  17  O4 ? ? E DA  11  F DT  45  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog85  hydrog ? ? E DA  8   N1    ? ? ? 1_555 F DT  18  N3 ? ? E DA  11  F DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? E DA  8   N6    ? ? ? 1_555 F DT  18  O4 ? ? E DA  11  F DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? E DA  9   N1    ? ? ? 1_555 F DT  17  N3 ? ? E DA  12  F DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? E DA  9   N6    ? ? ? 1_555 F DT  17  O4 ? ? E DA  12  F DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? E DG  10  N1    ? ? ? 1_555 F DC  16  N3 ? ? E DG  13  F DC  44  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog90  hydrog ? ? E DT  11  N3    ? ? ? 1_555 F DA  15  N1 ? ? E DT  14  F DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? E DT  11  O4    ? ? ? 1_555 F DA  15  N6 ? ? E DT  14  F DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? E DA  12  N1    ? ? ? 1_555 F DT  14  N3 ? ? E DA  15  F DT  42  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog93  hydrog ? ? E DT  13  N3    ? ? ? 1_555 F DA  13  N1 ? ? E DT  16  F DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? E DT  13  O4    ? ? ? 1_555 F DA  13  N6 ? ? E DT  16  F DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? E DG  14  N1    ? ? ? 1_555 F DC  12  N3 ? ? E DG  17  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? E DG  14  N2    ? ? ? 1_555 F DC  12  O2 ? ? E DG  17  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? E DG  14  O6    ? ? ? 1_555 F DC  12  N4 ? ? E DG  17  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? E DA  15  N1    ? ? ? 1_555 F DT  11  N3 ? ? E DA  18  F DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? E DA  15  N6    ? ? ? 1_555 F DT  11  O4 ? ? E DA  18  F DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? E DA  16  N1    ? ? ? 1_555 F DT  10  N3 ? ? E DA  19  F DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? E DA  16  N6    ? ? ? 1_555 F DT  10  O4 ? ? E DA  19  F DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? E DA  17  N1    ? ? ? 1_555 F DT  9   N3 ? ? E DA  20  F DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? E DA  17  N6    ? ? ? 1_555 F DT  9   O4 ? ? E DA  20  F DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? E DT  18  N3    ? ? ? 1_555 F DA  8   N1 ? ? E DT  21  F DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? E DT  18  O4    ? ? ? 1_555 F DA  8   N6 ? ? E DT  21  F DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? E DG  19  N1    ? ? ? 1_555 F DC  7   O2 ? ? E DG  22  F DC  35  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog107 hydrog ? ? E DT  20  N3    ? ? ? 1_555 F DA  6   N1 ? ? E DT  23  F DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? E DT  20  O4    ? ? ? 1_555 F DA  6   N6 ? ? E DT  23  F DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? E DC  21  N3    ? ? ? 1_555 F DG  5   N1 ? ? E DC  24  F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? E DC  21  N4    ? ? ? 1_555 F DG  5   O6 ? ? E DC  24  F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? E DC  21  O2    ? ? ? 1_555 F DG  5   N2 ? ? E DC  24  F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? E DG  22  N1    ? ? ? 1_555 F DC  4   N3 ? ? E DG  25  F DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? E DG  22  N2    ? ? ? 1_555 F DC  4   O2 ? ? E DG  25  F DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? E DG  22  O6    ? ? ? 1_555 F DC  4   N4 ? ? E DG  25  F DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? E DT  23  O4    ? ? ? 1_555 F DA  2   N6 ? ? E DT  26  F DA  30  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog116 hydrog ? ? E DT  23  N3    ? ? ? 1_555 F DA  3   N1 ? ? E DT  26  F DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? E DT  23  O4    ? ? ? 1_555 F DA  3   N6 ? ? E DT  26  F DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? E DT  24  N3    ? ? ? 1_555 F DA  2   N1 ? ? E DT  27  F DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? E DT  24  O4    ? ? ? 1_555 F DA  2   N6 ? ? E DT  27  F DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? E DT  25  N3    ? ? ? 1_555 F DA  1   N1 ? ? E DT  28  F DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? E DT  25  O4    ? ? ? 1_555 F DA  1   N6 ? ? E DT  28  F DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? F DG  31  N1    ? ? ? 1_555 H DC  10  N3 ? ? F DG  2   H DC  -1  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog123 hydrog ? ? F DC  32  N4    ? ? ? 1_555 H DT  8   O4 ? ? F DC  3   H DT  -3  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog124 hydrog ? ? F DC  32  N3    ? ? ? 1_555 H DG  9   N1 ? ? F DC  3   H DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? F DC  32  N4    ? ? ? 1_555 H DG  9   O6 ? ? F DC  3   H DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? F DC  32  O2    ? ? ? 1_555 H DG  9   N2 ? ? F DC  3   H DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? F DA  33  N1    ? ? ? 1_555 H DT  8   N3 ? ? F DA  4   H DT  -3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog128 hydrog ? ? F DG  34  N1    ? ? ? 1_555 H DC  7   N3 ? ? F DG  5   H DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? F DG  34  N2    ? ? ? 1_555 H DC  7   O2 ? ? F DG  5   H DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? F DG  34  O6    ? ? ? 1_555 H DC  7   N4 ? ? F DG  5   H DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? F DT  35  O4    ? ? ? 1_555 H DC  5   N4 ? ? F DT  6   H DC  -6  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog132 hydrog ? ? F DT  35  N3    ? ? ? 1_555 H DA  6   N1 ? ? F DT  6   H DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? F DT  35  O4    ? ? ? 1_555 H DA  6   N6 ? ? F DT  6   H DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? F DG  36  N1    ? ? ? 1_555 H DC  5   N3 ? ? F DG  7   H DC  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? F DG  36  N2    ? ? ? 1_555 H DC  5   O2 ? ? F DG  7   H DC  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? F DG  36  O6    ? ? ? 1_555 H DC  5   N4 ? ? F DG  7   H DC  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 113 ? VAL A 116 ? ILE A 113 VAL A 116 
AA1 2 LYS B 169 ? VAL B 172 ? LYS B 169 VAL B 172 
AA2 1 TRP A 119 ? VAL A 120 ? TRP A 119 VAL A 120 
AA2 2 THR B 181 ? ALA B 182 ? THR B 181 ALA B 182 
AA3 1 VAL A 202 ? LEU A 208 ? VAL A 202 LEU A 208 
AA3 2 LYS A 190 ? ASP A 198 ? LYS A 190 ASP A 198 
AA3 3 ILE A 152 ? PHE A 161 ? ILE A 152 PHE A 161 
AA3 4 ILE A 245 ? LEU A 247 ? ILE A 245 LEU A 247 
AA3 5 GLU A 269 ? VAL A 270 ? GLU A 269 VAL A 270 
AA4 1 LYS A 169 ? VAL A 172 ? LYS A 169 VAL A 172 
AA4 2 ILE B 113 ? VAL B 116 ? ILE B 113 VAL B 116 
AA5 1 THR A 181 ? ALA A 182 ? THR A 181 ALA A 182 
AA5 2 TRP B 119 ? VAL B 120 ? TRP B 119 VAL B 120 
AA6 1 VAL B 202 ? LEU B 208 ? VAL B 202 LEU B 208 
AA6 2 LYS B 190 ? ASP B 198 ? LYS B 190 ASP B 198 
AA6 3 ILE B 152 ? PHE B 161 ? ILE B 152 PHE B 161 
AA6 4 ILE B 245 ? LEU B 247 ? ILE B 245 LEU B 247 
AA6 5 GLU B 269 ? VAL B 270 ? GLU B 269 VAL B 270 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 115 ? N LYS A 115 O SER B 170 ? O SER B 170 
AA2 1 2 N VAL A 120 ? N VAL A 120 O THR B 181 ? O THR B 181 
AA3 1 2 O LEU A 208 ? O LEU A 208 N MET A 192 ? N MET A 192 
AA3 2 3 O LEU A 193 ? O LEU A 193 N LYS A 158 ? N LYS A 158 
AA3 3 4 N VAL A 153 ? N VAL A 153 O ILE A 245 ? O ILE A 245 
AA3 4 5 N PHE A 246 ? N PHE A 246 O GLU A 269 ? O GLU A 269 
AA4 1 2 N SER A 170 ? N SER A 170 O LYS B 115 ? O LYS B 115 
AA5 1 2 N THR A 181 ? N THR A 181 O VAL B 120 ? O VAL B 120 
AA6 1 2 O LEU B 208 ? O LEU B 208 N MET B 192 ? N MET B 192 
AA6 2 3 O LEU B 193 ? O LEU B 193 N LYS B 158 ? N LYS B 158 
AA6 3 4 N VAL B 153 ? N VAL B 153 O ILE B 245 ? O ILE B 245 
AA6 4 5 N PHE B 246 ? N PHE B 246 O GLU B 269 ? O GLU B 269 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 401 ? 5 'binding site for residue MG A 401' 
AC2 Software B MG 401 ? 5 'binding site for residue MG B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 156 ? ASP A 156 . ? 1_555 ? 
2  AC1 5 GLU A 157 ? GLU A 157 . ? 1_555 ? 
3  AC1 5 ASP A 249 ? ASP A 249 . ? 1_555 ? 
4  AC1 5 HOH K .   ? HOH A 501 . ? 1_555 ? 
5  AC1 5 DC  G 10  ? DC  G -1  . ? 1_555 ? 
6  AC2 5 ASP B 156 ? ASP B 156 . ? 1_555 ? 
7  AC2 5 GLU B 157 ? GLU B 157 . ? 1_555 ? 
8  AC2 5 ASP B 249 ? ASP B 249 . ? 1_555 ? 
9  AC2 5 HOH L .   ? HOH B 501 . ? 1_555 ? 
10 AC2 5 DC  H 10  ? DC  H -1  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5HOO 
_atom_sites.fract_transf_matrix[1][1]   0.003901 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000335 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016998 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009113 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 3   ? -2.873  -25.664 -28.601 1.00 64.47  ? 3   SER A N     1 
ATOM   2    C  CA    . SER A 1 3   ? -2.725  -25.259 -27.143 1.00 63.96  ? 3   SER A CA    1 
ATOM   3    C  C     . SER A 1 3   ? -1.233  -24.881 -26.795 1.00 63.09  ? 3   SER A C     1 
ATOM   4    O  O     . SER A 1 3   ? -0.501  -25.445 -25.923 1.00 62.41  ? 3   SER A O     1 
ATOM   5    C  CB    . SER A 1 3   ? -3.374  -26.302 -26.206 1.00 64.00  ? 3   SER A CB    1 
ATOM   6    O  OG    . SER A 1 3   ? -2.614  -27.502 -26.157 1.00 63.52  ? 3   SER A OG    1 
ATOM   7    N  N     . PHE A 1 4   ? -0.798  -23.901 -27.579 1.00 63.22  ? 4   PHE A N     1 
ATOM   8    C  CA    . PHE A 1 4   ? 0.483   -23.226 -27.401 1.00 62.62  ? 4   PHE A CA    1 
ATOM   9    C  C     . PHE A 1 4   ? 0.266   -21.730 -27.524 1.00 63.02  ? 4   PHE A C     1 
ATOM   10   O  O     . PHE A 1 4   ? -0.357  -21.260 -28.490 1.00 63.78  ? 4   PHE A O     1 
ATOM   11   C  CB    . PHE A 1 4   ? 1.491   -23.679 -28.453 1.00 62.48  ? 4   PHE A CB    1 
ATOM   12   C  CG    . PHE A 1 4   ? 2.625   -22.709 -28.663 1.00 62.22  ? 4   PHE A CG    1 
ATOM   13   C  CD1   . PHE A 1 4   ? 3.677   -22.650 -27.769 1.00 61.45  ? 4   PHE A CD1   1 
ATOM   14   C  CD2   . PHE A 1 4   ? 2.635   -21.843 -29.759 1.00 62.82  ? 4   PHE A CD2   1 
ATOM   15   C  CE1   . PHE A 1 4   ? 4.726   -21.755 -27.959 1.00 61.27  ? 4   PHE A CE1   1 
ATOM   16   C  CE2   . PHE A 1 4   ? 3.682   -20.948 -29.957 1.00 62.69  ? 4   PHE A CE2   1 
ATOM   17   C  CZ    . PHE A 1 4   ? 4.729   -20.904 -29.054 1.00 61.90  ? 4   PHE A CZ    1 
ATOM   18   N  N     . VAL A 1 5   ? 0.802   -20.996 -26.553 1.00 62.58  ? 5   VAL A N     1 
ATOM   19   C  CA    . VAL A 1 5   ? 0.790   -19.540 -26.579 1.00 62.94  ? 5   VAL A CA    1 
ATOM   20   C  C     . VAL A 1 5   ? 2.250   -19.045 -26.632 1.00 62.40  ? 5   VAL A C     1 
ATOM   21   O  O     . VAL A 1 5   ? 3.063   -19.452 -25.795 1.00 61.63  ? 5   VAL A O     1 
ATOM   22   C  CB    . VAL A 1 5   ? -0.021  -18.938 -25.388 1.00 63.15  ? 5   VAL A CB    1 
ATOM   23   C  CG1   . VAL A 1 5   ? 0.667   -19.143 -24.035 1.00 62.35  ? 5   VAL A CG1   1 
ATOM   24   C  CG2   . VAL A 1 5   ? -0.328  -17.457 -25.642 1.00 63.85  ? 5   VAL A CG2   1 
ATOM   25   N  N     . PRO A 1 6   ? 2.596   -18.201 -27.636 1.00 62.86  ? 6   PRO A N     1 
ATOM   26   C  CA    . PRO A 1 6   ? 3.949   -17.675 -27.743 1.00 62.49  ? 6   PRO A CA    1 
ATOM   27   C  C     . PRO A 1 6   ? 4.165   -16.491 -26.825 1.00 62.43  ? 6   PRO A C     1 
ATOM   28   O  O     . PRO A 1 6   ? 3.232   -15.722 -26.591 1.00 63.03  ? 6   PRO A O     1 
ATOM   29   C  CB    . PRO A 1 6   ? 4.016   -17.205 -29.185 1.00 63.25  ? 6   PRO A CB    1 
ATOM   30   C  CG    . PRO A 1 6   ? 2.640   -16.731 -29.467 1.00 64.12  ? 6   PRO A CG    1 
ATOM   31   C  CD    . PRO A 1 6   ? 1.729   -17.654 -28.700 1.00 63.87  ? 6   PRO A CD    1 
ATOM   32   N  N     . ASN A 1 7   ? 5.393   -16.341 -26.339 1.00 61.79  ? 7   ASN A N     1 
ATOM   33   C  CA    . ASN A 1 7   ? 5.777   -15.207 -25.496 1.00 61.74  ? 7   ASN A CA    1 
ATOM   34   C  C     . ASN A 1 7   ? 6.087   -13.943 -26.326 1.00 62.45  ? 7   ASN A C     1 
ATOM   35   O  O     . ASN A 1 7   ? 5.881   -13.925 -27.540 1.00 63.06  ? 7   ASN A O     1 
ATOM   36   C  CB    . ASN A 1 7   ? 6.969   -15.611 -24.625 1.00 60.81  ? 7   ASN A CB    1 
ATOM   37   C  CG    . ASN A 1 7   ? 8.255   -15.764 -25.416 1.00 60.61  ? 7   ASN A CG    1 
ATOM   38   O  OD1   . ASN A 1 7   ? 8.346   -15.361 -26.577 1.00 61.20  ? 7   ASN A OD1   1 
ATOM   39   N  ND2   . ASN A 1 7   ? 9.262   -16.347 -24.786 1.00 59.85  ? 7   ASN A ND2   1 
ATOM   40   N  N     . LYS A 1 8   ? 6.596   -12.901 -25.676 1.00 62.46  ? 8   LYS A N     1 
ATOM   41   C  CA    . LYS A 1 8   ? 7.004   -11.674 -26.373 1.00 63.18  ? 8   LYS A CA    1 
ATOM   42   C  C     . LYS A 1 8   ? 8.111   -11.920 -27.400 1.00 63.13  ? 8   LYS A C     1 
ATOM   43   O  O     . LYS A 1 8   ? 7.999   -11.479 -28.538 1.00 63.94  ? 8   LYS A O     1 
ATOM   44   C  CB    . LYS A 1 8   ? 7.472   -10.609 -25.376 1.00 63.14  ? 8   LYS A CB    1 
ATOM   45   C  CG    . LYS A 1 8   ? 6.371   -9.936  -24.580 1.00 63.63  ? 8   LYS A CG    1 
ATOM   46   C  CD    . LYS A 1 8   ? 6.950   -9.063  -23.461 1.00 63.48  ? 8   LYS A CD    1 
ATOM   47   C  CE    . LYS A 1 8   ? 6.733   -7.552  -23.628 1.00 64.55  ? 8   LYS A CE    1 
ATOM   48   N  NZ    . LYS A 1 8   ? 7.784   -6.738  -22.933 1.00 64.38  ? 8   LYS A NZ    1 
ATOM   49   N  N     . GLU A 1 9   ? 9.162   -12.633 -26.987 1.00 62.27  ? 9   GLU A N     1 
ATOM   50   C  CA    . GLU A 1 9   ? 10.364  -12.858 -27.819 1.00 62.22  ? 9   GLU A CA    1 
ATOM   51   C  C     . GLU A 1 9   ? 10.037  -13.634 -29.086 1.00 62.62  ? 9   GLU A C     1 
ATOM   52   O  O     . GLU A 1 9   ? 10.406  -13.223 -30.182 1.00 63.31  ? 9   GLU A O     1 
ATOM   53   C  CB    . GLU A 1 9   ? 11.466  -13.628 -27.059 1.00 61.24  ? 9   GLU A CB    1 
ATOM   54   C  CG    . GLU A 1 9   ? 12.241  -12.845 -25.997 1.00 60.90  ? 9   GLU A CG    1 
ATOM   55   C  CD    . GLU A 1 9   ? 11.534  -12.705 -24.642 1.00 60.54  ? 9   GLU A CD    1 
ATOM   56   O  OE1   . GLU A 1 9   ? 10.937  -13.684 -24.137 1.00 60.08  ? 9   GLU A OE1   1 
ATOM   57   O  OE2   . GLU A 1 9   ? 11.592  -11.593 -24.068 1.00 60.79  ? 9   GLU A OE2   1 
ATOM   58   N  N     . GLN A 1 10  ? 9.341   -14.756 -28.916 1.00 62.24  ? 10  GLN A N     1 
ATOM   59   C  CA    . GLN A 1 10  ? 8.941   -15.628 -30.026 1.00 62.60  ? 10  GLN A CA    1 
ATOM   60   C  C     . GLN A 1 10  ? 8.080   -14.878 -31.051 1.00 63.69  ? 10  GLN A C     1 
ATOM   61   O  O     . GLN A 1 10  ? 8.228   -15.076 -32.256 1.00 64.27  ? 10  GLN A O     1 
ATOM   62   C  CB    . GLN A 1 10  ? 8.169   -16.843 -29.502 1.00 62.11  ? 10  GLN A CB    1 
ATOM   63   C  CG    . GLN A 1 10  ? 8.975   -17.799 -28.635 1.00 61.16  ? 10  GLN A CG    1 
ATOM   64   C  CD    . GLN A 1 10  ? 8.095   -18.778 -27.859 1.00 60.77  ? 10  GLN A CD    1 
ATOM   65   O  OE1   . GLN A 1 10  ? 7.282   -18.375 -27.014 1.00 60.76  ? 10  GLN A OE1   1 
ATOM   66   N  NE2   . GLN A 1 10  ? 8.241   -20.072 -28.149 1.00 60.55  ? 10  GLN A NE2   1 
ATOM   67   N  N     . THR A 1 11  ? 7.173   -14.035 -30.553 1.00 64.04  ? 11  THR A N     1 
ATOM   68   C  CA    . THR A 1 11  ? 6.332   -13.170 -31.385 1.00 65.18  ? 11  THR A CA    1 
ATOM   69   C  C     . THR A 1 11  ? 7.160   -12.187 -32.215 1.00 65.88  ? 11  THR A C     1 
ATOM   70   O  O     . THR A 1 11  ? 6.902   -12.009 -33.404 1.00 66.79  ? 11  THR A O     1 
ATOM   71   C  CB    . THR A 1 11  ? 5.323   -12.388 -30.512 1.00 65.44  ? 11  THR A CB    1 
ATOM   72   O  OG1   . THR A 1 11  ? 4.503   -13.312 -29.781 1.00 64.93  ? 11  THR A OG1   1 
ATOM   73   C  CG2   . THR A 1 11  ? 4.429   -11.490 -31.355 1.00 66.72  ? 11  THR A CG2   1 
ATOM   74   N  N     . ARG A 1 12  ? 8.144   -11.554 -31.587 1.00 65.54  ? 12  ARG A N     1 
ATOM   75   C  CA    . ARG A 1 12  ? 8.989   -10.581 -32.279 1.00 66.25  ? 12  ARG A CA    1 
ATOM   76   C  C     . ARG A 1 12  ? 9.903   -11.221 -33.321 1.00 66.35  ? 12  ARG A C     1 
ATOM   77   O  O     . ARG A 1 12  ? 10.227  -10.593 -34.329 1.00 67.31  ? 12  ARG A O     1 
ATOM   78   C  CB    . ARG A 1 12  ? 9.805   -9.775  -31.272 1.00 65.87  ? 12  ARG A CB    1 
ATOM   79   C  CG    . ARG A 1 12  ? 8.954   -8.860  -30.396 1.00 66.12  ? 12  ARG A CG    1 
ATOM   80   C  CD    . ARG A 1 12  ? 9.535   -8.730  -29.001 1.00 65.25  ? 12  ARG A CD    1 
ATOM   81   N  NE    . ARG A 1 12  ? 8.959   -7.631  -28.224 1.00 65.69  ? 12  ARG A NE    1 
ATOM   82   C  CZ    . ARG A 1 12  ? 9.221   -7.388  -26.938 1.00 65.11  ? 12  ARG A CZ    1 
ATOM   83   N  NH1   . ARG A 1 12  ? 10.032  -8.183  -26.233 1.00 64.02  ? 12  ARG A NH1   1 
ATOM   84   N  NH2   . ARG A 1 12  ? 8.664   -6.346  -26.337 1.00 65.71  ? 12  ARG A NH2   1 
ATOM   85   N  N     . THR A 1 13  ? 10.331  -12.456 -33.063 1.00 65.45  ? 13  THR A N     1 
ATOM   86   C  CA    . THR A 1 13  ? 11.102  -13.240 -34.040 1.00 65.58  ? 13  THR A CA    1 
ATOM   87   C  C     . THR A 1 13  ? 10.282  -13.455 -35.305 1.00 66.52  ? 13  THR A C     1 
ATOM   88   O  O     . THR A 1 13  ? 10.778  -13.265 -36.414 1.00 67.34  ? 13  THR A O     1 
ATOM   89   C  CB    . THR A 1 13  ? 11.585  -14.581 -33.430 1.00 64.49  ? 13  THR A CB    1 
ATOM   90   O  OG1   . THR A 1 13  ? 12.721  -14.320 -32.605 1.00 63.88  ? 13  THR A OG1   1 
ATOM   91   C  CG2   . THR A 1 13  ? 12.005  -15.594 -34.474 1.00 64.74  ? 13  THR A CG2   1 
ATOM   92   N  N     . VAL A 1 14  ? 9.021   -13.830 -35.130 1.00 66.48  ? 14  VAL A N     1 
ATOM   93   C  CA    . VAL A 1 14  ? 8.131   -14.066 -36.259 1.00 67.38  ? 14  VAL A CA    1 
ATOM   94   C  C     . VAL A 1 14  ? 7.972   -12.790 -37.093 1.00 68.65  ? 14  VAL A C     1 
ATOM   95   O  O     . VAL A 1 14  ? 7.917   -12.863 -38.315 1.00 69.57  ? 14  VAL A O     1 
ATOM   96   C  CB    . VAL A 1 14  ? 6.776   -14.642 -35.787 1.00 67.13  ? 14  VAL A CB    1 
ATOM   97   C  CG1   . VAL A 1 14  ? 5.733   -14.618 -36.898 1.00 68.22  ? 14  VAL A CG1   1 
ATOM   98   C  CG2   . VAL A 1 14  ? 6.957   -16.070 -35.297 1.00 66.15  ? 14  VAL A CG2   1 
ATOM   99   N  N     . LEU A 1 15  ? 7.929   -11.628 -36.448 1.00 68.80  ? 15  LEU A N     1 
ATOM   100  C  CA    . LEU A 1 15  ? 7.889   -10.364 -37.189 1.00 70.09  ? 15  LEU A CA    1 
ATOM   101  C  C     . LEU A 1 15  ? 9.154   -10.133 -38.008 1.00 70.57  ? 15  LEU A C     1 
ATOM   102  O  O     . LEU A 1 15  ? 9.083   -9.580  -39.104 1.00 71.83  ? 15  LEU A O     1 
ATOM   103  C  CB    . LEU A 1 15  ? 7.661   -9.186  -36.250 1.00 70.16  ? 15  LEU A CB    1 
ATOM   104  C  CG    . LEU A 1 15  ? 6.293   -9.138  -35.575 1.00 70.11  ? 15  LEU A CG    1 
ATOM   105  C  CD1   . LEU A 1 15  ? 6.329   -8.172  -34.400 1.00 69.91  ? 15  LEU A CD1   1 
ATOM   106  C  CD2   . LEU A 1 15  ? 5.209   -8.750  -36.572 1.00 71.44  ? 15  LEU A CD2   1 
ATOM   107  N  N     . ILE A 1 16  ? 10.304  -10.548 -37.474 1.00 69.67  ? 16  ILE A N     1 
ATOM   108  C  CA    . ILE A 1 16  ? 11.562  -10.544 -38.236 1.00 70.09  ? 16  ILE A CA    1 
ATOM   109  C  C     . ILE A 1 16  ? 11.401  -11.446 -39.466 1.00 70.64  ? 16  ILE A C     1 
ATOM   110  O  O     . ILE A 1 16  ? 11.764  -11.066 -40.578 1.00 71.79  ? 16  ILE A O     1 
ATOM   111  C  CB    . ILE A 1 16  ? 12.780  -10.993 -37.379 1.00 68.97  ? 16  ILE A CB    1 
ATOM   112  C  CG1   . ILE A 1 16  ? 13.057  -9.961  -36.280 1.00 68.64  ? 16  ILE A CG1   1 
ATOM   113  C  CG2   . ILE A 1 16  ? 14.029  -11.181 -38.244 1.00 69.47  ? 16  ILE A CG2   1 
ATOM   114  C  CD1   . ILE A 1 16  ? 13.982  -10.436 -35.184 1.00 67.41  ? 16  ILE A CD1   1 
ATOM   115  N  N     . PHE A 1 17  ? 10.826  -12.626 -39.257 1.00 69.92  ? 17  PHE A N     1 
ATOM   116  C  CA    . PHE A 1 17  ? 10.592  -13.583 -40.329 1.00 70.39  ? 17  PHE A CA    1 
ATOM   117  C  C     . PHE A 1 17  ? 9.725   -12.978 -41.414 1.00 71.78  ? 17  PHE A C     1 
ATOM   118  O  O     . PHE A 1 17  ? 10.118  -12.964 -42.565 1.00 72.78  ? 17  PHE A O     1 
ATOM   119  C  CB    . PHE A 1 17  ? 9.940   -14.838 -39.760 1.00 69.42  ? 17  PHE A CB    1 
ATOM   120  C  CG    . PHE A 1 17  ? 9.764   -15.950 -40.748 1.00 69.81  ? 17  PHE A CG    1 
ATOM   121  C  CD1   . PHE A 1 17  ? 10.833  -16.426 -41.479 1.00 70.13  ? 17  PHE A CD1   1 
ATOM   122  C  CD2   . PHE A 1 17  ? 8.529   -16.561 -40.901 1.00 69.89  ? 17  PHE A CD2   1 
ATOM   123  C  CE1   . PHE A 1 17  ? 10.671  -17.473 -42.371 1.00 70.56  ? 17  PHE A CE1   1 
ATOM   124  C  CE2   . PHE A 1 17  ? 8.360   -17.611 -41.783 1.00 70.28  ? 17  PHE A CE2   1 
ATOM   125  C  CZ    . PHE A 1 17  ? 9.434   -18.067 -42.522 1.00 70.62  ? 17  PHE A CZ    1 
ATOM   126  N  N     . CYS A 1 18  ? 8.561   -12.458 -41.041 1.00 71.92  ? 18  CYS A N     1 
ATOM   127  C  CA    . CYS A 1 18  ? 7.646   -11.842 -42.006 1.00 73.30  ? 18  CYS A CA    1 
ATOM   128  C  C     . CYS A 1 18  ? 8.316   -10.699 -42.777 1.00 74.54  ? 18  CYS A C     1 
ATOM   129  O  O     . CYS A 1 18  ? 8.211   -10.621 -44.002 1.00 75.78  ? 18  CYS A O     1 
ATOM   130  C  CB    . CYS A 1 18  ? 6.373   -11.352 -41.303 1.00 73.25  ? 18  CYS A CB    1 
ATOM   131  S  SG    . CYS A 1 18  ? 5.352   -12.670 -40.590 1.00 72.17  ? 18  CYS A SG    1 
ATOM   132  N  N     . PHE A 1 19  ? 9.029   -9.841  -42.056 1.00 74.27  ? 19  PHE A N     1 
ATOM   133  C  CA    . PHE A 1 19  ? 9.762   -8.720  -42.649 1.00 75.43  ? 19  PHE A CA    1 
ATOM   134  C  C     . PHE A 1 19  ? 10.722  -9.176  -43.746 1.00 76.06  ? 19  PHE A C     1 
ATOM   135  O  O     . PHE A 1 19  ? 10.698  -8.634  -44.850 1.00 77.54  ? 19  PHE A O     1 
ATOM   136  C  CB    . PHE A 1 19  ? 10.522  -7.996  -41.547 1.00 74.76  ? 19  PHE A CB    1 
ATOM   137  C  CG    . PHE A 1 19  ? 11.200  -6.736  -41.983 1.00 75.96  ? 19  PHE A CG    1 
ATOM   138  C  CD1   . PHE A 1 19  ? 10.467  -5.678  -42.484 1.00 77.35  ? 19  PHE A CD1   1 
ATOM   139  C  CD2   . PHE A 1 19  ? 12.572  -6.586  -41.838 1.00 75.77  ? 19  PHE A CD2   1 
ATOM   140  C  CE1   . PHE A 1 19  ? 11.091  -4.499  -42.866 1.00 78.56  ? 19  PHE A CE1   1 
ATOM   141  C  CE2   . PHE A 1 19  ? 13.203  -5.414  -42.217 1.00 76.95  ? 19  PHE A CE2   1 
ATOM   142  C  CZ    . PHE A 1 19  ? 12.462  -4.365  -42.724 1.00 78.35  ? 19  PHE A CZ    1 
ATOM   143  N  N     . HIS A 1 20  ? 11.534  -10.190 -43.443 1.00 75.03  ? 20  HIS A N     1 
ATOM   144  C  CA    . HIS A 1 20  ? 12.476  -10.793 -44.413 1.00 75.57  ? 20  HIS A CA    1 
ATOM   145  C  C     . HIS A 1 20  ? 11.780  -11.491 -45.578 1.00 76.41  ? 20  HIS A C     1 
ATOM   146  O  O     . HIS A 1 20  ? 12.363  -11.607 -46.651 1.00 77.46  ? 20  HIS A O     1 
ATOM   147  C  CB    . HIS A 1 20  ? 13.427  -11.802 -43.738 1.00 74.27  ? 20  HIS A CB    1 
ATOM   148  C  CG    . HIS A 1 20  ? 14.561  -11.169 -42.990 1.00 73.84  ? 20  HIS A CG    1 
ATOM   149  N  ND1   . HIS A 1 20  ? 15.878  -11.353 -43.349 1.00 74.11  ? 20  HIS A ND1   1 
ATOM   150  C  CD2   . HIS A 1 20  ? 14.578  -10.351 -41.910 1.00 73.25  ? 20  HIS A CD2   1 
ATOM   151  C  CE1   . HIS A 1 20  ? 16.658  -10.674 -42.526 1.00 73.68  ? 20  HIS A CE1   1 
ATOM   152  N  NE2   . HIS A 1 20  ? 15.892  -10.058 -41.643 1.00 73.14  ? 20  HIS A NE2   1 
ATOM   153  N  N     . LEU A 1 21  ? 10.550  -11.960 -45.362 1.00 76.02  ? 21  LEU A N     1 
ATOM   154  C  CA    . LEU A 1 21  ? 9.693   -12.451 -46.444 1.00 76.95  ? 21  LEU A CA    1 
ATOM   155  C  C     . LEU A 1 21  ? 9.019   -11.321 -47.229 1.00 78.52  ? 21  LEU A C     1 
ATOM   156  O  O     . LEU A 1 21  ? 8.081   -11.582 -47.992 1.00 79.31  ? 21  LEU A O     1 
ATOM   157  C  CB    . LEU A 1 21  ? 8.616   -13.391 -45.901 1.00 76.01  ? 21  LEU A CB    1 
ATOM   158  C  CG    . LEU A 1 21  ? 9.084   -14.690 -45.270 1.00 74.66  ? 21  LEU A CG    1 
ATOM   159  C  CD1   . LEU A 1 21  ? 7.881   -15.440 -44.732 1.00 73.95  ? 21  LEU A CD1   1 
ATOM   160  C  CD2   . LEU A 1 21  ? 9.847   -15.541 -46.266 1.00 75.20  ? 21  LEU A CD2   1 
ATOM   161  N  N     . LYS A 1 22  ? 9.487   -10.077 -47.055 1.00 79.05  ? 22  LYS A N     1 
ATOM   162  C  CA    . LYS A 1 22  ? 8.987   -8.913  -47.795 1.00 80.70  ? 22  LYS A CA    1 
ATOM   163  C  C     . LYS A 1 22  ? 7.493   -8.664  -47.545 1.00 80.83  ? 22  LYS A C     1 
ATOM   164  O  O     . LYS A 1 22  ? 6.801   -8.134  -48.419 1.00 82.29  ? 22  LYS A O     1 
ATOM   165  C  CB    . LYS A 1 22  ? 9.273   -9.048  -49.316 1.00 82.28  ? 22  LYS A CB    1 
ATOM   166  C  CG    . LYS A 1 22  ? 10.654  -9.589  -49.698 1.00 82.23  ? 22  LYS A CG    1 
ATOM   167  C  CD    . LYS A 1 22  ? 11.777  -8.690  -49.187 1.00 82.18  ? 22  LYS A CD    1 
ATOM   168  C  CE    . LYS A 1 22  ? 13.124  -9.336  -49.106 1.00 81.62  ? 22  LYS A CE    1 
ATOM   169  N  NZ    . LYS A 1 22  ? 14.053  -8.631  -48.164 1.00 80.99  ? 22  LYS A NZ    1 
ATOM   170  N  N     . LYS A 1 23  ? 7.004   -9.048  -46.363 1.00 79.41  ? 23  LYS A N     1 
ATOM   171  C  CA    . LYS A 1 23  ? 5.589   -8.902  -46.055 1.00 79.50  ? 23  LYS A CA    1 
ATOM   172  C  C     . LYS A 1 23  ? 5.328   -7.500  -45.549 1.00 80.07  ? 23  LYS A C     1 
ATOM   173  O  O     . LYS A 1 23  ? 6.245   -6.804  -45.096 1.00 79.91  ? 23  LYS A O     1 
ATOM   174  C  CB    . LYS A 1 23  ? 5.101   -9.944  -45.039 1.00 77.90  ? 23  LYS A CB    1 
ATOM   175  C  CG    . LYS A 1 23  ? 4.745   -11.297 -45.639 1.00 77.71  ? 23  LYS A CG    1 
ATOM   176  C  CD    . LYS A 1 23  ? 3.663   -11.169 -46.709 1.00 79.15  ? 23  LYS A CD    1 
ATOM   177  C  CE    . LYS A 1 23  ? 2.699   -12.350 -46.755 1.00 78.74  ? 23  LYS A CE    1 
ATOM   178  N  NZ    . LYS A 1 23  ? 3.336   -13.609 -47.223 1.00 78.30  ? 23  LYS A NZ    1 
ATOM   179  N  N     . THR A 1 24  ? 4.065   -7.097  -45.659 1.00 80.84  ? 24  THR A N     1 
ATOM   180  C  CA    . THR A 1 24  ? 3.613   -5.789  -45.208 1.00 81.57  ? 24  THR A CA    1 
ATOM   181  C  C     . THR A 1 24  ? 3.243   -5.951  -43.745 1.00 80.15  ? 24  THR A C     1 
ATOM   182  O  O     . THR A 1 24  ? 3.067   -7.079  -43.271 1.00 78.89  ? 24  THR A O     1 
ATOM   183  C  CB    . THR A 1 24  ? 2.393   -5.293  -46.006 1.00 83.18  ? 24  THR A CB    1 
ATOM   184  O  OG1   . THR A 1 24  ? 1.212   -5.936  -45.531 1.00 82.61  ? 24  THR A OG1   1 
ATOM   185  C  CG2   . THR A 1 24  ? 2.541   -5.583  -47.493 1.00 84.41  ? 24  THR A CG2   1 
ATOM   186  N  N     . ALA A 1 25  ? 3.121   -4.835  -43.032 1.00 80.45  ? 25  ALA A N     1 
ATOM   187  C  CA    . ALA A 1 25  ? 2.899   -4.888  -41.586 1.00 79.19  ? 25  ALA A CA    1 
ATOM   188  C  C     . ALA A 1 25  ? 1.591   -5.575  -41.259 1.00 78.86  ? 25  ALA A C     1 
ATOM   189  O  O     . ALA A 1 25  ? 1.574   -6.565  -40.528 1.00 77.46  ? 25  ALA A O     1 
ATOM   190  C  CB    . ALA A 1 25  ? 2.938   -3.499  -40.966 1.00 79.82  ? 25  ALA A CB    1 
ATOM   191  N  N     . ALA A 1 26  ? 0.508   -5.057  -41.822 1.00 80.23  ? 26  ALA A N     1 
ATOM   192  C  CA    . ALA A 1 26  ? -0.817  -5.600  -41.562 1.00 80.16  ? 26  ALA A CA    1 
ATOM   193  C  C     . ALA A 1 26  ? -0.986  -7.042  -42.065 1.00 79.51  ? 26  ALA A C     1 
ATOM   194  O  O     . ALA A 1 26  ? -1.729  -7.811  -41.461 1.00 78.77  ? 26  ALA A O     1 
ATOM   195  C  CB    . ALA A 1 26  ? -1.880  -4.688  -42.149 1.00 81.95  ? 26  ALA A CB    1 
ATOM   196  N  N     . GLU A 1 27  ? -0.300  -7.403  -43.153 1.00 79.85  ? 27  GLU A N     1 
ATOM   197  C  CA    . GLU A 1 27  ? -0.338  -8.773  -43.686 1.00 79.32  ? 27  GLU A CA    1 
ATOM   198  C  C     . GLU A 1 27  ? 0.100   -9.732  -42.594 1.00 77.50  ? 27  GLU A C     1 
ATOM   199  O  O     . GLU A 1 27  ? -0.602  -10.688 -42.260 1.00 76.88  ? 27  GLU A O     1 
ATOM   200  C  CB    . GLU A 1 27  ? 0.597   -8.956  -44.929 1.00 79.94  ? 27  GLU A CB    1 
ATOM   201  C  CG    . GLU A 1 27  ? 0.037   -8.666  -46.327 1.00 81.70  ? 27  GLU A CG    1 
ATOM   202  C  CD    . GLU A 1 27  ? -0.906  -9.735  -46.877 1.00 81.84  ? 27  GLU A CD    1 
ATOM   203  O  OE1   . GLU A 1 27  ? -1.046  -10.790 -46.198 1.00 80.51  ? 27  GLU A OE1   1 
ATOM   204  O  OE2   . GLU A 1 27  ? -1.499  -9.520  -47.982 1.00 83.33  ? 27  GLU A OE2   1 
ATOM   205  N  N     . SER A 1 28  ? 1.266   -9.440  -42.035 1.00 76.75  ? 28  SER A N     1 
ATOM   206  C  CA    . SER A 1 28  ? 1.849   -10.230 -40.964 1.00 75.10  ? 28  SER A CA    1 
ATOM   207  C  C     . SER A 1 28  ? 0.876   -10.401 -39.797 1.00 74.45  ? 28  SER A C     1 
ATOM   208  O  O     . SER A 1 28  ? 0.639   -11.523 -39.329 1.00 73.49  ? 28  SER A O     1 
ATOM   209  C  CB    . SER A 1 28  ? 3.146   -9.566  -40.480 1.00 74.65  ? 28  SER A CB    1 
ATOM   210  O  OG    . SER A 1 28  ? 3.862   -9.012  -41.569 1.00 75.70  ? 28  SER A OG    1 
ATOM   211  N  N     . HIS A 1 29  ? 0.310   -9.290  -39.335 1.00 75.07  ? 29  HIS A N     1 
ATOM   212  C  CA    . HIS A 1 29  ? -0.629  -9.316  -38.221 1.00 74.66  ? 29  HIS A CA    1 
ATOM   213  C  C     . HIS A 1 29  ? -1.742  -10.333 -38.451 1.00 74.70  ? 29  HIS A C     1 
ATOM   214  O  O     . HIS A 1 29  ? -2.055  -11.109 -37.552 1.00 73.74  ? 29  HIS A O     1 
ATOM   215  C  CB    . HIS A 1 29  ? -1.194  -7.923  -37.976 1.00 75.75  ? 29  HIS A CB    1 
ATOM   216  C  CG    . HIS A 1 29  ? -2.186  -7.865  -36.867 1.00 75.55  ? 29  HIS A CG    1 
ATOM   217  N  ND1   . HIS A 1 29  ? -3.187  -6.923  -36.821 1.00 76.79  ? 29  HIS A ND1   1 
ATOM   218  C  CD2   . HIS A 1 29  ? -2.348  -8.639  -35.769 1.00 74.36  ? 29  HIS A CD2   1 
ATOM   219  C  CE1   . HIS A 1 29  ? -3.915  -7.108  -35.734 1.00 76.37  ? 29  HIS A CE1   1 
ATOM   220  N  NE2   . HIS A 1 29  ? -3.430  -8.147  -35.082 1.00 74.91  ? 29  HIS A NE2   1 
ATOM   221  N  N     . ARG A 1 30  ? -2.314  -10.351 -39.657 1.00 75.85  ? 30  ARG A N     1 
ATOM   222  C  CA    . ARG A 1 30  ? -3.351  -11.339 -40.007 1.00 76.01  ? 30  ARG A CA    1 
ATOM   223  C  C     . ARG A 1 30  ? -2.861  -12.793 -39.935 1.00 74.82  ? 30  ARG A C     1 
ATOM   224  O  O     . ARG A 1 30  ? -3.616  -13.682 -39.536 1.00 74.42  ? 30  ARG A O     1 
ATOM   225  C  CB    . ARG A 1 30  ? -3.951  -11.049 -41.387 1.00 77.57  ? 30  ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 30  ? -4.799  -9.789  -41.424 1.00 78.92  ? 30  ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 30  ? -5.647  -9.727  -42.678 1.00 80.43  ? 30  ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 30  ? -4.836  -9.627  -43.890 1.00 81.06  ? 30  ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 30  ? -4.319  -8.501  -44.391 1.00 82.05  ? 30  ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 30  ? -4.495  -7.320  -43.802 1.00 82.55  ? 30  ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 30  ? -3.608  -8.553  -45.509 1.00 82.64  ? 30  ARG A NH2   1 
ATOM   232  N  N     . MET A 1 31  ? -1.602  -13.023 -40.299 1.00 74.34  ? 31  MET A N     1 
ATOM   233  C  CA    . MET A 1 31  ? -0.992  -14.352 -40.190 1.00 73.26  ? 31  MET A CA    1 
ATOM   234  C  C     . MET A 1 31  ? -0.766  -14.765 -38.739 1.00 71.88  ? 31  MET A C     1 
ATOM   235  O  O     . MET A 1 31  ? -0.937  -15.934 -38.395 1.00 71.16  ? 31  MET A O     1 
ATOM   236  C  CB    . MET A 1 31  ? 0.345   -14.402 -40.915 1.00 73.22  ? 31  MET A CB    1 
ATOM   237  C  CG    . MET A 1 31  ? 0.288   -14.142 -42.407 1.00 74.59  ? 31  MET A CG    1 
ATOM   238  S  SD    . MET A 1 31  ? 1.913   -13.647 -43.008 1.00 74.76  ? 31  MET A SD    1 
ATOM   239  C  CE    . MET A 1 31  ? 2.879   -15.114 -42.650 1.00 73.38  ? 31  MET A CE    1 
ATOM   240  N  N     . LEU A 1 32  ? -0.363  -13.816 -37.899 1.00 71.60  ? 32  LEU A N     1 
ATOM   241  C  CA    . LEU A 1 32  ? -0.224  -14.081 -36.466 1.00 70.43  ? 32  LEU A CA    1 
ATOM   242  C  C     . LEU A 1 32  ? -1.512  -14.628 -35.847 1.00 70.39  ? 32  LEU A C     1 
ATOM   243  O  O     . LEU A 1 32  ? -1.478  -15.576 -35.050 1.00 69.44  ? 32  LEU A O     1 
ATOM   244  C  CB    . LEU A 1 32  ? 0.208   -12.821 -35.713 1.00 70.41  ? 32  LEU A CB    1 
ATOM   245  C  CG    . LEU A 1 32  ? 1.691   -12.463 -35.776 1.00 69.99  ? 32  LEU A CG    1 
ATOM   246  C  CD1   . LEU A 1 32  ? 1.923   -11.037 -35.304 1.00 70.40  ? 32  LEU A CD1   1 
ATOM   247  C  CD2   . LEU A 1 32  ? 2.517   -13.427 -34.938 1.00 68.59  ? 32  LEU A CD2   1 
ATOM   248  N  N     . VAL A 1 33  ? -2.641  -14.045 -36.246 1.00 71.51  ? 33  VAL A N     1 
ATOM   249  C  CA    . VAL A 1 33  ? -3.948  -14.451 -35.732 1.00 71.71  ? 33  VAL A CA    1 
ATOM   250  C  C     . VAL A 1 33  ? -4.371  -15.793 -36.337 1.00 71.65  ? 33  VAL A C     1 
ATOM   251  O  O     . VAL A 1 33  ? -4.920  -16.646 -35.634 1.00 71.17  ? 33  VAL A O     1 
ATOM   252  C  CB    . VAL A 1 33  ? -5.029  -13.383 -35.993 1.00 73.06  ? 33  VAL A CB    1 
ATOM   253  C  CG1   . VAL A 1 33  ? -6.358  -13.807 -35.372 1.00 73.30  ? 33  VAL A CG1   1 
ATOM   254  C  CG2   . VAL A 1 33  ? -4.602  -12.035 -35.423 1.00 73.25  ? 33  VAL A CG2   1 
ATOM   255  N  N     . GLU A 1 34  ? -4.107  -15.972 -37.634 1.00 72.22  ? 34  GLU A N     1 
ATOM   256  C  CA    . GLU A 1 34  ? -4.330  -17.259 -38.320 1.00 72.21  ? 34  GLU A CA    1 
ATOM   257  C  C     . GLU A 1 34  ? -3.615  -18.407 -37.592 1.00 70.90  ? 34  GLU A C     1 
ATOM   258  O  O     . GLU A 1 34  ? -4.144  -19.513 -37.514 1.00 70.73  ? 34  GLU A O     1 
ATOM   259  C  CB    . GLU A 1 34  ? -3.859  -17.181 -39.782 1.00 72.99  ? 34  GLU A CB    1 
ATOM   260  C  CG    . GLU A 1 34  ? -4.308  -18.322 -40.696 1.00 73.39  ? 34  GLU A CG    1 
ATOM   261  C  CD    . GLU A 1 34  ? -5.686  -18.089 -41.327 1.00 74.66  ? 34  GLU A CD    1 
ATOM   262  O  OE1   . GLU A 1 34  ? -6.681  -17.951 -40.562 1.00 74.74  ? 34  GLU A OE1   1 
ATOM   263  O  OE2   . GLU A 1 34  ? -5.774  -18.058 -42.588 1.00 75.66  ? 34  GLU A OE2   1 
ATOM   264  N  N     . ALA A 1 35  ? -2.431  -18.121 -37.047 1.00 70.06  ? 35  ALA A N     1 
ATOM   265  C  CA    . ALA A 1 35  ? -1.653  -19.090 -36.275 1.00 68.86  ? 35  ALA A CA    1 
ATOM   266  C  C     . ALA A 1 35  ? -2.129  -19.221 -34.840 1.00 68.21  ? 35  ALA A C     1 
ATOM   267  O  O     . ALA A 1 35  ? -2.595  -20.280 -34.432 1.00 67.89  ? 35  ALA A O     1 
ATOM   268  C  CB    . ALA A 1 35  ? -0.186  -18.700 -36.285 1.00 68.33  ? 35  ALA A CB    1 
ATOM   269  N  N     . PHE A 1 36  ? -2.008  -18.131 -34.089 1.00 68.12  ? 36  PHE A N     1 
ATOM   270  C  CA    . PHE A 1 36  ? -2.107  -18.169 -32.625 1.00 67.39  ? 36  PHE A CA    1 
ATOM   271  C  C     . PHE A 1 36  ? -3.416  -17.659 -32.019 1.00 68.00  ? 36  PHE A C     1 
ATOM   272  O  O     . PHE A 1 36  ? -3.546  -17.591 -30.789 1.00 67.55  ? 36  PHE A O     1 
ATOM   273  C  CB    . PHE A 1 36  ? -0.949  -17.366 -32.022 1.00 66.79  ? 36  PHE A CB    1 
ATOM   274  C  CG    . PHE A 1 36  ? 0.406   -17.772 -32.529 1.00 66.24  ? 36  PHE A CG    1 
ATOM   275  C  CD1   . PHE A 1 36  ? 0.797   -19.110 -32.516 1.00 65.61  ? 36  PHE A CD1   1 
ATOM   276  C  CD2   . PHE A 1 36  ? 1.298   -16.822 -32.994 1.00 66.44  ? 36  PHE A CD2   1 
ATOM   277  C  CE1   . PHE A 1 36  ? 2.046   -19.490 -32.970 1.00 65.21  ? 36  PHE A CE1   1 
ATOM   278  C  CE2   . PHE A 1 36  ? 2.548   -17.196 -33.445 1.00 66.03  ? 36  PHE A CE2   1 
ATOM   279  C  CZ    . PHE A 1 36  ? 2.924   -18.531 -33.431 1.00 65.41  ? 36  PHE A CZ    1 
ATOM   280  N  N     . GLY A 1 37  ? -4.382  -17.302 -32.863 1.00 69.11  ? 37  GLY A N     1 
ATOM   281  C  CA    . GLY A 1 37  ? -5.644  -16.744 -32.387 1.00 69.89  ? 37  GLY A CA    1 
ATOM   282  C  C     . GLY A 1 37  ? -5.512  -15.300 -31.938 1.00 70.24  ? 37  GLY A C     1 
ATOM   283  O  O     . GLY A 1 37  ? -4.507  -14.642 -32.198 1.00 70.05  ? 37  GLY A O     1 
ATOM   284  N  N     . GLU A 1 38  ? -6.515  -14.832 -31.200 1.00 70.80  ? 38  GLU A N     1 
ATOM   285  C  CA    . GLU A 1 38  ? -6.670  -13.401 -30.885 1.00 71.51  ? 38  GLU A CA    1 
ATOM   286  C  C     . GLU A 1 38  ? -5.744  -12.850 -29.822 1.00 70.73  ? 38  GLU A C     1 
ATOM   287  O  O     . GLU A 1 38  ? -5.855  -11.669 -29.499 1.00 71.34  ? 38  GLU A O     1 
ATOM   288  C  CB    . GLU A 1 38  ? -8.090  -13.121 -30.347 1.00 72.46  ? 38  GLU A CB    1 
ATOM   289  C  CG    . GLU A 1 38  ? -8.691  -11.794 -30.812 1.00 73.86  ? 38  GLU A CG    1 
ATOM   290  C  CD    . GLU A 1 38  ? -9.734  -11.232 -29.827 1.00 74.63  ? 38  GLU A CD    1 
ATOM   291  O  OE1   . GLU A 1 38  ? -10.852 -10.884 -30.292 1.00 75.94  ? 38  GLU A OE1   1 
ATOM   292  O  OE2   . GLU A 1 38  ? -9.455  -11.153 -28.591 1.00 74.01  ? 38  GLU A OE2   1 
ATOM   293  N  N     . GLN A 1 39  ? -4.859  -13.682 -29.276 1.00 69.48  ? 39  GLN A N     1 
ATOM   294  C  CA    . GLN A 1 39  ? -4.040  -13.304 -28.117 1.00 68.69  ? 39  GLN A CA    1 
ATOM   295  C  C     . GLN A 1 39  ? -2.940  -12.316 -28.523 1.00 68.67  ? 39  GLN A C     1 
ATOM   296  O  O     . GLN A 1 39  ? -2.487  -11.519 -27.699 1.00 68.51  ? 39  GLN A O     1 
ATOM   297  C  CB    . GLN A 1 39  ? -3.391  -14.531 -27.434 1.00 67.43  ? 39  GLN A CB    1 
ATOM   298  C  CG    . GLN A 1 39  ? -4.231  -15.812 -27.354 1.00 67.37  ? 39  GLN A CG    1 
ATOM   299  C  CD    . GLN A 1 39  ? -5.698  -15.574 -26.978 1.00 68.33  ? 39  GLN A CD    1 
ATOM   300  O  OE1   . GLN A 1 39  ? -6.570  -15.456 -27.854 1.00 69.28  ? 39  GLN A OE1   1 
ATOM   301  N  NE2   . GLN A 1 39  ? -5.976  -15.502 -25.673 1.00 68.18  ? 39  GLN A NE2   1 
ATOM   302  N  N     . VAL A 1 40  ? -2.556  -12.360 -29.803 1.00 68.95  ? 40  VAL A N     1 
ATOM   303  C  CA    . VAL A 1 40  ? -1.404  -11.629 -30.336 1.00 68.93  ? 40  VAL A CA    1 
ATOM   304  C  C     . VAL A 1 40  ? -1.606  -10.115 -30.374 1.00 69.96  ? 40  VAL A C     1 
ATOM   305  O  O     . VAL A 1 40  ? -2.724  -9.637  -30.181 1.00 70.84  ? 40  VAL A O     1 
ATOM   306  C  CB    . VAL A 1 40  ? -1.041  -12.127 -31.746 1.00 69.14  ? 40  VAL A CB    1 
ATOM   307  C  CG1   . VAL A 1 40  ? -0.811  -13.629 -31.721 1.00 68.21  ? 40  VAL A CG1   1 
ATOM   308  C  CG2   . VAL A 1 40  ? -2.096  -11.722 -32.772 1.00 70.49  ? 40  VAL A CG2   1 
ATOM   309  N  N     . PRO A 1 41  ? -0.523  -9.349  -30.617 1.00 69.96  ? 41  PRO A N     1 
ATOM   310  C  CA    . PRO A 1 41  ? -0.626  -7.894  -30.473 1.00 70.91  ? 41  PRO A CA    1 
ATOM   311  C  C     . PRO A 1 41  ? -1.405  -7.196  -31.575 1.00 72.42  ? 41  PRO A C     1 
ATOM   312  O  O     . PRO A 1 41  ? -1.789  -7.820  -32.562 1.00 72.72  ? 41  PRO A O     1 
ATOM   313  C  CB    . PRO A 1 41  ? 0.831   -7.425  -30.533 1.00 70.48  ? 41  PRO A CB    1 
ATOM   314  C  CG    . PRO A 1 41  ? 1.653   -8.640  -30.346 1.00 69.14  ? 41  PRO A CG    1 
ATOM   315  C  CD    . PRO A 1 41  ? 0.856   -9.744  -30.935 1.00 69.14  ? 41  PRO A CD    1 
ATOM   316  N  N     . THR A 1 42  ? -1.595  -5.892  -31.391 1.00 73.41  ? 42  THR A N     1 
ATOM   317  C  CA    . THR A 1 42  ? -2.273  -5.054  -32.362 1.00 75.01  ? 42  THR A CA    1 
ATOM   318  C  C     . THR A 1 42  ? -1.440  -4.921  -33.628 1.00 75.35  ? 42  THR A C     1 
ATOM   319  O  O     . THR A 1 42  ? -0.261  -5.267  -33.644 1.00 74.43  ? 42  THR A O     1 
ATOM   320  C  CB    . THR A 1 42  ? -2.530  -3.647  -31.794 1.00 76.03  ? 42  THR A CB    1 
ATOM   321  O  OG1   . THR A 1 42  ? -1.297  -3.073  -31.357 1.00 75.53  ? 42  THR A OG1   1 
ATOM   322  C  CG2   . THR A 1 42  ? -3.484  -3.707  -30.622 1.00 75.98  ? 42  THR A CG2   1 
ATOM   323  N  N     . VAL A 1 43  ? -2.068  -4.422  -34.688 1.00 76.78  ? 43  VAL A N     1 
ATOM   324  C  CA    . VAL A 1 43  ? -1.355  -4.064  -35.911 1.00 77.47  ? 43  VAL A CA    1 
ATOM   325  C  C     . VAL A 1 43  ? -0.360  -2.937  -35.648 1.00 77.74  ? 43  VAL A C     1 
ATOM   326  O  O     . VAL A 1 43  ? 0.677   -2.874  -36.293 1.00 77.70  ? 43  VAL A O     1 
ATOM   327  C  CB    . VAL A 1 43  ? -2.323  -3.617  -37.031 1.00 79.17  ? 43  VAL A CB    1 
ATOM   328  C  CG1   . VAL A 1 43  ? -2.865  -2.209  -36.783 1.00 80.59  ? 43  VAL A CG1   1 
ATOM   329  C  CG2   . VAL A 1 43  ? -1.659  -3.725  -38.397 1.00 79.69  ? 43  VAL A CG2   1 
ATOM   330  N  N     . LYS A 1 44  ? -0.690  -2.053  -34.704 1.00 78.09  ? 44  LYS A N     1 
ATOM   331  C  CA    . LYS A 1 44  ? 0.114   -0.871  -34.438 1.00 78.57  ? 44  LYS A CA    1 
ATOM   332  C  C     . LYS A 1 44  ? 1.498   -1.249  -33.972 1.00 77.19  ? 44  LYS A C     1 
ATOM   333  O  O     . LYS A 1 44  ? 2.463   -0.626  -34.394 1.00 77.57  ? 44  LYS A O     1 
ATOM   334  C  CB    . LYS A 1 44  ? -0.555  0.053   -33.413 1.00 79.19  ? 44  LYS A CB    1 
ATOM   335  C  CG    . LYS A 1 44  ? 0.164   1.379   -33.173 1.00 79.96  ? 44  LYS A CG    1 
ATOM   336  C  CD    . LYS A 1 44  ? 0.246   2.266   -34.406 1.00 81.64  ? 44  LYS A CD    1 
ATOM   337  C  CE    . LYS A 1 44  ? 0.848   3.617   -34.057 1.00 82.53  ? 44  LYS A CE    1 
ATOM   338  N  NZ    . LYS A 1 44  ? 1.117   4.484   -35.231 1.00 84.17  ? 44  LYS A NZ    1 
ATOM   339  N  N     . THR A 1 45  ? 1.608   -2.261  -33.116 1.00 75.66  ? 45  THR A N     1 
ATOM   340  C  CA    . THR A 1 45  ? 2.930   -2.684  -32.650 1.00 74.35  ? 45  THR A CA    1 
ATOM   341  C  C     . THR A 1 45  ? 3.714   -3.354  -33.772 1.00 74.14  ? 45  THR A C     1 
ATOM   342  O  O     . THR A 1 45  ? 4.919   -3.122  -33.888 1.00 73.91  ? 45  THR A O     1 
ATOM   343  C  CB    . THR A 1 45  ? 2.893   -3.558  -31.377 1.00 72.87  ? 45  THR A CB    1 
ATOM   344  O  OG1   . THR A 1 45  ? 1.961   -4.625  -31.538 1.00 72.55  ? 45  THR A OG1   1 
ATOM   345  C  CG2   . THR A 1 45  ? 2.497   -2.726  -30.181 1.00 73.09  ? 45  THR A CG2   1 
ATOM   346  N  N     . CYS A 1 46  ? 3.048   -4.130  -34.625 1.00 74.36  ? 46  CYS A N     1 
ATOM   347  C  CA    . CYS A 1 46  ? 3.728   -4.710  -35.784 1.00 74.40  ? 46  CYS A CA    1 
ATOM   348  C  C     . CYS A 1 46  ? 4.356   -3.613  -36.637 1.00 75.67  ? 46  CYS A C     1 
ATOM   349  O  O     . CYS A 1 46  ? 5.532   -3.703  -36.987 1.00 75.42  ? 46  CYS A O     1 
ATOM   350  C  CB    . CYS A 1 46  ? 2.776   -5.560  -36.618 1.00 74.72  ? 46  CYS A CB    1 
ATOM   351  S  SG    . CYS A 1 46  ? 1.989   -6.900  -35.701 1.00 73.39  ? 46  CYS A SG    1 
ATOM   352  N  N     . GLU A 1 47  ? 3.579   -2.565  -36.920 1.00 77.11  ? 47  GLU A N     1 
ATOM   353  C  CA    . GLU A 1 47  ? 4.059   -1.380  -37.660 1.00 78.56  ? 47  GLU A CA    1 
ATOM   354  C  C     . GLU A 1 47  ? 5.302   -0.733  -37.004 1.00 78.16  ? 47  GLU A C     1 
ATOM   355  O  O     . GLU A 1 47  ? 6.222   -0.303  -37.704 1.00 78.79  ? 47  GLU A O     1 
ATOM   356  C  CB    . GLU A 1 47  ? 2.935   -0.332  -37.810 1.00 80.14  ? 47  GLU A CB    1 
ATOM   357  C  CG    . GLU A 1 47  ? 1.782   -0.761  -38.717 1.00 80.96  ? 47  GLU A CG    1 
ATOM   358  C  CD    . GLU A 1 47  ? 0.523   0.096   -38.599 1.00 82.32  ? 47  GLU A CD    1 
ATOM   359  O  OE1   . GLU A 1 47  ? 0.403   0.902   -37.658 1.00 82.46  ? 47  GLU A OE1   1 
ATOM   360  O  OE2   . GLU A 1 47  ? -0.367  -0.056  -39.467 1.00 83.30  ? 47  GLU A OE2   1 
ATOM   361  N  N     . ARG A 1 48  ? 5.318   -0.687  -35.673 1.00 77.18  ? 48  ARG A N     1 
ATOM   362  C  CA    . ARG A 1 48  ? 6.455   -0.152  -34.915 1.00 76.69  ? 48  ARG A CA    1 
ATOM   363  C  C     . ARG A 1 48  ? 7.716   -0.994  -35.098 1.00 75.61  ? 48  ARG A C     1 
ATOM   364  O  O     . ARG A 1 48  ? 8.726   -0.481  -35.555 1.00 76.11  ? 48  ARG A O     1 
ATOM   365  C  CB    . ARG A 1 48  ? 6.114   -0.005  -33.423 1.00 75.90  ? 48  ARG A CB    1 
ATOM   366  C  CG    . ARG A 1 48  ? 5.325   1.254   -33.097 1.00 77.22  ? 48  ARG A CG    1 
ATOM   367  C  CD    . ARG A 1 48  ? 4.421   1.070   -31.896 1.00 76.66  ? 48  ARG A CD    1 
ATOM   368  N  NE    . ARG A 1 48  ? 3.676   2.287   -31.576 1.00 78.03  ? 48  ARG A NE    1 
ATOM   369  C  CZ    . ARG A 1 48  ? 2.588   2.342   -30.805 1.00 78.18  ? 48  ARG A CZ    1 
ATOM   370  N  NH1   . ARG A 1 48  ? 2.069   1.250   -30.244 1.00 77.03  ? 48  ARG A NH1   1 
ATOM   371  N  NH2   . ARG A 1 48  ? 1.994   3.509   -30.598 1.00 79.61  ? 48  ARG A NH2   1 
ATOM   372  N  N     . TRP A 1 49  ? 7.640   -2.283  -34.786 1.00 74.26  ? 49  TRP A N     1 
ATOM   373  C  CA    . TRP A 1 49  ? 8.789   -3.187  -34.956 1.00 73.26  ? 49  TRP A CA    1 
ATOM   374  C  C     . TRP A 1 49  ? 9.388   -3.167  -36.359 1.00 74.19  ? 49  TRP A C     1 
ATOM   375  O  O     . TRP A 1 49  ? 10.601  -3.289  -36.531 1.00 73.93  ? 49  TRP A O     1 
ATOM   376  C  CB    . TRP A 1 49  ? 8.413   -4.622  -34.562 1.00 71.93  ? 49  TRP A CB    1 
ATOM   377  C  CG    . TRP A 1 49  ? 8.418   -4.791  -33.107 1.00 70.79  ? 49  TRP A CG    1 
ATOM   378  C  CD1   . TRP A 1 49  ? 7.351   -4.758  -32.275 1.00 70.61  ? 49  TRP A CD1   1 
ATOM   379  C  CD2   . TRP A 1 49  ? 9.565   -4.963  -32.287 1.00 69.77  ? 49  TRP A CD2   1 
ATOM   380  N  NE1   . TRP A 1 49  ? 7.755   -4.918  -30.979 1.00 69.54  ? 49  TRP A NE1   1 
ATOM   381  C  CE2   . TRP A 1 49  ? 9.115   -5.047  -30.956 1.00 68.99  ? 49  TRP A CE2   1 
ATOM   382  C  CE3   . TRP A 1 49  ? 10.935  -5.057  -32.546 1.00 69.51  ? 49  TRP A CE3   1 
ATOM   383  C  CZ2   . TRP A 1 49  ? 9.981   -5.224  -29.883 1.00 67.95  ? 49  TRP A CZ2   1 
ATOM   384  C  CZ3   . TRP A 1 49  ? 11.797  -5.235  -31.485 1.00 68.47  ? 49  TRP A CZ3   1 
ATOM   385  C  CH2   . TRP A 1 49  ? 11.316  -5.319  -30.163 1.00 67.68  ? 49  TRP A CH2   1 
ATOM   386  N  N     . PHE A 1 50  ? 8.525   -3.013  -37.357 1.00 75.35  ? 50  PHE A N     1 
ATOM   387  C  CA    . PHE A 1 50  ? 8.963   -2.832  -38.744 1.00 76.55  ? 50  PHE A CA    1 
ATOM   388  C  C     . PHE A 1 50  ? 9.843   -1.597  -38.925 1.00 77.58  ? 50  PHE A C     1 
ATOM   389  O  O     . PHE A 1 50  ? 10.797  -1.643  -39.702 1.00 78.02  ? 50  PHE A O     1 
ATOM   390  C  CB    . PHE A 1 50  ? 7.761   -2.799  -39.705 1.00 77.73  ? 50  PHE A CB    1 
ATOM   391  C  CG    . PHE A 1 50  ? 7.352   -4.163  -40.224 1.00 77.14  ? 50  PHE A CG    1 
ATOM   392  C  CD1   . PHE A 1 50  ? 7.403   -5.305  -39.411 1.00 75.50  ? 50  PHE A CD1   1 
ATOM   393  C  CD2   . PHE A 1 50  ? 6.897   -4.308  -41.531 1.00 78.32  ? 50  PHE A CD2   1 
ATOM   394  C  CE1   . PHE A 1 50  ? 7.025   -6.549  -39.899 1.00 75.07  ? 50  PHE A CE1   1 
ATOM   395  C  CE2   . PHE A 1 50  ? 6.516   -5.549  -42.019 1.00 77.86  ? 50  PHE A CE2   1 
ATOM   396  C  CZ    . PHE A 1 50  ? 6.577   -6.671  -41.201 1.00 76.24  ? 50  PHE A CZ    1 
ATOM   397  N  N     . GLN A 1 51  ? 9.540   -0.516  -38.206 1.00 78.01  ? 51  GLN A N     1 
ATOM   398  C  CA    . GLN A 1 51  ? 10.413  0.660   -38.210 1.00 78.92  ? 51  GLN A CA    1 
ATOM   399  C  C     . GLN A 1 51  ? 11.797  0.292   -37.708 1.00 77.83  ? 51  GLN A C     1 
ATOM   400  O  O     . GLN A 1 51  ? 12.787  0.651   -38.341 1.00 78.55  ? 51  GLN A O     1 
ATOM   401  C  CB    . GLN A 1 51  ? 9.850   1.812   -37.373 1.00 79.48  ? 51  GLN A CB    1 
ATOM   402  C  CG    . GLN A 1 51  ? 8.531   2.361   -37.889 1.00 80.85  ? 51  GLN A CG    1 
ATOM   403  C  CD    . GLN A 1 51  ? 8.047   3.578   -37.124 1.00 81.64  ? 51  GLN A CD    1 
ATOM   404  O  OE1   . GLN A 1 51  ? 8.562   3.909   -36.053 1.00 80.95  ? 51  GLN A OE1   1 
ATOM   405  N  NE2   . GLN A 1 51  ? 7.040   4.252   -37.674 1.00 83.18  ? 51  GLN A NE2   1 
ATOM   406  N  N     . ARG A 1 52  ? 11.859  -0.437  -36.592 1.00 76.19  ? 52  ARG A N     1 
ATOM   407  C  CA    . ARG A 1 52  ? 13.149  -0.848  -36.017 1.00 75.10  ? 52  ARG A CA    1 
ATOM   408  C  C     . ARG A 1 52  ? 13.939  -1.763  -36.930 1.00 74.94  ? 52  ARG A C     1 
ATOM   409  O  O     . ARG A 1 52  ? 15.171  -1.679  -36.969 1.00 74.90  ? 52  ARG A O     1 
ATOM   410  C  CB    . ARG A 1 52  ? 12.993  -1.524  -34.656 1.00 73.44  ? 52  ARG A CB    1 
ATOM   411  C  CG    . ARG A 1 52  ? 13.182  -0.567  -33.507 1.00 73.36  ? 52  ARG A CG    1 
ATOM   412  C  CD    . ARG A 1 52  ? 12.658  -1.169  -32.175 1.00 71.97  ? 52  ARG A CD    1 
ATOM   413  N  NE    . ARG A 1 52  ? 13.611  -2.066  -31.509 1.00 70.55  ? 52  ARG A NE    1 
ATOM   414  C  CZ    . ARG A 1 52  ? 13.558  -2.400  -30.209 1.00 69.42  ? 52  ARG A CZ    1 
ATOM   415  N  NH1   . ARG A 1 52  ? 12.598  -1.920  -29.398 1.00 69.51  ? 52  ARG A NH1   1 
ATOM   416  N  NH2   . ARG A 1 52  ? 14.472  -3.232  -29.697 1.00 68.25  ? 52  ARG A NH2   1 
ATOM   417  N  N     . PHE A 1 53  ? 13.245  -2.647  -37.641 1.00 74.90  ? 53  PHE A N     1 
ATOM   418  C  CA    . PHE A 1 53  ? 13.914  -3.525  -38.592 1.00 74.94  ? 53  PHE A CA    1 
ATOM   419  C  C     . PHE A 1 53  ? 14.458  -2.730  -39.780 1.00 76.62  ? 53  PHE A C     1 
ATOM   420  O  O     . PHE A 1 53  ? 15.560  -3.025  -40.251 1.00 76.75  ? 53  PHE A O     1 
ATOM   421  C  CB    . PHE A 1 53  ? 13.002  -4.653  -39.076 1.00 74.59  ? 53  PHE A CB    1 
ATOM   422  C  CG    . PHE A 1 53  ? 12.392  -5.490  -37.978 1.00 73.08  ? 53  PHE A CG    1 
ATOM   423  C  CD1   . PHE A 1 53  ? 13.097  -5.807  -36.817 1.00 71.77  ? 53  PHE A CD1   1 
ATOM   424  C  CD2   . PHE A 1 53  ? 11.115  -6.002  -38.131 1.00 73.04  ? 53  PHE A CD2   1 
ATOM   425  C  CE1   . PHE A 1 53  ? 12.522  -6.590  -35.832 1.00 70.50  ? 53  PHE A CE1   1 
ATOM   426  C  CE2   . PHE A 1 53  ? 10.540  -6.785  -37.150 1.00 71.78  ? 53  PHE A CE2   1 
ATOM   427  C  CZ    . PHE A 1 53  ? 11.242  -7.080  -35.998 1.00 70.52  ? 53  PHE A CZ    1 
ATOM   428  N  N     . LYS A 1 54  ? 13.711  -1.720  -40.240 1.00 78.00  ? 54  LYS A N     1 
ATOM   429  C  CA    . LYS A 1 54  ? 14.186  -0.810  -41.312 1.00 79.81  ? 54  LYS A CA    1 
ATOM   430  C  C     . LYS A 1 54  ? 15.454  -0.015  -40.942 1.00 80.07  ? 54  LYS A C     1 
ATOM   431  O  O     . LYS A 1 54  ? 16.179  0.430   -41.832 1.00 81.35  ? 54  LYS A O     1 
ATOM   432  C  CB    . LYS A 1 54  ? 13.075  0.139   -41.789 1.00 81.29  ? 54  LYS A CB    1 
ATOM   433  C  CG    . LYS A 1 54  ? 12.065  -0.538  -42.705 1.00 81.71  ? 54  LYS A CG    1 
ATOM   434  C  CD    . LYS A 1 54  ? 11.063  0.423   -43.330 1.00 83.43  ? 54  LYS A CD    1 
ATOM   435  C  CE    . LYS A 1 54  ? 10.008  -0.339  -44.130 1.00 83.71  ? 54  LYS A CE    1 
ATOM   436  N  NZ    . LYS A 1 54  ? 9.132   0.549   -44.952 1.00 85.61  ? 54  LYS A NZ    1 
ATOM   437  N  N     . SER A 1 55  ? 15.718  0.151   -39.644 1.00 78.93  ? 55  SER A N     1 
ATOM   438  C  CA    . SER A 1 55  ? 17.021  0.616   -39.154 1.00 78.81  ? 55  SER A CA    1 
ATOM   439  C  C     . SER A 1 55  ? 17.863  -0.544  -38.587 1.00 77.19  ? 55  SER A C     1 
ATOM   440  O  O     . SER A 1 55  ? 18.529  -0.378  -37.566 1.00 76.36  ? 55  SER A O     1 
ATOM   441  C  CB    . SER A 1 55  ? 16.828  1.696   -38.078 1.00 78.83  ? 55  SER A CB    1 
ATOM   442  O  OG    . SER A 1 55  ? 16.403  1.138   -36.845 1.00 77.20  ? 55  SER A OG    1 
ATOM   443  N  N     . GLY A 1 56  ? 17.809  -1.713  -39.231 1.00 76.79  ? 56  GLY A N     1 
ATOM   444  C  CA    . GLY A 1 56  ? 18.587  -2.898  -38.839 1.00 75.43  ? 56  GLY A CA    1 
ATOM   445  C  C     . GLY A 1 56  ? 18.710  -3.283  -37.369 1.00 73.76  ? 56  GLY A C     1 
ATOM   446  O  O     . GLY A 1 56  ? 19.680  -3.934  -37.000 1.00 72.95  ? 56  GLY A O     1 
ATOM   447  N  N     . ASP A 1 57  ? 17.748  -2.887  -36.530 1.00 73.34  ? 57  ASP A N     1 
ATOM   448  C  CA    . ASP A 1 57  ? 17.770  -3.206  -35.100 1.00 71.87  ? 57  ASP A CA    1 
ATOM   449  C  C     . ASP A 1 57  ? 16.927  -4.455  -34.881 1.00 70.78  ? 57  ASP A C     1 
ATOM   450  O  O     . ASP A 1 57  ? 15.736  -4.364  -34.590 1.00 70.71  ? 57  ASP A O     1 
ATOM   451  C  CB    . ASP A 1 57  ? 17.258  -2.026  -34.246 1.00 72.14  ? 57  ASP A CB    1 
ATOM   452  C  CG    . ASP A 1 57  ? 17.342  -2.293  -32.721 1.00 70.72  ? 57  ASP A CG    1 
ATOM   453  O  OD1   . ASP A 1 57  ? 17.572  -3.451  -32.294 1.00 69.48  ? 57  ASP A OD1   1 
ATOM   454  O  OD2   . ASP A 1 57  ? 17.195  -1.328  -31.933 1.00 70.94  ? 57  ASP A OD2   1 
ATOM   455  N  N     . PHE A 1 58  ? 17.574  -5.615  -34.984 1.00 70.00  ? 58  PHE A N     1 
ATOM   456  C  CA    . PHE A 1 58  ? 16.919  -6.908  -34.763 1.00 68.98  ? 58  PHE A CA    1 
ATOM   457  C  C     . PHE A 1 58  ? 17.056  -7.425  -33.324 1.00 67.53  ? 58  PHE A C     1 
ATOM   458  O  O     . PHE A 1 58  ? 16.870  -8.617  -33.055 1.00 66.62  ? 58  PHE A O     1 
ATOM   459  C  CB    . PHE A 1 58  ? 17.441  -7.924  -35.775 1.00 69.13  ? 58  PHE A CB    1 
ATOM   460  C  CG    . PHE A 1 58  ? 17.272  -7.479  -37.187 1.00 70.61  ? 58  PHE A CG    1 
ATOM   461  C  CD1   . PHE A 1 58  ? 16.032  -7.541  -37.794 1.00 71.14  ? 58  PHE A CD1   1 
ATOM   462  C  CD2   . PHE A 1 58  ? 18.338  -6.952  -37.899 1.00 71.59  ? 58  PHE A CD2   1 
ATOM   463  C  CE1   . PHE A 1 58  ? 15.855  -7.113  -39.103 1.00 72.60  ? 58  PHE A CE1   1 
ATOM   464  C  CE2   . PHE A 1 58  ? 18.176  -6.525  -39.212 1.00 73.08  ? 58  PHE A CE2   1 
ATOM   465  C  CZ    . PHE A 1 58  ? 16.929  -6.604  -39.815 1.00 73.58  ? 58  PHE A CZ    1 
ATOM   466  N  N     . ASP A 1 59  ? 17.374  -6.525  -32.397 1.00 67.40  ? 59  ASP A N     1 
ATOM   467  C  CA    . ASP A 1 59  ? 17.289  -6.849  -30.985 1.00 66.20  ? 59  ASP A CA    1 
ATOM   468  C  C     . ASP A 1 59  ? 15.831  -7.108  -30.676 1.00 65.97  ? 59  ASP A C     1 
ATOM   469  O  O     . ASP A 1 59  ? 14.967  -6.320  -31.036 1.00 66.83  ? 59  ASP A O     1 
ATOM   470  C  CB    . ASP A 1 59  ? 17.824  -5.709  -30.105 1.00 66.31  ? 59  ASP A CB    1 
ATOM   471  C  CG    . ASP A 1 59  ? 17.838  -6.057  -28.616 1.00 65.11  ? 59  ASP A CG    1 
ATOM   472  O  OD1   . ASP A 1 59  ? 17.937  -7.250  -28.241 1.00 64.12  ? 59  ASP A OD1   1 
ATOM   473  O  OD2   . ASP A 1 59  ? 17.767  -5.108  -27.808 1.00 65.25  ? 59  ASP A OD2   1 
ATOM   474  N  N     . VAL A 1 60  ? 15.579  -8.235  -30.031 1.00 64.89  ? 60  VAL A N     1 
ATOM   475  C  CA    . VAL A 1 60  ? 14.237  -8.646  -29.623 1.00 64.58  ? 60  VAL A CA    1 
ATOM   476  C  C     . VAL A 1 60  ? 13.927  -8.195  -28.171 1.00 64.05  ? 60  VAL A C     1 
ATOM   477  O  O     . VAL A 1 60  ? 12.790  -7.800  -27.878 1.00 64.36  ? 60  VAL A O     1 
ATOM   478  C  CB    . VAL A 1 60  ? 14.081  -10.175 -29.849 1.00 63.89  ? 60  VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 60  ? 12.991  -10.772 -28.981 1.00 63.26  ? 60  VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 60  ? 13.850  -10.478 -31.341 1.00 64.70  ? 60  VAL A CG2   1 
ATOM   481  N  N     . ASP A 1 61  ? 14.926  -8.225  -27.286 1.00 63.36  ? 61  ASP A N     1 
ATOM   482  C  CA    . ASP A 1 61  ? 14.767  -7.727  -25.912 1.00 62.96  ? 61  ASP A CA    1 
ATOM   483  C  C     . ASP A 1 61  ? 14.356  -6.266  -25.877 1.00 63.93  ? 61  ASP A C     1 
ATOM   484  O  O     . ASP A 1 61  ? 14.768  -5.472  -26.724 1.00 64.82  ? 61  ASP A O     1 
ATOM   485  C  CB    . ASP A 1 61  ? 16.076  -7.865  -25.137 1.00 62.27  ? 61  ASP A CB    1 
ATOM   486  C  CG    . ASP A 1 61  ? 16.482  -9.312  -24.917 1.00 61.30  ? 61  ASP A CG    1 
ATOM   487  O  OD1   . ASP A 1 61  ? 15.631  -10.219 -25.121 1.00 61.06  ? 61  ASP A OD1   1 
ATOM   488  O  OD2   . ASP A 1 61  ? 17.659  -9.529  -24.521 1.00 60.85  ? 61  ASP A OD2   1 
ATOM   489  N  N     . ASP A 1 62  ? 13.565  -5.907  -24.874 1.00 63.85  ? 62  ASP A N     1 
ATOM   490  C  CA    . ASP A 1 62  ? 13.187  -4.520  -24.684 1.00 64.80  ? 62  ASP A CA    1 
ATOM   491  C  C     . ASP A 1 62  ? 14.444  -3.700  -24.506 1.00 65.00  ? 62  ASP A C     1 
ATOM   492  O  O     . ASP A 1 62  ? 15.474  -4.207  -24.067 1.00 64.20  ? 62  ASP A O     1 
ATOM   493  C  CB    . ASP A 1 62  ? 12.312  -4.330  -23.428 1.00 64.62  ? 62  ASP A CB    1 
ATOM   494  C  CG    . ASP A 1 62  ? 10.955  -5.009  -23.532 1.00 64.61  ? 62  ASP A CG    1 
ATOM   495  O  OD1   . ASP A 1 62  ? 10.656  -5.598  -24.591 1.00 64.75  ? 62  ASP A OD1   1 
ATOM   496  O  OD2   . ASP A 1 62  ? 10.184  -4.952  -22.546 1.00 64.52  ? 62  ASP A OD2   1 
ATOM   497  N  N     . LYS A 1 63  ? 14.357  -2.427  -24.860 1.00 66.15  ? 63  LYS A N     1 
ATOM   498  C  CA    . LYS A 1 63  ? 15.293  -1.443  -24.340 1.00 66.46  ? 63  LYS A CA    1 
ATOM   499  C  C     . LYS A 1 63  ? 15.004  -1.366  -22.831 1.00 65.87  ? 63  LYS A C     1 
ATOM   500  O  O     . LYS A 1 63  ? 13.870  -1.593  -22.406 1.00 65.80  ? 63  LYS A O     1 
ATOM   501  C  CB    . LYS A 1 63  ? 15.097  -0.091  -25.030 1.00 67.97  ? 63  LYS A CB    1 
ATOM   502  C  CG    . LYS A 1 63  ? 15.371  -0.095  -26.533 1.00 68.72  ? 63  LYS A CG    1 
ATOM   503  C  CD    . LYS A 1 63  ? 16.866  -0.101  -26.848 1.00 68.63  ? 63  LYS A CD    1 
ATOM   504  C  CE    . LYS A 1 63  ? 17.147  -0.114  -28.349 1.00 69.50  ? 63  LYS A CE    1 
ATOM   505  N  NZ    . LYS A 1 63  ? 16.993  -1.463  -28.964 1.00 68.79  ? 63  LYS A NZ    1 
ATOM   506  N  N     . GLU A 1 64  ? 16.019  -1.076  -22.028 1.00 65.51  ? 64  GLU A N     1 
ATOM   507  C  CA    . GLU A 1 64  ? 15.875  -1.097  -20.564 1.00 64.93  ? 64  GLU A CA    1 
ATOM   508  C  C     . GLU A 1 64  ? 14.845  -0.058  -20.105 1.00 65.87  ? 64  GLU A C     1 
ATOM   509  O  O     . GLU A 1 64  ? 14.951  1.109   -20.480 1.00 66.97  ? 64  GLU A O     1 
ATOM   510  C  CB    . GLU A 1 64  ? 17.225  -0.822  -19.887 1.00 64.58  ? 64  GLU A CB    1 
ATOM   511  C  CG    . GLU A 1 64  ? 17.262  -1.146  -18.400 1.00 63.78  ? 64  GLU A CG    1 
ATOM   512  C  CD    . GLU A 1 64  ? 18.290  -0.341  -17.632 1.00 63.93  ? 64  GLU A CD    1 
ATOM   513  O  OE1   . GLU A 1 64  ? 18.463  0.862   -17.922 1.00 64.97  ? 64  GLU A OE1   1 
ATOM   514  O  OE2   . GLU A 1 64  ? 18.911  -0.914  -16.717 1.00 63.07  ? 64  GLU A OE2   1 
ATOM   515  N  N     . HIS A 1 65  ? 13.878  -0.484  -19.289 1.00 65.51  ? 65  HIS A N     1 
ATOM   516  C  CA    . HIS A 1 65  ? 12.771  0.389   -18.866 1.00 66.47  ? 65  HIS A CA    1 
ATOM   517  C  C     . HIS A 1 65  ? 13.230  1.411   -17.826 1.00 66.87  ? 65  HIS A C     1 
ATOM   518  O  O     . HIS A 1 65  ? 14.357  1.354   -17.325 1.00 66.29  ? 65  HIS A O     1 
ATOM   519  C  CB    . HIS A 1 65  ? 11.599  -0.403  -18.251 1.00 66.05  ? 65  HIS A CB    1 
ATOM   520  C  CG    . HIS A 1 65  ? 11.160  -1.582  -19.054 1.00 65.50  ? 65  HIS A CG    1 
ATOM   521  N  ND1   . HIS A 1 65  ? 11.588  -2.863  -18.777 1.00 64.27  ? 65  HIS A ND1   1 
ATOM   522  C  CD2   . HIS A 1 65  ? 10.315  -1.682  -20.105 1.00 66.07  ? 65  HIS A CD2   1 
ATOM   523  C  CE1   . HIS A 1 65  ? 11.039  -3.699  -19.637 1.00 64.11  ? 65  HIS A CE1   1 
ATOM   524  N  NE2   . HIS A 1 65  ? 10.260  -3.008  -20.451 1.00 65.17  ? 65  HIS A NE2   1 
ATOM   525  N  N     . GLY A 1 66  ? 12.322  2.329   -17.495 1.00 67.94  ? 66  GLY A N     1 
ATOM   526  C  CA    . GLY A 1 66  ? 12.497  3.233   -16.373 1.00 68.41  ? 66  GLY A CA    1 
ATOM   527  C  C     . GLY A 1 66  ? 12.755  2.466   -15.097 1.00 67.30  ? 66  GLY A C     1 
ATOM   528  O  O     . GLY A 1 66  ? 12.472  1.265   -15.000 1.00 66.33  ? 66  GLY A O     1 
ATOM   529  N  N     . LYS A 1 67  ? 13.318  3.172   -14.124 1.00 67.52  ? 67  LYS A N     1 
ATOM   530  C  CA    . LYS A 1 67  ? 13.694  2.590   -12.839 1.00 66.62  ? 67  LYS A CA    1 
ATOM   531  C  C     . LYS A 1 67  ? 13.819  3.701   -11.795 1.00 67.43  ? 67  LYS A C     1 
ATOM   532  O  O     . LYS A 1 67  ? 14.058  4.855   -12.158 1.00 68.48  ? 67  LYS A O     1 
ATOM   533  C  CB    . LYS A 1 67  ? 15.015  1.839   -12.980 1.00 65.49  ? 67  LYS A CB    1 
ATOM   534  C  CG    . LYS A 1 67  ? 16.178  2.699   -13.462 1.00 65.94  ? 67  LYS A CG    1 
ATOM   535  C  CD    . LYS A 1 67  ? 16.912  2.058   -14.633 1.00 65.41  ? 67  LYS A CD    1 
ATOM   536  C  CE    . LYS A 1 67  ? 18.106  2.892   -15.069 1.00 65.93  ? 67  LYS A CE    1 
ATOM   537  N  NZ    . LYS A 1 67  ? 19.216  2.857   -14.067 1.00 65.37  ? 67  LYS A NZ    1 
ATOM   538  N  N     . PRO A 1 68  ? 13.670  3.365   -10.499 1.00 67.04  ? 68  PRO A N     1 
ATOM   539  C  CA    . PRO A 1 68  ? 13.786  4.410   -9.488  1.00 67.88  ? 68  PRO A CA    1 
ATOM   540  C  C     . PRO A 1 68  ? 15.231  4.921   -9.391  1.00 67.75  ? 68  PRO A C     1 
ATOM   541  O  O     . PRO A 1 68  ? 16.161  4.127   -9.508  1.00 66.67  ? 68  PRO A O     1 
ATOM   542  C  CB    . PRO A 1 68  ? 13.356  3.705   -8.186  1.00 67.36  ? 68  PRO A CB    1 
ATOM   543  C  CG    . PRO A 1 68  ? 12.843  2.358   -8.586  1.00 66.40  ? 68  PRO A CG    1 
ATOM   544  C  CD    . PRO A 1 68  ? 13.521  2.041   -9.879  1.00 65.88  ? 68  PRO A CD    1 
ATOM   545  N  N     . PRO A 1 69  ? 15.419  6.237   -9.209  1.00 68.94  ? 69  PRO A N     1 
ATOM   546  C  CA    . PRO A 1 69  ? 16.779  6.774   -9.100  1.00 68.95  ? 69  PRO A CA    1 
ATOM   547  C  C     . PRO A 1 69  ? 17.477  6.383   -7.795  1.00 68.21  ? 69  PRO A C     1 
ATOM   548  O  O     . PRO A 1 69  ? 16.820  6.183   -6.766  1.00 68.21  ? 69  PRO A O     1 
ATOM   549  C  CB    . PRO A 1 69  ? 16.566  8.289   -9.176  1.00 70.60  ? 69  PRO A CB    1 
ATOM   550  C  CG    . PRO A 1 69  ? 15.154  8.508   -8.756  1.00 71.36  ? 69  PRO A CG    1 
ATOM   551  C  CD    . PRO A 1 69  ? 14.399  7.301   -9.212  1.00 70.45  ? 69  PRO A CD    1 
ATOM   552  N  N     . LYS A 1 70  ? 18.802  6.295   -7.841  1.00 67.67  ? 70  LYS A N     1 
ATOM   553  C  CA    . LYS A 1 70  ? 19.598  5.899   -6.673  1.00 66.97  ? 70  LYS A CA    1 
ATOM   554  C  C     . LYS A 1 70  ? 19.579  6.961   -5.567  1.00 67.97  ? 70  LYS A C     1 
ATOM   555  O  O     . LYS A 1 70  ? 19.671  8.154   -5.850  1.00 69.14  ? 70  LYS A O     1 
ATOM   556  C  CB    . LYS A 1 70  ? 21.044  5.611   -7.085  1.00 66.31  ? 70  LYS A CB    1 
ATOM   557  C  CG    . LYS A 1 70  ? 21.179  4.421   -8.014  1.00 65.27  ? 70  LYS A CG    1 
ATOM   558  C  CD    . LYS A 1 70  ? 22.629  4.151   -8.367  1.00 64.74  ? 70  LYS A CD    1 
ATOM   559  C  CE    . LYS A 1 70  ? 22.754  2.916   -9.248  1.00 63.76  ? 70  LYS A CE    1 
ATOM   560  N  NZ    . LYS A 1 70  ? 23.908  2.053   -8.848  1.00 62.81  ? 70  LYS A NZ    1 
ATOM   561  N  N     . ARG A 1 71  ? 19.492  6.512   -4.316  1.00 67.57  ? 71  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 71  ? 19.398  7.415   -3.159  1.00 68.52  ? 71  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 71  ? 20.768  7.997   -2.860  1.00 68.65  ? 71  ARG A C     1 
ATOM   564  O  O     . ARG A 1 71  ? 20.902  9.139   -2.418  1.00 69.78  ? 71  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 71  ? 18.912  6.678   -1.921  1.00 68.08  ? 71  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 71  ? 17.666  5.842   -2.118  1.00 67.76  ? 71  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 71  ? 16.426  6.649   -2.455  1.00 69.01  ? 71  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 71  ? 15.268  5.752   -2.544  1.00 68.67  ? 71  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 71  ? 14.627  5.200   -1.504  1.00 68.60  ? 71  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 71  ? 15.005  5.439   -0.248  1.00 68.86  ? 71  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 71  ? 13.587  4.392   -1.722  1.00 68.35  ? 71  ARG A NH2   1 
ATOM   572  N  N     . TYR A 1 72  ? 21.781  7.172   -3.091  1.00 67.52  ? 72  TYR A N     1 
ATOM   573  C  CA    . TYR A 1 72  ? 23.179  7.550   -2.959  1.00 67.51  ? 72  TYR A CA    1 
ATOM   574  C  C     . TYR A 1 72  ? 23.918  6.855   -4.087  1.00 66.66  ? 72  TYR A C     1 
ATOM   575  O  O     . TYR A 1 72  ? 23.370  5.927   -4.683  1.00 65.93  ? 72  TYR A O     1 
ATOM   576  C  CB    . TYR A 1 72  ? 23.717  7.062   -1.614  1.00 66.97  ? 72  TYR A CB    1 
ATOM   577  C  CG    . TYR A 1 72  ? 23.784  5.546   -1.495  1.00 65.57  ? 72  TYR A CG    1 
ATOM   578  C  CD1   . TYR A 1 72  ? 22.675  4.809   -1.093  1.00 65.24  ? 72  TYR A CD1   1 
ATOM   579  C  CD2   . TYR A 1 72  ? 24.951  4.849   -1.807  1.00 64.68  ? 72  TYR A CD2   1 
ATOM   580  C  CE1   . TYR A 1 72  ? 22.730  3.427   -0.995  1.00 64.08  ? 72  TYR A CE1   1 
ATOM   581  C  CE2   . TYR A 1 72  ? 25.006  3.469   -1.713  1.00 63.53  ? 72  TYR A CE2   1 
ATOM   582  C  CZ    . TYR A 1 72  ? 23.894  2.764   -1.306  1.00 63.23  ? 72  TYR A CZ    1 
ATOM   583  O  OH    . TYR A 1 72  ? 23.928  1.397   -1.212  1.00 62.18  ? 72  TYR A OH    1 
ATOM   584  N  N     . GLU A 1 73  ? 25.164  7.264   -4.333  1.00 66.80  ? 73  GLU A N     1 
ATOM   585  C  CA    . GLU A 1 73  ? 25.996  6.690   -5.407  1.00 66.18  ? 73  GLU A CA    1 
ATOM   586  C  C     . GLU A 1 73  ? 27.192  5.876   -4.911  1.00 65.24  ? 73  GLU A C     1 
ATOM   587  O  O     . GLU A 1 73  ? 27.648  6.059   -3.787  1.00 65.29  ? 73  GLU A O     1 
ATOM   588  C  CB    . GLU A 1 73  ? 26.475  7.806   -6.332  1.00 67.25  ? 73  GLU A CB    1 
ATOM   589  C  CG    . GLU A 1 73  ? 25.377  8.257   -7.279  1.00 67.97  ? 73  GLU A CG    1 
ATOM   590  C  CD    . GLU A 1 73  ? 25.854  9.240   -8.314  1.00 69.06  ? 73  GLU A CD    1 
ATOM   591  O  OE1   . GLU A 1 73  ? 26.941  9.849   -8.123  1.00 69.52  ? 73  GLU A OE1   1 
ATOM   592  O  OE2   . GLU A 1 73  ? 25.126  9.397   -9.321  1.00 69.51  ? 73  GLU A OE2   1 
ATOM   593  N  N     . ASP A 1 74  ? 27.703  5.001   -5.780  1.00 64.48  ? 74  ASP A N     1 
ATOM   594  C  CA    . ASP A 1 74  ? 28.810  4.088   -5.448  1.00 63.59  ? 74  ASP A CA    1 
ATOM   595  C  C     . ASP A 1 74  ? 29.987  4.787   -4.731  1.00 64.06  ? 74  ASP A C     1 
ATOM   596  O  O     . ASP A 1 74  ? 30.482  4.295   -3.716  1.00 63.57  ? 74  ASP A O     1 
ATOM   597  C  CB    . ASP A 1 74  ? 29.316  3.361   -6.711  1.00 63.10  ? 74  ASP A CB    1 
ATOM   598  C  CG    . ASP A 1 74  ? 28.398  2.217   -7.155  1.00 62.29  ? 74  ASP A CG    1 
ATOM   599  O  OD1   . ASP A 1 74  ? 27.156  2.326   -7.042  1.00 62.44  ? 74  ASP A OD1   1 
ATOM   600  O  OD2   . ASP A 1 74  ? 28.927  1.202   -7.644  1.00 61.57  ? 74  ASP A OD2   1 
ATOM   601  N  N     . ALA A 1 75  ? 30.396  5.947   -5.241  1.00 65.09  ? 75  ALA A N     1 
ATOM   602  C  CA    . ALA A 1 75  ? 31.520  6.702   -4.667  1.00 65.69  ? 75  ALA A CA    1 
ATOM   603  C  C     . ALA A 1 75  ? 31.166  7.430   -3.375  1.00 66.26  ? 75  ALA A C     1 
ATOM   604  O  O     . ALA A 1 75  ? 32.071  7.769   -2.614  1.00 66.50  ? 75  ALA A O     1 
ATOM   605  C  CB    . ALA A 1 75  ? 32.064  7.692   -5.681  1.00 66.72  ? 75  ALA A CB    1 
ATOM   606  N  N     . GLU A 1 76  ? 29.874  7.694   -3.139  1.00 66.56  ? 76  GLU A N     1 
ATOM   607  C  CA    . GLU A 1 76  ? 29.400  8.248   -1.845  1.00 67.09  ? 76  GLU A CA    1 
ATOM   608  C  C     . GLU A 1 76  ? 29.535  7.250   -0.684  1.00 66.16  ? 76  GLU A C     1 
ATOM   609  O  O     . GLU A 1 76  ? 29.727  7.655   0.462   1.00 66.57  ? 76  GLU A O     1 
ATOM   610  C  CB    . GLU A 1 76  ? 27.944  8.723   -1.944  1.00 67.72  ? 76  GLU A CB    1 
ATOM   611  C  CG    . GLU A 1 76  ? 27.451  9.550   -0.753  1.00 68.65  ? 76  GLU A CG    1 
ATOM   612  C  CD    . GLU A 1 76  ? 26.034  10.105  -0.939  1.00 69.47  ? 76  GLU A CD    1 
ATOM   613  O  OE1   . GLU A 1 76  ? 25.510  10.157  -2.092  1.00 69.60  ? 76  GLU A OE1   1 
ATOM   614  O  OE2   . GLU A 1 76  ? 25.432  10.496  0.085   1.00 70.08  ? 76  GLU A OE2   1 
ATOM   615  N  N     . LEU A 1 77  ? 29.407  5.960   -1.005  1.00 65.02  ? 77  LEU A N     1 
ATOM   616  C  CA    . LEU A 1 77  ? 29.693  4.844   -0.085  1.00 64.09  ? 77  LEU A CA    1 
ATOM   617  C  C     . LEU A 1 77  ? 31.187  4.554   0.021   1.00 63.76  ? 77  LEU A C     1 
ATOM   618  O  O     . LEU A 1 77  ? 31.694  4.296   1.111   1.00 63.60  ? 77  LEU A O     1 
ATOM   619  C  CB    . LEU A 1 77  ? 28.982  3.569   -0.564  1.00 63.10  ? 77  LEU A CB    1 
ATOM   620  C  CG    . LEU A 1 77  ? 29.342  2.219   0.072   1.00 62.08  ? 77  LEU A CG    1 
ATOM   621  C  CD1   . LEU A 1 77  ? 29.033  2.245   1.559   1.00 62.29  ? 77  LEU A CD1   1 
ATOM   622  C  CD2   . LEU A 1 77  ? 28.599  1.086   -0.618  1.00 61.28  ? 77  LEU A CD2   1 
ATOM   623  N  N     . GLN A 1 78  ? 31.870  4.548   -1.121  1.00 63.69  ? 78  GLN A N     1 
ATOM   624  C  CA    . GLN A 1 78  ? 33.324  4.370   -1.165  1.00 63.55  ? 78  GLN A CA    1 
ATOM   625  C  C     . GLN A 1 78  ? 34.056  5.377   -0.266  1.00 64.39  ? 78  GLN A C     1 
ATOM   626  O  O     . GLN A 1 78  ? 35.013  5.014   0.430   1.00 64.14  ? 78  GLN A O     1 
ATOM   627  C  CB    . GLN A 1 78  ? 33.830  4.522   -2.606  1.00 63.73  ? 78  GLN A CB    1 
ATOM   628  C  CG    . GLN A 1 78  ? 35.315  4.254   -2.792  1.00 63.63  ? 78  GLN A CG    1 
ATOM   629  C  CD    . GLN A 1 78  ? 35.735  2.929   -2.204  1.00 62.63  ? 78  GLN A CD    1 
ATOM   630  O  OE1   . GLN A 1 78  ? 35.048  1.927   -2.376  1.00 61.84  ? 78  GLN A OE1   1 
ATOM   631  N  NE2   . GLN A 1 78  ? 36.852  2.919   -1.493  1.00 62.72  ? 78  GLN A NE2   1 
ATOM   632  N  N     . ALA A 1 79  ? 33.594  6.632   -0.309  1.00 65.44  ? 79  ALA A N     1 
ATOM   633  C  CA    . ALA A 1 79  ? 34.084  7.713   0.553   1.00 66.41  ? 79  ALA A CA    1 
ATOM   634  C  C     . ALA A 1 79  ? 34.084  7.326   2.040   1.00 66.14  ? 79  ALA A C     1 
ATOM   635  O  O     . ALA A 1 79  ? 35.040  7.613   2.770   1.00 66.46  ? 79  ALA A O     1 
ATOM   636  C  CB    . ALA A 1 79  ? 33.246  8.971   0.333   1.00 67.57  ? 79  ALA A CB    1 
ATOM   637  N  N     . LEU A 1 80  ? 33.014  6.666   2.469   1.00 65.62  ? 80  LEU A N     1 
ATOM   638  C  CA    . LEU A 1 80  ? 32.869  6.217   3.854   1.00 65.42  ? 80  LEU A CA    1 
ATOM   639  C  C     . LEU A 1 80  ? 33.790  5.053   4.229   1.00 64.50  ? 80  LEU A C     1 
ATOM   640  O  O     . LEU A 1 80  ? 34.194  4.940   5.386   1.00 64.59  ? 80  LEU A O     1 
ATOM   641  C  CB    . LEU A 1 80  ? 31.408  5.856   4.125   1.00 65.26  ? 80  LEU A CB    1 
ATOM   642  C  CG    . LEU A 1 80  ? 30.372  7.006   3.992   1.00 66.33  ? 80  LEU A CG    1 
ATOM   643  C  CD1   . LEU A 1 80  ? 29.205  6.733   4.922   1.00 66.43  ? 80  LEU A CD1   1 
ATOM   644  C  CD2   . LEU A 1 80  ? 30.907  8.411   4.275   1.00 67.57  ? 80  LEU A CD2   1 
ATOM   645  N  N     . LEU A 1 81  ? 34.119  4.196   3.265   1.00 63.70  ? 81  LEU A N     1 
ATOM   646  C  CA    . LEU A 1 81  ? 35.054  3.083   3.500   1.00 62.92  ? 81  LEU A CA    1 
ATOM   647  C  C     . LEU A 1 81  ? 36.522  3.518   3.535   1.00 63.31  ? 81  LEU A C     1 
ATOM   648  O  O     . LEU A 1 81  ? 37.336  2.883   4.215   1.00 63.01  ? 81  LEU A O     1 
ATOM   649  C  CB    . LEU A 1 81  ? 34.864  1.987   2.452   1.00 62.02  ? 81  LEU A CB    1 
ATOM   650  C  CG    . LEU A 1 81  ? 33.506  1.292   2.535   1.00 61.52  ? 81  LEU A CG    1 
ATOM   651  C  CD1   . LEU A 1 81  ? 33.215  0.553   1.241   1.00 60.90  ? 81  LEU A CD1   1 
ATOM   652  C  CD2   . LEU A 1 81  ? 33.426  0.351   3.731   1.00 61.08  ? 81  LEU A CD2   1 
ATOM   653  N  N     . ASP A 1 82  ? 36.852  4.585   2.804   1.00 64.06  ? 82  ASP A N     1 
ATOM   654  C  CA    . ASP A 1 82  ? 38.194  5.180   2.852   1.00 64.65  ? 82  ASP A CA    1 
ATOM   655  C  C     . ASP A 1 82  ? 38.449  5.877   4.196   1.00 65.34  ? 82  ASP A C     1 
ATOM   656  O  O     . ASP A 1 82  ? 39.553  5.783   4.740   1.00 65.45  ? 82  ASP A O     1 
ATOM   657  C  CB    . ASP A 1 82  ? 38.393  6.160   1.696   1.00 65.40  ? 82  ASP A CB    1 
ATOM   658  C  CG    . ASP A 1 82  ? 38.232  5.502   0.344   1.00 64.83  ? 82  ASP A CG    1 
ATOM   659  O  OD1   . ASP A 1 82  ? 38.681  4.349   0.178   1.00 64.00  ? 82  ASP A OD1   1 
ATOM   660  O  OD2   . ASP A 1 82  ? 37.644  6.146   -0.551  1.00 65.30  ? 82  ASP A OD2   1 
ATOM   661  N  N     . GLU A 1 83  ? 37.430  6.572   4.717   1.00 65.87  ? 83  GLU A N     1 
ATOM   662  C  CA    . GLU A 1 83  ? 37.428  7.069   6.108   1.00 66.48  ? 83  GLU A CA    1 
ATOM   663  C  C     . GLU A 1 83  ? 37.701  5.933   7.116   1.00 65.76  ? 83  GLU A C     1 
ATOM   664  O  O     . GLU A 1 83  ? 38.576  6.060   7.976   1.00 66.09  ? 83  GLU A O     1 
ATOM   665  C  CB    . GLU A 1 83  ? 36.086  7.751   6.466   1.00 67.08  ? 83  GLU A CB    1 
ATOM   666  C  CG    . GLU A 1 83  ? 35.932  9.207   6.035   1.00 68.30  ? 83  GLU A CG    1 
ATOM   667  C  CD    . GLU A 1 83  ? 34.586  9.807   6.451   1.00 68.96  ? 83  GLU A CD    1 
ATOM   668  O  OE1   . GLU A 1 83  ? 33.577  9.572   5.750   1.00 68.66  ? 83  GLU A OE1   1 
ATOM   669  O  OE2   . GLU A 1 83  ? 34.530  10.528  7.471   1.00 69.85  ? 83  GLU A OE2   1 
ATOM   670  N  N     . ASP A 1 84  ? 36.954  4.833   6.990   1.00 64.86  ? 84  ASP A N     1 
ATOM   671  C  CA    . ASP A 1 84  ? 36.988  3.736   7.965   1.00 64.27  ? 84  ASP A CA    1 
ATOM   672  C  C     . ASP A 1 84  ? 36.579  2.384   7.336   1.00 63.18  ? 84  ASP A C     1 
ATOM   673  O  O     . ASP A 1 84  ? 35.379  2.072   7.217   1.00 62.91  ? 84  ASP A O     1 
ATOM   674  C  CB    . ASP A 1 84  ? 36.085  4.104   9.160   1.00 64.83  ? 84  ASP A CB    1 
ATOM   675  C  CG    . ASP A 1 84  ? 36.238  3.162   10.365  1.00 64.53  ? 84  ASP A CG    1 
ATOM   676  O  OD1   . ASP A 1 84  ? 37.268  2.450   10.485  1.00 64.11  ? 84  ASP A OD1   1 
ATOM   677  O  OD2   . ASP A 1 84  ? 35.305  3.159   11.206  1.00 64.83  ? 84  ASP A OD2   1 
ATOM   678  N  N     . ASP A 1 85  ? 37.601  1.611   6.935   1.00 62.65  ? 85  ASP A N     1 
ATOM   679  C  CA    . ASP A 1 85  ? 37.455  0.256   6.349   1.00 61.68  ? 85  ASP A CA    1 
ATOM   680  C  C     . ASP A 1 85  ? 36.436  -0.597  7.086   1.00 61.28  ? 85  ASP A C     1 
ATOM   681  O  O     . ASP A 1 85  ? 35.518  -1.124  6.486   1.00 60.79  ? 85  ASP A O     1 
ATOM   682  C  CB    . ASP A 1 85  ? 38.774  -0.544  6.419   1.00 61.37  ? 85  ASP A CB    1 
ATOM   683  C  CG    . ASP A 1 85  ? 39.848  -0.070  5.445   1.00 61.62  ? 85  ASP A CG    1 
ATOM   684  O  OD1   . ASP A 1 85  ? 39.535  0.304   4.281   1.00 61.63  ? 85  ASP A OD1   1 
ATOM   685  O  OD2   . ASP A 1 85  ? 41.042  -0.113  5.859   1.00 61.88  ? 85  ASP A OD2   1 
ATOM   686  N  N     . ALA A 1 86  ? 36.642  -0.725  8.396   1.00 61.55  ? 86  ALA A N     1 
ATOM   687  C  CA    . ALA A 1 86  ? 35.904  -1.662  9.246   1.00 61.27  ? 86  ALA A CA    1 
ATOM   688  C  C     . ALA A 1 86  ? 34.732  -0.982  9.928   1.00 61.85  ? 86  ALA A C     1 
ATOM   689  O  O     . ALA A 1 86  ? 34.887  -0.323  10.960  1.00 62.58  ? 86  ALA A O     1 
ATOM   690  C  CB    . ALA A 1 86  ? 36.829  -2.277  10.289  1.00 61.34  ? 86  ALA A CB    1 
ATOM   691  N  N     . GLN A 1 87  ? 33.555  -1.175  9.355   1.00 61.58  ? 87  GLN A N     1 
ATOM   692  C  CA    . GLN A 1 87  ? 32.359  -0.471  9.773   1.00 62.20  ? 87  GLN A CA    1 
ATOM   693  C  C     . GLN A 1 87  ? 31.165  -1.408  9.507   1.00 61.68  ? 87  GLN A C     1 
ATOM   694  O  O     . GLN A 1 87  ? 31.109  -2.052  8.456   1.00 60.97  ? 87  GLN A O     1 
ATOM   695  C  CB    . GLN A 1 87  ? 32.270  0.839   8.976   1.00 62.73  ? 87  GLN A CB    1 
ATOM   696  C  CG    . GLN A 1 87  ? 31.733  2.044   9.735   1.00 63.82  ? 87  GLN A CG    1 
ATOM   697  C  CD    . GLN A 1 87  ? 31.882  3.339   8.950   1.00 64.44  ? 87  GLN A CD    1 
ATOM   698  O  OE1   . GLN A 1 87  ? 32.938  3.606   8.384   1.00 64.36  ? 87  GLN A OE1   1 
ATOM   699  N  NE2   . GLN A 1 87  ? 30.816  4.144   8.902   1.00 65.14  ? 87  GLN A NE2   1 
ATOM   700  N  N     . THR A 1 88  ? 30.253  -1.514  10.474  1.00 62.11  ? 88  THR A N     1 
ATOM   701  C  CA    . THR A 1 88  ? 29.097  -2.421  10.389  1.00 61.76  ? 88  THR A CA    1 
ATOM   702  C  C     . THR A 1 88  ? 28.093  -1.890  9.335   1.00 61.80  ? 88  THR A C     1 
ATOM   703  O  O     . THR A 1 88  ? 27.978  -0.671  9.141   1.00 62.45  ? 88  THR A O     1 
ATOM   704  C  CB    . THR A 1 88  ? 28.495  -2.691  11.821  1.00 62.36  ? 88  THR A CB    1 
ATOM   705  O  OG1   . THR A 1 88  ? 27.511  -3.723  11.766  1.00 62.02  ? 88  THR A OG1   1 
ATOM   706  C  CG2   . THR A 1 88  ? 27.856  -1.471  12.466  1.00 63.45  ? 88  THR A CG2   1 
ATOM   707  N  N     . GLN A 1 89  ? 27.406  -2.793  8.626   1.00 61.16  ? 89  GLN A N     1 
ATOM   708  C  CA    . GLN A 1 89  ? 26.456  -2.394  7.572   1.00 61.18  ? 89  GLN A CA    1 
ATOM   709  C  C     . GLN A 1 89  ? 25.366  -1.457  8.074   1.00 62.15  ? 89  GLN A C     1 
ATOM   710  O  O     . GLN A 1 89  ? 24.985  -0.539  7.356   1.00 62.55  ? 89  GLN A O     1 
ATOM   711  C  CB    . GLN A 1 89  ? 25.818  -3.603  6.902   1.00 60.43  ? 89  GLN A CB    1 
ATOM   712  C  CG    . GLN A 1 89  ? 26.769  -4.357  5.992   1.00 59.56  ? 89  GLN A CG    1 
ATOM   713  C  CD    . GLN A 1 89  ? 26.123  -5.530  5.277   1.00 58.90  ? 89  GLN A CD    1 
ATOM   714  O  OE1   . GLN A 1 89  ? 24.918  -5.734  5.345   1.00 59.06  ? 89  GLN A OE1   1 
ATOM   715  N  NE2   . GLN A 1 89  ? 26.934  -6.319  4.609   1.00 58.21  ? 89  GLN A NE2   1 
ATOM   716  N  N     . LYS A 1 90  ? 24.886  -1.670  9.300   1.00 62.64  ? 90  LYS A N     1 
ATOM   717  C  CA    . LYS A 1 90  ? 23.912  -0.757  9.899   1.00 63.73  ? 90  LYS A CA    1 
ATOM   718  C  C     . LYS A 1 90  ? 24.491  0.642   10.191  1.00 64.57  ? 90  LYS A C     1 
ATOM   719  O  O     . LYS A 1 90  ? 23.758  1.624   10.168  1.00 65.46  ? 90  LYS A O     1 
ATOM   720  C  CB    . LYS A 1 90  ? 23.279  -1.371  11.155  1.00 64.15  ? 90  LYS A CB    1 
ATOM   721  C  CG    . LYS A 1 90  ? 22.238  -0.462  11.807  1.00 65.40  ? 90  LYS A CG    1 
ATOM   722  C  CD    . LYS A 1 90  ? 21.175  -1.211  12.597  1.00 65.77  ? 90  LYS A CD    1 
ATOM   723  C  CE    . LYS A 1 90  ? 21.759  -2.089  13.691  1.00 65.65  ? 90  LYS A CE    1 
ATOM   724  N  NZ    . LYS A 1 90  ? 22.736  -1.378  14.561  1.00 66.18  ? 90  LYS A NZ    1 
ATOM   725  N  N     . GLN A 1 91  ? 25.797  0.731   10.435  1.00 64.36  ? 91  GLN A N     1 
ATOM   726  C  CA    . GLN A 1 91  ? 26.463  2.022   10.670  1.00 65.15  ? 91  GLN A CA    1 
ATOM   727  C  C     . GLN A 1 91  ? 26.544  2.856   9.397   1.00 65.21  ? 91  GLN A C     1 
ATOM   728  O  O     . GLN A 1 91  ? 26.251  4.053   9.412   1.00 66.18  ? 91  GLN A O     1 
ATOM   729  C  CB    . GLN A 1 91  ? 27.879  1.839   11.242  1.00 64.92  ? 91  GLN A CB    1 
ATOM   730  C  CG    . GLN A 1 91  ? 27.956  1.877   12.761  1.00 65.62  ? 91  GLN A CG    1 
ATOM   731  C  CD    . GLN A 1 91  ? 29.313  1.463   13.329  1.00 65.32  ? 91  GLN A CD    1 
ATOM   732  O  OE1   . GLN A 1 91  ? 29.402  0.960   14.465  1.00 65.55  ? 91  GLN A OE1   1 
ATOM   733  N  NE2   . GLN A 1 91  ? 30.371  1.660   12.552  1.00 64.88  ? 91  GLN A NE2   1 
ATOM   734  N  N     . LEU A 1 92  ? 26.978  2.214   8.314   1.00 64.24  ? 92  LEU A N     1 
ATOM   735  C  CA    . LEU A 1 92  ? 27.040  2.827   6.974   1.00 64.23  ? 92  LEU A CA    1 
ATOM   736  C  C     . LEU A 1 92  ? 25.647  3.232   6.483   1.00 64.71  ? 92  LEU A C     1 
ATOM   737  O  O     . LEU A 1 92  ? 25.439  4.357   6.019   1.00 65.50  ? 92  LEU A O     1 
ATOM   738  C  CB    . LEU A 1 92  ? 27.630  1.839   5.969   1.00 63.11  ? 92  LEU A CB    1 
ATOM   739  C  CG    . LEU A 1 92  ? 29.054  1.319   6.232   1.00 62.58  ? 92  LEU A CG    1 
ATOM   740  C  CD1   . LEU A 1 92  ? 29.181  -0.156  5.881   1.00 61.51  ? 92  LEU A CD1   1 
ATOM   741  C  CD2   . LEU A 1 92  ? 30.097  2.129   5.473   1.00 62.81  ? 92  LEU A CD2   1 
ATOM   742  N  N     . ALA A 1 93  ? 24.704  2.303   6.619   1.00 64.31  ? 93  ALA A N     1 
ATOM   743  C  CA    . ALA A 1 93  ? 23.297  2.528   6.293   1.00 64.78  ? 93  ALA A CA    1 
ATOM   744  C  C     . ALA A 1 93  ? 22.691  3.777   6.949   1.00 66.16  ? 93  ALA A C     1 
ATOM   745  O  O     . ALA A 1 93  ? 21.962  4.520   6.301   1.00 66.80  ? 93  ALA A O     1 
ATOM   746  C  CB    . ALA A 1 93  ? 22.491  1.299   6.678   1.00 64.27  ? 93  ALA A CB    1 
ATOM   747  N  N     . GLU A 1 94  ? 22.990  3.994   8.230   1.00 66.69  ? 94  GLU A N     1 
ATOM   748  C  CA    . GLU A 1 94  ? 22.520  5.189   8.950   1.00 68.11  ? 94  GLU A CA    1 
ATOM   749  C  C     . GLU A 1 94  ? 23.060  6.486   8.348   1.00 68.79  ? 94  GLU A C     1 
ATOM   750  O  O     . GLU A 1 94  ? 22.307  7.447   8.195   1.00 69.87  ? 94  GLU A O     1 
ATOM   751  C  CB    . GLU A 1 94  ? 22.860  5.117   10.447  1.00 68.55  ? 94  GLU A CB    1 
ATOM   752  C  CG    . GLU A 1 94  ? 21.902  4.220   11.221  1.00 68.55  ? 94  GLU A CG    1 
ATOM   753  C  CD    . GLU A 1 94  ? 22.331  3.920   12.653  1.00 68.86  ? 94  GLU A CD    1 
ATOM   754  O  OE1   . GLU A 1 94  ? 23.488  4.216   13.058  1.00 68.84  ? 94  GLU A OE1   1 
ATOM   755  O  OE2   . GLU A 1 94  ? 21.480  3.375   13.390  1.00 69.19  ? 94  GLU A OE2   1 
ATOM   756  N  N     . GLN A 1 95  ? 24.339  6.494   7.966   1.00 68.23  ? 95  GLN A N     1 
ATOM   757  C  CA    . GLN A 1 95  ? 24.947  7.671   7.328   1.00 68.88  ? 95  GLN A CA    1 
ATOM   758  C  C     . GLN A 1 95  ? 24.352  7.949   5.932   1.00 68.90  ? 95  GLN A C     1 
ATOM   759  O  O     . GLN A 1 95  ? 24.047  9.099   5.624   1.00 70.01  ? 95  GLN A O     1 
ATOM   760  C  CB    . GLN A 1 95  ? 26.466  7.534   7.247   1.00 68.30  ? 95  GLN A CB    1 
ATOM   761  C  CG    . GLN A 1 95  ? 27.138  7.497   8.602   1.00 68.52  ? 95  GLN A CG    1 
ATOM   762  C  CD    . GLN A 1 95  ? 28.603  7.152   8.495   1.00 67.84  ? 95  GLN A CD    1 
ATOM   763  O  OE1   . GLN A 1 95  ? 28.989  5.990   8.613   1.00 66.81  ? 95  GLN A OE1   1 
ATOM   764  N  NE2   . GLN A 1 95  ? 29.428  8.156   8.243   1.00 68.48  ? 95  GLN A NE2   1 
ATOM   765  N  N     . LEU A 1 96  ? 24.170  6.904   5.116   1.00 67.78  ? 96  LEU A N     1 
ATOM   766  C  CA    . LEU A 1 96  ? 23.546  7.034   3.783   1.00 67.76  ? 96  LEU A CA    1 
ATOM   767  C  C     . LEU A 1 96  ? 22.033  7.209   3.802   1.00 68.42  ? 96  LEU A C     1 
ATOM   768  O  O     . LEU A 1 96  ? 21.445  7.483   2.768   1.00 68.65  ? 96  LEU A O     1 
ATOM   769  C  CB    . LEU A 1 96  ? 23.854  5.811   2.926   1.00 66.40  ? 96  LEU A CB    1 
ATOM   770  C  CG    . LEU A 1 96  ? 25.321  5.516   2.622   1.00 65.70  ? 96  LEU A CG    1 
ATOM   771  C  CD1   . LEU A 1 96  ? 25.443  4.097   2.072   1.00 64.39  ? 96  LEU A CD1   1 
ATOM   772  C  CD2   . LEU A 1 96  ? 25.919  6.530   1.654   1.00 66.30  ? 96  LEU A CD2   1 
ATOM   773  N  N     . GLU A 1 97  ? 21.405  7.015   4.961   1.00 68.77  ? 97  GLU A N     1 
ATOM   774  C  CA    . GLU A 1 97  ? 19.951  7.146   5.135   1.00 69.52  ? 97  GLU A CA    1 
ATOM   775  C  C     . GLU A 1 97  ? 19.171  6.082   4.342   1.00 68.64  ? 97  GLU A C     1 
ATOM   776  O  O     . GLU A 1 97  ? 18.051  6.329   3.886   1.00 69.22  ? 97  GLU A O     1 
ATOM   777  C  CB    . GLU A 1 97  ? 19.467  8.571   4.803   1.00 70.99  ? 97  GLU A CB    1 
ATOM   778  C  CG    . GLU A 1 97  ? 20.375  9.671   5.353   1.00 71.86  ? 97  GLU A CG    1 
ATOM   779  C  CD    . GLU A 1 97  ? 19.660  10.991  5.607   1.00 73.62  ? 97  GLU A CD    1 
ATOM   780  O  OE1   . GLU A 1 97  ? 20.116  11.748  6.492   1.00 74.50  ? 97  GLU A OE1   1 
ATOM   781  O  OE2   . GLU A 1 97  ? 18.656  11.284  4.927   1.00 74.20  ? 97  GLU A OE2   1 
ATOM   782  N  N     . VAL A 1 98  ? 19.762  4.888   4.239   1.00 67.31  ? 98  VAL A N     1 
ATOM   783  C  CA    . VAL A 1 98  ? 19.150  3.717   3.571   1.00 66.39  ? 98  VAL A CA    1 
ATOM   784  C  C     . VAL A 1 98  ? 19.167  2.581   4.600   1.00 65.77  ? 98  VAL A C     1 
ATOM   785  O  O     . VAL A 1 98  ? 19.587  2.786   5.744   1.00 66.13  ? 98  VAL A O     1 
ATOM   786  C  CB    . VAL A 1 98  ? 19.852  3.303   2.229   1.00 65.43  ? 98  VAL A CB    1 
ATOM   787  C  CG1   . VAL A 1 98  ? 19.641  4.374   1.169   1.00 66.18  ? 98  VAL A CG1   1 
ATOM   788  C  CG2   . VAL A 1 98  ? 21.330  2.997   2.444   1.00 64.72  ? 98  VAL A CG2   1 
ATOM   789  N  N     . SER A 1 99  ? 18.697  1.401   4.209   1.00 64.94  ? 99  SER A N     1 
ATOM   790  C  CA    . SER A 1 99  ? 18.631  0.253   5.113   1.00 64.43  ? 99  SER A CA    1 
ATOM   791  C  C     . SER A 1 99  ? 19.925  -0.553  5.107   1.00 63.37  ? 99  SER A C     1 
ATOM   792  O  O     . SER A 1 99  ? 20.775  -0.367  4.235   1.00 62.91  ? 99  SER A O     1 
ATOM   793  C  CB    . SER A 1 99  ? 17.466  -0.654  4.727   1.00 64.17  ? 99  SER A CB    1 
ATOM   794  O  OG    . SER A 1 99  ? 17.744  -1.364  3.532   1.00 63.19  ? 99  SER A OG    1 
ATOM   795  N  N     . GLN A 1 100 ? 20.050  -1.449  6.087   1.00 63.09  ? 100 GLN A N     1 
ATOM   796  C  CA    . GLN A 1 100 ? 21.174  -2.397  6.177   1.00 62.14  ? 100 GLN A CA    1 
ATOM   797  C  C     . GLN A 1 100 ? 21.228  -3.286  4.945   1.00 61.18  ? 100 GLN A C     1 
ATOM   798  O  O     . GLN A 1 100 ? 22.295  -3.542  4.397   1.00 60.53  ? 100 GLN A O     1 
ATOM   799  C  CB    . GLN A 1 100 ? 21.051  -3.278  7.435   1.00 62.16  ? 100 GLN A CB    1 
ATOM   800  C  CG    . GLN A 1 100 ? 22.096  -4.393  7.557   1.00 61.26  ? 100 GLN A CG    1 
ATOM   801  C  CD    . GLN A 1 100 ? 21.663  -5.726  6.936   1.00 60.50  ? 100 GLN A CD    1 
ATOM   802  O  OE1   . GLN A 1 100 ? 20.644  -6.283  7.316   1.00 60.74  ? 100 GLN A OE1   1 
ATOM   803  N  NE2   . GLN A 1 100 ? 22.454  -6.249  5.996   1.00 59.66  ? 100 GLN A NE2   1 
ATOM   804  N  N     . GLN A 1 101 ? 20.058  -3.747  4.527   1.00 61.17  ? 101 GLN A N     1 
ATOM   805  C  CA    . GLN A 1 101 ? 19.927  -4.683  3.425   1.00 60.36  ? 101 GLN A CA    1 
ATOM   806  C  C     . GLN A 1 101 ? 20.328  -4.021  2.123   1.00 60.22  ? 101 GLN A C     1 
ATOM   807  O  O     . GLN A 1 101 ? 20.854  -4.677  1.235   1.00 59.48  ? 101 GLN A O     1 
ATOM   808  C  CB    . GLN A 1 101 ? 18.487  -5.189  3.330   1.00 60.57  ? 101 GLN A CB    1 
ATOM   809  C  CG    . GLN A 1 101 ? 18.052  -6.095  4.468   1.00 60.67  ? 101 GLN A CG    1 
ATOM   810  C  CD    . GLN A 1 101 ? 17.625  -5.359  5.723   1.00 61.68  ? 101 GLN A CD    1 
ATOM   811  O  OE1   . GLN A 1 101 ? 18.027  -4.224  5.971   1.00 62.21  ? 101 GLN A OE1   1 
ATOM   812  N  NE2   . GLN A 1 101 ? 16.803  -6.014  6.529   1.00 62.04  ? 101 GLN A NE2   1 
ATOM   813  N  N     . ALA A 1 102 ? 20.040  -2.723  2.020   1.00 61.04  ? 102 ALA A N     1 
ATOM   814  C  CA    . ALA A 1 102 ? 20.402  -1.916  0.859   1.00 61.16  ? 102 ALA A CA    1 
ATOM   815  C  C     . ALA A 1 102 ? 21.892  -1.943  0.621   1.00 60.66  ? 102 ALA A C     1 
ATOM   816  O  O     . ALA A 1 102 ? 22.345  -2.251  -0.491  1.00 60.15  ? 102 ALA A O     1 
ATOM   817  C  CB    . ALA A 1 102 ? 19.933  -0.480  1.038   1.00 62.30  ? 102 ALA A CB    1 
ATOM   818  N  N     . VAL A 1 103 ? 22.648  -1.640  1.672   1.00 60.86  ? 103 VAL A N     1 
ATOM   819  C  CA    . VAL A 1 103 ? 24.111  -1.627  1.556   1.00 60.48  ? 103 VAL A CA    1 
ATOM   820  C  C     . VAL A 1 103 ? 24.646  -3.025  1.288   1.00 59.48  ? 103 VAL A C     1 
ATOM   821  O  O     . VAL A 1 103 ? 25.501  -3.182  0.432   1.00 59.09  ? 103 VAL A O     1 
ATOM   822  C  CB    . VAL A 1 103 ? 24.898  -0.975  2.729   1.00 60.97  ? 103 VAL A CB    1 
ATOM   823  C  CG1   . VAL A 1 103 ? 24.734  0.538   2.720   1.00 62.00  ? 103 VAL A CG1   1 
ATOM   824  C  CG2   . VAL A 1 103 ? 24.533  -1.555  4.089   1.00 61.02  ? 103 VAL A CG2   1 
ATOM   825  N  N     . SER A 1 104 ? 24.125  -4.038  1.981   1.00 59.17  ? 104 SER A N     1 
ATOM   826  C  CA    . SER A 1 104 ? 24.516  -5.435  1.722   1.00 58.32  ? 104 SER A CA    1 
ATOM   827  C  C     . SER A 1 104 ? 24.690  -5.731  0.235   1.00 57.85  ? 104 SER A C     1 
ATOM   828  O  O     . SER A 1 104 ? 25.709  -6.285  -0.182  1.00 57.37  ? 104 SER A O     1 
ATOM   829  C  CB    . SER A 1 104 ? 23.475  -6.392  2.296   1.00 58.21  ? 104 SER A CB    1 
ATOM   830  O  OG    . SER A 1 104 ? 23.679  -7.698  1.800   1.00 57.48  ? 104 SER A OG    1 
ATOM   831  N  N     . ASN A 1 105 ? 23.690  -5.318  -0.542  1.00 58.12  ? 105 ASN A N     1 
ATOM   832  C  CA    . ASN A 1 105 ? 23.679  -5.508  -1.991  1.00 57.83  ? 105 ASN A CA    1 
ATOM   833  C  C     . ASN A 1 105 ? 24.736  -4.661  -2.668  1.00 58.03  ? 105 ASN A C     1 
ATOM   834  O  O     . ASN A 1 105 ? 25.558  -5.185  -3.412  1.00 57.60  ? 105 ASN A O     1 
ATOM   835  C  CB    . ASN A 1 105 ? 22.320  -5.133  -2.580  1.00 58.23  ? 105 ASN A CB    1 
ATOM   836  C  CG    . ASN A 1 105 ? 21.168  -5.912  -1.959  1.00 58.16  ? 105 ASN A CG    1 
ATOM   837  O  OD1   . ASN A 1 105 ? 21.343  -7.022  -1.449  1.00 57.65  ? 105 ASN A OD1   1 
ATOM   838  N  ND2   . ASN A 1 105 ? 19.978  -5.329  -2.007  1.00 58.77  ? 105 ASN A ND2   1 
ATOM   839  N  N     . ARG A 1 106 ? 24.729  -3.359  -2.392  1.00 58.78  ? 106 ARG A N     1 
ATOM   840  C  CA    . ARG A 1 106 ? 25.649  -2.426  -3.047  1.00 59.16  ? 106 ARG A CA    1 
ATOM   841  C  C     . ARG A 1 106 ? 27.121  -2.739  -2.875  1.00 58.81  ? 106 ARG A C     1 
ATOM   842  O  O     . ARG A 1 106 ? 27.927  -2.340  -3.704  1.00 58.97  ? 106 ARG A O     1 
ATOM   843  C  CB    . ARG A 1 106 ? 25.439  -1.017  -2.503  1.00 60.11  ? 106 ARG A CB    1 
ATOM   844  C  CG    . ARG A 1 106 ? 26.107  0.082   -3.311  1.00 60.73  ? 106 ARG A CG    1 
ATOM   845  C  CD    . ARG A 1 106 ? 25.462  0.262   -4.665  1.00 60.93  ? 106 ARG A CD    1 
ATOM   846  N  NE    . ARG A 1 106 ? 24.177  0.952   -4.551  1.00 61.64  ? 106 ARG A NE    1 
ATOM   847  C  CZ    . ARG A 1 106 ? 24.004  2.269   -4.646  1.00 62.68  ? 106 ARG A CZ    1 
ATOM   848  N  NH1   . ARG A 1 106 ? 22.780  2.779   -4.517  1.00 63.34  ? 106 ARG A NH1   1 
ATOM   849  N  NH2   . ARG A 1 106 ? 25.040  3.084   -4.862  1.00 63.15  ? 106 ARG A NH2   1 
ATOM   850  N  N     . LEU A 1 107 ? 27.470  -3.370  -1.762  1.00 58.48  ? 107 LEU A N     1 
ATOM   851  C  CA    . LEU A 1 107 ? 28.840  -3.815  -1.519  1.00 58.16  ? 107 LEU A CA    1 
ATOM   852  C  C     . LEU A 1 107 ? 29.225  -4.986  -2.403  1.00 57.48  ? 107 LEU A C     1 
ATOM   853  O  O     . LEU A 1 107 ? 30.401  -5.223  -2.646  1.00 57.35  ? 107 LEU A O     1 
ATOM   854  C  CB    . LEU A 1 107 ? 29.029  -4.196  -0.049  1.00 58.08  ? 107 LEU A CB    1 
ATOM   855  C  CG    . LEU A 1 107 ? 28.928  -3.044  0.970   1.00 58.83  ? 107 LEU A CG    1 
ATOM   856  C  CD1   . LEU A 1 107 ? 28.970  -3.591  2.394   1.00 58.76  ? 107 LEU A CD1   1 
ATOM   857  C  CD2   . LEU A 1 107 ? 30.022  -1.995  0.779   1.00 59.33  ? 107 LEU A CD2   1 
ATOM   858  N  N     . ARG A 1 108 ? 28.230  -5.730  -2.849  1.00 57.14  ? 108 ARG A N     1 
ATOM   859  C  CA    . ARG A 1 108 ? 28.430  -6.832  -3.753  1.00 56.59  ? 108 ARG A CA    1 
ATOM   860  C  C     . ARG A 1 108 ? 28.189  -6.431  -5.218  1.00 56.78  ? 108 ARG A C     1 
ATOM   861  O  O     . ARG A 1 108 ? 28.734  -7.051  -6.125  1.00 56.52  ? 108 ARG A O     1 
ATOM   862  C  CB    . ARG A 1 108 ? 27.491  -7.925  -3.294  1.00 56.17  ? 108 ARG A CB    1 
ATOM   863  C  CG    . ARG A 1 108 ? 28.067  -9.314  -3.409  1.00 55.61  ? 108 ARG A CG    1 
ATOM   864  C  CD    . ARG A 1 108 ? 27.098  -10.335 -2.833  1.00 55.33  ? 108 ARG A CD    1 
ATOM   865  N  NE    . ARG A 1 108 ? 25.744  -10.169 -3.378  1.00 55.44  ? 108 ARG A NE    1 
ATOM   866  C  CZ    . ARG A 1 108 ? 24.652  -10.796 -2.936  1.00 55.38  ? 108 ARG A CZ    1 
ATOM   867  N  NH1   . ARG A 1 108 ? 24.708  -11.674 -1.930  1.00 55.22  ? 108 ARG A NH1   1 
ATOM   868  N  NH2   . ARG A 1 108 ? 23.484  -10.547 -3.527  1.00 55.56  ? 108 ARG A NH2   1 
ATOM   869  N  N     . GLU A 1 109 ? 27.400  -5.380  -5.440  1.00 57.33  ? 109 GLU A N     1 
ATOM   870  C  CA    . GLU A 1 109 ? 27.307  -4.716  -6.742  1.00 57.74  ? 109 GLU A CA    1 
ATOM   871  C  C     . GLU A 1 109 ? 28.674  -4.074  -7.028  1.00 58.08  ? 109 GLU A C     1 
ATOM   872  O  O     . GLU A 1 109 ? 29.199  -4.206  -8.129  1.00 58.14  ? 109 GLU A O     1 
ATOM   873  C  CB    . GLU A 1 109 ? 26.148  -3.692  -6.750  1.00 58.38  ? 109 GLU A CB    1 
ATOM   874  C  CG    . GLU A 1 109 ? 25.779  -3.084  -8.111  1.00 58.88  ? 109 GLU A CG    1 
ATOM   875  C  CD    . GLU A 1 109 ? 26.202  -1.615  -8.259  1.00 59.80  ? 109 GLU A CD    1 
ATOM   876  O  OE1   . GLU A 1 109 ? 27.414  -1.298  -8.140  1.00 59.93  ? 109 GLU A OE1   1 
ATOM   877  O  OE2   . GLU A 1 109 ? 25.314  -0.761  -8.487  1.00 60.48  ? 109 GLU A OE2   1 
ATOM   878  N  N     . MET A 1 110 ? 29.264  -3.416  -6.026  1.00 58.37  ? 110 MET A N     1 
ATOM   879  C  CA    . MET A 1 110 ? 30.706  -3.077  -6.048  1.00 58.59  ? 110 MET A CA    1 
ATOM   880  C  C     . MET A 1 110 ? 31.514  -4.342  -5.761  1.00 57.91  ? 110 MET A C     1 
ATOM   881  O  O     . MET A 1 110 ? 30.948  -5.380  -5.422  1.00 57.33  ? 110 MET A O     1 
ATOM   882  C  CB    . MET A 1 110 ? 31.031  -1.964  -5.040  1.00 59.18  ? 110 MET A CB    1 
ATOM   883  C  CG    . MET A 1 110 ? 30.587  -0.584  -5.507  1.00 60.08  ? 110 MET A CG    1 
ATOM   884  S  SD    . MET A 1 110 ? 30.080  0.548   -4.186  1.00 60.76  ? 110 MET A SD    1 
ATOM   885  C  CE    . MET A 1 110 ? 31.574  0.698   -3.215  1.00 60.83  ? 110 MET A CE    1 
ATOM   886  N  N     . GLY A 1 111 ? 32.834  -4.266  -5.874  1.00 58.07  ? 111 GLY A N     1 
ATOM   887  C  CA    . GLY A 1 111 ? 33.671  -5.463  -5.781  1.00 57.56  ? 111 GLY A CA    1 
ATOM   888  C  C     . GLY A 1 111 ? 33.953  -6.031  -4.398  1.00 57.23  ? 111 GLY A C     1 
ATOM   889  O  O     . GLY A 1 111 ? 34.685  -7.010  -4.296  1.00 56.91  ? 111 GLY A O     1 
ATOM   890  N  N     . LYS A 1 112 ? 33.340  -5.469  -3.349  1.00 57.38  ? 112 LYS A N     1 
ATOM   891  C  CA    . LYS A 1 112 ? 33.848  -5.595  -1.960  1.00 57.37  ? 112 LYS A CA    1 
ATOM   892  C  C     . LYS A 1 112 ? 33.634  -6.966  -1.325  1.00 56.79  ? 112 LYS A C     1 
ATOM   893  O  O     . LYS A 1 112 ? 32.702  -7.680  -1.681  1.00 56.41  ? 112 LYS A O     1 
ATOM   894  C  CB    . LYS A 1 112 ? 33.214  -4.535  -1.027  1.00 57.85  ? 112 LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 112 ? 33.365  -3.081  -1.451  1.00 58.59  ? 112 LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 112 ? 34.821  -2.656  -1.520  1.00 58.94  ? 112 LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 112 ? 34.931  -1.168  -1.805  1.00 59.80  ? 112 LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 112 ? 36.220  -0.825  -2.469  1.00 60.18  ? 112 LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 113 ? 34.503  -7.299  -0.372  1.00 56.80  ? 113 ILE A N     1 
ATOM   900  C  CA    . ILE A 1 113 ? 34.373  -8.500  0.455   1.00 56.42  ? 113 ILE A CA    1 
ATOM   901  C  C     . ILE A 1 113 ? 34.802  -8.216  1.886   1.00 56.73  ? 113 ILE A C     1 
ATOM   902  O  O     . ILE A 1 113 ? 35.486  -7.227  2.157   1.00 57.19  ? 113 ILE A O     1 
ATOM   903  C  CB    . ILE A 1 113 ? 35.232  -9.660  -0.070  1.00 56.11  ? 113 ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 113 ? 36.684  -9.218  -0.294  1.00 56.46  ? 113 ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 113 ? 34.653  -10.201 -1.359  1.00 55.79  ? 113 ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 113 ? 37.686  -10.297 0.035   1.00 56.37  ? 113 ILE A CD1   1 
ATOM   907  N  N     . GLN A 1 114 ? 34.411  -9.106  2.792   1.00 56.55  ? 114 GLN A N     1 
ATOM   908  C  CA    . GLN A 1 114 ? 34.726  -8.988  4.212   1.00 56.88  ? 114 GLN A CA    1 
ATOM   909  C  C     . GLN A 1 114 ? 36.022  -9.741  4.506   1.00 56.86  ? 114 GLN A C     1 
ATOM   910  O  O     . GLN A 1 114 ? 36.107  -10.929 4.218   1.00 56.52  ? 114 GLN A O     1 
ATOM   911  C  CB    . GLN A 1 114 ? 33.583  -9.591  5.030   1.00 56.82  ? 114 GLN A CB    1 
ATOM   912  C  CG    . GLN A 1 114 ? 33.486  -9.066  6.445   1.00 57.35  ? 114 GLN A CG    1 
ATOM   913  C  CD    . GLN A 1 114 ? 32.497  -9.884  7.243   1.00 57.35  ? 114 GLN A CD    1 
ATOM   914  O  OE1   . GLN A 1 114 ? 32.758  -10.422 8.350   1.00 57.59  ? 114 GLN A OE1   1 
ATOM   915  N  NE2   . GLN A 1 114 ? 31.347  -10.024 6.643   1.00 57.14  ? 114 GLN A NE2   1 
ATOM   916  N  N     . LYS A 1 115 ? 37.016  -9.060  5.072   1.00 57.29  ? 115 LYS A N     1 
ATOM   917  C  CA    . LYS A 1 115 ? 38.256  -9.711  5.515   1.00 57.41  ? 115 LYS A CA    1 
ATOM   918  C  C     . LYS A 1 115 ? 38.458  -9.455  7.000   1.00 57.86  ? 115 LYS A C     1 
ATOM   919  O  O     . LYS A 1 115 ? 37.974  -8.450  7.529   1.00 58.20  ? 115 LYS A O     1 
ATOM   920  C  CB    . LYS A 1 115 ? 39.465  -9.191  4.749   1.00 57.61  ? 115 LYS A CB    1 
ATOM   921  C  CG    . LYS A 1 115 ? 39.501  -9.624  3.294   1.00 57.27  ? 115 LYS A CG    1 
ATOM   922  C  CD    . LYS A 1 115 ? 40.743  -9.126  2.560   1.00 57.62  ? 115 LYS A CD    1 
ATOM   923  C  CE    . LYS A 1 115 ? 41.968  -9.968  2.894   1.00 57.78  ? 115 LYS A CE    1 
ATOM   924  N  NZ    . LYS A 1 115 ? 43.143  -9.597  2.055   1.00 58.17  ? 115 LYS A NZ    1 
ATOM   925  N  N     . VAL A 1 116 ? 39.183  -10.363 7.660   1.00 57.95  ? 116 VAL A N     1 
ATOM   926  C  CA    . VAL A 1 116 ? 39.389  -10.303 9.124   1.00 58.44  ? 116 VAL A CA    1 
ATOM   927  C  C     . VAL A 1 116 ? 40.685  -9.597  9.509   1.00 58.95  ? 116 VAL A C     1 
ATOM   928  O  O     . VAL A 1 116 ? 41.738  -9.770  8.882   1.00 58.95  ? 116 VAL A O     1 
ATOM   929  C  CB    . VAL A 1 116 ? 39.340  -11.685 9.813   1.00 58.41  ? 116 VAL A CB    1 
ATOM   930  C  CG1   . VAL A 1 116 ? 37.897  -12.112 9.998   1.00 58.19  ? 116 VAL A CG1   1 
ATOM   931  C  CG2   . VAL A 1 116 ? 40.145  -12.738 9.054   1.00 58.16  ? 116 VAL A CG2   1 
ATOM   932  N  N     . GLY A 1 117 ? 40.576  -8.799  10.565  1.00 59.46  ? 117 GLY A N     1 
ATOM   933  C  CA    . GLY A 1 117 ? 41.644  -7.919  11.029  1.00 60.05  ? 117 GLY A CA    1 
ATOM   934  C  C     . GLY A 1 117 ? 42.828  -8.670  11.593  1.00 60.31  ? 117 GLY A C     1 
ATOM   935  O  O     . GLY A 1 117 ? 42.754  -9.263  12.679  1.00 60.57  ? 117 GLY A O     1 
ATOM   936  N  N     . ARG A 1 118 ? 43.917  -8.626  10.836  1.00 60.34  ? 118 ARG A N     1 
ATOM   937  C  CA    . ARG A 1 118 ? 45.163  -9.264  11.211  1.00 60.68  ? 118 ARG A CA    1 
ATOM   938  C  C     . ARG A 1 118 ? 45.651  -8.816  12.613  1.00 61.40  ? 118 ARG A C     1 
ATOM   939  O  O     . ARG A 1 118 ? 45.602  -7.628  12.944  1.00 61.77  ? 118 ARG A O     1 
ATOM   940  C  CB    . ARG A 1 118 ? 46.195  -8.960  10.122  1.00 60.75  ? 118 ARG A CB    1 
ATOM   941  C  CG    . ARG A 1 118 ? 47.524  -9.664  10.302  1.00 61.14  ? 118 ARG A CG    1 
ATOM   942  C  CD    . ARG A 1 118 ? 48.113  -10.108 8.973   1.00 60.95  ? 118 ARG A CD    1 
ATOM   943  N  NE    . ARG A 1 118 ? 49.575  -10.142 8.990   1.00 61.58  ? 118 ARG A NE    1 
ATOM   944  C  CZ    . ARG A 1 118 ? 50.333  -11.035 9.631   1.00 61.95  ? 118 ARG A CZ    1 
ATOM   945  N  NH1   . ARG A 1 118 ? 49.800  -12.012 10.365  1.00 61.79  ? 118 ARG A NH1   1 
ATOM   946  N  NH2   . ARG A 1 118 ? 51.655  -10.941 9.536   1.00 62.58  ? 118 ARG A NH2   1 
ATOM   947  N  N     . TRP A 1 119 ? 46.065  -9.779  13.439  1.00 61.65  ? 119 TRP A N     1 
ATOM   948  C  CA    . TRP A 1 119 ? 46.602  -9.487  14.774  1.00 62.39  ? 119 TRP A CA    1 
ATOM   949  C  C     . TRP A 1 119 ? 48.043  -8.962  14.698  1.00 62.93  ? 119 TRP A C     1 
ATOM   950  O  O     . TRP A 1 119 ? 48.850  -9.480  13.915  1.00 62.83  ? 119 TRP A O     1 
ATOM   951  C  CB    . TRP A 1 119 ? 46.616  -10.743 15.675  1.00 62.61  ? 119 TRP A CB    1 
ATOM   952  C  CG    . TRP A 1 119 ? 45.372  -11.076 16.481  1.00 62.59  ? 119 TRP A CG    1 
ATOM   953  C  CD1   . TRP A 1 119 ? 44.823  -12.312 16.638  1.00 62.41  ? 119 TRP A CD1   1 
ATOM   954  C  CD2   . TRP A 1 119 ? 44.576  -10.183 17.276  1.00 62.90  ? 119 TRP A CD2   1 
ATOM   955  N  NE1   . TRP A 1 119 ? 43.727  -12.248 17.459  1.00 62.58  ? 119 TRP A NE1   1 
ATOM   956  C  CE2   . TRP A 1 119 ? 43.549  -10.953 17.863  1.00 62.88  ? 119 TRP A CE2   1 
ATOM   957  C  CE3   . TRP A 1 119 ? 44.623  -8.805  17.538  1.00 63.27  ? 119 TRP A CE3   1 
ATOM   958  C  CZ2   . TRP A 1 119 ? 42.580  -10.398 18.697  1.00 63.24  ? 119 TRP A CZ2   1 
ATOM   959  C  CZ3   . TRP A 1 119 ? 43.651  -8.250  18.358  1.00 63.61  ? 119 TRP A CZ3   1 
ATOM   960  C  CH2   . TRP A 1 119 ? 42.646  -9.049  18.930  1.00 63.60  ? 119 TRP A CH2   1 
ATOM   961  N  N     . VAL A 1 120 ? 48.371  -7.982  15.550  1.00 63.58  ? 120 VAL A N     1 
ATOM   962  C  CA    . VAL A 1 120 ? 49.756  -7.494  15.706  1.00 64.24  ? 120 VAL A CA    1 
ATOM   963  C  C     . VAL A 1 120 ? 50.181  -7.509  17.193  1.00 65.03  ? 120 VAL A C     1 
ATOM   964  O  O     . VAL A 1 120 ? 49.339  -7.399  18.079  1.00 65.16  ? 120 VAL A O     1 
ATOM   965  C  CB    . VAL A 1 120 ? 49.978  -6.096  15.067  1.00 64.41  ? 120 VAL A CB    1 
ATOM   966  C  CG1   . VAL A 1 120 ? 49.833  -6.180  13.559  1.00 63.79  ? 120 VAL A CG1   1 
ATOM   967  C  CG2   . VAL A 1 120 ? 49.030  -5.052  15.630  1.00 64.58  ? 120 VAL A CG2   1 
ATOM   968  N  N     . PRO A 1 121 ? 51.492  -7.624  17.469  1.00 65.64  ? 121 PRO A N     1 
ATOM   969  C  CA    . PRO A 1 121 ? 51.945  -7.876  18.835  1.00 66.41  ? 121 PRO A CA    1 
ATOM   970  C  C     . PRO A 1 121 ? 51.625  -6.833  19.913  1.00 67.01  ? 121 PRO A C     1 
ATOM   971  O  O     . PRO A 1 121 ? 51.570  -7.203  21.085  1.00 67.54  ? 121 PRO A O     1 
ATOM   972  C  CB    . PRO A 1 121 ? 53.470  -7.966  18.694  1.00 66.98  ? 121 PRO A CB    1 
ATOM   973  C  CG    . PRO A 1 121 ? 53.753  -8.117  17.252  1.00 66.45  ? 121 PRO A CG    1 
ATOM   974  C  CD    . PRO A 1 121 ? 52.621  -7.485  16.530  1.00 65.75  ? 121 PRO A CD    1 
ATOM   975  N  N     . HIS A 1 122 ? 51.472  -5.554  19.555  1.00 67.07  ? 122 HIS A N     1 
ATOM   976  C  CA    . HIS A 1 122 ? 51.442  -4.486  20.575  1.00 67.86  ? 122 HIS A CA    1 
ATOM   977  C  C     . HIS A 1 122 ? 50.955  -3.132  20.065  1.00 67.85  ? 122 HIS A C     1 
ATOM   978  O  O     . HIS A 1 122 ? 51.070  -2.832  18.879  1.00 67.42  ? 122 HIS A O     1 
ATOM   979  C  CB    . HIS A 1 122 ? 52.852  -4.312  21.150  1.00 68.74  ? 122 HIS A CB    1 
ATOM   980  C  CG    . HIS A 1 122 ? 52.889  -3.662  22.492  1.00 69.67  ? 122 HIS A CG    1 
ATOM   981  N  ND1   . HIS A 1 122 ? 52.177  -4.142  23.569  1.00 69.90  ? 122 HIS A ND1   1 
ATOM   982  C  CD2   . HIS A 1 122 ? 53.578  -2.590  22.944  1.00 70.52  ? 122 HIS A CD2   1 
ATOM   983  C  CE1   . HIS A 1 122 ? 52.409  -3.382  24.622  1.00 70.84  ? 122 HIS A CE1   1 
ATOM   984  N  NE2   . HIS A 1 122 ? 53.257  -2.433  24.269  1.00 71.22  ? 122 HIS A NE2   1 
ATOM   985  N  N     . GLU A 1 123 ? 50.407  -2.321  20.971  1.00 68.42  ? 123 GLU A N     1 
ATOM   986  C  CA    . GLU A 1 123 ? 50.106  -0.917  20.674  1.00 68.72  ? 123 GLU A CA    1 
ATOM   987  C  C     . GLU A 1 123 ? 51.405  -0.139  20.862  1.00 69.56  ? 123 GLU A C     1 
ATOM   988  O  O     . GLU A 1 123 ? 51.925  -0.103  21.973  1.00 70.33  ? 123 GLU A O     1 
ATOM   989  C  CB    . GLU A 1 123 ? 48.996  -0.377  21.604  1.00 69.14  ? 123 GLU A CB    1 
ATOM   990  C  CG    . GLU A 1 123 ? 48.427  0.997   21.210  1.00 69.41  ? 123 GLU A CG    1 
ATOM   991  C  CD    . GLU A 1 123 ? 47.353  0.943   20.109  1.00 68.56  ? 123 GLU A CD    1 
ATOM   992  O  OE1   . GLU A 1 123 ? 46.263  0.394   20.363  1.00 68.19  ? 123 GLU A OE1   1 
ATOM   993  O  OE2   . GLU A 1 123 ? 47.569  1.464   18.990  1.00 68.31  ? 123 GLU A OE2   1 
ATOM   994  N  N     . LEU A 1 124 ? 51.921  0.468   19.789  1.00 69.49  ? 124 LEU A N     1 
ATOM   995  C  CA    . LEU A 1 124 ? 53.215  1.159   19.842  1.00 70.31  ? 124 LEU A CA    1 
ATOM   996  C  C     . LEU A 1 124 ? 53.112  2.657   20.128  1.00 71.16  ? 124 LEU A C     1 
ATOM   997  O  O     . LEU A 1 124 ? 52.203  3.323   19.650  1.00 70.97  ? 124 LEU A O     1 
ATOM   998  C  CB    . LEU A 1 124 ? 53.997  0.985   18.532  1.00 69.98  ? 124 LEU A CB    1 
ATOM   999  C  CG    . LEU A 1 124 ? 54.609  -0.363  18.107  1.00 69.47  ? 124 LEU A CG    1 
ATOM   1000 C  CD1   . LEU A 1 124 ? 55.882  -0.132  17.298  1.00 69.86  ? 124 LEU A CD1   1 
ATOM   1001 C  CD2   . LEU A 1 124 ? 54.921  -1.284  19.279  1.00 69.73  ? 124 LEU A CD2   1 
ATOM   1002 N  N     . ASN A 1 125 ? 54.067  3.160   20.911  1.00 72.15  ? 125 ASN A N     1 
ATOM   1003 C  CA    . ASN A 1 125 ? 54.289  4.594   21.091  1.00 73.12  ? 125 ASN A CA    1 
ATOM   1004 C  C     . ASN A 1 125 ? 54.895  5.237   19.875  1.00 73.20  ? 125 ASN A C     1 
ATOM   1005 O  O     . ASN A 1 125 ? 55.497  4.567   19.041  1.00 72.72  ? 125 ASN A O     1 
ATOM   1006 C  CB    . ASN A 1 125 ? 55.261  4.837   22.240  1.00 74.18  ? 125 ASN A CB    1 
ATOM   1007 C  CG    . ASN A 1 125 ? 54.645  4.565   23.577  1.00 74.48  ? 125 ASN A CG    1 
ATOM   1008 O  OD1   . ASN A 1 125 ? 53.764  5.292   24.015  1.00 74.83  ? 125 ASN A OD1   1 
ATOM   1009 N  ND2   . ASN A 1 125 ? 55.086  3.504   24.227  1.00 74.42  ? 125 ASN A ND2   1 
ATOM   1010 N  N     . GLU A 1 126 ? 54.783  6.556   19.810  1.00 73.96  ? 126 GLU A N     1 
ATOM   1011 C  CA    . GLU A 1 126 ? 55.501  7.323   18.810  1.00 74.37  ? 126 GLU A CA    1 
ATOM   1012 C  C     . GLU A 1 126 ? 57.020  7.081   18.971  1.00 74.95  ? 126 GLU A C     1 
ATOM   1013 O  O     . GLU A 1 126 ? 57.723  6.908   17.972  1.00 74.82  ? 126 GLU A O     1 
ATOM   1014 C  CB    . GLU A 1 126 ? 55.129  8.812   18.907  1.00 75.31  ? 126 GLU A CB    1 
ATOM   1015 C  CG    . GLU A 1 126 ? 55.814  9.735   17.893  1.00 75.93  ? 126 GLU A CG    1 
ATOM   1016 C  CD    . GLU A 1 126 ? 57.092  10.442  18.403  1.00 77.21  ? 126 GLU A CD    1 
ATOM   1017 O  OE1   . GLU A 1 126 ? 57.646  10.107  19.495  1.00 77.58  ? 126 GLU A OE1   1 
ATOM   1018 O  OE2   . GLU A 1 126 ? 57.568  11.355  17.680  1.00 77.93  ? 126 GLU A OE2   1 
ATOM   1019 N  N     . ARG A 1 127 ? 57.518  7.036   20.213  1.00 75.62  ? 127 ARG A N     1 
ATOM   1020 C  CA    . ARG A 1 127 ? 58.941  6.747   20.455  1.00 76.22  ? 127 ARG A CA    1 
ATOM   1021 C  C     . ARG A 1 127 ? 59.301  5.316   20.070  1.00 75.39  ? 127 ARG A C     1 
ATOM   1022 O  O     . ARG A 1 127 ? 60.167  5.110   19.232  1.00 75.43  ? 127 ARG A O     1 
ATOM   1023 C  CB    . ARG A 1 127 ? 59.350  7.013   21.905  1.00 77.19  ? 127 ARG A CB    1 
ATOM   1024 C  CG    . ARG A 1 127 ? 60.669  6.346   22.293  1.00 77.63  ? 127 ARG A CG    1 
ATOM   1025 C  CD    . ARG A 1 127 ? 61.518  7.223   23.202  1.00 79.03  ? 127 ARG A CD    1 
ATOM   1026 N  NE    . ARG A 1 127 ? 62.610  6.504   23.888  1.00 79.52  ? 127 ARG A NE    1 
ATOM   1027 C  CZ    . ARG A 1 127 ? 63.697  5.974   23.305  1.00 79.59  ? 127 ARG A CZ    1 
ATOM   1028 N  NH1   . ARG A 1 127 ? 63.883  6.027   21.976  1.00 79.19  ? 127 ARG A NH1   1 
ATOM   1029 N  NH2   . ARG A 1 127 ? 64.612  5.361   24.062  1.00 80.16  ? 127 ARG A NH2   1 
ATOM   1030 N  N     . GLN A 1 128 ? 58.650  4.344   20.703  1.00 74.75  ? 128 GLN A N     1 
ATOM   1031 C  CA    . GLN A 1 128 ? 58.825  2.914   20.386  1.00 73.95  ? 128 GLN A CA    1 
ATOM   1032 C  C     . GLN A 1 128 ? 58.963  2.598   18.900  1.00 73.30  ? 128 GLN A C     1 
ATOM   1033 O  O     . GLN A 1 128 ? 59.718  1.706   18.529  1.00 73.15  ? 128 GLN A O     1 
ATOM   1034 C  CB    . GLN A 1 128 ? 57.647  2.106   20.915  1.00 73.19  ? 128 GLN A CB    1 
ATOM   1035 C  CG    . GLN A 1 128 ? 57.713  1.798   22.396  1.00 73.76  ? 128 GLN A CG    1 
ATOM   1036 C  CD    . GLN A 1 128 ? 56.519  0.976   22.852  1.00 73.06  ? 128 GLN A CD    1 
ATOM   1037 O  OE1   . GLN A 1 128 ? 55.372  1.342   22.583  1.00 72.59  ? 128 GLN A OE1   1 
ATOM   1038 N  NE2   . GLN A 1 128 ? 56.775  -0.137  23.539  1.00 73.08  ? 128 GLN A NE2   1 
ATOM   1039 N  N     . MET A 1 129 ? 58.189  3.290   18.065  1.00 72.94  ? 129 MET A N     1 
ATOM   1040 C  CA    . MET A 1 129 ? 58.327  3.187   16.609  1.00 72.49  ? 129 MET A CA    1 
ATOM   1041 C  C     . MET A 1 129 ? 59.716  3.626   16.165  1.00 73.38  ? 129 MET A C     1 
ATOM   1042 O  O     . MET A 1 129 ? 60.459  2.814   15.631  1.00 73.26  ? 129 MET A O     1 
ATOM   1043 C  CB    . MET A 1 129 ? 57.287  4.048   15.883  1.00 72.20  ? 129 MET A CB    1 
ATOM   1044 C  CG    . MET A 1 129 ? 55.868  3.493   15.840  1.00 71.17  ? 129 MET A CG    1 
ATOM   1045 S  SD    . MET A 1 129 ? 54.659  4.747   15.356  1.00 71.20  ? 129 MET A SD    1 
ATOM   1046 C  CE    . MET A 1 129 ? 55.411  5.494   13.896  1.00 71.63  ? 129 MET A CE    1 
ATOM   1047 N  N     . GLU A 1 130 ? 60.073  4.891   16.402  1.00 74.37  ? 130 GLU A N     1 
ATOM   1048 C  CA    . GLU A 1 130 ? 61.371  5.425   15.930  1.00 75.35  ? 130 GLU A CA    1 
ATOM   1049 C  C     . GLU A 1 130 ? 62.564  4.719   16.589  1.00 75.86  ? 130 GLU A C     1 
ATOM   1050 O  O     . GLU A 1 130 ? 63.632  4.626   15.992  1.00 76.38  ? 130 GLU A O     1 
ATOM   1051 C  CB    . GLU A 1 130 ? 61.464  6.954   16.108  1.00 76.40  ? 130 GLU A CB    1 
ATOM   1052 C  CG    . GLU A 1 130 ? 62.087  7.427   17.421  1.00 77.42  ? 130 GLU A CG    1 
ATOM   1053 C  CD    . GLU A 1 130 ? 61.760  8.868   17.766  1.00 78.30  ? 130 GLU A CD    1 
ATOM   1054 O  OE1   . GLU A 1 130 ? 60.562  9.236   17.728  1.00 77.86  ? 130 GLU A OE1   1 
ATOM   1055 O  OE2   . GLU A 1 130 ? 62.699  9.627   18.089  1.00 79.50  ? 130 GLU A OE2   1 
ATOM   1056 N  N     . ARG A 1 131 ? 62.362  4.237   17.815  1.00 75.79  ? 131 ARG A N     1 
ATOM   1057 C  CA    . ARG A 1 131 ? 63.297  3.328   18.490  1.00 76.13  ? 131 ARG A CA    1 
ATOM   1058 C  C     . ARG A 1 131 ? 63.514  2.063   17.633  1.00 75.41  ? 131 ARG A C     1 
ATOM   1059 O  O     . ARG A 1 131 ? 64.648  1.643   17.419  1.00 75.95  ? 131 ARG A O     1 
ATOM   1060 C  CB    . ARG A 1 131 ? 62.772  2.980   19.913  1.00 76.09  ? 131 ARG A CB    1 
ATOM   1061 C  CG    . ARG A 1 131 ? 63.569  1.957   20.733  1.00 76.43  ? 131 ARG A CG    1 
ATOM   1062 C  CD    . ARG A 1 131 ? 64.984  2.440   21.011  1.00 77.70  ? 131 ARG A CD    1 
ATOM   1063 N  NE    . ARG A 1 131 ? 65.746  1.558   21.906  1.00 78.20  ? 131 ARG A NE    1 
ATOM   1064 C  CZ    . ARG A 1 131 ? 66.575  0.567   21.541  1.00 78.26  ? 131 ARG A CZ    1 
ATOM   1065 N  NH1   . ARG A 1 131 ? 66.788  0.246   20.258  1.00 77.84  ? 131 ARG A NH1   1 
ATOM   1066 N  NH2   . ARG A 1 131 ? 67.210  -0.132  22.488  1.00 78.86  ? 131 ARG A NH2   1 
ATOM   1067 N  N     . ARG A 1 132 ? 62.419  1.469   17.160  1.00 74.27  ? 132 ARG A N     1 
ATOM   1068 C  CA    . ARG A 1 132 ? 62.456  0.325   16.234  1.00 73.55  ? 132 ARG A CA    1 
ATOM   1069 C  C     . ARG A 1 132 ? 63.077  0.688   14.880  1.00 73.80  ? 132 ARG A C     1 
ATOM   1070 O  O     . ARG A 1 132 ? 63.943  -0.032  14.375  1.00 74.02  ? 132 ARG A O     1 
ATOM   1071 C  CB    . ARG A 1 132 ? 61.015  -0.237  15.994  1.00 72.30  ? 132 ARG A CB    1 
ATOM   1072 C  CG    . ARG A 1 132 ? 60.527  -1.169  17.070  1.00 71.95  ? 132 ARG A CG    1 
ATOM   1073 C  CD    . ARG A 1 132 ? 59.158  -1.706  16.687  1.00 70.80  ? 132 ARG A CD    1 
ATOM   1074 N  NE    . ARG A 1 132 ? 59.315  -2.773  15.700  1.00 70.23  ? 132 ARG A NE    1 
ATOM   1075 C  CZ    . ARG A 1 132 ? 58.400  -3.203  14.838  1.00 69.30  ? 132 ARG A CZ    1 
ATOM   1076 N  NH1   . ARG A 1 132 ? 57.167  -2.697  14.731  1.00 68.72  ? 132 ARG A NH1   1 
ATOM   1077 N  NH2   . ARG A 1 132 ? 58.762  -4.179  14.036  1.00 69.00  ? 132 ARG A NH2   1 
ATOM   1078 N  N     . LYS A 1 133 ? 62.627  1.808   14.310  1.00 73.88  ? 133 LYS A N     1 
ATOM   1079 C  CA    . LYS A 1 133 ? 63.083  2.284   12.994  1.00 74.20  ? 133 LYS A CA    1 
ATOM   1080 C  C     . LYS A 1 133 ? 64.595  2.457   12.940  1.00 75.38  ? 133 LYS A C     1 
ATOM   1081 O  O     . LYS A 1 133 ? 65.219  2.087   11.954  1.00 75.56  ? 133 LYS A O     1 
ATOM   1082 C  CB    . LYS A 1 133 ? 62.416  3.618   12.626  1.00 74.37  ? 133 LYS A CB    1 
ATOM   1083 C  CG    . LYS A 1 133 ? 62.527  3.986   11.148  1.00 74.48  ? 133 LYS A CG    1 
ATOM   1084 C  CD    . LYS A 1 133 ? 62.369  5.481   10.895  1.00 75.23  ? 133 LYS A CD    1 
ATOM   1085 C  CE    . LYS A 1 133 ? 62.448  5.800   9.408   1.00 75.40  ? 133 LYS A CE    1 
ATOM   1086 N  NZ    . LYS A 1 133 ? 62.495  7.260   9.128   1.00 76.39  ? 133 LYS A NZ    1 
ATOM   1087 N  N     . ASN A 1 134 ? 65.173  3.013   14.002  1.00 76.25  ? 134 ASN A N     1 
ATOM   1088 C  CA    . ASN A 1 134 ? 66.624  3.218   14.068  1.00 77.49  ? 134 ASN A CA    1 
ATOM   1089 C  C     . ASN A 1 134 ? 67.402  1.900   14.090  1.00 77.49  ? 134 ASN A C     1 
ATOM   1090 O  O     . ASN A 1 134 ? 68.357  1.745   13.326  1.00 78.12  ? 134 ASN A O     1 
ATOM   1091 C  CB    . ASN A 1 134 ? 67.030  4.085   15.274  1.00 78.45  ? 134 ASN A CB    1 
ATOM   1092 C  CG    . ASN A 1 134 ? 66.852  5.586   15.033  1.00 79.09  ? 134 ASN A CG    1 
ATOM   1093 O  OD1   . ASN A 1 134 ? 67.808  6.347   15.163  1.00 80.32  ? 134 ASN A OD1   1 
ATOM   1094 N  ND2   . ASN A 1 134 ? 65.627  6.022   14.715  1.00 78.37  ? 134 ASN A ND2   1 
ATOM   1095 N  N     . THR A 1 135 ? 66.994  0.959   14.949  1.00 76.89  ? 135 THR A N     1 
ATOM   1096 C  CA    . THR A 1 135 ? 67.654  -0.358  15.042  1.00 76.93  ? 135 THR A CA    1 
ATOM   1097 C  C     . THR A 1 135 ? 67.746  -0.985  13.650  1.00 76.56  ? 135 THR A C     1 
ATOM   1098 O  O     . THR A 1 135 ? 68.831  -1.355  13.185  1.00 77.31  ? 135 THR A O     1 
ATOM   1099 C  CB    . THR A 1 135 ? 66.907  -1.324  15.989  1.00 76.17  ? 135 THR A CB    1 
ATOM   1100 O  OG1   . THR A 1 135 ? 66.560  -0.645  17.199  1.00 76.42  ? 135 THR A OG1   1 
ATOM   1101 C  CG2   . THR A 1 135 ? 67.765  -2.535  16.326  1.00 76.58  ? 135 THR A CG2   1 
ATOM   1102 N  N     . CYS A 1 136 ? 66.605  -1.047  12.977  1.00 75.48  ? 136 CYS A N     1 
ATOM   1103 C  CA    . CYS A 1 136 ? 66.537  -1.551  11.620  1.00 75.09  ? 136 CYS A CA    1 
ATOM   1104 C  C     . CYS A 1 136 ? 67.490  -0.760  10.705  1.00 76.12  ? 136 CYS A C     1 
ATOM   1105 O  O     . CYS A 1 136 ? 68.381  -1.359  10.107  1.00 76.67  ? 136 CYS A O     1 
ATOM   1106 C  CB    . CYS A 1 136 ? 65.081  -1.512  11.127  1.00 73.86  ? 136 CYS A CB    1 
ATOM   1107 S  SG    . CYS A 1 136 ? 63.914  -2.365  12.236  1.00 72.78  ? 136 CYS A SG    1 
ATOM   1108 N  N     . GLU A 1 137 ? 67.328  0.570   10.648  1.00 76.51  ? 137 GLU A N     1 
ATOM   1109 C  CA    . GLU A 1 137 ? 68.187  1.479   9.832   1.00 77.63  ? 137 GLU A CA    1 
ATOM   1110 C  C     . GLU A 1 137 ? 69.683  1.232   10.004  1.00 78.88  ? 137 GLU A C     1 
ATOM   1111 O  O     . GLU A 1 137 ? 70.433  1.190   9.027   1.00 79.58  ? 137 GLU A O     1 
ATOM   1112 C  CB    . GLU A 1 137 ? 67.923  2.961   10.166  1.00 78.11  ? 137 GLU A CB    1 
ATOM   1113 C  CG    . GLU A 1 137 ? 66.902  3.661   9.280   1.00 77.60  ? 137 GLU A CG    1 
ATOM   1114 C  CD    . GLU A 1 137 ? 66.746  5.152   9.585   1.00 78.31  ? 137 GLU A CD    1 
ATOM   1115 O  OE1   . GLU A 1 137 ? 67.014  5.577   10.729  1.00 78.80  ? 137 GLU A OE1   1 
ATOM   1116 O  OE2   . GLU A 1 137 ? 66.330  5.908   8.677   1.00 78.43  ? 137 GLU A OE2   1 
ATOM   1117 N  N     . ILE A 1 138 ? 70.097  1.079   11.258  1.00 79.22  ? 138 ILE A N     1 
ATOM   1118 C  CA    . ILE A 1 138 ? 71.499  0.914   11.605  1.00 80.49  ? 138 ILE A CA    1 
ATOM   1119 C  C     . ILE A 1 138 ? 71.996  -0.481  11.204  1.00 80.43  ? 138 ILE A C     1 
ATOM   1120 O  O     . ILE A 1 138 ? 73.114  -0.614  10.714  1.00 81.50  ? 138 ILE A O     1 
ATOM   1121 C  CB    . ILE A 1 138 ? 71.734  1.237   13.105  1.00 80.94  ? 138 ILE A CB    1 
ATOM   1122 C  CG1   . ILE A 1 138 ? 71.375  2.713   13.406  1.00 81.27  ? 138 ILE A CG1   1 
ATOM   1123 C  CG2   . ILE A 1 138 ? 73.173  0.946   13.522  1.00 82.25  ? 138 ILE A CG2   1 
ATOM   1124 C  CD1   . ILE A 1 138 ? 72.003  3.757   12.491  1.00 82.30  ? 138 ILE A CD1   1 
ATOM   1125 N  N     . LEU A 1 139 ? 71.164  -1.502  11.377  1.00 79.27  ? 139 LEU A N     1 
ATOM   1126 C  CA    . LEU A 1 139 ? 71.493  -2.857  10.916  1.00 79.16  ? 139 LEU A CA    1 
ATOM   1127 C  C     . LEU A 1 139 ? 71.570  -3.000  9.391   1.00 79.18  ? 139 LEU A C     1 
ATOM   1128 O  O     . LEU A 1 139 ? 72.353  -3.803  8.893   1.00 79.77  ? 139 LEU A O     1 
ATOM   1129 C  CB    . LEU A 1 139 ? 70.482  -3.863  11.453  1.00 77.94  ? 139 LEU A CB    1 
ATOM   1130 C  CG    . LEU A 1 139 ? 70.527  -4.057  12.964  1.00 78.07  ? 139 LEU A CG    1 
ATOM   1131 C  CD1   . LEU A 1 139 ? 69.220  -4.630  13.467  1.00 76.79  ? 139 LEU A CD1   1 
ATOM   1132 C  CD2   . LEU A 1 139 ? 71.678  -4.958  13.356  1.00 79.03  ? 139 LEU A CD2   1 
ATOM   1133 N  N     . LEU A 1 140 ? 70.753  -2.241  8.662   1.00 78.61  ? 140 LEU A N     1 
ATOM   1134 C  CA    . LEU A 1 140 ? 70.821  -2.211  7.203   1.00 78.76  ? 140 LEU A CA    1 
ATOM   1135 C  C     . LEU A 1 140 ? 72.118  -1.589  6.702   1.00 80.33  ? 140 LEU A C     1 
ATOM   1136 O  O     . LEU A 1 140 ? 72.693  -2.081  5.735   1.00 80.88  ? 140 LEU A O     1 
ATOM   1137 C  CB    . LEU A 1 140 ? 69.646  -1.434  6.607   1.00 77.91  ? 140 LEU A CB    1 
ATOM   1138 C  CG    . LEU A 1 140 ? 68.287  -2.133  6.554   1.00 76.37  ? 140 LEU A CG    1 
ATOM   1139 C  CD1   . LEU A 1 140 ? 67.176  -1.133  6.269   1.00 75.73  ? 140 LEU A CD1   1 
ATOM   1140 C  CD2   . LEU A 1 140 ? 68.274  -3.243  5.507   1.00 76.08  ? 140 LEU A CD2   1 
ATOM   1141 N  N     . SER A 1 141 ? 72.556  -0.493  7.331   1.00 81.12  ? 141 SER A N     1 
ATOM   1142 C  CA    . SER A 1 141 ? 73.856  0.135   7.013   1.00 82.76  ? 141 SER A CA    1 
ATOM   1143 C  C     . SER A 1 141 ? 74.987  -0.878  7.096   1.00 83.61  ? 141 SER A C     1 
ATOM   1144 O  O     . SER A 1 141 ? 75.795  -0.997  6.176   1.00 84.61  ? 141 SER A O     1 
ATOM   1145 C  CB    . SER A 1 141 ? 74.175  1.298   7.966   1.00 83.47  ? 141 SER A CB    1 
ATOM   1146 O  OG    . SER A 1 141 ? 73.456  2.466   7.611   1.00 83.27  ? 141 SER A OG    1 
ATOM   1147 N  N     . ARG A 1 142 ? 75.016  -1.610  8.204   1.00 83.29  ? 142 ARG A N     1 
ATOM   1148 C  CA    . ARG A 1 142 ? 76.057  -2.582  8.475   1.00 84.14  ? 142 ARG A CA    1 
ATOM   1149 C  C     . ARG A 1 142 ? 75.987  -3.811  7.573   1.00 83.82  ? 142 ARG A C     1 
ATOM   1150 O  O     . ARG A 1 142 ? 77.025  -4.304  7.136   1.00 84.97  ? 142 ARG A O     1 
ATOM   1151 C  CB    . ARG A 1 142 ? 75.989  -3.006  9.934   1.00 83.87  ? 142 ARG A CB    1 
ATOM   1152 C  CG    . ARG A 1 142 ? 77.186  -3.809  10.399  1.00 85.02  ? 142 ARG A CG    1 
ATOM   1153 C  CD    . ARG A 1 142 ? 77.208  -3.879  11.909  1.00 85.02  ? 142 ARG A CD    1 
ATOM   1154 N  NE    . ARG A 1 142 ? 77.493  -5.217  12.410  1.00 85.12  ? 142 ARG A NE    1 
ATOM   1155 C  CZ    . ARG A 1 142 ? 77.557  -5.536  13.703  1.00 85.21  ? 142 ARG A CZ    1 
ATOM   1156 N  NH1   . ARG A 1 142 ? 77.377  -4.616  14.649  1.00 85.23  ? 142 ARG A NH1   1 
ATOM   1157 N  NH2   . ARG A 1 142 ? 77.819  -6.792  14.056  1.00 85.39  ? 142 ARG A NH2   1 
ATOM   1158 N  N     . TYR A 1 143 ? 74.784  -4.313  7.310   1.00 82.37  ? 143 TYR A N     1 
ATOM   1159 C  CA    . TYR A 1 143 ? 74.596  -5.452  6.397   1.00 82.01  ? 143 TYR A CA    1 
ATOM   1160 C  C     . TYR A 1 143 ? 75.152  -5.169  4.995   1.00 82.90  ? 143 TYR A C     1 
ATOM   1161 O  O     . TYR A 1 143 ? 75.826  -6.022  4.409   1.00 83.62  ? 143 TYR A O     1 
ATOM   1162 C  CB    . TYR A 1 143 ? 73.115  -5.828  6.303   1.00 80.30  ? 143 TYR A CB    1 
ATOM   1163 C  CG    . TYR A 1 143 ? 72.795  -6.845  5.226   1.00 79.90  ? 143 TYR A CG    1 
ATOM   1164 C  CD1   . TYR A 1 143 ? 73.256  -8.165  5.312   1.00 80.21  ? 143 TYR A CD1   1 
ATOM   1165 C  CD2   . TYR A 1 143 ? 72.031  -6.491  4.112   1.00 79.28  ? 143 TYR A CD2   1 
ATOM   1166 C  CE1   . TYR A 1 143 ? 72.960  -9.099  4.319   1.00 79.92  ? 143 TYR A CE1   1 
ATOM   1167 C  CE2   . TYR A 1 143 ? 71.727  -7.417  3.117   1.00 78.95  ? 143 TYR A CE2   1 
ATOM   1168 C  CZ    . TYR A 1 143 ? 72.192  -8.717  3.226   1.00 79.27  ? 143 TYR A CZ    1 
ATOM   1169 O  OH    . TYR A 1 143 ? 71.873  -9.620  2.245   1.00 79.01  ? 143 TYR A OH    1 
ATOM   1170 N  N     . LYS A 1 144 ? 74.863  -3.974  4.473   1.00 82.93  ? 144 LYS A N     1 
ATOM   1171 C  CA    . LYS A 1 144 ? 75.376  -3.517  3.166   1.00 83.92  ? 144 LYS A CA    1 
ATOM   1172 C  C     . LYS A 1 144 ? 76.899  -3.532  3.089   1.00 85.75  ? 144 LYS A C     1 
ATOM   1173 O  O     . LYS A 1 144 ? 77.459  -3.919  2.071   1.00 86.60  ? 144 LYS A O     1 
ATOM   1174 C  CB    . LYS A 1 144 ? 74.878  -2.103  2.847   1.00 83.84  ? 144 LYS A CB    1 
ATOM   1175 C  CG    . LYS A 1 144 ? 73.394  -2.007  2.530   1.00 82.26  ? 144 LYS A CG    1 
ATOM   1176 C  CD    . LYS A 1 144 ? 72.897  -0.575  2.695   1.00 82.20  ? 144 LYS A CD    1 
ATOM   1177 C  CE    . LYS A 1 144 ? 71.525  -0.362  2.072   1.00 80.96  ? 144 LYS A CE    1 
ATOM   1178 N  NZ    . LYS A 1 144 ? 70.434  -0.927  2.912   1.00 79.41  ? 144 LYS A NZ    1 
ATOM   1179 N  N     . ARG A 1 145 ? 77.559  -3.112  4.164   1.00 86.41  ? 145 ARG A N     1 
ATOM   1180 C  CA    . ARG A 1 145 ? 79.029  -3.116  4.227   1.00 88.22  ? 145 ARG A CA    1 
ATOM   1181 C  C     . ARG A 1 145 ? 79.585  -4.559  4.202   1.00 88.59  ? 145 ARG A C     1 
ATOM   1182 O  O     . ARG A 1 145 ? 80.476  -4.864  3.398   1.00 89.88  ? 145 ARG A O     1 
ATOM   1183 C  CB    . ARG A 1 145 ? 79.529  -2.294  5.438   1.00 88.80  ? 145 ARG A CB    1 
ATOM   1184 C  CG    . ARG A 1 145 ? 79.066  -0.832  5.408   1.00 88.69  ? 145 ARG A CG    1 
ATOM   1185 C  CD    . ARG A 1 145 ? 80.155  0.229   5.694   1.00 90.36  ? 145 ARG A CD    1 
ATOM   1186 N  NE    . ARG A 1 145 ? 79.793  1.495   5.056   1.00 90.54  ? 145 ARG A NE    1 
ATOM   1187 C  CZ    . ARG A 1 145 ? 80.593  2.557   4.934   1.00 92.03  ? 145 ARG A CZ    1 
ATOM   1188 N  NH1   . ARG A 1 145 ? 81.845  2.557   5.402   1.00 93.51  ? 145 ARG A NH1   1 
ATOM   1189 N  NH2   . ARG A 1 145 ? 80.130  3.647   4.328   1.00 92.12  ? 145 ARG A NH2   1 
ATOM   1190 N  N     . LYS A 1 146 ? 79.020  -5.447  5.028   1.00 87.52  ? 146 LYS A N     1 
ATOM   1191 C  CA    . LYS A 1 146 ? 79.218  -6.901  4.865   1.00 87.58  ? 146 LYS A CA    1 
ATOM   1192 C  C     . LYS A 1 146 ? 78.123  -7.736  5.540   1.00 85.98  ? 146 LYS A C     1 
ATOM   1193 O  O     . LYS A 1 146 ? 77.641  -7.383  6.619   1.00 85.26  ? 146 LYS A O     1 
ATOM   1194 C  CB    . LYS A 1 146 ? 80.586  -7.342  5.387   1.00 89.20  ? 146 LYS A CB    1 
ATOM   1195 C  CG    . LYS A 1 146 ? 81.054  -8.683  4.816   1.00 89.83  ? 146 LYS A CG    1 
ATOM   1196 C  CD    . LYS A 1 146 ? 82.305  -8.568  3.950   1.00 91.73  ? 146 LYS A CD    1 
ATOM   1197 C  CE    . LYS A 1 146 ? 83.556  -8.189  4.744   1.00 93.30  ? 146 LYS A CE    1 
ATOM   1198 N  NZ    . LYS A 1 146 ? 83.938  -9.205  5.761   1.00 93.57  ? 146 LYS A NZ    1 
ATOM   1199 N  N     . SER A 1 147 ? 77.722  -8.825  4.879   1.00 85.50  ? 147 SER A N     1 
ATOM   1200 C  CA    . SER A 1 147 ? 76.807  -9.793  5.470   1.00 84.22  ? 147 SER A CA    1 
ATOM   1201 C  C     . SER A 1 147 ? 77.506  -10.392 6.684   1.00 84.91  ? 147 SER A C     1 
ATOM   1202 O  O     . SER A 1 147 ? 78.594  -10.950 6.562   1.00 86.29  ? 147 SER A O     1 
ATOM   1203 C  CB    . SER A 1 147 ? 76.434  -10.892 4.472   1.00 83.89  ? 147 SER A CB    1 
ATOM   1204 O  OG    . SER A 1 147 ? 75.555  -11.842 5.056   1.00 82.75  ? 147 SER A OG    1 
ATOM   1205 N  N     . PHE A 1 148 ? 76.886  -10.226 7.849   1.00 84.05  ? 148 PHE A N     1 
ATOM   1206 C  CA    . PHE A 1 148 ? 77.352  -10.815 9.113   1.00 84.55  ? 148 PHE A CA    1 
ATOM   1207 C  C     . PHE A 1 148 ? 76.354  -11.881 9.603   1.00 83.38  ? 148 PHE A C     1 
ATOM   1208 O  O     . PHE A 1 148 ? 76.471  -12.390 10.717  1.00 83.57  ? 148 PHE A O     1 
ATOM   1209 C  CB    . PHE A 1 148 ? 77.560  -9.715  10.166  1.00 84.77  ? 148 PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1 148 ? 76.369  -8.806  10.356  1.00 83.40  ? 148 PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1 148 ? 75.286  -9.196  11.129  1.00 82.16  ? 148 PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1 148 ? 76.326  -7.555  9.744   1.00 83.45  ? 148 PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1 148 ? 74.187  -8.364  11.281  1.00 81.00  ? 148 PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1 148 ? 75.226  -6.718  9.900   1.00 82.29  ? 148 PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1 148 ? 74.157  -7.123  10.669  1.00 81.07  ? 148 PHE A CZ    1 
ATOM   1216 N  N     . LEU A 1 149 ? 75.402  -12.237 8.736   1.00 82.29  ? 149 LEU A N     1 
ATOM   1217 C  CA    . LEU A 1 149 ? 74.299  -13.142 9.073   1.00 81.08  ? 149 LEU A CA    1 
ATOM   1218 C  C     . LEU A 1 149 ? 74.742  -14.599 9.193   1.00 81.75  ? 149 LEU A C     1 
ATOM   1219 O  O     . LEU A 1 149 ? 74.059  -15.416 9.830   1.00 81.10  ? 149 LEU A O     1 
ATOM   1220 C  CB    . LEU A 1 149 ? 73.171  -13.024 8.027   1.00 79.81  ? 149 LEU A CB    1 
ATOM   1221 C  CG    . LEU A 1 149 ? 72.202  -11.833 8.145   1.00 78.69  ? 149 LEU A CG    1 
ATOM   1222 C  CD1   . LEU A 1 149 ? 72.867  -10.529 8.583   1.00 79.41  ? 149 LEU A CD1   1 
ATOM   1223 C  CD2   . LEU A 1 149 ? 71.476  -11.632 6.826   1.00 77.94  ? 149 LEU A CD2   1 
ATOM   1224 N  N     . HIS A 1 150 ? 75.878  -14.913 8.568   1.00 83.13  ? 150 HIS A N     1 
ATOM   1225 C  CA    . HIS A 1 150 ? 76.502  -16.233 8.659   1.00 84.11  ? 150 HIS A CA    1 
ATOM   1226 C  C     . HIS A 1 150 ? 77.103  -16.433 10.045  1.00 84.89  ? 150 HIS A C     1 
ATOM   1227 O  O     . HIS A 1 150 ? 77.298  -17.564 10.482  1.00 85.41  ? 150 HIS A O     1 
ATOM   1228 C  CB    . HIS A 1 150 ? 77.560  -16.394 7.544   1.00 85.49  ? 150 HIS A CB    1 
ATOM   1229 C  CG    . HIS A 1 150 ? 77.066  -16.014 6.162   1.00 84.90  ? 150 HIS A CG    1 
ATOM   1230 N  ND1   . HIS A 1 150 ? 77.504  -14.875 5.522   1.00 85.34  ? 150 HIS A ND1   1 
ATOM   1231 C  CD2   . HIS A 1 150 ? 76.172  -16.592 5.312   1.00 83.98  ? 150 HIS A CD2   1 
ATOM   1232 C  CE1   . HIS A 1 150 ? 76.915  -14.768 4.341   1.00 84.75  ? 150 HIS A CE1   1 
ATOM   1233 N  NE2   . HIS A 1 150 ? 76.102  -15.798 4.187   1.00 83.90  ? 150 HIS A NE2   1 
ATOM   1234 N  N     . ARG A 1 151 ? 77.347  -15.329 10.743  1.00 84.99  ? 151 ARG A N     1 
ATOM   1235 C  CA    . ARG A 1 151 ? 77.870  -15.357 12.096  1.00 85.71  ? 151 ARG A CA    1 
ATOM   1236 C  C     . ARG A 1 151 ? 76.797  -15.303 13.186  1.00 84.51  ? 151 ARG A C     1 
ATOM   1237 O  O     . ARG A 1 151 ? 77.131  -15.430 14.373  1.00 85.08  ? 151 ARG A O     1 
ATOM   1238 C  CB    . ARG A 1 151 ? 78.849  -14.191 12.294  1.00 86.72  ? 151 ARG A CB    1 
ATOM   1239 C  CG    . ARG A 1 151 ? 79.851  -14.005 11.149  1.00 87.90  ? 151 ARG A CG    1 
ATOM   1240 C  CD    . ARG A 1 151 ? 81.278  -13.701 11.596  1.00 89.71  ? 151 ARG A CD    1 
ATOM   1241 N  NE    . ARG A 1 151 ? 81.557  -12.295 11.885  1.00 89.90  ? 151 ARG A NE    1 
ATOM   1242 C  CZ    . ARG A 1 151 ? 81.377  -11.693 13.065  1.00 89.64  ? 151 ARG A CZ    1 
ATOM   1243 N  NH1   . ARG A 1 151 ? 81.691  -10.408 13.201  1.00 89.97  ? 151 ARG A NH1   1 
ATOM   1244 N  NH2   . ARG A 1 151 ? 80.875  -12.340 14.115  1.00 89.14  ? 151 ARG A NH2   1 
ATOM   1245 N  N     . ILE A 1 152 ? 75.531  -15.127 12.798  1.00 82.96  ? 152 ILE A N     1 
ATOM   1246 C  CA    . ILE A 1 152 ? 74.421  -14.938 13.761  1.00 81.81  ? 152 ILE A CA    1 
ATOM   1247 C  C     . ILE A 1 152 ? 73.952  -16.239 14.424  1.00 81.64  ? 152 ILE A C     1 
ATOM   1248 O  O     . ILE A 1 152 ? 73.625  -17.225 13.746  1.00 81.39  ? 152 ILE A O     1 
ATOM   1249 C  CB    . ILE A 1 152 ? 73.191  -14.210 13.125  1.00 80.26  ? 152 ILE A CB    1 
ATOM   1250 C  CG1   . ILE A 1 152 ? 73.379  -12.692 13.208  1.00 80.31  ? 152 ILE A CG1   1 
ATOM   1251 C  CG2   . ILE A 1 152 ? 71.877  -14.569 13.822  1.00 79.03  ? 152 ILE A CG2   1 
ATOM   1252 C  CD1   . ILE A 1 152 ? 72.385  -11.888 12.393  1.00 79.11  ? 152 ILE A CD1   1 
ATOM   1253 N  N     . VAL A 1 153 ? 73.869  -16.189 15.752  1.00 81.81  ? 153 VAL A N     1 
ATOM   1254 C  CA    . VAL A 1 153 ? 73.282  -17.242 16.574  1.00 81.63  ? 153 VAL A CA    1 
ATOM   1255 C  C     . VAL A 1 153 ? 72.194  -16.582 17.423  1.00 80.57  ? 153 VAL A C     1 
ATOM   1256 O  O     . VAL A 1 153 ? 72.487  -15.645 18.168  1.00 80.89  ? 153 VAL A O     1 
ATOM   1257 C  CB    . VAL A 1 153 ? 74.341  -17.870 17.511  1.00 83.18  ? 153 VAL A CB    1 
ATOM   1258 C  CG1   . VAL A 1 153 ? 73.759  -19.076 18.248  1.00 83.14  ? 153 VAL A CG1   1 
ATOM   1259 C  CG2   . VAL A 1 153 ? 75.612  -18.238 16.739  1.00 84.50  ? 153 VAL A CG2   1 
ATOM   1260 N  N     . THR A 1 154 ? 70.957  -17.066 17.314  1.00 79.40  ? 154 THR A N     1 
ATOM   1261 C  CA    . THR A 1 154 ? 69.830  -16.530 18.081  1.00 78.43  ? 154 THR A CA    1 
ATOM   1262 C  C     . THR A 1 154 ? 69.054  -17.584 18.778  1.00 78.19  ? 154 THR A C     1 
ATOM   1263 O  O     . THR A 1 154 ? 69.072  -18.728 18.363  1.00 78.37  ? 154 THR A O     1 
ATOM   1264 C  CB    . THR A 1 154 ? 68.749  -15.944 17.183  1.00 77.01  ? 154 THR A CB    1 
ATOM   1265 O  OG1   . THR A 1 154 ? 68.373  -16.917 16.202  1.00 76.56  ? 154 THR A OG1   1 
ATOM   1266 C  CG2   . THR A 1 154 ? 69.224  -14.744 16.524  1.00 77.06  ? 154 THR A CG2   1 
ATOM   1267 N  N     . GLY A 1 155 ? 68.275  -17.146 19.758  1.00 77.75  ? 155 GLY A N     1 
ATOM   1268 C  CA    . GLY A 1 155 ? 67.321  -18.009 20.408  1.00 77.39  ? 155 GLY A CA    1 
ATOM   1269 C  C     . GLY A 1 155 ? 66.319  -17.284 21.272  1.00 76.75  ? 155 GLY A C     1 
ATOM   1270 O  O     . GLY A 1 155 ? 66.486  -16.113 21.637  1.00 76.80  ? 155 GLY A O     1 
ATOM   1271 N  N     . ASP A 1 156 ? 65.260  -17.998 21.602  1.00 76.22  ? 156 ASP A N     1 
ATOM   1272 C  CA    . ASP A 1 156 ? 64.236  -17.449 22.447  1.00 75.71  ? 156 ASP A CA    1 
ATOM   1273 C  C     . ASP A 1 156 ? 63.553  -18.600 23.157  1.00 75.87  ? 156 ASP A C     1 
ATOM   1274 O  O     . ASP A 1 156 ? 63.784  -19.765 22.831  1.00 76.21  ? 156 ASP A O     1 
ATOM   1275 C  CB    . ASP A 1 156 ? 63.255  -16.629 21.592  1.00 74.36  ? 156 ASP A CB    1 
ATOM   1276 C  CG    . ASP A 1 156 ? 62.524  -15.546 22.378  1.00 74.03  ? 156 ASP A CG    1 
ATOM   1277 O  OD1   . ASP A 1 156 ? 62.933  -15.231 23.515  1.00 74.88  ? 156 ASP A OD1   1 
ATOM   1278 O  OD2   . ASP A 1 156 ? 61.527  -15.007 21.852  1.00 72.99  ? 156 ASP A OD2   1 
ATOM   1279 N  N     . GLU A 1 157 ? 62.752  -18.250 24.156  1.00 75.76  ? 157 GLU A N     1 
ATOM   1280 C  CA    . GLU A 1 157 ? 62.002  -19.199 24.949  1.00 75.99  ? 157 GLU A CA    1 
ATOM   1281 C  C     . GLU A 1 157 ? 60.537  -19.094 24.538  1.00 74.72  ? 157 GLU A C     1 
ATOM   1282 O  O     . GLU A 1 157 ? 60.055  -17.995 24.226  1.00 73.93  ? 157 GLU A O     1 
ATOM   1283 C  CB    . GLU A 1 157 ? 62.155  -18.901 26.450  1.00 76.97  ? 157 GLU A CB    1 
ATOM   1284 C  CG    . GLU A 1 157 ? 63.596  -18.860 26.980  1.00 78.30  ? 157 GLU A CG    1 
ATOM   1285 C  CD    . GLU A 1 157 ? 64.338  -17.556 26.702  1.00 78.28  ? 157 GLU A CD    1 
ATOM   1286 O  OE1   . GLU A 1 157 ? 63.691  -16.489 26.602  1.00 77.49  ? 157 GLU A OE1   1 
ATOM   1287 O  OE2   . GLU A 1 157 ? 65.578  -17.600 26.568  1.00 79.13  ? 157 GLU A OE2   1 
ATOM   1288 N  N     . LYS A 1 158 ? 59.853  -20.242 24.548  1.00 74.64  ? 158 LYS A N     1 
ATOM   1289 C  CA    . LYS A 1 158 ? 58.437  -20.367 24.164  1.00 73.56  ? 158 LYS A CA    1 
ATOM   1290 C  C     . LYS A 1 158 ? 57.761  -21.588 24.813  1.00 73.99  ? 158 LYS A C     1 
ATOM   1291 O  O     . LYS A 1 158 ? 58.388  -22.635 24.953  1.00 74.85  ? 158 LYS A O     1 
ATOM   1292 C  CB    . LYS A 1 158 ? 58.323  -20.480 22.634  1.00 72.58  ? 158 LYS A CB    1 
ATOM   1293 C  CG    . LYS A 1 158 ? 57.189  -21.380 22.127  1.00 71.89  ? 158 LYS A CG    1 
ATOM   1294 C  CD    . LYS A 1 158 ? 57.219  -21.636 20.626  1.00 71.13  ? 158 LYS A CD    1 
ATOM   1295 C  CE    . LYS A 1 158 ? 56.200  -22.702 20.229  1.00 70.68  ? 158 LYS A CE    1 
ATOM   1296 N  NZ    . LYS A 1 158 ? 54.786  -22.348 20.539  1.00 69.92  ? 158 LYS A NZ    1 
ATOM   1297 N  N     . TRP A 1 159 ? 56.469  -21.464 25.122  1.00 73.43  ? 159 TRP A N     1 
ATOM   1298 C  CA    . TRP A 1 159 ? 55.681  -22.553 25.719  1.00 73.82  ? 159 TRP A CA    1 
ATOM   1299 C  C     . TRP A 1 159 ? 55.232  -23.627 24.723  1.00 73.31  ? 159 TRP A C     1 
ATOM   1300 O  O     . TRP A 1 159 ? 55.021  -23.333 23.560  1.00 72.29  ? 159 TRP A O     1 
ATOM   1301 C  CB    . TRP A 1 159 ? 54.436  -21.983 26.400  1.00 73.49  ? 159 TRP A CB    1 
ATOM   1302 C  CG    . TRP A 1 159 ? 54.722  -21.275 27.674  1.00 74.35  ? 159 TRP A CG    1 
ATOM   1303 C  CD1   . TRP A 1 159 ? 54.601  -19.945 27.920  1.00 74.05  ? 159 TRP A CD1   1 
ATOM   1304 C  CD2   . TRP A 1 159 ? 55.170  -21.873 28.889  1.00 75.74  ? 159 TRP A CD2   1 
ATOM   1305 N  NE1   . TRP A 1 159 ? 54.949  -19.670 29.214  1.00 75.16  ? 159 TRP A NE1   1 
ATOM   1306 C  CE2   . TRP A 1 159 ? 55.307  -20.839 29.832  1.00 76.22  ? 159 TRP A CE2   1 
ATOM   1307 C  CE3   . TRP A 1 159 ? 55.476  -23.187 29.270  1.00 76.73  ? 159 TRP A CE3   1 
ATOM   1308 C  CZ2   . TRP A 1 159 ? 55.740  -21.074 31.135  1.00 77.62  ? 159 TRP A CZ2   1 
ATOM   1309 C  CZ3   . TRP A 1 159 ? 55.901  -23.421 30.561  1.00 78.14  ? 159 TRP A CZ3   1 
ATOM   1310 C  CH2   . TRP A 1 159 ? 56.030  -22.369 31.481  1.00 78.56  ? 159 TRP A CH2   1 
ATOM   1311 N  N     . ILE A 1 160 ? 55.063  -24.862 25.203  1.00 74.10  ? 160 ILE A N     1 
ATOM   1312 C  CA    . ILE A 1 160 ? 54.500  -25.979 24.420  1.00 73.78  ? 160 ILE A CA    1 
ATOM   1313 C  C     . ILE A 1 160 ? 53.517  -26.775 25.264  1.00 74.30  ? 160 ILE A C     1 
ATOM   1314 O  O     . ILE A 1 160 ? 53.934  -27.447 26.204  1.00 75.58  ? 160 ILE A O     1 
ATOM   1315 C  CB    . ILE A 1 160 ? 55.599  -26.957 23.948  1.00 74.55  ? 160 ILE A CB    1 
ATOM   1316 C  CG1   . ILE A 1 160 ? 56.466  -26.278 22.881  1.00 73.98  ? 160 ILE A CG1   1 
ATOM   1317 C  CG2   . ILE A 1 160 ? 54.990  -28.262 23.407  1.00 74.55  ? 160 ILE A CG2   1 
ATOM   1318 C  CD1   . ILE A 1 160 ? 57.614  -27.116 22.348  1.00 74.79  ? 160 ILE A CD1   1 
ATOM   1319 N  N     . PHE A 1 161 ? 52.232  -26.732 24.922  1.00 73.41  ? 161 PHE A N     1 
ATOM   1320 C  CA    . PHE A 1 161 ? 51.206  -27.409 25.726  1.00 73.92  ? 161 PHE A CA    1 
ATOM   1321 C  C     . PHE A 1 161 ? 51.136  -28.877 25.322  1.00 74.38  ? 161 PHE A C     1 
ATOM   1322 O  O     . PHE A 1 161 ? 51.390  -29.209 24.166  1.00 73.81  ? 161 PHE A O     1 
ATOM   1323 C  CB    . PHE A 1 161 ? 49.848  -26.728 25.560  1.00 72.88  ? 161 PHE A CB    1 
ATOM   1324 C  CG    . PHE A 1 161 ? 49.785  -25.337 26.142  1.00 72.66  ? 161 PHE A CG    1 
ATOM   1325 C  CD1   . PHE A 1 161 ? 50.368  -24.256 25.483  1.00 71.90  ? 161 PHE A CD1   1 
ATOM   1326 C  CD2   . PHE A 1 161 ? 49.121  -25.100 27.344  1.00 73.30  ? 161 PHE A CD2   1 
ATOM   1327 C  CE1   . PHE A 1 161 ? 50.303  -22.978 26.020  1.00 71.78  ? 161 PHE A CE1   1 
ATOM   1328 C  CE2   . PHE A 1 161 ? 49.050  -23.822 27.880  1.00 73.19  ? 161 PHE A CE2   1 
ATOM   1329 C  CZ    . PHE A 1 161 ? 49.645  -22.763 27.220  1.00 72.43  ? 161 PHE A CZ    1 
ATOM   1330 N  N     . PHE A 1 162 ? 50.809  -29.750 26.274  1.00 75.52  ? 162 PHE A N     1 
ATOM   1331 C  CA    . PHE A 1 162 ? 50.721  -31.192 26.004  1.00 76.18  ? 162 PHE A CA    1 
ATOM   1332 C  C     . PHE A 1 162 ? 49.556  -31.522 25.070  1.00 75.15  ? 162 PHE A C     1 
ATOM   1333 O  O     . PHE A 1 162 ? 49.634  -32.505 24.344  1.00 75.27  ? 162 PHE A O     1 
ATOM   1334 C  CB    . PHE A 1 162 ? 50.625  -32.021 27.295  1.00 77.78  ? 162 PHE A CB    1 
ATOM   1335 C  CG    . PHE A 1 162 ? 51.964  -32.369 27.904  1.00 79.14  ? 162 PHE A CG    1 
ATOM   1336 C  CD1   . PHE A 1 162 ? 52.900  -31.380 28.180  1.00 79.12  ? 162 PHE A CD1   1 
ATOM   1337 C  CD2   . PHE A 1 162 ? 52.284  -33.691 28.221  1.00 80.54  ? 162 PHE A CD2   1 
ATOM   1338 C  CE1   . PHE A 1 162 ? 54.130  -31.702 28.742  1.00 80.43  ? 162 PHE A CE1   1 
ATOM   1339 C  CE2   . PHE A 1 162 ? 53.513  -34.015 28.786  1.00 81.88  ? 162 PHE A CE2   1 
ATOM   1340 C  CZ    . PHE A 1 162 ? 54.441  -33.019 29.044  1.00 81.82  ? 162 PHE A CZ    1 
ATOM   1341 N  N     . VAL A 1 163 ? 48.483  -30.725 25.121  1.00 74.25  ? 163 VAL A N     1 
ATOM   1342 C  CA    . VAL A 1 163 ? 47.431  -30.744 24.097  1.00 73.06  ? 163 VAL A CA    1 
ATOM   1343 C  C     . VAL A 1 163 ? 47.276  -29.370 23.473  1.00 71.71  ? 163 VAL A C     1 
ATOM   1344 O  O     . VAL A 1 163 ? 47.371  -28.346 24.149  1.00 71.70  ? 163 VAL A O     1 
ATOM   1345 C  CB    . VAL A 1 163 ? 46.050  -31.234 24.602  1.00 73.30  ? 163 VAL A CB    1 
ATOM   1346 C  CG1   . VAL A 1 163 ? 46.142  -32.673 25.079  1.00 74.66  ? 163 VAL A CG1   1 
ATOM   1347 C  CG2   . VAL A 1 163 ? 45.462  -30.331 25.679  1.00 73.47  ? 163 VAL A CG2   1 
ATOM   1348 N  N     . ASN A 1 164 ? 47.014  -29.371 22.171  1.00 70.64  ? 164 ASN A N     1 
ATOM   1349 C  CA    . ASN A 1 164 ? 46.849  -28.154 21.385  1.00 69.37  ? 164 ASN A CA    1 
ATOM   1350 C  C     . ASN A 1 164 ? 45.562  -28.262 20.556  1.00 68.41  ? 164 ASN A C     1 
ATOM   1351 O  O     . ASN A 1 164 ? 45.630  -28.428 19.335  1.00 67.70  ? 164 ASN A O     1 
ATOM   1352 C  CB    . ASN A 1 164 ? 48.076  -27.943 20.472  1.00 69.10  ? 164 ASN A CB    1 
ATOM   1353 C  CG    . ASN A 1 164 ? 49.397  -28.206 21.178  1.00 70.25  ? 164 ASN A CG    1 
ATOM   1354 O  OD1   . ASN A 1 164 ? 50.065  -27.276 21.626  1.00 70.37  ? 164 ASN A OD1   1 
ATOM   1355 N  ND2   . ASN A 1 164 ? 49.781  -29.482 21.289  1.00 71.19  ? 164 ASN A ND2   1 
ATOM   1356 N  N     . PRO A 1 165 ? 44.385  -28.190 21.212  1.00 68.47  ? 165 PRO A N     1 
ATOM   1357 C  CA    . PRO A 1 165 ? 43.137  -28.252 20.467  1.00 67.63  ? 165 PRO A CA    1 
ATOM   1358 C  C     . PRO A 1 165 ? 42.907  -27.065 19.550  1.00 66.38  ? 165 PRO A C     1 
ATOM   1359 O  O     . PRO A 1 165 ? 43.320  -25.951 19.869  1.00 66.23  ? 165 PRO A O     1 
ATOM   1360 C  CB    . PRO A 1 165 ? 42.068  -28.254 21.562  1.00 68.17  ? 165 PRO A CB    1 
ATOM   1361 C  CG    . PRO A 1 165 ? 42.748  -28.829 22.732  1.00 69.51  ? 165 PRO A CG    1 
ATOM   1362 C  CD    . PRO A 1 165 ? 44.127  -28.247 22.657  1.00 69.50  ? 165 PRO A CD    1 
ATOM   1363 N  N     . LYS A 1 166 ? 42.253  -27.338 18.421  1.00 65.58  ? 166 LYS A N     1 
ATOM   1364 C  CA    . LYS A 1 166 ? 41.800  -26.324 17.466  1.00 64.43  ? 166 LYS A CA    1 
ATOM   1365 C  C     . LYS A 1 166 ? 40.342  -26.568 17.149  1.00 64.00  ? 166 LYS A C     1 
ATOM   1366 O  O     . LYS A 1 166 ? 39.887  -27.714 17.152  1.00 64.39  ? 166 LYS A O     1 
ATOM   1367 C  CB    . LYS A 1 166 ? 42.578  -26.377 16.145  1.00 63.87  ? 166 LYS A CB    1 
ATOM   1368 C  CG    . LYS A 1 166 ? 44.088  -26.342 16.321  1.00 64.40  ? 166 LYS A CG    1 
ATOM   1369 C  CD    . LYS A 1 166 ? 44.567  -24.915 16.508  1.00 64.11  ? 166 LYS A CD    1 
ATOM   1370 C  CE    . LYS A 1 166 ? 45.820  -24.868 17.361  1.00 65.00  ? 166 LYS A CE    1 
ATOM   1371 N  NZ    . LYS A 1 166 ? 46.390  -23.499 17.336  1.00 64.70  ? 166 LYS A NZ    1 
ATOM   1372 N  N     . ARG A 1 167 ? 39.635  -25.499 16.803  1.00 63.24  ? 167 ARG A N     1 
ATOM   1373 C  CA    . ARG A 1 167 ? 38.225  -25.603 16.408  1.00 62.80  ? 167 ARG A CA    1 
ATOM   1374 C  C     . ARG A 1 167 ? 38.077  -26.328 15.073  1.00 62.23  ? 167 ARG A C     1 
ATOM   1375 O  O     . ARG A 1 167 ? 38.778  -26.015 14.112  1.00 61.69  ? 167 ARG A O     1 
ATOM   1376 C  CB    . ARG A 1 167 ? 37.575  -24.226 16.290  1.00 62.18  ? 167 ARG A CB    1 
ATOM   1377 C  CG    . ARG A 1 167 ? 37.462  -23.479 17.605  1.00 62.79  ? 167 ARG A CG    1 
ATOM   1378 C  CD    . ARG A 1 167 ? 36.968  -22.054 17.412  1.00 62.25  ? 167 ARG A CD    1 
ATOM   1379 N  NE    . ARG A 1 167 ? 35.529  -21.997 17.170  1.00 61.98  ? 167 ARG A NE    1 
ATOM   1380 C  CZ    . ARG A 1 167 ? 34.848  -20.882 16.897  1.00 61.56  ? 167 ARG A CZ    1 
ATOM   1381 N  NH1   . ARG A 1 167 ? 35.467  -19.704 16.833  1.00 61.36  ? 167 ARG A NH1   1 
ATOM   1382 N  NH2   . ARG A 1 167 ? 33.535  -20.944 16.681  1.00 61.41  ? 167 ARG A NH2   1 
ATOM   1383 N  N     . LYS A 1 168 ? 37.153  -27.282 15.024  1.00 62.42  ? 168 LYS A N     1 
ATOM   1384 C  CA    . LYS A 1 168 ? 36.887  -28.051 13.815  1.00 61.99  ? 168 LYS A CA    1 
ATOM   1385 C  C     . LYS A 1 168 ? 36.040  -27.230 12.855  1.00 61.01  ? 168 LYS A C     1 
ATOM   1386 O  O     . LYS A 1 168 ? 35.423  -26.245 13.252  1.00 60.80  ? 168 LYS A O     1 
ATOM   1387 C  CB    . LYS A 1 168 ? 36.164  -29.352 14.158  1.00 62.65  ? 168 LYS A CB    1 
ATOM   1388 C  CG    . LYS A 1 168 ? 36.923  -30.271 15.098  1.00 63.77  ? 168 LYS A CG    1 
ATOM   1389 C  CD    . LYS A 1 168 ? 38.279  -30.694 14.544  1.00 63.90  ? 168 LYS A CD    1 
ATOM   1390 C  CE    . LYS A 1 168 ? 38.934  -31.732 15.440  1.00 65.13  ? 168 LYS A CE    1 
ATOM   1391 N  NZ    . LYS A 1 168 ? 39.034  -31.281 16.859  1.00 65.80  ? 168 LYS A NZ    1 
ATOM   1392 N  N     . LYS A 1 169 ? 36.035  -27.623 11.581  1.00 60.49  ? 169 LYS A N     1 
ATOM   1393 C  CA    . LYS A 1 169 ? 35.164  -27.017 10.573  1.00 59.64  ? 169 LYS A CA    1 
ATOM   1394 C  C     . LYS A 1 169 ? 34.396  -28.106 9.841   1.00 59.60  ? 169 LYS A C     1 
ATOM   1395 O  O     . LYS A 1 169 ? 35.001  -28.898 9.134   1.00 59.67  ? 169 LYS A O     1 
ATOM   1396 C  CB    . LYS A 1 169 ? 35.984  -26.199 9.590   1.00 59.03  ? 169 LYS A CB    1 
ATOM   1397 C  CG    . LYS A 1 169 ? 36.384  -24.848 10.137  1.00 58.92  ? 169 LYS A CG    1 
ATOM   1398 C  CD    . LYS A 1 169 ? 37.605  -24.315 9.417   1.00 58.68  ? 169 LYS A CD    1 
ATOM   1399 C  CE    . LYS A 1 169 ? 37.762  -22.823 9.639   1.00 58.43  ? 169 LYS A CE    1 
ATOM   1400 N  NZ    . LYS A 1 169 ? 39.118  -22.362 9.235   1.00 58.45  ? 169 LYS A NZ    1 
ATOM   1401 N  N     . SER A 1 170 ? 33.078  -28.136 10.024  1.00 59.56  ? 170 SER A N     1 
ATOM   1402 C  CA    . SER A 1 170 ? 32.239  -29.214 9.524   1.00 59.68  ? 170 SER A CA    1 
ATOM   1403 C  C     . SER A 1 170 ? 31.586  -28.794 8.237   1.00 58.86  ? 170 SER A C     1 
ATOM   1404 O  O     . SER A 1 170 ? 31.218  -27.629 8.083   1.00 58.34  ? 170 SER A O     1 
ATOM   1405 C  CB    . SER A 1 170 ? 31.141  -29.549 10.533  1.00 60.27  ? 170 SER A CB    1 
ATOM   1406 O  OG    . SER A 1 170 ? 31.651  -30.221 11.670  1.00 61.21  ? 170 SER A OG    1 
ATOM   1407 N  N     . TYR A 1 171 ? 31.448  -29.753 7.318   1.00 58.83  ? 171 TYR A N     1 
ATOM   1408 C  CA    . TYR A 1 171 ? 30.641  -29.596 6.099   1.00 58.20  ? 171 TYR A CA    1 
ATOM   1409 C  C     . TYR A 1 171 ? 29.307  -30.289 6.333   1.00 58.51  ? 171 TYR A C     1 
ATOM   1410 O  O     . TYR A 1 171 ? 29.221  -31.519 6.430   1.00 59.09  ? 171 TYR A O     1 
ATOM   1411 C  CB    . TYR A 1 171 ? 31.345  -30.161 4.859   1.00 58.01  ? 171 TYR A CB    1 
ATOM   1412 C  CG    . TYR A 1 171 ? 32.378  -29.229 4.281   1.00 57.55  ? 171 TYR A CG    1 
ATOM   1413 C  CD1   . TYR A 1 171 ? 32.038  -27.938 3.890   1.00 56.91  ? 171 TYR A CD1   1 
ATOM   1414 C  CD2   . TYR A 1 171 ? 33.697  -29.628 4.119   1.00 57.85  ? 171 TYR A CD2   1 
ATOM   1415 C  CE1   . TYR A 1 171 ? 32.980  -27.073 3.354   1.00 56.59  ? 171 TYR A CE1   1 
ATOM   1416 C  CE2   . TYR A 1 171 ? 34.650  -28.764 3.590   1.00 57.52  ? 171 TYR A CE2   1 
ATOM   1417 C  CZ    . TYR A 1 171 ? 34.287  -27.487 3.208   1.00 56.89  ? 171 TYR A CZ    1 
ATOM   1418 O  OH    . TYR A 1 171 ? 35.225  -26.623 2.687   1.00 56.66  ? 171 TYR A OH    1 
ATOM   1419 N  N     . VAL A 1 172 ? 28.270  -29.474 6.445   1.00 58.22  ? 172 VAL A N     1 
ATOM   1420 C  CA    . VAL A 1 172 ? 26.976  -29.949 6.865   1.00 58.63  ? 172 VAL A CA    1 
ATOM   1421 C  C     . VAL A 1 172 ? 25.889  -29.043 6.286   1.00 58.08  ? 172 VAL A C     1 
ATOM   1422 O  O     . VAL A 1 172 ? 26.144  -27.874 5.991   1.00 57.54  ? 172 VAL A O     1 
ATOM   1423 C  CB    . VAL A 1 172 ? 26.937  -29.994 8.412   1.00 59.40  ? 172 VAL A CB    1 
ATOM   1424 C  CG1   . VAL A 1 172 ? 26.885  -28.583 9.012   1.00 59.17  ? 172 VAL A CG1   1 
ATOM   1425 C  CG2   . VAL A 1 172 ? 25.813  -30.908 8.912   1.00 60.12  ? 172 VAL A CG2   1 
ATOM   1426 N  N     . ASP A 1 173 ? 24.688  -29.592 6.122   1.00 58.31  ? 173 ASP A N     1 
ATOM   1427 C  CA    . ASP A 1 173 ? 23.537  -28.821 5.653   1.00 57.95  ? 173 ASP A CA    1 
ATOM   1428 C  C     . ASP A 1 173 ? 23.322  -27.584 6.512   1.00 58.00  ? 173 ASP A C     1 
ATOM   1429 O  O     . ASP A 1 173 ? 23.547  -27.645 7.715   1.00 58.57  ? 173 ASP A O     1 
ATOM   1430 C  CB    . ASP A 1 173 ? 22.269  -29.659 5.738   1.00 58.47  ? 173 ASP A CB    1 
ATOM   1431 C  CG    . ASP A 1 173 ? 22.307  -30.862 4.840   1.00 58.49  ? 173 ASP A CG    1 
ATOM   1432 O  OD1   . ASP A 1 173 ? 22.650  -30.707 3.642   1.00 57.87  ? 173 ASP A OD1   1 
ATOM   1433 O  OD2   . ASP A 1 173 ? 21.992  -31.964 5.334   1.00 59.22  ? 173 ASP A OD2   1 
ATOM   1434 N  N     . PRO A 1 174 ? 22.870  -26.467 5.918   1.00 57.49  ? 174 PRO A N     1 
ATOM   1435 C  CA    . PRO A 1 174 ? 22.633  -25.271 6.737   1.00 57.64  ? 174 PRO A CA    1 
ATOM   1436 C  C     . PRO A 1 174 ? 21.562  -25.506 7.800   1.00 58.43  ? 174 PRO A C     1 
ATOM   1437 O  O     . PRO A 1 174 ? 20.586  -26.185 7.532   1.00 58.67  ? 174 PRO A O     1 
ATOM   1438 C  CB    . PRO A 1 174 ? 22.159  -24.229 5.722   1.00 57.06  ? 174 PRO A CB    1 
ATOM   1439 C  CG    . PRO A 1 174 ? 22.486  -24.783 4.379   1.00 56.53  ? 174 PRO A CG    1 
ATOM   1440 C  CD    . PRO A 1 174 ? 22.452  -26.264 4.524   1.00 56.90  ? 174 PRO A CD    1 
ATOM   1441 N  N     . GLY A 1 175 ? 21.777  -24.989 9.004   1.00 58.92  ? 175 GLY A N     1 
ATOM   1442 C  CA    . GLY A 1 175 ? 20.889  -25.251 10.131  1.00 59.84  ? 175 GLY A CA    1 
ATOM   1443 C  C     . GLY A 1 175 ? 21.349  -26.391 11.026  1.00 60.54  ? 175 GLY A C     1 
ATOM   1444 O  O     . GLY A 1 175 ? 20.900  -26.484 12.169  1.00 61.41  ? 175 GLY A O     1 
ATOM   1445 N  N     . GLN A 1 176 ? 22.235  -27.256 10.526  1.00 60.26  ? 176 GLN A N     1 
ATOM   1446 C  CA    . GLN A 1 176 ? 22.851  -28.302 11.349  1.00 60.97  ? 176 GLN A CA    1 
ATOM   1447 C  C     . GLN A 1 176 ? 24.038  -27.762 12.131  1.00 61.05  ? 176 GLN A C     1 
ATOM   1448 O  O     . GLN A 1 176 ? 24.675  -26.814 11.686  1.00 60.37  ? 176 GLN A O     1 
ATOM   1449 C  CB    . GLN A 1 176 ? 23.348  -29.459 10.487  1.00 60.76  ? 176 GLN A CB    1 
ATOM   1450 C  CG    . GLN A 1 176 ? 22.279  -30.143 9.661   1.00 60.73  ? 176 GLN A CG    1 
ATOM   1451 C  CD    . GLN A 1 176 ? 21.062  -30.471 10.484  1.00 61.62  ? 176 GLN A CD    1 
ATOM   1452 O  OE1   . GLN A 1 176 ? 19.982  -29.949 10.234  1.00 61.53  ? 176 GLN A OE1   1 
ATOM   1453 N  NE2   . GLN A 1 176 ? 21.241  -31.297 11.515  1.00 62.59  ? 176 GLN A NE2   1 
ATOM   1454 N  N     . PRO A 1 177 ? 24.344  -28.375 13.295  1.00 61.97  ? 177 PRO A N     1 
ATOM   1455 C  CA    . PRO A 1 177 ? 25.514  -27.989 14.071  1.00 62.16  ? 177 PRO A CA    1 
ATOM   1456 C  C     . PRO A 1 177 ? 26.812  -28.578 13.522  1.00 61.83  ? 177 PRO A C     1 
ATOM   1457 O  O     . PRO A 1 177 ? 26.795  -29.554 12.772  1.00 61.73  ? 177 PRO A O     1 
ATOM   1458 C  CB    . PRO A 1 177 ? 25.211  -28.568 15.451  1.00 63.39  ? 177 PRO A CB    1 
ATOM   1459 C  CG    . PRO A 1 177 ? 24.400  -29.778 15.172  1.00 63.82  ? 177 PRO A CG    1 
ATOM   1460 C  CD    . PRO A 1 177 ? 23.576  -29.443 13.968  1.00 62.98  ? 177 PRO A CD    1 
ATOM   1461 N  N     . ALA A 1 178 ? 27.923  -27.963 13.901  1.00 61.73  ? 178 ALA A N     1 
ATOM   1462 C  CA    . ALA A 1 178 ? 29.256  -28.470 13.592  1.00 61.63  ? 178 ALA A CA    1 
ATOM   1463 C  C     . ALA A 1 178 ? 29.820  -29.291 14.758  1.00 62.70  ? 178 ALA A C     1 
ATOM   1464 O  O     . ALA A 1 178 ? 29.335  -29.210 15.903  1.00 63.48  ? 178 ALA A O     1 
ATOM   1465 C  CB    . ALA A 1 178 ? 30.188  -27.308 13.288  1.00 60.97  ? 178 ALA A CB    1 
ATOM   1466 N  N     . THR A 1 179 ? 30.873  -30.058 14.465  1.00 62.82  ? 179 THR A N     1 
ATOM   1467 C  CA    . THR A 1 179 ? 31.615  -30.800 15.488  1.00 63.85  ? 179 THR A CA    1 
ATOM   1468 C  C     . THR A 1 179 ? 32.196  -29.798 16.476  1.00 64.06  ? 179 THR A C     1 
ATOM   1469 O  O     . THR A 1 179 ? 33.121  -29.063 16.131  1.00 63.51  ? 179 THR A O     1 
ATOM   1470 C  CB    . THR A 1 179 ? 32.745  -31.659 14.862  1.00 63.91  ? 179 THR A CB    1 
ATOM   1471 O  OG1   . THR A 1 179 ? 32.167  -32.731 14.111  1.00 63.97  ? 179 THR A OG1   1 
ATOM   1472 C  CG2   . THR A 1 179 ? 33.657  -32.265 15.923  1.00 65.00  ? 179 THR A CG2   1 
ATOM   1473 N  N     . SER A 1 180 ? 31.636  -29.760 17.684  1.00 64.92  ? 180 SER A N     1 
ATOM   1474 C  CA    . SER A 1 180 ? 32.226  -28.992 18.787  1.00 65.39  ? 180 SER A CA    1 
ATOM   1475 C  C     . SER A 1 180 ? 33.512  -29.648 19.301  1.00 66.09  ? 180 SER A C     1 
ATOM   1476 O  O     . SER A 1 180 ? 33.695  -30.857 19.169  1.00 66.60  ? 180 SER A O     1 
ATOM   1477 C  CB    . SER A 1 180 ? 31.234  -28.834 19.948  1.00 66.26  ? 180 SER A CB    1 
ATOM   1478 O  OG    . SER A 1 180 ? 30.731  -30.083 20.387  1.00 67.23  ? 180 SER A OG    1 
ATOM   1479 N  N     . THR A 1 181 ? 34.382  -28.835 19.895  1.00 66.19  ? 181 THR A N     1 
ATOM   1480 C  CA    . THR A 1 181 ? 35.672  -29.274 20.434  1.00 66.88  ? 181 THR A CA    1 
ATOM   1481 C  C     . THR A 1 181 ? 35.783  -28.855 21.884  1.00 67.84  ? 181 THR A C     1 
ATOM   1482 O  O     . THR A 1 181 ? 35.246  -27.814 22.265  1.00 67.66  ? 181 THR A O     1 
ATOM   1483 C  CB    . THR A 1 181 ? 36.820  -28.585 19.682  1.00 66.07  ? 181 THR A CB    1 
ATOM   1484 O  OG1   . THR A 1 181 ? 36.639  -28.762 18.274  1.00 65.11  ? 181 THR A OG1   1 
ATOM   1485 C  CG2   . THR A 1 181 ? 38.200  -29.122 20.062  1.00 66.77  ? 181 THR A CG2   1 
ATOM   1486 N  N     . ALA A 1 182 ? 36.508  -29.654 22.669  1.00 68.94  ? 182 ALA A N     1 
ATOM   1487 C  CA    . ALA A 1 182 ? 36.747  -29.394 24.096  1.00 70.05  ? 182 ALA A CA    1 
ATOM   1488 C  C     . ALA A 1 182 ? 37.904  -28.402 24.346  1.00 69.86  ? 182 ALA A C     1 
ATOM   1489 O  O     . ALA A 1 182 ? 39.070  -28.653 23.963  1.00 69.77  ? 182 ALA A O     1 
ATOM   1490 C  CB    . ALA A 1 182 ? 37.008  -30.698 24.824  1.00 71.42  ? 182 ALA A CB    1 
ATOM   1491 N  N     . ARG A 1 183 ? 37.558  -27.298 25.015  1.00 69.91  ? 183 ARG A N     1 
ATOM   1492 C  CA    . ARG A 1 183 ? 38.404  -26.103 25.143  1.00 69.57  ? 183 ARG A CA    1 
ATOM   1493 C  C     . ARG A 1 183 ? 39.719  -26.391 25.882  1.00 70.47  ? 183 ARG A C     1 
ATOM   1494 O  O     . ARG A 1 183 ? 39.749  -27.269 26.753  1.00 71.66  ? 183 ARG A O     1 
ATOM   1495 C  CB    . ARG A 1 183 ? 37.596  -24.998 25.840  1.00 69.71  ? 183 ARG A CB    1 
ATOM   1496 C  CG    . ARG A 1 183 ? 38.295  -23.676 26.067  1.00 69.48  ? 183 ARG A CG    1 
ATOM   1497 C  CD    . ARG A 1 183 ? 37.519  -22.761 26.994  1.00 70.01  ? 183 ARG A CD    1 
ATOM   1498 N  NE    . ARG A 1 183 ? 36.122  -22.565 26.646  1.00 69.63  ? 183 ARG A NE    1 
ATOM   1499 C  CZ    . ARG A 1 183 ? 35.683  -21.825 25.622  1.00 68.50  ? 183 ARG A CZ    1 
ATOM   1500 N  NH1   . ARG A 1 183 ? 34.368  -21.721 25.420  1.00 68.34  ? 183 ARG A NH1   1 
ATOM   1501 N  NH2   . ARG A 1 183 ? 36.529  -21.210 24.778  1.00 67.60  ? 183 ARG A NH2   1 
ATOM   1502 N  N     . PRO A 1 184 ? 40.813  -25.658 25.536  1.00 69.99  ? 184 PRO A N     1 
ATOM   1503 C  CA    . PRO A 1 184 ? 42.108  -25.987 26.153  1.00 70.87  ? 184 PRO A CA    1 
ATOM   1504 C  C     . PRO A 1 184 ? 42.200  -25.500 27.581  1.00 71.95  ? 184 PRO A C     1 
ATOM   1505 O  O     . PRO A 1 184 ? 41.750  -24.392 27.858  1.00 71.69  ? 184 PRO A O     1 
ATOM   1506 C  CB    . PRO A 1 184 ? 43.127  -25.208 25.298  1.00 69.99  ? 184 PRO A CB    1 
ATOM   1507 C  CG    . PRO A 1 184 ? 42.354  -24.554 24.189  1.00 68.68  ? 184 PRO A CG    1 
ATOM   1508 C  CD    . PRO A 1 184 ? 40.941  -24.473 24.657  1.00 68.80  ? 184 PRO A CD    1 
ATOM   1509 N  N     . ASN A 1 185 ? 42.798  -26.306 28.462  1.00 73.22  ? 185 ASN A N     1 
ATOM   1510 C  CA    . ASN A 1 185 ? 43.100  -25.877 29.845  1.00 74.40  ? 185 ASN A CA    1 
ATOM   1511 C  C     . ASN A 1 185 ? 44.284  -24.918 29.818  1.00 74.16  ? 185 ASN A C     1 
ATOM   1512 O  O     . ASN A 1 185 ? 45.398  -25.343 29.502  1.00 74.28  ? 185 ASN A O     1 
ATOM   1513 C  CB    . ASN A 1 185 ? 43.516  -27.063 30.759  1.00 75.94  ? 185 ASN A CB    1 
ATOM   1514 C  CG    . ASN A 1 185 ? 42.515  -28.230 30.750  1.00 76.38  ? 185 ASN A CG    1 
ATOM   1515 O  OD1   . ASN A 1 185 ? 42.871  -29.402 31.025  1.00 77.37  ? 185 ASN A OD1   1 
ATOM   1516 N  ND2   . ASN A 1 185 ? 41.257  -27.923 30.457  1.00 75.75  ? 185 ASN A ND2   1 
ATOM   1517 N  N     . ARG A 1 186 ? 44.074  -23.650 30.170  1.00 73.95  ? 186 ARG A N     1 
ATOM   1518 C  CA    . ARG A 1 186 ? 45.185  -22.660 30.154  1.00 73.78  ? 186 ARG A CA    1 
ATOM   1519 C  C     . ARG A 1 186 ? 46.240  -23.009 31.223  1.00 75.15  ? 186 ARG A C     1 
ATOM   1520 O  O     . ARG A 1 186 ? 47.381  -22.543 31.164  1.00 75.19  ? 186 ARG A O     1 
ATOM   1521 C  CB    . ARG A 1 186 ? 44.668  -21.195 30.229  1.00 73.27  ? 186 ARG A CB    1 
ATOM   1522 C  CG    . ARG A 1 186 ? 45.207  -20.288 31.381  1.00 74.21  ? 186 ARG A CG    1 
ATOM   1523 C  CD    . ARG A 1 186 ? 46.229  -19.254 30.895  1.00 73.67  ? 186 ARG A CD    1 
ATOM   1524 N  NE    . ARG A 1 186 ? 46.340  -18.074 31.772  1.00 74.26  ? 186 ARG A NE    1 
ATOM   1525 C  CZ    . ARG A 1 186 ? 47.251  -17.092 31.666  1.00 74.15  ? 186 ARG A CZ    1 
ATOM   1526 N  NH1   . ARG A 1 186 ? 47.220  -16.088 32.544  1.00 74.82  ? 186 ARG A NH1   1 
ATOM   1527 N  NH2   . ARG A 1 186 ? 48.196  -17.088 30.713  1.00 73.48  ? 186 ARG A NH2   1 
ATOM   1528 N  N     . PHE A 1 187 ? 45.817  -23.826 32.189  1.00 76.34  ? 187 PHE A N     1 
ATOM   1529 C  CA    . PHE A 1 187 ? 46.674  -24.442 33.167  1.00 77.79  ? 187 PHE A CA    1 
ATOM   1530 C  C     . PHE A 1 187 ? 46.644  -25.957 33.036  1.00 78.35  ? 187 PHE A C     1 
ATOM   1531 O  O     . PHE A 1 187 ? 46.408  -26.673 33.997  1.00 79.67  ? 187 PHE A O     1 
ATOM   1532 C  CB    . PHE A 1 187 ? 46.196  -24.005 34.538  1.00 78.95  ? 187 PHE A CB    1 
ATOM   1533 C  CG    . PHE A 1 187 ? 45.976  -22.530 34.640  1.00 78.43  ? 187 PHE A CG    1 
ATOM   1534 C  CD1   . PHE A 1 187 ? 46.976  -21.651 34.251  1.00 77.88  ? 187 PHE A CD1   1 
ATOM   1535 C  CD2   . PHE A 1 187 ? 44.778  -22.013 35.108  1.00 78.56  ? 187 PHE A CD2   1 
ATOM   1536 C  CE1   . PHE A 1 187 ? 46.791  -20.285 34.342  1.00 77.50  ? 187 PHE A CE1   1 
ATOM   1537 C  CE2   . PHE A 1 187 ? 44.590  -20.644 35.206  1.00 78.19  ? 187 PHE A CE2   1 
ATOM   1538 C  CZ    . PHE A 1 187 ? 45.598  -19.781 34.816  1.00 77.65  ? 187 PHE A CZ    1 
ATOM   1539 N  N     . GLY A 1 188 ? 46.891  -26.434 31.827  1.00 77.41  ? 188 GLY A N     1 
ATOM   1540 C  CA    . GLY A 1 188 ? 47.189  -27.835 31.599  1.00 77.99  ? 188 GLY A CA    1 
ATOM   1541 C  C     . GLY A 1 188 ? 48.696  -28.006 31.590  1.00 78.51  ? 188 GLY A C     1 
ATOM   1542 O  O     . GLY A 1 188 ? 49.445  -27.037 31.764  1.00 78.39  ? 188 GLY A O     1 
ATOM   1543 N  N     . LYS A 1 189 ? 49.127  -29.240 31.352  1.00 79.14  ? 189 LYS A N     1 
ATOM   1544 C  CA    . LYS A 1 189 ? 50.545  -29.589 31.301  1.00 79.80  ? 189 LYS A CA    1 
ATOM   1545 C  C     . LYS A 1 189 ? 51.288  -28.865 30.176  1.00 78.58  ? 189 LYS A C     1 
ATOM   1546 O  O     . LYS A 1 189 ? 50.784  -28.768 29.070  1.00 77.31  ? 189 LYS A O     1 
ATOM   1547 C  CB    . LYS A 1 189 ? 50.708  -31.095 31.109  1.00 80.66  ? 189 LYS A CB    1 
ATOM   1548 C  CG    . LYS A 1 189 ? 50.112  -31.943 32.229  1.00 82.14  ? 189 LYS A CG    1 
ATOM   1549 C  CD    . LYS A 1 189 ? 50.783  -33.314 32.337  1.00 83.51  ? 189 LYS A CD    1 
ATOM   1550 C  CE    . LYS A 1 189 ? 50.484  -34.221 31.142  1.00 82.90  ? 189 LYS A CE    1 
ATOM   1551 N  NZ    . LYS A 1 189 ? 49.272  -35.072 31.341  1.00 83.32  ? 189 LYS A NZ    1 
ATOM   1552 N  N     . LYS A 1 190 ? 52.486  -28.367 30.460  1.00 79.03  ? 190 LYS A N     1 
ATOM   1553 C  CA    . LYS A 1 190 ? 53.278  -27.625 29.472  1.00 78.06  ? 190 LYS A CA    1 
ATOM   1554 C  C     . LYS A 1 190 ? 54.773  -27.560 29.815  1.00 79.03  ? 190 LYS A C     1 
ATOM   1555 O  O     . LYS A 1 190 ? 55.193  -27.842 30.947  1.00 80.41  ? 190 LYS A O     1 
ATOM   1556 C  CB    . LYS A 1 190 ? 52.717  -26.209 29.301  1.00 76.90  ? 190 LYS A CB    1 
ATOM   1557 C  CG    . LYS A 1 190 ? 52.603  -25.440 30.603  1.00 77.63  ? 190 LYS A CG    1 
ATOM   1558 C  CD    . LYS A 1 190 ? 52.073  -24.031 30.416  1.00 76.59  ? 190 LYS A CD    1 
ATOM   1559 C  CE    . LYS A 1 190 ? 52.046  -23.295 31.753  1.00 77.49  ? 190 LYS A CE    1 
ATOM   1560 N  NZ    . LYS A 1 190 ? 50.875  -22.392 31.919  1.00 76.87  ? 190 LYS A NZ    1 
ATOM   1561 N  N     . THR A 1 191 ? 55.560  -27.177 28.816  1.00 78.36  ? 191 THR A N     1 
ATOM   1562 C  CA    . THR A 1 191 ? 57.012  -27.131 28.921  1.00 79.20  ? 191 THR A CA    1 
ATOM   1563 C  C     . THR A 1 191 ? 57.519  -25.869 28.255  1.00 78.25  ? 191 THR A C     1 
ATOM   1564 O  O     . THR A 1 191 ? 57.172  -25.609 27.113  1.00 77.03  ? 191 THR A O     1 
ATOM   1565 C  CB    . THR A 1 191 ? 57.656  -28.324 28.189  1.00 79.67  ? 191 THR A CB    1 
ATOM   1566 O  OG1   . THR A 1 191 ? 56.919  -29.522 28.451  1.00 80.21  ? 191 THR A OG1   1 
ATOM   1567 C  CG2   . THR A 1 191 ? 59.072  -28.519 28.643  1.00 81.01  ? 191 THR A CG2   1 
ATOM   1568 N  N     . MET A 1 192 ? 58.339  -25.090 28.954  1.00 78.89  ? 192 MET A N     1 
ATOM   1569 C  CA    . MET A 1 192 ? 59.038  -23.982 28.317  1.00 78.26  ? 192 MET A CA    1 
ATOM   1570 C  C     . MET A 1 192 ? 60.228  -24.548 27.535  1.00 78.68  ? 192 MET A C     1 
ATOM   1571 O  O     . MET A 1 192 ? 61.068  -25.270 28.086  1.00 80.00  ? 192 MET A O     1 
ATOM   1572 C  CB    . MET A 1 192 ? 59.494  -22.921 29.324  1.00 78.84  ? 192 MET A CB    1 
ATOM   1573 C  CG    . MET A 1 192 ? 60.356  -21.826 28.705  1.00 78.43  ? 192 MET A CG    1 
ATOM   1574 S  SD    . MET A 1 192 ? 60.355  -20.272 29.611  1.00 78.54  ? 192 MET A SD    1 
ATOM   1575 C  CE    . MET A 1 192 ? 58.822  -19.508 29.069  1.00 76.97  ? 192 MET A CE    1 
ATOM   1576 N  N     . LEU A 1 193 ? 60.264  -24.218 26.244  1.00 77.61  ? 193 LEU A N     1 
ATOM   1577 C  CA    . LEU A 1 193 ? 61.330  -24.608 25.334  1.00 77.89  ? 193 LEU A CA    1 
ATOM   1578 C  C     . LEU A 1 193 ? 62.307  -23.448 25.153  1.00 77.92  ? 193 LEU A C     1 
ATOM   1579 O  O     . LEU A 1 193 ? 61.960  -22.440 24.537  1.00 76.85  ? 193 LEU A O     1 
ATOM   1580 C  CB    . LEU A 1 193 ? 60.735  -24.973 23.979  1.00 76.78  ? 193 LEU A CB    1 
ATOM   1581 C  CG    . LEU A 1 193 ? 61.749  -25.391 22.914  1.00 77.06  ? 193 LEU A CG    1 
ATOM   1582 C  CD1   . LEU A 1 193 ? 62.211  -26.815 23.177  1.00 78.31  ? 193 LEU A CD1   1 
ATOM   1583 C  CD2   . LEU A 1 193 ? 61.169  -25.248 21.510  1.00 75.76  ? 193 LEU A CD2   1 
ATOM   1584 N  N     . CYS A 1 194 ? 63.520  -23.607 25.678  1.00 79.22  ? 194 CYS A N     1 
ATOM   1585 C  CA    . CYS A 1 194 ? 64.607  -22.664 25.449  1.00 79.47  ? 194 CYS A CA    1 
ATOM   1586 C  C     . CYS A 1 194 ? 65.502  -23.256 24.384  1.00 79.80  ? 194 CYS A C     1 
ATOM   1587 O  O     . CYS A 1 194 ? 66.027  -24.354 24.555  1.00 80.85  ? 194 CYS A O     1 
ATOM   1588 C  CB    . CYS A 1 194 ? 65.377  -22.432 26.735  1.00 80.80  ? 194 CYS A CB    1 
ATOM   1589 S  SG    . CYS A 1 194 ? 64.268  -21.995 28.080  1.00 80.69  ? 194 CYS A SG    1 
ATOM   1590 N  N     . VAL A 1 195 ? 65.673  -22.521 23.290  1.00 78.98  ? 195 VAL A N     1 
ATOM   1591 C  CA    . VAL A 1 195 ? 66.343  -23.038 22.099  1.00 79.13  ? 195 VAL A CA    1 
ATOM   1592 C  C     . VAL A 1 195 ? 67.080  -21.931 21.347  1.00 78.93  ? 195 VAL A C     1 
ATOM   1593 O  O     . VAL A 1 195 ? 66.541  -20.836 21.157  1.00 77.95  ? 195 VAL A O     1 
ATOM   1594 C  CB    . VAL A 1 195 ? 65.331  -23.733 21.166  1.00 78.12  ? 195 VAL A CB    1 
ATOM   1595 C  CG1   . VAL A 1 195 ? 64.187  -22.792 20.771  1.00 76.57  ? 195 VAL A CG1   1 
ATOM   1596 C  CG2   . VAL A 1 195 ? 66.029  -24.306 19.938  1.00 78.39  ? 195 VAL A CG2   1 
ATOM   1597 N  N     . TRP A 1 196 ? 68.316  -22.236 20.951  1.00 79.97  ? 196 TRP A N     1 
ATOM   1598 C  CA    . TRP A 1 196 ? 69.166  -21.324 20.203  1.00 80.06  ? 196 TRP A CA    1 
ATOM   1599 C  C     . TRP A 1 196 ? 69.669  -22.070 18.982  1.00 80.34  ? 196 TRP A C     1 
ATOM   1600 O  O     . TRP A 1 196 ? 69.865  -23.289 19.024  1.00 81.08  ? 196 TRP A O     1 
ATOM   1601 C  CB    . TRP A 1 196 ? 70.331  -20.810 21.058  1.00 81.33  ? 196 TRP A CB    1 
ATOM   1602 C  CG    . TRP A 1 196 ? 69.893  -20.227 22.381  1.00 81.30  ? 196 TRP A CG    1 
ATOM   1603 C  CD1   . TRP A 1 196 ? 69.708  -18.906 22.692  1.00 80.83  ? 196 TRP A CD1   1 
ATOM   1604 C  CD2   . TRP A 1 196 ? 69.582  -20.961 23.561  1.00 81.88  ? 196 TRP A CD2   1 
ATOM   1605 N  NE1   . TRP A 1 196 ? 69.287  -18.779 23.995  1.00 81.06  ? 196 TRP A NE1   1 
ATOM   1606 C  CE2   . TRP A 1 196 ? 69.207  -20.028 24.551  1.00 81.71  ? 196 TRP A CE2   1 
ATOM   1607 C  CE3   . TRP A 1 196 ? 69.578  -22.325 23.878  1.00 82.61  ? 196 TRP A CE3   1 
ATOM   1608 C  CZ2   . TRP A 1 196 ? 68.841  -20.415 25.832  1.00 82.26  ? 196 TRP A CZ2   1 
ATOM   1609 C  CZ3   . TRP A 1 196 ? 69.213  -22.709 25.142  1.00 83.16  ? 196 TRP A CZ3   1 
ATOM   1610 C  CH2   . TRP A 1 196 ? 68.850  -21.758 26.110  1.00 82.98  ? 196 TRP A CH2   1 
ATOM   1611 N  N     . TRP A 1 197 ? 69.850  -21.329 17.893  1.00 79.82  ? 197 TRP A N     1 
ATOM   1612 C  CA    . TRP A 1 197 ? 70.089  -21.912 16.569  1.00 79.85  ? 197 TRP A CA    1 
ATOM   1613 C  C     . TRP A 1 197 ? 70.822  -20.950 15.615  1.00 79.95  ? 197 TRP A C     1 
ATOM   1614 O  O     . TRP A 1 197 ? 70.601  -19.739 15.629  1.00 79.32  ? 197 TRP A O     1 
ATOM   1615 C  CB    . TRP A 1 197 ? 68.761  -22.370 15.941  1.00 78.53  ? 197 TRP A CB    1 
ATOM   1616 C  CG    . TRP A 1 197 ? 67.752  -21.279 15.739  1.00 77.09  ? 197 TRP A CG    1 
ATOM   1617 C  CD1   . TRP A 1 197 ? 67.087  -20.591 16.708  1.00 76.55  ? 197 TRP A CD1   1 
ATOM   1618 C  CD2   . TRP A 1 197 ? 67.273  -20.765 14.484  1.00 76.11  ? 197 TRP A CD2   1 
ATOM   1619 N  NE1   . TRP A 1 197 ? 66.232  -19.673 16.143  1.00 75.30  ? 197 TRP A NE1   1 
ATOM   1620 C  CE2   . TRP A 1 197 ? 66.324  -19.759 14.779  1.00 75.00  ? 197 TRP A CE2   1 
ATOM   1621 C  CE3   . TRP A 1 197 ? 67.553  -21.054 13.141  1.00 76.14  ? 197 TRP A CE3   1 
ATOM   1622 C  CZ2   . TRP A 1 197 ? 65.657  -19.038 13.781  1.00 73.93  ? 197 TRP A CZ2   1 
ATOM   1623 C  CZ3   . TRP A 1 197 ? 66.883  -20.337 12.148  1.00 75.06  ? 197 TRP A CZ3   1 
ATOM   1624 C  CH2   . TRP A 1 197 ? 65.947  -19.340 12.479  1.00 73.97  ? 197 TRP A CH2   1 
ATOM   1625 N  N     . ASP A 1 198 ? 71.704  -21.523 14.799  1.00 80.88  ? 198 ASP A N     1 
ATOM   1626 C  CA    . ASP A 1 198 ? 72.483  -20.813 13.786  1.00 81.23  ? 198 ASP A CA    1 
ATOM   1627 C  C     . ASP A 1 198 ? 71.760  -20.957 12.473  1.00 80.26  ? 198 ASP A C     1 
ATOM   1628 O  O     . ASP A 1 198 ? 70.789  -21.701 12.390  1.00 79.48  ? 198 ASP A O     1 
ATOM   1629 C  CB    . ASP A 1 198 ? 73.826  -21.555 13.683  1.00 82.97  ? 198 ASP A CB    1 
ATOM   1630 C  CG    . ASP A 1 198 ? 74.939  -20.765 13.033  1.00 83.83  ? 198 ASP A CG    1 
ATOM   1631 O  OD1   . ASP A 1 198 ? 74.692  -19.702 12.410  1.00 83.09  ? 198 ASP A OD1   1 
ATOM   1632 O  OD2   . ASP A 1 198 ? 76.083  -21.270 13.125  1.00 85.38  ? 198 ASP A OD2   1 
ATOM   1633 N  N     . GLN A 1 199 ? 72.248  -20.274 11.441  1.00 80.40  ? 199 GLN A N     1 
ATOM   1634 C  CA    . GLN A 1 199 ? 71.762  -20.535 10.089  1.00 79.80  ? 199 GLN A CA    1 
ATOM   1635 C  C     . GLN A 1 199 ? 72.007  -21.980 9.603   1.00 80.54  ? 199 GLN A C     1 
ATOM   1636 O  O     . GLN A 1 199 ? 71.299  -22.444 8.702   1.00 79.86  ? 199 GLN A O     1 
ATOM   1637 C  CB    . GLN A 1 199 ? 72.308  -19.513 9.083   1.00 80.02  ? 199 GLN A CB    1 
ATOM   1638 C  CG    . GLN A 1 199 ? 73.814  -19.473 8.878   1.00 81.71  ? 199 GLN A CG    1 
ATOM   1639 C  CD    . GLN A 1 199 ? 74.178  -18.762 7.585   1.00 81.93  ? 199 GLN A CD    1 
ATOM   1640 O  OE1   . GLN A 1 199 ? 73.786  -17.613 7.352   1.00 81.19  ? 199 GLN A OE1   1 
ATOM   1641 N  NE2   . GLN A 1 199 ? 74.901  -19.450 6.722   1.00 83.01  ? 199 GLN A NE2   1 
ATOM   1642 N  N     . SER A 1 200 ? 72.995  -22.665 10.192  1.00 81.98  ? 200 SER A N     1 
ATOM   1643 C  CA    . SER A 1 200 ? 73.236  -24.102 9.959   1.00 82.86  ? 200 SER A CA    1 
ATOM   1644 C  C     . SER A 1 200 ? 72.063  -24.998 10.359  1.00 81.98  ? 200 SER A C     1 
ATOM   1645 O  O     . SER A 1 200 ? 71.476  -25.680 9.514   1.00 81.56  ? 200 SER A O     1 
ATOM   1646 C  CB    . SER A 1 200 ? 74.477  -24.571 10.721  1.00 84.61  ? 200 SER A CB    1 
ATOM   1647 O  OG    . SER A 1 200 ? 75.646  -23.925 10.266  1.00 85.67  ? 200 SER A OG    1 
ATOM   1648 N  N     . GLY A 1 201 ? 71.732  -25.002 11.643  1.00 81.79  ? 201 GLY A N     1 
ATOM   1649 C  CA    . GLY A 1 201 ? 70.620  -25.801 12.150  1.00 81.07  ? 201 GLY A CA    1 
ATOM   1650 C  C     . GLY A 1 201 ? 70.304  -25.354 13.552  1.00 80.80  ? 201 GLY A C     1 
ATOM   1651 O  O     . GLY A 1 201 ? 70.612  -24.220 13.915  1.00 80.66  ? 201 GLY A O     1 
ATOM   1652 N  N     . VAL A 1 202 ? 69.674  -26.220 14.338  1.00 80.79  ? 202 VAL A N     1 
ATOM   1653 C  CA    . VAL A 1 202 ? 69.599  -26.007 15.791  1.00 81.02  ? 202 VAL A CA    1 
ATOM   1654 C  C     . VAL A 1 202 ? 70.975  -26.304 16.375  1.00 82.78  ? 202 VAL A C     1 
ATOM   1655 O  O     . VAL A 1 202 ? 71.685  -27.170 15.871  1.00 83.88  ? 202 VAL A O     1 
ATOM   1656 C  CB    . VAL A 1 202 ? 68.521  -26.894 16.463  1.00 80.65  ? 202 VAL A CB    1 
ATOM   1657 C  CG1   . VAL A 1 202 ? 68.615  -26.844 17.995  1.00 81.27  ? 202 VAL A CG1   1 
ATOM   1658 C  CG2   . VAL A 1 202 ? 67.135  -26.467 15.995  1.00 78.91  ? 202 VAL A CG2   1 
ATOM   1659 N  N     . ILE A 1 203 ? 71.341  -25.582 17.429  1.00 83.12  ? 203 ILE A N     1 
ATOM   1660 C  CA    . ILE A 1 203 ? 72.602  -25.809 18.119  1.00 84.82  ? 203 ILE A CA    1 
ATOM   1661 C  C     . ILE A 1 203 ? 72.341  -26.624 19.378  1.00 85.48  ? 203 ILE A C     1 
ATOM   1662 O  O     . ILE A 1 203 ? 72.787  -27.763 19.487  1.00 86.69  ? 203 ILE A O     1 
ATOM   1663 C  CB    . ILE A 1 203 ? 73.312  -24.474 18.464  1.00 85.00  ? 203 ILE A CB    1 
ATOM   1664 C  CG1   . ILE A 1 203 ? 73.708  -23.749 17.169  1.00 84.65  ? 203 ILE A CG1   1 
ATOM   1665 C  CG2   . ILE A 1 203 ? 74.537  -24.706 19.366  1.00 86.78  ? 203 ILE A CG2   1 
ATOM   1666 C  CD1   . ILE A 1 203 ? 74.270  -22.361 17.384  1.00 84.70  ? 203 ILE A CD1   1 
ATOM   1667 N  N     . TYR A 1 204 ? 71.640  -26.015 20.329  1.00 84.78  ? 204 TYR A N     1 
ATOM   1668 C  CA    . TYR A 1 204 ? 71.404  -26.601 21.646  1.00 85.47  ? 204 TYR A CA    1 
ATOM   1669 C  C     . TYR A 1 204 ? 70.051  -26.102 22.126  1.00 84.07  ? 204 TYR A C     1 
ATOM   1670 O  O     . TYR A 1 204 ? 69.592  -25.030 21.717  1.00 82.84  ? 204 TYR A O     1 
ATOM   1671 C  CB    . TYR A 1 204 ? 72.539  -26.211 22.618  1.00 86.87  ? 204 TYR A CB    1 
ATOM   1672 C  CG    . TYR A 1 204 ? 72.283  -26.513 24.089  1.00 87.54  ? 204 TYR A CG    1 
ATOM   1673 C  CD1   . TYR A 1 204 ? 72.235  -27.830 24.556  1.00 88.57  ? 204 TYR A CD1   1 
ATOM   1674 C  CD2   . TYR A 1 204 ? 72.096  -25.480 25.020  1.00 87.25  ? 204 TYR A CD2   1 
ATOM   1675 C  CE1   . TYR A 1 204 ? 71.995  -28.110 25.899  1.00 89.29  ? 204 TYR A CE1   1 
ATOM   1676 C  CE2   . TYR A 1 204 ? 71.861  -25.752 26.363  1.00 87.96  ? 204 TYR A CE2   1 
ATOM   1677 C  CZ    . TYR A 1 204 ? 71.811  -27.066 26.796  1.00 88.98  ? 204 TYR A CZ    1 
ATOM   1678 O  OH    . TYR A 1 204 ? 71.587  -27.341 28.122  1.00 89.79  ? 204 TYR A OH    1 
ATOM   1679 N  N     . TYR A 1 205 ? 69.401  -26.901 22.960  1.00 84.34  ? 205 TYR A N     1 
ATOM   1680 C  CA    . TYR A 1 205 ? 68.154  -26.493 23.576  1.00 83.28  ? 205 TYR A CA    1 
ATOM   1681 C  C     . TYR A 1 205 ? 67.888  -27.299 24.837  1.00 84.25  ? 205 TYR A C     1 
ATOM   1682 O  O     . TYR A 1 205 ? 68.363  -28.431 24.972  1.00 85.48  ? 205 TYR A O     1 
ATOM   1683 C  CB    . TYR A 1 205 ? 67.001  -26.653 22.588  1.00 81.80  ? 205 TYR A CB    1 
ATOM   1684 C  CG    . TYR A 1 205 ? 66.547  -28.072 22.386  1.00 82.13  ? 205 TYR A CG    1 
ATOM   1685 C  CD1   . TYR A 1 205 ? 67.336  -28.998 21.694  1.00 83.06  ? 205 TYR A CD1   1 
ATOM   1686 C  CD2   . TYR A 1 205 ? 65.323  -28.497 22.890  1.00 81.62  ? 205 TYR A CD2   1 
ATOM   1687 C  CE1   . TYR A 1 205 ? 66.903  -30.306 21.504  1.00 83.44  ? 205 TYR A CE1   1 
ATOM   1688 C  CE2   . TYR A 1 205 ? 64.880  -29.797 22.701  1.00 81.98  ? 205 TYR A CE2   1 
ATOM   1689 C  CZ    . TYR A 1 205 ? 65.670  -30.699 22.006  1.00 82.89  ? 205 TYR A CZ    1 
ATOM   1690 O  OH    . TYR A 1 205 ? 65.217  -31.985 21.823  1.00 83.32  ? 205 TYR A OH    1 
ATOM   1691 N  N     . GLU A 1 206 ? 67.134  -26.690 25.751  1.00 83.79  ? 206 GLU A N     1 
ATOM   1692 C  CA    . GLU A 1 206 ? 66.669  -27.330 26.984  1.00 84.59  ? 206 GLU A CA    1 
ATOM   1693 C  C     . GLU A 1 206 ? 65.141  -27.308 26.999  1.00 83.34  ? 206 GLU A C     1 
ATOM   1694 O  O     . GLU A 1 206 ? 64.516  -26.592 26.213  1.00 81.89  ? 206 GLU A O     1 
ATOM   1695 C  CB    . GLU A 1 206 ? 67.265  -26.636 28.230  1.00 85.53  ? 206 GLU A CB    1 
ATOM   1696 C  CG    . GLU A 1 206 ? 68.401  -27.408 28.890  1.00 87.45  ? 206 GLU A CG    1 
ATOM   1697 C  CD    . GLU A 1 206 ? 69.271  -26.544 29.786  1.00 88.32  ? 206 GLU A CD    1 
ATOM   1698 O  OE1   . GLU A 1 206 ? 69.862  -25.573 29.265  1.00 87.88  ? 206 GLU A OE1   1 
ATOM   1699 O  OE2   . GLU A 1 206 ? 69.405  -26.855 30.992  1.00 89.53  ? 206 GLU A OE2   1 
ATOM   1700 N  N     . LEU A 1 207 ? 64.572  -28.103 27.900  1.00 84.02  ? 207 LEU A N     1 
ATOM   1701 C  CA    . LEU A 1 207 ? 63.126  -28.248 28.054  1.00 83.14  ? 207 LEU A CA    1 
ATOM   1702 C  C     . LEU A 1 207 ? 62.806  -28.193 29.544  1.00 84.02  ? 207 LEU A C     1 
ATOM   1703 O  O     . LEU A 1 207 ? 63.040  -29.171 30.262  1.00 85.40  ? 207 LEU A O     1 
ATOM   1704 C  CB    . LEU A 1 207 ? 62.596  -29.564 27.466  1.00 83.17  ? 207 LEU A CB    1 
ATOM   1705 C  CG    . LEU A 1 207 ? 62.257  -29.720 25.946  1.00 81.93  ? 207 LEU A CG    1 
ATOM   1706 C  CD1   . LEU A 1 207 ? 62.220  -31.163 25.445  1.00 82.55  ? 207 LEU A CD1   1 
ATOM   1707 C  CD2   . LEU A 1 207 ? 60.897  -29.087 25.752  1.00 80.40  ? 207 LEU A CD2   1 
ATOM   1708 N  N     . LEU A 1 208 ? 62.273  -27.059 29.993  1.00 83.30  ? 208 LEU A N     1 
ATOM   1709 C  CA    . LEU A 1 208 ? 62.017  -26.807 31.420  1.00 84.16  ? 208 LEU A CA    1 
ATOM   1710 C  C     . LEU A 1 208 ? 60.652  -27.341 31.844  1.00 83.97  ? 208 LEU A C     1 
ATOM   1711 O  O     . LEU A 1 208 ? 59.653  -27.046 31.191  1.00 82.60  ? 208 LEU A O     1 
ATOM   1712 C  CB    . LEU A 1 208 ? 62.057  -25.304 31.725  1.00 83.59  ? 208 LEU A CB    1 
ATOM   1713 C  CG    . LEU A 1 208 ? 63.399  -24.581 31.853  1.00 84.22  ? 208 LEU A CG    1 
ATOM   1714 C  CD1   . LEU A 1 208 ? 64.415  -25.026 30.813  1.00 84.32  ? 208 LEU A CD1   1 
ATOM   1715 C  CD2   . LEU A 1 208 ? 63.169  -23.078 31.774  1.00 83.24  ? 208 LEU A CD2   1 
ATOM   1716 N  N     . LYS A 1 209 ? 60.603  -28.093 32.948  1.00 85.39  ? 209 LYS A N     1 
ATOM   1717 C  CA    . LYS A 1 209 ? 59.320  -28.457 33.565  1.00 85.43  ? 209 LYS A CA    1 
ATOM   1718 C  C     . LYS A 1 209 ? 58.801  -27.212 34.284  1.00 85.05  ? 209 LYS A C     1 
ATOM   1719 O  O     . LYS A 1 209 ? 59.595  -26.424 34.804  1.00 85.53  ? 209 LYS A O     1 
ATOM   1720 C  CB    . LYS A 1 209 ? 59.449  -29.616 34.560  1.00 87.24  ? 209 LYS A CB    1 
ATOM   1721 C  CG    . LYS A 1 209 ? 59.926  -30.944 33.966  1.00 87.90  ? 209 LYS A CG    1 
ATOM   1722 C  CD    . LYS A 1 209 ? 61.427  -31.175 34.164  1.00 89.20  ? 209 LYS A CD    1 
ATOM   1723 C  CE    . LYS A 1 209 ? 61.839  -32.634 34.006  1.00 90.46  ? 209 LYS A CE    1 
ATOM   1724 N  NZ    . LYS A 1 209 ? 63.171  -32.895 34.633  1.00 92.19  ? 209 LYS A NZ    1 
ATOM   1725 N  N     . PRO A 1 210 ? 57.472  -27.028 34.327  1.00 84.26  ? 210 PRO A N     1 
ATOM   1726 C  CA    . PRO A 1 210 ? 56.959  -25.801 34.930  1.00 83.90  ? 210 PRO A CA    1 
ATOM   1727 C  C     . PRO A 1 210 ? 57.163  -25.866 36.437  1.00 85.58  ? 210 PRO A C     1 
ATOM   1728 O  O     . PRO A 1 210 ? 56.927  -26.914 37.040  1.00 86.70  ? 210 PRO A O     1 
ATOM   1729 C  CB    . PRO A 1 210 ? 55.477  -25.806 34.543  1.00 82.82  ? 210 PRO A CB    1 
ATOM   1730 C  CG    . PRO A 1 210 ? 55.134  -27.241 34.299  1.00 83.23  ? 210 PRO A CG    1 
ATOM   1731 C  CD    . PRO A 1 210 ? 56.409  -28.032 34.140  1.00 84.15  ? 210 PRO A CD    1 
ATOM   1732 N  N     . GLY A 1 211 ? 57.631  -24.767 37.018  1.00 85.81  ? 211 GLY A N     1 
ATOM   1733 C  CA    . GLY A 1 211 ? 58.210  -24.774 38.365  1.00 87.53  ? 211 GLY A CA    1 
ATOM   1734 C  C     . GLY A 1 211 ? 59.732  -24.729 38.350  1.00 88.27  ? 211 GLY A C     1 
ATOM   1735 O  O     . GLY A 1 211 ? 60.363  -24.869 39.397  1.00 89.81  ? 211 GLY A O     1 
ATOM   1736 N  N     . GLU A 1 212 ? 60.314  -24.568 37.157  1.00 87.25  ? 212 GLU A N     1 
ATOM   1737 C  CA    . GLU A 1 212 ? 61.722  -24.199 36.978  1.00 87.67  ? 212 GLU A CA    1 
ATOM   1738 C  C     . GLU A 1 212 ? 61.738  -22.859 36.243  1.00 86.28  ? 212 GLU A C     1 
ATOM   1739 O  O     . GLU A 1 212 ? 61.797  -22.809 35.011  1.00 85.11  ? 212 GLU A O     1 
ATOM   1740 C  CB    . GLU A 1 212 ? 62.475  -25.259 36.161  1.00 87.90  ? 212 GLU A CB    1 
ATOM   1741 C  CG    . GLU A 1 212 ? 62.568  -26.634 36.812  1.00 89.42  ? 212 GLU A CG    1 
ATOM   1742 C  CD    . GLU A 1 212 ? 63.144  -27.706 35.889  1.00 89.56  ? 212 GLU A CD    1 
ATOM   1743 O  OE1   . GLU A 1 212 ? 63.785  -28.652 36.398  1.00 91.12  ? 212 GLU A OE1   1 
ATOM   1744 O  OE2   . GLU A 1 212 ? 62.954  -27.625 34.660  1.00 88.20  ? 212 GLU A OE2   1 
ATOM   1745 N  N     . THR A 1 213 ? 61.646  -21.772 37.001  1.00 86.47  ? 213 THR A N     1 
ATOM   1746 C  CA    . THR A 1 213 ? 61.609  -20.431 36.415  1.00 85.31  ? 213 THR A CA    1 
ATOM   1747 C  C     . THR A 1 213 ? 62.921  -20.043 35.748  1.00 85.30  ? 213 THR A C     1 
ATOM   1748 O  O     . THR A 1 213 ? 63.977  -20.562 36.099  1.00 86.50  ? 213 THR A O     1 
ATOM   1749 C  CB    . THR A 1 213 ? 61.262  -19.348 37.466  1.00 85.74  ? 213 THR A CB    1 
ATOM   1750 O  OG1   . THR A 1 213 ? 61.466  -18.054 36.889  1.00 84.85  ? 213 THR A OG1   1 
ATOM   1751 C  CG2   . THR A 1 213 ? 62.122  -19.471 38.754  1.00 87.58  ? 213 THR A CG2   1 
ATOM   1752 N  N     . VAL A 1 214 ? 62.833  -19.109 34.805  1.00 84.03  ? 214 VAL A N     1 
ATOM   1753 C  CA    . VAL A 1 214 ? 64.001  -18.581 34.109  1.00 83.97  ? 214 VAL A CA    1 
ATOM   1754 C  C     . VAL A 1 214 ? 64.550  -17.406 34.925  1.00 84.68  ? 214 VAL A C     1 
ATOM   1755 O  O     . VAL A 1 214 ? 64.004  -16.307 34.875  1.00 83.97  ? 214 VAL A O     1 
ATOM   1756 C  CB    . VAL A 1 214 ? 63.653  -18.186 32.644  1.00 82.37  ? 214 VAL A CB    1 
ATOM   1757 C  CG1   . VAL A 1 214 ? 64.780  -17.416 31.961  1.00 82.34  ? 214 VAL A CG1   1 
ATOM   1758 C  CG2   . VAL A 1 214 ? 63.331  -19.440 31.844  1.00 81.91  ? 214 VAL A CG2   1 
ATOM   1759 N  N     . ASN A 1 215 ? 65.616  -17.665 35.686  1.00 86.15  ? 215 ASN A N     1 
ATOM   1760 C  CA    . ASN A 1 215 ? 66.380  -16.614 36.368  1.00 86.96  ? 215 ASN A CA    1 
ATOM   1761 C  C     . ASN A 1 215 ? 67.628  -16.349 35.545  1.00 87.03  ? 215 ASN A C     1 
ATOM   1762 O  O     . ASN A 1 215 ? 68.035  -17.191 34.729  1.00 86.88  ? 215 ASN A O     1 
ATOM   1763 C  CB    . ASN A 1 215 ? 66.731  -16.958 37.841  1.00 88.68  ? 215 ASN A CB    1 
ATOM   1764 C  CG    . ASN A 1 215 ? 66.848  -18.446 38.102  1.00 89.51  ? 215 ASN A CG    1 
ATOM   1765 O  OD1   . ASN A 1 215 ? 67.910  -19.012 37.910  1.00 90.29  ? 215 ASN A OD1   1 
ATOM   1766 N  ND2   . ASN A 1 215 ? 65.763  -19.086 38.543  1.00 89.44  ? 215 ASN A ND2   1 
ATOM   1767 N  N     . ALA A 1 216 ? 68.223  -15.173 35.734  1.00 87.32  ? 216 ALA A N     1 
ATOM   1768 C  CA    . ALA A 1 216 ? 69.526  -14.857 35.141  1.00 87.72  ? 216 ALA A CA    1 
ATOM   1769 C  C     . ALA A 1 216 ? 70.523  -15.965 35.467  1.00 89.07  ? 216 ALA A C     1 
ATOM   1770 O  O     . ALA A 1 216 ? 71.317  -16.352 34.618  1.00 89.13  ? 216 ALA A O     1 
ATOM   1771 C  CB    . ALA A 1 216 ? 70.031  -13.515 35.642  1.00 88.24  ? 216 ALA A CB    1 
ATOM   1772 N  N     . ALA A 1 217 ? 70.428  -16.498 36.684  1.00 90.20  ? 217 ALA A N     1 
ATOM   1773 C  CA    . ALA A 1 217 ? 71.257  -17.619 37.146  1.00 91.65  ? 217 ALA A CA    1 
ATOM   1774 C  C     . ALA A 1 217 ? 71.105  -18.884 36.302  1.00 91.25  ? 217 ALA A C     1 
ATOM   1775 O  O     . ALA A 1 217 ? 72.087  -19.568 36.010  1.00 92.10  ? 217 ALA A O     1 
ATOM   1776 C  CB    . ALA A 1 217 ? 70.948  -17.926 38.608  1.00 92.85  ? 217 ALA A CB    1 
ATOM   1777 N  N     . ARG A 1 218 ? 69.871  -19.194 35.926  1.00 90.04  ? 218 ARG A N     1 
ATOM   1778 C  CA    . ARG A 1 218 ? 69.601  -20.292 34.999  1.00 89.47  ? 218 ARG A CA    1 
ATOM   1779 C  C     . ARG A 1 218 ? 70.120  -19.982 33.600  1.00 88.60  ? 218 ARG A C     1 
ATOM   1780 O  O     . ARG A 1 218 ? 70.796  -20.808 32.983  1.00 89.04  ? 218 ARG A O     1 
ATOM   1781 C  CB    . ARG A 1 218 ? 68.101  -20.565 34.919  1.00 88.34  ? 218 ARG A CB    1 
ATOM   1782 C  CG    . ARG A 1 218 ? 67.730  -21.694 33.979  1.00 87.75  ? 218 ARG A CG    1 
ATOM   1783 C  CD    . ARG A 1 218 ? 66.275  -22.051 34.152  1.00 86.97  ? 218 ARG A CD    1 
ATOM   1784 N  NE    . ARG A 1 218 ? 66.064  -22.965 35.266  1.00 88.25  ? 218 ARG A NE    1 
ATOM   1785 C  CZ    . ARG A 1 218 ? 66.344  -24.268 35.246  1.00 89.12  ? 218 ARG A CZ    1 
ATOM   1786 N  NH1   . ARG A 1 218 ? 66.877  -24.850 34.165  1.00 88.88  ? 218 ARG A NH1   1 
ATOM   1787 N  NH2   . ARG A 1 218 ? 66.099  -25.001 36.328  1.00 90.36  ? 218 ARG A NH2   1 
ATOM   1788 N  N     . TYR A 1 219 ? 69.775  -18.788 33.116  1.00 87.47  ? 219 TYR A N     1 
ATOM   1789 C  CA    . TYR A 1 219 ? 70.075  -18.361 31.746  1.00 86.51  ? 219 TYR A CA    1 
ATOM   1790 C  C     . TYR A 1 219 ? 71.591  -18.409 31.432  1.00 87.60  ? 219 TYR A C     1 
ATOM   1791 O  O     . TYR A 1 219 ? 71.987  -18.828 30.344  1.00 87.34  ? 219 TYR A O     1 
ATOM   1792 C  CB    . TYR A 1 219 ? 69.458  -16.975 31.477  1.00 85.36  ? 219 TYR A CB    1 
ATOM   1793 C  CG    . TYR A 1 219 ? 69.400  -16.614 30.010  1.00 84.16  ? 219 TYR A CG    1 
ATOM   1794 C  CD1   . TYR A 1 219 ? 68.669  -17.389 29.105  1.00 83.16  ? 219 TYR A CD1   1 
ATOM   1795 C  CD2   . TYR A 1 219 ? 70.081  -15.499 29.516  1.00 84.11  ? 219 TYR A CD2   1 
ATOM   1796 C  CE1   . TYR A 1 219 ? 68.628  -17.068 27.751  1.00 82.15  ? 219 TYR A CE1   1 
ATOM   1797 C  CE2   . TYR A 1 219 ? 70.044  -15.169 28.161  1.00 83.13  ? 219 TYR A CE2   1 
ATOM   1798 C  CZ    . TYR A 1 219 ? 69.318  -15.958 27.279  1.00 82.15  ? 219 TYR A CZ    1 
ATOM   1799 O  OH    . TYR A 1 219 ? 69.266  -15.634 25.934  1.00 81.24  ? 219 TYR A OH    1 
ATOM   1800 N  N     . GLN A 1 220 ? 72.429  -18.034 32.398  1.00 88.92  ? 220 GLN A N     1 
ATOM   1801 C  CA    . GLN A 1 220 ? 73.883  -18.187 32.258  1.00 90.21  ? 220 GLN A CA    1 
ATOM   1802 C  C     . GLN A 1 220 ? 74.268  -19.656 32.088  1.00 91.02  ? 220 GLN A C     1 
ATOM   1803 O  O     . GLN A 1 220 ? 75.042  -19.999 31.192  1.00 91.29  ? 220 GLN A O     1 
ATOM   1804 C  CB    . GLN A 1 220 ? 74.616  -17.619 33.474  1.00 91.59  ? 220 GLN A CB    1 
ATOM   1805 C  CG    . GLN A 1 220 ? 74.517  -16.111 33.617  1.00 91.10  ? 220 GLN A CG    1 
ATOM   1806 C  CD    . GLN A 1 220 ? 75.020  -15.603 34.964  1.00 92.45  ? 220 GLN A CD    1 
ATOM   1807 O  OE1   . GLN A 1 220 ? 74.700  -16.168 36.018  1.00 93.17  ? 220 GLN A OE1   1 
ATOM   1808 N  NE2   . GLN A 1 220 ? 75.782  -14.517 34.940  1.00 92.84  ? 220 GLN A NE2   1 
ATOM   1809 N  N     . GLN A 1 221 ? 73.720  -20.513 32.951  1.00 91.51  ? 221 GLN A N     1 
ATOM   1810 C  CA    . GLN A 1 221 ? 73.963  -21.966 32.892  1.00 92.38  ? 221 GLN A CA    1 
ATOM   1811 C  C     . GLN A 1 221 ? 73.606  -22.546 31.525  1.00 91.32  ? 221 GLN A C     1 
ATOM   1812 O  O     . GLN A 1 221 ? 74.296  -23.435 31.019  1.00 92.09  ? 221 GLN A O     1 
ATOM   1813 C  CB    . GLN A 1 221 ? 73.191  -22.693 34.012  1.00 92.90  ? 221 GLN A CB    1 
ATOM   1814 C  CG    . GLN A 1 221 ? 73.455  -24.191 34.143  1.00 94.08  ? 221 GLN A CG    1 
ATOM   1815 C  CD    . GLN A 1 221 ? 74.927  -24.527 34.277  1.00 95.80  ? 221 GLN A CD    1 
ATOM   1816 O  OE1   . GLN A 1 221 ? 75.685  -23.803 34.923  1.00 96.64  ? 221 GLN A OE1   1 
ATOM   1817 N  NE2   . GLN A 1 221 ? 75.341  -25.625 33.656  1.00 96.39  ? 221 GLN A NE2   1 
ATOM   1818 N  N     . GLN A 1 222 ? 72.546  -22.007 30.929  1.00 89.62  ? 222 GLN A N     1 
ATOM   1819 C  CA    . GLN A 1 222 ? 72.160  -22.357 29.559  1.00 88.47  ? 222 GLN A CA    1 
ATOM   1820 C  C     . GLN A 1 222 ? 73.160  -21.801 28.537  1.00 88.49  ? 222 GLN A C     1 
ATOM   1821 O  O     . GLN A 1 222 ? 73.509  -22.494 27.578  1.00 88.57  ? 222 GLN A O     1 
ATOM   1822 C  CB    . GLN A 1 222 ? 70.739  -21.864 29.238  1.00 86.72  ? 222 GLN A CB    1 
ATOM   1823 C  CG    . GLN A 1 222 ? 69.690  -22.331 30.240  1.00 86.71  ? 222 GLN A CG    1 
ATOM   1824 C  CD    . GLN A 1 222 ? 68.266  -22.133 29.769  1.00 85.08  ? 222 GLN A CD    1 
ATOM   1825 O  OE1   . GLN A 1 222 ? 67.831  -21.003 29.526  1.00 84.05  ? 222 GLN A OE1   1 
ATOM   1826 N  NE2   . GLN A 1 222 ? 67.522  -23.232 29.651  1.00 84.90  ? 222 GLN A NE2   1 
ATOM   1827 N  N     . LEU A 1 223 ? 73.609  -20.560 28.741  1.00 88.50  ? 223 LEU A N     1 
ATOM   1828 C  CA    . LEU A 1 223 ? 74.638  -19.956 27.881  1.00 88.74  ? 223 LEU A CA    1 
ATOM   1829 C  C     . LEU A 1 223 ? 75.966  -20.712 27.896  1.00 90.43  ? 223 LEU A C     1 
ATOM   1830 O  O     . LEU A 1 223 ? 76.656  -20.764 26.874  1.00 90.61  ? 223 LEU A O     1 
ATOM   1831 C  CB    . LEU A 1 223 ? 74.888  -18.488 28.254  1.00 88.65  ? 223 LEU A CB    1 
ATOM   1832 C  CG    . LEU A 1 223 ? 73.796  -17.479 27.898  1.00 87.02  ? 223 LEU A CG    1 
ATOM   1833 C  CD1   . LEU A 1 223 ? 74.149  -16.114 28.472  1.00 87.29  ? 223 LEU A CD1   1 
ATOM   1834 C  CD2   . LEU A 1 223 ? 73.587  -17.385 26.393  1.00 85.93  ? 223 LEU A CD2   1 
ATOM   1835 N  N     . ILE A 1 224 ? 76.333  -21.276 29.049  1.00 91.77  ? 224 ILE A N     1 
ATOM   1836 C  CA    . ILE A 1 224 ? 77.554  -22.083 29.143  1.00 93.53  ? 224 ILE A CA    1 
ATOM   1837 C  C     . ILE A 1 224 ? 77.352  -23.349 28.314  1.00 93.46  ? 224 ILE A C     1 
ATOM   1838 O  O     . ILE A 1 224 ? 78.125  -23.608 27.384  1.00 93.92  ? 224 ILE A O     1 
ATOM   1839 C  CB    . ILE A 1 224 ? 77.926  -22.446 30.596  1.00 95.04  ? 224 ILE A CB    1 
ATOM   1840 C  CG1   . ILE A 1 224 ? 78.219  -21.173 31.407  1.00 95.25  ? 224 ILE A CG1   1 
ATOM   1841 C  CG2   . ILE A 1 224 ? 79.142  -23.381 30.627  1.00 96.91  ? 224 ILE A CG2   1 
ATOM   1842 C  CD1   . ILE A 1 224 ? 78.035  -21.348 32.902  1.00 96.18  ? 224 ILE A CD1   1 
ATOM   1843 N  N     . ASN A 1 225 ? 76.288  -24.096 28.624  1.00 92.91  ? 225 ASN A N     1 
ATOM   1844 C  CA    . ASN A 1 225 ? 75.966  -25.334 27.894  1.00 92.84  ? 225 ASN A CA    1 
ATOM   1845 C  C     . ASN A 1 225 ? 75.736  -25.095 26.407  1.00 91.58  ? 225 ASN A C     1 
ATOM   1846 O  O     . ASN A 1 225 ? 75.935  -26.000 25.594  1.00 91.89  ? 225 ASN A O     1 
ATOM   1847 C  CB    . ASN A 1 225 ? 74.741  -26.023 28.487  1.00 92.34  ? 225 ASN A CB    1 
ATOM   1848 C  CG    . ASN A 1 225 ? 74.944  -26.421 29.926  1.00 93.76  ? 225 ASN A CG    1 
ATOM   1849 O  OD1   . ASN A 1 225 ? 75.986  -26.971 30.291  1.00 95.46  ? 225 ASN A OD1   1 
ATOM   1850 N  ND2   . ASN A 1 225 ? 73.950  -26.142 30.759  1.00 93.15  ? 225 ASN A ND2   1 
ATOM   1851 N  N     . LEU A 1 226 ? 75.290  -23.883 26.074  1.00 90.24  ? 226 LEU A N     1 
ATOM   1852 C  CA    . LEU A 1 226 ? 75.232  -23.422 24.697  1.00 89.20  ? 226 LEU A CA    1 
ATOM   1853 C  C     . LEU A 1 226 ? 76.634  -23.325 24.106  1.00 90.39  ? 226 LEU A C     1 
ATOM   1854 O  O     . LEU A 1 226 ? 76.892  -23.880 23.038  1.00 90.48  ? 226 LEU A O     1 
ATOM   1855 C  CB    . LEU A 1 226 ? 74.521  -22.064 24.601  1.00 87.73  ? 226 LEU A CB    1 
ATOM   1856 C  CG    . LEU A 1 226 ? 74.376  -21.436 23.207  1.00 86.62  ? 226 LEU A CG    1 
ATOM   1857 C  CD1   . LEU A 1 226 ? 73.533  -22.305 22.284  1.00 85.70  ? 226 LEU A CD1   1 
ATOM   1858 C  CD2   . LEU A 1 226 ? 73.781  -20.043 23.302  1.00 85.47  ? 226 LEU A CD2   1 
ATOM   1859 N  N     . ASN A 1 227 ? 77.533  -22.616 24.784  1.00 91.37  ? 227 ASN A N     1 
ATOM   1860 C  CA    . ASN A 1 227 ? 78.906  -22.497 24.288  1.00 92.65  ? 227 ASN A CA    1 
ATOM   1861 C  C     . ASN A 1 227 ? 79.596  -23.862 24.189  1.00 94.15  ? 227 ASN A C     1 
ATOM   1862 O  O     . ASN A 1 227 ? 80.287  -24.136 23.195  1.00 94.70  ? 227 ASN A O     1 
ATOM   1863 C  CB    . ASN A 1 227 ? 79.746  -21.535 25.142  1.00 93.57  ? 227 ASN A CB    1 
ATOM   1864 C  CG    . ASN A 1 227 ? 81.077  -21.173 24.483  1.00 94.69  ? 227 ASN A CG    1 
ATOM   1865 O  OD1   . ASN A 1 227 ? 81.197  -21.163 23.257  1.00 94.32  ? 227 ASN A OD1   1 
ATOM   1866 N  ND2   . ASN A 1 227 ? 82.075  -20.866 25.295  1.00 96.14  ? 227 ASN A ND2   1 
ATOM   1867 N  N     . ARG A 1 228 ? 79.403  -24.705 25.213  1.00 94.88  ? 228 ARG A N     1 
ATOM   1868 C  CA    . ARG A 1 228 ? 79.890  -26.093 25.171  1.00 96.29  ? 228 ARG A CA    1 
ATOM   1869 C  C     . ARG A 1 228 ? 79.495  -26.750 23.871  1.00 95.61  ? 228 ARG A C     1 
ATOM   1870 O  O     . ARG A 1 228 ? 80.342  -27.267 23.164  1.00 96.68  ? 228 ARG A O     1 
ATOM   1871 C  CB    . ARG A 1 228 ? 79.363  -26.956 26.299  1.00 96.80  ? 228 ARG A CB    1 
ATOM   1872 C  CG    . ARG A 1 228 ? 80.049  -28.330 26.427  1.00 98.65  ? 228 ARG A CG    1 
ATOM   1873 C  CD    . ARG A 1 228 ? 81.571  -28.332 26.343  1.00 100.48 ? 228 ARG A CD    1 
ATOM   1874 N  NE    . ARG A 1 228 ? 82.065  -28.305 24.960  1.00 100.40 ? 228 ARG A NE    1 
ATOM   1875 C  CZ    . ARG A 1 228 ? 83.288  -27.911 24.569  1.00 101.53 ? 228 ARG A CZ    1 
ATOM   1876 N  NH1   . ARG A 1 228 ? 83.611  -27.937 23.275  1.00 101.41 ? 228 ARG A NH1   1 
ATOM   1877 N  NH2   . ARG A 1 228 ? 84.209  -27.496 25.448  1.00 102.85 ? 228 ARG A NH2   1 
ATOM   1878 N  N     . ALA A 1 229 ? 78.197  -26.719 23.583  1.00 93.90  ? 229 ALA A N     1 
ATOM   1879 C  CA    . ALA A 1 229 ? 77.656  -27.293 22.366  1.00 93.09  ? 229 ALA A CA    1 
ATOM   1880 C  C     . ALA A 1 229 ? 78.231  -26.616 21.124  1.00 92.83  ? 229 ALA A C     1 
ATOM   1881 O  O     . ALA A 1 229 ? 78.652  -27.305 20.197  1.00 93.43  ? 229 ALA A O     1 
ATOM   1882 C  CB    . ALA A 1 229 ? 76.138  -27.200 22.372  1.00 91.27  ? 229 ALA A CB    1 
ATOM   1883 N  N     . LEU A 1 230 ? 78.252  -25.280 21.114  1.00 92.04  ? 230 LEU A N     1 
ATOM   1884 C  CA    . LEU A 1 230 ? 78.724  -24.494 19.947  1.00 91.75  ? 230 LEU A CA    1 
ATOM   1885 C  C     . LEU A 1 230 ? 80.192  -24.764 19.587  1.00 93.60  ? 230 LEU A C     1 
ATOM   1886 O  O     . LEU A 1 230 ? 80.539  -24.859 18.396  1.00 93.74  ? 230 LEU A O     1 
ATOM   1887 C  CB    . LEU A 1 230 ? 78.503  -22.981 20.170  1.00 90.76  ? 230 LEU A CB    1 
ATOM   1888 C  CG    . LEU A 1 230 ? 79.035  -21.946 19.144  1.00 90.58  ? 230 LEU A CG    1 
ATOM   1889 C  CD1   . LEU A 1 230 ? 78.642  -22.236 17.695  1.00 89.83  ? 230 LEU A CD1   1 
ATOM   1890 C  CD2   . LEU A 1 230 ? 78.588  -20.539 19.534  1.00 89.55  ? 230 LEU A CD2   1 
ATOM   1891 N  N     . GLN A 1 231 ? 81.036  -24.878 20.610  1.00 95.07  ? 231 GLN A N     1 
ATOM   1892 C  CA    . GLN A 1 231 ? 82.460  -25.166 20.410  1.00 97.02  ? 231 GLN A CA    1 
ATOM   1893 C  C     . GLN A 1 231 ? 82.736  -26.564 19.802  1.00 98.06  ? 231 GLN A C     1 
ATOM   1894 O  O     . GLN A 1 231 ? 83.676  -26.710 19.011  1.00 99.20  ? 231 GLN A O     1 
ATOM   1895 C  CB    . GLN A 1 231 ? 83.231  -24.968 21.728  1.00 98.37  ? 231 GLN A CB    1 
ATOM   1896 C  CG    . GLN A 1 231 ? 83.274  -23.510 22.184  1.00 97.75  ? 231 GLN A CG    1 
ATOM   1897 C  CD    . GLN A 1 231 ? 84.315  -22.654 21.470  1.00 98.44  ? 231 GLN A CD    1 
ATOM   1898 O  OE1   . GLN A 1 231 ? 84.124  -21.449 21.378  1.00 97.55  ? 231 GLN A OE1   1 
ATOM   1899 N  NE2   . GLN A 1 231 ? 85.401  -23.258 20.951  1.00 100.08 ? 231 GLN A NE2   1 
ATOM   1900 N  N     . ARG A 1 232 ? 81.918  -27.562 20.166  1.00 97.75  ? 232 ARG A N     1 
ATOM   1901 C  CA    . ARG A 1 232 ? 82.050  -28.963 19.649  1.00 98.73  ? 232 ARG A CA    1 
ATOM   1902 C  C     . ARG A 1 232 ? 81.228  -29.244 18.356  1.00 97.44  ? 232 ARG A C     1 
ATOM   1903 O  O     . ARG A 1 232 ? 81.536  -30.143 17.549  1.00 98.28  ? 232 ARG A O     1 
ATOM   1904 C  CB    . ARG A 1 232 ? 81.713  -30.002 20.750  1.00 99.43  ? 232 ARG A CB    1 
ATOM   1905 C  CG    . ARG A 1 232 ? 80.281  -29.995 21.257  1.00 97.75  ? 232 ARG A CG    1 
ATOM   1906 C  CD    . ARG A 1 232 ? 80.070  -30.923 22.444  1.00 98.69  ? 232 ARG A CD    1 
ATOM   1907 N  NE    . ARG A 1 232 ? 78.677  -30.841 22.876  1.00 97.09  ? 232 ARG A NE    1 
ATOM   1908 C  CZ    . ARG A 1 232 ? 77.647  -31.388 22.229  1.00 95.97  ? 232 ARG A CZ    1 
ATOM   1909 N  NH1   . ARG A 1 232 ? 77.817  -32.096 21.107  1.00 96.26  ? 232 ARG A NH1   1 
ATOM   1910 N  NH2   . ARG A 1 232 ? 76.421  -31.225 22.710  1.00 94.62  ? 232 ARG A NH2   1 
ATOM   1911 N  N     . LYS A 1 233 ? 80.164  -28.471 18.191  1.00 95.45  ? 233 LYS A N     1 
ATOM   1912 C  CA    . LYS A 1 233 ? 79.350  -28.501 16.961  1.00 94.08  ? 233 LYS A CA    1 
ATOM   1913 C  C     . LYS A 1 233 ? 79.869  -27.581 15.838  1.00 93.87  ? 233 LYS A C     1 
ATOM   1914 O  O     . LYS A 1 233 ? 79.582  -27.846 14.671  1.00 93.42  ? 233 LYS A O     1 
ATOM   1915 C  CB    . LYS A 1 233 ? 77.867  -28.224 17.258  1.00 92.11  ? 233 LYS A CB    1 
ATOM   1916 C  CG    . LYS A 1 233 ? 77.217  -29.275 18.180  1.00 92.30  ? 233 LYS A CG    1 
ATOM   1917 C  CD    . LYS A 1 233 ? 75.872  -28.803 18.722  1.00 90.55  ? 233 LYS A CD    1 
ATOM   1918 C  CE    . LYS A 1 233 ? 75.329  -29.763 19.781  1.00 90.98  ? 233 LYS A CE    1 
ATOM   1919 N  NZ    . LYS A 1 233 ? 74.839  -31.051 19.211  1.00 91.14  ? 233 LYS A NZ    1 
ATOM   1920 N  N     . ARG A 1 234 ? 80.597  -26.505 16.176  1.00 94.23  ? 234 ARG A N     1 
ATOM   1921 C  CA    . ARG A 1 234 ? 81.204  -25.603 15.180  1.00 94.29  ? 234 ARG A CA    1 
ATOM   1922 C  C     . ARG A 1 234 ? 82.646  -25.235 15.593  1.00 96.11  ? 234 ARG A C     1 
ATOM   1923 O  O     . ARG A 1 234 ? 83.427  -24.687 14.810  1.00 96.75  ? 234 ARG A O     1 
ATOM   1924 C  CB    . ARG A 1 234 ? 80.343  -24.316 15.040  1.00 92.42  ? 234 ARG A CB    1 
ATOM   1925 C  CG    . ARG A 1 234 ? 78.793  -24.465 15.057  1.00 90.51  ? 234 ARG A CG    1 
ATOM   1926 C  CD    . ARG A 1 234 ? 78.173  -24.467 13.676  1.00 89.48  ? 234 ARG A CD    1 
ATOM   1927 N  NE    . ARG A 1 234 ? 76.699  -24.417 13.703  1.00 87.63  ? 234 ARG A NE    1 
ATOM   1928 C  CZ    . ARG A 1 234 ? 75.885  -25.428 14.035  1.00 87.23  ? 234 ARG A CZ    1 
ATOM   1929 N  NH1   . ARG A 1 234 ? 76.368  -26.620 14.399  1.00 88.56  ? 234 ARG A NH1   1 
ATOM   1930 N  NH2   . ARG A 1 234 ? 74.560  -25.253 14.012  1.00 85.57  ? 234 ARG A NH2   1 
ATOM   1931 N  N     . ARG A 1 243 ? 83.691  -15.204 14.050  1.00 93.32  ? 243 ARG A N     1 
ATOM   1932 C  CA    . ARG A 1 243 ? 83.246  -14.815 15.405  1.00 92.76  ? 243 ARG A CA    1 
ATOM   1933 C  C     . ARG A 1 243 ? 81.725  -15.063 15.599  1.00 90.85  ? 243 ARG A C     1 
ATOM   1934 O  O     . ARG A 1 243 ? 81.053  -15.473 14.651  1.00 89.95  ? 243 ARG A O     1 
ATOM   1935 C  CB    . ARG A 1 243 ? 83.638  -13.349 15.654  1.00 93.03  ? 243 ARG A CB    1 
ATOM   1936 C  CG    . ARG A 1 243 ? 83.495  -12.848 17.089  1.00 92.95  ? 243 ARG A CG    1 
ATOM   1937 C  CD    . ARG A 1 243 ? 84.422  -11.674 17.392  1.00 94.05  ? 243 ARG A CD    1 
ATOM   1938 N  NE    . ARG A 1 243 ? 84.040  -10.945 18.608  1.00 93.67  ? 243 ARG A NE    1 
ATOM   1939 C  CZ    . ARG A 1 243 ? 83.025  -10.076 18.700  1.00 92.31  ? 243 ARG A CZ    1 
ATOM   1940 N  NH1   . ARG A 1 243 ? 82.245  -9.789  17.650  1.00 91.12  ? 243 ARG A NH1   1 
ATOM   1941 N  NH2   . ARG A 1 243 ? 82.782  -9.482  19.869  1.00 92.22  ? 243 ARG A NH2   1 
ATOM   1942 N  N     . VAL A 1 244 ? 81.201  -14.863 16.818  1.00 90.33  ? 244 VAL A N     1 
ATOM   1943 C  CA    . VAL A 1 244 ? 79.759  -15.013 17.117  1.00 88.63  ? 244 VAL A CA    1 
ATOM   1944 C  C     . VAL A 1 244 ? 79.051  -13.666 17.340  1.00 87.56  ? 244 VAL A C     1 
ATOM   1945 O  O     . VAL A 1 244 ? 79.609  -12.741 17.940  1.00 88.22  ? 244 VAL A O     1 
ATOM   1946 C  CB    . VAL A 1 244 ? 79.543  -15.972 18.326  1.00 88.86  ? 244 VAL A CB    1 
ATOM   1947 C  CG1   . VAL A 1 244 ? 78.154  -15.843 18.955  1.00 87.34  ? 244 VAL A CG1   1 
ATOM   1948 C  CG2   . VAL A 1 244 ? 79.784  -17.411 17.886  1.00 89.44  ? 244 VAL A CG2   1 
ATOM   1949 N  N     . ILE A 1 245 ? 77.808  -13.600 16.850  1.00 85.99  ? 245 ILE A N     1 
ATOM   1950 C  CA    . ILE A 1 245 ? 76.921  -12.434 16.964  1.00 84.84  ? 245 ILE A CA    1 
ATOM   1951 C  C     . ILE A 1 245 ? 75.569  -12.886 17.504  1.00 83.51  ? 245 ILE A C     1 
ATOM   1952 O  O     . ILE A 1 245 ? 74.826  -13.590 16.827  1.00 82.63  ? 245 ILE A O     1 
ATOM   1953 C  CB    . ILE A 1 245 ? 76.700  -11.765 15.600  1.00 84.27  ? 245 ILE A CB    1 
ATOM   1954 C  CG1   . ILE A 1 245 ? 78.021  -11.198 15.105  1.00 85.68  ? 245 ILE A CG1   1 
ATOM   1955 C  CG2   . ILE A 1 245 ? 75.664  -10.655 15.702  1.00 83.07  ? 245 ILE A CG2   1 
ATOM   1956 C  CD1   . ILE A 1 245 ? 77.980  -10.640 13.706  1.00 85.43  ? 245 ILE A CD1   1 
ATOM   1957 N  N     . PHE A 1 246 ? 75.252  -12.459 18.718  1.00 83.44  ? 246 PHE A N     1 
ATOM   1958 C  CA    . PHE A 1 246 ? 74.090  -12.954 19.439  1.00 82.49  ? 246 PHE A CA    1 
ATOM   1959 C  C     . PHE A 1 246 ? 72.914  -11.996 19.279  1.00 81.14  ? 246 PHE A C     1 
ATOM   1960 O  O     . PHE A 1 246 ? 73.089  -10.779 19.308  1.00 81.25  ? 246 PHE A O     1 
ATOM   1961 C  CB    . PHE A 1 246 ? 74.454  -13.155 20.923  1.00 83.38  ? 246 PHE A CB    1 
ATOM   1962 C  CG    . PHE A 1 246 ? 73.696  -14.268 21.597  1.00 83.04  ? 246 PHE A CG    1 
ATOM   1963 C  CD1   . PHE A 1 246 ? 73.795  -15.580 21.142  1.00 83.22  ? 246 PHE A CD1   1 
ATOM   1964 C  CD2   . PHE A 1 246 ? 72.903  -14.013 22.702  1.00 82.66  ? 246 PHE A CD2   1 
ATOM   1965 C  CE1   . PHE A 1 246 ? 73.093  -16.604 21.765  1.00 83.00  ? 246 PHE A CE1   1 
ATOM   1966 C  CE2   . PHE A 1 246 ? 72.194  -15.028 23.330  1.00 82.44  ? 246 PHE A CE2   1 
ATOM   1967 C  CZ    . PHE A 1 246 ? 72.291  -16.327 22.863  1.00 82.61  ? 246 PHE A CZ    1 
ATOM   1968 N  N     . LEU A 1 247 ? 71.723  -12.563 19.094  1.00 79.96  ? 247 LEU A N     1 
ATOM   1969 C  CA    . LEU A 1 247 ? 70.468  -11.805 19.068  1.00 78.70  ? 247 LEU A CA    1 
ATOM   1970 C  C     . LEU A 1 247 ? 69.404  -12.541 19.883  1.00 78.06  ? 247 LEU A C     1 
ATOM   1971 O  O     . LEU A 1 247 ? 69.185  -13.733 19.686  1.00 77.92  ? 247 LEU A O     1 
ATOM   1972 C  CB    . LEU A 1 247 ? 70.003  -11.589 17.624  1.00 77.80  ? 247 LEU A CB    1 
ATOM   1973 C  CG    . LEU A 1 247 ? 68.530  -11.291 17.335  1.00 76.36  ? 247 LEU A CG    1 
ATOM   1974 C  CD1   . LEU A 1 247 ? 68.169  -9.904  17.825  1.00 76.19  ? 247 LEU A CD1   1 
ATOM   1975 C  CD2   . LEU A 1 247 ? 68.247  -11.392 15.854  1.00 75.70  ? 247 LEU A CD2   1 
ATOM   1976 N  N     . HIS A 1 248 ? 68.765  -11.823 20.805  1.00 77.80  ? 248 HIS A N     1 
ATOM   1977 C  CA    . HIS A 1 248 ? 67.738  -12.403 21.659  1.00 77.32  ? 248 HIS A CA    1 
ATOM   1978 C  C     . HIS A 1 248 ? 66.892  -11.304 22.273  1.00 76.84  ? 248 HIS A C     1 
ATOM   1979 O  O     . HIS A 1 248 ? 67.327  -10.162 22.407  1.00 77.22  ? 248 HIS A O     1 
ATOM   1980 C  CB    . HIS A 1 248 ? 68.361  -13.294 22.738  1.00 78.42  ? 248 HIS A CB    1 
ATOM   1981 C  CG    . HIS A 1 248 ? 69.379  -12.598 23.579  1.00 79.62  ? 248 HIS A CG    1 
ATOM   1982 N  ND1   . HIS A 1 248 ? 69.215  -12.396 24.929  1.00 80.13  ? 248 HIS A ND1   1 
ATOM   1983 C  CD2   . HIS A 1 248 ? 70.571  -12.045 23.258  1.00 80.46  ? 248 HIS A CD2   1 
ATOM   1984 C  CE1   . HIS A 1 248 ? 70.267  -11.755 25.408  1.00 81.22  ? 248 HIS A CE1   1 
ATOM   1985 N  NE2   . HIS A 1 248 ? 71.107  -11.533 24.414  1.00 81.44  ? 248 HIS A NE2   1 
ATOM   1986 N  N     . ASP A 1 249 ? 65.669  -11.658 22.638  1.00 76.06  ? 249 ASP A N     1 
ATOM   1987 C  CA    . ASP A 1 249 ? 64.683  -10.654 23.020  1.00 75.48  ? 249 ASP A CA    1 
ATOM   1988 C  C     . ASP A 1 249 ? 65.065  -9.985  24.354  1.00 76.45  ? 249 ASP A C     1 
ATOM   1989 O  O     . ASP A 1 249 ? 65.750  -10.589 25.182  1.00 77.40  ? 249 ASP A O     1 
ATOM   1990 C  CB    . ASP A 1 249 ? 63.241  -11.231 22.952  1.00 74.43  ? 249 ASP A CB    1 
ATOM   1991 C  CG    . ASP A 1 249 ? 62.965  -12.363 23.959  1.00 74.82  ? 249 ASP A CG    1 
ATOM   1992 O  OD1   . ASP A 1 249 ? 63.882  -12.723 24.723  1.00 75.91  ? 249 ASP A OD1   1 
ATOM   1993 O  OD2   . ASP A 1 249 ? 61.827  -12.912 23.984  1.00 74.11  ? 249 ASP A OD2   1 
ATOM   1994 N  N     . ASN A 1 250 ? 64.655  -8.733  24.547  1.00 76.29  ? 250 ASN A N     1 
ATOM   1995 C  CA    . ASN A 1 250 ? 65.051  -7.951  25.733  1.00 77.26  ? 250 ASN A CA    1 
ATOM   1996 C  C     . ASN A 1 250 ? 64.322  -8.355  27.017  1.00 77.49  ? 250 ASN A C     1 
ATOM   1997 O  O     . ASN A 1 250 ? 63.760  -7.504  27.698  1.00 77.60  ? 250 ASN A O     1 
ATOM   1998 C  CB    . ASN A 1 250 ? 64.808  -6.450  25.499  1.00 77.11  ? 250 ASN A CB    1 
ATOM   1999 C  CG    . ASN A 1 250 ? 65.599  -5.889  24.341  1.00 77.13  ? 250 ASN A CG    1 
ATOM   2000 O  OD1   . ASN A 1 250 ? 66.495  -6.535  23.807  1.00 77.44  ? 250 ASN A OD1   1 
ATOM   2001 N  ND2   . ASN A 1 250 ? 65.282  -4.660  23.963  1.00 76.92  ? 250 ASN A ND2   1 
ATOM   2002 N  N     . ALA A 1 251 ? 64.357  -9.637  27.367  1.00 77.69  ? 251 ALA A N     1 
ATOM   2003 C  CA    . ALA A 1 251 ? 63.708  -10.111 28.584  1.00 78.05  ? 251 ALA A CA    1 
ATOM   2004 C  C     . ALA A 1 251 ? 64.544  -9.662  29.809  1.00 79.43  ? 251 ALA A C     1 
ATOM   2005 O  O     . ALA A 1 251 ? 65.727  -9.326  29.658  1.00 80.12  ? 251 ALA A O     1 
ATOM   2006 C  CB    . ALA A 1 251 ? 63.560  -11.623 28.543  1.00 77.99  ? 251 ALA A CB    1 
ATOM   2007 N  N     . PRO A 1 252 ? 63.950  -9.635  31.019  1.00 79.92  ? 252 PRO A N     1 
ATOM   2008 C  CA    . PRO A 1 252 ? 64.747  -9.189  32.159  1.00 81.28  ? 252 PRO A CA    1 
ATOM   2009 C  C     . PRO A 1 252 ? 65.905  -10.117 32.540  1.00 82.35  ? 252 PRO A C     1 
ATOM   2010 O  O     . PRO A 1 252 ? 66.904  -9.626  33.060  1.00 83.41  ? 252 PRO A O     1 
ATOM   2011 C  CB    . PRO A 1 252 ? 63.722  -9.100  33.284  1.00 81.52  ? 252 PRO A CB    1 
ATOM   2012 C  CG    . PRO A 1 252 ? 62.423  -8.923  32.607  1.00 80.22  ? 252 PRO A CG    1 
ATOM   2013 C  CD    . PRO A 1 252 ? 62.536  -9.778  31.389  1.00 79.33  ? 252 PRO A CD    1 
ATOM   2014 N  N     . SER A 1 253 ? 65.771  -11.422 32.277  1.00 82.14  ? 253 SER A N     1 
ATOM   2015 C  CA    . SER A 1 253 ? 66.879  -12.395 32.444  1.00 83.15  ? 253 SER A CA    1 
ATOM   2016 C  C     . SER A 1 253 ? 67.981  -12.194 31.408  1.00 83.16  ? 253 SER A C     1 
ATOM   2017 O  O     . SER A 1 253 ? 69.126  -12.582 31.607  1.00 84.23  ? 253 SER A O     1 
ATOM   2018 C  CB    . SER A 1 253 ? 66.376  -13.836 32.306  1.00 82.90  ? 253 SER A CB    1 
ATOM   2019 O  OG    . SER A 1 253 ? 65.073  -13.982 32.827  1.00 82.44  ? 253 SER A OG    1 
ATOM   2020 N  N     . HIS A 1 254 ? 67.593  -11.631 30.275  1.00 82.00  ? 254 HIS A N     1 
ATOM   2021 C  CA    . HIS A 1 254 ? 68.482  -11.351 29.168  1.00 81.91  ? 254 HIS A CA    1 
ATOM   2022 C  C     . HIS A 1 254 ? 69.157  -9.990  29.383  1.00 82.50  ? 254 HIS A C     1 
ATOM   2023 O  O     . HIS A 1 254 ? 70.325  -9.840  29.073  1.00 83.24  ? 254 HIS A O     1 
ATOM   2024 C  CB    . HIS A 1 254 ? 67.682  -11.387 27.842  1.00 80.46  ? 254 HIS A CB    1 
ATOM   2025 C  CG    . HIS A 1 254 ? 66.983  -12.699 27.566  1.00 79.87  ? 254 HIS A CG    1 
ATOM   2026 N  ND1   . HIS A 1 254 ? 66.138  -12.887 26.490  1.00 78.60  ? 254 HIS A ND1   1 
ATOM   2027 C  CD2   . HIS A 1 254 ? 66.988  -13.873 28.244  1.00 80.47  ? 254 HIS A CD2   1 
ATOM   2028 C  CE1   . HIS A 1 254 ? 65.678  -14.125 26.505  1.00 78.43  ? 254 HIS A CE1   1 
ATOM   2029 N  NE2   . HIS A 1 254 ? 66.172  -14.741 27.562  1.00 79.56  ? 254 HIS A NE2   1 
ATOM   2030 N  N     . THR A 1 255 ? 68.414  -9.014  29.911  1.00 82.24  ? 255 THR A N     1 
ATOM   2031 C  CA    . THR A 1 255 ? 68.942  -7.681  30.272  1.00 82.90  ? 255 THR A CA    1 
ATOM   2032 C  C     . THR A 1 255 ? 69.788  -7.662  31.562  1.00 84.42  ? 255 THR A C     1 
ATOM   2033 O  O     . THR A 1 255 ? 70.509  -6.691  31.826  1.00 85.21  ? 255 THR A O     1 
ATOM   2034 C  CB    . THR A 1 255 ? 67.786  -6.680  30.473  1.00 82.23  ? 255 THR A CB    1 
ATOM   2035 O  OG1   . THR A 1 255 ? 66.893  -6.758  29.360  1.00 80.85  ? 255 THR A OG1   1 
ATOM   2036 C  CG2   . THR A 1 255 ? 68.286  -5.234  30.613  1.00 82.83  ? 255 THR A CG2   1 
ATOM   2037 N  N     . ALA A 1 256 ? 69.688  -8.720  32.367  1.00 84.91  ? 256 ALA A N     1 
ATOM   2038 C  CA    . ALA A 1 256 ? 70.480  -8.852  33.582  1.00 86.42  ? 256 ALA A CA    1 
ATOM   2039 C  C     . ALA A 1 256 ? 71.951  -8.488  33.341  1.00 87.41  ? 256 ALA A C     1 
ATOM   2040 O  O     . ALA A 1 256 ? 72.577  -8.973  32.394  1.00 87.28  ? 256 ALA A O     1 
ATOM   2041 C  CB    . ALA A 1 256 ? 70.370  -10.270 34.137  1.00 86.83  ? 256 ALA A CB    1 
ATOM   2042 N  N     . ARG A 1 257 ? 72.467  -7.599  34.187  1.00 88.45  ? 257 ARG A N     1 
ATOM   2043 C  CA    . ARG A 1 257 ? 73.894  -7.287  34.272  1.00 89.71  ? 257 ARG A CA    1 
ATOM   2044 C  C     . ARG A 1 257 ? 74.734  -8.553  34.471  1.00 90.62  ? 257 ARG A C     1 
ATOM   2045 O  O     . ARG A 1 257 ? 75.802  -8.694  33.870  1.00 91.15  ? 257 ARG A O     1 
ATOM   2046 C  CB    . ARG A 1 257 ? 74.112  -6.304  35.429  1.00 90.77  ? 257 ARG A CB    1 
ATOM   2047 C  CG    . ARG A 1 257 ? 75.534  -5.880  35.717  1.00 92.23  ? 257 ARG A CG    1 
ATOM   2048 C  CD    . ARG A 1 257 ? 76.271  -5.398  34.480  1.00 92.02  ? 257 ARG A CD    1 
ATOM   2049 N  NE    . ARG A 1 257 ? 77.676  -5.040  34.707  1.00 93.50  ? 257 ARG A NE    1 
ATOM   2050 C  CZ    . ARG A 1 257 ? 78.447  -4.423  33.805  1.00 93.67  ? 257 ARG A CZ    1 
ATOM   2051 N  NH1   . ARG A 1 257 ? 79.710  -4.141  34.110  1.00 95.14  ? 257 ARG A NH1   1 
ATOM   2052 N  NH2   . ARG A 1 257 ? 77.975  -4.082  32.600  1.00 92.46  ? 257 ARG A NH2   1 
ATOM   2053 N  N     . ALA A 1 258 ? 74.242  -9.460  35.318  1.00 90.88  ? 258 ALA A N     1 
ATOM   2054 C  CA    . ALA A 1 258 ? 74.830  -10.791 35.510  1.00 91.68  ? 258 ALA A CA    1 
ATOM   2055 C  C     . ALA A 1 258 ? 75.161  -11.469 34.183  1.00 91.07  ? 258 ALA A C     1 
ATOM   2056 O  O     . ALA A 1 258 ? 76.283  -11.914 33.958  1.00 92.03  ? 258 ALA A O     1 
ATOM   2057 C  CB    . ALA A 1 258 ? 73.881  -11.666 36.318  1.00 91.62  ? 258 ALA A CB    1 
ATOM   2058 N  N     . VAL A 1 259 ? 74.174  -11.510 33.299  1.00 89.54  ? 259 VAL A N     1 
ATOM   2059 C  CA    . VAL A 1 259 ? 74.315  -12.151 31.987  1.00 88.84  ? 259 VAL A CA    1 
ATOM   2060 C  C     . VAL A 1 259 ? 75.159  -11.322 31.002  1.00 88.86  ? 259 VAL A C     1 
ATOM   2061 O  O     . VAL A 1 259 ? 75.944  -11.890 30.242  1.00 89.22  ? 259 VAL A O     1 
ATOM   2062 C  CB    . VAL A 1 259 ? 72.922  -12.498 31.396  1.00 87.24  ? 259 VAL A CB    1 
ATOM   2063 C  CG1   . VAL A 1 259 ? 73.026  -13.017 29.961  1.00 86.47  ? 259 VAL A CG1   1 
ATOM   2064 C  CG2   . VAL A 1 259 ? 72.233  -13.532 32.284  1.00 87.44  ? 259 VAL A CG2   1 
ATOM   2065 N  N     . ARG A 1 260 ? 75.003  -9.997  31.011  1.00 88.58  ? 260 ARG A N     1 
ATOM   2066 C  CA    . ARG A 1 260 ? 75.828  -9.126  30.162  1.00 88.78  ? 260 ARG A CA    1 
ATOM   2067 C  C     . ARG A 1 260 ? 77.333  -9.261  30.427  1.00 90.42  ? 260 ARG A C     1 
ATOM   2068 O  O     . ARG A 1 260 ? 78.130  -9.079  29.504  1.00 90.69  ? 260 ARG A O     1 
ATOM   2069 C  CB    . ARG A 1 260 ? 75.410  -7.664  30.291  1.00 88.42  ? 260 ARG A CB    1 
ATOM   2070 C  CG    . ARG A 1 260 ? 74.089  -7.325  29.616  1.00 86.80  ? 260 ARG A CG    1 
ATOM   2071 C  CD    . ARG A 1 260 ? 73.997  -5.835  29.315  1.00 86.62  ? 260 ARG A CD    1 
ATOM   2072 N  NE    . ARG A 1 260 ? 74.199  -5.033  30.532  1.00 87.59  ? 260 ARG A NE    1 
ATOM   2073 C  CZ    . ARG A 1 260 ? 73.232  -4.484  31.273  1.00 87.26  ? 260 ARG A CZ    1 
ATOM   2074 N  NH1   . ARG A 1 260 ? 71.939  -4.606  30.944  1.00 85.95  ? 260 ARG A NH1   1 
ATOM   2075 N  NH2   . ARG A 1 260 ? 73.556  -3.787  32.363  1.00 88.33  ? 260 ARG A NH2   1 
ATOM   2076 N  N     . ASP A 1 261 ? 77.710  -9.572  31.672  1.00 91.58  ? 261 ASP A N     1 
ATOM   2077 C  CA    . ASP A 1 261 ? 79.088  -9.962  31.991  1.00 93.22  ? 261 ASP A CA    1 
ATOM   2078 C  C     . ASP A 1 261 ? 79.424  -11.281 31.292  1.00 93.31  ? 261 ASP A C     1 
ATOM   2079 O  O     . ASP A 1 261 ? 80.448  -11.383 30.614  1.00 94.03  ? 261 ASP A O     1 
ATOM   2080 C  CB    . ASP A 1 261 ? 79.334  -10.157 33.504  1.00 94.48  ? 261 ASP A CB    1 
ATOM   2081 C  CG    . ASP A 1 261 ? 79.039  -8.923  34.339  1.00 94.62  ? 261 ASP A CG    1 
ATOM   2082 O  OD1   . ASP A 1 261 ? 79.272  -7.809  33.838  1.00 94.45  ? 261 ASP A OD1   1 
ATOM   2083 O  OD2   . ASP A 1 261 ? 78.586  -9.076  35.503  1.00 95.01  ? 261 ASP A OD2   1 
ATOM   2084 N  N     . THR A 1 262 ? 78.566  -12.287 31.474  1.00 92.69  ? 262 THR A N     1 
ATOM   2085 C  CA    . THR A 1 262 ? 78.748  -13.609 30.851  1.00 92.76  ? 262 THR A CA    1 
ATOM   2086 C  C     . THR A 1 262 ? 78.833  -13.529 29.322  1.00 91.93  ? 262 THR A C     1 
ATOM   2087 O  O     . THR A 1 262 ? 79.513  -14.341 28.701  1.00 92.52  ? 262 THR A O     1 
ATOM   2088 C  CB    . THR A 1 262 ? 77.618  -14.587 31.246  1.00 92.07  ? 262 THR A CB    1 
ATOM   2089 O  OG1   . THR A 1 262 ? 77.398  -14.516 32.659  1.00 92.76  ? 262 THR A OG1   1 
ATOM   2090 C  CG2   . THR A 1 262 ? 77.959  -16.032 30.863  1.00 92.58  ? 262 THR A CG2   1 
ATOM   2091 N  N     . LEU A 1 263 ? 78.159  -12.545 28.728  1.00 90.69  ? 263 LEU A N     1 
ATOM   2092 C  CA    . LEU A 1 263 ? 78.228  -12.332 27.283  1.00 89.97  ? 263 LEU A CA    1 
ATOM   2093 C  C     . LEU A 1 263 ? 79.540  -11.698 26.827  1.00 91.07  ? 263 LEU A C     1 
ATOM   2094 O  O     . LEU A 1 263 ? 79.977  -11.952 25.710  1.00 91.09  ? 263 LEU A O     1 
ATOM   2095 C  CB    . LEU A 1 263 ? 77.012  -11.542 26.785  1.00 88.32  ? 263 LEU A CB    1 
ATOM   2096 C  CG    . LEU A 1 263 ? 75.706  -12.363 26.850  1.00 87.13  ? 263 LEU A CG    1 
ATOM   2097 C  CD1   . LEU A 1 263 ? 74.469  -11.477 26.842  1.00 85.80  ? 263 LEU A CD1   1 
ATOM   2098 C  CD2   . LEU A 1 263 ? 75.620  -13.404 25.738  1.00 86.65  ? 263 LEU A CD2   1 
ATOM   2099 N  N     . GLU A 1 264 ? 80.170  -10.886 27.675  1.00 92.07  ? 264 GLU A N     1 
ATOM   2100 C  CA    . GLU A 1 264 ? 81.556  -10.445 27.429  1.00 93.47  ? 264 GLU A CA    1 
ATOM   2101 C  C     . GLU A 1 264 ? 82.561  -11.585 27.624  1.00 94.89  ? 264 GLU A C     1 
ATOM   2102 O  O     . GLU A 1 264 ? 83.406  -11.799 26.760  1.00 95.54  ? 264 GLU A O     1 
ATOM   2103 C  CB    . GLU A 1 264 ? 81.947  -9.280  28.334  1.00 94.24  ? 264 GLU A CB    1 
ATOM   2104 C  CG    . GLU A 1 264 ? 81.228  -7.981  28.026  1.00 93.20  ? 264 GLU A CG    1 
ATOM   2105 C  CD    . GLU A 1 264 ? 81.397  -6.963  29.130  1.00 93.92  ? 264 GLU A CD    1 
ATOM   2106 O  OE1   . GLU A 1 264 ? 80.391  -6.347  29.527  1.00 93.03  ? 264 GLU A OE1   1 
ATOM   2107 O  OE2   . GLU A 1 264 ? 82.534  -6.794  29.621  1.00 95.44  ? 264 GLU A OE2   1 
ATOM   2108 N  N     . THR A 1 265 ? 82.451  -12.311 28.741  1.00 95.44  ? 265 THR A N     1 
ATOM   2109 C  CA    . THR A 1 265 ? 83.332  -13.451 29.065  1.00 96.89  ? 265 THR A CA    1 
ATOM   2110 C  C     . THR A 1 265 ? 83.404  -14.482 27.943  1.00 96.67  ? 265 THR A C     1 
ATOM   2111 O  O     . THR A 1 265 ? 84.489  -14.935 27.583  1.00 97.96  ? 265 THR A O     1 
ATOM   2112 C  CB    . THR A 1 265 ? 82.878  -14.153 30.360  1.00 97.22  ? 265 THR A CB    1 
ATOM   2113 O  OG1   . THR A 1 265 ? 83.023  -13.243 31.451  1.00 97.80  ? 265 THR A OG1   1 
ATOM   2114 C  CG2   . THR A 1 265 ? 83.698  -15.416 30.652  1.00 98.73  ? 265 THR A CG2   1 
ATOM   2115 N  N     . LEU A 1 266 ? 82.248  -14.856 27.406  1.00 95.12  ? 266 LEU A N     1 
ATOM   2116 C  CA    . LEU A 1 266 ? 82.178  -15.688 26.195  1.00 94.70  ? 266 LEU A CA    1 
ATOM   2117 C  C     . LEU A 1 266 ? 82.764  -14.951 24.990  1.00 94.69  ? 266 LEU A C     1 
ATOM   2118 O  O     . LEU A 1 266 ? 83.357  -15.565 24.104  1.00 95.25  ? 266 LEU A O     1 
ATOM   2119 C  CB    . LEU A 1 266 ? 80.726  -16.066 25.893  1.00 92.95  ? 266 LEU A CB    1 
ATOM   2120 C  CG    . LEU A 1 266 ? 80.062  -16.988 26.922  1.00 92.96  ? 266 LEU A CG    1 
ATOM   2121 C  CD1   . LEU A 1 266 ? 78.547  -16.862 26.886  1.00 91.20  ? 266 LEU A CD1   1 
ATOM   2122 C  CD2   . LEU A 1 266 ? 80.495  -18.429 26.695  1.00 93.87  ? 266 LEU A CD2   1 
ATOM   2123 N  N     . ASN A 1 267 ? 82.562  -13.635 24.980  1.00 94.12  ? 267 ASN A N     1 
ATOM   2124 C  CA    . ASN A 1 267 ? 83.029  -12.716 23.943  1.00 94.11  ? 267 ASN A CA    1 
ATOM   2125 C  C     . ASN A 1 267 ? 82.120  -12.788 22.717  1.00 92.58  ? 267 ASN A C     1 
ATOM   2126 O  O     . ASN A 1 267 ? 82.582  -12.823 21.571  1.00 92.79  ? 267 ASN A O     1 
ATOM   2127 C  CB    . ASN A 1 267 ? 84.517  -12.920 23.617  1.00 95.91  ? 267 ASN A CB    1 
ATOM   2128 C  CG    . ASN A 1 267 ? 85.186  -11.646 23.147  1.00 96.39  ? 267 ASN A CG    1 
ATOM   2129 O  OD1   . ASN A 1 267 ? 85.923  -11.007 23.897  1.00 97.49  ? 267 ASN A OD1   1 
ATOM   2130 N  ND2   . ASN A 1 267 ? 84.919  -11.260 21.906  1.00 95.62  ? 267 ASN A ND2   1 
ATOM   2131 N  N     . TRP A 1 268 ? 80.815  -12.797 22.994  1.00 91.11  ? 268 TRP A N     1 
ATOM   2132 C  CA    . TRP A 1 268 ? 79.776  -12.781 21.978  1.00 89.54  ? 268 TRP A CA    1 
ATOM   2133 C  C     . TRP A 1 268 ? 79.179  -11.396 21.931  1.00 88.65  ? 268 TRP A C     1 
ATOM   2134 O  O     . TRP A 1 268 ? 78.769  -10.854 22.958  1.00 88.49  ? 268 TRP A O     1 
ATOM   2135 C  CB    . TRP A 1 268 ? 78.672  -13.780 22.303  1.00 88.55  ? 268 TRP A CB    1 
ATOM   2136 C  CG    . TRP A 1 268 ? 79.124  -15.190 22.345  1.00 89.39  ? 268 TRP A CG    1 
ATOM   2137 C  CD1   . TRP A 1 268 ? 80.323  -15.694 21.907  1.00 90.77  ? 268 TRP A CD1   1 
ATOM   2138 C  CD2   . TRP A 1 268 ? 78.375  -16.305 22.830  1.00 89.01  ? 268 TRP A CD2   1 
ATOM   2139 N  NE1   . TRP A 1 268 ? 80.369  -17.051 22.111  1.00 91.29  ? 268 TRP A NE1   1 
ATOM   2140 C  CE2   . TRP A 1 268 ? 79.185  -17.455 22.672  1.00 90.22  ? 268 TRP A CE2   1 
ATOM   2141 C  CE3   . TRP A 1 268 ? 77.102  -16.445 23.391  1.00 87.85  ? 268 TRP A CE3   1 
ATOM   2142 C  CZ2   . TRP A 1 268 ? 78.759  -18.733 23.055  1.00 90.32  ? 268 TRP A CZ2   1 
ATOM   2143 C  CZ3   . TRP A 1 268 ? 76.676  -17.715 23.769  1.00 87.93  ? 268 TRP A CZ3   1 
ATOM   2144 C  CH2   . TRP A 1 268 ? 77.507  -18.844 23.602  1.00 89.16  ? 268 TRP A CH2   1 
ATOM   2145 N  N     . GLU A 1 269 ? 79.117  -10.836 20.726  1.00 88.14  ? 269 GLU A N     1 
ATOM   2146 C  CA    . GLU A 1 269 ? 78.573  -9.502  20.509  1.00 87.38  ? 269 GLU A CA    1 
ATOM   2147 C  C     . GLU A 1 269 ? 77.062  -9.570  20.494  1.00 85.71  ? 269 GLU A C     1 
ATOM   2148 O  O     . GLU A 1 269 ? 76.502  -10.283 19.676  1.00 84.88  ? 269 GLU A O     1 
ATOM   2149 C  CB    . GLU A 1 269 ? 79.045  -8.960  19.166  1.00 87.55  ? 269 GLU A CB    1 
ATOM   2150 C  CG    . GLU A 1 269 ? 78.709  -7.493  18.942  1.00 87.14  ? 269 GLU A CG    1 
ATOM   2151 C  CD    . GLU A 1 269 ? 78.379  -7.175  17.502  1.00 86.48  ? 269 GLU A CD    1 
ATOM   2152 O  OE1   . GLU A 1 269 ? 78.931  -7.826  16.595  1.00 86.93  ? 269 GLU A OE1   1 
ATOM   2153 O  OE2   . GLU A 1 269 ? 77.571  -6.257  17.288  1.00 85.61  ? 269 GLU A OE2   1 
ATOM   2154 N  N     . VAL A 1 270 ? 76.418  -8.823  21.384  1.00 85.29  ? 270 VAL A N     1 
ATOM   2155 C  CA    . VAL A 1 270 ? 74.964  -8.766  21.427  1.00 83.79  ? 270 VAL A CA    1 
ATOM   2156 C  C     . VAL A 1 270 ? 74.481  -7.807  20.351  1.00 82.98  ? 270 VAL A C     1 
ATOM   2157 O  O     . VAL A 1 270 ? 75.006  -6.701  20.224  1.00 83.54  ? 270 VAL A O     1 
ATOM   2158 C  CB    . VAL A 1 270 ? 74.446  -8.287  22.800  1.00 83.79  ? 270 VAL A CB    1 
ATOM   2159 C  CG1   . VAL A 1 270 ? 72.923  -8.147  22.791  1.00 82.31  ? 270 VAL A CG1   1 
ATOM   2160 C  CG2   . VAL A 1 270 ? 74.891  -9.244  23.904  1.00 84.67  ? 270 VAL A CG2   1 
ATOM   2161 N  N     . LEU A 1 271 ? 73.466  -8.227  19.594  1.00 81.71  ? 271 LEU A N     1 
ATOM   2162 C  CA    . LEU A 1 271 ? 72.864  -7.364  18.584  1.00 80.88  ? 271 LEU A CA    1 
ATOM   2163 C  C     . LEU A 1 271 ? 71.848  -6.463  19.240  1.00 80.18  ? 271 LEU A C     1 
ATOM   2164 O  O     . LEU A 1 271 ? 71.139  -6.909  20.138  1.00 79.76  ? 271 LEU A O     1 
ATOM   2165 C  CB    . LEU A 1 271 ? 72.174  -8.152  17.467  1.00 79.86  ? 271 LEU A CB    1 
ATOM   2166 C  CG    . LEU A 1 271 ? 73.030  -8.538  16.256  1.00 80.41  ? 271 LEU A CG    1 
ATOM   2167 C  CD1   . LEU A 1 271 ? 72.238  -9.442  15.322  1.00 79.39  ? 271 LEU A CD1   1 
ATOM   2168 C  CD2   . LEU A 1 271 ? 73.554  -7.334  15.483  1.00 80.88  ? 271 LEU A CD2   1 
ATOM   2169 N  N     . PRO A 1 272 ? 71.760  -5.202  18.775  1.00 80.14  ? 272 PRO A N     1 
ATOM   2170 C  CA    . PRO A 1 272 ? 70.754  -4.301  19.290  1.00 79.53  ? 272 PRO A CA    1 
ATOM   2171 C  C     . PRO A 1 272 ? 69.393  -4.718  18.776  1.00 78.09  ? 272 PRO A C     1 
ATOM   2172 O  O     . PRO A 1 272 ? 69.248  -5.066  17.602  1.00 77.57  ? 272 PRO A O     1 
ATOM   2173 C  CB    . PRO A 1 272 ? 71.161  -2.950  18.716  1.00 80.03  ? 272 PRO A CB    1 
ATOM   2174 C  CG    . PRO A 1 272 ? 71.817  -3.282  17.435  1.00 80.23  ? 272 PRO A CG    1 
ATOM   2175 C  CD    . PRO A 1 272 ? 72.477  -4.613  17.630  1.00 80.63  ? 272 PRO A CD    1 
ATOM   2176 N  N     . HIS A 1 273 ? 68.417  -4.708  19.668  1.00 77.55  ? 273 HIS A N     1 
ATOM   2177 C  CA    . HIS A 1 273 ? 67.087  -5.196  19.368  1.00 76.27  ? 273 HIS A CA    1 
ATOM   2178 C  C     . HIS A 1 273 ? 66.106  -4.309  20.108  1.00 75.94  ? 273 HIS A C     1 
ATOM   2179 O  O     . HIS A 1 273 ? 66.266  -4.090  21.312  1.00 76.57  ? 273 HIS A O     1 
ATOM   2180 C  CB    . HIS A 1 273 ? 66.970  -6.649  19.829  1.00 76.11  ? 273 HIS A CB    1 
ATOM   2181 C  CG    . HIS A 1 273 ? 65.728  -7.330  19.362  1.00 74.87  ? 273 HIS A CG    1 
ATOM   2182 N  ND1   . HIS A 1 273 ? 65.592  -7.807  18.079  1.00 74.27  ? 273 HIS A ND1   1 
ATOM   2183 C  CD2   . HIS A 1 273 ? 64.571  -7.618  20.001  1.00 74.20  ? 273 HIS A CD2   1 
ATOM   2184 C  CE1   . HIS A 1 273 ? 64.405  -8.366  17.948  1.00 73.25  ? 273 HIS A CE1   1 
ATOM   2185 N  NE2   . HIS A 1 273 ? 63.763  -8.262  19.098  1.00 73.20  ? 273 HIS A NE2   1 
ATOM   2186 N  N     . ALA A 1 274 ? 65.108  -3.791  19.396  1.00 75.05  ? 274 ALA A N     1 
ATOM   2187 C  CA    . ALA A 1 274 ? 64.107  -2.927  20.007  1.00 74.77  ? 274 ALA A CA    1 
ATOM   2188 C  C     . ALA A 1 274 ? 63.061  -3.763  20.741  1.00 74.13  ? 274 ALA A C     1 
ATOM   2189 O  O     . ALA A 1 274 ? 62.860  -4.944  20.444  1.00 73.60  ? 274 ALA A O     1 
ATOM   2190 C  CB    . ALA A 1 274 ? 63.442  -2.049  18.962  1.00 74.19  ? 274 ALA A CB    1 
ATOM   2191 N  N     . ALA A 1 275 ? 62.413  -3.132  21.712  1.00 74.28  ? 275 ALA A N     1 
ATOM   2192 C  CA    . ALA A 1 275 ? 61.383  -3.780  22.501  1.00 73.83  ? 275 ALA A CA    1 
ATOM   2193 C  C     . ALA A 1 275 ? 60.155  -4.037  21.646  1.00 72.63  ? 275 ALA A C     1 
ATOM   2194 O  O     . ALA A 1 275 ? 59.841  -3.246  20.764  1.00 72.26  ? 275 ALA A O     1 
ATOM   2195 C  CB    . ALA A 1 275 ? 61.018  -2.914  23.688  1.00 74.43  ? 275 ALA A CB    1 
ATOM   2196 N  N     . TYR A 1 276 ? 59.487  -5.157  21.912  1.00 72.11  ? 276 TYR A N     1 
ATOM   2197 C  CA    . TYR A 1 276 ? 58.240  -5.559  21.245  1.00 71.01  ? 276 TYR A CA    1 
ATOM   2198 C  C     . TYR A 1 276 ? 58.389  -5.766  19.739  1.00 70.36  ? 276 TYR A C     1 
ATOM   2199 O  O     . TYR A 1 276 ? 57.582  -5.286  18.943  1.00 69.68  ? 276 TYR A O     1 
ATOM   2200 C  CB    . TYR A 1 276 ? 57.110  -4.574  21.546  1.00 70.79  ? 276 TYR A CB    1 
ATOM   2201 C  CG    . TYR A 1 276 ? 56.871  -4.398  23.009  1.00 71.47  ? 276 TYR A CG    1 
ATOM   2202 C  CD1   . TYR A 1 276 ? 56.056  -5.286  23.712  1.00 71.27  ? 276 TYR A CD1   1 
ATOM   2203 C  CD2   . TYR A 1 276 ? 57.473  -3.352  23.703  1.00 72.42  ? 276 TYR A CD2   1 
ATOM   2204 C  CE1   . TYR A 1 276 ? 55.841  -5.128  25.070  1.00 72.01  ? 276 TYR A CE1   1 
ATOM   2205 C  CE2   . TYR A 1 276 ? 57.267  -3.182  25.062  1.00 73.14  ? 276 TYR A CE2   1 
ATOM   2206 C  CZ    . TYR A 1 276 ? 56.452  -4.068  25.739  1.00 72.95  ? 276 TYR A CZ    1 
ATOM   2207 O  OH    . TYR A 1 276 ? 56.258  -3.884  27.080  1.00 73.77  ? 276 TYR A OH    1 
ATOM   2208 N  N     . SER A 1 277 ? 59.433  -6.491  19.362  1.00 70.66  ? 277 SER A N     1 
ATOM   2209 C  CA    . SER A 1 277 ? 59.671  -6.822  17.967  1.00 70.20  ? 277 SER A CA    1 
ATOM   2210 C  C     . SER A 1 277 ? 59.913  -8.326  17.854  1.00 70.09  ? 277 SER A C     1 
ATOM   2211 O  O     . SER A 1 277 ? 61.032  -8.761  17.596  1.00 70.67  ? 277 SER A O     1 
ATOM   2212 C  CB    . SER A 1 277 ? 60.843  -5.998  17.406  1.00 70.90  ? 277 SER A CB    1 
ATOM   2213 O  OG    . SER A 1 277 ? 60.918  -4.734  18.043  1.00 71.44  ? 277 SER A OG    1 
ATOM   2214 N  N     . PRO A 1 278 ? 58.858  -9.131  18.067  1.00 69.42  ? 278 PRO A N     1 
ATOM   2215 C  CA    . PRO A 1 278 ? 58.944  -10.542 17.719  1.00 69.23  ? 278 PRO A CA    1 
ATOM   2216 C  C     . PRO A 1 278 ? 58.872  -10.744 16.219  1.00 68.62  ? 278 PRO A C     1 
ATOM   2217 O  O     . PRO A 1 278 ? 59.262  -11.795 15.734  1.00 68.67  ? 278 PRO A O     1 
ATOM   2218 C  CB    . PRO A 1 278 ? 57.715  -11.140 18.385  1.00 68.74  ? 278 PRO A CB    1 
ATOM   2219 C  CG    . PRO A 1 278 ? 56.734  -10.032 18.395  1.00 68.24  ? 278 PRO A CG    1 
ATOM   2220 C  CD    . PRO A 1 278 ? 57.531  -8.781  18.602  1.00 68.90  ? 278 PRO A CD    1 
ATOM   2221 N  N     . ASP A 1 279 ? 58.358  -9.744  15.503  1.00 68.12  ? 279 ASP A N     1 
ATOM   2222 C  CA    . ASP A 1 279 ? 58.368  -9.726  14.046  1.00 67.68  ? 279 ASP A CA    1 
ATOM   2223 C  C     . ASP A 1 279 ? 59.762  -9.561  13.447  1.00 68.46  ? 279 ASP A C     1 
ATOM   2224 O  O     . ASP A 1 279 ? 59.939  -9.848  12.267  1.00 68.28  ? 279 ASP A O     1 
ATOM   2225 C  CB    . ASP A 1 279 ? 57.425  -8.643  13.497  1.00 67.07  ? 279 ASP A CB    1 
ATOM   2226 C  CG    . ASP A 1 279 ? 57.899  -7.225  13.786  1.00 67.68  ? 279 ASP A CG    1 
ATOM   2227 O  OD1   . ASP A 1 279 ? 58.612  -6.996  14.787  1.00 68.44  ? 279 ASP A OD1   1 
ATOM   2228 O  OD2   . ASP A 1 279 ? 57.527  -6.328  13.000  1.00 67.44  ? 279 ASP A OD2   1 
ATOM   2229 N  N     . LEU A 1 280 ? 60.724  -9.070  14.234  1.00 69.38  ? 280 LEU A N     1 
ATOM   2230 C  CA    . LEU A 1 280 ? 62.143  -9.039  13.839  1.00 70.30  ? 280 LEU A CA    1 
ATOM   2231 C  C     . LEU A 1 280 ? 63.005  -10.049 14.615  1.00 71.06  ? 280 LEU A C     1 
ATOM   2232 O  O     . LEU A 1 280 ? 64.214  -9.865  14.738  1.00 72.04  ? 280 LEU A O     1 
ATOM   2233 C  CB    . LEU A 1 280 ? 62.703  -7.624  14.022  1.00 70.94  ? 280 LEU A CB    1 
ATOM   2234 C  CG    . LEU A 1 280 ? 61.946  -6.480  13.350  1.00 70.43  ? 280 LEU A CG    1 
ATOM   2235 C  CD1   . LEU A 1 280 ? 62.609  -5.155  13.670  1.00 71.26  ? 280 LEU A CD1   1 
ATOM   2236 C  CD2   . LEU A 1 280 ? 61.868  -6.668  11.844  1.00 70.04  ? 280 LEU A CD2   1 
ATOM   2237 N  N     . ALA A 1 281 ? 62.383  -11.115 15.118  1.00 70.68  ? 281 ALA A N     1 
ATOM   2238 C  CA    . ALA A 1 281 ? 63.071  -12.149 15.876  1.00 71.42  ? 281 ALA A CA    1 
ATOM   2239 C  C     . ALA A 1 281 ? 62.912  -13.468 15.137  1.00 71.13  ? 281 ALA A C     1 
ATOM   2240 O  O     . ALA A 1 281 ? 61.864  -14.106 15.244  1.00 70.41  ? 281 ALA A O     1 
ATOM   2241 C  CB    . ALA A 1 281 ? 62.488  -12.247 17.274  1.00 71.45  ? 281 ALA A CB    1 
ATOM   2242 N  N     . PRO A 1 282 ? 63.941  -13.879 14.371  1.00 71.76  ? 282 PRO A N     1 
ATOM   2243 C  CA    . PRO A 1 282 ? 63.903  -15.116 13.587  1.00 71.65  ? 282 PRO A CA    1 
ATOM   2244 C  C     . PRO A 1 282 ? 63.293  -16.302 14.313  1.00 71.50  ? 282 PRO A C     1 
ATOM   2245 O  O     . PRO A 1 282 ? 62.498  -17.036 13.725  1.00 70.83  ? 282 PRO A O     1 
ATOM   2246 C  CB    . PRO A 1 282 ? 65.375  -15.376 13.284  1.00 72.85  ? 282 PRO A CB    1 
ATOM   2247 C  CG    . PRO A 1 282 ? 65.947  -14.013 13.163  1.00 73.18  ? 282 PRO A CG    1 
ATOM   2248 C  CD    . PRO A 1 282 ? 65.224  -13.179 14.183  1.00 72.73  ? 282 PRO A CD    1 
ATOM   2249 N  N     . SER A 1 283 ? 63.654  -16.480 15.580  1.00 72.20  ? 283 SER A N     1 
ATOM   2250 C  CA    . SER A 1 283 ? 63.099  -17.553 16.389  1.00 72.23  ? 283 SER A CA    1 
ATOM   2251 C  C     . SER A 1 283 ? 61.577  -17.453 16.422  1.00 71.05  ? 283 SER A C     1 
ATOM   2252 O  O     . SER A 1 283 ? 60.885  -18.446 16.213  1.00 70.67  ? 283 SER A O     1 
ATOM   2253 C  CB    . SER A 1 283 ? 63.675  -17.503 17.799  1.00 73.19  ? 283 SER A CB    1 
ATOM   2254 O  OG    . SER A 1 283 ? 65.062  -17.236 17.765  1.00 74.24  ? 283 SER A OG    1 
ATOM   2255 N  N     . ASP A 1 284 ? 61.070  -16.245 16.645  1.00 70.55  ? 284 ASP A N     1 
ATOM   2256 C  CA    . ASP A 1 284 ? 59.635  -16.025 16.684  1.00 69.52  ? 284 ASP A CA    1 
ATOM   2257 C  C     . ASP A 1 284 ? 59.022  -16.180 15.305  1.00 68.62  ? 284 ASP A C     1 
ATOM   2258 O  O     . ASP A 1 284 ? 58.377  -17.196 15.060  1.00 68.25  ? 284 ASP A O     1 
ATOM   2259 C  CB    . ASP A 1 284 ? 59.277  -14.667 17.289  1.00 69.36  ? 284 ASP A CB    1 
ATOM   2260 C  CG    . ASP A 1 284 ? 59.441  -14.630 18.804  1.00 70.10  ? 284 ASP A CG    1 
ATOM   2261 O  OD1   . ASP A 1 284 ? 59.238  -15.654 19.495  1.00 70.40  ? 284 ASP A OD1   1 
ATOM   2262 O  OD2   . ASP A 1 284 ? 59.762  -13.547 19.320  1.00 70.45  ? 284 ASP A OD2   1 
ATOM   2263 N  N     . TYR A 1 285 ? 59.245  -15.228 14.398  1.00 68.37  ? 285 TYR A N     1 
ATOM   2264 C  CA    . TYR A 1 285 ? 58.493  -15.207 13.130  1.00 67.47  ? 285 TYR A CA    1 
ATOM   2265 C  C     . TYR A 1 285 ? 58.664  -16.439 12.231  1.00 67.48  ? 285 TYR A C     1 
ATOM   2266 O  O     . TYR A 1 285 ? 57.711  -16.830 11.577  1.00 66.70  ? 285 TYR A O     1 
ATOM   2267 C  CB    . TYR A 1 285 ? 58.732  -13.923 12.321  1.00 67.34  ? 285 TYR A CB    1 
ATOM   2268 C  CG    . TYR A 1 285 ? 60.114  -13.740 11.740  1.00 68.17  ? 285 TYR A CG    1 
ATOM   2269 C  CD1   . TYR A 1 285 ? 60.542  -14.470 10.640  1.00 68.30  ? 285 TYR A CD1   1 
ATOM   2270 C  CD2   . TYR A 1 285 ? 60.983  -12.794 12.267  1.00 68.91  ? 285 TYR A CD2   1 
ATOM   2271 C  CE1   . TYR A 1 285 ? 61.809  -14.283 10.105  1.00 69.18  ? 285 TYR A CE1   1 
ATOM   2272 C  CE2   . TYR A 1 285 ? 62.251  -12.593 11.735  1.00 69.76  ? 285 TYR A CE2   1 
ATOM   2273 C  CZ    . TYR A 1 285 ? 62.663  -13.338 10.650  1.00 69.91  ? 285 TYR A CZ    1 
ATOM   2274 O  OH    . TYR A 1 285 ? 63.927  -13.150 10.125  1.00 70.87  ? 285 TYR A OH    1 
ATOM   2275 N  N     . HIS A 1 286 ? 59.853  -17.036 12.203  1.00 68.41  ? 286 HIS A N     1 
ATOM   2276 C  CA    . HIS A 1 286 ? 60.137  -18.174 11.321  1.00 68.60  ? 286 HIS A CA    1 
ATOM   2277 C  C     . HIS A 1 286 ? 60.086  -19.527 12.053  1.00 69.03  ? 286 HIS A C     1 
ATOM   2278 O  O     . HIS A 1 286 ? 59.204  -20.334 11.790  1.00 68.50  ? 286 HIS A O     1 
ATOM   2279 C  CB    . HIS A 1 286 ? 61.485  -17.954 10.627  1.00 69.46  ? 286 HIS A CB    1 
ATOM   2280 C  CG    . HIS A 1 286 ? 61.846  -19.001 9.612   1.00 69.79  ? 286 HIS A CG    1 
ATOM   2281 N  ND1   . HIS A 1 286 ? 62.571  -20.128 9.935   1.00 70.72  ? 286 HIS A ND1   1 
ATOM   2282 C  CD2   . HIS A 1 286 ? 61.637  -19.062 8.274   1.00 69.43  ? 286 HIS A CD2   1 
ATOM   2283 C  CE1   . HIS A 1 286 ? 62.772  -20.849 8.848   1.00 70.92  ? 286 HIS A CE1   1 
ATOM   2284 N  NE2   . HIS A 1 286 ? 62.211  -20.227 7.828   1.00 70.13  ? 286 HIS A NE2   1 
ATOM   2285 N  N     . LEU A 1 287 ? 61.007  -19.765 12.981  1.00 70.04  ? 287 LEU A N     1 
ATOM   2286 C  CA    . LEU A 1 287 ? 61.178  -21.102 13.590  1.00 70.73  ? 287 LEU A CA    1 
ATOM   2287 C  C     . LEU A 1 287 ? 59.972  -21.600 14.372  1.00 70.21  ? 287 LEU A C     1 
ATOM   2288 O  O     . LEU A 1 287 ? 59.482  -22.702 14.121  1.00 70.14  ? 287 LEU A O     1 
ATOM   2289 C  CB    . LEU A 1 287 ? 62.408  -21.129 14.508  1.00 71.99  ? 287 LEU A CB    1 
ATOM   2290 C  CG    . LEU A 1 287 ? 62.707  -22.390 15.335  1.00 72.94  ? 287 LEU A CG    1 
ATOM   2291 C  CD1   . LEU A 1 287 ? 62.749  -23.647 14.490  1.00 73.18  ? 287 LEU A CD1   1 
ATOM   2292 C  CD2   . LEU A 1 287 ? 64.027  -22.210 16.062  1.00 74.22  ? 287 LEU A CD2   1 
ATOM   2293 N  N     . PHE A 1 288 ? 59.518  -20.794 15.330  1.00 69.97  ? 288 PHE A N     1 
ATOM   2294 C  CA    . PHE A 1 288 ? 58.352  -21.143 16.147  1.00 69.57  ? 288 PHE A CA    1 
ATOM   2295 C  C     . PHE A 1 288 ? 57.057  -21.186 15.324  1.00 68.40  ? 288 PHE A C     1 
ATOM   2296 O  O     . PHE A 1 288 ? 56.186  -22.024 15.584  1.00 68.20  ? 288 PHE A O     1 
ATOM   2297 C  CB    . PHE A 1 288 ? 58.146  -20.151 17.303  1.00 69.63  ? 288 PHE A CB    1 
ATOM   2298 C  CG    . PHE A 1 288 ? 59.248  -20.115 18.337  1.00 70.82  ? 288 PHE A CG    1 
ATOM   2299 C  CD1   . PHE A 1 288 ? 60.061  -21.213 18.610  1.00 71.84  ? 288 PHE A CD1   1 
ATOM   2300 C  CD2   . PHE A 1 288 ? 59.414  -18.967 19.095  1.00 70.97  ? 288 PHE A CD2   1 
ATOM   2301 C  CE1   . PHE A 1 288 ? 61.043  -21.142 19.579  1.00 72.97  ? 288 PHE A CE1   1 
ATOM   2302 C  CE2   . PHE A 1 288 ? 60.389  -18.890 20.066  1.00 72.08  ? 288 PHE A CE2   1 
ATOM   2303 C  CZ    . PHE A 1 288 ? 61.209  -19.979 20.306  1.00 73.08  ? 288 PHE A CZ    1 
ATOM   2304 N  N     . ALA A 1 289 ? 56.932  -20.278 14.348  1.00 67.70  ? 289 ALA A N     1 
ATOM   2305 C  CA    . ALA A 1 289 ? 55.751  -20.196 13.487  1.00 66.62  ? 289 ALA A CA    1 
ATOM   2306 C  C     . ALA A 1 289 ? 55.504  -21.502 12.766  1.00 66.57  ? 289 ALA A C     1 
ATOM   2307 O  O     . ALA A 1 289 ? 54.395  -22.026 12.797  1.00 66.04  ? 289 ALA A O     1 
ATOM   2308 C  CB    . ALA A 1 289 ? 55.891  -19.061 12.497  1.00 66.13  ? 289 ALA A CB    1 
ATOM   2309 N  N     . SER A 1 290 ? 56.547  -22.031 12.144  1.00 67.21  ? 290 SER A N     1 
ATOM   2310 C  CA    . SER A 1 290 ? 56.493  -23.356 11.520  1.00 67.42  ? 290 SER A CA    1 
ATOM   2311 C  C     . SER A 1 290 ? 56.006  -24.420 12.505  1.00 67.79  ? 290 SER A C     1 
ATOM   2312 O  O     . SER A 1 290 ? 55.171  -25.266 12.165  1.00 67.47  ? 290 SER A O     1 
ATOM   2313 C  CB    . SER A 1 290 ? 57.879  -23.744 10.989  1.00 68.39  ? 290 SER A CB    1 
ATOM   2314 O  OG    . SER A 1 290 ? 57.879  -25.039 10.409  1.00 68.74  ? 290 SER A OG    1 
ATOM   2315 N  N     . MET A 1 291 ? 56.544  -24.359 13.718  1.00 68.55  ? 291 MET A N     1 
ATOM   2316 C  CA    . MET A 1 291 ? 56.195  -25.298 14.781  1.00 69.11  ? 291 MET A CA    1 
ATOM   2317 C  C     . MET A 1 291 ? 54.709  -25.211 15.133  1.00 68.28  ? 291 MET A C     1 
ATOM   2318 O  O     . MET A 1 291 ? 54.053  -26.235 15.315  1.00 68.41  ? 291 MET A O     1 
ATOM   2319 C  CB    . MET A 1 291 ? 57.063  -25.054 16.023  1.00 70.10  ? 291 MET A CB    1 
ATOM   2320 C  CG    . MET A 1 291 ? 57.452  -26.326 16.761  1.00 71.27  ? 291 MET A CG    1 
ATOM   2321 S  SD    . MET A 1 291 ? 58.182  -26.067 18.399  1.00 72.41  ? 291 MET A SD    1 
ATOM   2322 C  CE    . MET A 1 291 ? 59.308  -24.711 18.103  1.00 72.42  ? 291 MET A CE    1 
ATOM   2323 N  N     . GLY A 1 292 ? 54.176  -23.992 15.191  1.00 67.50  ? 292 GLY A N     1 
ATOM   2324 C  CA    . GLY A 1 292 ? 52.742  -23.758 15.441  1.00 66.70  ? 292 GLY A CA    1 
ATOM   2325 C  C     . GLY A 1 292 ? 51.770  -24.626 14.652  1.00 66.15  ? 292 GLY A C     1 
ATOM   2326 O  O     . GLY A 1 292 ? 50.792  -25.137 15.210  1.00 66.10  ? 292 GLY A O     1 
ATOM   2327 N  N     . HIS A 1 293 ? 52.064  -24.818 13.366  1.00 65.85  ? 293 HIS A N     1 
ATOM   2328 C  CA    . HIS A 1 293 ? 51.252  -25.676 12.497  1.00 65.41  ? 293 HIS A CA    1 
ATOM   2329 C  C     . HIS A 1 293 ? 51.438  -27.153 12.840  1.00 66.28  ? 293 HIS A C     1 
ATOM   2330 O  O     . HIS A 1 293 ? 50.462  -27.886 12.987  1.00 66.15  ? 293 HIS A O     1 
ATOM   2331 C  CB    . HIS A 1 293 ? 51.623  -25.480 11.030  1.00 65.01  ? 293 HIS A CB    1 
ATOM   2332 C  CG    . HIS A 1 293 ? 51.466  -24.075 10.539  1.00 64.24  ? 293 HIS A CG    1 
ATOM   2333 N  ND1   . HIS A 1 293 ? 50.260  -23.574 10.103  1.00 63.28  ? 293 HIS A ND1   1 
ATOM   2334 C  CD2   . HIS A 1 293 ? 52.369  -23.077 10.380  1.00 64.38  ? 293 HIS A CD2   1 
ATOM   2335 C  CE1   . HIS A 1 293 ? 50.422  -22.322 9.711   1.00 62.88  ? 293 HIS A CE1   1 
ATOM   2336 N  NE2   . HIS A 1 293 ? 51.692  -21.994 9.873   1.00 63.53  ? 293 HIS A NE2   1 
ATOM   2337 N  N     . ALA A 1 294 ? 52.695  -27.587 12.958  1.00 67.25  ? 294 ALA A N     1 
ATOM   2338 C  CA    . ALA A 1 294 ? 53.005  -28.982 13.298  1.00 68.28  ? 294 ALA A CA    1 
ATOM   2339 C  C     . ALA A 1 294 ? 52.484  -29.368 14.688  1.00 68.78  ? 294 ALA A C     1 
ATOM   2340 O  O     . ALA A 1 294 ? 52.265  -30.545 14.953  1.00 69.45  ? 294 ALA A O     1 
ATOM   2341 C  CB    . ALA A 1 294 ? 54.506  -29.245 13.186  1.00 69.32  ? 294 ALA A CB    1 
ATOM   2342 N  N     . LEU A 1 295 ? 52.295  -28.373 15.557  1.00 68.54  ? 295 LEU A N     1 
ATOM   2343 C  CA    . LEU A 1 295 ? 51.741  -28.581 16.893  1.00 69.02  ? 295 LEU A CA    1 
ATOM   2344 C  C     . LEU A 1 295 ? 50.223  -28.693 16.949  1.00 68.33  ? 295 LEU A C     1 
ATOM   2345 O  O     . LEU A 1 295 ? 49.692  -29.196 17.933  1.00 68.89  ? 295 LEU A O     1 
ATOM   2346 C  CB    . LEU A 1 295 ? 52.168  -27.447 17.834  1.00 69.16  ? 295 LEU A CB    1 
ATOM   2347 C  CG    . LEU A 1 295 ? 53.634  -27.387 18.259  1.00 70.16  ? 295 LEU A CG    1 
ATOM   2348 C  CD1   . LEU A 1 295 ? 53.861  -26.104 19.043  1.00 70.10  ? 295 LEU A CD1   1 
ATOM   2349 C  CD2   . LEU A 1 295 ? 54.026  -28.609 19.081  1.00 71.49  ? 295 LEU A CD2   1 
ATOM   2350 N  N     . ALA A 1 296 ? 49.511  -28.203 15.946  1.00 67.20  ? 296 ALA A N     1 
ATOM   2351 C  CA    . ALA A 1 296 ? 48.057  -28.328 15.963  1.00 66.61  ? 296 ALA A CA    1 
ATOM   2352 C  C     . ALA A 1 296 ? 47.631  -29.788 16.140  1.00 67.28  ? 296 ALA A C     1 
ATOM   2353 O  O     . ALA A 1 296 ? 48.322  -30.717 15.693  1.00 67.87  ? 296 ALA A O     1 
ATOM   2354 C  CB    . ALA A 1 296 ? 47.446  -27.746 14.703  1.00 65.42  ? 296 ALA A CB    1 
ATOM   2355 N  N     . GLU A 1 297 ? 46.505  -29.960 16.839  1.00 67.30  ? 297 GLU A N     1 
ATOM   2356 C  CA    . GLU A 1 297 ? 45.939  -31.268 17.214  1.00 68.04  ? 297 GLU A CA    1 
ATOM   2357 C  C     . GLU A 1 297 ? 46.987  -32.328 17.570  1.00 69.33  ? 297 GLU A C     1 
ATOM   2358 O  O     . GLU A 1 297 ? 46.907  -33.474 17.129  1.00 69.78  ? 297 GLU A O     1 
ATOM   2359 C  CB    . GLU A 1 297 ? 44.981  -31.774 16.119  1.00 67.34  ? 297 GLU A CB    1 
ATOM   2360 C  CG    . GLU A 1 297 ? 43.878  -30.790 15.703  1.00 66.13  ? 297 GLU A CG    1 
ATOM   2361 C  CD    . GLU A 1 297 ? 42.752  -30.644 16.733  1.00 66.30  ? 297 GLU A CD    1 
ATOM   2362 O  OE1   . GLU A 1 297 ? 42.988  -30.882 17.951  1.00 67.27  ? 297 GLU A OE1   1 
ATOM   2363 O  OE2   . GLU A 1 297 ? 41.616  -30.279 16.315  1.00 65.52  ? 297 GLU A OE2   1 
ATOM   2364 N  N     . GLN A 1 298 ? 47.970  -31.925 18.372  1.00 69.98  ? 298 GLN A N     1 
ATOM   2365 C  CA    . GLN A 1 298 ? 48.996  -32.831 18.860  1.00 71.34  ? 298 GLN A CA    1 
ATOM   2366 C  C     . GLN A 1 298 ? 48.783  -33.091 20.332  1.00 72.37  ? 298 GLN A C     1 
ATOM   2367 O  O     . GLN A 1 298 ? 48.418  -32.192 21.082  1.00 72.13  ? 298 GLN A O     1 
ATOM   2368 C  CB    . GLN A 1 298 ? 50.397  -32.243 18.653  1.00 71.49  ? 298 GLN A CB    1 
ATOM   2369 C  CG    . GLN A 1 298 ? 50.988  -32.589 17.304  1.00 71.24  ? 298 GLN A CG    1 
ATOM   2370 C  CD    . GLN A 1 298 ? 51.397  -34.050 17.223  1.00 72.42  ? 298 GLN A CD    1 
ATOM   2371 O  OE1   . GLN A 1 298 ? 52.007  -34.641 18.153  1.00 73.73  ? 298 GLN A OE1   1 
ATOM   2372 N  NE2   . GLN A 1 298 ? 51.059  -34.649 16.100  1.00 72.06  ? 298 GLN A NE2   1 
ATOM   2373 N  N     . ARG A 1 299 ? 49.062  -34.322 20.735  1.00 73.65  ? 299 ARG A N     1 
ATOM   2374 C  CA    . ARG A 1 299 ? 49.007  -34.701 22.130  1.00 74.90  ? 299 ARG A CA    1 
ATOM   2375 C  C     . ARG A 1 299 ? 50.281  -35.415 22.539  1.00 76.33  ? 299 ARG A C     1 
ATOM   2376 O  O     . ARG A 1 299 ? 50.917  -36.093 21.730  1.00 76.60  ? 299 ARG A O     1 
ATOM   2377 C  CB    . ARG A 1 299 ? 47.786  -35.558 22.417  1.00 75.25  ? 299 ARG A CB    1 
ATOM   2378 C  CG    . ARG A 1 299 ? 47.629  -36.796 21.539  1.00 75.51  ? 299 ARG A CG    1 
ATOM   2379 C  CD    . ARG A 1 299 ? 46.406  -37.632 21.937  1.00 76.00  ? 299 ARG A CD    1 
ATOM   2380 N  NE    . ARG A 1 299 ? 45.186  -36.821 22.138  1.00 75.04  ? 299 ARG A NE    1 
ATOM   2381 C  CZ    . ARG A 1 299 ? 44.746  -36.315 23.303  1.00 75.42  ? 299 ARG A CZ    1 
ATOM   2382 N  NH1   . ARG A 1 299 ? 45.404  -36.503 24.451  1.00 76.74  ? 299 ARG A NH1   1 
ATOM   2383 N  NH2   . ARG A 1 299 ? 43.624  -35.594 23.317  1.00 74.53  ? 299 ARG A NH2   1 
ATOM   2384 N  N     . PHE A 1 300 ? 50.638  -35.237 23.805  1.00 77.32  ? 300 PHE A N     1 
ATOM   2385 C  CA    . PHE A 1 300 ? 51.860  -35.779 24.361  1.00 78.78  ? 300 PHE A CA    1 
ATOM   2386 C  C     . PHE A 1 300 ? 51.532  -36.491 25.657  1.00 80.25  ? 300 PHE A C     1 
ATOM   2387 O  O     . PHE A 1 300 ? 50.655  -36.054 26.399  1.00 80.09  ? 300 PHE A O     1 
ATOM   2388 C  CB    . PHE A 1 300 ? 52.855  -34.650 24.608  1.00 78.58  ? 300 PHE A CB    1 
ATOM   2389 C  CG    . PHE A 1 300 ? 53.314  -33.963 23.349  1.00 77.36  ? 300 PHE A CG    1 
ATOM   2390 C  CD1   . PHE A 1 300 ? 54.223  -34.581 22.498  1.00 77.74  ? 300 PHE A CD1   1 
ATOM   2391 C  CD2   . PHE A 1 300 ? 52.828  -32.698 23.002  1.00 75.92  ? 300 PHE A CD2   1 
ATOM   2392 C  CE1   . PHE A 1 300 ? 54.642  -33.953 21.333  1.00 76.72  ? 300 PHE A CE1   1 
ATOM   2393 C  CE2   . PHE A 1 300 ? 53.244  -32.063 21.839  1.00 74.90  ? 300 PHE A CE2   1 
ATOM   2394 C  CZ    . PHE A 1 300 ? 54.150  -32.693 21.003  1.00 75.29  ? 300 PHE A CZ    1 
ATOM   2395 N  N     . ASP A 1 301 ? 52.215  -37.607 25.895  1.00 81.75  ? 301 ASP A N     1 
ATOM   2396 C  CA    . ASP A 1 301 ? 52.146  -38.306 27.175  1.00 83.44  ? 301 ASP A CA    1 
ATOM   2397 C  C     . ASP A 1 301 ? 53.024  -37.639 28.203  1.00 84.18  ? 301 ASP A C     1 
ATOM   2398 O  O     . ASP A 1 301 ? 52.553  -37.237 29.259  1.00 84.54  ? 301 ASP A O     1 
ATOM   2399 C  CB    . ASP A 1 301 ? 52.575  -39.769 27.031  1.00 84.91  ? 301 ASP A CB    1 
ATOM   2400 C  CG    . ASP A 1 301 ? 51.438  -40.659 26.579  1.00 84.81  ? 301 ASP A CG    1 
ATOM   2401 O  OD1   . ASP A 1 301 ? 50.687  -40.259 25.652  1.00 83.25  ? 301 ASP A OD1   1 
ATOM   2402 O  OD2   . ASP A 1 301 ? 51.290  -41.758 27.167  1.00 86.37  ? 301 ASP A OD2   1 
ATOM   2403 N  N     . SER A 1 302 ? 54.297  -37.508 27.860  1.00 84.43  ? 302 SER A N     1 
ATOM   2404 C  CA    . SER A 1 302 ? 55.358  -37.209 28.808  1.00 85.58  ? 302 SER A CA    1 
ATOM   2405 C  C     . SER A 1 302 ? 56.267  -36.122 28.243  1.00 84.65  ? 302 SER A C     1 
ATOM   2406 O  O     . SER A 1 302 ? 56.042  -35.650 27.135  1.00 83.19  ? 302 SER A O     1 
ATOM   2407 C  CB    . SER A 1 302 ? 56.163  -38.505 28.999  1.00 87.42  ? 302 SER A CB    1 
ATOM   2408 O  OG    . SER A 1 302 ? 56.605  -38.949 27.733  1.00 87.02  ? 302 SER A OG    1 
ATOM   2409 N  N     . TYR A 1 303 ? 57.306  -35.760 28.991  1.00 85.61  ? 303 TYR A N     1 
ATOM   2410 C  CA    . TYR A 1 303 ? 58.267  -34.745 28.552  1.00 84.97  ? 303 TYR A CA    1 
ATOM   2411 C  C     . TYR A 1 303 ? 59.234  -35.286 27.493  1.00 85.19  ? 303 TYR A C     1 
ATOM   2412 O  O     . TYR A 1 303 ? 59.655  -34.547 26.608  1.00 84.16  ? 303 TYR A O     1 
ATOM   2413 C  CB    . TYR A 1 303 ? 59.055  -34.192 29.742  1.00 86.03  ? 303 TYR A CB    1 
ATOM   2414 C  CG    . TYR A 1 303 ? 58.224  -33.386 30.722  1.00 85.72  ? 303 TYR A CG    1 
ATOM   2415 C  CD1   . TYR A 1 303 ? 57.534  -34.013 31.771  1.00 86.78  ? 303 TYR A CD1   1 
ATOM   2416 C  CD2   . TYR A 1 303 ? 58.131  -31.987 30.610  1.00 84.48  ? 303 TYR A CD2   1 
ATOM   2417 C  CE1   . TYR A 1 303 ? 56.773  -33.274 32.673  1.00 86.61  ? 303 TYR A CE1   1 
ATOM   2418 C  CE2   . TYR A 1 303 ? 57.372  -31.238 31.506  1.00 84.30  ? 303 TYR A CE2   1 
ATOM   2419 C  CZ    . TYR A 1 303 ? 56.694  -31.889 32.541  1.00 85.37  ? 303 TYR A CZ    1 
ATOM   2420 O  OH    . TYR A 1 303 ? 55.930  -31.165 33.436  1.00 85.31  ? 303 TYR A OH    1 
ATOM   2421 N  N     . GLU A 1 304 ? 59.573  -36.572 27.585  1.00 86.62  ? 304 GLU A N     1 
ATOM   2422 C  CA    . GLU A 1 304 ? 60.373  -37.264 26.556  1.00 87.00  ? 304 GLU A CA    1 
ATOM   2423 C  C     . GLU A 1 304 ? 59.552  -37.512 25.285  1.00 85.68  ? 304 GLU A C     1 
ATOM   2424 O  O     . GLU A 1 304 ? 60.132  -37.719 24.219  1.00 85.52  ? 304 GLU A O     1 
ATOM   2425 C  CB    . GLU A 1 304 ? 60.983  -38.595 27.052  1.00 89.10  ? 304 GLU A CB    1 
ATOM   2426 C  CG    . GLU A 1 304 ? 60.001  -39.539 27.718  1.00 89.85  ? 304 GLU A CG    1 
ATOM   2427 C  CD    . GLU A 1 304 ? 59.717  -39.195 29.179  1.00 90.54  ? 304 GLU A CD    1 
ATOM   2428 O  OE1   . GLU A 1 304 ? 58.991  -39.956 29.838  1.00 91.40  ? 304 GLU A OE1   1 
ATOM   2429 O  OE2   . GLU A 1 304 ? 60.194  -38.149 29.678  1.00 90.28  ? 304 GLU A OE2   1 
ATOM   2430 N  N     . SER A 1 305 ? 58.221  -37.487 25.387  1.00 84.81  ? 305 SER A N     1 
ATOM   2431 C  CA    . SER A 1 305 ? 57.372  -37.554 24.192  1.00 83.41  ? 305 SER A CA    1 
ATOM   2432 C  C     . SER A 1 305 ? 57.523  -36.239 23.397  1.00 81.78  ? 305 SER A C     1 
ATOM   2433 O  O     . SER A 1 305 ? 57.502  -36.253 22.161  1.00 80.94  ? 305 SER A O     1 
ATOM   2434 C  CB    . SER A 1 305 ? 55.901  -37.891 24.516  1.00 83.00  ? 305 SER A CB    1 
ATOM   2435 O  OG    . SER A 1 305 ? 55.213  -38.411 23.386  1.00 82.21  ? 305 SER A OG    1 
ATOM   2436 N  N     . VAL A 1 306 ? 57.715  -35.121 24.106  1.00 81.47  ? 306 VAL A N     1 
ATOM   2437 C  CA    . VAL A 1 306 ? 57.943  -33.813 23.474  1.00 80.13  ? 306 VAL A CA    1 
ATOM   2438 C  C     . VAL A 1 306 ? 59.333  -33.769 22.863  1.00 80.65  ? 306 VAL A C     1 
ATOM   2439 O  O     . VAL A 1 306 ? 59.487  -33.420 21.697  1.00 79.75  ? 306 VAL A O     1 
ATOM   2440 C  CB    . VAL A 1 306 ? 57.778  -32.634 24.468  1.00 79.83  ? 306 VAL A CB    1 
ATOM   2441 C  CG1   . VAL A 1 306 ? 58.099  -31.290 23.819  1.00 78.62  ? 306 VAL A CG1   1 
ATOM   2442 C  CG2   . VAL A 1 306 ? 56.358  -32.592 25.019  1.00 79.31  ? 306 VAL A CG2   1 
ATOM   2443 N  N     . LYS A 1 307 ? 60.342  -34.102 23.662  1.00 82.17  ? 307 LYS A N     1 
ATOM   2444 C  CA    . LYS A 1 307 ? 61.733  -34.079 23.192  1.00 82.89  ? 307 LYS A CA    1 
ATOM   2445 C  C     . LYS A 1 307 ? 61.912  -34.976 21.975  1.00 83.00  ? 307 LYS A C     1 
ATOM   2446 O  O     . LYS A 1 307 ? 62.507  -34.558 20.985  1.00 82.56  ? 307 LYS A O     1 
ATOM   2447 C  CB    . LYS A 1 307 ? 62.715  -34.508 24.291  1.00 84.74  ? 307 LYS A CB    1 
ATOM   2448 C  CG    . LYS A 1 307 ? 64.180  -34.257 23.940  1.00 85.49  ? 307 LYS A CG    1 
ATOM   2449 C  CD    . LYS A 1 307 ? 65.146  -34.958 24.890  1.00 87.52  ? 307 LYS A CD    1 
ATOM   2450 C  CE    . LYS A 1 307 ? 65.345  -36.432 24.568  1.00 88.79  ? 307 LYS A CE    1 
ATOM   2451 N  NZ    . LYS A 1 307 ? 66.228  -36.651 23.388  1.00 89.02  ? 307 LYS A NZ    1 
ATOM   2452 N  N     . LYS A 1 308 ? 61.393  -36.197 22.061  1.00 83.69  ? 308 LYS A N     1 
ATOM   2453 C  CA    . LYS A 1 308 ? 61.458  -37.152 20.960  1.00 83.91  ? 308 LYS A CA    1 
ATOM   2454 C  C     . LYS A 1 308 ? 60.856  -36.573 19.676  1.00 82.18  ? 308 LYS A C     1 
ATOM   2455 O  O     . LYS A 1 308 ? 61.446  -36.699 18.602  1.00 82.19  ? 308 LYS A O     1 
ATOM   2456 C  CB    . LYS A 1 308 ? 60.754  -38.448 21.356  1.00 84.78  ? 308 LYS A CB    1 
ATOM   2457 C  CG    . LYS A 1 308 ? 60.648  -39.472 20.247  1.00 85.01  ? 308 LYS A CG    1 
ATOM   2458 C  CD    . LYS A 1 308 ? 60.009  -40.752 20.748  1.00 86.07  ? 308 LYS A CD    1 
ATOM   2459 C  CE    . LYS A 1 308 ? 59.297  -41.464 19.610  1.00 85.55  ? 308 LYS A CE    1 
ATOM   2460 N  NZ    . LYS A 1 308 ? 58.955  -42.859 19.995  1.00 86.98  ? 308 LYS A NZ    1 
ATOM   2461 N  N     . TRP A 1 309 ? 59.699  -35.931 19.804  1.00 80.80  ? 309 TRP A N     1 
ATOM   2462 C  CA    . TRP A 1 309 ? 59.032  -35.285 18.672  1.00 79.13  ? 309 TRP A CA    1 
ATOM   2463 C  C     . TRP A 1 309 ? 59.870  -34.136 18.099  1.00 78.56  ? 309 TRP A C     1 
ATOM   2464 O  O     . TRP A 1 309 ? 59.934  -33.967 16.882  1.00 77.89  ? 309 TRP A O     1 
ATOM   2465 C  CB    . TRP A 1 309 ? 57.647  -34.772 19.103  1.00 77.95  ? 309 TRP A CB    1 
ATOM   2466 C  CG    . TRP A 1 309 ? 56.763  -34.164 18.008  1.00 76.26  ? 309 TRP A CG    1 
ATOM   2467 C  CD1   . TRP A 1 309 ? 55.729  -34.778 17.343  1.00 75.68  ? 309 TRP A CD1   1 
ATOM   2468 C  CD2   . TRP A 1 309 ? 56.800  -32.815 17.517  1.00 75.05  ? 309 TRP A CD2   1 
ATOM   2469 N  NE1   . TRP A 1 309 ? 55.137  -33.900 16.458  1.00 74.17  ? 309 TRP A NE1   1 
ATOM   2470 C  CE2   . TRP A 1 309 ? 55.774  -32.691 16.546  1.00 73.77  ? 309 TRP A CE2   1 
ATOM   2471 C  CE3   . TRP A 1 309 ? 57.604  -31.701 17.797  1.00 74.98  ? 309 TRP A CE3   1 
ATOM   2472 C  CZ2   . TRP A 1 309 ? 55.538  -31.497 15.853  1.00 72.48  ? 309 TRP A CZ2   1 
ATOM   2473 C  CZ3   . TRP A 1 309 ? 57.370  -30.518 17.113  1.00 73.70  ? 309 TRP A CZ3   1 
ATOM   2474 C  CH2   . TRP A 1 309 ? 56.344  -30.424 16.151  1.00 72.49  ? 309 TRP A CH2   1 
ATOM   2475 N  N     . LEU A 1 310 ? 60.473  -33.333 18.973  1.00 78.87  ? 310 LEU A N     1 
ATOM   2476 C  CA    . LEU A 1 310 ? 61.326  -32.206 18.547  1.00 78.50  ? 310 LEU A CA    1 
ATOM   2477 C  C     . LEU A 1 310 ? 62.534  -32.687 17.754  1.00 79.45  ? 310 LEU A C     1 
ATOM   2478 O  O     . LEU A 1 310 ? 62.802  -32.186 16.666  1.00 78.83  ? 310 LEU A O     1 
ATOM   2479 C  CB    . LEU A 1 310 ? 61.793  -31.372 19.755  1.00 78.90  ? 310 LEU A CB    1 
ATOM   2480 C  CG    . LEU A 1 310 ? 60.807  -30.309 20.276  1.00 77.70  ? 310 LEU A CG    1 
ATOM   2481 C  CD1   . LEU A 1 310 ? 60.941  -30.087 21.778  1.00 78.51  ? 310 LEU A CD1   1 
ATOM   2482 C  CD2   . LEU A 1 310 ? 60.991  -28.992 19.540  1.00 76.62  ? 310 LEU A CD2   1 
ATOM   2483 N  N     . ASP A 1 311 ? 63.239  -33.666 18.317  1.00 81.06  ? 311 ASP A N     1 
ATOM   2484 C  CA    . ASP A 1 311 ? 64.454  -34.225 17.718  1.00 82.29  ? 311 ASP A CA    1 
ATOM   2485 C  C     . ASP A 1 311 ? 64.191  -34.689 16.295  1.00 81.80  ? 311 ASP A C     1 
ATOM   2486 O  O     . ASP A 1 311 ? 64.906  -34.288 15.367  1.00 81.77  ? 311 ASP A O     1 
ATOM   2487 C  CB    . ASP A 1 311 ? 64.993  -35.401 18.548  1.00 84.13  ? 311 ASP A CB    1 
ATOM   2488 C  CG    . ASP A 1 311 ? 65.380  -35.000 19.964  1.00 84.85  ? 311 ASP A CG    1 
ATOM   2489 O  OD1   . ASP A 1 311 ? 65.669  -33.809 20.186  1.00 84.25  ? 311 ASP A OD1   1 
ATOM   2490 O  OD2   . ASP A 1 311 ? 65.370  -35.876 20.862  1.00 86.07  ? 311 ASP A OD2   1 
ATOM   2491 N  N     . GLU A 1 312 ? 63.160  -35.516 16.123  1.00 81.47  ? 312 GLU A N     1 
ATOM   2492 C  CA    . GLU A 1 312 ? 62.746  -35.965 14.784  1.00 80.93  ? 312 GLU A CA    1 
ATOM   2493 C  C     . GLU A 1 312 ? 62.467  -34.759 13.895  1.00 79.37  ? 312 GLU A C     1 
ATOM   2494 O  O     . GLU A 1 312 ? 63.022  -34.659 12.804  1.00 79.42  ? 312 GLU A O     1 
ATOM   2495 C  CB    . GLU A 1 312 ? 61.502  -36.857 14.850  1.00 80.62  ? 312 GLU A CB    1 
ATOM   2496 C  CG    . GLU A 1 312 ? 61.730  -38.226 15.488  1.00 82.30  ? 312 GLU A CG    1 
ATOM   2497 C  CD    . GLU A 1 312 ? 60.435  -38.903 15.899  1.00 82.00  ? 312 GLU A CD    1 
ATOM   2498 O  OE1   . GLU A 1 312 ? 59.419  -38.712 15.203  1.00 80.67  ? 312 GLU A OE1   1 
ATOM   2499 O  OE2   . GLU A 1 312 ? 60.420  -39.617 16.925  1.00 83.15  ? 312 GLU A OE2   1 
ATOM   2500 N  N     . TRP A 1 313 ? 61.669  -33.822 14.412  1.00 78.15  ? 313 TRP A N     1 
ATOM   2501 C  CA    . TRP A 1 313 ? 61.152  -32.681 13.636  1.00 76.59  ? 313 TRP A CA    1 
ATOM   2502 C  C     . TRP A 1 313 ? 62.186  -31.612 13.217  1.00 76.59  ? 313 TRP A C     1 
ATOM   2503 O  O     . TRP A 1 313 ? 62.023  -30.997 12.158  1.00 75.71  ? 313 TRP A O     1 
ATOM   2504 C  CB    . TRP A 1 313 ? 59.998  -32.017 14.402  1.00 75.47  ? 313 TRP A CB    1 
ATOM   2505 C  CG    . TRP A 1 313 ? 59.240  -30.979 13.623  1.00 73.89  ? 313 TRP A CG    1 
ATOM   2506 C  CD1   . TRP A 1 313 ? 58.193  -31.188 12.765  1.00 72.91  ? 313 TRP A CD1   1 
ATOM   2507 C  CD2   . TRP A 1 313 ? 59.467  -29.565 13.644  1.00 73.20  ? 313 TRP A CD2   1 
ATOM   2508 N  NE1   . TRP A 1 313 ? 57.757  -29.987 12.249  1.00 71.66  ? 313 TRP A NE1   1 
ATOM   2509 C  CE2   . TRP A 1 313 ? 58.523  -28.975 12.769  1.00 71.84  ? 313 TRP A CE2   1 
ATOM   2510 C  CE3   . TRP A 1 313 ? 60.379  -28.736 14.317  1.00 73.68  ? 313 TRP A CE3   1 
ATOM   2511 C  CZ2   . TRP A 1 313 ? 58.469  -27.593 12.549  1.00 70.98  ? 313 TRP A CZ2   1 
ATOM   2512 C  CZ3   . TRP A 1 313 ? 60.323  -27.358 14.100  1.00 72.81  ? 313 TRP A CZ3   1 
ATOM   2513 C  CH2   . TRP A 1 313 ? 59.375  -26.802 13.222  1.00 71.49  ? 313 TRP A CH2   1 
ATOM   2514 N  N     . PHE A 1 314 ? 63.205  -31.359 14.047  1.00 77.59  ? 314 PHE A N     1 
ATOM   2515 C  CA    . PHE A 1 314 ? 64.317  -30.459 13.672  1.00 77.88  ? 314 PHE A CA    1 
ATOM   2516 C  C     . PHE A 1 314 ? 65.137  -31.061 12.532  1.00 78.70  ? 314 PHE A C     1 
ATOM   2517 O  O     . PHE A 1 314 ? 65.316  -30.431 11.485  1.00 78.19  ? 314 PHE A O     1 
ATOM   2518 C  CB    . PHE A 1 314 ? 65.258  -30.171 14.863  1.00 78.95  ? 314 PHE A CB    1 
ATOM   2519 C  CG    . PHE A 1 314 ? 64.691  -29.243 15.926  1.00 78.23  ? 314 PHE A CG    1 
ATOM   2520 C  CD1   . PHE A 1 314 ? 63.822  -28.189 15.612  1.00 76.71  ? 314 PHE A CD1   1 
ATOM   2521 C  CD2   . PHE A 1 314 ? 65.066  -29.411 17.264  1.00 79.20  ? 314 PHE A CD2   1 
ATOM   2522 C  CE1   . PHE A 1 314 ? 63.334  -27.347 16.608  1.00 76.21  ? 314 PHE A CE1   1 
ATOM   2523 C  CE2   . PHE A 1 314 ? 64.584  -28.568 18.257  1.00 78.68  ? 314 PHE A CE2   1 
ATOM   2524 C  CZ    . PHE A 1 314 ? 63.716  -27.535 17.929  1.00 77.18  ? 314 PHE A CZ    1 
ATOM   2525 N  N     . ALA A 1 315 ? 65.623  -32.284 12.749  1.00 80.07  ? 315 ALA A N     1 
ATOM   2526 C  CA    . ALA A 1 315 ? 66.417  -33.018 11.755  1.00 81.12  ? 315 ALA A CA    1 
ATOM   2527 C  C     . ALA A 1 315 ? 65.668  -33.241 10.436  1.00 80.22  ? 315 ALA A C     1 
ATOM   2528 O  O     . ALA A 1 315 ? 66.286  -33.223 9.369   1.00 80.62  ? 315 ALA A O     1 
ATOM   2529 C  CB    . ALA A 1 315 ? 66.873  -34.352 12.324  1.00 82.75  ? 315 ALA A CB    1 
ATOM   2530 N  N     . ALA A 1 316 ? 64.349  -33.439 10.522  1.00 79.09  ? 316 ALA A N     1 
ATOM   2531 C  CA    . ALA A 1 316 ? 63.480  -33.613 9.346   1.00 78.12  ? 316 ALA A CA    1 
ATOM   2532 C  C     . ALA A 1 316 ? 63.483  -32.413 8.395   1.00 77.09  ? 316 ALA A C     1 
ATOM   2533 O  O     . ALA A 1 316 ? 63.258  -32.575 7.195   1.00 76.79  ? 316 ALA A O     1 
ATOM   2534 C  CB    . ALA A 1 316 ? 62.053  -33.923 9.781   1.00 77.12  ? 316 ALA A CB    1 
ATOM   2535 N  N     . LYS A 1 317 ? 63.722  -31.214 8.922   1.00 76.62  ? 317 LYS A N     1 
ATOM   2536 C  CA    . LYS A 1 317 ? 63.846  -30.019 8.071   1.00 75.84  ? 317 LYS A CA    1 
ATOM   2537 C  C     . LYS A 1 317 ? 65.118  -29.993 7.280   1.00 76.96  ? 317 LYS A C     1 
ATOM   2538 O  O     . LYS A 1 317 ? 66.114  -30.584 7.690   1.00 78.38  ? 317 LYS A O     1 
ATOM   2539 C  CB    . LYS A 1 317 ? 63.798  -28.762 8.906   1.00 75.20  ? 317 LYS A CB    1 
ATOM   2540 C  CG    . LYS A 1 317 ? 62.418  -28.636 9.508   1.00 73.98  ? 317 LYS A CG    1 
ATOM   2541 C  CD    . LYS A 1 317 ? 62.250  -27.307 10.213  1.00 73.27  ? 317 LYS A CD    1 
ATOM   2542 C  CE    . LYS A 1 317 ? 63.448  -27.046 11.130  1.00 74.41  ? 317 LYS A CE    1 
ATOM   2543 N  NZ    . LYS A 1 317 ? 63.226  -26.137 12.299  1.00 74.05  ? 317 LYS A NZ    1 
ATOM   2544 N  N     . ASP A 1 318 ? 65.076  -29.256 6.173   1.00 76.37  ? 318 ASP A N     1 
ATOM   2545 C  CA    . ASP A 1 318 ? 66.271  -28.947 5.408   1.00 77.37  ? 318 ASP A CA    1 
ATOM   2546 C  C     . ASP A 1 318 ? 67.194  -28.040 6.226   1.00 77.87  ? 318 ASP A C     1 
ATOM   2547 O  O     . ASP A 1 318 ? 66.822  -27.531 7.297   1.00 77.29  ? 318 ASP A O     1 
ATOM   2548 C  CB    . ASP A 1 318 ? 65.924  -28.235 4.093   1.00 76.58  ? 318 ASP A CB    1 
ATOM   2549 C  CG    . ASP A 1 318 ? 65.122  -29.095 3.150   1.00 76.22  ? 318 ASP A CG    1 
ATOM   2550 O  OD1   . ASP A 1 318 ? 64.408  -30.002 3.624   1.00 76.01  ? 318 ASP A OD1   1 
ATOM   2551 O  OD2   . ASP A 1 318 ? 65.208  -28.863 1.926   1.00 76.22  ? 318 ASP A OD2   1 
ATOM   2552 N  N     . ASP A 1 319 ? 68.404  -27.853 5.708   1.00 79.04  ? 319 ASP A N     1 
ATOM   2553 C  CA    . ASP A 1 319 ? 69.313  -26.820 6.212   1.00 79.51  ? 319 ASP A CA    1 
ATOM   2554 C  C     . ASP A 1 319 ? 68.851  -25.507 5.603   1.00 78.35  ? 319 ASP A C     1 
ATOM   2555 O  O     . ASP A 1 319 ? 68.744  -24.480 6.288   1.00 77.79  ? 319 ASP A O     1 
ATOM   2556 C  CB    . ASP A 1 319 ? 70.761  -27.091 5.806   1.00 81.27  ? 319 ASP A CB    1 
ATOM   2557 C  CG    . ASP A 1 319 ? 71.202  -28.510 6.114   1.00 82.57  ? 319 ASP A CG    1 
ATOM   2558 O  OD1   . ASP A 1 319 ? 70.630  -29.449 5.511   1.00 82.45  ? 319 ASP A OD1   1 
ATOM   2559 O  OD2   . ASP A 1 319 ? 72.126  -28.673 6.944   1.00 83.77  ? 319 ASP A OD2   1 
ATOM   2560 N  N     . GLU A 1 320 ? 68.558  -25.569 4.306   1.00 78.07  ? 320 GLU A N     1 
ATOM   2561 C  CA    . GLU A 1 320 ? 67.931  -24.470 3.574   1.00 76.93  ? 320 GLU A CA    1 
ATOM   2562 C  C     . GLU A 1 320 ? 66.764  -23.785 4.319   1.00 75.41  ? 320 GLU A C     1 
ATOM   2563 O  O     . GLU A 1 320 ? 66.497  -22.608 4.081   1.00 74.71  ? 320 GLU A O     1 
ATOM   2564 C  CB    . GLU A 1 320 ? 67.455  -24.956 2.193   1.00 76.71  ? 320 GLU A CB    1 
ATOM   2565 C  CG    . GLU A 1 320 ? 68.591  -25.159 1.186   1.00 78.15  ? 320 GLU A CG    1 
ATOM   2566 C  CD    . GLU A 1 320 ? 68.109  -25.611 -0.187  1.00 77.99  ? 320 GLU A CD    1 
ATOM   2567 O  OE1   . GLU A 1 320 ? 66.878  -25.828 -0.360  1.00 76.74  ? 320 GLU A OE1   1 
ATOM   2568 O  OE2   . GLU A 1 320 ? 68.971  -25.760 -1.093  1.00 79.19  ? 320 GLU A OE2   1 
ATOM   2569 N  N     . PHE A 1 321 ? 66.075  -24.525 5.190   1.00 75.00  ? 321 PHE A N     1 
ATOM   2570 C  CA    . PHE A 1 321 ? 65.038  -23.970 6.054   1.00 73.78  ? 321 PHE A CA    1 
ATOM   2571 C  C     . PHE A 1 321 ? 65.591  -22.917 6.994   1.00 73.98  ? 321 PHE A C     1 
ATOM   2572 O  O     . PHE A 1 321 ? 65.140  -21.780 7.014   1.00 73.16  ? 321 PHE A O     1 
ATOM   2573 C  CB    . PHE A 1 321 ? 64.391  -25.089 6.881   1.00 73.67  ? 321 PHE A CB    1 
ATOM   2574 C  CG    . PHE A 1 321 ? 63.291  -24.617 7.791   1.00 72.55  ? 321 PHE A CG    1 
ATOM   2575 C  CD1   . PHE A 1 321 ? 61.998  -24.443 7.309   1.00 71.26  ? 321 PHE A CD1   1 
ATOM   2576 C  CD2   . PHE A 1 321 ? 63.542  -24.351 9.127   1.00 72.86  ? 321 PHE A CD2   1 
ATOM   2577 C  CE1   . PHE A 1 321 ? 60.986  -24.013 8.151   1.00 70.34  ? 321 PHE A CE1   1 
ATOM   2578 C  CE2   . PHE A 1 321 ? 62.526  -23.924 9.967   1.00 71.93  ? 321 PHE A CE2   1 
ATOM   2579 C  CZ    . PHE A 1 321 ? 61.247  -23.756 9.483   1.00 70.69  ? 321 PHE A CZ    1 
ATOM   2580 N  N     . TYR A 1 322 ? 66.576  -23.318 7.776   1.00 75.16  ? 322 TYR A N     1 
ATOM   2581 C  CA    . TYR A 1 322 ? 67.084  -22.467 8.848   1.00 75.45  ? 322 TYR A CA    1 
ATOM   2582 C  C     . TYR A 1 322 ? 67.744  -21.234 8.253   1.00 75.63  ? 322 TYR A C     1 
ATOM   2583 O  O     . TYR A 1 322 ? 67.398  -20.106 8.607   1.00 74.98  ? 322 TYR A O     1 
ATOM   2584 C  CB    . TYR A 1 322 ? 68.082  -23.221 9.734   1.00 76.85  ? 322 TYR A CB    1 
ATOM   2585 C  CG    . TYR A 1 322 ? 67.510  -24.409 10.493  1.00 76.88  ? 322 TYR A CG    1 
ATOM   2586 C  CD1   . TYR A 1 322 ? 66.776  -24.235 11.664  1.00 76.30  ? 322 TYR A CD1   1 
ATOM   2587 C  CD2   . TYR A 1 322 ? 67.727  -25.718 10.041  1.00 77.63  ? 322 TYR A CD2   1 
ATOM   2588 C  CE1   . TYR A 1 322 ? 66.278  -25.321 12.362  1.00 76.47  ? 322 TYR A CE1   1 
ATOM   2589 C  CE2   . TYR A 1 322 ? 67.228  -26.813 10.734  1.00 77.80  ? 322 TYR A CE2   1 
ATOM   2590 C  CZ    . TYR A 1 322 ? 66.512  -26.611 11.900  1.00 77.23  ? 322 TYR A CZ    1 
ATOM   2591 O  OH    . TYR A 1 322 ? 66.007  -27.707 12.570  1.00 77.49  ? 322 TYR A OH    1 
ATOM   2592 N  N     . TRP A 1 323 ? 68.673  -21.471 7.329   1.00 76.61  ? 323 TRP A N     1 
ATOM   2593 C  CA    . TRP A 1 323 ? 69.315  -20.405 6.557   1.00 76.93  ? 323 TRP A CA    1 
ATOM   2594 C  C     . TRP A 1 323 ? 68.305  -19.364 6.079   1.00 75.59  ? 323 TRP A C     1 
ATOM   2595 O  O     . TRP A 1 323 ? 68.515  -18.163 6.248   1.00 75.53  ? 323 TRP A O     1 
ATOM   2596 C  CB    . TRP A 1 323 ? 70.070  -20.995 5.347   1.00 77.94  ? 323 TRP A CB    1 
ATOM   2597 C  CG    . TRP A 1 323 ? 70.767  -19.953 4.500   1.00 78.45  ? 323 TRP A CG    1 
ATOM   2598 C  CD1   . TRP A 1 323 ? 72.041  -19.506 4.654   1.00 79.76  ? 323 TRP A CD1   1 
ATOM   2599 C  CD2   . TRP A 1 323 ? 70.215  -19.225 3.386   1.00 77.74  ? 323 TRP A CD2   1 
ATOM   2600 N  NE1   . TRP A 1 323 ? 72.324  -18.546 3.710   1.00 79.94  ? 323 TRP A NE1   1 
ATOM   2601 C  CE2   . TRP A 1 323 ? 71.219  -18.354 2.918   1.00 78.72  ? 323 TRP A CE2   1 
ATOM   2602 C  CE3   . TRP A 1 323 ? 68.968  -19.225 2.743   1.00 76.43  ? 323 TRP A CE3   1 
ATOM   2603 C  CZ2   . TRP A 1 323 ? 71.015  -17.487 1.830   1.00 78.47  ? 323 TRP A CZ2   1 
ATOM   2604 C  CZ3   . TRP A 1 323 ? 68.766  -18.362 1.662   1.00 76.16  ? 323 TRP A CZ3   1 
ATOM   2605 C  CH2   . TRP A 1 323 ? 69.785  -17.508 1.220   1.00 77.19  ? 323 TRP A CH2   1 
ATOM   2606 N  N     . ARG A 1 324 ? 67.210  -19.846 5.498   1.00 74.59  ? 324 ARG A N     1 
ATOM   2607 C  CA    . ARG A 1 324 ? 66.223  -18.991 4.851   1.00 73.40  ? 324 ARG A CA    1 
ATOM   2608 C  C     . ARG A 1 324 ? 65.634  -17.977 5.842   1.00 72.62  ? 324 ARG A C     1 
ATOM   2609 O  O     . ARG A 1 324 ? 65.581  -16.777 5.550   1.00 72.37  ? 324 ARG A O     1 
ATOM   2610 C  CB    . ARG A 1 324 ? 65.200  -19.876 4.112   1.00 72.62  ? 324 ARG A CB    1 
ATOM   2611 C  CG    . ARG A 1 324 ? 63.770  -19.380 3.986   1.00 71.15  ? 324 ARG A CG    1 
ATOM   2612 C  CD    . ARG A 1 324 ? 62.796  -20.510 3.617   1.00 70.52  ? 324 ARG A CD    1 
ATOM   2613 N  NE    . ARG A 1 324 ? 63.142  -21.234 2.381   1.00 71.06  ? 324 ARG A NE    1 
ATOM   2614 C  CZ    . ARG A 1 324 ? 62.259  -21.832 1.558   1.00 70.45  ? 324 ARG A CZ    1 
ATOM   2615 N  NH1   . ARG A 1 324 ? 60.942  -21.873 1.816   1.00 69.25  ? 324 ARG A NH1   1 
ATOM   2616 N  NH2   . ARG A 1 324 ? 62.707  -22.428 0.449   1.00 71.14  ? 324 ARG A NH2   1 
ATOM   2617 N  N     . GLY A 1 325 ? 65.268  -18.452 7.031   1.00 72.41  ? 325 GLY A N     1 
ATOM   2618 C  CA    . GLY A 1 325 ? 64.672  -17.599 8.054   1.00 71.76  ? 325 GLY A CA    1 
ATOM   2619 C  C     . GLY A 1 325 ? 65.620  -16.557 8.612   1.00 72.51  ? 325 GLY A C     1 
ATOM   2620 O  O     . GLY A 1 325 ? 65.195  -15.439 8.898   1.00 72.00  ? 325 GLY A O     1 
ATOM   2621 N  N     . ILE A 1 326 ? 66.900  -16.915 8.751   1.00 73.78  ? 326 ILE A N     1 
ATOM   2622 C  CA    . ILE A 1 326 ? 67.920  -15.967 9.211   1.00 74.66  ? 326 ILE A CA    1 
ATOM   2623 C  C     . ILE A 1 326 ? 68.099  -14.906 8.134   1.00 74.64  ? 326 ILE A C     1 
ATOM   2624 O  O     . ILE A 1 326 ? 67.990  -13.708 8.405   1.00 74.44  ? 326 ILE A O     1 
ATOM   2625 C  CB    . ILE A 1 326 ? 69.292  -16.628 9.502   1.00 76.16  ? 326 ILE A CB    1 
ATOM   2626 C  CG1   . ILE A 1 326 ? 69.175  -17.752 10.545  1.00 76.36  ? 326 ILE A CG1   1 
ATOM   2627 C  CG2   . ILE A 1 326 ? 70.317  -15.588 9.974   1.00 77.08  ? 326 ILE A CG2   1 
ATOM   2628 C  CD1   . ILE A 1 326 ? 68.822  -17.303 11.948  1.00 76.11  ? 326 ILE A CD1   1 
ATOM   2629 N  N     . HIS A 1 327 ? 68.356  -15.358 6.907   1.00 74.91  ? 327 HIS A N     1 
ATOM   2630 C  CA    . HIS A 1 327 ? 68.616  -14.443 5.788   1.00 75.10  ? 327 HIS A CA    1 
ATOM   2631 C  C     . HIS A 1 327 ? 67.421  -13.581 5.360   1.00 73.87  ? 327 HIS A C     1 
ATOM   2632 O  O     . HIS A 1 327 ? 67.612  -12.601 4.652   1.00 74.07  ? 327 HIS A O     1 
ATOM   2633 C  CB    . HIS A 1 327 ? 69.232  -15.185 4.587   1.00 75.87  ? 327 HIS A CB    1 
ATOM   2634 C  CG    . HIS A 1 327 ? 70.723  -15.309 4.670   1.00 77.48  ? 327 HIS A CG    1 
ATOM   2635 N  ND1   . HIS A 1 327 ? 71.572  -14.681 3.783   1.00 78.45  ? 327 HIS A ND1   1 
ATOM   2636 C  CD2   . HIS A 1 327 ? 71.517  -15.948 5.565   1.00 78.37  ? 327 HIS A CD2   1 
ATOM   2637 C  CE1   . HIS A 1 327 ? 72.825  -14.946 4.117   1.00 79.86  ? 327 HIS A CE1   1 
ATOM   2638 N  NE2   . HIS A 1 327 ? 72.818  -15.711 5.195   1.00 79.84  ? 327 HIS A NE2   1 
ATOM   2639 N  N     . LYS A 1 328 ? 66.214  -13.913 5.814   1.00 72.70  ? 328 LYS A N     1 
ATOM   2640 C  CA    . LYS A 1 328 ? 65.044  -13.055 5.585   1.00 71.58  ? 328 LYS A CA    1 
ATOM   2641 C  C     . LYS A 1 328 ? 65.065  -11.741 6.411   1.00 71.61  ? 328 LYS A C     1 
ATOM   2642 O  O     . LYS A 1 328 ? 64.255  -10.844 6.152   1.00 70.93  ? 328 LYS A O     1 
ATOM   2643 C  CB    . LYS A 1 328 ? 63.768  -13.854 5.865   1.00 70.45  ? 328 LYS A CB    1 
ATOM   2644 C  CG    . LYS A 1 328 ? 62.485  -13.282 5.265   1.00 69.32  ? 328 LYS A CG    1 
ATOM   2645 C  CD    . LYS A 1 328 ? 61.384  -14.334 5.128   1.00 68.42  ? 328 LYS A CD    1 
ATOM   2646 C  CE    . LYS A 1 328 ? 61.243  -15.209 6.372   1.00 68.39  ? 328 LYS A CE    1 
ATOM   2647 N  NZ    . LYS A 1 328 ? 59.998  -16.016 6.422   1.00 67.46  ? 328 LYS A NZ    1 
ATOM   2648 N  N     . LEU A 1 329 ? 65.977  -11.636 7.389   1.00 72.46  ? 329 LEU A N     1 
ATOM   2649 C  CA    . LEU A 1 329 ? 66.150  -10.429 8.228   1.00 72.70  ? 329 LEU A CA    1 
ATOM   2650 C  C     . LEU A 1 329 ? 66.176  -9.074  7.505   1.00 72.82  ? 329 LEU A C     1 
ATOM   2651 O  O     . LEU A 1 329 ? 65.309  -8.236  7.749   1.00 72.15  ? 329 LEU A O     1 
ATOM   2652 C  CB    . LEU A 1 329 ? 67.409  -10.548 9.100   1.00 73.90  ? 329 LEU A CB    1 
ATOM   2653 C  CG    . LEU A 1 329 ? 67.226  -11.201 10.464  1.00 73.81  ? 329 LEU A CG    1 
ATOM   2654 C  CD1   . LEU A 1 329 ? 68.563  -11.659 11.023  1.00 75.12  ? 329 LEU A CD1   1 
ATOM   2655 C  CD2   . LEU A 1 329 ? 66.564  -10.230 11.428  1.00 73.36  ? 329 LEU A CD2   1 
ATOM   2656 N  N     . PRO A 1 330 ? 67.164  -8.845  6.623   1.00 73.76  ? 330 PRO A N     1 
ATOM   2657 C  CA    . PRO A 1 330 ? 67.287  -7.510  6.022   1.00 74.09  ? 330 PRO A CA    1 
ATOM   2658 C  C     . PRO A 1 330 ? 66.132  -7.100  5.097   1.00 73.14  ? 330 PRO A C     1 
ATOM   2659 O  O     . PRO A 1 330 ? 65.902  -5.903  4.903   1.00 73.20  ? 330 PRO A O     1 
ATOM   2660 C  CB    . PRO A 1 330 ? 68.604  -7.596  5.234   1.00 75.40  ? 330 PRO A CB    1 
ATOM   2661 C  CG    . PRO A 1 330 ? 69.245  -8.884  5.651   1.00 75.83  ? 330 PRO A CG    1 
ATOM   2662 C  CD    . PRO A 1 330 ? 68.106  -9.780  5.993   1.00 74.59  ? 330 PRO A CD    1 
ATOM   2663 N  N     . GLU A 1 331 ? 65.430  -8.083  4.532   1.00 72.36  ? 331 GLU A N     1 
ATOM   2664 C  CA    . GLU A 1 331 ? 64.163  -7.840  3.859   1.00 71.32  ? 331 GLU A CA    1 
ATOM   2665 C  C     . GLU A 1 331 ? 63.188  -7.148  4.815   1.00 70.55  ? 331 GLU A C     1 
ATOM   2666 O  O     . GLU A 1 331 ? 62.525  -6.178  4.447   1.00 70.24  ? 331 GLU A O     1 
ATOM   2667 C  CB    . GLU A 1 331 ? 63.566  -9.161  3.382   1.00 70.62  ? 331 GLU A CB    1 
ATOM   2668 C  CG    . GLU A 1 331 ? 62.325  -9.011  2.522   1.00 69.65  ? 331 GLU A CG    1 
ATOM   2669 C  CD    . GLU A 1 331 ? 61.530  -10.291 2.437   1.00 68.81  ? 331 GLU A CD    1 
ATOM   2670 O  OE1   . GLU A 1 331 ? 61.058  -10.780 3.495   1.00 68.29  ? 331 GLU A OE1   1 
ATOM   2671 O  OE2   . GLU A 1 331 ? 61.367  -10.806 1.309   1.00 68.73  ? 331 GLU A OE2   1 
ATOM   2672 N  N     . ARG A 1 332 ? 63.128  -7.654  6.045   1.00 70.37  ? 332 ARG A N     1 
ATOM   2673 C  CA    . ARG A 1 332 ? 62.213  -7.153  7.069   1.00 69.73  ? 332 ARG A CA    1 
ATOM   2674 C  C     . ARG A 1 332 ? 62.655  -5.830  7.660   1.00 70.39  ? 332 ARG A C     1 
ATOM   2675 O  O     . ARG A 1 332 ? 61.826  -4.975  7.969   1.00 69.98  ? 332 ARG A O     1 
ATOM   2676 C  CB    . ARG A 1 332 ? 62.058  -8.186  8.178   1.00 69.48  ? 332 ARG A CB    1 
ATOM   2677 C  CG    . ARG A 1 332 ? 61.478  -9.503  7.680   1.00 68.80  ? 332 ARG A CG    1 
ATOM   2678 C  CD    . ARG A 1 332 ? 61.583  -10.619 8.701   1.00 68.86  ? 332 ARG A CD    1 
ATOM   2679 N  NE    . ARG A 1 332 ? 60.363  -11.438 8.770   1.00 67.88  ? 332 ARG A NE    1 
ATOM   2680 C  CZ    . ARG A 1 332 ? 59.185  -11.088 9.275   1.00 67.10  ? 332 ARG A CZ    1 
ATOM   2681 N  NH1   . ARG A 1 332 ? 58.995  -9.898  9.808   1.00 67.15  ? 332 ARG A NH1   1 
ATOM   2682 N  NH2   . ARG A 1 332 ? 58.188  -11.966 9.239   1.00 66.35  ? 332 ARG A NH2   1 
ATOM   2683 N  N     . TRP A 1 333 ? 63.960  -5.664  7.819   1.00 71.50  ? 333 TRP A N     1 
ATOM   2684 C  CA    . TRP A 1 333 ? 64.504  -4.403  8.294   1.00 72.29  ? 333 TRP A CA    1 
ATOM   2685 C  C     . TRP A 1 333 ? 64.085  -3.252  7.378   1.00 72.27  ? 333 TRP A C     1 
ATOM   2686 O  O     . TRP A 1 333 ? 63.692  -2.197  7.854   1.00 72.32  ? 333 TRP A O     1 
ATOM   2687 C  CB    . TRP A 1 333 ? 66.035  -4.465  8.413   1.00 73.58  ? 333 TRP A CB    1 
ATOM   2688 C  CG    . TRP A 1 333 ? 66.588  -5.429  9.482   1.00 73.86  ? 333 TRP A CG    1 
ATOM   2689 C  CD1   . TRP A 1 333 ? 65.952  -5.866  10.609  1.00 73.30  ? 333 TRP A CD1   1 
ATOM   2690 C  CD2   . TRP A 1 333 ? 67.901  -6.014  9.518   1.00 74.92  ? 333 TRP A CD2   1 
ATOM   2691 N  NE1   . TRP A 1 333 ? 66.771  -6.705  11.327  1.00 73.92  ? 333 TRP A NE1   1 
ATOM   2692 C  CE2   . TRP A 1 333 ? 67.974  -6.809  10.684  1.00 74.92  ? 333 TRP A CE2   1 
ATOM   2693 C  CE3   . TRP A 1 333 ? 69.023  -5.946  8.673   1.00 75.97  ? 333 TRP A CE3   1 
ATOM   2694 C  CZ2   . TRP A 1 333 ? 69.118  -7.533  11.025  1.00 75.91  ? 333 TRP A CZ2   1 
ATOM   2695 C  CZ3   . TRP A 1 333 ? 70.164  -6.674  9.013   1.00 76.95  ? 333 TRP A CZ3   1 
ATOM   2696 C  CH2   . TRP A 1 333 ? 70.201  -7.453  10.180  1.00 76.91  ? 333 TRP A CH2   1 
ATOM   2697 N  N     . GLU A 1 334 ? 64.155  -3.467  6.066   1.00 72.28  ? 334 GLU A N     1 
ATOM   2698 C  CA    . GLU A 1 334 ? 63.713  -2.456  5.084   1.00 72.31  ? 334 GLU A CA    1 
ATOM   2699 C  C     . GLU A 1 334 ? 62.241  -2.076  5.233   1.00 71.26  ? 334 GLU A C     1 
ATOM   2700 O  O     . GLU A 1 334 ? 61.892  -0.895  5.160   1.00 71.47  ? 334 GLU A O     1 
ATOM   2701 C  CB    . GLU A 1 334 ? 64.006  -2.909  3.641   1.00 72.52  ? 334 GLU A CB    1 
ATOM   2702 C  CG    . GLU A 1 334 ? 65.377  -2.470  3.141   1.00 73.94  ? 334 GLU A CG    1 
ATOM   2703 C  CD    . GLU A 1 334 ? 65.872  -3.257  1.937   1.00 74.31  ? 334 GLU A CD    1 
ATOM   2704 O  OE1   . GLU A 1 334 ? 67.108  -3.316  1.764   1.00 75.48  ? 334 GLU A OE1   1 
ATOM   2705 O  OE2   . GLU A 1 334 ? 65.054  -3.804  1.164   1.00 73.51  ? 334 GLU A OE2   1 
ATOM   2706 N  N     . LYS A 1 335 ? 61.395  -3.079  5.442   1.00 70.22  ? 335 LYS A N     1 
ATOM   2707 C  CA    . LYS A 1 335 ? 59.963  -2.855  5.627   1.00 69.23  ? 335 LYS A CA    1 
ATOM   2708 C  C     . LYS A 1 335 ? 59.731  -2.004  6.850   1.00 69.40  ? 335 LYS A C     1 
ATOM   2709 O  O     . LYS A 1 335 ? 59.058  -0.973  6.791   1.00 69.36  ? 335 LYS A O     1 
ATOM   2710 C  CB    . LYS A 1 335 ? 59.236  -4.175  5.799   1.00 68.25  ? 335 LYS A CB    1 
ATOM   2711 C  CG    . LYS A 1 335 ? 59.227  -5.034  4.558   1.00 67.99  ? 335 LYS A CG    1 
ATOM   2712 C  CD    . LYS A 1 335 ? 58.704  -6.414  4.885   1.00 67.23  ? 335 LYS A CD    1 
ATOM   2713 C  CE    . LYS A 1 335 ? 58.567  -7.270  3.641   1.00 66.95  ? 335 LYS A CE    1 
ATOM   2714 N  NZ    . LYS A 1 335 ? 57.769  -8.489  3.935   1.00 66.10  ? 335 LYS A NZ    1 
ATOM   2715 N  N     . CYS A 1 336 ? 60.334  -2.441  7.950   1.00 69.69  ? 336 CYS A N     1 
ATOM   2716 C  CA    . CYS A 1 336 ? 60.309  -1.713  9.206   1.00 70.04  ? 336 CYS A CA    1 
ATOM   2717 C  C     . CYS A 1 336 ? 60.679  -0.229  9.032   1.00 70.90  ? 336 CYS A C     1 
ATOM   2718 O  O     . CYS A 1 336 ? 60.009  0.639   9.603   1.00 70.88  ? 336 CYS A O     1 
ATOM   2719 C  CB    . CYS A 1 336 ? 61.227  -2.390  10.224  1.00 70.53  ? 336 CYS A CB    1 
ATOM   2720 S  SG    . CYS A 1 336 ? 61.212  -1.488  11.797  1.00 71.06  ? 336 CYS A SG    1 
ATOM   2721 N  N     . VAL A 1 337 ? 61.719  0.055   8.237   1.00 71.72  ? 337 VAL A N     1 
ATOM   2722 C  CA    . VAL A 1 337 ? 62.153  1.439   7.964   1.00 72.69  ? 337 VAL A CA    1 
ATOM   2723 C  C     . VAL A 1 337 ? 61.129  2.162   7.091   1.00 72.31  ? 337 VAL A C     1 
ATOM   2724 O  O     . VAL A 1 337 ? 60.828  3.335   7.322   1.00 72.74  ? 337 VAL A O     1 
ATOM   2725 C  CB    . VAL A 1 337 ? 63.548  1.501   7.299   1.00 73.78  ? 337 VAL A CB    1 
ATOM   2726 C  CG1   . VAL A 1 337 ? 63.938  2.938   6.967   1.00 74.84  ? 337 VAL A CG1   1 
ATOM   2727 C  CG2   . VAL A 1 337 ? 64.606  0.901   8.207   1.00 74.33  ? 337 VAL A CG2   1 
ATOM   2728 N  N     . ALA A 1 338 ? 60.589  1.450   6.103   1.00 71.57  ? 338 ALA A N     1 
ATOM   2729 C  CA    . ALA A 1 338 ? 59.519  1.984   5.257   1.00 71.13  ? 338 ALA A CA    1 
ATOM   2730 C  C     . ALA A 1 338 ? 58.227  2.277   6.030   1.00 70.41  ? 338 ALA A C     1 
ATOM   2731 O  O     . ALA A 1 338 ? 57.446  3.117   5.614   1.00 70.40  ? 338 ALA A O     1 
ATOM   2732 C  CB    . ALA A 1 338 ? 59.231  1.039   4.099   1.00 70.50  ? 338 ALA A CB    1 
ATOM   2733 N  N     . SER A 1 339 ? 58.004  1.592   7.143   1.00 69.90  ? 339 SER A N     1 
ATOM   2734 C  CA    . SER A 1 339 ? 56.837  1.841   7.985   1.00 69.36  ? 339 SER A CA    1 
ATOM   2735 C  C     . SER A 1 339 ? 57.054  2.893   9.087   1.00 70.15  ? 339 SER A C     1 
ATOM   2736 O  O     . SER A 1 339 ? 56.210  3.022   9.981   1.00 69.84  ? 339 SER A O     1 
ATOM   2737 C  CB    . SER A 1 339 ? 56.419  0.529   8.638   1.00 68.49  ? 339 SER A CB    1 
ATOM   2738 O  OG    . SER A 1 339 ? 56.644  -0.535  7.749   1.00 68.05  ? 339 SER A OG    1 
ATOM   2739 N  N     . ASP A 1 340 ? 58.173  3.626   9.055   1.00 71.24  ? 340 ASP A N     1 
ATOM   2740 C  CA    . ASP A 1 340 ? 58.544  4.569   10.130  1.00 72.12  ? 340 ASP A CA    1 
ATOM   2741 C  C     . ASP A 1 340 ? 58.564  3.924   11.524  1.00 71.91  ? 340 ASP A C     1 
ATOM   2742 O  O     . ASP A 1 340 ? 58.222  4.564   12.520  1.00 72.25  ? 340 ASP A O     1 
ATOM   2743 C  CB    . ASP A 1 340 ? 57.631  5.811   10.103  1.00 72.37  ? 340 ASP A CB    1 
ATOM   2744 C  CG    . ASP A 1 340 ? 57.934  6.720   8.938   1.00 73.06  ? 340 ASP A CG    1 
ATOM   2745 O  OD1   . ASP A 1 340 ? 59.019  7.343   8.961   1.00 74.15  ? 340 ASP A OD1   1 
ATOM   2746 O  OD2   . ASP A 1 340 ? 57.100  6.808   8.009   1.00 72.60  ? 340 ASP A OD2   1 
ATOM   2747 N  N     . GLY A 1 341 ? 58.971  2.655   11.572  1.00 71.46  ? 341 GLY A N     1 
ATOM   2748 C  CA    . GLY A 1 341 ? 58.985  1.875   12.808  1.00 71.26  ? 341 GLY A CA    1 
ATOM   2749 C  C     . GLY A 1 341 ? 57.758  1.020   13.100  1.00 70.18  ? 341 GLY A C     1 
ATOM   2750 O  O     . GLY A 1 341 ? 57.824  0.145   13.975  1.00 70.01  ? 341 GLY A O     1 
ATOM   2751 N  N     . LYS A 1 342 ? 56.653  1.248   12.380  1.00 69.53  ? 342 LYS A N     1 
ATOM   2752 C  CA    . LYS A 1 342 ? 55.393  0.539   12.633  1.00 68.56  ? 342 LYS A CA    1 
ATOM   2753 C  C     . LYS A 1 342 ? 55.460  -0.940  12.315  1.00 67.86  ? 342 LYS A C     1 
ATOM   2754 O  O     . LYS A 1 342 ? 56.428  -1.423  11.731  1.00 68.07  ? 342 LYS A O     1 
ATOM   2755 C  CB    . LYS A 1 342 ? 54.241  1.157   11.835  1.00 68.12  ? 342 LYS A CB    1 
ATOM   2756 C  CG    . LYS A 1 342 ? 53.840  2.530   12.319  1.00 68.76  ? 342 LYS A CG    1 
ATOM   2757 C  CD    . LYS A 1 342 ? 52.467  2.927   11.794  1.00 68.26  ? 342 LYS A CD    1 
ATOM   2758 C  CE    . LYS A 1 342 ? 51.907  4.117   12.560  1.00 68.91  ? 342 LYS A CE    1 
ATOM   2759 N  NZ    . LYS A 1 342 ? 52.589  5.406   12.242  1.00 69.94  ? 342 LYS A NZ    1 
ATOM   2760 N  N     . TYR A 1 343 ? 54.410  -1.648  12.713  1.00 67.12  ? 343 TYR A N     1 
ATOM   2761 C  CA    . TYR A 1 343 ? 54.233  -3.036  12.321  1.00 66.40  ? 343 TYR A CA    1 
ATOM   2762 C  C     . TYR A 1 343 ? 53.889  -3.115  10.830  1.00 65.87  ? 343 TYR A C     1 
ATOM   2763 O  O     . TYR A 1 343 ? 52.724  -2.973  10.436  1.00 65.27  ? 343 TYR A O     1 
ATOM   2764 C  CB    . TYR A 1 343 ? 53.150  -3.727  13.172  1.00 65.85  ? 343 TYR A CB    1 
ATOM   2765 C  CG    . TYR A 1 343 ? 53.619  -3.994  14.572  1.00 66.41  ? 343 TYR A CG    1 
ATOM   2766 C  CD1   . TYR A 1 343 ? 54.636  -4.923  14.815  1.00 66.70  ? 343 TYR A CD1   1 
ATOM   2767 C  CD2   . TYR A 1 343 ? 53.083  -3.305  15.666  1.00 66.75  ? 343 TYR A CD2   1 
ATOM   2768 C  CE1   . TYR A 1 343 ? 55.112  -5.157  16.100  1.00 67.31  ? 343 TYR A CE1   1 
ATOM   2769 C  CE2   . TYR A 1 343 ? 53.553  -3.544  16.960  1.00 67.36  ? 343 TYR A CE2   1 
ATOM   2770 C  CZ    . TYR A 1 343 ? 54.565  -4.470  17.165  1.00 67.63  ? 343 TYR A CZ    1 
ATOM   2771 O  OH    . TYR A 1 343 ? 55.028  -4.720  18.426  1.00 68.29  ? 343 TYR A OH    1 
ATOM   2772 N  N     . PHE A 1 344 ? 54.919  -3.273  10.004  1.00 66.21  ? 344 PHE A N     1 
ATOM   2773 C  CA    . PHE A 1 344 ? 54.756  -3.774  8.628   1.00 65.74  ? 344 PHE A CA    1 
ATOM   2774 C  C     . PHE A 1 344 ? 54.162  -5.181  8.622   1.00 64.95  ? 344 PHE A C     1 
ATOM   2775 O  O     . PHE A 1 344 ? 54.395  -5.952  9.564   1.00 65.00  ? 344 PHE A O     1 
ATOM   2776 C  CB    . PHE A 1 344 ? 56.102  -3.879  7.905   1.00 66.40  ? 344 PHE A CB    1 
ATOM   2777 C  CG    . PHE A 1 344 ? 57.044  -4.893  8.512   1.00 66.72  ? 344 PHE A CG    1 
ATOM   2778 C  CD1   . PHE A 1 344 ? 57.890  -4.535  9.547   1.00 67.49  ? 344 PHE A CD1   1 
ATOM   2779 C  CD2   . PHE A 1 344 ? 57.059  -6.215  8.062   1.00 66.31  ? 344 PHE A CD2   1 
ATOM   2780 C  CE1   . PHE A 1 344 ? 58.730  -5.462  10.119  1.00 67.85  ? 344 PHE A CE1   1 
ATOM   2781 C  CE2   . PHE A 1 344 ? 57.896  -7.150  8.636   1.00 66.70  ? 344 PHE A CE2   1 
ATOM   2782 C  CZ    . PHE A 1 344 ? 58.735  -6.767  9.662   1.00 67.47  ? 344 PHE A CZ    1 
ATOM   2783 N  N     . GLU A 1 345 ? 53.440  -5.491  7.540   1.00 64.32  ? 345 GLU A N     1 
ATOM   2784 C  CA    . GLU A 1 345 ? 52.839  -6.807  7.241   1.00 63.59  ? 345 GLU A CA    1 
ATOM   2785 C  C     . GLU A 1 345 ? 51.691  -7.146  8.200   1.00 63.04  ? 345 GLU A C     1 
ATOM   2786 O  O     . GLU A 1 345 ? 51.569  -6.731  9.371   1.00 63.30  ? 345 GLU A O     1 
ATOM   2787 C  CB    . GLU A 1 345 ? 53.819  -8.007  7.199   1.00 63.84  ? 345 GLU A CB    1 
ATOM   2788 C  CG    . GLU A 1 345 ? 54.305  -8.532  8.559   1.00 64.19  ? 345 GLU A CG    1 
ATOM   2789 C  CD    . GLU A 1 345 ? 54.862  -9.952  8.512   1.00 64.28  ? 345 GLU A CD    1 
ATOM   2790 O  OE1   . GLU A 1 345 ? 54.280  -10.812 7.810   1.00 63.72  ? 345 GLU A OE1   1 
ATOM   2791 O  OE2   . GLU A 1 345 ? 55.885  -10.217 9.197   1.00 64.98  ? 345 GLU A OE2   1 
ATOM   2792 O  OXT   . GLU A 1 345 ? 50.853  -7.931  7.774   1.00 62.37  ? 345 GLU A OXT   1 
ATOM   2793 N  N     . SER B 1 3   ? 22.475  -8.822  -43.281 1.00 71.66  ? 3   SER B N     1 
ATOM   2794 C  CA    . SER B 1 3   ? 21.870  -8.040  -42.159 1.00 71.30  ? 3   SER B CA    1 
ATOM   2795 C  C     . SER B 1 3   ? 21.728  -8.828  -40.907 1.00 69.72  ? 3   SER B C     1 
ATOM   2796 O  O     . SER B 1 3   ? 22.246  -8.389  -39.908 1.00 69.52  ? 3   SER B O     1 
ATOM   2797 C  CB    . SER B 1 3   ? 20.489  -7.469  -42.490 1.00 71.71  ? 3   SER B CB    1 
ATOM   2798 O  OG    . SER B 1 3   ? 19.500  -8.480  -42.641 1.00 70.79  ? 3   SER B OG    1 
ATOM   2799 N  N     . PHE B 1 4   ? 20.996  -9.950  -40.970 1.00 68.72  ? 4   PHE B N     1 
ATOM   2800 C  CA    . PHE B 1 4   ? 20.598  -10.707 -39.784 1.00 67.29  ? 4   PHE B CA    1 
ATOM   2801 C  C     . PHE B 1 4   ? 20.628  -12.217 -40.011 1.00 66.46  ? 4   PHE B C     1 
ATOM   2802 O  O     . PHE B 1 4   ? 20.077  -12.714 -40.994 1.00 66.76  ? 4   PHE B O     1 
ATOM   2803 C  CB    . PHE B 1 4   ? 19.179  -10.294 -39.388 1.00 67.11  ? 4   PHE B CB    1 
ATOM   2804 C  CG    . PHE B 1 4   ? 18.503  -11.254 -38.457 1.00 65.80  ? 4   PHE B CG    1 
ATOM   2805 C  CD1   . PHE B 1 4   ? 18.823  -11.269 -37.100 1.00 64.96  ? 4   PHE B CD1   1 
ATOM   2806 C  CD2   . PHE B 1 4   ? 17.549  -12.151 -38.933 1.00 65.52  ? 4   PHE B CD2   1 
ATOM   2807 C  CE1   . PHE B 1 4   ? 18.196  -12.160 -36.235 1.00 63.85  ? 4   PHE B CE1   1 
ATOM   2808 C  CE2   . PHE B 1 4   ? 16.918  -13.040 -38.077 1.00 64.49  ? 4   PHE B CE2   1 
ATOM   2809 C  CZ    . PHE B 1 4   ? 17.240  -13.045 -36.725 1.00 63.65  ? 4   PHE B CZ    1 
ATOM   2810 N  N     . VAL B 1 5   ? 21.243  -12.926 -39.069 1.00 65.53  ? 5   VAL B N     1 
ATOM   2811 C  CA    . VAL B 1 5   ? 21.258  -14.384 -39.065 1.00 64.76  ? 5   VAL B CA    1 
ATOM   2812 C  C     . VAL B 1 5   ? 20.564  -14.861 -37.780 1.00 63.58  ? 5   VAL B C     1 
ATOM   2813 O  O     . VAL B 1 5   ? 20.902  -14.407 -36.682 1.00 63.15  ? 5   VAL B O     1 
ATOM   2814 C  CB    . VAL B 1 5   ? 22.696  -14.960 -39.219 1.00 64.92  ? 5   VAL B CB    1 
ATOM   2815 C  CG1   . VAL B 1 5   ? 23.577  -14.688 -37.993 1.00 64.48  ? 5   VAL B CG1   1 
ATOM   2816 C  CG2   . VAL B 1 5   ? 22.659  -16.456 -39.541 1.00 64.50  ? 5   VAL B CG2   1 
ATOM   2817 N  N     . PRO B 1 6   ? 19.563  -15.755 -37.909 1.00 63.16  ? 6   PRO B N     1 
ATOM   2818 C  CA    . PRO B 1 6   ? 18.837  -16.245 -36.731 1.00 62.20  ? 6   PRO B CA    1 
ATOM   2819 C  C     . PRO B 1 6   ? 19.559  -17.400 -36.074 1.00 61.45  ? 6   PRO B C     1 
ATOM   2820 O  O     . PRO B 1 6   ? 20.223  -18.174 -36.763 1.00 61.70  ? 6   PRO B O     1 
ATOM   2821 C  CB    . PRO B 1 6   ? 17.533  -16.758 -37.327 1.00 62.38  ? 6   PRO B CB    1 
ATOM   2822 C  CG    . PRO B 1 6   ? 17.935  -17.262 -38.668 1.00 63.04  ? 6   PRO B CG    1 
ATOM   2823 C  CD    . PRO B 1 6   ? 19.015  -16.334 -39.153 1.00 63.70  ? 6   PRO B CD    1 
ATOM   2824 N  N     . ASN B 1 7   ? 19.405  -17.517 -34.757 1.00 60.63  ? 7   ASN B N     1 
ATOM   2825 C  CA    . ASN B 1 7   ? 19.987  -18.621 -33.978 1.00 59.93  ? 7   ASN B CA    1 
ATOM   2826 C  C     . ASN B 1 7   ? 19.127  -19.900 -34.045 1.00 59.67  ? 7   ASN B C     1 
ATOM   2827 O  O     . ASN B 1 7   ? 18.173  -19.965 -34.807 1.00 60.10  ? 7   ASN B O     1 
ATOM   2828 C  CB    . ASN B 1 7   ? 20.197  -18.172 -32.524 1.00 59.25  ? 7   ASN B CB    1 
ATOM   2829 C  CG    . ASN B 1 7   ? 18.894  -18.027 -31.755 1.00 58.83  ? 7   ASN B CG    1 
ATOM   2830 O  OD1   . ASN B 1 7   ? 17.835  -18.459 -32.212 1.00 58.99  ? 7   ASN B OD1   1 
ATOM   2831 N  ND2   . ASN B 1 7   ? 18.964  -17.404 -30.589 1.00 58.41  ? 7   ASN B ND2   1 
ATOM   2832 N  N     . LYS B 1 8   ? 19.470  -20.904 -33.240 1.00 59.10  ? 8   LYS B N     1 
ATOM   2833 C  CA    . LYS B 1 8   ? 18.707  -22.157 -33.170 1.00 58.98  ? 8   LYS B CA    1 
ATOM   2834 C  C     . LYS B 1 8   ? 17.280  -21.933 -32.690 1.00 58.81  ? 8   LYS B C     1 
ATOM   2835 O  O     . LYS B 1 8   ? 16.339  -22.405 -33.323 1.00 59.25  ? 8   LYS B O     1 
ATOM   2836 C  CB    . LYS B 1 8   ? 19.427  -23.184 -32.257 1.00 58.49  ? 8   LYS B CB    1 
ATOM   2837 C  CG    . LYS B 1 8   ? 20.778  -23.708 -32.830 1.00 58.88  ? 8   LYS B CG    1 
ATOM   2838 C  CD    . LYS B 1 8   ? 20.621  -24.792 -33.915 1.00 59.56  ? 8   LYS B CD    1 
ATOM   2839 C  CE    . LYS B 1 8   ? 20.522  -24.223 -35.337 1.00 60.32  ? 8   LYS B CE    1 
ATOM   2840 N  NZ    . LYS B 1 8   ? 19.677  -25.059 -36.243 1.00 60.89  ? 8   LYS B NZ    1 
ATOM   2841 N  N     . GLU B 1 9   ? 17.140  -21.190 -31.595 1.00 58.31  ? 9   GLU B N     1 
ATOM   2842 C  CA    . GLU B 1 9   ? 15.842  -20.970 -30.943 1.00 58.19  ? 9   GLU B CA    1 
ATOM   2843 C  C     . GLU B 1 9   ? 14.871  -20.233 -31.853 1.00 58.91  ? 9   GLU B C     1 
ATOM   2844 O  O     . GLU B 1 9   ? 13.737  -20.665 -32.023 1.00 59.24  ? 9   GLU B O     1 
ATOM   2845 C  CB    . GLU B 1 9   ? 15.978  -20.162 -29.634 1.00 57.63  ? 9   GLU B CB    1 
ATOM   2846 C  CG    . GLU B 1 9   ? 16.555  -20.911 -28.433 1.00 56.91  ? 9   GLU B CG    1 
ATOM   2847 C  CD    . GLU B 1 9   ? 18.084  -20.980 -28.415 1.00 56.71  ? 9   GLU B CD    1 
ATOM   2848 O  OE1   . GLU B 1 9   ? 18.623  -21.884 -27.727 1.00 56.31  ? 9   GLU B OE1   1 
ATOM   2849 O  OE2   . GLU B 1 9   ? 18.763  -20.138 -29.066 1.00 57.07  ? 9   GLU B OE2   1 
ATOM   2850 N  N     . GLN B 1 10  ? 15.329  -19.118 -32.416 1.00 59.26  ? 10  GLN B N     1 
ATOM   2851 C  CA    . GLN B 1 10  ? 14.522  -18.281 -33.314 1.00 60.07  ? 10  GLN B CA    1 
ATOM   2852 C  C     . GLN B 1 10  ? 14.036  -19.061 -34.543 1.00 60.67  ? 10  GLN B C     1 
ATOM   2853 O  O     . GLN B 1 10  ? 12.893  -18.905 -34.963 1.00 61.25  ? 10  GLN B O     1 
ATOM   2854 C  CB    . GLN B 1 10  ? 15.320  -17.066 -33.788 1.00 60.48  ? 10  GLN B CB    1 
ATOM   2855 C  CG    . GLN B 1 10  ? 15.683  -16.069 -32.704 1.00 60.18  ? 10  GLN B CG    1 
ATOM   2856 C  CD    . GLN B 1 10  ? 16.753  -15.083 -33.167 1.00 60.68  ? 10  GLN B CD    1 
ATOM   2857 O  OE1   . GLN B 1 10  ? 17.896  -15.473 -33.457 1.00 60.60  ? 10  GLN B OE1   1 
ATOM   2858 N  NE2   . GLN B 1 10  ? 16.399  -13.796 -33.213 1.00 61.33  ? 10  GLN B NE2   1 
ATOM   2859 N  N     . THR B 1 11  ? 14.913  -19.900 -35.096 1.00 60.64  ? 11  THR B N     1 
ATOM   2860 C  CA    . THR B 1 11  ? 14.585  -20.810 -36.197 1.00 61.22  ? 11  THR B CA    1 
ATOM   2861 C  C     . THR B 1 11  ? 13.485  -21.805 -35.817 1.00 61.23  ? 11  THR B C     1 
ATOM   2862 O  O     . THR B 1 11  ? 12.550  -22.018 -36.583 1.00 61.94  ? 11  THR B O     1 
ATOM   2863 C  CB    . THR B 1 11  ? 15.840  -21.589 -36.652 1.00 61.20  ? 11  THR B CB    1 
ATOM   2864 O  OG1   . THR B 1 11  ? 16.855  -20.660 -37.054 1.00 61.39  ? 11  THR B OG1   1 
ATOM   2865 C  CG2   . THR B 1 11  ? 15.533  -22.521 -37.806 1.00 61.92  ? 11  THR B CG2   1 
ATOM   2866 N  N     . ARG B 1 12  ? 13.592  -22.404 -34.631 1.00 60.55  ? 12  ARG B N     1 
ATOM   2867 C  CA    . ARG B 1 12  ? 12.590  -23.381 -34.161 1.00 60.66  ? 12  ARG B CA    1 
ATOM   2868 C  C     . ARG B 1 12  ? 11.225  -22.752 -33.844 1.00 60.99  ? 12  ARG B C     1 
ATOM   2869 O  O     . ARG B 1 12  ? 10.193  -23.401 -34.029 1.00 61.59  ? 12  ARG B O     1 
ATOM   2870 C  CB    . ARG B 1 12  ? 13.113  -24.161 -32.953 1.00 59.93  ? 12  ARG B CB    1 
ATOM   2871 C  CG    . ARG B 1 12  ? 14.293  -25.064 -33.282 1.00 59.87  ? 12  ARG B CG    1 
ATOM   2872 C  CD    . ARG B 1 12  ? 15.238  -25.146 -32.110 1.00 59.05  ? 12  ARG B CD    1 
ATOM   2873 N  NE    . ARG B 1 12  ? 16.204  -26.237 -32.210 1.00 59.11  ? 12  ARG B NE    1 
ATOM   2874 C  CZ    . ARG B 1 12  ? 17.220  -26.439 -31.354 1.00 58.57  ? 12  ARG B CZ    1 
ATOM   2875 N  NH1   . ARG B 1 12  ? 17.459  -25.605 -30.336 1.00 57.87  ? 12  ARG B NH1   1 
ATOM   2876 N  NH2   . ARG B 1 12  ? 18.028  -27.479 -31.534 1.00 58.83  ? 12  ARG B NH2   1 
ATOM   2877 N  N     . THR B 1 13  ? 11.232  -21.503 -33.375 1.00 60.74  ? 13  THR B N     1 
ATOM   2878 C  CA    . THR B 1 13  ? 10.007  -20.729 -33.184 1.00 61.24  ? 13  THR B CA    1 
ATOM   2879 C  C     . THR B 1 13  ? 9.262   -20.555 -34.514 1.00 62.29  ? 13  THR B C     1 
ATOM   2880 O  O     . THR B 1 13  ? 8.051   -20.773 -34.588 1.00 62.97  ? 13  THR B O     1 
ATOM   2881 C  CB    . THR B 1 13  ? 10.309  -19.369 -32.517 1.00 60.93  ? 13  THR B CB    1 
ATOM   2882 O  OG1   . THR B 1 13  ? 10.509  -19.589 -31.125 1.00 60.15  ? 13  THR B OG1   1 
ATOM   2883 C  CG2   . THR B 1 13  ? 9.173   -18.376 -32.658 1.00 61.73  ? 13  THR B CG2   1 
ATOM   2884 N  N     . VAL B 1 14  ? 9.995   -20.194 -35.561 1.00 62.50  ? 14  VAL B N     1 
ATOM   2885 C  CA    . VAL B 1 14  ? 9.411   -20.007 -36.883 1.00 63.52  ? 14  VAL B CA    1 
ATOM   2886 C  C     . VAL B 1 14  ? 8.773   -21.309 -37.376 1.00 64.02  ? 14  VAL B C     1 
ATOM   2887 O  O     . VAL B 1 14  ? 7.717   -21.274 -37.995 1.00 64.95  ? 14  VAL B O     1 
ATOM   2888 C  CB    . VAL B 1 14  ? 10.450  -19.443 -37.881 1.00 63.67  ? 14  VAL B CB    1 
ATOM   2889 C  CG1   . VAL B 1 14  ? 9.963   -19.519 -39.322 1.00 64.72  ? 14  VAL B CG1   1 
ATOM   2890 C  CG2   . VAL B 1 14  ? 10.772  -18.001 -37.529 1.00 63.61  ? 14  VAL B CG2   1 
ATOM   2891 N  N     . LEU B 1 15  ? 9.379   -22.455 -37.082 1.00 63.54  ? 15  LEU B N     1 
ATOM   2892 C  CA    . LEU B 1 15  ? 8.759   -23.741 -37.424 1.00 64.14  ? 15  LEU B CA    1 
ATOM   2893 C  C     . LEU B 1 15  ? 7.442   -23.976 -36.676 1.00 64.52  ? 15  LEU B C     1 
ATOM   2894 O  O     . LEU B 1 15  ? 6.516   -24.551 -37.239 1.00 65.50  ? 15  LEU B O     1 
ATOM   2895 C  CB    . LEU B 1 15  ? 9.716   -24.898 -37.158 1.00 63.66  ? 15  LEU B CB    1 
ATOM   2896 C  CG    . LEU B 1 15  ? 10.953  -24.953 -38.049 1.00 63.60  ? 15  LEU B CG    1 
ATOM   2897 C  CD1   . LEU B 1 15  ? 11.990  -25.891 -37.444 1.00 63.02  ? 15  LEU B CD1   1 
ATOM   2898 C  CD2   . LEU B 1 15  ? 10.580  -25.376 -39.470 1.00 64.67  ? 15  LEU B CD2   1 
ATOM   2899 N  N     . ILE B 1 16  ? 7.368   -23.530 -35.422 1.00 63.86  ? 16  ILE B N     1 
ATOM   2900 C  CA    . ILE B 1 16  ? 6.110   -23.529 -34.672 1.00 64.32  ? 16  ILE B CA    1 
ATOM   2901 C  C     . ILE B 1 16  ? 5.094   -22.666 -35.427 1.00 65.35  ? 16  ILE B C     1 
ATOM   2902 O  O     . ILE B 1 16  ? 3.944   -23.059 -35.605 1.00 66.36  ? 16  ILE B O     1 
ATOM   2903 C  CB    . ILE B 1 16  ? 6.295   -23.040 -33.203 1.00 63.45  ? 16  ILE B CB    1 
ATOM   2904 C  CG1   . ILE B 1 16  ? 7.154   -24.045 -32.418 1.00 62.62  ? 16  ILE B CG1   1 
ATOM   2905 C  CG2   . ILE B 1 16  ? 4.953   -22.850 -32.502 1.00 64.10  ? 16  ILE B CG2   1 
ATOM   2906 C  CD1   . ILE B 1 16  ? 7.697   -23.527 -31.102 1.00 61.62  ? 16  ILE B CD1   1 
ATOM   2907 N  N     . PHE B 1 17  ? 5.533   -21.495 -35.871 1.00 65.22  ? 17  PHE B N     1 
ATOM   2908 C  CA    . PHE B 1 17  ? 4.679   -20.564 -36.604 1.00 66.25  ? 17  PHE B CA    1 
ATOM   2909 C  C     . PHE B 1 17  ? 4.132   -21.195 -37.862 1.00 67.31  ? 17  PHE B C     1 
ATOM   2910 O  O     . PHE B 1 17  ? 2.931   -21.237 -38.041 1.00 68.37  ? 17  PHE B O     1 
ATOM   2911 C  CB    . PHE B 1 17  ? 5.467   -19.308 -36.943 1.00 65.98  ? 17  PHE B CB    1 
ATOM   2912 C  CG    . PHE B 1 17  ? 4.669   -18.232 -37.585 1.00 67.06  ? 17  PHE B CG    1 
ATOM   2913 C  CD1   . PHE B 1 17  ? 3.530   -17.748 -36.983 1.00 67.72  ? 17  PHE B CD1   1 
ATOM   2914 C  CD2   . PHE B 1 17  ? 5.102   -17.651 -38.767 1.00 67.52  ? 17  PHE B CD2   1 
ATOM   2915 C  CE1   . PHE B 1 17  ? 2.809   -16.726 -37.565 1.00 68.85  ? 17  PHE B CE1   1 
ATOM   2916 C  CE2   . PHE B 1 17  ? 4.396   -16.625 -39.354 1.00 68.61  ? 17  PHE B CE2   1 
ATOM   2917 C  CZ    . PHE B 1 17  ? 3.244   -16.161 -38.751 1.00 69.29  ? 17  PHE B CZ    1 
ATOM   2918 N  N     . CYS B 1 18  ? 5.010   -21.723 -38.703 1.00 67.10  ? 18  CYS B N     1 
ATOM   2919 C  CA    . CYS B 1 18  ? 4.592   -22.385 -39.942 1.00 68.12  ? 18  CYS B CA    1 
ATOM   2920 C  C     . CYS B 1 18  ? 3.611   -23.540 -39.683 1.00 68.82  ? 18  CYS B C     1 
ATOM   2921 O  O     . CYS B 1 18  ? 2.573   -23.645 -40.331 1.00 70.06  ? 18  CYS B O     1 
ATOM   2922 C  CB    . CYS B 1 18  ? 5.813   -22.873 -40.722 1.00 67.74  ? 18  CYS B CB    1 
ATOM   2923 S  SG    . CYS B 1 18  ? 6.881   -21.539 -41.324 1.00 67.38  ? 18  CYS B SG    1 
ATOM   2924 N  N     . PHE B 1 19  ? 3.925   -24.365 -38.695 1.00 68.14  ? 19  PHE B N     1 
ATOM   2925 C  CA    . PHE B 1 19  ? 3.070   -25.482 -38.288 1.00 68.85  ? 19  PHE B CA    1 
ATOM   2926 C  C     . PHE B 1 19  ? 1.644   -25.035 -37.964 1.00 69.84  ? 19  PHE B C     1 
ATOM   2927 O  O     . PHE B 1 19  ? 0.686   -25.606 -38.478 1.00 71.15  ? 19  PHE B O     1 
ATOM   2928 C  CB    . PHE B 1 19  ? 3.706   -26.162 -37.072 1.00 67.85  ? 19  PHE B CB    1 
ATOM   2929 C  CG    . PHE B 1 19  ? 3.030   -27.424 -36.639 1.00 68.58  ? 19  PHE B CG    1 
ATOM   2930 C  CD1   . PHE B 1 19  ? 2.947   -28.507 -37.499 1.00 69.50  ? 19  PHE B CD1   1 
ATOM   2931 C  CD2   . PHE B 1 19  ? 2.523   -27.549 -35.354 1.00 68.45  ? 19  PHE B CD2   1 
ATOM   2932 C  CE1   . PHE B 1 19  ? 2.342   -29.684 -37.091 1.00 70.35  ? 19  PHE B CE1   1 
ATOM   2933 C  CE2   . PHE B 1 19  ? 1.918   -28.719 -34.941 1.00 69.27  ? 19  PHE B CE2   1 
ATOM   2934 C  CZ    . PHE B 1 19  ? 1.833   -29.791 -35.805 1.00 70.24  ? 19  PHE B CZ    1 
ATOM   2935 N  N     . HIS B 1 20  ? 1.520   -24.005 -37.123 1.00 69.34  ? 20  HIS B N     1 
ATOM   2936 C  CA    . HIS B 1 20  ? 0.213   -23.411 -36.759 1.00 70.35  ? 20  HIS B CA    1 
ATOM   2937 C  C     . HIS B 1 20  ? -0.499  -22.756 -37.936 1.00 71.58  ? 20  HIS B C     1 
ATOM   2938 O  O     . HIS B 1 20  ? -1.720  -22.641 -37.913 1.00 72.86  ? 20  HIS B O     1 
ATOM   2939 C  CB    . HIS B 1 20  ? 0.352   -22.364 -35.640 1.00 69.57  ? 20  HIS B CB    1 
ATOM   2940 C  CG    . HIS B 1 20  ? 0.504   -22.946 -34.275 1.00 68.84  ? 20  HIS B CG    1 
ATOM   2941 N  ND1   . HIS B 1 20  ? 1.715   -23.374 -33.780 1.00 67.49  ? 20  HIS B ND1   1 
ATOM   2942 C  CD2   . HIS B 1 20  ? -0.400  -23.151 -33.291 1.00 69.37  ? 20  HIS B CD2   1 
ATOM   2943 C  CE1   . HIS B 1 20  ? 1.549   -23.834 -32.555 1.00 67.18  ? 20  HIS B CE1   1 
ATOM   2944 N  NE2   . HIS B 1 20  ? 0.276   -23.705 -32.232 1.00 68.30  ? 20  HIS B NE2   1 
ATOM   2945 N  N     . LEU B 1 21  ? 0.261   -22.309 -38.940 1.00 71.30  ? 21  LEU B N     1 
ATOM   2946 C  CA    . LEU B 1 21  ? -0.302  -21.854 -40.212 1.00 72.52  ? 21  LEU B CA    1 
ATOM   2947 C  C     . LEU B 1 21  ? -0.667  -23.003 -41.145 1.00 73.49  ? 21  LEU B C     1 
ATOM   2948 O  O     . LEU B 1 21  ? -0.903  -22.773 -42.332 1.00 74.38  ? 21  LEU B O     1 
ATOM   2949 C  CB    . LEU B 1 21  ? 0.672   -20.917 -40.928 1.00 71.96  ? 21  LEU B CB    1 
ATOM   2950 C  CG    . LEU B 1 21  ? 0.998   -19.594 -40.251 1.00 71.36  ? 21  LEU B CG    1 
ATOM   2951 C  CD1   . LEU B 1 21  ? 2.026   -18.852 -41.088 1.00 71.01  ? 21  LEU B CD1   1 
ATOM   2952 C  CD2   . LEU B 1 21  ? -0.247  -18.749 -40.055 1.00 72.54  ? 21  LEU B CD2   1 
ATOM   2953 N  N     . LYS B 1 22  ? -0.716  -24.227 -40.617 1.00 73.41  ? 22  LYS B N     1 
ATOM   2954 C  CA    . LYS B 1 22  ? -1.128  -25.409 -41.359 1.00 74.50  ? 22  LYS B CA    1 
ATOM   2955 C  C     . LYS B 1 22  ? -0.207  -25.676 -42.550 1.00 74.30  ? 22  LYS B C     1 
ATOM   2956 O  O     . LYS B 1 22  ? -0.644  -26.243 -43.559 1.00 75.50  ? 22  LYS B O     1 
ATOM   2957 C  CB    . LYS B 1 22  ? -2.606  -25.302 -41.819 1.00 76.35  ? 22  LYS B CB    1 
ATOM   2958 C  CG    . LYS B 1 22  ? -3.597  -24.744 -40.795 1.00 76.82  ? 22  LYS B CG    1 
ATOM   2959 C  CD    . LYS B 1 22  ? -3.708  -25.574 -39.517 1.00 76.48  ? 22  LYS B CD    1 
ATOM   2960 C  CE    . LYS B 1 22  ? -4.407  -24.746 -38.391 1.00 76.58  ? 22  LYS B CE    1 
ATOM   2961 N  NZ    . LYS B 1 22  ? -5.904  -24.809 -38.467 1.00 78.56  ? 22  LYS B NZ    1 
ATOM   2962 N  N     . LYS B 1 23  ? 1.060   -25.280 -42.443 1.00 72.92  ? 23  LYS B N     1 
ATOM   2963 C  CA    . LYS B 1 23  ? 1.997   -25.452 -43.553 1.00 72.79  ? 23  LYS B CA    1 
ATOM   2964 C  C     . LYS B 1 23  ? 2.587   -26.850 -43.522 1.00 72.64  ? 23  LYS B C     1 
ATOM   2965 O  O     . LYS B 1 23  ? 2.577   -27.517 -42.482 1.00 72.23  ? 23  LYS B O     1 
ATOM   2966 C  CB    . LYS B 1 23  ? 3.115   -24.396 -43.539 1.00 71.63  ? 23  LYS B CB    1 
ATOM   2967 C  CG    . LYS B 1 23  ? 2.740   -23.063 -44.176 1.00 72.17  ? 23  LYS B CG    1 
ATOM   2968 C  CD    . LYS B 1 23  ? 2.313   -23.247 -45.638 1.00 73.48  ? 23  LYS B CD    1 
ATOM   2969 C  CE    . LYS B 1 23  ? 2.709   -22.083 -46.544 1.00 73.69  ? 23  LYS B CE    1 
ATOM   2970 N  NZ    . LYS B 1 23  ? 1.970   -20.828 -46.237 1.00 74.09  ? 23  LYS B NZ    1 
ATOM   2971 N  N     . THR B 1 24  ? 3.090   -27.274 -44.681 1.00 73.08  ? 24  THR B N     1 
ATOM   2972 C  CA    . THR B 1 24  ? 3.733   -28.569 -44.844 1.00 73.15  ? 24  THR B CA    1 
ATOM   2973 C  C     . THR B 1 24  ? 5.195   -28.371 -44.477 1.00 71.74  ? 24  THR B C     1 
ATOM   2974 O  O     . THR B 1 24  ? 5.681   -27.233 -44.442 1.00 70.98  ? 24  THR B O     1 
ATOM   2975 C  CB    . THR B 1 24  ? 3.615   -29.095 -46.287 1.00 74.41  ? 24  THR B CB    1 
ATOM   2976 O  OG1   . THR B 1 24  ? 4.568   -28.445 -47.119 1.00 74.00  ? 24  THR B OG1   1 
ATOM   2977 C  CG2   . THR B 1 24  ? 2.227   -28.851 -46.852 1.00 75.83  ? 24  THR B CG2   1 
ATOM   2978 N  N     . ALA B 1 25  ? 5.901   -29.466 -44.218 1.00 71.53  ? 25  ALA B N     1 
ATOM   2979 C  CA    . ALA B 1 25  ? 7.285   -29.377 -43.747 1.00 70.30  ? 25  ALA B CA    1 
ATOM   2980 C  C     . ALA B 1 25  ? 8.182   -28.703 -44.770 1.00 70.19  ? 25  ALA B C     1 
ATOM   2981 O  O     . ALA B 1 25  ? 8.816   -27.691 -44.473 1.00 69.29  ? 25  ALA B O     1 
ATOM   2982 C  CB    . ALA B 1 25  ? 7.830   -30.749 -43.404 1.00 70.39  ? 25  ALA B CB    1 
ATOM   2983 N  N     . ALA B 1 26  ? 8.195   -29.246 -45.983 1.00 71.23  ? 26  ALA B N     1 
ATOM   2984 C  CA    . ALA B 1 26  ? 9.027   -28.711 -47.050 1.00 71.35  ? 26  ALA B CA    1 
ATOM   2985 C  C     . ALA B 1 26  ? 8.634   -27.286 -47.463 1.00 71.36  ? 26  ALA B C     1 
ATOM   2986 O  O     . ALA B 1 26  ? 9.502   -26.509 -47.856 1.00 71.02  ? 26  ALA B O     1 
ATOM   2987 C  CB    . ALA B 1 26  ? 9.018   -29.645 -48.242 1.00 72.61  ? 26  ALA B CB    1 
ATOM   2988 N  N     . GLU B 1 27  ? 7.350   -26.935 -47.359 1.00 71.86  ? 27  GLU B N     1 
ATOM   2989 C  CA    . GLU B 1 27  ? 6.912   -25.559 -47.662 1.00 71.99  ? 27  GLU B CA    1 
ATOM   2990 C  C     . GLU B 1 27  ? 7.640   -24.586 -46.793 1.00 70.78  ? 27  GLU B C     1 
ATOM   2991 O  O     . GLU B 1 27  ? 8.232   -23.641 -47.287 1.00 70.70  ? 27  GLU B O     1 
ATOM   2992 C  CB    . GLU B 1 27  ? 5.401   -25.343 -47.488 1.00 72.76  ? 27  GLU B CB    1 
ATOM   2993 C  CG    . GLU B 1 27  ? 4.790   -24.036 -48.076 1.00 73.37  ? 27  GLU B CG    1 
ATOM   2994 C  CD    . GLU B 1 27  ? 5.111   -23.731 -49.540 1.00 74.18  ? 27  GLU B CD    1 
ATOM   2995 O  OE1   . GLU B 1 27  ? 4.154   -23.596 -50.341 1.00 75.42  ? 27  GLU B OE1   1 
ATOM   2996 O  OE2   . GLU B 1 27  ? 6.306   -23.593 -49.905 1.00 73.70  ? 27  GLU B OE2   1 
ATOM   2997 N  N     . SER B 1 28  ? 7.586   -24.848 -45.495 1.00 69.94  ? 28  SER B N     1 
ATOM   2998 C  CA    . SER B 1 28  ? 8.253   -24.028 -44.490 1.00 68.78  ? 28  SER B CA    1 
ATOM   2999 C  C     . SER B 1 28  ? 9.745   -23.844 -44.800 1.00 68.25  ? 28  SER B C     1 
ATOM   3000 O  O     . SER B 1 28  ? 10.242  -22.717 -44.848 1.00 68.00  ? 28  SER B O     1 
ATOM   3001 C  CB    . SER B 1 28  ? 8.077   -24.668 -43.117 1.00 68.05  ? 28  SER B CB    1 
ATOM   3002 O  OG    . SER B 1 28  ? 6.788   -25.244 -42.991 1.00 68.82  ? 28  SER B OG    1 
ATOM   3003 N  N     . HIS B 1 29  ? 10.432  -24.952 -45.069 1.00 68.30  ? 29  HIS B N     1 
ATOM   3004 C  CA    . HIS B 1 29  ? 11.853  -24.920 -45.413 1.00 68.01  ? 29  HIS B CA    1 
ATOM   3005 C  C     . HIS B 1 29  ? 12.149  -23.925 -46.540 1.00 68.61  ? 29  HIS B C     1 
ATOM   3006 O  O     . HIS B 1 29  ? 13.075  -23.135 -46.417 1.00 68.22  ? 29  HIS B O     1 
ATOM   3007 C  CB    . HIS B 1 29  ? 12.360  -26.320 -45.771 1.00 68.38  ? 29  HIS B CB    1 
ATOM   3008 C  CG    . HIS B 1 29  ? 13.817  -26.368 -46.131 1.00 68.27  ? 29  HIS B CG    1 
ATOM   3009 N  ND1   . HIS B 1 29  ? 14.341  -27.322 -46.970 1.00 69.03  ? 29  HIS B ND1   1 
ATOM   3010 C  CD2   . HIS B 1 29  ? 14.854  -25.572 -45.782 1.00 67.66  ? 29  HIS B CD2   1 
ATOM   3011 C  CE1   . HIS B 1 29  ? 15.639  -27.123 -47.117 1.00 68.89  ? 29  HIS B CE1   1 
ATOM   3012 N  NE2   . HIS B 1 29  ? 15.974  -26.062 -46.412 1.00 68.07  ? 29  HIS B NE2   1 
ATOM   3013 N  N     . ARG B 1 30  ? 11.352  -23.944 -47.607 1.00 69.66  ? 30  ARG B N     1 
ATOM   3014 C  CA    . ARG B 1 30  ? 11.512  -22.978 -48.706 1.00 70.38  ? 30  ARG B CA    1 
ATOM   3015 C  C     . ARG B 1 30  ? 11.328  -21.516 -48.271 1.00 70.10  ? 30  ARG B C     1 
ATOM   3016 O  O     . ARG B 1 30  ? 12.012  -20.632 -48.787 1.00 70.35  ? 30  ARG B O     1 
ATOM   3017 C  CB    . ARG B 1 30  ? 10.561  -23.302 -49.865 1.00 71.62  ? 30  ARG B CB    1 
ATOM   3018 C  CG    . ARG B 1 30  ? 10.924  -24.577 -50.609 1.00 72.21  ? 30  ARG B CG    1 
ATOM   3019 C  CD    . ARG B 1 30  ? 10.190  -24.676 -51.926 1.00 73.55  ? 30  ARG B CD    1 
ATOM   3020 N  NE    . ARG B 1 30  ? 8.741   -24.780 -51.742 1.00 74.01  ? 30  ARG B NE    1 
ATOM   3021 C  CZ    . ARG B 1 30  ? 8.063   -25.904 -51.492 1.00 74.35  ? 30  ARG B CZ    1 
ATOM   3022 N  NH1   . ARG B 1 30  ? 8.672   -27.078 -51.364 1.00 74.25  ? 30  ARG B NH1   1 
ATOM   3023 N  NH2   . ARG B 1 30  ? 6.744   -25.852 -51.370 1.00 74.94  ? 30  ARG B NH2   1 
ATOM   3024 N  N     . MET B 1 31  ? 10.413  -21.274 -47.330 1.00 69.72  ? 31  MET B N     1 
ATOM   3025 C  CA    . MET B 1 31  ? 10.198  -19.936 -46.778 1.00 69.51  ? 31  MET B CA    1 
ATOM   3026 C  C     . MET B 1 31  ? 11.370  -19.495 -45.925 1.00 68.54  ? 31  MET B C     1 
ATOM   3027 O  O     . MET B 1 31  ? 11.739  -18.329 -45.944 1.00 68.66  ? 31  MET B O     1 
ATOM   3028 C  CB    . MET B 1 31  ? 8.939   -19.881 -45.921 1.00 69.43  ? 31  MET B CB    1 
ATOM   3029 C  CG    . MET B 1 31  ? 7.645   -20.178 -46.656 1.00 70.56  ? 31  MET B CG    1 
ATOM   3030 S  SD    . MET B 1 31  ? 6.345   -20.660 -45.503 1.00 70.45  ? 31  MET B SD    1 
ATOM   3031 C  CE    . MET B 1 31  ? 6.190   -19.171 -44.522 1.00 70.04  ? 31  MET B CE    1 
ATOM   3032 N  N     . LEU B 1 32  ? 11.937  -20.421 -45.159 1.00 67.69  ? 32  LEU B N     1 
ATOM   3033 C  CA    . LEU B 1 32  ? 13.140  -20.124 -44.372 1.00 66.84  ? 32  LEU B CA    1 
ATOM   3034 C  C     . LEU B 1 32  ? 14.276  -19.580 -45.241 1.00 67.31  ? 32  LEU B C     1 
ATOM   3035 O  O     . LEU B 1 32  ? 14.951  -18.616 -44.858 1.00 67.11  ? 32  LEU B O     1 
ATOM   3036 C  CB    . LEU B 1 32  ? 13.625  -21.358 -43.592 1.00 66.07  ? 32  LEU B CB    1 
ATOM   3037 C  CG    . LEU B 1 32  ? 12.885  -21.698 -42.295 1.00 65.36  ? 32  LEU B CG    1 
ATOM   3038 C  CD1   . LEU B 1 32  ? 13.218  -23.107 -41.836 1.00 64.97  ? 32  LEU B CD1   1 
ATOM   3039 C  CD2   . LEU B 1 32  ? 13.220  -20.698 -41.207 1.00 64.61  ? 32  LEU B CD2   1 
ATOM   3040 N  N     . VAL B 1 33  ? 14.455  -20.187 -46.413 1.00 68.06  ? 33  VAL B N     1 
ATOM   3041 C  CA    . VAL B 1 33  ? 15.515  -19.794 -47.338 1.00 68.69  ? 33  VAL B CA    1 
ATOM   3042 C  C     . VAL B 1 33  ? 15.154  -18.475 -48.024 1.00 69.51  ? 33  VAL B C     1 
ATOM   3043 O  O     . VAL B 1 33  ? 16.022  -17.617 -48.204 1.00 69.81  ? 33  VAL B O     1 
ATOM   3044 C  CB    . VAL B 1 33  ? 15.814  -20.886 -48.389 1.00 69.35  ? 33  VAL B CB    1 
ATOM   3045 C  CG1   . VAL B 1 33  ? 16.976  -20.466 -49.289 1.00 70.07  ? 33  VAL B CG1   1 
ATOM   3046 C  CG2   . VAL B 1 33  ? 16.138  -22.210 -47.708 1.00 68.71  ? 33  VAL B CG2   1 
ATOM   3047 N  N     . GLU B 1 34  ? 13.882  -18.317 -48.394 1.00 70.01  ? 34  GLU B N     1 
ATOM   3048 C  CA    . GLU B 1 34  ? 13.376  -17.050 -48.938 1.00 70.87  ? 34  GLU B CA    1 
ATOM   3049 C  C     . GLU B 1 34  ? 13.694  -15.884 -47.998 1.00 70.47  ? 34  GLU B C     1 
ATOM   3050 O  O     . GLU B 1 34  ? 14.016  -14.785 -48.456 1.00 71.22  ? 34  GLU B O     1 
ATOM   3051 C  CB    . GLU B 1 34  ? 11.860  -17.135 -49.188 1.00 71.38  ? 34  GLU B CB    1 
ATOM   3052 C  CG    . GLU B 1 34  ? 11.252  -15.980 -49.977 1.00 72.55  ? 34  GLU B CG    1 
ATOM   3053 C  CD    . GLU B 1 34  ? 11.367  -16.150 -51.487 1.00 73.68  ? 34  GLU B CD    1 
ATOM   3054 O  OE1   . GLU B 1 34  ? 12.508  -16.260 -52.003 1.00 73.79  ? 34  GLU B OE1   1 
ATOM   3055 O  OE2   . GLU B 1 34  ? 10.307  -16.164 -52.174 1.00 74.56  ? 34  GLU B OE2   1 
ATOM   3056 N  N     . ALA B 1 35  ? 13.602  -16.140 -46.692 1.00 69.39  ? 35  ALA B N     1 
ATOM   3057 C  CA    . ALA B 1 35  ? 13.888  -15.139 -45.669 1.00 68.97  ? 35  ALA B CA    1 
ATOM   3058 C  C     . ALA B 1 35  ? 15.377  -14.980 -45.417 1.00 68.65  ? 35  ALA B C     1 
ATOM   3059 O  O     . ALA B 1 35  ? 15.943  -13.916 -45.666 1.00 69.29  ? 35  ALA B O     1 
ATOM   3060 C  CB    . ALA B 1 35  ? 13.191  -15.506 -44.375 1.00 68.02  ? 35  ALA B CB    1 
ATOM   3061 N  N     . PHE B 1 36  ? 16.005  -16.050 -44.939 1.00 67.82  ? 36  PHE B N     1 
ATOM   3062 C  CA    . PHE B 1 36  ? 17.341  -15.974 -44.349 1.00 67.38  ? 36  PHE B CA    1 
ATOM   3063 C  C     . PHE B 1 36  ? 18.493  -16.484 -45.215 1.00 67.88  ? 36  PHE B C     1 
ATOM   3064 O  O     . PHE B 1 36  ? 19.641  -16.512 -44.757 1.00 67.64  ? 36  PHE B O     1 
ATOM   3065 C  CB    . PHE B 1 36  ? 17.346  -16.739 -43.028 1.00 66.15  ? 36  PHE B CB    1 
ATOM   3066 C  CG    . PHE B 1 36  ? 16.257  -16.325 -42.077 1.00 65.67  ? 36  PHE B CG    1 
ATOM   3067 C  CD1   . PHE B 1 36  ? 16.052  -14.982 -41.764 1.00 66.00  ? 36  PHE B CD1   1 
ATOM   3068 C  CD2   . PHE B 1 36  ? 15.444  -17.278 -41.474 1.00 65.03  ? 36  PHE B CD2   1 
ATOM   3069 C  CE1   . PHE B 1 36  ? 15.057  -14.600 -40.878 1.00 65.68  ? 36  PHE B CE1   1 
ATOM   3070 C  CE2   . PHE B 1 36  ? 14.449  -16.901 -40.588 1.00 64.71  ? 36  PHE B CE2   1 
ATOM   3071 C  CZ    . PHE B 1 36  ? 14.256  -15.562 -40.287 1.00 65.02  ? 36  PHE B CZ    1 
ATOM   3072 N  N     . GLY B 1 37  ? 18.206  -16.868 -46.453 1.00 68.68  ? 37  GLY B N     1 
ATOM   3073 C  CA    . GLY B 1 37  ? 19.229  -17.419 -47.333 1.00 69.29  ? 37  GLY B CA    1 
ATOM   3074 C  C     . GLY B 1 37  ? 19.595  -18.848 -46.972 1.00 68.66  ? 37  GLY B C     1 
ATOM   3075 O  O     . GLY B 1 37  ? 18.903  -19.507 -46.183 1.00 67.83  ? 37  GLY B O     1 
ATOM   3076 N  N     . GLU B 1 38  ? 20.710  -19.313 -47.533 1.00 69.19  ? 38  GLU B N     1 
ATOM   3077 C  CA    . GLU B 1 38  ? 21.053  -20.743 -47.536 1.00 69.02  ? 38  GLU B CA    1 
ATOM   3078 C  C     . GLU B 1 38  ? 21.625  -21.251 -46.190 1.00 68.01  ? 38  GLU B C     1 
ATOM   3079 O  O     . GLU B 1 38  ? 21.950  -22.435 -46.071 1.00 67.91  ? 38  GLU B O     1 
ATOM   3080 C  CB    . GLU B 1 38  ? 21.909  -21.107 -48.791 1.00 70.21  ? 38  GLU B CB    1 
ATOM   3081 C  CG    . GLU B 1 38  ? 21.087  -21.392 -50.077 1.00 71.08  ? 38  GLU B CG    1 
ATOM   3082 C  CD    . GLU B 1 38  ? 21.862  -22.019 -51.244 1.00 72.23  ? 38  GLU B CD    1 
ATOM   3083 O  OE1   . GLU B 1 38  ? 22.182  -23.230 -51.182 1.00 72.23  ? 38  GLU B OE1   1 
ATOM   3084 O  OE2   . GLU B 1 38  ? 22.090  -21.323 -52.266 1.00 73.26  ? 38  GLU B OE2   1 
ATOM   3085 N  N     . GLN B 1 39  ? 21.650  -20.401 -45.154 1.00 67.31  ? 39  GLN B N     1 
ATOM   3086 C  CA    . GLN B 1 39  ? 22.297  -20.742 -43.869 1.00 66.43  ? 39  GLN B CA    1 
ATOM   3087 C  C     . GLN B 1 39  ? 21.462  -21.736 -43.058 1.00 65.55  ? 39  GLN B C     1 
ATOM   3088 O  O     . GLN B 1 39  ? 21.995  -22.493 -42.254 1.00 65.03  ? 39  GLN B O     1 
ATOM   3089 C  CB    . GLN B 1 39  ? 22.574  -19.488 -43.002 1.00 66.07  ? 39  GLN B CB    1 
ATOM   3090 C  CG    . GLN B 1 39  ? 22.989  -18.208 -43.732 1.00 67.04  ? 39  GLN B CG    1 
ATOM   3091 C  CD    . GLN B 1 39  ? 23.936  -18.433 -44.905 1.00 68.19  ? 39  GLN B CD    1 
ATOM   3092 O  OE1   . GLN B 1 39  ? 25.137  -18.649 -44.714 1.00 68.45  ? 39  GLN B OE1   1 
ATOM   3093 N  NE2   . GLN B 1 39  ? 23.399  -18.369 -46.129 1.00 68.99  ? 39  GLN B NE2   1 
ATOM   3094 N  N     . VAL B 1 40  ? 20.159  -21.728 -43.305 1.00 65.52  ? 40  VAL B N     1 
ATOM   3095 C  CA    . VAL B 1 40  ? 19.176  -22.453 -42.501 1.00 64.82  ? 40  VAL B CA    1 
ATOM   3096 C  C     . VAL B 1 40  ? 19.266  -23.966 -42.648 1.00 64.96  ? 40  VAL B C     1 
ATOM   3097 O  O     . VAL B 1 40  ? 19.948  -24.448 -43.534 1.00 65.70  ? 40  VAL B O     1 
ATOM   3098 C  CB    . VAL B 1 40  ? 17.743  -21.983 -42.843 1.00 65.03  ? 40  VAL B CB    1 
ATOM   3099 C  CG1   . VAL B 1 40  ? 17.623  -20.470 -42.667 1.00 65.03  ? 40  VAL B CG1   1 
ATOM   3100 C  CG2   . VAL B 1 40  ? 17.320  -22.419 -44.245 1.00 66.04  ? 40  VAL B CG2   1 
ATOM   3101 N  N     . PRO B 1 41  ? 18.554  -24.717 -41.785 1.00 64.40  ? 41  PRO B N     1 
ATOM   3102 C  CA    . PRO B 1 41  ? 18.745  -26.161 -41.772 1.00 64.62  ? 41  PRO B CA    1 
ATOM   3103 C  C     . PRO B 1 41  ? 18.148  -26.886 -42.954 1.00 65.60  ? 41  PRO B C     1 
ATOM   3104 O  O     . PRO B 1 41  ? 17.432  -26.300 -43.752 1.00 66.05  ? 41  PRO B O     1 
ATOM   3105 C  CB    . PRO B 1 41  ? 18.015  -26.610 -40.489 1.00 63.85  ? 41  PRO B CB    1 
ATOM   3106 C  CG    . PRO B 1 41  ? 17.779  -25.379 -39.706 1.00 63.10  ? 41  PRO B CG    1 
ATOM   3107 C  CD    . PRO B 1 41  ? 17.615  -24.308 -40.725 1.00 63.65  ? 41  PRO B CD    1 
ATOM   3108 N  N     . THR B 1 42  ? 18.412  -28.184 -43.004 1.00 65.99  ? 42  THR B N     1 
ATOM   3109 C  CA    . THR B 1 42  ? 17.872  -29.050 -44.027 1.00 67.02  ? 42  THR B CA    1 
ATOM   3110 C  C     . THR B 1 42  ? 16.365  -29.202 -43.879 1.00 67.08  ? 42  THR B C     1 
ATOM   3111 O  O     . THR B 1 42  ? 15.790  -28.850 -42.857 1.00 66.30  ? 42  THR B O     1 
ATOM   3112 C  CB    . THR B 1 42  ? 18.510  -30.452 -43.965 1.00 67.53  ? 42  THR B CB    1 
ATOM   3113 O  OG1   . THR B 1 42  ? 18.318  -31.011 -42.665 1.00 66.86  ? 42  THR B OG1   1 
ATOM   3114 C  CG2   . THR B 1 42  ? 19.991  -30.385 -44.258 1.00 67.78  ? 42  THR B CG2   1 
ATOM   3115 N  N     . VAL B 1 43  ? 15.728  -29.731 -44.919 1.00 68.11  ? 43  VAL B N     1 
ATOM   3116 C  CA    . VAL B 1 43  ? 14.316  -30.106 -44.850 1.00 68.48  ? 43  VAL B CA    1 
ATOM   3117 C  C     . VAL B 1 43  ? 14.091  -31.210 -43.824 1.00 68.33  ? 43  VAL B C     1 
ATOM   3118 O  O     . VAL B 1 43  ? 13.030  -31.283 -43.222 1.00 68.24  ? 43  VAL B O     1 
ATOM   3119 C  CB    . VAL B 1 43  ? 13.782  -30.594 -46.224 1.00 69.82  ? 43  VAL B CB    1 
ATOM   3120 C  CG1   . VAL B 1 43  ? 14.272  -32.005 -46.568 1.00 70.68  ? 43  VAL B CG1   1 
ATOM   3121 C  CG2   . VAL B 1 43  ? 12.254  -30.511 -46.283 1.00 70.26  ? 43  VAL B CG2   1 
ATOM   3122 N  N     . LYS B 1 44  ? 15.085  -32.080 -43.660 1.00 68.45  ? 44  LYS B N     1 
ATOM   3123 C  CA    . LYS B 1 44  ? 14.945  -33.249 -42.818 1.00 68.58  ? 44  LYS B CA    1 
ATOM   3124 C  C     . LYS B 1 44  ? 14.707  -32.852 -41.388 1.00 67.44  ? 44  LYS B C     1 
ATOM   3125 O  O     . LYS B 1 44  ? 13.890  -33.476 -40.729 1.00 67.61  ? 44  LYS B O     1 
ATOM   3126 C  CB    . LYS B 1 44  ? 16.173  -34.162 -42.922 1.00 69.01  ? 44  LYS B CB    1 
ATOM   3127 C  CG    . LYS B 1 44  ? 16.064  -35.482 -42.166 1.00 69.44  ? 44  LYS B CG    1 
ATOM   3128 C  CD    . LYS B 1 44  ? 14.951  -36.384 -42.666 1.00 70.69  ? 44  LYS B CD    1 
ATOM   3129 C  CE    . LYS B 1 44  ? 14.996  -37.724 -41.963 1.00 71.32  ? 44  LYS B CE    1 
ATOM   3130 N  NZ    . LYS B 1 44  ? 13.847  -38.614 -42.270 1.00 72.64  ? 44  LYS B NZ    1 
ATOM   3131 N  N     . THR B 1 45  ? 15.403  -31.824 -40.903 1.00 66.39  ? 45  THR B N     1 
ATOM   3132 C  CA    . THR B 1 45  ? 15.194  -31.379 -39.522 1.00 65.32  ? 45  THR B CA    1 
ATOM   3133 C  C     . THR B 1 45  ? 13.833  -30.720 -39.364 1.00 65.23  ? 45  THR B C     1 
ATOM   3134 O  O     . THR B 1 45  ? 13.163  -30.946 -38.363 1.00 64.94  ? 45  THR B O     1 
ATOM   3135 C  CB    . THR B 1 45  ? 16.328  -30.487 -38.977 1.00 64.34  ? 45  THR B CB    1 
ATOM   3136 O  OG1   . THR B 1 45  ? 16.614  -29.426 -39.886 1.00 64.43  ? 45  THR B OG1   1 
ATOM   3137 C  CG2   . THR B 1 45  ? 17.573  -31.305 -38.763 1.00 64.45  ? 45  THR B CG2   1 
ATOM   3138 N  N     . CYS B 1 46  ? 13.386  -29.965 -40.361 1.00 65.63  ? 46  CYS B N     1 
ATOM   3139 C  CA    . CYS B 1 46  ? 12.036  -29.408 -40.317 1.00 65.82  ? 46  CYS B CA    1 
ATOM   3140 C  C     . CYS B 1 46  ? 10.985  -30.513 -40.144 1.00 66.62  ? 46  CYS B C     1 
ATOM   3141 O  O     . CYS B 1 46  ? 10.123  -30.414 -39.270 1.00 66.45  ? 46  CYS B O     1 
ATOM   3142 C  CB    . CYS B 1 46  ? 11.743  -28.582 -41.563 1.00 66.39  ? 46  CYS B CB    1 
ATOM   3143 S  SG    . CYS B 1 46  ? 12.917  -27.237 -41.856 1.00 65.75  ? 46  CYS B SG    1 
ATOM   3144 N  N     . GLU B 1 47  ? 11.097  -31.572 -40.951 1.00 67.62  ? 47  GLU B N     1 
ATOM   3145 C  CA    . GLU B 1 47  ? 10.228  -32.766 -40.851 1.00 68.63  ? 47  GLU B CA    1 
ATOM   3146 C  C     . GLU B 1 47  ? 10.234  -33.376 -39.438 1.00 68.16  ? 47  GLU B C     1 
ATOM   3147 O  O     . GLU B 1 47  ? 9.196   -33.817 -38.939 1.00 68.70  ? 47  GLU B O     1 
ATOM   3148 C  CB    . GLU B 1 47  ? 10.640  -33.830 -41.890 1.00 69.77  ? 47  GLU B CB    1 
ATOM   3149 C  CG    . GLU B 1 47  ? 10.374  -33.427 -43.337 1.00 70.57  ? 47  GLU B CG    1 
ATOM   3150 C  CD    . GLU B 1 47  ? 11.074  -34.291 -44.384 1.00 71.55  ? 47  GLU B CD    1 
ATOM   3151 O  OE1   . GLU B 1 47  ? 11.981  -35.078 -44.046 1.00 71.52  ? 47  GLU B OE1   1 
ATOM   3152 O  OE2   . GLU B 1 47  ? 10.718  -34.166 -45.581 1.00 72.45  ? 47  GLU B OE2   1 
ATOM   3153 N  N     . ARG B 1 48  ? 11.408  -33.393 -38.804 1.00 67.26  ? 48  ARG B N     1 
ATOM   3154 C  CA    . ARG B 1 48  ? 11.552  -33.914 -37.450 1.00 66.76  ? 48  ARG B CA    1 
ATOM   3155 C  C     . ARG B 1 48  ? 10.797  -33.057 -36.442 1.00 65.98  ? 48  ARG B C     1 
ATOM   3156 O  O     . ARG B 1 48  ? 9.939   -33.563 -35.725 1.00 66.36  ? 48  ARG B O     1 
ATOM   3157 C  CB    . ARG B 1 48  ? 13.031  -34.050 -37.063 1.00 66.04  ? 48  ARG B CB    1 
ATOM   3158 C  CG    . ARG B 1 48  ? 13.707  -35.313 -37.591 1.00 67.01  ? 48  ARG B CG    1 
ATOM   3159 C  CD    . ARG B 1 48  ? 15.196  -35.119 -37.835 1.00 66.60  ? 48  ARG B CD    1 
ATOM   3160 N  NE    . ARG B 1 48  ? 15.842  -36.333 -38.335 1.00 67.67  ? 48  ARG B NE    1 
ATOM   3161 C  CZ    . ARG B 1 48  ? 17.036  -36.384 -38.932 1.00 67.88  ? 48  ARG B CZ    1 
ATOM   3162 N  NH1   . ARG B 1 48  ? 17.758  -35.282 -39.138 1.00 67.09  ? 48  ARG B NH1   1 
ATOM   3163 N  NH2   . ARG B 1 48  ? 17.508  -37.554 -39.349 1.00 69.04  ? 48  ARG B NH2   1 
ATOM   3164 N  N     . TRP B 1 49  ? 11.098  -31.763 -36.389 1.00 65.05  ? 49  TRP B N     1 
ATOM   3165 C  CA    . TRP B 1 49  ? 10.411  -30.846 -35.454 1.00 64.39  ? 49  TRP B CA    1 
ATOM   3166 C  C     . TRP B 1 49  ? 8.876   -30.876 -35.573 1.00 65.29  ? 49  TRP B C     1 
ATOM   3167 O  O     . TRP B 1 49  ? 8.163   -30.753 -34.562 1.00 65.14  ? 49  TRP B O     1 
ATOM   3168 C  CB    . TRP B 1 49  ? 10.927  -29.409 -35.616 1.00 63.57  ? 49  TRP B CB    1 
ATOM   3169 C  CG    . TRP B 1 49  ? 12.213  -29.210 -34.926 1.00 62.57  ? 49  TRP B CG    1 
ATOM   3170 C  CD1   . TRP B 1 49  ? 13.447  -29.234 -35.476 1.00 62.44  ? 49  TRP B CD1   1 
ATOM   3171 C  CD2   . TRP B 1 49  ? 12.399  -29.002 -33.530 1.00 61.70  ? 49  TRP B CD2   1 
ATOM   3172 N  NE1   . TRP B 1 49  ? 14.409  -29.045 -34.509 1.00 61.56  ? 49  TRP B NE1   1 
ATOM   3173 C  CE2   . TRP B 1 49  ? 13.787  -28.897 -33.302 1.00 61.05  ? 49  TRP B CE2   1 
ATOM   3174 C  CE3   . TRP B 1 49  ? 11.524  -28.890 -32.443 1.00 61.49  ? 49  TRP B CE3   1 
ATOM   3175 C  CZ2   . TRP B 1 49  ? 14.323  -28.683 -32.039 1.00 60.18  ? 49  TRP B CZ2   1 
ATOM   3176 C  CZ3   . TRP B 1 49  ? 12.056  -28.675 -31.185 1.00 60.58  ? 49  TRP B CZ3   1 
ATOM   3177 C  CH2   . TRP B 1 49  ? 13.450  -28.569 -30.995 1.00 59.92  ? 49  TRP B CH2   1 
ATOM   3178 N  N     . PHE B 1 50  ? 8.390   -31.060 -36.796 1.00 66.31  ? 50  PHE B N     1 
ATOM   3179 C  CA    . PHE B 1 50  ? 6.975   -31.267 -37.036 1.00 67.45  ? 50  PHE B CA    1 
ATOM   3180 C  C     . PHE B 1 50  ? 6.427   -32.493 -36.308 1.00 68.16  ? 50  PHE B C     1 
ATOM   3181 O  O     . PHE B 1 50  ? 5.298   -32.459 -35.817 1.00 68.73  ? 50  PHE B O     1 
ATOM   3182 C  CB    . PHE B 1 50  ? 6.696   -31.346 -38.543 1.00 68.50  ? 50  PHE B CB    1 
ATOM   3183 C  CG    . PHE B 1 50  ? 6.418   -30.010 -39.181 1.00 68.36  ? 50  PHE B CG    1 
ATOM   3184 C  CD1   . PHE B 1 50  ? 7.095   -28.854 -38.778 1.00 67.18  ? 50  PHE B CD1   1 
ATOM   3185 C  CD2   . PHE B 1 50  ? 5.470   -29.903 -40.193 1.00 69.56  ? 50  PHE B CD2   1 
ATOM   3186 C  CE1   . PHE B 1 50  ? 6.824   -27.629 -39.371 1.00 67.24  ? 50  PHE B CE1   1 
ATOM   3187 C  CE2   . PHE B 1 50  ? 5.200   -28.681 -40.785 1.00 69.57  ? 50  PHE B CE2   1 
ATOM   3188 C  CZ    . PHE B 1 50  ? 5.876   -27.541 -40.375 1.00 68.43  ? 50  PHE B CZ    1 
ATOM   3189 N  N     . GLN B 1 51  ? 7.218   -33.561 -36.220 1.00 68.25  ? 51  GLN B N     1 
ATOM   3190 C  CA    . GLN B 1 51  ? 6.828   -34.727 -35.414 1.00 68.94  ? 51  GLN B CA    1 
ATOM   3191 C  C     . GLN B 1 51  ? 6.624   -34.340 -33.952 1.00 68.09  ? 51  GLN B C     1 
ATOM   3192 O  O     . GLN B 1 51  ? 5.610   -34.697 -33.358 1.00 68.84  ? 51  GLN B O     1 
ATOM   3193 C  CB    . GLN B 1 51  ? 7.840   -35.874 -35.513 1.00 69.18  ? 51  GLN B CB    1 
ATOM   3194 C  CG    . GLN B 1 51  ? 7.994   -36.446 -36.914 1.00 70.28  ? 51  GLN B CG    1 
ATOM   3195 C  CD    . GLN B 1 51  ? 8.922   -37.646 -36.976 1.00 70.78  ? 51  GLN B CD    1 
ATOM   3196 O  OE1   . GLN B 1 51  ? 9.633   -37.957 -36.019 1.00 70.14  ? 51  GLN B OE1   1 
ATOM   3197 N  NE2   . GLN B 1 51  ? 8.912   -38.334 -38.112 1.00 72.04  ? 51  GLN B NE2   1 
ATOM   3198 N  N     . ARG B 1 52  ? 7.565   -33.583 -33.391 1.00 66.64  ? 52  ARG B N     1 
ATOM   3199 C  CA    . ARG B 1 52  ? 7.459   -33.131 -31.991 1.00 65.78  ? 52  ARG B CA    1 
ATOM   3200 C  C     . ARG B 1 52  ? 6.283   -32.212 -31.718 1.00 65.92  ? 52  ARG B C     1 
ATOM   3201 O  O     . ARG B 1 52  ? 5.662   -32.289 -30.652 1.00 66.00  ? 52  ARG B O     1 
ATOM   3202 C  CB    . ARG B 1 52  ? 8.732   -32.435 -31.527 1.00 64.30  ? 52  ARG B CB    1 
ATOM   3203 C  CG    . ARG B 1 52  ? 9.808   -33.393 -31.026 1.00 64.05  ? 52  ARG B CG    1 
ATOM   3204 C  CD    . ARG B 1 52  ? 10.334  -32.982 -29.699 1.00 62.92  ? 52  ARG B CD    1 
ATOM   3205 N  NE    . ARG B 1 52  ? 11.772  -33.218 -29.642 1.00 62.32  ? 52  ARG B NE    1 
ATOM   3206 C  CZ    . ARG B 1 52  ? 12.722  -32.296 -29.455 1.00 61.26  ? 52  ARG B CZ    1 
ATOM   3207 N  NH1   . ARG B 1 52  ? 12.431  -31.011 -29.263 1.00 60.60  ? 52  ARG B NH1   1 
ATOM   3208 N  NH2   . ARG B 1 52  ? 13.997  -32.680 -29.431 1.00 60.99  ? 52  ARG B NH2   1 
ATOM   3209 N  N     . PHE B 1 53  ? 5.976   -31.351 -32.679 1.00 66.08  ? 53  PHE B N     1 
ATOM   3210 C  CA    . PHE B 1 53  ? 4.807   -30.500 -32.554 1.00 66.48  ? 53  PHE B CA    1 
ATOM   3211 C  C     . PHE B 1 53  ? 3.504   -31.317 -32.619 1.00 68.06  ? 53  PHE B C     1 
ATOM   3212 O  O     . PHE B 1 53  ? 2.565   -31.015 -31.881 1.00 68.44  ? 53  PHE B O     1 
ATOM   3213 C  CB    . PHE B 1 53  ? 4.790   -29.407 -33.624 1.00 66.45  ? 53  PHE B CB    1 
ATOM   3214 C  CG    . PHE B 1 53  ? 6.031   -28.556 -33.675 1.00 65.16  ? 53  PHE B CG    1 
ATOM   3215 C  CD1   . PHE B 1 53  ? 6.714   -28.197 -32.520 1.00 64.01  ? 53  PHE B CD1   1 
ATOM   3216 C  CD2   . PHE B 1 53  ? 6.480   -28.068 -34.900 1.00 65.24  ? 53  PHE B CD2   1 
ATOM   3217 C  CE1   . PHE B 1 53  ? 7.834   -27.395 -32.589 1.00 63.01  ? 53  PHE B CE1   1 
ATOM   3218 C  CE2   . PHE B 1 53  ? 7.593   -27.264 -34.972 1.00 64.27  ? 53  PHE B CE2   1 
ATOM   3219 C  CZ    . PHE B 1 53  ? 8.273   -26.928 -33.815 1.00 63.18  ? 53  PHE B CZ    1 
ATOM   3220 N  N     . LYS B 1 54  ? 3.455   -32.344 -33.479 1.00 69.09  ? 54  LYS B N     1 
ATOM   3221 C  CA    . LYS B 1 54  ? 2.302   -33.268 -33.536 1.00 70.78  ? 54  LYS B CA    1 
ATOM   3222 C  C     . LYS B 1 54  ? 2.033   -34.027 -32.224 1.00 71.02  ? 54  LYS B C     1 
ATOM   3223 O  O     . LYS B 1 54  ? 0.912   -34.487 -32.001 1.00 72.40  ? 54  LYS B O     1 
ATOM   3224 C  CB    . LYS B 1 54  ? 2.420   -34.252 -34.717 1.00 71.89  ? 54  LYS B CB    1 
ATOM   3225 C  CG    . LYS B 1 54  ? 2.068   -33.616 -36.059 1.00 72.40  ? 54  LYS B CG    1 
ATOM   3226 C  CD    . LYS B 1 54  ? 1.986   -34.607 -37.212 1.00 73.77  ? 54  LYS B CD    1 
ATOM   3227 C  CE    . LYS B 1 54  ? 1.755   -33.882 -38.534 1.00 74.13  ? 54  LYS B CE    1 
ATOM   3228 N  NZ    . LYS B 1 54  ? 1.443   -34.809 -39.662 1.00 75.72  ? 54  LYS B NZ    1 
ATOM   3229 N  N     . SER B 1 55  ? 3.055   -34.161 -31.375 1.00 69.79  ? 55  SER B N     1 
ATOM   3230 C  CA    . SER B 1 55  ? 2.879   -34.606 -29.991 1.00 69.74  ? 55  SER B CA    1 
ATOM   3231 C  C     . SER B 1 55  ? 2.974   -33.423 -29.026 1.00 68.44  ? 55  SER B C     1 
ATOM   3232 O  O     . SER B 1 55  ? 3.558   -33.553 -27.953 1.00 67.61  ? 55  SER B O     1 
ATOM   3233 C  CB    . SER B 1 55  ? 3.933   -35.662 -29.636 1.00 69.46  ? 55  SER B CB    1 
ATOM   3234 O  OG    . SER B 1 55  ? 5.215   -35.079 -29.450 1.00 67.81  ? 55  SER B OG    1 
ATOM   3235 N  N     . GLY B 1 56  ? 2.425   -32.272 -29.410 1.00 68.35  ? 56  GLY B N     1 
ATOM   3236 C  CA    . GLY B 1 56  ? 2.386   -31.074 -28.563 1.00 67.38  ? 56  GLY B CA    1 
ATOM   3237 C  C     . GLY B 1 56  ? 3.613   -30.663 -27.750 1.00 65.72  ? 56  GLY B C     1 
ATOM   3238 O  O     . GLY B 1 56  ? 3.462   -29.976 -26.729 1.00 65.16  ? 56  GLY B O     1 
ATOM   3239 N  N     . ASP B 1 57  ? 4.815   -31.048 -28.191 1.00 65.03  ? 57  ASP B N     1 
ATOM   3240 C  CA    . ASP B 1 57  ? 6.052   -30.685 -27.492 1.00 63.58  ? 57  ASP B CA    1 
ATOM   3241 C  C     . ASP B 1 57  ? 6.645   -29.445 -28.154 1.00 62.77  ? 57  ASP B C     1 
ATOM   3242 O  O     . ASP B 1 57  ? 7.454   -29.551 -29.081 1.00 62.60  ? 57  ASP B O     1 
ATOM   3243 C  CB    . ASP B 1 57  ? 7.058   -31.848 -27.499 1.00 63.46  ? 57  ASP B CB    1 
ATOM   3244 C  CG    . ASP B 1 57  ? 8.328   -31.551 -26.662 1.00 62.11  ? 57  ASP B CG    1 
ATOM   3245 O  OD1   . ASP B 1 57  ? 8.596   -30.379 -26.316 1.00 61.19  ? 57  ASP B OD1   1 
ATOM   3246 O  OD2   . ASP B 1 57  ? 9.073   -32.506 -26.368 1.00 62.08  ? 57  ASP B OD2   1 
ATOM   3247 N  N     . PHE B 1 58  ? 6.243   -28.276 -27.667 1.00 62.41  ? 58  PHE B N     1 
ATOM   3248 C  CA    . PHE B 1 58  ? 6.737   -27.004 -28.192 1.00 61.80  ? 58  PHE B CA    1 
ATOM   3249 C  C     . PHE B 1 58  ? 7.934   -26.458 -27.410 1.00 60.53  ? 58  PHE B C     1 
ATOM   3250 O  O     . PHE B 1 58  ? 8.252   -25.264 -27.497 1.00 60.07  ? 58  PHE B O     1 
ATOM   3251 C  CB    . PHE B 1 58  ? 5.592   -25.998 -28.245 1.00 62.40  ? 58  PHE B CB    1 
ATOM   3252 C  CG    . PHE B 1 58  ? 4.426   -26.480 -29.051 1.00 63.77  ? 58  PHE B CG    1 
ATOM   3253 C  CD1   . PHE B 1 58  ? 4.472   -26.455 -30.441 1.00 64.26  ? 58  PHE B CD1   1 
ATOM   3254 C  CD2   . PHE B 1 58  ? 3.294   -26.992 -28.430 1.00 64.69  ? 58  PHE B CD2   1 
ATOM   3255 C  CE1   . PHE B 1 58  ? 3.405   -26.913 -31.197 1.00 65.62  ? 58  PHE B CE1   1 
ATOM   3256 C  CE2   . PHE B 1 58  ? 2.221   -27.452 -29.181 1.00 66.11  ? 58  PHE B CE2   1 
ATOM   3257 C  CZ    . PHE B 1 58  ? 2.278   -27.414 -30.567 1.00 66.57  ? 58  PHE B CZ    1 
ATOM   3258 N  N     . ASP B 1 59  ? 8.609   -27.328 -26.658 1.00 60.07  ? 59  ASP B N     1 
ATOM   3259 C  CA    . ASP B 1 59  ? 9.898   -26.979 -26.088 1.00 59.00  ? 59  ASP B CA    1 
ATOM   3260 C  C     . ASP B 1 59  ? 10.854  -26.747 -27.251 1.00 58.85  ? 59  ASP B C     1 
ATOM   3261 O  O     . ASP B 1 59  ? 10.955  -27.568 -28.150 1.00 59.40  ? 59  ASP B O     1 
ATOM   3262 C  CB    . ASP B 1 59  ? 10.429  -28.087 -25.163 1.00 58.73  ? 59  ASP B CB    1 
ATOM   3263 C  CG    . ASP B 1 59  ? 11.749  -27.715 -24.471 1.00 57.70  ? 59  ASP B CG    1 
ATOM   3264 O  OD1   . ASP B 1 59  ? 12.026  -26.510 -24.244 1.00 57.14  ? 59  ASP B OD1   1 
ATOM   3265 O  OD2   . ASP B 1 59  ? 12.516  -28.649 -24.161 1.00 57.57  ? 59  ASP B OD2   1 
ATOM   3266 N  N     . VAL B 1 60  ? 11.520  -25.607 -27.223 1.00 58.25  ? 60  VAL B N     1 
ATOM   3267 C  CA    . VAL B 1 60  ? 12.489  -25.216 -28.236 1.00 58.16  ? 60  VAL B CA    1 
ATOM   3268 C  C     . VAL B 1 60  ? 13.925  -25.638 -27.827 1.00 57.55  ? 60  VAL B C     1 
ATOM   3269 O  O     . VAL B 1 60  ? 14.727  -26.021 -28.685 1.00 57.75  ? 60  VAL B O     1 
ATOM   3270 C  CB    . VAL B 1 60  ? 12.340  -23.693 -28.508 1.00 58.13  ? 60  VAL B CB    1 
ATOM   3271 C  CG1   . VAL B 1 60  ? 13.607  -23.079 -29.071 1.00 57.86  ? 60  VAL B CG1   1 
ATOM   3272 C  CG2   . VAL B 1 60  ? 11.134  -23.421 -29.418 1.00 59.01  ? 60  VAL B CG2   1 
ATOM   3273 N  N     . ASP B 1 61  ? 14.251  -25.569 -26.531 1.00 56.90  ? 61  ASP B N     1 
ATOM   3274 C  CA    . ASP B 1 61  ? 15.560  -26.029 -26.013 1.00 56.42  ? 61  ASP B CA    1 
ATOM   3275 C  C     . ASP B 1 61  ? 15.794  -27.494 -26.319 1.00 56.85  ? 61  ASP B C     1 
ATOM   3276 O  O     . ASP B 1 61  ? 14.847  -28.289 -26.342 1.00 57.37  ? 61  ASP B O     1 
ATOM   3277 C  CB    . ASP B 1 61  ? 15.637  -25.853 -24.494 1.00 55.79  ? 61  ASP B CB    1 
ATOM   3278 C  CG    . ASP B 1 61  ? 15.626  -24.395 -24.069 1.00 55.40  ? 61  ASP B CG    1 
ATOM   3279 O  OD1   . ASP B 1 61  ? 15.826  -23.501 -24.951 1.00 55.60  ? 61  ASP B OD1   1 
ATOM   3280 O  OD2   . ASP B 1 61  ? 15.408  -24.165 -22.845 1.00 55.01  ? 61  ASP B OD2   1 
ATOM   3281 N  N     . ASP B 1 62  ? 17.051  -27.852 -26.545 1.00 56.79  ? 62  ASP B N     1 
ATOM   3282 C  CA    . ASP B 1 62  ? 17.394  -29.239 -26.785 1.00 57.31  ? 62  ASP B CA    1 
ATOM   3283 C  C     . ASP B 1 62  ? 16.958  -30.045 -25.586 1.00 57.24  ? 62  ASP B C     1 
ATOM   3284 O  O     . ASP B 1 62  ? 16.848  -29.515 -24.484 1.00 56.62  ? 62  ASP B O     1 
ATOM   3285 C  CB    . ASP B 1 62  ? 18.908  -29.432 -26.968 1.00 57.28  ? 62  ASP B CB    1 
ATOM   3286 C  CG    . ASP B 1 62  ? 19.463  -28.753 -28.213 1.00 57.54  ? 62  ASP B CG    1 
ATOM   3287 O  OD1   . ASP B 1 62  ? 18.683  -28.140 -28.962 1.00 57.73  ? 62  ASP B OD1   1 
ATOM   3288 O  OD2   . ASP B 1 62  ? 20.690  -28.836 -28.439 1.00 57.67  ? 62  ASP B OD2   1 
ATOM   3289 N  N     . LYS B 1 63  ? 16.689  -31.322 -25.811 1.00 57.98  ? 63  LYS B N     1 
ATOM   3290 C  CA    . LYS B 1 63  ? 16.702  -32.287 -24.730 1.00 58.08  ? 63  LYS B CA    1 
ATOM   3291 C  C     . LYS B 1 63  ? 18.161  -32.356 -24.288 1.00 57.68  ? 63  LYS B C     1 
ATOM   3292 O  O     . LYS B 1 63  ? 19.066  -32.148 -25.105 1.00 57.77  ? 63  LYS B O     1 
ATOM   3293 C  CB    . LYS B 1 63  ? 16.198  -33.654 -25.189 1.00 59.20  ? 63  LYS B CB    1 
ATOM   3294 C  CG    . LYS B 1 63  ? 14.731  -33.678 -25.619 1.00 59.81  ? 63  LYS B CG    1 
ATOM   3295 C  CD    . LYS B 1 63  ? 13.780  -33.666 -24.427 1.00 59.72  ? 63  LYS B CD    1 
ATOM   3296 C  CE    . LYS B 1 63  ? 12.318  -33.672 -24.850 1.00 60.50  ? 63  LYS B CE    1 
ATOM   3297 N  NZ    . LYS B 1 63  ? 11.830  -32.328 -25.285 1.00 60.05  ? 63  LYS B NZ    1 
ATOM   3298 N  N     . GLU B 1 64  ? 18.398  -32.607 -23.004 1.00 57.32  ? 64  GLU B N     1 
ATOM   3299 C  CA    . GLU B 1 64  ? 19.748  -32.562 -22.450 1.00 56.95  ? 64  GLU B CA    1 
ATOM   3300 C  C     . GLU B 1 64  ? 20.616  -33.636 -23.103 1.00 57.78  ? 64  GLU B C     1 
ATOM   3301 O  O     . GLU B 1 64  ? 20.219  -34.801 -23.159 1.00 58.58  ? 64  GLU B O     1 
ATOM   3302 C  CB    . GLU B 1 64  ? 19.692  -32.784 -20.945 1.00 56.57  ? 64  GLU B CB    1 
ATOM   3303 C  CG    . GLU B 1 64  ? 20.986  -32.460 -20.214 1.00 56.08  ? 64  GLU B CG    1 
ATOM   3304 C  CD    . GLU B 1 64  ? 21.140  -33.222 -18.913 1.00 56.11  ? 64  GLU B CD    1 
ATOM   3305 O  OE1   . GLU B 1 64  ? 20.757  -34.412 -18.850 1.00 56.87  ? 64  GLU B OE1   1 
ATOM   3306 O  OE2   . GLU B 1 64  ? 21.679  -32.634 -17.956 1.00 55.49  ? 64  GLU B OE2   1 
ATOM   3307 N  N     . HIS B 1 65  ? 21.796  -33.237 -23.594 1.00 57.72  ? 65  HIS B N     1 
ATOM   3308 C  CA    . HIS B 1 65  ? 22.690  -34.140 -24.360 1.00 58.64  ? 65  HIS B CA    1 
ATOM   3309 C  C     . HIS B 1 65  ? 23.364  -35.147 -23.433 1.00 59.01  ? 65  HIS B C     1 
ATOM   3310 O  O     . HIS B 1 65  ? 23.268  -35.059 -22.198 1.00 58.47  ? 65  HIS B O     1 
ATOM   3311 C  CB    . HIS B 1 65  ? 23.807  -33.381 -25.115 1.00 58.62  ? 65  HIS B CB    1 
ATOM   3312 C  CG    . HIS B 1 65  ? 23.331  -32.206 -25.899 1.00 58.22  ? 65  HIS B CG    1 
ATOM   3313 N  ND1   . HIS B 1 65  ? 23.388  -30.918 -25.413 1.00 57.39  ? 65  HIS B ND1   1 
ATOM   3314 C  CD2   . HIS B 1 65  ? 22.772  -32.124 -27.127 1.00 58.65  ? 65  HIS B CD2   1 
ATOM   3315 C  CE1   . HIS B 1 65  ? 22.878  -30.093 -26.307 1.00 57.35  ? 65  HIS B CE1   1 
ATOM   3316 N  NE2   . HIS B 1 65  ? 22.499  -30.799 -27.357 1.00 58.08  ? 65  HIS B NE2   1 
ATOM   3317 N  N     . GLY B 1 66  ? 24.074  -36.090 -24.044 1.00 60.03  ? 66  GLY B N     1 
ATOM   3318 C  CA    . GLY B 1 66  ? 24.962  -36.988 -23.319 1.00 60.59  ? 66  GLY B CA    1 
ATOM   3319 C  C     . GLY B 1 66  ? 25.964  -36.220 -22.489 1.00 59.88  ? 66  GLY B C     1 
ATOM   3320 O  O     . GLY B 1 66  ? 26.204  -35.030 -22.711 1.00 59.18  ? 66  GLY B O     1 
ATOM   3321 N  N     . LYS B 1 67  ? 26.523  -36.919 -21.513 1.00 60.19  ? 67  LYS B N     1 
ATOM   3322 C  CA    . LYS B 1 67  ? 27.468  -36.341 -20.564 1.00 59.67  ? 67  LYS B CA    1 
ATOM   3323 C  C     . LYS B 1 67  ? 28.298  -37.459 -19.941 1.00 60.59  ? 67  LYS B C     1 
ATOM   3324 O  O     . LYS B 1 67  ? 27.843  -38.606 -19.908 1.00 61.39  ? 67  LYS B O     1 
ATOM   3325 C  CB    . LYS B 1 67  ? 26.716  -35.566 -19.487 1.00 58.50  ? 67  LYS B CB    1 
ATOM   3326 C  CG    . LYS B 1 67  ? 25.713  -36.400 -18.697 1.00 58.62  ? 67  LYS B CG    1 
ATOM   3327 C  CD    . LYS B 1 67  ? 24.350  -35.727 -18.632 1.00 57.86  ? 67  LYS B CD    1 
ATOM   3328 C  CE    . LYS B 1 67  ? 23.358  -36.527 -17.799 1.00 58.12  ? 67  LYS B CE    1 
ATOM   3329 N  NZ    . LYS B 1 67  ? 23.678  -36.484 -16.347 1.00 57.70  ? 67  LYS B NZ    1 
ATOM   3330 N  N     . PRO B 1 68  ? 29.509  -37.139 -19.442 1.00 60.61  ? 68  PRO B N     1 
ATOM   3331 C  CA    . PRO B 1 68  ? 30.317  -38.198 -18.857 1.00 61.61  ? 68  PRO B CA    1 
ATOM   3332 C  C     . PRO B 1 68  ? 29.673  -38.701 -17.566 1.00 61.34  ? 68  PRO B C     1 
ATOM   3333 O  O     . PRO B 1 68  ? 29.130  -37.898 -16.808 1.00 60.20  ? 68  PRO B O     1 
ATOM   3334 C  CB    . PRO B 1 68  ? 31.667  -37.515 -18.585 1.00 61.61  ? 68  PRO B CB    1 
ATOM   3335 C  CG    . PRO B 1 68  ? 31.595  -36.167 -19.226 1.00 60.78  ? 68  PRO B CG    1 
ATOM   3336 C  CD    . PRO B 1 68  ? 30.146  -35.825 -19.271 1.00 59.84  ? 68  PRO B CD    1 
ATOM   3337 N  N     . PRO B 1 69  ? 29.689  -40.022 -17.334 1.00 62.47  ? 69  PRO B N     1 
ATOM   3338 C  CA    . PRO B 1 69  ? 29.065  -40.554 -16.116 1.00 62.38  ? 69  PRO B CA    1 
ATOM   3339 C  C     . PRO B 1 69  ? 29.817  -40.170 -14.841 1.00 61.92  ? 69  PRO B C     1 
ATOM   3340 O  O     . PRO B 1 69  ? 31.031  -39.973 -14.883 1.00 62.26  ? 69  PRO B O     1 
ATOM   3341 C  CB    . PRO B 1 69  ? 29.102  -42.069 -16.331 1.00 64.02  ? 69  PRO B CB    1 
ATOM   3342 C  CG    . PRO B 1 69  ? 30.190  -42.295 -17.323 1.00 64.98  ? 69  PRO B CG    1 
ATOM   3343 C  CD    . PRO B 1 69  ? 30.200  -41.091 -18.206 1.00 64.02  ? 69  PRO B CD    1 
ATOM   3344 N  N     . LYS B 1 70  ? 29.093  -40.067 -13.728 1.00 61.27  ? 70  LYS B N     1 
ATOM   3345 C  CA    . LYS B 1 70  ? 29.679  -39.634 -12.455 1.00 60.76  ? 70  LYS B CA    1 
ATOM   3346 C  C     . LYS B 1 70  ? 30.642  -40.671 -11.893 1.00 62.00  ? 70  LYS B C     1 
ATOM   3347 O  O     . LYS B 1 70  ? 30.374  -41.875 -11.942 1.00 63.13  ? 70  LYS B O     1 
ATOM   3348 C  CB    . LYS B 1 70  ? 28.591  -39.347 -11.423 1.00 59.90  ? 70  LYS B CB    1 
ATOM   3349 C  CG    . LYS B 1 70  ? 27.708  -38.176 -11.788 1.00 58.69  ? 70  LYS B CG    1 
ATOM   3350 C  CD    . LYS B 1 70  ? 26.660  -37.906 -10.722 1.00 58.01  ? 70  LYS B CD    1 
ATOM   3351 C  CE    . LYS B 1 70  ? 25.823  -36.689 -11.093 1.00 56.93  ? 70  LYS B CE    1 
ATOM   3352 N  NZ    . LYS B 1 70  ? 25.575  -35.810 -9.924  1.00 56.02  ? 70  LYS B NZ    1 
ATOM   3353 N  N     . ARG B 1 71  ? 31.756  -40.191 -11.349 1.00 61.89  ? 71  ARG B N     1 
ATOM   3354 C  CA    . ARG B 1 71  ? 32.814  -41.069 -10.841 1.00 63.16  ? 71  ARG B CA    1 
ATOM   3355 C  C     . ARG B 1 71  ? 32.398  -41.648 -9.503  1.00 63.26  ? 71  ARG B C     1 
ATOM   3356 O  O     . ARG B 1 71  ? 32.741  -42.778 -9.155  1.00 64.57  ? 71  ARG B O     1 
ATOM   3357 C  CB    . ARG B 1 71  ? 34.118  -40.301 -10.653 1.00 63.09  ? 71  ARG B CB    1 
ATOM   3358 C  CG    . ARG B 1 71  ? 34.564  -39.465 -11.846 1.00 62.88  ? 71  ARG B CG    1 
ATOM   3359 C  CD    . ARG B 1 71  ? 34.911  -40.273 -13.092 1.00 64.18  ? 71  ARG B CD    1 
ATOM   3360 N  NE    . ARG B 1 71  ? 35.389  -39.369 -14.142 1.00 63.97  ? 71  ARG B NE    1 
ATOM   3361 C  CZ    . ARG B 1 71  ? 36.598  -38.796 -14.172 1.00 64.35  ? 71  ARG B CZ    1 
ATOM   3362 N  NH1   . ARG B 1 71  ? 37.515  -39.025 -13.222 1.00 64.97  ? 71  ARG B NH1   1 
ATOM   3363 N  NH2   . ARG B 1 71  ? 36.902  -37.971 -15.165 1.00 64.22  ? 71  ARG B NH2   1 
ATOM   3364 N  N     . TYR B 1 72  ? 31.679  -40.826 -8.758  1.00 61.95  ? 72  TYR B N     1 
ATOM   3365 C  CA    . TYR B 1 72  ? 31.092  -41.201 -7.499  1.00 61.87  ? 72  TYR B CA    1 
ATOM   3366 C  C     . TYR B 1 72  ? 29.738  -40.521 -7.426  1.00 60.68  ? 72  TYR B C     1 
ATOM   3367 O  O     . TYR B 1 72  ? 29.483  -39.585 -8.192  1.00 59.81  ? 72  TYR B O     1 
ATOM   3368 C  CB    . TYR B 1 72  ? 31.980  -40.707 -6.372  1.00 61.59  ? 72  TYR B CB    1 
ATOM   3369 C  CG    . TYR B 1 72  ? 32.075  -39.196 -6.289  1.00 60.20  ? 72  TYR B CG    1 
ATOM   3370 C  CD1   . TYR B 1 72  ? 32.937  -38.482 -7.116  1.00 60.11  ? 72  TYR B CD1   1 
ATOM   3371 C  CD2   . TYR B 1 72  ? 31.305  -38.482 -5.374  1.00 59.11  ? 72  TYR B CD2   1 
ATOM   3372 C  CE1   . TYR B 1 72  ? 33.029  -37.104 -7.029  1.00 59.02  ? 72  TYR B CE1   1 
ATOM   3373 C  CE2   . TYR B 1 72  ? 31.393  -37.104 -5.284  1.00 58.01  ? 72  TYR B CE2   1 
ATOM   3374 C  CZ    . TYR B 1 72  ? 32.256  -36.427 -6.113  1.00 57.99  ? 72  TYR B CZ    1 
ATOM   3375 O  OH    . TYR B 1 72  ? 32.349  -35.075 -6.011  1.00 57.07  ? 72  TYR B OH    1 
ATOM   3376 N  N     . GLU B 1 73  ? 28.895  -40.970 -6.498  1.00 60.75  ? 73  GLU B N     1 
ATOM   3377 C  CA    . GLU B 1 73  ? 27.546  -40.430 -6.342  1.00 59.86  ? 73  GLU B CA    1 
ATOM   3378 C  C     . GLU B 1 73  ? 27.371  -39.605 -5.088  1.00 58.90  ? 73  GLU B C     1 
ATOM   3379 O  O     . GLU B 1 73  ? 28.112  -39.760 -4.122  1.00 59.13  ? 73  GLU B O     1 
ATOM   3380 C  CB    . GLU B 1 73  ? 26.524  -41.552 -6.378  1.00 60.83  ? 73  GLU B CB    1 
ATOM   3381 C  CG    . GLU B 1 73  ? 26.255  -42.018 -7.801  1.00 61.46  ? 73  GLU B CG    1 
ATOM   3382 C  CD    . GLU B 1 73  ? 25.098  -42.991 -7.903  1.00 62.43  ? 73  GLU B CD    1 
ATOM   3383 O  OE1   . GLU B 1 73  ? 24.715  -43.586 -6.856  1.00 62.99  ? 73  GLU B OE1   1 
ATOM   3384 O  OE2   . GLU B 1 73  ? 24.598  -43.158 -9.043  1.00 62.74  ? 73  GLU B OE2   1 
ATOM   3385 N  N     . ASP B 1 74  ? 26.364  -38.737 -5.109  1.00 57.93  ? 74  ASP B N     1 
ATOM   3386 C  CA    . ASP B 1 74  ? 26.093  -37.806 -4.003  1.00 57.00  ? 74  ASP B CA    1 
ATOM   3387 C  C     . ASP B 1 74  ? 26.121  -38.491 -2.625  1.00 57.54  ? 74  ASP B C     1 
ATOM   3388 O  O     . ASP B 1 74  ? 26.731  -37.982 -1.690  1.00 57.14  ? 74  ASP B O     1 
ATOM   3389 C  CB    . ASP B 1 74  ? 24.744  -37.082 -4.228  1.00 56.29  ? 74  ASP B CB    1 
ATOM   3390 C  CG    . ASP B 1 74  ? 24.835  -35.958 -5.266  1.00 55.49  ? 74  ASP B CG    1 
ATOM   3391 O  OD1   . ASP B 1 74  ? 25.591  -36.096 -6.251  1.00 55.75  ? 74  ASP B OD1   1 
ATOM   3392 O  OD2   . ASP B 1 74  ? 24.142  -34.932 -5.088  1.00 54.70  ? 74  ASP B OD2   1 
ATOM   3393 N  N     . ALA B 1 75  ? 25.467  -39.647 -2.524  1.00 58.54  ? 75  ALA B N     1 
ATOM   3394 C  CA    . ALA B 1 75  ? 25.376  -40.391 -1.271  1.00 59.24  ? 75  ALA B CA    1 
ATOM   3395 C  C     . ALA B 1 75  ? 26.670  -41.101 -0.896  1.00 60.07  ? 75  ALA B C     1 
ATOM   3396 O  O     . ALA B 1 75  ? 26.848  -41.440 0.271   1.00 60.45  ? 75  ALA B O     1 
ATOM   3397 C  CB    . ALA B 1 75  ? 24.226  -41.390 -1.318  1.00 60.24  ? 75  ALA B CB    1 
ATOM   3398 N  N     . GLU B 1 76  ? 27.543  -41.361 -1.873  1.00 60.49  ? 76  GLU B N     1 
ATOM   3399 C  CA    . GLU B 1 76  ? 28.886  -41.915 -1.609  1.00 61.35  ? 76  GLU B CA    1 
ATOM   3400 C  C     . GLU B 1 76  ? 29.801  -40.910 -0.902  1.00 60.53  ? 76  GLU B C     1 
ATOM   3401 O  O     . GLU B 1 76  ? 30.684  -41.313 -0.149  1.00 61.20  ? 76  GLU B O     1 
ATOM   3402 C  CB    . GLU B 1 76  ? 29.551  -42.396 -2.906  1.00 62.11  ? 76  GLU B CB    1 
ATOM   3403 C  CG    . GLU B 1 76  ? 30.831  -43.214 -2.718  1.00 63.42  ? 76  GLU B CG    1 
ATOM   3404 C  CD    . GLU B 1 76  ? 31.405  -43.762 -4.031  1.00 64.36  ? 76  GLU B CD    1 
ATOM   3405 O  OE1   . GLU B 1 76  ? 30.693  -43.825 -5.067  1.00 64.27  ? 76  GLU B OE1   1 
ATOM   3406 O  OE2   . GLU B 1 76  ? 32.596  -44.151 -4.028  1.00 65.32  ? 76  GLU B OE2   1 
ATOM   3407 N  N     . LEU B 1 77  ? 29.593  -39.623 -1.189  1.00 59.22  ? 77  LEU B N     1 
ATOM   3408 C  CA    . LEU B 1 77  ? 30.237  -38.506 -0.482  1.00 58.39  ? 77  LEU B CA    1 
ATOM   3409 C  C     . LEU B 1 77  ? 29.554  -38.213 0.848   1.00 57.91  ? 77  LEU B C     1 
ATOM   3410 O  O     . LEU B 1 77  ? 30.221  -37.947 1.846   1.00 57.90  ? 77  LEU B O     1 
ATOM   3411 C  CB    . LEU B 1 77  ? 30.199  -37.241 -1.345  1.00 57.35  ? 77  LEU B CB    1 
ATOM   3412 C  CG    . LEU B 1 77  ? 30.559  -35.891 -0.718  1.00 56.42  ? 77  LEU B CG    1 
ATOM   3413 C  CD1   . LEU B 1 77  ? 31.982  -35.909 -0.202  1.00 56.98  ? 77  LEU B CD1   1 
ATOM   3414 C  CD2   . LEU B 1 77  ? 30.361  -34.763 -1.722  1.00 55.62  ? 77  LEU B CD2   1 
ATOM   3415 N  N     . GLN B 1 78  ? 28.224  -38.221 0.844   1.00 57.60  ? 78  GLN B N     1 
ATOM   3416 C  CA    . GLN B 1 78  ? 27.431  -38.033 2.057   1.00 57.32  ? 78  GLN B CA    1 
ATOM   3417 C  C     . GLN B 1 78  ? 27.811  -39.025 3.148   1.00 58.31  ? 78  GLN B C     1 
ATOM   3418 O  O     . GLN B 1 78  ? 27.913  -38.653 4.324   1.00 58.07  ? 78  GLN B O     1 
ATOM   3419 C  CB    . GLN B 1 78  ? 25.944  -38.189 1.741   1.00 57.26  ? 78  GLN B CB    1 
ATOM   3420 C  CG    . GLN B 1 78  ? 25.006  -37.914 2.898   1.00 57.04  ? 78  GLN B CG    1 
ATOM   3421 C  CD    . GLN B 1 78  ? 25.282  -36.580 3.549   1.00 55.99  ? 78  GLN B CD    1 
ATOM   3422 O  OE1   . GLN B 1 78  ? 25.493  -35.581 2.863   1.00 55.20  ? 78  GLN B OE1   1 
ATOM   3423 N  NE2   . GLN B 1 78  ? 25.303  -36.557 4.882   1.00 56.09  ? 78  GLN B NE2   1 
ATOM   3424 N  N     . ALA B 1 79  ? 28.011  -40.281 2.746   1.00 59.52  ? 79  ALA B N     1 
ATOM   3425 C  CA    . ALA B 1 79  ? 28.498  -41.352 3.630   1.00 60.74  ? 79  ALA B CA    1 
ATOM   3426 C  C     . ALA B 1 79  ? 29.766  -40.961 4.400   1.00 60.67  ? 79  ALA B C     1 
ATOM   3427 O  O     . ALA B 1 79  ? 29.891  -41.241 5.593   1.00 61.08  ? 79  ALA B O     1 
ATOM   3428 C  CB    . ALA B 1 79  ? 28.751  -42.615 2.814   1.00 62.11  ? 79  ALA B CB    1 
ATOM   3429 N  N     . LEU B 1 80  ? 30.694  -40.314 3.701   1.00 60.25  ? 80  LEU B N     1 
ATOM   3430 C  CA    . LEU B 1 80  ? 31.953  -39.860 4.287   1.00 60.29  ? 80  LEU B CA    1 
ATOM   3431 C  C     . LEU B 1 80  ? 31.783  -38.688 5.267   1.00 59.21  ? 80  LEU B C     1 
ATOM   3432 O  O     . LEU B 1 80  ? 32.563  -38.563 6.212   1.00 59.48  ? 80  LEU B O     1 
ATOM   3433 C  CB    . LEU B 1 80  ? 32.965  -39.486 3.179   1.00 60.31  ? 80  LEU B CB    1 
ATOM   3434 C  CG    . LEU B 1 80  ? 33.745  -40.513 2.338   1.00 61.64  ? 80  LEU B CG    1 
ATOM   3435 C  CD1   . LEU B 1 80  ? 32.918  -41.601 1.686   1.00 62.34  ? 80  LEU B CD1   1 
ATOM   3436 C  CD2   . LEU B 1 80  ? 34.552  -39.779 1.279   1.00 61.37  ? 80  LEU B CD2   1 
ATOM   3437 N  N     . LEU B 1 81  ? 30.797  -37.827 5.032   1.00 58.11  ? 81  LEU B N     1 
ATOM   3438 C  CA    . LEU B 1 81  ? 30.514  -36.710 5.943   1.00 57.20  ? 81  LEU B CA    1 
ATOM   3439 C  C     . LEU B 1 81  ? 29.778  -37.141 7.213   1.00 57.46  ? 81  LEU B C     1 
ATOM   3440 O  O     . LEU B 1 81  ? 29.929  -36.504 8.262   1.00 57.13  ? 81  LEU B O     1 
ATOM   3441 C  CB    . LEU B 1 81  ? 29.715  -35.620 5.232   1.00 56.10  ? 81  LEU B CB    1 
ATOM   3442 C  CG    . LEU B 1 81  ? 30.500  -34.933 4.115   1.00 55.79  ? 81  LEU B CG    1 
ATOM   3443 C  CD1   . LEU B 1 81  ? 29.546  -34.201 3.187   1.00 54.98  ? 81  LEU B CD1   1 
ATOM   3444 C  CD2   . LEU B 1 81  ? 31.555  -33.985 4.665   1.00 55.59  ? 81  LEU B CD2   1 
ATOM   3445 N  N     . ASP B 1 82  ? 28.982  -38.208 7.119   1.00 58.15  ? 82  ASP B N     1 
ATOM   3446 C  CA    . ASP B 1 82  ? 28.330  -38.796 8.298   1.00 58.70  ? 82  ASP B CA    1 
ATOM   3447 C  C     . ASP B 1 82  ? 29.351  -39.480 9.231   1.00 59.66  ? 82  ASP B C     1 
ATOM   3448 O  O     . ASP B 1 82  ? 29.236  -39.379 10.461  1.00 59.74  ? 82  ASP B O     1 
ATOM   3449 C  CB    . ASP B 1 82  ? 27.236  -39.780 7.873   1.00 59.41  ? 82  ASP B CB    1 
ATOM   3450 C  CG    . ASP B 1 82  ? 26.167  -39.128 7.029   1.00 58.59  ? 82  ASP B CG    1 
ATOM   3451 O  OD1   . ASP B 1 82  ? 25.796  -37.970 7.310   1.00 57.57  ? 82  ASP B OD1   1 
ATOM   3452 O  OD2   . ASP B 1 82  ? 25.699  -39.776 6.081   1.00 59.06  ? 82  ASP B OD2   1 
ATOM   3453 N  N     . GLU B 1 83  ? 30.325  -40.180 8.636   1.00 60.47  ? 83  GLU B N     1 
ATOM   3454 C  CA    . GLU B 1 83  ? 31.508  -40.677 9.356   1.00 61.41  ? 83  GLU B CA    1 
ATOM   3455 C  C     . GLU B 1 83  ? 32.228  -39.544 10.100  1.00 60.67  ? 83  GLU B C     1 
ATOM   3456 O  O     . GLU B 1 83  ? 32.511  -39.662 11.299  1.00 61.08  ? 83  GLU B O     1 
ATOM   3457 C  CB    . GLU B 1 83  ? 32.508  -41.365 8.399   1.00 62.33  ? 83  GLU B CB    1 
ATOM   3458 C  CG    . GLU B 1 83  ? 32.220  -42.825 8.053   1.00 63.75  ? 83  GLU B CG    1 
ATOM   3459 C  CD    . GLU B 1 83  ? 33.271  -43.426 7.114   1.00 64.74  ? 83  GLU B CD    1 
ATOM   3460 O  OE1   . GLU B 1 83  ? 33.189  -43.206 5.890   1.00 64.35  ? 83  GLU B OE1   1 
ATOM   3461 O  OE2   . GLU B 1 83  ? 34.182  -44.136 7.585   1.00 66.01  ? 83  GLU B OE2   1 
ATOM   3462 N  N     . ASP B 1 84  ? 32.509  -38.454 9.384   1.00 59.70  ? 84  ASP B N     1 
ATOM   3463 C  CA    . ASP B 1 84  ? 33.320  -37.352 9.913   1.00 59.19  ? 84  ASP B CA    1 
ATOM   3464 C  C     . ASP B 1 84  ? 32.982  -36.005 9.234   1.00 57.93  ? 84  ASP B C     1 
ATOM   3465 O  O     . ASP B 1 84  ? 33.501  -35.684 8.152   1.00 57.80  ? 84  ASP B O     1 
ATOM   3466 C  CB    . ASP B 1 84  ? 34.810  -37.706 9.765   1.00 60.16  ? 84  ASP B CB    1 
ATOM   3467 C  CG    . ASP B 1 84  ? 35.750  -36.749 10.512  1.00 60.01  ? 84  ASP B CG    1 
ATOM   3468 O  OD1   . ASP B 1 84  ? 35.322  -36.041 11.454  1.00 59.39  ? 84  ASP B OD1   1 
ATOM   3469 O  OD2   . ASP B 1 84  ? 36.954  -36.736 10.168  1.00 60.68  ? 84  ASP B OD2   1 
ATOM   3470 N  N     . ASP B 1 85  ? 32.106  -35.242 9.907   1.00 57.14  ? 85  ASP B N     1 
ATOM   3471 C  CA    . ASP B 1 85  ? 31.664  -33.892 9.489   1.00 56.04  ? 85  ASP B CA    1 
ATOM   3472 C  C     . ASP B 1 85  ? 32.813  -33.024 8.994   1.00 55.93  ? 85  ASP B C     1 
ATOM   3473 O  O     . ASP B 1 85  ? 32.772  -32.498 7.897   1.00 55.50  ? 85  ASP B O     1 
ATOM   3474 C  CB    . ASP B 1 85  ? 31.044  -33.113 10.674  1.00 55.55  ? 85  ASP B CB    1 
ATOM   3475 C  CG    . ASP B 1 85  ? 29.661  -33.618 11.115  1.00 55.53  ? 85  ASP B CG    1 
ATOM   3476 O  OD1   . ASP B 1 85  ? 28.813  -34.005 10.262  1.00 55.43  ? 85  ASP B OD1   1 
ATOM   3477 O  OD2   . ASP B 1 85  ? 29.419  -33.556 12.345  1.00 55.68  ? 85  ASP B OD2   1 
ATOM   3478 N  N     . ALA B 1 86  ? 33.828  -32.885 9.847   1.00 56.42  ? 86  ALA B N     1 
ATOM   3479 C  CA    . ALA B 1 86  ? 34.933  -31.944 9.646   1.00 56.48  ? 86  ALA B CA    1 
ATOM   3480 C  C     . ALA B 1 86  ? 36.134  -32.608 8.993   1.00 57.43  ? 86  ALA B C     1 
ATOM   3481 O  O     . ALA B 1 86  ? 36.940  -33.256 9.665   1.00 58.36  ? 86  ALA B O     1 
ATOM   3482 C  CB    . ALA B 1 86  ? 35.343  -31.320 10.973  1.00 56.59  ? 86  ALA B CB    1 
ATOM   3483 N  N     . GLN B 1 87  ? 36.257  -32.412 7.687   1.00 57.29  ? 87  GLN B N     1 
ATOM   3484 C  CA    . GLN B 1 87  ? 37.246  -33.109 6.893   1.00 58.25  ? 87  GLN B CA    1 
ATOM   3485 C  C     . GLN B 1 87  ? 37.639  -32.186 5.736   1.00 58.00  ? 87  GLN B C     1 
ATOM   3486 O  O     . GLN B 1 87  ? 36.780  -31.549 5.139   1.00 57.09  ? 87  GLN B O     1 
ATOM   3487 C  CB    . GLN B 1 87  ? 36.623  -34.427 6.408   1.00 58.56  ? 87  GLN B CB    1 
ATOM   3488 C  CG    . GLN B 1 87  ? 37.556  -35.629 6.349   1.00 59.96  ? 87  GLN B CG    1 
ATOM   3489 C  CD    . GLN B 1 87  ? 36.810  -36.930 6.079   1.00 60.38  ? 87  GLN B CD    1 
ATOM   3490 O  OE1   . GLN B 1 87  ? 35.775  -37.195 6.688   1.00 59.98  ? 87  GLN B OE1   1 
ATOM   3491 N  NE2   . GLN B 1 87  ? 37.326  -37.744 5.166   1.00 61.32  ? 87  GLN B NE2   1 
ATOM   3492 N  N     . THR B 1 88  ? 38.931  -32.090 5.429   1.00 58.92  ? 88  THR B N     1 
ATOM   3493 C  CA    . THR B 1 88  ? 39.396  -31.208 4.337   1.00 58.89  ? 88  THR B CA    1 
ATOM   3494 C  C     . THR B 1 88  ? 39.035  -31.751 2.988   1.00 58.84  ? 88  THR B C     1 
ATOM   3495 O  O     . THR B 1 88  ? 39.006  -32.963 2.812   1.00 59.41  ? 88  THR B O     1 
ATOM   3496 C  CB    . THR B 1 88  ? 40.915  -31.089 4.278   1.00 60.16  ? 88  THR B CB    1 
ATOM   3497 O  OG1   . THR B 1 88  ? 41.493  -32.395 4.376   1.00 61.26  ? 88  THR B OG1   1 
ATOM   3498 C  CG2   . THR B 1 88  ? 41.407  -30.239 5.395   1.00 60.28  ? 88  THR B CG2   1 
ATOM   3499 N  N     . GLN B 1 89  ? 38.848  -30.857 2.024   1.00 58.35  ? 89  GLN B N     1 
ATOM   3500 C  CA    . GLN B 1 89  ? 38.468  -31.266 0.676   1.00 58.27  ? 89  GLN B CA    1 
ATOM   3501 C  C     . GLN B 1 89  ? 39.460  -32.219 0.026   1.00 59.56  ? 89  GLN B C     1 
ATOM   3502 O  O     . GLN B 1 89  ? 39.045  -33.136 -0.669  1.00 59.73  ? 89  GLN B O     1 
ATOM   3503 C  CB    . GLN B 1 89  ? 38.243  -30.061 -0.221  1.00 57.69  ? 89  GLN B CB    1 
ATOM   3504 C  CG    . GLN B 1 89  ? 36.982  -29.302 0.123   1.00 56.45  ? 89  GLN B CG    1 
ATOM   3505 C  CD    . GLN B 1 89  ? 36.728  -28.127 -0.794  1.00 56.00  ? 89  GLN B CD    1 
ATOM   3506 O  OE1   . GLN B 1 89  ? 37.400  -27.938 -1.798  1.00 56.54  ? 89  GLN B OE1   1 
ATOM   3507 N  NE2   . GLN B 1 89  ? 35.732  -27.343 -0.461  1.00 55.10  ? 89  GLN B NE2   1 
ATOM   3508 N  N     . LYS B 1 90  ? 40.752  -32.004 0.256   1.00 60.59  ? 90  LYS B N     1 
ATOM   3509 C  CA    . LYS B 1 90  ? 41.768  -32.916 -0.259  1.00 62.03  ? 90  LYS B CA    1 
ATOM   3510 C  C     . LYS B 1 90  ? 41.710  -34.305 0.403   1.00 62.66  ? 90  LYS B C     1 
ATOM   3511 O  O     . LYS B 1 90  ? 42.082  -35.300 -0.224  1.00 63.69  ? 90  LYS B O     1 
ATOM   3512 C  CB    . LYS B 1 90  ? 43.181  -32.308 -0.166  1.00 63.16  ? 90  LYS B CB    1 
ATOM   3513 C  CG    . LYS B 1 90  ? 44.279  -33.229 -0.712  1.00 64.85  ? 90  LYS B CG    1 
ATOM   3514 C  CD    . LYS B 1 90  ? 45.514  -32.497 -1.225  1.00 65.99  ? 90  LYS B CD    1 
ATOM   3515 C  CE    . LYS B 1 90  ? 46.159  -31.609 -0.173  1.00 66.24  ? 90  LYS B CE    1 
ATOM   3516 N  NZ    . LYS B 1 90  ? 46.396  -32.306 1.124   1.00 66.68  ? 90  LYS B NZ    1 
ATOM   3517 N  N     . GLN B 1 91  ? 41.240  -34.379 1.645   1.00 62.18  ? 91  GLN B N     1 
ATOM   3518 C  CA    . GLN B 1 91  ? 41.100  -35.667 2.342   1.00 62.82  ? 91  GLN B CA    1 
ATOM   3519 C  C     . GLN B 1 91  ? 39.963  -36.504 1.768   1.00 62.42  ? 91  GLN B C     1 
ATOM   3520 O  O     . GLN B 1 91  ? 40.127  -37.703 1.539   1.00 63.47  ? 91  GLN B O     1 
ATOM   3521 C  CB    . GLN B 1 91  ? 40.856  -35.468 3.838   1.00 62.42  ? 91  GLN B CB    1 
ATOM   3522 C  CG    . GLN B 1 91  ? 42.104  -35.492 4.690   1.00 63.57  ? 91  GLN B CG    1 
ATOM   3523 C  CD    . GLN B 1 91  ? 41.797  -35.044 6.099   1.00 63.00  ? 91  GLN B CD    1 
ATOM   3524 O  OE1   . GLN B 1 91  ? 40.665  -35.173 6.550   1.00 62.08  ? 91  GLN B OE1   1 
ATOM   3525 N  NE2   . GLN B 1 91  ? 42.799  -34.505 6.802   1.00 63.64  ? 91  GLN B NE2   1 
ATOM   3526 N  N     . LEU B 1 92  ? 38.817  -35.859 1.566   1.00 61.04  ? 92  LEU B N     1 
ATOM   3527 C  CA    . LEU B 1 92  ? 37.652  -36.477 0.931   1.00 60.62  ? 92  LEU B CA    1 
ATOM   3528 C  C     . LEU B 1 92  ? 37.978  -36.899 -0.504  1.00 61.26  ? 92  LEU B C     1 
ATOM   3529 O  O     . LEU B 1 92  ? 37.661  -38.018 -0.923  1.00 61.93  ? 92  LEU B O     1 
ATOM   3530 C  CB    . LEU B 1 92  ? 36.485  -35.489 0.900   1.00 59.12  ? 92  LEU B CB    1 
ATOM   3531 C  CG    . LEU B 1 92  ? 35.960  -34.949 2.240   1.00 58.38  ? 92  LEU B CG    1 
ATOM   3532 C  CD1   . LEU B 1 92  ? 35.596  -33.478 2.156   1.00 57.27  ? 92  LEU B CD1   1 
ATOM   3533 C  CD2   . LEU B 1 92  ? 34.766  -35.753 2.734   1.00 58.21  ? 92  LEU B CD2   1 
ATOM   3534 N  N     . ALA B 1 93  ? 38.592  -35.978 -1.245  1.00 61.14  ? 93  ALA B N     1 
ATOM   3535 C  CA    . ALA B 1 93  ? 39.029  -36.210 -2.619  1.00 61.80  ? 93  ALA B CA    1 
ATOM   3536 C  C     . ALA B 1 93  ? 39.891  -37.464 -2.787  1.00 63.47  ? 93  ALA B C     1 
ATOM   3537 O  O     . ALA B 1 93  ? 39.717  -38.221 -3.741  1.00 64.04  ? 93  ALA B O     1 
ATOM   3538 C  CB    . ALA B 1 93  ? 39.774  -34.989 -3.126  1.00 61.69  ? 93  ALA B CB    1 
ATOM   3539 N  N     . GLU B 1 94  ? 40.819  -37.680 -1.865  1.00 64.35  ? 94  GLU B N     1 
ATOM   3540 C  CA    . GLU B 1 94  ? 41.658  -38.888 -1.881  1.00 66.11  ? 94  GLU B CA    1 
ATOM   3541 C  C     . GLU B 1 94  ? 40.831  -40.171 -1.729  1.00 66.45  ? 94  GLU B C     1 
ATOM   3542 O  O     . GLU B 1 94  ? 41.102  -41.157 -2.422  1.00 67.71  ? 94  GLU B O     1 
ATOM   3543 C  CB    . GLU B 1 94  ? 42.763  -38.816 -0.818  1.00 67.00  ? 94  GLU B CB    1 
ATOM   3544 C  CG    . GLU B 1 94  ? 43.926  -37.934 -1.252  1.00 67.55  ? 94  GLU B CG    1 
ATOM   3545 C  CD    . GLU B 1 94  ? 44.947  -37.630 -0.151  1.00 68.31  ? 94  GLU B CD    1 
ATOM   3546 O  OE1   . GLU B 1 94  ? 44.689  -37.897 1.065   1.00 68.11  ? 94  GLU B OE1   1 
ATOM   3547 O  OE2   . GLU B 1 94  ? 46.023  -37.091 -0.525  1.00 69.20  ? 94  GLU B OE2   1 
ATOM   3548 N  N     . GLN B 1 95  ? 39.827  -40.152 -0.850  1.00 65.47  ? 95  GLN B N     1 
ATOM   3549 C  CA    . GLN B 1 95  ? 38.965  -41.321 -0.633  1.00 65.87  ? 95  GLN B CA    1 
ATOM   3550 C  C     . GLN B 1 95  ? 38.092  -41.608 -1.841  1.00 65.60  ? 95  GLN B C     1 
ATOM   3551 O  O     . GLN B 1 95  ? 37.973  -42.762 -2.246  1.00 66.76  ? 95  GLN B O     1 
ATOM   3552 C  CB    . GLN B 1 95  ? 38.116  -41.159 0.625   1.00 64.98  ? 95  GLN B CB    1 
ATOM   3553 C  CG    . GLN B 1 95  ? 38.936  -41.126 1.911   1.00 65.51  ? 95  GLN B CG    1 
ATOM   3554 C  CD    . GLN B 1 95  ? 38.092  -40.764 3.109   1.00 64.50  ? 95  GLN B CD    1 
ATOM   3555 O  OE1   . GLN B 1 95  ? 38.009  -39.602 3.486   1.00 63.35  ? 95  GLN B OE1   1 
ATOM   3556 N  NE2   . GLN B 1 95  ? 37.438  -41.755 3.695   1.00 65.03  ? 95  GLN B NE2   1 
ATOM   3557 N  N     . LEU B 1 96  ? 37.527  -40.562 -2.445  1.00 64.21  ? 96  LEU B N     1 
ATOM   3558 C  CA    . LEU B 1 96  ? 36.724  -40.689 -3.699  1.00 63.91  ? 96  LEU B CA    1 
ATOM   3559 C  C     . LEU B 1 96  ? 37.521  -40.876 -4.991  1.00 64.84  ? 96  LEU B C     1 
ATOM   3560 O  O     . LEU B 1 96  ? 36.935  -41.132 -6.035  1.00 64.83  ? 96  LEU B O     1 
ATOM   3561 C  CB    . LEU B 1 96  ? 35.837  -39.463 -3.894  1.00 62.20  ? 96  LEU B CB    1 
ATOM   3562 C  CG    . LEU B 1 96  ? 34.812  -39.164 -2.800  1.00 61.19  ? 96  LEU B CG    1 
ATOM   3563 C  CD1   . LEU B 1 96  ? 34.289  -37.749 -2.989  1.00 59.71  ? 96  LEU B CD1   1 
ATOM   3564 C  CD2   . LEU B 1 96  ? 33.674  -40.183 -2.790  1.00 61.49  ? 96  LEU B CD2   1 
ATOM   3565 N  N     . GLU B 1 97  ? 38.840  -40.718 -4.909  1.00 65.69  ? 97  GLU B N     1 
ATOM   3566 C  CA    . GLU B 1 97  ? 39.754  -40.892 -6.037  1.00 66.81  ? 97  GLU B CA    1 
ATOM   3567 C  C     . GLU B 1 97  ? 39.558  -39.822 -7.119  1.00 65.85  ? 97  GLU B C     1 
ATOM   3568 O  O     . GLU B 1 97  ? 39.755  -40.072 -8.298  1.00 66.50  ? 97  GLU B O     1 
ATOM   3569 C  CB    . GLU B 1 97  ? 39.663  -42.320 -6.605  1.00 68.27  ? 97  GLU B CB    1 
ATOM   3570 C  CG    . GLU B 1 97  ? 39.582  -43.409 -5.528  1.00 69.18  ? 97  GLU B CG    1 
ATOM   3571 C  CD    . GLU B 1 97  ? 40.047  -44.785 -5.990  1.00 71.23  ? 97  GLU B CD    1 
ATOM   3572 O  OE1   . GLU B 1 97  ? 40.473  -45.577 -5.117  1.00 72.40  ? 97  GLU B OE1   1 
ATOM   3573 O  OE2   . GLU B 1 97  ? 40.001  -45.078 -7.211  1.00 71.77  ? 97  GLU B OE2   1 
ATOM   3574 N  N     . VAL B 1 98  ? 39.199  -38.625 -6.674  1.00 64.42  ? 98  VAL B N     1 
ATOM   3575 C  CA    . VAL B 1 98  ? 38.885  -37.498 -7.520  1.00 63.42  ? 98  VAL B CA    1 
ATOM   3576 C  C     . VAL B 1 98  ? 39.727  -36.322 -7.038  1.00 63.19  ? 98  VAL B C     1 
ATOM   3577 O  O     . VAL B 1 98  ? 40.468  -36.501 -6.096  1.00 63.80  ? 98  VAL B O     1 
ATOM   3578 C  CB    . VAL B 1 98  ? 37.383  -37.274 -7.373  1.00 62.01  ? 98  VAL B CB    1 
ATOM   3579 C  CG1   . VAL B 1 98  ? 37.022  -36.530 -6.097  1.00 60.96  ? 98  VAL B CG1   1 
ATOM   3580 C  CG2   . VAL B 1 98  ? 36.781  -36.636 -8.611  1.00 61.33  ? 98  VAL B CG2   1 
ATOM   3581 N  N     . SER B 1 99  ? 39.632  -35.145 -7.656  1.00 62.44  ? 99  SER B N     1 
ATOM   3582 C  CA    . SER B 1 99  ? 40.437  -33.985 -7.246  1.00 62.40  ? 99  SER B CA    1 
ATOM   3583 C  C     . SER B 1 99  ? 39.759  -33.165 -6.161  1.00 61.12  ? 99  SER B C     1 
ATOM   3584 O  O     . SER B 1 99  ? 38.584  -33.338 -5.895  1.00 60.14  ? 99  SER B O     1 
ATOM   3585 C  CB    . SER B 1 99  ? 40.735  -33.077 -8.446  1.00 62.47  ? 99  SER B CB    1 
ATOM   3586 O  OG    . SER B 1 99  ? 39.585  -32.354 -8.845  1.00 61.13  ? 99  SER B OG    1 
ATOM   3587 N  N     . GLN B 1 100 ? 40.526  -32.264 -5.550  1.00 61.27  ? 100 GLN B N     1 
ATOM   3588 C  CA    . GLN B 1 100 ? 40.019  -31.309 -4.552  1.00 60.20  ? 100 GLN B CA    1 
ATOM   3589 C  C     . GLN B 1 100 ? 38.962  -30.422 -5.154  1.00 59.02  ? 100 GLN B C     1 
ATOM   3590 O  O     . GLN B 1 100 ? 37.943  -30.154 -4.528  1.00 57.97  ? 100 GLN B O     1 
ATOM   3591 C  CB    . GLN B 1 100 ? 41.155  -30.419 -4.009  1.00 60.84  ? 100 GLN B CB    1 
ATOM   3592 C  CG    . GLN B 1 100 ? 40.721  -29.295 -3.060  1.00 59.91  ? 100 GLN B CG    1 
ATOM   3593 C  CD    . GLN B 1 100 ? 40.432  -27.965 -3.749  1.00 59.40  ? 100 GLN B CD    1 
ATOM   3594 O  OE1   . GLN B 1 100 ? 41.290  -27.414 -4.418  1.00 60.23  ? 100 GLN B OE1   1 
ATOM   3595 N  NE2   . GLN B 1 100 ? 39.240  -27.438 -3.564  1.00 58.17  ? 100 GLN B NE2   1 
ATOM   3596 N  N     . GLN B 1 101 ? 39.227  -29.965 -6.377  1.00 59.31  ? 101 GLN B N     1 
ATOM   3597 C  CA    . GLN B 1 101 ? 38.366  -29.017 -7.086  1.00 58.40  ? 101 GLN B CA    1 
ATOM   3598 C  C     . GLN B 1 101 ? 37.048  -29.670 -7.446  1.00 57.60  ? 101 GLN B C     1 
ATOM   3599 O  O     . GLN B 1 101 ? 36.010  -29.016 -7.428  1.00 56.61  ? 101 GLN B O     1 
ATOM   3600 C  CB    . GLN B 1 101 ? 39.043  -28.514 -8.352  1.00 59.12  ? 101 GLN B CB    1 
ATOM   3601 C  CG    . GLN B 1 101 ? 40.237  -27.607 -8.116  1.00 59.97  ? 101 GLN B CG    1 
ATOM   3602 C  CD    . GLN B 1 101 ? 41.529  -28.337 -7.808  1.00 61.35  ? 101 GLN B CD    1 
ATOM   3603 O  OE1   . GLN B 1 101 ? 41.525  -29.484 -7.355  1.00 61.55  ? 101 GLN B OE1   1 
ATOM   3604 N  NE2   . GLN B 1 101 ? 42.647  -27.673 -8.056  1.00 62.45  ? 101 GLN B NE2   1 
ATOM   3605 N  N     . ALA B 1 102 ? 37.106  -30.968 -7.743  1.00 58.18  ? 102 ALA B N     1 
ATOM   3606 C  CA    . ALA B 1 102 ? 35.919  -31.771 -8.020  1.00 57.70  ? 102 ALA B CA    1 
ATOM   3607 C  C     . ALA B 1 102 ? 34.934  -31.733 -6.862  1.00 56.80  ? 102 ALA B C     1 
ATOM   3608 O  O     . ALA B 1 102 ? 33.749  -31.445 -7.036  1.00 55.96  ? 102 ALA B O     1 
ATOM   3609 C  CB    . ALA B 1 102 ? 36.311  -33.210 -8.311  1.00 58.76  ? 102 ALA B CB    1 
ATOM   3610 N  N     . VAL B 1 103 ? 35.448  -32.019 -5.674  1.00 57.08  ? 103 VAL B N     1 
ATOM   3611 C  CA    . VAL B 1 103 ? 34.640  -32.032 -4.479  1.00 56.40  ? 103 VAL B CA    1 
ATOM   3612 C  C     . VAL B 1 103 ? 34.106  -30.647 -4.153  1.00 55.42  ? 103 VAL B C     1 
ATOM   3613 O  O     . VAL B 1 103 ? 32.915  -30.508 -3.850  1.00 54.66  ? 103 VAL B O     1 
ATOM   3614 C  CB    . VAL B 1 103 ? 35.443  -32.599 -3.310  1.00 57.05  ? 103 VAL B CB    1 
ATOM   3615 C  CG1   . VAL B 1 103 ? 34.756  -32.314 -1.992  1.00 56.34  ? 103 VAL B CG1   1 
ATOM   3616 C  CG2   . VAL B 1 103 ? 35.638  -34.093 -3.514  1.00 58.02  ? 103 VAL B CG2   1 
ATOM   3617 N  N     . SER B 1 104 ? 34.962  -29.633 -4.225  1.00 55.58  ? 104 SER B N     1 
ATOM   3618 C  CA    . SER B 1 104 ? 34.532  -28.246 -4.032  1.00 54.86  ? 104 SER B CA    1 
ATOM   3619 C  C     . SER B 1 104 ? 33.164  -27.965 -4.665  1.00 54.06  ? 104 SER B C     1 
ATOM   3620 O  O     . SER B 1 104 ? 32.270  -27.411 -4.006  1.00 53.37  ? 104 SER B O     1 
ATOM   3621 C  CB    . SER B 1 104 ? 35.552  -27.291 -4.623  1.00 55.39  ? 104 SER B CB    1 
ATOM   3622 O  OG    . SER B 1 104 ? 35.023  -25.990 -4.715  1.00 54.82  ? 104 SER B OG    1 
ATOM   3623 N  N     . ASN B 1 105 ? 33.008  -28.391 -5.922  1.00 54.25  ? 105 ASN B N     1 
ATOM   3624 C  CA    . ASN B 1 105 ? 31.763  -28.223 -6.660  1.00 53.66  ? 105 ASN B CA    1 
ATOM   3625 C  C     . ASN B 1 105 ? 30.655  -29.073 -6.101  1.00 53.33  ? 105 ASN B C     1 
ATOM   3626 O  O     . ASN B 1 105 ? 29.597  -28.546 -5.793  1.00 52.70  ? 105 ASN B O     1 
ATOM   3627 C  CB    . ASN B 1 105 ? 31.949  -28.601 -8.112  1.00 54.10  ? 105 ASN B CB    1 
ATOM   3628 C  CG    . ASN B 1 105 ? 33.086  -27.873 -8.738  1.00 54.64  ? 105 ASN B CG    1 
ATOM   3629 O  OD1   . ASN B 1 105 ? 33.906  -28.489 -9.403  1.00 55.43  ? 105 ASN B OD1   1 
ATOM   3630 N  ND2   . ASN B 1 105 ? 33.202  -26.580 -8.462  1.00 54.38  ? 105 ASN B ND2   1 
ATOM   3631 N  N     . ARG B 1 106 ? 30.907  -30.377 -5.959  1.00 53.90  ? 106 ARG B N     1 
ATOM   3632 C  CA    . ARG B 1 106 ? 29.871  -31.351 -5.530  1.00 53.85  ? 106 ARG B CA    1 
ATOM   3633 C  C     . ARG B 1 106 ? 29.269  -31.067 -4.147  1.00 53.37  ? 106 ARG B C     1 
ATOM   3634 O  O     . ARG B 1 106 ? 28.098  -31.371 -3.907  1.00 53.14  ? 106 ARG B O     1 
ATOM   3635 C  CB    . ARG B 1 106 ? 30.360  -32.802 -5.710  1.00 54.78  ? 106 ARG B CB    1 
ATOM   3636 C  CG    . ARG B 1 106 ? 30.334  -33.246 -7.170  1.00 55.22  ? 106 ARG B CG    1 
ATOM   3637 C  CD    . ARG B 1 106 ? 28.933  -33.538 -7.690  1.00 54.96  ? 106 ARG B CD    1 
ATOM   3638 N  NE    . ARG B 1 106 ? 28.379  -34.751 -7.114  1.00 55.47  ? 106 ARG B NE    1 
ATOM   3639 C  CZ    . ARG B 1 106 ? 28.735  -35.995 -7.442  1.00 56.48  ? 106 ARG B CZ    1 
ATOM   3640 N  NH1   . ARG B 1 106 ? 28.123  -37.005 -6.839  1.00 57.00  ? 106 ARG B NH1   1 
ATOM   3641 N  NH2   . ARG B 1 106 ? 29.690  -36.259 -8.346  1.00 57.13  ? 106 ARG B NH2   1 
ATOM   3642 N  N     . LEU B 1 107 ? 30.028  -30.389 -3.290  1.00 53.27  ? 107 LEU B N     1 
ATOM   3643 C  CA    . LEU B 1 107 ? 29.507  -29.885 -2.021  1.00 52.80  ? 107 LEU B CA    1 
ATOM   3644 C  C     . LEU B 1 107 ? 28.546  -28.705 -2.167  1.00 52.10  ? 107 LEU B C     1 
ATOM   3645 O  O     . LEU B 1 107 ? 27.712  -28.464 -1.288  1.00 51.77  ? 107 LEU B O     1 
ATOM   3646 C  CB    . LEU B 1 107 ? 30.651  -29.481 -1.092  1.00 53.03  ? 107 LEU B CB    1 
ATOM   3647 C  CG    . LEU B 1 107 ? 31.565  -30.621 -0.632  1.00 53.82  ? 107 LEU B CG    1 
ATOM   3648 C  CD1   . LEU B 1 107 ? 32.745  -30.060 0.147   1.00 54.12  ? 107 LEU B CD1   1 
ATOM   3649 C  CD2   . LEU B 1 107 ? 30.830  -31.663 0.204   1.00 53.96  ? 107 LEU B CD2   1 
ATOM   3650 N  N     . ARG B 1 108 ? 28.675  -27.958 -3.252  1.00 51.98  ? 108 ARG B N     1 
ATOM   3651 C  CA    . ARG B 1 108 ? 27.727  -26.888 -3.566  1.00 51.47  ? 108 ARG B CA    1 
ATOM   3652 C  C     . ARG B 1 108 ? 26.626  -27.338 -4.492  1.00 51.39  ? 108 ARG B C     1 
ATOM   3653 O  O     . ARG B 1 108 ? 25.593  -26.692 -4.547  1.00 51.06  ? 108 ARG B O     1 
ATOM   3654 C  CB    . ARG B 1 108 ? 28.413  -25.707 -4.212  1.00 51.50  ? 108 ARG B CB    1 
ATOM   3655 C  CG    . ARG B 1 108 ? 29.611  -25.165 -3.442  1.00 51.77  ? 108 ARG B CG    1 
ATOM   3656 C  CD    . ARG B 1 108 ? 30.204  -23.987 -4.198  1.00 51.98  ? 108 ARG B CD    1 
ATOM   3657 N  NE    . ARG B 1 108 ? 29.159  -23.046 -4.620  1.00 51.60  ? 108 ARG B NE    1 
ATOM   3658 C  CZ    . ARG B 1 108 ? 29.345  -22.025 -5.454  1.00 51.80  ? 108 ARG B CZ    1 
ATOM   3659 N  NH1   . ARG B 1 108 ? 30.555  -21.746 -5.971  1.00 52.39  ? 108 ARG B NH1   1 
ATOM   3660 N  NH2   . ARG B 1 108 ? 28.305  -21.254 -5.758  1.00 51.53  ? 108 ARG B NH2   1 
ATOM   3661 N  N     . GLU B 1 109 ? 26.881  -28.383 -5.278  1.00 51.80  ? 109 GLU B N     1 
ATOM   3662 C  CA    . GLU B 1 109 ? 25.849  -29.049 -6.066  1.00 51.90  ? 109 GLU B CA    1 
ATOM   3663 C  C     . GLU B 1 109 ? 24.885  -29.683 -5.058  1.00 51.91  ? 109 GLU B C     1 
ATOM   3664 O  O     . GLU B 1 109 ? 23.671  -29.548 -5.203  1.00 51.78  ? 109 GLU B O     1 
ATOM   3665 C  CB    . GLU B 1 109 ? 26.483  -30.064 -7.041  1.00 52.50  ? 109 GLU B CB    1 
ATOM   3666 C  CG    . GLU B 1 109 ? 25.554  -30.702 -8.074  1.00 52.74  ? 109 GLU B CG    1 
ATOM   3667 C  CD    . GLU B 1 109 ? 25.219  -32.166 -7.761  1.00 53.36  ? 109 GLU B CD    1 
ATOM   3668 O  OE1   . GLU B 1 109 ? 24.634  -32.462 -6.685  1.00 53.34  ? 109 GLU B OE1   1 
ATOM   3669 O  OE2   . GLU B 1 109 ? 25.538  -33.034 -8.604  1.00 54.00  ? 109 GLU B OE2   1 
ATOM   3670 N  N     . MET B 1 110 ? 25.429  -30.318 -4.018  1.00 52.16  ? 110 MET B N     1 
ATOM   3671 C  CA    . MET B 1 110 ? 24.653  -30.630 -2.806  1.00 52.16  ? 110 MET B CA    1 
ATOM   3672 C  C     . MET B 1 110 ? 24.479  -29.353 -1.974  1.00 51.60  ? 110 MET B C     1 
ATOM   3673 O  O     . MET B 1 110 ? 25.056  -28.323 -2.293  1.00 51.30  ? 110 MET B O     1 
ATOM   3674 C  CB    . MET B 1 110 ? 25.335  -31.731 -1.986  1.00 52.72  ? 110 MET B CB    1 
ATOM   3675 C  CG    . MET B 1 110 ? 25.159  -33.112 -2.595  1.00 53.47  ? 110 MET B CG    1 
ATOM   3676 S  SD    . MET B 1 110 ? 26.535  -34.245 -2.339  1.00 54.33  ? 110 MET B SD    1 
ATOM   3677 C  CE    . MET B 1 110 ? 26.587  -34.377 -0.550  1.00 54.38  ? 110 MET B CE    1 
ATOM   3678 N  N     . GLY B 1 111 ? 23.700  -29.409 -0.897  1.00 51.58  ? 111 GLY B N     1 
ATOM   3679 C  CA    . GLY B 1 111 ? 23.353  -28.194 -0.143  1.00 51.16  ? 111 GLY B CA    1 
ATOM   3680 C  C     . GLY B 1 111 ? 24.401  -27.604 0.790   1.00 51.04  ? 111 GLY B C     1 
ATOM   3681 O  O     . GLY B 1 111 ? 24.129  -26.586 1.432   1.00 50.79  ? 111 GLY B O     1 
ATOM   3682 N  N     . LYS B 1 112 ? 25.603  -28.190 0.831   1.00 51.31  ? 112 LYS B N     1 
ATOM   3683 C  CA    . LYS B 1 112 ? 26.513  -28.066 1.993   1.00 51.42  ? 112 LYS B CA    1 
ATOM   3684 C  C     . LYS B 1 112 ? 27.202  -26.716 2.146   1.00 51.21  ? 112 LYS B C     1 
ATOM   3685 O  O     . LYS B 1 112 ? 27.423  -26.004 1.167   1.00 51.09  ? 112 LYS B O     1 
ATOM   3686 C  CB    . LYS B 1 112 ? 27.615  -29.137 1.961   1.00 51.97  ? 112 LYS B CB    1 
ATOM   3687 C  CG    . LYS B 1 112 ? 27.160  -30.586 1.878   1.00 52.45  ? 112 LYS B CG    1 
ATOM   3688 C  CD    . LYS B 1 112 ? 26.332  -31.003 3.077   1.00 52.56  ? 112 LYS B CD    1 
ATOM   3689 C  CE    . LYS B 1 112 ? 26.036  -32.488 3.028   1.00 53.28  ? 112 LYS B CE    1 
ATOM   3690 N  NZ    . LYS B 1 112 ? 24.787  -32.825 3.760   1.00 53.44  ? 112 LYS B NZ    1 
ATOM   3691 N  N     . ILE B 1 113 ? 27.545  -26.398 3.396   1.00 51.27  ? 113 ILE B N     1 
ATOM   3692 C  CA    . ILE B 1 113 ? 28.364  -25.234 3.751   1.00 51.29  ? 113 ILE B CA    1 
ATOM   3693 C  C     . ILE B 1 113 ? 29.336  -25.570 4.901   1.00 51.68  ? 113 ILE B C     1 
ATOM   3694 O  O     . ILE B 1 113 ? 29.134  -26.543 5.625   1.00 51.84  ? 113 ILE B O     1 
ATOM   3695 C  CB    . ILE B 1 113 ? 27.502  -24.032 4.178   1.00 51.00  ? 113 ILE B CB    1 
ATOM   3696 C  CG1   . ILE B 1 113 ? 26.509  -24.434 5.274   1.00 50.94  ? 113 ILE B CG1   1 
ATOM   3697 C  CG2   . ILE B 1 113 ? 26.761  -23.460 2.993   1.00 50.76  ? 113 ILE B CG2   1 
ATOM   3698 C  CD1   . ILE B 1 113 ? 26.282  -23.347 6.294   1.00 50.95  ? 113 ILE B CD1   1 
ATOM   3699 N  N     . GLN B 1 114 ? 30.359  -24.734 5.066   1.00 51.93  ? 114 GLN B N     1 
ATOM   3700 C  CA    . GLN B 1 114 ? 31.370  -24.891 6.108   1.00 52.41  ? 114 GLN B CA    1 
ATOM   3701 C  C     . GLN B 1 114 ? 30.946  -24.105 7.340   1.00 52.29  ? 114 GLN B C     1 
ATOM   3702 O  O     . GLN B 1 114 ? 30.680  -22.911 7.246   1.00 52.16  ? 114 GLN B O     1 
ATOM   3703 C  CB    . GLN B 1 114 ? 32.713  -24.360 5.612   1.00 52.93  ? 114 GLN B CB    1 
ATOM   3704 C  CG    . GLN B 1 114 ? 33.920  -24.962 6.316   1.00 53.64  ? 114 GLN B CG    1 
ATOM   3705 C  CD    . GLN B 1 114 ? 35.223  -24.230 6.021   1.00 54.33  ? 114 GLN B CD    1 
ATOM   3706 O  OE1   . GLN B 1 114 ? 35.266  -23.048 6.244   1.00 54.37  ? 114 GLN B OE1   1 
ATOM   3707 N  NE2   . GLN B 1 114 ? 36.283  -24.917 5.530   1.00 55.04  ? 114 GLN B NE2   1 
ATOM   3708 N  N     . LYS B 1 115 ? 30.849  -24.771 8.491   1.00 52.43  ? 115 LYS B N     1 
ATOM   3709 C  CA    . LYS B 1 115 ? 30.542  -24.097 9.770   1.00 52.45  ? 115 LYS B CA    1 
ATOM   3710 C  C     . LYS B 1 115 ? 31.646  -24.382 10.751  1.00 53.02  ? 115 LYS B C     1 
ATOM   3711 O  O     . LYS B 1 115 ? 32.310  -25.411 10.647  1.00 53.37  ? 115 LYS B O     1 
ATOM   3712 C  CB    . LYS B 1 115 ? 29.203  -24.574 10.354  1.00 52.17  ? 115 LYS B CB    1 
ATOM   3713 C  CG    . LYS B 1 115 ? 27.975  -24.086 9.595   1.00 51.72  ? 115 LYS B CG    1 
ATOM   3714 C  CD    . LYS B 1 115 ? 26.671  -24.539 10.238  1.00 51.65  ? 115 LYS B CD    1 
ATOM   3715 C  CE    . LYS B 1 115 ? 26.327  -23.700 11.462  1.00 51.78  ? 115 LYS B CE    1 
ATOM   3716 N  NZ    . LYS B 1 115 ? 24.987  -24.037 12.010  1.00 51.83  ? 115 LYS B NZ    1 
ATOM   3717 N  N     . VAL B 1 116 ? 31.807  -23.487 11.720  1.00 53.21  ? 116 VAL B N     1 
ATOM   3718 C  CA    . VAL B 1 116 ? 32.895  -23.600 12.705  1.00 53.85  ? 116 VAL B CA    1 
ATOM   3719 C  C     . VAL B 1 116 ? 32.486  -24.323 13.988  1.00 53.95  ? 116 VAL B C     1 
ATOM   3720 O  O     . VAL B 1 116 ? 31.391  -24.122 14.526  1.00 53.63  ? 116 VAL B O     1 
ATOM   3721 C  CB    . VAL B 1 116 ? 33.531  -22.238 13.080  1.00 54.25  ? 116 VAL B CB    1 
ATOM   3722 C  CG1   . VAL B 1 116 ? 34.505  -21.813 11.996  1.00 54.61  ? 116 VAL B CG1   1 
ATOM   3723 C  CG2   . VAL B 1 116 ? 32.476  -21.160 13.337  1.00 53.91  ? 116 VAL B CG2   1 
ATOM   3724 N  N     . GLY B 1 117 ? 33.414  -25.142 14.475  1.00 54.53  ? 117 GLY B N     1 
ATOM   3725 C  CA    . GLY B 1 117 ? 33.207  -25.989 15.637  1.00 54.81  ? 117 GLY B CA    1 
ATOM   3726 C  C     . GLY B 1 117 ? 33.072  -25.203 16.924  1.00 54.96  ? 117 GLY B C     1 
ATOM   3727 O  O     . GLY B 1 117 ? 34.045  -24.624 17.436  1.00 55.49  ? 117 GLY B O     1 
ATOM   3728 N  N     . ARG B 1 118 ? 31.855  -25.202 17.443  1.00 54.62  ? 118 ARG B N     1 
ATOM   3729 C  CA    . ARG B 1 118 ? 31.526  -24.510 18.674  1.00 54.79  ? 118 ARG B CA    1 
ATOM   3730 C  C     . ARG B 1 118 ? 32.440  -24.937 19.857  1.00 55.52  ? 118 ARG B C     1 
ATOM   3731 O  O     . ARG B 1 118 ? 32.713  -26.124 20.028  1.00 55.84  ? 118 ARG B O     1 
ATOM   3732 C  CB    . ARG B 1 118 ? 30.045  -24.769 18.966  1.00 54.47  ? 118 ARG B CB    1 
ATOM   3733 C  CG    . ARG B 1 118 ? 29.501  -24.007 20.151  1.00 54.66  ? 118 ARG B CG    1 
ATOM   3734 C  CD    . ARG B 1 118 ? 28.067  -23.549 19.941  1.00 54.31  ? 118 ARG B CD    1 
ATOM   3735 N  NE    . ARG B 1 118 ? 27.355  -23.550 21.217  1.00 54.67  ? 118 ARG B NE    1 
ATOM   3736 C  CZ    . ARG B 1 118 ? 27.542  -22.681 22.216  1.00 55.05  ? 118 ARG B CZ    1 
ATOM   3737 N  NH1   . ARG B 1 118 ? 28.414  -21.667 22.127  1.00 55.17  ? 118 ARG B NH1   1 
ATOM   3738 N  NH2   . ARG B 1 118 ? 26.833  -22.826 23.331  1.00 55.44  ? 118 ARG B NH2   1 
ATOM   3739 N  N     . TRP B 1 119 ? 32.942  -23.968 20.633  1.00 55.90  ? 119 TRP B N     1 
ATOM   3740 C  CA    . TRP B 1 119 ? 33.758  -24.261 21.835  1.00 56.65  ? 119 TRP B CA    1 
ATOM   3741 C  C     . TRP B 1 119 ? 32.870  -24.683 23.009  1.00 56.74  ? 119 TRP B C     1 
ATOM   3742 O  O     . TRP B 1 119 ? 31.788  -24.114 23.212  1.00 56.39  ? 119 TRP B O     1 
ATOM   3743 C  CB    . TRP B 1 119 ? 34.554  -23.041 22.295  1.00 57.16  ? 119 TRP B CB    1 
ATOM   3744 C  CG    . TRP B 1 119 ? 35.933  -22.841 21.727  1.00 57.70  ? 119 TRP B CG    1 
ATOM   3745 C  CD1   . TRP B 1 119 ? 36.456  -21.657 21.295  1.00 57.95  ? 119 TRP B CD1   1 
ATOM   3746 C  CD2   . TRP B 1 119 ? 36.990  -23.813 21.589  1.00 58.27  ? 119 TRP B CD2   1 
ATOM   3747 N  NE1   . TRP B 1 119 ? 37.757  -21.828 20.880  1.00 58.63  ? 119 TRP B NE1   1 
ATOM   3748 C  CE2   . TRP B 1 119 ? 38.111  -23.139 21.047  1.00 58.84  ? 119 TRP B CE2   1 
ATOM   3749 C  CE3   . TRP B 1 119 ? 37.095  -25.183 21.849  1.00 58.49  ? 119 TRP B CE3   1 
ATOM   3750 C  CZ2   . TRP B 1 119 ? 39.321  -23.791 20.763  1.00 59.61  ? 119 TRP B CZ2   1 
ATOM   3751 C  CZ3   . TRP B 1 119 ? 38.300  -25.835 21.563  1.00 59.25  ? 119 TRP B CZ3   1 
ATOM   3752 C  CH2   . TRP B 1 119 ? 39.396  -25.133 21.029  1.00 59.80  ? 119 TRP B CH2   1 
ATOM   3753 N  N     . VAL B 1 120 ? 33.336  -25.655 23.794  1.00 57.32  ? 120 VAL B N     1 
ATOM   3754 C  CA    . VAL B 1 120 ? 32.641  -26.071 25.025  1.00 57.60  ? 120 VAL B CA    1 
ATOM   3755 C  C     . VAL B 1 120 ? 33.597  -26.050 26.230  1.00 58.45  ? 120 VAL B C     1 
ATOM   3756 O  O     . VAL B 1 120 ? 34.804  -26.204 26.059  1.00 58.92  ? 120 VAL B O     1 
ATOM   3757 C  CB    . VAL B 1 120 ? 31.944  -27.450 24.879  1.00 57.60  ? 120 VAL B CB    1 
ATOM   3758 C  CG1   . VAL B 1 120 ? 30.794  -27.358 23.891  1.00 56.86  ? 120 VAL B CG1   1 
ATOM   3759 C  CG2   . VAL B 1 120 ? 32.913  -28.542 24.464  1.00 58.06  ? 120 VAL B CG2   1 
ATOM   3760 N  N     . PRO B 1 121 ? 33.064  -25.859 27.452  1.00 58.75  ? 121 PRO B N     1 
ATOM   3761 C  CA    . PRO B 1 121 ? 33.925  -25.585 28.609  1.00 59.56  ? 121 PRO B CA    1 
ATOM   3762 C  C     . PRO B 1 121 ? 34.958  -26.638 29.003  1.00 60.35  ? 121 PRO B C     1 
ATOM   3763 O  O     . PRO B 1 121 ? 35.960  -26.269 29.630  1.00 61.06  ? 121 PRO B O     1 
ATOM   3764 C  CB    . PRO B 1 121 ? 32.934  -25.431 29.770  1.00 59.73  ? 121 PRO B CB    1 
ATOM   3765 C  CG    . PRO B 1 121 ? 31.599  -25.259 29.164  1.00 59.00  ? 121 PRO B CG    1 
ATOM   3766 C  CD    . PRO B 1 121 ? 31.643  -25.931 27.836  1.00 58.48  ? 121 PRO B CD    1 
ATOM   3767 N  N     . HIS B 1 122 ? 34.724  -27.915 28.686  1.00 60.39  ? 122 HIS B N     1 
ATOM   3768 C  CA    . HIS B 1 122 ? 35.553  -28.985 29.249  1.00 61.34  ? 122 HIS B CA    1 
ATOM   3769 C  C     . HIS B 1 122 ? 35.382  -30.352 28.584  1.00 61.45  ? 122 HIS B C     1 
ATOM   3770 O  O     . HIS B 1 122 ? 34.333  -30.643 28.030  1.00 60.87  ? 122 HIS B O     1 
ATOM   3771 C  CB    . HIS B 1 122 ? 35.219  -29.117 30.741  1.00 61.94  ? 122 HIS B CB    1 
ATOM   3772 C  CG    . HIS B 1 122 ? 36.285  -29.783 31.544  1.00 63.07  ? 122 HIS B CG    1 
ATOM   3773 N  ND1   . HIS B 1 122 ? 37.591  -29.350 31.548  1.00 63.61  ? 122 HIS B ND1   1 
ATOM   3774 C  CD2   . HIS B 1 122 ? 36.235  -30.840 32.383  1.00 63.89  ? 122 HIS B CD2   1 
ATOM   3775 C  CE1   . HIS B 1 122 ? 38.306  -30.122 32.345  1.00 64.69  ? 122 HIS B CE1   1 
ATOM   3776 N  NE2   . HIS B 1 122 ? 37.505  -31.032 32.866  1.00 64.87  ? 122 HIS B NE2   1 
ATOM   3777 N  N     . GLU B 1 123 ? 36.417  -31.187 28.654  1.00 62.33  ? 123 GLU B N     1 
ATOM   3778 C  CA    . GLU B 1 123 ? 36.306  -32.587 28.260  1.00 62.78  ? 123 GLU B CA    1 
ATOM   3779 C  C     . GLU B 1 123 ? 35.706  -33.328 29.447  1.00 63.44  ? 123 GLU B C     1 
ATOM   3780 O  O     . GLU B 1 123 ? 36.307  -33.352 30.511  1.00 64.24  ? 123 GLU B O     1 
ATOM   3781 C  CB    . GLU B 1 123 ? 37.679  -33.163 27.895  1.00 63.66  ? 123 GLU B CB    1 
ATOM   3782 C  CG    . GLU B 1 123 ? 37.651  -34.543 27.231  1.00 64.18  ? 123 GLU B CG    1 
ATOM   3783 C  CD    . GLU B 1 123 ? 37.378  -34.504 25.719  1.00 63.39  ? 123 GLU B CD    1 
ATOM   3784 O  OE1   . GLU B 1 123 ? 38.239  -33.990 24.964  1.00 63.29  ? 123 GLU B OE1   1 
ATOM   3785 O  OE2   . GLU B 1 123 ? 36.317  -35.011 25.262  1.00 62.97  ? 123 GLU B OE2   1 
ATOM   3786 N  N     . LEU B 1 124 ? 34.521  -33.912 29.281  1.00 63.20  ? 124 LEU B N     1 
ATOM   3787 C  CA    . LEU B 1 124 ? 33.810  -34.558 30.399  1.00 63.89  ? 124 LEU B CA    1 
ATOM   3788 C  C     . LEU B 1 124 ? 34.067  -36.054 30.506  1.00 65.06  ? 124 LEU B C     1 
ATOM   3789 O  O     . LEU B 1 124 ? 34.166  -36.747 29.508  1.00 65.13  ? 124 LEU B O     1 
ATOM   3790 C  CB    . LEU B 1 124 ? 32.287  -34.351 30.304  1.00 63.25  ? 124 LEU B CB    1 
ATOM   3791 C  CG    . LEU B 1 124 ? 31.618  -32.981 30.547  1.00 62.38  ? 124 LEU B CG    1 
ATOM   3792 C  CD1   . LEU B 1 124 ? 30.213  -33.163 31.118  1.00 62.52  ? 124 LEU B CD1   1 
ATOM   3793 C  CD2   . LEU B 1 124 ? 32.420  -32.058 31.450  1.00 62.55  ? 124 LEU B CD2   1 
ATOM   3794 N  N     . ASN B 1 125 ? 34.142  -36.533 31.744  1.00 66.08  ? 125 ASN B N     1 
ATOM   3795 C  CA    . ASN B 1 125 ? 34.105  -37.963 32.064  1.00 67.38  ? 125 ASN B CA    1 
ATOM   3796 C  C     . ASN B 1 125 ? 32.745  -38.579 31.912  1.00 67.43  ? 125 ASN B C     1 
ATOM   3797 O  O     . ASN B 1 125 ? 31.736  -37.880 31.890  1.00 66.58  ? 125 ASN B O     1 
ATOM   3798 C  CB    . ASN B 1 125 ? 34.503  -38.176 33.505  1.00 68.47  ? 125 ASN B CB    1 
ATOM   3799 C  CG    . ASN B 1 125 ? 35.956  -37.916 33.721  1.00 68.92  ? 125 ASN B CG    1 
ATOM   3800 O  OD1   . ASN B 1 125 ? 36.805  -38.673 33.249  1.00 69.69  ? 125 ASN B OD1   1 
ATOM   3801 N  ND2   . ASN B 1 125 ? 36.266  -36.850 34.441  1.00 68.60  ? 125 ASN B ND2   1 
ATOM   3802 N  N     . GLU B 1 126 ? 32.723  -39.903 31.826  1.00 68.60  ? 126 GLU B N     1 
ATOM   3803 C  CA    . GLU B 1 126 ? 31.470  -40.638 31.850  1.00 69.06  ? 126 GLU B CA    1 
ATOM   3804 C  C     . GLU B 1 126 ? 30.749  -40.336 33.168  1.00 69.38  ? 126 GLU B C     1 
ATOM   3805 O  O     . GLU B 1 126 ? 29.533  -40.130 33.166  1.00 69.05  ? 126 GLU B O     1 
ATOM   3806 C  CB    . GLU B 1 126 ? 31.722  -42.145 31.642  1.00 70.58  ? 126 GLU B CB    1 
ATOM   3807 C  CG    . GLU B 1 126 ? 30.471  -43.040 31.660  1.00 71.40  ? 126 GLU B CG    1 
ATOM   3808 C  CD    . GLU B 1 126 ? 30.158  -43.711 33.023  1.00 72.92  ? 126 GLU B CD    1 
ATOM   3809 O  OE1   . GLU B 1 126 ? 30.742  -43.347 34.078  1.00 73.16  ? 126 GLU B OE1   1 
ATOM   3810 O  OE2   . GLU B 1 126 ? 29.304  -44.629 33.042  1.00 73.99  ? 126 GLU B OE2   1 
ATOM   3811 N  N     . ARG B 1 127 ? 31.493  -40.280 34.277  1.00 70.08  ? 127 ARG B N     1 
ATOM   3812 C  CA    . ARG B 1 127 ? 30.890  -39.946 35.573  1.00 70.44  ? 127 ARG B CA    1 
ATOM   3813 C  C     . ARG B 1 127 ? 30.408  -38.500 35.605  1.00 69.05  ? 127 ARG B C     1 
ATOM   3814 O  O     . ARG B 1 127 ? 29.226  -38.255 35.840  1.00 68.89  ? 127 ARG B O     1 
ATOM   3815 C  CB    . ARG B 1 127 ? 31.839  -40.206 36.746  1.00 71.56  ? 127 ARG B CB    1 
ATOM   3816 C  CG    . ARG B 1 127 ? 31.419  -39.497 38.031  1.00 71.63  ? 127 ARG B CG    1 
ATOM   3817 C  CD    . ARG B 1 127 ? 31.655  -40.352 39.262  1.00 73.31  ? 127 ARG B CD    1 
ATOM   3818 N  NE    . ARG B 1 127 ? 31.605  -39.611 40.539  1.00 73.45  ? 127 ARG B NE    1 
ATOM   3819 C  CZ    . ARG B 1 127 ? 30.514  -39.050 41.088  1.00 73.20  ? 127 ARG B CZ    1 
ATOM   3820 N  NH1   . ARG B 1 127 ? 29.323  -39.076 40.468  1.00 72.73  ? 127 ARG B NH1   1 
ATOM   3821 N  NH2   . ARG B 1 127 ? 30.622  -38.431 42.273  1.00 73.50  ? 127 ARG B NH2   1 
ATOM   3822 N  N     . GLN B 1 128 ? 31.325  -37.557 35.403  1.00 68.24  ? 128 GLN B N     1 
ATOM   3823 C  CA    . GLN B 1 128 ? 31.001  -36.118 35.335  1.00 67.01  ? 128 GLN B CA    1 
ATOM   3824 C  C     . GLN B 1 128 ? 29.712  -35.772 34.588  1.00 66.15  ? 128 GLN B C     1 
ATOM   3825 O  O     . GLN B 1 128 ? 28.993  -34.863 34.998  1.00 65.70  ? 128 GLN B O     1 
ATOM   3826 C  CB    . GLN B 1 128 ? 32.131  -35.361 34.661  1.00 66.27  ? 128 GLN B CB    1 
ATOM   3827 C  CG    . GLN B 1 128 ? 33.319  -35.068 35.552  1.00 66.89  ? 128 GLN B CG    1 
ATOM   3828 C  CD    . GLN B 1 128 ? 34.392  -34.287 34.816  1.00 66.28  ? 128 GLN B CD    1 
ATOM   3829 O  OE1   . GLN B 1 128 ? 34.813  -34.688 33.731  1.00 66.08  ? 128 GLN B OE1   1 
ATOM   3830 N  NE2   . GLN B 1 128 ? 34.843  -33.172 35.397  1.00 66.11  ? 128 GLN B NE2   1 
ATOM   3831 N  N     . MET B 1 129 ? 29.448  -36.479 33.488  1.00 66.01  ? 129 MET B N     1 
ATOM   3832 C  CA    . MET B 1 129 ? 28.174  -36.370 32.777  1.00 65.46  ? 129 MET B CA    1 
ATOM   3833 C  C     . MET B 1 129 ? 27.004  -36.757 33.685  1.00 66.32  ? 129 MET B C     1 
ATOM   3834 O  O     . MET B 1 129 ? 26.165  -35.912 33.982  1.00 65.91  ? 129 MET B O     1 
ATOM   3835 C  CB    . MET B 1 129 ? 28.143  -37.267 31.538  1.00 65.48  ? 129 MET B CB    1 
ATOM   3836 C  CG    . MET B 1 129 ? 28.929  -36.773 30.339  1.00 64.46  ? 129 MET B CG    1 
ATOM   3837 S  SD    . MET B 1 129 ? 29.180  -38.082 29.105  1.00 64.93  ? 129 MET B SD    1 
ATOM   3838 C  CE    . MET B 1 129 ? 27.529  -38.775 28.911  1.00 65.39  ? 129 MET B CE    1 
ATOM   3839 N  N     . GLU B 1 130 ? 26.956  -38.014 34.137  1.00 67.66  ? 130 GLU B N     1 
ATOM   3840 C  CA    . GLU B 1 130 ? 25.819  -38.494 34.941  1.00 68.71  ? 130 GLU B CA    1 
ATOM   3841 C  C     . GLU B 1 130 ? 25.699  -37.747 36.282  1.00 68.92  ? 130 GLU B C     1 
ATOM   3842 O  O     . GLU B 1 130 ? 24.608  -37.631 36.830  1.00 69.38  ? 130 GLU B O     1 
ATOM   3843 C  CB    . GLU B 1 130 ? 25.863  -40.021 35.147  1.00 70.29  ? 130 GLU B CB    1 
ATOM   3844 C  CG    . GLU B 1 130 ? 26.568  -40.493 36.418  1.00 71.49  ? 130 GLU B CG    1 
ATOM   3845 C  CD    . GLU B 1 130 ? 26.985  -41.952 36.368  1.00 72.97  ? 130 GLU B CD    1 
ATOM   3846 O  OE1   . GLU B 1 130 ? 27.627  -42.360 35.369  1.00 72.73  ? 130 GLU B OE1   1 
ATOM   3847 O  OE2   . GLU B 1 130 ? 26.702  -42.682 37.347  1.00 74.47  ? 130 GLU B OE2   1 
ATOM   3848 N  N     . ARG B 1 131 ? 26.832  -37.281 36.809  1.00 68.73  ? 131 ARG B N     1 
ATOM   3849 C  CA    . ARG B 1 131 ? 26.880  -36.366 37.966  1.00 68.76  ? 131 ARG B CA    1 
ATOM   3850 C  C     . ARG B 1 131 ? 26.095  -35.097 37.646  1.00 67.67  ? 131 ARG B C     1 
ATOM   3851 O  O     . ARG B 1 131 ? 25.276  -34.642 38.436  1.00 68.01  ? 131 ARG B O     1 
ATOM   3852 C  CB    . ARG B 1 131 ? 28.354  -36.047 38.337  1.00 68.69  ? 131 ARG B CB    1 
ATOM   3853 C  CG    . ARG B 1 131 ? 28.599  -35.014 39.439  1.00 68.68  ? 131 ARG B CG    1 
ATOM   3854 C  CD    . ARG B 1 131 ? 28.009  -35.453 40.762  1.00 69.94  ? 131 ARG B CD    1 
ATOM   3855 N  NE    . ARG B 1 131 ? 28.331  -34.550 41.879  1.00 70.11  ? 131 ARG B NE    1 
ATOM   3856 C  CZ    . ARG B 1 131 ? 27.582  -33.532 42.338  1.00 69.82  ? 131 ARG B CZ    1 
ATOM   3857 N  NH1   . ARG B 1 131 ? 26.420  -33.199 41.781  1.00 69.31  ? 131 ARG B NH1   1 
ATOM   3858 N  NH2   . ARG B 1 131 ? 28.013  -32.821 43.384  1.00 70.16  ? 131 ARG B NH2   1 
ATOM   3859 N  N     . ARG B 1 132 ? 26.339  -34.538 36.473  1.00 66.47  ? 132 ARG B N     1 
ATOM   3860 C  CA    . ARG B 1 132 ? 25.568  -33.395 36.026  1.00 65.53  ? 132 ARG B CA    1 
ATOM   3861 C  C     . ARG B 1 132 ? 24.119  -33.718 35.693  1.00 65.77  ? 132 ARG B C     1 
ATOM   3862 O  O     . ARG B 1 132 ? 23.235  -32.965 36.074  1.00 65.75  ? 132 ARG B O     1 
ATOM   3863 C  CB    . ARG B 1 132 ? 26.265  -32.735 34.891  1.00 64.33  ? 132 ARG B CB    1 
ATOM   3864 C  CG    . ARG B 1 132 ? 25.651  -31.407 34.469  1.00 63.40  ? 132 ARG B CG    1 
ATOM   3865 C  CD    . ARG B 1 132 ? 26.709  -30.375 34.111  1.00 62.61  ? 132 ARG B CD    1 
ATOM   3866 N  NE    . ARG B 1 132 ? 27.213  -30.678 32.799  1.00 61.95  ? 132 ARG B NE    1 
ATOM   3867 C  CZ    . ARG B 1 132 ? 26.880  -30.067 31.664  1.00 61.04  ? 132 ARG B CZ    1 
ATOM   3868 N  NH1   . ARG B 1 132 ? 27.455  -30.537 30.589  1.00 60.65  ? 132 ARG B NH1   1 
ATOM   3869 N  NH2   . ARG B 1 132 ? 26.013  -29.042 31.554  1.00 60.61  ? 132 ARG B NH2   1 
ATOM   3870 N  N     . LYS B 1 133 ? 23.887  -34.839 35.011  1.00 66.14  ? 133 LYS B N     1 
ATOM   3871 C  CA    . LYS B 1 133 ? 22.534  -35.294 34.643  1.00 66.59  ? 133 LYS B CA    1 
ATOM   3872 C  C     . LYS B 1 133 ? 21.615  -35.418 35.856  1.00 67.78  ? 133 LYS B C     1 
ATOM   3873 O  O     . LYS B 1 133 ? 20.456  -35.026 35.797  1.00 67.90  ? 133 LYS B O     1 
ATOM   3874 C  CB    . LYS B 1 133 ? 22.577  -36.642 33.904  1.00 67.15  ? 133 LYS B CB    1 
ATOM   3875 C  CG    . LYS B 1 133 ? 21.289  -36.996 33.165  1.00 67.41  ? 133 LYS B CG    1 
ATOM   3876 C  CD    . LYS B 1 133 ? 21.136  -38.495 32.930  1.00 68.65  ? 133 LYS B CD    1 
ATOM   3877 C  CE    . LYS B 1 133 ? 19.856  -38.804 32.157  1.00 68.99  ? 133 LYS B CE    1 
ATOM   3878 N  NZ    . LYS B 1 133 ? 19.559  -40.264 32.074  1.00 70.53  ? 133 LYS B NZ    1 
ATOM   3879 N  N     . ASN B 1 134 ? 22.139  -35.963 36.947  1.00 68.76  ? 134 ASN B N     1 
ATOM   3880 C  CA    . ASN B 1 134 ? 21.362  -36.108 38.179  1.00 70.02  ? 134 ASN B CA    1 
ATOM   3881 C  C     . ASN B 1 134 ? 20.971  -34.782 38.805  1.00 69.62  ? 134 ASN B C     1 
ATOM   3882 O  O     . ASN B 1 134 ? 19.809  -34.595 39.150  1.00 70.25  ? 134 ASN B O     1 
ATOM   3883 C  CB    . ASN B 1 134 ? 22.096  -36.966 39.209  1.00 71.20  ? 134 ASN B CB    1 
ATOM   3884 C  CG    . ASN B 1 134 ? 21.909  -38.432 38.951  1.00 72.37  ? 134 ASN B CG    1 
ATOM   3885 O  OD1   . ASN B 1 134 ? 22.798  -39.111 38.433  1.00 72.33  ? 134 ASN B OD1   1 
ATOM   3886 N  ND2   . ASN B 1 134 ? 20.726  -38.931 39.290  1.00 73.58  ? 134 ASN B ND2   1 
ATOM   3887 N  N     . THR B 1 135 ? 21.932  -33.867 38.941  1.00 68.72  ? 135 THR B N     1 
ATOM   3888 C  CA    . THR B 1 135 ? 21.663  -32.532 39.497  1.00 68.38  ? 135 THR B CA    1 
ATOM   3889 C  C     . THR B 1 135 ? 20.475  -31.900 38.765  1.00 67.95  ? 135 THR B C     1 
ATOM   3890 O  O     . THR B 1 135 ? 19.492  -31.485 39.389  1.00 68.62  ? 135 THR B O     1 
ATOM   3891 C  CB    . THR B 1 135 ? 22.892  -31.595 39.401  1.00 67.38  ? 135 THR B CB    1 
ATOM   3892 O  OG1   . THR B 1 135 ? 24.064  -32.290 39.828  1.00 67.76  ? 135 THR B OG1   1 
ATOM   3893 C  CG2   . THR B 1 135 ? 22.712  -30.356 40.273  1.00 67.45  ? 135 THR B CG2   1 
ATOM   3894 N  N     . CYS B 1 136 ? 20.571  -31.870 37.438  1.00 66.94  ? 136 CYS B N     1 
ATOM   3895 C  CA    . CYS B 1 136 ? 19.511  -31.355 36.588  1.00 66.52  ? 136 CYS B CA    1 
ATOM   3896 C  C     . CYS B 1 136 ? 18.198  -32.108 36.879  1.00 67.79  ? 136 CYS B C     1 
ATOM   3897 O  O     . CYS B 1 136 ? 17.216  -31.481 37.271  1.00 68.27  ? 136 CYS B O     1 
ATOM   3898 C  CB    . CYS B 1 136 ? 19.941  -31.442 35.113  1.00 65.37  ? 136 CYS B CB    1 
ATOM   3899 S  SG    . CYS B 1 136 ? 21.545  -30.638 34.755  1.00 64.12  ? 136 CYS B SG    1 
ATOM   3900 N  N     . GLU B 1 137 ? 18.216  -33.439 36.754  1.00 68.52  ? 137 GLU B N     1 
ATOM   3901 C  CA    . GLU B 1 137 ? 17.039  -34.310 37.027  1.00 69.99  ? 137 GLU B CA    1 
ATOM   3902 C  C     . GLU B 1 137 ? 16.338  -34.010 38.347  1.00 71.19  ? 137 GLU B C     1 
ATOM   3903 O  O     . GLU B 1 137 ? 15.107  -33.955 38.415  1.00 72.05  ? 137 GLU B O     1 
ATOM   3904 C  CB    . GLU B 1 137 ? 17.429  -35.805 37.033  1.00 70.89  ? 137 GLU B CB    1 
ATOM   3905 C  CG    . GLU B 1 137 ? 17.264  -36.533 35.700  1.00 70.64  ? 137 GLU B CG    1 
ATOM   3906 C  CD    . GLU B 1 137 ? 17.578  -38.029 35.773  1.00 71.82  ? 137 GLU B CD    1 
ATOM   3907 O  OE1   . GLU B 1 137 ? 18.359  -38.454 36.651  1.00 72.39  ? 137 GLU B OE1   1 
ATOM   3908 O  OE2   . GLU B 1 137 ? 17.049  -38.790 34.933  1.00 72.28  ? 137 GLU B OE2   1 
ATOM   3909 N  N     . ILE B 1 138 ? 17.139  -33.852 39.391  1.00 71.36  ? 138 ILE B N     1 
ATOM   3910 C  CA    . ILE B 1 138 ? 16.633  -33.650 40.744  1.00 72.59  ? 138 ILE B CA    1 
ATOM   3911 C  C     . ILE B 1 138 ? 16.042  -32.248 40.895  1.00 72.20  ? 138 ILE B C     1 
ATOM   3912 O  O     . ILE B 1 138 ? 15.008  -32.076 41.539  1.00 73.35  ? 138 ILE B O     1 
ATOM   3913 C  CB    . ILE B 1 138 ? 17.735  -33.966 41.802  1.00 72.96  ? 138 ILE B CB    1 
ATOM   3914 C  CG1   . ILE B 1 138 ? 18.160  -35.454 41.713  1.00 73.74  ? 138 ILE B CG1   1 
ATOM   3915 C  CG2   . ILE B 1 138 ? 17.269  -33.629 43.214  1.00 74.17  ? 138 ILE B CG2   1 
ATOM   3916 C  CD1   . ILE B 1 138 ? 17.031  -36.478 41.739  1.00 75.28  ? 138 ILE B CD1   1 
ATOM   3917 N  N     . LEU B 1 139 ? 16.678  -31.257 40.285  1.00 70.74  ? 139 LEU B N     1 
ATOM   3918 C  CA    . LEU B 1 139 ? 16.138  -29.895 40.270  1.00 70.39  ? 139 LEU B CA    1 
ATOM   3919 C  C     . LEU B 1 139 ? 14.844  -29.750 39.470  1.00 70.59  ? 139 LEU B C     1 
ATOM   3920 O  O     . LEU B 1 139 ? 14.011  -28.910 39.799  1.00 71.09  ? 139 LEU B O     1 
ATOM   3921 C  CB    . LEU B 1 139 ? 17.176  -28.926 39.718  1.00 68.89  ? 139 LEU B CB    1 
ATOM   3922 C  CG    . LEU B 1 139 ? 18.399  -28.737 40.608  1.00 68.81  ? 139 LEU B CG    1 
ATOM   3923 C  CD1   . LEU B 1 139 ? 19.569  -28.206 39.802  1.00 67.42  ? 139 LEU B CD1   1 
ATOM   3924 C  CD2   . LEU B 1 139 ? 18.085  -27.802 41.755  1.00 69.54  ? 139 LEU B CD2   1 
ATOM   3925 N  N     . LEU B 1 140 ? 14.696  -30.534 38.404  1.00 70.26  ? 140 LEU B N     1 
ATOM   3926 C  CA    . LEU B 1 140 ? 13.450  -30.550 37.622  1.00 70.62  ? 140 LEU B CA    1 
ATOM   3927 C  C     . LEU B 1 140 ? 12.286  -31.128 38.420  1.00 72.50  ? 140 LEU B C     1 
ATOM   3928 O  O     . LEU B 1 140 ? 11.180  -30.606 38.323  1.00 73.12  ? 140 LEU B O     1 
ATOM   3929 C  CB    . LEU B 1 140 ? 13.608  -31.347 36.321  1.00 69.96  ? 140 LEU B CB    1 
ATOM   3930 C  CG    . LEU B 1 140 ? 14.351  -30.685 35.158  1.00 68.22  ? 140 LEU B CG    1 
ATOM   3931 C  CD1   . LEU B 1 140 ? 14.729  -31.722 34.106  1.00 67.78  ? 140 LEU B CD1   1 
ATOM   3932 C  CD2   . LEU B 1 140 ? 13.529  -29.569 34.531  1.00 67.84  ? 140 LEU B CD2   1 
ATOM   3933 N  N     . SER B 1 141 ? 12.533  -32.205 39.175  1.00 73.51  ? 141 SER B N     1 
ATOM   3934 C  CA    . SER B 1 141 ? 11.524  -32.786 40.082  1.00 75.49  ? 141 SER B CA    1 
ATOM   3935 C  C     . SER B 1 141 ? 10.971  -31.735 41.025  1.00 76.13  ? 141 SER B C     1 
ATOM   3936 O  O     . SER B 1 141 ? 9.761   -31.581 41.152  1.00 77.33  ? 141 SER B O     1 
ATOM   3937 C  CB    . SER B 1 141 ? 12.109  -33.929 40.924  1.00 76.43  ? 141 SER B CB    1 
ATOM   3938 O  OG    . SER B 1 141 ? 12.207  -35.119 40.180  1.00 76.63  ? 141 SER B OG    1 
ATOM   3939 N  N     . ARG B 1 142 ? 11.880  -31.007 41.661  1.00 75.40  ? 142 ARG B N     1 
ATOM   3940 C  CA    . ARG B 1 142 ? 11.527  -29.995 42.641  1.00 76.02  ? 142 ARG B CA    1 
ATOM   3941 C  C     . ARG B 1 142 ? 10.844  -28.765 42.041  1.00 75.58  ? 142 ARG B C     1 
ATOM   3942 O  O     . ARG B 1 142 ? 9.907   -28.239 42.623  1.00 76.77  ? 142 ARG B O     1 
ATOM   3943 C  CB    . ARG B 1 142 ? 12.774  -29.578 43.395  1.00 75.35  ? 142 ARG B CB    1 
ATOM   3944 C  CG    . ARG B 1 142 ? 12.492  -28.735 44.617  1.00 76.28  ? 142 ARG B CG    1 
ATOM   3945 C  CD    . ARG B 1 142 ? 13.725  -28.676 45.492  1.00 75.99  ? 142 ARG B CD    1 
ATOM   3946 N  NE    . ARG B 1 142 ? 14.010  -27.339 45.985  1.00 75.70  ? 142 ARG B NE    1 
ATOM   3947 C  CZ    . ARG B 1 142 ? 15.055  -27.037 46.754  1.00 75.49  ? 142 ARG B CZ    1 
ATOM   3948 N  NH1   . ARG B 1 142 ? 15.925  -27.974 47.147  1.00 75.53  ? 142 ARG B NH1   1 
ATOM   3949 N  NH2   . ARG B 1 142 ? 15.233  -25.782 47.145  1.00 75.37  ? 142 ARG B NH2   1 
ATOM   3950 N  N     . TYR B 1 143 ? 11.328  -28.300 40.893  1.00 73.98  ? 143 TYR B N     1 
ATOM   3951 C  CA    . TYR B 1 143 ? 10.714  -27.162 40.188  1.00 73.55  ? 143 TYR B CA    1 
ATOM   3952 C  C     . TYR B 1 143 ? 9.244   -27.420 39.847  1.00 74.80  ? 143 TYR B C     1 
ATOM   3953 O  O     . TYR B 1 143 ? 8.401   -26.542 40.034  1.00 75.53  ? 143 TYR B O     1 
ATOM   3954 C  CB    . TYR B 1 143 ? 11.492  -26.837 38.906  1.00 71.71  ? 143 TYR B CB    1 
ATOM   3955 C  CG    . TYR B 1 143 ? 10.818  -25.824 37.997  1.00 71.32  ? 143 TYR B CG    1 
ATOM   3956 C  CD1   . TYR B 1 143 ? 10.665  -24.487 38.389  1.00 71.47  ? 143 TYR B CD1   1 
ATOM   3957 C  CD2   . TYR B 1 143 ? 10.338  -26.199 36.739  1.00 70.90  ? 143 TYR B CD2   1 
ATOM   3958 C  CE1   . TYR B 1 143 ? 10.051  -23.557 37.554  1.00 71.25  ? 143 TYR B CE1   1 
ATOM   3959 C  CE2   . TYR B 1 143 ? 9.728   -25.278 35.896  1.00 70.61  ? 143 TYR B CE2   1 
ATOM   3960 C  CZ    . TYR B 1 143 ? 9.586   -23.963 36.306  1.00 70.80  ? 143 TYR B CZ    1 
ATOM   3961 O  OH    . TYR B 1 143 ? 8.976   -23.069 35.459  1.00 70.64  ? 143 TYR B OH    1 
ATOM   3962 N  N     . LYS B 1 144 ? 8.957   -28.621 39.338  1.00 75.15  ? 144 LYS B N     1 
ATOM   3963 C  CA    . LYS B 1 144 ? 7.581   -29.057 39.030  1.00 76.57  ? 144 LYS B CA    1 
ATOM   3964 C  C     . LYS B 1 144 ? 6.653   -28.986 40.245  1.00 78.59  ? 144 LYS B C     1 
ATOM   3965 O  O     . LYS B 1 144 ? 5.496   -28.588 40.103  1.00 79.68  ? 144 LYS B O     1 
ATOM   3966 C  CB    . LYS B 1 144 ? 7.561   -30.490 38.481  1.00 76.86  ? 144 LYS B CB    1 
ATOM   3967 C  CG    . LYS B 1 144 ? 8.137   -30.638 37.086  1.00 75.21  ? 144 LYS B CG    1 
ATOM   3968 C  CD    . LYS B 1 144 ? 8.512   -32.091 36.816  1.00 75.45  ? 144 LYS B CD    1 
ATOM   3969 C  CE    . LYS B 1 144 ? 8.719   -32.362 35.331  1.00 74.28  ? 144 LYS B CE    1 
ATOM   3970 N  NZ    . LYS B 1 144 ? 7.449   -32.553 34.563  1.00 75.19  ? 144 LYS B NZ    1 
ATOM   3971 N  N     . ARG B 1 145 ? 7.148   -29.376 41.422  1.00 79.20  ? 145 ARG B N     1 
ATOM   3972 C  CA    . ARG B 1 145 ? 6.333   -29.283 42.639  1.00 81.18  ? 145 ARG B CA    1 
ATOM   3973 C  C     . ARG B 1 145 ? 6.034   -27.838 42.971  1.00 81.20  ? 145 ARG B C     1 
ATOM   3974 O  O     . ARG B 1 145 ? 4.885   -27.506 43.268  1.00 82.77  ? 145 ARG B O     1 
ATOM   3975 C  CB    . ARG B 1 145 ? 6.973   -29.964 43.843  1.00 81.83  ? 145 ARG B CB    1 
ATOM   3976 C  CG    . ARG B 1 145 ? 6.641   -31.444 43.956  1.00 83.16  ? 145 ARG B CG    1 
ATOM   3977 C  CD    . ARG B 1 145 ? 7.881   -32.247 44.003  1.00 82.25  ? 145 ARG B CD    1 
ATOM   3978 N  NE    . ARG B 1 145 ? 8.742   -31.835 45.095  1.00 82.02  ? 145 ARG B NE    1 
ATOM   3979 C  CZ    . ARG B 1 145 ? 10.019  -32.171 45.209  1.00 80.97  ? 145 ARG B CZ    1 
ATOM   3980 N  NH1   . ARG B 1 145 ? 10.614  -32.944 44.300  1.00 80.05  ? 145 ARG B NH1   1 
ATOM   3981 N  NH2   . ARG B 1 145 ? 10.712  -31.718 46.242  1.00 80.94  ? 145 ARG B NH2   1 
ATOM   3982 N  N     . LYS B 1 146 ? 7.069   -26.997 42.959  1.00 79.65  ? 146 LYS B N     1 
ATOM   3983 C  CA    . LYS B 1 146 ? 6.869   -25.546 43.016  1.00 79.49  ? 146 LYS B CA    1 
ATOM   3984 C  C     . LYS B 1 146 ? 8.069   -24.765 42.492  1.00 77.50  ? 146 LYS B C     1 
ATOM   3985 O  O     . LYS B 1 146 ? 9.219   -25.137 42.738  1.00 76.59  ? 146 LYS B O     1 
ATOM   3986 C  CB    . LYS B 1 146 ? 6.540   -25.074 44.445  1.00 81.05  ? 146 LYS B CB    1 
ATOM   3987 C  CG    . LYS B 1 146 ? 5.841   -23.712 44.491  1.00 81.65  ? 146 LYS B CG    1 
ATOM   3988 C  CD    . LYS B 1 146 ? 4.419   -23.780 45.043  1.00 83.96  ? 146 LYS B CD    1 
ATOM   3989 C  CE    . LYS B 1 146 ? 4.369   -24.128 46.535  1.00 85.51  ? 146 LYS B CE    1 
ATOM   3990 N  NZ    . LYS B 1 146 ? 5.029   -23.113 47.406  1.00 85.33  ? 146 LYS B NZ    1 
ATOM   3991 N  N     . SER B 1 147 ? 7.787   -23.675 41.781  1.00 77.00  ? 147 SER B N     1 
ATOM   3992 C  CA    . SER B 1 147 ? 8.820   -22.741 41.364  1.00 75.44  ? 147 SER B CA    1 
ATOM   3993 C  C     . SER B 1 147 ? 9.432   -22.133 42.616  1.00 75.84  ? 147 SER B C     1 
ATOM   3994 O  O     . SER B 1 147 ? 8.728   -21.540 43.431  1.00 77.24  ? 147 SER B O     1 
ATOM   3995 C  CB    . SER B 1 147 ? 8.240   -21.637 40.474  1.00 75.22  ? 147 SER B CB    1 
ATOM   3996 O  OG    . SER B 1 147 ? 9.240   -20.722 40.068  1.00 73.87  ? 147 SER B OG    1 
ATOM   3997 N  N     . PHE B 1 148 ? 10.734  -22.331 42.775  1.00 74.73  ? 148 PHE B N     1 
ATOM   3998 C  CA    . PHE B 1 148 ? 11.513  -21.737 43.865  1.00 74.93  ? 148 PHE B CA    1 
ATOM   3999 C  C     . PHE B 1 148 ? 12.509  -20.708 43.307  1.00 73.60  ? 148 PHE B C     1 
ATOM   4000 O  O     . PHE B 1 148 ? 13.377  -20.210 44.030  1.00 73.55  ? 148 PHE B O     1 
ATOM   4001 C  CB    . PHE B 1 148 ? 12.231  -22.838 44.653  1.00 75.05  ? 148 PHE B CB    1 
ATOM   4002 C  CG    . PHE B 1 148 ? 13.035  -23.788 43.795  1.00 73.73  ? 148 PHE B CG    1 
ATOM   4003 C  CD1   . PHE B 1 148 ? 14.301  -23.441 43.347  1.00 72.32  ? 148 PHE B CD1   1 
ATOM   4004 C  CD2   . PHE B 1 148 ? 12.525  -25.036 43.441  1.00 74.07  ? 148 PHE B CD2   1 
ATOM   4005 C  CE1   . PHE B 1 148 ? 15.036  -24.314 42.561  1.00 71.24  ? 148 PHE B CE1   1 
ATOM   4006 C  CE2   . PHE B 1 148 ? 13.261  -25.911 42.655  1.00 72.99  ? 148 PHE B CE2   1 
ATOM   4007 C  CZ    . PHE B 1 148 ? 14.517  -25.551 42.217  1.00 71.57  ? 148 PHE B CZ    1 
ATOM   4008 N  N     . LEU B 1 149 ? 12.348  -20.371 42.022  1.00 72.67  ? 149 LEU B N     1 
ATOM   4009 C  CA    . LEU B 1 149 ? 13.278  -19.506 41.273  1.00 71.38  ? 149 LEU B CA    1 
ATOM   4010 C  C     . LEU B 1 149 ? 13.145  -18.037 41.653  1.00 72.02  ? 149 LEU B C     1 
ATOM   4011 O  O     . LEU B 1 149 ? 14.089  -17.260 41.466  1.00 71.33  ? 149 LEU B O     1 
ATOM   4012 C  CB    . LEU B 1 149 ? 13.067  -19.660 39.765  1.00 70.32  ? 149 LEU B CB    1 
ATOM   4013 C  CG    . LEU B 1 149 ? 13.688  -20.880 39.071  1.00 69.23  ? 149 LEU B CG    1 
ATOM   4014 C  CD1   . LEU B 1 149 ? 13.634  -22.161 39.886  1.00 69.90  ? 149 LEU B CD1   1 
ATOM   4015 C  CD2   . LEU B 1 149 ? 13.006  -21.101 37.730  1.00 68.71  ? 149 LEU B CD2   1 
ATOM   4016 N  N     . HIS B 1 150 ? 11.994  -17.676 42.226  1.00 73.49  ? 150 HIS B N     1 
ATOM   4017 C  CA    . HIS B 1 150 ? 11.780  -16.334 42.783  1.00 74.47  ? 150 HIS B CA    1 
ATOM   4018 C  C     . HIS B 1 150 ? 12.583  -16.140 44.078  1.00 74.97  ? 150 HIS B C     1 
ATOM   4019 O  O     . HIS B 1 150 ? 12.850  -15.011 44.463  1.00 75.47  ? 150 HIS B O     1 
ATOM   4020 C  CB    . HIS B 1 150 ? 10.282  -15.992 42.969  1.00 76.06  ? 150 HIS B CB    1 
ATOM   4021 C  CG    . HIS B 1 150 ? 9.552   -16.928 43.880  1.00 77.30  ? 150 HIS B CG    1 
ATOM   4022 N  ND1   . HIS B 1 150 ? 8.740   -17.953 43.434  1.00 77.50  ? 150 HIS B ND1   1 
ATOM   4023 C  CD2   . HIS B 1 150 ? 9.530   -16.991 45.228  1.00 78.51  ? 150 HIS B CD2   1 
ATOM   4024 C  CE1   . HIS B 1 150 ? 8.253   -18.603 44.477  1.00 78.83  ? 150 HIS B CE1   1 
ATOM   4025 N  NE2   . HIS B 1 150 ? 8.726   -18.045 45.576  1.00 79.42  ? 150 HIS B NE2   1 
ATOM   4026 N  N     . ARG B 1 151 ? 12.985  -17.242 44.713  1.00 74.90  ? 151 ARG B N     1 
ATOM   4027 C  CA    . ARG B 1 151 ? 13.795  -17.214 45.926  1.00 75.35  ? 151 ARG B CA    1 
ATOM   4028 C  C     . ARG B 1 151 ? 15.296  -17.308 45.663  1.00 74.01  ? 151 ARG B C     1 
ATOM   4029 O  O     . ARG B 1 151 ? 16.082  -17.179 46.601  1.00 74.35  ? 151 ARG B O     1 
ATOM   4030 C  CB    . ARG B 1 151 ? 13.377  -18.357 46.856  1.00 76.27  ? 151 ARG B CB    1 
ATOM   4031 C  CG    . ARG B 1 151 ? 11.869  -18.502 47.028  1.00 77.67  ? 151 ARG B CG    1 
ATOM   4032 C  CD    . ARG B 1 151 ? 11.419  -18.803 48.448  1.00 79.36  ? 151 ARG B CD    1 
ATOM   4033 N  NE    . ARG B 1 151 ? 11.453  -20.233 48.788  1.00 79.51  ? 151 ARG B NE    1 
ATOM   4034 C  CZ    . ARG B 1 151 ? 12.463  -20.893 49.365  1.00 79.13  ? 151 ARG B CZ    1 
ATOM   4035 N  NH1   . ARG B 1 151 ? 13.609  -20.294 49.676  1.00 78.49  ? 151 ARG B NH1   1 
ATOM   4036 N  NH2   . ARG B 1 151 ? 12.331  -22.191 49.625  1.00 79.51  ? 151 ARG B NH2   1 
ATOM   4037 N  N     . ILE B 1 152 ? 15.693  -17.519 44.402  1.00 72.61  ? 152 ILE B N     1 
ATOM   4038 C  CA    . ILE B 1 152 ? 17.111  -17.747 44.032  1.00 71.38  ? 152 ILE B CA    1 
ATOM   4039 C  C     . ILE B 1 152 ? 17.957  -16.469 43.988  1.00 71.22  ? 152 ILE B C     1 
ATOM   4040 O  O     . ILE B 1 152 ? 17.604  -15.491 43.317  1.00 71.17  ? 152 ILE B O     1 
ATOM   4041 C  CB    . ILE B 1 152 ? 17.270  -18.504 42.677  1.00 70.01  ? 152 ILE B CB    1 
ATOM   4042 C  CG1   . ILE B 1 152 ? 17.192  -20.014 42.908  1.00 70.03  ? 152 ILE B CG1   1 
ATOM   4043 C  CG2   . ILE B 1 152 ? 18.603  -18.195 41.988  1.00 68.83  ? 152 ILE B CG2   1 
ATOM   4044 C  CD1   . ILE B 1 152 ? 17.066  -20.846 41.646  1.00 69.02  ? 152 ILE B CD1   1 
ATOM   4045 N  N     . VAL B 1 153 ? 19.095  -16.532 44.682  1.00 71.21  ? 153 VAL B N     1 
ATOM   4046 C  CA    . VAL B 1 153 ? 20.132  -15.508 44.660  1.00 71.09  ? 153 VAL B CA    1 
ATOM   4047 C  C     . VAL B 1 153 ? 21.422  -16.217 44.276  1.00 70.05  ? 153 VAL B C     1 
ATOM   4048 O  O     . VAL B 1 153 ? 21.844  -17.143 44.962  1.00 70.19  ? 153 VAL B O     1 
ATOM   4049 C  CB    . VAL B 1 153 ? 20.314  -14.854 46.046  1.00 72.43  ? 153 VAL B CB    1 
ATOM   4050 C  CG1   . VAL B 1 153 ? 21.273  -13.671 45.958  1.00 72.53  ? 153 VAL B CG1   1 
ATOM   4051 C  CG2   . VAL B 1 153 ? 18.958  -14.441 46.635  1.00 73.70  ? 153 VAL B CG2   1 
ATOM   4052 N  N     . THR B 1 154 ? 22.037  -15.798 43.173  1.00 69.12  ? 154 THR B N     1 
ATOM   4053 C  CA    . THR B 1 154 ? 23.263  -16.439 42.675  1.00 68.20  ? 154 THR B CA    1 
ATOM   4054 C  C     . THR B 1 154 ? 24.322  -15.385 42.336  1.00 68.12  ? 154 THR B C     1 
ATOM   4055 O  O     . THR B 1 154 ? 24.016  -14.194 42.169  1.00 68.55  ? 154 THR B O     1 
ATOM   4056 C  CB    . THR B 1 154 ? 22.976  -17.411 41.488  1.00 67.06  ? 154 THR B CB    1 
ATOM   4057 O  OG1   . THR B 1 154 ? 24.191  -18.003 41.037  1.00 66.33  ? 154 THR B OG1   1 
ATOM   4058 C  CG2   . THR B 1 154 ? 22.332  -16.733 40.335  1.00 66.56  ? 154 THR B CG2   1 
ATOM   4059 N  N     . GLY B 1 155 ? 25.576  -15.826 42.305  1.00 67.76  ? 155 GLY B N     1 
ATOM   4060 C  CA    . GLY B 1 155 ? 26.682  -14.974 41.900  1.00 67.74  ? 155 GLY B CA    1 
ATOM   4061 C  C     . GLY B 1 155 ? 27.951  -15.728 41.588  1.00 67.21  ? 155 GLY B C     1 
ATOM   4062 O  O     . GLY B 1 155 ? 28.135  -16.888 41.969  1.00 67.07  ? 155 GLY B O     1 
ATOM   4063 N  N     . ASP B 1 156 ? 28.837  -15.050 40.888  1.00 67.05  ? 156 ASP B N     1 
ATOM   4064 C  CA    . ASP B 1 156 ? 30.098  -15.633 40.540  1.00 66.72  ? 156 ASP B CA    1 
ATOM   4065 C  C     . ASP B 1 156 ? 31.096  -14.508 40.355  1.00 67.29  ? 156 ASP B C     1 
ATOM   4066 O  O     . ASP B 1 156 ? 30.725  -13.331 40.332  1.00 67.79  ? 156 ASP B O     1 
ATOM   4067 C  CB    . ASP B 1 156 ? 29.934  -16.472 39.266  1.00 65.51  ? 156 ASP B CB    1 
ATOM   4068 C  CG    . ASP B 1 156 ? 30.978  -17.577 39.128  1.00 65.24  ? 156 ASP B CG    1 
ATOM   4069 O  OD1   . ASP B 1 156 ? 31.671  -17.886 40.120  1.00 65.97  ? 156 ASP B OD1   1 
ATOM   4070 O  OD2   . ASP B 1 156 ? 31.097  -18.145 38.016  1.00 64.38  ? 156 ASP B OD2   1 
ATOM   4071 N  N     . GLU B 1 157 ? 32.366  -14.884 40.263  1.00 67.37  ? 157 GLU B N     1 
ATOM   4072 C  CA    . GLU B 1 157 ? 33.463  -13.955 40.064  1.00 68.05  ? 157 GLU B CA    1 
ATOM   4073 C  C     . GLU B 1 157 ? 33.948  -14.093 38.626  1.00 67.23  ? 157 GLU B C     1 
ATOM   4074 O  O     . GLU B 1 157 ? 33.943  -15.207 38.076  1.00 66.35  ? 157 GLU B O     1 
ATOM   4075 C  CB    . GLU B 1 157 ? 34.611  -14.256 41.043  1.00 68.99  ? 157 GLU B CB    1 
ATOM   4076 C  CG    . GLU B 1 157 ? 34.231  -14.258 42.525  1.00 69.85  ? 157 GLU B CG    1 
ATOM   4077 C  CD    . GLU B 1 157 ? 33.555  -15.538 43.006  1.00 69.35  ? 157 GLU B CD    1 
ATOM   4078 O  OE1   . GLU B 1 157 ? 33.822  -16.625 42.446  1.00 68.61  ? 157 GLU B OE1   1 
ATOM   4079 O  OE2   . GLU B 1 157 ? 32.742  -15.451 43.960  1.00 69.83  ? 157 GLU B OE2   1 
ATOM   4080 N  N     . LYS B 1 158 ? 34.371  -12.965 38.044  1.00 67.66  ? 158 LYS B N     1 
ATOM   4081 C  CA    . LYS B 1 158 ? 34.864  -12.881 36.655  1.00 67.09  ? 158 LYS B CA    1 
ATOM   4082 C  C     . LYS B 1 158 ? 35.802  -11.683 36.436  1.00 68.17  ? 158 LYS B C     1 
ATOM   4083 O  O     . LYS B 1 158 ? 35.588  -10.621 37.014  1.00 69.13  ? 158 LYS B O     1 
ATOM   4084 C  CB    . LYS B 1 158 ? 33.672  -12.764 35.690  1.00 66.08  ? 158 LYS B CB    1 
ATOM   4085 C  CG    . LYS B 1 158 ? 33.917  -11.895 34.450  1.00 66.01  ? 158 LYS B CG    1 
ATOM   4086 C  CD    . LYS B 1 158 ? 32.666  -11.632 33.625  1.00 65.24  ? 158 LYS B CD    1 
ATOM   4087 C  CE    . LYS B 1 158 ? 32.929  -10.587 32.542  1.00 65.47  ? 158 LYS B CE    1 
ATOM   4088 N  NZ    . LYS B 1 158 ? 33.977  -10.978 31.555  1.00 65.12  ? 158 LYS B NZ    1 
ATOM   4089 N  N     . TRP B 1 159 ? 36.780  -11.843 35.543  1.00 68.09  ? 159 TRP B N     1 
ATOM   4090 C  CA    . TRP B 1 159 ? 37.741  -10.774 35.209  1.00 69.22  ? 159 TRP B CA    1 
ATOM   4091 C  C     . TRP B 1 159 ? 37.199  -9.713  34.254  1.00 69.17  ? 159 TRP B C     1 
ATOM   4092 O  O     . TRP B 1 159 ? 36.349  -10.003 33.435  1.00 68.01  ? 159 TRP B O     1 
ATOM   4093 C  CB    . TRP B 1 159 ? 38.998  -11.373 34.577  1.00 69.29  ? 159 TRP B CB    1 
ATOM   4094 C  CG    . TRP B 1 159 ? 39.875  -12.075 35.541  1.00 69.96  ? 159 TRP B CG    1 
ATOM   4095 C  CD1   . TRP B 1 159 ? 40.115  -13.414 35.607  1.00 69.34  ? 159 TRP B CD1   1 
ATOM   4096 C  CD2   . TRP B 1 159 ? 40.638  -11.476 36.588  1.00 71.52  ? 159 TRP B CD2   1 
ATOM   4097 N  NE1   . TRP B 1 159 ? 40.983  -13.689 36.631  1.00 70.41  ? 159 TRP B NE1   1 
ATOM   4098 C  CE2   . TRP B 1 159 ? 41.318  -12.516 37.254  1.00 71.73  ? 159 TRP B CE2   1 
ATOM   4099 C  CE3   . TRP B 1 159 ? 40.806  -10.162 37.034  1.00 72.86  ? 159 TRP B CE3   1 
ATOM   4100 C  CZ2   . TRP B 1 159 ? 42.154  -12.283 38.339  1.00 73.19  ? 159 TRP B CZ2   1 
ATOM   4101 C  CZ3   . TRP B 1 159 ? 41.631  -9.931  38.107  1.00 74.32  ? 159 TRP B CZ3   1 
ATOM   4102 C  CH2   . TRP B 1 159 ? 42.299  -10.987 38.750  1.00 74.45  ? 159 TRP B CH2   1 
ATOM   4103 N  N     . ILE B 1 160 ? 37.723  -8.491  34.362  1.00 70.56  ? 160 ILE B N     1 
ATOM   4104 C  CA    . ILE B 1 160 ? 37.418  -7.386  33.444  1.00 70.86  ? 160 ILE B CA    1 
ATOM   4105 C  C     . ILE B 1 160 ? 38.695  -6.632  33.101  1.00 72.26  ? 160 ILE B C     1 
ATOM   4106 O  O     . ILE B 1 160 ? 39.238  -5.936  33.953  1.00 73.78  ? 160 ILE B O     1 
ATOM   4107 C  CB    . ILE B 1 160 ? 36.427  -6.374  34.070  1.00 71.53  ? 160 ILE B CB    1 
ATOM   4108 C  CG1   . ILE B 1 160 ? 35.043  -7.018  34.200  1.00 70.23  ? 160 ILE B CG1   1 
ATOM   4109 C  CG2   . ILE B 1 160 ? 36.345  -5.081  33.239  1.00 72.35  ? 160 ILE B CG2   1 
ATOM   4110 C  CD1   . ILE B 1 160 ? 33.977  -6.142  34.834  1.00 70.90  ? 160 ILE B CD1   1 
ATOM   4111 N  N     . PHE B 1 161 ? 39.132  -6.705  31.848  1.00 71.90  ? 161 PHE B N     1 
ATOM   4112 C  CA    . PHE B 1 161 ? 40.374  -6.048  31.430  1.00 73.33  ? 161 PHE B CA    1 
ATOM   4113 C  C     . PHE B 1 161 ? 40.107  -4.572  31.114  1.00 74.52  ? 161 PHE B C     1 
ATOM   4114 O  O     . PHE B 1 161 ? 39.008  -4.221  30.670  1.00 73.84  ? 161 PHE B O     1 
ATOM   4115 C  CB    . PHE B 1 161 ? 40.975  -6.760  30.223  1.00 72.59  ? 161 PHE B CB    1 
ATOM   4116 C  CG    . PHE B 1 161 ? 41.455  -8.152  30.520  1.00 71.84  ? 161 PHE B CG    1 
ATOM   4117 C  CD1   . PHE B 1 161 ? 40.554  -9.206  30.657  1.00 70.23  ? 161 PHE B CD1   1 
ATOM   4118 C  CD2   . PHE B 1 161 ? 42.808  -8.418  30.641  1.00 72.89  ? 161 PHE B CD2   1 
ATOM   4119 C  CE1   . PHE B 1 161 ? 40.998  -10.492 30.916  1.00 69.69  ? 161 PHE B CE1   1 
ATOM   4120 C  CE2   . PHE B 1 161 ? 43.257  -9.701  30.900  1.00 72.34  ? 161 PHE B CE2   1 
ATOM   4121 C  CZ    . PHE B 1 161 ? 42.353  -10.740 31.041  1.00 70.74  ? 161 PHE B CZ    1 
ATOM   4122 N  N     . PHE B 1 162 ? 41.100  -3.712  31.351  1.00 76.42  ? 162 PHE B N     1 
ATOM   4123 C  CA    . PHE B 1 162 ? 40.961  -2.266  31.091  1.00 77.90  ? 162 PHE B CA    1 
ATOM   4124 C  C     . PHE B 1 162 ? 40.846  -1.954  29.600  1.00 77.54  ? 162 PHE B C     1 
ATOM   4125 O  O     . PHE B 1 162 ? 40.215  -0.969  29.237  1.00 78.09  ? 162 PHE B O     1 
ATOM   4126 C  CB    . PHE B 1 162 ? 42.102  -1.457  31.716  1.00 80.22  ? 162 PHE B CB    1 
ATOM   4127 C  CG    . PHE B 1 162 ? 41.863  -1.073  33.156  1.00 81.16  ? 162 PHE B CG    1 
ATOM   4128 C  CD1   . PHE B 1 162 ? 41.538  -2.039  34.109  1.00 80.11  ? 162 PHE B CD1   1 
ATOM   4129 C  CD2   . PHE B 1 162 ? 41.971  0.258   33.568  1.00 83.24  ? 162 PHE B CD2   1 
ATOM   4130 C  CE1   . PHE B 1 162 ? 41.325  -1.686  35.436  1.00 81.04  ? 162 PHE B CE1   1 
ATOM   4131 C  CE2   . PHE B 1 162 ? 41.758  0.614   34.892  1.00 84.19  ? 162 PHE B CE2   1 
ATOM   4132 C  CZ    . PHE B 1 162 ? 41.437  -0.357  35.827  1.00 83.06  ? 162 PHE B CZ    1 
ATOM   4133 N  N     . VAL B 1 163 ? 41.463  -2.785  28.754  1.00 76.72  ? 163 VAL B N     1 
ATOM   4134 C  CA    . VAL B 1 163 ? 41.179  -2.801  27.313  1.00 75.89  ? 163 VAL B CA    1 
ATOM   4135 C  C     . VAL B 1 163 ? 40.701  -4.180  26.873  1.00 73.70  ? 163 VAL B C     1 
ATOM   4136 O  O     . VAL B 1 163 ? 41.195  -5.202  27.345  1.00 73.20  ? 163 VAL B O     1 
ATOM   4137 C  CB    . VAL B 1 163 ? 42.370  -2.365  26.419  1.00 77.21  ? 163 VAL B CB    1 
ATOM   4138 C  CG1   . VAL B 1 163 ? 42.745  -0.926  26.718  1.00 79.52  ? 163 VAL B CG1   1 
ATOM   4139 C  CG2   . VAL B 1 163 ? 43.570  -3.299  26.543  1.00 77.33  ? 163 VAL B CG2   1 
ATOM   4140 N  N     . ASN B 1 164 ? 39.752  -4.178  25.939  1.00 72.54  ? 164 ASN B N     1 
ATOM   4141 C  CA    . ASN B 1 164 ? 39.152  -5.388  25.390  1.00 70.55  ? 164 ASN B CA    1 
ATOM   4142 C  C     . ASN B 1 164 ? 39.167  -5.295  23.865  1.00 70.14  ? 164 ASN B C     1 
ATOM   4143 O  O     . ASN B 1 164 ? 38.125  -5.087  23.237  1.00 69.34  ? 164 ASN B O     1 
ATOM   4144 C  CB    . ASN B 1 164 ? 37.718  -5.543  25.906  1.00 69.50  ? 164 ASN B CB    1 
ATOM   4145 C  CG    . ASN B 1 164 ? 37.591  -5.245  27.396  1.00 70.30  ? 164 ASN B CG    1 
ATOM   4146 O  OD1   . ASN B 1 164 ? 37.585  -6.157  28.211  1.00 69.70  ? 164 ASN B OD1   1 
ATOM   4147 N  ND2   . ASN B 1 164 ? 37.501  -3.962  27.751  1.00 71.77  ? 164 ASN B ND2   1 
ATOM   4148 N  N     . PRO B 1 165 ? 40.361  -5.418  23.254  1.00 70.81  ? 165 PRO B N     1 
ATOM   4149 C  CA    . PRO B 1 165 ? 40.418  -5.385  21.800  1.00 70.46  ? 165 PRO B CA    1 
ATOM   4150 C  C     . PRO B 1 165 ? 39.712  -6.549  21.140  1.00 68.48  ? 165 PRO B C     1 
ATOM   4151 O  O     . PRO B 1 165 ? 39.700  -7.659  21.670  1.00 67.56  ? 165 PRO B O     1 
ATOM   4152 C  CB    . PRO B 1 165 ? 41.914  -5.463  21.511  1.00 71.68  ? 165 PRO B CB    1 
ATOM   4153 C  CG    . PRO B 1 165 ? 42.551  -4.878  22.707  1.00 73.27  ? 165 PRO B CG    1 
ATOM   4154 C  CD    . PRO B 1 165 ? 41.714  -5.395  23.833  1.00 72.25  ? 165 PRO B CD    1 
ATOM   4155 N  N     . LYS B 1 166 ? 39.140  -6.263  19.980  1.00 67.97  ? 166 LYS B N     1 
ATOM   4156 C  CA    . LYS B 1 166 ? 38.489  -7.239  19.141  1.00 66.28  ? 166 LYS B CA    1 
ATOM   4157 C  C     . LYS B 1 166 ? 39.014  -7.068  17.693  1.00 66.52  ? 166 LYS B C     1 
ATOM   4158 O  O     . LYS B 1 166 ? 39.390  -5.958  17.279  1.00 67.84  ? 166 LYS B O     1 
ATOM   4159 C  CB    . LYS B 1 166 ? 36.990  -6.998  19.247  1.00 65.41  ? 166 LYS B CB    1 
ATOM   4160 C  CG    . LYS B 1 166 ? 36.153  -8.182  18.851  1.00 63.66  ? 166 LYS B CG    1 
ATOM   4161 C  CD    . LYS B 1 166 ? 34.666  -7.880  18.908  1.00 63.01  ? 166 LYS B CD    1 
ATOM   4162 C  CE    . LYS B 1 166 ? 33.899  -8.781  17.953  1.00 61.55  ? 166 LYS B CE    1 
ATOM   4163 N  NZ    . LYS B 1 166 ? 32.446  -8.651  18.199  1.00 61.00  ? 166 LYS B NZ    1 
ATOM   4164 N  N     . ARG B 1 167 ? 39.098  -8.169  16.947  1.00 65.42  ? 167 ARG B N     1 
ATOM   4165 C  CA    . ARG B 1 167 ? 39.589  -8.119  15.560  1.00 65.60  ? 167 ARG B CA    1 
ATOM   4166 C  C     . ARG B 1 167 ? 38.606  -7.370  14.685  1.00 65.30  ? 167 ARG B C     1 
ATOM   4167 O  O     . ARG B 1 167 ? 37.400  -7.635  14.746  1.00 64.11  ? 167 ARG B O     1 
ATOM   4168 C  CB    . ARG B 1 167 ? 39.802  -9.519  14.977  1.00 64.49  ? 167 ARG B CB    1 
ATOM   4169 C  CG    . ARG B 1 167 ? 40.927  -10.286 15.638  1.00 65.01  ? 167 ARG B CG    1 
ATOM   4170 C  CD    . ARG B 1 167 ? 41.001  -11.728 15.170  1.00 63.93  ? 167 ARG B CD    1 
ATOM   4171 N  NE    . ARG B 1 167 ? 41.616  -11.851 13.854  1.00 64.23  ? 167 ARG B NE    1 
ATOM   4172 C  CZ    . ARG B 1 167 ? 41.806  -13.003 13.217  1.00 63.57  ? 167 ARG B CZ    1 
ATOM   4173 N  NH1   . ARG B 1 167 ? 41.428  -14.157 13.767  1.00 62.59  ? 167 ARG B NH1   1 
ATOM   4174 N  NH2   . ARG B 1 167 ? 42.381  -13.005 12.019  1.00 64.00  ? 167 ARG B NH2   1 
ATOM   4175 N  N     . LYS B 1 168 ? 39.116  -6.457  13.859  1.00 66.47  ? 168 LYS B N     1 
ATOM   4176 C  CA    . LYS B 1 168 ? 38.266  -5.681  12.965  1.00 66.41  ? 168 LYS B CA    1 
ATOM   4177 C  C     . LYS B 1 168 ? 37.887  -6.529  11.757  1.00 65.08  ? 168 LYS B C     1 
ATOM   4178 O  O     . LYS B 1 168 ? 38.543  -7.525  11.461  1.00 64.64  ? 168 LYS B O     1 
ATOM   4179 C  CB    . LYS B 1 168 ? 38.974  -4.400  12.509  1.00 68.31  ? 168 LYS B CB    1 
ATOM   4180 C  CG    . LYS B 1 168 ? 39.390  -3.471  13.637  1.00 69.89  ? 168 LYS B CG    1 
ATOM   4181 C  CD    . LYS B 1 168 ? 38.211  -2.986  14.474  1.00 69.58  ? 168 LYS B CD    1 
ATOM   4182 C  CE    . LYS B 1 168 ? 38.654  -1.933  15.472  1.00 71.41  ? 168 LYS B CE    1 
ATOM   4183 N  NZ    . LYS B 1 168 ? 39.777  -2.411  16.329  1.00 71.96  ? 168 LYS B NZ    1 
ATOM   4184 N  N     . LYS B 1 169 ? 36.812  -6.142  11.081  1.00 64.54  ? 169 LYS B N     1 
ATOM   4185 C  CA    . LYS B 1 169 ? 36.428  -6.765  9.822   1.00 63.51  ? 169 LYS B CA    1 
ATOM   4186 C  C     . LYS B 1 169 ? 36.228  -5.680  8.781   1.00 64.34  ? 169 LYS B C     1 
ATOM   4187 O  O     . LYS B 1 169 ? 35.314  -4.870  8.920   1.00 64.54  ? 169 LYS B O     1 
ATOM   4188 C  CB    . LYS B 1 169 ? 35.154  -7.568  10.002  1.00 61.88  ? 169 LYS B CB    1 
ATOM   4189 C  CG    . LYS B 1 169 ? 35.399  -8.914  10.641  1.00 60.94  ? 169 LYS B CG    1 
ATOM   4190 C  CD    . LYS B 1 169 ? 34.146  -9.423  11.324  1.00 59.83  ? 169 LYS B CD    1 
ATOM   4191 C  CE    . LYS B 1 169 ? 34.237  -10.914 11.591  1.00 58.79  ? 169 LYS B CE    1 
ATOM   4192 N  NZ    . LYS B 1 169 ? 33.185  -11.353 12.546  1.00 58.05  ? 169 LYS B NZ    1 
ATOM   4193 N  N     . SER B 1 170 ? 37.072  -5.671  7.744   1.00 64.92  ? 170 SER B N     1 
ATOM   4194 C  CA    . SER B 1 170 ? 37.071  -4.616  6.723   1.00 65.99  ? 170 SER B CA    1 
ATOM   4195 C  C     . SER B 1 170 ? 36.332  -5.073  5.479   1.00 64.88  ? 170 SER B C     1 
ATOM   4196 O  O     . SER B 1 170 ? 36.431  -6.235  5.089   1.00 63.75  ? 170 SER B O     1 
ATOM   4197 C  CB    . SER B 1 170 ? 38.501  -4.250  6.329   1.00 67.59  ? 170 SER B CB    1 
ATOM   4198 O  OG    . SER B 1 170 ? 39.179  -3.573  7.371   1.00 69.00  ? 170 SER B OG    1 
ATOM   4199 N  N     . TYR B 1 171 ? 35.596  -4.140  4.876   1.00 65.32  ? 171 TYR B N     1 
ATOM   4200 C  CA    . TYR B 1 171 ? 35.011  -4.317  3.554   1.00 64.69  ? 171 TYR B CA    1 
ATOM   4201 C  C     . TYR B 1 171 ? 35.906  -3.606  2.548   1.00 66.17  ? 171 TYR B C     1 
ATOM   4202 O  O     . TYR B 1 171 ? 35.988  -2.374  2.519   1.00 67.69  ? 171 TYR B O     1 
ATOM   4203 C  CB    . TYR B 1 171 ? 33.569  -3.790  3.485   1.00 64.30  ? 171 TYR B CB    1 
ATOM   4204 C  CG    . TYR B 1 171 ? 32.540  -4.750  4.052   1.00 62.64  ? 171 TYR B CG    1 
ATOM   4205 C  CD1   . TYR B 1 171 ? 32.418  -6.045  3.558   1.00 61.23  ? 171 TYR B CD1   1 
ATOM   4206 C  CD2   . TYR B 1 171 ? 31.676  -4.363  5.072   1.00 62.61  ? 171 TYR B CD2   1 
ATOM   4207 C  CE1   . TYR B 1 171 ? 31.482  -6.928  4.072   1.00 59.89  ? 171 TYR B CE1   1 
ATOM   4208 C  CE2   . TYR B 1 171 ? 30.733  -5.244  5.587   1.00 61.25  ? 171 TYR B CE2   1 
ATOM   4209 C  CZ    . TYR B 1 171 ? 30.643  -6.524  5.081   1.00 59.91  ? 171 TYR B CZ    1 
ATOM   4210 O  OH    . TYR B 1 171 ? 29.720  -7.400  5.584   1.00 58.74  ? 171 TYR B OH    1 
ATOM   4211 N  N     . VAL B 1 172 ? 36.570  -4.401  1.719   1.00 65.83  ? 172 VAL B N     1 
ATOM   4212 C  CA    . VAL B 1 172 ? 37.596  -3.898  0.836   1.00 67.31  ? 172 VAL B CA    1 
ATOM   4213 C  C     . VAL B 1 172 ? 37.722  -4.808  -0.389  1.00 66.50  ? 172 VAL B C     1 
ATOM   4214 O  O     . VAL B 1 172 ? 37.374  -5.985  -0.330  1.00 64.96  ? 172 VAL B O     1 
ATOM   4215 C  CB    . VAL B 1 172 ? 38.919  -3.803  1.631   1.00 68.56  ? 172 VAL B CB    1 
ATOM   4216 C  CG1   . VAL B 1 172 ? 39.495  -5.199  1.915   1.00 67.55  ? 172 VAL B CG1   1 
ATOM   4217 C  CG2   . VAL B 1 172 ? 39.916  -2.860  0.947   1.00 70.69  ? 172 VAL B CG2   1 
ATOM   4218 N  N     . ASP B 1 173 ? 38.219  -4.252  -1.487  1.00 67.68  ? 173 ASP B N     1 
ATOM   4219 C  CA    . ASP B 1 173 ? 38.476  -5.026  -2.697  1.00 67.21  ? 173 ASP B CA    1 
ATOM   4220 C  C     . ASP B 1 173 ? 39.359  -6.231  -2.403  1.00 66.76  ? 173 ASP B C     1 
ATOM   4221 O  O     . ASP B 1 173 ? 40.243  -6.134  -1.575  1.00 67.64  ? 173 ASP B O     1 
ATOM   4222 C  CB    . ASP B 1 173 ? 39.194  -4.170  -3.731  1.00 69.00  ? 173 ASP B CB    1 
ATOM   4223 C  CG    . ASP B 1 173 ? 38.365  -2.999  -4.197  1.00 69.63  ? 173 ASP B CG    1 
ATOM   4224 O  OD1   . ASP B 1 173 ? 37.181  -3.201  -4.549  1.00 68.36  ? 173 ASP B OD1   1 
ATOM   4225 O  OD2   . ASP B 1 173 ? 38.908  -1.877  -4.210  1.00 71.54  ? 173 ASP B OD2   1 
ATOM   4226 N  N     . PRO B 1 174 ? 39.146  -7.361  -3.101  1.00 65.54  ? 174 PRO B N     1 
ATOM   4227 C  CA    . PRO B 1 174 ? 39.993  -8.532  -2.845  1.00 65.27  ? 174 PRO B CA    1 
ATOM   4228 C  C     . PRO B 1 174 ? 41.450  -8.249  -3.169  1.00 67.10  ? 174 PRO B C     1 
ATOM   4229 O  O     . PRO B 1 174 ? 41.728  -7.569  -4.152  1.00 68.20  ? 174 PRO B O     1 
ATOM   4230 C  CB    . PRO B 1 174 ? 39.437  -9.602  -3.791  1.00 63.95  ? 174 PRO B CB    1 
ATOM   4231 C  CG    . PRO B 1 174 ? 38.118  -9.093  -4.246  1.00 63.20  ? 174 PRO B CG    1 
ATOM   4232 C  CD    . PRO B 1 174 ? 38.211  -7.604  -4.210  1.00 64.60  ? 174 PRO B CD    1 
ATOM   4233 N  N     . GLY B 1 175 ? 42.363  -8.734  -2.332  1.00 67.54  ? 175 GLY B N     1 
ATOM   4234 C  CA    . GLY B 1 175 ? 43.784  -8.440  -2.480  1.00 69.49  ? 175 GLY B CA    1 
ATOM   4235 C  C     . GLY B 1 175 ? 44.253  -7.278  -1.621  1.00 71.02  ? 175 GLY B C     1 
ATOM   4236 O  O     . GLY B 1 175 ? 45.455  -7.134  -1.398  1.00 72.65  ? 175 GLY B O     1 
ATOM   4237 N  N     . GLN B 1 176 ? 43.327  -6.430  -1.164  1.00 70.68  ? 176 GLN B N     1 
ATOM   4238 C  CA    . GLN B 1 176 ? 43.658  -5.356  -0.226  1.00 72.08  ? 176 GLN B CA    1 
ATOM   4239 C  C     . GLN B 1 176 ? 43.698  -5.892  1.186   1.00 71.40  ? 176 GLN B C     1 
ATOM   4240 O  O     . GLN B 1 176 ? 43.004  -6.857  1.495   1.00 69.57  ? 176 GLN B O     1 
ATOM   4241 C  CB    . GLN B 1 176 ? 42.620  -4.229  -0.277  1.00 72.12  ? 176 GLN B CB    1 
ATOM   4242 C  CG    . GLN B 1 176 ? 42.479  -3.552  -1.623  1.00 72.91  ? 176 GLN B CG    1 
ATOM   4243 C  CD    . GLN B 1 176 ? 43.828  -3.177  -2.198  1.00 75.06  ? 176 GLN B CD    1 
ATOM   4244 O  OE1   . GLN B 1 176 ? 44.229  -3.699  -3.233  1.00 75.11  ? 176 GLN B OE1   1 
ATOM   4245 N  NE2   . GLN B 1 176 ? 44.561  -2.319  -1.498  1.00 76.92  ? 176 GLN B NE2   1 
ATOM   4246 N  N     . PRO B 1 177 ? 44.480  -5.244  2.059   1.00 72.96  ? 177 PRO B N     1 
ATOM   4247 C  CA    . PRO B 1 177 ? 44.515  -5.647  3.455   1.00 72.46  ? 177 PRO B CA    1 
ATOM   4248 C  C     . PRO B 1 177 ? 43.333  -5.115  4.261   1.00 71.58  ? 177 PRO B C     1 
ATOM   4249 O  O     . PRO B 1 177 ? 42.682  -4.149  3.860   1.00 71.94  ? 177 PRO B O     1 
ATOM   4250 C  CB    . PRO B 1 177 ? 45.817  -5.025  3.949   1.00 74.74  ? 177 PRO B CB    1 
ATOM   4251 C  CG    . PRO B 1 177 ? 45.972  -3.795  3.130   1.00 76.41  ? 177 PRO B CG    1 
ATOM   4252 C  CD    . PRO B 1 177 ? 45.418  -4.139  1.784   1.00 75.41  ? 177 PRO B CD    1 
ATOM   4253 N  N     . ALA B 1 178 ? 43.074  -5.762  5.392   1.00 70.56  ? 178 ALA B N     1 
ATOM   4254 C  CA    . ALA B 1 178 ? 42.097  -5.297  6.376   1.00 69.96  ? 178 ALA B CA    1 
ATOM   4255 C  C     . ALA B 1 178 ? 42.783  -4.493  7.473   1.00 71.61  ? 178 ALA B C     1 
ATOM   4256 O  O     . ALA B 1 178 ? 44.006  -4.561  7.650   1.00 72.93  ? 178 ALA B O     1 
ATOM   4257 C  CB    . ALA B 1 178 ? 41.359  -6.477  6.990   1.00 67.97  ? 178 ALA B CB    1 
ATOM   4258 N  N     . THR B 1 179 ? 41.982  -3.731  8.206   1.00 71.63  ? 179 THR B N     1 
ATOM   4259 C  CA    . THR B 1 179 ? 42.469  -2.983  9.350   1.00 73.08  ? 179 THR B CA    1 
ATOM   4260 C  C     . THR B 1 179 ? 43.008  -3.980  10.372  1.00 72.56  ? 179 THR B C     1 
ATOM   4261 O  O     . THR B 1 179 ? 42.234  -4.720  10.977  1.00 70.94  ? 179 THR B O     1 
ATOM   4262 C  CB    . THR B 1 179 ? 41.349  -2.118  9.973   1.00 73.00  ? 179 THR B CB    1 
ATOM   4263 O  OG1   . THR B 1 179 ? 41.018  -1.055  9.075   1.00 73.97  ? 179 THR B OG1   1 
ATOM   4264 C  CG2   . THR B 1 179 ? 41.777  -1.508  11.290  1.00 74.32  ? 179 THR B CG2   1 
ATOM   4265 N  N     . SER B 1 180 ? 44.335  -4.018  10.528  1.00 74.04  ? 180 SER B N     1 
ATOM   4266 C  CA    . SER B 1 180 ? 44.963  -4.788  11.604  1.00 73.99  ? 180 SER B CA    1 
ATOM   4267 C  C     . SER B 1 180 ? 44.713  -4.108  12.940  1.00 74.58  ? 180 SER B C     1 
ATOM   4268 O  O     . SER B 1 180 ? 44.536  -2.895  13.016  1.00 75.82  ? 180 SER B O     1 
ATOM   4269 C  CB    . SER B 1 180 ? 46.466  -4.969  11.372  1.00 75.64  ? 180 SER B CB    1 
ATOM   4270 O  OG    . SER B 1 180 ? 47.109  -3.735  11.142  1.00 77.87  ? 180 SER B OG    1 
ATOM   4271 N  N     . THR B 1 181 ? 44.702  -4.905  13.995  1.00 73.79  ? 181 THR B N     1 
ATOM   4272 C  CA    . THR B 1 181 ? 44.374  -4.417  15.341  1.00 74.13  ? 181 THR B CA    1 
ATOM   4273 C  C     . THR B 1 181 ? 45.277  -5.084  16.392  1.00 74.61  ? 181 THR B C     1 
ATOM   4274 O  O     . THR B 1 181 ? 45.617  -6.256  16.277  1.00 73.75  ? 181 THR B O     1 
ATOM   4275 C  CB    . THR B 1 181 ? 42.880  -4.597  15.666  1.00 72.33  ? 181 THR B CB    1 
ATOM   4276 O  OG1   . THR B 1 181 ? 42.687  -4.532  17.083  1.00 72.45  ? 181 THR B OG1   1 
ATOM   4277 C  CG2   . THR B 1 181 ? 42.373  -5.922  15.165  1.00 70.30  ? 181 THR B CG2   1 
ATOM   4278 N  N     . ALA B 1 182 ? 45.658  -4.316  17.408  1.00 76.09  ? 182 ALA B N     1 
ATOM   4279 C  CA    . ALA B 1 182 ? 46.752  -4.684  18.311  1.00 77.18  ? 182 ALA B CA    1 
ATOM   4280 C  C     . ALA B 1 182 ? 46.337  -5.635  19.448  1.00 75.85  ? 182 ALA B C     1 
ATOM   4281 O  O     . ALA B 1 182 ? 45.487  -5.297  20.261  1.00 75.37  ? 182 ALA B O     1 
ATOM   4282 C  CB    . ALA B 1 182 ? 47.397  -3.420  18.869  1.00 79.57  ? 182 ALA B CB    1 
ATOM   4283 N  N     . ARG B 1 183 ? 47.009  -6.788  19.520  1.00 75.50  ? 183 ARG B N     1 
ATOM   4284 C  CA    . ARG B 1 183 ? 46.640  -7.927  20.386  1.00 74.13  ? 183 ARG B CA    1 
ATOM   4285 C  C     . ARG B 1 183 ? 46.620  -7.583  21.891  1.00 74.79  ? 183 ARG B C     1 
ATOM   4286 O  O     . ARG B 1 183 ? 47.411  -6.734  22.334  1.00 76.71  ? 183 ARG B O     1 
ATOM   4287 C  CB    . ARG B 1 183 ? 47.602  -9.098  20.094  1.00 74.20  ? 183 ARG B CB    1 
ATOM   4288 C  CG    . ARG B 1 183 ? 47.377  -10.380 20.879  1.00 73.02  ? 183 ARG B CG    1 
ATOM   4289 C  CD    . ARG B 1 183 ? 48.332  -11.489 20.461  1.00 73.29  ? 183 ARG B CD    1 
ATOM   4290 N  NE    . ARG B 1 183 ? 47.812  -12.278 19.338  1.00 71.82  ? 183 ARG B NE    1 
ATOM   4291 C  CZ    . ARG B 1 183 ? 48.476  -13.275 18.761  1.00 71.90  ? 183 ARG B CZ    1 
ATOM   4292 N  NH1   . ARG B 1 183 ? 49.731  -13.583 19.122  1.00 73.45  ? 183 ARG B NH1   1 
ATOM   4293 N  NH2   . ARG B 1 183 ? 47.889  -13.944 17.775  1.00 70.55  ? 183 ARG B NH2   1 
ATOM   4294 N  N     . PRO B 1 184 ? 45.729  -8.240  22.683  1.00 73.33  ? 184 PRO B N     1 
ATOM   4295 C  CA    . PRO B 1 184 ? 45.608  -7.845  24.099  1.00 73.95  ? 184 PRO B CA    1 
ATOM   4296 C  C     . PRO B 1 184 ? 46.745  -8.354  24.956  1.00 75.07  ? 184 PRO B C     1 
ATOM   4297 O  O     . PRO B 1 184 ? 47.162  -9.496  24.779  1.00 74.52  ? 184 PRO B O     1 
ATOM   4298 C  CB    . PRO B 1 184 ? 44.308  -8.534  24.553  1.00 72.03  ? 184 PRO B CB    1 
ATOM   4299 C  CG    . PRO B 1 184 ? 43.738  -9.216  23.343  1.00 70.47  ? 184 PRO B CG    1 
ATOM   4300 C  CD    . PRO B 1 184 ? 44.864  -9.400  22.392  1.00 71.25  ? 184 PRO B CD    1 
ATOM   4301 N  N     . ASN B 1 185 ? 47.228  -7.529  25.885  1.00 76.71  ? 185 ASN B N     1 
ATOM   4302 C  CA    . ASN B 1 185 ? 48.218  -7.981  26.879  1.00 77.84  ? 185 ASN B CA    1 
ATOM   4303 C  C     . ASN B 1 185 ? 47.521  -8.812  27.969  1.00 76.59  ? 185 ASN B C     1 
ATOM   4304 O  O     . ASN B 1 185 ? 46.672  -8.313  28.716  1.00 76.29  ? 185 ASN B O     1 
ATOM   4305 C  CB    . ASN B 1 185 ? 49.015  -6.812  27.470  1.00 80.19  ? 185 ASN B CB    1 
ATOM   4306 C  CG    . ASN B 1 185 ? 50.241  -7.266  28.264  1.00 81.65  ? 185 ASN B CG    1 
ATOM   4307 O  OD1   . ASN B 1 185 ? 50.598  -8.433  28.234  1.00 81.02  ? 185 ASN B OD1   1 
ATOM   4308 N  ND2   . ASN B 1 185 ? 50.902  -6.331  28.956  1.00 83.75  ? 185 ASN B ND2   1 
ATOM   4309 N  N     . ARG B 1 186 ? 47.885  -10.089 28.050  1.00 75.98  ? 186 ARG B N     1 
ATOM   4310 C  CA    . ARG B 1 186 ? 47.246  -11.019 29.002  1.00 74.82  ? 186 ARG B CA    1 
ATOM   4311 C  C     . ARG B 1 186 ? 47.557  -10.639 30.450  1.00 76.04  ? 186 ARG B C     1 
ATOM   4312 O  O     . ARG B 1 186 ? 46.866  -11.066 31.372  1.00 75.28  ? 186 ARG B O     1 
ATOM   4313 C  CB    . ARG B 1 186 ? 47.593  -12.507 28.727  1.00 74.07  ? 186 ARG B CB    1 
ATOM   4314 C  CG    . ARG B 1 186 ? 48.681  -12.790 27.712  1.00 74.86  ? 186 ARG B CG    1 
ATOM   4315 C  CD    . ARG B 1 186 ? 49.074  -14.260 27.558  1.00 74.39  ? 186 ARG B CD    1 
ATOM   4316 N  NE    . ARG B 1 186 ? 49.966  -14.456 26.399  1.00 75.06  ? 186 ARG B NE    1 
ATOM   4317 C  CZ    . ARG B 1 186 ? 50.427  -15.641 25.965  1.00 74.91  ? 186 ARG B CZ    1 
ATOM   4318 N  NH1   . ARG B 1 186 ? 50.084  -16.785 26.567  1.00 74.09  ? 186 ARG B NH1   1 
ATOM   4319 N  NH2   . ARG B 1 186 ? 51.243  -15.687 24.907  1.00 75.70  ? 186 ARG B NH2   1 
ATOM   4320 N  N     . PHE B 1 187 ? 48.610  -9.842  30.622  1.00 78.04  ? 187 PHE B N     1 
ATOM   4321 C  CA    . PHE B 1 187 ? 48.951  -9.223  31.878  1.00 79.50  ? 187 PHE B CA    1 
ATOM   4322 C  C     . PHE B 1 187 ? 48.892  -7.714  31.782  1.00 80.76  ? 187 PHE B C     1 
ATOM   4323 O  O     . PHE B 1 187 ? 49.844  -7.018  32.130  1.00 82.82  ? 187 PHE B O     1 
ATOM   4324 C  CB    . PHE B 1 187 ? 50.343  -9.688  32.262  1.00 81.08  ? 187 PHE B CB    1 
ATOM   4325 C  CG    . PHE B 1 187 ? 50.505  -11.168 32.183  1.00 80.07  ? 187 PHE B CG    1 
ATOM   4326 C  CD1   . PHE B 1 187 ? 49.597  -11.999 32.819  1.00 78.54  ? 187 PHE B CD1   1 
ATOM   4327 C  CD2   . PHE B 1 187 ? 51.542  -11.740 31.475  1.00 80.78  ? 187 PHE B CD2   1 
ATOM   4328 C  CE1   . PHE B 1 187 ? 49.717  -13.372 32.765  1.00 77.75  ? 187 PHE B CE1   1 
ATOM   4329 C  CE2   . PHE B 1 187 ? 51.671  -13.118 31.417  1.00 79.98  ? 187 PHE B CE2   1 
ATOM   4330 C  CZ    . PHE B 1 187 ? 50.754  -13.933 32.060  1.00 78.47  ? 187 PHE B CZ    1 
ATOM   4331 N  N     . GLY B 1 188 ? 47.774  -7.211  31.283  1.00 79.65  ? 188 GLY B N     1 
ATOM   4332 C  CA    . GLY B 1 188 ? 47.467  -5.799  31.373  1.00 80.75  ? 188 GLY B CA    1 
ATOM   4333 C  C     . GLY B 1 188 ? 46.630  -5.581  32.612  1.00 80.52  ? 188 GLY B C     1 
ATOM   4334 O  O     . GLY B 1 188 ? 46.327  -6.524  33.348  1.00 79.53  ? 188 GLY B O     1 
ATOM   4335 N  N     . LYS B 1 189 ? 46.234  -4.331  32.819  1.00 81.53  ? 189 LYS B N     1 
ATOM   4336 C  CA    . LYS B 1 189 ? 45.410  -3.940  33.961  1.00 81.58  ? 189 LYS B CA    1 
ATOM   4337 C  C     . LYS B 1 189 ? 44.043  -4.634  33.956  1.00 79.36  ? 189 LYS B C     1 
ATOM   4338 O  O     . LYS B 1 189 ? 43.400  -4.728  32.917  1.00 78.13  ? 189 LYS B O     1 
ATOM   4339 C  CB    . LYS B 1 189 ? 45.193  -2.428  33.954  1.00 83.15  ? 189 LYS B CB    1 
ATOM   4340 C  CG    . LYS B 1 189 ? 46.472  -1.609  34.075  1.00 85.66  ? 189 LYS B CG    1 
ATOM   4341 C  CD    . LYS B 1 189 ? 46.219  -0.220  34.661  1.00 87.49  ? 189 LYS B CD    1 
ATOM   4342 C  CE    . LYS B 1 189 ? 45.425  0.685   33.718  1.00 87.41  ? 189 LYS B CE    1 
ATOM   4343 N  NZ    . LYS B 1 189 ? 46.293  1.491   32.809  1.00 89.15  ? 189 LYS B NZ    1 
ATOM   4344 N  N     . LYS B 1 190 ? 43.595  -5.096  35.121  1.00 78.99  ? 190 LYS B N     1 
ATOM   4345 C  CA    . LYS B 1 190 ? 42.309  -5.800  35.233  1.00 77.10  ? 190 LYS B CA    1 
ATOM   4346 C  C     . LYS B 1 190 ? 41.747  -5.825  36.664  1.00 77.33  ? 190 LYS B C     1 
ATOM   4347 O  O     . LYS B 1 190 ? 42.459  -5.546  37.640  1.00 78.78  ? 190 LYS B O     1 
ATOM   4348 C  CB    . LYS B 1 190 ? 42.448  -7.229  34.696  1.00 75.54  ? 190 LYS B CB    1 
ATOM   4349 C  CG    . LYS B 1 190 ? 43.574  -8.015  35.347  1.00 76.19  ? 190 LYS B CG    1 
ATOM   4350 C  CD    . LYS B 1 190 ? 43.679  -9.434  34.825  1.00 74.79  ? 190 LYS B CD    1 
ATOM   4351 C  CE    . LYS B 1 190 ? 44.778  -10.189 35.563  1.00 75.64  ? 190 LYS B CE    1 
ATOM   4352 N  NZ    . LYS B 1 190 ? 45.535  -11.131 34.698  1.00 75.27  ? 190 LYS B NZ    1 
ATOM   4353 N  N     . THR B 1 191 ? 40.466  -6.174  36.764  1.00 75.97  ? 191 THR B N     1 
ATOM   4354 C  CA    . THR B 1 191 ? 39.736  -6.186  38.027  1.00 76.12  ? 191 THR B CA    1 
ATOM   4355 C  C     . THR B 1 191 ? 38.875  -7.428  38.099  1.00 74.35  ? 191 THR B C     1 
ATOM   4356 O  O     . THR B 1 191 ? 38.119  -7.690  37.173  1.00 73.07  ? 191 THR B O     1 
ATOM   4357 C  CB    . THR B 1 191 ? 38.795  -4.976  38.123  1.00 76.74  ? 191 THR B CB    1 
ATOM   4358 O  OG1   . THR B 1 191 ? 39.455  -3.804  37.632  1.00 78.21  ? 191 THR B OG1   1 
ATOM   4359 C  CG2   . THR B 1 191 ? 38.381  -4.744  39.539  1.00 77.55  ? 191 THR B CG2   1 
ATOM   4360 N  N     . MET B 1 192 ? 38.977  -8.189  39.183  1.00 74.39  ? 192 MET B N     1 
ATOM   4361 C  CA    . MET B 1 192 ? 38.027  -9.268  39.420  1.00 73.00  ? 192 MET B CA    1 
ATOM   4362 C  C     . MET B 1 192 ? 36.718  -8.662  39.946  1.00 73.05  ? 192 MET B C     1 
ATOM   4363 O  O     . MET B 1 192 ? 36.713  -7.924  40.941  1.00 74.32  ? 192 MET B O     1 
ATOM   4364 C  CB    . MET B 1 192 ? 38.579  -10.323 40.384  1.00 73.13  ? 192 MET B CB    1 
ATOM   4365 C  CG    . MET B 1 192 ? 37.559  -11.388 40.771  1.00 71.99  ? 192 MET B CG    1 
ATOM   4366 S  SD    . MET B 1 192 ? 38.273  -12.950 41.312  1.00 71.76  ? 192 MET B SD    1 
ATOM   4367 C  CE    . MET B 1 192 ? 38.679  -13.751 39.762  1.00 70.57  ? 192 MET B CE    1 
ATOM   4368 N  N     . LEU B 1 193 ? 35.626  -8.982  39.253  1.00 71.77  ? 193 LEU B N     1 
ATOM   4369 C  CA    . LEU B 1 193 ? 34.284  -8.562  39.615  1.00 71.73  ? 193 LEU B CA    1 
ATOM   4370 C  C     . LEU B 1 193 ? 33.557  -9.693  40.340  1.00 71.01  ? 193 LEU B C     1 
ATOM   4371 O  O     . LEU B 1 193 ? 33.223  -10.713 39.728  1.00 69.73  ? 193 LEU B O     1 
ATOM   4372 C  CB    . LEU B 1 193 ? 33.507  -8.209  38.356  1.00 70.91  ? 193 LEU B CB    1 
ATOM   4373 C  CG    . LEU B 1 193 ? 32.064  -7.758  38.583  1.00 70.92  ? 193 LEU B CG    1 
ATOM   4374 C  CD1   . LEU B 1 193 ? 32.054  -6.325  39.086  1.00 72.55  ? 193 LEU B CD1   1 
ATOM   4375 C  CD2   . LEU B 1 193 ? 31.233  -7.909  37.324  1.00 69.75  ? 193 LEU B CD2   1 
ATOM   4376 N  N     . CYS B 1 194 ? 33.301  -9.500  41.636  1.00 71.93  ? 194 CYS B N     1 
ATOM   4377 C  CA    . CYS B 1 194 ? 32.472  -10.414 42.429  1.00 71.53  ? 194 CYS B CA    1 
ATOM   4378 C  C     . CYS B 1 194 ? 31.103  -9.797  42.567  1.00 71.72  ? 194 CYS B C     1 
ATOM   4379 O  O     . CYS B 1 194 ? 30.972  -8.682  43.060  1.00 72.91  ? 194 CYS B O     1 
ATOM   4380 C  CB    . CYS B 1 194 ? 33.093  -10.633 43.793  1.00 72.55  ? 194 CYS B CB    1 
ATOM   4381 S  SG    . CYS B 1 194 ? 34.822  -11.103 43.639  1.00 72.75  ? 194 CYS B SG    1 
ATOM   4382 N  N     . VAL B 1 195 ? 30.095  -10.526 42.109  1.00 70.66  ? 195 VAL B N     1 
ATOM   4383 C  CA    . VAL B 1 195 ? 28.755  -9.984  41.968  1.00 70.75  ? 195 VAL B CA    1 
ATOM   4384 C  C     . VAL B 1 195 ? 27.698  -11.065 42.176  1.00 70.08  ? 195 VAL B C     1 
ATOM   4385 O  O     . VAL B 1 195 ? 27.811  -12.169 41.636  1.00 69.00  ? 195 VAL B O     1 
ATOM   4386 C  CB    . VAL B 1 195 ? 28.572  -9.314  40.580  1.00 70.25  ? 195 VAL B CB    1 
ATOM   4387 C  CG1   . VAL B 1 195 ? 28.869  -10.279 39.430  1.00 68.78  ? 195 VAL B CG1   1 
ATOM   4388 C  CG2   . VAL B 1 195 ? 27.174  -8.709  40.441  1.00 70.52  ? 195 VAL B CG2   1 
ATOM   4389 N  N     . TRP B 1 196 ? 26.675  -10.717 42.957  1.00 70.87  ? 196 TRP B N     1 
ATOM   4390 C  CA    . TRP B 1 196 ? 25.548  -11.593 43.244  1.00 70.58  ? 196 TRP B CA    1 
ATOM   4391 C  C     . TRP B 1 196 ? 24.268  -10.820 42.928  1.00 70.98  ? 196 TRP B C     1 
ATOM   4392 O  O     . TRP B 1 196 ? 24.214  -9.598  43.097  1.00 71.96  ? 196 TRP B O     1 
ATOM   4393 C  CB    . TRP B 1 196 ? 25.573  -12.073 44.708  1.00 71.43  ? 196 TRP B CB    1 
ATOM   4394 C  CG    . TRP B 1 196 ? 26.895  -12.671 45.117  1.00 71.33  ? 196 TRP B CG    1 
ATOM   4395 C  CD1   . TRP B 1 196 ? 27.229  -13.997 45.163  1.00 70.66  ? 196 TRP B CD1   1 
ATOM   4396 C  CD2   . TRP B 1 196 ? 28.061  -11.953 45.504  1.00 72.06  ? 196 TRP B CD2   1 
ATOM   4397 N  NE1   . TRP B 1 196 ? 28.538  -14.145 45.552  1.00 70.92  ? 196 TRP B NE1   1 
ATOM   4398 C  CE2   . TRP B 1 196 ? 29.070  -12.903 45.769  1.00 71.78  ? 196 TRP B CE2   1 
ATOM   4399 C  CE3   . TRP B 1 196 ? 28.355  -10.594 45.645  1.00 73.06  ? 196 TRP B CE3   1 
ATOM   4400 C  CZ2   . TRP B 1 196 ? 30.343  -12.536 46.173  1.00 72.46  ? 196 TRP B CZ2   1 
ATOM   4401 C  CZ3   . TRP B 1 196 ? 29.612  -10.230 46.045  1.00 73.75  ? 196 TRP B CZ3   1 
ATOM   4402 C  CH2   . TRP B 1 196 ? 30.597  -11.198 46.308  1.00 73.44  ? 196 TRP B CH2   1 
ATOM   4403 N  N     . TRP B 1 197 ? 23.247  -11.546 42.477  1.00 70.35  ? 197 TRP B N     1 
ATOM   4404 C  CA    . TRP B 1 197 ? 22.028  -10.946 41.922  1.00 70.59  ? 197 TRP B CA    1 
ATOM   4405 C  C     . TRP B 1 197 ? 20.803  -11.880 42.023  1.00 70.46  ? 197 TRP B C     1 
ATOM   4406 O  O     . TRP B 1 197 ? 20.926  -13.099 41.850  1.00 69.62  ? 197 TRP B O     1 
ATOM   4407 C  CB    . TRP B 1 197 ? 22.277  -10.531 40.462  1.00 69.70  ? 197 TRP B CB    1 
ATOM   4408 C  CG    . TRP B 1 197 ? 22.663  -11.654 39.543  1.00 68.23  ? 197 TRP B CG    1 
ATOM   4409 C  CD1   . TRP B 1 197 ? 23.821  -12.375 39.568  1.00 67.61  ? 197 TRP B CD1   1 
ATOM   4410 C  CD2   . TRP B 1 197 ? 21.898  -12.168 38.443  1.00 67.33  ? 197 TRP B CD2   1 
ATOM   4411 N  NE1   . TRP B 1 197 ? 23.822  -13.315 38.565  1.00 66.40  ? 197 TRP B NE1   1 
ATOM   4412 C  CE2   . TRP B 1 197 ? 22.657  -13.207 37.854  1.00 66.18  ? 197 TRP B CE2   1 
ATOM   4413 C  CE3   . TRP B 1 197 ? 20.639  -11.862 37.902  1.00 67.48  ? 197 TRP B CE3   1 
ATOM   4414 C  CZ2   . TRP B 1 197 ? 22.199  -13.939 36.748  1.00 65.17  ? 197 TRP B CZ2   1 
ATOM   4415 C  CZ3   . TRP B 1 197 ? 20.185  -12.593 36.796  1.00 66.46  ? 197 TRP B CZ3   1 
ATOM   4416 C  CH2   . TRP B 1 197 ? 20.967  -13.622 36.238  1.00 65.30  ? 197 TRP B CH2   1 
ATOM   4417 N  N     . ASP B 1 198 ? 19.638  -11.287 42.299  1.00 71.45  ? 198 ASP B N     1 
ATOM   4418 C  CA    . ASP B 1 198 ? 18.355  -12.015 42.347  1.00 71.62  ? 198 ASP B CA    1 
ATOM   4419 C  C     . ASP B 1 198 ? 17.671  -11.814 40.994  1.00 71.00  ? 198 ASP B C     1 
ATOM   4420 O  O     . ASP B 1 198 ? 18.195  -11.104 40.113  1.00 70.50  ? 198 ASP B O     1 
ATOM   4421 C  CB    . ASP B 1 198 ? 17.458  -11.651 43.570  1.00 73.26  ? 198 ASP B CB    1 
ATOM   4422 C  CG    . ASP B 1 198 ? 17.240  -10.162 43.769  1.00 74.46  ? 198 ASP B CG    1 
ATOM   4423 O  OD1   . ASP B 1 198 ? 17.802  -9.324  43.041  1.00 74.15  ? 198 ASP B OD1   1 
ATOM   4424 O  OD2   . ASP B 1 198 ? 16.493  -9.832  44.710  1.00 75.88  ? 198 ASP B OD2   1 
ATOM   4425 N  N     . GLN B 1 199 ? 16.529  -12.466 40.803  1.00 71.10  ? 199 GLN B N     1 
ATOM   4426 C  CA    . GLN B 1 199 ? 15.713  -12.217 39.604  1.00 70.78  ? 199 GLN B CA    1 
ATOM   4427 C  C     . GLN B 1 199 ? 15.212  -10.771 39.495  1.00 71.83  ? 199 GLN B C     1 
ATOM   4428 O  O     . GLN B 1 199 ? 14.888  -10.320 38.403  1.00 71.50  ? 199 GLN B O     1 
ATOM   4429 C  CB    . GLN B 1 199 ? 14.556  -13.215 39.488  1.00 70.91  ? 199 GLN B CB    1 
ATOM   4430 C  CG    . GLN B 1 199 ? 13.527  -13.212 40.598  1.00 72.49  ? 199 GLN B CG    1 
ATOM   4431 C  CD    . GLN B 1 199 ? 12.246  -13.909 40.172  1.00 72.81  ? 199 GLN B CD    1 
ATOM   4432 O  OE1   . GLN B 1 199 ? 12.260  -15.065 39.765  1.00 72.02  ? 199 GLN B OE1   1 
ATOM   4433 N  NE2   . GLN B 1 199 ? 11.133  -13.212 40.283  1.00 74.13  ? 199 GLN B NE2   1 
ATOM   4434 N  N     . SER B 1 200 ? 15.146  -10.066 40.627  1.00 73.20  ? 200 SER B N     1 
ATOM   4435 C  CA    . SER B 1 200 ? 14.849  -8.627  40.671  1.00 74.43  ? 200 SER B CA    1 
ATOM   4436 C  C     . SER B 1 200 ? 15.869  -7.775  39.921  1.00 73.89  ? 200 SER B C     1 
ATOM   4437 O  O     . SER B 1 200 ? 15.522  -7.092  38.968  1.00 73.92  ? 200 SER B O     1 
ATOM   4438 C  CB    . SER B 1 200 ? 14.769  -8.130  42.123  1.00 76.01  ? 200 SER B CB    1 
ATOM   4439 O  OG    . SER B 1 200 ? 13.708  -8.746  42.844  1.00 76.86  ? 200 SER B OG    1 
ATOM   4440 N  N     . GLY B 1 201 ? 17.113  -7.799  40.379  1.00 73.55  ? 201 GLY B N     1 
ATOM   4441 C  CA    . GLY B 1 201 ? 18.188  -7.030  39.756  1.00 73.21  ? 201 GLY B CA    1 
ATOM   4442 C  C     . GLY B 1 201 ? 19.517  -7.501  40.294  1.00 72.68  ? 201 GLY B C     1 
ATOM   4443 O  O     . GLY B 1 201 ? 19.609  -8.616  40.786  1.00 72.13  ? 201 GLY B O     1 
ATOM   4444 N  N     . VAL B 1 202 ? 20.541  -6.656  40.217  1.00 72.99  ? 202 VAL B N     1 
ATOM   4445 C  CA    . VAL B 1 202 ? 21.775  -6.870  40.991  1.00 73.03  ? 202 VAL B CA    1 
ATOM   4446 C  C     . VAL B 1 202 ? 21.490  -6.523  42.449  1.00 74.52  ? 202 VAL B C     1 
ATOM   4447 O  O     . VAL B 1 202 ? 20.687  -5.635  42.727  1.00 75.78  ? 202 VAL B O     1 
ATOM   4448 C  CB    . VAL B 1 202 ? 22.956  -6.022  40.466  1.00 73.15  ? 202 VAL B CB    1 
ATOM   4449 C  CG1   . VAL B 1 202 ? 24.161  -6.078  41.410  1.00 73.61  ? 202 VAL B CG1   1 
ATOM   4450 C  CG2   . VAL B 1 202 ? 23.340  -6.490  39.069  1.00 71.66  ? 202 VAL B CG2   1 
ATOM   4451 N  N     . ILE B 1 203 ? 22.128  -7.243  43.369  1.00 74.44  ? 203 ILE B N     1 
ATOM   4452 C  CA    . ILE B 1 203 ? 21.981  -6.988  44.802  1.00 75.84  ? 203 ILE B CA    1 
ATOM   4453 C  C     . ILE B 1 203 ? 23.178  -6.198  45.300  1.00 76.67  ? 203 ILE B C     1 
ATOM   4454 O  O     . ILE B 1 203 ? 23.042  -5.038  45.678  1.00 78.10  ? 203 ILE B O     1 
ATOM   4455 C  CB    . ILE B 1 203 ? 21.827  -8.302  45.603  1.00 75.46  ? 203 ILE B CB    1 
ATOM   4456 C  CG1   . ILE B 1 203 ? 20.519  -9.002  45.203  1.00 75.01  ? 203 ILE B CG1   1 
ATOM   4457 C  CG2   . ILE B 1 203 ? 21.878  -8.038  47.112  1.00 76.92  ? 203 ILE B CG2   1 
ATOM   4458 C  CD1   . ILE B 1 203 ? 20.339  -10.373 45.813  1.00 74.62  ? 203 ILE B CD1   1 
ATOM   4459 N  N     . TYR B 1 204 ? 24.343  -6.837  45.276  1.00 75.88  ? 204 TYR B N     1 
ATOM   4460 C  CA    . TYR B 1 204 ? 25.576  -6.262  45.795  1.00 76.69  ? 204 TYR B CA    1 
ATOM   4461 C  C     . TYR B 1 204 ? 26.731  -6.803  44.960  1.00 75.48  ? 204 TYR B C     1 
ATOM   4462 O  O     . TYR B 1 204 ? 26.629  -7.883  44.369  1.00 74.09  ? 204 TYR B O     1 
ATOM   4463 C  CB    . TYR B 1 204 ? 25.729  -6.617  47.279  1.00 77.57  ? 204 TYR B CB    1 
ATOM   4464 C  CG    . TYR B 1 204 ? 27.091  -6.327  47.888  1.00 78.28  ? 204 TYR B CG    1 
ATOM   4465 C  CD1   . TYR B 1 204 ? 27.530  -5.016  48.082  1.00 79.71  ? 204 TYR B CD1   1 
ATOM   4466 C  CD2   . TYR B 1 204 ? 27.941  -7.372  48.280  1.00 77.69  ? 204 TYR B CD2   1 
ATOM   4467 C  CE1   . TYR B 1 204 ? 28.774  -4.751  48.641  1.00 80.51  ? 204 TYR B CE1   1 
ATOM   4468 C  CE2   . TYR B 1 204 ? 29.186  -7.117  48.840  1.00 78.46  ? 204 TYR B CE2   1 
ATOM   4469 C  CZ    . TYR B 1 204 ? 29.598  -5.807  49.021  1.00 79.87  ? 204 TYR B CZ    1 
ATOM   4470 O  OH    . TYR B 1 204 ? 30.824  -5.550  49.589  1.00 80.80  ? 204 TYR B OH    1 
ATOM   4471 N  N     . TYR B 1 205 ? 27.807  -6.028  44.874  1.00 76.15  ? 205 TYR B N     1 
ATOM   4472 C  CA    . TYR B 1 205 ? 29.014  -6.474  44.199  1.00 75.33  ? 205 TYR B CA    1 
ATOM   4473 C  C     . TYR B 1 205 ? 30.219  -5.685  44.677  1.00 76.62  ? 205 TYR B C     1 
ATOM   4474 O  O     . TYR B 1 205 ? 30.087  -4.538  45.120  1.00 78.09  ? 205 TYR B O     1 
ATOM   4475 C  CB    . TYR B 1 205 ? 28.855  -6.339  42.686  1.00 74.31  ? 205 TYR B CB    1 
ATOM   4476 C  CG    . TYR B 1 205 ? 28.994  -4.926  42.166  1.00 75.32  ? 205 TYR B CG    1 
ATOM   4477 C  CD1   . TYR B 1 205 ? 27.919  -4.039  42.189  1.00 76.14  ? 205 TYR B CD1   1 
ATOM   4478 C  CD2   . TYR B 1 205 ? 30.207  -4.474  41.645  1.00 75.63  ? 205 TYR B CD2   1 
ATOM   4479 C  CE1   . TYR B 1 205 ? 28.047  -2.741  41.710  1.00 77.23  ? 205 TYR B CE1   1 
ATOM   4480 C  CE2   . TYR B 1 205 ? 30.345  -3.177  41.162  1.00 76.73  ? 205 TYR B CE2   1 
ATOM   4481 C  CZ    . TYR B 1 205 ? 29.261  -2.313  41.196  1.00 77.52  ? 205 TYR B CZ    1 
ATOM   4482 O  OH    . TYR B 1 205 ? 29.386  -1.024  40.725  1.00 78.77  ? 205 TYR B OH    1 
ATOM   4483 N  N     . GLU B 1 206 ? 31.382  -6.324  44.591  1.00 76.20  ? 206 GLU B N     1 
ATOM   4484 C  CA    . GLU B 1 206 ? 32.668  -5.706  44.903  1.00 77.39  ? 206 GLU B CA    1 
ATOM   4485 C  C     . GLU B 1 206 ? 33.548  -5.789  43.670  1.00 76.71  ? 206 GLU B C     1 
ATOM   4486 O  O     . GLU B 1 206 ? 33.244  -6.498  42.709  1.00 75.24  ? 206 GLU B O     1 
ATOM   4487 C  CB    . GLU B 1 206 ? 33.348  -6.384  46.112  1.00 77.88  ? 206 GLU B CB    1 
ATOM   4488 C  CG    . GLU B 1 206 ? 33.264  -5.581  47.409  1.00 79.63  ? 206 GLU B CG    1 
ATOM   4489 C  CD    . GLU B 1 206 ? 33.481  -6.424  48.652  1.00 79.88  ? 206 GLU B CD    1 
ATOM   4490 O  OE1   . GLU B 1 206 ? 32.699  -7.375  48.857  1.00 78.93  ? 206 GLU B OE1   1 
ATOM   4491 O  OE2   . GLU B 1 206 ? 34.412  -6.123  49.434  1.00 81.14  ? 206 GLU B OE2   1 
ATOM   4492 N  N     . LEU B 1 207 ? 34.638  -5.037  43.715  1.00 77.95  ? 207 LEU B N     1 
ATOM   4493 C  CA    . LEU B 1 207 ? 35.539  -4.871  42.594  1.00 77.76  ? 207 LEU B CA    1 
ATOM   4494 C  C     . LEU B 1 207 ? 36.994  -4.930  43.138  1.00 78.84  ? 207 LEU B C     1 
ATOM   4495 O  O     . LEU B 1 207 ? 37.502  -3.975  43.732  1.00 80.57  ? 207 LEU B O     1 
ATOM   4496 C  CB    . LEU B 1 207 ? 35.130  -3.531  41.941  1.00 78.56  ? 207 LEU B CB    1 
ATOM   4497 C  CG    . LEU B 1 207 ? 35.367  -3.169  40.491  1.00 78.13  ? 207 LEU B CG    1 
ATOM   4498 C  CD1   . LEU B 1 207 ? 34.748  -4.175  39.551  1.00 76.10  ? 207 LEU B CD1   1 
ATOM   4499 C  CD2   . LEU B 1 207 ? 34.971  -1.742  40.069  1.00 79.35  ? 207 LEU B CD2   1 
ATOM   4500 N  N     . LEU B 1 208 ? 37.636  -6.093  42.975  1.00 77.92  ? 208 LEU B N     1 
ATOM   4501 C  CA    . LEU B 1 208 ? 38.962  -6.367  43.575  1.00 78.90  ? 208 LEU B CA    1 
ATOM   4502 C  C     . LEU B 1 208 ? 40.104  -5.885  42.678  1.00 79.57  ? 208 LEU B C     1 
ATOM   4503 O  O     . LEU B 1 208 ? 40.123  -6.217  41.491  1.00 78.48  ? 208 LEU B O     1 
ATOM   4504 C  CB    . LEU B 1 208 ? 39.151  -7.878  43.811  1.00 77.77  ? 208 LEU B CB    1 
ATOM   4505 C  CG    . LEU B 1 208 ? 38.482  -8.573  45.001  1.00 77.57  ? 208 LEU B CG    1 
ATOM   4506 C  CD1   . LEU B 1 208 ? 37.058  -8.089  45.243  1.00 77.33  ? 208 LEU B CD1   1 
ATOM   4507 C  CD2   . LEU B 1 208 ? 38.508  -10.083 44.800  1.00 76.23  ? 208 LEU B CD2   1 
ATOM   4508 N  N     . LYS B 1 209 ? 41.069  -5.145  43.238  1.00 81.44  ? 209 LYS B N     1 
ATOM   4509 C  CA    . LYS B 1 209 ? 42.319  -4.834  42.514  1.00 82.33  ? 209 LYS B CA    1 
ATOM   4510 C  C     . LYS B 1 209 ? 43.175  -6.099  42.514  1.00 81.76  ? 209 LYS B C     1 
ATOM   4511 O  O     . LYS B 1 209 ? 43.133  -6.870  43.484  1.00 81.59  ? 209 LYS B O     1 
ATOM   4512 C  CB    . LYS B 1 209 ? 43.106  -3.683  43.151  1.00 84.72  ? 209 LYS B CB    1 
ATOM   4513 C  CG    . LYS B 1 209 ? 42.385  -2.337  43.177  1.00 85.69  ? 209 LYS B CG    1 
ATOM   4514 C  CD    . LYS B 1 209 ? 41.719  -2.053  44.523  1.00 86.37  ? 209 LYS B CD    1 
ATOM   4515 C  CE    . LYS B 1 209 ? 41.413  -0.574  44.738  1.00 88.15  ? 209 LYS B CE    1 
ATOM   4516 N  NZ    . LYS B 1 209 ? 41.207  -0.269  46.188  1.00 89.40  ? 209 LYS B NZ    1 
ATOM   4517 N  N     . PRO B 1 210 ? 43.945  -6.329  41.430  1.00 81.57  ? 210 PRO B N     1 
ATOM   4518 C  CA    . PRO B 1 210 ? 44.702  -7.578  41.377  1.00 81.06  ? 210 PRO B CA    1 
ATOM   4519 C  C     . PRO B 1 210 ? 45.825  -7.519  42.409  1.00 82.88  ? 210 PRO B C     1 
ATOM   4520 O  O     . PRO B 1 210 ? 46.487  -6.491  42.534  1.00 84.66  ? 210 PRO B O     1 
ATOM   4521 C  CB    . PRO B 1 210 ? 45.222  -7.619  39.937  1.00 80.68  ? 210 PRO B CB    1 
ATOM   4522 C  CG    . PRO B 1 210 ? 45.244  -6.194  39.485  1.00 81.84  ? 210 PRO B CG    1 
ATOM   4523 C  CD    . PRO B 1 210 ? 44.415  -5.361  40.423  1.00 82.41  ? 210 PRO B CD    1 
ATOM   4524 N  N     . GLY B 1 211 ? 46.004  -8.611  43.144  1.00 82.53  ? 211 GLY B N     1 
ATOM   4525 C  CA    . GLY B 1 211 ? 46.782  -8.611  44.375  1.00 84.14  ? 211 GLY B CA    1 
ATOM   4526 C  C     . GLY B 1 211 ? 45.909  -8.622  45.622  1.00 84.05  ? 211 GLY B C     1 
ATOM   4527 O  O     . GLY B 1 211 ? 46.427  -8.486  46.743  1.00 85.47  ? 211 GLY B O     1 
ATOM   4528 N  N     . GLU B 1 212 ? 44.591  -8.747  45.429  1.00 82.51  ? 212 GLU B N     1 
ATOM   4529 C  CA    . GLU B 1 212 ? 43.647  -9.068  46.501  1.00 82.11  ? 212 GLU B CA    1 
ATOM   4530 C  C     . GLU B 1 212 ? 42.996  -10.404 46.128  1.00 80.21  ? 212 GLU B C     1 
ATOM   4531 O  O     . GLU B 1 212 ? 41.940  -10.422 45.502  1.00 78.89  ? 212 GLU B O     1 
ATOM   4532 C  CB    . GLU B 1 212 ? 42.585  -7.967  46.647  1.00 82.26  ? 212 GLU B CB    1 
ATOM   4533 C  CG    . GLU B 1 212 ? 43.121  -6.597  47.063  1.00 84.30  ? 212 GLU B CG    1 
ATOM   4534 C  CD    . GLU B 1 212 ? 42.076  -5.487  46.995  1.00 84.50  ? 212 GLU B CD    1 
ATOM   4535 O  OE1   . GLU B 1 212 ? 42.168  -4.526  47.789  1.00 86.18  ? 212 GLU B OE1   1 
ATOM   4536 O  OE2   . GLU B 1 212 ? 41.156  -5.560  46.150  1.00 83.08  ? 212 GLU B OE2   1 
ATOM   4537 N  N     . THR B 1 213 ? 43.643  -11.515 46.488  1.00 80.21  ? 213 THR B N     1 
ATOM   4538 C  CA    . THR B 1 213 ? 43.130  -12.853 46.138  1.00 78.64  ? 213 THR B CA    1 
ATOM   4539 C  C     . THR B 1 213 ? 41.852  -13.188 46.907  1.00 77.95  ? 213 THR B C     1 
ATOM   4540 O  O     . THR B 1 213 ? 41.547  -12.607 47.961  1.00 78.85  ? 213 THR B O     1 
ATOM   4541 C  CB    . THR B 1 213 ? 44.160  -14.021 46.255  1.00 78.92  ? 213 THR B CB    1 
ATOM   4542 O  OG1   . THR B 1 213 ? 44.619  -14.187 47.602  1.00 80.20  ? 213 THR B OG1   1 
ATOM   4543 C  CG2   . THR B 1 213 ? 45.360  -13.791 45.327  1.00 79.53  ? 213 THR B CG2   1 
ATOM   4544 N  N     . VAL B 1 214 ? 41.095  -14.111 46.330  1.00 76.44  ? 214 VAL B N     1 
ATOM   4545 C  CA    . VAL B 1 214 ? 39.844  -14.577 46.908  1.00 75.75  ? 214 VAL B CA    1 
ATOM   4546 C  C     . VAL B 1 214 ? 40.155  -15.739 47.846  1.00 76.10  ? 214 VAL B C     1 
ATOM   4547 O  O     . VAL B 1 214 ? 40.413  -16.854 47.391  1.00 75.47  ? 214 VAL B O     1 
ATOM   4548 C  CB    . VAL B 1 214 ? 38.830  -14.965 45.798  1.00 74.10  ? 214 VAL B CB    1 
ATOM   4549 C  CG1   . VAL B 1 214 ? 37.613  -15.695 46.357  1.00 73.48  ? 214 VAL B CG1   1 
ATOM   4550 C  CG2   . VAL B 1 214 ? 38.381  -13.713 45.055  1.00 73.95  ? 214 VAL B CG2   1 
ATOM   4551 N  N     . ASN B 1 215 ? 40.171  -15.455 49.148  1.00 77.24  ? 215 ASN B N     1 
ATOM   4552 C  CA    . ASN B 1 215 ? 40.253  -16.500 50.165  1.00 77.65  ? 215 ASN B CA    1 
ATOM   4553 C  C     . ASN B 1 215 ? 38.875  -16.720 50.707  1.00 77.16  ? 215 ASN B C     1 
ATOM   4554 O  O     . ASN B 1 215 ? 38.029  -15.839 50.610  1.00 76.97  ? 215 ASN B O     1 
ATOM   4555 C  CB    . ASN B 1 215 ? 41.109  -16.113 51.373  1.00 79.35  ? 215 ASN B CB    1 
ATOM   4556 C  CG    . ASN B 1 215 ? 42.231  -15.160 51.043  1.00 80.33  ? 215 ASN B CG    1 
ATOM   4557 O  OD1   . ASN B 1 215 ? 42.203  -13.973 51.408  1.00 81.22  ? 215 ASN B OD1   1 
ATOM   4558 N  ND2   . ASN B 1 215 ? 43.239  -15.677 50.371  1.00 80.34  ? 215 ASN B ND2   1 
ATOM   4559 N  N     . ALA B 1 216 ? 38.682  -17.864 51.355  1.00 77.19  ? 216 ALA B N     1 
ATOM   4560 C  CA    . ALA B 1 216 ? 37.470  -18.131 52.110  1.00 77.12  ? 216 ALA B CA    1 
ATOM   4561 C  C     . ALA B 1 216 ? 37.211  -16.986 53.081  1.00 78.20  ? 216 ALA B C     1 
ATOM   4562 O  O     . ALA B 1 216 ? 36.065  -16.579 53.262  1.00 78.02  ? 216 ALA B O     1 
ATOM   4563 C  CB    . ALA B 1 216 ? 37.573  -19.460 52.848  1.00 77.46  ? 216 ALA B CB    1 
ATOM   4564 N  N     . ALA B 1 217 ? 38.287  -16.467 53.680  1.00 79.45  ? 217 ALA B N     1 
ATOM   4565 C  CA    . ALA B 1 217 ? 38.223  -15.332 54.608  1.00 80.71  ? 217 ALA B CA    1 
ATOM   4566 C  C     . ALA B 1 217 ? 37.639  -14.070 53.978  1.00 80.48  ? 217 ALA B C     1 
ATOM   4567 O  O     . ALA B 1 217 ? 36.857  -13.354 54.616  1.00 81.06  ? 217 ALA B O     1 
ATOM   4568 C  CB    . ALA B 1 217 ? 39.606  -15.043 55.182  1.00 82.12  ? 217 ALA B CB    1 
ATOM   4569 N  N     . ARG B 1 218 ? 38.030  -13.797 52.740  1.00 79.75  ? 218 ARG B N     1 
ATOM   4570 C  CA    . ARG B 1 218 ? 37.449  -12.700 51.979  1.00 79.43  ? 218 ARG B CA    1 
ATOM   4571 C  C     . ARG B 1 218 ? 36.000  -12.981 51.622  1.00 78.29  ? 218 ARG B C     1 
ATOM   4572 O  O     . ARG B 1 218 ? 35.128  -12.133 51.820  1.00 78.62  ? 218 ARG B O     1 
ATOM   4573 C  CB    . ARG B 1 218 ? 38.242  -12.473 50.700  1.00 78.93  ? 218 ARG B CB    1 
ATOM   4574 C  CG    . ARG B 1 218 ? 37.707  -11.344 49.847  1.00 78.68  ? 218 ARG B CG    1 
ATOM   4575 C  CD    . ARG B 1 218 ? 38.689  -11.032 48.743  1.00 78.58  ? 218 ARG B CD    1 
ATOM   4576 N  NE    . ARG B 1 218 ? 39.752  -10.133 49.169  1.00 80.23  ? 218 ARG B NE    1 
ATOM   4577 C  CZ    . ARG B 1 218 ? 39.610  -8.821  49.347  1.00 81.33  ? 218 ARG B CZ    1 
ATOM   4578 N  NH1   . ARG B 1 218 ? 38.433  -8.215  49.174  1.00 80.98  ? 218 ARG B NH1   1 
ATOM   4579 N  NH2   . ARG B 1 218 ? 40.657  -8.101  49.723  1.00 82.96  ? 218 ARG B NH2   1 
ATOM   4580 N  N     . TYR B 1 219 ? 35.766  -14.181 51.099  1.00 77.10  ? 219 TYR B N     1 
ATOM   4581 C  CA    . TYR B 1 219 ? 34.456  -14.586 50.591  1.00 75.98  ? 219 TYR B CA    1 
ATOM   4582 C  C     . TYR B 1 219 ? 33.339  -14.491 51.662  1.00 76.60  ? 219 TYR B C     1 
ATOM   4583 O  O     . TYR B 1 219 ? 32.227  -14.057 51.361  1.00 76.28  ? 219 TYR B O     1 
ATOM   4584 C  CB    . TYR B 1 219 ? 34.547  -15.992 49.953  1.00 74.85  ? 219 TYR B CB    1 
ATOM   4585 C  CG    . TYR B 1 219 ? 33.367  -16.351 49.087  1.00 73.63  ? 219 TYR B CG    1 
ATOM   4586 C  CD1   . TYR B 1 219 ? 33.054  -15.594 47.958  1.00 72.93  ? 219 TYR B CD1   1 
ATOM   4587 C  CD2   . TYR B 1 219 ? 32.554  -17.443 49.391  1.00 73.29  ? 219 TYR B CD2   1 
ATOM   4588 C  CE1   . TYR B 1 219 ? 31.956  -15.905 47.164  1.00 71.89  ? 219 TYR B CE1   1 
ATOM   4589 C  CE2   . TYR B 1 219 ? 31.454  -17.767 48.604  1.00 72.32  ? 219 TYR B CE2   1 
ATOM   4590 C  CZ    . TYR B 1 219 ? 31.154  -16.995 47.490  1.00 71.60  ? 219 TYR B CZ    1 
ATOM   4591 O  OH    . TYR B 1 219 ? 30.066  -17.306 46.697  1.00 70.71  ? 219 TYR B OH    1 
ATOM   4592 N  N     . GLN B 1 220 ? 33.648  -14.852 52.907  1.00 77.60  ? 220 GLN B N     1 
ATOM   4593 C  CA    . GLN B 1 220 ? 32.717  -14.651 54.026  1.00 78.47  ? 220 GLN B CA    1 
ATOM   4594 C  C     . GLN B 1 220 ? 32.394  -13.174 54.226  1.00 79.33  ? 220 GLN B C     1 
ATOM   4595 O  O     . GLN B 1 220 ? 31.225  -12.803 54.335  1.00 79.43  ? 220 GLN B O     1 
ATOM   4596 C  CB    . GLN B 1 220 ? 33.295  -15.203 55.324  1.00 79.55  ? 220 GLN B CB    1 
ATOM   4597 C  CG    . GLN B 1 220 ? 33.432  -16.716 55.345  1.00 79.00  ? 220 GLN B CG    1 
ATOM   4598 C  CD    . GLN B 1 220 ? 34.258  -17.231 56.519  1.00 80.15  ? 220 GLN B CD    1 
ATOM   4599 O  OE1   . GLN B 1 220 ? 35.320  -16.688 56.841  1.00 80.97  ? 220 GLN B OE1   1 
ATOM   4600 N  NE2   . GLN B 1 220 ? 33.775  -18.292 57.161  1.00 80.32  ? 220 GLN B NE2   1 
ATOM   4601 N  N     . GLN B 1 221 ? 33.437  -12.341 54.251  1.00 80.09  ? 221 GLN B N     1 
ATOM   4602 C  CA    . GLN B 1 221 ? 33.287  -10.883 54.372  1.00 81.10  ? 221 GLN B CA    1 
ATOM   4603 C  C     . GLN B 1 221 ? 32.371  -10.310 53.287  1.00 80.29  ? 221 GLN B C     1 
ATOM   4604 O  O     . GLN B 1 221 ? 31.588  -9.391  53.546  1.00 81.04  ? 221 GLN B O     1 
ATOM   4605 C  CB    . GLN B 1 221 ? 34.665  -10.188 54.343  1.00 81.99  ? 221 GLN B CB    1 
ATOM   4606 C  CG    . GLN B 1 221 ? 34.656  -8.685  54.602  1.00 83.39  ? 221 GLN B CG    1 
ATOM   4607 C  CD    . GLN B 1 221 ? 33.940  -8.305  55.888  1.00 84.65  ? 221 GLN B CD    1 
ATOM   4608 O  OE1   . GLN B 1 221 ? 34.030  -9.008  56.894  1.00 85.06  ? 221 GLN B OE1   1 
ATOM   4609 N  NE2   . GLN B 1 221 ? 33.218  -7.189  55.855  1.00 85.38  ? 221 GLN B NE2   1 
ATOM   4610 N  N     . GLN B 1 222 ? 32.464  -10.876 52.087  1.00 78.85  ? 222 GLN B N     1 
ATOM   4611 C  CA    . GLN B 1 222 ? 31.565  -10.525 50.984  1.00 77.94  ? 222 GLN B CA    1 
ATOM   4612 C  C     . GLN B 1 222 ? 30.147  -11.044 51.241  1.00 77.58  ? 222 GLN B C     1 
ATOM   4613 O  O     . GLN B 1 222 ? 29.175  -10.333 50.969  1.00 77.74  ? 222 GLN B O     1 
ATOM   4614 C  CB    . GLN B 1 222 ? 32.090  -11.054 49.644  1.00 76.55  ? 222 GLN B CB    1 
ATOM   4615 C  CG    . GLN B 1 222 ? 33.521  -10.626 49.335  1.00 76.98  ? 222 GLN B CG    1 
ATOM   4616 C  CD    . GLN B 1 222 ? 33.933  -10.861 47.889  1.00 75.78  ? 222 GLN B CD    1 
ATOM   4617 O  OE1   . GLN B 1 222 ? 33.964  -12.005 47.418  1.00 74.66  ? 222 GLN B OE1   1 
ATOM   4618 N  NE2   . GLN B 1 222 ? 34.284  -9.783  47.185  1.00 76.14  ? 222 GLN B NE2   1 
ATOM   4619 N  N     . LEU B 1 223 ? 30.031  -12.271 51.760  1.00 77.25  ? 223 LEU B N     1 
ATOM   4620 C  CA    . LEU B 1 223 ? 28.724  -12.841 52.138  1.00 77.18  ? 223 LEU B CA    1 
ATOM   4621 C  C     . LEU B 1 223 ? 28.003  -12.053 53.228  1.00 78.63  ? 223 LEU B C     1 
ATOM   4622 O  O     . LEU B 1 223 ? 26.772  -11.962 53.204  1.00 78.72  ? 223 LEU B O     1 
ATOM   4623 C  CB    . LEU B 1 223 ? 28.852  -14.303 52.586  1.00 76.84  ? 223 LEU B CB    1 
ATOM   4624 C  CG    . LEU B 1 223 ? 29.149  -15.341 51.502  1.00 75.41  ? 223 LEU B CG    1 
ATOM   4625 C  CD1   . LEU B 1 223 ? 29.391  -16.697 52.146  1.00 75.49  ? 223 LEU B CD1   1 
ATOM   4626 C  CD2   . LEU B 1 223 ? 28.028  -15.427 50.477  1.00 74.45  ? 223 LEU B CD2   1 
ATOM   4627 N  N     . ILE B 1 224 ? 28.757  -11.484 54.166  1.00 79.85  ? 224 ILE B N     1 
ATOM   4628 C  CA    . ILE B 1 224 ? 28.162  -10.635 55.196  1.00 81.38  ? 224 ILE B CA    1 
ATOM   4629 C  C     . ILE B 1 224 ? 27.623  -9.373  54.523  1.00 81.65  ? 224 ILE B C     1 
ATOM   4630 O  O     . ILE B 1 224 ? 26.428  -9.080  54.632  1.00 82.05  ? 224 ILE B O     1 
ATOM   4631 C  CB    . ILE B 1 224 ? 29.160  -10.264 56.322  1.00 82.74  ? 224 ILE B CB    1 
ATOM   4632 C  CG1   . ILE B 1 224 ? 29.637  -11.529 57.051  1.00 82.63  ? 224 ILE B CG1   1 
ATOM   4633 C  CG2   . ILE B 1 224 ? 28.520  -9.291  57.322  1.00 84.42  ? 224 ILE B CG2   1 
ATOM   4634 C  CD1   . ILE B 1 224 ? 30.975  -11.367 57.737  1.00 83.53  ? 224 ILE B CD1   1 
ATOM   4635 N  N     . ASN B 1 225 ? 28.497  -8.660  53.806  1.00 81.52  ? 225 ASN B N     1 
ATOM   4636 C  CA    . ASN B 1 225 ? 28.111  -7.424  53.103  1.00 81.89  ? 225 ASN B CA    1 
ATOM   4637 C  C     . ASN B 1 225 ? 27.019  -7.656  52.068  1.00 80.76  ? 225 ASN B C     1 
ATOM   4638 O  O     . ASN B 1 225 ? 26.251  -6.742  51.756  1.00 81.31  ? 225 ASN B O     1 
ATOM   4639 C  CB    . ASN B 1 225 ? 29.308  -6.772  52.424  1.00 81.90  ? 225 ASN B CB    1 
ATOM   4640 C  CG    . ASN B 1 225 ? 30.389  -6.375  53.406  1.00 83.28  ? 225 ASN B CG    1 
ATOM   4641 O  OD1   . ASN B 1 225 ? 30.110  -5.797  54.455  1.00 84.76  ? 225 ASN B OD1   1 
ATOM   4642 N  ND2   . ASN B 1 225 ? 31.634  -6.694  53.071  1.00 82.89  ? 225 ASN B ND2   1 
ATOM   4643 N  N     . LEU B 1 226 ? 26.964  -8.880  51.540  1.00 79.29  ? 226 LEU B N     1 
ATOM   4644 C  CA    . LEU B 1 226 ? 25.843  -9.336  50.727  1.00 78.30  ? 226 LEU B CA    1 
ATOM   4645 C  C     . LEU B 1 226 ? 24.555  -9.394  51.546  1.00 79.18  ? 226 LEU B C     1 
ATOM   4646 O  O     . LEU B 1 226 ? 23.543  -8.813  51.143  1.00 79.45  ? 226 LEU B O     1 
ATOM   4647 C  CB    . LEU B 1 226 ? 26.135  -10.710 50.122  1.00 76.76  ? 226 LEU B CB    1 
ATOM   4648 C  CG    . LEU B 1 226 ? 25.049  -11.329 49.225  1.00 75.70  ? 226 LEU B CG    1 
ATOM   4649 C  CD1   . LEU B 1 226 ? 24.786  -10.483 47.983  1.00 75.22  ? 226 LEU B CD1   1 
ATOM   4650 C  CD2   . LEU B 1 226 ? 25.433  -12.744 48.822  1.00 74.47  ? 226 LEU B CD2   1 
ATOM   4651 N  N     . ASN B 1 227 ? 24.588  -10.080 52.690  1.00 79.74  ? 227 ASN B N     1 
ATOM   4652 C  CA    . ASN B 1 227 ? 23.405  -10.148 53.549  1.00 80.78  ? 227 ASN B CA    1 
ATOM   4653 C  C     . ASN B 1 227 ? 22.968  -8.758  54.043  1.00 82.37  ? 227 ASN B C     1 
ATOM   4654 O  O     . ASN B 1 227 ? 21.765  -8.455  54.025  1.00 82.96  ? 227 ASN B O     1 
ATOM   4655 C  CB    . ASN B 1 227 ? 23.612  -11.088 54.734  1.00 81.25  ? 227 ASN B CB    1 
ATOM   4656 C  CG    . ASN B 1 227 ? 22.309  -11.409 55.454  1.00 82.15  ? 227 ASN B CG    1 
ATOM   4657 O  OD1   . ASN B 1 227 ? 21.228  -11.398 54.859  1.00 81.96  ? 227 ASN B OD1   1 
ATOM   4658 N  ND2   . ASN B 1 227 ? 22.402  -11.686 56.744  1.00 83.26  ? 227 ASN B ND2   1 
ATOM   4659 N  N     . ARG B 1 228 ? 23.945  -7.927  54.445  1.00 83.17  ? 228 ARG B N     1 
ATOM   4660 C  CA    . ARG B 1 228 ? 23.740  -6.497  54.774  1.00 84.76  ? 228 ARG B CA    1 
ATOM   4661 C  C     . ARG B 1 228 ? 22.859  -5.834  53.707  1.00 84.55  ? 228 ARG B C     1 
ATOM   4662 O  O     . ARG B 1 228 ? 21.767  -5.316  53.989  1.00 85.63  ? 228 ARG B O     1 
ATOM   4663 C  CB    . ARG B 1 228 ? 25.126  -5.752  54.855  1.00 85.26  ? 228 ARG B CB    1 
ATOM   4664 C  CG    . ARG B 1 228 ? 25.977  -6.020  56.079  1.00 86.09  ? 228 ARG B CG    1 
ATOM   4665 C  CD    . ARG B 1 228 ? 25.233  -5.598  57.345  1.00 87.86  ? 228 ARG B CD    1 
ATOM   4666 N  NE    . ARG B 1 228 ? 26.099  -4.829  58.270  1.00 89.43  ? 228 ARG B NE    1 
ATOM   4667 C  CZ    . ARG B 1 228 ? 26.079  -3.499  58.422  1.00 90.96  ? 228 ARG B CZ    1 
ATOM   4668 N  NH1   . ARG B 1 228 ? 25.223  -2.729  57.746  1.00 91.23  ? 228 ARG B NH1   1 
ATOM   4669 N  NH2   . ARG B 1 228 ? 26.919  -2.925  59.284  1.00 92.40  ? 228 ARG B NH2   1 
ATOM   4670 N  N     . ALA B 1 229 ? 23.333  -5.923  52.469  1.00 83.17  ? 229 ALA B N     1 
ATOM   4671 C  CA    . ALA B 1 229 ? 22.639  -5.378  51.311  1.00 82.78  ? 229 ALA B CA    1 
ATOM   4672 C  C     . ALA B 1 229 ? 21.272  -6.027  51.075  1.00 82.36  ? 229 ALA B C     1 
ATOM   4673 O  O     . ALA B 1 229 ? 20.285  -5.316  50.886  1.00 83.21  ? 229 ALA B O     1 
ATOM   4674 C  CB    . ALA B 1 229 ? 23.507  -5.514  50.071  1.00 81.32  ? 229 ALA B CB    1 
ATOM   4675 N  N     . LEU B 1 230 ? 21.217  -7.362  51.116  1.00 81.26  ? 230 LEU B N     1 
ATOM   4676 C  CA    . LEU B 1 230 ? 19.963  -8.124  50.873  1.00 80.89  ? 230 LEU B CA    1 
ATOM   4677 C  C     . LEU B 1 230 ? 18.844  -7.818  51.881  1.00 82.59  ? 230 LEU B C     1 
ATOM   4678 O  O     . LEU B 1 230 ? 17.669  -7.690  51.493  1.00 82.93  ? 230 LEU B O     1 
ATOM   4679 C  CB    . LEU B 1 230 ? 20.237  -9.641  50.855  1.00 79.63  ? 230 LEU B CB    1 
ATOM   4680 C  CG    . LEU B 1 230 ? 19.065  -10.647 50.740  1.00 79.37  ? 230 LEU B CG    1 
ATOM   4681 C  CD1   . LEU B 1 230 ? 18.100  -10.353 49.592  1.00 78.98  ? 230 LEU B CD1   1 
ATOM   4682 C  CD2   . LEU B 1 230 ? 19.611  -12.068 50.619  1.00 78.16  ? 230 LEU B CD2   1 
ATOM   4683 N  N     . GLN B 1 231 ? 19.217  -7.694  53.158  1.00 83.75  ? 231 GLN B N     1 
ATOM   4684 C  CA    . GLN B 1 231 ? 18.259  -7.361  54.220  1.00 85.55  ? 231 GLN B CA    1 
ATOM   4685 C  C     . GLN B 1 231 ? 17.644  -5.960  54.046  1.00 86.91  ? 231 GLN B C     1 
ATOM   4686 O  O     . GLN B 1 231 ? 16.480  -5.732  54.395  1.00 88.15  ? 231 GLN B O     1 
ATOM   4687 C  CB    . GLN B 1 231 ? 18.910  -7.528  55.599  1.00 86.48  ? 231 GLN B CB    1 
ATOM   4688 C  CG    . GLN B 1 231 ? 19.232  -8.985  55.926  1.00 85.53  ? 231 GLN B CG    1 
ATOM   4689 C  CD    . GLN B 1 231 ? 18.033  -9.766  56.440  1.00 86.14  ? 231 GLN B CD    1 
ATOM   4690 O  OE1   . GLN B 1 231 ? 17.492  -9.516  57.539  1.00 87.79  ? 231 GLN B OE1   1 
ATOM   4691 N  NE2   . GLN B 1 231 ? 17.620  -10.742 55.645  1.00 84.92  ? 231 GLN B NE2   1 
ATOM   4692 N  N     . ARG B 1 232 ? 18.414  -5.040  53.471  1.00 86.78  ? 232 ARG B N     1 
ATOM   4693 C  CA    . ARG B 1 232 ? 17.905  -3.721  53.090  1.00 87.98  ? 232 ARG B CA    1 
ATOM   4694 C  C     . ARG B 1 232 ? 17.103  -3.683  51.771  1.00 87.16  ? 232 ARG B C     1 
ATOM   4695 O  O     . ARG B 1 232 ? 16.847  -2.591  51.291  1.00 88.00  ? 232 ARG B O     1 
ATOM   4696 C  CB    . ARG B 1 232 ? 19.070  -2.711  53.087  1.00 88.47  ? 232 ARG B CB    1 
ATOM   4697 C  CG    . ARG B 1 232 ? 18.713  -1.287  53.483  1.00 90.63  ? 232 ARG B CG    1 
ATOM   4698 C  CD    . ARG B 1 232 ? 19.976  -0.461  53.723  1.00 91.30  ? 232 ARG B CD    1 
ATOM   4699 N  NE    . ARG B 1 232 ? 20.679  -0.137  52.471  1.00 90.23  ? 232 ARG B NE    1 
ATOM   4700 C  CZ    . ARG B 1 232 ? 21.685  -0.823  51.913  1.00 88.53  ? 232 ARG B CZ    1 
ATOM   4701 N  NH1   . ARG B 1 232 ? 22.170  -1.935  52.461  1.00 87.60  ? 232 ARG B NH1   1 
ATOM   4702 N  NH2   . ARG B 1 232 ? 22.220  -0.381  50.775  1.00 87.87  ? 232 ARG B NH2   1 
ATOM   4703 N  N     . LYS B 1 233 ? 16.721  -4.837  51.189  1.00 85.68  ? 233 LYS B N     1 
ATOM   4704 C  CA    . LYS B 1 233 ? 15.735  -4.915  50.081  1.00 85.14  ? 233 LYS B CA    1 
ATOM   4705 C  C     . LYS B 1 233 ? 14.460  -5.751  50.382  1.00 85.51  ? 233 LYS B C     1 
ATOM   4706 O  O     . LYS B 1 233 ? 13.329  -5.261  50.232  1.00 86.63  ? 233 LYS B O     1 
ATOM   4707 C  CB    . LYS B 1 233 ? 16.425  -5.508  48.841  1.00 83.02  ? 233 LYS B CB    1 
ATOM   4708 C  CG    . LYS B 1 233 ? 17.803  -4.966  48.602  1.00 82.55  ? 233 LYS B CG    1 
ATOM   4709 C  CD    . LYS B 1 233 ? 17.776  -3.546  48.080  1.00 83.52  ? 233 LYS B CD    1 
ATOM   4710 C  CE    . LYS B 1 233 ? 19.188  -2.980  48.027  1.00 83.42  ? 233 LYS B CE    1 
ATOM   4711 N  NZ    . LYS B 1 233 ? 19.750  -2.693  49.380  1.00 84.72  ? 233 LYS B NZ    1 
ATOM   4712 N  N     . ARG B 1 234 ? 14.650  -7.000  50.821  1.00 84.72  ? 234 ARG B N     1 
ATOM   4713 C  CA    . ARG B 1 234 ? 13.678  -8.085  50.545  1.00 84.30  ? 234 ARG B CA    1 
ATOM   4714 C  C     . ARG B 1 234 ? 13.336  -9.005  51.743  1.00 85.06  ? 234 ARG B C     1 
ATOM   4715 O  O     . ARG B 1 234 ? 14.188  -9.192  52.616  1.00 85.15  ? 234 ARG B O     1 
ATOM   4716 C  CB    . ARG B 1 234 ? 14.207  -8.867  49.325  1.00 82.16  ? 234 ARG B CB    1 
ATOM   4717 C  CG    . ARG B 1 234 ? 14.238  -7.951  48.116  1.00 81.70  ? 234 ARG B CG    1 
ATOM   4718 C  CD    . ARG B 1 234 ? 14.184  -8.575  46.731  1.00 80.01  ? 234 ARG B CD    1 
ATOM   4719 N  NE    . ARG B 1 234 ? 14.722  -7.669  45.685  1.00 79.40  ? 234 ARG B NE    1 
ATOM   4720 C  CZ    . ARG B 1 234 ? 16.011  -7.321  45.533  1.00 78.74  ? 234 ARG B CZ    1 
ATOM   4721 N  NH1   . ARG B 1 234 ? 16.948  -7.779  46.366  1.00 78.56  ? 234 ARG B NH1   1 
ATOM   4722 N  NH2   . ARG B 1 234 ? 16.384  -6.510  44.538  1.00 78.36  ? 234 ARG B NH2   1 
ATOM   4723 N  N     . PRO B 1 235 ? 12.099  -9.590  51.776  1.00 85.71  ? 235 PRO B N     1 
ATOM   4724 C  CA    . PRO B 1 235 ? 11.550  -10.391 52.898  1.00 86.81  ? 235 PRO B CA    1 
ATOM   4725 C  C     . PRO B 1 235 ? 12.464  -10.750 54.109  1.00 87.04  ? 235 PRO B C     1 
ATOM   4726 O  O     . PRO B 1 235 ? 13.244  -11.707 54.073  1.00 85.80  ? 235 PRO B O     1 
ATOM   4727 C  CB    . PRO B 1 235 ? 11.034  -11.652 52.169  1.00 85.81  ? 235 PRO B CB    1 
ATOM   4728 C  CG    . PRO B 1 235 ? 10.750  -11.195 50.750  1.00 84.90  ? 235 PRO B CG    1 
ATOM   4729 C  CD    . PRO B 1 235 ? 11.193  -9.755  50.618  1.00 85.25  ? 235 PRO B CD    1 
ATOM   4730 N  N     . ARG B 1 243 ? 12.107  -17.167 51.842  1.00 82.36  ? 243 ARG B N     1 
ATOM   4731 C  CA    . ARG B 1 243 ? 13.456  -17.614 52.239  1.00 81.50  ? 243 ARG B CA    1 
ATOM   4732 C  C     . ARG B 1 243 ? 14.476  -17.425 51.089  1.00 79.60  ? 243 ARG B C     1 
ATOM   4733 O  O     . ARG B 1 243 ? 14.079  -17.031 49.986  1.00 78.93  ? 243 ARG B O     1 
ATOM   4734 C  CB    . ARG B 1 243 ? 13.391  -19.072 52.733  1.00 81.80  ? 243 ARG B CB    1 
ATOM   4735 C  CG    . ARG B 1 243 ? 14.641  -19.589 53.438  1.00 81.45  ? 243 ARG B CG    1 
ATOM   4736 C  CD    . ARG B 1 243 ? 14.338  -20.735 54.402  1.00 82.60  ? 243 ARG B CD    1 
ATOM   4737 N  NE    . ARG B 1 243 ? 15.547  -21.482 54.790  1.00 82.06  ? 243 ARG B NE    1 
ATOM   4738 C  CZ    . ARG B 1 243 ? 16.188  -22.376 54.020  1.00 80.82  ? 243 ARG B CZ    1 
ATOM   4739 N  NH1   . ARG B 1 243 ? 15.760  -22.676 52.785  1.00 79.89  ? 243 ARG B NH1   1 
ATOM   4740 N  NH2   . ARG B 1 243 ? 17.274  -22.985 54.496  1.00 80.60  ? 243 ARG B NH2   1 
ATOM   4741 N  N     . VAL B 1 244 ? 15.771  -17.653 51.349  1.00 78.86  ? 244 VAL B N     1 
ATOM   4742 C  CA    . VAL B 1 244 ? 16.837  -17.543 50.323  1.00 77.20  ? 244 VAL B CA    1 
ATOM   4743 C  C     . VAL B 1 244 ? 17.404  -18.903 49.903  1.00 76.19  ? 244 VAL B C     1 
ATOM   4744 O  O     . VAL B 1 244 ? 17.546  -19.821 50.721  1.00 76.75  ? 244 VAL B O     1 
ATOM   4745 C  CB    . VAL B 1 244 ? 17.971  -16.595 50.805  1.00 77.23  ? 244 VAL B CB    1 
ATOM   4746 C  CG1   . VAL B 1 244 ? 19.275  -16.769 50.025  1.00 75.76  ? 244 VAL B CG1   1 
ATOM   4747 C  CG2   . VAL B 1 244 ? 17.504  -15.146 50.725  1.00 77.91  ? 244 VAL B CG2   1 
ATOM   4748 N  N     . ILE B 1 245 ? 17.713  -18.996 48.609  1.00 74.79  ? 245 ILE B N     1 
ATOM   4749 C  CA    . ILE B 1 245 ? 18.275  -20.188 47.972  1.00 73.75  ? 245 ILE B CA    1 
ATOM   4750 C  C     . ILE B 1 245 ? 19.493  -19.774 47.164  1.00 72.46  ? 245 ILE B C     1 
ATOM   4751 O  O     . ILE B 1 245 ? 19.368  -19.107 46.145  1.00 71.73  ? 245 ILE B O     1 
ATOM   4752 C  CB    . ILE B 1 245 ? 17.257  -20.863 47.022  1.00 73.44  ? 245 ILE B CB    1 
ATOM   4753 C  CG1   . ILE B 1 245 ? 16.081  -21.394 47.833  1.00 74.90  ? 245 ILE B CG1   1 
ATOM   4754 C  CG2   . ILE B 1 245 ? 17.898  -22.007 46.248  1.00 72.36  ? 245 ILE B CG2   1 
ATOM   4755 C  CD1   . ILE B 1 245 ? 14.942  -21.945 47.009  1.00 74.95  ? 245 ILE B CD1   1 
ATOM   4756 N  N     . PHE B 1 246 ? 20.660  -20.223 47.597  1.00 72.27  ? 246 PHE B N     1 
ATOM   4757 C  CA    . PHE B 1 246 ? 21.922  -19.778 47.038  1.00 71.36  ? 246 PHE B CA    1 
ATOM   4758 C  C     . PHE B 1 246 ? 22.435  -20.777 46.008  1.00 70.22  ? 246 PHE B C     1 
ATOM   4759 O  O     . PHE B 1 246 ? 22.327  -21.990 46.187  1.00 70.35  ? 246 PHE B O     1 
ATOM   4760 C  CB    . PHE B 1 246 ? 22.940  -19.580 48.172  1.00 72.05  ? 246 PHE B CB    1 
ATOM   4761 C  CG    . PHE B 1 246 ? 23.949  -18.495 47.908  1.00 71.75  ? 246 PHE B CG    1 
ATOM   4762 C  CD1   . PHE B 1 246 ? 23.548  -17.179 47.704  1.00 72.00  ? 246 PHE B CD1   1 
ATOM   4763 C  CD2   . PHE B 1 246 ? 25.302  -18.784 47.890  1.00 71.42  ? 246 PHE B CD2   1 
ATOM   4764 C  CE1   . PHE B 1 246 ? 24.483  -16.181 47.468  1.00 71.92  ? 246 PHE B CE1   1 
ATOM   4765 C  CE2   . PHE B 1 246 ? 26.246  -17.795 47.652  1.00 71.32  ? 246 PHE B CE2   1 
ATOM   4766 C  CZ    . PHE B 1 246 ? 25.836  -16.490 47.443  1.00 71.59  ? 246 PHE B CZ    1 
ATOM   4767 N  N     . LEU B 1 247 ? 22.977  -20.248 44.917  1.00 69.21  ? 247 LEU B N     1 
ATOM   4768 C  CA    . LEU B 1 247 ? 23.648  -21.047 43.886  1.00 68.13  ? 247 LEU B CA    1 
ATOM   4769 C  C     . LEU B 1 247 ? 24.940  -20.349 43.479  1.00 67.63  ? 247 LEU B C     1 
ATOM   4770 O  O     . LEU B 1 247 ? 24.932  -19.163 43.150  1.00 67.55  ? 247 LEU B O     1 
ATOM   4771 C  CB    . LEU B 1 247 ? 22.722  -21.255 42.674  1.00 67.41  ? 247 LEU B CB    1 
ATOM   4772 C  CG    . LEU B 1 247 ? 23.306  -21.601 41.301  1.00 66.19  ? 247 LEU B CG    1 
ATOM   4773 C  CD1   . LEU B 1 247 ? 23.884  -23.004 41.316  1.00 66.07  ? 247 LEU B CD1   1 
ATOM   4774 C  CD2   . LEU B 1 247 ? 22.254  -21.494 40.220  1.00 65.67  ? 247 LEU B CD2   1 
ATOM   4775 N  N     . HIS B 1 248 ? 26.040  -21.094 43.498  1.00 67.43  ? 248 HIS B N     1 
ATOM   4776 C  CA    . HIS B 1 248 ? 27.343  -20.556 43.123  1.00 67.11  ? 248 HIS B CA    1 
ATOM   4777 C  C     . HIS B 1 248 ? 28.302  -21.683 42.772  1.00 66.75  ? 248 HIS B C     1 
ATOM   4778 O  O     . HIS B 1 248 ? 28.136  -22.813 43.220  1.00 67.06  ? 248 HIS B O     1 
ATOM   4779 C  CB    . HIS B 1 248 ? 27.907  -19.656 44.236  1.00 68.08  ? 248 HIS B CB    1 
ATOM   4780 C  CG    . HIS B 1 248 ? 28.126  -20.355 45.553  1.00 69.01  ? 248 HIS B CG    1 
ATOM   4781 N  ND1   . HIS B 1 248 ? 27.112  -20.879 46.326  1.00 69.60  ? 248 HIS B ND1   1 
ATOM   4782 C  CD2   . HIS B 1 248 ? 29.266  -20.604 46.228  1.00 69.55  ? 248 HIS B CD2   1 
ATOM   4783 C  CE1   . HIS B 1 248 ? 27.625  -21.432 47.411  1.00 70.43  ? 248 HIS B CE1   1 
ATOM   4784 N  NE2   . HIS B 1 248 ? 28.933  -21.280 47.373  1.00 70.40  ? 248 HIS B NE2   1 
ATOM   4785 N  N     . ASP B 1 249 ? 29.302  -21.367 41.962  1.00 66.23  ? 249 ASP B N     1 
ATOM   4786 C  CA    . ASP B 1 249 ? 30.153  -22.405 41.387  1.00 65.86  ? 249 ASP B CA    1 
ATOM   4787 C  C     . ASP B 1 249 ? 31.028  -23.072 42.462  1.00 66.75  ? 249 ASP B C     1 
ATOM   4788 O  O     . ASP B 1 249 ? 31.329  -22.455 43.474  1.00 67.55  ? 249 ASP B O     1 
ATOM   4789 C  CB    . ASP B 1 249 ? 30.924  -21.868 40.147  1.00 65.14  ? 249 ASP B CB    1 
ATOM   4790 C  CG    . ASP B 1 249 ? 31.948  -20.752 40.467  1.00 65.67  ? 249 ASP B CG    1 
ATOM   4791 O  OD1   . ASP B 1 249 ? 32.058  -20.369 41.642  1.00 66.56  ? 249 ASP B OD1   1 
ATOM   4792 O  OD2   . ASP B 1 249 ? 32.624  -20.239 39.524  1.00 65.29  ? 249 ASP B OD2   1 
ATOM   4793 N  N     . ASN B 1 250 ? 31.385  -24.340 42.265  1.00 66.74  ? 250 ASN B N     1 
ATOM   4794 C  CA    . ASN B 1 250 ? 32.109  -25.120 43.283  1.00 67.70  ? 250 ASN B CA    1 
ATOM   4795 C  C     . ASN B 1 250 ? 33.579  -24.751 43.401  1.00 68.11  ? 250 ASN B C     1 
ATOM   4796 O  O     . ASN B 1 250 ? 34.441  -25.620 43.334  1.00 68.44  ? 250 ASN B O     1 
ATOM   4797 C  CB    . ASN B 1 250 ? 32.024  -26.622 42.989  1.00 67.72  ? 250 ASN B CB    1 
ATOM   4798 C  CG    . ASN B 1 250 ? 30.614  -27.153 43.015  1.00 67.63  ? 250 ASN B CG    1 
ATOM   4799 O  OD1   . ASN B 1 250 ? 29.678  -26.474 43.428  1.00 67.69  ? 250 ASN B OD1   1 
ATOM   4800 N  ND2   . ASN B 1 250 ? 30.453  -28.387 42.565  1.00 67.63  ? 250 ASN B ND2   1 
ATOM   4801 N  N     . ALA B 1 251 ? 33.879  -23.472 43.598  1.00 68.27  ? 251 ALA B N     1 
ATOM   4802 C  CA    . ALA B 1 251 ? 35.263  -23.028 43.736  1.00 68.85  ? 251 ALA B CA    1 
ATOM   4803 C  C     . ALA B 1 251 ? 35.787  -23.461 45.124  1.00 70.07  ? 251 ALA B C     1 
ATOM   4804 O  O     . ALA B 1 251 ? 34.989  -23.750 46.020  1.00 70.45  ? 251 ALA B O     1 
ATOM   4805 C  CB    . ALA B 1 251 ? 35.356  -21.520 43.553  1.00 68.83  ? 251 ALA B CB    1 
ATOM   4806 N  N     . PRO B 1 252 ? 37.121  -23.523 45.317  1.00 70.80  ? 252 PRO B N     1 
ATOM   4807 C  CA    . PRO B 1 252 ? 37.597  -23.939 46.631  1.00 72.02  ? 252 PRO B CA    1 
ATOM   4808 C  C     . PRO B 1 252 ? 37.270  -22.976 47.768  1.00 72.73  ? 252 PRO B C     1 
ATOM   4809 O  O     . PRO B 1 252 ? 37.130  -23.431 48.899  1.00 73.56  ? 252 PRO B O     1 
ATOM   4810 C  CB    . PRO B 1 252 ? 39.103  -24.062 46.429  1.00 72.68  ? 252 PRO B CB    1 
ATOM   4811 C  CG    . PRO B 1 252 ? 39.279  -24.277 44.976  1.00 71.73  ? 252 PRO B CG    1 
ATOM   4812 C  CD    . PRO B 1 252 ? 38.231  -23.417 44.357  1.00 70.68  ? 252 PRO B CD    1 
ATOM   4813 N  N     . SER B 1 253 ? 37.162  -21.674 47.478  1.00 72.53  ? 253 SER B N     1 
ATOM   4814 C  CA    . SER B 1 253 ? 36.693  -20.664 48.459  1.00 73.20  ? 253 SER B CA    1 
ATOM   4815 C  C     . SER B 1 253 ? 35.211  -20.822 48.793  1.00 72.84  ? 253 SER B C     1 
ATOM   4816 O  O     . SER B 1 253 ? 34.739  -20.399 49.843  1.00 73.60  ? 253 SER B O     1 
ATOM   4817 C  CB    . SER B 1 253 ? 36.908  -19.238 47.936  1.00 73.16  ? 253 SER B CB    1 
ATOM   4818 O  OG    . SER B 1 253 ? 38.076  -19.133 47.147  1.00 73.16  ? 253 SER B OG    1 
ATOM   4819 N  N     . HIS B 1 254 ? 34.486  -21.394 47.849  1.00 71.77  ? 254 HIS B N     1 
ATOM   4820 C  CA    . HIS B 1 254 ? 33.069  -21.638 47.962  1.00 71.43  ? 254 HIS B CA    1 
ATOM   4821 C  C     . HIS B 1 254 ? 32.832  -22.977 48.660  1.00 71.89  ? 254 HIS B C     1 
ATOM   4822 O  O     . HIS B 1 254 ? 31.912  -23.086 49.453  1.00 72.37  ? 254 HIS B O     1 
ATOM   4823 C  CB    . HIS B 1 254 ? 32.441  -21.620 46.557  1.00 70.17  ? 254 HIS B CB    1 
ATOM   4824 C  CG    . HIS B 1 254 ? 32.647  -20.330 45.797  1.00 69.77  ? 254 HIS B CG    1 
ATOM   4825 N  ND1   . HIS B 1 254 ? 32.246  -20.160 44.486  1.00 68.70  ? 254 HIS B ND1   1 
ATOM   4826 C  CD2   . HIS B 1 254 ? 33.225  -19.160 46.161  1.00 70.42  ? 254 HIS B CD2   1 
ATOM   4827 C  CE1   . HIS B 1 254 ? 32.549  -18.937 44.088  1.00 68.72  ? 254 HIS B CE1   1 
ATOM   4828 N  NE2   . HIS B 1 254 ? 33.153  -18.314 45.081  1.00 69.78  ? 254 HIS B NE2   1 
ATOM   4829 N  N     . THR B 1 255 ? 33.667  -23.977 48.365  1.00 71.89  ? 255 THR B N     1 
ATOM   4830 C  CA    . THR B 1 255 ? 33.642  -25.294 49.031  1.00 72.55  ? 255 THR B CA    1 
ATOM   4831 C  C     . THR B 1 255 ? 34.201  -25.288 50.470  1.00 73.90  ? 255 THR B C     1 
ATOM   4832 O  O     . THR B 1 255 ? 33.990  -26.244 51.232  1.00 74.64  ? 255 THR B O     1 
ATOM   4833 C  CB    . THR B 1 255 ? 34.455  -26.332 48.222  1.00 72.28  ? 255 THR B CB    1 
ATOM   4834 O  OG1   . THR B 1 255 ? 34.052  -26.283 46.860  1.00 71.07  ? 255 THR B OG1   1 
ATOM   4835 C  CG2   . THR B 1 255 ? 34.254  -27.762 48.744  1.00 72.97  ? 255 THR B CG2   1 
ATOM   4836 N  N     . ALA B 1 256 ? 34.942  -24.238 50.825  1.00 74.32  ? 256 ALA B N     1 
ATOM   4837 C  CA    . ALA B 1 256 ? 35.508  -24.093 52.161  1.00 75.64  ? 256 ALA B CA    1 
ATOM   4838 C  C     . ALA B 1 256 ? 34.474  -24.410 53.243  1.00 76.30  ? 256 ALA B C     1 
ATOM   4839 O  O     . ALA B 1 256 ? 33.350  -23.903 53.209  1.00 75.95  ? 256 ALA B O     1 
ATOM   4840 C  CB    . ALA B 1 256 ? 36.064  -22.684 52.351  1.00 75.99  ? 256 ALA B CB    1 
ATOM   4841 N  N     . ARG B 1 257 ? 34.861  -25.291 54.165  1.00 77.33  ? 257 ARG B N     1 
ATOM   4842 C  CA    . ARG B 1 257 ? 34.111  -25.563 55.396  1.00 78.30  ? 257 ARG B CA    1 
ATOM   4843 C  C     . ARG B 1 257 ? 33.825  -24.274 56.173  1.00 78.82  ? 257 ARG B C     1 
ATOM   4844 O  O     . ARG B 1 257 ? 32.725  -24.101 56.701  1.00 79.10  ? 257 ARG B O     1 
ATOM   4845 C  CB    . ARG B 1 257 ? 34.913  -26.533 56.270  1.00 79.50  ? 257 ARG B CB    1 
ATOM   4846 C  CG    . ARG B 1 257 ? 34.268  -26.904 57.613  1.00 80.70  ? 257 ARG B CG    1 
ATOM   4847 C  CD    . ARG B 1 257 ? 34.859  -28.228 58.098  1.00 81.66  ? 257 ARG B CD    1 
ATOM   4848 N  NE    . ARG B 1 257 ? 34.250  -29.367 57.391  1.00 81.21  ? 257 ARG B NE    1 
ATOM   4849 C  CZ    . ARG B 1 257 ? 33.567  -30.373 57.955  1.00 82.02  ? 257 ARG B CZ    1 
ATOM   4850 N  NH1   . ARG B 1 257 ? 33.371  -30.450 59.279  1.00 83.35  ? 257 ARG B NH1   1 
ATOM   4851 N  NH2   . ARG B 1 257 ? 33.073  -31.334 57.171  1.00 81.61  ? 257 ARG B NH2   1 
ATOM   4852 N  N     . ALA B 1 258 ? 34.826  -23.390 56.230  1.00 79.09  ? 258 ALA B N     1 
ATOM   4853 C  CA    . ALA B 1 258 ? 34.684  -22.047 56.789  1.00 79.60  ? 258 ALA B CA    1 
ATOM   4854 C  C     . ALA B 1 258 ? 33.416  -21.356 56.290  1.00 78.86  ? 258 ALA B C     1 
ATOM   4855 O  O     . ALA B 1 258 ? 32.604  -20.872 57.084  1.00 79.52  ? 258 ALA B O     1 
ATOM   4856 C  CB    . ALA B 1 258 ? 35.906  -21.205 56.451  1.00 79.74  ? 258 ALA B CB    1 
ATOM   4857 N  N     . VAL B 1 259 ? 33.247  -21.336 54.973  1.00 77.59  ? 259 VAL B N     1 
ATOM   4858 C  CA    . VAL B 1 259 ? 32.107  -20.674 54.334  1.00 76.85  ? 259 VAL B CA    1 
ATOM   4859 C  C     . VAL B 1 259 ? 30.800  -21.473 54.489  1.00 76.75  ? 259 VAL B C     1 
ATOM   4860 O  O     . VAL B 1 259 ? 29.737  -20.876 54.704  1.00 76.95  ? 259 VAL B O     1 
ATOM   4861 C  CB    . VAL B 1 259 ? 32.416  -20.362 52.853  1.00 75.60  ? 259 VAL B CB    1 
ATOM   4862 C  CG1   . VAL B 1 259 ? 31.186  -19.831 52.120  1.00 74.83  ? 259 VAL B CG1   1 
ATOM   4863 C  CG2   . VAL B 1 259 ? 33.555  -19.357 52.770  1.00 75.95  ? 259 VAL B CG2   1 
ATOM   4864 N  N     . ARG B 1 260 ? 30.867  -22.802 54.398  1.00 76.63  ? 260 ARG B N     1 
ATOM   4865 C  CA    . ARG B 1 260 ? 29.677  -23.645 54.617  1.00 76.80  ? 260 ARG B CA    1 
ATOM   4866 C  C     . ARG B 1 260 ? 29.043  -23.472 56.010  1.00 78.14  ? 260 ARG B C     1 
ATOM   4867 O  O     . ARG B 1 260 ? 27.823  -23.622 56.149  1.00 78.36  ? 260 ARG B O     1 
ATOM   4868 C  CB    . ARG B 1 260 ? 29.984  -25.121 54.359  1.00 76.71  ? 260 ARG B CB    1 
ATOM   4869 C  CG    . ARG B 1 260 ? 30.162  -25.479 52.884  1.00 75.40  ? 260 ARG B CG    1 
ATOM   4870 C  CD    . ARG B 1 260 ? 29.929  -26.962 52.623  1.00 75.46  ? 260 ARG B CD    1 
ATOM   4871 N  NE    . ARG B 1 260 ? 30.936  -27.774 53.298  1.00 76.34  ? 260 ARG B NE    1 
ATOM   4872 C  CZ    . ARG B 1 260 ? 30.824  -28.322 54.514  1.00 77.63  ? 260 ARG B CZ    1 
ATOM   4873 N  NH1   . ARG B 1 260 ? 29.716  -28.204 55.256  1.00 78.27  ? 260 ARG B NH1   1 
ATOM   4874 N  NH2   . ARG B 1 260 ? 31.850  -29.013 55.006  1.00 78.41  ? 260 ARG B NH2   1 
ATOM   4875 N  N     . ASP B 1 261 ? 29.862  -23.150 57.020  1.00 79.11  ? 261 ASP B N     1 
ATOM   4876 C  CA    . ASP B 1 261 ? 29.349  -22.712 58.329  1.00 80.42  ? 261 ASP B CA    1 
ATOM   4877 C  C     . ASP B 1 261 ? 28.616  -21.376 58.198  1.00 80.35  ? 261 ASP B C     1 
ATOM   4878 O  O     . ASP B 1 261 ? 27.475  -21.245 58.647  1.00 80.92  ? 261 ASP B O     1 
ATOM   4879 C  CB    . ASP B 1 261 ? 30.463  -22.553 59.373  1.00 81.49  ? 261 ASP B CB    1 
ATOM   4880 C  CG    . ASP B 1 261 ? 31.253  -23.839 59.612  1.00 81.81  ? 261 ASP B CG    1 
ATOM   4881 O  OD1   . ASP B 1 261 ? 30.801  -24.913 59.172  1.00 81.44  ? 261 ASP B OD1   1 
ATOM   4882 O  OD2   . ASP B 1 261 ? 32.330  -23.780 60.250  1.00 82.56  ? 261 ASP B OD2   1 
ATOM   4883 N  N     . THR B 1 262 ? 29.277  -20.400 57.573  1.00 79.79  ? 262 THR B N     1 
ATOM   4884 C  CA    . THR B 1 262 ? 28.690  -19.075 57.338  1.00 79.78  ? 262 THR B CA    1 
ATOM   4885 C  C     . THR B 1 262 ? 27.379  -19.148 56.547  1.00 79.07  ? 262 THR B C     1 
ATOM   4886 O  O     . THR B 1 262 ? 26.498  -18.306 56.731  1.00 79.54  ? 262 THR B O     1 
ATOM   4887 C  CB    . THR B 1 262 ? 29.675  -18.140 56.602  1.00 79.26  ? 262 THR B CB    1 
ATOM   4888 O  OG1   . THR B 1 262 ? 30.964  -18.228 57.214  1.00 79.91  ? 262 THR B OG1   1 
ATOM   4889 C  CG2   . THR B 1 262 ? 29.204  -16.685 56.637  1.00 79.71  ? 262 THR B CG2   1 
ATOM   4890 N  N     . LEU B 1 263 ? 27.250  -20.145 55.672  1.00 78.06  ? 263 LEU B N     1 
ATOM   4891 C  CA    . LEU B 1 263 ? 26.014  -20.342 54.909  1.00 77.46  ? 263 LEU B CA    1 
ATOM   4892 C  C     . LEU B 1 263 ? 24.873  -20.930 55.742  1.00 78.46  ? 263 LEU B C     1 
ATOM   4893 O  O     . LEU B 1 263 ? 23.715  -20.653 55.454  1.00 78.51  ? 263 LEU B O     1 
ATOM   4894 C  CB    . LEU B 1 263 ? 26.276  -21.165 53.641  1.00 76.13  ? 263 LEU B CB    1 
ATOM   4895 C  CG    . LEU B 1 263 ? 27.092  -20.384 52.585  1.00 75.11  ? 263 LEU B CG    1 
ATOM   4896 C  CD1   . LEU B 1 263 ? 27.766  -21.304 51.577  1.00 74.04  ? 263 LEU B CD1   1 
ATOM   4897 C  CD2   . LEU B 1 263 ? 26.247  -19.335 51.863  1.00 74.69  ? 263 LEU B CD2   1 
ATOM   4898 N  N     . GLU B 1 264 ? 25.187  -21.727 56.760  1.00 79.37  ? 264 GLU B N     1 
ATOM   4899 C  CA    . GLU B 1 264 ? 24.182  -22.121 57.755  1.00 80.65  ? 264 GLU B CA    1 
ATOM   4900 C  C     . GLU B 1 264 ? 23.802  -20.946 58.649  1.00 81.74  ? 264 GLU B C     1 
ATOM   4901 O  O     . GLU B 1 264 ? 22.621  -20.703 58.857  1.00 82.39  ? 264 GLU B O     1 
ATOM   4902 C  CB    . GLU B 1 264 ? 24.682  -23.267 58.631  1.00 81.45  ? 264 GLU B CB    1 
ATOM   4903 C  CG    . GLU B 1 264 ? 24.813  -24.595 57.915  1.00 80.80  ? 264 GLU B CG    1 
ATOM   4904 C  CD    . GLU B 1 264 ? 25.610  -25.605 58.727  1.00 81.60  ? 264 GLU B CD    1 
ATOM   4905 O  OE1   . GLU B 1 264 ? 26.500  -26.265 58.147  1.00 80.95  ? 264 GLU B OE1   1 
ATOM   4906 O  OE2   . GLU B 1 264 ? 25.358  -25.733 59.942  1.00 82.98  ? 264 GLU B OE2   1 
ATOM   4907 N  N     . THR B 1 265 ? 24.804  -20.239 59.185  1.00 82.08  ? 265 THR B N     1 
ATOM   4908 C  CA    . THR B 1 265 ? 24.594  -19.077 60.081  1.00 83.26  ? 265 THR B CA    1 
ATOM   4909 C  C     . THR B 1 265 ? 23.655  -18.030 59.483  1.00 83.11  ? 265 THR B C     1 
ATOM   4910 O  O     . THR B 1 265 ? 22.757  -17.541 60.165  1.00 84.27  ? 265 THR B O     1 
ATOM   4911 C  CB    . THR B 1 265 ? 25.934  -18.402 60.439  1.00 83.46  ? 265 THR B CB    1 
ATOM   4912 O  OG1   . THR B 1 265 ? 26.725  -19.318 61.198  1.00 83.95  ? 265 THR B OG1   1 
ATOM   4913 C  CG2   . THR B 1 265 ? 25.737  -17.120 61.256  1.00 84.71  ? 265 THR B CG2   1 
ATOM   4914 N  N     . LEU B 1 266 ? 23.882  -17.690 58.219  1.00 81.79  ? 266 LEU B N     1 
ATOM   4915 C  CA    . LEU B 1 266 ? 22.948  -16.853 57.460  1.00 81.52  ? 266 LEU B CA    1 
ATOM   4916 C  C     . LEU B 1 266 ? 21.602  -17.561 57.282  1.00 81.65  ? 266 LEU B C     1 
ATOM   4917 O  O     . LEU B 1 266 ? 20.550  -16.920 57.248  1.00 82.25  ? 266 LEU B O     1 
ATOM   4918 C  CB    . LEU B 1 266 ? 23.530  -16.523 56.087  1.00 80.04  ? 266 LEU B CB    1 
ATOM   4919 C  CG    . LEU B 1 266 ? 24.771  -15.631 56.104  1.00 80.04  ? 266 LEU B CG    1 
ATOM   4920 C  CD1   . LEU B 1 266 ? 25.599  -15.802 54.835  1.00 78.56  ? 266 LEU B CD1   1 
ATOM   4921 C  CD2   . LEU B 1 266 ? 24.378  -14.175 56.300  1.00 80.94  ? 266 LEU B CD2   1 
ATOM   4922 N  N     . ASN B 1 267 ? 21.677  -18.884 57.141  1.00 81.19  ? 267 ASN B N     1 
ATOM   4923 C  CA    . ASN B 1 267 ? 20.538  -19.775 56.947  1.00 81.36  ? 267 ASN B CA    1 
ATOM   4924 C  C     . ASN B 1 267 ? 20.048  -19.721 55.497  1.00 80.11  ? 267 ASN B C     1 
ATOM   4925 O  O     . ASN B 1 267 ? 18.845  -19.665 55.224  1.00 80.47  ? 267 ASN B O     1 
ATOM   4926 C  CB    . ASN B 1 267 ? 19.429  -19.520 57.975  1.00 83.05  ? 267 ASN B CB    1 
ATOM   4927 C  CG    . ASN B 1 267 ? 18.633  -20.769 58.281  1.00 83.71  ? 267 ASN B CG    1 
ATOM   4928 O  OD1   . ASN B 1 267 ? 18.822  -21.396 59.323  1.00 84.71  ? 267 ASN B OD1   1 
ATOM   4929 N  ND2   . ASN B 1 267 ? 17.759  -21.155 57.365  1.00 83.25  ? 267 ASN B ND2   1 
ATOM   4930 N  N     . TRP B 1 268 ? 21.017  -19.759 54.577  1.00 78.72  ? 268 TRP B N     1 
ATOM   4931 C  CA    . TRP B 1 268 ? 20.775  -19.803 53.146  1.00 77.41  ? 268 TRP B CA    1 
ATOM   4932 C  C     . TRP B 1 268 ? 21.046  -21.203 52.652  1.00 76.70  ? 268 TRP B C     1 
ATOM   4933 O  O     . TRP B 1 268 ? 22.112  -21.762 52.913  1.00 76.50  ? 268 TRP B O     1 
ATOM   4934 C  CB    . TRP B 1 268 ? 21.694  -18.839 52.413  1.00 76.47  ? 268 TRP B CB    1 
ATOM   4935 C  CG    . TRP B 1 268 ? 21.501  -17.417 52.786  1.00 77.22  ? 268 TRP B CG    1 
ATOM   4936 C  CD1   . TRP B 1 268 ? 20.470  -16.874 53.508  1.00 78.50  ? 268 TRP B CD1   1 
ATOM   4937 C  CD2   . TRP B 1 268 ? 22.347  -16.332 52.420  1.00 76.88  ? 268 TRP B CD2   1 
ATOM   4938 N  NE1   . TRP B 1 268 ? 20.641  -15.521 53.631  1.00 78.99  ? 268 TRP B NE1   1 
ATOM   4939 C  CE2   . TRP B 1 268 ? 21.783  -15.157 52.967  1.00 78.02  ? 268 TRP B CE2   1 
ATOM   4940 C  CE3   . TRP B 1 268 ? 23.536  -16.235 51.693  1.00 75.87  ? 268 TRP B CE3   1 
ATOM   4941 C  CZ2   . TRP B 1 268 ? 22.371  -13.895 52.804  1.00 78.21  ? 268 TRP B CZ2   1 
ATOM   4942 C  CZ3   . TRP B 1 268 ? 24.119  -14.982 51.530  1.00 76.05  ? 268 TRP B CZ3   1 
ATOM   4943 C  CH2   . TRP B 1 268 ? 23.534  -13.827 52.087  1.00 77.22  ? 268 TRP B CH2   1 
ATOM   4944 N  N     . GLU B 1 269 ? 20.074  -21.760 51.936  1.00 76.44  ? 269 GLU B N     1 
ATOM   4945 C  CA    . GLU B 1 269 ? 20.171  -23.108 51.407  1.00 75.93  ? 269 GLU B CA    1 
ATOM   4946 C  C     . GLU B 1 269 ? 21.020  -23.079 50.167  1.00 74.38  ? 269 GLU B C     1 
ATOM   4947 O  O     . GLU B 1 269 ? 20.682  -22.381 49.217  1.00 73.63  ? 269 GLU B O     1 
ATOM   4948 C  CB    . GLU B 1 269 ? 18.790  -23.627 51.037  1.00 76.33  ? 269 GLU B CB    1 
ATOM   4949 C  CG    . GLU B 1 269 ? 18.766  -25.102 50.670  1.00 76.21  ? 269 GLU B CG    1 
ATOM   4950 C  CD    . GLU B 1 269 ? 17.760  -25.426 49.594  1.00 75.85  ? 269 GLU B CD    1 
ATOM   4951 O  OE1   . GLU B 1 269 ? 16.715  -24.746 49.505  1.00 76.30  ? 269 GLU B OE1   1 
ATOM   4952 O  OE2   . GLU B 1 269 ? 18.013  -26.369 48.822  1.00 75.21  ? 269 GLU B OE2   1 
ATOM   4953 N  N     . VAL B 1 270 ? 22.103  -23.849 50.161  1.00 74.01  ? 270 VAL B N     1 
ATOM   4954 C  CA    . VAL B 1 270 ? 22.967  -23.956 48.978  1.00 72.66  ? 270 VAL B CA    1 
ATOM   4955 C  C     . VAL B 1 270 ? 22.340  -24.925 47.974  1.00 72.10  ? 270 VAL B C     1 
ATOM   4956 O  O     . VAL B 1 270 ? 21.900  -26.013 48.362  1.00 72.82  ? 270 VAL B O     1 
ATOM   4957 C  CB    . VAL B 1 270 ? 24.377  -24.462 49.343  1.00 72.65  ? 270 VAL B CB    1 
ATOM   4958 C  CG1   . VAL B 1 270 ? 25.226  -24.650 48.090  1.00 71.39  ? 270 VAL B CG1   1 
ATOM   4959 C  CG2   . VAL B 1 270 ? 25.049  -23.500 50.311  1.00 73.27  ? 270 VAL B CG2   1 
ATOM   4960 N  N     . LEU B 1 271 ? 22.295  -24.528 46.700  1.00 70.96  ? 271 LEU B N     1 
ATOM   4961 C  CA    . LEU B 1 271 ? 21.773  -25.397 45.659  1.00 70.40  ? 271 LEU B CA    1 
ATOM   4962 C  C     . LEU B 1 271 ? 22.857  -26.324 45.208  1.00 69.86  ? 271 LEU B C     1 
ATOM   4963 O  O     . LEU B 1 271 ? 24.016  -25.916 45.133  1.00 69.39  ? 271 LEU B O     1 
ATOM   4964 C  CB    . LEU B 1 271 ? 21.274  -24.625 44.445  1.00 69.45  ? 271 LEU B CB    1 
ATOM   4965 C  CG    . LEU B 1 271 ? 19.804  -24.207 44.452  1.00 70.02  ? 271 LEU B CG    1 
ATOM   4966 C  CD1   . LEU B 1 271 ? 19.508  -23.320 43.247  1.00 69.07  ? 271 LEU B CD1   1 
ATOM   4967 C  CD2   . LEU B 1 271 ? 18.836  -25.386 44.463  1.00 70.69  ? 271 LEU B CD2   1 
ATOM   4968 N  N     . PRO B 1 272 ? 22.489  -27.572 44.879  1.00 70.05  ? 272 PRO B N     1 
ATOM   4969 C  CA    . PRO B 1 272 ? 23.473  -28.508 44.374  1.00 69.65  ? 272 PRO B CA    1 
ATOM   4970 C  C     . PRO B 1 272 ? 23.839  -28.123 42.961  1.00 68.30  ? 272 PRO B C     1 
ATOM   4971 O  O     . PRO B 1 272 ? 22.971  -27.785 42.165  1.00 67.80  ? 272 PRO B O     1 
ATOM   4972 C  CB    . PRO B 1 272 ? 22.742  -29.847 44.406  1.00 70.43  ? 272 PRO B CB    1 
ATOM   4973 C  CG    . PRO B 1 272 ? 21.326  -29.490 44.210  1.00 70.62  ? 272 PRO B CG    1 
ATOM   4974 C  CD    . PRO B 1 272 ? 21.135  -28.143 44.841  1.00 70.70  ? 272 PRO B CD    1 
ATOM   4975 N  N     . HIS B 1 273 ? 25.130  -28.169 42.674  1.00 67.81  ? 273 HIS B N     1 
ATOM   4976 C  CA    . HIS B 1 273 ? 25.662  -27.720 41.398  1.00 66.63  ? 273 HIS B CA    1 
ATOM   4977 C  C     . HIS B 1 273 ? 26.815  -28.648 41.035  1.00 66.54  ? 273 HIS B C     1 
ATOM   4978 O  O     . HIS B 1 273 ? 27.697  -28.892 41.866  1.00 67.18  ? 273 HIS B O     1 
ATOM   4979 C  CB    . HIS B 1 273 ? 26.144  -26.281 41.547  1.00 66.31  ? 273 HIS B CB    1 
ATOM   4980 C  CG    . HIS B 1 273 ? 26.579  -25.652 40.268  1.00 65.21  ? 273 HIS B CG    1 
ATOM   4981 N  ND1   . HIS B 1 273 ? 27.899  -25.607 39.874  1.00 64.88  ? 273 HIS B ND1   1 
ATOM   4982 C  CD2   . HIS B 1 273 ? 25.873  -25.051 39.285  1.00 64.48  ? 273 HIS B CD2   1 
ATOM   4983 C  CE1   . HIS B 1 273 ? 27.990  -25.003 38.700  1.00 63.98  ? 273 HIS B CE1   1 
ATOM   4984 N  NE2   . HIS B 1 273 ? 26.773  -24.655 38.322  1.00 63.70  ? 273 HIS B NE2   1 
ATOM   4985 N  N     . ALA B 1 274 ? 26.788  -29.198 39.824  1.00 65.87  ? 274 ALA B N     1 
ATOM   4986 C  CA    . ALA B 1 274 ? 27.830  -30.109 39.378  1.00 65.88  ? 274 ALA B CA    1 
ATOM   4987 C  C     . ALA B 1 274 ? 29.041  -29.315 38.926  1.00 65.27  ? 274 ALA B C     1 
ATOM   4988 O  O     . ALA B 1 274 ? 28.945  -28.138 38.557  1.00 64.62  ? 274 ALA B O     1 
ATOM   4989 C  CB    . ALA B 1 274 ? 27.327  -30.998 38.255  1.00 65.53  ? 274 ALA B CB    1 
ATOM   4990 N  N     . ALA B 1 275 ? 30.187  -29.976 38.954  1.00 65.64  ? 275 ALA B N     1 
ATOM   4991 C  CA    . ALA B 1 275 ? 31.436  -29.367 38.527  1.00 65.31  ? 275 ALA B CA    1 
ATOM   4992 C  C     . ALA B 1 275 ? 31.431  -29.139 37.022  1.00 64.26  ? 275 ALA B C     1 
ATOM   4993 O  O     . ALA B 1 275 ? 30.879  -29.939 36.284  1.00 64.01  ? 275 ALA B O     1 
ATOM   4994 C  CB    . ALA B 1 275 ? 32.603  -30.258 38.918  1.00 66.16  ? 275 ALA B CB    1 
ATOM   4995 N  N     . TYR B 1 276 ? 32.052  -28.044 36.599  1.00 63.78  ? 276 TYR B N     1 
ATOM   4996 C  CA    . TYR B 1 276 ? 32.232  -27.686 35.190  1.00 62.88  ? 276 TYR B CA    1 
ATOM   4997 C  C     . TYR B 1 276 ? 30.920  -27.472 34.457  1.00 62.10  ? 276 TYR B C     1 
ATOM   4998 O  O     . TYR B 1 276 ? 30.721  -27.970 33.346  1.00 61.56  ? 276 TYR B O     1 
ATOM   4999 C  CB    . TYR B 1 276 ? 33.102  -28.712 34.459  1.00 63.00  ? 276 TYR B CB    1 
ATOM   5000 C  CG    . TYR B 1 276 ? 34.446  -28.916 35.097  1.00 63.89  ? 276 TYR B CG    1 
ATOM   5001 C  CD1   . TYR B 1 276 ? 35.512  -28.071 34.799  1.00 63.90  ? 276 TYR B CD1   1 
ATOM   5002 C  CD2   . TYR B 1 276 ? 34.652  -29.955 36.005  1.00 64.86  ? 276 TYR B CD2   1 
ATOM   5003 C  CE1   . TYR B 1 276 ? 36.745  -28.258 35.389  1.00 64.85  ? 276 TYR B CE1   1 
ATOM   5004 C  CE2   . TYR B 1 276 ? 35.878  -30.150 36.602  1.00 65.78  ? 276 TYR B CE2   1 
ATOM   5005 C  CZ    . TYR B 1 276 ? 36.916  -29.305 36.287  1.00 65.78  ? 276 TYR B CZ    1 
ATOM   5006 O  OH    . TYR B 1 276 ? 38.129  -29.506 36.878  1.00 66.83  ? 276 TYR B OH    1 
ATOM   5007 N  N     . SER B 1 277 ? 30.034  -26.712 35.085  1.00 62.14  ? 277 SER B N     1 
ATOM   5008 C  CA    . SER B 1 277 ? 28.762  -26.364 34.471  1.00 61.56  ? 277 SER B CA    1 
ATOM   5009 C  C     . SER B 1 277 ? 28.564  -24.852 34.562  1.00 61.35  ? 277 SER B C     1 
ATOM   5010 O  O     . SER B 1 277 ? 27.733  -24.372 35.336  1.00 61.73  ? 277 SER B O     1 
ATOM   5011 C  CB    . SER B 1 277 ? 27.619  -27.134 35.137  1.00 62.09  ? 277 SER B CB    1 
ATOM   5012 O  OG    . SER B 1 277 ? 28.073  -28.386 35.598  1.00 62.75  ? 277 SER B OG    1 
ATOM   5013 N  N     . PRO B 1 278 ? 29.352  -24.085 33.785  1.00 60.90  ? 278 PRO B N     1 
ATOM   5014 C  CA    . PRO B 1 278 ? 29.063  -22.663 33.647  1.00 60.74  ? 278 PRO B CA    1 
ATOM   5015 C  C     . PRO B 1 278 ? 27.877  -22.457 32.737  1.00 60.11  ? 278 PRO B C     1 
ATOM   5016 O  O     . PRO B 1 278 ? 27.289  -21.385 32.752  1.00 60.14  ? 278 PRO B O     1 
ATOM   5017 C  CB    . PRO B 1 278 ? 30.326  -22.109 33.012  1.00 60.59  ? 278 PRO B CB    1 
ATOM   5018 C  CG    . PRO B 1 278 ? 30.871  -23.251 32.235  1.00 60.26  ? 278 PRO B CG    1 
ATOM   5019 C  CD    . PRO B 1 278 ? 30.552  -24.477 33.028  1.00 60.69  ? 278 PRO B CD    1 
ATOM   5020 N  N     . ASP B 1 279 ? 27.554  -23.472 31.931  1.00 59.65  ? 279 ASP B N     1 
ATOM   5021 C  CA    . ASP B 1 279 ? 26.354  -23.469 31.103  1.00 59.18  ? 279 ASP B CA    1 
ATOM   5022 C  C     . ASP B 1 279 ? 25.066  -23.583 31.905  1.00 59.71  ? 279 ASP B C     1 
ATOM   5023 O  O     . ASP B 1 279 ? 24.005  -23.279 31.379  1.00 59.51  ? 279 ASP B O     1 
ATOM   5024 C  CB    . ASP B 1 279 ? 26.417  -24.576 30.041  1.00 58.69  ? 279 ASP B CB    1 
ATOM   5025 C  CG    . ASP B 1 279 ? 26.354  -25.980 30.627  1.00 59.22  ? 279 ASP B CG    1 
ATOM   5026 O  OD1   . ASP B 1 279 ? 26.768  -26.198 31.783  1.00 59.90  ? 279 ASP B OD1   1 
ATOM   5027 O  OD2   . ASP B 1 279 ? 25.902  -26.885 29.892  1.00 59.04  ? 279 ASP B OD2   1 
ATOM   5028 N  N     . LEU B 1 280 ? 25.157  -24.043 33.156  1.00 60.46  ? 280 LEU B N     1 
ATOM   5029 C  CA    . LEU B 1 280 ? 24.032  -24.026 34.102  1.00 61.18  ? 280 LEU B CA    1 
ATOM   5030 C  C     . LEU B 1 280 ? 24.212  -23.004 35.235  1.00 61.80  ? 280 LEU B C     1 
ATOM   5031 O  O     . LEU B 1 280 ? 23.614  -23.145 36.300  1.00 62.60  ? 280 LEU B O     1 
ATOM   5032 C  CB    . LEU B 1 280 ? 23.829  -25.427 34.693  1.00 61.78  ? 280 LEU B CB    1 
ATOM   5033 C  CG    . LEU B 1 280 ? 23.677  -26.591 33.706  1.00 61.43  ? 280 LEU B CG    1 
ATOM   5034 C  CD1   . LEU B 1 280 ? 23.528  -27.896 34.464  1.00 62.30  ? 280 LEU B CD1   1 
ATOM   5035 C  CD2   . LEU B 1 280 ? 22.490  -26.392 32.784  1.00 61.08  ? 280 LEU B CD2   1 
ATOM   5036 N  N     . ALA B 1 281 ? 25.000  -21.965 34.986  1.00 61.54  ? 281 ALA B N     1 
ATOM   5037 C  CA    . ALA B 1 281 ? 25.249  -20.914 35.953  1.00 62.19  ? 281 ALA B CA    1 
ATOM   5038 C  C     . ALA B 1 281 ? 24.761  -19.591 35.368  1.00 62.03  ? 281 ALA B C     1 
ATOM   5039 O  O     . ALA B 1 281 ? 25.457  -18.986 34.559  1.00 61.57  ? 281 ALA B O     1 
ATOM   5040 C  CB    . ALA B 1 281 ? 26.729  -20.839 36.264  1.00 62.31  ? 281 ALA B CB    1 
ATOM   5041 N  N     . PRO B 1 282 ? 23.562  -19.133 35.772  1.00 62.54  ? 282 PRO B N     1 
ATOM   5042 C  CA    . PRO B 1 282 ? 22.969  -17.896 35.266  1.00 62.59  ? 282 PRO B CA    1 
ATOM   5043 C  C     . PRO B 1 282 ? 23.932  -16.740 35.155  1.00 62.69  ? 282 PRO B C     1 
ATOM   5044 O  O     . PRO B 1 282 ? 23.912  -16.032 34.159  1.00 62.31  ? 282 PRO B O     1 
ATOM   5045 C  CB    . PRO B 1 282 ? 21.885  -17.586 36.297  1.00 63.60  ? 282 PRO B CB    1 
ATOM   5046 C  CG    . PRO B 1 282 ? 21.425  -18.931 36.736  1.00 63.73  ? 282 PRO B CG    1 
ATOM   5047 C  CD    . PRO B 1 282 ? 22.664  -19.792 36.742  1.00 63.26  ? 282 PRO B CD    1 
ATOM   5048 N  N     . SER B 1 283 ? 24.766  -16.557 36.170  1.00 63.30  ? 283 SER B N     1 
ATOM   5049 C  CA    . SER B 1 283 ? 25.765  -15.508 36.152  1.00 63.60  ? 283 SER B CA    1 
ATOM   5050 C  C     . SER B 1 283 ? 26.649  -15.649 34.921  1.00 62.75  ? 283 SER B C     1 
ATOM   5051 O  O     . SER B 1 283 ? 26.896  -14.683 34.218  1.00 62.74  ? 283 SER B O     1 
ATOM   5052 C  CB    . SER B 1 283 ? 26.595  -15.559 37.429  1.00 64.38  ? 283 SER B CB    1 
ATOM   5053 O  OG    . SER B 1 283 ? 25.774  -15.790 38.563  1.00 65.08  ? 283 SER B OG    1 
ATOM   5054 N  N     . ASP B 1 284 ? 27.095  -16.871 34.651  1.00 62.16  ? 284 ASP B N     1 
ATOM   5055 C  CA    . ASP B 1 284 ? 27.937  -17.135 33.497  1.00 61.44  ? 284 ASP B CA    1 
ATOM   5056 C  C     . ASP B 1 284 ? 27.152  -16.979 32.212  1.00 60.70  ? 284 ASP B C     1 
ATOM   5057 O  O     . ASP B 1 284 ? 27.344  -15.996 31.519  1.00 60.67  ? 284 ASP B O     1 
ATOM   5058 C  CB    . ASP B 1 284 ? 28.617  -18.515 33.574  1.00 61.16  ? 284 ASP B CB    1 
ATOM   5059 C  CG    . ASP B 1 284 ? 29.782  -18.557 34.568  1.00 61.89  ? 284 ASP B CG    1 
ATOM   5060 O  OD1   . ASP B 1 284 ? 30.485  -17.546 34.779  1.00 62.43  ? 284 ASP B OD1   1 
ATOM   5061 O  OD2   . ASP B 1 284 ? 29.998  -19.633 35.146  1.00 62.04  ? 284 ASP B OD2   1 
ATOM   5062 N  N     . TYR B 1 285 ? 26.264  -17.922 31.898  1.00 60.22  ? 285 TYR B N     1 
ATOM   5063 C  CA    . TYR B 1 285 ? 25.658  -17.971 30.552  1.00 59.48  ? 285 TYR B CA    1 
ATOM   5064 C  C     . TYR B 1 285 ? 24.848  -16.736 30.159  1.00 59.66  ? 285 TYR B C     1 
ATOM   5065 O  O     . TYR B 1 285 ? 24.847  -16.368 28.995  1.00 59.17  ? 285 TYR B O     1 
ATOM   5066 C  CB    . TYR B 1 285 ? 24.832  -19.243 30.326  1.00 59.11  ? 285 TYR B CB    1 
ATOM   5067 C  CG    . TYR B 1 285 ? 23.562  -19.379 31.148  1.00 59.68  ? 285 TYR B CG    1 
ATOM   5068 C  CD1   . TYR B 1 285 ? 22.428  -18.627 30.866  1.00 59.87  ? 285 TYR B CD1   1 
ATOM   5069 C  CD2   . TYR B 1 285 ? 23.480  -20.302 32.186  1.00 60.16  ? 285 TYR B CD2   1 
ATOM   5070 C  CE1   . TYR B 1 285 ? 21.264  -18.768 31.610  1.00 60.55  ? 285 TYR B CE1   1 
ATOM   5071 C  CE2   . TYR B 1 285 ? 22.319  -20.456 32.931  1.00 60.82  ? 285 TYR B CE2   1 
ATOM   5072 C  CZ    . TYR B 1 285 ? 21.212  -19.689 32.637  1.00 61.03  ? 285 TYR B CZ    1 
ATOM   5073 O  OH    . TYR B 1 285 ? 20.059  -19.838 33.371  1.00 61.83  ? 285 TYR B OH    1 
ATOM   5074 N  N     . HIS B 1 286 ? 24.172  -16.106 31.121  1.00 60.46  ? 286 HIS B N     1 
ATOM   5075 C  CA    . HIS B 1 286 ? 23.306  -14.950 30.843  1.00 60.87  ? 286 HIS B CA    1 
ATOM   5076 C  C     . HIS B 1 286 ? 23.962  -13.607 31.187  1.00 61.60  ? 286 HIS B C     1 
ATOM   5077 O  O     . HIS B 1 286 ? 24.236  -12.819 30.283  1.00 61.49  ? 286 HIS B O     1 
ATOM   5078 C  CB    . HIS B 1 286 ? 21.964  -15.112 31.573  1.00 61.46  ? 286 HIS B CB    1 
ATOM   5079 C  CG    . HIS B 1 286 ? 21.021  -13.948 31.429  1.00 62.11  ? 286 HIS B CG    1 
ATOM   5080 N  ND1   . HIS B 1 286 ? 20.091  -13.842 30.414  1.00 61.84  ? 286 HIS B ND1   1 
ATOM   5081 C  CD2   . HIS B 1 286 ? 20.834  -12.863 32.218  1.00 63.17  ? 286 HIS B CD2   1 
ATOM   5082 C  CE1   . HIS B 1 286 ? 19.393  -12.731 30.574  1.00 62.72  ? 286 HIS B CE1   1 
ATOM   5083 N  NE2   . HIS B 1 286 ? 19.823  -12.120 31.662  1.00 63.55  ? 286 HIS B NE2   1 
ATOM   5084 N  N     . LEU B 1 287 ? 24.206  -13.348 32.470  1.00 62.44  ? 287 LEU B N     1 
ATOM   5085 C  CA    . LEU B 1 287 ? 24.619  -12.012 32.929  1.00 63.42  ? 287 LEU B CA    1 
ATOM   5086 C  C     . LEU B 1 287 ? 25.950  -11.557 32.360  1.00 63.33  ? 287 LEU B C     1 
ATOM   5087 O  O     . LEU B 1 287 ? 26.044  -10.466 31.795  1.00 63.73  ? 287 LEU B O     1 
ATOM   5088 C  CB    . LEU B 1 287 ? 24.683  -11.961 34.456  1.00 64.37  ? 287 LEU B CB    1 
ATOM   5089 C  CG    . LEU B 1 287 ? 25.214  -10.698 35.146  1.00 65.56  ? 287 LEU B CG    1 
ATOM   5090 C  CD1   . LEU B 1 287 ? 24.513  -9.434  34.677  1.00 66.21  ? 287 LEU B CD1   1 
ATOM   5091 C  CD2   . LEU B 1 287 ? 25.057  -10.838 36.647  1.00 66.43  ? 287 LEU B CD2   1 
ATOM   5092 N  N     . PHE B 1 288 ? 26.977  -12.384 32.533  1.00 62.96  ? 288 PHE B N     1 
ATOM   5093 C  CA    . PHE B 1 288 ? 28.318  -12.069 32.024  1.00 63.00  ? 288 PHE B CA    1 
ATOM   5094 C  C     . PHE B 1 288 ? 28.378  -12.053 30.491  1.00 62.19  ? 288 PHE B C     1 
ATOM   5095 O  O     . PHE B 1 288 ? 29.091  -11.234 29.910  1.00 62.54  ? 288 PHE B O     1 
ATOM   5096 C  CB    . PHE B 1 288 ? 29.371  -13.070 32.531  1.00 62.86  ? 288 PHE B CB    1 
ATOM   5097 C  CG    . PHE B 1 288 ? 29.599  -13.086 34.033  1.00 63.74  ? 288 PHE B CG    1 
ATOM   5098 C  CD1   . PHE B 1 288 ? 29.380  -11.973 34.840  1.00 64.83  ? 288 PHE B CD1   1 
ATOM   5099 C  CD2   . PHE B 1 288 ? 30.110  -14.236 34.626  1.00 63.58  ? 288 PHE B CD2   1 
ATOM   5100 C  CE1   . PHE B 1 288 ? 29.624  -12.022 36.202  1.00 65.66  ? 288 PHE B CE1   1 
ATOM   5101 C  CE2   . PHE B 1 288 ? 30.359  -14.292 35.979  1.00 64.41  ? 288 PHE B CE2   1 
ATOM   5102 C  CZ    . PHE B 1 288 ? 30.113  -13.182 36.771  1.00 65.43  ? 288 PHE B CZ    1 
ATOM   5103 N  N     . ALA B 1 289 ? 27.639  -12.960 29.852  1.00 61.24  ? 289 ALA B N     1 
ATOM   5104 C  CA    . ALA B 1 289 ? 27.594  -13.056 28.396  1.00 60.45  ? 289 ALA B CA    1 
ATOM   5105 C  C     . ALA B 1 289 ? 27.151  -11.754 27.762  1.00 60.86  ? 289 ALA B C     1 
ATOM   5106 O  O     . ALA B 1 289 ? 27.802  -11.256 26.850  1.00 60.83  ? 289 ALA B O     1 
ATOM   5107 C  CB    . ALA B 1 289 ? 26.674  -14.182 27.977  1.00 59.58  ? 289 ALA B CB    1 
ATOM   5108 N  N     . SER B 1 290 ? 26.051  -11.202 28.262  1.00 61.38  ? 290 SER B N     1 
ATOM   5109 C  CA    . SER B 1 290 ? 25.579  -9.874  27.852  1.00 62.07  ? 290 SER B CA    1 
ATOM   5110 C  C     . SER B 1 290 ? 26.677  -8.823  27.989  1.00 63.00  ? 290 SER B C     1 
ATOM   5111 O  O     . SER B 1 290 ? 26.883  -7.991  27.096  1.00 63.27  ? 290 SER B O     1 
ATOM   5112 C  CB    . SER B 1 290 ? 24.380  -9.445  28.700  1.00 62.83  ? 290 SER B CB    1 
ATOM   5113 O  OG    . SER B 1 290 ? 23.940  -8.138  28.361  1.00 63.70  ? 290 SER B OG    1 
ATOM   5114 N  N     . MET B 1 291 ? 27.375  -8.882  29.122  1.00 63.58  ? 291 MET B N     1 
ATOM   5115 C  CA    . MET B 1 291 ? 28.471  -7.962  29.417  1.00 64.64  ? 291 MET B CA    1 
ATOM   5116 C  C     . MET B 1 291 ? 29.596  -8.080  28.380  1.00 64.28  ? 291 MET B C     1 
ATOM   5117 O  O     . MET B 1 291 ? 30.127  -7.066  27.936  1.00 65.10  ? 291 MET B O     1 
ATOM   5118 C  CB    . MET B 1 291 ? 29.010  -8.190  30.835  1.00 65.28  ? 291 MET B CB    1 
ATOM   5119 C  CG    . MET B 1 291 ? 29.424  -6.911  31.556  1.00 66.86  ? 291 MET B CG    1 
ATOM   5120 S  SD    . MET B 1 291 ? 30.368  -7.156  33.087  1.00 67.69  ? 291 MET B SD    1 
ATOM   5121 C  CE    . MET B 1 291 ? 29.465  -8.485  33.868  1.00 66.78  ? 291 MET B CE    1 
ATOM   5122 N  N     . GLY B 1 292 ? 29.926  -9.309  27.983  1.00 63.18  ? 292 GLY B N     1 
ATOM   5123 C  CA    . GLY B 1 292 ? 30.935  -9.568  26.952  1.00 62.81  ? 292 GLY B CA    1 
ATOM   5124 C  C     . GLY B 1 292 ? 30.830  -8.703  25.712  1.00 62.92  ? 292 GLY B C     1 
ATOM   5125 O  O     . GLY B 1 292 ? 31.845  -8.225  25.205  1.00 63.48  ? 292 GLY B O     1 
ATOM   5126 N  N     . HIS B 1 293 ? 29.601  -8.495  25.238  1.00 62.53  ? 293 HIS B N     1 
ATOM   5127 C  CA    . HIS B 1 293 ? 29.341  -7.648  24.064  1.00 62.70  ? 293 HIS B CA    1 
ATOM   5128 C  C     . HIS B 1 293 ? 29.537  -6.181  24.389  1.00 64.23  ? 293 HIS B C     1 
ATOM   5129 O  O     . HIS B 1 293 ? 30.216  -5.470  23.656  1.00 64.84  ? 293 HIS B O     1 
ATOM   5130 C  CB    . HIS B 1 293 ? 27.917  -7.821  23.537  1.00 62.02  ? 293 HIS B CB    1 
ATOM   5131 C  CG    . HIS B 1 293 ? 27.581  -9.218  23.131  1.00 60.67  ? 293 HIS B CG    1 
ATOM   5132 N  ND1   . HIS B 1 293 ? 27.894  -9.728  21.891  1.00 59.86  ? 293 HIS B ND1   1 
ATOM   5133 C  CD2   . HIS B 1 293 ? 26.940  -10.209 23.797  1.00 60.10  ? 293 HIS B CD2   1 
ATOM   5134 C  CE1   . HIS B 1 293 ? 27.463  -10.975 21.811  1.00 58.87  ? 293 HIS B CE1   1 
ATOM   5135 N  NE2   . HIS B 1 293 ? 26.874  -11.290 22.952  1.00 59.02  ? 293 HIS B NE2   1 
ATOM   5136 N  N     . ALA B 1 294 ? 28.935  -5.730  25.486  1.00 64.96  ? 294 ALA B N     1 
ATOM   5137 C  CA    . ALA B 1 294 ? 29.065  -4.338  25.911  1.00 66.59  ? 294 ALA B CA    1 
ATOM   5138 C  C     . ALA B 1 294 ? 30.514  -3.971  26.261  1.00 67.55  ? 294 ALA B C     1 
ATOM   5139 O  O     . ALA B 1 294 ? 30.881  -2.792  26.214  1.00 68.98  ? 294 ALA B O     1 
ATOM   5140 C  CB    . ALA B 1 294 ? 28.142  -4.045  27.084  1.00 67.22  ? 294 ALA B CB    1 
ATOM   5141 N  N     . LEU B 1 295 ? 31.328  -4.973  26.607  1.00 66.92  ? 295 LEU B N     1 
ATOM   5142 C  CA    . LEU B 1 295 ? 32.758  -4.780  26.902  1.00 67.83  ? 295 LEU B CA    1 
ATOM   5143 C  C     . LEU B 1 295 ? 33.658  -4.700  25.683  1.00 67.83  ? 295 LEU B C     1 
ATOM   5144 O  O     . LEU B 1 295 ? 34.768  -4.211  25.789  1.00 68.99  ? 295 LEU B O     1 
ATOM   5145 C  CB    . LEU B 1 295 ? 33.283  -5.908  27.790  1.00 67.30  ? 295 LEU B CB    1 
ATOM   5146 C  CG    . LEU B 1 295 ? 32.819  -5.939  29.243  1.00 67.72  ? 295 LEU B CG    1 
ATOM   5147 C  CD1   . LEU B 1 295 ? 33.318  -7.223  29.890  1.00 67.03  ? 295 LEU B CD1   1 
ATOM   5148 C  CD2   . LEU B 1 295 ? 33.296  -4.714  30.011  1.00 69.54  ? 295 LEU B CD2   1 
ATOM   5149 N  N     . ALA B 1 296 ? 33.209  -5.194  24.534  1.00 66.65  ? 296 ALA B N     1 
ATOM   5150 C  CA    . ALA B 1 296 ? 34.022  -5.097  23.329  1.00 66.72  ? 296 ALA B CA    1 
ATOM   5151 C  C     . ALA B 1 296 ? 34.422  -3.644  23.068  1.00 68.41  ? 296 ALA B C     1 
ATOM   5152 O  O     . ALA B 1 296 ? 33.680  -2.703  23.386  1.00 69.21  ? 296 ALA B O     1 
ATOM   5153 C  CB    . ALA B 1 296 ? 33.302  -5.681  22.123  1.00 65.33  ? 296 ALA B CB    1 
ATOM   5154 N  N     . GLU B 1 297 ? 35.628  -3.497  22.529  1.00 69.12  ? 297 GLU B N     1 
ATOM   5155 C  CA    . GLU B 1 297 ? 36.274  -2.207  22.258  1.00 70.97  ? 297 GLU B CA    1 
ATOM   5156 C  C     . GLU B 1 297 ? 36.005  -1.133  23.311  1.00 72.47  ? 297 GLU B C     1 
ATOM   5157 O  O     . GLU B 1 297 ? 35.717  0.018   22.984  1.00 73.68  ? 297 GLU B O     1 
ATOM   5158 C  CB    . GLU B 1 297 ? 35.899  -1.706  20.856  1.00 70.90  ? 297 GLU B CB    1 
ATOM   5159 C  CG    . GLU B 1 297 ? 36.133  -2.710  19.727  1.00 69.52  ? 297 GLU B CG    1 
ATOM   5160 C  CD    . GLU B 1 297 ? 37.610  -2.910  19.377  1.00 70.25  ? 297 GLU B CD    1 
ATOM   5161 O  OE1   . GLU B 1 297 ? 38.506  -2.687  20.231  1.00 71.44  ? 297 GLU B OE1   1 
ATOM   5162 O  OE2   . GLU B 1 297 ? 37.878  -3.306  18.216  1.00 69.70  ? 297 GLU B OE2   1 
ATOM   5163 N  N     . GLN B 1 298 ? 36.110  -1.529  24.576  1.00 72.48  ? 298 GLN B N     1 
ATOM   5164 C  CA    . GLN B 1 298 ? 35.964  -0.608  25.696  1.00 73.98  ? 298 GLN B CA    1 
ATOM   5165 C  C     . GLN B 1 298 ? 37.309  -0.375  26.347  1.00 75.45  ? 298 GLN B C     1 
ATOM   5166 O  O     . GLN B 1 298 ? 38.131  -1.290  26.463  1.00 74.91  ? 298 GLN B O     1 
ATOM   5167 C  CB    . GLN B 1 298 ? 35.005  -1.156  26.745  1.00 73.10  ? 298 GLN B CB    1 
ATOM   5168 C  CG    . GLN B 1 298 ? 33.567  -0.781  26.473  1.00 72.69  ? 298 GLN B CG    1 
ATOM   5169 C  CD    . GLN B 1 298 ? 33.284  0.687   26.738  1.00 74.60  ? 298 GLN B CD    1 
ATOM   5170 O  OE1   . GLN B 1 298 ? 32.608  1.306   25.940  1.00 74.80  ? 298 GLN B OE1   1 
ATOM   5171 N  NE2   . GLN B 1 298 ? 33.825  1.261   27.834  1.00 76.13  ? 298 GLN B NE2   1 
ATOM   5172 N  N     . ARG B 1 299 ? 37.529  0.860   26.766  1.00 77.44  ? 299 ARG B N     1 
ATOM   5173 C  CA    . ARG B 1 299 ? 38.753  1.222   27.444  1.00 79.15  ? 299 ARG B CA    1 
ATOM   5174 C  C     . ARG B 1 299 ? 38.420  1.977   28.707  1.00 80.48  ? 299 ARG B C     1 
ATOM   5175 O  O     . ARG B 1 299 ? 37.421  2.700   28.776  1.00 80.84  ? 299 ARG B O     1 
ATOM   5176 C  CB    . ARG B 1 299 ? 39.676  2.031   26.539  1.00 80.72  ? 299 ARG B CB    1 
ATOM   5177 C  CG    . ARG B 1 299 ? 39.054  3.262   25.879  1.00 81.81  ? 299 ARG B CG    1 
ATOM   5178 C  CD    . ARG B 1 299 ? 40.054  4.029   25.018  1.00 83.56  ? 299 ARG B CD    1 
ATOM   5179 N  NE    . ARG B 1 299 ? 40.835  3.146   24.132  1.00 82.60  ? 299 ARG B NE    1 
ATOM   5180 C  CZ    . ARG B 1 299 ? 42.043  2.620   24.397  1.00 83.05  ? 299 ARG B CZ    1 
ATOM   5181 N  NH1   . ARG B 1 299 ? 42.691  2.860   25.547  1.00 84.44  ? 299 ARG B NH1   1 
ATOM   5182 N  NH2   . ARG B 1 299 ? 42.620  1.826   23.492  1.00 82.16  ? 299 ARG B NH2   1 
ATOM   5183 N  N     . PHE B 1 300 ? 39.270  1.785   29.704  1.00 81.30  ? 300 PHE B N     1 
ATOM   5184 C  CA    . PHE B 1 300 ? 39.065  2.354   31.010  1.00 82.55  ? 300 PHE B CA    1 
ATOM   5185 C  C     . PHE B 1 300 ? 40.346  3.041   31.441  1.00 84.83  ? 300 PHE B C     1 
ATOM   5186 O  O     . PHE B 1 300 ? 41.440  2.567   31.147  1.00 84.95  ? 300 PHE B O     1 
ATOM   5187 C  CB    . PHE B 1 300 ? 38.679  1.256   31.994  1.00 81.11  ? 300 PHE B CB    1 
ATOM   5188 C  CG    . PHE B 1 300 ? 37.361  0.593   31.676  1.00 79.08  ? 300 PHE B CG    1 
ATOM   5189 C  CD1   . PHE B 1 300 ? 36.163  1.244   31.936  1.00 79.33  ? 300 PHE B CD1   1 
ATOM   5190 C  CD2   . PHE B 1 300 ? 37.317  -0.684  31.119  1.00 77.08  ? 300 PHE B CD2   1 
ATOM   5191 C  CE1   . PHE B 1 300 ? 34.951  0.631   31.652  1.00 77.63  ? 300 PHE B CE1   1 
ATOM   5192 C  CE2   . PHE B 1 300 ? 36.106  -1.300  30.834  1.00 75.38  ? 300 PHE B CE2   1 
ATOM   5193 C  CZ    . PHE B 1 300 ? 34.923  -0.641  31.101  1.00 75.66  ? 300 PHE B CZ    1 
ATOM   5194 N  N     . ASP B 1 301 ? 40.191  4.181   32.107  1.00 86.78  ? 301 ASP B N     1 
ATOM   5195 C  CA    . ASP B 1 301 ? 41.313  4.872   32.740  1.00 89.18  ? 301 ASP B CA    1 
ATOM   5196 C  C     . ASP B 1 301 ? 41.653  4.233   34.076  1.00 89.10  ? 301 ASP B C     1 
ATOM   5197 O  O     . ASP B 1 301 ? 42.776  3.800   34.286  1.00 89.58  ? 301 ASP B O     1 
ATOM   5198 C  CB    . ASP B 1 301 ? 40.998  6.357   32.949  1.00 91.48  ? 301 ASP B CB    1 
ATOM   5199 C  CG    . ASP B 1 301 ? 41.245  7.187   31.701  1.00 92.58  ? 301 ASP B CG    1 
ATOM   5200 O  OD1   . ASP B 1 301 ? 40.876  6.743   30.590  1.00 90.97  ? 301 ASP B OD1   1 
ATOM   5201 O  OD2   . ASP B 1 301 ? 41.818  8.286   31.837  1.00 95.16  ? 301 ASP B OD2   1 
ATOM   5202 N  N     . SER B 1 302 ? 40.662  4.157   34.955  1.00 88.54  ? 302 SER B N     1 
ATOM   5203 C  CA    . SER B 1 302 ? 40.868  3.841   36.368  1.00 88.96  ? 302 SER B CA    1 
ATOM   5204 C  C     . SER B 1 302 ? 39.822  2.822   36.830  1.00 86.78  ? 302 SER B C     1 
ATOM   5205 O  O     . SER B 1 302 ? 39.026  2.337   36.027  1.00 84.99  ? 302 SER B O     1 
ATOM   5206 C  CB    . SER B 1 302 ? 40.882  5.128   37.195  1.00 91.49  ? 302 SER B CB    1 
ATOM   5207 O  OG    . SER B 1 302 ? 42.205  5.640   37.341  1.00 93.61  ? 302 SER B OG    1 
ATOM   5208 N  N     . TYR B 1 303 ? 39.844  2.479   38.112  1.00 87.00  ? 303 TYR B N     1 
ATOM   5209 C  CA    . TYR B 1 303 ? 38.916  1.499   38.684  1.00 85.20  ? 303 TYR B CA    1 
ATOM   5210 C  C     . TYR B 1 303 ? 37.514  2.081   38.867  1.00 85.18  ? 303 TYR B C     1 
ATOM   5211 O  O     . TYR B 1 303 ? 36.526  1.355   38.747  1.00 83.45  ? 303 TYR B O     1 
ATOM   5212 C  CB    . TYR B 1 303 ? 39.445  0.970   40.020  1.00 85.65  ? 303 TYR B CB    1 
ATOM   5213 C  CG    . TYR B 1 303 ? 40.709  0.124   39.886  1.00 85.39  ? 303 TYR B CG    1 
ATOM   5214 C  CD1   . TYR B 1 303 ? 41.990  0.711   39.861  1.00 87.27  ? 303 TYR B CD1   1 
ATOM   5215 C  CD2   . TYR B 1 303 ? 40.628  -1.273  39.783  1.00 83.42  ? 303 TYR B CD2   1 
ATOM   5216 C  CE1   . TYR B 1 303 ? 43.145  -0.072  39.739  1.00 87.18  ? 303 TYR B CE1   1 
ATOM   5217 C  CE2   . TYR B 1 303 ? 41.777  -2.063  39.663  1.00 83.31  ? 303 TYR B CE2   1 
ATOM   5218 C  CZ    . TYR B 1 303 ? 43.031  -1.464  39.642  1.00 85.18  ? 303 TYR B CZ    1 
ATOM   5219 O  OH    . TYR B 1 303 ? 44.154  -2.254  39.535  1.00 85.20  ? 303 TYR B OH    1 
ATOM   5220 N  N     . GLU B 1 304 ? 37.430  3.385   39.148  1.00 87.24  ? 304 GLU B N     1 
ATOM   5221 C  CA    . GLU B 1 304 ? 36.135  4.098   39.203  1.00 87.57  ? 304 GLU B CA    1 
ATOM   5222 C  C     . GLU B 1 304 ? 35.532  4.286   37.824  1.00 86.68  ? 304 GLU B C     1 
ATOM   5223 O  O     . GLU B 1 304 ? 34.338  4.535   37.704  1.00 86.37  ? 304 GLU B O     1 
ATOM   5224 C  CB    . GLU B 1 304 ? 36.245  5.479   39.850  1.00 90.26  ? 304 GLU B CB    1 
ATOM   5225 C  CG    . GLU B 1 304 ? 36.501  5.482   41.349  1.00 91.37  ? 304 GLU B CG    1 
ATOM   5226 C  CD    . GLU B 1 304 ? 37.920  5.071   41.676  1.00 91.82  ? 304 GLU B CD    1 
ATOM   5227 O  OE1   . GLU B 1 304 ? 38.859  5.707   41.139  1.00 93.18  ? 304 GLU B OE1   1 
ATOM   5228 O  OE2   . GLU B 1 304 ? 38.095  4.091   42.432  1.00 90.86  ? 304 GLU B OE2   1 
ATOM   5229 N  N     . SER B 1 305 ? 36.360  4.198   36.788  1.00 86.43  ? 305 SER B N     1 
ATOM   5230 C  CA    . SER B 1 305 ? 35.874  4.217   35.417  1.00 85.39  ? 305 SER B CA    1 
ATOM   5231 C  C     . SER B 1 305 ? 35.082  2.941   35.154  1.00 82.84  ? 305 SER B C     1 
ATOM   5232 O  O     . SER B 1 305 ? 34.078  2.970   34.431  1.00 81.95  ? 305 SER B O     1 
ATOM   5233 C  CB    . SER B 1 305 ? 37.055  4.310   34.437  1.00 85.76  ? 305 SER B CB    1 
ATOM   5234 O  OG    . SER B 1 305 ? 38.036  5.222   34.885  1.00 88.15  ? 305 SER B OG    1 
ATOM   5235 N  N     . VAL B 1 306 ? 35.542  1.834   35.746  1.00 81.80  ? 306 VAL B N     1 
ATOM   5236 C  CA    . VAL B 1 306 ? 34.875  0.539   35.615  1.00 79.56  ? 306 VAL B CA    1 
ATOM   5237 C  C     . VAL B 1 306 ? 33.592  0.542   36.418  1.00 79.40  ? 306 VAL B C     1 
ATOM   5238 O  O     . VAL B 1 306 ? 32.529  0.211   35.890  1.00 78.19  ? 306 VAL B O     1 
ATOM   5239 C  CB    . VAL B 1 306 ? 35.771  -0.638  36.066  1.00 78.74  ? 306 VAL B CB    1 
ATOM   5240 C  CG1   . VAL B 1 306 ? 35.023  -1.963  35.993  1.00 76.63  ? 306 VAL B CG1   1 
ATOM   5241 C  CG2   . VAL B 1 306 ? 37.019  -0.713  35.196  1.00 78.91  ? 306 VAL B CG2   1 
ATOM   5242 N  N     . LYS B 1 307 ? 33.694  0.917   37.686  1.00 80.71  ? 307 LYS B N     1 
ATOM   5243 C  CA    . LYS B 1 307 ? 32.527  0.944   38.556  1.00 80.80  ? 307 LYS B CA    1 
ATOM   5244 C  C     . LYS B 1 307 ? 31.434  1.849   37.996  1.00 81.32  ? 307 LYS B C     1 
ATOM   5245 O  O     . LYS B 1 307 ? 30.269  1.455   37.942  1.00 80.38  ? 307 LYS B O     1 
ATOM   5246 C  CB    . LYS B 1 307 ? 32.920  1.405   39.960  1.00 20.00  ? 307 LYS B CB    1 
ATOM   5247 C  CG    . LYS B 1 307 ? 33.820  0.432   40.706  1.00 20.00  ? 307 LYS B CG    1 
ATOM   5248 C  CD    . LYS B 1 307 ? 34.190  0.962   42.080  1.00 20.00  ? 307 LYS B CD    1 
ATOM   5249 C  CE    . LYS B 1 307 ? 35.070  -0.021  42.834  1.00 20.00  ? 307 LYS B CE    1 
ATOM   5250 N  NZ    . LYS B 1 307 ? 35.460  0.497   44.174  1.00 20.00  ? 307 LYS B NZ    1 
ATOM   5251 N  N     . LYS B 1 308 ? 31.821  3.056   37.591  1.00 82.95  ? 308 LYS B N     1 
ATOM   5252 C  CA    . LYS B 1 308 ? 30.894  4.013   36.995  1.00 83.72  ? 308 LYS B CA    1 
ATOM   5253 C  C     . LYS B 1 308 ? 30.153  3.403   35.796  1.00 81.84  ? 308 LYS B C     1 
ATOM   5254 O  O     . LYS B 1 308 ? 28.939  3.564   35.669  1.00 81.71  ? 308 LYS B O     1 
ATOM   5255 C  CB    . LYS B 1 308 ? 31.648  5.283   36.581  1.00 85.72  ? 308 LYS B CB    1 
ATOM   5256 C  CG    . LYS B 1 308 ? 30.823  6.299   35.812  1.00 86.64  ? 308 LYS B CG    1 
ATOM   5257 C  CD    . LYS B 1 308 ? 31.626  7.544   35.487  1.00 88.86  ? 308 LYS B CD    1 
ATOM   5258 C  CE    . LYS B 1 308 ? 31.104  8.202   34.218  1.00 89.10  ? 308 LYS B CE    1 
ATOM   5259 N  NZ    . LYS B 1 308 ? 31.646  9.577   34.076  1.00 91.73  ? 308 LYS B NZ    1 
ATOM   5260 N  N     . TRP B 1 309 ? 30.892  2.716   34.924  1.00 80.54  ? 309 TRP B N     1 
ATOM   5261 C  CA    . TRP B 1 309 ? 30.321  2.047   33.745  1.00 78.73  ? 309 TRP B CA    1 
ATOM   5262 C  C     . TRP B 1 309 ? 29.362  0.923   34.138  1.00 77.13  ? 309 TRP B C     1 
ATOM   5263 O  O     . TRP B 1 309 ? 28.309  0.772   33.525  1.00 76.36  ? 309 TRP B O     1 
ATOM   5264 C  CB    . TRP B 1 309 ? 31.447  1.502   32.858  1.00 77.85  ? 309 TRP B CB    1 
ATOM   5265 C  CG    . TRP B 1 309 ? 31.017  0.878   31.530  1.00 76.14  ? 309 TRP B CG    1 
ATOM   5266 C  CD1   . TRP B 1 309 ? 31.038  1.471   30.289  1.00 76.33  ? 309 TRP B CD1   1 
ATOM   5267 C  CD2   . TRP B 1 309 ? 30.552  -0.458  31.322  1.00 74.11  ? 309 TRP B CD2   1 
ATOM   5268 N  NE1   . TRP B 1 309 ? 30.600  0.588   29.332  1.00 74.51  ? 309 TRP B NE1   1 
ATOM   5269 C  CE2   . TRP B 1 309 ? 30.298  -0.602  29.939  1.00 73.15  ? 309 TRP B CE2   1 
ATOM   5270 C  CE3   . TRP B 1 309 ? 30.317  -1.548  32.173  1.00 73.12  ? 309 TRP B CE3   1 
ATOM   5271 C  CZ2   . TRP B 1 309 ? 29.823  -1.787  29.392  1.00 71.27  ? 309 TRP B CZ2   1 
ATOM   5272 C  CZ3   . TRP B 1 309 ? 29.847  -2.727  31.628  1.00 71.31  ? 309 TRP B CZ3   1 
ATOM   5273 C  CH2   . TRP B 1 309 ? 29.605  -2.839  30.248  1.00 70.40  ? 309 TRP B CH2   1 
ATOM   5274 N  N     . LEU B 1 310 ? 29.734  0.147   35.158  1.00 76.78  ? 310 LEU B N     1 
ATOM   5275 C  CA    . LEU B 1 310 ? 28.881  -0.940  35.671  1.00 75.51  ? 310 LEU B CA    1 
ATOM   5276 C  C     . LEU B 1 310 ? 27.553  -0.416  36.217  1.00 76.29  ? 310 LEU B C     1 
ATOM   5277 O  O     . LEU B 1 310 ? 26.481  -0.902  35.824  1.00 75.34  ? 310 LEU B O     1 
ATOM   5278 C  CB    . LEU B 1 310 ? 29.595  -1.753  36.768  1.00 75.33  ? 310 LEU B CB    1 
ATOM   5279 C  CG    . LEU B 1 310 ? 30.551  -2.843  36.269  1.00 73.99  ? 310 LEU B CG    1 
ATOM   5280 C  CD1   . LEU B 1 310 ? 31.710  -3.072  37.220  1.00 74.65  ? 310 LEU B CD1   1 
ATOM   5281 C  CD2   . LEU B 1 310 ? 29.805  -4.150  36.030  1.00 72.21  ? 310 LEU B CD2   1 
ATOM   5282 N  N     . ASP B 1 311 ? 27.644  0.586   37.096  1.00 78.16  ? 311 ASP B N     1 
ATOM   5283 C  CA    . ASP B 1 311 ? 26.472  1.199   37.740  1.00 79.28  ? 311 ASP B CA    1 
ATOM   5284 C  C     . ASP B 1 311 ? 25.439  1.654   36.705  1.00 79.20  ? 311 ASP B C     1 
ATOM   5285 O  O     . ASP B 1 311 ? 24.266  1.274   36.787  1.00 78.76  ? 311 ASP B O     1 
ATOM   5286 C  CB    . ASP B 1 311 ? 26.885  2.397   38.611  1.00 81.55  ? 311 ASP B CB    1 
ATOM   5287 C  CG    . ASP B 1 311 ? 27.827  2.011   39.732  1.00 81.86  ? 311 ASP B CG    1 
ATOM   5288 O  OD1   . ASP B 1 311 ? 27.823  0.832   40.134  1.00 80.52  ? 311 ASP B OD1   1 
ATOM   5289 O  OD2   . ASP B 1 311 ? 28.591  2.879   40.197  1.00 83.53  ? 311 ASP B OD2   1 
ATOM   5290 N  N     . GLU B 1 312 ? 25.892  2.443   35.728  1.00 79.70  ? 312 GLU B N     1 
ATOM   5291 C  CA    . GLU B 1 312 ? 25.037  2.879   34.626  1.00 79.62  ? 312 GLU B CA    1 
ATOM   5292 C  C     . GLU B 1 312 ? 24.437  1.659   33.949  1.00 77.50  ? 312 GLU B C     1 
ATOM   5293 O  O     . GLU B 1 312 ? 23.222  1.593   33.788  1.00 77.38  ? 312 GLU B O     1 
ATOM   5294 C  CB    . GLU B 1 312 ? 25.812  3.715   33.591  1.00 80.27  ? 312 GLU B CB    1 
ATOM   5295 C  CG    . GLU B 1 312 ? 26.259  5.090   34.078  1.00 82.70  ? 312 GLU B CG    1 
ATOM   5296 C  CD    . GLU B 1 312 ? 27.341  5.701   33.200  1.00 83.30  ? 312 GLU B CD    1 
ATOM   5297 O  OE1   . GLU B 1 312 ? 27.315  5.459   31.974  1.00 82.23  ? 312 GLU B OE1   1 
ATOM   5298 O  OE2   . GLU B 1 312 ? 28.209  6.426   33.737  1.00 84.95  ? 312 GLU B OE2   1 
ATOM   5299 N  N     . TRP B 1 313 ? 25.292  0.690   33.604  1.00 75.99  ? 313 TRP B N     1 
ATOM   5300 C  CA    . TRP B 1 313 ? 24.918  -0.459  32.758  1.00 74.01  ? 313 TRP B CA    1 
ATOM   5301 C  C     . TRP B 1 313 ? 23.982  -1.495  33.392  1.00 73.14  ? 313 TRP B C     1 
ATOM   5302 O  O     . TRP B 1 313 ? 23.174  -2.097  32.672  1.00 72.07  ? 313 TRP B O     1 
ATOM   5303 C  CB    . TRP B 1 313 ? 26.170  -1.159  32.244  1.00 72.89  ? 313 TRP B CB    1 
ATOM   5304 C  CG    . TRP B 1 313 ? 25.905  -2.204  31.208  1.00 71.06  ? 313 TRP B CG    1 
ATOM   5305 C  CD1   . TRP B 1 313 ? 25.759  -2.014  29.859  1.00 70.55  ? 313 TRP B CD1   1 
ATOM   5306 C  CD2   . TRP B 1 313 ? 25.775  -3.609  31.432  1.00 69.60  ? 313 TRP B CD2   1 
ATOM   5307 N  NE1   . TRP B 1 313 ? 25.551  -3.219  29.233  1.00 68.85  ? 313 TRP B NE1   1 
ATOM   5308 C  CE2   . TRP B 1 313 ? 25.555  -4.214  30.174  1.00 68.27  ? 313 TRP B CE2   1 
ATOM   5309 C  CE3   . TRP B 1 313 ? 25.818  -4.416  32.575  1.00 69.39  ? 313 TRP B CE3   1 
ATOM   5310 C  CZ2   . TRP B 1 313 ? 25.381  -5.591  30.028  1.00 66.80  ? 313 TRP B CZ2   1 
ATOM   5311 C  CZ3   . TRP B 1 313 ? 25.646  -5.783  32.427  1.00 67.94  ? 313 TRP B CZ3   1 
ATOM   5312 C  CH2   . TRP B 1 313 ? 25.433  -6.358  31.162  1.00 66.69  ? 313 TRP B CH2   1 
ATOM   5313 N  N     . PHE B 1 314 ? 24.089  -1.712  34.703  1.00 73.67  ? 314 PHE B N     1 
ATOM   5314 C  CA    . PHE B 1 314 ? 23.123  -2.559  35.419  1.00 73.23  ? 314 PHE B CA    1 
ATOM   5315 C  C     . PHE B 1 314 ? 21.730  -1.925  35.440  1.00 74.19  ? 314 PHE B C     1 
ATOM   5316 O  O     . PHE B 1 314 ? 20.748  -2.538  35.006  1.00 73.43  ? 314 PHE B O     1 
ATOM   5317 C  CB    . PHE B 1 314 ? 23.573  -2.825  36.865  1.00 73.82  ? 314 PHE B CB    1 
ATOM   5318 C  CG    . PHE B 1 314 ? 24.750  -3.775  37.000  1.00 72.78  ? 314 PHE B CG    1 
ATOM   5319 C  CD1   . PHE B 1 314 ? 24.886  -4.916  36.193  1.00 71.07  ? 314 PHE B CD1   1 
ATOM   5320 C  CD2   . PHE B 1 314 ? 25.714  -3.553  37.990  1.00 73.64  ? 314 PHE B CD2   1 
ATOM   5321 C  CE1   . PHE B 1 314 ? 25.966  -5.784  36.357  1.00 70.31  ? 314 PHE B CE1   1 
ATOM   5322 C  CE2   . PHE B 1 314 ? 26.792  -4.421  38.152  1.00 72.86  ? 314 PHE B CE2   1 
ATOM   5323 C  CZ    . PHE B 1 314 ? 26.916  -5.536  37.335  1.00 71.21  ? 314 PHE B CZ    1 
ATOM   5324 N  N     . ALA B 1 315 ? 21.663  -0.695  35.945  1.00 76.00  ? 315 ALA B N     1 
ATOM   5325 C  CA    . ALA B 1 315 ? 20.408  0.063   36.025  1.00 77.28  ? 315 ALA B CA    1 
ATOM   5326 C  C     . ALA B 1 315 ? 19.749  0.272   34.661  1.00 76.84  ? 315 ALA B C     1 
ATOM   5327 O  O     . ALA B 1 315 ? 18.524  0.290   34.566  1.00 77.20  ? 315 ALA B O     1 
ATOM   5328 C  CB    . ALA B 1 315 ? 20.649  1.407   36.698  1.00 79.42  ? 315 ALA B CB    1 
ATOM   5329 N  N     . ALA B 1 316 ? 20.567  0.432   33.618  1.00 76.17  ? 316 ALA B N     1 
ATOM   5330 C  CA    . ALA B 1 316 ? 20.096  0.594   32.228  1.00 75.65  ? 316 ALA B CA    1 
ATOM   5331 C  C     . ALA B 1 316 ? 19.294  -0.595  31.708  1.00 74.07  ? 316 ALA B C     1 
ATOM   5332 O  O     . ALA B 1 316 ? 18.438  -0.419  30.842  1.00 74.05  ? 316 ALA B O     1 
ATOM   5333 C  CB    . ALA B 1 316 ? 21.269  0.868   31.290  1.00 75.21  ? 316 ALA B CB    1 
ATOM   5334 N  N     . LYS B 1 317 ? 19.583  -1.794  32.219  1.00 72.86  ? 317 LYS B N     1 
ATOM   5335 C  CA    . LYS B 1 317 ? 18.825  -2.991  31.864  1.00 71.54  ? 317 LYS B CA    1 
ATOM   5336 C  C     . LYS B 1 317 ? 17.421  -2.946  32.470  1.00 72.49  ? 317 LYS B C     1 
ATOM   5337 O  O     . LYS B 1 317 ? 17.179  -2.311  33.500  1.00 73.94  ? 317 LYS B O     1 
ATOM   5338 C  CB    . LYS B 1 317 ? 19.494  -4.273  32.386  1.00 70.30  ? 317 LYS B CB    1 
ATOM   5339 C  CG    . LYS B 1 317 ? 20.898  -4.659  31.924  1.00 69.25  ? 317 LYS B CG    1 
ATOM   5340 C  CD    . LYS B 1 317 ? 21.008  -5.222  30.521  1.00 67.87  ? 317 LYS B CD    1 
ATOM   5341 C  CE    . LYS B 1 317 ? 21.731  -4.244  29.598  1.00 68.19  ? 317 LYS B CE    1 
ATOM   5342 N  NZ    . LYS B 1 317 ? 21.560  -4.473  28.138  1.00 67.21  ? 317 LYS B NZ    1 
ATOM   5343 N  N     . ASP B 1 318 ? 16.502  -3.654  31.824  1.00 71.75  ? 318 ASP B N     1 
ATOM   5344 C  CA    . ASP B 1 318 ? 15.170  -3.905  32.384  1.00 72.51  ? 318 ASP B CA    1 
ATOM   5345 C  C     . ASP B 1 318 ? 15.282  -4.818  33.591  1.00 72.32  ? 318 ASP B C     1 
ATOM   5346 O  O     . ASP B 1 318 ? 16.360  -5.350  33.891  1.00 71.45  ? 318 ASP B O     1 
ATOM   5347 C  CB    . ASP B 1 318 ? 14.266  -4.579  31.346  1.00 71.70  ? 318 ASP B CB    1 
ATOM   5348 C  CG    . ASP B 1 318 ? 13.963  -3.684  30.168  1.00 72.05  ? 318 ASP B CG    1 
ATOM   5349 O  OD1   . ASP B 1 318 ? 14.798  -2.807  29.851  1.00 72.31  ? 318 ASP B OD1   1 
ATOM   5350 O  OD2   . ASP B 1 318 ? 12.893  -3.874  29.552  1.00 72.15  ? 318 ASP B OD2   1 
ATOM   5351 N  N     . ASP B 1 319 ? 14.158  -4.990  34.276  1.00 73.27  ? 319 ASP B N     1 
ATOM   5352 C  CA    . ASP B 1 319 ? 14.032  -6.020  35.312  1.00 73.11  ? 319 ASP B CA    1 
ATOM   5353 C  C     . ASP B 1 319 ? 13.791  -7.325  34.582  1.00 71.65  ? 319 ASP B C     1 
ATOM   5354 O  O     . ASP B 1 319 ? 14.390  -8.351  34.899  1.00 70.68  ? 319 ASP B O     1 
ATOM   5355 C  CB    . ASP B 1 319 ? 12.859  -5.745  36.265  1.00 74.81  ? 319 ASP B CB    1 
ATOM   5356 C  CG    . ASP B 1 319 ? 12.856  -4.328  36.811  1.00 76.53  ? 319 ASP B CG    1 
ATOM   5357 O  OD1   . ASP B 1 319 ? 12.708  -3.379  35.996  1.00 77.00  ? 319 ASP B OD1   1 
ATOM   5358 O  OD2   . ASP B 1 319 ? 12.983  -4.167  38.043  1.00 77.51  ? 319 ASP B OD2   1 
ATOM   5359 N  N     . GLU B 1 320 ? 12.904  -7.250  33.590  1.00 71.63  ? 320 GLU B N     1 
ATOM   5360 C  CA    . GLU B 1 320 ? 12.629  -8.347  32.664  1.00 70.35  ? 320 GLU B CA    1 
ATOM   5361 C  C     . GLU B 1 320 ? 13.882  -9.064  32.161  1.00 68.66  ? 320 GLU B C     1 
ATOM   5362 O  O     . GLU B 1 320 ? 13.816  -10.244 31.827  1.00 67.68  ? 320 GLU B O     1 
ATOM   5363 C  CB    . GLU B 1 320 ? 11.804  -7.840  31.470  1.00 70.55  ? 320 GLU B CB    1 
ATOM   5364 C  CG    . GLU B 1 320 ? 10.332  -7.594  31.797  1.00 72.10  ? 320 GLU B CG    1 
ATOM   5365 C  CD    . GLU B 1 320 ? 9.514   -7.106  30.602  1.00 72.40  ? 320 GLU B CD    1 
ATOM   5366 O  OE1   . GLU B 1 320 ? 10.092  -6.916  29.500  1.00 71.38  ? 320 GLU B OE1   1 
ATOM   5367 O  OE2   . GLU B 1 320 ? 8.278   -6.917  30.769  1.00 73.75  ? 320 GLU B OE2   1 
ATOM   5368 N  N     . PHE B 1 321 ? 15.005  -8.347  32.090  1.00 68.47  ? 321 PHE B N     1 
ATOM   5369 C  CA    . PHE B 1 321 ? 16.299  -8.933  31.734  1.00 67.12  ? 321 PHE B CA    1 
ATOM   5370 C  C     . PHE B 1 321 ? 16.734  -9.985  32.745  1.00 66.79  ? 321 PHE B C     1 
ATOM   5371 O  O     . PHE B 1 321 ? 16.988  -11.140 32.398  1.00 65.71  ? 321 PHE B O     1 
ATOM   5372 C  CB    . PHE B 1 321 ? 17.369  -7.830  31.652  1.00 67.41  ? 321 PHE B CB    1 
ATOM   5373 C  CG    . PHE B 1 321 ? 18.734  -8.335  31.281  1.00 66.25  ? 321 PHE B CG    1 
ATOM   5374 C  CD1   . PHE B 1 321 ? 19.063  -8.563  29.960  1.00 65.19  ? 321 PHE B CD1   1 
ATOM   5375 C  CD2   . PHE B 1 321 ? 19.691  -8.593  32.254  1.00 66.30  ? 321 PHE B CD2   1 
ATOM   5376 C  CE1   . PHE B 1 321 ? 20.318  -9.039  29.615  1.00 64.25  ? 321 PHE B CE1   1 
ATOM   5377 C  CE2   . PHE B 1 321 ? 20.948  -9.069  31.911  1.00 65.38  ? 321 PHE B CE2   1 
ATOM   5378 C  CZ    . PHE B 1 321 ? 21.258  -9.295  30.590  1.00 64.38  ? 321 PHE B CZ    1 
ATOM   5379 N  N     . TYR B 1 322 ? 16.823  -9.568  34.000  1.00 67.84  ? 322 TYR B N     1 
ATOM   5380 C  CA    . TYR B 1 322 ? 17.403  -10.411 35.034  1.00 67.68  ? 322 TYR B CA    1 
ATOM   5381 C  C     . TYR B 1 322 ? 16.511  -11.618 35.252  1.00 67.53  ? 322 TYR B C     1 
ATOM   5382 O  O     . TYR B 1 322 ? 16.978  -12.763 35.195  1.00 66.62  ? 322 TYR B O     1 
ATOM   5383 C  CB    . TYR B 1 322 ? 17.571  -9.638  36.336  1.00 69.01  ? 322 TYR B CB    1 
ATOM   5384 C  CG    . TYR B 1 322 ? 18.532  -8.471  36.270  1.00 69.40  ? 322 TYR B CG    1 
ATOM   5385 C  CD1   . TYR B 1 322 ? 19.908  -8.675  36.323  1.00 68.78  ? 322 TYR B CD1   1 
ATOM   5386 C  CD2   . TYR B 1 322 ? 18.066  -7.160  36.185  1.00 70.59  ? 322 TYR B CD2   1 
ATOM   5387 C  CE1   . TYR B 1 322 ? 20.792  -7.607  36.292  1.00 69.34  ? 322 TYR B CE1   1 
ATOM   5388 C  CE2   . TYR B 1 322 ? 18.940  -6.086  36.155  1.00 71.17  ? 322 TYR B CE2   1 
ATOM   5389 C  CZ    . TYR B 1 322 ? 20.301  -6.311  36.208  1.00 70.54  ? 322 TYR B CZ    1 
ATOM   5390 O  OH    . TYR B 1 322 ? 21.178  -5.250  36.192  1.00 71.28  ? 322 TYR B OH    1 
ATOM   5391 N  N     . TRP B 1 323 ? 15.224  -11.345 35.477  1.00 68.56  ? 323 TRP B N     1 
ATOM   5392 C  CA    . TRP B 1 323 ? 14.200  -12.384 35.583  1.00 68.69  ? 323 TRP B CA    1 
ATOM   5393 C  C     . TRP B 1 323 ? 14.367  -13.453 34.492  1.00 67.30  ? 323 TRP B C     1 
ATOM   5394 O  O     . TRP B 1 323 ? 14.361  -14.655 34.810  1.00 67.00  ? 323 TRP B O     1 
ATOM   5395 C  CB    . TRP B 1 323 ? 12.791  -11.768 35.507  1.00 69.94  ? 323 TRP B CB    1 
ATOM   5396 C  CG    . TRP B 1 323 ? 11.684  -12.780 35.619  1.00 70.33  ? 323 TRP B CG    1 
ATOM   5397 C  CD1   . TRP B 1 323 ? 11.071  -13.189 36.758  1.00 71.46  ? 323 TRP B CD1   1 
ATOM   5398 C  CD2   . TRP B 1 323 ? 11.074  -13.522 34.547  1.00 69.71  ? 323 TRP B CD2   1 
ATOM   5399 N  NE1   . TRP B 1 323 ? 10.112  -14.137 36.473  1.00 71.66  ? 323 TRP B NE1   1 
ATOM   5400 C  CE2   . TRP B 1 323 ? 10.097  -14.363 35.123  1.00 70.60  ? 323 TRP B CE2   1 
ATOM   5401 C  CE3   . TRP B 1 323 ? 11.267  -13.567 33.156  1.00 68.58  ? 323 TRP B CE3   1 
ATOM   5402 C  CZ2   . TRP B 1 323 ? 9.306   -15.235 34.356  1.00 70.44  ? 323 TRP B CZ2   1 
ATOM   5403 C  CZ3   . TRP B 1 323 ? 10.489  -14.438 32.397  1.00 68.34  ? 323 TRP B CZ3   1 
ATOM   5404 C  CH2   . TRP B 1 323 ? 9.515   -15.256 33.000  1.00 69.30  ? 323 TRP B CH2   1 
ATOM   5405 N  N     . ARG B 1 324 ? 14.538  -13.008 33.236  1.00 66.56  ? 324 ARG B N     1 
ATOM   5406 C  CA    . ARG B 1 324 ? 14.581  -13.923 32.076  1.00 65.36  ? 324 ARG B CA    1 
ATOM   5407 C  C     . ARG B 1 324 ? 15.670  -14.951 32.252  1.00 64.40  ? 324 ARG B C     1 
ATOM   5408 O  O     . ARG B 1 324 ? 15.434  -16.141 32.052  1.00 63.99  ? 324 ARG B O     1 
ATOM   5409 C  CB    . ARG B 1 324 ? 14.846  -13.230 30.706  1.00 64.66  ? 324 ARG B CB    1 
ATOM   5410 C  CG    . ARG B 1 324 ? 13.622  -12.977 29.821  1.00 65.01  ? 324 ARG B CG    1 
ATOM   5411 C  CD    . ARG B 1 324 ? 13.990  -12.828 28.345  1.00 63.98  ? 324 ARG B CD    1 
ATOM   5412 N  NE    . ARG B 1 324 ? 14.998  -11.777 28.176  1.00 63.85  ? 324 ARG B NE    1 
ATOM   5413 C  CZ    . ARG B 1 324 ? 14.748  -10.465 28.195  1.00 64.80  ? 324 ARG B CZ    1 
ATOM   5414 N  NH1   . ARG B 1 324 ? 13.506  -10.003 28.370  1.00 65.94  ? 324 ARG B NH1   1 
ATOM   5415 N  NH2   . ARG B 1 324 ? 15.754  -9.597  28.042  1.00 64.75  ? 324 ARG B NH2   1 
ATOM   5416 N  N     . GLY B 1 325 ? 16.863  -14.476 32.605  1.00 64.18  ? 325 GLY B N     1 
ATOM   5417 C  CA    . GLY B 1 325 ? 18.025  -15.342 32.716  1.00 63.36  ? 325 GLY B CA    1 
ATOM   5418 C  C     . GLY B 1 325 ? 17.923  -16.359 33.834  1.00 63.77  ? 325 GLY B C     1 
ATOM   5419 O  O     . GLY B 1 325 ? 18.379  -17.497 33.669  1.00 63.13  ? 325 GLY B O     1 
ATOM   5420 N  N     . ILE B 1 326 ? 17.304  -15.970 34.953  1.00 64.93  ? 326 ILE B N     1 
ATOM   5421 C  CA    . ILE B 1 326 ? 17.076  -16.893 36.077  1.00 65.53  ? 326 ILE B CA    1 
ATOM   5422 C  C     . ILE B 1 326 ? 16.065  -17.945 35.648  1.00 65.52  ? 326 ILE B C     1 
ATOM   5423 O  O     . ILE B 1 326 ? 16.333  -19.143 35.719  1.00 65.20  ? 326 ILE B O     1 
ATOM   5424 C  CB    . ILE B 1 326 ? 16.550  -16.189 37.350  1.00 66.92  ? 326 ILE B CB    1 
ATOM   5425 C  CG1   . ILE B 1 326 ? 17.502  -15.077 37.822  1.00 67.15  ? 326 ILE B CG1   1 
ATOM   5426 C  CG2   . ILE B 1 326 ? 16.337  -17.199 38.477  1.00 67.57  ? 326 ILE B CG2   1 
ATOM   5427 C  CD1   . ILE B 1 326 ? 18.845  -15.548 38.339  1.00 66.72  ? 326 ILE B CD1   1 
ATOM   5428 N  N     . HIS B 1 327 ? 14.925  -17.481 35.154  1.00 65.98  ? 327 HIS B N     1 
ATOM   5429 C  CA    . HIS B 1 327 ? 13.851  -18.381 34.737  1.00 66.21  ? 327 HIS B CA    1 
ATOM   5430 C  C     . HIS B 1 327 ? 14.170  -19.277 33.534  1.00 65.04  ? 327 HIS B C     1 
ATOM   5431 O  O     . HIS B 1 327 ? 13.449  -20.238 33.296  1.00 65.28  ? 327 HIS B O     1 
ATOM   5432 C  CB    . HIS B 1 327 ? 12.535  -17.613 34.527  1.00 67.18  ? 327 HIS B CB    1 
ATOM   5433 C  CG    . HIS B 1 327 ? 11.751  -17.443 35.785  1.00 68.72  ? 327 HIS B CG    1 
ATOM   5434 N  ND1   . HIS B 1 327 ? 10.530  -18.049 35.989  1.00 69.78  ? 327 HIS B ND1   1 
ATOM   5435 C  CD2   . HIS B 1 327 ? 12.039  -16.777 36.926  1.00 69.49  ? 327 HIS B CD2   1 
ATOM   5436 C  CE1   . HIS B 1 327 ? 10.086  -17.740 37.194  1.00 71.14  ? 327 HIS B CE1   1 
ATOM   5437 N  NE2   . HIS B 1 327 ? 10.984  -16.972 37.784  1.00 70.96  ? 327 HIS B NE2   1 
ATOM   5438 N  N     . LYS B 1 328 ? 15.237  -18.982 32.791  1.00 63.90  ? 328 LYS B N     1 
ATOM   5439 C  CA    . LYS B 1 328 ? 15.699  -19.867 31.711  1.00 62.82  ? 328 LYS B CA    1 
ATOM   5440 C  C     . LYS B 1 328 ? 16.328  -21.186 32.224  1.00 62.70  ? 328 LYS B C     1 
ATOM   5441 O  O     . LYS B 1 328 ? 16.556  -22.101 31.428  1.00 62.06  ? 328 LYS B O     1 
ATOM   5442 C  CB    . LYS B 1 328 ? 16.672  -19.105 30.807  1.00 61.83  ? 328 LYS B CB    1 
ATOM   5443 C  CG    . LYS B 1 328 ? 16.889  -19.705 29.425  1.00 60.82  ? 328 LYS B CG    1 
ATOM   5444 C  CD    . LYS B 1 328 ? 17.417  -18.683 28.419  1.00 60.15  ? 328 LYS B CD    1 
ATOM   5445 C  CE    . LYS B 1 328 ? 18.540  -17.820 28.989  1.00 60.17  ? 328 LYS B CE    1 
ATOM   5446 N  NZ    . LYS B 1 328 ? 19.310  -17.050 27.976  1.00 59.53  ? 328 LYS B NZ    1 
ATOM   5447 N  N     . LEU B 1 329 ? 16.595  -21.274 33.537  1.00 63.39  ? 329 LEU B N     1 
ATOM   5448 C  CA    . LEU B 1 329 ? 17.159  -22.477 34.181  1.00 63.51  ? 329 LEU B CA    1 
ATOM   5449 C  C     . LEU B 1 329 ? 16.518  -23.823 33.818  1.00 63.73  ? 329 LEU B C     1 
ATOM   5450 O  O     . LEU B 1 329 ? 17.198  -24.688 33.263  1.00 63.11  ? 329 LEU B O     1 
ATOM   5451 C  CB    . LEU B 1 329 ? 17.162  -22.326 35.705  1.00 64.54  ? 329 LEU B CB    1 
ATOM   5452 C  CG    . LEU B 1 329 ? 18.403  -21.689 36.321  1.00 64.33  ? 329 LEU B CG    1 
ATOM   5453 C  CD1   . LEU B 1 329 ? 18.115  -21.192 37.732  1.00 65.48  ? 329 LEU B CD1   1 
ATOM   5454 C  CD2   . LEU B 1 329 ? 19.552  -22.682 36.348  1.00 63.86  ? 329 LEU B CD2   1 
ATOM   5455 N  N     . PRO B 1 330 ? 15.222  -24.012 34.121  1.00 64.74  ? 330 PRO B N     1 
ATOM   5456 C  CA    . PRO B 1 330 ? 14.630  -25.341 33.919  1.00 65.22  ? 330 PRO B CA    1 
ATOM   5457 C  C     . PRO B 1 330 ? 14.531  -25.780 32.457  1.00 64.41  ? 330 PRO B C     1 
ATOM   5458 O  O     . PRO B 1 330 ? 14.463  -26.982 32.180  1.00 64.60  ? 330 PRO B O     1 
ATOM   5459 C  CB    . PRO B 1 330 ? 13.231  -25.208 34.548  1.00 66.63  ? 330 PRO B CB    1 
ATOM   5460 C  CG    . PRO B 1 330 ? 13.237  -23.905 35.279  1.00 66.91  ? 330 PRO B CG    1 
ATOM   5461 C  CD    . PRO B 1 330 ? 14.192  -23.046 34.520  1.00 65.59  ? 330 PRO B CD    1 
ATOM   5462 N  N     . GLU B 1 331 ? 14.499  -24.813 31.541  1.00 63.65  ? 331 GLU B N     1 
ATOM   5463 C  CA    . GLU B 1 331 ? 14.649  -25.084 30.118  1.00 62.71  ? 331 GLU B CA    1 
ATOM   5464 C  C     . GLU B 1 331 ? 15.965  -25.809 29.870  1.00 61.91  ? 331 GLU B C     1 
ATOM   5465 O  O     . GLU B 1 331 ? 16.010  -26.802 29.132  1.00 61.70  ? 331 GLU B O     1 
ATOM   5466 C  CB    . GLU B 1 331 ? 14.627  -23.774 29.327  1.00 62.05  ? 331 GLU B CB    1 
ATOM   5467 C  CG    . GLU B 1 331 ? 14.620  -23.944 27.815  1.00 61.19  ? 331 GLU B CG    1 
ATOM   5468 C  CD    . GLU B 1 331 ? 15.026  -22.677 27.088  1.00 60.42  ? 331 GLU B CD    1 
ATOM   5469 O  OE1   . GLU B 1 331 ? 16.178  -22.224 27.283  1.00 59.86  ? 331 GLU B OE1   1 
ATOM   5470 O  OE2   . GLU B 1 331 ? 14.192  -22.154 26.316  1.00 60.50  ? 331 GLU B OE2   1 
ATOM   5471 N  N     . ARG B 1 332 ? 17.021  -25.310 30.506  1.00 61.59  ? 332 ARG B N     1 
ATOM   5472 C  CA    . ARG B 1 332 ? 18.369  -25.853 30.344  1.00 60.95  ? 332 ARG B CA    1 
ATOM   5473 C  C     . ARG B 1 332 ? 18.570  -27.173 31.074  1.00 61.64  ? 332 ARG B C     1 
ATOM   5474 O  O     . ARG B 1 332 ? 19.278  -28.051 30.582  1.00 61.31  ? 332 ARG B O     1 
ATOM   5475 C  CB    . ARG B 1 332 ? 19.399  -24.844 30.824  1.00 60.60  ? 332 ARG B CB    1 
ATOM   5476 C  CG    . ARG B 1 332 ? 19.357  -23.543 30.049  1.00 60.01  ? 332 ARG B CG    1 
ATOM   5477 C  CD    . ARG B 1 332 ? 20.200  -22.470 30.713  1.00 60.03  ? 332 ARG B CD    1 
ATOM   5478 N  NE    . ARG B 1 332 ? 21.503  -22.298 30.075  1.00 59.26  ? 332 ARG B NE    1 
ATOM   5479 C  CZ    . ARG B 1 332 ? 21.747  -21.732 28.904  1.00 58.56  ? 332 ARG B CZ    1 
ATOM   5480 N  NH1   . ARG B 1 332 ? 20.765  -21.227 28.168  1.00 58.45  ? 332 ARG B NH1   1 
ATOM   5481 N  NH2   . ARG B 1 332 ? 23.002  -21.674 28.476  1.00 58.07  ? 332 ARG B NH2   1 
ATOM   5482 N  N     . TRP B 1 333 ? 17.952  -27.305 32.246  1.00 62.69  ? 333 TRP B N     1 
ATOM   5483 C  CA    . TRP B 1 333 ? 17.995  -28.553 32.994  1.00 63.57  ? 333 TRP B CA    1 
ATOM   5484 C  C     . TRP B 1 333 ? 17.445  -29.708 32.151  1.00 63.80  ? 333 TRP B C     1 
ATOM   5485 O  O     . TRP B 1 333 ? 18.043  -30.771 32.113  1.00 63.97  ? 333 TRP B O     1 
ATOM   5486 C  CB    . TRP B 1 333 ? 17.229  -28.445 34.322  1.00 64.80  ? 333 TRP B CB    1 
ATOM   5487 C  CG    . TRP B 1 333 ? 17.813  -27.483 35.353  1.00 64.85  ? 333 TRP B CG    1 
ATOM   5488 C  CD1   . TRP B 1 333 ? 19.112  -27.076 35.459  1.00 64.16  ? 333 TRP B CD1   1 
ATOM   5489 C  CD2   . TRP B 1 333 ? 17.109  -26.850 36.436  1.00 65.79  ? 333 TRP B CD2   1 
ATOM   5490 N  NE1   . TRP B 1 333 ? 19.255  -26.213 36.521  1.00 64.60  ? 333 TRP B NE1   1 
ATOM   5491 C  CE2   . TRP B 1 333 ? 18.042  -26.057 37.137  1.00 65.58  ? 333 TRP B CE2   1 
ATOM   5492 C  CE3   . TRP B 1 333 ? 15.781  -26.875 36.881  1.00 66.92  ? 333 TRP B CE3   1 
ATOM   5493 C  CZ2   . TRP B 1 333 ? 17.690  -25.289 38.254  1.00 66.40  ? 333 TRP B CZ2   1 
ATOM   5494 C  CZ3   . TRP B 1 333 ? 15.429  -26.107 37.992  1.00 67.75  ? 333 TRP B CZ3   1 
ATOM   5495 C  CH2   . TRP B 1 333 ? 16.383  -25.325 38.663  1.00 67.47  ? 333 TRP B CH2   1 
ATOM   5496 N  N     . GLU B 1 334 ? 16.330  -29.483 31.458  1.00 63.89  ? 334 GLU B N     1 
ATOM   5497 C  CA    . GLU B 1 334 ? 15.752  -30.496 30.555  1.00 64.15  ? 334 GLU B CA    1 
ATOM   5498 C  C     . GLU B 1 334 ? 16.698  -30.915 29.429  1.00 63.13  ? 334 GLU B C     1 
ATOM   5499 O  O     . GLU B 1 334 ? 16.824  -32.105 29.131  1.00 63.54  ? 334 GLU B O     1 
ATOM   5500 C  CB    . GLU B 1 334 ? 14.415  -30.024 29.969  1.00 64.44  ? 334 GLU B CB    1 
ATOM   5501 C  CG    . GLU B 1 334 ? 13.221  -30.434 30.822  1.00 66.03  ? 334 GLU B CG    1 
ATOM   5502 C  CD    . GLU B 1 334 ? 11.955  -29.644 30.539  1.00 66.46  ? 334 GLU B CD    1 
ATOM   5503 O  OE1   . GLU B 1 334 ? 11.103  -29.585 31.448  1.00 67.75  ? 334 GLU B OE1   1 
ATOM   5504 O  OE2   . GLU B 1 334 ? 11.805  -29.076 29.428  1.00 65.64  ? 334 GLU B OE2   1 
ATOM   5505 N  N     . LYS B 1 335 ? 17.374  -29.939 28.831  1.00 61.94  ? 335 LYS B N     1 
ATOM   5506 C  CA    . LYS B 1 335 ? 18.348  -30.209 27.778  1.00 61.00  ? 335 LYS B CA    1 
ATOM   5507 C  C     . LYS B 1 335 ? 19.468  -31.083 28.320  1.00 61.25  ? 335 LYS B C     1 
ATOM   5508 O  O     . LYS B 1 335 ? 19.784  -32.122 27.734  1.00 61.36  ? 335 LYS B O     1 
ATOM   5509 C  CB    . LYS B 1 335 ? 18.937  -28.914 27.238  1.00 59.90  ? 335 LYS B CB    1 
ATOM   5510 C  CG    . LYS B 1 335 ? 17.939  -28.045 26.501  1.00 59.63  ? 335 LYS B CG    1 
ATOM   5511 C  CD    . LYS B 1 335 ? 18.539  -26.682 26.222  1.00 58.80  ? 335 LYS B CD    1 
ATOM   5512 C  CE    . LYS B 1 335 ? 17.615  -25.818 25.389  1.00 58.57  ? 335 LYS B CE    1 
ATOM   5513 N  NZ    . LYS B 1 335 ? 18.342  -24.625 24.884  1.00 57.78  ? 335 LYS B NZ    1 
ATOM   5514 N  N     . CYS B 1 336 ? 20.047  -30.642 29.441  1.00 61.42  ? 336 CYS B N     1 
ATOM   5515 C  CA    . CYS B 1 336 ? 21.093  -31.375 30.177  1.00 61.84  ? 336 CYS B CA    1 
ATOM   5516 C  C     . CYS B 1 336 ? 20.701  -32.835 30.396  1.00 62.93  ? 336 CYS B C     1 
ATOM   5517 O  O     . CYS B 1 336 ? 21.517  -33.723 30.151  1.00 63.07  ? 336 CYS B O     1 
ATOM   5518 C  CB    . CYS B 1 336 ? 21.385  -30.643 31.515  1.00 62.16  ? 336 CYS B CB    1 
ATOM   5519 S  SG    . CYS B 1 336 ? 22.331  -31.378 32.902  1.00 63.08  ? 336 CYS B SG    1 
ATOM   5520 N  N     . VAL B 1 337 ? 19.444  -33.078 30.782  1.00 63.80  ? 337 VAL B N     1 
ATOM   5521 C  CA    . VAL B 1 337 ? 18.938  -34.445 30.997  1.00 65.07  ? 337 VAL B CA    1 
ATOM   5522 C  C     . VAL B 1 337 ? 18.795  -35.185 29.664  1.00 64.89  ? 337 VAL B C     1 
ATOM   5523 O  O     . VAL B 1 337 ? 19.114  -36.376 29.575  1.00 65.63  ? 337 VAL B O     1 
ATOM   5524 C  CB    . VAL B 1 337 ? 17.588  -34.466 31.768  1.00 66.24  ? 337 VAL B CB    1 
ATOM   5525 C  CG1   . VAL B 1 337 ? 17.058  -35.888 31.932  1.00 67.73  ? 337 VAL B CG1   1 
ATOM   5526 C  CG2   . VAL B 1 337 ? 17.747  -33.842 33.141  1.00 66.60  ? 337 VAL B CG2   1 
ATOM   5527 N  N     . ALA B 1 338 ? 18.308  -34.482 28.641  1.00 64.03  ? 338 ALA B N     1 
ATOM   5528 C  CA    . ALA B 1 338 ? 18.196  -35.043 27.293  1.00 63.74  ? 338 ALA B CA    1 
ATOM   5529 C  C     . ALA B 1 338 ? 19.548  -35.383 26.674  1.00 63.06  ? 338 ALA B C     1 
ATOM   5530 O  O     . ALA B 1 338 ? 19.629  -36.240 25.805  1.00 63.25  ? 338 ALA B O     1 
ATOM   5531 C  CB    . ALA B 1 338 ? 17.431  -34.099 26.381  1.00 62.96  ? 338 ALA B CB    1 
ATOM   5532 N  N     . SER B 1 339 ? 20.608  -34.724 27.125  1.00 62.41  ? 339 SER B N     1 
ATOM   5533 C  CA    . SER B 1 339 ? 21.962  -35.019 26.655  1.00 61.95  ? 339 SER B CA    1 
ATOM   5534 C  C     . SER B 1 339 ? 22.718  -36.068 27.482  1.00 62.97  ? 339 SER B C     1 
ATOM   5535 O  O     . SER B 1 339 ? 23.923  -36.232 27.286  1.00 62.73  ? 339 SER B O     1 
ATOM   5536 C  CB    . SER B 1 339 ? 22.768  -33.724 26.647  1.00 60.85  ? 339 SER B CB    1 
ATOM   5537 O  OG    . SER B 1 339 ? 21.933  -32.638 26.298  1.00 60.21  ? 339 SER B OG    1 
ATOM   5538 N  N     . ASP B 1 340 ? 22.036  -36.769 28.391  1.00 64.19  ? 340 ASP B N     1 
ATOM   5539 C  CA    . ASP B 1 340 ? 22.683  -37.708 29.316  1.00 65.32  ? 340 ASP B CA    1 
ATOM   5540 C  C     . ASP B 1 340 ? 23.838  -37.068 30.098  1.00 64.92  ? 340 ASP B C     1 
ATOM   5541 O  O     . ASP B 1 340 ? 24.833  -37.728 30.407  1.00 65.48  ? 340 ASP B O     1 
ATOM   5542 C  CB    . ASP B 1 340 ? 23.145  -38.978 28.583  1.00 65.96  ? 340 ASP B CB    1 
ATOM   5543 C  CG    . ASP B 1 340 ? 21.992  -39.863 28.194  1.00 66.93  ? 340 ASP B CG    1 
ATOM   5544 O  OD1   . ASP B 1 340 ? 21.380  -40.450 29.104  1.00 68.23  ? 340 ASP B OD1   1 
ATOM   5545 O  OD2   . ASP B 1 340 ? 21.691  -39.975 26.987  1.00 66.50  ? 340 ASP B OD2   1 
ATOM   5546 N  N     . GLY B 1 341 ? 23.677  -35.785 30.434  1.00 64.12  ? 341 GLY B N     1 
ATOM   5547 C  CA    . GLY B 1 341 ? 24.702  -35.006 31.133  1.00 63.75  ? 341 GLY B CA    1 
ATOM   5548 C  C     . GLY B 1 341 ? 25.658  -34.193 30.264  1.00 62.58  ? 341 GLY B C     1 
ATOM   5549 O  O     . GLY B 1 341 ? 26.376  -33.339 30.788  1.00 62.27  ? 341 GLY B O     1 
ATOM   5550 N  N     . LYS B 1 342 ? 25.684  -34.454 28.952  1.00 62.05  ? 342 LYS B N     1 
ATOM   5551 C  CA    . LYS B 1 342 ? 26.636  -33.804 28.039  1.00 61.10  ? 342 LYS B CA    1 
ATOM   5552 C  C     . LYS B 1 342 ? 26.370  -32.327 27.869  1.00 60.15  ? 342 LYS B C     1 
ATOM   5553 O  O     . LYS B 1 342 ? 25.358  -31.801 28.347  1.00 60.17  ? 342 LYS B O     1 
ATOM   5554 C  CB    . LYS B 1 342 ? 26.618  -34.458 26.656  1.00 60.85  ? 342 LYS B CB    1 
ATOM   5555 C  CG    . LYS B 1 342 ? 27.208  -35.848 26.634  1.00 61.83  ? 342 LYS B CG    1 
ATOM   5556 C  CD    . LYS B 1 342 ? 27.539  -36.292 25.218  1.00 61.52  ? 342 LYS B CD    1 
ATOM   5557 C  CE    . LYS B 1 342 ? 28.453  -37.509 25.224  1.00 62.54  ? 342 LYS B CE    1 
ATOM   5558 N  NZ    . LYS B 1 342 ? 27.769  -38.770 25.638  1.00 63.80  ? 342 LYS B NZ    1 
ATOM   5559 N  N     . TYR B 1 343 ? 27.314  -31.663 27.207  1.00 59.46  ? 343 TYR B N     1 
ATOM   5560 C  CA    . TYR B 1 343 ? 27.146  -30.271 26.835  1.00 58.63  ? 343 TYR B CA    1 
ATOM   5561 C  C     . TYR B 1 343 ? 26.132  -30.186 25.714  1.00 58.07  ? 343 TYR B C     1 
ATOM   5562 O  O     . TYR B 1 343 ? 26.457  -30.343 24.535  1.00 57.60  ? 343 TYR B O     1 
ATOM   5563 C  CB    . TYR B 1 343 ? 28.479  -29.630 26.432  1.00 58.26  ? 343 TYR B CB    1 
ATOM   5564 C  CG    . TYR B 1 343 ? 29.371  -29.357 27.620  1.00 58.82  ? 343 TYR B CG    1 
ATOM   5565 C  CD1   . TYR B 1 343 ? 29.013  -28.391 28.572  1.00 58.90  ? 343 TYR B CD1   1 
ATOM   5566 C  CD2   . TYR B 1 343 ? 30.559  -30.074 27.828  1.00 59.40  ? 343 TYR B CD2   1 
ATOM   5567 C  CE1   . TYR B 1 343 ? 29.805  -28.154 29.694  1.00 59.50  ? 343 TYR B CE1   1 
ATOM   5568 C  CE2   . TYR B 1 343 ? 31.361  -29.826 28.944  1.00 60.01  ? 343 TYR B CE2   1 
ATOM   5569 C  CZ    . TYR B 1 343 ? 30.978  -28.867 29.869  1.00 60.03  ? 343 TYR B CZ    1 
ATOM   5570 O  OH    . TYR B 1 343 ? 31.750  -28.612 30.968  1.00 60.69  ? 343 TYR B OH    1 
ATOM   5571 N  N     . PHE B 1 344 ? 24.872  -29.999 26.098  1.00 58.24  ? 344 PHE B N     1 
ATOM   5572 C  CA    . PHE B 1 344 ? 23.868  -29.480 25.165  1.00 57.71  ? 344 PHE B CA    1 
ATOM   5573 C  C     . PHE B 1 344 ? 24.488  -28.180 24.651  1.00 56.93  ? 344 PHE B C     1 
ATOM   5574 O  O     . PHE B 1 344 ? 24.850  -27.297 25.426  1.00 56.99  ? 344 PHE B O     1 
ATOM   5575 C  CB    . PHE B 1 344 ? 22.486  -29.289 25.848  1.00 58.21  ? 344 PHE B CB    1 
ATOM   5576 C  CG    . PHE B 1 344 ? 22.481  -28.258 26.948  1.00 58.37  ? 344 PHE B CG    1 
ATOM   5577 C  CD1   . PHE B 1 344 ? 22.841  -28.606 28.240  1.00 59.08  ? 344 PHE B CD1   1 
ATOM   5578 C  CD2   . PHE B 1 344 ? 22.130  -26.935 26.681  1.00 57.92  ? 344 PHE B CD2   1 
ATOM   5579 C  CE1   . PHE B 1 344 ? 22.848  -27.660 29.237  1.00 59.30  ? 344 PHE B CE1   1 
ATOM   5580 C  CE2   . PHE B 1 344 ? 22.139  -25.982 27.681  1.00 58.20  ? 344 PHE B CE2   1 
ATOM   5581 C  CZ    . PHE B 1 344 ? 22.498  -26.349 28.960  1.00 58.88  ? 344 PHE B CZ    1 
ATOM   5582 N  N     . GLU B 1 345 ? 24.769  -28.122 23.364  1.00 56.32  ? 345 GLU B N     1 
ATOM   5583 C  CA    . GLU B 1 345 ? 25.211  -26.870 22.782  1.00 55.70  ? 345 GLU B CA    1 
ATOM   5584 C  C     . GLU B 1 345 ? 24.010  -25.910 23.005  1.00 55.67  ? 345 GLU B C     1 
ATOM   5585 O  O     . GLU B 1 345 ? 23.034  -25.855 22.228  1.00 55.46  ? 345 GLU B O     1 
ATOM   5586 C  CB    . GLU B 1 345 ? 25.632  -27.083 21.287  1.00 55.15  ? 345 GLU B CB    1 
ATOM   5587 C  CG    . GLU B 1 345 ? 26.864  -27.993 21.015  1.00 55.32  ? 345 GLU B CG    1 
ATOM   5588 C  CD    . GLU B 1 345 ? 26.955  -28.461 19.551  1.00 54.95  ? 345 GLU B CD    1 
ATOM   5589 O  OE1   . GLU B 1 345 ? 25.904  -28.794 18.942  1.00 54.81  ? 345 GLU B OE1   1 
ATOM   5590 O  OE2   . GLU B 1 345 ? 28.082  -28.502 18.996  1.00 54.89  ? 345 GLU B OE2   1 
ATOM   5591 O  OXT   . GLU B 1 345 ? 23.970  -25.215 24.045  1.00 56.00  ? 345 GLU B OXT   1 
ATOM   5592 O  OP3   . DG  C 2 1   ? 17.744  -15.599 24.036  1.00 83.11  ? 4   DG  C OP3   1 
ATOM   5593 P  P     . DG  C 2 1   ? 18.318  -14.457 23.252  1.00 82.13  ? 4   DG  C P     1 
ATOM   5594 O  OP1   . DG  C 2 1   ? 19.527  -14.883 22.464  1.00 79.83  ? 4   DG  C OP1   1 
ATOM   5595 O  OP2   . DG  C 2 1   ? 17.160  -13.818 22.571  1.00 82.35  ? 4   DG  C OP2   1 
ATOM   5596 O  "O5'" . DG  C 2 1   ? 18.754  -13.379 24.349  1.00 84.28  ? 4   DG  C "O5'" 1 
ATOM   5597 C  "C5'" . DG  C 2 1   ? 20.010  -12.641 24.323  1.00 83.93  ? 4   DG  C "C5'" 1 
ATOM   5598 C  "C4'" . DG  C 2 1   ? 20.687  -12.806 25.667  1.00 85.53  ? 4   DG  C "C4'" 1 
ATOM   5599 O  "O4'" . DG  C 2 1   ? 20.825  -14.221 25.907  1.00 84.82  ? 4   DG  C "O4'" 1 
ATOM   5600 C  "C3'" . DG  C 2 1   ? 22.089  -12.197 25.818  1.00 85.42  ? 4   DG  C "C3'" 1 
ATOM   5601 O  "O3'" . DG  C 2 1   ? 22.167  -10.970 26.599  1.00 87.65  ? 4   DG  C "O3'" 1 
ATOM   5602 C  "C2'" . DG  C 2 1   ? 22.887  -13.261 26.562  1.00 85.38  ? 4   DG  C "C2'" 1 
ATOM   5603 C  "C1'" . DG  C 2 1   ? 21.978  -14.483 26.680  1.00 85.21  ? 4   DG  C "C1'" 1 
ATOM   5604 N  N9    . DG  C 2 1   ? 22.535  -15.745 26.210  1.00 83.35  ? 4   DG  C N9    1 
ATOM   5605 C  C8    . DG  C 2 1   ? 22.536  -16.941 26.885  1.00 83.76  ? 4   DG  C C8    1 
ATOM   5606 N  N7    . DG  C 2 1   ? 23.070  -17.915 26.200  1.00 81.90  ? 4   DG  C N7    1 
ATOM   5607 C  C5    . DG  C 2 1   ? 23.424  -17.332 24.993  1.00 80.15  ? 4   DG  C C5    1 
ATOM   5608 C  C6    . DG  C 2 1   ? 24.042  -17.896 23.850  1.00 77.91  ? 4   DG  C C6    1 
ATOM   5609 O  O6    . DG  C 2 1   ? 24.426  -19.059 23.677  1.00 77.00  ? 4   DG  C O6    1 
ATOM   5610 N  N1    . DG  C 2 1   ? 24.212  -16.950 22.840  1.00 76.85  ? 4   DG  C N1    1 
ATOM   5611 C  C2    . DG  C 2 1   ? 23.842  -15.628 22.925  1.00 77.84  ? 4   DG  C C2    1 
ATOM   5612 N  N2    . DG  C 2 1   ? 24.098  -14.870 21.850  1.00 76.67  ? 4   DG  C N2    1 
ATOM   5613 N  N3    . DG  C 2 1   ? 23.268  -15.089 23.989  1.00 79.97  ? 4   DG  C N3    1 
ATOM   5614 C  C4    . DG  C 2 1   ? 23.087  -15.994 24.977  1.00 81.00  ? 4   DG  C C4    1 
ATOM   5615 P  P     . DG  C 2 2   ? 21.472  -9.596  26.106  1.00 88.47  ? 5   DG  C P     1 
ATOM   5616 O  OP1   . DG  C 2 2   ? 22.084  -8.478  26.864  1.00 90.45  ? 5   DG  C OP1   1 
ATOM   5617 O  OP2   . DG  C 2 2   ? 19.997  -9.770  26.152  1.00 89.30  ? 5   DG  C OP2   1 
ATOM   5618 O  "O5'" . DG  C 2 2   ? 21.978  -9.474  24.612  1.00 85.90  ? 5   DG  C "O5'" 1 
ATOM   5619 C  "C5'" . DG  C 2 2   ? 23.390  -9.400  24.397  1.00 84.96  ? 5   DG  C "C5'" 1 
ATOM   5620 C  "C4'" . DG  C 2 2   ? 23.678  -9.328  22.923  1.00 82.68  ? 5   DG  C "C4'" 1 
ATOM   5621 O  "O4'" . DG  C 2 2   ? 23.586  -10.633 22.321  1.00 80.67  ? 5   DG  C "O4'" 1 
ATOM   5622 C  "C3'" . DG  C 2 2   ? 22.724  -8.409  22.160  1.00 82.82  ? 5   DG  C "C3'" 1 
ATOM   5623 O  "O3'" . DG  C 2 2   ? 23.611  -7.334  21.875  1.00 83.14  ? 5   DG  C "O3'" 1 
ATOM   5624 C  "C2'" . DG  C 2 2   ? 22.188  -9.276  21.030  1.00 80.59  ? 5   DG  C "C2'" 1 
ATOM   5625 C  "C1'" . DG  C 2 2   ? 23.163  -10.440 20.993  1.00 79.10  ? 5   DG  C "C1'" 1 
ATOM   5626 N  N9    . DG  C 2 2   ? 22.623  -11.704 20.506  1.00 77.59  ? 5   DG  C N9    1 
ATOM   5627 C  C8    . DG  C 2 2   ? 21.418  -12.291 20.812  1.00 78.11  ? 5   DG  C C8    1 
ATOM   5628 N  N7    . DG  C 2 2   ? 21.231  -13.427 20.195  1.00 76.52  ? 5   DG  C N7    1 
ATOM   5629 C  C5    . DG  C 2 2   ? 22.382  -13.598 19.437  1.00 74.84  ? 5   DG  C C5    1 
ATOM   5630 C  C6    . DG  C 2 2   ? 22.763  -14.649 18.559  1.00 72.86  ? 5   DG  C C6    1 
ATOM   5631 O  O6    . DG  C 2 2   ? 22.130  -15.667 18.253  1.00 72.12  ? 5   DG  C O6    1 
ATOM   5632 N  N1    . DG  C 2 2   ? 24.019  -14.420 18.002  1.00 71.87  ? 5   DG  C N1    1 
ATOM   5633 C  C2    . DG  C 2 2   ? 24.809  -13.323 18.256  1.00 72.70  ? 5   DG  C C2    1 
ATOM   5634 N  N2    . DG  C 2 2   ? 25.995  -13.277 17.632  1.00 71.72  ? 5   DG  C N2    1 
ATOM   5635 N  N3    . DG  C 2 2   ? 24.469  -12.345 19.077  1.00 74.54  ? 5   DG  C N3    1 
ATOM   5636 C  C4    . DG  C 2 2   ? 23.251  -12.543 19.623  1.00 75.50  ? 5   DG  C C4    1 
ATOM   5637 P  P     . DT  C 2 3   ? 23.294  -6.251  20.761  1.00 82.80  ? 6   DT  C P     1 
ATOM   5638 O  OP1   . DT  C 2 3   ? 23.969  -4.986  21.157  1.00 84.56  ? 6   DT  C OP1   1 
ATOM   5639 O  OP2   . DT  C 2 3   ? 21.830  -6.261  20.497  1.00 83.01  ? 6   DT  C OP2   1 
ATOM   5640 O  "O5'" . DT  C 2 3   ? 24.087  -6.823  19.507  1.00 80.19  ? 6   DT  C "O5'" 1 
ATOM   5641 C  "C5'" . DT  C 2 3   ? 25.477  -7.181  19.632  1.00 79.63  ? 6   DT  C "C5'" 1 
ATOM   5642 C  "C4'" . DT  C 2 3   ? 26.004  -7.632  18.292  1.00 77.33  ? 6   DT  C "C4'" 1 
ATOM   5643 O  "O4'" . DT  C 2 3   ? 25.414  -8.910  17.950  1.00 75.76  ? 6   DT  C "O4'" 1 
ATOM   5644 C  "C3'" . DT  C 2 3   ? 25.681  -6.680  17.134  1.00 76.91  ? 6   DT  C "C3'" 1 
ATOM   5645 O  "O3'" . DT  C 2 3   ? 26.871  -6.436  16.380  1.00 76.12  ? 6   DT  C "O3'" 1 
ATOM   5646 C  "C2'" . DT  C 2 3   ? 24.589  -7.398  16.359  1.00 75.41  ? 6   DT  C "C2'" 1 
ATOM   5647 C  "C1'" . DT  C 2 3   ? 24.895  -8.863  16.631  1.00 74.27  ? 6   DT  C "C1'" 1 
ATOM   5648 N  N1    . DT  C 2 3   ? 23.743  -9.795  16.562  1.00 73.61  ? 6   DT  C N1    1 
ATOM   5649 C  C2    . DT  C 2 3   ? 23.889  -10.959 15.840  1.00 71.73  ? 6   DT  C C2    1 
ATOM   5650 O  O2    . DT  C 2 3   ? 24.910  -11.250 15.241  1.00 70.58  ? 6   DT  C O2    1 
ATOM   5651 N  N3    . DT  C 2 3   ? 22.783  -11.775 15.841  1.00 71.40  ? 6   DT  C N3    1 
ATOM   5652 C  C4    . DT  C 2 3   ? 21.581  -11.553 16.489  1.00 72.80  ? 6   DT  C C4    1 
ATOM   5653 O  O4    . DT  C 2 3   ? 20.673  -12.375 16.391  1.00 72.44  ? 6   DT  C O4    1 
ATOM   5654 C  C5    . DT  C 2 3   ? 21.502  -10.319 17.238  1.00 74.78  ? 6   DT  C C5    1 
ATOM   5655 C  C7    . DT  C 2 3   ? 20.242  -9.996  17.980  1.00 76.61  ? 6   DT  C C7    1 
ATOM   5656 C  C6    . DT  C 2 3   ? 22.575  -9.516  17.243  1.00 75.07  ? 6   DT  C C6    1 
ATOM   5657 P  P     . DG  C 2 4   ? 26.898  -5.342  15.221  1.00 75.96  ? 7   DG  C P     1 
ATOM   5658 O  OP1   . DG  C 2 4   ? 28.128  -4.531  15.375  1.00 77.05  ? 7   DG  C OP1   1 
ATOM   5659 O  OP2   . DG  C 2 4   ? 25.580  -4.669  15.183  1.00 76.78  ? 7   DG  C OP2   1 
ATOM   5660 O  "O5'" . DG  C 2 4   ? 27.053  -6.242  13.922  1.00 73.52  ? 7   DG  C "O5'" 1 
ATOM   5661 C  "C5'" . DG  C 2 4   ? 27.983  -7.340  13.873  1.00 72.35  ? 7   DG  C "C5'" 1 
ATOM   5662 C  "C4'" . DG  C 2 4   ? 27.788  -8.121  12.595  1.00 70.25  ? 7   DG  C "C4'" 1 
ATOM   5663 O  "O4'" . DG  C 2 4   ? 26.713  -9.073  12.773  1.00 69.53  ? 7   DG  C "O4'" 1 
ATOM   5664 C  "C3'" . DG  C 2 4   ? 27.405  -7.267  11.383  1.00 69.85  ? 7   DG  C "C3'" 1 
ATOM   5665 O  "O3'" . DG  C 2 4   ? 28.191  -7.644  10.253  1.00 68.47  ? 7   DG  C "O3'" 1 
ATOM   5666 C  "C2'" . DG  C 2 4   ? 25.915  -7.515  11.224  1.00 69.43  ? 7   DG  C "C2'" 1 
ATOM   5667 C  "C1'" . DG  C 2 4   ? 25.771  -8.938  11.722  1.00 68.61  ? 7   DG  C "C1'" 1 
ATOM   5668 N  N9    . DG  C 2 4   ? 24.451  -9.287  12.243  1.00 68.97  ? 7   DG  C N9    1 
ATOM   5669 C  C8    . DG  C 2 4   ? 23.614  -8.508  13.006  1.00 70.64  ? 7   DG  C C8    1 
ATOM   5670 N  N7    . DG  C 2 4   ? 22.493  -9.104  13.309  1.00 70.70  ? 7   DG  C N7    1 
ATOM   5671 C  C5    . DG  C 2 4   ? 22.598  -10.354 12.715  1.00 68.95  ? 7   DG  C C5    1 
ATOM   5672 C  C6    . DG  C 2 4   ? 21.692  -11.449 12.707  1.00 68.34  ? 7   DG  C C6    1 
ATOM   5673 O  O6    . DG  C 2 4   ? 20.579  -11.533 13.242  1.00 69.28  ? 7   DG  C O6    1 
ATOM   5674 N  N1    . DG  C 2 4   ? 22.199  -12.526 11.987  1.00 66.63  ? 7   DG  C N1    1 
ATOM   5675 C  C2    . DG  C 2 4   ? 23.418  -12.548 11.351  1.00 65.66  ? 7   DG  C C2    1 
ATOM   5676 N  N2    . DG  C 2 4   ? 23.733  -13.681 10.706  1.00 64.21  ? 7   DG  C N2    1 
ATOM   5677 N  N3    . DG  C 2 4   ? 24.273  -11.539 11.358  1.00 66.25  ? 7   DG  C N3    1 
ATOM   5678 C  C4    . DG  C 2 4   ? 23.800  -10.481 12.050  1.00 67.86  ? 7   DG  C C4    1 
ATOM   5679 P  P     . DT  C 2 5   ? 28.007  -6.918  8.863   1.00 67.91  ? 8   DT  C P     1 
ATOM   5680 O  OP1   . DT  C 2 5   ? 29.346  -6.704  8.286   1.00 67.88  ? 8   DT  C OP1   1 
ATOM   5681 O  OP2   . DT  C 2 5   ? 27.090  -5.768  9.045   1.00 69.16  ? 8   DT  C OP2   1 
ATOM   5682 O  "O5'" . DT  C 2 5   ? 27.365  -8.073  7.988   1.00 65.97  ? 8   DT  C "O5'" 1 
ATOM   5683 C  "C5'" . DT  C 2 5   ? 27.962  -9.382  7.996   1.00 64.88  ? 8   DT  C "C5'" 1 
ATOM   5684 C  "C4'" . DT  C 2 5   ? 27.182  -10.318 7.103   1.00 63.28  ? 8   DT  C "C4'" 1 
ATOM   5685 O  "O4'" . DT  C 2 5   ? 25.965  -10.733 7.769   1.00 63.42  ? 8   DT  C "O4'" 1 
ATOM   5686 C  "C3'" . DT  C 2 5   ? 26.745  -9.711  5.766   1.00 62.67  ? 8   DT  C "C3'" 1 
ATOM   5687 O  "O3'" . DT  C 2 5   ? 27.015  -10.657 4.727   1.00 61.19  ? 8   DT  C "O3'" 1 
ATOM   5688 C  "C2'" . DT  C 2 5   ? 25.274  -9.402  5.989   1.00 63.00  ? 8   DT  C "C2'" 1 
ATOM   5689 C  "C1'" . DT  C 2 5   ? 24.869  -10.546 6.892   1.00 62.82  ? 8   DT  C "C1'" 1 
ATOM   5690 N  N1    . DT  C 2 5   ? 23.659  -10.338 7.711   1.00 63.76  ? 8   DT  C N1    1 
ATOM   5691 C  C2    . DT  C 2 5   ? 22.775  -11.388 7.839   1.00 63.20  ? 8   DT  C C2    1 
ATOM   5692 O  O2    . DT  C 2 5   ? 22.935  -12.470 7.295   1.00 61.93  ? 8   DT  C O2    1 
ATOM   5693 N  N3    . DT  C 2 5   ? 21.684  -11.123 8.630   1.00 64.35  ? 8   DT  C N3    1 
ATOM   5694 C  C4    . DT  C 2 5   ? 21.401  -9.944  9.295   1.00 66.00  ? 8   DT  C C4    1 
ATOM   5695 O  O4    . DT  C 2 5   ? 20.382  -9.855  9.974   1.00 67.07  ? 8   DT  C O4    1 
ATOM   5696 C  C5    . DT  C 2 5   ? 22.372  -8.888  9.120   1.00 66.49  ? 8   DT  C C5    1 
ATOM   5697 C  C7    . DT  C 2 5   ? 22.146  -7.574  9.799   1.00 68.42  ? 8   DT  C C7    1 
ATOM   5698 C  C6    . DT  C 2 5   ? 23.439  -9.135  8.349   1.00 65.36  ? 8   DT  C C6    1 
ATOM   5699 P  P     . DA  C 2 6   ? 26.645  -10.349 3.220   1.00 60.33  ? 9   DA  C P     1 
ATOM   5700 O  OP1   . DA  C 2 6   ? 27.715  -10.907 2.376   1.00 59.58  ? 9   DA  C OP1   1 
ATOM   5701 O  OP2   . DA  C 2 6   ? 26.256  -8.924  3.097   1.00 61.34  ? 9   DA  C OP2   1 
ATOM   5702 O  "O5'" . DA  C 2 6   ? 25.372  -11.271 3.001   1.00 59.34  ? 9   DA  C "O5'" 1 
ATOM   5703 C  "C5'" . DA  C 2 6   ? 25.453  -12.681 3.244   1.00 58.56  ? 9   DA  C "C5'" 1 
ATOM   5704 C  "C4'" . DA  C 2 6   ? 24.107  -13.310 2.986   1.00 57.94  ? 9   DA  C "C4'" 1 
ATOM   5705 O  "O4'" . DA  C 2 6   ? 23.150  -12.797 3.944   1.00 58.97  ? 9   DA  C "O4'" 1 
ATOM   5706 C  "C3'" . DA  C 2 6   ? 23.525  -13.010 1.605   1.00 57.20  ? 9   DA  C "C3'" 1 
ATOM   5707 O  "O3'" . DA  C 2 6   ? 22.912  -14.191 1.095   1.00 56.20  ? 9   DA  C "O3'" 1 
ATOM   5708 C  "C2'" . DA  C 2 6   ? 22.516  -11.911 1.877   1.00 58.11  ? 9   DA  C "C2'" 1 
ATOM   5709 C  "C1'" . DA  C 2 6   ? 22.029  -12.272 3.263   1.00 58.91  ? 9   DA  C "C1'" 1 
ATOM   5710 N  N9    . DA  C 2 6   ? 21.520  -11.153 4.041   1.00 60.35  ? 9   DA  C N9    1 
ATOM   5711 C  C8    . DA  C 2 6   ? 22.012  -9.876  4.144   1.00 61.32  ? 9   DA  C C8    1 
ATOM   5712 N  N7    . DA  C 2 6   ? 21.313  -9.104  4.937   1.00 62.70  ? 9   DA  C N7    1 
ATOM   5713 C  C5    . DA  C 2 6   ? 20.292  -9.928  5.388   1.00 62.65  ? 9   DA  C C5    1 
ATOM   5714 C  C6    . DA  C 2 6   ? 19.214  -9.707  6.264   1.00 63.93  ? 9   DA  C C6    1 
ATOM   5715 N  N6    . DA  C 2 6   ? 18.974  -8.538  6.862   1.00 65.56  ? 9   DA  C N6    1 
ATOM   5716 N  N1    . DA  C 2 6   ? 18.380  -10.742 6.505   1.00 63.66  ? 9   DA  C N1    1 
ATOM   5717 C  C2    . DA  C 2 6   ? 18.623  -11.917 5.903   1.00 62.17  ? 9   DA  C C2    1 
ATOM   5718 N  N3    . DA  C 2 6   ? 19.606  -12.246 5.067   1.00 60.88  ? 9   DA  C N3    1 
ATOM   5719 C  C4    . DA  C 2 6   ? 20.412  -11.194 4.847   1.00 61.20  ? 9   DA  C C4    1 
ATOM   5720 P  P     . DC  C 2 7   ? 22.466  -14.268 -0.426  1.00 55.25  ? 10  DC  C P     1 
ATOM   5721 O  OP1   . DC  C 2 7   ? 23.285  -15.298 -1.103  1.00 54.36  ? 10  DC  C OP1   1 
ATOM   5722 O  OP2   . DC  C 2 7   ? 22.425  -12.890 -0.972  1.00 55.71  ? 10  DC  C OP2   1 
ATOM   5723 O  "O5'" . DC  C 2 7   ? 20.992  -14.854 -0.328  1.00 55.12  ? 10  DC  C "O5'" 1 
ATOM   5724 C  "C5'" . DC  C 2 7   ? 20.705  -16.022 0.459   1.00 55.12  ? 10  DC  C "C5'" 1 
ATOM   5725 C  "C4'" . DC  C 2 7   ? 19.259  -15.969 0.886   1.00 55.72  ? 10  DC  C "C4'" 1 
ATOM   5726 O  "O4'" . DC  C 2 7   ? 19.058  -14.812 1.736   1.00 56.91  ? 10  DC  C "O4'" 1 
ATOM   5727 C  "C3'" . DC  C 2 7   ? 18.282  -15.812 -0.286  1.00 55.26  ? 10  DC  C "C3'" 1 
ATOM   5728 O  "O3'" . DC  C 2 7   ? 17.205  -16.749 -0.263  1.00 55.24  ? 10  DC  C "O3'" 1 
ATOM   5729 C  "C2'" . DC  C 2 7   ? 17.714  -14.417 -0.110  1.00 56.20  ? 10  DC  C "C2'" 1 
ATOM   5730 C  "C1'" . DC  C 2 7   ? 17.822  -14.228 1.382   1.00 57.32  ? 10  DC  C "C1'" 1 
ATOM   5731 N  N1    . DC  C 2 7   ? 17.832  -12.820 1.800   1.00 58.43  ? 10  DC  C N1    1 
ATOM   5732 C  C2    . DC  C 2 7   ? 16.873  -12.381 2.721   1.00 59.79  ? 10  DC  C C2    1 
ATOM   5733 O  O2    . DC  C 2 7   ? 16.073  -13.200 3.193   1.00 60.04  ? 10  DC  C O2    1 
ATOM   5734 N  N3    . DC  C 2 7   ? 16.854  -11.079 3.084   1.00 60.97  ? 10  DC  C N3    1 
ATOM   5735 C  C4    . DC  C 2 7   ? 17.737  -10.227 2.558   1.00 60.82  ? 10  DC  C C4    1 
ATOM   5736 N  N4    . DC  C 2 7   ? 17.684  -8.955  2.952   1.00 62.16  ? 10  DC  C N4    1 
ATOM   5737 C  C5    . DC  C 2 7   ? 18.717  -10.645 1.610   1.00 59.46  ? 10  DC  C C5    1 
ATOM   5738 C  C6    . DC  C 2 7   ? 18.722  -11.936 1.255   1.00 58.30  ? 10  DC  C C6    1 
ATOM   5739 P  P     . DA  C 2 8   ? 16.332  -16.963 -1.593  1.00 54.60  ? 11  DA  C P     1 
ATOM   5740 O  OP1   . DA  C 2 8   ? 16.668  -18.315 -2.135  1.00 53.72  ? 11  DA  C OP1   1 
ATOM   5741 O  OP2   . DA  C 2 8   ? 16.520  -15.778 -2.494  1.00 54.43  ? 11  DA  C OP2   1 
ATOM   5742 O  "O5'" . DA  C 2 8   ? 14.817  -16.904 -1.076  1.00 55.61  ? 11  DA  C "O5'" 1 
ATOM   5743 C  "C5'" . DA  C 2 8   ? 14.405  -16.797 0.310   1.00 56.85  ? 11  DA  C "C5'" 1 
ATOM   5744 C  "C4'" . DA  C 2 8   ? 13.274  -15.800 0.470   1.00 58.00  ? 11  DA  C "C4'" 1 
ATOM   5745 O  "O4'" . DA  C 2 8   ? 13.840  -14.553 0.897   1.00 58.58  ? 11  DA  C "O4'" 1 
ATOM   5746 C  "C3'" . DA  C 2 8   ? 12.409  -15.441 -0.748  1.00 57.74  ? 11  DA  C "C3'" 1 
ATOM   5747 O  "O3'" . DA  C 2 8   ? 11.183  -16.174 -0.664  1.00 58.31  ? 11  DA  C "O3'" 1 
ATOM   5748 C  "C2'" . DA  C 2 8   ? 12.186  -13.936 -0.619  1.00 58.69  ? 11  DA  C "C2'" 1 
ATOM   5749 C  "C1'" . DA  C 2 8   ? 12.903  -13.533 0.654   1.00 59.46  ? 11  DA  C "C1'" 1 
ATOM   5750 N  N9    . DA  C 2 8   ? 13.634  -12.272 0.570   1.00 59.70  ? 11  DA  C N9    1 
ATOM   5751 C  C8    . DA  C 2 8   ? 14.759  -12.007 -0.168  1.00 58.70  ? 11  DA  C C8    1 
ATOM   5752 N  N7    . DA  C 2 8   ? 15.210  -10.785 -0.024  1.00 59.41  ? 11  DA  C N7    1 
ATOM   5753 C  C5    . DA  C 2 8   ? 14.326  -10.209 0.878   1.00 60.97  ? 11  DA  C C5    1 
ATOM   5754 C  C6    . DA  C 2 8   ? 14.257  -8.926  1.447   1.00 62.46  ? 11  DA  C C6    1 
ATOM   5755 N  N6    . DA  C 2 8   ? 15.114  -7.945  1.161   1.00 62.61  ? 11  DA  C N6    1 
ATOM   5756 N  N1    . DA  C 2 8   ? 13.245  -8.673  2.307   1.00 64.00  ? 11  DA  C N1    1 
ATOM   5757 C  C2    . DA  C 2 8   ? 12.374  -9.657  2.579   1.00 64.01  ? 11  DA  C C2    1 
ATOM   5758 N  N3    . DA  C 2 8   ? 12.342  -10.904 2.115   1.00 62.70  ? 11  DA  C N3    1 
ATOM   5759 C  C4    . DA  C 2 8   ? 13.353  -11.116 1.255   1.00 61.18  ? 11  DA  C C4    1 
ATOM   5760 P  P     . DA  C 2 9   ? 10.068  -16.074 -1.807  1.00 58.27  ? 12  DA  C P     1 
ATOM   5761 O  OP1   . DA  C 2 9   ? 9.135   -17.224 -1.637  1.00 58.71  ? 12  DA  C OP1   1 
ATOM   5762 O  OP2   . DA  C 2 9   ? 10.752  -15.829 -3.113  1.00 56.93  ? 12  DA  C OP2   1 
ATOM   5763 O  "O5'" . DA  C 2 9   ? 9.235   -14.780 -1.400  1.00 59.76  ? 12  DA  C "O5'" 1 
ATOM   5764 C  "C5'" . DA  C 2 9   ? 8.669   -14.640 -0.084  1.00 61.38  ? 12  DA  C "C5'" 1 
ATOM   5765 C  "C4'" . DA  C 2 9   ? 8.130   -13.238 0.069   1.00 62.69  ? 12  DA  C "C4'" 1 
ATOM   5766 O  "O4'" . DA  C 2 9   ? 9.219   -12.284 0.126   1.00 62.37  ? 12  DA  C "O4'" 1 
ATOM   5767 C  "C3'" . DA  C 2 9   ? 7.231   -12.774 -1.083  1.00 62.75  ? 12  DA  C "C3'" 1 
ATOM   5768 O  "O3'" . DA  C 2 9   ? 6.139   -12.040 -0.521  1.00 64.71  ? 12  DA  C "O3'" 1 
ATOM   5769 C  "C2'" . DA  C 2 9   ? 8.159   -11.903 -1.911  1.00 61.76  ? 12  DA  C "C2'" 1 
ATOM   5770 C  "C1'" . DA  C 2 9   ? 8.938   -11.245 -0.803  1.00 62.45  ? 12  DA  C "C1'" 1 
ATOM   5771 N  N9    . DA  C 2 9   ? 10.198  -10.638 -1.204  1.00 61.56  ? 12  DA  C N9    1 
ATOM   5772 C  C8    . DA  C 2 9   ? 11.161  -11.110 -2.059  1.00 59.91  ? 12  DA  C C8    1 
ATOM   5773 N  N7    . DA  C 2 9   ? 12.182  -10.301 -2.199  1.00 59.72  ? 12  DA  C N7    1 
ATOM   5774 C  C5    . DA  C 2 9   ? 11.864  -9.221  -1.389  1.00 61.32  ? 12  DA  C C5    1 
ATOM   5775 C  C6    . DA  C 2 9   ? 12.534  -8.019  -1.107  1.00 62.10  ? 12  DA  C C6    1 
ATOM   5776 N  N6    . DA  C 2 9   ? 13.720  -7.696  -1.622  1.00 61.34  ? 12  DA  C N6    1 
ATOM   5777 N  N1    . DA  C 2 9   ? 11.944  -7.156  -0.251  1.00 63.90  ? 12  DA  C N1    1 
ATOM   5778 C  C2    . DA  C 2 9   ? 10.757  -7.482  0.271   1.00 64.86  ? 12  DA  C C2    1 
ATOM   5779 N  N3    . DA  C 2 9   ? 10.026  -8.576  0.075   1.00 64.31  ? 12  DA  C N3    1 
ATOM   5780 C  C4    . DA  C 2 9   ? 10.645  -9.416  -0.772  1.00 62.48  ? 12  DA  C C4    1 
ATOM   5781 P  P     . DG  C 2 10  ? 4.985   -11.444 -1.450  1.00 65.41  ? 13  DG  C P     1 
ATOM   5782 O  OP1   . DG  C 2 10  ? 3.686   -11.874 -0.875  1.00 67.06  ? 13  DG  C OP1   1 
ATOM   5783 O  OP2   . DG  C 2 10  ? 5.309   -11.755 -2.872  1.00 63.66  ? 13  DG  C OP2   1 
ATOM   5784 O  "O5'" . DG  C 2 10  ? 5.104   -9.879  -1.186  1.00 66.58  ? 13  DG  C "O5'" 1 
ATOM   5785 C  "C5'" . DG  C 2 10  ? 4.864   -9.346  0.132   1.00 68.45  ? 13  DG  C "C5'" 1 
ATOM   5786 C  "C4'" . DG  C 2 10  ? 5.074   -7.851  0.134   1.00 69.43  ? 13  DG  C "C4'" 1 
ATOM   5787 O  "O4'" . DG  C 2 10  ? 6.460   -7.556  -0.166  1.00 68.00  ? 13  DG  C "O4'" 1 
ATOM   5788 C  "C3'" . DG  C 2 10  ? 4.249   -7.094  -0.908  1.00 69.94  ? 13  DG  C "C3'" 1 
ATOM   5789 O  "O3'" . DG  C 2 10  ? 3.733   -5.903  -0.306  1.00 72.17  ? 13  DG  C "O3'" 1 
ATOM   5790 C  "C2'" . DG  C 2 10  ? 5.248   -6.853  -2.026  1.00 68.09  ? 13  DG  C "C2'" 1 
ATOM   5791 C  "C1'" . DG  C 2 10  ? 6.525   -6.640  -1.248  1.00 67.75  ? 13  DG  C "C1'" 1 
ATOM   5792 N  N9    . DG  C 2 10  ? 7.745   -6.914  -2.002  1.00 65.76  ? 13  DG  C N9    1 
ATOM   5793 C  C8    . DG  C 2 10  ? 8.078   -8.076  -2.655  1.00 63.96  ? 13  DG  C C8    1 
ATOM   5794 N  N7    . DG  C 2 10  ? 9.238   -8.015  -3.249  1.00 62.64  ? 13  DG  C N7    1 
ATOM   5795 C  C5    . DG  C 2 10  ? 9.700   -6.737  -2.969  1.00 63.61  ? 13  DG  C C5    1 
ATOM   5796 C  C6    . DG  C 2 10  ? 10.908  -6.092  -3.344  1.00 63.10  ? 13  DG  C C6    1 
ATOM   5797 O  O6    . DG  C 2 10  ? 11.850  -6.543  -4.005  1.00 61.65  ? 13  DG  C O6    1 
ATOM   5798 N  N1    . DG  C 2 10  ? 10.974  -4.797  -2.840  1.00 64.69  ? 13  DG  C N1    1 
ATOM   5799 C  C2    . DG  C 2 10  ? 10.002  -4.195  -2.078  1.00 66.56  ? 13  DG  C C2    1 
ATOM   5800 N  N2    . DG  C 2 10  ? 10.248  -2.936  -1.689  1.00 68.06  ? 13  DG  C N2    1 
ATOM   5801 N  N3    . DG  C 2 10  ? 8.869   -4.782  -1.729  1.00 67.09  ? 13  DG  C N3    1 
ATOM   5802 C  C4    . DG  C 2 10  ? 8.787   -6.044  -2.203  1.00 65.54  ? 13  DG  C C4    1 
ATOM   5803 P  P     . DT  C 2 11  ? 3.004   -4.785  -1.197  1.00 73.20  ? 14  DT  C P     1 
ATOM   5804 O  OP1   . DT  C 2 11  ? 2.080   -4.021  -0.318  1.00 75.94  ? 14  DT  C OP1   1 
ATOM   5805 O  OP2   . DT  C 2 11  ? 2.478   -5.430  -2.432  1.00 71.99  ? 14  DT  C OP2   1 
ATOM   5806 O  "O5'" . DT  C 2 11  ? 4.216   -3.837  -1.604  1.00 72.45  ? 14  DT  C "O5'" 1 
ATOM   5807 C  "C5'" . DT  C 2 11  ? 4.784   -2.896  -0.675  1.00 73.76  ? 14  DT  C "C5'" 1 
ATOM   5808 C  "C4'" . DT  C 2 11  ? 5.350   -1.731  -1.449  1.00 73.77  ? 14  DT  C "C4'" 1 
ATOM   5809 O  "O4'" . DT  C 2 11  ? 6.523   -2.183  -2.166  1.00 71.48  ? 14  DT  C "O4'" 1 
ATOM   5810 C  "C3'" . DT  C 2 11  ? 4.400   -1.167  -2.509  1.00 74.40  ? 14  DT  C "C3'" 1 
ATOM   5811 O  "O3'" . DT  C 2 11  ? 4.506   0.257   -2.555  1.00 76.00  ? 14  DT  C "O3'" 1 
ATOM   5812 C  "C2'" . DT  C 2 11  ? 4.898   -1.801  -3.795  1.00 72.02  ? 14  DT  C "C2'" 1 
ATOM   5813 C  "C1'" . DT  C 2 11  ? 6.393   -1.827  -3.531  1.00 70.82  ? 14  DT  C "C1'" 1 
ATOM   5814 N  N1    . DT  C 2 11  ? 7.218   -2.763  -4.332  1.00 68.41  ? 14  DT  C N1    1 
ATOM   5815 C  C2    . DT  C 2 11  ? 8.473   -2.339  -4.709  1.00 67.61  ? 14  DT  C C2    1 
ATOM   5816 O  O2    . DT  C 2 11  ? 8.922   -1.243  -4.416  1.00 68.77  ? 14  DT  C O2    1 
ATOM   5817 N  N3    . DT  C 2 11  ? 9.188   -3.249  -5.448  1.00 65.56  ? 14  DT  C N3    1 
ATOM   5818 C  C4    . DT  C 2 11  ? 8.790   -4.518  -5.821  1.00 64.27  ? 14  DT  C C4    1 
ATOM   5819 O  O4    . DT  C 2 11  ? 9.549   -5.229  -6.471  1.00 62.62  ? 14  DT  C O4    1 
ATOM   5820 C  C5    . DT  C 2 11  ? 7.470   -4.905  -5.378  1.00 65.19  ? 14  DT  C C5    1 
ATOM   5821 C  C7    . DT  C 2 11  ? 6.947   -6.257  -5.746  1.00 64.08  ? 14  DT  C C7    1 
ATOM   5822 C  C6    . DT  C 2 11  ? 6.759   -4.020  -4.666  1.00 67.20  ? 14  DT  C C6    1 
ATOM   5823 P  P     . DA  C 2 12  ? 3.294   1.142   -3.112  1.00 77.88  ? 15  DA  C P     1 
ATOM   5824 O  OP1   . DA  C 2 12  ? 2.664   1.850   -1.963  1.00 80.63  ? 15  DA  C OP1   1 
ATOM   5825 O  OP2   . DA  C 2 12  ? 2.455   0.275   -3.981  1.00 76.88  ? 15  DA  C OP2   1 
ATOM   5826 O  "O5'" . DA  C 2 12  ? 4.028   2.191   -4.065  1.00 77.66  ? 15  DA  C "O5'" 1 
ATOM   5827 C  "C5'" . DA  C 2 12  ? 4.671   3.385   -3.566  1.00 79.15  ? 15  DA  C "C5'" 1 
ATOM   5828 C  "C4'" . DA  C 2 12  ? 5.975   3.600   -4.297  1.00 77.61  ? 15  DA  C "C4'" 1 
ATOM   5829 O  "O4'" . DA  C 2 12  ? 6.653   2.331   -4.366  1.00 75.17  ? 15  DA  C "O4'" 1 
ATOM   5830 C  "C3'" . DA  C 2 12  ? 5.850   4.037   -5.755  1.00 77.15  ? 15  DA  C "C3'" 1 
ATOM   5831 O  "O3'" . DA  C 2 12  ? 5.602   5.437   -5.991  1.00 79.27  ? 15  DA  C "O3'" 1 
ATOM   5832 C  "C2'" . DA  C 2 12  ? 7.136   3.509   -6.363  1.00 74.86  ? 15  DA  C "C2'" 1 
ATOM   5833 C  "C1'" . DA  C 2 12  ? 7.454   2.286   -5.542  1.00 73.52  ? 15  DA  C "C1'" 1 
ATOM   5834 N  N9    . DA  C 2 12  ? 7.181   1.037   -6.236  1.00 71.54  ? 15  DA  C N9    1 
ATOM   5835 C  C8    . DA  C 2 12  ? 6.015   0.317   -6.304  1.00 71.52  ? 15  DA  C C8    1 
ATOM   5836 N  N7    . DA  C 2 12  ? 6.116   -0.784  -7.007  1.00 69.57  ? 15  DA  C N7    1 
ATOM   5837 C  C5    . DA  C 2 12  ? 7.433   -0.781  -7.444  1.00 68.23  ? 15  DA  C C5    1 
ATOM   5838 C  C6    . DA  C 2 12  ? 8.172   -1.683  -8.230  1.00 66.13  ? 15  DA  C C6    1 
ATOM   5839 N  N6    . DA  C 2 12  ? 7.660   -2.800  -8.750  1.00 64.93  ? 15  DA  C N6    1 
ATOM   5840 N  N1    . DA  C 2 12  ? 9.467   -1.386  -8.478  1.00 65.48  ? 15  DA  C N1    1 
ATOM   5841 C  C2    . DA  C 2 12  ? 9.976   -0.259  -7.963  1.00 66.83  ? 15  DA  C C2    1 
ATOM   5842 N  N3    . DA  C 2 12  ? 9.382   0.665   -7.210  1.00 68.82  ? 15  DA  C N3    1 
ATOM   5843 C  C4    . DA  C 2 12  ? 8.097   0.340   -6.986  1.00 69.43  ? 15  DA  C C4    1 
ATOM   5844 P  P     . DT  C 2 13  ? 6.800   6.536   -6.030  1.00 79.97  ? 16  DT  C P     1 
ATOM   5845 O  OP1   . DT  C 2 13  ? 7.530   6.465   -4.728  1.00 80.33  ? 16  DT  C OP1   1 
ATOM   5846 O  OP2   . DT  C 2 13  ? 6.236   7.836   -6.496  1.00 82.19  ? 16  DT  C OP2   1 
ATOM   5847 O  "O5'" . DT  C 2 13  ? 7.747   6.057   -7.220  1.00 77.60  ? 16  DT  C "O5'" 1 
ATOM   5848 C  "C5'" . DT  C 2 13  ? 9.155   6.347   -7.148  1.00 77.16  ? 16  DT  C "C5'" 1 
ATOM   5849 C  "C4'" . DT  C 2 13  ? 9.885   5.808   -8.355  1.00 75.07  ? 16  DT  C "C4'" 1 
ATOM   5850 O  "O4'" . DT  C 2 13  ? 9.530   4.437   -8.624  1.00 73.03  ? 16  DT  C "O4'" 1 
ATOM   5851 C  "C3'" . DT  C 2 13  ? 9.617   6.579   -9.648  1.00 75.64  ? 16  DT  C "C3'" 1 
ATOM   5852 O  "O3'" . DT  C 2 13  ? 10.864  7.181   -9.994  1.00 75.76  ? 16  DT  C "O3'" 1 
ATOM   5853 C  "C2'" . DT  C 2 13  ? 9.150   5.522   -10.639 1.00 73.68  ? 16  DT  C "C2'" 1 
ATOM   5854 C  "C1'" . DT  C 2 13  ? 9.648   4.235   -10.020 1.00 71.83  ? 16  DT  C "C1'" 1 
ATOM   5855 N  N1    . DT  C 2 13  ? 8.908   3.000   -10.362 1.00 70.31  ? 16  DT  C N1    1 
ATOM   5856 C  C2    . DT  C 2 13  ? 9.559   1.999   -11.056 1.00 68.20  ? 16  DT  C C2    1 
ATOM   5857 O  O2    . DT  C 2 13  ? 10.706  2.101   -11.460 1.00 67.55  ? 16  DT  C O2    1 
ATOM   5858 N  N3    . DT  C 2 13  ? 8.809   0.869   -11.269 1.00 67.05  ? 16  DT  C N3    1 
ATOM   5859 C  C4    . DT  C 2 13  ? 7.513   0.635   -10.848 1.00 67.80  ? 16  DT  C C4    1 
ATOM   5860 O  O4    . DT  C 2 13  ? 6.967   -0.430  -11.120 1.00 66.73  ? 16  DT  C O4    1 
ATOM   5861 C  C5    . DT  C 2 13  ? 6.896   1.723   -10.117 1.00 70.05  ? 16  DT  C C5    1 
ATOM   5862 C  C7    . DT  C 2 13  ? 5.492   1.565   -9.623  1.00 71.23  ? 16  DT  C C7    1 
ATOM   5863 C  C6    . DT  C 2 13  ? 7.617   2.833   -9.910  1.00 71.16  ? 16  DT  C C6    1 
ATOM   5864 P  P     . DG  C 2 14  ? 10.900  8.529   -10.793 1.00 77.54  ? 17  DG  C P     1 
ATOM   5865 O  OP1   . DG  C 2 14  ? 12.240  9.129   -10.611 1.00 78.11  ? 17  DG  C OP1   1 
ATOM   5866 O  OP2   . DG  C 2 14  ? 9.683   9.305   -10.457 1.00 79.67  ? 17  DG  C OP2   1 
ATOM   5867 O  "O5'" . DG  C 2 14  ? 10.808  8.023   -12.293 1.00 75.97  ? 17  DG  C "O5'" 1 
ATOM   5868 C  "C5'" . DG  C 2 14  ? 11.805  7.132   -12.813 1.00 73.88  ? 17  DG  C "C5'" 1 
ATOM   5869 C  "C4'" . DG  C 2 14  ? 11.439  6.722   -14.219 1.00 72.78  ? 17  DG  C "C4'" 1 
ATOM   5870 O  "O4'" . DG  C 2 14  ? 10.574  5.564   -14.158 1.00 71.35  ? 17  DG  C "O4'" 1 
ATOM   5871 C  "C3'" . DG  C 2 14  ? 10.654  7.780   -14.993 1.00 74.48  ? 17  DG  C "C3'" 1 
ATOM   5872 O  "O3'" . DG  C 2 14  ? 10.967  7.702   -16.382 1.00 73.75  ? 17  DG  C "O3'" 1 
ATOM   5873 C  "C2'" . DG  C 2 14  ? 9.217   7.365   -14.763 1.00 74.53  ? 17  DG  C "C2'" 1 
ATOM   5874 C  "C1'" . DG  C 2 14  ? 9.370   5.864   -14.836 1.00 72.08  ? 17  DG  C "C1'" 1 
ATOM   5875 N  N9    . DG  C 2 14  ? 8.301   5.059   -14.260 1.00 71.66  ? 17  DG  C N9    1 
ATOM   5876 C  C8    . DG  C 2 14  ? 7.159   5.484   -13.622 1.00 73.26  ? 17  DG  C C8    1 
ATOM   5877 N  N7    . DG  C 2 14  ? 6.377   4.501   -13.268 1.00 72.51  ? 17  DG  C N7    1 
ATOM   5878 C  C5    . DG  C 2 14  ? 7.029   3.362   -13.722 1.00 70.24  ? 17  DG  C C5    1 
ATOM   5879 C  C6    . DG  C 2 14  ? 6.659   1.993   -13.638 1.00 68.68  ? 17  DG  C C6    1 
ATOM   5880 O  O6    . DG  C 2 14  ? 5.653   1.497   -13.119 1.00 69.00  ? 17  DG  C O6    1 
ATOM   5881 N  N1    . DG  C 2 14  ? 7.615   1.167   -14.224 1.00 66.75  ? 17  DG  C N1    1 
ATOM   5882 C  C2    . DG  C 2 14  ? 8.777   1.601   -14.817 1.00 66.40  ? 17  DG  C C2    1 
ATOM   5883 N  N2    . DG  C 2 14  ? 9.575   0.651   -15.329 1.00 64.63  ? 17  DG  C N2    1 
ATOM   5884 N  N3    . DG  C 2 14  ? 9.126   2.874   -14.912 1.00 67.87  ? 17  DG  C N3    1 
ATOM   5885 C  C4    . DG  C 2 14  ? 8.214   3.692   -14.343 1.00 69.71  ? 17  DG  C C4    1 
ATOM   5886 P  P     . DA  C 2 15  ? 11.566  8.966   -17.125 1.00 75.42  ? 18  DA  C P     1 
ATOM   5887 O  OP1   . DA  C 2 15  ? 12.664  9.501   -16.289 1.00 76.28  ? 18  DA  C OP1   1 
ATOM   5888 O  OP2   . DA  C 2 15  ? 10.441  9.843   -17.526 1.00 77.16  ? 18  DA  C OP2   1 
ATOM   5889 O  "O5'" . DA  C 2 15  ? 12.251  8.329   -18.408 1.00 73.85  ? 18  DA  C "O5'" 1 
ATOM   5890 C  "C5'" . DA  C 2 15  ? 13.236  7.294   -18.265 1.00 72.00  ? 18  DA  C "C5'" 1 
ATOM   5891 C  "C4'" . DA  C 2 15  ? 12.838  6.083   -19.074 1.00 70.04  ? 18  DA  C "C4'" 1 
ATOM   5892 O  "O4'" . DA  C 2 15  ? 11.708  5.418   -18.457 1.00 69.43  ? 18  DA  C "O4'" 1 
ATOM   5893 C  "C3'" . DA  C 2 15  ? 12.402  6.379   -20.509 1.00 70.36  ? 18  DA  C "C3'" 1 
ATOM   5894 O  "O3'" . DA  C 2 15  ? 12.830  5.287   -21.321 1.00 68.57  ? 18  DA  C "O3'" 1 
ATOM   5895 C  "C2'" . DA  C 2 15  ? 10.891  6.386   -20.402 1.00 70.74  ? 18  DA  C "C2'" 1 
ATOM   5896 C  "C1'" . DA  C 2 15  ? 10.701  5.237   -19.440 1.00 69.25  ? 18  DA  C "C1'" 1 
ATOM   5897 N  N9    . DA  C 2 15  ? 9.406   5.170   -18.767 1.00 69.77  ? 18  DA  C N9    1 
ATOM   5898 C  C8    . DA  C 2 15  ? 8.560   6.186   -18.388 1.00 71.74  ? 18  DA  C C8    1 
ATOM   5899 N  N7    . DA  C 2 15  ? 7.463   5.768   -17.804 1.00 71.83  ? 18  DA  C N7    1 
ATOM   5900 C  C5    . DA  C 2 15  ? 7.587   4.386   -17.810 1.00 69.75  ? 18  DA  C C5    1 
ATOM   5901 C  C6    . DA  C 2 15  ? 6.753   3.357   -17.337 1.00 68.94  ? 18  DA  C C6    1 
ATOM   5902 N  N6    . DA  C 2 15  ? 5.577   3.570   -16.742 1.00 70.19  ? 18  DA  C N6    1 
ATOM   5903 N  N1    . DA  C 2 15  ? 7.173   2.082   -17.500 1.00 66.95  ? 18  DA  C N1    1 
ATOM   5904 C  C2    . DA  C 2 15  ? 8.355   1.867   -18.097 1.00 65.88  ? 18  DA  C C2    1 
ATOM   5905 N  N3    . DA  C 2 15  ? 9.227   2.749   -18.579 1.00 66.51  ? 18  DA  C N3    1 
ATOM   5906 C  C4    . DA  C 2 15  ? 8.777   4.004   -18.405 1.00 68.46  ? 18  DA  C C4    1 
ATOM   5907 P  P     . DA  C 2 16  ? 12.781  5.388   -22.912 1.00 68.64  ? 19  DA  C P     1 
ATOM   5908 O  OP1   . DA  C 2 16  ? 13.911  6.240   -23.344 1.00 69.80  ? 19  DA  C OP1   1 
ATOM   5909 O  OP2   . DA  C 2 16  ? 11.401  5.741   -23.330 1.00 69.37  ? 19  DA  C OP2   1 
ATOM   5910 O  "O5'" . DA  C 2 16  ? 13.062  3.896   -23.391 1.00 66.50  ? 19  DA  C "O5'" 1 
ATOM   5911 C  "C5'" . DA  C 2 16  ? 13.247  2.794   -22.476 1.00 65.00  ? 19  DA  C "C5'" 1 
ATOM   5912 C  "C4'" . DA  C 2 16  ? 12.207  1.723   -22.716 1.00 63.76  ? 19  DA  C "C4'" 1 
ATOM   5913 O  "O4'" . DA  C 2 16  ? 11.005  2.000   -21.956 1.00 64.41  ? 19  DA  C "O4'" 1 
ATOM   5914 C  "C3'" . DA  C 2 16  ? 11.750  1.559   -24.167 1.00 63.64  ? 19  DA  C "C3'" 1 
ATOM   5915 O  "O3'" . DA  C 2 16  ? 11.681  0.163   -24.457 1.00 62.00  ? 19  DA  C "O3'" 1 
ATOM   5916 C  "C2'" . DA  C 2 16  ? 10.380  2.213   -24.178 1.00 64.75  ? 19  DA  C "C2'" 1 
ATOM   5917 C  "C1'" . DA  C 2 16  ? 9.876   1.838   -22.801 1.00 64.46  ? 19  DA  C "C1'" 1 
ATOM   5918 N  N9    . DA  C 2 16  ? 8.791   2.665   -22.271 1.00 65.94  ? 19  DA  C N9    1 
ATOM   5919 C  C8    . DA  C 2 16  ? 8.680   4.033   -22.328 1.00 67.80  ? 19  DA  C C8    1 
ATOM   5920 N  N7    . DA  C 2 16  ? 7.597   4.500   -21.756 1.00 68.98  ? 19  DA  C N7    1 
ATOM   5921 C  C5    . DA  C 2 16  ? 6.952   3.365   -21.287 1.00 67.81  ? 19  DA  C C5    1 
ATOM   5922 C  C6    . DA  C 2 16  ? 5.745   3.186   -20.586 1.00 68.38  ? 19  DA  C C6    1 
ATOM   5923 N  N6    . DA  C 2 16  ? 4.944   4.192   -20.227 1.00 70.33  ? 19  DA  C N6    1 
ATOM   5924 N  N1    . DA  C 2 16  ? 5.383   1.923   -20.269 1.00 67.03  ? 19  DA  C N1    1 
ATOM   5925 C  C2    . DA  C 2 16  ? 6.189   0.914   -20.634 1.00 65.23  ? 19  DA  C C2    1 
ATOM   5926 N  N3    . DA  C 2 16  ? 7.350   0.957   -21.291 1.00 64.55  ? 19  DA  C N3    1 
ATOM   5927 C  C4    . DA  C 2 16  ? 7.677   2.227   -21.594 1.00 65.92  ? 19  DA  C C4    1 
ATOM   5928 P  P     . DA  C 2 17  ? 11.349  -0.338  -25.926 1.00 61.59  ? 20  DA  C P     1 
ATOM   5929 O  OP1   . DA  C 2 17  ? 12.246  -1.485  -26.223 1.00 60.25  ? 20  DA  C OP1   1 
ATOM   5930 O  OP2   . DA  C 2 17  ? 11.340  0.840   -26.836 1.00 63.04  ? 20  DA  C OP2   1 
ATOM   5931 O  "O5'" . DA  C 2 17  ? 9.868   -0.901  -25.750 1.00 61.27  ? 20  DA  C "O5'" 1 
ATOM   5932 C  "C5'" . DA  C 2 17  ? 9.644   -2.063  -24.940 1.00 60.06  ? 20  DA  C "C5'" 1 
ATOM   5933 C  "C4'" . DA  C 2 17  ? 8.164   -2.301  -24.764 1.00 60.31  ? 20  DA  C "C4'" 1 
ATOM   5934 O  "O4'" . DA  C 2 17  ? 7.543   -1.140  -24.171 1.00 61.78  ? 20  DA  C "O4'" 1 
ATOM   5935 C  "C3'" . DA  C 2 17  ? 7.397   -2.581  -26.059 1.00 60.36  ? 20  DA  C "C3'" 1 
ATOM   5936 O  "O3'" . DA  C 2 17  ? 6.703   -3.827  -25.906 1.00 59.47  ? 20  DA  C "O3'" 1 
ATOM   5937 C  "C2'" . DA  C 2 17  ? 6.484   -1.374  -26.210 1.00 61.98  ? 20  DA  C "C2'" 1 
ATOM   5938 C  "C1'" . DA  C 2 17  ? 6.281   -0.952  -24.774 1.00 62.54  ? 20  DA  C "C1'" 1 
ATOM   5939 N  N9    . DA  C 2 17  ? 5.889   0.440   -24.568 1.00 64.30  ? 20  DA  C N9    1 
ATOM   5940 C  C8    . DA  C 2 17  ? 6.557   1.563   -24.991 1.00 65.29  ? 20  DA  C C8    1 
ATOM   5941 N  N7    . DA  C 2 17  ? 5.975   2.685   -24.644 1.00 66.99  ? 20  DA  C N7    1 
ATOM   5942 C  C5    . DA  C 2 17  ? 4.857   2.276   -23.931 1.00 67.14  ? 20  DA  C C5    1 
ATOM   5943 C  C6    . DA  C 2 17  ? 3.831   2.992   -23.287 1.00 68.77  ? 20  DA  C C6    1 
ATOM   5944 N  N6    . DA  C 2 17  ? 3.765   4.326   -23.262 1.00 70.60  ? 20  DA  C N6    1 
ATOM   5945 N  N1    . DA  C 2 17  ? 2.871   2.284   -22.654 1.00 68.64  ? 20  DA  C N1    1 
ATOM   5946 C  C2    . DA  C 2 17  ? 2.940   0.945   -22.680 1.00 66.95  ? 20  DA  C C2    1 
ATOM   5947 N  N3    . DA  C 2 17  ? 3.854   0.159   -23.251 1.00 65.30  ? 20  DA  C N3    1 
ATOM   5948 C  C4    . DA  C 2 17  ? 4.795   0.895   -23.870 1.00 65.49  ? 20  DA  C C4    1 
ATOM   5949 P  P     . DT  C 2 18  ? 5.892   -4.468  -27.120 1.00 59.33  ? 21  DT  C P     1 
ATOM   5950 O  OP1   . DT  C 2 18  ? 5.845   -5.939  -26.908 1.00 58.11  ? 21  DT  C OP1   1 
ATOM   5951 O  OP2   . DT  C 2 18  ? 6.475   -3.943  -28.375 1.00 59.65  ? 21  DT  C OP2   1 
ATOM   5952 O  "O5'" . DT  C 2 18  ? 4.425   -3.885  -26.896 1.00 60.60  ? 21  DT  C "O5'" 1 
ATOM   5953 C  "C5'" . DT  C 2 18  ? 3.653   -4.297  -25.762 1.00 60.69  ? 21  DT  C "C5'" 1 
ATOM   5954 C  "C4'" . DT  C 2 18  ? 2.418   -3.438  -25.640 1.00 62.30  ? 21  DT  C "C4'" 1 
ATOM   5955 O  "O4'" . DT  C 2 18  ? 2.786   -2.048  -25.553 1.00 63.40  ? 21  DT  C "O4'" 1 
ATOM   5956 C  "C3'" . DT  C 2 18  ? 1.439   -3.516  -26.815 1.00 62.88  ? 21  DT  C "C3'" 1 
ATOM   5957 O  "O3'" . DT  C 2 18  ? 0.330   -4.374  -26.527 1.00 62.99  ? 21  DT  C "O3'" 1 
ATOM   5958 C  "C2'" . DT  C 2 18  ? 0.992   -2.074  -27.024 1.00 64.58  ? 21  DT  C "C2'" 1 
ATOM   5959 C  "C1'" . DT  C 2 18  ? 1.607   -1.336  -25.856 1.00 64.94  ? 21  DT  C "C1'" 1 
ATOM   5960 N  N1    . DT  C 2 18  ? 1.965   0.063   -26.132 1.00 66.17  ? 21  DT  C N1    1 
ATOM   5961 C  C2    . DT  C 2 18  ? 1.163   1.052   -25.606 1.00 67.94  ? 21  DT  C C2    1 
ATOM   5962 O  O2    . DT  C 2 18  ? 0.188   0.823   -24.908 1.00 68.56  ? 21  DT  C O2    1 
ATOM   5963 N  N3    . DT  C 2 18  ? 1.561   2.330   -25.906 1.00 69.16  ? 21  DT  C N3    1 
ATOM   5964 C  C4    . DT  C 2 18  ? 2.651   2.707   -26.667 1.00 68.81  ? 21  DT  C C4    1 
ATOM   5965 O  O4    . DT  C 2 18  ? 2.879   3.896   -26.857 1.00 70.19  ? 21  DT  C O4    1 
ATOM   5966 C  C5    . DT  C 2 18  ? 3.443   1.617   -27.194 1.00 66.95  ? 21  DT  C C5    1 
ATOM   5967 C  C7    . DT  C 2 18  ? 4.641   1.929   -28.034 1.00 66.67  ? 21  DT  C C7    1 
ATOM   5968 C  C6    . DT  C 2 18  ? 3.062   0.367   -26.908 1.00 65.73  ? 21  DT  C C6    1 
ATOM   5969 P  P     . DG  C 2 19  ? -0.799  -4.629  -27.637 1.00 63.66  ? 22  DG  C P     1 
ATOM   5970 O  OP1   . DG  C 2 19  ? -1.457  -5.923  -27.340 1.00 63.21  ? 22  DG  C OP1   1 
ATOM   5971 O  OP2   . DG  C 2 19  ? -0.203  -4.378  -28.973 1.00 63.36  ? 22  DG  C OP2   1 
ATOM   5972 O  "O5'" . DG  C 2 19  ? -1.870  -3.497  -27.330 1.00 65.62  ? 22  DG  C "O5'" 1 
ATOM   5973 C  "C5'" . DG  C 2 19  ? -2.411  -3.356  -26.012 1.00 66.41  ? 22  DG  C "C5'" 1 
ATOM   5974 C  "C4'" . DG  C 2 19  ? -3.369  -2.192  -25.992 1.00 68.48  ? 22  DG  C "C4'" 1 
ATOM   5975 O  "O4'" . DG  C 2 19  ? -2.628  -0.950  -26.075 1.00 68.98  ? 22  DG  C "O4'" 1 
ATOM   5976 C  "C3'" . DG  C 2 19  ? -4.352  -2.173  -27.165 1.00 69.36  ? 22  DG  C "C3'" 1 
ATOM   5977 O  "O3'" . DG  C 2 19  ? -5.665  -1.923  -26.658 1.00 71.15  ? 22  DG  C "O3'" 1 
ATOM   5978 C  "C2'" . DG  C 2 19  ? -3.820  -1.056  -28.042 1.00 69.81  ? 22  DG  C "C2'" 1 
ATOM   5979 C  "C1'" . DG  C 2 19  ? -3.288  -0.109  -26.995 1.00 70.40  ? 22  DG  C "C1'" 1 
ATOM   5980 N  N9    . DG  C 2 19  ? -2.330  0.878   -27.485 1.00 70.51  ? 22  DG  C N9    1 
ATOM   5981 C  C8    . DG  C 2 19  ? -1.129  0.630   -28.104 1.00 69.10  ? 22  DG  C C8    1 
ATOM   5982 N  N7    . DG  C 2 19  ? -0.498  1.719   -28.451 1.00 69.82  ? 22  DG  C N7    1 
ATOM   5983 C  C5    . DG  C 2 19  ? -1.335  2.748   -28.044 1.00 71.80  ? 22  DG  C C5    1 
ATOM   5984 C  C6    . DG  C 2 19  ? -1.184  4.156   -28.152 1.00 73.47  ? 22  DG  C C6    1 
ATOM   5985 O  O6    . DG  C 2 19  ? -0.249  4.794   -28.646 1.00 73.53  ? 22  DG  C O6    1 
ATOM   5986 N  N1    . DG  C 2 19  ? -2.273  4.831   -27.614 1.00 75.40  ? 22  DG  C N1    1 
ATOM   5987 C  C2    . DG  C 2 19  ? -3.369  4.234   -27.043 1.00 75.73  ? 22  DG  C C2    1 
ATOM   5988 N  N2    . DG  C 2 19  ? -4.313  5.060   -26.569 1.00 77.91  ? 22  DG  C N2    1 
ATOM   5989 N  N3    . DG  C 2 19  ? -3.520  2.923   -26.926 1.00 74.20  ? 22  DG  C N3    1 
ATOM   5990 C  C4    . DG  C 2 19  ? -2.473  2.246   -27.449 1.00 72.27  ? 22  DG  C C4    1 
ATOM   5991 P  P     . DT  C 2 20  ? -6.908  -1.768  -27.647 1.00 72.59  ? 23  DT  C P     1 
ATOM   5992 O  OP1   . DT  C 2 20  ? -8.110  -2.261  -26.934 1.00 73.76  ? 23  DT  C OP1   1 
ATOM   5993 O  OP2   . DT  C 2 20  ? -6.545  -2.352  -28.966 1.00 71.41  ? 23  DT  C OP2   1 
ATOM   5994 O  "O5'" . DT  C 2 20  ? -7.030  -0.191  -27.809 1.00 74.33  ? 23  DT  C "O5'" 1 
ATOM   5995 C  "C5'" . DT  C 2 20  ? -7.353  0.641   -26.685 1.00 75.88  ? 23  DT  C "C5'" 1 
ATOM   5996 C  "C4'" . DT  C 2 20  ? -7.911  1.954   -27.176 1.00 77.98  ? 23  DT  C "C4'" 1 
ATOM   5997 O  "O4'" . DT  C 2 20  ? -6.823  2.768   -27.675 1.00 77.52  ? 23  DT  C "O4'" 1 
ATOM   5998 C  "C3'" . DT  C 2 20  ? -8.907  1.829   -28.329 1.00 78.87  ? 23  DT  C "C3'" 1 
ATOM   5999 O  "O3'" . DT  C 2 20  ? -9.991  2.737   -28.131 1.00 81.45  ? 23  DT  C "O3'" 1 
ATOM   6000 C  "C2'" . DT  C 2 20  ? -8.073  2.167   -29.550 1.00 77.99  ? 23  DT  C "C2'" 1 
ATOM   6001 C  "C1'" . DT  C 2 20  ? -7.116  3.199   -28.989 1.00 78.18  ? 23  DT  C "C1'" 1 
ATOM   6002 N  N1    . DT  C 2 20  ? -5.838  3.337   -29.714 1.00 76.80  ? 23  DT  C N1    1 
ATOM   6003 C  C2    . DT  C 2 20  ? -5.395  4.601   -30.043 1.00 77.92  ? 23  DT  C C2    1 
ATOM   6004 O  O2    . DT  C 2 20  ? -6.015  5.618   -29.776 1.00 80.00  ? 23  DT  C O2    1 
ATOM   6005 N  N3    . DT  C 2 20  ? -4.197  4.629   -30.716 1.00 76.69  ? 23  DT  C N3    1 
ATOM   6006 C  C4    . DT  C 2 20  ? -3.419  3.546   -31.083 1.00 74.54  ? 23  DT  C C4    1 
ATOM   6007 O  O4    . DT  C 2 20  ? -2.368  3.727   -31.691 1.00 73.84  ? 23  DT  C O4    1 
ATOM   6008 C  C5    . DT  C 2 20  ? -3.942  2.253   -30.701 1.00 73.45  ? 23  DT  C C5    1 
ATOM   6009 C  C7    . DT  C 2 20  ? -3.170  1.022   -31.056 1.00 71.28  ? 23  DT  C C7    1 
ATOM   6010 C  C6    . DT  C 2 20  ? -5.106  2.215   -30.041 1.00 74.61  ? 23  DT  C C6    1 
ATOM   6011 P  P     . DC  C 2 21  ? -11.162 2.832   -29.198 1.00 82.96  ? 24  DC  C P     1 
ATOM   6012 O  OP1   . DC  C 2 21  ? -12.413 3.162   -28.478 1.00 85.37  ? 24  DC  C OP1   1 
ATOM   6013 O  OP2   . DC  C 2 21  ? -11.111 1.628   -30.064 1.00 81.28  ? 24  DC  C OP2   1 
ATOM   6014 O  "O5'" . DC  C 2 21  ? -10.719 4.080   -30.073 1.00 83.72  ? 24  DC  C "O5'" 1 
ATOM   6015 C  "C5'" . DC  C 2 21  ? -10.494 5.373   -29.490 1.00 85.24  ? 24  DC  C "C5'" 1 
ATOM   6016 C  "C4'" . DC  C 2 21  ? -10.207 6.361   -30.595 1.00 86.01  ? 24  DC  C "C4'" 1 
ATOM   6017 O  "O4'" . DC  C 2 21  ? -8.864  6.136   -31.091 1.00 83.89  ? 24  DC  C "O4'" 1 
ATOM   6018 C  "C3'" . DC  C 2 21  ? -11.128 6.209   -31.808 1.00 86.85  ? 24  DC  C "C3'" 1 
ATOM   6019 O  "O3'" . DC  C 2 21  ? -11.454 7.477   -32.372 1.00 89.02  ? 24  DC  C "O3'" 1 
ATOM   6020 C  "C2'" . DC  C 2 21  ? -10.291 5.403   -32.782 1.00 84.52  ? 24  DC  C "C2'" 1 
ATOM   6021 C  "C1'" . DC  C 2 21  ? -8.920  5.980   -32.502 1.00 83.61  ? 24  DC  C "C1'" 1 
ATOM   6022 N  N1    . DC  C 2 21  ? -7.750  5.187   -32.934 1.00 81.13  ? 24  DC  C N1    1 
ATOM   6023 C  C2    . DC  C 2 21  ? -6.580  5.871   -33.285 1.00 80.76  ? 24  DC  C C2    1 
ATOM   6024 O  O2    . DC  C 2 21  ? -6.563  7.109   -33.213 1.00 82.49  ? 24  DC  C O2    1 
ATOM   6025 N  N3    . DC  C 2 21  ? -5.498  5.168   -33.696 1.00 78.70  ? 24  DC  C N3    1 
ATOM   6026 C  C4    . DC  C 2 21  ? -5.556  3.836   -33.766 1.00 77.03  ? 24  DC  C C4    1 
ATOM   6027 N  N4    . DC  C 2 21  ? -4.461  3.184   -34.160 1.00 75.18  ? 24  DC  C N4    1 
ATOM   6028 C  C5    . DC  C 2 21  ? -6.736  3.113   -33.418 1.00 77.34  ? 24  DC  C C5    1 
ATOM   6029 C  C6    . DC  C 2 21  ? -7.799  3.821   -33.012 1.00 79.41  ? 24  DC  C C6    1 
ATOM   6030 P  P     . DG  C 2 22  ? -12.745 7.613   -33.292 1.00 90.90  ? 25  DG  C P     1 
ATOM   6031 O  OP1   . DG  C 2 22  ? -13.919 7.777   -32.397 1.00 93.00  ? 25  DG  C OP1   1 
ATOM   6032 O  OP2   . DG  C 2 22  ? -12.735 6.504   -34.283 1.00 89.21  ? 25  DG  C OP2   1 
ATOM   6033 O  "O5'" . DG  C 2 22  ? -12.480 8.977   -34.069 1.00 92.48  ? 25  DG  C "O5'" 1 
ATOM   6034 C  "C5'" . DG  C 2 22  ? -12.158 10.199  -33.371 1.00 94.02  ? 25  DG  C "C5'" 1 
ATOM   6035 C  "C4'" . DG  C 2 22  ? -10.978 10.879  -34.026 1.00 93.48  ? 25  DG  C "C4'" 1 
ATOM   6036 O  "O4'" . DG  C 2 22  ? -9.877  9.943   -34.124 1.00 90.56  ? 25  DG  C "O4'" 1 
ATOM   6037 C  "C3'" . DG  C 2 22  ? -11.235 11.371  -35.455 1.00 94.53  ? 25  DG  C "C3'" 1 
ATOM   6038 O  "O3'" . DG  C 2 22  ? -10.592 12.632  -35.681 1.00 95.85  ? 25  DG  C "O3'" 1 
ATOM   6039 C  "C2'" . DG  C 2 22  ? -10.628 10.271  -36.303 1.00 91.98  ? 25  DG  C "C2'" 1 
ATOM   6040 C  "C1'" . DG  C 2 22  ? -9.423  9.920   -35.465 1.00 89.95  ? 25  DG  C "C1'" 1 
ATOM   6041 N  N9    . DG  C 2 22  ? -8.878  8.598   -35.733 1.00 87.28  ? 25  DG  C N9    1 
ATOM   6042 C  C8    . DG  C 2 22  ? -9.544  7.397   -35.698 1.00 86.29  ? 25  DG  C C8    1 
ATOM   6043 N  N7    . DG  C 2 22  ? -8.782  6.382   -36.001 1.00 83.98  ? 25  DG  C N7    1 
ATOM   6044 C  C5    . DG  C 2 22  ? -7.543  6.948   -36.266 1.00 83.43  ? 25  DG  C C5    1 
ATOM   6045 C  C6    . DG  C 2 22  ? -6.319  6.344   -36.647 1.00 81.37  ? 25  DG  C C6    1 
ATOM   6046 O  O6    . DG  C 2 22  ? -6.079  5.148   -36.838 1.00 79.55  ? 25  DG  C O6    1 
ATOM   6047 N  N1    . DG  C 2 22  ? -5.308  7.289   -36.808 1.00 81.77  ? 25  DG  C N1    1 
ATOM   6048 C  C2    . DG  C 2 22  ? -5.458  8.643   -36.630 1.00 83.88  ? 25  DG  C C2    1 
ATOM   6049 N  N2    . DG  C 2 22  ? -4.367  9.396   -36.832 1.00 84.09  ? 25  DG  C N2    1 
ATOM   6050 N  N3    . DG  C 2 22  ? -6.593  9.217   -36.268 1.00 85.81  ? 25  DG  C N3    1 
ATOM   6051 C  C4    . DG  C 2 22  ? -7.586  8.316   -36.103 1.00 85.45  ? 25  DG  C C4    1 
ATOM   6052 P  P     . DT  C 2 23  ? -10.653 13.344  -37.131 1.00 97.17  ? 26  DT  C P     1 
ATOM   6053 O  OP1   . DT  C 2 23  ? -10.711 14.816  -36.925 1.00 99.89  ? 26  DT  C OP1   1 
ATOM   6054 O  OP2   . DT  C 2 23  ? -11.702 12.674  -37.950 1.00 97.34  ? 26  DT  C OP2   1 
ATOM   6055 O  "O5'" . DT  C 2 23  ? -9.240  12.980  -37.765 1.00 94.92  ? 26  DT  C "O5'" 1 
ATOM   6056 C  "C5'" . DT  C 2 23  ? -8.020  13.427  -37.147 1.00 94.33  ? 26  DT  C "C5'" 1 
ATOM   6057 C  "C4'" . DT  C 2 23  ? -6.856  13.212  -38.084 1.00 92.87  ? 26  DT  C "C4'" 1 
ATOM   6058 O  "O4'" . DT  C 2 23  ? -6.580  11.794  -38.192 1.00 90.19  ? 26  DT  C "O4'" 1 
ATOM   6059 C  "C3'" . DT  C 2 23  ? -7.068  13.716  -39.517 1.00 94.20  ? 26  DT  C "C3'" 1 
ATOM   6060 O  "O3'" . DT  C 2 23  ? -5.904  14.444  -39.920 1.00 94.52  ? 26  DT  C "O3'" 1 
ATOM   6061 C  "C2'" . DT  C 2 23  ? -7.299  12.441  -40.310 1.00 92.37  ? 26  DT  C "C2'" 1 
ATOM   6062 C  "C1'" . DT  C 2 23  ? -6.428  11.455  -39.557 1.00 89.73  ? 26  DT  C "C1'" 1 
ATOM   6063 N  N1    . DT  C 2 23  ? -6.804  10.032  -39.724 1.00 87.83  ? 26  DT  C N1    1 
ATOM   6064 C  C2    . DT  C 2 23  ? -5.858  9.147   -40.196 1.00 85.71  ? 26  DT  C C2    1 
ATOM   6065 O  O2    . DT  C 2 23  ? -4.720  9.477   -40.486 1.00 85.33  ? 26  DT  C O2    1 
ATOM   6066 N  N3    . DT  C 2 23  ? -6.302  7.854   -40.331 1.00 84.23  ? 26  DT  C N3    1 
ATOM   6067 C  C4    . DT  C 2 23  ? -7.564  7.370   -40.041 1.00 84.67  ? 26  DT  C C4    1 
ATOM   6068 O  O4    . DT  C 2 23  ? -7.815  6.182   -40.210 1.00 83.31  ? 26  DT  C O4    1 
ATOM   6069 C  C5    . DT  C 2 23  ? -8.503  8.353   -39.547 1.00 86.94  ? 26  DT  C C5    1 
ATOM   6070 C  C7    . DT  C 2 23  ? -9.894  7.921   -39.203 1.00 87.78  ? 26  DT  C C7    1 
ATOM   6071 C  C6    . DT  C 2 23  ? -8.082  9.617   -39.416 1.00 88.38  ? 26  DT  C C6    1 
ATOM   6072 P  P     . DT  C 2 24  ? -5.759  15.030  -41.409 1.00 95.83  ? 27  DT  C P     1 
ATOM   6073 O  OP1   . DT  C 2 24  ? -5.173  16.389  -41.315 1.00 97.87  ? 27  DT  C OP1   1 
ATOM   6074 O  OP2   . DT  C 2 24  ? -7.045  14.838  -42.122 1.00 96.80  ? 27  DT  C OP2   1 
ATOM   6075 O  "O5'" . DT  C 2 24  ? -4.641  14.091  -42.042 1.00 93.42  ? 27  DT  C "O5'" 1 
ATOM   6076 C  "C5'" . DT  C 2 24  ? -3.322  14.055  -41.460 1.00 92.20  ? 27  DT  C "C5'" 1 
ATOM   6077 C  "C4'" . DT  C 2 24  ? -2.458  13.040  -42.170 1.00 90.09  ? 27  DT  C "C4'" 1 
ATOM   6078 O  "O4'" . DT  C 2 24  ? -3.077  11.729  -42.104 1.00 88.25  ? 27  DT  C "O4'" 1 
ATOM   6079 C  "C3'" . DT  C 2 24  ? -2.223  13.323  -43.657 1.00 91.04  ? 27  DT  C "C3'" 1 
ATOM   6080 O  "O3'" . DT  C 2 24  ? -0.837  13.071  -43.938 1.00 89.97  ? 27  DT  C "O3'" 1 
ATOM   6081 C  "C2'" . DT  C 2 24  ? -3.192  12.375  -44.343 1.00 90.32  ? 27  DT  C "C2'" 1 
ATOM   6082 C  "C1'" . DT  C 2 24  ? -3.136  11.180  -43.410 1.00 87.91  ? 27  DT  C "C1'" 1 
ATOM   6083 N  N1    . DT  C 2 24  ? -4.297  10.264  -43.474 1.00 87.28  ? 27  DT  C N1    1 
ATOM   6084 C  C2    . DT  C 2 24  ? -4.067  8.926   -43.718 1.00 85.17  ? 27  DT  C C2    1 
ATOM   6085 O  O2    . DT  C 2 24  ? -2.951  8.460   -43.893 1.00 83.80  ? 27  DT  C O2    1 
ATOM   6086 N  N3    . DT  C 2 24  ? -5.199  8.148   -43.752 1.00 84.89  ? 27  DT  C N3    1 
ATOM   6087 C  C4    . DT  C 2 24  ? -6.506  8.566   -43.570 1.00 86.50  ? 27  DT  C C4    1 
ATOM   6088 O  O4    . DT  C 2 24  ? -7.422  7.751   -43.634 1.00 86.16  ? 27  DT  C O4    1 
ATOM   6089 C  C5    . DT  C 2 24  ? -6.673  9.982   -43.320 1.00 88.68  ? 27  DT  C C5    1 
ATOM   6090 C  C7    . DT  C 2 24  ? -8.050  10.525  -43.104 1.00 90.71  ? 27  DT  C C7    1 
ATOM   6091 C  C6    . DT  C 2 24  ? -5.575  10.748  -43.283 1.00 88.95  ? 27  DT  C C6    1 
ATOM   6092 P  P     . DT  C 2 25  ? -0.184  13.410  -45.378 1.00 90.98  ? 28  DT  C P     1 
ATOM   6093 O  OP1   . DT  C 2 25  ? 0.863   14.450  -45.174 1.00 92.28  ? 28  DT  C OP1   1 
ATOM   6094 O  OP2   . DT  C 2 25  ? -1.283  13.653  -46.363 1.00 92.46  ? 28  DT  C OP2   1 
ATOM   6095 O  "O5'" . DT  C 2 25  ? 0.543   12.039  -45.753 1.00 88.55  ? 28  DT  C "O5'" 1 
ATOM   6096 C  "C5'" . DT  C 2 25  ? -0.055  10.767  -45.414 1.00 86.54  ? 28  DT  C "C5'" 1 
ATOM   6097 C  "C4'" . DT  C 2 25  ? 0.526   9.643   -46.239 1.00 85.02  ? 28  DT  C "C4'" 1 
ATOM   6098 O  "O4'" . DT  C 2 25  ? -0.459  8.589   -46.343 1.00 83.92  ? 28  DT  C "O4'" 1 
ATOM   6099 C  "C3'" . DT  C 2 25  ? 0.890   9.994   -47.680 1.00 86.35  ? 28  DT  C "C3'" 1 
ATOM   6100 O  "O3'" . DT  C 2 25  ? 1.954   9.149   -48.127 1.00 85.05  ? 28  DT  C "O3'" 1 
ATOM   6101 C  "C2'" . DT  C 2 25  ? -0.400  9.726   -48.434 1.00 86.93  ? 28  DT  C "C2'" 1 
ATOM   6102 C  "C1'" . DT  C 2 25  ? -1.043  8.582   -47.640 1.00 84.99  ? 28  DT  C "C1'" 1 
ATOM   6103 N  N1    . DT  C 2 25  ? -2.520  8.622   -47.476 1.00 85.69  ? 28  DT  C N1    1 
ATOM   6104 C  C2    . DT  C 2 25  ? -3.192  7.420   -47.390 1.00 84.31  ? 28  DT  C C2    1 
ATOM   6105 O  O2    . DT  C 2 25  ? -2.634  6.336   -47.444 1.00 82.55  ? 28  DT  C O2    1 
ATOM   6106 N  N3    . DT  C 2 25  ? -4.553  7.534   -47.249 1.00 85.26  ? 28  DT  C N3    1 
ATOM   6107 C  C4    . DT  C 2 25  ? -5.291  8.702   -47.182 1.00 87.40  ? 28  DT  C C4    1 
ATOM   6108 O  O4    . DT  C 2 25  ? -6.512  8.646   -47.062 1.00 88.18  ? 28  DT  C O4    1 
ATOM   6109 C  C5    . DT  C 2 25  ? -4.522  9.925   -47.269 1.00 88.74  ? 28  DT  C C5    1 
ATOM   6110 C  C7    . DT  C 2 25  ? -5.234  11.239  -47.202 1.00 91.24  ? 28  DT  C C7    1 
ATOM   6111 C  C6    . DT  C 2 25  ? -3.194  9.824   -47.406 1.00 87.83  ? 28  DT  C C6    1 
ATOM   6112 O  "O5'" . DA  D 3 1   ? -9.439  -1.747  -47.076 1.00 78.75  ? 29  DA  D "O5'" 1 
ATOM   6113 C  "C5'" . DA  D 3 1   ? -8.729  -2.659  -47.929 1.00 77.77  ? 29  DA  D "C5'" 1 
ATOM   6114 C  "C4'" . DA  D 3 1   ? -7.257  -2.317  -47.957 1.00 76.75  ? 29  DA  D "C4'" 1 
ATOM   6115 O  "O4'" . DA  D 3 1   ? -7.094  -0.892  -48.147 1.00 77.98  ? 29  DA  D "O4'" 1 
ATOM   6116 C  "C3'" . DA  D 3 1   ? -6.488  -2.676  -46.685 1.00 75.07  ? 29  DA  D "C3'" 1 
ATOM   6117 O  "O3'" . DA  D 3 1   ? -5.270  -3.360  -47.017 1.00 73.75  ? 29  DA  D "O3'" 1 
ATOM   6118 C  "C2'" . DA  D 3 1   ? -6.290  -1.340  -45.987 1.00 75.68  ? 29  DA  D "C2'" 1 
ATOM   6119 C  "C1'" . DA  D 3 1   ? -6.286  -0.336  -47.124 1.00 77.24  ? 29  DA  D "C1'" 1 
ATOM   6120 N  N9    . DA  D 3 1   ? -6.837  0.976   -46.781 1.00 78.80  ? 29  DA  D N9    1 
ATOM   6121 C  C8    . DA  D 3 1   ? -8.058  1.268   -46.225 1.00 79.88  ? 29  DA  D C8    1 
ATOM   6122 N  N7    . DA  D 3 1   ? -8.265  2.551   -46.049 1.00 81.37  ? 29  DA  D N7    1 
ATOM   6123 C  C5    . DA  D 3 1   ? -7.105  3.144   -46.526 1.00 81.25  ? 29  DA  D C5    1 
ATOM   6124 C  C6    . DA  D 3 1   ? -6.698  4.487   -46.623 1.00 82.55  ? 29  DA  D C6    1 
ATOM   6125 N  N6    . DA  D 3 1   ? -7.441  5.520   -46.218 1.00 84.27  ? 29  DA  D N6    1 
ATOM   6126 N  N1    . DA  D 3 1   ? -5.476  4.737   -47.143 1.00 82.18  ? 29  DA  D N1    1 
ATOM   6127 C  C2    . DA  D 3 1   ? -4.725  3.702   -47.543 1.00 80.62  ? 29  DA  D C2    1 
ATOM   6128 N  N3    . DA  D 3 1   ? -4.998  2.399   -47.504 1.00 79.30  ? 29  DA  D N3    1 
ATOM   6129 C  C4    . DA  D 3 1   ? -6.217  2.185   -46.980 1.00 79.68  ? 29  DA  D C4    1 
ATOM   6130 P  P     . DA  D 3 2   ? -4.323  -3.967  -45.868 1.00 71.90  ? 30  DA  D P     1 
ATOM   6131 O  OP1   . DA  D 3 2   ? -3.652  -5.176  -46.399 1.00 70.87  ? 30  DA  D OP1   1 
ATOM   6132 O  OP2   . DA  D 3 2   ? -5.105  -4.058  -44.609 1.00 71.72  ? 30  DA  D OP2   1 
ATOM   6133 O  "O5'" . DA  D 3 2   ? -3.231  -2.827  -45.682 1.00 71.95  ? 30  DA  D "O5'" 1 
ATOM   6134 C  "C5'" . DA  D 3 2   ? -2.612  -2.179  -46.806 1.00 72.80  ? 30  DA  D "C5'" 1 
ATOM   6135 C  "C4'" . DA  D 3 2   ? -1.808  -1.000  -46.315 1.00 73.08  ? 30  DA  D "C4'" 1 
ATOM   6136 O  "O4'" . DA  D 3 2   ? -2.703  0.118   -46.091 1.00 74.54  ? 30  DA  D "O4'" 1 
ATOM   6137 C  "C3'" . DA  D 3 2   ? -1.102  -1.251  -44.977 1.00 71.64  ? 30  DA  D "C3'" 1 
ATOM   6138 O  "O3'" . DA  D 3 2   ? 0.253   -0.793  -44.932 1.00 71.37  ? 30  DA  D "O3'" 1 
ATOM   6139 C  "C2'" . DA  D 3 2   ? -1.941  -0.470  -43.984 1.00 72.31  ? 30  DA  D "C2'" 1 
ATOM   6140 C  "C1'" . DA  D 3 2   ? -2.385  0.690   -44.837 1.00 74.21  ? 30  DA  D "C1'" 1 
ATOM   6141 N  N9    . DA  D 3 2   ? -3.554  1.409   -44.340 1.00 75.46  ? 30  DA  D N9    1 
ATOM   6142 C  C8    . DA  D 3 2   ? -4.688  0.909   -43.748 1.00 75.47  ? 30  DA  D C8    1 
ATOM   6143 N  N7    . DA  D 3 2   ? -5.542  1.833   -43.383 1.00 76.98  ? 30  DA  D N7    1 
ATOM   6144 C  C5    . DA  D 3 2   ? -4.921  3.021   -43.741 1.00 77.98  ? 30  DA  D C5    1 
ATOM   6145 C  C6    . DA  D 3 2   ? -5.314  4.367   -43.625 1.00 79.86  ? 30  DA  D C6    1 
ATOM   6146 N  N6    . DA  D 3 2   ? -6.472  4.755   -43.086 1.00 81.09  ? 30  DA  D N6    1 
ATOM   6147 N  N1    . DA  D 3 2   ? -4.467  5.313   -44.092 1.00 80.60  ? 30  DA  D N1    1 
ATOM   6148 C  C2    . DA  D 3 2   ? -3.307  4.922   -44.636 1.00 79.55  ? 30  DA  D C2    1 
ATOM   6149 N  N3    . DA  D 3 2   ? -2.828  3.689   -44.800 1.00 77.81  ? 30  DA  D N3    1 
ATOM   6150 C  C4    . DA  D 3 2   ? -3.693  2.775   -44.324 1.00 77.07  ? 30  DA  D C4    1 
ATOM   6151 P  P     . DA  D 3 3   ? 1.244   -1.345  -43.794 1.00 69.72  ? 31  DA  D P     1 
ATOM   6152 O  OP1   . DA  D 3 3   ? 2.372   -2.022  -44.468 1.00 69.08  ? 31  DA  D OP1   1 
ATOM   6153 O  OP2   . DA  D 3 3   ? 0.443   -2.081  -42.777 1.00 68.83  ? 31  DA  D OP2   1 
ATOM   6154 O  "O5'" . DA  D 3 3   ? 1.749   -0.015  -43.080 1.00 70.39  ? 31  DA  D "O5'" 1 
ATOM   6155 C  "C5'" . DA  D 3 3   ? 2.303   1.069   -43.839 1.00 71.76  ? 31  DA  D "C5'" 1 
ATOM   6156 C  "C4'" . DA  D 3 3   ? 1.884   2.391   -43.239 1.00 73.03  ? 31  DA  D "C4'" 1 
ATOM   6157 O  "O4'" . DA  D 3 3   ? 0.449   2.459   -43.089 1.00 73.65  ? 31  DA  D "O4'" 1 
ATOM   6158 C  "C3'" . DA  D 3 3   ? 2.441   2.669   -41.843 1.00 72.38  ? 31  DA  D "C3'" 1 
ATOM   6159 O  "O3'" . DA  D 3 3   ? 3.570   3.545   -41.871 1.00 73.06  ? 31  DA  D "O3'" 1 
ATOM   6160 C  "C2'" . DA  D 3 3   ? 1.279   3.317   -41.101 1.00 73.28  ? 31  DA  D "C2'" 1 
ATOM   6161 C  "C1'" . DA  D 3 3   ? 0.215   3.499   -42.160 1.00 74.52  ? 31  DA  D "C1'" 1 
ATOM   6162 N  N9    . DA  D 3 3   ? -1.142  3.371   -41.634 1.00 74.87  ? 31  DA  D N9    1 
ATOM   6163 C  C8    . DA  D 3 3   ? -1.781  2.237   -41.198 1.00 73.74  ? 31  DA  D C8    1 
ATOM   6164 N  N7    . DA  D 3 3   ? -2.987  2.456   -40.733 1.00 74.64  ? 31  DA  D N7    1 
ATOM   6165 C  C5    . DA  D 3 3   ? -3.142  3.831   -40.843 1.00 76.43  ? 31  DA  D C5    1 
ATOM   6166 C  C6    . DA  D 3 3   ? -4.203  4.694   -40.512 1.00 78.20  ? 31  DA  D C6    1 
ATOM   6167 N  N6    . DA  D 3 3   ? -5.354  4.279   -39.978 1.00 78.46  ? 31  DA  D N6    1 
ATOM   6168 N  N1    . DA  D 3 3   ? -4.040  6.015   -40.752 1.00 79.88  ? 31  DA  D N1    1 
ATOM   6169 C  C2    . DA  D 3 3   ? -2.882  6.431   -41.282 1.00 79.78  ? 31  DA  D C2    1 
ATOM   6170 N  N3    . DA  D 3 3   ? -1.811  5.718   -41.633 1.00 78.25  ? 31  DA  D N3    1 
ATOM   6171 C  C4    . DA  D 3 3   ? -2.008  4.409   -41.383 1.00 76.58  ? 31  DA  D C4    1 
ATOM   6172 P  P     . DC  D 3 4   ? 4.278   3.959   -40.493 1.00 72.64  ? 32  DC  D P     1 
ATOM   6173 O  OP1   . DC  D 3 4   ? 5.692   4.307   -40.782 1.00 72.88  ? 32  DC  D OP1   1 
ATOM   6174 O  OP2   . DC  D 3 4   ? 3.973   2.912   -39.481 1.00 70.97  ? 32  DC  D OP2   1 
ATOM   6175 O  "O5'" . DC  D 3 4   ? 3.505   5.285   -40.067 1.00 74.40  ? 32  DC  D "O5'" 1 
ATOM   6176 C  "C5'" . DC  D 3 4   ? 3.344   6.411   -40.960 1.00 76.41  ? 32  DC  D "C5'" 1 
ATOM   6177 C  "C4'" . DC  D 3 4   ? 2.368   7.393   -40.354 1.00 77.88  ? 32  DC  D "C4'" 1 
ATOM   6178 O  "O4'" . DC  D 3 4   ? 1.086   6.746   -40.190 1.00 77.45  ? 32  DC  D "O4'" 1 
ATOM   6179 C  "C3'" . DC  D 3 4   ? 2.766   7.890   -38.961 1.00 77.87  ? 32  DC  D "C3'" 1 
ATOM   6180 O  "O3'" . DC  D 3 4   ? 3.310   9.213   -39.021 1.00 79.69  ? 32  DC  D "O3'" 1 
ATOM   6181 C  "C2'" . DC  D 3 4   ? 1.482   7.834   -38.143 1.00 78.07  ? 32  DC  D "C2'" 1 
ATOM   6182 C  "C1'" . DC  D 3 4   ? 0.404   7.343   -39.098 1.00 78.24  ? 32  DC  D "C1'" 1 
ATOM   6183 N  N1    . DC  D 3 4   ? -0.506  6.333   -38.510 1.00 77.14  ? 32  DC  D N1    1 
ATOM   6184 C  C2    . DC  D 3 4   ? -1.767  6.735   -38.052 1.00 78.39  ? 32  DC  D C2    1 
ATOM   6185 O  O2    . DC  D 3 4   ? -2.101  7.923   -38.173 1.00 80.37  ? 32  DC  D O2    1 
ATOM   6186 N  N3    . DC  D 3 4   ? -2.596  5.817   -37.505 1.00 77.58  ? 32  DC  D N3    1 
ATOM   6187 C  C4    . DC  D 3 4   ? -2.208  4.544   -37.407 1.00 75.58  ? 32  DC  D C4    1 
ATOM   6188 N  N4    . DC  D 3 4   ? -3.060  3.675   -36.868 1.00 75.00  ? 32  DC  D N4    1 
ATOM   6189 C  C5    . DC  D 3 4   ? -0.931  4.108   -37.861 1.00 74.26  ? 32  DC  D C5    1 
ATOM   6190 C  C6    . DC  D 3 4   ? -0.115  5.028   -38.393 1.00 75.10  ? 32  DC  D C6    1 
ATOM   6191 P  P     . DG  D 3 5   ? 4.094   9.819   -37.757 1.00 79.90  ? 33  DG  D P     1 
ATOM   6192 O  OP1   . DG  D 3 5   ? 5.025   10.863  -38.251 1.00 81.48  ? 33  DG  D OP1   1 
ATOM   6193 O  OP2   . DG  D 3 5   ? 4.618   8.698   -36.937 1.00 77.68  ? 33  DG  D OP2   1 
ATOM   6194 O  "O5'" . DG  D 3 5   ? 2.941   10.543  -36.927 1.00 81.24  ? 33  DG  D "O5'" 1 
ATOM   6195 C  "C5'" . DG  D 3 5   ? 2.061   11.505  -37.554 1.00 83.42  ? 33  DG  D "C5'" 1 
ATOM   6196 C  "C4'" . DG  D 3 5   ? 1.178   12.185  -36.530 1.00 84.74  ? 33  DG  D "C4'" 1 
ATOM   6197 O  "O4'" . DG  D 3 5   ? 0.090   11.322  -36.121 1.00 83.80  ? 33  DG  D "O4'" 1 
ATOM   6198 C  "C3'" . DG  D 3 5   ? 1.863   12.615  -35.236 1.00 84.85  ? 33  DG  D "C3'" 1 
ATOM   6199 O  "O3'" . DG  D 3 5   ? 1.249   13.846  -34.858 1.00 87.32  ? 33  DG  D "O3'" 1 
ATOM   6200 C  "C2'" . DG  D 3 5   ? 1.572   11.467  -34.281 1.00 82.85  ? 33  DG  D "C2'" 1 
ATOM   6201 C  "C1'" . DG  D 3 5   ? 0.211   10.968  -34.746 1.00 82.88  ? 33  DG  D "C1'" 1 
ATOM   6202 N  N9    . DG  D 3 5   ? -0.007  9.530   -34.650 1.00 80.67  ? 33  DG  D N9    1 
ATOM   6203 C  C8    . DG  D 3 5   ? 0.894   8.524   -34.901 1.00 78.59  ? 33  DG  D C8    1 
ATOM   6204 N  N7    . DG  D 3 5   ? 0.373   7.332   -34.796 1.00 77.10  ? 33  DG  D N7    1 
ATOM   6205 C  C5    . DG  D 3 5   ? -0.959  7.567   -34.487 1.00 78.28  ? 33  DG  D C5    1 
ATOM   6206 C  C6    . DG  D 3 5   ? -2.025  6.658   -34.256 1.00 77.72  ? 33  DG  D C6    1 
ATOM   6207 O  O6    . DG  D 3 5   ? -2.004  5.423   -34.280 1.00 75.99  ? 33  DG  D O6    1 
ATOM   6208 N  N1    . DG  D 3 5   ? -3.212  7.324   -33.969 1.00 79.62  ? 33  DG  D N1    1 
ATOM   6209 C  C2    . DG  D 3 5   ? -3.357  8.688   -33.913 1.00 81.78  ? 33  DG  D C2    1 
ATOM   6210 N  N2    . DG  D 3 5   ? -4.584  9.144   -33.623 1.00 83.57  ? 33  DG  D N2    1 
ATOM   6211 N  N3    . DG  D 3 5   ? -2.374  9.545   -34.134 1.00 82.33  ? 33  DG  D N3    1 
ATOM   6212 C  C4    . DG  D 3 5   ? -1.212  8.919   -34.409 1.00 80.50  ? 33  DG  D C4    1 
ATOM   6213 P  P     . DA  D 3 6   ? 1.751   14.641  -33.582 1.00 88.33  ? 34  DA  D P     1 
ATOM   6214 O  OP1   . DA  D 3 6   ? 1.629   16.090  -33.873 1.00 91.21  ? 34  DA  D OP1   1 
ATOM   6215 O  OP2   . DA  D 3 6   ? 3.057   14.080  -33.175 1.00 86.56  ? 34  DA  D OP2   1 
ATOM   6216 O  "O5'" . DA  D 3 6   ? 0.680   14.239  -32.476 1.00 88.11  ? 34  DA  D "O5'" 1 
ATOM   6217 C  "C5'" . DA  D 3 6   ? -0.718  14.543  -32.661 1.00 89.63  ? 34  DA  D "C5'" 1 
ATOM   6218 C  "C4'" . DA  D 3 6   ? -1.526  14.081  -31.471 1.00 89.35  ? 34  DA  D "C4'" 1 
ATOM   6219 O  "O4'" . DA  D 3 6   ? -1.737  12.650  -31.563 1.00 86.93  ? 34  DA  D "O4'" 1 
ATOM   6220 C  "C3'" . DA  D 3 6   ? -0.874  14.324  -30.106 1.00 89.35  ? 34  DA  D "C3'" 1 
ATOM   6221 O  "O3'" . DA  D 3 6   ? -1.865  14.761  -29.165 1.00 91.06  ? 34  DA  D "O3'" 1 
ATOM   6222 C  "C2'" . DA  D 3 6   ? -0.297  12.964  -29.761 1.00 86.43  ? 34  DA  D "C2'" 1 
ATOM   6223 C  "C1'" . DA  D 3 6   ? -1.362  12.056  -30.340 1.00 85.61  ? 34  DA  D "C1'" 1 
ATOM   6224 N  N9    . DA  D 3 6   ? -0.949  10.683  -30.612 1.00 82.93  ? 34  DA  D N9    1 
ATOM   6225 C  C8    . DA  D 3 6   ? 0.299   10.205  -30.928 1.00 81.22  ? 34  DA  D C8    1 
ATOM   6226 N  N7    . DA  D 3 6   ? 0.339   8.906   -31.095 1.00 79.11  ? 34  DA  D N7    1 
ATOM   6227 C  C5    . DA  D 3 6   ? -0.967  8.500   -30.864 1.00 79.43  ? 34  DA  D C5    1 
ATOM   6228 C  C6    . DA  D 3 6   ? -1.582  7.237   -30.889 1.00 78.01  ? 34  DA  D C6    1 
ATOM   6229 N  N6    . DA  D 3 6   ? -0.930  6.107   -31.164 1.00 75.86  ? 34  DA  D N6    1 
ATOM   6230 N  N1    . DA  D 3 6   ? -2.906  7.176   -30.620 1.00 79.05  ? 34  DA  D N1    1 
ATOM   6231 C  C2    . DA  D 3 6   ? -3.558  8.315   -30.346 1.00 81.38  ? 34  DA  D C2    1 
ATOM   6232 N  N3    . DA  D 3 6   ? -3.089  9.561   -30.293 1.00 82.91  ? 34  DA  D N3    1 
ATOM   6233 C  C4    . DA  D 3 6   ? -1.772  9.584   -30.566 1.00 81.79  ? 34  DA  D C4    1 
ATOM   6234 P  P     . DC  D 3 7   ? -1.453  15.216  -27.665 1.00 91.80  ? 35  DC  D P     1 
ATOM   6235 O  OP1   . DC  D 3 7   ? -2.058  16.549  -27.412 1.00 95.00  ? 35  DC  D OP1   1 
ATOM   6236 O  OP2   . DC  D 3 7   ? 0.015   15.033  -27.490 1.00 90.29  ? 35  DC  D OP2   1 
ATOM   6237 O  "O5'" . DC  D 3 7   ? -2.187  14.136  -26.746 1.00 90.55  ? 35  DC  D "O5'" 1 
ATOM   6238 C  "C5'" . DC  D 3 7   ? -3.623  13.974  -26.774 1.00 91.61  ? 35  DC  D "C5'" 1 
ATOM   6239 C  "C4'" . DC  D 3 7   ? -4.003  12.571  -26.362 1.00 89.53  ? 35  DC  D "C4'" 1 
ATOM   6240 O  "O4'" . DC  D 3 7   ? -3.340  11.624  -27.226 1.00 87.00  ? 35  DC  D "O4'" 1 
ATOM   6241 C  "C3'" . DC  D 3 7   ? -3.577  12.185  -24.947 1.00 88.78  ? 35  DC  D "C3'" 1 
ATOM   6242 O  "O3'" . DC  D 3 7   ? -4.599  12.352  -23.956 1.00 90.50  ? 35  DC  D "O3'" 1 
ATOM   6243 C  "C2'" . DC  D 3 7   ? -3.246  10.709  -25.058 1.00 85.85  ? 35  DC  D "C2'" 1 
ATOM   6244 C  "C1'" . DC  D 3 7   ? -3.240  10.389  -26.541 1.00 84.94  ? 35  DC  D "C1'" 1 
ATOM   6245 N  N1    . DC  D 3 7   ? -1.985  9.739   -26.935 1.00 82.59  ? 35  DC  D N1    1 
ATOM   6246 C  C2    . DC  D 3 7   ? -1.988  8.370   -27.238 1.00 80.36  ? 35  DC  D C2    1 
ATOM   6247 O  O2    . DC  D 3 7   ? -3.063  7.753   -27.234 1.00 80.42  ? 35  DC  D O2    1 
ATOM   6248 N  N3    . DC  D 3 7   ? -0.823  7.762   -27.559 1.00 78.37  ? 35  DC  D N3    1 
ATOM   6249 C  C4    . DC  D 3 7   ? 0.315   8.459   -27.556 1.00 78.54  ? 35  DC  D C4    1 
ATOM   6250 N  N4    . DC  D 3 7   ? 1.439   7.820   -27.881 1.00 76.70  ? 35  DC  D N4    1 
ATOM   6251 C  C5    . DC  D 3 7   ? 0.351   9.846   -27.223 1.00 80.78  ? 35  DC  D C5    1 
ATOM   6252 C  C6    . DC  D 3 7   ? -0.809  10.436  -26.907 1.00 82.73  ? 35  DC  D C6    1 
ATOM   6253 P  P     . DA  D 3 8   ? -4.297  11.967  -22.413 1.00 90.05  ? 36  DA  D P     1 
ATOM   6254 O  OP1   . DA  D 3 8   ? -5.220  12.756  -21.557 1.00 92.91  ? 36  DA  D OP1   1 
ATOM   6255 O  OP2   . DA  D 3 8   ? -2.823  12.021  -22.185 1.00 88.65  ? 36  DA  D OP2   1 
ATOM   6256 O  "O5'" . DA  D 3 8   ? -4.725  10.438  -22.315 1.00 87.92  ? 36  DA  D "O5'" 1 
ATOM   6257 C  "C5'" . DA  D 3 8   ? -6.048  9.992   -22.660 1.00 88.60  ? 36  DA  D "C5'" 1 
ATOM   6258 C  "C4'" . DA  D 3 8   ? -6.120  8.494   -22.482 1.00 86.33  ? 36  DA  D "C4'" 1 
ATOM   6259 O  "O4'" . DA  D 3 8   ? -5.140  7.867   -23.347 1.00 83.84  ? 36  DA  D "O4'" 1 
ATOM   6260 C  "C3'" . DA  D 3 8   ? -5.792  8.014   -21.068 1.00 85.79  ? 36  DA  D "C3'" 1 
ATOM   6261 O  "O3'" . DA  D 3 8   ? -6.671  6.931   -20.736 1.00 85.40  ? 36  DA  D "O3'" 1 
ATOM   6262 C  "C2'" . DA  D 3 8   ? -4.323  7.642   -21.171 1.00 83.40  ? 36  DA  D "C2'" 1 
ATOM   6263 C  "C1'" . DA  D 3 8   ? -4.254  7.071   -22.570 1.00 81.89  ? 36  DA  D "C1'" 1 
ATOM   6264 N  N9    . DA  D 3 8   ? -2.926  7.142   -23.177 1.00 80.35  ? 36  DA  D N9    1 
ATOM   6265 C  C8    . DA  D 3 8   ? -2.140  8.257   -23.323 1.00 81.23  ? 36  DA  D C8    1 
ATOM   6266 N  N7    . DA  D 3 8   ? -0.987  8.019   -23.896 1.00 79.60  ? 36  DA  D N7    1 
ATOM   6267 C  C5    . DA  D 3 8   ? -1.006  6.652   -24.128 1.00 77.47  ? 36  DA  D C5    1 
ATOM   6268 C  C6    . DA  D 3 8   ? -0.072  5.779   -24.710 1.00 75.25  ? 36  DA  D C6    1 
ATOM   6269 N  N6    . DA  D 3 8   ? 1.111   6.171   -25.180 1.00 74.78  ? 36  DA  D N6    1 
ATOM   6270 N  N1    . DA  D 3 8   ? -0.395  4.470   -24.785 1.00 73.68  ? 36  DA  D N1    1 
ATOM   6271 C  C2    . DA  D 3 8   ? -1.582  4.075   -24.309 1.00 74.32  ? 36  DA  D C2    1 
ATOM   6272 N  N3    . DA  D 3 8   ? -2.547  4.802   -23.745 1.00 76.40  ? 36  DA  D N3    1 
ATOM   6273 C  C4    . DA  D 3 8   ? -2.191  6.097   -23.683 1.00 77.90  ? 36  DA  D C4    1 
ATOM   6274 P  P     . DT  D 3 9   ? -6.297  5.895   -19.578 1.00 83.95  ? 37  DT  D P     1 
ATOM   6275 O  OP1   . DT  D 3 9   ? -7.544  5.211   -19.158 1.00 84.88  ? 37  DT  D OP1   1 
ATOM   6276 O  OP2   . DT  D 3 9   ? -5.464  6.597   -18.567 1.00 84.45  ? 37  DT  D OP2   1 
ATOM   6277 O  "O5'" . DT  D 3 9   ? -5.370  4.847   -20.329 1.00 80.91  ? 37  DT  D "O5'" 1 
ATOM   6278 C  "C5'" . DT  D 3 9   ? -5.923  3.797   -21.131 1.00 79.81  ? 37  DT  D "C5'" 1 
ATOM   6279 C  "C4'" . DT  D 3 9   ? -5.099  2.550   -20.928 1.00 77.25  ? 37  DT  D "C4'" 1 
ATOM   6280 O  "O4'" . DT  D 3 9   ? -3.775  2.766   -21.469 1.00 75.75  ? 37  DT  D "O4'" 1 
ATOM   6281 C  "C3'" . DT  D 3 9   ? -4.898  2.144   -19.466 1.00 77.14  ? 37  DT  D "C3'" 1 
ATOM   6282 O  "O3'" . DT  D 3 9   ? -5.109  0.729   -19.395 1.00 75.72  ? 37  DT  D "O3'" 1 
ATOM   6283 C  "C2'" . DT  D 3 9   ? -3.498  2.645   -19.151 1.00 76.25  ? 37  DT  D "C2'" 1 
ATOM   6284 C  "C1'" . DT  D 3 9   ? -2.796  2.481   -20.483 1.00 74.68  ? 37  DT  D "C1'" 1 
ATOM   6285 N  N1    . DT  D 3 9   ? -1.628  3.365   -20.728 1.00 74.50  ? 37  DT  D N1    1 
ATOM   6286 C  C2    . DT  D 3 9   ? -0.524  2.815   -21.342 1.00 72.49  ? 37  DT  D C2    1 
ATOM   6287 O  O2    . DT  D 3 9   ? -0.462  1.644   -21.679 1.00 70.85  ? 37  DT  D O2    1 
ATOM   6288 N  N3    . DT  D 3 9   ? 0.515   3.691   -21.549 1.00 72.63  ? 37  DT  D N3    1 
ATOM   6289 C  C4    . DT  D 3 9   ? 0.554   5.033   -21.218 1.00 74.55  ? 37  DT  D C4    1 
ATOM   6290 O  O4    . DT  D 3 9   ? 1.555   5.696   -21.478 1.00 74.58  ? 37  DT  D O4    1 
ATOM   6291 C  C5    . DT  D 3 9   ? -0.642  5.548   -20.586 1.00 76.60  ? 37  DT  D C5    1 
ATOM   6292 C  C7    . DT  D 3 9   ? -0.693  6.991   -20.193 1.00 78.94  ? 37  DT  D C7    1 
ATOM   6293 C  C6    . DT  D 3 9   ? -1.661  4.701   -20.380 1.00 76.48  ? 37  DT  D C6    1 
ATOM   6294 P  P     . DT  D 3 10  ? -4.511  -0.144  -18.213 1.00 74.54  ? 38  DT  D P     1 
ATOM   6295 O  OP1   . DT  D 3 10  ? -5.352  -1.356  -18.079 1.00 74.34  ? 38  DT  D OP1   1 
ATOM   6296 O  OP2   . DT  D 3 10  ? -4.293  0.734   -17.034 1.00 75.90  ? 38  DT  D OP2   1 
ATOM   6297 O  "O5'" . DT  D 3 10  ? -3.110  -0.602  -18.802 1.00 72.07  ? 38  DT  D "O5'" 1 
ATOM   6298 C  "C5'" . DT  D 3 10  ? -3.056  -1.542  -19.879 1.00 70.54  ? 38  DT  D "C5'" 1 
ATOM   6299 C  "C4'" . DT  D 3 10  ? -1.662  -2.111  -19.975 1.00 68.39  ? 38  DT  D "C4'" 1 
ATOM   6300 O  "O4'" . DT  D 3 10  ? -0.715  -1.032  -20.153 1.00 68.50  ? 38  DT  D "O4'" 1 
ATOM   6301 C  "C3'" . DT  D 3 10  ? -1.191  -2.863  -18.733 1.00 67.61  ? 38  DT  D "C3'" 1 
ATOM   6302 O  "O3'" . DT  D 3 10  ? -0.293  -3.881  -19.152 1.00 65.56  ? 38  DT  D "O3'" 1 
ATOM   6303 C  "C2'" . DT  D 3 10  ? -0.385  -1.822  -17.985 1.00 68.15  ? 38  DT  D "C2'" 1 
ATOM   6304 C  "C1'" . DT  D 3 10  ? 0.282   -1.119  -19.150 1.00 67.80  ? 38  DT  D "C1'" 1 
ATOM   6305 N  N1    . DT  D 3 10  ? 0.807   0.242   -18.909 1.00 68.93  ? 38  DT  D N1    1 
ATOM   6306 C  C2    . DT  D 3 10  ? 2.072   0.529   -19.373 1.00 68.00  ? 38  DT  D C2    1 
ATOM   6307 O  O2    . DT  D 3 10  ? 2.774   -0.286  -19.948 1.00 66.30  ? 38  DT  D O2    1 
ATOM   6308 N  N3    . DT  D 3 10  ? 2.492   1.812   -19.131 1.00 69.29  ? 38  DT  D N3    1 
ATOM   6309 C  C4    . DT  D 3 10  ? 1.787   2.815   -18.491 1.00 71.40  ? 38  DT  D C4    1 
ATOM   6310 O  O4    . DT  D 3 10  ? 2.291   3.924   -18.358 1.00 72.52  ? 38  DT  D O4    1 
ATOM   6311 C  C5    . DT  D 3 10  ? 0.465   2.447   -18.037 1.00 72.31  ? 38  DT  D C5    1 
ATOM   6312 C  C7    . DT  D 3 10  ? -0.370  3.467   -17.329 1.00 74.79  ? 38  DT  D C7    1 
ATOM   6313 C  C6    . DT  D 3 10  ? 0.044   1.198   -18.272 1.00 71.04  ? 38  DT  D C6    1 
ATOM   6314 P  P     . DT  D 3 11  ? -0.340  -5.309  -18.477 1.00 64.58  ? 39  DT  D P     1 
ATOM   6315 O  OP1   . DT  D 3 11  ? -1.275  -6.146  -19.264 1.00 64.55  ? 39  DT  D OP1   1 
ATOM   6316 O  OP2   . DT  D 3 11  ? -0.557  -5.127  -17.019 1.00 65.56  ? 39  DT  D OP2   1 
ATOM   6317 O  "O5'" . DT  D 3 11  ? 1.123   -5.883  -18.729 1.00 62.60  ? 39  DT  D "O5'" 1 
ATOM   6318 C  "C5'" . DT  D 3 11  ? 1.789   -5.729  -20.000 1.00 61.74  ? 39  DT  D "C5'" 1 
ATOM   6319 C  "C4'" . DT  D 3 11  ? 3.219   -5.267  -19.812 1.00 61.02  ? 39  DT  D "C4'" 1 
ATOM   6320 O  "O4'" . DT  D 3 11  ? 3.291   -3.884  -19.393 1.00 62.33  ? 39  DT  D "O4'" 1 
ATOM   6321 C  "C3'" . DT  D 3 11  ? 4.051   -6.055  -18.794 1.00 60.00  ? 39  DT  D "C3'" 1 
ATOM   6322 O  "O3'" . DT  D 3 11  ? 5.124   -6.647  -19.517 1.00 58.58  ? 39  DT  D "O3'" 1 
ATOM   6323 C  "C2'" . DT  D 3 11  ? 4.559   -5.002  -17.819 1.00 60.82  ? 39  DT  D "C2'" 1 
ATOM   6324 C  "C1'" . DT  D 3 11  ? 4.490   -3.745  -18.651 1.00 61.78  ? 39  DT  D "C1'" 1 
ATOM   6325 N  N1    . DT  D 3 11  ? 4.430   -2.469  -17.905 1.00 63.32  ? 39  DT  D N1    1 
ATOM   6326 C  C2    . DT  D 3 11  ? 5.488   -1.596  -18.018 1.00 63.47  ? 39  DT  D C2    1 
ATOM   6327 O  O2    . DT  D 3 11  ? 6.481   -1.834  -18.686 1.00 62.40  ? 39  DT  D O2    1 
ATOM   6328 N  N3    . DT  D 3 11  ? 5.341   -0.424  -17.318 1.00 65.10  ? 39  DT  D N3    1 
ATOM   6329 C  C4    . DT  D 3 11  ? 4.267   -0.049  -16.536 1.00 66.60  ? 39  DT  D C4    1 
ATOM   6330 O  O4    . DT  D 3 11  ? 4.283   1.033   -15.956 1.00 68.13  ? 39  DT  D O4    1 
ATOM   6331 C  C5    . DT  D 3 11  ? 3.191   -1.011  -16.465 1.00 66.38  ? 39  DT  D C5    1 
ATOM   6332 C  C7    . DT  D 3 11  ? 1.982   -0.689  -15.645 1.00 68.16  ? 39  DT  D C7    1 
ATOM   6333 C  C6    . DT  D 3 11  ? 3.325   -2.157  -17.144 1.00 64.76  ? 39  DT  D C6    1 
ATOM   6334 P  P     . DC  D 3 12  ? 5.900   -7.870  -18.924 1.00 57.28  ? 40  DC  D P     1 
ATOM   6335 O  OP1   . DC  D 3 12  ? 6.498   -8.627  -20.053 1.00 56.15  ? 40  DC  D OP1   1 
ATOM   6336 O  OP2   . DC  D 3 12  ? 5.023   -8.553  -17.948 1.00 57.63  ? 40  DC  D OP2   1 
ATOM   6337 O  "O5'" . DC  D 3 12  ? 7.084   -7.165  -18.134 1.00 57.27  ? 40  DC  D "O5'" 1 
ATOM   6338 C  "C5'" . DC  D 3 12  ? 8.129   -6.473  -18.839 1.00 57.10  ? 40  DC  D "C5'" 1 
ATOM   6339 C  "C4'" . DC  D 3 12  ? 9.216   -6.059  -17.876 1.00 57.12  ? 40  DC  D "C4'" 1 
ATOM   6340 O  "O4'" . DC  D 3 12  ? 8.848   -4.810  -17.243 1.00 58.54  ? 40  DC  D "O4'" 1 
ATOM   6341 C  "C3'" . DC  D 3 12  ? 9.477   -7.041  -16.737 1.00 56.46  ? 40  DC  D "C3'" 1 
ATOM   6342 O  "O3'" . DC  D 3 12  ? 10.858  -6.966  -16.393 1.00 56.01  ? 40  DC  D "O3'" 1 
ATOM   6343 C  "C2'" . DC  D 3 12  ? 8.628   -6.482  -15.614 1.00 57.65  ? 40  DC  D "C2'" 1 
ATOM   6344 C  "C1'" . DC  D 3 12  ? 8.816   -4.988  -15.834 1.00 58.79  ? 40  DC  D "C1'" 1 
ATOM   6345 N  N1    . DC  D 3 12  ? 7.797   -4.078  -15.275 1.00 60.39  ? 40  DC  D N1    1 
ATOM   6346 C  C2    . DC  D 3 12  ? 7.956   -2.702  -15.478 1.00 61.61  ? 40  DC  D C2    1 
ATOM   6347 O  O2    . DC  D 3 12  ? 8.923   -2.301  -16.143 1.00 61.29  ? 40  DC  D O2    1 
ATOM   6348 N  N3    . DC  D 3 12  ? 7.049   -1.847  -14.949 1.00 63.26  ? 40  DC  D N3    1 
ATOM   6349 C  C4    . DC  D 3 12  ? 6.021   -2.320  -14.238 1.00 63.73  ? 40  DC  D C4    1 
ATOM   6350 N  N4    . DC  D 3 12  ? 5.148   -1.442  -13.739 1.00 65.56  ? 40  DC  D N4    1 
ATOM   6351 C  C5    . DC  D 3 12  ? 5.847   -3.715  -14.001 1.00 62.53  ? 40  DC  D C5    1 
ATOM   6352 C  C6    . DC  D 3 12  ? 6.753   -4.549  -14.527 1.00 60.88  ? 40  DC  D C6    1 
ATOM   6353 P  P     . DA  D 3 13  ? 11.731  -8.286  -16.264 1.00 54.69  ? 41  DA  D P     1 
ATOM   6354 O  OP1   . DA  D 3 13  ? 11.798  -8.919  -17.605 1.00 53.97  ? 41  DA  D OP1   1 
ATOM   6355 O  OP2   . DA  D 3 13  ? 11.229  -9.059  -15.097 1.00 54.61  ? 41  DA  D OP2   1 
ATOM   6356 O  "O5'" . DA  D 3 13  ? 13.179  -7.707  -15.941 1.00 54.76  ? 41  DA  D "O5'" 1 
ATOM   6357 C  "C5'" . DA  D 3 13  ? 13.898  -6.944  -16.937 1.00 55.01  ? 41  DA  D "C5'" 1 
ATOM   6358 C  "C4'" . DA  D 3 13  ? 14.524  -5.712  -16.323 1.00 56.04  ? 41  DA  D "C4'" 1 
ATOM   6359 O  "O4'" . DA  D 3 13  ? 13.494  -4.833  -15.804 1.00 57.16  ? 41  DA  D "O4'" 1 
ATOM   6360 C  "C3'" . DA  D 3 13  ? 15.476  -5.983  -15.154 1.00 55.87  ? 41  DA  D "C3'" 1 
ATOM   6361 O  "O3'" . DA  D 3 13  ? 16.634  -5.140  -15.275 1.00 56.49  ? 41  DA  D "O3'" 1 
ATOM   6362 C  "C2'" . DA  D 3 13  ? 14.616  -5.700  -13.935 1.00 56.56  ? 41  DA  D "C2'" 1 
ATOM   6363 C  "C1'" . DA  D 3 13  ? 13.721  -4.576  -14.426 1.00 57.68  ? 41  DA  D "C1'" 1 
ATOM   6364 N  N9    . DA  D 3 13  ? 12.421  -4.488  -13.759 1.00 58.36  ? 41  DA  D N9    1 
ATOM   6365 C  C8    . DA  D 3 13  ? 11.602  -5.515  -13.356 1.00 57.84  ? 41  DA  D C8    1 
ATOM   6366 N  N7    . DA  D 3 13  ? 10.501  -5.112  -12.769 1.00 58.91  ? 41  DA  D N7    1 
ATOM   6367 C  C5    . DA  D 3 13  ? 10.602  -3.728  -12.786 1.00 60.19  ? 41  DA  D C5    1 
ATOM   6368 C  C6    . DA  D 3 13  ? 9.754   -2.713  -12.312 1.00 61.86  ? 41  DA  D C6    1 
ATOM   6369 N  N6    . DA  D 3 13  ? 8.585   -2.946  -11.717 1.00 62.55  ? 41  DA  D N6    1 
ATOM   6370 N  N1    . DA  D 3 13  ? 10.151  -1.433  -12.482 1.00 62.99  ? 41  DA  D N1    1 
ATOM   6371 C  C2    . DA  D 3 13  ? 11.319  -1.199  -13.094 1.00 62.48  ? 41  DA  D C2    1 
ATOM   6372 N  N3    . DA  D 3 13  ? 12.200  -2.068  -13.588 1.00 60.98  ? 41  DA  D N3    1 
ATOM   6373 C  C4    . DA  D 3 13  ? 11.779  -3.330  -13.394 1.00 59.87  ? 41  DA  D C4    1 
ATOM   6374 P  P     . DT  D 3 14  ? 17.796  -5.141  -14.145 1.00 56.65  ? 42  DT  D P     1 
ATOM   6375 O  OP1   . DT  D 3 14  ? 19.076  -4.757  -14.795 1.00 56.93  ? 42  DT  D OP1   1 
ATOM   6376 O  OP2   . DT  D 3 14  ? 17.704  -6.405  -13.363 1.00 55.68  ? 42  DT  D OP2   1 
ATOM   6377 O  "O5'" . DT  D 3 14  ? 17.374  -3.926  -13.207 1.00 58.06  ? 42  DT  D "O5'" 1 
ATOM   6378 C  "C5'" . DT  D 3 14  ? 17.180  -2.615  -13.766 1.00 59.30  ? 42  DT  D "C5'" 1 
ATOM   6379 C  "C4'" . DT  D 3 14  ? 16.669  -1.679  -12.699 1.00 60.67  ? 42  DT  D "C4'" 1 
ATOM   6380 O  "O4'" . DT  D 3 14  ? 15.334  -2.067  -12.312 1.00 60.56  ? 42  DT  D "O4'" 1 
ATOM   6381 C  "C3'" . DT  D 3 14  ? 17.502  -1.665  -11.416 1.00 61.01  ? 42  DT  D "C3'" 1 
ATOM   6382 O  "O3'" . DT  D 3 14  ? 17.898  -0.321  -11.141 1.00 62.67  ? 42  DT  D "O3'" 1 
ATOM   6383 C  "C2'" . DT  D 3 14  ? 16.563  -2.205  -10.352 1.00 60.90  ? 42  DT  D "C2'" 1 
ATOM   6384 C  "C1'" . DT  D 3 14  ? 15.198  -1.874  -10.924 1.00 61.31  ? 42  DT  D "C1'" 1 
ATOM   6385 N  N1    . DT  D 3 14  ? 14.063  -2.703  -10.463 1.00 60.88  ? 42  DT  D N1    1 
ATOM   6386 C  C2    . DT  D 3 14  ? 12.928  -2.069  -10.006 1.00 62.17  ? 42  DT  D C2    1 
ATOM   6387 O  O2    . DT  D 3 14  ? 12.826  -0.856  -9.931  1.00 63.65  ? 42  DT  D O2    1 
ATOM   6388 N  N3    . DT  D 3 14  ? 11.915  -2.914  -9.626  1.00 61.85  ? 42  DT  D N3    1 
ATOM   6389 C  C4    . DT  D 3 14  ? 11.920  -4.295  -9.667  1.00 60.40  ? 42  DT  D C4    1 
ATOM   6390 O  O4    . DT  D 3 14  ? 10.932  -4.920  -9.298  1.00 60.46  ? 42  DT  D O4    1 
ATOM   6391 C  C5    . DT  D 3 14  ? 13.137  -4.894  -10.168 1.00 59.08  ? 42  DT  D C5    1 
ATOM   6392 C  C7    . DT  D 3 14  ? 13.233  -6.384  -10.253 1.00 57.64  ? 42  DT  D C7    1 
ATOM   6393 C  C6    . DT  D 3 14  ? 14.130  -4.078  -10.546 1.00 59.39  ? 42  DT  D C6    1 
ATOM   6394 P  P     . DA  D 3 15  ? 19.241  -0.033  -10.360 1.00 63.25  ? 43  DA  D P     1 
ATOM   6395 O  OP1   . DA  D 3 15  ? 19.926  1.106   -11.021 1.00 64.51  ? 43  DA  D OP1   1 
ATOM   6396 O  OP2   . DA  D 3 15  ? 19.943  -1.319  -10.145 1.00 61.78  ? 43  DA  D OP2   1 
ATOM   6397 O  "O5'" . DA  D 3 15  ? 18.714  0.475   -8.955  1.00 64.44  ? 43  DA  D "O5'" 1 
ATOM   6398 C  "C5'" . DA  D 3 15  ? 18.035  1.728   -8.853  1.00 66.18  ? 43  DA  D "C5'" 1 
ATOM   6399 C  "C4'" . DA  D 3 15  ? 17.404  1.810   -7.486  1.00 67.01  ? 43  DA  D "C4'" 1 
ATOM   6400 O  "O4'" . DA  D 3 15  ? 16.334  0.837   -7.429  1.00 65.95  ? 43  DA  D "O4'" 1 
ATOM   6401 C  "C3'" . DA  D 3 15  ? 18.365  1.459   -6.345  1.00 66.99  ? 43  DA  D "C3'" 1 
ATOM   6402 O  "O3'" . DA  D 3 15  ? 18.312  2.406   -5.269  1.00 68.90  ? 43  DA  D "O3'" 1 
ATOM   6403 C  "C2'" . DA  D 3 15  ? 17.937  0.063   -5.937  1.00 65.44  ? 43  DA  D "C2'" 1 
ATOM   6404 C  "C1'" . DA  D 3 15  ? 16.455  0.099   -6.240  1.00 65.61  ? 43  DA  D "C1'" 1 
ATOM   6405 N  N9    . DA  D 3 15  ? 15.821  -1.201  -6.439  1.00 64.06  ? 43  DA  D N9    1 
ATOM   6406 C  C8    . DA  D 3 15  ? 16.391  -2.407  -6.766  1.00 62.34  ? 43  DA  D C8    1 
ATOM   6407 N  N7    . DA  D 3 15  ? 15.536  -3.400  -6.811  1.00 61.45  ? 43  DA  D N7    1 
ATOM   6408 C  C5    . DA  D 3 15  ? 14.326  -2.812  -6.475  1.00 62.67  ? 43  DA  D C5    1 
ATOM   6409 C  C6    . DA  D 3 15  ? 13.029  -3.332  -6.339  1.00 62.71  ? 43  DA  D C6    1 
ATOM   6410 N  N6    . DA  D 3 15  ? 12.724  -4.616  -6.534  1.00 61.41  ? 43  DA  D N6    1 
ATOM   6411 N  N1    . DA  D 3 15  ? 12.042  -2.476  -5.991  1.00 64.33  ? 43  DA  D N1    1 
ATOM   6412 C  C2    . DA  D 3 15  ? 12.351  -1.186  -5.791  1.00 65.80  ? 43  DA  D C2    1 
ATOM   6413 N  N3    . DA  D 3 15  ? 13.532  -0.580  -5.889  1.00 65.93  ? 43  DA  D N3    1 
ATOM   6414 C  C4    . DA  D 3 15  ? 14.488  -1.459  -6.239  1.00 64.29  ? 43  DA  D C4    1 
ATOM   6415 P  P     . DC  D 3 16  ? 19.397  2.327   -4.103  1.00 69.34  ? 44  DC  D P     1 
ATOM   6416 O  OP1   . DC  D 3 16  ? 19.720  3.714   -3.672  1.00 71.58  ? 44  DC  D OP1   1 
ATOM   6417 O  OP2   . DC  D 3 16  ? 20.489  1.429   -4.559  1.00 67.76  ? 44  DC  D OP2   1 
ATOM   6418 O  "O5'" . DC  D 3 16  ? 18.623  1.421   -3.044  1.00 68.84  ? 44  DC  D "O5'" 1 
ATOM   6419 C  "C5'" . DC  D 3 16  ? 17.931  1.989   -1.920  1.00 70.52  ? 44  DC  D "C5'" 1 
ATOM   6420 C  "C4'" . DC  D 3 16  ? 16.432  1.784   -1.977  1.00 70.60  ? 44  DC  D "C4'" 1 
ATOM   6421 O  "O4'" . DC  D 3 16  ? 15.960  0.929   -3.045  1.00 68.83  ? 44  DC  D "O4'" 1 
ATOM   6422 C  "C3'" . DC  D 3 16  ? 15.798  1.200   -0.722  1.00 70.98  ? 44  DC  D "C3'" 1 
ATOM   6423 O  "O3'" . DC  D 3 16  ? 15.719  2.173   0.323   1.00 73.21  ? 44  DC  D "O3'" 1 
ATOM   6424 C  "C2'" . DC  D 3 16  ? 14.426  0.803   -1.228  1.00 70.61  ? 44  DC  D "C2'" 1 
ATOM   6425 C  "C1'" . DC  D 3 16  ? 14.713  0.343   -2.658  1.00 68.79  ? 44  DC  D "C1'" 1 
ATOM   6426 N  N1    . DC  D 3 16  ? 14.814  -1.122  -2.831  1.00 66.78  ? 44  DC  D N1    1 
ATOM   6427 C  C2    . DC  D 3 16  ? 13.650  -1.895  -2.712  1.00 66.46  ? 44  DC  D C2    1 
ATOM   6428 O  O2    . DC  D 3 16  ? 12.577  -1.330  -2.447  1.00 67.87  ? 44  DC  D O2    1 
ATOM   6429 N  N3    . DC  D 3 16  ? 13.727  -3.237  -2.884  1.00 64.77  ? 44  DC  D N3    1 
ATOM   6430 C  C4    . DC  D 3 16  ? 14.903  -3.808  -3.166  1.00 63.45  ? 44  DC  D C4    1 
ATOM   6431 N  N4    . DC  D 3 16  ? 14.935  -5.132  -3.325  1.00 61.96  ? 44  DC  D N4    1 
ATOM   6432 C  C5    . DC  D 3 16  ? 16.101  -3.044  -3.289  1.00 63.77  ? 44  DC  D C5    1 
ATOM   6433 C  C6    . DC  D 3 16  ? 16.012  -1.718  -3.119  1.00 65.43  ? 44  DC  D C6    1 
ATOM   6434 P  P     . DT  D 3 17  ? 15.804  1.720   1.847   1.00 73.84  ? 45  DT  D P     1 
ATOM   6435 O  OP1   . DT  D 3 17  ? 15.818  2.943   2.681   1.00 76.36  ? 45  DT  D OP1   1 
ATOM   6436 O  OP2   . DT  D 3 17  ? 16.909  0.752   1.983   1.00 72.19  ? 45  DT  D OP2   1 
ATOM   6437 O  "O5'" . DT  D 3 17  ? 14.442  0.925   2.067   1.00 73.58  ? 45  DT  D "O5'" 1 
ATOM   6438 C  "C5'" . DT  D 3 17  ? 13.206  1.625   2.283   1.00 75.43  ? 45  DT  D "C5'" 1 
ATOM   6439 C  "C4'" . DT  D 3 17  ? 12.056  0.650   2.384   1.00 74.91  ? 45  DT  D "C4'" 1 
ATOM   6440 O  "O4'" . DT  D 3 17  ? 12.076  -0.250  1.255   1.00 72.64  ? 45  DT  D "O4'" 1 
ATOM   6441 C  "C3'" . DT  D 3 17  ? 12.074  -0.256  3.609   1.00 74.92  ? 45  DT  D "C3'" 1 
ATOM   6442 O  "O3'" . DT  D 3 17  ? 11.460  0.396   4.726   1.00 77.38  ? 45  DT  D "O3'" 1 
ATOM   6443 C  "C2'" . DT  D 3 17  ? 11.280  -1.459  3.137   1.00 73.49  ? 45  DT  D "C2'" 1 
ATOM   6444 C  "C1'" . DT  D 3 17  ? 11.569  -1.525  1.637   1.00 71.74  ? 45  DT  D "C1'" 1 
ATOM   6445 N  N1    . DT  D 3 17  ? 12.556  -2.555  1.229   1.00 69.51  ? 45  DT  D N1    1 
ATOM   6446 C  C2    . DT  D 3 17  ? 12.117  -3.848  1.037   1.00 68.16  ? 45  DT  D C2    1 
ATOM   6447 O  O2    . DT  D 3 17  ? 10.956  -4.190  1.192   1.00 68.72  ? 45  DT  D O2    1 
ATOM   6448 N  N3    . DT  D 3 17  ? 13.098  -4.736  0.665   1.00 66.30  ? 45  DT  D N3    1 
ATOM   6449 C  C4    . DT  D 3 17  ? 14.439  -4.464  0.466   1.00 65.70  ? 45  DT  D C4    1 
ATOM   6450 O  O4    . DT  D 3 17  ? 15.204  -5.365  0.133   1.00 64.15  ? 45  DT  D O4    1 
ATOM   6451 C  C5    . DT  D 3 17  ? 14.829  -3.091  0.685   1.00 67.19  ? 45  DT  D C5    1 
ATOM   6452 C  C7    . DT  D 3 17  ? 16.259  -2.700  0.487   1.00 66.86  ? 45  DT  D C7    1 
ATOM   6453 C  C6    . DT  D 3 17  ? 13.882  -2.218  1.052   1.00 68.98  ? 45  DT  D C6    1 
ATOM   6454 P  P     . DT  D 3 18  ? 11.742  -0.111  6.223   1.00 78.14  ? 46  DT  D P     1 
ATOM   6455 O  OP1   . DT  D 3 18  ? 11.108  0.839   7.164   1.00 80.99  ? 46  DT  D OP1   1 
ATOM   6456 O  OP2   . DT  D 3 18  ? 13.183  -0.417  6.358   1.00 76.86  ? 46  DT  D OP2   1 
ATOM   6457 O  "O5'" . DT  D 3 18  ? 10.918  -1.466  6.299   1.00 77.13  ? 46  DT  D "O5'" 1 
ATOM   6458 C  "C5'" . DT  D 3 18  ? 9.486   -1.465  6.231   1.00 78.27  ? 46  DT  D "C5'" 1 
ATOM   6459 C  "C4'" . DT  D 3 18  ? 8.984   -2.884  6.333   1.00 77.14  ? 46  DT  D "C4'" 1 
ATOM   6460 O  "O4'" . DT  D 3 18  ? 9.646   -3.695  5.331   1.00 74.49  ? 46  DT  D "O4'" 1 
ATOM   6461 C  "C3'" . DT  D 3 18  ? 9.274   -3.556  7.678   1.00 77.70  ? 46  DT  D "C3'" 1 
ATOM   6462 O  "O3'" . DT  D 3 18  ? 8.141   -4.343  8.073   1.00 78.41  ? 46  DT  D "O3'" 1 
ATOM   6463 C  "C2'" . DT  D 3 18  ? 10.526  -4.364  7.391   1.00 75.34  ? 46  DT  D "C2'" 1 
ATOM   6464 C  "C1'" . DT  D 3 18  ? 10.279  -4.797  5.961   1.00 73.46  ? 46  DT  D "C1'" 1 
ATOM   6465 N  N1    . DT  D 3 18  ? 11.496  -5.127  5.196   1.00 71.31  ? 46  DT  D N1    1 
ATOM   6466 C  C2    . DT  D 3 18  ? 11.591  -6.377  4.624   1.00 69.39  ? 46  DT  D C2    1 
ATOM   6467 O  O2    . DT  D 3 18  ? 10.715  -7.221  4.713   1.00 69.37  ? 46  DT  D O2    1 
ATOM   6468 N  N3    . DT  D 3 18  ? 12.761  -6.605  3.940   1.00 67.67  ? 46  DT  D N3    1 
ATOM   6469 C  C4    . DT  D 3 18  ? 13.817  -5.730  3.774   1.00 67.69  ? 46  DT  D C4    1 
ATOM   6470 O  O4    . DT  D 3 18  ? 14.801  -6.077  3.129   1.00 66.19  ? 46  DT  D O4    1 
ATOM   6471 C  C5    . DT  D 3 18  ? 13.650  -4.436  4.401   1.00 69.74  ? 46  DT  D C5    1 
ATOM   6472 C  C7    . DT  D 3 18  ? 14.739  -3.418  4.271   1.00 70.10  ? 46  DT  D C7    1 
ATOM   6473 C  C6    . DT  D 3 18  ? 12.517  -4.207  5.079   1.00 71.42  ? 46  DT  D C6    1 
ATOM   6474 P  P     . DG  D 3 19  ? 8.226   -5.325  9.335   1.00 78.86  ? 47  DG  D P     1 
ATOM   6475 O  OP1   . DG  D 3 19  ? 6.856   -5.486  9.891   1.00 80.89  ? 47  DG  D OP1   1 
ATOM   6476 O  OP2   . DG  D 3 19  ? 9.334   -4.854  10.214  1.00 79.37  ? 47  DG  D OP2   1 
ATOM   6477 O  "O5'" . DG  D 3 19  ? 8.644   -6.706  8.664   1.00 76.22  ? 47  DG  D "O5'" 1 
ATOM   6478 C  "C5'" . DG  D 3 19  ? 7.776   -7.385  7.734   1.00 75.32  ? 47  DG  D "C5'" 1 
ATOM   6479 C  "C4'" . DG  D 3 19  ? 8.168   -8.842  7.644   1.00 73.54  ? 47  DG  D "C4'" 1 
ATOM   6480 O  "O4'" . DG  D 3 19  ? 9.368   -8.979  6.839   1.00 71.33  ? 47  DG  D "O4'" 1 
ATOM   6481 C  "C3'" . DG  D 3 19  ? 8.493   -9.499  8.991   1.00 74.31  ? 47  DG  D "C3'" 1 
ATOM   6482 O  "O3'" . DG  D 3 19  ? 8.001   -10.845 8.995   1.00 73.79  ? 47  DG  D "O3'" 1 
ATOM   6483 C  "C2'" . DG  D 3 19  ? 10.008  -9.418  9.054   1.00 72.97  ? 47  DG  D "C2'" 1 
ATOM   6484 C  "C1'" . DG  D 3 19  ? 10.365  -9.654  7.600   1.00 70.75  ? 47  DG  D "C1'" 1 
ATOM   6485 N  N9    . DG  D 3 19  ? 11.672  -9.150  7.194   1.00 69.60  ? 47  DG  D N9    1 
ATOM   6486 C  C8    . DG  D 3 19  ? 12.253  -7.951  7.533   1.00 70.55  ? 47  DG  D C8    1 
ATOM   6487 N  N7    . DG  D 3 19  ? 13.439  -7.793  7.013   1.00 69.27  ? 47  DG  D N7    1 
ATOM   6488 C  C5    . DG  D 3 19  ? 13.653  -8.957  6.288   1.00 67.35  ? 47  DG  D C5    1 
ATOM   6489 C  C6    . DG  D 3 19  ? 14.761  -9.357  5.502   1.00 65.53  ? 47  DG  D C6    1 
ATOM   6490 O  O6    . DG  D 3 19  ? 15.810  -8.745  5.283   1.00 65.25  ? 47  DG  D O6    1 
ATOM   6491 N  N1    . DG  D 3 19  ? 14.565  -10.616 4.943   1.00 64.13  ? 47  DG  D N1    1 
ATOM   6492 C  C2    . DG  D 3 19  ? 13.446  -11.392 5.118   1.00 64.44  ? 47  DG  D C2    1 
ATOM   6493 N  N2    . DG  D 3 19  ? 13.442  -12.578 4.494   1.00 63.06  ? 47  DG  D N2    1 
ATOM   6494 N  N3    . DG  D 3 19  ? 12.398  -11.023 5.835   1.00 66.16  ? 47  DG  D N3    1 
ATOM   6495 C  C4    . DG  D 3 19  ? 12.573  -9.806  6.395   1.00 67.52  ? 47  DG  D C4    1 
ATOM   6496 P  P     . DT  D 3 20  ? 8.369   -11.850 10.191  1.00 74.19  ? 48  DT  D P     1 
ATOM   6497 O  OP1   . DT  D 3 20  ? 7.319   -12.896 10.233  1.00 74.70  ? 48  DT  D OP1   1 
ATOM   6498 O  OP2   . DT  D 3 20  ? 8.680   -11.046 11.414  1.00 76.01  ? 48  DT  D OP2   1 
ATOM   6499 O  "O5'" . DT  D 3 20  ? 9.706   -12.542 9.677   1.00 71.74  ? 48  DT  D "O5'" 1 
ATOM   6500 C  "C5'" . DT  D 3 20  ? 9.720   -13.350 8.482   1.00 69.80  ? 48  DT  D "C5'" 1 
ATOM   6501 C  "C4'" . DT  D 3 20  ? 11.097  -13.937 8.270   1.00 67.97  ? 48  DT  D "C4'" 1 
ATOM   6502 O  "O4'" . DT  D 3 20  ? 12.063  -12.891 7.989   1.00 67.47  ? 48  DT  D "O4'" 1 
ATOM   6503 C  "C3'" . DT  D 3 20  ? 11.654  -14.706 9.477   1.00 68.46  ? 48  DT  D "C3'" 1 
ATOM   6504 O  "O3'" . DT  D 3 20  ? 12.224  -15.946 9.050   1.00 66.88  ? 48  DT  D "O3'" 1 
ATOM   6505 C  "C2'" . DT  D 3 20  ? 12.738  -13.790 10.017  1.00 68.70  ? 48  DT  D "C2'" 1 
ATOM   6506 C  "C1'" . DT  D 3 20  ? 13.242  -13.184 8.721   1.00 67.20  ? 48  DT  D "C1'" 1 
ATOM   6507 N  N1    . DT  D 3 20  ? 14.046  -11.944 8.838   1.00 67.55  ? 48  DT  D N1    1 
ATOM   6508 C  C2    . DT  D 3 20  ? 15.213  -11.871 8.113   1.00 66.05  ? 48  DT  D C2    1 
ATOM   6509 O  O2    . DT  D 3 20  ? 15.593  -12.763 7.373   1.00 64.47  ? 48  DT  D O2    1 
ATOM   6510 N  N3    . DT  D 3 20  ? 15.921  -10.706 8.281   1.00 66.65  ? 48  DT  D N3    1 
ATOM   6511 C  C4    . DT  D 3 20  ? 15.586  -9.633  9.086   1.00 68.56  ? 48  DT  D C4    1 
ATOM   6512 O  O4    . DT  D 3 20  ? 16.324  -8.656  9.140   1.00 69.02  ? 48  DT  D O4    1 
ATOM   6513 C  C5    . DT  D 3 20  ? 14.351  -9.779  9.824   1.00 70.07  ? 48  DT  D C5    1 
ATOM   6514 C  C7    . DT  D 3 20  ? 13.907  -8.670  10.727  1.00 72.39  ? 48  DT  D C7    1 
ATOM   6515 C  C6    . DT  D 3 20  ? 13.653  -10.912 9.664   1.00 69.50  ? 48  DT  D C6    1 
ATOM   6516 P  P     . DA  D 3 21  ? 12.229  -17.207 10.031  1.00 67.46  ? 49  DA  D P     1 
ATOM   6517 O  OP1   . DA  D 3 21  ? 11.028  -18.032 9.718   1.00 67.84  ? 49  DA  D OP1   1 
ATOM   6518 O  OP2   . DA  D 3 21  ? 12.473  -16.725 11.428  1.00 69.11  ? 49  DA  D OP2   1 
ATOM   6519 O  "O5'" . DA  D 3 21  ? 13.482  -18.036 9.512   1.00 65.56  ? 49  DA  D "O5'" 1 
ATOM   6520 C  "C5'" . DA  D 3 21  ? 13.539  -18.493 8.149   1.00 63.89  ? 49  DA  D "C5'" 1 
ATOM   6521 C  "C4'" . DA  D 3 21  ? 14.983  -18.625 7.727   1.00 62.43  ? 49  DA  D "C4'" 1 
ATOM   6522 O  "O4'" . DA  D 3 21  ? 15.593  -17.313 7.728   1.00 62.51  ? 49  DA  D "O4'" 1 
ATOM   6523 C  "C3'" . DA  D 3 21  ? 15.831  -19.491 8.661   1.00 62.61  ? 49  DA  D "C3'" 1 
ATOM   6524 O  "O3'" . DA  D 3 21  ? 16.714  -20.332 7.915   1.00 61.15  ? 49  DA  D "O3'" 1 
ATOM   6525 C  "C2'" . DA  D 3 21  ? 16.594  -18.481 9.496   1.00 63.33  ? 49  DA  D "C2'" 1 
ATOM   6526 C  "C1'" . DA  D 3 21  ? 16.766  -17.327 8.523   1.00 62.64  ? 49  DA  D "C1'" 1 
ATOM   6527 N  N9    . DA  D 3 21  ? 16.899  -16.011 9.148   1.00 63.78  ? 49  DA  D N9    1 
ATOM   6528 C  C8    . DA  D 3 21  ? 16.026  -15.408 10.020  1.00 65.51  ? 49  DA  D C8    1 
ATOM   6529 N  N7    . DA  D 3 21  ? 16.408  -14.216 10.409  1.00 66.35  ? 49  DA  D N7    1 
ATOM   6530 C  C5    . DA  D 3 21  ? 17.611  -14.017 9.745   1.00 65.08  ? 49  DA  D C5    1 
ATOM   6531 C  C6    . DA  D 3 21  ? 18.523  -12.947 9.739   1.00 65.29  ? 49  DA  D C6    1 
ATOM   6532 N  N6    . DA  D 3 21  ? 18.353  -11.826 10.445  1.00 66.89  ? 49  DA  D N6    1 
ATOM   6533 N  N1    . DA  D 3 21  ? 19.630  -13.070 8.972   1.00 63.97  ? 49  DA  D N1    1 
ATOM   6534 C  C2    . DA  D 3 21  ? 19.798  -14.195 8.262   1.00 62.53  ? 49  DA  D C2    1 
ATOM   6535 N  N3    . DA  D 3 21  ? 19.015  -15.270 8.191   1.00 62.18  ? 49  DA  D N3    1 
ATOM   6536 C  C4    . DA  D 3 21  ? 17.927  -15.117 8.966   1.00 63.51  ? 49  DA  D C4    1 
ATOM   6537 P  P     . DC  D 3 22  ? 17.374  -21.609 8.607   1.00 61.23  ? 50  DC  D P     1 
ATOM   6538 O  OP1   . DC  D 3 22  ? 17.289  -22.754 7.668   1.00 60.23  ? 50  DC  D OP1   1 
ATOM   6539 O  OP2   . DC  D 3 22  ? 16.832  -21.727 9.976   1.00 62.90  ? 50  DC  D OP2   1 
ATOM   6540 O  "O5'" . DC  D 3 22  ? 18.900  -21.201 8.767   1.00 60.73  ? 50  DC  D "O5'" 1 
ATOM   6541 C  "C5'" . DC  D 3 22  ? 19.515  -20.185 7.957   1.00 59.93  ? 50  DC  D "C5'" 1 
ATOM   6542 C  "C4'" . DC  D 3 22  ? 20.772  -19.671 8.619   1.00 60.24  ? 50  DC  D "C4'" 1 
ATOM   6543 O  "O4'" . DC  D 3 22  ? 20.528  -18.335 9.123   1.00 61.21  ? 50  DC  D "O4'" 1 
ATOM   6544 C  "C3'" . DC  D 3 22  ? 21.264  -20.480 9.825   1.00 61.03  ? 50  DC  D "C3'" 1 
ATOM   6545 O  "O3'" . DC  D 3 22  ? 22.692  -20.434 9.894   1.00 60.72  ? 50  DC  D "O3'" 1 
ATOM   6546 C  "C2'" . DC  D 3 22  ? 20.704  -19.696 10.995  1.00 62.58  ? 50  DC  D "C2'" 1 
ATOM   6547 C  "C1'" . DC  D 3 22  ? 20.951  -18.298 10.471  1.00 62.41  ? 50  DC  D "C1'" 1 
ATOM   6548 N  N1    . DC  D 3 22  ? 20.288  -17.164 11.133  1.00 63.77  ? 50  DC  D N1    1 
ATOM   6549 C  C2    . DC  D 3 22  ? 20.908  -15.914 11.060  1.00 64.04  ? 50  DC  D C2    1 
ATOM   6550 O  O2    . DC  D 3 22  ? 21.981  -15.813 10.450  1.00 63.14  ? 50  DC  D O2    1 
ATOM   6551 N  N3    . DC  D 3 22  ? 20.332  -14.852 11.664  1.00 65.45  ? 50  DC  D N3    1 
ATOM   6552 C  C4    . DC  D 3 22  ? 19.180  -15.003 12.319  1.00 66.58  ? 50  DC  D C4    1 
ATOM   6553 N  N4    . DC  D 3 22  ? 18.642  -13.924 12.887  1.00 68.12  ? 50  DC  D N4    1 
ATOM   6554 C  C5    . DC  D 3 22  ? 18.519  -16.264 12.401  1.00 66.35  ? 50  DC  D C5    1 
ATOM   6555 C  C6    . DC  D 3 22  ? 19.106  -17.310 11.806  1.00 64.93  ? 50  DC  D C6    1 
ATOM   6556 P  P     . DA  D 3 23  ? 23.557  -21.729 9.596   1.00 60.00  ? 51  DA  D P     1 
ATOM   6557 O  OP1   . DA  D 3 23  ? 23.259  -22.167 8.212   1.00 58.77  ? 51  DA  D OP1   1 
ATOM   6558 O  OP2   . DA  D 3 23  ? 23.357  -22.683 10.715  1.00 60.93  ? 51  DA  D OP2   1 
ATOM   6559 O  "O5'" . DA  D 3 23  ? 25.044  -21.162 9.637   1.00 59.95  ? 51  DA  D "O5'" 1 
ATOM   6560 C  "C5'" . DA  D 3 23  ? 25.515  -20.271 8.612   1.00 59.25  ? 51  DA  D "C5'" 1 
ATOM   6561 C  "C4'" . DA  D 3 23  ? 26.405  -19.200 9.197   1.00 60.03  ? 51  DA  D "C4'" 1 
ATOM   6562 O  "O4'" . DA  D 3 23  ? 25.586  -18.230 9.890   1.00 60.98  ? 51  DA  D "O4'" 1 
ATOM   6563 C  "C3'" . DA  D 3 23  ? 27.443  -19.690 10.210  1.00 60.77  ? 51  DA  D "C3'" 1 
ATOM   6564 O  "O3'" . DA  D 3 23  ? 28.721  -19.118 9.923   1.00 60.82  ? 51  DA  D "O3'" 1 
ATOM   6565 C  "C2'" . DA  D 3 23  ? 26.895  -19.221 11.547  1.00 62.11  ? 51  DA  D "C2'" 1 
ATOM   6566 C  "C1'" . DA  D 3 23  ? 26.132  -17.968 11.173  1.00 62.23  ? 51  DA  D "C1'" 1 
ATOM   6567 N  N9    . DA  D 3 23  ? 25.025  -17.630 12.070  1.00 63.33  ? 51  DA  D N9    1 
ATOM   6568 C  C8    . DA  D 3 23  ? 23.978  -18.439 12.442  1.00 63.55  ? 51  DA  D C8    1 
ATOM   6569 N  N7    . DA  D 3 23  ? 23.118  -17.855 13.239  1.00 64.81  ? 51  DA  D N7    1 
ATOM   6570 C  C5    . DA  D 3 23  ? 23.630  -16.576 13.404  1.00 65.42  ? 51  DA  D C5    1 
ATOM   6571 C  C6    . DA  D 3 23  ? 23.184  -15.466 14.144  1.00 66.91  ? 51  DA  D C6    1 
ATOM   6572 N  N6    . DA  D 3 23  ? 22.072  -15.470 14.883  1.00 68.10  ? 51  DA  D N6    1 
ATOM   6573 N  N1    . DA  D 3 23  ? 23.931  -14.341 14.102  1.00 67.33  ? 51  DA  D N1    1 
ATOM   6574 C  C2    . DA  D 3 23  ? 25.053  -14.343 13.369  1.00 66.33  ? 51  DA  D C2    1 
ATOM   6575 N  N3    . DA  D 3 23  ? 25.572  -15.321 12.627  1.00 64.94  ? 51  DA  D N3    1 
ATOM   6576 C  C4    . DA  D 3 23  ? 24.806  -16.424 12.692  1.00 64.53  ? 51  DA  D C4    1 
ATOM   6577 P  P     . DC  D 3 24  ? 30.053  -19.670 10.643  1.00 61.46  ? 52  DC  D P     1 
ATOM   6578 O  OP1   . DC  D 3 24  ? 31.186  -19.474 9.714   1.00 61.04  ? 52  DC  D OP1   1 
ATOM   6579 O  OP2   . DC  D 3 24  ? 29.787  -21.019 11.204  1.00 61.52  ? 52  DC  D OP2   1 
ATOM   6580 O  "O5'" . DC  D 3 24  ? 30.234  -18.674 11.871  1.00 62.88  ? 52  DC  D "O5'" 1 
ATOM   6581 C  "C5'" . DC  D 3 24  ? 30.121  -17.244 11.697  1.00 63.29  ? 52  DC  D "C5'" 1 
ATOM   6582 C  "C4'" . DC  D 3 24  ? 30.146  -16.544 13.036  1.00 64.85  ? 52  DC  D "C4'" 1 
ATOM   6583 O  "O4'" . DC  D 3 24  ? 28.795  -16.419 13.554  1.00 65.25  ? 52  DC  D "O4'" 1 
ATOM   6584 C  "C3'" . DC  D 3 24  ? 30.949  -17.257 14.133  1.00 65.68  ? 52  DC  D "C3'" 1 
ATOM   6585 O  "O3'" . DC  D 3 24  ? 31.692  -16.251 14.839  1.00 67.02  ? 52  DC  D "O3'" 1 
ATOM   6586 C  "C2'" . DC  D 3 24  ? 29.861  -17.944 14.935  1.00 66.01  ? 52  DC  D "C2'" 1 
ATOM   6587 C  "C1'" . DC  D 3 24  ? 28.816  -16.856 14.899  1.00 66.39  ? 52  DC  D "C1'" 1 
ATOM   6588 N  N1    . DC  D 3 24  ? 27.446  -17.218 15.312  1.00 66.65  ? 52  DC  D N1    1 
ATOM   6589 C  C2    . DC  D 3 24  ? 26.646  -16.223 15.885  1.00 67.82  ? 52  DC  D C2    1 
ATOM   6590 O  O2    . DC  D 3 24  ? 27.091  -15.069 15.967  1.00 68.51  ? 52  DC  D O2    1 
ATOM   6591 N  N3    . DC  D 3 24  ? 25.403  -16.540 16.316  1.00 68.32  ? 52  DC  D N3    1 
ATOM   6592 C  C4    . DC  D 3 24  ? 24.958  -17.794 16.207  1.00 67.70  ? 52  DC  D C4    1 
ATOM   6593 N  N4    . DC  D 3 24  ? 23.722  -18.057 16.634  1.00 68.40  ? 52  DC  D N4    1 
ATOM   6594 C  C5    . DC  D 3 24  ? 25.757  -18.830 15.639  1.00 66.50  ? 52  DC  D C5    1 
ATOM   6595 C  C6    . DC  D 3 24  ? 26.989  -18.505 15.222  1.00 66.03  ? 52  DC  D C6    1 
ATOM   6596 P  P     . DC  D 3 25  ? 32.508  -16.556 16.212  1.00 68.41  ? 53  DC  D P     1 
ATOM   6597 O  OP1   . DC  D 3 25  ? 33.911  -16.128 16.002  1.00 68.83  ? 53  DC  D OP1   1 
ATOM   6598 O  OP2   . DC  D 3 25  ? 32.235  -17.946 16.660  1.00 68.14  ? 53  DC  D OP2   1 
ATOM   6599 O  "O5'" . DC  D 3 25  ? 31.869  -15.502 17.222  1.00 69.91  ? 53  DC  D "O5'" 1 
ATOM   6600 C  "C5'" . DC  D 3 25  ? 31.674  -14.128 16.817  1.00 70.29  ? 53  DC  D "C5'" 1 
ATOM   6601 C  "C4'" . DC  D 3 25  ? 31.052  -13.329 17.937  1.00 71.96  ? 53  DC  D "C4'" 1 
ATOM   6602 O  "O4'" . DC  D 3 25  ? 29.679  -13.746 18.107  1.00 71.75  ? 53  DC  D "O4'" 1 
ATOM   6603 C  "C3'" . DC  D 3 25  ? 31.733  -13.516 19.290  1.00 73.47  ? 53  DC  D "C3'" 1 
ATOM   6604 O  "O3'" . DC  D 3 25  ? 31.956  -12.270 19.949  1.00 75.20  ? 53  DC  D "O3'" 1 
ATOM   6605 C  "C2'" . DC  D 3 25  ? 30.775  -14.396 20.070  1.00 73.70  ? 53  DC  D "C2'" 1 
ATOM   6606 C  "C1'" . DC  D 3 25  ? 29.424  -14.105 19.447  1.00 73.09  ? 53  DC  D "C1'" 1 
ATOM   6607 N  N1    . DC  D 3 25  ? 28.507  -15.261 19.444  1.00 72.38  ? 53  DC  D N1    1 
ATOM   6608 C  C2    . DC  D 3 25  ? 27.231  -15.121 20.003  1.00 73.28  ? 53  DC  D C2    1 
ATOM   6609 O  O2    . DC  D 3 25  ? 26.893  -14.020 20.462  1.00 74.62  ? 53  DC  D O2    1 
ATOM   6610 N  N3    . DC  D 3 25  ? 26.395  -16.186 20.016  1.00 72.82  ? 53  DC  D N3    1 
ATOM   6611 C  C4    . DC  D 3 25  ? 26.794  -17.353 19.503  1.00 71.51  ? 53  DC  D C4    1 
ATOM   6612 N  N4    . DC  D 3 25  ? 25.940  -18.377 19.540  1.00 71.26  ? 53  DC  D N4    1 
ATOM   6613 C  C5    . DC  D 3 25  ? 28.090  -17.525 18.938  1.00 70.59  ? 53  DC  D C5    1 
ATOM   6614 C  C6    . DC  D 3 25  ? 28.906  -16.463 18.929  1.00 71.06  ? 53  DC  D C6    1 
ATOM   6615 P  P     . DT  D 3 26  ? 33.052  -12.168 21.111  1.00 76.86  ? 54  DT  D P     1 
ATOM   6616 O  OP1   . DT  D 3 26  ? 33.515  -10.760 21.179  1.00 78.21  ? 54  DT  D OP1   1 
ATOM   6617 O  OP2   . DT  D 3 26  ? 34.030  -13.276 20.952  1.00 76.04  ? 54  DT  D OP2   1 
ATOM   6618 O  "O5'" . DT  D 3 26  ? 32.237  -12.544 22.421  1.00 78.08  ? 54  DT  D "O5'" 1 
ATOM   6619 C  "C5'" . DT  D 3 26  ? 31.175  -11.713 22.903  1.00 79.28  ? 54  DT  D "C5'" 1 
ATOM   6620 C  "C4'" . DT  D 3 26  ? 30.455  -12.414 24.029  1.00 80.23  ? 54  DT  D "C4'" 1 
ATOM   6621 O  "O4'" . DT  D 3 26  ? 29.423  -13.267 23.502  1.00 78.91  ? 54  DT  D "O4'" 1 
ATOM   6622 C  "C3'" . DT  D 3 26  ? 31.320  -13.350 24.859  1.00 80.66  ? 54  DT  D "C3'" 1 
ATOM   6623 O  "O3'" . DT  D 3 26  ? 32.070  -12.579 25.805  1.00 82.59  ? 54  DT  D "O3'" 1 
ATOM   6624 C  "C2'" . DT  D 3 26  ? 30.287  -14.286 25.462  1.00 80.86  ? 54  DT  D "C2'" 1 
ATOM   6625 C  "C1'" . DT  D 3 26  ? 29.123  -14.261 24.471  1.00 79.57  ? 54  DT  D "C1'" 1 
ATOM   6626 N  N1    . DT  D 3 26  ? 28.877  -15.542 23.763  1.00 77.79  ? 54  DT  D N1    1 
ATOM   6627 C  C2    . DT  D 3 26  ? 27.586  -16.018 23.716  1.00 77.64  ? 54  DT  D C2    1 
ATOM   6628 O  O2    . DT  D 3 26  ? 26.636  -15.426 24.202  1.00 78.89  ? 54  DT  D O2    1 
ATOM   6629 N  N3    . DT  D 3 26  ? 27.442  -17.215 23.059  1.00 76.11  ? 54  DT  D N3    1 
ATOM   6630 C  C4    . DT  D 3 26  ? 28.435  -17.966 22.460  1.00 74.78  ? 54  DT  D C4    1 
ATOM   6631 O  O4    . DT  D 3 26  ? 28.148  -19.017 21.895  1.00 73.62  ? 54  DT  D O4    1 
ATOM   6632 C  C5    . DT  D 3 26  ? 29.766  -17.413 22.553  1.00 75.06  ? 54  DT  D C5    1 
ATOM   6633 C  C7    . DT  D 3 26  ? 30.908  -18.163 21.944  1.00 73.92  ? 54  DT  D C7    1 
ATOM   6634 C  C6    . DT  D 3 26  ? 29.918  -16.245 23.192  1.00 76.52  ? 54  DT  D C6    1 
ATOM   6635 P  P     . DG  D 3 27  ? 33.258  -13.241 26.658  1.00 83.37  ? 55  DG  D P     1 
ATOM   6636 O  OP1   . DG  D 3 27  ? 33.964  -12.148 27.359  1.00 85.32  ? 55  DG  D OP1   1 
ATOM   6637 O  OP2   . DG  D 3 27  ? 34.013  -14.166 25.788  1.00 81.57  ? 55  DG  D OP2   1 
ATOM   6638 O  "O5'" . DG  D 3 27  ? 32.486  -14.135 27.721  1.00 84.19  ? 55  DG  D "O5'" 1 
ATOM   6639 C  "C5'" . DG  D 3 27  ? 31.792  -13.530 28.817  1.00 86.28  ? 55  DG  D "C5'" 1 
ATOM   6640 C  "C4'" . DG  D 3 27  ? 30.995  -14.574 29.562  1.00 86.73  ? 55  DG  D "C4'" 1 
ATOM   6641 O  "O4'" . DG  D 3 27  ? 30.031  -15.169 28.667  1.00 85.05  ? 55  DG  D "O4'" 1 
ATOM   6642 C  "C3'" . DG  D 3 27  ? 31.786  -15.755 30.117  1.00 86.74  ? 55  DG  D "C3'" 1 
ATOM   6643 O  "O3'" . DG  D 3 27  ? 32.386  -15.465 31.389  1.00 88.91  ? 55  DG  D "O3'" 1 
ATOM   6644 C  "C2'" . DG  D 3 27  ? 30.702  -16.812 30.224  1.00 86.37  ? 55  DG  D "C2'" 1 
ATOM   6645 C  "C1'" . DG  D 3 27  ? 29.826  -16.527 29.010  1.00 84.76  ? 55  DG  D "C1'" 1 
ATOM   6646 N  N9    . DG  D 3 27  ? 30.163  -17.353 27.856  1.00 82.49  ? 55  DG  D N9    1 
ATOM   6647 C  C8    . DG  D 3 27  ? 31.419  -17.628 27.371  1.00 81.53  ? 55  DG  D C8    1 
ATOM   6648 N  N7    . DG  D 3 27  ? 31.408  -18.457 26.364  1.00 79.68  ? 55  DG  D N7    1 
ATOM   6649 C  C5    . DG  D 3 27  ? 30.067  -18.765 26.186  1.00 79.37  ? 55  DG  D C5    1 
ATOM   6650 C  C6    . DG  D 3 27  ? 29.435  -19.617 25.239  1.00 77.74  ? 55  DG  D C6    1 
ATOM   6651 O  O6    . DG  D 3 27  ? 29.954  -20.293 24.343  1.00 76.20  ? 55  DG  D O6    1 
ATOM   6652 N  N1    . DG  D 3 27  ? 28.055  -19.637 25.412  1.00 78.20  ? 55  DG  D N1    1 
ATOM   6653 C  C2    . DG  D 3 27  ? 27.367  -18.934 26.373  1.00 80.05  ? 55  DG  D C2    1 
ATOM   6654 N  N2    . DG  D 3 27  ? 26.032  -19.090 26.381  1.00 80.40  ? 55  DG  D N2    1 
ATOM   6655 N  N3    . DG  D 3 27  ? 27.944  -18.139 27.261  1.00 81.60  ? 55  DG  D N3    1 
ATOM   6656 C  C4    . DG  D 3 27  ? 29.286  -18.103 27.111  1.00 81.12  ? 55  DG  D C4    1 
ATOM   6657 P  P     . DA  D 3 28  ? 33.974  -15.321 31.577  1.00 89.29  ? 56  DA  D P     1 
ATOM   6658 O  OP1   . DA  D 3 28  ? 34.288  -15.732 32.964  1.00 91.25  ? 56  DA  D OP1   1 
ATOM   6659 O  OP2   . DA  D 3 28  ? 34.386  -13.976 31.139  1.00 89.59  ? 56  DA  D OP2   1 
ATOM   6660 O  "O5'" . DA  D 3 28  ? 34.569  -16.336 30.505  1.00 87.01  ? 56  DA  D "O5'" 1 
ATOM   6661 C  "C5'" . DA  D 3 28  ? 35.135  -17.602 30.846  1.00 86.85  ? 56  DA  D "C5'" 1 
ATOM   6662 C  "C4'" . DA  D 3 28  ? 34.065  -18.478 31.442  1.00 87.22  ? 56  DA  D "C4'" 1 
ATOM   6663 O  "O4'" . DA  D 3 28  ? 33.176  -18.893 30.402  1.00 85.40  ? 56  DA  D "O4'" 1 
ATOM   6664 C  "C3'" . DA  D 3 28  ? 34.578  -19.770 32.052  1.00 87.59  ? 56  DA  D "C3'" 1 
ATOM   6665 O  "O3'" . DA  D 3 28  ? 34.865  -19.537 33.428  1.00 89.89  ? 56  DA  D "O3'" 1 
ATOM   6666 C  "C2'" . DA  D 3 28  ? 33.412  -20.725 31.873  1.00 86.90  ? 56  DA  D "C2'" 1 
ATOM   6667 C  "C1'" . DA  D 3 28  ? 32.479  -20.025 30.889  1.00 85.67  ? 56  DA  D "C1'" 1 
ATOM   6668 N  N9    . DA  D 3 28  ? 32.060  -20.828 29.744  1.00 83.62  ? 56  DA  D N9    1 
ATOM   6669 C  C8    . DA  D 3 28  ? 32.823  -21.580 28.886  1.00 82.08  ? 56  DA  D C8    1 
ATOM   6670 N  N7    . DA  D 3 28  ? 32.125  -22.196 27.963  1.00 80.56  ? 56  DA  D N7    1 
ATOM   6671 C  C5    . DA  D 3 28  ? 30.815  -21.827 28.235  1.00 81.14  ? 56  DA  D C5    1 
ATOM   6672 C  C6    . DA  D 3 28  ? 29.591  -22.148 27.618  1.00 80.30  ? 56  DA  D C6    1 
ATOM   6673 N  N6    . DA  D 3 28  ? 29.487  -22.936 26.546  1.00 78.57  ? 56  DA  D N6    1 
ATOM   6674 N  N1    . DA  D 3 28  ? 28.465  -21.608 28.136  1.00 81.45  ? 56  DA  D N1    1 
ATOM   6675 C  C2    . DA  D 3 28  ? 28.571  -20.806 29.202  1.00 83.32  ? 56  DA  D C2    1 
ATOM   6676 N  N3    . DA  D 3 28  ? 29.661  -20.431 29.867  1.00 84.26  ? 56  DA  D N3    1 
ATOM   6677 C  C4    . DA  D 3 28  ? 30.761  -20.985 29.328  1.00 83.05  ? 56  DA  D C4    1 
ATOM   6678 P  P     . DT  D 3 29  ? 35.837  -20.503 34.229  1.00 102.26 ? 0   DT  D P     1 
ATOM   6679 O  OP1   . DT  D 3 29  ? 35.788  -21.834 33.568  1.00 102.96 ? 0   DT  D OP1   1 
ATOM   6680 O  OP2   . DT  D 3 29  ? 35.452  -20.388 35.650  1.00 101.94 ? 0   DT  D OP2   1 
ATOM   6681 O  "O5'" . DT  D 3 29  ? 37.294  -19.909 33.961  1.00 101.35 ? 0   DT  D "O5'" 1 
ATOM   6682 C  "C5'" . DT  D 3 29  ? 38.015  -19.136 34.944  1.00 100.44 ? 0   DT  D "C5'" 1 
ATOM   6683 C  "C4'" . DT  D 3 29  ? 39.350  -19.782 35.287  1.00 99.73  ? 0   DT  D "C4'" 1 
ATOM   6684 O  "O4'" . DT  D 3 29  ? 39.232  -21.223 35.209  1.00 100.17 ? 0   DT  D "O4'" 1 
ATOM   6685 C  "C3'" . DT  D 3 29  ? 40.532  -19.406 34.380  1.00 99.37  ? 0   DT  D "C3'" 1 
ATOM   6686 O  "O3'" . DT  D 3 29  ? 41.575  -18.701 35.076  1.00 98.57  ? 0   DT  D "O3'" 1 
ATOM   6687 C  "C2'" . DT  D 3 29  ? 41.062  -20.729 33.838  1.00 99.67  ? 0   DT  D "C2'" 1 
ATOM   6688 C  "C1'" . DT  D 3 29  ? 40.450  -21.783 34.736  1.00 99.95  ? 0   DT  D "C1'" 1 
ATOM   6689 N  N1    . DT  D 3 29  ? 40.138  -23.057 34.031  1.00 100.89 ? 0   DT  D N1    1 
ATOM   6690 C  C2    . DT  D 3 29  ? 41.154  -23.721 33.367  1.00 101.10 ? 0   DT  D C2    1 
ATOM   6691 O  O2    . DT  D 3 29  ? 42.310  -23.324 33.337  1.00 100.45 ? 0   DT  D O2    1 
ATOM   6692 N  N3    . DT  D 3 29  ? 40.765  -24.881 32.742  1.00 102.26 ? 0   DT  D N3    1 
ATOM   6693 C  C4    . DT  D 3 29  ? 39.495  -25.430 32.712  1.00 103.18 ? 0   DT  D C4    1 
ATOM   6694 O  O4    . DT  D 3 29  ? 39.297  -26.480 32.104  1.00 104.37 ? 0   DT  D O4    1 
ATOM   6695 C  C5    . DT  D 3 29  ? 38.480  -24.681 33.424  1.00 102.80 ? 0   DT  D C5    1 
ATOM   6696 C  C7    . DT  D 3 29  ? 37.073  -25.194 33.441  1.00 103.82 ? 0   DT  D C7    1 
ATOM   6697 C  C6    . DT  D 3 29  ? 38.849  -23.550 34.040  1.00 101.72 ? 0   DT  D C6    1 
ATOM   6698 P  P     . DA  D 3 30  ? 41.626  -17.102 34.990  1.00 98.43  ? 1   DA  D P     1 
ATOM   6699 O  OP1   . DA  D 3 30  ? 40.268  -16.579 35.255  1.00 99.01  ? 1   DA  D OP1   1 
ATOM   6700 O  OP2   . DA  D 3 30  ? 42.368  -16.703 33.763  1.00 98.43  ? 1   DA  D OP2   1 
ATOM   6701 O  "O5'" . DA  D 3 30  ? 42.505  -16.669 36.234  1.00 97.81  ? 1   DA  D "O5'" 1 
ATOM   6702 C  "C5'" . DA  D 3 30  ? 43.928  -16.813 36.244  1.00 97.27  ? 1   DA  D "C5'" 1 
ATOM   6703 C  "C4'" . DA  D 3 30  ? 44.543  -15.549 36.787  1.00 97.05  ? 1   DA  D "C4'" 1 
ATOM   6704 O  "O4'" . DA  D 3 30  ? 43.908  -15.221 38.041  1.00 97.31  ? 1   DA  D "O4'" 1 
ATOM   6705 C  "C3'" . DA  D 3 30  ? 46.026  -15.662 37.097  1.00 96.58  ? 1   DA  D "C3'" 1 
ATOM   6706 O  "O3'" . DA  D 3 30  ? 46.625  -14.375 37.029  1.00 96.54  ? 1   DA  D "O3'" 1 
ATOM   6707 C  "C2'" . DA  D 3 30  ? 46.027  -16.137 38.530  1.00 96.63  ? 1   DA  D "C2'" 1 
ATOM   6708 C  "C1'" . DA  D 3 30  ? 44.810  -15.433 39.106  1.00 97.10  ? 1   DA  D "C1'" 1 
ATOM   6709 N  N9    . DA  D 3 30  ? 44.115  -16.183 40.144  1.00 97.40  ? 1   DA  D N9    1 
ATOM   6710 C  C8    . DA  D 3 30  ? 43.985  -17.542 40.292  1.00 97.41  ? 1   DA  D C8    1 
ATOM   6711 N  N7    . DA  D 3 30  ? 43.333  -17.895 41.374  1.00 97.84  ? 1   DA  D N7    1 
ATOM   6712 C  C5    . DA  D 3 30  ? 43.022  -16.687 41.983  1.00 98.18  ? 1   DA  D C5    1 
ATOM   6713 C  C6    . DA  D 3 30  ? 42.342  -16.373 43.175  1.00 98.87  ? 1   DA  D C6    1 
ATOM   6714 N  N6    . DA  D 3 30  ? 41.823  -17.289 43.996  1.00 99.28  ? 1   DA  D N6    1 
ATOM   6715 N  N1    . DA  D 3 30  ? 42.203  -15.067 43.493  1.00 99.33  ? 1   DA  D N1    1 
ATOM   6716 C  C2    . DA  D 3 30  ? 42.716  -14.146 42.665  1.00 99.05  ? 1   DA  D C2    1 
ATOM   6717 N  N3    . DA  D 3 30  ? 43.379  -14.317 41.524  1.00 98.34  ? 1   DA  D N3    1 
ATOM   6718 C  C4    . DA  D 3 30  ? 43.500  -15.625 41.237  1.00 97.94  ? 1   DA  D C4    1 
ATOM   6719 P  P     . DG  D 3 31  ? 47.378  -13.930 35.719  1.00 96.42  ? 2   DG  D P     1 
ATOM   6720 O  OP1   . DG  D 3 31  ? 47.637  -12.477 35.827  1.00 96.62  ? 2   DG  D OP1   1 
ATOM   6721 O  OP2   . DG  D 3 31  ? 46.641  -14.474 34.560  1.00 96.70  ? 2   DG  D OP2   1 
ATOM   6722 O  "O5'" . DG  D 3 31  ? 48.742  -14.739 35.791  1.00 96.01  ? 2   DG  D "O5'" 1 
ATOM   6723 C  "C5'" . DG  D 3 31  ? 49.652  -14.533 36.884  1.00 95.86  ? 2   DG  D "C5'" 1 
ATOM   6724 C  "C4'" . DG  D 3 31  ? 50.971  -15.208 36.593  1.00 95.64  ? 2   DG  D "C4'" 1 
ATOM   6725 O  "O4'" . DG  D 3 31  ? 51.643  -14.482 35.539  1.00 95.59  ? 2   DG  D "O4'" 1 
ATOM   6726 C  "C3'" . DG  D 3 31  ? 51.953  -15.204 37.757  1.00 95.65  ? 2   DG  D "C3'" 1 
ATOM   6727 O  "O3'" . DG  D 3 31  ? 52.889  -16.268 37.561  1.00 95.62  ? 2   DG  D "O3'" 1 
ATOM   6728 C  "C2'" . DG  D 3 31  ? 52.611  -13.850 37.591  1.00 95.69  ? 2   DG  D "C2'" 1 
ATOM   6729 C  "C1'" . DG  D 3 31  ? 52.743  -13.765 36.076  1.00 95.55  ? 2   DG  D "C1'" 1 
ATOM   6730 N  N9    . DG  D 3 31  ? 52.723  -12.423 35.504  1.00 95.72  ? 2   DG  D N9    1 
ATOM   6731 C  C8    . DG  D 3 31  ? 51.924  -11.368 35.871  1.00 96.06  ? 2   DG  D C8    1 
ATOM   6732 N  N7    . DG  D 3 31  ? 52.139  -10.292 35.164  1.00 96.33  ? 2   DG  D N7    1 
ATOM   6733 C  C5    . DG  D 3 31  ? 53.127  -10.666 34.263  1.00 96.10  ? 2   DG  D C5    1 
ATOM   6734 C  C6    . DG  D 3 31  ? 53.767  -9.920  33.236  1.00 96.32  ? 2   DG  D C6    1 
ATOM   6735 O  O6    . DG  D 3 31  ? 53.579  -8.744  32.906  1.00 96.79  ? 2   DG  D O6    1 
ATOM   6736 N  N1    . DG  D 3 31  ? 54.716  -10.685 32.564  1.00 96.12  ? 2   DG  D N1    1 
ATOM   6737 C  C2    . DG  D 3 31  ? 55.013  -11.998 32.844  1.00 95.83  ? 2   DG  D C2    1 
ATOM   6738 N  N2    . DG  D 3 31  ? 55.959  -12.568 32.086  1.00 95.88  ? 2   DG  D N2    1 
ATOM   6739 N  N3    . DG  D 3 31  ? 54.424  -12.702 33.797  1.00 95.64  ? 2   DG  D N3    1 
ATOM   6740 C  C4    . DG  D 3 31  ? 53.494  -11.980 34.457  1.00 95.75  ? 2   DG  D C4    1 
ATOM   6741 P  P     . DC  D 3 32  ? 53.674  -16.959 38.795  1.00 95.88  ? 3   DC  D P     1 
ATOM   6742 O  OP1   . DC  D 3 32  ? 53.418  -18.423 38.732  1.00 96.09  ? 3   DC  D OP1   1 
ATOM   6743 O  OP2   . DC  D 3 32  ? 53.383  -16.218 40.066  1.00 96.15  ? 3   DC  D OP2   1 
ATOM   6744 O  "O5'" . DC  D 3 32  ? 55.198  -16.740 38.387  1.00 95.88  ? 3   DC  D "O5'" 1 
ATOM   6745 C  "C5'" . DC  D 3 32  ? 55.910  -15.544 38.755  1.00 95.95  ? 3   DC  D "C5'" 1 
ATOM   6746 C  "C4'" . DC  D 3 32  ? 56.800  -15.095 37.620  1.00 95.80  ? 3   DC  D "C4'" 1 
ATOM   6747 O  "O4'" . DC  D 3 32  ? 56.153  -14.056 36.849  1.00 95.62  ? 3   DC  D "O4'" 1 
ATOM   6748 C  "C3'" . DC  D 3 32  ? 58.125  -14.486 38.071  1.00 96.08  ? 3   DC  D "C3'" 1 
ATOM   6749 O  "O3'" . DC  D 3 32  ? 59.048  -15.529 38.408  1.00 96.38  ? 3   DC  D "O3'" 1 
ATOM   6750 C  "C2'" . DC  D 3 32  ? 58.516  -13.620 36.883  1.00 95.93  ? 3   DC  D "C2'" 1 
ATOM   6751 C  "C1'" . DC  D 3 32  ? 57.159  -13.201 36.319  1.00 95.70  ? 3   DC  D "C1'" 1 
ATOM   6752 N  N1    . DC  D 3 32  ? 56.652  -11.817 36.188  1.00 95.83  ? 3   DC  D N1    1 
ATOM   6753 C  C2    . DC  D 3 32  ? 57.368  -10.921 35.393  1.00 95.97  ? 3   DC  D C2    1 
ATOM   6754 O  O2    . DC  D 3 32  ? 58.390  -11.318 34.817  1.00 95.94  ? 3   DC  D O2    1 
ATOM   6755 N  N3    . DC  D 3 32  ? 56.925  -9.649  35.263  1.00 96.29  ? 3   DC  D N3    1 
ATOM   6756 C  C4    . DC  D 3 32  ? 55.819  -9.260  35.899  1.00 96.48  ? 3   DC  D C4    1 
ATOM   6757 N  N4    . DC  D 3 32  ? 55.422  -7.994  35.749  1.00 97.01  ? 3   DC  D N4    1 
ATOM   6758 C  C5    . DC  D 3 32  ? 55.073  -10.149 36.722  1.00 96.30  ? 3   DC  D C5    1 
ATOM   6759 C  C6    . DC  D 3 32  ? 55.520  -11.407 36.837  1.00 95.96  ? 3   DC  D C6    1 
ATOM   6760 P  P     . DA  D 3 33  ? 60.164  -15.284 39.526  1.00 97.00  ? 4   DA  D P     1 
ATOM   6761 O  OP1   . DA  D 3 33  ? 60.788  -16.587 39.863  1.00 97.43  ? 4   DA  D OP1   1 
ATOM   6762 O  OP2   . DA  D 3 33  ? 59.586  -14.429 40.592  1.00 97.28  ? 4   DA  D OP2   1 
ATOM   6763 O  "O5'" . DA  D 3 33  ? 61.237  -14.413 38.752  1.00 97.01  ? 4   DA  D "O5'" 1 
ATOM   6764 C  "C5'" . DA  D 3 33  ? 61.815  -14.856 37.515  1.00 96.84  ? 4   DA  D "C5'" 1 
ATOM   6765 C  "C4'" . DA  D 3 33  ? 62.644  -13.729 36.947  1.00 96.92  ? 4   DA  D "C4'" 1 
ATOM   6766 O  "O4'" . DA  D 3 33  ? 61.766  -12.629 36.610  1.00 96.63  ? 4   DA  D "O4'" 1 
ATOM   6767 C  "C3'" . DA  D 3 33  ? 63.659  -13.162 37.941  1.00 97.54  ? 4   DA  D "C3'" 1 
ATOM   6768 O  "O3'" . DA  D 3 33  ? 64.836  -12.712 37.278  1.00 97.80  ? 4   DA  D "O3'" 1 
ATOM   6769 C  "C2'" . DA  D 3 33  ? 62.941  -11.963 38.525  1.00 97.61  ? 4   DA  D "C2'" 1 
ATOM   6770 C  "C1'" . DA  D 3 33  ? 62.176  -11.466 37.311  1.00 97.05  ? 4   DA  D "C1'" 1 
ATOM   6771 N  N9    . DA  D 3 33  ? 60.985  -10.669 37.597  1.00 97.00  ? 4   DA  D N9    1 
ATOM   6772 C  C8    . DA  D 3 33  ? 60.015  -10.874 38.548  1.00 97.06  ? 4   DA  D C8    1 
ATOM   6773 N  N7    . DA  D 3 33  ? 59.073  -9.962  38.546  1.00 97.16  ? 4   DA  D N7    1 
ATOM   6774 C  C5    . DA  D 3 33  ? 59.455  -9.091  37.536  1.00 97.18  ? 4   DA  D C5    1 
ATOM   6775 C  C6    . DA  D 3 33  ? 58.882  -7.907  37.040  1.00 97.44  ? 4   DA  D C6    1 
ATOM   6776 N  N6    . DA  D 3 33  ? 57.749  -7.382  37.505  1.00 97.75  ? 4   DA  D N6    1 
ATOM   6777 N  N1    . DA  D 3 33  ? 59.513  -7.281  36.022  1.00 97.54  ? 4   DA  D N1    1 
ATOM   6778 C  C2    . DA  D 3 33  ? 60.645  -7.815  35.545  1.00 97.35  ? 4   DA  D C2    1 
ATOM   6779 N  N3    . DA  D 3 33  ? 61.282  -8.919  35.930  1.00 97.13  ? 4   DA  D N3    1 
ATOM   6780 C  C4    . DA  D 3 33  ? 60.627  -9.517  36.940  1.00 97.05  ? 4   DA  D C4    1 
ATOM   6781 P  P     . DG  D 3 34  ? 66.198  -12.687 38.053  1.00 98.63  ? 5   DG  D P     1 
ATOM   6782 O  OP1   . DG  D 3 34  ? 66.842  -14.002 37.888  1.00 98.89  ? 5   DG  D OP1   1 
ATOM   6783 O  OP2   . DG  D 3 34  ? 65.948  -12.155 39.414  1.00 99.14  ? 5   DG  D OP2   1 
ATOM   6784 O  "O5'" . DG  D 3 34  ? 67.082  -11.701 37.177  1.00 98.78  ? 5   DG  D "O5'" 1 
ATOM   6785 C  "C5'" . DG  D 3 34  ? 67.517  -10.449 37.702  1.00 99.34  ? 5   DG  D "C5'" 1 
ATOM   6786 C  "C4'" . DG  D 3 34  ? 66.811  -9.343  36.964  1.00 98.99  ? 5   DG  D "C4'" 1 
ATOM   6787 O  "O4'" . DG  D 3 34  ? 65.410  -9.297  37.267  1.00 98.56  ? 5   DG  D "O4'" 1 
ATOM   6788 C  "C3'" . DG  D 3 34  ? 67.294  -7.953  37.325  1.00 99.76  ? 5   DG  D "C3'" 1 
ATOM   6789 O  "O3'" . DG  D 3 34  ? 68.553  -7.721  36.707  1.00 100.15 ? 5   DG  D "O3'" 1 
ATOM   6790 C  "C2'" . DG  D 3 34  ? 66.164  -7.081  36.818  1.00 99.45  ? 5   DG  D "C2'" 1 
ATOM   6791 C  "C1'" . DG  D 3 34  ? 64.957  -8.015  36.846  1.00 98.67  ? 5   DG  D "C1'" 1 
ATOM   6792 N  N9    . DG  D 3 34  ? 63.842  -7.612  37.695  1.00 98.80  ? 5   DG  D N9    1 
ATOM   6793 C  C8    . DG  D 3 34  ? 63.234  -8.345  38.684  1.00 98.74  ? 5   DG  D C8    1 
ATOM   6794 N  N7    . DG  D 3 34  ? 62.206  -7.739  39.212  1.00 98.98  ? 5   DG  D N7    1 
ATOM   6795 C  C5    . DG  D 3 34  ? 62.117  -6.542  38.515  1.00 99.22  ? 5   DG  D C5    1 
ATOM   6796 C  C6    . DG  D 3 34  ? 61.197  -5.470  38.643  1.00 99.72  ? 5   DG  D C6    1 
ATOM   6797 O  O6    . DG  D 3 34  ? 60.243  -5.362  39.420  1.00 100.03 ? 5   DG  D O6    1 
ATOM   6798 N  N1    . DG  D 3 34  ? 61.468  -4.451  37.735  1.00 100.03 ? 5   DG  D N1    1 
ATOM   6799 C  C2    . DG  D 3 34  ? 62.497  -4.458  36.825  1.00 99.84  ? 5   DG  D C2    1 
ATOM   6800 N  N2    . DG  D 3 34  ? 62.595  -3.379  36.033  1.00 100.32 ? 5   DG  D N2    1 
ATOM   6801 N  N3    . DG  D 3 34  ? 63.365  -5.450  36.700  1.00 99.37  ? 5   DG  D N3    1 
ATOM   6802 C  C4    . DG  D 3 34  ? 63.116  -6.452  37.570  1.00 99.10  ? 5   DG  D C4    1 
ATOM   6803 P  P     . DT  D 3 35  ? 69.632  -6.883  37.483  1.00 101.31 ? 6   DT  D P     1 
ATOM   6804 O  OP1   . DT  D 3 35  ? 70.860  -6.841  36.661  1.00 101.60 ? 6   DT  D OP1   1 
ATOM   6805 O  OP2   . DT  D 3 35  ? 69.695  -7.404  38.868  1.00 101.86 ? 6   DT  D OP2   1 
ATOM   6806 O  "O5'" . DT  D 3 35  ? 68.994  -5.429  37.465  1.00 101.67 ? 6   DT  D "O5'" 1 
ATOM   6807 C  "C5'" . DT  D 3 35  ? 68.783  -4.764  36.214  1.00 101.38 ? 6   DT  D "C5'" 1 
ATOM   6808 C  "C4'" . DT  D 3 35  ? 68.097  -3.442  36.448  1.00 101.99 ? 6   DT  D "C4'" 1 
ATOM   6809 O  "O4'" . DT  D 3 35  ? 66.783  -3.662  37.012  1.00 101.61 ? 6   DT  D "O4'" 1 
ATOM   6810 C  "C3'" . DT  D 3 35  ? 68.826  -2.524  37.432  1.00 103.40 ? 6   DT  D "C3'" 1 
ATOM   6811 O  "O3'" . DT  D 3 35  ? 68.837  -1.198  36.904  1.00 104.15 ? 6   DT  D "O3'" 1 
ATOM   6812 C  "C2'" . DT  D 3 35  ? 67.981  -2.613  38.691  1.00 103.71 ? 6   DT  D "C2'" 1 
ATOM   6813 C  "C1'" . DT  D 3 35  ? 66.606  -2.753  38.083  1.00 102.74 ? 6   DT  D "C1'" 1 
ATOM   6814 N  N1    . DT  D 3 35  ? 65.583  -3.304  38.987  1.00 102.51 ? 6   DT  D N1    1 
ATOM   6815 C  C2    . DT  D 3 35  ? 64.498  -2.521  39.315  1.00 102.99 ? 6   DT  D C2    1 
ATOM   6816 O  O2    . DT  D 3 35  ? 64.337  -1.389  38.888  1.00 103.65 ? 6   DT  D O2    1 
ATOM   6817 N  N3    . DT  D 3 35  ? 63.600  -3.119  40.165  1.00 102.82 ? 6   DT  D N3    1 
ATOM   6818 C  C4    . DT  D 3 35  ? 63.682  -4.388  40.710  1.00 102.25 ? 6   DT  D C4    1 
ATOM   6819 O  O4    . DT  D 3 35  ? 62.794  -4.792  41.454  1.00 102.25 ? 6   DT  D O4    1 
ATOM   6820 C  C5    . DT  D 3 35  ? 64.848  -5.151  40.324  1.00 101.84 ? 6   DT  D C5    1 
ATOM   6821 C  C7    . DT  D 3 35  ? 65.027  -6.534  40.866  1.00 101.44 ? 6   DT  D C7    1 
ATOM   6822 C  C6    . DT  D 3 35  ? 65.730  -4.575  39.498  1.00 101.98 ? 6   DT  D C6    1 
ATOM   6823 P  P     . DG  D 3 36  ? 69.600  -0.024  37.685  1.00 105.91 ? 7   DG  D P     1 
ATOM   6824 O  OP1   . DG  D 3 36  ? 70.177  0.889   36.661  1.00 106.40 ? 7   DG  D OP1   1 
ATOM   6825 O  OP2   . DG  D 3 36  ? 70.490  -0.642  38.711  1.00 106.42 ? 7   DG  D OP2   1 
ATOM   6826 O  "O5'" . DG  D 3 36  ? 68.418  0.705   38.470  1.00 106.63 ? 7   DG  D "O5'" 1 
ATOM   6827 C  "C5'" . DG  D 3 36  ? 67.697  1.830   37.917  1.00 107.17 ? 7   DG  D "C5'" 1 
ATOM   6828 C  "C4'" . DG  D 3 36  ? 67.065  2.632   39.031  1.00 108.62 ? 7   DG  D "C4'" 1 
ATOM   6829 O  "O4'" . DG  D 3 36  ? 66.093  1.803   39.714  1.00 107.90 ? 7   DG  D "O4'" 1 
ATOM   6830 C  "C3'" . DG  D 3 36  ? 68.044  3.111   40.110  1.00 110.35 ? 7   DG  D "C3'" 1 
ATOM   6831 O  "O3'" . DG  D 3 36  ? 67.729  4.433   40.561  1.00 112.28 ? 7   DG  D "O3'" 1 
ATOM   6832 C  "C2'" . DG  D 3 36  ? 67.852  2.109   41.233  1.00 110.08 ? 7   DG  D "C2'" 1 
ATOM   6833 C  "C1'" . DG  D 3 36  ? 66.370  1.796   41.106  1.00 109.10 ? 7   DG  D "C1'" 1 
ATOM   6834 N  N9    . DG  D 3 36  ? 65.923  0.516   41.651  1.00 108.03 ? 7   DG  D N9    1 
ATOM   6835 C  C8    . DG  D 3 36  ? 66.650  -0.642  41.791  1.00 107.23 ? 7   DG  D C8    1 
ATOM   6836 N  N7    . DG  D 3 36  ? 65.964  -1.616  42.325  1.00 106.53 ? 7   DG  D N7    1 
ATOM   6837 C  C5    . DG  D 3 36  ? 64.705  -1.071  42.541  1.00 106.82 ? 7   DG  D C5    1 
ATOM   6838 C  C6    . DG  D 3 36  ? 63.533  -1.652  43.094  1.00 106.42 ? 7   DG  D C6    1 
ATOM   6839 O  O6    . DG  D 3 36  ? 63.374  -2.794  43.539  1.00 105.74 ? 7   DG  D O6    1 
ATOM   6840 N  N1    . DG  D 3 36  ? 62.481  -0.741  43.137  1.00 107.11 ? 7   DG  D N1    1 
ATOM   6841 C  C2    . DG  D 3 36  ? 62.546  0.560   42.704  1.00 108.13 ? 7   DG  D C2    1 
ATOM   6842 N  N2    . DG  D 3 36  ? 61.424  1.283   42.829  1.00 108.87 ? 7   DG  D N2    1 
ATOM   6843 N  N3    . DG  D 3 36  ? 63.631  1.113   42.184  1.00 108.52 ? 7   DG  D N3    1 
ATOM   6844 C  C4    . DG  D 3 36  ? 64.666  0.246   42.135  1.00 107.79 ? 7   DG  D C4    1 
ATOM   6845 O  OP3   . DG  E 2 1   ? 57.705  -16.735 -0.489  1.00 89.35  ? 4   DG  E OP3   1 
ATOM   6846 P  P     . DG  E 2 1   ? 57.418  -18.125 -0.037  1.00 88.12  ? 4   DG  E P     1 
ATOM   6847 O  OP1   . DG  E 2 1   ? 55.938  -18.132 0.246   1.00 85.20  ? 4   DG  E OP1   1 
ATOM   6848 O  OP2   . DG  E 2 1   ? 57.918  -18.971 -1.166  1.00 88.95  ? 4   DG  E OP2   1 
ATOM   6849 O  "O5'" . DG  E 2 1   ? 58.371  -18.256 1.243   1.00 89.91  ? 4   DG  E "O5'" 1 
ATOM   6850 C  "C5'" . DG  E 2 1   ? 58.824  -19.539 1.741   1.00 90.34  ? 4   DG  E "C5'" 1 
ATOM   6851 C  "C4'" . DG  E 2 1   ? 57.869  -20.111 2.770   1.00 88.21  ? 4   DG  E "C4'" 1 
ATOM   6852 O  "O4'" . DG  E 2 1   ? 57.358  -19.021 3.576   1.00 87.60  ? 4   DG  E "O4'" 1 
ATOM   6853 C  "C3'" . DG  E 2 1   ? 56.637  -20.812 2.175   1.00 85.61  ? 4   DG  E "C3'" 1 
ATOM   6854 O  "O3'" . DG  E 2 1   ? 56.743  -22.217 1.851   1.00 85.51  ? 4   DG  E "O3'" 1 
ATOM   6855 C  "C2'" . DG  E 2 1   ? 55.481  -20.390 3.072   1.00 83.59  ? 4   DG  E "C2'" 1 
ATOM   6856 C  "C1'" . DG  E 2 1   ? 56.011  -19.269 3.960   1.00 84.99  ? 4   DG  E "C1'" 1 
ATOM   6857 N  N9    . DG  E 2 1   ? 55.224  -18.054 3.746   1.00 84.00  ? 4   DG  E N9    1 
ATOM   6858 C  C8    . DG  E 2 1   ? 55.526  -16.969 2.954   1.00 84.97  ? 4   DG  E C8    1 
ATOM   6859 N  N7    . DG  E 2 1   ? 54.563  -16.089 2.903   1.00 83.65  ? 4   DG  E N7    1 
ATOM   6860 C  C5    . DG  E 2 1   ? 53.556  -16.636 3.686   1.00 81.70  ? 4   DG  E C5    1 
ATOM   6861 C  C6    . DG  E 2 1   ? 52.274  -16.132 4.016   1.00 79.87  ? 4   DG  E C6    1 
ATOM   6862 O  O6    . DG  E 2 1   ? 51.752  -15.067 3.664   1.00 79.54  ? 4   DG  E O6    1 
ATOM   6863 N  N1    . DG  E 2 1   ? 51.578  -17.009 4.846   1.00 78.48  ? 4   DG  E N1    1 
ATOM   6864 C  C2    . DG  E 2 1   ? 52.059  -18.212 5.307   1.00 78.81  ? 4   DG  E C2    1 
ATOM   6865 N  N2    . DG  E 2 1   ? 51.232  -18.926 6.080   1.00 77.42  ? 4   DG  E N2    1 
ATOM   6866 N  N3    . DG  E 2 1   ? 53.249  -18.697 4.997   1.00 80.49  ? 4   DG  E N3    1 
ATOM   6867 C  C4    . DG  E 2 1   ? 53.941  -17.860 4.195   1.00 81.87  ? 4   DG  E C4    1 
ATOM   6868 P  P     . DG  E 2 2   ? 56.683  -23.465 2.926   1.00 85.20  ? 5   DG  E P     1 
ATOM   6869 O  OP1   . DG  E 2 2   ? 57.831  -23.326 3.871   1.00 87.44  ? 5   DG  E OP1   1 
ATOM   6870 O  OP2   . DG  E 2 2   ? 56.564  -24.724 2.133   1.00 84.88  ? 5   DG  E OP2   1 
ATOM   6871 O  "O5'" . DG  E 2 2   ? 55.274  -23.336 3.689   1.00 82.64  ? 5   DG  E "O5'" 1 
ATOM   6872 C  "C5'" . DG  E 2 2   ? 55.134  -23.562 5.131   1.00 82.51  ? 5   DG  E "C5'" 1 
ATOM   6873 C  "C4'" . DG  E 2 2   ? 53.770  -24.121 5.498   1.00 80.16  ? 5   DG  E "C4'" 1 
ATOM   6874 O  "O4'" . DG  E 2 2   ? 52.807  -23.038 5.497   1.00 78.70  ? 5   DG  E "O4'" 1 
ATOM   6875 C  "C3'" . DG  E 2 2   ? 53.183  -25.196 4.568   1.00 78.98  ? 5   DG  E "C3'" 1 
ATOM   6876 O  "O3'" . DG  E 2 2   ? 52.472  -26.266 5.254   1.00 77.93  ? 5   DG  E "O3'" 1 
ATOM   6877 C  "C2'" . DG  E 2 2   ? 52.339  -24.373 3.603   1.00 77.52  ? 5   DG  E "C2'" 1 
ATOM   6878 C  "C1'" . DG  E 2 2   ? 51.815  -23.258 4.499   1.00 76.91  ? 5   DG  E "C1'" 1 
ATOM   6879 N  N9    . DG  E 2 2   ? 51.553  -21.982 3.842   1.00 76.59  ? 5   DG  E N9    1 
ATOM   6880 C  C8    . DG  E 2 2   ? 52.343  -21.328 2.926   1.00 77.89  ? 5   DG  E C8    1 
ATOM   6881 N  N7    . DG  E 2 2   ? 51.847  -20.181 2.549   1.00 77.33  ? 5   DG  E N7    1 
ATOM   6882 C  C5    . DG  E 2 2   ? 50.653  -20.076 3.252   1.00 75.56  ? 5   DG  E C5    1 
ATOM   6883 C  C6    . DG  E 2 2   ? 49.677  -19.043 3.262   1.00 74.41  ? 5   DG  E C6    1 
ATOM   6884 O  O6    . DG  E 2 2   ? 49.676  -17.979 2.634   1.00 74.70  ? 5   DG  E O6    1 
ATOM   6885 N  N1    . DG  E 2 2   ? 48.634  -19.332 4.136   1.00 72.99  ? 5   DG  E N1    1 
ATOM   6886 C  C2    . DG  E 2 2   ? 48.540  -20.467 4.906   1.00 72.70  ? 5   DG  E C2    1 
ATOM   6887 N  N2    . DG  E 2 2   ? 47.450  -20.569 5.681   1.00 71.42  ? 5   DG  E N2    1 
ATOM   6888 N  N3    . DG  E 2 2   ? 49.444  -21.433 4.911   1.00 73.73  ? 5   DG  E N3    1 
ATOM   6889 C  C4    . DG  E 2 2   ? 50.465  -21.174 4.065   1.00 75.12  ? 5   DG  E C4    1 
ATOM   6890 P  P     . DT  E 2 3   ? 51.623  -27.390 4.422   1.00 76.54  ? 6   DT  E P     1 
ATOM   6891 O  OP1   . DT  E 2 3   ? 51.672  -28.669 5.172   1.00 76.91  ? 6   DT  E OP1   1 
ATOM   6892 O  OP2   . DT  E 2 3   ? 52.043  -27.359 2.994   1.00 77.05  ? 6   DT  E OP2   1 
ATOM   6893 O  "O5'" . DT  E 2 3   ? 50.129  -26.860 4.558   1.00 74.25  ? 6   DT  E "O5'" 1 
ATOM   6894 C  "C5'" . DT  E 2 3   ? 49.581  -26.532 5.852   1.00 73.71  ? 6   DT  E "C5'" 1 
ATOM   6895 C  "C4'" . DT  E 2 3   ? 48.140  -26.108 5.697   1.00 71.68  ? 6   DT  E "C4'" 1 
ATOM   6896 O  "O4'" . DT  E 2 3   ? 48.094  -24.821 5.036   1.00 71.45  ? 6   DT  E "O4'" 1 
ATOM   6897 C  "C3'" . DT  E 2 3   ? 47.277  -27.053 4.853   1.00 70.39  ? 6   DT  E "C3'" 1 
ATOM   6898 O  "O3'" . DT  E 2 3   ? 46.038  -27.305 5.530   1.00 69.04  ? 6   DT  E "O3'" 1 
ATOM   6899 C  "C2'" . DT  E 2 3   ? 47.111  -26.321 3.529   1.00 69.82  ? 6   DT  E "C2'" 1 
ATOM   6900 C  "C1'" . DT  E 2 3   ? 47.174  -24.862 3.956   1.00 69.97  ? 6   DT  E "C1'" 1 
ATOM   6901 N  N1    . DT  E 2 3   ? 47.634  -23.890 2.941   1.00 70.43  ? 6   DT  E N1    1 
ATOM   6902 C  C2    . DT  E 2 3   ? 46.923  -22.718 2.790   1.00 69.56  ? 6   DT  E C2    1 
ATOM   6903 O  O2    . DT  E 2 3   ? 45.913  -22.463 3.426   1.00 68.44  ? 6   DT  E O2    1 
ATOM   6904 N  N3    . DT  E 2 3   ? 47.431  -21.859 1.845   1.00 70.22  ? 6   DT  E N3    1 
ATOM   6905 C  C4    . DT  E 2 3   ? 48.560  -22.045 1.068   1.00 71.69  ? 6   DT  E C4    1 
ATOM   6906 O  O4    . DT  E 2 3   ? 48.900  -21.179 0.267   1.00 72.28  ? 6   DT  E O4    1 
ATOM   6907 C  C5    . DT  E 2 3   ? 49.267  -23.287 1.294   1.00 72.58  ? 6   DT  E C5    1 
ATOM   6908 C  C7    . DT  E 2 3   ? 50.499  -23.578 0.496   1.00 74.40  ? 6   DT  E C7    1 
ATOM   6909 C  C6    . DT  E 2 3   ? 48.782  -24.130 2.215   1.00 71.91  ? 6   DT  E C6    1 
ATOM   6910 P  P     . DG  E 2 4   ? 45.025  -28.414 4.980   1.00 67.84  ? 7   DG  E P     1 
ATOM   6911 O  OP1   . DG  E 2 4   ? 44.574  -29.222 6.145   1.00 67.84  ? 7   DG  E OP1   1 
ATOM   6912 O  OP2   . DG  E 2 4   ? 45.650  -29.081 3.800   1.00 68.41  ? 7   DG  E OP2   1 
ATOM   6913 O  "O5'" . DG  E 2 4   ? 43.805  -27.540 4.456   1.00 66.18  ? 7   DG  E "O5'" 1 
ATOM   6914 C  "C5'" . DG  E 2 4   ? 43.277  -26.451 5.233   1.00 65.74  ? 7   DG  E "C5'" 1 
ATOM   6915 C  "C4'" . DG  E 2 4   ? 42.241  -25.709 4.422   1.00 64.37  ? 7   DG  E "C4'" 1 
ATOM   6916 O  "O4'" . DG  E 2 4   ? 42.910  -24.730 3.593   1.00 64.80  ? 7   DG  E "O4'" 1 
ATOM   6917 C  "C3'" . DG  E 2 4   ? 41.410  -26.581 3.472   1.00 63.29  ? 7   DG  E "C3'" 1 
ATOM   6918 O  "O3'" . DG  E 2 4   ? 40.026  -26.253 3.573   1.00 62.00  ? 7   DG  E "O3'" 1 
ATOM   6919 C  "C2'" . DG  E 2 4   ? 42.019  -26.305 2.108   1.00 63.51  ? 7   DG  E "C2'" 1 
ATOM   6920 C  "C1'" . DG  E 2 4   ? 42.484  -24.872 2.249   1.00 63.98  ? 7   DG  E "C1'" 1 
ATOM   6921 N  N9    . DG  E 2 4   ? 43.597  -24.488 1.386   1.00 65.03  ? 7   DG  E N9    1 
ATOM   6922 C  C8    . DG  E 2 4   ? 44.702  -25.232 1.048   1.00 66.28  ? 7   DG  E C8    1 
ATOM   6923 N  N7    . DG  E 2 4   ? 45.528  -24.594 0.265   1.00 67.21  ? 7   DG  E N7    1 
ATOM   6924 C  C5    . DG  E 2 4   ? 44.939  -23.350 0.085   1.00 66.50  ? 7   DG  E C5    1 
ATOM   6925 C  C6    . DG  E 2 4   ? 45.371  -22.226 -0.667  1.00 67.09  ? 7   DG  E C6    1 
ATOM   6926 O  O6    . DG  E 2 4   ? 46.391  -22.104 -1.351  1.00 68.42  ? 7   DG  E O6    1 
ATOM   6927 N  N1    . DG  E 2 4   ? 44.469  -21.170 -0.575  1.00 66.13  ? 7   DG  E N1    1 
ATOM   6928 C  C2    . DG  E 2 4   ? 43.300  -21.191 0.148   1.00 64.82  ? 7   DG  E C2    1 
ATOM   6929 N  N2    . DG  E 2 4   ? 42.558  -20.075 0.117   1.00 64.21  ? 7   DG  E N2    1 
ATOM   6930 N  N3    . DG  E 2 4   ? 42.889  -22.230 0.855   1.00 64.30  ? 7   DG  E N3    1 
ATOM   6931 C  C4    . DG  E 2 4   ? 43.748  -23.268 0.775   1.00 65.16  ? 7   DG  E C4    1 
ATOM   6932 P  P     . DT  E 2 5   ? 38.946  -27.005 2.674   1.00 60.84  ? 8   DT  E P     1 
ATOM   6933 O  OP1   . DT  E 2 5   ? 37.761  -27.284 3.503   1.00 60.21  ? 8   DT  E OP1   1 
ATOM   6934 O  OP2   . DT  E 2 5   ? 39.606  -28.126 1.973   1.00 61.38  ? 8   DT  E OP2   1 
ATOM   6935 O  "O5'" . DT  E 2 5   ? 38.484  -25.847 1.692   1.00 60.04  ? 8   DT  E "O5'" 1 
ATOM   6936 C  "C5'" . DT  E 2 5   ? 38.143  -24.560 2.240   1.00 59.89  ? 8   DT  E "C5'" 1 
ATOM   6937 C  "C4'" . DT  E 2 5   ? 37.755  -23.605 1.140   1.00 59.26  ? 8   DT  E "C4'" 1 
ATOM   6938 O  "O4'" . DT  E 2 5   ? 38.946  -23.142 0.458   1.00 60.12  ? 8   DT  E "O4'" 1 
ATOM   6939 C  "C3'" . DT  E 2 5   ? 36.855  -24.212 0.062   1.00 58.21  ? 8   DT  E "C3'" 1 
ATOM   6940 O  "O3'" . DT  E 2 5   ? 35.800  -23.286 -0.232  1.00 57.36  ? 8   DT  E "O3'" 1 
ATOM   6941 C  "C2'" . DT  E 2 5   ? 37.817  -24.472 -1.085  1.00 58.72  ? 8   DT  E "C2'" 1 
ATOM   6942 C  "C1'" . DT  E 2 5   ? 38.778  -23.307 -0.935  1.00 59.64  ? 8   DT  E "C1'" 1 
ATOM   6943 N  N1    . DT  E 2 5   ? 40.117  -23.467 -1.546  1.00 60.80  ? 8   DT  E N1    1 
ATOM   6944 C  C2    . DT  E 2 5   ? 40.653  -22.390 -2.217  1.00 61.35  ? 8   DT  E C2    1 
ATOM   6945 O  O2    . DT  E 2 5   ? 40.079  -21.319 -2.330  1.00 60.88  ? 8   DT  E O2    1 
ATOM   6946 N  N3    . DT  E 2 5   ? 41.895  -22.616 -2.758  1.00 62.63  ? 8   DT  E N3    1 
ATOM   6947 C  C4    . DT  E 2 5   ? 42.635  -23.782 -2.695  1.00 63.41  ? 8   DT  E C4    1 
ATOM   6948 O  O4    . DT  E 2 5   ? 43.739  -23.835 -3.230  1.00 64.73  ? 8   DT  E O4    1 
ATOM   6949 C  C5    . DT  E 2 5   ? 42.011  -24.870 -1.982  1.00 62.74  ? 8   DT  E C5    1 
ATOM   6950 C  C7    . DT  E 2 5   ? 42.737  -26.172 -1.862  1.00 63.66  ? 8   DT  E C7    1 
ATOM   6951 C  C6    . DT  E 2 5   ? 40.800  -24.661 -1.450  1.00 61.49  ? 8   DT  E C6    1 
ATOM   6952 P  P     . DA  E 2 6   ? 34.715  -23.589 -1.363  1.00 56.27  ? 9   DA  E P     1 
ATOM   6953 O  OP1   . DA  E 2 6   ? 33.411  -23.078 -0.899  1.00 55.59  ? 9   DA  E OP1   1 
ATOM   6954 O  OP2   . DA  E 2 6   ? 34.851  -25.002 -1.797  1.00 56.27  ? 9   DA  E OP2   1 
ATOM   6955 O  "O5'" . DA  E 2 6   ? 35.181  -22.624 -2.530  1.00 56.38  ? 9   DA  E "O5'" 1 
ATOM   6956 C  "C5'" . DA  E 2 6   ? 35.312  -21.217 -2.299  1.00 56.70  ? 9   DA  E "C5'" 1 
ATOM   6957 C  "C4'" . DA  E 2 6   ? 35.783  -20.547 -3.566  1.00 56.92  ? 9   DA  E "C4'" 1 
ATOM   6958 O  "O4'" . DA  E 2 6   ? 37.106  -21.030 -3.893  1.00 57.89  ? 9   DA  E "O4'" 1 
ATOM   6959 C  "C3'" . DA  E 2 6   ? 34.918  -20.826 -4.794  1.00 55.99  ? 9   DA  E "C3'" 1 
ATOM   6960 O  "O3'" . DA  E 2 6   ? 34.786  -19.622 -5.544  1.00 56.03  ? 9   DA  E "O3'" 1 
ATOM   6961 C  "C2'" . DA  E 2 6   ? 35.690  -21.901 -5.537  1.00 56.38  ? 9   DA  E "C2'" 1 
ATOM   6962 C  "C1'" . DA  E 2 6   ? 37.120  -21.524 -5.220  1.00 57.68  ? 9   DA  E "C1'" 1 
ATOM   6963 N  N9    . DA  E 2 6   ? 38.083  -22.621 -5.282  1.00 58.47  ? 9   DA  E N9    1 
ATOM   6964 C  C8    . DA  E 2 6   ? 37.941  -23.914 -4.840  1.00 58.31  ? 9   DA  E C8    1 
ATOM   6965 N  N7    . DA  E 2 6   ? 39.000  -24.660 -5.042  1.00 59.34  ? 9   DA  E N7    1 
ATOM   6966 C  C5    . DA  E 2 6   ? 39.897  -23.803 -5.663  1.00 60.25  ? 9   DA  E C5    1 
ATOM   6967 C  C6    . DA  E 2 6   ? 41.198  -23.992 -6.149  1.00 61.71  ? 9   DA  E C6    1 
ATOM   6968 N  N6    . DA  E 2 6   ? 41.851  -25.153 -6.078  1.00 62.50  ? 9   DA  E N6    1 
ATOM   6969 N  N1    . DA  E 2 6   ? 41.819  -22.932 -6.712  1.00 62.50  ? 9   DA  E N1    1 
ATOM   6970 C  C2    . DA  E 2 6   ? 41.161  -21.767 -6.783  1.00 61.82  ? 9   DA  E C2    1 
ATOM   6971 N  N3    . DA  E 2 6   ? 39.935  -21.467 -6.364  1.00 60.46  ? 9   DA  E N3    1 
ATOM   6972 C  C4    . DA  E 2 6   ? 39.348  -22.542 -5.811  1.00 59.72  ? 9   DA  E C4    1 
ATOM   6973 P  P     . DC  E 2 7   ? 33.712  -19.524 -6.702  1.00 55.11  ? 10  DC  E P     1 
ATOM   6974 O  OP1   . DC  E 2 7   ? 32.705  -18.513 -6.320  1.00 54.70  ? 10  DC  E OP1   1 
ATOM   6975 O  OP2   . DC  E 2 7   ? 33.282  -20.899 -7.054  1.00 54.51  ? 10  DC  E OP2   1 
ATOM   6976 O  "O5'" . DC  E 2 7   ? 34.546  -18.904 -7.901  1.00 55.81  ? 10  DC  E "O5'" 1 
ATOM   6977 C  "C5'" . DC  E 2 7   ? 35.352  -17.731 -7.720  1.00 56.83  ? 10  DC  E "C5'" 1 
ATOM   6978 C  "C4'" . DC  E 2 7   ? 36.458  -17.755 -8.747  1.00 57.80  ? 10  DC  E "C4'" 1 
ATOM   6979 O  "O4'" . DC  E 2 7   ? 37.312  -18.900 -8.502  1.00 58.29  ? 10  DC  E "O4'" 1 
ATOM   6980 C  "C3'" . DC  E 2 7   ? 35.950  -17.908 -10.183 1.00 57.34  ? 10  DC  E "C3'" 1 
ATOM   6981 O  "O3'" . DC  E 2 7   ? 36.483  -16.944 -11.089 1.00 58.24  ? 10  DC  E "O3'" 1 
ATOM   6982 C  "C2'" . DC  E 2 7   ? 36.426  -19.286 -10.602 1.00 57.47  ? 10  DC  E "C2'" 1 
ATOM   6983 C  "C1'" . DC  E 2 7   ? 37.659  -19.458 -9.751  1.00 58.58  ? 10  DC  E "C1'" 1 
ATOM   6984 N  N1    . DC  E 2 7   ? 38.040  -20.863 -9.548  1.00 58.70  ? 10  DC  E N1    1 
ATOM   6985 C  C2    . DC  E 2 7   ? 39.328  -21.277 -9.914  1.00 60.08  ? 10  DC  E C2    1 
ATOM   6986 O  O2    . DC  E 2 7   ? 40.132  -20.434 -10.346 1.00 61.20  ? 10  DC  E O2    1 
ATOM   6987 N  N3    . DC  E 2 7   ? 39.666  -22.580 -9.773  1.00 60.33  ? 10  DC  E N3    1 
ATOM   6988 C  C4    . DC  E 2 7   ? 38.773  -23.455 -9.302  1.00 59.26  ? 10  DC  E C4    1 
ATOM   6989 N  N4    . DC  E 2 7   ? 39.151  -24.728 -9.177  1.00 59.69  ? 10  DC  E N4    1 
ATOM   6990 C  C5    . DC  E 2 7   ? 37.454  -23.062 -8.935  1.00 57.87  ? 10  DC  E C5    1 
ATOM   6991 C  C6    . DC  E 2 7   ? 37.129  -21.772 -9.084  1.00 57.63  ? 10  DC  E C6    1 
ATOM   6992 P  P     . DA  E 2 8   ? 35.776  -16.745 -12.525 1.00 57.79  ? 11  DA  E P     1 
ATOM   6993 O  OP1   . DA  E 2 8   ? 35.124  -15.419 -12.533 1.00 57.68  ? 11  DA  E OP1   1 
ATOM   6994 O  OP2   . DA  E 2 8   ? 34.946  -17.957 -12.842 1.00 56.67  ? 11  DA  E OP2   1 
ATOM   6995 O  "O5'" . DA  E 2 8   ? 37.020  -16.705 -13.512 1.00 59.25  ? 11  DA  E "O5'" 1 
ATOM   6996 C  "C5'" . DA  E 2 8   ? 37.211  -17.805 -14.387 1.00 59.30  ? 11  DA  E "C5'" 1 
ATOM   6997 C  "C4'" . DA  E 2 8   ? 38.677  -18.101 -14.572 1.00 60.94  ? 11  DA  E "C4'" 1 
ATOM   6998 O  "O4'" . DA  E 2 8   ? 39.122  -19.071 -13.604 1.00 60.96  ? 11  DA  E "O4'" 1 
ATOM   6999 C  "C3'" . DA  E 2 8   ? 38.920  -18.696 -15.953 1.00 61.51  ? 11  DA  E "C3'" 1 
ATOM   7000 O  "O3'" . DA  E 2 8   ? 39.472  -17.668 -16.777 1.00 62.76  ? 11  DA  E "O3'" 1 
ATOM   7001 C  "C2'" . DA  E 2 8   ? 39.816  -19.896 -15.729 1.00 62.31  ? 11  DA  E "C2'" 1 
ATOM   7002 C  "C1'" . DA  E 2 8   ? 39.817  -20.129 -14.237 1.00 61.78  ? 11  DA  E "C1'" 1 
ATOM   7003 N  N9    . DA  E 2 8   ? 39.245  -21.383 -13.767 1.00 60.78  ? 11  DA  E N9    1 
ATOM   7004 C  C8    . DA  E 2 8   ? 38.021  -21.644 -13.197 1.00 59.21  ? 11  DA  E C8    1 
ATOM   7005 N  N7    . DA  E 2 8   ? 37.889  -22.879 -12.778 1.00 58.90  ? 11  DA  E N7    1 
ATOM   7006 C  C5    . DA  E 2 8   ? 39.113  -23.463 -13.071 1.00 60.36  ? 11  DA  E C5    1 
ATOM   7007 C  C6    . DA  E 2 8   ? 39.618  -24.759 -12.867 1.00 60.96  ? 11  DA  E C6    1 
ATOM   7008 N  N6    . DA  E 2 8   ? 38.917  -25.748 -12.307 1.00 60.11  ? 11  DA  E N6    1 
ATOM   7009 N  N1    . DA  E 2 8   ? 40.879  -25.014 -13.280 1.00 62.66  ? 11  DA  E N1    1 
ATOM   7010 C  C2    . DA  E 2 8   ? 41.580  -24.025 -13.847 1.00 63.68  ? 11  DA  E C2    1 
ATOM   7011 N  N3    . DA  E 2 8   ? 41.218  -22.768 -14.086 1.00 63.27  ? 11  DA  E N3    1 
ATOM   7012 C  C4    . DA  E 2 8   ? 39.960  -22.549 -13.670 1.00 61.55  ? 11  DA  E C4    1 
ATOM   7013 P  P     . DA  E 2 9   ? 39.051  -17.587 -18.314 1.00 62.87  ? 12  DA  E P     1 
ATOM   7014 O  OP1   . DA  E 2 9   ? 39.665  -16.356 -18.870 1.00 64.30  ? 12  DA  E OP1   1 
ATOM   7015 O  OP2   . DA  E 2 9   ? 37.580  -17.804 -18.432 1.00 61.05  ? 12  DA  E OP2   1 
ATOM   7016 O  "O5'" . DA  E 2 9   ? 39.790  -18.854 -18.920 1.00 63.80  ? 12  DA  E "O5'" 1 
ATOM   7017 C  "C5'" . DA  E 2 9   ? 41.219  -18.996 -18.811 1.00 65.68  ? 12  DA  E "C5'" 1 
ATOM   7018 C  "C4'" . DA  E 2 9   ? 41.607  -20.387 -19.249 1.00 66.23  ? 12  DA  E "C4'" 1 
ATOM   7019 O  "O4'" . DA  E 2 9   ? 41.166  -21.344 -18.252 1.00 65.00  ? 12  DA  E "O4'" 1 
ATOM   7020 C  "C3'" . DA  E 2 9   ? 40.969  -20.838 -20.570 1.00 65.99  ? 12  DA  E "C3'" 1 
ATOM   7021 O  "O3'" . DA  E 2 9   ? 41.959  -21.554 -21.317 1.00 67.83  ? 12  DA  E "O3'" 1 
ATOM   7022 C  "C2'" . DA  E 2 9   ? 39.827  -21.727 -20.112 1.00 64.10  ? 12  DA  E "C2'" 1 
ATOM   7023 C  "C1'" . DA  E 2 9   ? 40.474  -22.384 -18.914 1.00 64.33  ? 12  DA  E "C1'" 1 
ATOM   7024 N  N9    . DA  E 2 9   ? 39.547  -22.996 -17.970 1.00 62.65  ? 12  DA  E N9    1 
ATOM   7025 C  C8    . DA  E 2 9   ? 38.321  -22.535 -17.563 1.00 60.95  ? 12  DA  E C8    1 
ATOM   7026 N  N7    . DA  E 2 9   ? 37.712  -23.332 -16.720 1.00 59.91  ? 12  DA  E N7    1 
ATOM   7027 C  C5    . DA  E 2 9   ? 38.590  -24.396 -16.572 1.00 60.95  ? 12  DA  E C5    1 
ATOM   7028 C  C6    . DA  E 2 9   ? 38.521  -25.581 -15.820 1.00 60.72  ? 12  DA  E C6    1 
ATOM   7029 N  N6    . DA  E 2 9   ? 37.488  -25.899 -15.041 1.00 59.32  ? 12  DA  E N6    1 
ATOM   7030 N  N1    . DA  E 2 9   ? 39.563  -26.437 -15.896 1.00 62.15  ? 12  DA  E N1    1 
ATOM   7031 C  C2    . DA  E 2 9   ? 40.597  -26.117 -16.681 1.00 63.75  ? 12  DA  E C2    1 
ATOM   7032 N  N3    . DA  E 2 9   ? 40.775  -25.036 -17.441 1.00 64.17  ? 12  DA  E N3    1 
ATOM   7033 C  C4    . DA  E 2 9   ? 39.723  -24.204 -17.339 1.00 62.65  ? 12  DA  E C4    1 
ATOM   7034 P  P     . DG  E 2 10  ? 41.640  -22.142 -22.765 1.00 68.28  ? 13  DG  E P     1 
ATOM   7035 O  OP1   . DG  E 2 10  ? 42.733  -21.700 -23.665 1.00 70.61  ? 13  DG  E OP1   1 
ATOM   7036 O  OP2   . DG  E 2 10  ? 40.224  -21.837 -23.098 1.00 66.44  ? 13  DG  E OP2   1 
ATOM   7037 O  "O5'" . DG  E 2 10  ? 41.828  -23.709 -22.554 1.00 68.48  ? 13  DG  E "O5'" 1 
ATOM   7038 C  "C5'" . DG  E 2 10  ? 43.119  -24.238 -22.197 1.00 70.26  ? 13  DG  E "C5'" 1 
ATOM   7039 C  "C4'" . DG  E 2 10  ? 43.034  -25.735 -22.011 1.00 70.22  ? 13  DG  E "C4'" 1 
ATOM   7040 O  "O4'" . DG  E 2 10  ? 42.166  -26.040 -20.894 1.00 68.21  ? 13  DG  E "O4'" 1 
ATOM   7041 C  "C3'" . DG  E 2 10  ? 42.460  -26.495 -23.205 1.00 70.34  ? 13  DG  E "C3'" 1 
ATOM   7042 O  "O3'" . DG  E 2 10  ? 43.238  -27.679 -23.409 1.00 72.03  ? 13  DG  E "O3'" 1 
ATOM   7043 C  "C2'" . DG  E 2 10  ? 41.024  -26.752 -22.789 1.00 67.95  ? 13  DG  E "C2'" 1 
ATOM   7044 C  "C1'" . DG  E 2 10  ? 41.183  -26.967 -21.304 1.00 67.24  ? 13  DG  E "C1'" 1 
ATOM   7045 N  N9    . DG  E 2 10  ? 39.975  -26.700 -20.539 1.00 65.03  ? 13  DG  E N9    1 
ATOM   7046 C  C8    . DG  E 2 10  ? 39.241  -25.539 -20.529 1.00 63.81  ? 13  DG  E C8    1 
ATOM   7047 N  N7    . DG  E 2 10  ? 38.190  -25.604 -19.759 1.00 62.07  ? 13  DG  E N7    1 
ATOM   7048 C  C5    . DG  E 2 10  ? 38.235  -26.884 -19.224 1.00 62.12  ? 13  DG  E C5    1 
ATOM   7049 C  C6    . DG  E 2 10  ? 37.356  -27.533 -18.322 1.00 60.82  ? 13  DG  E C6    1 
ATOM   7050 O  O6    . DG  E 2 10  ? 36.325  -27.095 -17.808 1.00 59.33  ? 13  DG  E O6    1 
ATOM   7051 N  N1    . DG  E 2 10  ? 37.774  -28.829 -18.040 1.00 61.58  ? 13  DG  E N1    1 
ATOM   7052 C  C2    . DG  E 2 10  ? 38.892  -29.428 -18.566 1.00 63.39  ? 13  DG  E C2    1 
ATOM   7053 N  N2    . DG  E 2 10  ? 39.128  -30.689 -18.175 1.00 64.01  ? 13  DG  E N2    1 
ATOM   7054 N  N3    . DG  E 2 10  ? 39.717  -28.836 -19.415 1.00 64.68  ? 13  DG  E N3    1 
ATOM   7055 C  C4    . DG  E 2 10  ? 39.330  -27.574 -19.697 1.00 63.93  ? 13  DG  E C4    1 
ATOM   7056 P  P     . DT  E 2 11  ? 42.772  -28.792 -24.461 1.00 72.48  ? 14  DT  E P     1 
ATOM   7057 O  OP1   . DT  E 2 11  ? 43.979  -29.538 -24.905 1.00 75.09  ? 14  DT  E OP1   1 
ATOM   7058 O  OP2   . DT  E 2 11  ? 41.886  -28.150 -25.477 1.00 71.69  ? 14  DT  E OP2   1 
ATOM   7059 O  "O5'" . DT  E 2 11  ? 41.884  -29.750 -23.553 1.00 70.78  ? 14  DT  E "O5'" 1 
ATOM   7060 C  "C5'" . DT  E 2 11  ? 42.479  -30.688 -22.644 1.00 71.42  ? 14  DT  E "C5'" 1 
ATOM   7061 C  "C4'" . DT  E 2 11  ? 41.550  -31.865 -22.484 1.00 70.49  ? 14  DT  E "C4'" 1 
ATOM   7062 O  "O4'" . DT  E 2 11  ? 40.382  -31.433 -21.747 1.00 68.10  ? 14  DT  E "O4'" 1 
ATOM   7063 C  "C3'" . DT  E 2 11  ? 41.029  -32.439 -23.803 1.00 71.03  ? 14  DT  E "C3'" 1 
ATOM   7064 O  "O3'" . DT  E 2 11  ? 40.948  -33.866 -23.725 1.00 71.72  ? 14  DT  E "O3'" 1 
ATOM   7065 C  "C2'" . DT  E 2 11  ? 39.653  -31.813 -23.927 1.00 68.82  ? 14  DT  E "C2'" 1 
ATOM   7066 C  "C1'" . DT  E 2 11  ? 39.225  -31.802 -22.465 1.00 67.20  ? 14  DT  E "C1'" 1 
ATOM   7067 N  N1    . DT  E 2 11  ? 38.131  -30.884 -22.066 1.00 65.06  ? 14  DT  E N1    1 
ATOM   7068 C  C2    . DT  E 2 11  ? 37.242  -31.326 -21.107 1.00 63.61  ? 14  DT  E C2    1 
ATOM   7069 O  O2    . DT  E 2 11  ? 37.316  -32.428 -20.583 1.00 63.98  ? 14  DT  E O2    1 
ATOM   7070 N  N3    . DT  E 2 11  ? 36.244  -30.432 -20.797 1.00 61.85  ? 14  DT  E N3    1 
ATOM   7071 C  C4    . DT  E 2 11  ? 36.062  -29.167 -21.324 1.00 61.40  ? 14  DT  E C4    1 
ATOM   7072 O  O4    . DT  E 2 11  ? 35.119  -28.479 -20.947 1.00 59.91  ? 14  DT  E O4    1 
ATOM   7073 C  C5    . DT  E 2 11  ? 37.036  -28.764 -22.317 1.00 62.97  ? 14  DT  E C5    1 
ATOM   7074 C  C7    . DT  E 2 11  ? 36.930  -27.403 -22.932 1.00 62.76  ? 14  DT  E C7    1 
ATOM   7075 C  C6    . DT  E 2 11  ? 38.011  -29.629 -22.628 1.00 64.71  ? 14  DT  E C6    1 
ATOM   7076 P  P     . DA  E 2 12  ? 41.037  -34.743 -25.050 1.00 73.50  ? 15  DA  E P     1 
ATOM   7077 O  OP1   . DA  E 2 12  ? 42.348  -35.440 -25.056 1.00 75.99  ? 15  DA  E OP1   1 
ATOM   7078 O  OP2   . DA  E 2 12  ? 40.659  -33.878 -26.200 1.00 73.31  ? 15  DA  E OP2   1 
ATOM   7079 O  "O5'" . DA  E 2 12  ? 39.860  -35.799 -24.862 1.00 72.43  ? 15  DA  E "O5'" 1 
ATOM   7080 C  "C5'" . DA  E 2 12  ? 39.997  -37.002 -24.082 1.00 72.96  ? 15  DA  E "C5'" 1 
ATOM   7081 C  "C4'" . DA  E 2 12  ? 38.732  -37.228 -23.290 1.00 70.85  ? 15  DA  E "C4'" 1 
ATOM   7082 O  "O4'" . DA  E 2 12  ? 38.342  -35.964 -22.714 1.00 68.93  ? 15  DA  E "O4'" 1 
ATOM   7083 C  "C3'" . DA  E 2 12  ? 37.508  -37.658 -24.098 1.00 70.25  ? 15  DA  E "C3'" 1 
ATOM   7084 O  "O3'" . DA  E 2 12  ? 37.412  -39.048 -24.459 1.00 71.67  ? 15  DA  E "O3'" 1 
ATOM   7085 C  "C2'" . DA  E 2 12  ? 36.359  -37.153 -23.248 1.00 67.84  ? 15  DA  E "C2'" 1 
ATOM   7086 C  "C1'" . DA  E 2 12  ? 36.919  -35.920 -22.585 1.00 67.06  ? 15  DA  E "C1'" 1 
ATOM   7087 N  N9    . DA  E 2 12  ? 36.434  -34.665 -23.159 1.00 65.94  ? 15  DA  E N9    1 
ATOM   7088 C  C8    . DA  E 2 12  ? 36.923  -33.935 -24.213 1.00 66.76  ? 15  DA  E C8    1 
ATOM   7089 N  N7    . DA  E 2 12  ? 36.260  -32.828 -24.442 1.00 65.41  ? 15  DA  E N7    1 
ATOM   7090 C  C5    . DA  E 2 12  ? 35.257  -32.838 -23.484 1.00 63.62  ? 15  DA  E C5    1 
ATOM   7091 C  C6    . DA  E 2 12  ? 34.222  -31.938 -23.188 1.00 61.80  ? 15  DA  E C6    1 
ATOM   7092 N  N6    . DA  E 2 12  ? 34.008  -30.812 -23.868 1.00 61.40  ? 15  DA  E N6    1 
ATOM   7093 N  N1    . DA  E 2 12  ? 33.392  -32.245 -22.168 1.00 60.53  ? 15  DA  E N1    1 
ATOM   7094 C  C2    . DA  E 2 12  ? 33.604  -33.378 -21.488 1.00 61.05  ? 15  DA  E C2    1 
ATOM   7095 N  N3    . DA  E 2 12  ? 34.543  -34.302 -21.669 1.00 62.69  ? 15  DA  E N3    1 
ATOM   7096 C  C4    . DA  E 2 12  ? 35.345  -33.969 -22.695 1.00 63.94  ? 15  DA  E C4    1 
ATOM   7097 P  P     . DT  E 2 13  ? 36.803  -40.169 -23.464 1.00 71.29  ? 16  DT  E P     1 
ATOM   7098 O  OP1   . DT  E 2 13  ? 37.653  -40.199 -22.246 1.00 71.49  ? 16  DT  E OP1   1 
ATOM   7099 O  OP2   . DT  E 2 13  ? 36.580  -41.415 -24.244 1.00 72.90  ? 16  DT  E OP2   1 
ATOM   7100 O  "O5'" . DT  E 2 13  ? 35.316  -39.687 -23.155 1.00 68.91  ? 16  DT  E "O5'" 1 
ATOM   7101 C  "C5'" . DT  E 2 13  ? 34.720  -40.010 -21.886 1.00 67.78  ? 16  DT  E "C5'" 1 
ATOM   7102 C  "C4'" . DT  E 2 13  ? 33.310  -39.478 -21.789 1.00 65.80  ? 16  DT  E "C4'" 1 
ATOM   7103 O  "O4'" . DT  E 2 13  ? 33.238  -38.096 -22.189 1.00 64.68  ? 16  DT  E "O4'" 1 
ATOM   7104 C  "C3'" . DT  E 2 13  ? 32.292  -40.223 -22.650 1.00 66.11  ? 16  DT  E "C3'" 1 
ATOM   7105 O  "O3'" . DT  E 2 13  ? 31.409  -40.860 -21.734 1.00 65.47  ? 16  DT  E "O3'" 1 
ATOM   7106 C  "C2'" . DT  E 2 13  ? 31.630  -39.140 -23.490 1.00 64.95  ? 16  DT  E "C2'" 1 
ATOM   7107 C  "C1'" . DT  E 2 13  ? 31.952  -37.873 -22.722 1.00 63.60  ? 16  DT  E "C1'" 1 
ATOM   7108 N  N1    . DT  E 2 13  ? 32.011  -36.623 -23.509 1.00 63.06  ? 16  DT  E N1    1 
ATOM   7109 C  C2    . DT  E 2 13  ? 31.087  -35.633 -23.260 1.00 61.30  ? 16  DT  E C2    1 
ATOM   7110 O  O2    . DT  E 2 13  ? 30.184  -35.753 -22.450 1.00 60.21  ? 16  DT  E O2    1 
ATOM   7111 N  N3    . DT  E 2 13  ? 31.244  -34.500 -24.020 1.00 61.05  ? 16  DT  E N3    1 
ATOM   7112 C  C4    . DT  E 2 13  ? 32.223  -34.257 -24.967 1.00 62.37  ? 16  DT  E C4    1 
ATOM   7113 O  O4    . DT  E 2 13  ? 32.232  -33.192 -25.579 1.00 62.06  ? 16  DT  E O4    1 
ATOM   7114 C  C5    . DT  E 2 13  ? 33.163  -35.336 -25.171 1.00 64.22  ? 16  DT  E C5    1 
ATOM   7115 C  C7    . DT  E 2 13  ? 34.251  -35.171 -26.187 1.00 65.96  ? 16  DT  E C7    1 
ATOM   7116 C  C6    . DT  E 2 13  ? 33.016  -36.446 -24.437 1.00 64.45  ? 16  DT  E C6    1 
ATOM   7117 P  P     . DG  E 2 14  ? 30.698  -42.213 -22.125 1.00 66.58  ? 17  DG  E P     1 
ATOM   7118 O  OP1   . DG  E 2 14  ? 30.217  -42.854 -20.881 1.00 66.28  ? 17  DG  E OP1   1 
ATOM   7119 O  OP2   . DG  E 2 14  ? 31.575  -42.960 -23.057 1.00 68.71  ? 17  DG  E OP2   1 
ATOM   7120 O  "O5'" . DG  E 2 14  ? 29.417  -41.696 -22.897 1.00 65.46  ? 17  DG  E "O5'" 1 
ATOM   7121 C  "C5'" . DG  E 2 14  ? 28.484  -40.820 -22.247 1.00 63.50  ? 17  DG  E "C5'" 1 
ATOM   7122 C  "C4'" . DG  E 2 14  ? 27.415  -40.405 -23.229 1.00 62.89  ? 17  DG  E "C4'" 1 
ATOM   7123 O  "O4'" . DG  E 2 14  ? 27.872  -39.236 -23.945 1.00 62.39  ? 17  DG  E "O4'" 1 
ATOM   7124 C  "C3'" . DG  E 2 14  ? 27.108  -41.453 -24.299 1.00 64.41  ? 17  DG  E "C3'" 1 
ATOM   7125 O  "O3'" . DG  E 2 14  ? 25.736  -41.384 -24.685 1.00 63.74  ? 17  DG  E "O3'" 1 
ATOM   7126 C  "C2'" . DG  E 2 14  ? 27.993  -41.023 -25.448 1.00 65.21  ? 17  DG  E "C2'" 1 
ATOM   7127 C  "C1'" . DG  E 2 14  ? 27.856  -39.523 -25.327 1.00 63.47  ? 17  DG  E "C1'" 1 
ATOM   7128 N  N9    . DG  E 2 14  ? 28.878  -38.714 -25.971 1.00 63.83  ? 17  DG  E N9    1 
ATOM   7129 C  C8    . DG  E 2 14  ? 29.987  -39.124 -26.671 1.00 65.60  ? 17  DG  E C8    1 
ATOM   7130 N  N7    . DG  E 2 14  ? 30.667  -38.131 -27.175 1.00 65.61  ? 17  DG  E N7    1 
ATOM   7131 C  C5    . DG  E 2 14  ? 29.949  -37.003 -26.806 1.00 63.70  ? 17  DG  E C5    1 
ATOM   7132 C  C6    . DG  E 2 14  ? 30.189  -35.633 -27.072 1.00 62.96  ? 17  DG  E C6    1 
ATOM   7133 O  O6    . DG  E 2 14  ? 31.110  -35.126 -27.716 1.00 63.86  ? 17  DG  E O6    1 
ATOM   7134 N  N1    . DG  E 2 14  ? 29.214  -34.821 -26.504 1.00 61.12  ? 17  DG  E N1    1 
ATOM   7135 C  C2    . DG  E 2 14  ? 28.142  -35.269 -25.774 1.00 60.18  ? 17  DG  E C2    1 
ATOM   7136 N  N2    . DG  E 2 14  ? 27.301  -34.332 -25.317 1.00 58.62  ? 17  DG  E N2    1 
ATOM   7137 N  N3    . DG  E 2 14  ? 27.905  -36.545 -25.522 1.00 60.88  ? 17  DG  E N3    1 
ATOM   7138 C  C4    . DG  E 2 14  ? 28.841  -37.349 -26.066 1.00 62.61  ? 17  DG  E C4    1 
ATOM   7139 P  P     . DA  E 2 15  ? 24.804  -42.654 -24.508 1.00 64.61  ? 18  DA  E P     1 
ATOM   7140 O  OP1   . DA  E 2 15  ? 25.014  -43.182 -23.143 1.00 64.63  ? 18  DA  E OP1   1 
ATOM   7141 O  OP2   . DA  E 2 15  ? 24.995  -43.537 -25.683 1.00 66.44  ? 18  DA  E OP2   1 
ATOM   7142 O  "O5'" . DA  E 2 15  ? 23.344  -42.030 -24.522 1.00 63.24  ? 18  DA  E "O5'" 1 
ATOM   7143 C  "C5'" . DA  E 2 15  ? 22.995  -40.987 -23.601 1.00 61.48  ? 18  DA  E "C5'" 1 
ATOM   7144 C  "C4'" . DA  E 2 15  ? 22.460  -39.788 -24.346 1.00 60.37  ? 18  DA  E "C4'" 1 
ATOM   7145 O  "O4'" . DA  E 2 15  ? 23.537  -39.123 -25.048 1.00 60.48  ? 18  DA  E "O4'" 1 
ATOM   7146 C  "C3'" . DA  E 2 15  ? 21.410  -40.102 -25.412 1.00 60.86  ? 18  DA  E "C3'" 1 
ATOM   7147 O  "O3'" . DA  E 2 15  ? 20.481  -39.019 -25.431 1.00 59.49  ? 18  DA  E "O3'" 1 
ATOM   7148 C  "C2'" . DA  E 2 15  ? 22.226  -40.112 -26.689 1.00 61.83  ? 18  DA  E "C2'" 1 
ATOM   7149 C  "C1'" . DA  E 2 15  ? 23.153  -38.954 -26.401 1.00 60.87  ? 18  DA  E "C1'" 1 
ATOM   7150 N  N9    . DA  E 2 15  ? 24.361  -38.884 -27.216 1.00 61.86  ? 18  DA  E N9    1 
ATOM   7151 C  C8    . DA  E 2 15  ? 25.089  -39.902 -27.780 1.00 63.66  ? 18  DA  E C8    1 
ATOM   7152 N  N7    . DA  E 2 15  ? 26.124  -39.490 -28.468 1.00 64.34  ? 18  DA  E N7    1 
ATOM   7153 C  C5    . DA  E 2 15  ? 26.070  -38.108 -28.357 1.00 62.86  ? 18  DA  E C5    1 
ATOM   7154 C  C6    . DA  E 2 15  ? 26.888  -37.085 -28.866 1.00 62.83  ? 18  DA  E C6    1 
ATOM   7155 N  N6    . DA  E 2 15  ? 27.967  -37.307 -29.619 1.00 64.40  ? 18  DA  E N6    1 
ATOM   7156 N  N1    . DA  E 2 15  ? 26.556  -35.809 -28.571 1.00 61.30  ? 18  DA  E N1    1 
ATOM   7157 C  C2    . DA  E 2 15  ? 25.476  -35.586 -27.811 1.00 59.91  ? 18  DA  E C2    1 
ATOM   7158 N  N3    . DA  E 2 15  ? 24.630  -36.464 -27.275 1.00 59.81  ? 18  DA  E N3    1 
ATOM   7159 C  C4    . DA  E 2 15  ? 24.986  -37.722 -27.592 1.00 61.33  ? 18  DA  E C4    1 
ATOM   7160 P  P     . DA  E 2 16  ? 19.106  -39.138 -26.225 1.00 59.67  ? 19  DA  E P     1 
ATOM   7161 O  OP1   . DA  E 2 16  ? 18.197  -39.988 -25.429 1.00 60.04  ? 19  DA  E OP1   1 
ATOM   7162 O  OP2   . DA  E 2 16  ? 19.394  -39.513 -27.626 1.00 60.83  ? 19  DA  E OP2   1 
ATOM   7163 O  "O5'" . DA  E 2 16  ? 18.539  -37.647 -26.218 1.00 58.12  ? 19  DA  E "O5'" 1 
ATOM   7164 C  "C5'" . DA  E 2 16  ? 19.248  -36.532 -25.640 1.00 56.99  ? 19  DA  E "C5'" 1 
ATOM   7165 C  "C4'" . DA  E 2 16  ? 19.526  -35.474 -26.683 1.00 56.65  ? 19  DA  E "C4'" 1 
ATOM   7166 O  "O4'" . DA  E 2 16  ? 20.759  -35.761 -27.384 1.00 57.59  ? 19  DA  E "O4'" 1 
ATOM   7167 C  "C3'" . DA  E 2 16  ? 18.462  -35.325 -27.768 1.00 56.83  ? 19  DA  E "C3'" 1 
ATOM   7168 O  "O3'" . DA  E 2 16  ? 18.251  -33.934 -28.001 1.00 55.83  ? 19  DA  E "O3'" 1 
ATOM   7169 C  "C2'" . DA  E 2 16  ? 19.091  -36.013 -28.965 1.00 58.19  ? 19  DA  E "C2'" 1 
ATOM   7170 C  "C1'" . DA  E 2 16  ? 20.536  -35.637 -28.770 1.00 58.19  ? 19  DA  E "C1'" 1 
ATOM   7171 N  N9    . DA  E 2 16  ? 21.502  -36.489 -29.451 1.00 59.69  ? 19  DA  E N9    1 
ATOM   7172 C  C8    . DA  E 2 16  ? 21.514  -37.858 -29.551 1.00 61.01  ? 19  DA  E C8    1 
ATOM   7173 N  N7    . DA  E 2 16  ? 22.537  -38.330 -30.220 1.00 62.36  ? 19  DA  E N7    1 
ATOM   7174 C  C5    . DA  E 2 16  ? 23.252  -37.196 -30.576 1.00 61.90  ? 19  DA  E C5    1 
ATOM   7175 C  C6    . DA  E 2 16  ? 24.446  -37.020 -31.293 1.00 62.95  ? 19  DA  E C6    1 
ATOM   7176 N  N6    . DA  E 2 16  ? 25.155  -38.029 -31.803 1.00 64.74  ? 19  DA  E N6    1 
ATOM   7177 N  N1    . DA  E 2 16  ? 24.889  -35.756 -31.475 1.00 62.26  ? 19  DA  E N1    1 
ATOM   7178 C  C2    . DA  E 2 16  ? 24.173  -34.744 -30.960 1.00 60.61  ? 19  DA  E C2    1 
ATOM   7179 N  N3    . DA  E 2 16  ? 23.038  -34.784 -30.267 1.00 59.52  ? 19  DA  E N3    1 
ATOM   7180 C  C4    . DA  E 2 16  ? 22.627  -36.055 -30.106 1.00 60.25  ? 19  DA  E C4    1 
ATOM   7181 P  P     . DA  E 2 17  ? 17.123  -33.455 -29.016 1.00 55.81  ? 20  DA  E P     1 
ATOM   7182 O  OP1   . DA  E 2 17  ? 16.450  -32.286 -28.420 1.00 54.63  ? 20  DA  E OP1   1 
ATOM   7183 O  OP2   . DA  E 2 17  ? 16.315  -34.635 -29.414 1.00 56.80  ? 20  DA  E OP2   1 
ATOM   7184 O  "O5'" . DA  E 2 17  ? 17.982  -32.917 -30.237 1.00 56.26  ? 20  DA  E "O5'" 1 
ATOM   7185 C  "C5'" . DA  E 2 17  ? 18.811  -31.758 -30.076 1.00 55.61  ? 20  DA  E "C5'" 1 
ATOM   7186 C  "C4'" . DA  E 2 17  ? 19.669  -31.557 -31.302 1.00 56.49  ? 20  DA  E "C4'" 1 
ATOM   7187 O  "O4'" . DA  E 2 17  ? 20.478  -32.730 -31.538 1.00 57.71  ? 20  DA  E "O4'" 1 
ATOM   7188 C  "C3'" . DA  E 2 17  ? 18.897  -31.302 -32.602 1.00 56.93  ? 20  DA  E "C3'" 1 
ATOM   7189 O  "O3'" . DA  E 2 17  ? 19.368  -30.075 -33.170 1.00 56.77  ? 20  DA  E "O3'" 1 
ATOM   7190 C  "C2'" . DA  E 2 17  ? 19.178  -32.537 -33.445 1.00 58.41  ? 20  DA  E "C2'" 1 
ATOM   7191 C  "C1'" . DA  E 2 17  ? 20.527  -32.969 -32.927 1.00 58.87  ? 20  DA  E "C1'" 1 
ATOM   7192 N  N9    . DA  E 2 17  ? 20.853  -34.378 -33.121 1.00 60.20  ? 20  DA  E N9    1 
ATOM   7193 C  C8    . DA  E 2 17  ? 20.163  -35.486 -32.695 1.00 60.49  ? 20  DA  E C8    1 
ATOM   7194 N  N7    . DA  E 2 17  ? 20.742  -36.620 -33.003 1.00 61.95  ? 20  DA  E N7    1 
ATOM   7195 C  C5    . DA  E 2 17  ? 21.899  -36.233 -33.666 1.00 62.66  ? 20  DA  E C5    1 
ATOM   7196 C  C6    . DA  E 2 17  ? 22.947  -36.967 -34.250 1.00 64.38  ? 20  DA  E C6    1 
ATOM   7197 N  N6    . DA  E 2 17  ? 23.005  -38.298 -34.260 1.00 65.70  ? 20  DA  E N6    1 
ATOM   7198 N  N1    . DA  E 2 17  ? 23.954  -36.273 -34.827 1.00 64.87  ? 20  DA  E N1    1 
ATOM   7199 C  C2    . DA  E 2 17  ? 23.899  -34.935 -34.818 1.00 63.68  ? 20  DA  E C2    1 
ATOM   7200 N  N3    . DA  E 2 17  ? 22.969  -34.134 -34.302 1.00 62.03  ? 20  DA  E N3    1 
ATOM   7201 C  C4    . DA  E 2 17  ? 21.983  -34.855 -33.737 1.00 61.59  ? 20  DA  E C4    1 
ATOM   7202 P  P     . DT  E 2 18  ? 18.692  -29.461 -34.466 1.00 57.12  ? 21  DT  E P     1 
ATOM   7203 O  OP1   . DT  E 2 18  ? 18.903  -27.996 -34.468 1.00 56.49  ? 21  DT  E OP1   1 
ATOM   7204 O  OP2   . DT  E 2 18  ? 17.317  -29.996 -34.567 1.00 57.05  ? 21  DT  E OP2   1 
ATOM   7205 O  "O5'" . DT  E 2 18  ? 19.593  -30.075 -35.617 1.00 58.68  ? 21  DT  E "O5'" 1 
ATOM   7206 C  "C5'" . DT  E 2 18  ? 20.957  -29.672 -35.771 1.00 59.23  ? 21  DT  E "C5'" 1 
ATOM   7207 C  "C4'" . DT  E 2 18  ? 21.640  -30.554 -36.788 1.00 60.96  ? 21  DT  E "C4'" 1 
ATOM   7208 O  "O4'" . DT  E 2 18  ? 21.537  -31.936 -36.394 1.00 61.42  ? 21  DT  E "O4'" 1 
ATOM   7209 C  "C3'" . DT  E 2 18  ? 21.051  -30.498 -38.200 1.00 61.86  ? 21  DT  E "C3'" 1 
ATOM   7210 O  "O3'" . DT  E 2 18  ? 21.817  -29.654 -39.066 1.00 62.65  ? 21  DT  E "O3'" 1 
ATOM   7211 C  "C2'" . DT  E 2 18  ? 21.066  -31.950 -38.661 1.00 63.23  ? 21  DT  E "C2'" 1 
ATOM   7212 C  "C1'" . DT  E 2 18  ? 21.812  -32.674 -37.559 1.00 63.13  ? 21  DT  E "C1'" 1 
ATOM   7213 N  N1    . DT  E 2 18  ? 21.396  -34.070 -37.336 1.00 63.73  ? 21  DT  E N1    1 
ATOM   7214 C  C2    . DT  E 2 18  ? 22.229  -35.068 -37.784 1.00 65.45  ? 21  DT  E C2    1 
ATOM   7215 O  O2    . DT  E 2 18  ? 23.290  -34.850 -38.341 1.00 66.50  ? 21  DT  E O2    1 
ATOM   7216 N  N3    . DT  E 2 18  ? 21.772  -36.341 -37.554 1.00 66.08  ? 21  DT  E N3    1 
ATOM   7217 C  C4    . DT  E 2 18  ? 20.591  -36.704 -36.937 1.00 65.21  ? 21  DT  E C4    1 
ATOM   7218 O  O4    . DT  E 2 18  ? 20.315  -37.890 -36.795 1.00 66.10  ? 21  DT  E O4    1 
ATOM   7219 C  C5    . DT  E 2 18  ? 19.764  -35.606 -36.496 1.00 63.45  ? 21  DT  E C5    1 
ATOM   7220 C  C7    . DT  E 2 18  ? 18.457  -35.902 -35.831 1.00 62.63  ? 21  DT  E C7    1 
ATOM   7221 C  C6    . DT  E 2 18  ? 20.199  -34.360 -36.720 1.00 62.80  ? 21  DT  E C6    1 
ATOM   7222 P  P     . DG  E 2 19  ? 21.343  -29.411 -40.569 1.00 63.71  ? 22  DG  E P     1 
ATOM   7223 O  OP1   . DG  E 2 19  ? 21.907  -28.125 -41.034 1.00 63.89  ? 22  DG  E OP1   1 
ATOM   7224 O  OP2   . DG  E 2 19  ? 19.888  -29.652 -40.639 1.00 63.06  ? 22  DG  E OP2   1 
ATOM   7225 O  "O5'" . DG  E 2 19  ? 22.086  -30.558 -41.376 1.00 65.70  ? 22  DG  E "O5'" 1 
ATOM   7226 C  "C5'" . DG  E 2 19  ? 23.505  -30.709 -41.264 1.00 66.70  ? 22  DG  E "C5'" 1 
ATOM   7227 C  "C4'" . DG  E 2 19  ? 23.948  -31.891 -42.089 1.00 68.73  ? 22  DG  E "C4'" 1 
ATOM   7228 O  "O4'" . DG  E 2 19  ? 23.530  -33.122 -41.446 1.00 68.57  ? 22  DG  E "O4'" 1 
ATOM   7229 C  "C3'" . DG  E 2 19  ? 23.341  -31.923 -43.490 1.00 69.89  ? 22  DG  E "C3'" 1 
ATOM   7230 O  "O3'" . DG  E 2 19  ? 24.384  -32.182 -44.431 1.00 72.07  ? 22  DG  E "O3'" 1 
ATOM   7231 C  "C2'" . DG  E 2 19  ? 22.312  -33.035 -43.393 1.00 69.80  ? 22  DG  E "C2'" 1 
ATOM   7232 C  "C1'" . DG  E 2 19  ? 22.999  -33.975 -42.437 1.00 69.95  ? 22  DG  E "C1'" 1 
ATOM   7233 N  N9    . DG  E 2 19  ? 22.126  -34.949 -41.789 1.00 69.41  ? 22  DG  E N9    1 
ATOM   7234 C  C8    . DG  E 2 19  ? 21.034  -34.682 -41.002 1.00 67.63  ? 22  DG  E C8    1 
ATOM   7235 N  N7    . DG  E 2 19  ? 20.434  -35.760 -40.576 1.00 67.78  ? 22  DG  E N7    1 
ATOM   7236 C  C5    . DG  E 2 19  ? 21.172  -36.801 -41.119 1.00 69.75  ? 22  DG  E C5    1 
ATOM   7237 C  C6    . DG  E 2 19  ? 21.000  -38.205 -41.007 1.00 70.93  ? 22  DG  E C6    1 
ATOM   7238 O  O6    . DG  E 2 19  ? 20.137  -38.827 -40.384 1.00 70.45  ? 22  DG  E O6    1 
ATOM   7239 N  N1    . DG  E 2 19  ? 21.970  -38.897 -41.720 1.00 73.06  ? 22  DG  E N1    1 
ATOM   7240 C  C2    . DG  E 2 19  ? 22.976  -38.316 -42.450 1.00 73.97  ? 22  DG  E C2    1 
ATOM   7241 N  N2    . DG  E 2 19  ? 23.815  -39.154 -43.072 1.00 76.25  ? 22  DG  E N2    1 
ATOM   7242 N  N3    . DG  E 2 19  ? 23.150  -37.009 -42.559 1.00 72.91  ? 22  DG  E N3    1 
ATOM   7243 C  C4    . DG  E 2 19  ? 22.216  -36.317 -41.875 1.00 70.80  ? 22  DG  E C4    1 
ATOM   7244 P  P     . DT  E 2 20  ? 24.060  -32.355 -45.987 1.00 73.87  ? 23  DT  E P     1 
ATOM   7245 O  OP1   . DT  E 2 20  ? 25.236  -31.875 -46.745 1.00 75.60  ? 23  DT  E OP1   1 
ATOM   7246 O  OP2   . DT  E 2 20  ? 22.724  -31.769 -46.264 1.00 72.67  ? 23  DT  E OP2   1 
ATOM   7247 O  "O5'" . DT  E 2 20  ? 23.962  -33.934 -46.140 1.00 75.21  ? 23  DT  E "O5'" 1 
ATOM   7248 C  "C5'" . DT  E 2 20  ? 25.107  -34.769 -45.907 1.00 76.65  ? 23  DT  E "C5'" 1 
ATOM   7249 C  "C4'" . DT  E 2 20  ? 24.914  -36.091 -46.607 1.00 78.60  ? 23  DT  E "C4'" 1 
ATOM   7250 O  "O4'" . DT  E 2 20  ? 23.974  -36.892 -45.856 1.00 77.53  ? 23  DT  E "O4'" 1 
ATOM   7251 C  "C3'" . DT  E 2 20  ? 24.334  -35.976 -48.019 1.00 79.89  ? 23  DT  E "C3'" 1 
ATOM   7252 O  "O3'" . DT  E 2 20  ? 24.997  -36.887 -48.899 1.00 82.65  ? 23  DT  E "O3'" 1 
ATOM   7253 C  "C2'" . DT  E 2 20  ? 22.863  -36.299 -47.824 1.00 78.63  ? 23  DT  E "C2'" 1 
ATOM   7254 C  "C1'" . DT  E 2 20  ? 22.927  -37.322 -46.709 1.00 78.21  ? 23  DT  E "C1'" 1 
ATOM   7255 N  N1    . DT  E 2 20  ? 21.703  -37.440 -45.899 1.00 76.33  ? 23  DT  E N1    1 
ATOM   7256 C  C2    . DT  E 2 20  ? 21.204  -38.699 -45.644 1.00 76.99  ? 23  DT  E C2    1 
ATOM   7257 O  O2    . DT  E 2 20  ? 21.723  -39.722 -46.061 1.00 79.04  ? 23  DT  E O2    1 
ATOM   7258 N  N3    . DT  E 2 20  ? 20.067  -38.716 -44.872 1.00 75.32  ? 23  DT  E N3    1 
ATOM   7259 C  C4    . DT  E 2 20  ? 19.400  -37.627 -44.343 1.00 73.15  ? 23  DT  E C4    1 
ATOM   7260 O  O4    . DT  E 2 20  ? 18.389  -37.800 -43.668 1.00 72.02  ? 23  DT  E O4    1 
ATOM   7261 C  C5    . DT  E 2 20  ? 19.979  -36.339 -44.652 1.00 72.57  ? 23  DT  E C5    1 
ATOM   7262 C  C7    . DT  E 2 20  ? 19.322  -35.101 -44.131 1.00 70.44  ? 23  DT  E C7    1 
ATOM   7263 C  C6    . DT  E 2 20  ? 21.087  -36.311 -45.403 1.00 74.16  ? 23  DT  E C6    1 
ATOM   7264 P  P     . DC  E 2 21  ? 24.570  -36.983 -50.424 1.00 84.57  ? 24  DC  E P     1 
ATOM   7265 O  OP1   . DC  E 2 21  ? 25.781  -37.319 -51.209 1.00 87.35  ? 24  DC  E OP1   1 
ATOM   7266 O  OP2   . DC  E 2 21  ? 23.772  -35.778 -50.773 1.00 83.13  ? 24  DC  E OP2   1 
ATOM   7267 O  "O5'" . DC  E 2 21  ? 23.576  -38.223 -50.415 1.00 84.91  ? 24  DC  E "O5'" 1 
ATOM   7268 C  "C5'" . DC  E 2 21  ? 23.990  -39.518 -49.948 1.00 86.05  ? 24  DC  E "C5'" 1 
ATOM   7269 C  "C4'" . DC  E 2 21  ? 22.871  -40.500 -50.192 1.00 86.57  ? 24  DC  E "C4'" 1 
ATOM   7270 O  "O4'" . DC  E 2 21  ? 21.835  -40.278 -49.204 1.00 84.02  ? 24  DC  E "O4'" 1 
ATOM   7271 C  "C3'" . DC  E 2 21  ? 22.193  -40.339 -51.557 1.00 87.82  ? 24  DC  E "C3'" 1 
ATOM   7272 O  "O3'" . DC  E 2 21  ? 21.833  -41.601 -52.113 1.00 89.94  ? 24  DC  E "O3'" 1 
ATOM   7273 C  "C2'" . DC  E 2 21  ? 20.949  -39.535 -51.233 1.00 85.37  ? 24  DC  E "C2'" 1 
ATOM   7274 C  "C1'" . DC  E 2 21  ? 20.598  -40.116 -49.875 1.00 83.83  ? 24  DC  E "C1'" 1 
ATOM   7275 N  N1    . DC  E 2 21  ? 19.698  -39.322 -49.013 1.00 81.08  ? 24  DC  E N1    1 
ATOM   7276 C  C2    . DC  E 2 21  ? 18.859  -40.000 -48.120 1.00 80.15  ? 24  DC  E C2    1 
ATOM   7277 O  O2    . DC  E 2 21  ? 18.912  -41.239 -48.069 1.00 81.62  ? 24  DC  E O2    1 
ATOM   7278 N  N3    . DC  E 2 21  ? 18.010  -39.290 -47.341 1.00 77.84  ? 24  DC  E N3    1 
ATOM   7279 C  C4    . DC  E 2 21  ? 17.976  -37.959 -47.434 1.00 76.46  ? 24  DC  E C4    1 
ATOM   7280 N  N4    . DC  E 2 21  ? 17.124  -37.299 -46.649 1.00 74.37  ? 24  DC  E N4    1 
ATOM   7281 C  C5    . DC  E 2 21  ? 18.821  -37.243 -48.331 1.00 77.34  ? 24  DC  E C5    1 
ATOM   7282 C  C6    . DC  E 2 21  ? 19.654  -37.956 -49.098 1.00 79.64  ? 24  DC  E C6    1 
ATOM   7283 P  P     . DG  E 2 22  ? 21.570  -41.732 -53.684 1.00 92.34  ? 25  DG  E P     1 
ATOM   7284 O  OP1   . DG  E 2 22  ? 22.891  -41.889 -54.345 1.00 94.80  ? 25  DG  E OP1   1 
ATOM   7285 O  OP2   . DG  E 2 22  ? 20.671  -40.623 -54.102 1.00 90.83  ? 25  DG  E OP2   1 
ATOM   7286 O  "O5'" . DG  E 2 22  ? 20.763  -43.102 -53.797 1.00 93.69  ? 25  DG  E "O5'" 1 
ATOM   7287 C  "C5'" . DG  E 2 22  ? 21.258  -44.319 -53.196 1.00 94.86  ? 25  DG  E "C5'" 1 
ATOM   7288 C  "C4'" . DG  E 2 22  ? 20.160  -44.996 -52.408 1.00 93.77  ? 25  DG  E "C4'" 1 
ATOM   7289 O  "O4'" . DG  E 2 22  ? 19.582  -44.055 -51.465 1.00 90.57  ? 25  DG  E "O4'" 1 
ATOM   7290 C  "C3'" . DG  E 2 22  ? 18.989  -45.508 -53.252 1.00 95.00  ? 25  DG  E "C3'" 1 
ATOM   7291 O  "O3'" . DG  E 2 22  ? 18.518  -46.768 -52.746 1.00 95.87  ? 25  DG  E "O3'" 1 
ATOM   7292 C  "C2'" . DG  E 2 22  ? 17.952  -44.412 -53.090 1.00 92.44  ? 25  DG  E "C2'" 1 
ATOM   7293 C  "C1'" . DG  E 2 22  ? 18.170  -44.036 -51.639 1.00 89.88  ? 25  DG  E "C1'" 1 
ATOM   7294 N  N9    . DG  E 2 22  ? 17.672  -42.709 -51.283 1.00 87.22  ? 25  DG  E N9    1 
ATOM   7295 C  C8    . DG  E 2 22  ? 17.990  -41.520 -51.894 1.00 86.72  ? 25  DG  E C8    1 
ATOM   7296 N  N7    . DG  E 2 22  ? 17.363  -40.497 -51.381 1.00 84.32  ? 25  DG  E N7    1 
ATOM   7297 C  C5    . DG  E 2 22  ? 16.565  -41.045 -50.387 1.00 83.20  ? 25  DG  E C5    1 
ATOM   7298 C  C6    . DG  E 2 22  ? 15.657  -40.423 -49.493 1.00 80.81  ? 25  DG  E C6    1 
ATOM   7299 O  O6    . DG  E 2 22  ? 15.370  -39.224 -49.396 1.00 79.13  ? 25  DG  E O6    1 
ATOM   7300 N  N1    . DG  E 2 22  ? 15.057  -41.350 -48.646 1.00 80.63  ? 25  DG  E N1    1 
ATOM   7301 C  C2    . DG  E 2 22  ? 15.301  -42.703 -48.656 1.00 82.51  ? 25  DG  E C2    1 
ATOM   7302 N  N2    . DG  E 2 22  ? 14.624  -43.433 -47.759 1.00 82.13  ? 25  DG  E N2    1 
ATOM   7303 N  N3    . DG  E 2 22  ? 16.148  -43.295 -49.484 1.00 84.75  ? 25  DG  E N3    1 
ATOM   7304 C  C4    . DG  E 2 22  ? 16.739  -42.412 -50.318 1.00 84.96  ? 25  DG  E C4    1 
ATOM   7305 P  P     . DT  E 2 23  ? 17.246  -47.502 -53.417 1.00 97.29  ? 26  DT  E P     1 
ATOM   7306 O  OP1   . DT  E 2 23  ? 17.467  -48.971 -53.342 1.00 99.76  ? 26  DT  E OP1   1 
ATOM   7307 O  OP2   . DT  E 2 23  ? 16.969  -46.857 -54.735 1.00 98.12  ? 26  DT  E OP2   1 
ATOM   7308 O  "O5'" . DT  E 2 23  ? 16.056  -47.129 -52.425 1.00 94.56  ? 26  DT  E "O5'" 1 
ATOM   7309 C  "C5'" . DT  E 2 23  ? 16.073  -47.540 -51.043 1.00 93.24  ? 26  DT  E "C5'" 1 
ATOM   7310 C  "C4'" . DT  E 2 23  ? 14.714  -47.314 -50.420 1.00 91.44  ? 26  DT  E "C4'" 1 
ATOM   7311 O  "O4'" . DT  E 2 23  ? 14.471  -45.893 -50.261 1.00 88.90  ? 26  DT  E "O4'" 1 
ATOM   7312 C  "C3'" . DT  E 2 23  ? 13.528  -47.860 -51.226 1.00 93.02  ? 26  DT  E "C3'" 1 
ATOM   7313 O  "O3'" . DT  E 2 23  ? 12.650  -48.556 -50.334 1.00 92.72  ? 26  DT  E "O3'" 1 
ATOM   7314 C  "C2'" . DT  E 2 23  ? 12.905  -46.611 -51.827 1.00 91.63  ? 26  DT  E "C2'" 1 
ATOM   7315 C  "C1'" . DT  E 2 23  ? 13.167  -45.594 -50.737 1.00 88.65  ? 26  DT  E "C1'" 1 
ATOM   7316 N  N1    . DT  E 2 23  ? 13.155  -44.191 -51.187 1.00 87.16  ? 26  DT  E N1    1 
ATOM   7317 C  C2    . DT  E 2 23  ? 12.271  -43.309 -50.599 1.00 84.88  ? 26  DT  E C2    1 
ATOM   7318 O  O2    . DT  E 2 23  ? 11.496  -43.626 -49.711 1.00 84.03  ? 26  DT  E O2    1 
ATOM   7319 N  N3    . DT  E 2 23  ? 12.331  -42.029 -51.092 1.00 83.80  ? 26  DT  E N3    1 
ATOM   7320 C  C4    . DT  E 2 23  ? 13.166  -41.554 -52.086 1.00 84.75  ? 26  DT  E C4    1 
ATOM   7321 O  O4    . DT  E 2 23  ? 13.110  -40.373 -52.416 1.00 83.68  ? 26  DT  E O4    1 
ATOM   7322 C  C5    . DT  E 2 23  ? 14.070  -42.531 -52.654 1.00 87.17  ? 26  DT  E C5    1 
ATOM   7323 C  C7    . DT  E 2 23  ? 15.009  -42.109 -53.740 1.00 88.57  ? 26  DT  E C7    1 
ATOM   7324 C  C6    . DT  E 2 23  ? 14.018  -43.783 -52.183 1.00 88.24  ? 26  DT  E C6    1 
ATOM   7325 P  P     . DT  E 2 24  ? 11.275  -49.186 -50.854 1.00 94.19  ? 27  DT  E P     1 
ATOM   7326 O  OP1   . DT  E 2 24  ? 11.128  -50.520 -50.219 1.00 95.68  ? 27  DT  E OP1   1 
ATOM   7327 O  OP2   . DT  E 2 24  ? 11.221  -49.060 -52.340 1.00 95.97  ? 27  DT  E OP2   1 
ATOM   7328 O  "O5'" . DT  E 2 24  ? 10.180  -48.234 -50.196 1.00 91.56  ? 27  DT  E "O5'" 1 
ATOM   7329 C  "C5'" . DT  E 2 24  ? 10.078  -48.130 -48.764 1.00 89.59  ? 27  DT  E "C5'" 1 
ATOM   7330 C  "C4'" . DT  E 2 24  ? 9.016   -47.127 -48.380 1.00 87.45  ? 27  DT  E "C4'" 1 
ATOM   7331 O  "O4'" . DT  E 2 24  ? 9.328   -45.834 -48.955 1.00 86.11  ? 27  DT  E "O4'" 1 
ATOM   7332 C  "C3'" . DT  E 2 24  ? 7.598   -47.469 -48.854 1.00 88.61  ? 27  DT  E "C3'" 1 
ATOM   7333 O  "O3'" . DT  E 2 24  ? 6.688   -47.189 -47.776 1.00 87.03  ? 27  DT  E "O3'" 1 
ATOM   7334 C  "C2'" . DT  E 2 24  ? 7.419   -46.582 -50.078 1.00 88.65  ? 27  DT  E "C2'" 1 
ATOM   7335 C  "C1'" . DT  E 2 24  ? 8.184   -45.344 -49.645 1.00 86.18  ? 27  DT  E "C1'" 1 
ATOM   7336 N  N1    . DT  E 2 24  ? 8.649   -44.460 -50.735 1.00 86.20  ? 27  DT  E N1    1 
ATOM   7337 C  C2    . DT  E 2 24  ? 8.293   -43.129 -50.702 1.00 84.24  ? 27  DT  E C2    1 
ATOM   7338 O  O2    . DT  E 2 24  ? 7.600   -42.644 -49.825 1.00 82.52  ? 27  DT  E O2    1 
ATOM   7339 N  N3    . DT  E 2 24  ? 8.777   -42.381 -51.745 1.00 84.53  ? 27  DT  E N3    1 
ATOM   7340 C  C4    . DT  E 2 24  ? 9.567   -42.821 -52.790 1.00 86.58  ? 27  DT  E C4    1 
ATOM   7341 O  O4    . DT  E 2 24  ? 9.927   -42.029 -53.656 1.00 86.72  ? 27  DT  E O4    1 
ATOM   7342 C  C5    . DT  E 2 24  ? 9.906   -44.227 -52.760 1.00 88.59  ? 27  DT  E C5    1 
ATOM   7343 C  C7    . DT  E 2 24  ? 10.754  -44.795 -53.854 1.00 91.10  ? 27  DT  E C7    1 
ATOM   7344 C  C6    . DT  E 2 24  ? 9.439   -44.965 -51.745 1.00 88.29  ? 27  DT  E C6    1 
ATOM   7345 P  P     . DT  E 2 25  ? 5.114   -47.580 -47.869 1.00 88.06  ? 28  DT  E P     1 
ATOM   7346 O  OP1   . DT  E 2 25  ? 4.827   -48.578 -46.795 1.00 88.65  ? 28  DT  E OP1   1 
ATOM   7347 O  OP2   . DT  E 2 25  ? 4.773   -47.903 -49.295 1.00 90.26  ? 28  DT  E OP2   1 
ATOM   7348 O  "O5'" . DT  E 2 25  ? 4.397   -46.207 -47.481 1.00 85.64  ? 28  DT  E "O5'" 1 
ATOM   7349 C  "C5'" . DT  E 2 25  ? 4.941   -44.937 -47.909 1.00 84.01  ? 28  DT  E "C5'" 1 
ATOM   7350 C  "C4'" . DT  E 2 25  ? 3.904   -43.839 -47.847 1.00 82.62  ? 28  DT  E "C4'" 1 
ATOM   7351 O  "O4'" . DT  E 2 25  ? 4.246   -42.824 -48.816 1.00 82.13  ? 28  DT  E "O4'" 1 
ATOM   7352 C  "C3'" . DT  E 2 25  ? 2.473   -44.254 -48.186 1.00 84.06  ? 28  DT  E "C3'" 1 
ATOM   7353 O  "O3'" . DT  E 2 25  ? 1.550   -43.404 -47.502 1.00 82.52  ? 28  DT  E "O3'" 1 
ATOM   7354 C  "C2'" . DT  E 2 25  ? 2.404   -44.060 -49.689 1.00 85.39  ? 28  DT  E "C2'" 1 
ATOM   7355 C  "C1'" . DT  E 2 25  ? 3.366   -42.893 -49.938 1.00 83.69  ? 28  DT  E "C1'" 1 
ATOM   7356 N  N1    . DT  E 2 25  ? 4.198   -42.965 -51.165 1.00 84.98  ? 28  DT  E N1    1 
ATOM   7357 C  C2    . DT  E 2 25  ? 4.564   -41.779 -51.766 1.00 83.99  ? 28  DT  E C2    1 
ATOM   7358 O  O2    . DT  E 2 25  ? 4.229   -40.684 -51.345 1.00 82.12  ? 28  DT  E O2    1 
ATOM   7359 N  N3    . DT  E 2 25  ? 5.345   -41.922 -52.886 1.00 85.44  ? 28  DT  E N3    1 
ATOM   7360 C  C4    . DT  E 2 25  ? 5.796   -43.104 -53.445 1.00 87.74  ? 28  DT  E C4    1 
ATOM   7361 O  O4    . DT  E 2 25  ? 6.499   -43.074 -54.450 1.00 88.98  ? 28  DT  E O4    1 
ATOM   7362 C  C5    . DT  E 2 25  ? 5.383   -44.310 -52.758 1.00 88.65  ? 28  DT  E C5    1 
ATOM   7363 C  C7    . DT  E 2 25  ? 5.827   -45.638 -53.285 1.00 91.30  ? 28  DT  E C7    1 
ATOM   7364 C  C6    . DT  E 2 25  ? 4.621   -44.181 -51.665 1.00 87.23  ? 28  DT  E C6    1 
ATOM   7365 O  "O5'" . DA  F 3 1   ? 8.276   -32.674 -57.099 1.00 80.91  ? 29  DA  F "O5'" 1 
ATOM   7366 C  "C5'" . DA  F 3 1   ? 7.224   -31.717 -56.891 1.00 79.69  ? 29  DA  F "C5'" 1 
ATOM   7367 C  "C4'" . DA  F 3 1   ? 6.501   -32.005 -55.595 1.00 78.12  ? 29  DA  F "C4'" 1 
ATOM   7368 O  "O4'" . DA  F 3 1   ? 6.195   -33.416 -55.510 1.00 79.21  ? 29  DA  F "O4'" 1 
ATOM   7369 C  "C3'" . DA  F 3 1   ? 7.276   -31.653 -54.323 1.00 76.22  ? 29  DA  F "C3'" 1 
ATOM   7370 O  "O3'" . DA  F 3 1   ? 6.428   -30.921 -53.425 1.00 74.51  ? 29  DA  F "O3'" 1 
ATOM   7371 C  "C2'" . DA  F 3 1   ? 7.742   -33.000 -53.796 1.00 76.68  ? 29  DA  F "C2'" 1 
ATOM   7372 C  "C1'" . DA  F 3 1   ? 6.688   -33.970 -54.305 1.00 78.15  ? 29  DA  F "C1'" 1 
ATOM   7373 N  N9    . DA  F 3 1   ? 7.175   -35.314 -54.610 1.00 79.84  ? 29  DA  F N9    1 
ATOM   7374 C  C8    . DA  F 3 1   ? 8.235   -35.653 -55.415 1.00 81.34  ? 29  DA  F C8    1 
ATOM   7375 N  N7    . DA  F 3 1   ? 8.422   -36.944 -55.527 1.00 82.87  ? 29  DA  F N7    1 
ATOM   7376 C  C5    . DA  F 3 1   ? 7.408   -37.496 -54.757 1.00 82.34  ? 29  DA  F C5    1 
ATOM   7377 C  C6    . DA  F 3 1   ? 7.059   -38.826 -54.468 1.00 83.47  ? 29  DA  F C6    1 
ATOM   7378 N  N6    . DA  F 3 1   ? 7.728   -39.880 -54.939 1.00 85.42  ? 29  DA  F N6    1 
ATOM   7379 N  N1    . DA  F 3 1   ? 5.993   -39.037 -53.663 1.00 82.69  ? 29  DA  F N1    1 
ATOM   7380 C  C2    . DA  F 3 1   ? 5.328   -37.974 -53.189 1.00 80.91  ? 29  DA  F C2    1 
ATOM   7381 N  N3    . DA  F 3 1   ? 5.559   -36.676 -53.392 1.00 79.71  ? 29  DA  F N3    1 
ATOM   7382 C  C4    . DA  F 3 1   ? 6.625   -36.503 -54.194 1.00 80.50  ? 29  DA  F C4    1 
ATOM   7383 P  P     . DA  F 3 2   ? 7.011   -30.292 -52.074 1.00 72.43  ? 30  DA  F P     1 
ATOM   7384 O  OP1   . DA  F 3 2   ? 6.257   -29.053 -51.766 1.00 71.26  ? 30  DA  F OP1   1 
ATOM   7385 O  OP2   . DA  F 3 2   ? 8.486   -30.244 -52.179 1.00 72.58  ? 30  DA  F OP2   1 
ATOM   7386 O  "O5'" . DA  F 3 2   ? 6.635   -31.395 -50.992 1.00 71.98  ? 30  DA  F "O5'" 1 
ATOM   7387 C  "C5'" . DA  F 3 2   ? 5.337   -32.016 -50.951 1.00 72.52  ? 30  DA  F "C5'" 1 
ATOM   7388 C  "C4'" . DA  F 3 2   ? 5.370   -33.168 -49.974 1.00 72.39  ? 30  DA  F "C4'" 1 
ATOM   7389 O  "O4'" . DA  F 3 2   ? 5.953   -34.317 -50.633 1.00 74.06  ? 30  DA  F "O4'" 1 
ATOM   7390 C  "C3'" . DA  F 3 2   ? 6.231   -32.910 -48.732 1.00 70.72  ? 30  DA  F "C3'" 1 
ATOM   7391 O  "O3'" . DA  F 3 2   ? 5.617   -33.310 -47.502 1.00 69.88  ? 30  DA  F "O3'" 1 
ATOM   7392 C  "C2'" . DA  F 3 2   ? 7.478   -33.731 -48.996 1.00 71.60  ? 30  DA  F "C2'" 1 
ATOM   7393 C  "C1'" . DA  F 3 2   ? 6.907   -34.895 -49.768 1.00 73.54  ? 30  DA  F "C1'" 1 
ATOM   7394 N  N9    . DA  F 3 2   ? 7.865   -35.644 -50.580 1.00 75.17  ? 30  DA  F N9    1 
ATOM   7395 C  C8    . DA  F 3 2   ? 8.924   -35.178 -51.319 1.00 75.65  ? 30  DA  F C8    1 
ATOM   7396 N  N7    . DA  F 3 2   ? 9.603   -36.122 -51.924 1.00 77.41  ? 30  DA  F N7    1 
ATOM   7397 C  C5    . DA  F 3 2   ? 8.949   -37.289 -51.556 1.00 78.10  ? 30  DA  F C5    1 
ATOM   7398 C  C6    . DA  F 3 2   ? 9.177   -38.640 -51.867 1.00 80.02  ? 30  DA  F C6    1 
ATOM   7399 N  N6    . DA  F 3 2   ? 10.170  -39.061 -52.650 1.00 81.65  ? 30  DA  F N6    1 
ATOM   7400 N  N1    . DA  F 3 2   ? 8.333   -39.557 -51.346 1.00 80.39  ? 30  DA  F N1    1 
ATOM   7401 C  C2    . DA  F 3 2   ? 7.333   -39.134 -50.561 1.00 78.93  ? 30  DA  F C2    1 
ATOM   7402 N  N3    . DA  F 3 2   ? 7.022   -37.894 -50.189 1.00 77.09  ? 30  DA  F N3    1 
ATOM   7403 C  C4    . DA  F 3 2   ? 7.878   -37.009 -50.728 1.00 76.74  ? 30  DA  F C4    1 
ATOM   7404 P  P     . DA  F 3 3   ? 6.172   -32.724 -46.109 1.00 67.94  ? 31  DA  F P     1 
ATOM   7405 O  OP1   . DA  F 3 3   ? 5.071   -32.001 -45.436 1.00 66.98  ? 31  DA  F OP1   1 
ATOM   7406 O  OP2   . DA  F 3 3   ? 7.462   -32.025 -46.362 1.00 67.47  ? 31  DA  F OP2   1 
ATOM   7407 O  "O5'" . DA  F 3 3   ? 6.533   -34.031 -45.281 1.00 68.19  ? 31  DA  F "O5'" 1 
ATOM   7408 C  "C5'" . DA  F 3 3   ? 5.578   -35.087 -45.101 1.00 69.16  ? 31  DA  F "C5'" 1 
ATOM   7409 C  "C4'" . DA  F 3 3   ? 6.269   -36.429 -45.145 1.00 70.35  ? 31  DA  F "C4'" 1 
ATOM   7410 O  "O4'" . DA  F 3 3   ? 7.054   -36.558 -46.353 1.00 71.53  ? 31  DA  F "O4'" 1 
ATOM   7411 C  "C3'" . DA  F 3 3   ? 7.252   -36.680 -44.003 1.00 69.37  ? 31  DA  F "C3'" 1 
ATOM   7412 O  "O3'" . DA  F 3 3   ? 6.707   -37.506 -42.971 1.00 69.39  ? 31  DA  F "O3'" 1 
ATOM   7413 C  "C2'" . DA  F 3 3   ? 8.426   -37.374 -44.678 1.00 70.58  ? 31  DA  F "C2'" 1 
ATOM   7414 C  "C1'" . DA  F 3 3   ? 7.970   -37.598 -46.101 1.00 72.26  ? 31  DA  F "C1'" 1 
ATOM   7415 N  N9    . DA  F 3 3   ? 9.054   -37.514 -47.077 1.00 73.16  ? 31  DA  F N9    1 
ATOM   7416 C  C8    . DA  F 3 3   ? 9.765   -36.408 -47.476 1.00 72.47  ? 31  DA  F C8    1 
ATOM   7417 N  N7    . DA  F 3 3   ? 10.713  -36.673 -48.342 1.00 73.80  ? 31  DA  F N7    1 
ATOM   7418 C  C5    . DA  F 3 3   ? 10.633  -38.048 -48.513 1.00 75.44  ? 31  DA  F C5    1 
ATOM   7419 C  C6    . DA  F 3 3   ? 11.370  -38.950 -49.301 1.00 77.50  ? 31  DA  F C6    1 
ATOM   7420 N  N6    . DA  F 3 3   ? 12.366  -38.582 -50.110 1.00 78.30  ? 31  DA  F N6    1 
ATOM   7421 N  N1    . DA  F 3 3   ? 11.034  -40.258 -49.242 1.00 78.93  ? 31  DA  F N1    1 
ATOM   7422 C  C2    . DA  F 3 3   ? 10.029  -40.627 -48.434 1.00 78.31  ? 31  DA  F C2    1 
ATOM   7423 N  N3    . DA  F 3 3   ? 9.269   -39.874 -47.639 1.00 76.44  ? 31  DA  F N3    1 
ATOM   7424 C  C4    . DA  F 3 3   ? 9.624   -38.580 -47.729 1.00 75.05  ? 31  DA  F C4    1 
ATOM   7425 P  P     . DC  F 3 4   ? 7.621   -37.897 -41.707 1.00 68.54  ? 32  DC  F P     1 
ATOM   7426 O  OP1   . DC  F 3 4   ? 6.739   -38.189 -40.554 1.00 68.10  ? 32  DC  F OP1   1 
ATOM   7427 O  OP2   . DC  F 3 4   ? 8.672   -36.863 -41.561 1.00 67.19  ? 32  DC  F OP2   1 
ATOM   7428 O  "O5'" . DC  F 3 4   ? 8.316   -39.254 -42.169 1.00 70.31  ? 32  DC  F "O5'" 1 
ATOM   7429 C  "C5'" . DC  F 3 4   ? 7.566   -40.377 -42.667 1.00 72.18  ? 32  DC  F "C5'" 1 
ATOM   7430 C  "C4'" . DC  F 3 4   ? 8.512   -41.398 -43.255 1.00 73.85  ? 32  DC  F "C4'" 1 
ATOM   7431 O  "O4'" . DC  F 3 4   ? 9.221   -40.802 -44.360 1.00 74.12  ? 32  DC  F "O4'" 1 
ATOM   7432 C  "C3'" . DC  F 3 4   ? 9.587   -41.885 -42.287 1.00 73.47  ? 32  DC  F "C3'" 1 
ATOM   7433 O  "O3'" . DC  F 3 4   ? 9.292   -43.187 -41.774 1.00 74.73  ? 32  DC  F "O3'" 1 
ATOM   7434 C  "C2'" . DC  F 3 4   ? 10.874  -41.868 -43.101 1.00 74.20  ? 32  DC  F "C2'" 1 
ATOM   7435 C  "C1'" . DC  F 3 4   ? 10.476  -41.428 -44.498 1.00 75.03  ? 32  DC  F "C1'" 1 
ATOM   7436 N  N1    . DC  F 3 4   ? 11.412  -40.453 -45.090 1.00 74.50  ? 32  DC  F N1    1 
ATOM   7437 C  C2    . DC  F 3 4   ? 12.363  -40.892 -46.019 1.00 76.18  ? 32  DC  F C2    1 
ATOM   7438 O  O2    . DC  F 3 4   ? 12.377  -42.086 -46.348 1.00 78.07  ? 32  DC  F O2    1 
ATOM   7439 N  N3    . DC  F 3 4   ? 13.237  -40.000 -46.540 1.00 75.86  ? 32  DC  F N3    1 
ATOM   7440 C  C4    . DC  F 3 4   ? 13.197  -38.722 -46.153 1.00 73.94  ? 32  DC  F C4    1 
ATOM   7441 N  N4    . DC  F 3 4   ? 14.078  -37.876 -46.688 1.00 73.86  ? 32  DC  F N4    1 
ATOM   7442 C  C5    . DC  F 3 4   ? 12.246  -38.252 -45.205 1.00 72.20  ? 32  DC  F C5    1 
ATOM   7443 C  C6    . DC  F 3 4   ? 11.388  -39.144 -44.696 1.00 72.55  ? 32  DC  F C6    1 
ATOM   7444 P  P     . DG  F 3 5   ? 10.111  -43.764 -40.502 1.00 74.31  ? 33  DG  F P     1 
ATOM   7445 O  OP1   . DG  F 3 5   ? 9.265   -44.791 -39.847 1.00 75.27  ? 33  DG  F OP1   1 
ATOM   7446 O  OP2   . DG  F 3 5   ? 10.645  -42.622 -39.704 1.00 72.06  ? 33  DG  F OP2   1 
ATOM   7447 O  "O5'" . DG  F 3 5   ? 11.353  -44.508 -41.162 1.00 75.90  ? 33  DG  F "O5'" 1 
ATOM   7448 C  "C5'" . DG  F 3 5   ? 11.160  -45.489 -42.202 1.00 78.31  ? 33  DG  F "C5'" 1 
ATOM   7449 C  "C4'" . DG  F 3 5   ? 12.464  -46.172 -42.552 1.00 79.75  ? 33  DG  F "C4'" 1 
ATOM   7450 O  "O4'" . DG  F 3 5   ? 13.299  -45.330 -43.383 1.00 79.47  ? 33  DG  F "O4'" 1 
ATOM   7451 C  "C3'" . DG  F 3 5   ? 13.341  -46.581 -41.372 1.00 79.29  ? 33  DG  F "C3'" 1 
ATOM   7452 O  "O3'" . DG  F 3 5   ? 13.938  -47.822 -41.752 1.00 81.69  ? 33  DG  F "O3'" 1 
ATOM   7453 C  "C2'" . DG  F 3 5   ? 14.329  -45.433 -41.257 1.00 77.61  ? 33  DG  F "C2'" 1 
ATOM   7454 C  "C1'" . DG  F 3 5   ? 14.495  -44.972 -42.703 1.00 78.46  ? 33  DG  F "C1'" 1 
ATOM   7455 N  N9    . DG  F 3 5   ? 14.690  -43.540 -42.898 1.00 76.71  ? 33  DG  F N9    1 
ATOM   7456 C  C8    . DG  F 3 5   ? 14.073  -42.522 -42.214 1.00 74.51  ? 33  DG  F C8    1 
ATOM   7457 N  N7    . DG  F 3 5   ? 14.418  -41.338 -42.638 1.00 73.52  ? 33  DG  F N7    1 
ATOM   7458 C  C5    . DG  F 3 5   ? 15.303  -41.589 -43.675 1.00 75.16  ? 33  DG  F C5    1 
ATOM   7459 C  C6    . DG  F 3 5   ? 16.012  -40.692 -44.513 1.00 75.21  ? 33  DG  F C6    1 
ATOM   7460 O  O6    . DG  F 3 5   ? 16.001  -39.457 -44.501 1.00 73.75  ? 33  DG  F O6    1 
ATOM   7461 N  N1    . DG  F 3 5   ? 16.801  -41.368 -45.436 1.00 77.42  ? 33  DG  F N1    1 
ATOM   7462 C  C2    . DG  F 3 5   ? 16.896  -42.733 -45.542 1.00 79.34  ? 33  DG  F C2    1 
ATOM   7463 N  N2    . DG  F 3 5   ? 17.707  -43.196 -46.504 1.00 81.51  ? 33  DG  F N2    1 
ATOM   7464 N  N3    . DG  F 3 5   ? 16.243  -43.582 -44.763 1.00 79.31  ? 33  DG  F N3    1 
ATOM   7465 C  C4    . DG  F 3 5   ? 15.471  -42.944 -43.858 1.00 77.16  ? 33  DG  F C4    1 
ATOM   7466 P  P     . DA  F 3 6   ? 14.850  -48.617 -40.751 1.00 82.12  ? 34  DA  F P     1 
ATOM   7467 O  OP1   . DA  F 3 6   ? 14.628  -50.066 -41.002 1.00 84.75  ? 34  DA  F OP1   1 
ATOM   7468 O  OP2   . DA  F 3 6   ? 14.652  -48.044 -39.399 1.00 79.84  ? 34  DA  F OP2   1 
ATOM   7469 O  "O5'" . DA  F 3 6   ? 16.316  -48.223 -41.235 1.00 82.34  ? 34  DA  F "O5'" 1 
ATOM   7470 C  "C5'" . DA  F 3 6   ? 16.768  -48.524 -42.575 1.00 84.42  ? 34  DA  F "C5'" 1 
ATOM   7471 C  "C4'" . DA  F 3 6   ? 18.193  -48.058 -42.774 1.00 84.45  ? 34  DA  F "C4'" 1 
ATOM   7472 O  "O4'" . DA  F 3 6   ? 18.212  -46.625 -43.000 1.00 82.48  ? 34  DA  F "O4'" 1 
ATOM   7473 C  "C3'" . DA  F 3 6   ? 19.136  -48.309 -41.589 1.00 83.94  ? 34  DA  F "C3'" 1 
ATOM   7474 O  "O3'" . DA  F 3 6   ? 20.417  -48.740 -42.072 1.00 85.84  ? 34  DA  F "O3'" 1 
ATOM   7475 C  "C2'" . DA  F 3 6   ? 19.195  -46.953 -40.905 1.00 81.09  ? 34  DA  F "C2'" 1 
ATOM   7476 C  "C1'" . DA  F 3 6   ? 19.149  -46.033 -42.107 1.00 81.01  ? 34  DA  F "C1'" 1 
ATOM   7477 N  N9    . DA  F 3 6   ? 18.734  -44.654 -41.846 1.00 78.54  ? 34  DA  F N9    1 
ATOM   7478 C  C8    . DA  F 3 6   ? 17.906  -44.164 -40.866 1.00 76.45  ? 34  DA  F C8    1 
ATOM   7479 N  N7    . DA  F 3 6   ? 17.754  -42.862 -40.906 1.00 74.69  ? 34  DA  F N7    1 
ATOM   7480 C  C5    . DA  F 3 6   ? 18.541  -42.468 -41.980 1.00 75.65  ? 34  DA  F C5    1 
ATOM   7481 C  C6    . DA  F 3 6   ? 18.809  -41.209 -42.547 1.00 74.82  ? 34  DA  F C6    1 
ATOM   7482 N  N6    . DA  F 3 6   ? 18.288  -40.067 -42.096 1.00 72.73  ? 34  DA  F N6    1 
ATOM   7483 N  N1    . DA  F 3 6   ? 19.635  -41.164 -43.616 1.00 76.41  ? 34  DA  F N1    1 
ATOM   7484 C  C2    . DA  F 3 6   ? 20.158  -42.310 -44.071 1.00 78.68  ? 34  DA  F C2    1 
ATOM   7485 N  N3    . DA  F 3 6   ? 19.986  -43.551 -43.620 1.00 79.68  ? 34  DA  F N3    1 
ATOM   7486 C  C4    . DA  F 3 6   ? 19.155  -43.561 -42.563 1.00 78.03  ? 34  DA  F C4    1 
ATOM   7487 P  P     . DC  F 3 7   ? 21.575  -49.206 -41.053 1.00 86.09  ? 35  DC  F P     1 
ATOM   7488 O  OP1   . DC  F 3 7   ? 22.064  -50.534 -41.508 1.00 89.16  ? 35  DC  F OP1   1 
ATOM   7489 O  OP2   . DC  F 3 7   ? 21.092  -49.033 -39.651 1.00 83.97  ? 35  DC  F OP2   1 
ATOM   7490 O  "O5'" . DC  F 3 7   ? 22.718  -48.118 -41.289 1.00 85.33  ? 35  DC  F "O5'" 1 
ATOM   7491 C  "C5'" . DC  F 3 7   ? 23.331  -47.931 -42.588 1.00 87.03  ? 35  DC  F "C5'" 1 
ATOM   7492 C  "C4'" . DC  F 3 7   ? 23.865  -46.522 -42.720 1.00 85.43  ? 35  DC  F "C4'" 1 
ATOM   7493 O  "O4'" . DC  F 3 7   ? 22.790  -45.583 -42.503 1.00 82.98  ? 35  DC  F "O4'" 1 
ATOM   7494 C  "C3'" . DC  F 3 7   ? 24.935  -46.143 -41.695 1.00 84.45  ? 35  DC  F "C3'" 1 
ATOM   7495 O  "O3'" . DC  F 3 7   ? 26.280  -46.305 -42.159 1.00 86.43  ? 35  DC  F "O3'" 1 
ATOM   7496 C  "C2'" . DC  F 3 7   ? 24.683  -44.668 -41.433 1.00 81.82  ? 35  DC  F "C2'" 1 
ATOM   7497 C  "C1'" . DC  F 3 7   ? 23.347  -44.348 -42.081 1.00 81.13  ? 35  DC  F "C1'" 1 
ATOM   7498 N  N1    . DC  F 3 7   ? 22.424  -43.722 -41.124 1.00 78.52  ? 35  DC  F N1    1 
ATOM   7499 C  C2    . DC  F 3 7   ? 22.131  -42.358 -41.248 1.00 76.69  ? 35  DC  F C2    1 
ATOM   7500 O  O2    . DC  F 3 7   ? 22.614  -41.723 -42.195 1.00 77.31  ? 35  DC  F O2    1 
ATOM   7501 N  N3    . DC  F 3 7   ? 21.315  -41.773 -40.345 1.00 74.46  ? 35  DC  F N3    1 
ATOM   7502 C  C4    . DC  F 3 7   ? 20.823  -42.489 -39.330 1.00 74.01  ? 35  DC  F C4    1 
ATOM   7503 N  N4    . DC  F 3 7   ? 20.027  -41.869 -38.458 1.00 71.95  ? 35  DC  F N4    1 
ATOM   7504 C  C5    . DC  F 3 7   ? 21.131  -43.871 -39.161 1.00 75.80  ? 35  DC  F C5    1 
ATOM   7505 C  C6    . DC  F 3 7   ? 21.937  -44.439 -40.066 1.00 78.00  ? 35  DC  F C6    1 
ATOM   7506 P  P     . DA  F 3 8   ? 27.512  -45.939 -41.188 1.00 85.82  ? 36  DA  F P     1 
ATOM   7507 O  OP1   . DA  F 3 8   ? 28.692  -46.728 -41.625 1.00 88.71  ? 36  DA  F OP1   1 
ATOM   7508 O  OP2   . DA  F 3 8   ? 27.046  -46.013 -39.778 1.00 83.77  ? 36  DA  F OP2   1 
ATOM   7509 O  "O5'" . DA  F 3 8   ? 27.793  -44.404 -41.506 1.00 84.32  ? 36  DA  F "O5'" 1 
ATOM   7510 C  "C5'" . DA  F 3 8   ? 28.094  -43.938 -42.834 1.00 85.70  ? 36  DA  F "C5'" 1 
ATOM   7511 C  "C4'" . DA  F 3 8   ? 28.295  -42.442 -42.794 1.00 83.90  ? 36  DA  F "C4'" 1 
ATOM   7512 O  "O4'" . DA  F 3 8   ? 27.077  -41.816 -42.320 1.00 81.29  ? 36  DA  F "O4'" 1 
ATOM   7513 C  "C3'" . DA  F 3 8   ? 29.398  -41.986 -41.837 1.00 83.27  ? 36  DA  F "C3'" 1 
ATOM   7514 O  "O3'" . DA  F 3 8   ? 30.128  -40.911 -42.438 1.00 83.58  ? 36  DA  F "O3'" 1 
ATOM   7515 C  "C2'" . DA  F 3 8   ? 28.623  -41.616 -40.584 1.00 80.43  ? 36  DA  F "C2'" 1 
ATOM   7516 C  "C1'" . DA  F 3 8   ? 27.354  -41.033 -41.174 1.00 79.19  ? 36  DA  F "C1'" 1 
ATOM   7517 N  N9    . DA  F 3 8   ? 26.199  -41.112 -40.280 1.00 77.16  ? 36  DA  F N9    1 
ATOM   7518 C  C8    . DA  F 3 8   ? 25.717  -42.231 -39.648 1.00 77.38  ? 36  DA  F C8    1 
ATOM   7519 N  N7    . DA  F 3 8   ? 24.687  -41.998 -38.872 1.00 75.42  ? 36  DA  F N7    1 
ATOM   7520 C  C5    . DA  F 3 8   ? 24.488  -40.629 -38.983 1.00 73.76  ? 36  DA  F C5    1 
ATOM   7521 C  C6    . DA  F 3 8   ? 23.548  -39.760 -38.403 1.00 71.49  ? 36  DA  F C6    1 
ATOM   7522 N  N6    . DA  F 3 8   ? 22.590  -40.160 -37.565 1.00 70.47  ? 36  DA  F N6    1 
ATOM   7523 N  N1    . DA  F 3 8   ? 23.620  -38.449 -38.726 1.00 70.47  ? 36  DA  F N1    1 
ATOM   7524 C  C2    . DA  F 3 8   ? 24.581  -38.049 -39.571 1.00 71.67  ? 36  DA  F C2    1 
ATOM   7525 N  N3    . DA  F 3 8   ? 25.518  -38.772 -40.183 1.00 73.85  ? 36  DA  F N3    1 
ATOM   7526 C  C4    . DA  F 3 8   ? 25.417  -40.069 -39.842 1.00 74.80  ? 36  DA  F C4    1 
ATOM   7527 P  P     . DT  F 3 9   ? 30.994  -39.893 -41.539 1.00 82.25  ? 37  DT  F P     1 
ATOM   7528 O  OP1   . DT  F 3 9   ? 31.964  -39.209 -42.434 1.00 83.87  ? 37  DT  F OP1   1 
ATOM   7529 O  OP2   . DT  F 3 9   ? 31.477  -40.609 -40.323 1.00 82.08  ? 37  DT  F OP2   1 
ATOM   7530 O  "O5'" . DT  F 3 9   ? 29.908  -38.834 -41.063 1.00 79.25  ? 37  DT  F "O5'" 1 
ATOM   7531 C  "C5'" . DT  F 3 9   ? 29.469  -37.772 -41.925 1.00 78.76  ? 37  DT  F "C5'" 1 
ATOM   7532 C  "C4'" . DT  F 3 9   ? 29.265  -36.530 -41.092 1.00 76.31  ? 37  DT  F "C4'" 1 
ATOM   7533 O  "O4'" . DT  F 3 9   ? 28.153  -36.747 -40.189 1.00 74.27  ? 37  DT  F "O4'" 1 
ATOM   7534 C  "C3'" . DT  F 3 9   ? 30.459  -36.142 -40.215 1.00 76.21  ? 37  DT  F "C3'" 1 
ATOM   7535 O  "O3'" . DT  F 3 9   ? 30.635  -34.730 -40.367 1.00 75.39  ? 37  DT  F "O3'" 1 
ATOM   7536 C  "C2'" . DT  F 3 9   ? 30.060  -36.644 -38.839 1.00 74.60  ? 37  DT  F "C2'" 1 
ATOM   7537 C  "C1'" . DT  F 3 9   ? 28.552  -36.472 -38.861 1.00 72.89  ? 37  DT  F "C1'" 1 
ATOM   7538 N  N1    . DT  F 3 9   ? 27.776  -37.357 -37.957 1.00 71.97  ? 37  DT  F N1    1 
ATOM   7539 C  C2    . DT  F 3 9   ? 26.721  -36.806 -37.262 1.00 69.77  ? 37  DT  F C2    1 
ATOM   7540 O  O2    . DT  F 3 9   ? 26.398  -35.631 -37.355 1.00 68.54  ? 37  DT  F O2    1 
ATOM   7541 N  N3    . DT  F 3 9   ? 26.053  -37.687 -36.446 1.00 69.23  ? 37  DT  F N3    1 
ATOM   7542 C  C4    . DT  F 3 9   ? 26.328  -39.031 -36.264 1.00 70.62  ? 37  DT  F C4    1 
ATOM   7543 O  O4    . DT  F 3 9   ? 25.648  -39.694 -35.491 1.00 70.04  ? 37  DT  F O4    1 
ATOM   7544 C  C5    . DT  F 3 9   ? 27.442  -39.542 -37.025 1.00 72.89  ? 37  DT  F C5    1 
ATOM   7545 C  C7    . DT  F 3 9   ? 27.810  -40.987 -36.894 1.00 74.69  ? 37  DT  F C7    1 
ATOM   7546 C  C6    . DT  F 3 9   ? 28.098  -38.693 -37.828 1.00 73.46  ? 37  DT  F C6    1 
ATOM   7547 P  P     . DT  F 3 10  ? 31.387  -33.860 -39.275 1.00 74.27  ? 38  DT  F P     1 
ATOM   7548 O  OP1   . DT  F 3 10  ? 31.916  -32.653 -39.943 1.00 74.83  ? 38  DT  F OP1   1 
ATOM   7549 O  OP2   . DT  F 3 10  ? 32.302  -34.740 -38.512 1.00 75.16  ? 38  DT  F OP2   1 
ATOM   7550 O  "O5'" . DT  F 3 10  ? 30.198  -33.389 -38.336 1.00 71.49  ? 38  DT  F "O5'" 1 
ATOM   7551 C  "C5'" . DT  F 3 10  ? 29.221  -32.450 -38.809 1.00 70.30  ? 38  DT  F "C5'" 1 
ATOM   7552 C  "C4'" . DT  F 3 10  ? 28.466  -31.869 -37.639 1.00 67.89  ? 38  DT  F "C4'" 1 
ATOM   7553 O  "O4'" . DT  F 3 10  ? 27.863  -32.940 -36.881 1.00 67.25  ? 38  DT  F "O4'" 1 
ATOM   7554 C  "C3'" . DT  F 3 10  ? 29.330  -31.102 -36.642 1.00 67.24  ? 38  DT  F "C3'" 1 
ATOM   7555 O  "O3'" . DT  F 3 10  ? 28.529  -30.073 -36.076 1.00 65.29  ? 38  DT  F "O3'" 1 
ATOM   7556 C  "C2'" . DT  F 3 10  ? 29.610  -32.132 -35.568 1.00 67.08  ? 38  DT  F "C2'" 1 
ATOM   7557 C  "C1'" . DT  F 3 10  ? 28.268  -32.832 -35.528 1.00 66.21  ? 38  DT  F "C1'" 1 
ATOM   7558 N  N1    . DT  F 3 10  ? 28.226  -34.181 -34.938 1.00 66.58  ? 38  DT  F N1    1 
ATOM   7559 C  C2    . DT  F 3 10  ? 27.214  -34.448 -34.044 1.00 65.07  ? 38  DT  F C2    1 
ATOM   7560 O  O2    . DT  F 3 10  ? 26.387  -33.617 -33.704 1.00 63.48  ? 38  DT  F O2    1 
ATOM   7561 N  N3    . DT  F 3 10  ? 27.211  -35.727 -33.549 1.00 65.66  ? 38  DT  F N3    1 
ATOM   7562 C  C4    . DT  F 3 10  ? 28.090  -36.747 -33.863 1.00 67.58  ? 38  DT  F C4    1 
ATOM   7563 O  O4    . DT  F 3 10  ? 27.964  -37.847 -33.333 1.00 68.01  ? 38  DT  F O4    1 
ATOM   7564 C  C5    . DT  F 3 10  ? 29.120  -36.401 -34.816 1.00 69.13  ? 38  DT  F C5    1 
ATOM   7565 C  C7    . DT  F 3 10  ? 30.124  -37.439 -35.210 1.00 71.46  ? 38  DT  F C7    1 
ATOM   7566 C  C6    . DT  F 3 10  ? 29.131  -35.154 -35.306 1.00 68.56  ? 38  DT  F C6    1 
ATOM   7567 P  P     . DT  F 3 11  ? 29.137  -28.641 -35.845 1.00 64.94  ? 39  DT  F P     1 
ATOM   7568 O  OP1   . DT  F 3 11  ? 28.867  -27.830 -37.049 1.00 65.51  ? 39  DT  F OP1   1 
ATOM   7569 O  OP2   . DT  F 3 11  ? 30.527  -28.813 -35.356 1.00 65.98  ? 39  DT  F OP2   1 
ATOM   7570 O  "O5'" . DT  F 3 11  ? 28.249  -28.048 -34.665 1.00 62.72  ? 39  DT  F "O5'" 1 
ATOM   7571 C  "C5'" . DT  F 3 11  ? 26.820  -28.189 -34.656 1.00 61.51  ? 39  DT  F "C5'" 1 
ATOM   7572 C  "C4'" . DT  F 3 11  ? 26.340  -28.620 -33.288 1.00 60.14  ? 39  DT  F "C4'" 1 
ATOM   7573 O  "O4'" . DT  F 3 11  ? 26.664  -30.001 -33.012 1.00 60.85  ? 39  DT  F "O4'" 1 
ATOM   7574 C  "C3'" . DT  F 3 11  ? 26.877  -27.821 -32.093 1.00 59.27  ? 39  DT  F "C3'" 1 
ATOM   7575 O  "O3'" . DT  F 3 11  ? 25.758  -27.197 -31.469 1.00 57.71  ? 39  DT  F "O3'" 1 
ATOM   7576 C  "C2'" . DT  F 3 11  ? 27.477  -28.870 -31.167 1.00 59.48  ? 39  DT  F "C2'" 1 
ATOM   7577 C  "C1'" . DT  F 3 11  ? 26.751  -30.120 -31.606 1.00 59.85  ? 39  DT  F "C1'" 1 
ATOM   7578 N  N1    . DT  F 3 11  ? 27.411  -31.400 -31.295 1.00 60.84  ? 39  DT  F N1    1 
ATOM   7579 C  C2    . DT  F 3 11  ? 26.801  -32.254 -30.403 1.00 60.20  ? 39  DT  F C2    1 
ATOM   7580 O  O2    . DT  F 3 11  ? 25.752  -31.991 -29.835 1.00 58.88  ? 39  DT  F O2    1 
ATOM   7581 N  N3    . DT  F 3 11  ? 27.475  -33.431 -30.188 1.00 61.34  ? 39  DT  F N3    1 
ATOM   7582 C  C4    . DT  F 3 11  ? 28.670  -33.826 -30.759 1.00 63.04  ? 39  DT  F C4    1 
ATOM   7583 O  O4    . DT  F 3 11  ? 29.162  -34.908 -30.457 1.00 64.04  ? 39  DT  F O4    1 
ATOM   7584 C  C5    . DT  F 3 11  ? 29.249  -32.884 -31.690 1.00 63.67  ? 39  DT  F C5    1 
ATOM   7585 C  C7    . DT  F 3 11  ? 30.543  -33.225 -32.360 1.00 65.72  ? 39  DT  F C7    1 
ATOM   7586 C  C6    . DT  F 3 11  ? 28.598  -31.735 -31.909 1.00 62.53  ? 39  DT  F C6    1 
ATOM   7587 P  P     . DC  F 3 12  ? 25.946  -25.961 -30.512 1.00 56.76  ? 40  DC  F P     1 
ATOM   7588 O  OP1   . DC  F 3 12  ? 24.691  -25.169 -30.531 1.00 55.71  ? 40  DC  F OP1   1 
ATOM   7589 O  OP2   . DC  F 3 12  ? 27.230  -25.312 -30.834 1.00 57.78  ? 40  DC  F OP2   1 
ATOM   7590 O  "O5'" . DC  F 3 12  ? 26.046  -26.655 -29.091 1.00 56.08  ? 40  DC  F "O5'" 1 
ATOM   7591 C  "C5'" . DC  F 3 12  ? 24.908  -27.313 -28.505 1.00 55.19  ? 40  DC  F "C5'" 1 
ATOM   7592 C  "C4'" . DC  F 3 12  ? 25.217  -27.710 -27.082 1.00 54.69  ? 40  DC  F "C4'" 1 
ATOM   7593 O  "O4'" . DC  F 3 12  ? 25.932  -28.970 -27.085 1.00 55.65  ? 40  DC  F "O4'" 1 
ATOM   7594 C  "C3'" . DC  F 3 12  ? 26.106  -26.732 -26.314 1.00 54.49  ? 40  DC  F "C3'" 1 
ATOM   7595 O  "O3'" . DC  F 3 12  ? 25.739  -26.781 -24.936 1.00 53.57  ? 40  DC  F "O3'" 1 
ATOM   7596 C  "C2'" . DC  F 3 12  ? 27.492  -27.313 -26.510 1.00 55.74  ? 40  DC  F "C2'" 1 
ATOM   7597 C  "C1'" . DC  F 3 12  ? 27.185  -28.801 -26.432 1.00 56.04  ? 40  DC  F "C1'" 1 
ATOM   7598 N  N1    . DC  F 3 12  ? 28.151  -29.731 -27.042 1.00 57.53  ? 40  DC  F N1    1 
ATOM   7599 C  C2    . DC  F 3 12  ? 27.874  -31.102 -26.996 1.00 57.99  ? 40  DC  F C2    1 
ATOM   7600 O  O2    . DC  F 3 12  ? 26.814  -31.484 -26.478 1.00 57.13  ? 40  DC  F O2    1 
ATOM   7601 N  N3    . DC  F 3 12  ? 28.755  -31.973 -27.534 1.00 59.52  ? 40  DC  F N3    1 
ATOM   7602 C  C4    . DC  F 3 12  ? 29.874  -31.522 -28.103 1.00 60.60  ? 40  DC  F C4    1 
ATOM   7603 N  N4    . DC  F 3 12  ? 30.710  -32.418 -28.630 1.00 62.28  ? 40  DC  F N4    1 
ATOM   7604 C  C5    . DC  F 3 12  ? 30.190  -30.134 -28.148 1.00 60.17  ? 40  DC  F C5    1 
ATOM   7605 C  C6    . DC  F 3 12  ? 29.312  -29.282 -27.607 1.00 58.63  ? 40  DC  F C6    1 
ATOM   7606 P  P     . DA  F 3 13  ? 25.442  -25.444 -24.123 1.00 52.67  ? 41  DA  F P     1 
ATOM   7607 O  OP1   . DA  F 3 13  ? 24.245  -24.799 -24.728 1.00 52.16  ? 41  DA  F OP1   1 
ATOM   7608 O  OP2   . DA  F 3 13  ? 26.710  -24.691 -24.009 1.00 53.23  ? 41  DA  F OP2   1 
ATOM   7609 O  "O5'" . DA  F 3 13  ? 25.016  -26.003 -22.690 1.00 51.99  ? 41  DA  F "O5'" 1 
ATOM   7610 C  "C5'" . DA  F 3 13  ? 23.785  -26.748 -22.539 1.00 51.55  ? 41  DA  F "C5'" 1 
ATOM   7611 C  "C4'" . DA  F 3 13  ? 23.996  -27.978 -21.685 1.00 51.74  ? 41  DA  F "C4'" 1 
ATOM   7612 O  "O4'" . DA  F 3 13  ? 24.943  -28.870 -22.323 1.00 52.75  ? 41  DA  F "O4'" 1 
ATOM   7613 C  "C3'" . DA  F 3 13  ? 24.546  -27.712 -20.284 1.00 51.45  ? 41  DA  F "C3'" 1 
ATOM   7614 O  "O3'" . DA  F 3 13  ? 23.869  -28.557 -19.338 1.00 51.22  ? 41  DA  F "O3'" 1 
ATOM   7615 C  "C2'" . DA  F 3 13  ? 26.026  -28.006 -20.437 1.00 52.31  ? 41  DA  F "C2'" 1 
ATOM   7616 C  "C1'" . DA  F 3 13  ? 26.023  -29.134 -21.449 1.00 53.08  ? 41  DA  F "C1'" 1 
ATOM   7617 N  N9    . DA  F 3 13  ? 27.236  -29.230 -22.253 1.00 54.15  ? 41  DA  F N9    1 
ATOM   7618 C  C8    . DA  F 3 13  ? 27.986  -28.209 -22.783 1.00 54.47  ? 41  DA  F C8    1 
ATOM   7619 N  N7    . DA  F 3 13  ? 29.034  -28.617 -23.456 1.00 55.70  ? 41  DA  F N7    1 
ATOM   7620 C  C5    . DA  F 3 13  ? 28.971  -29.999 -23.362 1.00 56.19  ? 41  DA  F C5    1 
ATOM   7621 C  C6    . DA  F 3 13  ? 29.794  -31.015 -23.867 1.00 57.60  ? 41  DA  F C6    1 
ATOM   7622 N  N6    . DA  F 3 13  ? 30.887  -30.783 -24.595 1.00 58.81  ? 41  DA  F N6    1 
ATOM   7623 N  N1    . DA  F 3 13  ? 29.452  -32.294 -23.597 1.00 57.89  ? 41  DA  F N1    1 
ATOM   7624 C  C2    . DA  F 3 13  ? 28.351  -32.524 -22.870 1.00 56.85  ? 41  DA  F C2    1 
ATOM   7625 N  N3    . DA  F 3 13  ? 27.493  -31.651 -22.344 1.00 55.53  ? 41  DA  F N3    1 
ATOM   7626 C  C4    . DA  F 3 13  ? 27.867  -30.391 -22.627 1.00 55.25  ? 41  DA  F C4    1 
ATOM   7627 P  P     . DT  F 3 14  ? 24.274  -28.558 -17.779 1.00 51.03  ? 42  DT  F P     1 
ATOM   7628 O  OP1   . DT  F 3 14  ? 23.080  -28.931 -16.992 1.00 50.65  ? 42  DT  F OP1   1 
ATOM   7629 O  OP2   . DT  F 3 14  ? 25.001  -27.299 -17.477 1.00 50.85  ? 42  DT  F OP2   1 
ATOM   7630 O  "O5'" . DT  F 3 14  ? 25.283  -29.782 -17.680 1.00 51.89  ? 42  DT  F "O5'" 1 
ATOM   7631 C  "C5'" . DT  F 3 14  ? 24.890  -31.094 -18.118 1.00 52.44  ? 42  DT  F "C5'" 1 
ATOM   7632 C  "C4'" . DT  F 3 14  ? 26.067  -32.035 -18.023 1.00 53.43  ? 42  DT  F "C4'" 1 
ATOM   7633 O  "O4'" . DT  F 3 14  ? 27.069  -31.661 -18.994 1.00 54.01  ? 42  DT  F "O4'" 1 
ATOM   7634 C  "C3'" . DT  F 3 14  ? 26.773  -32.051 -16.664 1.00 53.45  ? 42  DT  F "C3'" 1 
ATOM   7635 O  "O3'" . DT  F 3 14  ? 26.819  -33.391 -16.170 1.00 54.14  ? 42  DT  F "O3'" 1 
ATOM   7636 C  "C2'" . DT  F 3 14  ? 28.166  -31.519 -16.958 1.00 53.98  ? 42  DT  F "C2'" 1 
ATOM   7637 C  "C1'" . DT  F 3 14  ? 28.342  -31.863 -18.425 1.00 54.68  ? 42  DT  F "C1'" 1 
ATOM   7638 N  N1    . DT  F 3 14  ? 29.304  -31.041 -19.183 1.00 55.13  ? 42  DT  F N1    1 
ATOM   7639 C  C2    . DT  F 3 14  ? 30.264  -31.680 -19.936 1.00 56.44  ? 42  DT  F C2    1 
ATOM   7640 O  O2    . DT  F 3 14  ? 30.378  -32.893 -19.982 1.00 57.23  ? 42  DT  F O2    1 
ATOM   7641 N  N3    . DT  F 3 14  ? 31.099  -30.841 -20.629 1.00 56.96  ? 42  DT  F N3    1 
ATOM   7642 C  C4    . DT  F 3 14  ? 31.064  -29.460 -20.651 1.00 56.32  ? 42  DT  F C4    1 
ATOM   7643 O  O4    . DT  F 3 14  ? 31.891  -28.840 -21.312 1.00 57.08  ? 42  DT  F O4    1 
ATOM   7644 C  C5    . DT  F 3 14  ? 30.022  -28.856 -19.851 1.00 54.94  ? 42  DT  F C5    1 
ATOM   7645 C  C7    . DT  F 3 14  ? 29.907  -27.366 -19.813 1.00 54.34  ? 42  DT  F C7    1 
ATOM   7646 C  C6    . DT  F 3 14  ? 29.201  -29.667 -19.173 1.00 54.43  ? 42  DT  F C6    1 
ATOM   7647 P  P     . DA  F 3 15  ? 26.835  -33.663 -14.619 1.00 54.04  ? 43  DA  F P     1 
ATOM   7648 O  OP1   . DA  F 3 15  ? 25.934  -34.803 -14.339 1.00 54.37  ? 43  DA  F OP1   1 
ATOM   7649 O  OP2   . DA  F 3 15  ? 26.674  -32.369 -13.913 1.00 53.12  ? 43  DA  F OP2   1 
ATOM   7650 O  "O5'" . DA  F 3 15  ? 28.311  -34.170 -14.370 1.00 55.04  ? 43  DA  F "O5'" 1 
ATOM   7651 C  "C5'" . DA  F 3 15  ? 28.740  -35.428 -14.889 1.00 56.23  ? 43  DA  F "C5'" 1 
ATOM   7652 C  "C4'" . DA  F 3 15  ? 30.238  -35.509 -14.738 1.00 57.15  ? 43  DA  F "C4'" 1 
ATOM   7653 O  "O4'" . DA  F 3 15  ? 30.837  -34.543 -15.638 1.00 57.11  ? 43  DA  F "O4'" 1 
ATOM   7654 C  "C3'" . DA  F 3 15  ? 30.731  -35.149 -13.332 1.00 56.93  ? 43  DA  F "C3'" 1 
ATOM   7655 O  "O3'" . DA  F 3 15  ? 31.685  -36.095 -12.836 1.00 58.15  ? 43  DA  F "O3'" 1 
ATOM   7656 C  "C2'" . DA  F 3 15  ? 31.310  -33.758 -13.509 1.00 56.45  ? 43  DA  F "C2'" 1 
ATOM   7657 C  "C1'" . DA  F 3 15  ? 31.816  -33.813 -14.934 1.00 57.17  ? 43  DA  F "C1'" 1 
ATOM   7658 N  N9    . DA  F 3 15  ? 31.990  -32.520 -15.592 1.00 56.72  ? 43  DA  F N9    1 
ATOM   7659 C  C8    . DA  F 3 15  ? 31.398  -31.320 -15.283 1.00 55.57  ? 43  DA  F C8    1 
ATOM   7660 N  N7    . DA  F 3 15  ? 31.786  -30.328 -16.046 1.00 55.61  ? 43  DA  F N7    1 
ATOM   7661 C  C5    . DA  F 3 15  ? 32.701  -30.909 -16.908 1.00 56.88  ? 43  DA  F C5    1 
ATOM   7662 C  C6    . DA  F 3 15  ? 33.470  -30.385 -17.958 1.00 57.69  ? 43  DA  F C6    1 
ATOM   7663 N  N6    . DA  F 3 15  ? 33.429  -29.106 -18.336 1.00 57.28  ? 43  DA  F N6    1 
ATOM   7664 N  N1    . DA  F 3 15  ? 34.285  -31.233 -18.624 1.00 59.12  ? 43  DA  F N1    1 
ATOM   7665 C  C2    . DA  F 3 15  ? 34.317  -32.520 -18.248 1.00 59.67  ? 43  DA  F C2    1 
ATOM   7666 N  N3    . DA  F 3 15  ? 33.642  -33.129 -17.273 1.00 59.00  ? 43  DA  F N3    1 
ATOM   7667 C  C4    . DA  F 3 15  ? 32.843  -32.258 -16.635 1.00 57.58  ? 43  DA  F C4    1 
ATOM   7668 P  P     . DC  F 3 16  ? 32.133  -36.083 -11.299 1.00 58.19  ? 44  DC  F P     1 
ATOM   7669 O  OP1   . DC  F 3 16  ? 31.631  -37.331 -10.676 1.00 58.73  ? 44  DC  F OP1   1 
ATOM   7670 O  OP2   . DC  F 3 16  ? 31.820  -34.771 -10.673 1.00 57.01  ? 44  DC  F OP2   1 
ATOM   7671 O  "O5'" . DC  F 3 16  ? 33.698  -36.344 -11.378 1.00 59.55  ? 44  DC  F "O5'" 1 
ATOM   7672 C  "C5'" . DC  F 3 16  ? 34.654  -35.277 -11.457 1.00 59.59  ? 44  DC  F "C5'" 1 
ATOM   7673 C  "C4'" . DC  F 3 16  ? 35.454  -35.404 -12.731 1.00 60.66  ? 44  DC  F "C4'" 1 
ATOM   7674 O  "O4'" . DC  F 3 16  ? 34.799  -34.604 -13.729 1.00 59.80  ? 44  DC  F "O4'" 1 
ATOM   7675 C  "C3'" . DC  F 3 16  ? 36.867  -34.841 -12.650 1.00 61.61  ? 44  DC  F "C3'" 1 
ATOM   7676 O  "O3'" . DC  F 3 16  ? 37.806  -35.810 -12.177 1.00 63.09  ? 44  DC  F "O3'" 1 
ATOM   7677 C  "C2'" . DC  F 3 16  ? 37.142  -34.463 -14.090 1.00 62.08  ? 44  DC  F "C2'" 1 
ATOM   7678 C  "C1'" . DC  F 3 16  ? 35.775  -34.015 -14.587 1.00 60.59  ? 44  DC  F "C1'" 1 
ATOM   7679 N  N1    . DC  F 3 16  ? 35.571  -32.555 -14.588 1.00 59.55  ? 44  DC  F N1    1 
ATOM   7680 C  C2    . DC  F 3 16  ? 36.263  -31.781 -15.531 1.00 60.15  ? 44  DC  F C2    1 
ATOM   7681 O  O2    . DC  F 3 16  ? 37.038  -32.342 -16.321 1.00 61.55  ? 44  DC  F O2    1 
ATOM   7682 N  N3    . DC  F 3 16  ? 36.067  -30.444 -15.559 1.00 59.34  ? 44  DC  F N3    1 
ATOM   7683 C  C4    . DC  F 3 16  ? 35.218  -29.876 -14.699 1.00 58.00  ? 44  DC  F C4    1 
ATOM   7684 N  N4    . DC  F 3 16  ? 35.054  -28.555 -14.768 1.00 57.39  ? 44  DC  F N4    1 
ATOM   7685 C  C5    . DC  F 3 16  ? 34.503  -30.638 -13.729 1.00 57.39  ? 44  DC  F C5    1 
ATOM   7686 C  C6    . DC  F 3 16  ? 34.704  -31.962 -13.711 1.00 58.19  ? 44  DC  F C6    1 
ATOM   7687 P  P     . DT  F 3 17  ? 39.067  -35.355 -11.339 1.00 63.90  ? 45  DT  F P     1 
ATOM   7688 O  OP1   . DT  F 3 17  ? 39.771  -36.574 -10.906 1.00 65.42  ? 45  DT  F OP1   1 
ATOM   7689 O  OP2   . DT  F 3 17  ? 38.625  -34.359 -10.351 1.00 62.55  ? 45  DT  F OP2   1 
ATOM   7690 O  "O5'" . DT  F 3 17  ? 39.949  -34.563 -12.396 1.00 64.70  ? 45  DT  F "O5'" 1 
ATOM   7691 C  "C5'" . DT  F 3 17  ? 40.761  -35.259 -13.353 1.00 66.46  ? 45  DT  F "C5'" 1 
ATOM   7692 C  "C4'" . DT  F 3 17  ? 41.435  -34.281 -14.286 1.00 67.06  ? 45  DT  F "C4'" 1 
ATOM   7693 O  "O4'" . DT  F 3 17  ? 40.461  -33.373 -14.839 1.00 65.51  ? 45  DT  F "O4'" 1 
ATOM   7694 C  "C3'" . DT  F 3 17  ? 42.482  -33.383 -13.642 1.00 67.65  ? 45  DT  F "C3'" 1 
ATOM   7695 O  "O3'" . DT  F 3 17  ? 43.755  -34.041 -13.613 1.00 69.78  ? 45  DT  F "O3'" 1 
ATOM   7696 C  "C2'" . DT  F 3 17  ? 42.487  -32.172 -14.556 1.00 67.40  ? 45  DT  F "C2'" 1 
ATOM   7697 C  "C1'" . DT  F 3 17  ? 41.055  -32.096 -15.064 1.00 65.67  ? 45  DT  F "C1'" 1 
ATOM   7698 N  N1    . DT  F 3 17  ? 40.208  -31.069 -14.413 1.00 63.85  ? 45  DT  F N1    1 
ATOM   7699 C  C2    . DT  F 3 17  ? 40.262  -29.775 -14.885 1.00 63.58  ? 45  DT  F C2    1 
ATOM   7700 O  O2    . DT  F 3 17  ? 40.988  -29.427 -15.800 1.00 64.76  ? 45  DT  F O2    1 
ATOM   7701 N  N3    . DT  F 3 17  ? 39.426  -28.896 -14.243 1.00 62.01  ? 45  DT  F N3    1 
ATOM   7702 C  C4    . DT  F 3 17  ? 38.555  -29.178 -13.207 1.00 60.76  ? 45  DT  F C4    1 
ATOM   7703 O  O4    . DT  F 3 17  ? 37.869  -28.283 -12.725 1.00 59.60  ? 45  DT  F O4    1 
ATOM   7704 C  C5    . DT  F 3 17  ? 38.545  -30.554 -12.767 1.00 61.14  ? 45  DT  F C5    1 
ATOM   7705 C  C7    . DT  F 3 17  ? 37.640  -30.952 -11.645 1.00 60.05  ? 45  DT  F C7    1 
ATOM   7706 C  C6    . DT  F 3 17  ? 39.364  -31.417 -13.381 1.00 62.63  ? 45  DT  F C6    1 
ATOM   7707 P  P     . DT  F 3 18  ? 44.895  -33.555 -12.603 1.00 70.72  ? 46  DT  F P     1 
ATOM   7708 O  OP1   . DT  F 3 18  ? 46.013  -34.520 -12.685 1.00 73.00  ? 46  DT  F OP1   1 
ATOM   7709 O  OP2   . DT  F 3 18  ? 44.273  -33.252 -11.285 1.00 69.15  ? 46  DT  F OP2   1 
ATOM   7710 O  "O5'" . DT  F 3 18  ? 45.384  -32.192 -13.252 1.00 71.02  ? 46  DT  F "O5'" 1 
ATOM   7711 C  "C5'" . DT  F 3 18  ? 46.062  -32.186 -14.514 1.00 72.66  ? 46  DT  F "C5'" 1 
ATOM   7712 C  "C4'" . DT  F 3 18  ? 46.420  -30.763 -14.869 1.00 72.76  ? 46  DT  F "C4'" 1 
ATOM   7713 O  "O4'" . DT  F 3 18  ? 45.220  -29.951 -14.822 1.00 70.53  ? 46  DT  F "O4'" 1 
ATOM   7714 C  "C3'" . DT  F 3 18  ? 47.417  -30.105 -13.907 1.00 73.65  ? 46  DT  F "C3'" 1 
ATOM   7715 O  "O3'" . DT  F 3 18  ? 48.353  -29.318 -14.656 1.00 75.34  ? 46  DT  F "O3'" 1 
ATOM   7716 C  "C2'" . DT  F 3 18  ? 46.522  -29.293 -12.990 1.00 71.50  ? 46  DT  F "C2'" 1 
ATOM   7717 C  "C1'" . DT  F 3 18  ? 45.431  -28.855 -13.949 1.00 70.08  ? 46  DT  F "C1'" 1 
ATOM   7718 N  N1    . DT  F 3 18  ? 44.148  -28.528 -13.308 1.00 67.79  ? 46  DT  F N1    1 
ATOM   7719 C  C2    . DT  F 3 18  ? 43.614  -27.277 -13.519 1.00 66.79  ? 46  DT  F C2    1 
ATOM   7720 O  O2    . DT  F 3 18  ? 44.147  -26.429 -14.221 1.00 67.68  ? 46  DT  F O2    1 
ATOM   7721 N  N3    . DT  F 3 18  ? 42.425  -27.050 -12.871 1.00 64.85  ? 46  DT  F N3    1 
ATOM   7722 C  C4    . DT  F 3 18  ? 41.736  -27.926 -12.055 1.00 63.88  ? 46  DT  F C4    1 
ATOM   7723 O  O4    . DT  F 3 18  ? 40.682  -27.574 -11.537 1.00 62.33  ? 46  DT  F O4    1 
ATOM   7724 C  C5    . DT  F 3 18  ? 42.351  -29.221 -11.881 1.00 65.00  ? 46  DT  F C5    1 
ATOM   7725 C  C7    . DT  F 3 18  ? 41.682  -30.236 -11.008 1.00 64.24  ? 46  DT  F C7    1 
ATOM   7726 C  C6    . DT  F 3 18  ? 43.516  -29.450 -12.500 1.00 66.87  ? 46  DT  F C6    1 
ATOM   7727 P  P     . DG  F 3 19  ? 49.380  -28.347 -13.924 1.00 76.46  ? 47  DG  F P     1 
ATOM   7728 O  OP1   . DG  F 3 19  ? 50.571  -28.192 -14.799 1.00 79.06  ? 47  DG  F OP1   1 
ATOM   7729 O  OP2   . DG  F 3 19  ? 49.546  -28.824 -12.532 1.00 76.19  ? 47  DG  F OP2   1 
ATOM   7730 O  "O5'" . DG  F 3 19  ? 48.602  -26.962 -13.915 1.00 74.78  ? 47  DG  F "O5'" 1 
ATOM   7731 C  "C5'" . DG  F 3 19  ? 48.274  -26.281 -15.141 1.00 74.72  ? 47  DG  F "C5'" 1 
ATOM   7732 C  "C4'" . DG  F 3 19  ? 48.001  -24.822 -14.860 1.00 73.93  ? 47  DG  F "C4'" 1 
ATOM   7733 O  "O4'" . DG  F 3 19  ? 46.689  -24.675 -14.255 1.00 71.43  ? 47  DG  F "O4'" 1 
ATOM   7734 C  "C3'" . DG  F 3 19  ? 48.988  -24.169 -13.888 1.00 75.12  ? 47  DG  F "C3'" 1 
ATOM   7735 O  "O3'" . DG  F 3 19  ? 49.259  -22.829 -14.322 1.00 75.81  ? 47  DG  F "O3'" 1 
ATOM   7736 C  "C2'" . DG  F 3 19  ? 48.253  -24.244 -12.562 1.00 73.25  ? 47  DG  F "C2'" 1 
ATOM   7737 C  "C1'" . DG  F 3 19  ? 46.826  -23.998 -13.011 1.00 71.07  ? 47  DG  F "C1'" 1 
ATOM   7738 N  N9    . DG  F 3 19  ? 45.788  -24.489 -12.112 1.00 69.11  ? 47  DG  F N9    1 
ATOM   7739 C  C8    . DG  F 3 19  ? 45.755  -25.693 -11.451 1.00 68.92  ? 47  DG  F C8    1 
ATOM   7740 N  N7    . DG  F 3 19  ? 44.691  -25.842 -10.711 1.00 67.13  ? 47  DG  F N7    1 
ATOM   7741 C  C5    . DG  F 3 19  ? 43.977  -24.666 -10.895 1.00 66.06  ? 47  DG  F C5    1 
ATOM   7742 C  C6    . DG  F 3 19  ? 42.735  -24.250 -10.350 1.00 64.20  ? 47  DG  F C6    1 
ATOM   7743 O  O6    . DG  F 3 19  ? 41.994  -24.859 -9.570  1.00 63.11  ? 47  DG  F O6    1 
ATOM   7744 N  N1    . DG  F 3 19  ? 42.377  -22.983 -10.801 1.00 63.83  ? 47  DG  F N1    1 
ATOM   7745 C  C2    . DG  F 3 19  ? 43.122  -22.209 -11.657 1.00 65.10  ? 47  DG  F C2    1 
ATOM   7746 N  N2    . DG  F 3 19  ? 42.606  -21.015 -11.980 1.00 64.60  ? 47  DG  F N2    1 
ATOM   7747 N  N3    . DG  F 3 19  ? 44.273  -22.593 -12.185 1.00 66.86  ? 47  DG  F N3    1 
ATOM   7748 C  C4    . DG  F 3 19  ? 44.642  -23.820 -11.757 1.00 67.24  ? 47  DG  F C4    1 
ATOM   7749 P  P     . DT  F 3 20  ? 50.111  -21.828 -13.406 1.00 76.97  ? 48  DT  F P     1 
ATOM   7750 O  OP1   . DT  F 3 20  ? 50.697  -20.791 -14.300 1.00 78.63  ? 48  DT  F OP1   1 
ATOM   7751 O  OP2   . DT  F 3 20  ? 50.993  -22.638 -12.521 1.00 78.11  ? 48  DT  F OP2   1 
ATOM   7752 O  "O5'" . DT  F 3 20  ? 48.995  -21.132 -12.504 1.00 74.66  ? 48  DT  F "O5'" 1 
ATOM   7753 C  "C5'" . DT  F 3 20  ? 47.978  -20.307 -13.104 1.00 73.30  ? 48  DT  F "C5'" 1 
ATOM   7754 C  "C4'" . DT  F 3 20  ? 47.097  -19.708 -12.033 1.00 71.54  ? 48  DT  F "C4'" 1 
ATOM   7755 O  "O4'" . DT  F 3 20  ? 46.348  -20.748 -11.355 1.00 69.92  ? 48  DT  F "O4'" 1 
ATOM   7756 C  "C3'" . DT  F 3 20  ? 47.854  -18.953 -10.936 1.00 72.59  ? 48  DT  F "C3'" 1 
ATOM   7757 O  "O3'" . DT  F 3 20  ? 47.199  -17.711 -10.662 1.00 71.81  ? 48  DT  F "O3'" 1 
ATOM   7758 C  "C2'" . DT  F 3 20  ? 47.753  -19.876 -9.738  1.00 71.83  ? 48  DT  F "C2'" 1 
ATOM   7759 C  "C1'" . DT  F 3 20  ? 46.376  -20.460 -9.972  1.00 69.61  ? 48  DT  F "C1'" 1 
ATOM   7760 N  N1    . DT  F 3 20  ? 46.030  -21.693 -9.226  1.00 68.70  ? 48  DT  F N1    1 
ATOM   7761 C  C2    . DT  F 3 20  ? 44.798  -21.749 -8.605  1.00 66.76  ? 48  DT  F C2    1 
ATOM   7762 O  O2    . DT  F 3 20  ? 43.979  -20.845 -8.660  1.00 65.75  ? 48  DT  F O2    1 
ATOM   7763 N  N3    . DT  F 3 20  ? 44.556  -22.914 -7.916  1.00 66.19  ? 48  DT  F N3    1 
ATOM   7764 C  C4    . DT  F 3 20  ? 45.400  -24.002 -7.793  1.00 67.33  ? 48  DT  F C4    1 
ATOM   7765 O  O4    . DT  F 3 20  ? 45.043  -24.981 -7.145  1.00 66.74  ? 48  DT  F O4    1 
ATOM   7766 C  C5    . DT  F 3 20  ? 46.675  -23.876 -8.469  1.00 69.36  ? 48  DT  F C5    1 
ATOM   7767 C  C7    . DT  F 3 20  ? 47.658  -25.000 -8.384  1.00 70.89  ? 48  DT  F C7    1 
ATOM   7768 C  C6    . DT  F 3 20  ? 46.923  -22.742 -9.139  1.00 69.95  ? 48  DT  F C6    1 
ATOM   7769 P  P     . DA  F 3 21  ? 48.033  -16.455 -10.121 1.00 73.48  ? 49  DA  F P     1 
ATOM   7770 O  OP1   . DA  F 3 21  ? 48.398  -15.617 -11.288 1.00 74.81  ? 49  DA  F OP1   1 
ATOM   7771 O  OP2   . DA  F 3 21  ? 49.089  -16.953 -9.189  1.00 74.79  ? 49  DA  F OP2   1 
ATOM   7772 O  "O5'" . DA  F 3 21  ? 46.927  -15.630 -9.330  1.00 71.86  ? 49  DA  F "O5'" 1 
ATOM   7773 C  "C5'" . DA  F 3 21  ? 45.737  -15.166 -9.995  1.00 70.38  ? 49  DA  F "C5'" 1 
ATOM   7774 C  "C4'" . DA  F 3 21  ? 44.617  -15.049 -8.991  1.00 68.59  ? 49  DA  F "C4'" 1 
ATOM   7775 O  "O4'" . DA  F 3 21  ? 44.302  -16.361 -8.475  1.00 67.47  ? 49  DA  F "O4'" 1 
ATOM   7776 C  "C3'" . DA  F 3 21  ? 44.960  -14.186 -7.777  1.00 69.35  ? 49  DA  F "C3'" 1 
ATOM   7777 O  "O3'" . DA  F 3 21  ? 43.852  -13.370 -7.391  1.00 68.23  ? 49  DA  F "O3'" 1 
ATOM   7778 C  "C2'" . DA  F 3 21  ? 45.280  -15.198 -6.694  1.00 69.17  ? 49  DA  F "C2'" 1 
ATOM   7779 C  "C1'" . DA  F 3 21  ? 44.359  -16.344 -7.057  1.00 67.39  ? 49  DA  F "C1'" 1 
ATOM   7780 N  N9    . DA  F 3 21  ? 44.817  -17.656 -6.615  1.00 67.47  ? 49  DA  F N9    1 
ATOM   7781 C  C8    . DA  F 3 21  ? 46.006  -18.274 -6.911  1.00 68.99  ? 49  DA  F C8    1 
ATOM   7782 N  N7    . DA  F 3 21  ? 46.131  -19.464 -6.376  1.00 68.76  ? 49  DA  F N7    1 
ATOM   7783 C  C5    . DA  F 3 21  ? 44.936  -19.649 -5.695  1.00 66.95  ? 49  DA  F C5    1 
ATOM   7784 C  C6    . DA  F 3 21  ? 44.445  -20.713 -4.922  1.00 66.01  ? 49  DA  F C6    1 
ATOM   7785 N  N6    . DA  F 3 21  ? 45.124  -21.840 -4.700  1.00 66.72  ? 49  DA  F N6    1 
ATOM   7786 N  N1    . DA  F 3 21  ? 43.219  -20.575 -4.371  1.00 64.44  ? 49  DA  F N1    1 
ATOM   7787 C  C2    . DA  F 3 21  ? 42.539  -19.441 -4.592  1.00 63.87  ? 49  DA  F C2    1 
ATOM   7788 N  N3    . DA  F 3 21  ? 42.899  -18.368 -5.292  1.00 64.62  ? 49  DA  F N3    1 
ATOM   7789 C  C4    . DA  F 3 21  ? 44.122  -18.539 -5.825  1.00 66.17  ? 49  DA  F C4    1 
ATOM   7790 P  P     . DC  F 3 22  ? 44.088  -12.091 -6.472  1.00 69.29  ? 50  DC  F P     1 
ATOM   7791 O  OP1   . DC  F 3 22  ? 43.338  -10.961 -7.087  1.00 69.09  ? 50  DC  F OP1   1 
ATOM   7792 O  OP2   . DC  F 3 22  ? 45.546  -11.964 -6.213  1.00 71.40  ? 50  DC  F OP2   1 
ATOM   7793 O  "O5'" . DC  F 3 22  ? 43.466  -12.506 -5.065  1.00 68.18  ? 50  DC  F "O5'" 1 
ATOM   7794 C  "C5'" . DC  F 3 22  ? 42.463  -13.526 -4.943  1.00 66.28  ? 50  DC  F "C5'" 1 
ATOM   7795 C  "C4'" . DC  F 3 22  ? 42.397  -14.035 -3.523  1.00 66.00  ? 50  DC  F "C4'" 1 
ATOM   7796 O  "O4'" . DC  F 3 22  ? 42.954  -15.372 -3.483  1.00 65.97  ? 50  DC  F "O4'" 1 
ATOM   7797 C  "C3'" . DC  F 3 22  ? 43.187  -13.231 -2.483  1.00 67.54  ? 50  DC  F "C3'" 1 
ATOM   7798 O  "O3'" . DC  F 3 22  ? 42.534  -13.269 -1.209  1.00 66.93  ? 50  DC  F "O3'" 1 
ATOM   7799 C  "C2'" . DC  F 3 22  ? 44.473  -14.022 -2.370  1.00 68.71  ? 50  DC  F "C2'" 1 
ATOM   7800 C  "C1'" . DC  F 3 22  ? 43.887  -15.415 -2.422  1.00 67.20  ? 50  DC  F "C1'" 1 
ATOM   7801 N  N1    . DC  F 3 22  ? 44.784  -16.552 -2.649  1.00 67.80  ? 50  DC  F N1    1 
ATOM   7802 C  C2    . DC  F 3 22  ? 44.401  -17.798 -2.147  1.00 66.84  ? 50  DC  F C2    1 
ATOM   7803 O  O2    . DC  F 3 22  ? 43.330  -17.892 -1.536  1.00 65.53  ? 50  DC  F O2    1 
ATOM   7804 N  N3    . DC  F 3 22  ? 45.204  -18.865 -2.337  1.00 67.51  ? 50  DC  F N3    1 
ATOM   7805 C  C4    . DC  F 3 22  ? 46.353  -18.723 -2.998  1.00 69.11  ? 50  DC  F C4    1 
ATOM   7806 N  N4    . DC  F 3 22  ? 47.110  -19.808 -3.170  1.00 69.88  ? 50  DC  F N4    1 
ATOM   7807 C  C5    . DC  F 3 22  ? 46.768  -17.466 -3.527  1.00 70.15  ? 50  DC  F C5    1 
ATOM   7808 C  C6    . DC  F 3 22  ? 45.961  -16.416 -3.330  1.00 69.44  ? 50  DC  F C6    1 
ATOM   7809 P  P     . DA  F 3 23  ? 41.847  -11.964 -0.610  1.00 67.13  ? 51  DA  F P     1 
ATOM   7810 O  OP1   . DA  F 3 23  ? 40.822  -11.516 -1.570  1.00 66.11  ? 51  DA  F OP1   1 
ATOM   7811 O  OP2   . DA  F 3 23  ? 42.907  -11.023 -0.209  1.00 69.12  ? 51  DA  F OP2   1 
ATOM   7812 O  "O5'" . DA  F 3 23  ? 41.107  -12.530 0.678   1.00 66.26  ? 51  DA  F "O5'" 1 
ATOM   7813 C  "C5'" . DA  F 3 23  ? 39.980  -13.416 0.540   1.00 64.51  ? 51  DA  F "C5'" 1 
ATOM   7814 C  "C4'" . DA  F 3 23  ? 40.013  -14.496 1.596   1.00 64.23  ? 51  DA  F "C4'" 1 
ATOM   7815 O  "O4'" . DA  F 3 23  ? 41.025  -15.471 1.261   1.00 64.60  ? 51  DA  F "O4'" 1 
ATOM   7816 C  "C3'" . DA  F 3 23  ? 40.333  -14.014 3.013   1.00 65.32  ? 51  DA  F "C3'" 1 
ATOM   7817 O  "O3'" . DA  F 3 23  ? 39.409  -14.586 3.943   1.00 64.51  ? 51  DA  F "O3'" 1 
ATOM   7818 C  "C2'" . DA  F 3 23  ? 41.753  -14.493 3.246   1.00 66.53  ? 51  DA  F "C2'" 1 
ATOM   7819 C  "C1'" . DA  F 3 23  ? 41.821  -15.742 2.394   1.00 65.64  ? 51  DA  F "C1'" 1 
ATOM   7820 N  N9    . DA  F 3 23  ? 43.163  -16.067 1.923   1.00 66.80  ? 51  DA  F N9    1 
ATOM   7821 C  C8    . DA  F 3 23  ? 44.041  -15.261 1.240   1.00 68.07  ? 51  DA  F C8    1 
ATOM   7822 N  N7    . DA  F 3 23  ? 45.184  -15.840 0.962   1.00 69.13  ? 51  DA  F N7    1 
ATOM   7823 C  C5    . DA  F 3 23  ? 45.049  -17.115 1.497   1.00 68.47  ? 51  DA  F C5    1 
ATOM   7824 C  C6    . DA  F 3 23  ? 45.919  -18.221 1.541   1.00 69.15  ? 51  DA  F C6    1 
ATOM   7825 N  N6    . DA  F 3 23  ? 47.144  -18.223 1.011   1.00 70.70  ? 51  DA  F N6    1 
ATOM   7826 N  N1    . DA  F 3 23  ? 45.478  -19.343 2.149   1.00 68.32  ? 51  DA  F N1    1 
ATOM   7827 C  C2    . DA  F 3 23  ? 44.248  -19.342 2.683   1.00 66.95  ? 51  DA  F C2    1 
ATOM   7828 N  N3    . DA  F 3 23  ? 43.339  -18.367 2.705   1.00 66.24  ? 51  DA  F N3    1 
ATOM   7829 C  C4    . DA  F 3 23  ? 43.809  -17.267 2.091   1.00 67.05  ? 51  DA  F C4    1 
ATOM   7830 P  P     . DC  F 3 24  ? 39.295  -14.021 5.440   1.00 65.43  ? 52  DC  F P     1 
ATOM   7831 O  OP1   . DC  F 3 24  ? 37.894  -14.220 5.895   1.00 64.42  ? 52  DC  F OP1   1 
ATOM   7832 O  OP2   . DC  F 3 24  ? 39.919  -12.668 5.499   1.00 66.88  ? 52  DC  F OP2   1 
ATOM   7833 O  "O5'" . DC  F 3 24  ? 40.231  -15.013 6.257   1.00 66.06  ? 52  DC  F "O5'" 1 
ATOM   7834 C  "C5'" . DC  F 3 24  ? 40.144  -16.443 6.085   1.00 65.15  ? 52  DC  F "C5'" 1 
ATOM   7835 C  "C4'" . DC  F 3 24  ? 41.259  -17.128 6.841   1.00 66.21  ? 52  DC  F "C4'" 1 
ATOM   7836 O  "O4'" . DC  F 3 24  ? 42.423  -17.269 5.980   1.00 66.88  ? 52  DC  F "O4'" 1 
ATOM   7837 C  "C3'" . DC  F 3 24  ? 41.753  -16.392 8.096   1.00 67.66  ? 52  DC  F "C3'" 1 
ATOM   7838 O  "O3'" . DC  F 3 24  ? 41.957  -17.374 9.124   1.00 67.94  ? 52  DC  F "O3'" 1 
ATOM   7839 C  "C2'" . DC  F 3 24  ? 43.017  -15.719 7.595   1.00 68.99  ? 52  DC  F "C2'" 1 
ATOM   7840 C  "C1'" . DC  F 3 24  ? 43.547  -16.825 6.710   1.00 68.57  ? 52  DC  F "C1'" 1 
ATOM   7841 N  N1    . DC  F 3 24  ? 44.627  -16.482 5.769   1.00 69.54  ? 52  DC  F N1    1 
ATOM   7842 C  C2    . DC  F 3 24  ? 45.546  -17.479 5.433   1.00 70.04  ? 52  DC  F C2    1 
ATOM   7843 O  O2    . DC  F 3 24  ? 45.379  -18.626 5.879   1.00 69.53  ? 52  DC  F O2    1 
ATOM   7844 N  N3    . DC  F 3 24  ? 46.582  -17.176 4.618   1.00 71.20  ? 52  DC  F N3    1 
ATOM   7845 C  C4    . DC  F 3 24  ? 46.732  -15.929 4.164   1.00 71.86  ? 52  DC  F C4    1 
ATOM   7846 N  N4    . DC  F 3 24  ? 47.767  -15.676 3.364   1.00 73.17  ? 52  DC  F N4    1 
ATOM   7847 C  C5    . DC  F 3 24  ? 45.820  -14.889 4.506   1.00 71.37  ? 52  DC  F C5    1 
ATOM   7848 C  C6    . DC  F 3 24  ? 44.799  -15.203 5.313   1.00 70.24  ? 52  DC  F C6    1 
ATOM   7849 P  P     . DC  F 3 25  ? 42.668  -17.032 10.542  1.00 69.59  ? 53  DC  F P     1 
ATOM   7850 O  OP1   . DC  F 3 25  ? 41.739  -17.438 11.612  1.00 69.24  ? 53  DC  F OP1   1 
ATOM   7851 O  OP2   . DC  F 3 25  ? 43.193  -15.642 10.526  1.00 70.81  ? 53  DC  F OP2   1 
ATOM   7852 O  "O5'" . DC  F 3 25  ? 43.870  -18.074 10.573  1.00 70.31  ? 53  DC  F "O5'" 1 
ATOM   7853 C  "C5'" . DC  F 3 25  ? 43.649  -19.458 10.224  1.00 69.35  ? 53  DC  F "C5'" 1 
ATOM   7854 C  "C4'" . DC  F 3 25  ? 44.939  -20.236 10.336  1.00 70.49  ? 53  DC  F "C4'" 1 
ATOM   7855 O  "O4'" . DC  F 3 25  ? 45.832  -19.836 9.272   1.00 71.07  ? 53  DC  F "O4'" 1 
ATOM   7856 C  "C3'" . DC  F 3 25  ? 45.695  -20.013 11.645  1.00 72.11  ? 53  DC  F "C3'" 1 
ATOM   7857 O  "O3'" . DC  F 3 25  ? 46.138  -21.239 12.225  1.00 72.56  ? 53  DC  F "O3'" 1 
ATOM   7858 C  "C2'" . DC  F 3 25  ? 46.868  -19.135 11.253  1.00 73.53  ? 53  DC  F "C2'" 1 
ATOM   7859 C  "C1'" . DC  F 3 25  ? 47.093  -19.461 9.790   1.00 72.93  ? 53  DC  F "C1'" 1 
ATOM   7860 N  N1    . DC  F 3 25  ? 47.585  -18.322 8.997   1.00 73.61  ? 53  DC  F N1    1 
ATOM   7861 C  C2    . DC  F 3 25  ? 48.752  -18.474 8.242   1.00 74.75  ? 53  DC  F C2    1 
ATOM   7862 O  O2    . DC  F 3 25  ? 49.338  -19.567 8.253   1.00 75.14  ? 53  DC  F O2    1 
ATOM   7863 N  N3    . DC  F 3 25  ? 49.211  -17.427 7.516   1.00 75.56  ? 53  DC  F N3    1 
ATOM   7864 C  C4    . DC  F 3 25  ? 48.556  -16.263 7.537   1.00 75.24  ? 53  DC  F C4    1 
ATOM   7865 N  N4    . DC  F 3 25  ? 49.042  -15.257 6.809   1.00 76.20  ? 53  DC  F N4    1 
ATOM   7866 C  C5    . DC  F 3 25  ? 47.369  -16.080 8.305   1.00 74.10  ? 53  DC  F C5    1 
ATOM   7867 C  C6    . DC  F 3 25  ? 46.921  -17.127 9.009   1.00 73.33  ? 53  DC  F C6    1 
ATOM   7868 P  P     . DT  F 3 26  ? 46.494  -21.303 13.777  1.00 73.87  ? 54  DT  F P     1 
ATOM   7869 O  OP1   . DT  F 3 26  ? 46.305  -22.705 14.222  1.00 73.62  ? 54  DT  F OP1   1 
ATOM   7870 O  OP2   . DT  F 3 26  ? 45.804  -20.188 14.473  1.00 73.93  ? 54  DT  F OP2   1 
ATOM   7871 O  "O5'" . DT  F 3 26  ? 48.034  -20.909 13.818  1.00 75.77  ? 54  DT  F "O5'" 1 
ATOM   7872 C  "C5'" . DT  F 3 26  ? 49.047  -21.739 13.228  1.00 76.43  ? 54  DT  F "C5'" 1 
ATOM   7873 C  "C4'" . DT  F 3 26  ? 50.376  -21.020 13.254  1.00 78.36  ? 54  DT  F "C4'" 1 
ATOM   7874 O  "O4'" . DT  F 3 26  ? 50.513  -20.186 12.087  1.00 78.21  ? 54  DT  F "O4'" 1 
ATOM   7875 C  "C3'" . DT  F 3 26  ? 50.573  -20.067 14.424  1.00 79.60  ? 54  DT  F "C3'" 1 
ATOM   7876 O  "O3'" . DT  F 3 26  ? 50.929  -20.852 15.569  1.00 80.49  ? 54  DT  F "O3'" 1 
ATOM   7877 C  "C2'" . DT  F 3 26  ? 51.643  -19.127 13.895  1.00 81.12  ? 54  DT  F "C2'" 1 
ATOM   7878 C  "C1'" . DT  F 3 26  ? 51.476  -19.180 12.361  1.00 80.06  ? 54  DT  F "C1'" 1 
ATOM   7879 N  N1    . DT  F 3 26  ? 51.028  -17.928 11.700  1.00 79.64  ? 54  DT  F N1    1 
ATOM   7880 C  C2    . DT  F 3 26  ? 51.680  -17.501 10.559  1.00 80.25  ? 54  DT  F C2    1 
ATOM   7881 O  O2    . DT  F 3 26  ? 52.608  -18.106 10.054  1.00 81.16  ? 54  DT  F O2    1 
ATOM   7882 N  N3    . DT  F 3 26  ? 51.204  -16.325 10.033  1.00 79.93  ? 54  DT  F N3    1 
ATOM   7883 C  C4    . DT  F 3 26  ? 50.158  -15.560 10.512  1.00 79.09  ? 54  DT  F C4    1 
ATOM   7884 O  O4    . DT  F 3 26  ? 49.844  -14.526 9.930   1.00 79.02  ? 54  DT  F O4    1 
ATOM   7885 C  C5    . DT  F 3 26  ? 49.512  -16.073 11.703  1.00 78.51  ? 54  DT  F C5    1 
ATOM   7886 C  C7    . DT  F 3 26  ? 48.357  -15.321 12.287  1.00 77.78  ? 54  DT  F C7    1 
ATOM   7887 C  C6    . DT  F 3 26  ? 49.972  -17.217 12.227  1.00 78.79  ? 54  DT  F C6    1 
ATOM   7888 P  P     . DG  F 3 27  ? 50.933  -20.229 17.036  1.00 81.66  ? 55  DG  F P     1 
ATOM   7889 O  OP1   . DG  F 3 27  ? 51.099  -21.342 17.991  1.00 82.16  ? 55  DG  F OP1   1 
ATOM   7890 O  OP2   . DG  F 3 27  ? 49.792  -19.301 17.174  1.00 80.67  ? 55  DG  F OP2   1 
ATOM   7891 O  "O5'" . DG  F 3 27  ? 52.240  -19.330 17.024  1.00 83.75  ? 55  DG  F "O5'" 1 
ATOM   7892 C  "C5'" . DG  F 3 27  ? 53.538  -19.931 17.105  1.00 85.39  ? 55  DG  F "C5'" 1 
ATOM   7893 C  "C4'" . DG  F 3 27  ? 54.604  -18.872 16.960  1.00 87.33  ? 55  DG  F "C4'" 1 
ATOM   7894 O  "O4'" . DG  F 3 27  ? 54.476  -18.233 15.675  1.00 86.67  ? 55  DG  F "O4'" 1 
ATOM   7895 C  "C3'" . DG  F 3 27  ? 54.563  -17.724 17.963  1.00 88.46  ? 55  DG  F "C3'" 1 
ATOM   7896 O  "O3'" . DG  F 3 27  ? 55.156  -18.038 19.234  1.00 90.05  ? 55  DG  F "O3'" 1 
ATOM   7897 C  "C2'" . DG  F 3 27  ? 55.311  -16.640 17.215  1.00 89.72  ? 55  DG  F "C2'" 1 
ATOM   7898 C  "C1'" . DG  F 3 27  ? 54.872  -16.867 15.779  1.00 88.05  ? 55  DG  F "C1'" 1 
ATOM   7899 N  N9    . DG  F 3 27  ? 53.739  -16.056 15.355  1.00 86.53  ? 55  DG  F N9    1 
ATOM   7900 C  C8    . DG  F 3 27  ? 52.549  -15.868 16.016  1.00 85.30  ? 55  DG  F C8    1 
ATOM   7901 N  N7    . DG  F 3 27  ? 51.703  -15.133 15.348  1.00 84.15  ? 55  DG  F N7    1 
ATOM   7902 C  C5    . DG  F 3 27  ? 52.371  -14.826 14.172  1.00 84.59  ? 55  DG  F C5    1 
ATOM   7903 C  C6    . DG  F 3 27  ? 51.963  -14.046 13.062  1.00 83.90  ? 55  DG  F C6    1 
ATOM   7904 O  O6    . DG  F 3 27  ? 50.896  -13.451 12.889  1.00 82.71  ? 55  DG  F O6    1 
ATOM   7905 N  N1    . DG  F 3 27  ? 52.949  -13.997 12.082  1.00 84.90  ? 55  DG  F N1    1 
ATOM   7906 C  C2    . DG  F 3 27  ? 54.175  -14.612 12.164  1.00 86.44  ? 55  DG  F C2    1 
ATOM   7907 N  N2    . DG  F 3 27  ? 54.992  -14.449 11.119  1.00 87.42  ? 55  DG  F N2    1 
ATOM   7908 N  N3    . DG  F 3 27  ? 54.567  -15.341 13.194  1.00 87.09  ? 55  DG  F N3    1 
ATOM   7909 C  C4    . DG  F 3 27  ? 53.623  -15.402 14.156  1.00 86.07  ? 55  DG  F C4    1 
ATOM   7910 P  P     . DA  F 3 28  ? 54.243  -18.639 20.403  1.00 89.25  ? 56  DA  F P     1 
ATOM   7911 O  OP1   . DA  F 3 28  ? 54.885  -19.836 20.929  1.00 90.04  ? 56  DA  F OP1   1 
ATOM   7912 O  OP2   . DA  F 3 28  ? 52.858  -18.733 19.920  1.00 86.91  ? 56  DA  F OP2   1 
ATOM   7913 O  "O5'" . DA  F 3 28  ? 54.333  -17.572 21.562  1.00 90.83  ? 56  DA  F "O5'" 1 
ATOM   7914 C  "C5'" . DA  F 3 28  ? 53.700  -16.304 21.469  1.00 90.60  ? 56  DA  F "C5'" 1 
ATOM   7915 C  "C4'" . DA  F 3 28  ? 54.692  -15.301 20.929  1.00 92.22  ? 56  DA  F "C4'" 1 
ATOM   7916 O  "O4'" . DA  F 3 28  ? 54.308  -14.875 19.623  1.00 90.95  ? 56  DA  F "O4'" 1 
ATOM   7917 C  "C3'" . DA  F 3 28  ? 54.818  -14.009 21.719  1.00 93.95  ? 56  DA  F "C3'" 1 
ATOM   7918 O  "O3'" . DA  F 3 28  ? 55.806  -14.215 22.721  1.00 96.08  ? 56  DA  F "O3'" 1 
ATOM   7919 C  "C2'" . DA  F 3 28  ? 55.319  -13.016 20.687  1.00 94.64  ? 56  DA  F "C2'" 1 
ATOM   7920 C  "C1'" . DA  F 3 28  ? 54.971  -13.664 19.348  1.00 92.61  ? 56  DA  F "C1'" 1 
ATOM   7921 N  N9    . DA  F 3 28  ? 54.075  -12.861 18.527  1.00 91.30  ? 56  DA  F N9    1 
ATOM   7922 C  C8    . DA  F 3 28  ? 52.906  -12.251 18.913  1.00 90.39  ? 56  DA  F C8    1 
ATOM   7923 N  N7    . DA  F 3 28  ? 52.313  -11.591 17.950  1.00 89.40  ? 56  DA  F N7    1 
ATOM   7924 C  C5    . DA  F 3 28  ? 53.135  -11.796 16.850  1.00 89.62  ? 56  DA  F C5    1 
ATOM   7925 C  C6    . DA  F 3 28  ? 53.059  -11.357 15.517  1.00 89.01  ? 56  DA  F C6    1 
ATOM   7926 N  N6    . DA  F 3 28  ? 52.071  -10.591 15.047  1.00 87.94  ? 56  DA  F N6    1 
ATOM   7927 N  N1    . DA  F 3 28  ? 54.044  -11.736 14.672  1.00 89.67  ? 56  DA  F N1    1 
ATOM   7928 C  C2    . DA  F 3 28  ? 55.033  -12.507 15.144  1.00 90.87  ? 56  DA  F C2    1 
ATOM   7929 N  N3    . DA  F 3 28  ? 55.213  -12.983 16.375  1.00 91.51  ? 56  DA  F N3    1 
ATOM   7930 C  C4    . DA  F 3 28  ? 54.219  -12.585 17.189  1.00 90.81  ? 56  DA  F C4    1 
ATOM   7931 P  P     . DT  F 3 29  ? 55.807  -13.335 24.054  1.00 100.15 ? 0   DT  F P     1 
ATOM   7932 O  OP1   . DT  F 3 29  ? 54.863  -12.197 23.879  1.00 100.33 ? 0   DT  F OP1   1 
ATOM   7933 O  OP2   . DT  F 3 29  ? 57.216  -13.072 24.439  1.00 99.70  ? 0   DT  F OP2   1 
ATOM   7934 O  "O5'" . DT  F 3 29  ? 55.295  -14.385 25.137  1.00 99.48  ? 0   DT  F "O5'" 1 
ATOM   7935 C  "C5'" . DT  F 3 29  ? 54.017  -14.300 25.775  1.00 99.12  ? 0   DT  F "C5'" 1 
ATOM   7936 C  "C4'" . DT  F 3 29  ? 54.142  -13.586 27.093  1.00 98.12  ? 0   DT  F "C4'" 1 
ATOM   7937 O  "O4'" . DT  F 3 29  ? 54.305  -12.162 26.883  1.00 98.19  ? 0   DT  F "O4'" 1 
ATOM   7938 C  "C3'" . DT  F 3 29  ? 52.904  -13.762 27.964  1.00 97.77  ? 0   DT  F "C3'" 1 
ATOM   7939 O  "O3'" . DT  F 3 29  ? 53.182  -14.666 29.033  1.00 97.21  ? 0   DT  F "O3'" 1 
ATOM   7940 C  "C2'" . DT  F 3 29  ? 52.610  -12.357 28.446  1.00 97.55  ? 0   DT  F "C2'" 1 
ATOM   7941 C  "C1'" . DT  F 3 29  ? 53.142  -11.489 27.327  1.00 98.15  ? 0   DT  F "C1'" 1 
ATOM   7942 P  P     . DA  F 3 30  ? 52.877  -16.233 28.917  1.00 97.56  ? 1   DA  F P     1 
ATOM   7943 O  OP1   . DA  F 3 30  ? 53.700  -16.789 27.829  1.00 98.27  ? 1   DA  F OP1   1 
ATOM   7944 O  OP2   . DA  F 3 30  ? 51.412  -16.424 28.898  1.00 97.82  ? 1   DA  F OP2   1 
ATOM   7945 O  "O5'" . DA  F 3 30  ? 53.472  -16.772 30.290  1.00 96.93  ? 1   DA  F "O5'" 1 
ATOM   7946 C  "C5'" . DA  F 3 30  ? 52.719  -16.637 31.510  1.00 96.46  ? 1   DA  F "C5'" 1 
ATOM   7947 C  "C4'" . DA  F 3 30  ? 52.887  -17.874 32.357  1.00 96.45  ? 1   DA  F "C4'" 1 
ATOM   7948 O  "O4'" . DA  F 3 30  ? 54.297  -18.105 32.548  1.00 96.42  ? 1   DA  F "O4'" 1 
ATOM   7949 C  "C3'" . DA  F 3 30  ? 52.295  -17.767 33.755  1.00 96.08  ? 1   DA  F "C3'" 1 
ATOM   7950 O  "O3'" . DA  F 3 30  ? 51.973  -19.062 34.241  1.00 96.35  ? 1   DA  F "O3'" 1 
ATOM   7951 C  "C2'" . DA  F 3 30  ? 53.442  -17.207 34.561  1.00 95.77  ? 1   DA  F "C2'" 1 
ATOM   7952 C  "C1'" . DA  F 3 30  ? 54.652  -17.841 33.893  1.00 96.03  ? 1   DA  F "C1'" 1 
ATOM   7953 N  N9    . DA  F 3 30  ? 55.848  -17.003 33.891  1.00 95.89  ? 1   DA  F N9    1 
ATOM   7954 C  C8    . DA  F 3 30  ? 55.932  -15.634 33.833  1.00 95.67  ? 1   DA  F C8    1 
ATOM   7955 N  N7    . DA  F 3 30  ? 57.159  -15.177 33.888  1.00 95.70  ? 1   DA  F N7    1 
ATOM   7956 C  C5    . DA  F 3 30  ? 57.936  -16.321 34.001  1.00 95.95  ? 1   DA  F C5    1 
ATOM   7957 C  C6    . DA  F 3 30  ? 59.327  -16.518 34.103  1.00 96.21  ? 1   DA  F C6    1 
ATOM   7958 N  N6    . DA  F 3 30  ? 60.219  -15.524 34.108  1.00 96.20  ? 1   DA  F N6    1 
ATOM   7959 N  N1    . DA  F 3 30  ? 59.776  -17.790 34.196  1.00 96.64  ? 1   DA  F N1    1 
ATOM   7960 C  C2    . DA  F 3 30  ? 58.882  -18.788 34.186  1.00 96.79  ? 1   DA  F C2    1 
ATOM   7961 N  N3    . DA  F 3 30  ? 57.555  -18.729 34.094  1.00 96.55  ? 1   DA  F N3    1 
ATOM   7962 C  C4    . DA  F 3 30  ? 57.140  -17.453 34.006  1.00 96.10  ? 1   DA  F C4    1 
ATOM   7963 P  P     . DG  F 3 31  ? 50.497  -19.594 34.120  1.00 96.66  ? 2   DG  F P     1 
ATOM   7964 O  OP1   . DG  F 3 31  ? 50.512  -21.042 34.444  1.00 97.13  ? 2   DG  F OP1   1 
ATOM   7965 O  OP2   . DG  F 3 31  ? 49.932  -19.113 32.838  1.00 96.94  ? 2   DG  F OP2   1 
ATOM   7966 O  "O5'" . DG  F 3 31  ? 49.725  -18.788 35.253  1.00 96.28  ? 2   DG  F "O5'" 1 
ATOM   7967 C  "C5'" . DG  F 3 31  ? 50.101  -18.932 36.633  1.00 96.14  ? 2   DG  F "C5'" 1 
ATOM   7968 C  "C4'" . DG  F 3 31  ? 49.086  -18.251 37.519  1.00 96.10  ? 2   DG  F "C4'" 1 
ATOM   7969 O  "O4'" . DG  F 3 31  ? 47.850  -19.000 37.491  1.00 96.42  ? 2   DG  F "O4'" 1 
ATOM   7970 C  "C3'" . DG  F 3 31  ? 49.473  -18.193 38.989  1.00 96.17  ? 2   DG  F "C3'" 1 
ATOM   7971 O  "O3'" . DG  F 3 31  ? 48.743  -17.124 39.599  1.00 96.26  ? 2   DG  F "O3'" 1 
ATOM   7972 C  "C2'" . DG  F 3 31  ? 48.987  -19.539 39.483  1.00 96.53  ? 2   DG  F "C2'" 1 
ATOM   7973 C  "C1'" . DG  F 3 31  ? 47.670  -19.669 38.734  1.00 96.63  ? 2   DG  F "C1'" 1 
ATOM   7974 N  N9    . DG  F 3 31  ? 47.230  -21.029 38.446  1.00 97.06  ? 2   DG  F N9    1 
ATOM   7975 C  C8    . DG  F 3 31  ? 47.996  -22.092 38.031  1.00 97.35  ? 2   DG  F C8    1 
ATOM   7976 N  N7    . DG  F 3 31  ? 47.300  -23.180 37.842  1.00 97.94  ? 2   DG  F N7    1 
ATOM   7977 C  C5    . DG  F 3 31  ? 45.996  -22.809 38.138  1.00 97.95  ? 2   DG  F C5    1 
ATOM   7978 C  C6    . DG  F 3 31  ? 44.799  -23.568 38.120  1.00 98.54  ? 2   DG  F C6    1 
ATOM   7979 O  O6    . DG  F 3 31  ? 44.645  -24.757 37.821  1.00 99.23  ? 2   DG  F O6    1 
ATOM   7980 N  N1    . DG  F 3 31  ? 43.701  -22.800 38.494  1.00 98.43  ? 2   DG  F N1    1 
ATOM   7981 C  C2    . DG  F 3 31  ? 43.750  -21.472 38.845  1.00 97.94  ? 2   DG  F C2    1 
ATOM   7982 N  N2    . DG  F 3 31  ? 42.587  -20.904 39.183  1.00 98.13  ? 2   DG  F N2    1 
ATOM   7983 N  N3    . DG  F 3 31  ? 44.859  -20.755 38.864  1.00 97.45  ? 2   DG  F N3    1 
ATOM   7984 C  C4    . DG  F 3 31  ? 45.936  -21.481 38.500  1.00 97.43  ? 2   DG  F C4    1 
ATOM   7985 P  P     . DC  F 3 32  ? 49.289  -16.355 40.902  1.00 96.54  ? 3   DC  F P     1 
ATOM   7986 O  OP1   . DC  F 3 32  ? 49.306  -14.907 40.583  1.00 96.55  ? 3   DC  F OP1   1 
ATOM   7987 O  OP2   . DC  F 3 32  ? 50.531  -17.037 41.415  1.00 96.62  ? 3   DC  F OP2   1 
ATOM   7988 O  "O5'" . DC  F 3 32  ? 48.108  -16.563 41.951  1.00 97.03  ? 3   DC  F "O5'" 1 
ATOM   7989 C  "C5'" . DC  F 3 32  ? 48.050  -17.725 42.801  1.00 97.37  ? 3   DC  F "C5'" 1 
ATOM   7990 C  "C4'" . DC  F 3 32  ? 46.623  -18.203 42.920  1.00 97.61  ? 3   DC  F "C4'" 1 
ATOM   7991 O  "O4'" . DC  F 3 32  ? 46.362  -19.282 41.990  1.00 97.40  ? 3   DC  F "O4'" 1 
ATOM   7992 C  "C3'" . DC  F 3 32  ? 46.269  -18.767 44.292  1.00 98.31  ? 3   DC  F "C3'" 1 
ATOM   7993 O  "O3'" . DC  F 3 32  ? 46.016  -17.692 45.204  1.00 98.85  ? 3   DC  F "O3'" 1 
ATOM   7994 C  "C2'" . DC  F 3 32  ? 45.071  -19.653 43.987  1.00 98.43  ? 3   DC  F "C2'" 1 
ATOM   7995 C  "C1'" . DC  F 3 32  ? 45.366  -20.123 42.561  1.00 97.88  ? 3   DC  F "C1'" 1 
ATOM   7996 N  N1    . DC  F 3 32  ? 45.553  -21.526 42.125  1.00 98.02  ? 3   DC  F N1    1 
ATOM   7997 C  C2    . DC  F 3 32  ? 44.498  -22.425 42.312  1.00 98.53  ? 3   DC  F C2    1 
ATOM   7998 O  O2    . DC  F 3 32  ? 43.443  -22.012 42.811  1.00 98.76  ? 3   DC  F O2    1 
ATOM   7999 N  N3    . DC  F 3 32  ? 44.646  -23.711 41.919  1.00 98.89  ? 3   DC  F N3    1 
ATOM   8000 C  C4    . DC  F 3 32  ? 45.794  -24.113 41.368  1.00 98.79  ? 3   DC  F C4    1 
ATOM   8001 N  N4    . DC  F 3 32  ? 45.898  -25.391 41.001  1.00 99.39  ? 3   DC  F N4    1 
ATOM   8002 C  C5    . DC  F 3 32  ? 46.889  -23.221 41.175  1.00 98.22  ? 3   DC  F C5    1 
ATOM   8003 C  C6    . DC  F 3 32  ? 46.726  -21.948 41.561  1.00 97.84  ? 3   DC  F C6    1 
ATOM   8004 P  P     . DA  F 3 33  ? 46.316  -17.869 46.758  1.00 99.81  ? 4   DA  F P     1 
ATOM   8005 O  OP1   . DA  F 3 33  ? 46.246  -16.529 47.391  1.00 100.44 ? 4   DA  F OP1   1 
ATOM   8006 O  OP2   . DA  F 3 33  ? 47.526  -18.712 46.914  1.00 99.78  ? 4   DA  F OP2   1 
ATOM   8007 O  "O5'" . DA  F 3 33  ? 45.079  -18.732 47.245  1.00 100.28 ? 4   DA  F "O5'" 1 
ATOM   8008 C  "C5'" . DA  F 3 33  ? 43.733  -18.299 47.010  1.00 100.38 ? 4   DA  F "C5'" 1 
ATOM   8009 C  "C4'" . DA  F 3 33  ? 42.801  -19.410 47.423  1.00 100.83 ? 4   DA  F "C4'" 1 
ATOM   8010 O  "O4'" . DA  F 3 33  ? 43.022  -20.553 46.566  1.00 100.28 ? 4   DA  F "O4'" 1 
ATOM   8011 C  "C3'" . DA  F 3 33  ? 43.049  -19.908 48.845  1.00 101.83 ? 4   DA  F "C3'" 1 
ATOM   8012 O  "O3'" . DA  F 3 33  ? 41.839  -20.324 49.470  1.00 102.59 ? 4   DA  F "O3'" 1 
ATOM   8013 C  "C2'" . DA  F 3 33  ? 43.934  -21.119 48.642  1.00 101.59 ? 4   DA  F "C2'" 1 
ATOM   8014 C  "C1'" . DA  F 3 33  ? 43.361  -21.676 47.360  1.00 100.86 ? 4   DA  F "C1'" 1 
ATOM   8015 N  N9    . DA  F 3 33  ? 44.264  -22.510 46.581  1.00 100.40 ? 4   DA  F N9    1 
ATOM   8016 C  C8    . DA  F 3 33  ? 45.588  -22.309 46.285  1.00 100.01 ? 4   DA  F C8    1 
ATOM   8017 N  N7    . DA  F 3 33  ? 46.108  -23.246 45.532  1.00 99.84  ? 4   DA  F N7    1 
ATOM   8018 C  C5    . DA  F 3 33  ? 45.056  -24.126 45.322  1.00 100.16 ? 4   DA  F C5    1 
ATOM   8019 C  C6    . DA  F 3 33  ? 44.960  -25.332 44.611  1.00 100.40 ? 4   DA  F C6    1 
ATOM   8020 N  N6    . DA  F 3 33  ? 45.974  -25.877 43.942  1.00 100.35 ? 4   DA  F N6    1 
ATOM   8021 N  N1    . DA  F 3 33  ? 43.766  -25.963 44.599  1.00 100.88 ? 4   DA  F N1    1 
ATOM   8022 C  C2    . DA  F 3 33  ? 42.745  -25.410 45.264  1.00 101.03 ? 4   DA  F C2    1 
ATOM   8023 N  N3    . DA  F 3 33  ? 42.713  -24.283 45.970  1.00 100.88 ? 4   DA  F N3    1 
ATOM   8024 C  C4    . DA  F 3 33  ? 43.913  -23.681 45.957  1.00 100.46 ? 4   DA  F C4    1 
ATOM   8025 P  P     . DG  F 3 34  ? 41.723  -20.267 51.036  1.00 103.99 ? 5   DG  F P     1 
ATOM   8026 O  OP1   . DG  F 3 34  ? 40.377  -19.731 51.362  1.00 104.65 ? 5   DG  F OP1   1 
ATOM   8027 O  OP2   . DG  F 3 34  ? 42.928  -19.589 51.554  1.00 104.30 ? 5   DG  F OP2   1 
ATOM   8028 O  "O5'" . DG  F 3 34  ? 41.919  -21.784 51.465  1.00 104.41 ? 5   DG  F "O5'" 1 
ATOM   8029 C  "C5'" . DG  F 3 34  ? 40.860  -22.529 52.076  1.00 105.27 ? 5   DG  F "C5'" 1 
ATOM   8030 C  "C4'" . DG  F 3 34  ? 40.421  -23.600 51.107  1.00 104.64 ? 5   DG  F "C4'" 1 
ATOM   8031 O  "O4'" . DG  F 3 34  ? 41.431  -23.712 50.096  1.00 103.61 ? 5   DG  F "O4'" 1 
ATOM   8032 C  "C3'" . DG  F 3 34  ? 40.342  -25.001 51.691  1.00 105.52 ? 5   DG  F "C3'" 1 
ATOM   8033 O  "O3'" . DG  F 3 34  ? 39.091  -25.206 52.348  1.00 106.44 ? 5   DG  F "O3'" 1 
ATOM   8034 C  "C2'" . DG  F 3 34  ? 40.547  -25.883 50.474  1.00 104.76 ? 5   DG  F "C2'" 1 
ATOM   8035 C  "C1'" . DG  F 3 34  ? 41.296  -24.987 49.497  1.00 103.55 ? 5   DG  F "C1'" 1 
ATOM   8036 N  N9    . DG  F 3 34  ? 42.619  -25.432 49.079  1.00 103.20 ? 5   DG  F N9    1 
ATOM   8037 C  C8    . DG  F 3 34  ? 43.800  -24.734 49.164  1.00 102.85 ? 5   DG  F C8    1 
ATOM   8038 N  N7    . DG  F 3 34  ? 44.809  -25.371 48.634  1.00 102.64 ? 5   DG  F N7    1 
ATOM   8039 C  C5    . DG  F 3 34  ? 44.255  -26.548 48.150  1.00 102.91 ? 5   DG  F C5    1 
ATOM   8040 C  C6    . DG  F 3 34  ? 44.861  -27.639 47.473  1.00 103.07 ? 5   DG  F C6    1 
ATOM   8041 O  O6    . DG  F 3 34  ? 46.048  -27.789 47.159  1.00 102.96 ? 5   DG  F O6    1 
ATOM   8042 N  N1    . DG  F 3 34  ? 43.935  -28.631 47.168  1.00 103.61 ? 5   DG  F N1    1 
ATOM   8043 C  C2    . DG  F 3 34  ? 42.597  -28.581 47.475  1.00 103.86 ? 5   DG  F C2    1 
ATOM   8044 N  N2    . DG  F 3 34  ? 41.864  -29.636 47.093  1.00 104.50 ? 5   DG  F N2    1 
ATOM   8045 N  N3    . DG  F 3 34  ? 42.020  -27.570 48.104  1.00 103.68 ? 5   DG  F N3    1 
ATOM   8046 C  C4    . DG  F 3 34  ? 42.903  -26.597 48.411  1.00 103.23 ? 5   DG  F C4    1 
ATOM   8047 P  P     . DT  F 3 35  ? 39.049  -26.068 53.674  1.00 107.98 ? 6   DT  F P     1 
ATOM   8048 O  OP1   . DT  F 3 35  ? 37.658  -26.054 54.185  1.00 108.82 ? 6   DT  F OP1   1 
ATOM   8049 O  OP2   . DT  F 3 35  ? 40.160  -25.611 54.544  1.00 108.56 ? 6   DT  F OP2   1 
ATOM   8050 O  "O5'" . DT  F 3 35  ? 39.344  -27.530 53.128  1.00 107.95 ? 6   DT  F "O5'" 1 
ATOM   8051 C  "C5'" . DT  F 3 35  ? 38.424  -28.144 52.217  1.00 107.60 ? 6   DT  F "C5'" 1 
ATOM   8052 C  "C4'" . DT  F 3 35  ? 38.962  -29.483 51.778  1.00 107.85 ? 6   DT  F "C4'" 1 
ATOM   8053 O  "O4'" . DT  F 3 35  ? 40.204  -29.306 51.055  1.00 106.97 ? 6   DT  F "O4'" 1 
ATOM   8054 C  "C3'" . DT  F 3 35  ? 39.281  -30.438 52.927  1.00 109.36 ? 6   DT  F "C3'" 1 
ATOM   8055 O  "O3'" . DT  F 3 35  ? 38.782  -31.731 52.589  1.00 110.05 ? 6   DT  F "O3'" 1 
ATOM   8056 C  "C2'" . DT  F 3 35  ? 40.797  -30.416 52.992  1.00 109.21 ? 6   DT  F "C2'" 1 
ATOM   8057 C  "C1'" . DT  F 3 35  ? 41.133  -30.262 51.529  1.00 107.83 ? 6   DT  F "C1'" 1 
ATOM   8058 N  N1    . DT  F 3 35  ? 42.491  -29.765 51.235  1.00 107.14 ? 6   DT  F N1    1 
ATOM   8059 C  C2    . DT  F 3 35  ? 43.360  -30.578 50.539  1.00 107.15 ? 6   DT  F C2    1 
ATOM   8060 O  O2    . DT  F 3 35  ? 43.068  -31.700 50.160  1.00 107.78 ? 6   DT  F O2    1 
ATOM   8061 N  N3    . DT  F 3 35  ? 44.596  -30.028 50.308  1.00 106.55 ? 6   DT  F N3    1 
ATOM   8062 C  C4    . DT  F 3 35  ? 45.039  -28.777 50.696  1.00 106.00 ? 6   DT  F C4    1 
ATOM   8063 O  O4    . DT  F 3 35  ? 46.183  -28.423 50.421  1.00 105.59 ? 6   DT  F O4    1 
ATOM   8064 C  C5    . DT  F 3 35  ? 44.074  -27.977 51.418  1.00 106.13 ? 6   DT  F C5    1 
ATOM   8065 C  C7    . DT  F 3 35  ? 44.463  -26.607 51.878  1.00 105.83 ? 6   DT  F C7    1 
ATOM   8066 C  C6    . DT  F 3 35  ? 42.866  -28.506 51.650  1.00 106.68 ? 6   DT  F C6    1 
ATOM   8067 P  P     . DG  F 3 36  ? 38.881  -32.931 53.630  1.00 111.85 ? 7   DG  F P     1 
ATOM   8068 O  OP1   . DG  F 3 36  ? 37.670  -33.777 53.448  1.00 112.59 ? 7   DG  F OP1   1 
ATOM   8069 O  OP2   . DG  F 3 36  ? 39.193  -32.358 54.971  1.00 112.62 ? 7   DG  F OP2   1 
ATOM   8070 O  "O5'" . DG  F 3 36  ? 40.185  -33.714 53.146  1.00 111.97 ? 7   DG  F "O5'" 1 
ATOM   8071 C  "C5'" . DG  F 3 36  ? 40.126  -34.816 52.214  1.00 112.26 ? 7   DG  F "C5'" 1 
ATOM   8072 C  "C4'" . DG  F 3 36  ? 41.356  -35.680 52.363  1.00 113.20 ? 7   DG  F "C4'" 1 
ATOM   8073 O  "O4'" . DG  F 3 36  ? 42.528  -34.900 52.028  1.00 112.12 ? 7   DG  F "O4'" 1 
ATOM   8074 C  "C3'" . DG  F 3 36  ? 41.594  -36.211 53.779  1.00 114.92 ? 7   DG  F "C3'" 1 
ATOM   8075 O  "O3'" . DG  F 3 36  ? 42.081  -37.557 53.754  1.00 116.44 ? 7   DG  F "O3'" 1 
ATOM   8076 C  "C2'" . DG  F 3 36  ? 42.647  -35.272 54.334  1.00 114.47 ? 7   DG  F "C2'" 1 
ATOM   8077 C  "C1'" . DG  F 3 36  ? 43.463  -34.968 53.093  1.00 113.09 ? 7   DG  F "C1'" 1 
ATOM   8078 N  N9    . DG  F 3 36  ? 44.224  -33.723 53.103  1.00 111.92 ? 7   DG  F N9    1 
ATOM   8079 C  C8    . DG  F 3 36  ? 43.943  -32.567 53.791  1.00 111.50 ? 7   DG  F C8    1 
ATOM   8080 N  N7    . DG  F 3 36  ? 44.818  -31.622 53.581  1.00 110.58 ? 7   DG  F N7    1 
ATOM   8081 C  C5    . DG  F 3 36  ? 45.727  -32.185 52.696  1.00 110.30 ? 7   DG  F C5    1 
ATOM   8082 C  C6    . DG  F 3 36  ? 46.899  -31.639 52.108  1.00 109.45 ? 7   DG  F C6    1 
ATOM   8083 O  O6    . DG  F 3 36  ? 47.369  -30.503 52.239  1.00 108.71 ? 7   DG  F O6    1 
ATOM   8084 N  N1    . DG  F 3 36  ? 47.527  -32.556 51.271  1.00 109.64 ? 7   DG  F N1    1 
ATOM   8085 C  C2    . DG  F 3 36  ? 47.085  -33.834 51.025  1.00 110.63 ? 7   DG  F C2    1 
ATOM   8086 N  N2    . DG  F 3 36  ? 47.829  -34.569 50.184  1.00 110.92 ? 7   DG  F N2    1 
ATOM   8087 N  N3    . DG  F 3 36  ? 45.995  -34.354 51.567  1.00 111.43 ? 7   DG  F N3    1 
ATOM   8088 C  C4    . DG  F 3 36  ? 45.371  -33.480 52.387  1.00 111.16 ? 7   DG  F C4    1 
ATOM   8089 O  "O5'" . DG  G 4 1   ? 73.265  -7.420  53.501  1.00 121.20 ? -10 DG  G "O5'" 1 
ATOM   8090 C  "C5'" . DG  G 4 1   ? 73.382  -8.649  54.237  1.00 121.90 ? -10 DG  G "C5'" 1 
ATOM   8091 C  "C4'" . DG  G 4 1   ? 72.324  -8.710  55.312  1.00 122.91 ? -10 DG  G "C4'" 1 
ATOM   8092 O  "O4'" . DG  G 4 1   ? 72.367  -7.508  56.108  1.00 125.18 ? -10 DG  G "O4'" 1 
ATOM   8093 C  "C3'" . DG  G 4 1   ? 70.894  -8.768  54.799  1.00 120.78 ? -10 DG  G "C3'" 1 
ATOM   8094 O  "O3'" . DG  G 4 1   ? 70.534  -10.092 54.416  1.00 119.15 ? -10 DG  G "O3'" 1 
ATOM   8095 C  "C2'" . DG  G 4 1   ? 70.117  -8.239  55.984  1.00 122.67 ? -10 DG  G "C2'" 1 
ATOM   8096 C  "C1'" . DG  G 4 1   ? 71.040  -7.131  56.472  1.00 125.06 ? -10 DG  G "C1'" 1 
ATOM   8097 N  N9    . DG  G 4 1   ? 70.765  -5.820  55.891  1.00 124.71 ? -10 DG  G N9    1 
ATOM   8098 C  C8    . DG  G 4 1   ? 71.557  -5.094  55.033  1.00 124.27 ? -10 DG  G C8    1 
ATOM   8099 N  N7    . DG  G 4 1   ? 71.034  -3.943  54.706  1.00 124.26 ? -10 DG  G N7    1 
ATOM   8100 C  C5    . DG  G 4 1   ? 69.826  -3.908  55.388  1.00 124.72 ? -10 DG  G C5    1 
ATOM   8101 C  C6    . DG  G 4 1   ? 68.818  -2.910  55.422  1.00 125.09 ? -10 DG  G C6    1 
ATOM   8102 O  O6    . DG  G 4 1   ? 68.789  -1.823  54.832  1.00 125.10 ? -10 DG  G O6    1 
ATOM   8103 N  N1    . DG  G 4 1   ? 67.756  -3.282  56.241  1.00 125.63 ? -10 DG  G N1    1 
ATOM   8104 C  C2    . DG  G 4 1   ? 67.673  -4.464  56.940  1.00 125.79 ? -10 DG  G C2    1 
ATOM   8105 N  N2    . DG  G 4 1   ? 66.564  -4.646  57.675  1.00 126.41 ? -10 DG  G N2    1 
ATOM   8106 N  N3    . DG  G 4 1   ? 68.607  -5.401  56.917  1.00 125.51 ? -10 DG  G N3    1 
ATOM   8107 C  C4    . DG  G 4 1   ? 69.647  -5.059  56.126  1.00 124.98 ? -10 DG  G C4    1 
ATOM   8108 P  P     . DG  G 4 2   ? 69.591  -10.305 53.152  1.00 116.22 ? -9  DG  G P     1 
ATOM   8109 O  OP1   . DG  G 4 2   ? 69.408  -11.762 52.954  1.00 115.21 ? -9  DG  G OP1   1 
ATOM   8110 O  OP2   . DG  G 4 2   ? 70.103  -9.467  52.036  1.00 115.21 ? -9  DG  G OP2   1 
ATOM   8111 O  "O5'" . DG  G 4 2   ? 68.208  -9.687  53.639  1.00 116.34 ? -9  DG  G "O5'" 1 
ATOM   8112 C  "C5'" . DG  G 4 2   ? 67.487  -10.295 54.719  1.00 117.36 ? -9  DG  G "C5'" 1 
ATOM   8113 C  "C4'" . DG  G 4 2   ? 66.235  -9.512  55.033  1.00 117.51 ? -9  DG  G "C4'" 1 
ATOM   8114 O  "O4'" . DG  G 4 2   ? 66.564  -8.273  55.707  1.00 119.67 ? -9  DG  G "O4'" 1 
ATOM   8115 C  "C3'" . DG  G 4 2   ? 65.396  -9.047  53.850  1.00 115.28 ? -9  DG  G "C3'" 1 
ATOM   8116 O  "O3'" . DG  G 4 2   ? 64.796  -10.072 53.034  1.00 113.08 ? -9  DG  G "O3'" 1 
ATOM   8117 C  "C2'" . DG  G 4 2   ? 64.526  -8.021  54.547  1.00 116.62 ? -9  DG  G "C2'" 1 
ATOM   8118 C  "C1'" . DG  G 4 2   ? 65.585  -7.291  55.350  1.00 119.13 ? -9  DG  G "C1'" 1 
ATOM   8119 N  N9    . DG  G 4 2   ? 66.231  -6.254  54.550  1.00 118.88 ? -9  DG  G N9    1 
ATOM   8120 C  C8    . DG  G 4 2   ? 67.426  -6.317  53.874  1.00 118.37 ? -9  DG  G C8    1 
ATOM   8121 N  N7    . DG  G 4 2   ? 67.697  -5.224  53.213  1.00 118.28 ? -9  DG  G N7    1 
ATOM   8122 C  C5    . DG  G 4 2   ? 66.604  -4.403  53.446  1.00 118.75 ? -9  DG  G C5    1 
ATOM   8123 C  C6    . DG  G 4 2   ? 66.332  -3.086  52.996  1.00 119.09 ? -9  DG  G C6    1 
ATOM   8124 O  O6    . DG  G 4 2   ? 67.024  -2.361  52.274  1.00 118.98 ? -9  DG  G O6    1 
ATOM   8125 N  N1    . DG  G 4 2   ? 65.106  -2.627  53.469  1.00 119.76 ? -9  DG  G N1    1 
ATOM   8126 C  C2    . DG  G 4 2   ? 64.254  -3.339  54.280  1.00 120.04 ? -9  DG  G C2    1 
ATOM   8127 N  N2    . DG  G 4 2   ? 63.114  -2.726  54.636  1.00 120.82 ? -9  DG  G N2    1 
ATOM   8128 N  N3    . DG  G 4 2   ? 64.499  -4.566  54.708  1.00 119.70 ? -9  DG  G N3    1 
ATOM   8129 C  C4    . DG  G 4 2   ? 65.684  -5.031  54.257  1.00 119.09 ? -9  DG  G C4    1 
ATOM   8130 P  P     . DC  G 4 3   ? 63.334  -10.639 53.341  1.00 112.50 ? -8  DC  G P     1 
ATOM   8131 O  OP1   . DC  G 4 3   ? 63.311  -11.062 54.776  1.00 114.58 ? -8  DC  G OP1   1 
ATOM   8132 O  OP2   . DC  G 4 3   ? 62.989  -11.605 52.269  1.00 110.29 ? -8  DC  G OP2   1 
ATOM   8133 O  "O5'" . DC  G 4 3   ? 62.383  -9.381  53.127  1.00 112.39 ? -8  DC  G "O5'" 1 
ATOM   8134 C  "C5'" . DC  G 4 3   ? 61.418  -9.020  54.134  1.00 113.79 ? -8  DC  G "C5'" 1 
ATOM   8135 C  "C4'" . DC  G 4 3   ? 60.818  -7.681  53.792  1.00 113.93 ? -8  DC  G "C4'" 1 
ATOM   8136 O  "O4'" . DC  G 4 3   ? 61.865  -6.731  53.509  1.00 114.61 ? -8  DC  G "O4'" 1 
ATOM   8137 C  "C3'" . DC  G 4 3   ? 59.950  -7.744  52.541  1.00 111.63 ? -8  DC  G "C3'" 1 
ATOM   8138 O  "O3'" . DC  G 4 3   ? 58.588  -7.562  52.903  1.00 111.89 ? -8  DC  G "O3'" 1 
ATOM   8139 C  "C2'" . DC  G 4 3   ? 60.446  -6.617  51.654  1.00 111.34 ? -8  DC  G "C2'" 1 
ATOM   8140 C  "C1'" . DC  G 4 3   ? 61.431  -5.845  52.500  1.00 113.58 ? -8  DC  G "C1'" 1 
ATOM   8141 N  N1    . DC  G 4 3   ? 62.607  -5.415  51.731  1.00 113.22 ? -8  DC  G N1    1 
ATOM   8142 C  C2    . DC  G 4 3   ? 62.726  -4.069  51.367  1.00 113.92 ? -8  DC  G C2    1 
ATOM   8143 O  O2    . DC  G 4 3   ? 61.852  -3.267  51.731  1.00 114.94 ? -8  DC  G O2    1 
ATOM   8144 N  N3    . DC  G 4 3   ? 63.802  -3.672  50.647  1.00 113.64 ? -8  DC  G N3    1 
ATOM   8145 C  C4    . DC  G 4 3   ? 64.721  -4.566  50.271  1.00 112.68 ? -8  DC  G C4    1 
ATOM   8146 N  N4    . DC  G 4 3   ? 65.763  -4.131  49.558  1.00 112.52 ? -8  DC  G N4    1 
ATOM   8147 C  C5    . DC  G 4 3   ? 64.612  -5.947  50.610  1.00 111.99 ? -8  DC  G C5    1 
ATOM   8148 C  C6    . DC  G 4 3   ? 63.545  -6.326  51.325  1.00 112.26 ? -8  DC  G C6    1 
ATOM   8149 P  P     . DC  G 4 4   ? 57.450  -7.831  51.828  1.00 109.82 ? -7  DC  G P     1 
ATOM   8150 O  OP1   . DC  G 4 4   ? 56.219  -8.213  52.566  1.00 110.32 ? -7  DC  G OP1   1 
ATOM   8151 O  OP2   . DC  G 4 4   ? 58.003  -8.731  50.779  1.00 107.89 ? -7  DC  G OP2   1 
ATOM   8152 O  "O5'" . DC  G 4 4   ? 57.218  -6.400  51.167  1.00 109.97 ? -7  DC  G "O5'" 1 
ATOM   8153 C  "C5'" . DC  G 4 4   ? 56.903  -5.243  51.970  1.00 112.08 ? -7  DC  G "C5'" 1 
ATOM   8154 C  "C4'" . DC  G 4 4   ? 56.984  -3.990  51.129  1.00 112.10 ? -7  DC  G "C4'" 1 
ATOM   8155 O  "O4'" . DC  G 4 4   ? 58.363  -3.713  50.805  1.00 112.17 ? -7  DC  G "O4'" 1 
ATOM   8156 C  "C3'" . DC  G 4 4   ? 56.237  -4.077  49.797  1.00 110.10 ? -7  DC  G "C3'" 1 
ATOM   8157 O  "O3'" . DC  G 4 4   ? 54.963  -3.440  49.990  1.00 110.89 ? -7  DC  G "O3'" 1 
ATOM   8158 C  "C2'" . DC  G 4 4   ? 57.236  -3.569  48.763  1.00 109.41 ? -7  DC  G "C2'" 1 
ATOM   8159 C  "C1'" . DC  G 4 4   ? 58.423  -3.053  49.560  1.00 111.15 ? -7  DC  G "C1'" 1 
ATOM   8160 N  N1    . DC  G 4 4   ? 59.728  -3.366  48.944  1.00 110.29 ? -7  DC  G N1    1 
ATOM   8161 C  C2    . DC  G 4 4   ? 60.525  -2.326  48.444  1.00 110.88 ? -7  DC  G C2    1 
ATOM   8162 O  O2    . DC  G 4 4   ? 60.123  -1.156  48.544  1.00 112.19 ? -7  DC  G O2    1 
ATOM   8163 N  N3    . DC  G 4 4   ? 61.712  -2.626  47.866  1.00 110.15 ? -7  DC  G N3    1 
ATOM   8164 C  C4    . DC  G 4 4   ? 62.109  -3.899  47.774  1.00 108.95 ? -7  DC  G C4    1 
ATOM   8165 N  N4    . DC  G 4 4   ? 63.287  -4.149  47.197  1.00 108.42 ? -7  DC  G N4    1 
ATOM   8166 C  C5    . DC  G 4 4   ? 61.316  -4.973  48.271  1.00 108.39 ? -7  DC  G C5    1 
ATOM   8167 C  C6    . DC  G 4 4   ? 60.143  -4.665  48.839  1.00 109.04 ? -7  DC  G C6    1 
ATOM   8168 P  P     . DC  G 4 5   ? 54.375  -2.368  48.951  1.00 110.70 ? -6  DC  G P     1 
ATOM   8169 O  OP1   . DC  G 4 5   ? 53.065  -1.915  49.486  1.00 111.91 ? -6  DC  G OP1   1 
ATOM   8170 O  OP2   . DC  G 4 5   ? 54.428  -2.969  47.585  1.00 108.42 ? -6  DC  G OP2   1 
ATOM   8171 O  "O5'" . DC  G 4 5   ? 55.398  -1.148  49.094  1.00 112.32 ? -6  DC  G "O5'" 1 
ATOM   8172 C  "C5'" . DC  G 4 5   ? 55.096  0.185   48.618  1.00 113.36 ? -6  DC  G "C5'" 1 
ATOM   8173 C  "C4'" . DC  G 4 5   ? 55.615  0.406   47.213  1.00 111.93 ? -6  DC  G "C4'" 1 
ATOM   8174 O  "O4'" . DC  G 4 5   ? 56.847  -0.317  46.978  1.00 110.79 ? -6  DC  G "O4'" 1 
ATOM   8175 C  "C3'" . DC  G 4 5   ? 54.656  -0.001  46.083  1.00 110.16 ? -6  DC  G "C3'" 1 
ATOM   8176 O  "O3'" . DC  G 4 5   ? 54.180  1.190   45.435  1.00 111.02 ? -6  DC  G "O3'" 1 
ATOM   8177 C  "C2'" . DC  G 4 5   ? 55.477  -0.959  45.226  1.00 108.11 ? -6  DC  G "C2'" 1 
ATOM   8178 C  "C1'" . DC  G 4 5   ? 56.901  -0.607  45.601  1.00 108.93 ? -6  DC  G "C1'" 1 
ATOM   8179 N  N1    . DC  G 4 5   ? 57.917  -1.653  45.384  1.00 107.61 ? -6  DC  G N1    1 
ATOM   8180 C  C2    . DC  G 4 5   ? 59.188  -1.267  44.946  1.00 107.72 ? -6  DC  G C2    1 
ATOM   8181 O  O2    . DC  G 4 5   ? 59.423  -0.062  44.772  1.00 108.91 ? -6  DC  G O2    1 
ATOM   8182 N  N3    . DC  G 4 5   ? 60.128  -2.216  44.727  1.00 106.67 ? -6  DC  G N3    1 
ATOM   8183 C  C4    . DC  G 4 5   ? 59.836  -3.504  44.928  1.00 105.60 ? -6  DC  G C4    1 
ATOM   8184 N  N4    . DC  G 4 5   ? 60.794  -4.405  44.702  1.00 104.80 ? -6  DC  G N4    1 
ATOM   8185 C  C5    . DC  G 4 5   ? 58.548  -3.925  45.368  1.00 105.44 ? -6  DC  G C5    1 
ATOM   8186 C  C6    . DC  G 4 5   ? 57.625  -2.977  45.574  1.00 106.42 ? -6  DC  G C6    1 
ATOM   8187 P  P     . DA  G 4 6   ? 53.564  1.159   43.944  1.00 109.59 ? -5  DA  G P     1 
ATOM   8188 O  OP1   . DA  G 4 6   ? 52.688  2.346   43.786  1.00 111.16 ? -5  DA  G OP1   1 
ATOM   8189 O  OP2   . DA  G 4 6   ? 53.017  -0.200  43.676  1.00 107.72 ? -5  DA  G OP2   1 
ATOM   8190 O  "O5'" . DA  G 4 6   ? 54.853  1.383   43.040  1.00 108.94 ? -5  DA  G "O5'" 1 
ATOM   8191 C  "C5'" . DA  G 4 6   ? 55.661  2.573   43.153  1.00 110.55 ? -5  DA  G "C5'" 1 
ATOM   8192 C  "C4'" . DA  G 4 6   ? 56.244  2.922   41.804  1.00 109.82 ? -5  DA  G "C4'" 1 
ATOM   8193 O  "O4'" . DA  G 4 6   ? 57.323  2.008   41.502  1.00 108.34 ? -5  DA  G "O4'" 1 
ATOM   8194 C  "C3'" . DA  G 4 6   ? 55.268  2.786   40.639  1.00 108.84 ? -5  DA  G "C3'" 1 
ATOM   8195 O  "O3'" . DA  G 4 6   ? 55.631  3.691   39.591  1.00 109.31 ? -5  DA  G "O3'" 1 
ATOM   8196 C  "C2'" . DA  G 4 6   ? 55.436  1.333   40.235  1.00 106.69 ? -5  DA  G "C2'" 1 
ATOM   8197 C  "C1'" . DA  G 4 6   ? 56.923  1.097   40.484  1.00 106.47 ? -5  DA  G "C1'" 1 
ATOM   8198 N  N9    . DA  G 4 6   ? 57.295  -0.249  40.916  1.00 105.23 ? -5  DA  G N9    1 
ATOM   8199 C  C8    . DA  G 4 6   ? 56.550  -1.200  41.571  1.00 104.68 ? -5  DA  G C8    1 
ATOM   8200 N  N7    . DA  G 4 6   ? 57.204  -2.311  41.809  1.00 103.74 ? -5  DA  G N7    1 
ATOM   8201 C  C5    . DA  G 4 6   ? 58.463  -2.076  41.277  1.00 103.65 ? -5  DA  G C5    1 
ATOM   8202 C  C6    . DA  G 4 6   ? 59.624  -2.864  41.212  1.00 102.99 ? -5  DA  G C6    1 
ATOM   8203 N  N6    . DA  G 4 6   ? 59.705  -4.103  41.703  1.00 102.31 ? -5  DA  G N6    1 
ATOM   8204 N  N1    . DA  G 4 6   ? 60.714  -2.330  40.616  1.00 103.20 ? -5  DA  G N1    1 
ATOM   8205 C  C2    . DA  G 4 6   ? 60.630  -1.086  40.122  1.00 104.02 ? -5  DA  G C2    1 
ATOM   8206 N  N3    . DA  G 4 6   ? 59.597  -0.248  40.125  1.00 104.78 ? -5  DA  G N3    1 
ATOM   8207 C  C4    . DA  G 4 6   ? 58.535  -0.808  40.729  1.00 104.53 ? -5  DA  G C4    1 
ATOM   8208 P  P     . DC  G 4 7   ? 54.687  3.869   38.311  1.00 108.94 ? -4  DC  G P     1 
ATOM   8209 O  OP1   . DC  G 4 7   ? 55.060  5.142   37.643  1.00 110.32 ? -4  DC  G OP1   1 
ATOM   8210 O  OP2   . DC  G 4 7   ? 53.288  3.656   38.751  1.00 109.16 ? -4  DC  G OP2   1 
ATOM   8211 O  "O5'" . DC  G 4 7   ? 55.081  2.621   37.400  1.00 106.76 ? -4  DC  G "O5'" 1 
ATOM   8212 C  "C5'" . DC  G 4 7   ? 55.551  2.756   36.042  1.00 106.30 ? -4  DC  G "C5'" 1 
ATOM   8213 C  "C4'" . DC  G 4 7   ? 57.034  2.474   35.959  1.00 105.73 ? -4  DC  G "C4'" 1 
ATOM   8214 O  "O4'" . DC  G 4 7   ? 57.450  1.622   37.043  1.00 105.12 ? -4  DC  G "O4'" 1 
ATOM   8215 C  "C3'" . DC  G 4 7   ? 57.478  1.741   34.701  1.00 104.43 ? -4  DC  G "C3'" 1 
ATOM   8216 O  "O3'" . DC  G 4 7   ? 57.755  2.682   33.666  1.00 105.25 ? -4  DC  G "O3'" 1 
ATOM   8217 C  "C2'" . DC  G 4 7   ? 58.750  1.043   35.143  1.00 103.71 ? -4  DC  G "C2'" 1 
ATOM   8218 C  "C1'" . DC  G 4 7   ? 58.575  0.850   36.645  1.00 104.04 ? -4  DC  G "C1'" 1 
ATOM   8219 N  N1    . DC  G 4 7   ? 58.352  -0.540  37.081  1.00 102.78 ? -4  DC  G N1    1 
ATOM   8220 C  C2    . DC  G 4 7   ? 59.380  -1.473  36.899  1.00 101.83 ? -4  DC  G C2    1 
ATOM   8221 O  O2    . DC  G 4 7   ? 60.433  -1.110  36.352  1.00 102.02 ? -4  DC  G O2    1 
ATOM   8222 N  N3    . DC  G 4 7   ? 59.198  -2.748  37.317  1.00 100.88 ? -4  DC  G N3    1 
ATOM   8223 C  C4    . DC  G 4 7   ? 58.052  -3.099  37.904  1.00 100.79 ? -4  DC  G C4    1 
ATOM   8224 N  N4    . DC  G 4 7   ? 57.917  -4.364  38.300  1.00 99.96  ? -4  DC  G N4    1 
ATOM   8225 C  C5    . DC  G 4 7   ? 56.992  -2.168  38.107  1.00 101.69 ? -4  DC  G C5    1 
ATOM   8226 C  C6    . DC  G 4 7   ? 57.184  -0.911  37.687  1.00 102.69 ? -4  DC  G C6    1 
ATOM   8227 P  P     . DT  G 4 8   ? 57.585  2.256   32.151  1.00 104.57 ? -3  DT  G P     1 
ATOM   8228 O  OP1   . DT  G 4 8   ? 58.121  3.359   31.311  1.00 105.72 ? -3  DT  G OP1   1 
ATOM   8229 O  OP2   . DT  G 4 8   ? 56.181  1.811   31.969  1.00 104.28 ? -3  DT  G OP2   1 
ATOM   8230 O  "O5'" . DT  G 4 8   ? 58.528  0.975   32.031  1.00 103.10 ? -3  DT  G "O5'" 1 
ATOM   8231 C  "C5'" . DT  G 4 8   ? 59.934  1.104   31.740  1.00 103.14 ? -3  DT  G "C5'" 1 
ATOM   8232 C  "C4'" . DT  G 4 8   ? 60.569  -0.246  31.496  1.00 101.85 ? -3  DT  G "C4'" 1 
ATOM   8233 O  "O4'" . DT  G 4 8   ? 60.612  -1.016  32.715  1.00 101.25 ? -3  DT  G "O4'" 1 
ATOM   8234 C  "C3'" . DT  G 4 8   ? 59.855  -1.152  30.503  1.00 101.11 ? -3  DT  G "C3'" 1 
ATOM   8235 O  "O3'" . DT  G 4 8   ? 60.216  -0.851  29.157  1.00 101.52 ? -3  DT  G "O3'" 1 
ATOM   8236 C  "C2'" . DT  G 4 8   ? 60.372  -2.519  30.898  1.00 100.03 ? -3  DT  G "C2'" 1 
ATOM   8237 C  "C1'" . DT  G 4 8   ? 60.537  -2.407  32.404  1.00 100.10 ? -3  DT  G "C1'" 1 
ATOM   8238 N  N1    . DT  G 4 8   ? 59.406  -2.988  33.156  1.00 99.69  ? -3  DT  G N1    1 
ATOM   8239 C  C2    . DT  G 4 8   ? 59.532  -4.273  33.642  1.00 98.84  ? -3  DT  G C2    1 
ATOM   8240 O  O2    . DT  G 4 8   ? 60.540  -4.947  33.496  1.00 98.48  ? -3  DT  G O2    1 
ATOM   8241 N  N3    . DT  G 4 8   ? 58.431  -4.739  34.319  1.00 98.59  ? -3  DT  G N3    1 
ATOM   8242 C  C4    . DT  G 4 8   ? 57.245  -4.067  34.545  1.00 99.08  ? -3  DT  G C4    1 
ATOM   8243 O  O4    . DT  G 4 8   ? 56.345  -4.613  35.176  1.00 98.84  ? -3  DT  G O4    1 
ATOM   8244 C  C5    . DT  G 4 8   ? 57.177  -2.730  33.996  1.00 100.02 ? -3  DT  G C5    1 
ATOM   8245 C  C7    . DT  G 4 8   ? 55.929  -1.927  34.186  1.00 100.82 ? -3  DT  G C7    1 
ATOM   8246 C  C6    . DT  G 4 8   ? 58.242  -2.269  33.330  1.00 100.26 ? -3  DT  G C6    1 
ATOM   8247 P  P     . DG  G 4 9   ? 59.484  -1.593  27.961  1.00 101.26 ? -2  DG  G P     1 
ATOM   8248 O  OP1   . DG  G 4 9   ? 59.980  -1.011  26.698  1.00 102.08 ? -2  DG  G OP1   1 
ATOM   8249 O  OP2   . DG  G 4 9   ? 58.033  -1.621  28.247  1.00 101.28 ? -2  DG  G OP2   1 
ATOM   8250 O  "O5'" . DG  G 4 9   ? 59.997  -3.089  28.084  1.00 100.17 ? -2  DG  G "O5'" 1 
ATOM   8251 C  "C5'" . DG  G 4 9   ? 61.286  -3.463  27.597  1.00 100.10 ? -2  DG  G "C5'" 1 
ATOM   8252 C  "C4'" . DG  G 4 9   ? 61.380  -4.967  27.558  1.00 99.33  ? -2  DG  G "C4'" 1 
ATOM   8253 O  "O4'" . DG  G 4 9   ? 60.861  -5.519  28.788  1.00 98.65  ? -2  DG  G "O4'" 1 
ATOM   8254 C  "C3'" . DG  G 4 9   ? 60.569  -5.618  26.446  1.00 99.48  ? -2  DG  G "C3'" 1 
ATOM   8255 O  "O3'" . DG  G 4 9   ? 61.295  -6.756  26.004  1.00 99.30  ? -2  DG  G "O3'" 1 
ATOM   8256 C  "C2'" . DG  G 4 9   ? 59.279  -6.008  27.141  1.00 99.01  ? -2  DG  G "C2'" 1 
ATOM   8257 C  "C1'" . DG  G 4 9   ? 59.780  -6.394  28.516  1.00 98.32  ? -2  DG  G "C1'" 1 
ATOM   8258 N  N9    . DG  G 4 9   ? 58.817  -6.250  29.600  1.00 98.06  ? -2  DG  G N9    1 
ATOM   8259 C  C8    . DG  G 4 9   ? 58.021  -5.161  29.864  1.00 98.56  ? -2  DG  G C8    1 
ATOM   8260 N  N7    . DG  G 4 9   ? 57.282  -5.314  30.929  1.00 98.31  ? -2  DG  G N7    1 
ATOM   8261 C  C5    . DG  G 4 9   ? 57.619  -6.574  31.403  1.00 97.58  ? -2  DG  G C5    1 
ATOM   8262 C  C6    . DG  G 4 9   ? 57.146  -7.287  32.536  1.00 97.15  ? -2  DG  G C6    1 
ATOM   8263 O  O6    . DG  G 4 9   ? 56.307  -6.936  33.371  1.00 97.31  ? -2  DG  G O6    1 
ATOM   8264 N  N1    . DG  G 4 9   ? 57.754  -8.533  32.648  1.00 96.65  ? -2  DG  G N1    1 
ATOM   8265 C  C2    . DG  G 4 9   ? 58.701  -9.028  31.788  1.00 96.62  ? -2  DG  G C2    1 
ATOM   8266 N  N2    . DG  G 4 9   ? 59.164  -10.255 32.062  1.00 96.32  ? -2  DG  G N2    1 
ATOM   8267 N  N3    . DG  G 4 9   ? 59.147  -8.376  30.725  1.00 97.01  ? -2  DG  G N3    1 
ATOM   8268 C  C4    . DG  G 4 9   ? 58.569  -7.163  30.597  1.00 97.45  ? -2  DG  G C4    1 
ATOM   8269 P  P     . DC  G 4 10  ? 60.826  -7.531  24.728  1.00 99.79  ? -1  DC  G P     1 
ATOM   8270 O  OP1   . DC  G 4 10  ? 62.025  -7.787  23.894  1.00 100.34 ? -1  DC  G OP1   1 
ATOM   8271 O  OP2   . DC  G 4 10  ? 59.666  -6.814  24.149  1.00 100.37 ? -1  DC  G OP2   1 
ATOM   8272 O  "O5'" . DC  G 4 10  ? 60.269  -8.886  25.338  1.00 99.13  ? -1  DC  G "O5'" 1 
ATOM   8273 C  "C5'" . DC  G 4 10  ? 60.978  -10.104 25.125  1.00 99.16  ? -1  DC  G "C5'" 1 
ATOM   8274 C  "C4'" . DC  G 4 10  ? 60.520  -11.144 26.114  1.00 98.48  ? -1  DC  G "C4'" 1 
ATOM   8275 O  "O4'" . DC  G 4 10  ? 60.031  -10.489 27.298  1.00 97.84  ? -1  DC  G "O4'" 1 
ATOM   8276 C  "C3'" . DC  G 4 10  ? 59.359  -11.987 25.615  1.00 98.75  ? -1  DC  G "C3'" 1 
ATOM   8277 O  "O3'" . DC  G 4 10  ? 59.862  -13.145 24.949  1.00 99.34  ? -1  DC  G "O3'" 1 
ATOM   8278 C  "C2'" . DC  G 4 10  ? 58.616  -12.353 26.886  1.00 97.96  ? -1  DC  G "C2'" 1 
ATOM   8279 C  "C1'" . DC  G 4 10  ? 59.015  -11.281 27.894  1.00 97.45  ? -1  DC  G "C1'" 1 
ATOM   8280 N  N1    . DC  G 4 10  ? 57.912  -10.387 28.287  1.00 97.33  ? -1  DC  G N1    1 
ATOM   8281 C  C2    . DC  G 4 10  ? 57.238  -10.642 29.485  1.00 96.82  ? -1  DC  G C2    1 
ATOM   8282 O  O2    . DC  G 4 10  ? 57.602  -11.597 30.187  1.00 96.47  ? -1  DC  G O2    1 
ATOM   8283 N  N3    . DC  G 4 10  ? 56.226  -9.827  29.862  1.00 96.88  ? -1  DC  G N3    1 
ATOM   8284 C  C4    . DC  G 4 10  ? 55.872  -8.801  29.086  1.00 97.44  ? -1  DC  G C4    1 
ATOM   8285 N  N4    . DC  G 4 10  ? 54.864  -8.028  29.494  1.00 97.66  ? -1  DC  G N4    1 
ATOM   8286 C  C5    . DC  G 4 10  ? 56.533  -8.525  27.853  1.00 97.97  ? -1  DC  G C5    1 
ATOM   8287 C  C6    . DC  G 4 10  ? 57.534  -9.340  27.492  1.00 97.88  ? -1  DC  G C6    1 
ATOM   8288 O  "O5'" . DG  H 4 1   ? 55.498  -23.879 67.801  1.00 133.92 ? -10 DG  H "O5'" 1 
ATOM   8289 C  "C5'" . DG  H 4 1   ? 54.139  -23.615 67.401  1.00 132.26 ? -10 DG  H "C5'" 1 
ATOM   8290 C  "C4'" . DG  H 4 1   ? 53.947  -23.932 65.937  1.00 128.93 ? -10 DG  H "C4'" 1 
ATOM   8291 O  "O4'" . DG  H 4 1   ? 54.088  -25.360 65.728  1.00 128.81 ? -10 DG  H "O4'" 1 
ATOM   8292 C  "C3'" . DG  H 4 1   ? 52.565  -23.554 65.381  1.00 127.09 ? -10 DG  H "C3'" 1 
ATOM   8293 O  "O3'" . DG  H 4 1   ? 52.645  -22.594 64.293  1.00 124.79 ? -10 DG  H "O3'" 1 
ATOM   8294 C  "C2'" . DG  H 4 1   ? 51.911  -24.903 65.121  1.00 126.48 ? -10 DG  H "C2'" 1 
ATOM   8295 C  "C1'" . DG  H 4 1   ? 53.129  -25.716 64.760  1.00 126.44 ? -10 DG  H "C1'" 1 
ATOM   8296 N  N9    . DG  H 4 1   ? 53.013  -27.166 64.711  1.00 126.75 ? -10 DG  H N9    1 
ATOM   8297 C  C8    . DG  H 4 1   ? 51.902  -27.931 64.973  1.00 127.08 ? -10 DG  H C8    1 
ATOM   8298 N  N7    . DG  H 4 1   ? 52.093  -29.203 64.750  1.00 127.31 ? -10 DG  H N7    1 
ATOM   8299 C  C5    . DG  H 4 1   ? 53.394  -29.276 64.271  1.00 127.02 ? -10 DG  H C5    1 
ATOM   8300 C  C6    . DG  H 4 1   ? 54.161  -30.397 63.859  1.00 127.29 ? -10 DG  H C6    1 
ATOM   8301 O  O6    . DG  H 4 1   ? 53.833  -31.589 63.841  1.00 127.88 ? -10 DG  H O6    1 
ATOM   8302 N  N1    . DG  H 4 1   ? 55.439  -30.022 63.452  1.00 126.98 ? -10 DG  H N1    1 
ATOM   8303 C  C2    . DG  H 4 1   ? 55.917  -28.734 63.437  1.00 126.47 ? -10 DG  H C2    1 
ATOM   8304 N  N2    . DG  H 4 1   ? 57.177  -28.571 63.004  1.00 126.30 ? -10 DG  H N2    1 
ATOM   8305 N  N3    . DG  H 4 1   ? 55.211  -27.681 63.818  1.00 126.29 ? -10 DG  H N3    1 
ATOM   8306 C  C4    . DG  H 4 1   ? 53.968  -28.024 64.223  1.00 126.60 ? -10 DG  H C4    1 
ATOM   8307 P  P     . DG  H 4 2   ? 52.913  -23.012 62.722  1.00 121.80 ? -9  DG  H P     1 
ATOM   8308 O  OP1   . DG  H 4 2   ? 53.070  -21.766 61.923  1.00 120.25 ? -9  DG  H OP1   1 
ATOM   8309 O  OP2   . DG  H 4 2   ? 51.874  -23.990 62.299  1.00 120.75 ? -9  DG  H OP2   1 
ATOM   8310 O  "O5'" . DG  H 4 2   ? 54.331  -23.743 62.774  1.00 122.59 ? -9  DG  H "O5'" 1 
ATOM   8311 C  "C5'" . DG  H 4 2   ? 55.590  -23.053 62.627  1.00 122.77 ? -9  DG  H "C5'" 1 
ATOM   8312 C  "C4'" . DG  H 4 2   ? 56.299  -23.559 61.394  1.00 120.86 ? -9  DG  H "C4'" 1 
ATOM   8313 O  "O4'" . DG  H 4 2   ? 56.260  -25.008 61.373  1.00 121.19 ? -9  DG  H "O4'" 1 
ATOM   8314 C  "C3'" . DG  H 4 2   ? 55.662  -23.116 60.076  1.00 118.09 ? -9  DG  H "C3'" 1 
ATOM   8315 O  "O3'" . DG  H 4 2   ? 56.674  -23.002 59.073  1.00 116.81 ? -9  DG  H "O3'" 1 
ATOM   8316 C  "C2'" . DG  H 4 2   ? 54.762  -24.284 59.739  1.00 117.39 ? -9  DG  H "C2'" 1 
ATOM   8317 C  "C1'" . DG  H 4 2   ? 55.658  -25.424 60.160  1.00 118.88 ? -9  DG  H "C1'" 1 
ATOM   8318 N  N9    . DG  H 4 2   ? 54.948  -26.672 60.395  1.00 119.44 ? -9  DG  H N9    1 
ATOM   8319 C  C8    . DG  H 4 2   ? 53.725  -26.839 60.997  1.00 119.99 ? -9  DG  H C8    1 
ATOM   8320 N  N7    . DG  H 4 2   ? 53.330  -28.083 61.016  1.00 120.43 ? -9  DG  H N7    1 
ATOM   8321 C  C5    . DG  H 4 2   ? 54.342  -28.773 60.365  1.00 120.17 ? -9  DG  H C5    1 
ATOM   8322 C  C6    . DG  H 4 2   ? 54.471  -30.153 60.077  1.00 120.64 ? -9  DG  H C6    1 
ATOM   8323 O  O6    . DG  H 4 2   ? 53.691  -31.071 60.351  1.00 121.36 ? -9  DG  H O6    1 
ATOM   8324 N  N1    . DG  H 4 2   ? 55.658  -30.427 59.402  1.00 120.37 ? -9  DG  H N1    1 
ATOM   8325 C  C2    . DG  H 4 2   ? 56.599  -29.490 59.047  1.00 119.66 ? -9  DG  H C2    1 
ATOM   8326 N  N2    . DG  H 4 2   ? 57.681  -29.948 58.398  1.00 119.60 ? -9  DG  H N2    1 
ATOM   8327 N  N3    . DG  H 4 2   ? 56.489  -28.199 59.311  1.00 119.20 ? -9  DG  H N3    1 
ATOM   8328 C  C4    . DG  H 4 2   ? 55.342  -27.913 59.965  1.00 119.51 ? -9  DG  H C4    1 
ATOM   8329 P  P     . DC  H 4 3   ? 56.305  -22.554 57.571  1.00 114.09 ? -8  DC  H P     1 
ATOM   8330 O  OP1   . DC  H 4 3   ? 57.309  -21.547 57.159  1.00 113.71 ? -8  DC  H OP1   1 
ATOM   8331 O  OP2   . DC  H 4 3   ? 54.852  -22.221 57.504  1.00 113.33 ? -8  DC  H OP2   1 
ATOM   8332 O  "O5'" . DC  H 4 3   ? 56.538  -23.882 56.720  1.00 113.24 ? -8  DC  H "O5'" 1 
ATOM   8333 C  "C5'" . DC  H 4 3   ? 57.841  -24.493 56.633  1.00 113.95 ? -8  DC  H "C5'" 1 
ATOM   8334 C  "C4'" . DC  H 4 3   ? 57.826  -25.617 55.624  1.00 112.97 ? -8  DC  H "C4'" 1 
ATOM   8335 O  "O4'" . DC  H 4 3   ? 57.027  -26.709 56.139  1.00 113.85 ? -8  DC  H "O4'" 1 
ATOM   8336 C  "C3'" . DC  H 4 3   ? 57.220  -25.268 54.262  1.00 110.69 ? -8  DC  H "C3'" 1 
ATOM   8337 O  "O3'" . DC  H 4 3   ? 57.923  -26.008 53.256  1.00 110.15 ? -8  DC  H "O3'" 1 
ATOM   8338 C  "C2'" . DC  H 4 3   ? 55.788  -25.746 54.402  1.00 110.46 ? -8  DC  H "C2'" 1 
ATOM   8339 C  "C1'" . DC  H 4 3   ? 55.985  -27.005 55.224  1.00 112.27 ? -8  DC  H "C1'" 1 
ATOM   8340 N  N1    . DC  H 4 3   ? 54.819  -27.476 55.995  1.00 113.05 ? -8  DC  H N1    1 
ATOM   8341 C  C2    . DC  H 4 3   ? 54.548  -28.850 56.024  1.00 113.83 ? -8  DC  H C2    1 
ATOM   8342 O  O2    . DC  H 4 3   ? 55.287  -29.622 55.394  1.00 113.88 ? -8  DC  H O2    1 
ATOM   8343 N  N3    . DC  H 4 3   ? 53.483  -29.299 56.729  1.00 114.63 ? -8  DC  H N3    1 
ATOM   8344 C  C4    . DC  H 4 3   ? 52.709  -28.437 57.392  1.00 114.70 ? -8  DC  H C4    1 
ATOM   8345 N  N4    . DC  H 4 3   ? 51.671  -28.925 58.076  1.00 115.60 ? -8  DC  H N4    1 
ATOM   8346 C  C5    . DC  H 4 3   ? 52.968  -27.034 57.388  1.00 114.03 ? -8  DC  H C5    1 
ATOM   8347 C  C6    . DC  H 4 3   ? 54.024  -26.602 56.684  1.00 113.22 ? -8  DC  H C6    1 
ATOM   8348 P  P     . DC  H 4 4   ? 57.743  -25.683 51.685  1.00 108.08 ? -7  DC  H P     1 
ATOM   8349 O  OP1   . DC  H 4 4   ? 58.963  -24.977 51.216  1.00 107.77 ? -7  DC  H OP1   1 
ATOM   8350 O  OP2   . DC  H 4 4   ? 56.404  -25.072 51.461  1.00 106.94 ? -7  DC  H OP2   1 
ATOM   8351 O  "O5'" . DC  H 4 4   ? 57.720  -27.130 51.016  1.00 108.25 ? -7  DC  H "O5'" 1 
ATOM   8352 C  "C5'" . DC  H 4 4   ? 58.631  -28.181 51.411  1.00 109.85 ? -7  DC  H "C5'" 1 
ATOM   8353 C  "C4'" . DC  H 4 4   ? 58.078  -29.519 50.980  1.00 110.20 ? -7  DC  H "C4'" 1 
ATOM   8354 O  "O4'" . DC  H 4 4   ? 57.003  -29.900 51.875  1.00 110.88 ? -7  DC  H "O4'" 1 
ATOM   8355 C  "C3'" . DC  H 4 4   ? 57.469  -29.516 49.577  1.00 108.62 ? -7  DC  H "C3'" 1 
ATOM   8356 O  "O3'" . DC  H 4 4   ? 57.684  -30.751 48.894  1.00 109.30 ? -7  DC  H "O3'" 1 
ATOM   8357 C  "C2'" . DC  H 4 4   ? 55.989  -29.340 49.848  1.00 108.05 ? -7  DC  H "C2'" 1 
ATOM   8358 C  "C1'" . DC  H 4 4   ? 55.827  -30.141 51.120  1.00 109.80 ? -7  DC  H "C1'" 1 
ATOM   8359 N  N1    . DC  H 4 4   ? 54.665  -29.757 51.939  1.00 109.80 ? -7  DC  H N1    1 
ATOM   8360 C  C2    . DC  H 4 4   ? 53.792  -30.757 52.383  1.00 110.73 ? -7  DC  H C2    1 
ATOM   8361 O  O2    . DC  H 4 4   ? 54.033  -31.939 52.092  1.00 111.61 ? -7  DC  H O2    1 
ATOM   8362 N  N3    . DC  H 4 4   ? 52.713  -30.410 53.124  1.00 110.81 ? -7  DC  H N3    1 
ATOM   8363 C  C4    . DC  H 4 4   ? 52.490  -29.126 53.417  1.00 110.08 ? -7  DC  H C4    1 
ATOM   8364 N  N4    . DC  H 4 4   ? 51.419  -28.830 54.157  1.00 110.37 ? -7  DC  H N4    1 
ATOM   8365 C  C5    . DC  H 4 4   ? 53.358  -28.088 52.971  1.00 109.17 ? -7  DC  H C5    1 
ATOM   8366 C  C6    . DC  H 4 4   ? 54.422  -28.445 52.239  1.00 109.02 ? -7  DC  H C6    1 
ATOM   8367 P  P     . DC  H 4 5   ? 57.510  -30.816 47.301  1.00 108.13 ? -6  DC  H P     1 
ATOM   8368 O  OP1   . DC  H 4 5   ? 57.801  -32.206 46.865  1.00 109.46 ? -6  DC  H OP1   1 
ATOM   8369 O  OP2   . DC  H 4 5   ? 58.273  -29.683 46.712  1.00 107.01 ? -6  DC  H OP2   1 
ATOM   8370 O  "O5'" . DC  H 4 5   ? 55.957  -30.533 47.080  1.00 107.05 ? -6  DC  H "O5'" 1 
ATOM   8371 C  "C5'" . DC  H 4 5   ? 55.144  -31.381 46.252  1.00 107.10 ? -6  DC  H "C5'" 1 
ATOM   8372 C  "C4'" . DC  H 4 5   ? 54.651  -32.575 47.037  1.00 108.62 ? -6  DC  H "C4'" 1 
ATOM   8373 O  "O4'" . DC  H 4 5   ? 54.190  -32.148 48.334  1.00 108.81 ? -6  DC  H "O4'" 1 
ATOM   8374 C  "C3'" . DC  H 4 5   ? 53.479  -33.301 46.384  1.00 108.68 ? -6  DC  H "C3'" 1 
ATOM   8375 O  "O3'" . DC  H 4 5   ? 54.005  -34.424 45.670  1.00 109.88 ? -6  DC  H "O3'" 1 
ATOM   8376 C  "C2'" . DC  H 4 5   ? 52.591  -33.719 47.544  1.00 109.49 ? -6  DC  H "C2'" 1 
ATOM   8377 C  "C1'" . DC  H 4 5   ? 53.002  -32.830 48.709  1.00 109.36 ? -6  DC  H "C1'" 1 
ATOM   8378 N  N1    . DC  H 4 5   ? 52.019  -31.823 49.157  1.00 108.34 ? -6  DC  H N1    1 
ATOM   8379 C  C2    . DC  H 4 5   ? 50.822  -32.257 49.741  1.00 108.86 ? -6  DC  H C2    1 
ATOM   8380 O  O2    . DC  H 4 5   ? 50.590  -33.475 49.805  1.00 110.09 ? -6  DC  H O2    1 
ATOM   8381 N  N3    . DC  H 4 5   ? 49.942  -31.339 50.206  1.00 108.14 ? -6  DC  H N3    1 
ATOM   8382 C  C4    . DC  H 4 5   ? 50.228  -30.037 50.118  1.00 107.03 ? -6  DC  H C4    1 
ATOM   8383 N  N4    . DC  H 4 5   ? 49.330  -29.166 50.583  1.00 106.57 ? -6  DC  H N4    1 
ATOM   8384 C  C5    . DC  H 4 5   ? 51.444  -29.569 49.542  1.00 106.48 ? -6  DC  H C5    1 
ATOM   8385 C  C6    . DC  H 4 5   ? 52.306  -30.487 49.085  1.00 107.13 ? -6  DC  H C6    1 
ATOM   8386 P  P     . DA  H 4 6   ? 53.944  -34.467 44.070  1.00 109.33 ? -5  DA  H P     1 
ATOM   8387 O  OP1   . DA  H 4 6   ? 54.989  -35.405 43.589  1.00 110.80 ? -5  DA  H OP1   1 
ATOM   8388 O  OP2   . DA  H 4 6   ? 53.917  -33.066 43.565  1.00 107.45 ? -5  DA  H OP2   1 
ATOM   8389 O  "O5'" . DA  H 4 6   ? 52.546  -35.175 43.797  1.00 109.74 ? -5  DA  H "O5'" 1 
ATOM   8390 C  "C5'" . DA  H 4 6   ? 52.166  -36.369 44.507  1.00 111.43 ? -5  DA  H "C5'" 1 
ATOM   8391 C  "C4'" . DA  H 4 6   ? 50.678  -36.342 44.759  1.00 111.06 ? -5  DA  H "C4'" 1 
ATOM   8392 O  "O4'" . DA  H 4 6   ? 50.348  -35.252 45.653  1.00 109.84 ? -5  DA  H "O4'" 1 
ATOM   8393 C  "C3'" . DA  H 4 6   ? 49.846  -36.117 43.494  1.00 110.29 ? -5  DA  H "C3'" 1 
ATOM   8394 O  "O3'" . DA  H 4 6   ? 48.824  -37.102 43.382  1.00 111.45 ? -5  DA  H "O3'" 1 
ATOM   8395 C  "C2'" . DA  H 4 6   ? 49.228  -34.745 43.692  1.00 108.43 ? -5  DA  H "C2'" 1 
ATOM   8396 C  "C1'" . DA  H 4 6   ? 49.148  -34.664 45.196  1.00 108.72 ? -5  DA  H "C1'" 1 
ATOM   8397 N  N9    . DA  H 4 6   ? 49.069  -33.306 45.730  1.00 107.33 ? -5  DA  H N9    1 
ATOM   8398 C  C8    . DA  H 4 6   ? 49.887  -32.233 45.468  1.00 106.21 ? -5  DA  H C8    1 
ATOM   8399 N  N7    . DA  H 4 6   ? 49.536  -31.138 46.097  1.00 105.33 ? -5  DA  H N7    1 
ATOM   8400 C  C5    . DA  H 4 6   ? 48.406  -31.510 46.812  1.00 105.87 ? -5  DA  H C5    1 
ATOM   8401 C  C6    . DA  H 4 6   ? 47.558  -30.800 47.680  1.00 105.60 ? -5  DA  H C6    1 
ATOM   8402 N  N6    . DA  H 4 6   ? 47.728  -29.514 47.989  1.00 104.74 ? -5  DA  H N6    1 
ATOM   8403 N  N1    . DA  H 4 6   ? 46.518  -31.467 48.229  1.00 106.41 ? -5  DA  H N1    1 
ATOM   8404 C  C2    . DA  H 4 6   ? 46.351  -32.760 47.921  1.00 107.45 ? -5  DA  H C2    1 
ATOM   8405 N  N3    . DA  H 4 6   ? 47.080  -33.535 47.121  1.00 107.92 ? -5  DA  H N3    1 
ATOM   8406 C  C4    . DA  H 4 6   ? 48.105  -32.842 46.592  1.00 107.06 ? -5  DA  H C4    1 
ATOM   8407 P  P     . DC  H 4 7   ? 48.172  -37.396 41.968  1.00 111.67 ? -4  DC  H P     1 
ATOM   8408 O  OP1   . DC  H 4 7   ? 48.466  -38.808 41.619  1.00 113.85 ? -4  DC  H OP1   1 
ATOM   8409 O  OP2   . DC  H 4 7   ? 48.567  -36.303 41.038  1.00 110.17 ? -4  DC  H OP2   1 
ATOM   8410 O  "O5'" . DC  H 4 7   ? 46.616  -37.273 42.270  1.00 111.35 ? -4  DC  H "O5'" 1 
ATOM   8411 C  "C5'" . DC  H 4 7   ? 45.891  -36.081 41.938  1.00 109.66 ? -4  DC  H "C5'" 1 
ATOM   8412 C  "C4'" . DC  H 4 7   ? 44.877  -35.792 43.018  1.00 109.33 ? -4  DC  H "C4'" 1 
ATOM   8413 O  "O4'" . DC  H 4 7   ? 45.477  -35.015 44.075  1.00 108.51 ? -4  DC  H "O4'" 1 
ATOM   8414 C  "C3'" . DC  H 4 7   ? 43.689  -34.971 42.545  1.00 108.31 ? -4  DC  H "C3'" 1 
ATOM   8415 O  "O3'" . DC  H 4 7   ? 42.677  -35.855 42.076  1.00 109.48 ? -4  DC  H "O3'" 1 
ATOM   8416 C  "C2'" . DC  H 4 7   ? 43.248  -34.258 43.805  1.00 107.63 ? -4  DC  H "C2'" 1 
ATOM   8417 C  "C1'" . DC  H 4 7   ? 44.550  -34.041 44.548  1.00 107.47 ? -4  DC  H "C1'" 1 
ATOM   8418 N  N1    . DC  H 4 7   ? 45.143  -32.709 44.349  1.00 105.97 ? -4  DC  H N1    1 
ATOM   8419 C  C2    . DC  H 4 7   ? 44.684  -31.651 45.140  1.00 105.16 ? -4  DC  H C2    1 
ATOM   8420 O  O2    . DC  H 4 7   ? 43.786  -31.864 45.967  1.00 105.68 ? -4  DC  H O2    1 
ATOM   8421 N  N3    . DC  H 4 7   ? 45.232  -30.424 44.986  1.00 103.98 ? -4  DC  H N3    1 
ATOM   8422 C  C4    . DC  H 4 7   ? 46.201  -30.236 44.088  1.00 103.52 ? -4  DC  H C4    1 
ATOM   8423 N  N4    . DC  H 4 7   ? 46.711  -29.012 43.972  1.00 102.46 ? -4  DC  H N4    1 
ATOM   8424 C  C5    . DC  H 4 7   ? 46.686  -31.295 43.267  1.00 104.30 ? -4  DC  H C5    1 
ATOM   8425 C  C6    . DC  H 4 7   ? 46.131  -32.502 43.425  1.00 105.55 ? -4  DC  H C6    1 
ATOM   8426 P  P     . DT  H 4 8   ? 41.640  -35.348 41.001  1.00 109.04 ? -3  DT  H P     1 
ATOM   8427 O  OP1   . DT  H 4 8   ? 40.570  -36.372 40.885  1.00 110.54 ? -3  DT  H OP1   1 
ATOM   8428 O  OP2   . DT  H 4 8   ? 42.407  -34.928 39.801  1.00 108.57 ? -3  DT  H OP2   1 
ATOM   8429 O  "O5'" . DT  H 4 8   ? 41.057  -34.025 41.666  1.00 107.52 ? -3  DT  H "O5'" 1 
ATOM   8430 C  "C5'" . DT  H 4 8   ? 39.981  -34.055 42.621  1.00 107.76 ? -3  DT  H "C5'" 1 
ATOM   8431 C  "C4'" . DT  H 4 8   ? 39.559  -32.640 42.942  1.00 106.39 ? -3  DT  H "C4'" 1 
ATOM   8432 O  "O4'" . DT  H 4 8   ? 40.712  -31.896 43.387  1.00 105.46 ? -3  DT  H "O4'" 1 
ATOM   8433 C  "C3'" . DT  H 4 8   ? 39.023  -31.850 41.752  1.00 105.74 ? -3  DT  H "C3'" 1 
ATOM   8434 O  "O3'" . DT  H 4 8   ? 37.610  -32.046 41.583  1.00 106.37 ? -3  DT  H "O3'" 1 
ATOM   8435 C  "C2'" . DT  H 4 8   ? 39.379  -30.415 42.102  1.00 104.36 ? -3  DT  H "C2'" 1 
ATOM   8436 C  "C1'" . DT  H 4 8   ? 40.526  -30.516 43.106  1.00 104.23 ? -3  DT  H "C1'" 1 
ATOM   8437 N  N1    . DT  H 4 8   ? 41.819  -29.955 42.626  1.00 103.43 ? -3  DT  H N1    1 
ATOM   8438 C  C2    . DT  H 4 8   ? 42.138  -28.662 42.986  1.00 102.42 ? -3  DT  H C2    1 
ATOM   8439 O  O2    . DT  H 4 8   ? 41.421  -27.969 43.688  1.00 102.22 ? -3  DT  H O2    1 
ATOM   8440 N  N3    . DT  H 4 8   ? 43.338  -28.210 42.496  1.00 101.79 ? -3  DT  H N3    1 
ATOM   8441 C  C4    . DT  H 4 8   ? 44.225  -28.902 41.694  1.00 102.09 ? -3  DT  H C4    1 
ATOM   8442 O  O4    . DT  H 4 8   ? 45.267  -28.363 41.334  1.00 101.51 ? -3  DT  H O4    1 
ATOM   8443 C  C5    . DT  H 4 8   ? 43.825  -30.250 41.349  1.00 103.26 ? -3  DT  H C5    1 
ATOM   8444 C  C7    . DT  H 4 8   ? 44.722  -31.076 40.481  1.00 103.93 ? -3  DT  H C7    1 
ATOM   8445 C  C6    . DT  H 4 8   ? 42.655  -30.700 41.820  1.00 103.86 ? -3  DT  H C6    1 
ATOM   8446 P  P     . DG  H 4 9   ? 36.864  -31.554 40.249  1.00 106.31 ? -2  DG  H P     1 
ATOM   8447 O  OP1   . DG  H 4 9   ? 35.510  -32.142 40.235  1.00 107.42 ? -2  DG  H OP1   1 
ATOM   8448 O  OP2   . DG  H 4 9   ? 37.768  -31.750 39.103  1.00 106.37 ? -2  DG  H OP2   1 
ATOM   8449 O  "O5'" . DG  H 4 9   ? 36.725  -29.992 40.471  1.00 104.98 ? -2  DG  H "O5'" 1 
ATOM   8450 C  "C5'" . DG  H 4 9   ? 35.868  -29.484 41.491  1.00 104.88 ? -2  DG  H "C5'" 1 
ATOM   8451 C  "C4'" . DG  H 4 9   ? 35.823  -27.983 41.367  1.00 103.87 ? -2  DG  H "C4'" 1 
ATOM   8452 O  "O4'" . DG  H 4 9   ? 37.163  -27.452 41.494  1.00 102.96 ? -2  DG  H "O4'" 1 
ATOM   8453 C  "C3'" . DG  H 4 9   ? 35.310  -27.501 40.013  1.00 103.90 ? -2  DG  H "C3'" 1 
ATOM   8454 O  "O3'" . DG  H 4 9   ? 34.501  -26.349 40.229  1.00 103.64 ? -2  DG  H "O3'" 1 
ATOM   8455 C  "C2'" . DG  H 4 9   ? 36.584  -27.204 39.242  1.00 103.21 ? -2  DG  H "C2'" 1 
ATOM   8456 C  "C1'" . DG  H 4 9   ? 37.496  -26.695 40.342  1.00 102.39 ? -2  DG  H "C1'" 1 
ATOM   8457 N  N9    . DG  H 4 9   ? 38.931  -26.842 40.114  1.00 101.92 ? -2  DG  H N9    1 
ATOM   8458 C  C8    . DG  H 4 9   ? 39.580  -27.901 39.528  1.00 102.43 ? -2  DG  H C8    1 
ATOM   8459 N  N7    . DG  H 4 9   ? 40.876  -27.750 39.490  1.00 101.92 ? -2  DG  H N7    1 
ATOM   8460 C  C5    . DG  H 4 9   ? 41.097  -26.521 40.097  1.00 101.00 ? -2  DG  H C5    1 
ATOM   8461 C  C6    . DG  H 4 9   ? 42.307  -25.824 40.349  1.00 100.26 ? -2  DG  H C6    1 
ATOM   8462 O  O6    . DG  H 4 9   ? 43.463  -26.164 40.079  1.00 100.19 ? -2  DG  H O6    1 
ATOM   8463 N  N1    . DG  H 4 9   ? 42.075  -24.610 40.986  1.00 99.72  ? -2  DG  H N1    1 
ATOM   8464 C  C2    . DG  H 4 9   ? 40.839  -24.127 41.338  1.00 99.90  ? -2  DG  H C2    1 
ATOM   8465 N  N2    . DG  H 4 9   ? 40.819  -22.933 41.944  1.00 99.55  ? -2  DG  H N2    1 
ATOM   8466 N  N3    . DG  H 4 9   ? 39.704  -24.767 41.110  1.00 100.54 ? -2  DG  H N3    1 
ATOM   8467 C  C4    . DG  H 4 9   ? 39.906  -25.950 40.492  1.00 101.04 ? -2  DG  H C4    1 
ATOM   8468 P  P     . DC  H 4 10  ? 33.639  -25.765 39.063  1.00 104.00 ? -1  DC  H P     1 
ATOM   8469 O  OP1   . DC  H 4 10  ? 32.268  -25.572 39.574  1.00 104.67 ? -1  DC  H OP1   1 
ATOM   8470 O  OP2   . DC  H 4 10  ? 33.855  -26.607 37.868  1.00 104.59 ? -1  DC  H OP2   1 
ATOM   8471 O  "O5'" . DC  H 4 10  ? 34.335  -24.362 38.809  1.00 103.00 ? -1  DC  H "O5'" 1 
ATOM   8472 C  "C5'" . DC  H 4 10  ? 33.825  -23.184 39.429  1.00 102.82 ? -1  DC  H "C5'" 1 
ATOM   8473 C  "C4'" . DC  H 4 10  ? 34.920  -22.161 39.590  1.00 101.88 ? -1  DC  H "C4'" 1 
ATOM   8474 O  "O4'" . DC  H 4 10  ? 36.173  -22.831 39.814  1.00 101.35 ? -1  DC  H "O4'" 1 
ATOM   8475 C  "C3'" . DC  H 4 10  ? 35.140  -21.310 38.349  1.00 101.68 ? -1  DC  H "C3'" 1 
ATOM   8476 O  "O3'" . DC  H 4 10  ? 34.288  -20.164 38.368  1.00 102.04 ? -1  DC  H "O3'" 1 
ATOM   8477 C  "C2'" . DC  H 4 10  ? 36.614  -20.951 38.429  1.00 100.76 ? -1  DC  H "C2'" 1 
ATOM   8478 C  "C1'" . DC  H 4 10  ? 37.234  -22.031 39.312  1.00 100.60 ? -1  DC  H "C1'" 1 
ATOM   8479 N  N1    . DC  H 4 10  ? 38.188  -22.920 38.623  1.00 100.47 ? -1  DC  H N1    1 
ATOM   8480 C  C2    . DC  H 4 10  ? 39.543  -22.579 38.627  1.00 99.75  ? -1  DC  H C2    1 
ATOM   8481 O  O2    . DC  H 4 10  ? 39.898  -21.542 39.205  1.00 99.27  ? -1  DC  H O2    1 
ATOM   8482 N  N3    . DC  H 4 10  ? 40.432  -23.391 38.011  1.00 99.77  ? -1  DC  H N3    1 
ATOM   8483 C  C4    . DC  H 4 10  ? 40.009  -24.501 37.402  1.00 100.55 ? -1  DC  H C4    1 
ATOM   8484 N  N4    . DC  H 4 10  ? 40.920  -25.272 36.807  1.00 100.77 ? -1  DC  H N4    1 
ATOM   8485 C  C5    . DC  H 4 10  ? 38.633  -24.869 37.377  1.00 101.32 ? -1  DC  H C5    1 
ATOM   8486 C  C6    . DC  H 4 10  ? 37.764  -24.057 37.992  1.00 101.20 ? -1  DC  H C6    1 
HETATM 8487 MG MG    . MG  I 5 .   ? 61.174  -14.860 24.740  1.00 145.00 ? 401 MG  A MG    1 
HETATM 8488 MG MG    . MG  J 5 .   ? 33.628  -18.307 39.273  1.00 145.00 ? 401 MG  B MG    1 
HETATM 8489 O  O     . HOH K 6 .   ? 60.326  -16.911 24.632  1.00 145.00 ? 501 HOH A O     1 
HETATM 8490 O  O     . HOH L 6 .   ? 33.792  -16.296 38.394  1.00 145.00 ? 501 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . SER A 3   ? 0.6272 1.2910 0.5312 -0.1407 -0.1102 -0.0340 3   SER A N     
2    C CA    . SER A 3   ? 0.6168 1.2831 0.5302 -0.1348 -0.1033 -0.0341 3   SER A CA    
3    C C     . SER A 3   ? 0.6147 1.2694 0.5127 -0.1331 -0.0984 -0.0278 3   SER A C     
4    O O     . SER A 3   ? 0.6082 1.2601 0.5030 -0.1331 -0.0870 -0.0271 3   SER A O     
5    C CB    . SER A 3   ? 0.6096 1.2856 0.5363 -0.1368 -0.0926 -0.0395 3   SER A CB    
6    O OG    . SER A 3   ? 0.6095 1.2785 0.5254 -0.1421 -0.0824 -0.0386 3   SER A OG    
7    N N     . PHE A 4   ? 0.6221 1.2698 0.5101 -0.1322 -0.1084 -0.0228 4   PHE A N     
8    C CA    . PHE A 4   ? 0.6222 1.2600 0.4969 -0.1307 -0.1074 -0.0164 4   PHE A CA    
9    C C     . PHE A 4   ? 0.6274 1.2621 0.5050 -0.1259 -0.1204 -0.0130 4   PHE A C     
10   O O     . PHE A 4   ? 0.6370 1.2717 0.5147 -0.1270 -0.1326 -0.0121 4   PHE A O     
11   C CB    . PHE A 4   ? 0.6294 1.2601 0.4842 -0.1371 -0.1061 -0.0126 4   PHE A CB    
12   C CG    . PHE A 4   ? 0.6336 1.2556 0.4745 -0.1368 -0.1098 -0.0052 4   PHE A CG    
13   C CD1   . PHE A 4   ? 0.6265 1.2446 0.4635 -0.1346 -0.1012 -0.0029 4   PHE A CD1   
14   C CD2   . PHE A 4   ? 0.6458 1.2637 0.4773 -0.1396 -0.1223 -0.0002 4   PHE A CD2   
15   C CE1   . PHE A 4   ? 0.6308 1.2416 0.4556 -0.1351 -0.1046 0.0039  4   PHE A CE1   
16   C CE2   . PHE A 4   ? 0.6511 1.2611 0.4694 -0.1407 -0.1258 0.0073  4   PHE A CE2   
17   C CZ    . PHE A 4   ? 0.6432 1.2500 0.4586 -0.1385 -0.1167 0.0091  4   PHE A CZ    
18   N N     . VAL A 5   ? 0.6223 1.2535 0.5018 -0.1206 -0.1183 -0.0110 5   VAL A N     
19   C CA    . VAL A 5   ? 0.6283 1.2537 0.5094 -0.1158 -0.1305 -0.0075 5   VAL A CA    
20   C C     . VAL A 5   ? 0.6310 1.2449 0.4947 -0.1179 -0.1292 0.0003  5   VAL A C     
21   O O     . VAL A 5   ? 0.6226 1.2359 0.4832 -0.1173 -0.1178 0.0003  5   VAL A O     
22   C CB    . VAL A 5   ? 0.6218 1.2543 0.5231 -0.1071 -0.1315 -0.0135 5   VAL A CB    
23   C CG1   . VAL A 5   ? 0.6110 1.2445 0.5133 -0.1044 -0.1187 -0.0146 5   VAL A CG1   
24   C CG2   . VAL A 5   ? 0.6312 1.2577 0.5372 -0.1017 -0.1476 -0.0113 5   VAL A CG2   
25   N N     . PRO A 6   ? 0.6437 1.2490 0.4957 -0.1210 -0.1411 0.0072  6   PRO A N     
26   C CA    . PRO A 6   ? 0.6476 1.2432 0.4835 -0.1240 -0.1405 0.0149  6   PRO A CA    
27   C C     . PRO A 6   ? 0.6468 1.2362 0.4889 -0.1175 -0.1453 0.0166  6   PRO A C     
28   O O     . PRO A 6   ? 0.6498 1.2393 0.5056 -0.1114 -0.1552 0.0139  6   PRO A O     
29   C CB    . PRO A 6   ? 0.6637 1.2536 0.4857 -0.1307 -0.1527 0.0216  6   PRO A CB    
30   C CG    . PRO A 6   ? 0.6695 1.2615 0.5051 -0.1267 -0.1655 0.0187  6   PRO A CG    
31   C CD    . PRO A 6   ? 0.6564 1.2605 0.5097 -0.1222 -0.1564 0.0087  6   PRO A CD    
32   N N     . ASN A 7   ? 0.6436 1.2279 0.4763 -0.1187 -0.1387 0.0207  7   ASN A N     
33   C CA    . ASN A 7   ? 0.6440 1.2212 0.4804 -0.1134 -0.1431 0.0227  7   ASN A CA    
34   C C     . ASN A 7   ? 0.6604 1.2252 0.4872 -0.1165 -0.1587 0.0314  7   ASN A C     
35   O O     . ASN A 7   ? 0.6717 1.2344 0.4896 -0.1225 -0.1666 0.0358  7   ASN A O     
36   C CB    . ASN A 7   ? 0.6343 1.2116 0.4646 -0.1138 -0.1298 0.0235  7   ASN A CB    
37   C CG    . ASN A 7   ? 0.6396 1.2125 0.4505 -0.1222 -0.1273 0.0310  7   ASN A CG    
38   O OD1   . ASN A 7   ? 0.6522 1.2207 0.4524 -0.1283 -0.1363 0.0368  7   ASN A OD1   
39   N ND2   . ASN A 7   ? 0.6309 1.2059 0.4372 -0.1228 -0.1151 0.0308  7   ASN A ND2   
40   N N     . LYS A 8   ? 0.6631 1.2192 0.4907 -0.1131 -0.1634 0.0343  8   LYS A N     
41   C CA    . LYS A 8   ? 0.6801 1.2226 0.4978 -0.1170 -0.1784 0.0436  8   LYS A CA    
42   C C     . LYS A 8   ? 0.6876 1.2276 0.4833 -0.1287 -0.1761 0.0527  8   LYS A C     
43   O O     . LYS A 8   ? 0.7032 1.2374 0.4888 -0.1351 -0.1875 0.0596  8   LYS A O     
44   C CB    . LYS A 8   ? 0.6810 1.2145 0.5035 -0.1116 -0.1822 0.0444  8   LYS A CB    
45   C CG    . LYS A 8   ? 0.6804 1.2136 0.5235 -0.1003 -0.1900 0.0363  8   LYS A CG    
46   C CD    . LYS A 8   ? 0.6795 1.2054 0.5268 -0.0949 -0.1908 0.0353  8   LYS A CD    
47   C CE    . LYS A 8   ? 0.6971 1.2071 0.5480 -0.0916 -0.2104 0.0388  8   LYS A CE    
48   N NZ    . LYS A 8   ? 0.7003 1.1996 0.5460 -0.0917 -0.2114 0.0424  8   LYS A NZ    
49   N N     . GLU A 9   ? 0.6773 1.2224 0.4659 -0.1315 -0.1614 0.0524  9   GLU A N     
50   C CA    . GLU A 9   ? 0.6833 1.2286 0.4522 -0.1420 -0.1575 0.0598  9   GLU A CA    
51   C C     . GLU A 9   ? 0.6892 1.2408 0.4490 -0.1489 -0.1573 0.0600  9   GLU A C     
52   O O     . GLU A 9   ? 0.7041 1.2523 0.4488 -0.1578 -0.1647 0.0679  9   GLU A O     
53   C CB    . GLU A 9   ? 0.6696 1.2214 0.4359 -0.1420 -0.1411 0.0572  9   GLU A CB    
54   C CG    . GLU A 9   ? 0.6664 1.2121 0.4352 -0.1386 -0.1405 0.0593  9   GLU A CG    
55   C CD    . GLU A 9   ? 0.6558 1.2015 0.4426 -0.1274 -0.1390 0.0517  9   GLU A CD    
56   O OE1   . GLU A 9   ? 0.6439 1.1986 0.4402 -0.1227 -0.1297 0.0439  9   GLU A OE1   
57   O OE2   . GLU A 9   ? 0.6605 1.1973 0.4517 -0.1238 -0.1472 0.0534  9   GLU A OE2   
58   N N     . GLN A 10  ? 0.6784 1.2394 0.4471 -0.1452 -0.1488 0.0514  10  GLN A N     
59   C CA    . GLN A 10  ? 0.6828 1.2507 0.4448 -0.1508 -0.1478 0.0496  10  GLN A CA    
60   C C     . GLN A 10  ? 0.6994 1.2619 0.4586 -0.1538 -0.1646 0.0542  10  GLN A C     
61   O O     . GLN A 10  ? 0.7110 1.2752 0.4556 -0.1624 -0.1679 0.0581  10  GLN A O     
62   C CB    . GLN A 10  ? 0.6691 1.2461 0.4445 -0.1455 -0.1377 0.0394  10  GLN A CB    
63   C CG    . GLN A 10  ? 0.6549 1.2371 0.4315 -0.1435 -0.1214 0.0350  10  GLN A CG    
64   C CD    . GLN A 10  ? 0.6426 1.2314 0.4348 -0.1376 -0.1135 0.0260  10  GLN A CD    
65   O OE1   . GLN A 10  ? 0.6375 1.2264 0.4445 -0.1308 -0.1163 0.0229  10  GLN A OE1   
66   N NE2   . GLN A 10  ? 0.6389 1.2336 0.4280 -0.1405 -0.1037 0.0215  10  GLN A NE2   
67   N N     . THR A 11  ? 0.7010 1.2576 0.4746 -0.1464 -0.1754 0.0533  11  THR A N     
68   C CA    . THR A 11  ? 0.7178 1.2673 0.4912 -0.1475 -0.1937 0.0579  11  THR A CA    
69   C C     . THR A 11  ? 0.7367 1.2752 0.4911 -0.1566 -0.2044 0.0704  11  THR A C     
70   O O     . THR A 11  ? 0.7528 1.2891 0.4957 -0.1638 -0.2145 0.0761  11  THR A O     
71   C CB    . THR A 11  ? 0.7154 1.2609 0.5101 -0.1362 -0.2028 0.0533  11  THR A CB    
72   O OG1   . THR A 11  ? 0.6991 1.2567 0.5110 -0.1291 -0.1928 0.0420  11  THR A OG1   
73   C CG2   . THR A 11  ? 0.7337 1.2712 0.5300 -0.1362 -0.2231 0.0577  11  THR A CG2   
74   N N     . ARG A 12  ? 0.7357 1.2676 0.4865 -0.1569 -0.2023 0.0748  12  ARG A N     
75   C CA    . ARG A 12  ? 0.7542 1.2755 0.4873 -0.1664 -0.2121 0.0873  12  ARG A CA    
76   C C     . ARG A 12  ? 0.7600 1.2892 0.4715 -0.1791 -0.2045 0.0919  12  ARG A C     
77   O O     . ARG A 12  ? 0.7797 1.3031 0.4744 -0.1894 -0.2148 0.1022  12  ARG A O     
78   C CB    . ARG A 12  ? 0.7512 1.2641 0.4872 -0.1635 -0.2113 0.0899  12  ARG A CB    
79   C CG    . ARG A 12  ? 0.7514 1.2545 0.5064 -0.1520 -0.2224 0.0865  12  ARG A CG    
80   C CD    . ARG A 12  ? 0.7372 1.2401 0.5016 -0.1450 -0.2132 0.0817  12  ARG A CD    
81   N NE    . ARG A 12  ? 0.7416 1.2333 0.5210 -0.1355 -0.2253 0.0795  12  ARG A NE    
82   C CZ    . ARG A 12  ? 0.7309 1.2220 0.5211 -0.1277 -0.2196 0.0739  12  ARG A CZ    
83   N NH1   . ARG A 12  ? 0.7145 1.2152 0.5027 -0.1280 -0.2022 0.0704  12  ARG A NH1   
84   N NH2   . ARG A 12  ? 0.7374 1.2182 0.5409 -0.1192 -0.2319 0.0712  12  ARG A NH2   
85   N N     . THR A 13  ? 0.7441 1.2864 0.4559 -0.1785 -0.1869 0.0843  13  THR A N     
86   C CA    . THR A 13  ? 0.7483 1.3009 0.4422 -0.1890 -0.1784 0.0855  13  THR A CA    
87   C C     . THR A 13  ? 0.7621 1.3170 0.4481 -0.1946 -0.1871 0.0866  13  THR A C     
88   O O     . THR A 13  ? 0.7785 1.3348 0.4450 -0.2061 -0.1911 0.0939  13  THR A O     
89   C CB    . THR A 13  ? 0.7287 1.2936 0.4279 -0.1851 -0.1590 0.0754  13  THR A CB    
90   O OG1   . THR A 13  ? 0.7213 1.2854 0.4201 -0.1843 -0.1515 0.0773  13  THR A OG1   
91   C CG2   . THR A 13  ? 0.7325 1.3094 0.4178 -0.1933 -0.1509 0.0728  13  THR A CG2   
92   N N     . VAL A 14  ? 0.7563 1.3122 0.4573 -0.1868 -0.1903 0.0795  14  VAL A N     
93   C CA    . VAL A 14  ? 0.7686 1.3270 0.4643 -0.1911 -0.1992 0.0796  14  VAL A CA    
94   C C     . VAL A 14  ? 0.7926 1.3390 0.4768 -0.1977 -0.2187 0.0919  14  VAL A C     
95   O O     . VAL A 14  ? 0.8089 1.3576 0.4767 -0.2074 -0.2247 0.0966  14  VAL A O     
96   C CB    . VAL A 14  ? 0.7571 1.3194 0.4739 -0.1810 -0.1993 0.0694  14  VAL A CB    
97   C CG1   . VAL A 14  ? 0.7719 1.3345 0.4855 -0.1845 -0.2124 0.0705  14  VAL A CG1   
98   C CG2   . VAL A 14  ? 0.7387 1.3129 0.4615 -0.1781 -0.1808 0.0586  14  VAL A CG2   
99   N N     . LEU A 15  ? 0.7963 1.3295 0.4881 -0.1930 -0.2290 0.0973  15  LEU A N     
100  C CA    . LEU A 15  ? 0.8211 1.3403 0.5015 -0.1998 -0.2485 0.1102  15  LEU A CA    
101  C C     . LEU A 15  ? 0.8357 1.3554 0.4902 -0.2148 -0.2466 0.1208  15  LEU A C     
102  O O     . LEU A 15  ? 0.8589 1.3731 0.4969 -0.2250 -0.2599 0.1310  15  LEU A O     
103  C CB    . LEU A 15  ? 0.8223 1.3264 0.5171 -0.1911 -0.2594 0.1127  15  LEU A CB    
104  C CG    . LEU A 15  ? 0.8135 1.3166 0.5337 -0.1769 -0.2655 0.1033  15  LEU A CG    
105  C CD1   . LEU A 15  ? 0.8098 1.3015 0.5450 -0.1673 -0.2705 0.1024  15  LEU A CD1   
106  C CD2   . LEU A 15  ? 0.8324 1.3302 0.5517 -0.1784 -0.2842 0.1070  15  LEU A CD2   
107  N N     . ILE A 16  ? 0.8230 1.3500 0.4741 -0.2165 -0.2305 0.1186  16  ILE A N     
108  C CA    . ILE A 16  ? 0.8340 1.3670 0.4619 -0.2308 -0.2252 0.1262  16  ILE A CA    
109  C C     . ILE A 16  ? 0.8415 1.3877 0.4548 -0.2392 -0.2215 0.1238  16  ILE A C     
110  O O     . ILE A 16  ? 0.8630 1.4096 0.4550 -0.2525 -0.2284 0.1334  16  ILE A O     
111  C CB    . ILE A 16  ? 0.8164 1.3577 0.4464 -0.2294 -0.2073 0.1218  16  ILE A CB    
112  C CG1   . ILE A 16  ? 0.8132 1.3408 0.4538 -0.2235 -0.2125 0.1258  16  ILE A CG1   
113  C CG2   . ILE A 16  ? 0.8266 1.3789 0.4340 -0.2440 -0.1999 0.1272  16  ILE A CG2   
114  C CD1   . ILE A 16  ? 0.7927 1.3274 0.4412 -0.2183 -0.1959 0.1194  16  ILE A CD1   
115  N N     . PHE A 17  ? 0.8250 1.3816 0.4498 -0.2316 -0.2111 0.1110  17  PHE A N     
116  C CA    . PHE A 17  ? 0.8306 1.3997 0.4442 -0.2378 -0.2071 0.1063  17  PHE A CA    
117  C C     . PHE A 17  ? 0.8537 1.4160 0.4573 -0.2441 -0.2257 0.1142  17  PHE A C     
118  O O     . PHE A 17  ? 0.8720 1.4396 0.4537 -0.2570 -0.2283 0.1201  17  PHE A O     
119  C CB    . PHE A 17  ? 0.8095 1.3870 0.4409 -0.2272 -0.1955 0.0915  17  PHE A CB    
120  C CG    . PHE A 17  ? 0.8134 1.4039 0.4350 -0.2326 -0.1895 0.0846  17  PHE A CG    
121  C CD1   . PHE A 17  ? 0.8198 1.4221 0.4227 -0.2427 -0.1799 0.0843  17  PHE A CD1   
122  C CD2   . PHE A 17  ? 0.8101 1.4024 0.4427 -0.2273 -0.1929 0.0770  17  PHE A CD2   
123  C CE1   . PHE A 17  ? 0.8240 1.4385 0.4183 -0.2471 -0.1743 0.0764  17  PHE A CE1   
124  C CE2   . PHE A 17  ? 0.8140 1.4177 0.4382 -0.2321 -0.1876 0.0698  17  PHE A CE2   
125  C CZ    . PHE A 17  ? 0.8213 1.4357 0.4261 -0.2418 -0.1784 0.0692  17  PHE A CZ    
126  N N     . CYS A 18  ? 0.8538 1.4050 0.4736 -0.2351 -0.2389 0.1142  18  CYS A N     
127  C CA    . CYS A 18  ? 0.8761 1.4196 0.4891 -0.2395 -0.2587 0.1216  18  CYS A CA    
128  C C     . CYS A 18  ? 0.9028 1.4361 0.4933 -0.2529 -0.2716 0.1381  18  CYS A C     
129  O O     . CYS A 18  ? 0.9243 1.4595 0.4952 -0.2643 -0.2802 0.1449  18  CYS A O     
130  C CB    . CYS A 18  ? 0.8708 1.4039 0.5083 -0.2261 -0.2709 0.1184  18  CYS A CB    
131  S SG    . CYS A 18  ? 0.8445 1.3904 0.5070 -0.2128 -0.2585 0.1003  18  CYS A SG    
132  N N     . PHE A 19  ? 0.9020 1.4252 0.4946 -0.2521 -0.2728 0.1446  19  PHE A N     
133  C CA    . PHE A 19  ? 0.9271 1.4396 0.4993 -0.2653 -0.2845 0.1608  19  PHE A CA    
134  C C     . PHE A 19  ? 0.9394 1.4663 0.4842 -0.2821 -0.2760 0.1652  19  PHE A C     
135  O O     . PHE A 19  ? 0.9664 1.4893 0.4905 -0.2950 -0.2890 0.1769  19  PHE A O     
136  C CB    . PHE A 19  ? 0.9189 1.4219 0.4997 -0.2612 -0.2820 0.1638  19  PHE A CB    
137  C CG    . PHE A 19  ? 0.9446 1.4336 0.5079 -0.2737 -0.2956 0.1807  19  PHE A CG    
138  C CD1   . PHE A 19  ? 0.9695 1.4397 0.5295 -0.2760 -0.3193 0.1918  19  PHE A CD1   
139  C CD2   . PHE A 19  ? 0.9444 1.4383 0.4959 -0.2829 -0.2853 0.1856  19  PHE A CD2   
140  C CE1   . PHE A 19  ? 0.9952 1.4504 0.5389 -0.2882 -0.3330 0.2083  19  PHE A CE1   
141  C CE2   . PHE A 19  ? 0.9690 1.4498 0.5046 -0.2955 -0.2980 0.2017  19  PHE A CE2   
142  C CZ    . PHE A 19  ? 0.9950 1.4555 0.5262 -0.2984 -0.3220 0.2135  19  PHE A CZ    
143  N N     . HIS A 20  ? 0.9205 1.4647 0.4656 -0.2816 -0.2546 0.1553  20  HIS A N     
144  C CA    . HIS A 20  ? 0.9291 1.4911 0.4510 -0.2958 -0.2435 0.1558  20  HIS A CA    
145  C C     . HIS A 20  ? 0.9404 1.5119 0.4509 -0.3011 -0.2462 0.1521  20  HIS A C     
146  O O     . HIS A 20  ? 0.9580 1.5404 0.4446 -0.3157 -0.2445 0.1566  20  HIS A O     
147  C CB    . HIS A 20  ? 0.9049 1.4832 0.4337 -0.2914 -0.2202 0.1437  20  HIS A CB    
148  C CG    . HIS A 20  ? 0.9003 1.4754 0.4298 -0.2932 -0.2153 0.1492  20  HIS A CG    
149  N ND1   . HIS A 20  ? 0.9040 1.4938 0.4180 -0.3044 -0.2035 0.1509  20  HIS A ND1   
150  C CD2   . HIS A 20  ? 0.8930 1.4529 0.4370 -0.2853 -0.2206 0.1530  20  HIS A CD2   
151  C CE1   . HIS A 20  ? 0.8989 1.4824 0.4180 -0.3036 -0.2021 0.1560  20  HIS A CE1   
152  N NE2   . HIS A 20  ? 0.8925 1.4572 0.4292 -0.2922 -0.2124 0.1573  20  HIS A NE2   
153  N N     . LEU A 21  ? 0.9307 1.4994 0.4582 -0.2896 -0.2502 0.1435  21  LEU A N     
154  C CA    . LEU A 21  ? 0.9436 1.5180 0.4622 -0.2938 -0.2570 0.1412  21  LEU A CA    
155  C C     . LEU A 21  ? 0.9722 1.5316 0.4795 -0.3009 -0.2812 0.1559  21  LEU A C     
156  O O     . LEU A 21  ? 0.9829 1.5435 0.4869 -0.3020 -0.2906 0.1545  21  LEU A O     
157  C CB    . LEU A 21  ? 0.9227 1.5004 0.4649 -0.2794 -0.2523 0.1264  21  LEU A CB    
158  C CG    . LEU A 21  ? 0.8973 1.4894 0.4500 -0.2726 -0.2299 0.1111  21  LEU A CG    
159  C CD1   . LEU A 21  ? 0.8805 1.4728 0.4565 -0.2596 -0.2288 0.0990  21  LEU A CD1   
160  C CD2   . LEU A 21  ? 0.9052 1.5150 0.4369 -0.2839 -0.2186 0.1067  21  LEU A CD2   
161  N N     . LYS A 22  ? 0.9859 1.5304 0.4873 -0.3058 -0.2922 0.1701  22  LYS A N     
162  C CA    . LYS A 22  ? 1.0165 1.5442 0.5054 -0.3137 -0.3165 0.1860  22  LYS A CA    
163  C C     . LYS A 22  ? 1.0154 1.5305 0.5251 -0.3006 -0.3327 0.1831  22  LYS A C     
164  O O     . LYS A 22  ? 1.0402 1.5467 0.5398 -0.3063 -0.3520 0.1922  22  LYS A O     
165  C CB    . LYS A 22  ? 1.0438 1.5815 0.5008 -0.3325 -0.3202 0.1938  22  LYS A CB    
166  C CG    . LYS A 22  ? 1.0433 1.6005 0.4805 -0.3452 -0.3012 0.1925  22  LYS A CG    
167  C CD    . LYS A 22  ? 1.0467 1.5967 0.4791 -0.3512 -0.2999 0.2031  22  LYS A CD    
168  C CE    . LYS A 22  ? 1.0354 1.6060 0.4595 -0.3576 -0.2776 0.1972  22  LYS A CE    
169  N NZ    . LYS A 22  ? 1.0277 1.5908 0.4586 -0.3567 -0.2738 0.2027  22  LYS A NZ    
170  N N     . LYS A 23  ? 0.9878 1.5028 0.5263 -0.2834 -0.3251 0.1704  23  LYS A N     
171  C CA    . LYS A 23  ? 0.9842 1.4913 0.5451 -0.2703 -0.3382 0.1654  23  LYS A CA    
172  C C     . LYS A 23  ? 0.9958 1.4803 0.5662 -0.2651 -0.3572 0.1753  23  LYS A C     
173  O O     . LYS A 23  ? 0.9982 1.4741 0.5639 -0.2684 -0.3560 0.1827  23  LYS A O     
174  C CB    . LYS A 23  ? 0.9514 1.4697 0.5388 -0.2550 -0.3220 0.1473  23  LYS A CB    
175  C CG    . LYS A 23  ? 0.9439 1.4805 0.5282 -0.2569 -0.3109 0.1362  23  LYS A CG    
176  C CD    . LYS A 23  ? 0.9648 1.4993 0.5431 -0.2605 -0.3290 0.1396  23  LYS A CD    
177  C CE    . LYS A 23  ? 0.9504 1.4983 0.5429 -0.2536 -0.3224 0.1249  23  LYS A CE    
178  N NZ    . LYS A 23  ? 0.9435 1.5090 0.5225 -0.2608 -0.3036 0.1165  23  LYS A NZ    
179  N N     . THR A 24  ? 1.0040 1.4794 0.5881 -0.2571 -0.3753 0.1750  24  THR A N     
180  C CA    . THR A 24  ? 1.0164 1.4698 0.6129 -0.2500 -0.3959 0.1825  24  THR A CA    
181  C C     . THR A 24  ? 0.9873 1.4423 0.6157 -0.2317 -0.3866 0.1685  24  THR A C     
182  O O     . THR A 24  ? 0.9615 1.4338 0.6019 -0.2251 -0.3683 0.1543  24  THR A O     
183  C CB    . THR A 24  ? 1.0395 1.4833 0.6376 -0.2488 -0.4205 0.1876  24  THR A CB    
184  O OG1   . THR A 24  ? 1.0200 1.4734 0.6452 -0.2339 -0.4182 0.1723  24  THR A OG1   
185  C CG2   . THR A 24  ? 1.0631 1.5128 0.6311 -0.2660 -0.4253 0.1967  24  THR A CG2   
186  N N     . ALA A 25  ? 0.9926 1.4297 0.6343 -0.2238 -0.3995 0.1723  25  ALA A N     
187  C CA    . ALA A 25  ? 0.9666 1.4053 0.6366 -0.2073 -0.3903 0.1595  25  ALA A CA    
188  C C     . ALA A 25  ? 0.9502 1.4008 0.6450 -0.1940 -0.3886 0.1447  25  ALA A C     
189  O O     . ALA A 25  ? 0.9230 1.3897 0.6305 -0.1874 -0.3689 0.1316  25  ALA A O     
190  C CB    . ALA A 25  ? 0.9789 1.3954 0.6583 -0.2014 -0.4067 0.1659  25  ALA A CB    
191  N N     . ALA A 26  ? 0.9680 1.4109 0.6694 -0.1905 -0.4099 0.1473  26  ALA A N     
192  C CA    . ALA A 26  ? 0.9549 1.4094 0.6814 -0.1781 -0.4109 0.1336  26  ALA A CA    
193  C C     . ALA A 26  ? 0.9414 1.4173 0.6620 -0.1831 -0.3947 0.1257  26  ALA A C     
194  O O     . ALA A 26  ? 0.9201 1.4103 0.6624 -0.1732 -0.3849 0.1115  26  ALA A O     
195  C CB    . ALA A 26  ? 0.9796 1.4208 0.7134 -0.1740 -0.4388 0.1390  26  ALA A CB    
196  N N     . GLU A 27  ? 0.9546 1.4331 0.6462 -0.1988 -0.3919 0.1345  27  GLU A N     
197  C CA    . GLU A 27  ? 0.9440 1.4419 0.6277 -0.2045 -0.3765 0.1268  27  GLU A CA    
198  C C     . GLU A 27  ? 0.9124 1.4236 0.6087 -0.1981 -0.3513 0.1139  27  GLU A C     
199  O O     . GLU A 27  ? 0.8944 1.4195 0.6070 -0.1913 -0.3417 0.1010  27  GLU A O     
200  C CB    . GLU A 27  ? 0.9632 1.4625 0.6115 -0.2231 -0.3748 0.1378  27  GLU A CB    
201  C CG    . GLU A 27  ? 0.9927 1.4880 0.6235 -0.2328 -0.3943 0.1472  27  GLU A CG    
202  C CD    . GLU A 27  ? 0.9874 1.4985 0.6235 -0.2316 -0.3917 0.1367  27  GLU A CD    
203  O OE1   . GLU A 27  ? 0.9606 1.4862 0.6123 -0.2244 -0.3731 0.1222  27  GLU A OE1   
204  O OE2   . GLU A 27  ? 1.0111 1.5197 0.6352 -0.2383 -0.4087 0.1433  27  GLU A OE2   
205  N N     . SER A 28  ? 0.9070 1.4133 0.5957 -0.2006 -0.3417 0.1181  28  SER A N     
206  C CA    . SER A 28  ? 0.8794 1.3960 0.5778 -0.1952 -0.3189 0.1079  28  SER A CA    
207  C C     . SER A 28  ? 0.8591 1.3801 0.5893 -0.1792 -0.3161 0.0952  28  SER A C     
208  O O     . SER A 28  ? 0.8385 1.3740 0.5795 -0.1751 -0.3001 0.0835  28  SER A O     
209  C CB    . SER A 28  ? 0.8803 1.3877 0.5683 -0.1991 -0.3142 0.1159  28  SER A CB    
210  O OG    . SER A 28  ? 0.9052 1.4053 0.5657 -0.2138 -0.3231 0.1301  28  SER A OG    
211  N N     . HIS A 29  ? 0.8662 1.3748 0.6113 -0.1705 -0.3319 0.0973  29  HIS A N     
212  C CA    . HIS A 29  ? 0.8490 1.3629 0.6248 -0.1552 -0.3304 0.0850  29  HIS A CA    
213  C C     . HIS A 29  ? 0.8397 1.3699 0.6284 -0.1520 -0.3268 0.0741  29  HIS A C     
214  O O     . HIS A 29  ? 0.8175 1.3604 0.6236 -0.1448 -0.3120 0.0622  29  HIS A O     
215  C CB    . HIS A 29  ? 0.8638 1.3619 0.6525 -0.1470 -0.3520 0.0888  29  HIS A CB    
216  C CG    . HIS A 29  ? 0.8482 1.3532 0.6688 -0.1311 -0.3514 0.0754  29  HIS A CG    
217  N ND1   . HIS A 29  ? 0.8604 1.3578 0.6991 -0.1215 -0.3717 0.0739  29  HIS A ND1   
218  C CD2   . HIS A 29  ? 0.8225 1.3423 0.6604 -0.1234 -0.3331 0.0624  29  HIS A CD2   
219  C CE1   . HIS A 29  ? 0.8422 1.3510 0.7084 -0.1084 -0.3652 0.0599  29  HIS A CE1   
220  N NE2   . HIS A 29  ? 0.8193 1.3418 0.6848 -0.1099 -0.3418 0.0532  29  HIS A NE2   
221  N N     . ARG A 30  ? 0.8576 1.3874 0.6370 -0.1582 -0.3401 0.0786  30  ARG A N     
222  C CA    . ARG A 30  ? 0.8509 1.3963 0.6408 -0.1567 -0.3375 0.0689  30  ARG A CA    
223  C C     . ARG A 30  ? 0.8332 1.3933 0.6162 -0.1621 -0.3145 0.0616  30  ARG A C     
224  O O     . ARG A 30  ? 0.8178 1.3915 0.6180 -0.1570 -0.3059 0.0500  30  ARG A O     
225  C CB    . ARG A 30  ? 0.8759 1.4172 0.6539 -0.1636 -0.3570 0.0762  30  ARG A CB    
226  C CG    . ARG A 30  ? 0.8925 1.4216 0.6843 -0.1557 -0.3815 0.0803  30  ARG A CG    
227  C CD    . ARG A 30  ? 0.9138 1.4428 0.6994 -0.1605 -0.3998 0.0845  30  ARG A CD    
228  N NE    . ARG A 30  ? 0.9357 1.4568 0.6871 -0.1763 -0.4046 0.0982  30  ARG A NE    
229  C CZ    . ARG A 30  ? 0.9602 1.4626 0.6944 -0.1824 -0.4207 0.1133  30  ARG A CZ    
230  N NH1   . ARG A 30  ? 0.9672 1.4542 0.7150 -0.1735 -0.4349 0.1169  30  ARG A NH1   
231  N NH2   . ARG A 30  ? 0.9794 1.4786 0.6819 -0.1981 -0.4228 0.1247  30  ARG A NH2   
232  N N     . MET A 31  ? 0.8361 1.3935 0.5949 -0.1722 -0.3049 0.0681  31  MET A N     
233  C CA    . MET A 31  ? 0.8206 1.3901 0.5726 -0.1766 -0.2833 0.0611  31  MET A CA    
234  C C     . MET A 31  ? 0.7956 1.3699 0.5655 -0.1676 -0.2667 0.0524  31  MET A C     
235  O O     . MET A 31  ? 0.7801 1.3661 0.5574 -0.1663 -0.2522 0.0427  31  MET A O     
236  C CB    . MET A 31  ? 0.8309 1.3973 0.5537 -0.1891 -0.2778 0.0697  31  MET A CB    
237  C CG    . MET A 31  ? 0.8565 1.4203 0.5569 -0.2006 -0.2914 0.0786  31  MET A CG    
238  S SD    . MET A 31  ? 0.8714 1.4290 0.5401 -0.2143 -0.2885 0.0916  31  MET A SD    
239  C CE    . MET A 31  ? 0.8503 1.4230 0.5148 -0.2163 -0.2611 0.0809  31  MET A CE    
240  N N     . LEU A 32  ? 0.7932 1.3579 0.5691 -0.1618 -0.2692 0.0562  32  LEU A N     
241  C CA    . LEU A 32  ? 0.7712 1.3403 0.5645 -0.1527 -0.2552 0.0482  32  LEU A CA    
242  C C     . LEU A 32  ? 0.7580 1.3389 0.5773 -0.1437 -0.2530 0.0361  32  LEU A C     
243  O O     . LEU A 32  ? 0.7397 1.3305 0.5681 -0.1410 -0.2365 0.0277  32  LEU A O     
244  C CB    . LEU A 32  ? 0.7738 1.3301 0.5713 -0.1472 -0.2620 0.0536  32  LEU A CB    
245  C CG    . LEU A 32  ? 0.7783 1.3259 0.5549 -0.1547 -0.2569 0.0630  32  LEU A CG    
246  C CD1   . LEU A 32  ? 0.7874 1.3198 0.5674 -0.1504 -0.2695 0.0697  32  LEU A CD1   
247  C CD2   . LEU A 32  ? 0.7577 1.3139 0.5345 -0.1542 -0.2349 0.0569  32  LEU A CD2   
248  N N     . VAL A 33  ? 0.7686 1.3488 0.5995 -0.1396 -0.2700 0.0356  33  VAL A N     
249  C CA    . VAL A 33  ? 0.7582 1.3512 0.6151 -0.1313 -0.2698 0.0242  33  VAL A CA    
250  C C     . VAL A 33  ? 0.7541 1.3598 0.6084 -0.1375 -0.2616 0.0184  33  VAL A C     
251  O O     . VAL A 33  ? 0.7382 1.3567 0.6090 -0.1338 -0.2502 0.0083  33  VAL A O     
252  C CB    . VAL A 33  ? 0.7718 1.3608 0.6434 -0.1243 -0.2916 0.0248  33  VAL A CB    
253  C CG1   . VAL A 33  ? 0.7596 1.3650 0.6602 -0.1154 -0.2900 0.0117  33  VAL A CG1   
254  C CG2   . VAL A 33  ? 0.7781 1.3526 0.6522 -0.1181 -0.3010 0.0302  33  VAL A CG2   
255  N N     . GLU A 34  ? 0.7695 1.3718 0.6027 -0.1474 -0.2677 0.0247  34  GLU A N     
256  C CA    . GLU A 34  ? 0.7680 1.3807 0.5948 -0.1546 -0.2599 0.0195  34  GLU A CA    
257  C C     . GLU A 34  ? 0.7497 1.3686 0.5754 -0.1559 -0.2375 0.0134  34  GLU A C     
258  O O     . GLU A 34  ? 0.7412 1.3707 0.5752 -0.1567 -0.2290 0.0048  34  GLU A O     
259  C CB    . GLU A 34  ? 0.7887 1.3958 0.5885 -0.1660 -0.2684 0.0281  34  GLU A CB    
260  C CG    . GLU A 34  ? 0.7925 1.4096 0.5861 -0.1731 -0.2657 0.0225  34  GLU A CG    
261  C CD    . GLU A 34  ? 0.8034 1.4248 0.6086 -0.1713 -0.2829 0.0206  34  GLU A CD    
262  O OE1   . GLU A 34  ? 0.7935 1.4209 0.6251 -0.1618 -0.2857 0.0138  34  GLU A OE1   
263  O OE2   . GLU A 34  ? 0.8224 1.4422 0.6102 -0.1796 -0.2936 0.0255  34  GLU A OE2   
264  N N     . ALA A 35  ? 0.7448 1.3564 0.5607 -0.1561 -0.2291 0.0181  35  ALA A N     
265  C CA    . ALA A 35  ? 0.7286 1.3442 0.5435 -0.1564 -0.2091 0.0133  35  ALA A CA    
266  C C     . ALA A 35  ? 0.7107 1.3318 0.5490 -0.1470 -0.2010 0.0060  35  ALA A C     
267  O O     . ALA A 35  ? 0.6999 1.3307 0.5488 -0.1464 -0.1908 -0.0021 35  ALA A O     
268  C CB    . ALA A 35  ? 0.7313 1.3380 0.5267 -0.1604 -0.2041 0.0212  35  ALA A CB    
269  N N     . PHE A 36  ? 0.7090 1.3241 0.5548 -0.1401 -0.2060 0.0091  36  PHE A N     
270  C CA    . PHE A 36  ? 0.6925 1.3120 0.5559 -0.1319 -0.1961 0.0032  36  PHE A CA    
271  C C     . PHE A 36  ? 0.6893 1.3162 0.5782 -0.1228 -0.2040 -0.0033 36  PHE A C     
272  O O     . PHE A 36  ? 0.6770 1.3088 0.5806 -0.1159 -0.1964 -0.0086 36  PHE A O     
273  C CB    . PHE A 36  ? 0.6913 1.3001 0.5461 -0.1300 -0.1938 0.0096  36  PHE A CB    
274  C CG    . PHE A 36  ? 0.6940 1.2972 0.5254 -0.1384 -0.1858 0.0157  36  PHE A CG    
275  C CD1   . PHE A 36  ? 0.6856 1.2953 0.5118 -0.1427 -0.1708 0.0112  36  PHE A CD1   
276  C CD2   . PHE A 36  ? 0.7057 1.2976 0.5209 -0.1421 -0.1933 0.0255  36  PHE A CD2   
277  C CE1   . PHE A 36  ? 0.6883 1.2945 0.4947 -0.1495 -0.1634 0.0154  36  PHE A CE1   
278  C CE2   . PHE A 36  ? 0.7081 1.2976 0.5029 -0.1500 -0.1853 0.0303  36  PHE A CE2   
279  C CZ    . PHE A 36  ? 0.6990 1.2963 0.4899 -0.1532 -0.1702 0.0247  36  PHE A CZ    
280  N N     . GLY A 37  ? 0.7009 1.3296 0.5953 -0.1226 -0.2191 -0.0035 37  GLY A N     
281  C CA    . GLY A 37  ? 0.6996 1.3364 0.6193 -0.1134 -0.2283 -0.0103 37  GLY A CA    
282  C C     . GLY A 37  ? 0.7056 1.3323 0.6309 -0.1053 -0.2399 -0.0069 37  GLY A C     
283  O O     . GLY A 37  ? 0.7139 1.3257 0.6217 -0.1082 -0.2437 0.0023  37  GLY A O     
284  N N     . GLU A 38  ? 0.7013 1.3369 0.6517 -0.0953 -0.2447 -0.0153 38  GLU A N     
285  C CA    . GLU A 38  ? 0.7101 1.3367 0.6700 -0.0861 -0.2595 -0.0141 38  GLU A CA    
286  C C     . GLU A 38  ? 0.7037 1.3224 0.6611 -0.0819 -0.2523 -0.0129 38  GLU A C     
287  O O     . GLU A 38  ? 0.7114 1.3220 0.6772 -0.0740 -0.2644 -0.0128 38  GLU A O     
288  C CB    . GLU A 38  ? 0.7068 1.3486 0.6975 -0.0754 -0.2660 -0.0261 38  GLU A CB    
289  C CG    . GLU A 38  ? 0.7245 1.3572 0.7247 -0.0679 -0.2897 -0.0244 38  GLU A CG    
290  C CD    . GLU A 38  ? 0.7193 1.3651 0.7511 -0.0542 -0.2937 -0.0375 38  GLU A CD    
291  O OE1   . GLU A 38  ? 0.7280 1.3803 0.7769 -0.0488 -0.3087 -0.0422 38  GLU A OE1   
292  O OE2   . GLU A 38  ? 0.7069 1.3580 0.7471 -0.0487 -0.2818 -0.0437 38  GLU A OE2   
293  N N     . GLN A 39  ? 0.6907 1.3115 0.6374 -0.0868 -0.2336 -0.0123 39  GLN A N     
294  C CA    . GLN A 39  ? 0.6823 1.2988 0.6287 -0.0827 -0.2247 -0.0127 39  GLN A CA    
295  C C     . GLN A 39  ? 0.6951 1.2912 0.6228 -0.0854 -0.2337 -0.0012 39  GLN A C     
296  O O     . GLN A 39  ? 0.6943 1.2835 0.6252 -0.0798 -0.2345 -0.0013 39  GLN A O     
297  C CB    . GLN A 39  ? 0.6659 1.2901 0.6058 -0.0875 -0.2028 -0.0148 39  GLN A CB    
298  C CG    . GLN A 39  ? 0.6559 1.2975 0.6061 -0.0899 -0.1925 -0.0227 39  GLN A CG    
299  C CD    . GLN A 39  ? 0.6542 1.3109 0.6311 -0.0820 -0.1986 -0.0331 39  GLN A CD    
300  O OE1   . GLN A 39  ? 0.6630 1.3228 0.6462 -0.0821 -0.2108 -0.0341 39  GLN A OE1   
301  N NE2   . GLN A 39  ? 0.6435 1.3108 0.6362 -0.0753 -0.1902 -0.0412 39  GLN A NE2   
302  N N     . VAL A 40  ? 0.7080 1.2951 0.6164 -0.0945 -0.2410 0.0082  40  VAL A N     
303  C CA    . VAL A 40  ? 0.7209 1.2903 0.6076 -0.1006 -0.2474 0.0205  40  VAL A CA    
304  C C     . VAL A 40  ? 0.7370 1.2920 0.6292 -0.0947 -0.2673 0.0246  40  VAL A C     
305  O O     . VAL A 40  ? 0.7401 1.2987 0.6527 -0.0856 -0.2782 0.0178  40  VAL A O     
306  C CB    . VAL A 40  ? 0.7318 1.2984 0.5966 -0.1127 -0.2497 0.0288  40  VAL A CB    
307  C CG1   . VAL A 40  ? 0.7174 1.2968 0.5772 -0.1180 -0.2308 0.0240  40  VAL A CG1   
308  C CG2   . VAL A 40  ? 0.7480 1.3131 0.6169 -0.1127 -0.2685 0.0304  40  VAL A CG2   
309  N N     . PRO A 41  ? 0.7483 1.2867 0.6228 -0.0998 -0.2726 0.0355  41  PRO A N     
310  C CA    . PRO A 41  ? 0.7638 1.2863 0.6441 -0.0938 -0.2910 0.0391  41  PRO A CA    
311  C C     . PRO A 41  ? 0.7859 1.2993 0.6663 -0.0944 -0.3135 0.0447  41  PRO A C     
312  O O     . PRO A 41  ? 0.7903 1.3095 0.6632 -0.1010 -0.3152 0.0469  41  PRO A O     
313  C CB    . PRO A 41  ? 0.7704 1.2785 0.6290 -0.1019 -0.2890 0.0505  41  PRO A CB    
314  C CG    . PRO A 41  ? 0.7534 1.2729 0.6005 -0.1087 -0.2671 0.0494  41  PRO A CG    
315  C CD    . PRO A 41  ? 0.7476 1.2815 0.5976 -0.1108 -0.2619 0.0442  41  PRO A CD    
316  N N     . THR A 42  ? 0.8009 1.2991 0.6892 -0.0877 -0.3314 0.0469  42  THR A N     
317  C CA    . THR A 42  ? 0.8250 1.3109 0.7138 -0.0875 -0.3556 0.0533  42  THR A CA    
318  C C     . THR A 42  ? 0.8439 1.3167 0.7023 -0.1029 -0.3624 0.0700  42  THR A C     
319  O O     . THR A 42  ? 0.8391 1.3107 0.6780 -0.1125 -0.3494 0.0763  42  THR A O     
320  C CB    . THR A 42  ? 0.8382 1.3083 0.7420 -0.0766 -0.3734 0.0520  42  THR A CB    
321  O OG1   . THR A 42  ? 0.8412 1.2970 0.7315 -0.0807 -0.3703 0.0593  42  THR A OG1   
322  C CG2   . THR A 42  ? 0.8223 1.3073 0.7573 -0.0609 -0.3686 0.0343  42  THR A CG2   
323  N N     . VAL A 43  ? 0.8661 1.3300 0.7209 -0.1054 -0.3828 0.0769  43  VAL A N     
324  C CA    . VAL A 43  ? 0.8893 1.3388 0.7153 -0.1202 -0.3931 0.0938  43  VAL A CA    
325  C C     . VAL A 43  ? 0.9032 1.3316 0.7186 -0.1233 -0.4009 0.1043  43  VAL A C     
326  O O     . VAL A 43  ? 0.9140 1.3351 0.7032 -0.1374 -0.3992 0.1171  43  VAL A O     
327  C CB    . VAL A 43  ? 0.9132 1.3557 0.7390 -0.1212 -0.4166 0.0994  43  VAL A CB    
328  C CG1   . VAL A 43  ? 0.9325 1.3557 0.7737 -0.1110 -0.4409 0.1011  43  VAL A CG1   
329  C CG2   . VAL A 43  ? 0.9328 1.3689 0.7261 -0.1390 -0.4211 0.1151  43  VAL A CG2   
330  N N     . LYS A 44  ? 0.9038 1.3232 0.7398 -0.1104 -0.4094 0.0982  44  LYS A N     
331  C CA    . LYS A 44  ? 0.9198 1.3169 0.7486 -0.1122 -0.4201 0.1074  44  LYS A CA    
332  C C     . LYS A 44  ? 0.9066 1.3066 0.7194 -0.1206 -0.4003 0.1108  44  LYS A C     
333  O O     . LYS A 44  ? 0.9234 1.3080 0.7159 -0.1317 -0.4064 0.1245  44  LYS A O     
334  C CB    . LYS A 44  ? 0.9210 1.3100 0.7776 -0.0951 -0.4315 0.0971  44  LYS A CB    
335  C CG    . LYS A 44  ? 0.9413 1.3043 0.7922 -0.0962 -0.4462 0.1063  44  LYS A CG    
336  C CD    . LYS A 44  ? 0.9764 1.3160 0.8093 -0.1065 -0.4710 0.1241  44  LYS A CD    
337  C CE    . LYS A 44  ? 0.9974 1.3099 0.8281 -0.1062 -0.4868 0.1319  44  LYS A CE    
338  N NZ    . LYS A 44  ? 1.0334 1.3215 0.8429 -0.1190 -0.5101 0.1517  44  LYS A NZ    
339  N N     . THR A 45  ? 0.8777 1.2976 0.6994 -0.1159 -0.3771 0.0987  45  THR A N     
340  C CA    . THR A 45  ? 0.8645 1.2883 0.6721 -0.1233 -0.3581 0.1012  45  THR A CA    
341  C C     . THR A 45  ? 0.8695 1.2979 0.6495 -0.1400 -0.3509 0.1121  45  THR A C     
342  O O     . THR A 45  ? 0.8748 1.2968 0.6363 -0.1502 -0.3467 0.1215  45  THR A O     
343  C CB    . THR A 45  ? 0.8341 1.2763 0.6580 -0.1139 -0.3361 0.0862  45  THR A CB    
344  O OG1   . THR A 45  ? 0.8205 1.2814 0.6544 -0.1104 -0.3279 0.0767  45  THR A OG1   
345  C CG2   . THR A 45  ? 0.8315 1.2677 0.6778 -0.0996 -0.3420 0.0771  45  THR A CG2   
346  N N     . CYS A 46  ? 0.8696 1.3090 0.6465 -0.1432 -0.3503 0.1106  46  CYS A N     
347  C CA    . CYS A 46  ? 0.8775 1.3215 0.6276 -0.1591 -0.3452 0.1203  46  CYS A CA    
348  C C     . CYS A 46  ? 0.9073 1.3316 0.6362 -0.1711 -0.3626 0.1376  46  CYS A C     
349  O O     . CYS A 46  ? 0.9111 1.3358 0.6186 -0.1838 -0.3547 0.1462  46  CYS A O     
350  C CB    . CYS A 46  ? 0.8771 1.3336 0.6281 -0.1601 -0.3458 0.1160  46  CYS A CB    
351  S SG    . CYS A 46  ? 0.8446 1.3242 0.6196 -0.1482 -0.3261 0.0967  46  CYS A SG    
352  N N     . GLU A 47  ? 0.9287 1.3362 0.6646 -0.1668 -0.3865 0.1424  47  GLU A N     
353  C CA    . GLU A 47  ? 0.9606 1.3458 0.6783 -0.1775 -0.4066 0.1597  47  GLU A CA    
354  C C     . GLU A 47  ? 0.9615 1.3361 0.6720 -0.1818 -0.4022 0.1657  47  GLU A C     
355  O O     . GLU A 47  ? 0.9805 1.3462 0.6669 -0.1972 -0.4066 0.1804  47  GLU A O     
356  C CB    . GLU A 47  ? 0.9817 1.3490 0.7142 -0.1684 -0.4336 0.1613  47  GLU A CB    
357  C CG    . GLU A 47  ? 0.9889 1.3632 0.7240 -0.1673 -0.4431 0.1596  47  GLU A CG    
358  C CD    . GLU A 47  ? 1.0026 1.3643 0.7605 -0.1537 -0.4669 0.1560  47  GLU A CD    
359  O OE1   . GLU A 47  ? 1.0021 1.3525 0.7785 -0.1421 -0.4737 0.1510  47  GLU A OE1   
360  O OE2   . GLU A 47  ? 1.0144 1.3784 0.7723 -0.1543 -0.4790 0.1574  47  GLU A OE2   
361  N N     . ARG A 48  ? 0.9416 1.3182 0.6726 -0.1688 -0.3934 0.1541  48  ARG A N     
362  C CA    . ARG A 48  ? 0.9395 1.3079 0.6664 -0.1713 -0.3879 0.1576  48  ARG A CA    
363  C C     . ARG A 48  ? 0.9275 1.3105 0.6345 -0.1841 -0.3665 0.1610  48  ARG A C     
364  O O     . ARG A 48  ? 0.9434 1.3178 0.6304 -0.1977 -0.3698 0.1741  48  ARG A O     
365  C CB    . ARG A 48  ? 0.9201 1.2899 0.6738 -0.1539 -0.3824 0.1428  48  ARG A CB    
366  C CG    . ARG A 48  ? 0.9379 1.2872 0.7088 -0.1430 -0.4059 0.1418  48  ARG A CG    
367  C CD    . ARG A 48  ? 0.9174 1.2765 0.7185 -0.1237 -0.4005 0.1230  48  ARG A CD    
368  N NE    . ARG A 48  ? 0.9352 1.2755 0.7541 -0.1122 -0.4232 0.1204  48  ARG A NE    
369  C CZ    . ARG A 48  ? 0.9255 1.2725 0.7723 -0.0950 -0.4256 0.1046  48  ARG A CZ    
370  N NH1   . ARG A 48  ? 0.8981 1.2701 0.7584 -0.0877 -0.4067 0.0905  48  ARG A NH1   
371  N NH2   . ARG A 48  ? 0.9446 1.2733 0.8067 -0.0850 -0.4477 0.1027  48  ARG A NH2   
372  N N     . TRP A 49  ? 0.9012 1.3063 0.6138 -0.1801 -0.3456 0.1494  49  TRP A N     
373  C CA    . TRP A 49  ? 0.8891 1.3095 0.5850 -0.1907 -0.3250 0.1508  49  TRP A CA    
374  C C     . TRP A 49  ? 0.9102 1.3305 0.5781 -0.2090 -0.3293 0.1647  49  TRP A C     
375  O O     . TRP A 49  ? 0.9108 1.3361 0.5621 -0.2203 -0.3193 0.1708  49  TRP A O     
376  C CB    . TRP A 49  ? 0.8613 1.3039 0.5679 -0.1834 -0.3049 0.1363  49  TRP A CB    
377  C CG    . TRP A 49  ? 0.8387 1.2853 0.5654 -0.1704 -0.2937 0.1247  49  TRP A CG    
378  C CD1   . TRP A 49  ? 0.8281 1.2758 0.5789 -0.1555 -0.2962 0.1133  49  TRP A CD1   
379  C CD2   . TRP A 49  ? 0.8253 1.2759 0.5495 -0.1716 -0.2789 0.1234  49  TRP A CD2   
380  N NE1   . TRP A 49  ? 0.8092 1.2613 0.5716 -0.1477 -0.2834 0.1051  49  TRP A NE1   
381  C CE2   . TRP A 49  ? 0.8071 1.2605 0.5535 -0.1571 -0.2730 0.1113  49  TRP A CE2   
382  C CE3   . TRP A 49  ? 0.8274 1.2807 0.5329 -0.1836 -0.2702 0.1311  49  TRP A CE3   
383  C CZ2   . TRP A 49  ? 0.7915 1.2490 0.5411 -0.1543 -0.2592 0.1072  49  TRP A CZ2   
384  C CZ3   . TRP A 49  ? 0.8111 1.2689 0.5212 -0.1803 -0.2566 0.1267  49  TRP A CZ3   
385  C CH2   . TRP A 49  ? 0.7936 1.2527 0.5252 -0.1657 -0.2515 0.1151  49  TRP A CH2   
386  N N     . PHE A 50  ? 0.9281 1.3439 0.5909 -0.2119 -0.3442 0.1695  50  PHE A N     
387  C CA    . PHE A 50  ? 0.9532 1.3668 0.5884 -0.2298 -0.3519 0.1839  50  PHE A CA    
388  C C     . PHE A 50  ? 0.9774 1.3724 0.5976 -0.2411 -0.3645 0.1998  50  PHE A C     
389  O O     . PHE A 50  ? 0.9895 1.3893 0.5856 -0.2578 -0.3605 0.2101  50  PHE A O     
390  C CB    . PHE A 50  ? 0.9695 1.3797 0.6039 -0.2296 -0.3682 0.1861  50  PHE A CB    
391  C CG    . PHE A 50  ? 0.9554 1.3875 0.5878 -0.2300 -0.3545 0.1768  50  PHE A CG    
392  C CD1   . PHE A 50  ? 0.9240 1.3742 0.5703 -0.2211 -0.3323 0.1616  50  PHE A CD1   
393  C CD2   . PHE A 50  ? 0.9751 1.4090 0.5914 -0.2396 -0.3644 0.1834  50  PHE A CD2   
394  C CE1   . PHE A 50  ? 0.9131 1.3814 0.5577 -0.2219 -0.3208 0.1531  50  PHE A CE1   
395  C CE2   . PHE A 50  ? 0.9635 1.4168 0.5779 -0.2402 -0.3525 0.1743  50  PHE A CE2   
396  C CZ    . PHE A 50  ? 0.9325 1.4026 0.5615 -0.2312 -0.3307 0.1590  50  PHE A CZ    
397  N N     . GLN A 51  ? 0.9848 1.3596 0.6195 -0.2323 -0.3794 0.2012  51  GLN A N     
398  C CA    . GLN A 51  ? 1.0067 1.3623 0.6295 -0.2423 -0.3909 0.2153  51  GLN A CA    
399  C C     . GLN A 51  ? 0.9915 1.3590 0.6064 -0.2490 -0.3706 0.2147  51  GLN A C     
400  O O     . GLN A 51  ? 1.0087 1.3742 0.6014 -0.2661 -0.3717 0.2279  51  GLN A O     
401  C CB    . GLN A 51  ? 1.0148 1.3471 0.6576 -0.2294 -0.4090 0.2139  51  GLN A CB    
402  C CG    . GLN A 51  ? 1.0342 1.3521 0.6854 -0.2228 -0.4325 0.2157  51  GLN A CG    
403  C CD    . GLN A 51  ? 1.0459 1.3395 0.7163 -0.2106 -0.4520 0.2145  51  GLN A CD    
404  O OE1   . GLN A 51  ? 1.0349 1.3246 0.7160 -0.2044 -0.4461 0.2091  51  GLN A OE1   
405  N NE2   . GLN A 51  ? 1.0691 1.3465 0.7446 -0.2067 -0.4761 0.2189  51  GLN A NE2   
406  N N     . ARG A 52  ? 0.9603 1.3411 0.5933 -0.2362 -0.3524 0.1995  52  ARG A N     
407  C CA    . ARG A 52  ? 0.9441 1.3370 0.5721 -0.2408 -0.3329 0.1975  52  ARG A CA    
408  C C     . ARG A 52  ? 0.9424 1.3556 0.5493 -0.2552 -0.3180 0.2007  52  ARG A C     
409  O O     . ARG A 52  ? 0.9444 1.3629 0.5383 -0.2664 -0.3097 0.2067  52  ARG A O     
410  C CB    . ARG A 52  ? 0.9119 1.3153 0.5630 -0.2242 -0.3167 0.1806  52  ARG A CB    
411  C CG    . ARG A 52  ? 0.9115 1.2992 0.5764 -0.2159 -0.3233 0.1792  52  ARG A CG    
412  C CD    . ARG A 52  ? 0.8826 1.2795 0.5723 -0.1976 -0.3109 0.1617  52  ARG A CD    
413  N NE    . ARG A 52  ? 0.8590 1.2734 0.5480 -0.1978 -0.2881 0.1552  52  ARG A NE    
414  C CZ    . ARG A 52  ? 0.8369 1.2571 0.5435 -0.1850 -0.2770 0.1430  52  ARG A CZ    
415  N NH1   . ARG A 52  ? 0.8342 1.2458 0.5610 -0.1707 -0.2855 0.1347  52  ARG A NH1   
416  N NH2   . ARG A 52  ? 0.8178 1.2533 0.5221 -0.1863 -0.2574 0.1385  52  ARG A NH2   
417  N N     . PHE A 53  ? 0.9386 1.3643 0.5430 -0.2546 -0.3141 0.1957  53  PHE A N     
418  C CA    . PHE A 53  ? 0.9392 1.3845 0.5234 -0.2679 -0.3010 0.1976  53  PHE A CA    
419  C C     . PHE A 53  ? 0.9719 1.4098 0.5295 -0.2876 -0.3139 0.2155  53  PHE A C     
420  O O     . PHE A 53  ? 0.9748 1.4264 0.5147 -0.3012 -0.3026 0.2199  53  PHE A O     
421  C CB    . PHE A 53  ? 0.9288 1.3883 0.5168 -0.2626 -0.2948 0.1874  53  PHE A CB    
422  C CG    . PHE A 53  ? 0.8986 1.3661 0.5117 -0.2447 -0.2824 0.1705  53  PHE A CG    
423  C CD1   . PHE A 53  ? 0.8764 1.3497 0.5006 -0.2378 -0.2670 0.1629  53  PHE A CD1   
424  C CD2   . PHE A 53  ? 0.8934 1.3635 0.5182 -0.2356 -0.2861 0.1624  53  PHE A CD2   
425  C CE1   . PHE A 53  ? 0.8508 1.3315 0.4964 -0.2226 -0.2560 0.1483  53  PHE A CE1   
426  C CE2   . PHE A 53  ? 0.8672 1.3455 0.5143 -0.2207 -0.2747 0.1475  53  PHE A CE2   
427  C CZ    . PHE A 53  ? 0.8464 1.3298 0.5032 -0.2145 -0.2597 0.1407  53  PHE A CZ    
428  N N     . LYS A 54  ? 0.9973 1.4140 0.5523 -0.2894 -0.3375 0.2258  54  LYS A N     
429  C CA    . LYS A 54  ? 1.0324 1.4380 0.5618 -0.3088 -0.3529 0.2451  54  LYS A CA    
430  C C     . LYS A 54  ? 1.0408 1.4395 0.5618 -0.3192 -0.3521 0.2549  54  LYS A C     
431  O O     . LYS A 54  ? 1.0653 1.4635 0.5620 -0.3385 -0.3570 0.2696  54  LYS A O     
432  C CB    . LYS A 54  ? 1.0589 1.4404 0.5894 -0.3070 -0.3803 0.2541  54  LYS A CB    
433  C CG    . LYS A 54  ? 1.0626 1.4527 0.5892 -0.3062 -0.3838 0.2508  54  LYS A CG    
434  C CD    . LYS A 54  ? 1.0928 1.4597 0.6174 -0.3067 -0.4123 0.2616  54  LYS A CD    
435  C CE    . LYS A 54  ? 1.0931 1.4704 0.6168 -0.3040 -0.4146 0.2562  54  LYS A CE    
436  N NZ    . LYS A 54  ? 1.1263 1.4830 0.6435 -0.3075 -0.4429 0.2687  54  LYS A NZ    
437  N N     . SER A 55  ? 1.0213 1.4156 0.5620 -0.3070 -0.3460 0.2469  55  SER A N     
438  C CA    . SER A 55  ? 1.0217 1.4156 0.5570 -0.3153 -0.3397 0.2524  55  SER A CA    
439  C C     . SER A 55  ? 0.9906 1.4112 0.5308 -0.3120 -0.3124 0.2396  55  SER A C     
440  O O     . SER A 55  ? 0.9769 1.3969 0.5275 -0.3071 -0.3049 0.2356  55  SER A O     
441  C CB    . SER A 55  ? 1.0243 1.3936 0.5772 -0.3049 -0.3531 0.2529  55  SER A CB    
442  O OG    . SER A 55  ? 0.9933 1.3683 0.5717 -0.2848 -0.3418 0.2354  55  SER A OG    
443  N N     . GLY A 56  ? 0.9804 1.4234 0.5136 -0.3142 -0.2983 0.2328  56  GLY A N     
444  C CA    . GLY A 56  ? 0.9536 1.4221 0.4902 -0.3115 -0.2733 0.2207  56  GLY A CA    
445  C C     . GLY A 56  ? 0.9238 1.3946 0.4840 -0.2948 -0.2611 0.2073  56  GLY A C     
446  O O     . GLY A 56  ? 0.9077 1.3957 0.4681 -0.2959 -0.2433 0.2015  56  GLY A O     
447  N N     . ASP A 57  ? 0.9174 1.3718 0.4973 -0.2794 -0.2705 0.2022  57  ASP A N     
448  C CA    . ASP A 57  ? 0.8909 1.3470 0.4927 -0.2636 -0.2600 0.1896  57  ASP A CA    
449  C C     . ASP A 57  ? 0.8683 1.3380 0.4831 -0.2508 -0.2483 0.1749  57  ASP A C     
450  O O     . ASP A 57  ? 0.8655 1.3265 0.4946 -0.2392 -0.2567 0.1696  57  ASP A O     
451  C CB    . ASP A 57  ? 0.8976 1.3296 0.5138 -0.2544 -0.2764 0.1915  57  ASP A CB    
452  C CG    . ASP A 57  ? 0.8717 1.3062 0.5091 -0.2389 -0.2654 0.1787  57  ASP A CG    
453  O OD1   . ASP A 57  ? 0.8478 1.3011 0.4910 -0.2333 -0.2464 0.1679  57  ASP A OD1   
454  O OD2   . ASP A 57  ? 0.8767 1.2937 0.5247 -0.2325 -0.2764 0.1794  57  ASP A OD2   
455  N N     . PHE A 58  ? 0.8526 1.3438 0.4633 -0.2529 -0.2290 0.1679  58  PHE A N     
456  C CA    . PHE A 58  ? 0.8314 1.3360 0.4535 -0.2422 -0.2164 0.1539  58  PHE A CA    
457  C C     . PHE A 58  ? 0.8052 1.3138 0.4467 -0.2282 -0.2035 0.1423  58  PHE A C     
458  O O     . PHE A 58  ? 0.7866 1.3087 0.4356 -0.2213 -0.1895 0.1312  58  PHE A O     
459  C CB    . PHE A 58  ? 0.8318 1.3564 0.4384 -0.2520 -0.2042 0.1523  58  PHE A CB    
460  C CG    . PHE A 58  ? 0.8581 1.3803 0.4444 -0.2662 -0.2162 0.1633  58  PHE A CG    
461  C CD1   . PHE A 58  ? 0.8663 1.3829 0.4536 -0.2635 -0.2271 0.1628  58  PHE A CD1   
462  C CD2   . PHE A 58  ? 0.8761 1.4017 0.4422 -0.2828 -0.2175 0.1747  58  PHE A CD2   
463  C CE1   . PHE A 58  ? 0.8923 1.4061 0.4598 -0.2768 -0.2393 0.1736  58  PHE A CE1   
464  C CE2   . PHE A 58  ? 0.9025 1.4261 0.4481 -0.2970 -0.2291 0.1857  58  PHE A CE2   
465  C CZ    . PHE A 58  ? 0.9109 1.4280 0.4568 -0.2939 -0.2403 0.1854  58  PHE A CZ    
466  N N     . ASP A 59  ? 0.8051 1.3015 0.4542 -0.2244 -0.2088 0.1449  59  ASP A N     
467  C CA    . ASP A 59  ? 0.7831 1.2807 0.4512 -0.2104 -0.1999 0.1343  59  ASP A CA    
468  C C     . ASP A 59  ? 0.7761 1.2701 0.4601 -0.1977 -0.2043 0.1259  59  ASP A C     
469  O O     . ASP A 59  ? 0.7907 1.2716 0.4767 -0.1967 -0.2207 0.1300  59  ASP A O     
470  C CB    . ASP A 59  ? 0.7876 1.2713 0.4602 -0.2090 -0.2070 0.1388  59  ASP A CB    
471  C CG    . ASP A 59  ? 0.7656 1.2521 0.4560 -0.1954 -0.1970 0.1279  59  ASP A CG    
472  O OD1   . ASP A 59  ? 0.7464 1.2480 0.4419 -0.1903 -0.1810 0.1188  59  ASP A OD1   
473  O OD2   . ASP A 59  ? 0.7691 1.2420 0.4680 -0.1901 -0.2057 0.1285  59  ASP A OD2   
474  N N     . VAL A 60  ? 0.7546 1.2609 0.4498 -0.1887 -0.1898 0.1142  60  VAL A N     
475  C CA    . VAL A 60  ? 0.7451 1.2517 0.4568 -0.1769 -0.1910 0.1048  60  VAL A CA    
476  C C     . VAL A 60  ? 0.7344 1.2347 0.4644 -0.1643 -0.1915 0.0984  60  VAL A C     
477  O O     . VAL A 60  ? 0.7359 1.2299 0.4793 -0.1558 -0.2008 0.0942  60  VAL A O     
478  C CB    . VAL A 60  ? 0.7305 1.2540 0.4428 -0.1758 -0.1757 0.0963  60  VAL A CB    
479  C CG1   . VAL A 60  ? 0.7148 1.2418 0.4466 -0.1630 -0.1713 0.0850  60  VAL A CG1   
480  C CG2   . VAL A 60  ? 0.7442 1.2719 0.4419 -0.1857 -0.1800 0.1007  60  VAL A CG2   
481  N N     . ASP A 61  ? 0.7247 1.2273 0.4554 -0.1634 -0.1820 0.0973  61  ASP A N     
482  C CA    . ASP A 61  ? 0.7165 1.2134 0.4622 -0.1527 -0.1826 0.0916  61  ASP A CA    
483  C C     . ASP A 61  ? 0.7337 1.2125 0.4829 -0.1511 -0.2016 0.0965  61  ASP A C     
484  O O     . ASP A 61  ? 0.7525 1.2213 0.4890 -0.1609 -0.2129 0.1074  61  ASP A O     
485  C CB    . ASP A 61  ? 0.7075 1.2085 0.4497 -0.1544 -0.1715 0.0920  61  ASP A CB    
486  C CG    . ASP A 61  ? 0.6898 1.2074 0.4318 -0.1535 -0.1530 0.0856  61  ASP A CG    
487  O OD1   . ASP A 61  ? 0.6825 1.2075 0.4298 -0.1496 -0.1481 0.0794  61  ASP A OD1   
488  O OD2   . ASP A 61  ? 0.6840 1.2067 0.4211 -0.1564 -0.1440 0.0868  61  ASP A OD2   
489  N N     . ASP A 62  ? 0.7282 1.2030 0.4948 -0.1389 -0.2051 0.0882  62  ASP A N     
490  C CA    . ASP A 62  ? 0.7441 1.2013 0.5167 -0.1353 -0.2231 0.0908  62  ASP A CA    
491  C C     . ASP A 62  ? 0.7534 1.2005 0.5157 -0.1426 -0.2263 0.0992  62  ASP A C     
492  O O     . ASP A 62  ? 0.7422 1.1980 0.4991 -0.1459 -0.2128 0.0991  62  ASP A O     
493  C CB    . ASP A 62  ? 0.7345 1.1923 0.5283 -0.1203 -0.2233 0.0782  62  ASP A CB    
494  C CG    . ASP A 62  ? 0.7267 1.1946 0.5333 -0.1126 -0.2217 0.0693  62  ASP A CG    
495  O OD1   . ASP A 62  ? 0.7293 1.2021 0.5285 -0.1186 -0.2215 0.0729  62  ASP A OD1   
496  O OD2   . ASP A 62  ? 0.7184 1.1903 0.5426 -0.1010 -0.2205 0.0583  62  ASP A OD2   
497  N N     . LYS A 63  ? 0.7749 1.2034 0.5350 -0.1454 -0.2450 0.1067  63  LYS A N     
498  C CA    . LYS A 63  ? 0.7841 1.2001 0.5407 -0.1486 -0.2507 0.1118  63  LYS A CA    
499  C C     . LYS A 63  ? 0.7702 1.1879 0.5447 -0.1344 -0.2458 0.0989  63  LYS A C     
500  O O     . LYS A 63  ? 0.7628 1.1846 0.5527 -0.1228 -0.2461 0.0885  63  LYS A O     
501  C CB    . LYS A 63  ? 0.8124 1.2058 0.5642 -0.1538 -0.2737 0.1222  63  LYS A CB    
502  C CG    . LYS A 63  ? 0.8291 1.2206 0.5614 -0.1691 -0.2797 0.1359  63  LYS A CG    
503  C CD    . LYS A 63  ? 0.8327 1.2279 0.5468 -0.1841 -0.2725 0.1461  63  LYS A CD    
504  C CE    . LYS A 63  ? 0.8504 1.2460 0.5440 -0.2002 -0.2776 0.1594  63  LYS A CE    
505  N NZ    . LYS A 63  ? 0.8361 1.2529 0.5245 -0.2021 -0.2625 0.1553  63  LYS A NZ    
506  N N     . GLU A 64  ? 0.7668 1.1829 0.5394 -0.1358 -0.2409 0.0992  64  GLU A N     
507  C CA    . GLU A 64  ? 0.7532 1.1731 0.5405 -0.1235 -0.2343 0.0870  64  GLU A CA    
508  C C     . GLU A 64  ? 0.7646 1.1705 0.5673 -0.1124 -0.2504 0.0803  64  GLU A C     
509  O O     . GLU A 64  ? 0.7860 1.1726 0.5859 -0.1159 -0.2679 0.0873  64  GLU A O     
510  C CB    . GLU A 64  ? 0.7514 1.1699 0.5322 -0.1283 -0.2289 0.0901  64  GLU A CB    
511  C CG    . GLU A 64  ? 0.7345 1.1617 0.5268 -0.1176 -0.2179 0.0780  64  GLU A CG    
512  C CD    . GLU A 64  ? 0.7401 1.1585 0.5302 -0.1196 -0.2209 0.0798  64  GLU A CD    
513  O OE1   . GLU A 64  ? 0.7603 1.1601 0.5479 -0.1236 -0.2372 0.0861  64  GLU A OE1   
514  O OE2   . GLU A 64  ? 0.7252 1.1548 0.5161 -0.1173 -0.2074 0.0749  64  GLU A OE2   
515  N N     . HIS A 65  ? 0.7513 1.1674 0.5703 -0.0994 -0.2446 0.0666  65  HIS A N     
516  C CA    . HIS A 65  ? 0.7608 1.1676 0.5970 -0.0874 -0.2587 0.0578  65  HIS A CA    
517  C C     . HIS A 65  ? 0.7680 1.1630 0.6098 -0.0823 -0.2652 0.0535  65  HIS A C     
518  O O     . HIS A 65  ? 0.7631 1.1591 0.5965 -0.0876 -0.2572 0.0565  65  HIS A O     
519  C CB    . HIS A 65  ? 0.7440 1.1686 0.5968 -0.0754 -0.2492 0.0434  65  HIS A CB    
520  C CG    . HIS A 65  ? 0.7336 1.1724 0.5824 -0.0795 -0.2398 0.0453  65  HIS A CG    
521  N ND1   . HIS A 65  ? 0.7140 1.1702 0.5575 -0.0825 -0.2199 0.0437  65  HIS A ND1   
522  C CD2   . HIS A 65  ? 0.7409 1.1788 0.5906 -0.0808 -0.2481 0.0481  65  HIS A CD2   
523  C CE1   . HIS A 65  ? 0.7099 1.1748 0.5511 -0.0856 -0.2163 0.0453  65  HIS A CE1   
524  N NE2   . HIS A 65  ? 0.7255 1.1803 0.5703 -0.0848 -0.2329 0.0479  65  HIS A NE2   
525  N N     . GLY A 66  ? 0.7799 1.1643 0.6370 -0.0716 -0.2799 0.0454  66  GLY A N     
526  C CA    . GLY A 66  ? 0.7857 1.1613 0.6521 -0.0636 -0.2856 0.0371  66  GLY A CA    
527  C C     . GLY A 66  ? 0.7639 1.1585 0.6345 -0.0582 -0.2662 0.0263  66  GLY A C     
528  O O     . GLY A 66  ? 0.7448 1.1594 0.6158 -0.0575 -0.2499 0.0227  66  GLY A O     
529  N N     . LYS A 67  ? 0.7683 1.1557 0.6413 -0.0548 -0.2686 0.0216  67  LYS A N     
530  C CA    . LYS A 67  ? 0.7509 1.1541 0.6261 -0.0504 -0.2519 0.0122  67  LYS A CA    
531  C C     . LYS A 67  ? 0.7620 1.1542 0.6458 -0.0426 -0.2611 0.0030  67  LYS A C     
532  O O     . LYS A 67  ? 0.7830 1.1530 0.6658 -0.0447 -0.2790 0.0080  67  LYS A O     
533  C CB    . LYS A 67  ? 0.7404 1.1498 0.5981 -0.0626 -0.2384 0.0230  67  LYS A CB    
534  C CG    . LYS A 67  ? 0.7565 1.1473 0.6015 -0.0736 -0.2490 0.0359  67  LYS A CG    
535  C CD    . LYS A 67  ? 0.7543 1.1482 0.5827 -0.0878 -0.2437 0.0508  67  LYS A CD    
536  C CE    . LYS A 67  ? 0.7704 1.1485 0.5860 -0.1000 -0.2530 0.0635  67  LYS A CE    
537  N NZ    . LYS A 67  ? 0.7629 1.1456 0.5752 -0.1015 -0.2441 0.0617  67  LYS A NZ    
538  N N     . PRO A 68  ? 0.7495 1.1566 0.6410 -0.0341 -0.2495 -0.0103 68  PRO A N     
539  C CA    . PRO A 68  ? 0.7607 1.1582 0.6601 -0.0264 -0.2580 -0.0204 68  PRO A CA    
540  C C     . PRO A 68  ? 0.7684 1.1520 0.6538 -0.0363 -0.2610 -0.0104 68  PRO A C     
541  O O     . PRO A 68  ? 0.7563 1.1483 0.6283 -0.0459 -0.2482 -0.0012 68  PRO A O     
542  C CB    . PRO A 68  ? 0.7436 1.1644 0.6512 -0.0174 -0.2416 -0.0356 68  PRO A CB    
543  C CG    . PRO A 68  ? 0.7253 1.1659 0.6315 -0.0196 -0.2267 -0.0336 68  PRO A CG    
544  C CD    . PRO A 68  ? 0.7266 1.1585 0.6179 -0.0325 -0.2283 -0.0159 68  PRO A CD    
545  N N     . PRO A 69  ? 0.7892 1.1516 0.6785 -0.0341 -0.2784 -0.0121 69  PRO A N     
546  C CA    . PRO A 69  ? 0.7978 1.1470 0.6747 -0.0440 -0.2821 -0.0027 69  PRO A CA    
547  C C     . PRO A 69  ? 0.7847 1.1474 0.6593 -0.0421 -0.2678 -0.0103 69  PRO A C     
548  O O     . PRO A 69  ? 0.7768 1.1527 0.6621 -0.0306 -0.2610 -0.0258 69  PRO A O     
549  C CB    . PRO A 69  ? 0.8251 1.1475 0.7096 -0.0402 -0.3057 -0.0049 69  PRO A CB    
550  C CG    . PRO A 69  ? 0.8268 1.1538 0.7307 -0.0241 -0.3106 -0.0218 69  PRO A CG    
551  C CD    . PRO A 69  ? 0.8076 1.1560 0.7130 -0.0230 -0.2970 -0.0218 69  PRO A CD    
552  N N     . LYS A 70  ? 0.7834 1.1436 0.6441 -0.0536 -0.2637 0.0006  70  LYS A N     
553  C CA    . LYS A 70  ? 0.7718 1.1442 0.6285 -0.0532 -0.2508 -0.0045 70  LYS A CA    
554  C C     . LYS A 70  ? 0.7849 1.1474 0.6500 -0.0448 -0.2604 -0.0172 70  LYS A C     
555  O O     . LYS A 70  ? 0.8065 1.1463 0.6740 -0.0458 -0.2787 -0.0154 70  LYS A O     
556  C CB    . LYS A 70  ? 0.7688 1.1408 0.6098 -0.0678 -0.2457 0.0105  70  LYS A CB    
557  C CG    . LYS A 70  ? 0.7539 1.1395 0.5863 -0.0755 -0.2333 0.0209  70  LYS A CG    
558  C CD    . LYS A 70  ? 0.7513 1.1387 0.5697 -0.0891 -0.2280 0.0339  70  LYS A CD    
559  C CE    . LYS A 70  ? 0.7365 1.1389 0.5472 -0.0957 -0.2150 0.0423  70  LYS A CE    
560  N NZ    . LYS A 70  ? 0.7221 1.1396 0.5247 -0.1012 -0.2002 0.0457  70  LYS A NZ    
561  N N     . ARG A 71  ? 0.7731 1.1522 0.6417 -0.0372 -0.2483 -0.0298 71  ARG A N     
562  C CA    . ARG A 71  ? 0.7844 1.1578 0.6612 -0.0282 -0.2554 -0.0445 71  ARG A CA    
563  C C     . ARG A 71  ? 0.7933 1.1547 0.6602 -0.0369 -0.2602 -0.0377 71  ARG A C     
564  O O     . ARG A 71  ? 0.8117 1.1564 0.6833 -0.0337 -0.2742 -0.0441 71  ARG A O     
565  C CB    . ARG A 71  ? 0.7694 1.1666 0.6508 -0.0188 -0.2397 -0.0592 71  ARG A CB    
566  C CG    . ARG A 71  ? 0.7567 1.1713 0.6463 -0.0121 -0.2306 -0.0651 71  ARG A CG    
567  C CD    . ARG A 71  ? 0.7701 1.1759 0.6760 -0.0019 -0.2449 -0.0749 71  ARG A CD    
568  N NE    . ARG A 71  ? 0.7563 1.1823 0.6702 0.0039  -0.2344 -0.0811 71  ARG A NE    
569  C CZ    . ARG A 71  ? 0.7458 1.1943 0.6662 0.0118  -0.2216 -0.0953 71  ARG A CZ    
570  N NH1   . ARG A 71  ? 0.7474 1.2019 0.6668 0.0156  -0.2174 -0.1057 71  ARG A NH1   
571  N NH2   . ARG A 71  ? 0.7343 1.2004 0.6620 0.0155  -0.2129 -0.0992 71  ARG A NH2   
572  N N     . TYR A 72  ? 0.7803 1.1510 0.6341 -0.0478 -0.2483 -0.0255 72  TYR A N     
573  C CA    . TYR A 72  ? 0.7861 1.1489 0.6299 -0.0582 -0.2510 -0.0168 72  TYR A CA    
574  C C     . TYR A 72  ? 0.7780 1.1445 0.6102 -0.0716 -0.2449 0.0009  72  TYR A C     
575  O O     . TYR A 72  ? 0.7649 1.1433 0.5966 -0.0712 -0.2357 0.0039  72  TYR A O     
576  C CB    . TYR A 72  ? 0.7748 1.1536 0.6158 -0.0549 -0.2383 -0.0251 72  TYR A CB    
577  C CG    . TYR A 72  ? 0.7510 1.1540 0.5863 -0.0560 -0.2180 -0.0223 72  TYR A CG    
578  C CD1   . TYR A 72  ? 0.7393 1.1583 0.5812 -0.0464 -0.2080 -0.0323 72  TYR A CD1   
579  C CD2   . TYR A 72  ? 0.7411 1.1513 0.5652 -0.0669 -0.2092 -0.0097 72  TYR A CD2   
580  C CE1   . TYR A 72  ? 0.7196 1.1587 0.5562 -0.0479 -0.1905 -0.0292 72  TYR A CE1   
581  C CE2   . TYR A 72  ? 0.7212 1.1516 0.5408 -0.0673 -0.1920 -0.0074 72  TYR A CE2   
582  C CZ    . TYR A 72  ? 0.7110 1.1547 0.5365 -0.0581 -0.1830 -0.0168 72  TYR A CZ    
583  O OH    . TYR A 72  ? 0.6932 1.1551 0.5142 -0.0589 -0.1669 -0.0141 72  TYR A OH    
584  N N     . GLU A 73  ? 0.7856 1.1436 0.6088 -0.0834 -0.2494 0.0117  73  GLU A N     
585  C CA    . GLU A 73  ? 0.7798 1.1425 0.5919 -0.0972 -0.2440 0.0282  73  GLU A CA    
586  C C     . GLU A 73  ? 0.7649 1.1447 0.5690 -0.1031 -0.2295 0.0319  73  GLU A C     
587  O O     . GLU A 73  ? 0.7643 1.1468 0.5696 -0.0996 -0.2278 0.0245  73  GLU A O     
588  C CB    . GLU A 73  ? 0.8024 1.1426 0.6102 -0.1085 -0.2614 0.0400  73  GLU A CB    
589  C CG    . GLU A 73  ? 0.8147 1.1408 0.6270 -0.1060 -0.2736 0.0420  73  GLU A CG    
590  C CD    . GLU A 73  ? 0.8379 1.1422 0.6436 -0.1190 -0.2904 0.0561  73  GLU A CD    
591  O OE1   . GLU A 73  ? 0.8482 1.1446 0.6484 -0.1285 -0.2957 0.0619  73  GLU A OE1   
592  O OE2   . GLU A 73  ? 0.8465 1.1419 0.6524 -0.1203 -0.2986 0.0617  73  GLU A OE2   
593  N N     . ASP A 74  ? 0.7541 1.1452 0.5504 -0.1120 -0.2200 0.0430  74  ASP A N     
594  C CA    . ASP A 74  ? 0.7390 1.1480 0.5289 -0.1171 -0.2058 0.0467  74  ASP A CA    
595  C C     . ASP A 74  ? 0.7473 1.1517 0.5348 -0.1224 -0.2108 0.0475  74  ASP A C     
596  O O     . ASP A 74  ? 0.7371 1.1537 0.5244 -0.1187 -0.2018 0.0419  74  ASP A O     
597  C CB    . ASP A 74  ? 0.7326 1.1503 0.5146 -0.1280 -0.1992 0.0596  74  ASP A CB    
598  C CG    . ASP A 74  ? 0.7177 1.1477 0.5011 -0.1224 -0.1883 0.0576  74  ASP A CG    
599  O OD1   . ASP A 74  ? 0.7188 1.1441 0.5092 -0.1130 -0.1916 0.0500  74  ASP A OD1   
600  O OD2   . ASP A 74  ? 0.7054 1.1502 0.4836 -0.1275 -0.1768 0.0633  74  ASP A OD2   
601  N N     . ALA A 75  ? 0.7671 1.1532 0.5528 -0.1310 -0.2259 0.0543  75  ALA A N     
602  C CA    . ALA A 75  ? 0.7774 1.1574 0.5609 -0.1376 -0.2323 0.0559  75  ALA A CA    
603  C C     . ALA A 75  ? 0.7853 1.1562 0.5758 -0.1271 -0.2392 0.0420  75  ALA A C     
604  O O     . ALA A 75  ? 0.7888 1.1601 0.5778 -0.1300 -0.2406 0.0404  75  ALA A O     
605  C CB    . ALA A 75  ? 0.7978 1.1608 0.5765 -0.1518 -0.2464 0.0686  75  ALA A CB    
606  N N     . GLU A 76  ? 0.7890 1.1524 0.5872 -0.1151 -0.2440 0.0316  76  GLU A N     
607  C CA    . GLU A 76  ? 0.7948 1.1536 0.6004 -0.1031 -0.2484 0.0156  76  GLU A CA    
608  C C     . GLU A 76  ? 0.7760 1.1570 0.5807 -0.0960 -0.2320 0.0069  76  GLU A C     
609  O O     . GLU A 76  ? 0.7807 1.1613 0.5873 -0.0908 -0.2339 -0.0032 76  GLU A O     
610  C CB    . GLU A 76  ? 0.8032 1.1512 0.6186 -0.0918 -0.2569 0.0060  76  GLU A CB    
611  C CG    . GLU A 76  ? 0.8146 1.1548 0.6387 -0.0801 -0.2649 -0.0110 76  GLU A CG    
612  C CD    . GLU A 76  ? 0.8248 1.1541 0.6605 -0.0688 -0.2750 -0.0209 76  GLU A CD    
613  O OE1   . GLU A 76  ? 0.8288 1.1499 0.6656 -0.0716 -0.2808 -0.0127 76  GLU A OE1   
614  O OE2   . GLU A 76  ? 0.8295 1.1594 0.6735 -0.0568 -0.2773 -0.0376 76  GLU A OE2   
615  N N     . LEU A 77  ? 0.7564 1.1558 0.5580 -0.0959 -0.2167 0.0109  77  LEU A N     
616  C CA    . LEU A 77  ? 0.7385 1.1592 0.5372 -0.0918 -0.2006 0.0065  77  LEU A CA    
617  C C     . LEU A 77  ? 0.7343 1.1624 0.5256 -0.1017 -0.1962 0.0152  77  LEU A C     
618  O O     . LEU A 77  ? 0.7299 1.1672 0.5193 -0.0988 -0.1909 0.0097  77  LEU A O     
619  C CB    . LEU A 77  ? 0.7211 1.1566 0.5196 -0.0886 -0.1873 0.0083  77  LEU A CB    
620  C CG    . LEU A 77  ? 0.7027 1.1593 0.4968 -0.0869 -0.1705 0.0078  77  LEU A CG    
621  C CD1   . LEU A 77  ? 0.7027 1.1654 0.4986 -0.0776 -0.1674 -0.0053 77  LEU A CD1   
622  C CD2   . LEU A 77  ? 0.6889 1.1560 0.4833 -0.0851 -0.1600 0.0107  77  LEU A CD2   
623  N N     . GLN A 78  ? 0.7356 1.1614 0.5227 -0.1132 -0.1980 0.0285  78  GLN A N     
624  C CA    . GLN A 78  ? 0.7331 1.1666 0.5147 -0.1236 -0.1950 0.0370  78  GLN A CA    
625  C C     . GLN A 78  ? 0.7465 1.1711 0.5286 -0.1255 -0.2047 0.0330  78  GLN A C     
626  O O     . GLN A 78  ? 0.7405 1.1765 0.5200 -0.1275 -0.1990 0.0329  78  GLN A O     
627  C CB    . GLN A 78  ? 0.7379 1.1677 0.5156 -0.1367 -0.1986 0.0510  78  GLN A CB    
628  C CG    . GLN A 78  ? 0.7343 1.1757 0.5074 -0.1481 -0.1941 0.0599  78  GLN A CG    
629  C CD    . GLN A 78  ? 0.7145 1.1780 0.4869 -0.1433 -0.1784 0.0573  78  GLN A CD    
630  O OE1   . GLN A 78  ? 0.7014 1.1741 0.4741 -0.1370 -0.1683 0.0553  78  GLN A OE1   
631  N NE2   . GLN A 78  ? 0.7133 1.1847 0.4849 -0.1465 -0.1768 0.0573  78  GLN A NE2   
632  N N     . ALA A 79  ? 0.7656 1.1691 0.5514 -0.1248 -0.2201 0.0295  79  ALA A N     
633  C CA    . ALA A 79  ? 0.7815 1.1729 0.5688 -0.1253 -0.2315 0.0237  79  ALA A CA    
634  C C     . ALA A 79  ? 0.7739 1.1771 0.5618 -0.1154 -0.2241 0.0109  79  ALA A C     
635  O O     . ALA A 79  ? 0.7781 1.1831 0.5637 -0.1189 -0.2261 0.0097  79  ALA A O     
636  C CB    . ALA A 79  ? 0.8026 1.1692 0.5953 -0.1222 -0.2485 0.0190  79  ALA A CB    
637  N N     . LEU A 80  ? 0.7636 1.1755 0.5541 -0.1036 -0.2156 0.0018  80  LEU A N     
638  C CA    . LEU A 80  ? 0.7570 1.1816 0.5468 -0.0944 -0.2077 -0.0100 80  LEU A CA    
639  C C     . LEU A 80  ? 0.7407 1.1855 0.5242 -0.0977 -0.1940 -0.0045 80  LEU A C     
640  O O     . LEU A 80  ? 0.7403 1.1927 0.5211 -0.0944 -0.1912 -0.0112 80  LEU A O     
641  C CB    . LEU A 80  ? 0.7519 1.1809 0.5466 -0.0822 -0.2026 -0.0208 80  LEU A CB    
642  C CG    . LEU A 80  ? 0.7687 1.1793 0.5719 -0.0757 -0.2164 -0.0300 80  LEU A CG    
643  C CD1   . LEU A 80  ? 0.7651 1.1856 0.5730 -0.0623 -0.2104 -0.0458 80  LEU A CD1   
644  C CD2   . LEU A 80  ? 0.7904 1.1813 0.5955 -0.0787 -0.2331 -0.0332 80  LEU A CD2   
645  N N     . LEU A 81  ? 0.7285 1.1819 0.5096 -0.1037 -0.1861 0.0069  81  LEU A N     
646  C CA    . LEU A 81  ? 0.7141 1.1859 0.4905 -0.1069 -0.1743 0.0126  81  LEU A CA    
647  C C     . LEU A 81  ? 0.7197 1.1917 0.4940 -0.1169 -0.1793 0.0192  81  LEU A C     
648  O O     . LEU A 81  ? 0.7123 1.1979 0.4837 -0.1172 -0.1727 0.0196  81  LEU A O     
649  C CB    . LEU A 81  ? 0.6998 1.1813 0.4753 -0.1090 -0.1641 0.0211  81  LEU A CB    
650  C CG    . LEU A 81  ? 0.6914 1.1771 0.4689 -0.0993 -0.1566 0.0149  81  LEU A CG    
651  C CD1   . LEU A 81  ? 0.6822 1.1717 0.4597 -0.1028 -0.1508 0.0234  81  LEU A CD1   
652  C CD2   . LEU A 81  ? 0.6820 1.1822 0.4566 -0.0921 -0.1459 0.0086  81  LEU A CD2   
653  N N     . ASP A 82  ? 0.7336 1.1909 0.5093 -0.1256 -0.1914 0.0246  82  ASP A N     
654  C CA    . ASP A 82  ? 0.7419 1.1979 0.5164 -0.1362 -0.1979 0.0303  82  ASP A CA    
655  C C     . ASP A 82  ? 0.7523 1.2033 0.5270 -0.1321 -0.2047 0.0201  82  ASP A C     
656  O O     . ASP A 82  ? 0.7513 1.2112 0.5243 -0.1366 -0.2038 0.0217  82  ASP A O     
657  C CB    . ASP A 82  ? 0.7564 1.1967 0.5315 -0.1475 -0.2096 0.0393  82  ASP A CB    
658  C CG    . ASP A 82  ? 0.7477 1.1941 0.5213 -0.1529 -0.2031 0.0496  82  ASP A CG    
659  O OD1   . ASP A 82  ? 0.7312 1.1970 0.5033 -0.1533 -0.1902 0.0533  82  ASP A OD1   
660  O OD2   . ASP A 82  ? 0.7585 1.1899 0.5325 -0.1564 -0.2116 0.0537  82  ASP A OD2   
661  N N     . GLU A 83  ? 0.7626 1.2003 0.5399 -0.1235 -0.2117 0.0090  83  GLU A N     
662  C CA    . GLU A 83  ? 0.7712 1.2066 0.5482 -0.1167 -0.2160 -0.0037 83  GLU A CA    
663  C C     . GLU A 83  ? 0.7565 1.2131 0.5290 -0.1112 -0.2027 -0.0073 83  GLU A C     
664  O O     . GLU A 83  ? 0.7600 1.2215 0.5297 -0.1131 -0.2043 -0.0096 83  GLU A O     
665  C CB    . GLU A 83  ? 0.7817 1.2039 0.5631 -0.1060 -0.2226 -0.0168 83  GLU A CB    
666  C CG    . GLU A 83  ? 0.8038 1.2010 0.5900 -0.1095 -0.2405 -0.0180 83  GLU A CG    
667  C CD    . GLU A 83  ? 0.8138 1.1999 0.6061 -0.0970 -0.2467 -0.0327 83  GLU A CD    
668  O OE1   . GLU A 83  ? 0.8095 1.1936 0.6055 -0.0926 -0.2448 -0.0322 83  GLU A OE1   
669  O OE2   . GLU A 83  ? 0.8266 1.2067 0.6205 -0.0916 -0.2538 -0.0456 83  GLU A OE2   
670  N N     . ASP A 84  ? 0.7415 1.2097 0.5129 -0.1048 -0.1904 -0.0074 84  ASP A N     
671  C CA    . ASP A 84  ? 0.7297 1.2159 0.4964 -0.0987 -0.1784 -0.0111 84  ASP A CA    
672  C C     . ASP A 84  ? 0.7120 1.2106 0.4778 -0.0970 -0.1651 -0.0046 84  ASP A C     
673  O O     . ASP A 84  ? 0.7081 1.2066 0.4755 -0.0902 -0.1607 -0.0092 84  ASP A O     
674  C CB    . ASP A 84  ? 0.7376 1.2221 0.5035 -0.0885 -0.1798 -0.0265 84  ASP A CB    
675  C CG    . ASP A 84  ? 0.7304 1.2321 0.4893 -0.0837 -0.1697 -0.0307 84  ASP A CG    
676  O OD1   . ASP A 84  ? 0.7229 1.2352 0.4778 -0.0884 -0.1648 -0.0227 84  ASP A OD1   
677  O OD2   . ASP A 84  ? 0.7337 1.2384 0.4910 -0.0753 -0.1670 -0.0423 84  ASP A OD2   
678  N N     . ASP A 85  ? 0.7022 1.2117 0.4663 -0.1033 -0.1593 0.0055  85  ASP A N     
679  C CA    . ASP A 85  ? 0.6860 1.2080 0.4494 -0.1024 -0.1470 0.0122  85  ASP A CA    
680  C C     . ASP A 85  ? 0.6794 1.2086 0.4400 -0.0928 -0.1379 0.0054  85  ASP A C     
681  O O     . ASP A 85  ? 0.6725 1.2024 0.4348 -0.0898 -0.1324 0.0061  85  ASP A O     
682  C CB    . ASP A 85  ? 0.6780 1.2140 0.4398 -0.1071 -0.1418 0.0197  85  ASP A CB    
683  C CG    . ASP A 85  ? 0.6805 1.2153 0.4455 -0.1181 -0.1470 0.0287  85  ASP A CG    
684  O OD1   . ASP A 85  ? 0.6823 1.2096 0.4497 -0.1229 -0.1498 0.0335  85  ASP A OD1   
685  O OD2   . ASP A 85  ? 0.6810 1.2240 0.4459 -0.1222 -0.1482 0.0312  85  ASP A OD2   
686  N N     . ALA A 86  ? 0.6824 1.2178 0.4384 -0.0888 -0.1367 -0.0007 86  ALA A N     
687  C CA    . ALA A 86  ? 0.6771 1.2224 0.4284 -0.0815 -0.1272 -0.0057 86  ALA A CA    
688  C C     . ALA A 86  ? 0.6861 1.2263 0.4376 -0.0747 -0.1299 -0.0183 86  ALA A C     
689  O O     . ALA A 86  ? 0.6967 1.2358 0.4452 -0.0726 -0.1350 -0.0267 86  ALA A O     
690  C CB    . ALA A 86  ? 0.6765 1.2326 0.4212 -0.0817 -0.1241 -0.0043 86  ALA A CB    
691  N N     . GLN A 87  ? 0.6819 1.2205 0.4373 -0.0710 -0.1263 -0.0204 87  GLN A N     
692  C CA    . GLN A 87  ? 0.6901 1.2243 0.4487 -0.0642 -0.1294 -0.0329 87  GLN A CA    
693  C C     . GLN A 87  ? 0.6805 1.2226 0.4404 -0.0599 -0.1193 -0.0337 87  GLN A C     
694  O O     . GLN A 87  ? 0.6706 1.2129 0.4329 -0.0628 -0.1152 -0.0248 87  GLN A O     
695  C CB    . GLN A 87  ? 0.7000 1.2170 0.4661 -0.0661 -0.1422 -0.0343 87  GLN A CB    
696  C CG    . GLN A 87  ? 0.7156 1.2243 0.4847 -0.0604 -0.1514 -0.0485 87  GLN A CG    
697  C CD    . GLN A 87  ? 0.7277 1.2169 0.5036 -0.0636 -0.1659 -0.0477 87  GLN A CD    
698  O OE1   . GLN A 87  ? 0.7293 1.2120 0.5041 -0.0721 -0.1712 -0.0378 87  GLN A OE1   
699  N NE2   . GLN A 87  ? 0.7373 1.2172 0.5205 -0.0571 -0.1728 -0.0582 87  GLN A NE2   
700  N N     . THR A 88  ? 0.6838 1.2339 0.4420 -0.0535 -0.1148 -0.0446 88  THR A N     
701  C CA    . THR A 88  ? 0.6758 1.2356 0.4350 -0.0499 -0.1047 -0.0462 88  THR A CA    
702  C C     . THR A 88  ? 0.6755 1.2269 0.4454 -0.0473 -0.1090 -0.0489 88  THR A C     
703  O O     . THR A 88  ? 0.6857 1.2252 0.4617 -0.0456 -0.1200 -0.0548 88  THR A O     
704  C CB    . THR A 88  ? 0.6809 1.2541 0.4341 -0.0452 -0.0983 -0.0569 88  THR A CB    
705  O OG1   . THR A 88  ? 0.6730 1.2572 0.4260 -0.0436 -0.0875 -0.0564 88  THR A OG1   
706  C CG2   . THR A 88  ? 0.6941 1.2647 0.4517 -0.0392 -0.1054 -0.0727 88  THR A CG2   
707  N N     . GLN A 89  ? 0.6650 1.2214 0.4373 -0.0474 -0.1014 -0.0441 89  GLN A N     
708  C CA    . GLN A 89  ? 0.6644 1.2137 0.4465 -0.0453 -0.1054 -0.0456 89  GLN A CA    
709  C C     . GLN A 89  ? 0.6745 1.2228 0.4641 -0.0375 -0.1106 -0.0608 89  GLN A C     
710  O O     . GLN A 89  ? 0.6808 1.2168 0.4788 -0.0357 -0.1206 -0.0634 89  GLN A O     
711  C CB    . GLN A 89  ? 0.6520 1.2091 0.4349 -0.0463 -0.0954 -0.0396 89  GLN A CB    
712  C CG    . GLN A 89  ? 0.6430 1.1979 0.4220 -0.0533 -0.0928 -0.0252 89  GLN A CG    
713  C CD    . GLN A 89  ? 0.6320 1.1934 0.4122 -0.0541 -0.0838 -0.0200 89  GLN A CD    
714  O OE1   . GLN A 89  ? 0.6308 1.1976 0.4155 -0.0500 -0.0801 -0.0263 89  GLN A OE1   
715  N NE2   . GLN A 89  ? 0.6245 1.1861 0.4011 -0.0594 -0.0802 -0.0091 89  GLN A NE2   
716  N N     . LYS A 90  ? 0.6773 1.2388 0.4639 -0.0331 -0.1044 -0.0711 90  LYS A N     
717  C CA    . LYS A 90  ? 0.6880 1.2511 0.4822 -0.0251 -0.1090 -0.0877 90  LYS A CA    
718  C C     . LYS A 90  ? 0.7026 1.2516 0.4990 -0.0234 -0.1227 -0.0943 90  LYS A C     
719  O O     . LYS A 90  ? 0.7127 1.2554 0.5189 -0.0169 -0.1311 -0.1060 90  LYS A O     
720  C CB    . LYS A 90  ? 0.6882 1.2714 0.4776 -0.0218 -0.0979 -0.0971 90  LYS A CB    
721  C CG    . LYS A 90  ? 0.6995 1.2878 0.4975 -0.0130 -0.1016 -0.1161 90  LYS A CG    
722  C CD    . LYS A 90  ? 0.6970 1.3078 0.4941 -0.0102 -0.0891 -0.1247 90  LYS A CD    
723  C CE    . LYS A 90  ? 0.6963 1.3202 0.4777 -0.0151 -0.0790 -0.1209 90  LYS A CE    
724  N NZ    . LYS A 90  ? 0.7072 1.3263 0.4810 -0.0152 -0.0854 -0.1249 90  LYS A NZ    
725  N N     . GLN A 91  ? 0.7045 1.2481 0.4925 -0.0291 -0.1255 -0.0870 91  GLN A N     
726  C CA    . GLN A 91  ? 0.7189 1.2480 0.5084 -0.0291 -0.1390 -0.0918 91  GLN A CA    
727  C C     . GLN A 91  ? 0.7235 1.2328 0.5211 -0.0314 -0.1513 -0.0860 91  GLN A C     
728  O O     . GLN A 91  ? 0.7377 1.2341 0.5427 -0.0273 -0.1636 -0.0951 91  GLN A O     
729  C CB    . GLN A 91  ? 0.7194 1.2493 0.4980 -0.0355 -0.1386 -0.0847 91  GLN A CB    
730  C CG    . GLN A 91  ? 0.7268 1.2681 0.4982 -0.0321 -0.1353 -0.0959 91  GLN A CG    
731  C CD    . GLN A 91  ? 0.7255 1.2703 0.4857 -0.0384 -0.1335 -0.0877 91  GLN A CD    
732  O OE1   . GLN A 91  ? 0.7270 1.2853 0.4780 -0.0374 -0.1268 -0.0918 91  GLN A OE1   
733  N NE2   . GLN A 91  ? 0.7235 1.2573 0.4842 -0.0453 -0.1397 -0.0759 91  GLN A NE2   
734  N N     . LEU A 92  ? 0.7127 1.2195 0.5085 -0.0384 -0.1484 -0.0707 92  LEU A N     
735  C CA    . LEU A 92  ? 0.7163 1.2061 0.5178 -0.0424 -0.1586 -0.0627 92  LEU A CA    
736  C C     . LEU A 92  ? 0.7201 1.2057 0.5327 -0.0352 -0.1630 -0.0707 92  LEU A C     
737  O O     . LEU A 92  ? 0.7335 1.2020 0.5532 -0.0337 -0.1769 -0.0736 92  LEU A O     
738  C CB    . LEU A 92  ? 0.7025 1.1958 0.4992 -0.0507 -0.1516 -0.0464 92  LEU A CB    
739  C CG    . LEU A 92  ? 0.6972 1.1958 0.4847 -0.0582 -0.1472 -0.0369 92  LEU A CG    
740  C CD1   . LEU A 92  ? 0.6806 1.1928 0.4635 -0.0609 -0.1337 -0.0278 92  LEU A CD1   
741  C CD2   . LEU A 92  ? 0.7050 1.1892 0.4922 -0.0668 -0.1581 -0.0278 92  LEU A CD2   
742  N N     . ALA A 93  ? 0.7093 1.2104 0.5235 -0.0308 -0.1514 -0.0742 93  ALA A N     
743  C CA    . ALA A 93  ? 0.7113 1.2132 0.5367 -0.0231 -0.1535 -0.0833 93  ALA A CA    
744  C C     . ALA A 93  ? 0.7279 1.2232 0.5626 -0.0141 -0.1644 -0.1003 93  ALA A C     
745  O O     . ALA A 93  ? 0.7361 1.2201 0.5816 -0.0097 -0.1749 -0.1044 93  ALA A O     
746  C CB    . ALA A 93  ? 0.6981 1.2213 0.5226 -0.0203 -0.1379 -0.0861 93  ALA A CB    
747  N N     . GLU A 94  ? 0.7336 1.2361 0.5641 -0.0112 -0.1623 -0.1103 94  GLU A N     
748  C CA    . GLU A 94  ? 0.7507 1.2475 0.5895 -0.0024 -0.1727 -0.1280 94  GLU A CA    
749  C C     . GLU A 94  ? 0.7666 1.2370 0.6098 -0.0043 -0.1913 -0.1255 94  GLU A C     
750  O O     . GLU A 94  ? 0.7800 1.2396 0.6351 0.0032  -0.2031 -0.1362 94  GLU A O     
751  C CB    . GLU A 94  ? 0.7543 1.2646 0.5854 -0.0003 -0.1664 -0.1385 94  GLU A CB    
752  C CG    . GLU A 94  ? 0.7461 1.2818 0.5767 0.0045  -0.1514 -0.1477 94  GLU A CG    
753  C CD    . GLU A 94  ? 0.7486 1.2996 0.5679 0.0043  -0.1433 -0.1546 94  GLU A CD    
754  O OE1   . GLU A 94  ? 0.7539 1.2972 0.5643 -0.0004 -0.1477 -0.1504 94  GLU A OE1   
755  O OE2   . GLU A 94  ? 0.7459 1.3177 0.5650 0.0084  -0.1325 -0.1644 94  GLU A OE2   
756  N N     . GLN A 95  ? 0.7659 1.2261 0.6000 -0.0146 -0.1942 -0.1110 95  GLN A N     
757  C CA    . GLN A 95  ? 0.7817 1.2167 0.6184 -0.0189 -0.2117 -0.1060 95  GLN A CA    
758  C C     . GLN A 95  ? 0.7841 1.2051 0.6286 -0.0199 -0.2202 -0.0984 95  GLN A C     
759  O O     . GLN A 95  ? 0.8018 1.2034 0.6547 -0.0167 -0.2363 -0.1033 95  GLN A O     
760  C CB    . GLN A 95  ? 0.7796 1.2104 0.6049 -0.0307 -0.2115 -0.0920 95  GLN A CB    
761  C CG    . GLN A 95  ? 0.7815 1.2220 0.5997 -0.0300 -0.2071 -0.0996 95  GLN A CG    
762  C CD    . GLN A 95  ? 0.7764 1.2170 0.5841 -0.0414 -0.2049 -0.0852 95  GLN A CD    
763  O OE1   . GLN A 95  ? 0.7605 1.2173 0.5607 -0.0449 -0.1914 -0.0776 95  GLN A OE1   
764  N NE2   . GLN A 95  ? 0.7905 1.2129 0.5985 -0.0476 -0.2186 -0.0813 95  GLN A NE2   
765  N N     . LEU A 96  ? 0.7678 1.1982 0.6092 -0.0242 -0.2100 -0.0869 96  LEU A N     
766  C CA    . LEU A 96  ? 0.7691 1.1888 0.6167 -0.0254 -0.2167 -0.0795 96  LEU A CA    
767  C C     . LEU A 96  ? 0.7717 1.1952 0.6327 -0.0135 -0.2187 -0.0930 96  LEU A C     
768  O O     . LEU A 96  ? 0.7760 1.1889 0.6434 -0.0132 -0.2269 -0.0887 96  LEU A O     
769  C CB    . LEU A 96  ? 0.7509 1.1809 0.5907 -0.0337 -0.2046 -0.0639 96  LEU A CB    
770  C CG    . LEU A 96  ? 0.7467 1.1748 0.5747 -0.0461 -0.2020 -0.0488 96  LEU A CG    
771  C CD1   . LEU A 96  ? 0.7269 1.1709 0.5486 -0.0510 -0.1868 -0.0383 96  LEU A CD1   
772  C CD2   . LEU A 96  ? 0.7620 1.1674 0.5894 -0.0545 -0.2179 -0.0387 96  LEU A CD2   
773  N N     . GLU A 97  ? 0.7693 1.2093 0.6342 -0.0042 -0.2110 -0.1091 97  GLU A N     
774  C CA    . GLU A 97  ? 0.7714 1.2196 0.6503 0.0076  -0.2114 -0.1244 97  GLU A CA    
775  C C     . GLU A 97  ? 0.7553 1.2163 0.6362 0.0067  -0.2012 -0.1177 97  GLU A C     
776  O O     . GLU A 97  ? 0.7587 1.2191 0.6523 0.0138  -0.2064 -0.1244 97  GLU A O     
777  C CB    . GLU A 97  ? 0.7931 1.2192 0.6850 0.0145  -0.2319 -0.1328 97  GLU A CB    
778  C CG    . GLU A 97  ? 0.8110 1.2193 0.7001 0.0131  -0.2445 -0.1362 97  GLU A CG    
779  C CD    . GLU A 97  ? 0.8332 1.2266 0.7374 0.0245  -0.2617 -0.1531 97  GLU A CD    
780  O OE1   . GLU A 97  ? 0.8465 1.2335 0.7505 0.0272  -0.2681 -0.1633 97  GLU A OE1   
781  O OE2   . GLU A 97  ? 0.8382 1.2260 0.7550 0.0310  -0.2696 -0.1566 97  GLU A OE2   
782  N N     . VAL A 98  ? 0.7385 1.2115 0.6074 -0.0015 -0.1868 -0.1055 98  VAL A N     
783  C CA    . VAL A 98  ? 0.7223 1.2087 0.5912 -0.0036 -0.1754 -0.0987 98  VAL A CA    
784  C C     . VAL A 98  ? 0.7090 1.2190 0.5708 -0.0037 -0.1573 -0.1020 98  VAL A C     
785  O O     . VAL A 98  ? 0.7133 1.2286 0.5707 -0.0019 -0.1550 -0.1096 98  VAL A O     
786  C CB    . VAL A 98  ? 0.7163 1.1923 0.5775 -0.0145 -0.1766 -0.0789 98  VAL A CB    
787  C CG1   . VAL A 98  ? 0.7309 1.1846 0.5989 -0.0147 -0.1944 -0.0754 98  VAL A CG1   
788  C CG2   . VAL A 98  ? 0.7124 1.1868 0.5597 -0.0240 -0.1722 -0.0679 98  VAL A CG2   
789  N N     . SER A 99  ? 0.6945 1.2181 0.5548 -0.0061 -0.1453 -0.0963 99  SER A N     
790  C CA    . SER A 99  ? 0.6832 1.2282 0.5366 -0.0071 -0.1287 -0.0980 99  SER A CA    
791  C C     . SER A 99  ? 0.6748 1.2195 0.5134 -0.0166 -0.1216 -0.0835 99  SER A C     
792  O O     . SER A 99  ? 0.6750 1.2056 0.5095 -0.0229 -0.1277 -0.0716 99  SER A O     
793  C CB    . SER A 99  ? 0.6730 1.2325 0.5326 -0.0054 -0.1196 -0.0992 99  SER A CB    
794  O OG    . SER A 99  ? 0.6636 1.2177 0.5193 -0.0125 -0.1177 -0.0841 99  SER A OG    
795  N N     . GLN A 100 ? 0.6683 1.2294 0.4991 -0.0176 -0.1089 -0.0850 100 GLN A N     
796  C CA    . GLN A 100 ? 0.6599 1.2233 0.4776 -0.0255 -0.1010 -0.0721 100 GLN A CA    
797  C C     . GLN A 100 ? 0.6487 1.2101 0.4654 -0.0311 -0.0970 -0.0589 100 GLN A C     
798  O O     . GLN A 100 ? 0.6452 1.1994 0.4552 -0.0377 -0.0978 -0.0470 100 GLN A O     
799  C CB    . GLN A 100 ? 0.6565 1.2384 0.4668 -0.0251 -0.0883 -0.0763 100 GLN A CB    
800  C CG    . GLN A 100 ? 0.6483 1.2333 0.4460 -0.0324 -0.0801 -0.0633 100 GLN A CG    
801  C CD    . GLN A 100 ? 0.6365 1.2288 0.4333 -0.0358 -0.0701 -0.0550 100 GLN A CD    
802  O OE1   . GLN A 100 ? 0.6343 1.2396 0.4336 -0.0337 -0.0624 -0.0606 100 GLN A OE1   
803  N NE2   . GLN A 100 ? 0.6295 1.2143 0.4230 -0.0415 -0.0701 -0.0420 100 GLN A NE2   
804  N N     . GLN A 101 ? 0.6438 1.2126 0.4677 -0.0285 -0.0928 -0.0620 101 GLN A N     
805  C CA    . GLN A 101 ? 0.6336 1.2026 0.4570 -0.0332 -0.0880 -0.0514 101 GLN A CA    
806  C C     . GLN A 101 ? 0.6367 1.1889 0.4623 -0.0364 -0.0991 -0.0436 101 GLN A C     
807  O O     . GLN A 101 ? 0.6299 1.1794 0.4506 -0.0427 -0.0964 -0.0321 101 GLN A O     
808  C CB    . GLN A 101 ? 0.6294 1.2105 0.4614 -0.0294 -0.0823 -0.0581 101 GLN A CB    
809  C CG    . GLN A 101 ? 0.6256 1.2253 0.4540 -0.0287 -0.0694 -0.0632 101 GLN A CG    
810  C CD    . GLN A 101 ? 0.6347 1.2428 0.4660 -0.0224 -0.0703 -0.0778 101 GLN A CD    
811  O OE1   . GLN A 101 ? 0.6440 1.2426 0.4771 -0.0190 -0.0801 -0.0832 101 GLN A OE1   
812  N NE2   . GLN A 101 ? 0.6330 1.2595 0.4648 -0.0212 -0.0600 -0.0846 101 GLN A NE2   
813  N N     . ALA A 102 ? 0.6483 1.1895 0.4814 -0.0321 -0.1117 -0.0503 102 ALA A N     
814  C CA    . ALA A 102 ? 0.6552 1.1786 0.4898 -0.0356 -0.1243 -0.0430 102 ALA A CA    
815  C C     . ALA A 102 ? 0.6548 1.1709 0.4788 -0.0441 -0.1253 -0.0313 102 ALA A C     
816  O O     . ALA A 102 ? 0.6514 1.1625 0.4716 -0.0510 -0.1259 -0.0199 102 ALA A O     
817  C CB    . ALA A 102 ? 0.6705 1.1821 0.5144 -0.0292 -0.1386 -0.0530 102 ALA A CB    
818  N N     . VAL A 103 ? 0.6586 1.1756 0.4779 -0.0437 -0.1250 -0.0346 103 VAL A N     
819  C CA    . VAL A 103 ? 0.6586 1.1704 0.4690 -0.0516 -0.1261 -0.0245 103 VAL A CA    
820  C C     . VAL A 103 ? 0.6447 1.1675 0.4478 -0.0567 -0.1136 -0.0150 103 VAL A C     
821  O O     . VAL A 103 ? 0.6425 1.1611 0.4414 -0.0640 -0.1147 -0.0044 103 VAL A O     
822  C CB    . VAL A 103 ? 0.6665 1.1765 0.4733 -0.0506 -0.1296 -0.0298 103 VAL A CB    
823  C CG1   . VAL A 103 ? 0.6829 1.1769 0.4959 -0.0478 -0.1450 -0.0362 103 VAL A CG1   
824  C CG2   . VAL A 103 ? 0.6627 1.1880 0.4675 -0.0449 -0.1197 -0.0392 103 VAL A CG2   
825  N N     . SER A 104 ? 0.6364 1.1732 0.4384 -0.0533 -0.1021 -0.0190 104 SER A N     
826  C CA    . SER A 104 ? 0.6244 1.1705 0.4206 -0.0574 -0.0909 -0.0106 104 SER A CA    
827  C C     . SER A 104 ? 0.6202 1.1612 0.4166 -0.0630 -0.0921 -0.0009 104 SER A C     
828  O O     . SER A 104 ? 0.6155 1.1577 0.4063 -0.0687 -0.0889 0.0078  104 SER A O     
829  C CB    . SER A 104 ? 0.6183 1.1774 0.4159 -0.0533 -0.0805 -0.0161 104 SER A CB    
830  O OG    . SER A 104 ? 0.6084 1.1732 0.4021 -0.0572 -0.0715 -0.0079 104 SER A OG    
831  N N     . ASN A 105 ? 0.6230 1.1589 0.4262 -0.0611 -0.0973 -0.0032 105 ASN A N     
832  C CA    . ASN A 105 ? 0.6209 1.1520 0.4242 -0.0663 -0.0995 0.0050  105 ASN A CA    
833  C C     . ASN A 105 ? 0.6286 1.1483 0.4280 -0.0731 -0.1088 0.0127  105 ASN A C     
834  O O     . ASN A 105 ? 0.6242 1.1458 0.4183 -0.0799 -0.1056 0.0217  105 ASN A O     
835  C CB    . ASN A 105 ? 0.6243 1.1520 0.4360 -0.0623 -0.1047 0.0001  105 ASN A CB    
836  C CG    . ASN A 105 ? 0.6176 1.1579 0.4343 -0.0562 -0.0957 -0.0079 105 ASN A CG    
837  O OD1   . ASN A 105 ? 0.6090 1.1601 0.4214 -0.0570 -0.0844 -0.0067 105 ASN A OD1   
838  N ND2   . ASN A 105 ? 0.6225 1.1617 0.4489 -0.0503 -0.1012 -0.0162 105 ASN A ND2   
839  N N     . ARG A 106 ? 0.6408 1.1493 0.4433 -0.0715 -0.1203 0.0087  106 ARG A N     
840  C CA    . ARG A 106 ? 0.6508 1.1468 0.4500 -0.0789 -0.1308 0.0163  106 ARG A CA    
841  C C     . ARG A 106 ? 0.6474 1.1480 0.4392 -0.0857 -0.1266 0.0233  106 ARG A C     
842  O O     . ARG A 106 ? 0.6525 1.1474 0.4406 -0.0942 -0.1319 0.0320  106 ARG A O     
843  C CB    . ARG A 106 ? 0.6657 1.1485 0.4697 -0.0752 -0.1438 0.0094  106 ARG A CB    
844  C CG    . ARG A 106 ? 0.6796 1.1463 0.4814 -0.0831 -0.1573 0.0173  106 ARG A CG    
845  C CD    . ARG A 106 ? 0.6844 1.1431 0.4876 -0.0863 -0.1637 0.0232  106 ARG A CD    
846  N NE    . ARG A 106 ? 0.6929 1.1432 0.5057 -0.0776 -0.1725 0.0140  106 ARG A NE    
847  C CZ    . ARG A 106 ? 0.7106 1.1430 0.5276 -0.0767 -0.1884 0.0122  106 ARG A CZ    
848  N NH1   . ARG A 106 ? 0.7174 1.1443 0.5447 -0.0673 -0.1957 0.0025  106 ARG A NH1   
849  N NH2   . ARG A 106 ? 0.7226 1.1426 0.5341 -0.0852 -0.1976 0.0197  106 ARG A NH2   
850  N N     . LEU A 107 ? 0.6404 1.1513 0.4302 -0.0823 -0.1182 0.0194  107 LEU A N     
851  C CA    . LEU A 107 ? 0.6361 1.1535 0.4200 -0.0876 -0.1135 0.0253  107 LEU A CA    
852  C C     . LEU A 107 ? 0.6255 1.1521 0.4064 -0.0921 -0.1045 0.0331  107 LEU A C     
853  O O     . LEU A 107 ? 0.6235 1.1545 0.4008 -0.0981 -0.1027 0.0394  107 LEU A O     
854  C CB    . LEU A 107 ? 0.6329 1.1585 0.4152 -0.0821 -0.1076 0.0188  107 LEU A CB    
855  C CG    . LEU A 107 ? 0.6442 1.1626 0.4283 -0.0781 -0.1161 0.0103  107 LEU A CG    
856  C CD1   . LEU A 107 ? 0.6409 1.1697 0.4220 -0.0729 -0.1087 0.0039  107 LEU A CD1   
857  C CD2   . LEU A 107 ? 0.6544 1.1629 0.4369 -0.0848 -0.1264 0.0148  107 LEU A CD2   
858  N N     . ARG A 108 ? 0.6192 1.1494 0.4022 -0.0890 -0.0990 0.0317  108 ARG A N     
859  C CA    . ARG A 108 ? 0.6105 1.1482 0.3913 -0.0926 -0.0912 0.0377  108 ARG A CA    
860  C C     . ARG A 108 ? 0.6151 1.1465 0.3957 -0.0985 -0.0969 0.0432  108 ARG A C     
861  O O     . ARG A 108 ? 0.6111 1.1480 0.3884 -0.1041 -0.0927 0.0494  108 ARG A O     
862  C CB    . ARG A 108 ? 0.6020 1.1475 0.3847 -0.0863 -0.0818 0.0328  108 ARG A CB    
863  C CG    . ARG A 108 ? 0.5925 1.1481 0.3722 -0.0877 -0.0715 0.0368  108 ARG A CG    
864  C CD    . ARG A 108 ? 0.5865 1.1481 0.3677 -0.0821 -0.0632 0.0322  108 ARG A CD    
865  N NE    . ARG A 108 ? 0.5872 1.1460 0.3732 -0.0800 -0.0650 0.0287  108 ARG A NE    
866  C CZ    . ARG A 108 ? 0.5838 1.1474 0.3727 -0.0756 -0.0595 0.0237  108 ARG A CZ    
867  N NH1   . ARG A 108 ? 0.5802 1.1510 0.3667 -0.0733 -0.0517 0.0222  108 ARG A NH1   
868  N NH2   . ARG A 108 ? 0.5850 1.1465 0.3793 -0.0740 -0.0623 0.0205  108 ARG A NH2   
869  N N     . GLU A 109 ? 0.6247 1.1447 0.4086 -0.0972 -0.1070 0.0408  109 GLU A N     
870  C CA    . GLU A 109 ? 0.6334 1.1444 0.4159 -0.1038 -0.1157 0.0472  109 GLU A CA    
871  C C     . GLU A 109 ? 0.6405 1.1485 0.4177 -0.1131 -0.1207 0.0547  109 GLU A C     
872  O O     . GLU A 109 ? 0.6421 1.1521 0.4146 -0.1216 -0.1206 0.0626  109 GLU A O     
873  C CB    . GLU A 109 ? 0.6438 1.1420 0.4323 -0.0990 -0.1269 0.0421  109 GLU A CB    
874  C CG    . GLU A 109 ? 0.6541 1.1419 0.4413 -0.1048 -0.1368 0.0486  109 GLU A CG    
875  C CD    . GLU A 109 ? 0.6715 1.1429 0.4576 -0.1096 -0.1518 0.0522  109 GLU A CD    
876  O OE1   . GLU A 109 ? 0.6749 1.1459 0.4559 -0.1167 -0.1529 0.0575  109 GLU A OE1   
877  O OE2   . GLU A 109 ? 0.6828 1.1413 0.4739 -0.1064 -0.1633 0.0497  109 GLU A OE2   
878  N N     . MET A 110 ? 0.6451 1.1496 0.4230 -0.1119 -0.1246 0.0519  110 MET A N     
879  C CA    . MET A 110 ? 0.6487 1.1550 0.4223 -0.1203 -0.1264 0.0582  110 MET A CA    
880  C C     . MET A 110 ? 0.6351 1.1583 0.4069 -0.1201 -0.1134 0.0590  110 MET A C     
881  O O     . MET A 110 ? 0.6247 1.1555 0.3980 -0.1134 -0.1044 0.0548  110 MET A O     
882  C CB    . MET A 110 ? 0.6588 1.1556 0.4341 -0.1188 -0.1354 0.0542  110 MET A CB    
883  C CG    . MET A 110 ? 0.6759 1.1541 0.4526 -0.1216 -0.1506 0.0555  110 MET A CG    
884  S SD    . MET A 110 ? 0.6870 1.1521 0.4695 -0.1128 -0.1607 0.0443  110 MET A SD    
885  C CE    . MET A 110 ? 0.6870 1.1578 0.4663 -0.1169 -0.1592 0.0450  110 MET A CE    
886  N N     . GLY A 111 ? 0.6361 1.1651 0.4051 -0.1274 -0.1130 0.0644  111 GLY A N     
887  C CA    . GLY A 111 ? 0.6244 1.1696 0.3928 -0.1275 -0.1018 0.0656  111 GLY A CA    
888  C C     . GLY A 111 ? 0.6176 1.1691 0.3876 -0.1200 -0.0963 0.0601  111 GLY A C     
889  O O     . GLY A 111 ? 0.6094 1.1733 0.3794 -0.1198 -0.0883 0.0612  111 GLY A O     
890  N N     . LYS A 112 ? 0.6217 1.1653 0.3931 -0.1137 -0.1006 0.0537  112 LYS A N     
891  C CA    . LYS A 112 ? 0.6202 1.1681 0.3914 -0.1091 -0.0987 0.0494  112 LYS A CA    
892  C C     . LYS A 112 ? 0.6095 1.1677 0.3803 -0.1025 -0.0879 0.0467  112 LYS A C     
893  O O     . LYS A 112 ? 0.6041 1.1635 0.3757 -0.0991 -0.0825 0.0454  112 LYS A O     
894  C CB    . LYS A 112 ? 0.6295 1.1664 0.4019 -0.1045 -0.1068 0.0422  112 LYS A CB    
895  C CG    . LYS A 112 ? 0.6431 1.1664 0.4163 -0.1101 -0.1196 0.0439  112 LYS A CG    
896  C CD    . LYS A 112 ? 0.6474 1.1731 0.4187 -0.1187 -0.1232 0.0498  112 LYS A CD    
897  C CE    . LYS A 112 ? 0.6634 1.1735 0.4351 -0.1246 -0.1370 0.0515  112 LYS A CE    
898  N NZ    . LYS A 112 ? 0.6678 1.1810 0.4376 -0.1366 -0.1400 0.0604  112 LYS A NZ    
899  N N     . ILE A 113 ? 0.6078 1.1728 0.3773 -0.1010 -0.0855 0.0461  113 ILE A N     
900  C CA    . ILE A 113 ? 0.6009 1.1738 0.3690 -0.0949 -0.0771 0.0439  113 ILE A CA    
901  C C     . ILE A 113 ? 0.6053 1.1792 0.3708 -0.0918 -0.0793 0.0402  113 ILE A C     
902  O O     . ILE A 113 ? 0.6122 1.1828 0.3777 -0.0951 -0.0866 0.0399  113 ILE A O     
903  C CB    . ILE A 113 ? 0.5932 1.1767 0.3621 -0.0967 -0.0703 0.0490  113 ILE A CB    
904  C CG1   . ILE A 113 ? 0.5954 1.1841 0.3657 -0.1029 -0.0740 0.0531  113 ILE A CG1   
905  C CG2   . ILE A 113 ? 0.5884 1.1724 0.3590 -0.0984 -0.0663 0.0513  113 ILE A CG2   
906  C CD1   . ILE A 113 ? 0.5899 1.1904 0.3615 -0.1012 -0.0686 0.0549  113 ILE A CD1   
907  N N     . GLN A 114 ? 0.6023 1.1809 0.3652 -0.0862 -0.0732 0.0375  114 GLN A N     
908  C CA    . GLN A 114 ? 0.6072 1.1880 0.3659 -0.0832 -0.0744 0.0340  114 GLN A CA    
909  C C     . GLN A 114 ? 0.6045 1.1936 0.3622 -0.0844 -0.0723 0.0389  114 GLN A C     
910  O O     . GLN A 114 ? 0.5982 1.1927 0.3564 -0.0831 -0.0659 0.0424  114 GLN A O     
911  C CB    . GLN A 114 ? 0.6071 1.1893 0.3623 -0.0775 -0.0688 0.0292  114 GLN A CB    
912  C CG    . GLN A 114 ? 0.6152 1.1979 0.3656 -0.0745 -0.0715 0.0229  114 GLN A CG    
913  C CD    . GLN A 114 ? 0.6152 1.2027 0.3611 -0.0703 -0.0643 0.0196  114 GLN A CD    
914  O OE1   . GLN A 114 ? 0.6187 1.2116 0.3578 -0.0689 -0.0617 0.0196  114 GLN A OE1   
915  N NE2   . GLN A 114 ? 0.6118 1.1977 0.3612 -0.0690 -0.0611 0.0174  114 GLN A NE2   
916  N N     . LYS A 115 ? 0.6098 1.2000 0.3669 -0.0866 -0.0782 0.0388  115 LYS A N     
917  C CA    . LYS A 115 ? 0.6084 1.2074 0.3653 -0.0869 -0.0773 0.0425  115 LYS A CA    
918  C C     . LYS A 115 ? 0.6159 1.2155 0.3669 -0.0841 -0.0804 0.0388  115 LYS A C     
919  O O     . LYS A 115 ? 0.6230 1.2165 0.3716 -0.0837 -0.0852 0.0331  115 LYS A O     
920  C CB    . LYS A 115 ? 0.6080 1.2107 0.3702 -0.0933 -0.0816 0.0465  115 LYS A CB    
921  C CG    . LYS A 115 ? 0.6011 1.2067 0.3682 -0.0967 -0.0777 0.0508  115 LYS A CG    
922  C CD    . LYS A 115 ? 0.6016 1.2137 0.3737 -0.1042 -0.0813 0.0547  115 LYS A CD    
923  C CE    . LYS A 115 ? 0.5982 1.2234 0.3738 -0.1030 -0.0789 0.0567  115 LYS A CE    
924  N NZ    . LYS A 115 ? 0.5978 1.2327 0.3795 -0.1106 -0.0809 0.0601  115 LYS A NZ    
925  N N     . VAL A 116 ? 0.6153 1.2223 0.3642 -0.0821 -0.0783 0.0417  116 VAL A N     
926  C CA    . VAL A 116 ? 0.6233 1.2319 0.3649 -0.0796 -0.0808 0.0389  116 VAL A CA    
927  C C     . VAL A 116 ? 0.6281 1.2401 0.3714 -0.0828 -0.0883 0.0393  116 VAL A C     
928  O O     . VAL A 116 ? 0.6240 1.2418 0.3738 -0.0858 -0.0895 0.0438  116 VAL A O     
929  C CB    . VAL A 116 ? 0.6232 1.2364 0.3596 -0.0756 -0.0755 0.0422  116 VAL A CB    
930  C CG1   . VAL A 116 ? 0.6233 1.2329 0.3547 -0.0729 -0.0695 0.0396  116 VAL A CG1   
931  C CG2   . VAL A 116 ? 0.6161 1.2348 0.3590 -0.0755 -0.0728 0.0486  116 VAL A CG2   
932  N N     . GLY A 117 ? 0.6375 1.2467 0.3749 -0.0822 -0.0933 0.0338  117 GLY A N     
933  C CA    . GLY A 117 ? 0.6442 1.2548 0.3824 -0.0856 -0.1015 0.0326  117 GLY A CA    
934  C C     . GLY A 117 ? 0.6444 1.2647 0.3824 -0.0851 -0.1024 0.0371  117 GLY A C     
935  O O     . GLY A 117 ? 0.6494 1.2724 0.3795 -0.0814 -0.1014 0.0366  117 GLY A O     
936  N N     . ARG A 118 ? 0.6399 1.2660 0.3867 -0.0891 -0.1046 0.0414  118 ARG A N     
937  C CA    . ARG A 118 ? 0.6396 1.2764 0.3894 -0.0887 -0.1064 0.0453  118 ARG A CA    
938  C C     . ARG A 118 ? 0.6506 1.2886 0.3934 -0.0881 -0.1132 0.0422  118 ARG A C     
939  O O     . ARG A 118 ? 0.6577 1.2905 0.3985 -0.0912 -0.1191 0.0373  118 ARG A O     
940  C CB    . ARG A 118 ? 0.6342 1.2782 0.3955 -0.0945 -0.1082 0.0486  118 ARG A CB    
941  C CG    . ARG A 118 ? 0.6325 1.2900 0.4003 -0.0938 -0.1097 0.0521  118 ARG A CG    
942  C CD    . ARG A 118 ? 0.6232 1.2902 0.4025 -0.0964 -0.1057 0.0556  118 ARG A CD    
943  N NE    . ARG A 118 ? 0.6232 1.3046 0.4118 -0.0989 -0.1097 0.0571  118 ARG A NE    
944  C CZ    . ARG A 118 ? 0.6239 1.3144 0.4154 -0.0937 -0.1109 0.0583  118 ARG A CZ    
945  N NH1   . ARG A 118 ? 0.6259 1.3114 0.4104 -0.0861 -0.1088 0.0591  118 ARG A NH1   
946  N NH2   . ARG A 118 ? 0.6236 1.3286 0.4254 -0.0965 -0.1148 0.0589  118 ARG A NH2   
947  N N     . TRP A 119 ? 0.6531 1.2971 0.3920 -0.0841 -0.1129 0.0449  119 TRP A N     
948  C CA    . TRP A 119 ? 0.6642 1.3106 0.3958 -0.0836 -0.1195 0.0427  119 TRP A CA    
949  C C     . TRP A 119 ? 0.6653 1.3200 0.4056 -0.0879 -0.1269 0.0438  119 TRP A C     
950  O O     . TRP A 119 ? 0.6576 1.3208 0.4088 -0.0887 -0.1257 0.0483  119 TRP A O     
951  C CB    . TRP A 119 ? 0.6684 1.3181 0.3922 -0.0785 -0.1177 0.0466  119 TRP A CB    
952  C CG    . TRP A 119 ? 0.6748 1.3184 0.3847 -0.0755 -0.1134 0.0445  119 TRP A CG    
953  C CD1   . TRP A 119 ? 0.6745 1.3172 0.3793 -0.0720 -0.1078 0.0491  119 TRP A CD1   
954  C CD2   . TRP A 119 ? 0.6837 1.3226 0.3834 -0.0762 -0.1146 0.0369  119 TRP A CD2   
955  N NE1   . TRP A 119 ? 0.6823 1.3211 0.3741 -0.0713 -0.1048 0.0455  119 TRP A NE1   
956  C CE2   . TRP A 119 ? 0.6877 1.3249 0.3765 -0.0735 -0.1086 0.0374  119 TRP A CE2   
957  C CE3   . TRP A 119 ? 0.6895 1.3255 0.3888 -0.0790 -0.1204 0.0294  119 TRP A CE3   
958  C CZ2   . TRP A 119 ? 0.6966 1.3316 0.3744 -0.0732 -0.1075 0.0300  119 TRP A CZ2   
959  C CZ3   . TRP A 119 ? 0.6986 1.3309 0.3874 -0.0779 -0.1198 0.0215  119 TRP A CZ3   
960  C CH2   . TRP A 119 ? 0.7018 1.3347 0.3800 -0.0750 -0.1130 0.0216  119 TRP A CH2   
961  N N     . VAL A 120 ? 0.6755 1.3288 0.4111 -0.0905 -0.1345 0.0391  120 VAL A N     
962  C CA    . VAL A 120 ? 0.6786 1.3406 0.4214 -0.0947 -0.1424 0.0398  120 VAL A CA    
963  C C     . VAL A 120 ? 0.6908 1.3557 0.4240 -0.0927 -0.1488 0.0377  120 VAL A C     
964  O O     . VAL A 120 ? 0.6990 1.3573 0.4192 -0.0901 -0.1483 0.0336  120 VAL A O     
965  C CB    . VAL A 120 ? 0.6801 1.3379 0.4292 -0.1024 -0.1473 0.0367  120 VAL A CB    
966  C CG1   . VAL A 120 ? 0.6689 1.3269 0.4279 -0.1056 -0.1418 0.0405  120 VAL A CG1   
967  C CG2   . VAL A 120 ? 0.6897 1.3344 0.4295 -0.1027 -0.1504 0.0292  120 VAL A CG2   
968  N N     . PRO A 121 ? 0.6928 1.3686 0.4324 -0.0942 -0.1550 0.0403  121 PRO A N     
969  C CA    . PRO A 121 ? 0.7042 1.3840 0.4348 -0.0916 -0.1610 0.0397  121 PRO A CA    
970  C C     . PRO A 121 ? 0.7181 1.3914 0.4364 -0.0936 -0.1670 0.0322  121 PRO A C     
971  O O     . PRO A 121 ? 0.7284 1.4030 0.4346 -0.0906 -0.1695 0.0316  121 PRO A O     
972  C CB    . PRO A 121 ? 0.7026 1.3961 0.4461 -0.0939 -0.1673 0.0430  121 PRO A CB    
973  C CG    . PRO A 121 ? 0.6892 1.3877 0.4479 -0.0963 -0.1623 0.0460  121 PRO A CG    
974  C CD    . PRO A 121 ? 0.6853 1.3717 0.4411 -0.0988 -0.1569 0.0433  121 PRO A CD    
975  N N     . HIS A 122 ? 0.7200 1.3868 0.4414 -0.0988 -0.1700 0.0265  122 HIS A N     
976  C CA    . HIS A 122 ? 0.7346 1.3967 0.4470 -0.1010 -0.1778 0.0183  122 HIS A CA    
977  C C     . HIS A 122 ? 0.7372 1.3880 0.4528 -0.1055 -0.1804 0.0117  122 HIS A C     
978  O O     . HIS A 122 ? 0.7287 1.3774 0.4555 -0.1096 -0.1790 0.0148  122 HIS A O     
979  C CB    . HIS A 122 ? 0.7409 1.4134 0.4574 -0.1042 -0.1872 0.0195  122 HIS A CB    
980  C CG    . HIS A 122 ? 0.7575 1.4279 0.4615 -0.1045 -0.1949 0.0122  122 HIS A CG    
981  N ND1   . HIS A 122 ? 0.7664 1.4354 0.4538 -0.0995 -0.1927 0.0096  122 HIS A ND1   
982  C CD2   . HIS A 122 ? 0.7679 1.4383 0.4732 -0.1097 -0.2048 0.0067  122 HIS A CD2   
983  C CE1   . HIS A 122 ? 0.7815 1.4500 0.4601 -0.1013 -0.2007 0.0023  122 HIS A CE1   
984  N NE2   . HIS A 122 ? 0.7826 1.4514 0.4721 -0.1072 -0.2083 0.0003  122 HIS A NE2   
985  N N     . GLU A 123 ? 0.7504 1.3937 0.4555 -0.1049 -0.1847 0.0024  123 GLU A N     
986  C CA    . GLU A 123 ? 0.7571 1.3885 0.4654 -0.1091 -0.1903 -0.0050 123 GLU A CA    
987  C C     . GLU A 123 ? 0.7645 1.3994 0.4791 -0.1161 -0.2011 -0.0053 123 GLU A C     
988  O O     . GLU A 123 ? 0.7748 1.4151 0.4823 -0.1155 -0.2068 -0.0086 123 GLU A O     
989  C CB    . GLU A 123 ? 0.7694 1.3924 0.4650 -0.1047 -0.1907 -0.0164 123 GLU A CB    
990  C CG    . GLU A 123 ? 0.7765 1.3847 0.4760 -0.1070 -0.1960 -0.0250 123 GLU A CG    
991  C CD    . GLU A 123 ? 0.7667 1.3664 0.4715 -0.1050 -0.1891 -0.0236 123 GLU A CD    
992  O OE1   . GLU A 123 ? 0.7644 1.3643 0.4621 -0.0987 -0.1812 -0.0266 123 GLU A OE1   
993  O OE2   . GLU A 123 ? 0.7623 1.3553 0.4778 -0.1102 -0.1916 -0.0195 123 GLU A OE2   
994  N N     . LEU A 124 ? 0.7602 1.3926 0.4874 -0.1232 -0.2041 -0.0016 124 LEU A N     
995  C CA    . LEU A 124 ? 0.7664 1.4038 0.5013 -0.1313 -0.2139 -0.0007 124 LEU A CA    
996  C C     . LEU A 124 ? 0.7821 1.4055 0.5158 -0.1364 -0.2242 -0.0095 124 LEU A C     
997  O O     . LEU A 124 ? 0.7848 1.3935 0.5182 -0.1363 -0.2241 -0.0134 124 LEU A O     
998  C CB    . LEU A 124 ? 0.7546 1.3998 0.5045 -0.1381 -0.2118 0.0085  124 LEU A CB    
999  C CG    . LEU A 124 ? 0.7401 1.4025 0.4969 -0.1354 -0.2045 0.0172  124 LEU A CG    
1000 C CD1   . LEU A 124 ? 0.7359 1.4105 0.5078 -0.1445 -0.2077 0.0229  124 LEU A CD1   
1001 C CD2   . LEU A 124 ? 0.7425 1.4148 0.4919 -0.1283 -0.2047 0.0171  124 LEU A CD2   
1002 N N     . ASN A 125 ? 0.7932 1.4212 0.5266 -0.1405 -0.2338 -0.0125 125 ASN A N     
1003 C CA    . ASN A 125 ? 0.8090 1.4249 0.5440 -0.1474 -0.2455 -0.0196 125 ASN A CA    
1004 C C     . ASN A 125 ? 0.8066 1.4195 0.5551 -0.1581 -0.2491 -0.0130 125 ASN A C     
1005 O O     . ASN A 125 ? 0.7932 1.4187 0.5509 -0.1614 -0.2437 -0.0032 125 ASN A O     
1006 C CB    . ASN A 125 ? 0.8210 1.4449 0.5526 -0.1496 -0.2546 -0.0237 125 ASN A CB    
1007 C CG    . ASN A 125 ? 0.8300 1.4539 0.5457 -0.1410 -0.2540 -0.0325 125 ASN A CG    
1008 O OD1   . ASN A 125 ? 0.8414 1.4520 0.5495 -0.1381 -0.2564 -0.0430 125 ASN A OD1   
1009 N ND2   . ASN A 125 ? 0.8260 1.4649 0.5365 -0.1369 -0.2508 -0.0283 125 ASN A ND2   
1010 N N     . GLU A 126 ? 0.8212 1.4178 0.5710 -0.1641 -0.2590 -0.0186 126 GLU A N     
1011 C CA    . GLU A 126 ? 0.8237 1.4170 0.5851 -0.1767 -0.2650 -0.0123 126 GLU A CA    
1012 C C     . GLU A 126 ? 0.8217 1.4347 0.5911 -0.1840 -0.2685 -0.0068 126 GLU A C     
1013 O O     . GLU A 126 ? 0.8131 1.4362 0.5935 -0.1921 -0.2661 0.0025  126 GLU A O     
1014 C CB    . GLU A 126 ? 0.8435 1.4139 0.6038 -0.1815 -0.2771 -0.0202 126 GLU A CB    
1015 C CG    . GLU A 126 ? 0.8501 1.4137 0.6210 -0.1961 -0.2850 -0.0132 126 GLU A CG    
1016 C CD    . GLU A 126 ? 0.8632 1.4315 0.6388 -0.2065 -0.2967 -0.0142 126 GLU A CD    
1017 O OE1   . GLU A 126 ? 0.8650 1.4456 0.6370 -0.2029 -0.2985 -0.0189 126 GLU A OE1   
1018 O OE2   . GLU A 126 ? 0.8727 1.4325 0.6556 -0.2194 -0.3048 -0.0095 126 GLU A OE2   
1019 N N     . ARG A 127 ? 0.8298 1.4496 0.5937 -0.1812 -0.2739 -0.0128 127 ARG A N     
1020 C CA    . ARG A 127 ? 0.8281 1.4679 0.6000 -0.1870 -0.2776 -0.0082 127 ARG A CA    
1021 C C     . ARG A 127 ? 0.8089 1.4694 0.5859 -0.1821 -0.2667 0.0003  127 ARG A C     
1022 O O     . ARG A 127 ? 0.8005 1.4748 0.5905 -0.1892 -0.2651 0.0081  127 ARG A O     
1023 C CB    . ARG A 127 ? 0.8423 1.4842 0.6062 -0.1847 -0.2865 -0.0168 127 ARG A CB    
1024 C CG    . ARG A 127 ? 0.8378 1.5032 0.6084 -0.1867 -0.2884 -0.0120 127 ARG A CG    
1025 C CD    . ARG A 127 ? 0.8554 1.5214 0.6258 -0.1932 -0.3021 -0.0183 127 ARG A CD    
1026 N NE    . ARG A 127 ? 0.8532 1.5412 0.6267 -0.1920 -0.3046 -0.0159 127 ARG A NE    
1027 C CZ    . ARG A 127 ? 0.8423 1.5509 0.6308 -0.1968 -0.3030 -0.0074 127 ARG A CZ    
1028 N NH1   . ARG A 127 ? 0.8316 1.5438 0.6332 -0.2039 -0.2979 0.0000  127 ARG A NH1   
1029 N NH2   . ARG A 127 ? 0.8425 1.5697 0.6333 -0.1943 -0.3068 -0.0066 127 ARG A NH2   
1030 N N     . GLN A 128 ? 0.8033 1.4663 0.5703 -0.1702 -0.2598 -0.0013 128 GLN A N     
1031 C CA    . GLN A 128 ? 0.7866 1.4659 0.5572 -0.1638 -0.2497 0.0061  128 GLN A CA    
1032 C C     . GLN A 128 ? 0.7721 1.4573 0.5554 -0.1683 -0.2422 0.0146  128 GLN A C     
1033 O O     . GLN A 128 ? 0.7610 1.4647 0.5537 -0.1677 -0.2378 0.0207  128 GLN A O     
1034 C CB    . GLN A 128 ? 0.7835 1.4567 0.5404 -0.1519 -0.2418 0.0036  128 GLN A CB    
1035 C CG    . GLN A 128 ? 0.7938 1.4704 0.5381 -0.1458 -0.2459 -0.0015 128 GLN A CG    
1036 C CD    . GLN A 128 ? 0.7913 1.4629 0.5218 -0.1354 -0.2374 -0.0031 128 GLN A CD    
1037 O OE1   . GLN A 128 ? 0.7917 1.4494 0.5169 -0.1333 -0.2332 -0.0073 128 GLN A OE1   
1038 N NE2   . GLN A 128 ? 0.7896 1.4724 0.5145 -0.1293 -0.2351 0.0004  128 GLN A NE2   
1039 N N     . MET A 129 ? 0.7729 1.4425 0.5559 -0.1723 -0.2407 0.0145  129 MET A N     
1040 C CA    . MET A 129 ? 0.7621 1.4361 0.5560 -0.1787 -0.2349 0.0224  129 MET A CA    
1041 C C     . MET A 129 ? 0.7640 1.4527 0.5714 -0.1910 -0.2405 0.0268  129 MET A C     
1042 O O     . MET A 129 ? 0.7522 1.4612 0.5699 -0.1918 -0.2349 0.0324  129 MET A O     
1043 C CB    . MET A 129 ? 0.7669 1.4193 0.5571 -0.1820 -0.2352 0.0213  129 MET A CB    
1044 C CG    . MET A 129 ? 0.7606 1.4018 0.5415 -0.1711 -0.2267 0.0190  129 MET A CG    
1045 S SD    . MET A 129 ? 0.7718 1.3854 0.5479 -0.1738 -0.2313 0.0146  129 MET A SD    
1046 C CE    . MET A 129 ? 0.7731 1.3871 0.5613 -0.1899 -0.2350 0.0239  129 MET A CE    
1047 N N     . GLU A 130 ? 0.7795 1.4587 0.5874 -0.2007 -0.2517 0.0237  130 GLU A N     
1048 C CA    . GLU A 130 ? 0.7829 1.4757 0.6039 -0.2146 -0.2575 0.0282  130 GLU A CA    
1049 C C     . GLU A 130 ? 0.7786 1.4963 0.6072 -0.2127 -0.2587 0.0284  130 GLU A C     
1050 O O     . GLU A 130 ? 0.7740 1.5114 0.6164 -0.2211 -0.2584 0.0335  130 GLU A O     
1051 C CB    . GLU A 130 ? 0.8028 1.4778 0.6221 -0.2257 -0.2704 0.0247  130 GLU A CB    
1052 C CG    . GLU A 130 ? 0.8163 1.4922 0.6330 -0.2260 -0.2815 0.0175  130 GLU A CG    
1053 C CD    . GLU A 130 ? 0.8374 1.4889 0.6485 -0.2325 -0.2939 0.0112  130 GLU A CD    
1054 O OE1   . GLU A 130 ? 0.8422 1.4717 0.6442 -0.2271 -0.2935 0.0069  130 GLU A OE1   
1055 O OE2   . GLU A 130 ? 0.8497 1.5043 0.6663 -0.2428 -0.3045 0.0101  130 GLU A OE2   
1056 N N     . ARG A 131 ? 0.7811 1.4980 0.6005 -0.2017 -0.2604 0.0229  131 ARG A N     
1057 C CA    . ARG A 131 ? 0.7763 1.5152 0.6009 -0.1966 -0.2609 0.0235  131 ARG A CA    
1058 C C     . ARG A 131 ? 0.7578 1.5149 0.5924 -0.1918 -0.2495 0.0302  131 ARG A C     
1059 O O     . ARG A 131 ? 0.7524 1.5324 0.6010 -0.1947 -0.2499 0.0332  131 ARG A O     
1060 C CB    . ARG A 131 ? 0.7835 1.5148 0.5927 -0.1851 -0.2636 0.0172  131 ARG A CB    
1061 C CG    . ARG A 131 ? 0.7807 1.5312 0.5921 -0.1780 -0.2649 0.0182  131 ARG A CG    
1062 C CD    . ARG A 131 ? 0.7873 1.5541 0.6107 -0.1869 -0.2750 0.0179  131 ARG A CD    
1063 N NE    . ARG A 131 ? 0.7874 1.5713 0.6124 -0.1798 -0.2785 0.0182  131 ARG A NE    
1064 C CZ    . ARG A 131 ? 0.7760 1.5823 0.6153 -0.1767 -0.2752 0.0233  131 ARG A CZ    
1065 N NH1   . ARG A 131 ? 0.7623 1.5793 0.6158 -0.1800 -0.2670 0.0283  131 ARG A NH1   
1066 N NH2   . ARG A 131 ? 0.7794 1.5980 0.6187 -0.1700 -0.2806 0.0230  131 ARG A NH2   
1067 N N     . ARG A 132 ? 0.7490 1.4962 0.5767 -0.1842 -0.2398 0.0317  132 ARG A N     
1068 C CA    . ARG A 132 ? 0.7324 1.4934 0.5686 -0.1797 -0.2287 0.0372  132 ARG A CA    
1069 C C     . ARG A 132 ? 0.7269 1.4996 0.5775 -0.1917 -0.2259 0.0422  132 ARG A C     
1070 O O     . ARG A 132 ? 0.7174 1.5133 0.5817 -0.1920 -0.2218 0.0452  132 ARG A O     
1071 C CB    . ARG A 132 ? 0.7259 1.4707 0.5505 -0.1703 -0.2196 0.0373  132 ARG A CB    
1072 C CG    . ARG A 132 ? 0.7260 1.4680 0.5396 -0.1572 -0.2180 0.0350  132 ARG A CG    
1073 C CD    . ARG A 132 ? 0.7192 1.4474 0.5235 -0.1499 -0.2084 0.0357  132 ARG A CD    
1074 N NE    . ARG A 132 ? 0.7045 1.4452 0.5187 -0.1468 -0.1991 0.0411  132 ARG A NE    
1075 C CZ    . ARG A 132 ? 0.6955 1.4293 0.5079 -0.1440 -0.1899 0.0433  132 ARG A CZ    
1076 N NH1   . ARG A 132 ? 0.6984 1.4125 0.5000 -0.1434 -0.1878 0.0410  132 ARG A NH1   
1077 N NH2   . ARG A 132 ? 0.6837 1.4316 0.5064 -0.1414 -0.1828 0.0473  132 ARG A NH2   
1078 N N     . LYS A 133 ? 0.7343 1.4911 0.5814 -0.2016 -0.2285 0.0428  133 LYS A N     
1079 C CA    . LYS A 133 ? 0.7322 1.4970 0.5898 -0.2149 -0.2263 0.0483  133 LYS A CA    
1080 C C     . LYS A 133 ? 0.7337 1.5235 0.6067 -0.2247 -0.2309 0.0498  133 LYS A C     
1081 O O     . LYS A 133 ? 0.7251 1.5353 0.6105 -0.2304 -0.2247 0.0541  133 LYS A O     
1082 C CB    . LYS A 133 ? 0.7450 1.4854 0.5951 -0.2247 -0.2320 0.0486  133 LYS A CB    
1083 C CG    . LYS A 133 ? 0.7430 1.4870 0.5996 -0.2373 -0.2280 0.0557  133 LYS A CG    
1084 C CD    . LYS A 133 ? 0.7605 1.4843 0.6133 -0.2510 -0.2381 0.0570  133 LYS A CD    
1085 C CE    . LYS A 133 ? 0.7600 1.4872 0.6175 -0.2642 -0.2341 0.0653  133 LYS A CE    
1086 N NZ    . LYS A 133 ? 0.7793 1.4885 0.6345 -0.2797 -0.2454 0.0682  133 LYS A NZ    
1087 N N     . ASN A 134 ? 0.7451 1.5345 0.6175 -0.2268 -0.2416 0.0458  134 ASN A N     
1088 C CA    . ASN A 134 ? 0.7477 1.5613 0.6351 -0.2361 -0.2471 0.0466  134 ASN A CA    
1089 C C     . ASN A 134 ? 0.7340 1.5762 0.6340 -0.2275 -0.2412 0.0470  134 ASN A C     
1090 O O     . ASN A 134 ? 0.7283 1.5953 0.6445 -0.2352 -0.2382 0.0498  134 ASN A O     
1091 C CB    . ASN A 134 ? 0.7638 1.5697 0.6470 -0.2395 -0.2607 0.0416  134 ASN A CB    
1092 C CG    . ASN A 134 ? 0.7800 1.5661 0.6589 -0.2540 -0.2693 0.0418  134 ASN A CG    
1093 O OD1   . ASN A 134 ? 0.7900 1.5843 0.6771 -0.2663 -0.2780 0.0419  134 ASN A OD1   
1094 N ND2   . ASN A 134 ? 0.7837 1.5433 0.6504 -0.2524 -0.2676 0.0416  134 ASN A ND2   
1095 N N     . THR A 135 ? 0.7299 1.5687 0.6227 -0.2119 -0.2397 0.0441  135 THR A N     
1096 C CA    . THR A 135 ? 0.7187 1.5813 0.6229 -0.2018 -0.2354 0.0444  135 THR A CA    
1097 C C     . THR A 135 ? 0.7049 1.5829 0.6207 -0.2033 -0.2238 0.0480  135 THR A C     
1098 O O     . THR A 135 ? 0.6991 1.6051 0.6330 -0.2066 -0.2222 0.0485  135 THR A O     
1099 C CB    . THR A 135 ? 0.7171 1.5683 0.6086 -0.1851 -0.2341 0.0425  135 THR A CB    
1100 O OG1   . THR A 135 ? 0.7311 1.5645 0.6079 -0.1844 -0.2435 0.0386  135 THR A OG1   
1101 C CG2   . THR A 135 ? 0.7106 1.5847 0.6141 -0.1755 -0.2340 0.0425  135 THR A CG2   
1102 N N     . CYS A 136 ? 0.7005 1.5610 0.6063 -0.2014 -0.2161 0.0501  136 CYS A N     
1103 C CA    . CYS A 136 ? 0.6890 1.5610 0.6029 -0.2035 -0.2051 0.0533  136 CYS A CA    
1104 C C     . CYS A 136 ? 0.6915 1.5819 0.6187 -0.2208 -0.2059 0.0558  136 CYS A C     
1105 O O     . CYS A 136 ? 0.6835 1.6023 0.6271 -0.2221 -0.2009 0.0558  136 CYS A O     
1106 C CB    . CYS A 136 ? 0.6869 1.5335 0.5858 -0.2004 -0.1987 0.0550  136 CYS A CB    
1107 S SG    . CYS A 136 ? 0.6857 1.5113 0.5682 -0.1820 -0.1977 0.0521  136 CYS A SG    
1108 N N     . GLU A 137 ? 0.7038 1.5787 0.6243 -0.2341 -0.2126 0.0577  137 GLU A N     
1109 C CA    . GLU A 137 ? 0.7098 1.5990 0.6406 -0.2531 -0.2147 0.0613  137 GLU A CA    
1110 C C     . GLU A 137 ? 0.7079 1.6310 0.6579 -0.2572 -0.2172 0.0595  137 GLU A C     
1111 O O     . GLU A 137 ? 0.7039 1.6519 0.6675 -0.2672 -0.2119 0.0618  137 GLU A O     
1112 C CB    . GLU A 137 ? 0.7274 1.5924 0.6481 -0.2652 -0.2258 0.0624  137 GLU A CB    
1113 C CG    . GLU A 137 ? 0.7326 1.5737 0.6419 -0.2725 -0.2237 0.0670  137 GLU A CG    
1114 C CD    . GLU A 137 ? 0.7520 1.5696 0.6536 -0.2848 -0.2361 0.0678  137 GLU A CD    
1115 O OE1   . GLU A 137 ? 0.7612 1.5721 0.6606 -0.2829 -0.2461 0.0630  137 GLU A OE1   
1116 O OE2   . GLU A 137 ? 0.7595 1.5639 0.6565 -0.2964 -0.2366 0.0733  137 GLU A OE2   
1117 N N     . ILE A 138 ? 0.7116 1.6360 0.6624 -0.2495 -0.2254 0.0552  138 ILE A N     
1118 C CA    . ILE A 138 ? 0.7115 1.6662 0.6804 -0.2525 -0.2300 0.0529  138 ILE A CA    
1119 C C     . ILE A 138 ? 0.6964 1.6790 0.6804 -0.2414 -0.2211 0.0510  138 ILE A C     
1120 O O     . ILE A 138 ? 0.6929 1.7073 0.6961 -0.2480 -0.2195 0.0502  138 ILE A O     
1121 C CB    . ILE A 138 ? 0.7221 1.6675 0.6855 -0.2479 -0.2427 0.0489  138 ILE A CB    
1122 C CG1   . ILE A 138 ? 0.7388 1.6589 0.6899 -0.2606 -0.2522 0.0496  138 ILE A CG1   
1123 C CG2   . ILE A 138 ? 0.7215 1.6992 0.7044 -0.2490 -0.2480 0.0461  138 ILE A CG2   
1124 C CD1   . ILE A 138 ? 0.7460 1.6751 0.7059 -0.2817 -0.2540 0.0539  138 ILE A CD1   
1125 N N     . LEU A 139 ? 0.6882 1.6594 0.6642 -0.2250 -0.2154 0.0499  139 LEU A N     
1126 C CA    . LEU A 139 ? 0.6749 1.6685 0.6643 -0.2136 -0.2069 0.0479  139 LEU A CA    
1127 C C     . LEU A 139 ? 0.6666 1.6767 0.6651 -0.2213 -0.1953 0.0496  139 LEU A C     
1128 O O     . LEU A 139 ? 0.6582 1.6979 0.6748 -0.2178 -0.1900 0.0466  139 LEU A O     
1129 C CB    . LEU A 139 ? 0.6703 1.6439 0.6470 -0.1955 -0.2041 0.0471  139 LEU A CB    
1130 C CG    . LEU A 139 ? 0.6777 1.6412 0.6472 -0.1855 -0.2144 0.0450  139 LEU A CG    
1131 C CD1   . LEU A 139 ? 0.6772 1.6128 0.6273 -0.1728 -0.2118 0.0458  139 LEU A CD1   
1132 C CD2   . LEU A 139 ? 0.6745 1.6657 0.6625 -0.1773 -0.2178 0.0419  139 LEU A CD2   
1133 N N     . LEU A 140 ? 0.6698 1.6611 0.6557 -0.2314 -0.1918 0.0540  140 LEU A N     
1134 C CA    . LEU A 140 ? 0.6647 1.6708 0.6567 -0.2415 -0.1817 0.0566  140 LEU A CA    
1135 C C     . LEU A 140 ? 0.6688 1.7056 0.6776 -0.2583 -0.1832 0.0570  140 LEU A C     
1136 O O     . LEU A 140 ? 0.6615 1.7271 0.6844 -0.2616 -0.1745 0.0557  140 LEU A O     
1137 C CB    . LEU A 140 ? 0.6699 1.6466 0.6435 -0.2493 -0.1797 0.0620  140 LEU A CB    
1138 C CG    . LEU A 140 ? 0.6634 1.6157 0.6225 -0.2354 -0.1737 0.0620  140 LEU A CG    
1139 C CD1   . LEU A 140 ? 0.6718 1.5925 0.6129 -0.2432 -0.1757 0.0667  140 LEU A CD1   
1140 C CD2   . LEU A 140 ? 0.6506 1.6217 0.6182 -0.2296 -0.1611 0.0606  140 LEU A CD2   
1141 N N     . SER A 141 ? 0.6812 1.7123 0.6885 -0.2696 -0.1941 0.0586  141 SER A N     
1142 C CA    . SER A 141 ? 0.6865 1.7474 0.7105 -0.2864 -0.1971 0.0591  141 SER A CA    
1143 C C     . SER A 141 ? 0.6767 1.7763 0.7237 -0.2782 -0.1941 0.0528  141 SER A C     
1144 O O     . SER A 141 ? 0.6729 1.8054 0.7361 -0.2873 -0.1874 0.0519  141 SER A O     
1145 C CB    . SER A 141 ? 0.7016 1.7489 0.7210 -0.2960 -0.2112 0.0603  141 SER A CB    
1146 O OG    . SER A 141 ? 0.7136 1.7330 0.7172 -0.3095 -0.2145 0.0663  141 SER A OG    
1147 N N     . ARG A 142 ? 0.6736 1.7691 0.7217 -0.2609 -0.1994 0.0482  142 ARG A N     
1148 C CA    . ARG A 142 ? 0.6662 1.7946 0.7360 -0.2507 -0.1993 0.0419  142 ARG A CA    
1149 C C     . ARG A 142 ? 0.6528 1.7993 0.7327 -0.2401 -0.1868 0.0384  142 ARG A C     
1150 O O     . ARG A 142 ? 0.6474 1.8311 0.7498 -0.2404 -0.1833 0.0334  142 ARG A O     
1151 C CB    . ARG A 142 ? 0.6690 1.7833 0.7340 -0.2353 -0.2096 0.0392  142 ARG A CB    
1152 C CG    . ARG A 142 ? 0.6652 1.8121 0.7531 -0.2263 -0.2135 0.0332  142 ARG A CG    
1153 C CD    . ARG A 142 ? 0.6727 1.8043 0.7534 -0.2162 -0.2263 0.0321  142 ARG A CD    
1154 N NE    . ARG A 142 ? 0.6670 1.8093 0.7576 -0.1968 -0.2276 0.0279  142 ARG A NE    
1155 C CZ    . ARG A 142 ? 0.6734 1.8054 0.7588 -0.1857 -0.2385 0.0271  142 ARG A CZ    
1156 N NH1   . ARG A 142 ? 0.6852 1.7974 0.7557 -0.1919 -0.2485 0.0292  142 ARG A NH1   
1157 N NH2   . ARG A 142 ? 0.6693 1.8107 0.7643 -0.1685 -0.2398 0.0240  142 ARG A NH2   
1158 N N     . TYR A 143 ? 0.6479 1.7693 0.7122 -0.2306 -0.1805 0.0402  143 TYR A N     
1159 C CA    . TYR A 143 ? 0.6363 1.7714 0.7082 -0.2209 -0.1686 0.0368  143 TYR A CA    
1160 C C     . TYR A 143 ? 0.6338 1.7983 0.7175 -0.2362 -0.1589 0.0365  143 TYR A C     
1161 O O     . TYR A 143 ? 0.6260 1.8225 0.7287 -0.2310 -0.1520 0.0302  143 TYR A O     
1162 C CB    . TYR A 143 ? 0.6334 1.7336 0.6840 -0.2116 -0.1639 0.0398  143 TYR A CB    
1163 C CG    . TYR A 143 ? 0.6230 1.7338 0.6787 -0.2043 -0.1513 0.0369  143 TYR A CG    
1164 C CD1   . TYR A 143 ? 0.6154 1.7450 0.6871 -0.1881 -0.1489 0.0300  143 TYR A CD1   
1165 C CD2   . TYR A 143 ? 0.6219 1.7235 0.6667 -0.2136 -0.1426 0.0408  143 TYR A CD2   
1166 C CE1   . TYR A 143 ? 0.6070 1.7458 0.6836 -0.1812 -0.1378 0.0263  143 TYR A CE1   
1167 C CE2   . TYR A 143 ? 0.6132 1.7246 0.6620 -0.2073 -0.1312 0.0376  143 TYR A CE2   
1168 C CZ    . TYR A 143 ? 0.6057 1.7356 0.6705 -0.1911 -0.1287 0.0300  143 TYR A CZ    
1169 O OH    . TYR A 143 ? 0.5982 1.7367 0.6668 -0.1847 -0.1179 0.0260  143 TYR A OH    
1170 N N     . LYS A 144 ? 0.6418 1.7953 0.7139 -0.2551 -0.1589 0.0433  144 LYS A N     
1171 C CA    . LYS A 144 ? 0.6428 1.8225 0.7230 -0.2734 -0.1507 0.0449  144 LYS A CA    
1172 C C     . LYS A 144 ? 0.6426 1.8668 0.7485 -0.2804 -0.1514 0.0397  144 LYS A C     
1173 O O     . LYS A 144 ? 0.6375 1.8951 0.7577 -0.2852 -0.1414 0.0360  144 LYS A O     
1174 C CB    . LYS A 144 ? 0.6553 1.8120 0.7181 -0.2933 -0.1543 0.0543  144 LYS A CB    
1175 C CG    . LYS A 144 ? 0.6558 1.7744 0.6953 -0.2899 -0.1513 0.0594  144 LYS A CG    
1176 C CD    . LYS A 144 ? 0.6707 1.7594 0.6931 -0.3054 -0.1601 0.0676  144 LYS A CD    
1177 C CE    . LYS A 144 ? 0.6724 1.7293 0.6743 -0.3058 -0.1562 0.0731  144 LYS A CE    
1178 N NZ    . LYS A 144 ? 0.6672 1.6934 0.6565 -0.2861 -0.1581 0.0707  144 LYS A NZ    
1179 N N     . ARG A 145 ? 0.6484 1.8743 0.7604 -0.2811 -0.1630 0.0389  145 ARG A N     
1180 C CA    . ARG A 145 ? 0.6485 1.9170 0.7862 -0.2870 -0.1652 0.0335  145 ARG A CA    
1181 C C     . ARG A 145 ? 0.6364 1.9340 0.7954 -0.2678 -0.1601 0.0233  145 ARG A C     
1182 O O     . ARG A 145 ? 0.6321 1.9708 0.8120 -0.2729 -0.1526 0.0177  145 ARG A O     
1183 C CB    . ARG A 145 ? 0.6588 1.9189 0.7963 -0.2921 -0.1801 0.0353  145 ARG A CB    
1184 C CG    . ARG A 145 ? 0.6726 1.9055 0.7914 -0.3118 -0.1858 0.0444  145 ARG A CG    
1185 C CD    . ARG A 145 ? 0.6842 1.9350 0.8138 -0.3309 -0.1947 0.0460  145 ARG A CD    
1186 N NE    . ARG A 145 ? 0.6969 1.9309 0.8123 -0.3533 -0.1955 0.0550  145 ARG A NE    
1187 C CZ    . ARG A 145 ? 0.7092 1.9565 0.8310 -0.3752 -0.2012 0.0587  145 ARG A CZ    
1188 N NH1   . ARG A 145 ? 0.7099 1.9900 0.8531 -0.3786 -0.2063 0.0538  145 ARG A NH1   
1189 N NH2   . ARG A 145 ? 0.7221 1.9492 0.8288 -0.3944 -0.2024 0.0678  145 ARG A NH2   
1190 N N     . LYS A 146 ? 0.6319 1.9081 0.7852 -0.2462 -0.1640 0.0209  146 LYS A N     
1191 C CA    . LYS A 146 ? 0.6215 1.9157 0.7903 -0.2264 -0.1585 0.0123  146 LYS A CA    
1192 C C     . LYS A 146 ? 0.6187 1.8767 0.7713 -0.2062 -0.1608 0.0133  146 LYS A C     
1193 O O     . LYS A 146 ? 0.6248 1.8528 0.7619 -0.2028 -0.1706 0.0178  146 LYS A O     
1194 C CB    . LYS A 146 ? 0.6205 1.9513 0.8172 -0.2204 -0.1647 0.0042  146 LYS A CB    
1195 C CG    . LYS A 146 ? 0.6109 1.9720 0.8299 -0.2051 -0.1571 -0.0062 146 LYS A CG    
1196 C CD    . LYS A 146 ? 0.6086 2.0217 0.8547 -0.2164 -0.1506 -0.0134 146 LYS A CD    
1197 C CE    . LYS A 146 ? 0.6133 2.0522 0.8793 -0.2203 -0.1615 -0.0164 146 LYS A CE    
1198 N NZ    . LYS A 146 ? 0.6118 2.0524 0.8911 -0.1976 -0.1713 -0.0228 146 LYS A NZ    
1199 N N     . SER A 147 ? 0.6103 1.8716 0.7663 -0.1938 -0.1515 0.0089  147 SER A N     
1200 C CA    . SER A 147 ? 0.6078 1.8398 0.7522 -0.1740 -0.1534 0.0090  147 SER A CA    
1201 C C     . SER A 147 ? 0.6105 1.8484 0.7672 -0.1597 -0.1651 0.0052  147 SER A C     
1202 O O     . SER A 147 ? 0.6078 1.8805 0.7900 -0.1545 -0.1658 -0.0025 147 SER A O     
1203 C CB    . SER A 147 ? 0.5993 1.8389 0.7491 -0.1639 -0.1417 0.0037  147 SER A CB    
1204 O OG    . SER A 147 ? 0.5981 1.8088 0.7369 -0.1455 -0.1440 0.0043  147 SER A OG    
1205 N N     . PHE A 148 ? 0.6168 1.8216 0.7551 -0.1541 -0.1747 0.0106  148 PHE A N     
1206 C CA    . PHE A 148 ? 0.6215 1.8249 0.7659 -0.1400 -0.1870 0.0088  148 PHE A CA    
1207 C C     . PHE A 148 ? 0.6214 1.7949 0.7517 -0.1218 -0.1877 0.0105  148 PHE A C     
1208 O O     . PHE A 148 ? 0.6274 1.7914 0.7562 -0.1099 -0.1982 0.0111  148 PHE A O     
1209 C CB    . PHE A 148 ? 0.6315 1.8235 0.7659 -0.1496 -0.1987 0.0134  148 PHE A CB    
1210 C CG    . PHE A 148 ? 0.6362 1.7908 0.7417 -0.1583 -0.1982 0.0210  148 PHE A CG    
1211 C CD1   . PHE A 148 ? 0.6394 1.7589 0.7234 -0.1471 -0.2011 0.0247  148 PHE A CD1   
1212 C CD2   . PHE A 148 ? 0.6386 1.7933 0.7386 -0.1780 -0.1951 0.0244  148 PHE A CD2   
1213 C CE1   . PHE A 148 ? 0.6437 1.7309 0.7029 -0.1544 -0.2005 0.0303  148 PHE A CE1   
1214 C CE2   . PHE A 148 ? 0.6439 1.7638 0.7188 -0.1850 -0.1955 0.0306  148 PHE A CE2   
1215 C CZ    . PHE A 148 ? 0.6460 1.7329 0.7010 -0.1728 -0.1980 0.0329  148 PHE A CZ    
1216 N N     . LEU A 149 ? 0.6153 1.7756 0.7358 -0.1202 -0.1767 0.0115  149 LEU A N     
1217 C CA    . LEU A 149 ? 0.6154 1.7451 0.7201 -0.1058 -0.1759 0.0140  149 LEU A CA    
1218 C C     . LEU A 149 ? 0.6142 1.7556 0.7361 -0.0870 -0.1781 0.0081  149 LEU A C     
1219 O O     . LEU A 149 ? 0.6179 1.7348 0.7287 -0.0738 -0.1819 0.0108  149 LEU A O     
1220 C CB    . LEU A 149 ? 0.6095 1.7231 0.6997 -0.1111 -0.1634 0.0165  149 LEU A CB    
1221 C CG    . LEU A 149 ? 0.6130 1.6985 0.6783 -0.1240 -0.1628 0.0241  149 LEU A CG    
1222 C CD1   . LEU A 149 ? 0.6195 1.7122 0.6853 -0.1389 -0.1701 0.0263  149 LEU A CD1   
1223 C CD2   . LEU A 149 ? 0.6068 1.6890 0.6656 -0.1320 -0.1503 0.0252  149 LEU A CD2   
1224 N N     . HIS A 150 ? 0.6099 1.7892 0.7593 -0.0862 -0.1759 -0.0001 150 HIS A N     
1225 C CA    . HIS A 150 ? 0.6099 1.8052 0.7806 -0.0684 -0.1795 -0.0075 150 HIS A CA    
1226 C C     . HIS A 150 ? 0.6194 1.8120 0.7939 -0.0598 -0.1953 -0.0059 150 HIS A C     
1227 O O     . HIS A 150 ? 0.6234 1.8145 0.8071 -0.0429 -0.2019 -0.0086 150 HIS A O     
1228 C CB    . HIS A 150 ? 0.6029 1.8426 0.8027 -0.0712 -0.1719 -0.0180 150 HIS A CB    
1229 C CG    . HIS A 150 ? 0.5951 1.8407 0.7899 -0.0831 -0.1566 -0.0190 150 HIS A CG    
1230 N ND1   . HIS A 150 ? 0.5930 1.8590 0.7904 -0.1027 -0.1511 -0.0183 150 HIS A ND1   
1231 C CD2   . HIS A 150 ? 0.5903 1.8235 0.7769 -0.0790 -0.1462 -0.0199 150 HIS A CD2   
1232 C CE1   . HIS A 150 ? 0.5876 1.8539 0.7782 -0.1102 -0.1382 -0.0186 150 HIS A CE1   
1233 N NE2   . HIS A 150 ? 0.5855 1.8324 0.7696 -0.0959 -0.1349 -0.0199 150 HIS A NE2   
1234 N N     . ARG A 151 ? 0.6243 1.8143 0.7905 -0.0716 -0.2021 -0.0012 151 ARG A N     
1235 C CA    . ARG A 151 ? 0.6345 1.8207 0.8010 -0.0658 -0.2175 0.0009  151 ARG A CA    
1236 C C     . ARG A 151 ? 0.6433 1.7880 0.7796 -0.0624 -0.2238 0.0099  151 ARG A C     
1237 O O     . ARG A 151 ? 0.6535 1.7921 0.7870 -0.0566 -0.2369 0.0123  151 ARG A O     
1238 C CB    . ARG A 151 ? 0.6364 1.8458 0.8126 -0.0806 -0.2223 -0.0001 151 ARG A CB    
1239 C CG    . ARG A 151 ? 0.6280 1.8800 0.8317 -0.0886 -0.2143 -0.0083 151 ARG A CG    
1240 C CD    . ARG A 151 ? 0.6315 1.9175 0.8592 -0.0915 -0.2239 -0.0132 151 ARG A CD    
1241 N NE    . ARG A 151 ? 0.6356 1.9236 0.8563 -0.1105 -0.2274 -0.0091 151 ARG A NE    
1242 C CZ    . ARG A 151 ? 0.6455 1.9112 0.8492 -0.1133 -0.2389 -0.0031 151 ARG A CZ    
1243 N NH1   . ARG A 151 ? 0.6495 1.9194 0.8493 -0.1312 -0.2416 -0.0006 151 ARG A NH1   
1244 N NH2   . ARG A 151 ? 0.6526 1.8918 0.8424 -0.0991 -0.2478 0.0004  151 ARG A NH2   
1245 N N     . ILE A 152 ? 0.6401 1.7577 0.7541 -0.0661 -0.2148 0.0146  152 ILE A N     
1246 C CA    . ILE A 152 ? 0.6480 1.7277 0.7323 -0.0651 -0.2190 0.0226  152 ILE A CA    
1247 C C     . ILE A 152 ? 0.6546 1.7151 0.7323 -0.0479 -0.2242 0.0252  152 ILE A C     
1248 O O     . ILE A 152 ? 0.6498 1.7091 0.7335 -0.0386 -0.2178 0.0230  152 ILE A O     
1249 C CB    . ILE A 152 ? 0.6429 1.7006 0.7060 -0.0757 -0.2079 0.0266  152 ILE A CB    
1250 C CG1   . ILE A 152 ? 0.6449 1.7047 0.7018 -0.0932 -0.2094 0.0282  152 ILE A CG1   
1251 C CG2   . ILE A 152 ? 0.6486 1.6692 0.6850 -0.0692 -0.2086 0.0328  152 ILE A CG2   
1252 C CD1   . ILE A 152 ? 0.6401 1.6841 0.6815 -0.1048 -0.1990 0.0310  152 ILE A CD1   
1253 N N     . VAL A 153 ? 0.6668 1.7111 0.7304 -0.0448 -0.2360 0.0302  153 VAL A N     
1254 C CA    . VAL A 153 ? 0.6766 1.6974 0.7273 -0.0315 -0.2422 0.0351  153 VAL A CA    
1255 C C     . VAL A 153 ? 0.6840 1.6741 0.7029 -0.0378 -0.2433 0.0422  153 VAL A C     
1256 O O     . VAL A 153 ? 0.6903 1.6809 0.7019 -0.0458 -0.2501 0.0432  153 VAL A O     
1257 C CB    . VAL A 153 ? 0.6877 1.7207 0.7520 -0.0213 -0.2576 0.0345  153 VAL A CB    
1258 C CG1   . VAL A 153 ? 0.6994 1.7082 0.7514 -0.0075 -0.2642 0.0403  153 VAL A CG1   
1259 C CG2   . VAL A 153 ? 0.6806 1.7502 0.7795 -0.0171 -0.2576 0.0256  153 VAL A CG2   
1260 N N     . THR A 154 ? 0.6838 1.6484 0.6846 -0.0342 -0.2366 0.0463  154 THR A N     
1261 C CA    . THR A 154 ? 0.6908 1.6272 0.6619 -0.0392 -0.2365 0.0521  154 THR A CA    
1262 C C     . THR A 154 ? 0.7007 1.6140 0.6560 -0.0289 -0.2396 0.0580  154 THR A C     
1263 O O     . THR A 154 ? 0.6995 1.6133 0.6648 -0.0187 -0.2383 0.0579  154 THR A O     
1264 C CB    . THR A 154 ? 0.6805 1.6047 0.6406 -0.0474 -0.2229 0.0520  154 THR A CB    
1265 O OG1   . THR A 154 ? 0.6723 1.5961 0.6405 -0.0403 -0.2141 0.0509  154 THR A OG1   
1266 C CG2   . THR A 154 ? 0.6729 1.6130 0.6418 -0.0602 -0.2192 0.0481  154 THR A CG2   
1267 N N     . GLY A 155 ? 0.7106 1.6029 0.6403 -0.0327 -0.2426 0.0628  155 GLY A N     
1268 C CA    . GLY A 155 ? 0.7207 1.5890 0.6308 -0.0259 -0.2436 0.0693  155 GLY A CA    
1269 C C     . GLY A 155 ? 0.7288 1.5766 0.6104 -0.0328 -0.2432 0.0727  155 GLY A C     
1270 O O     . GLY A 155 ? 0.7302 1.5814 0.6062 -0.0418 -0.2454 0.0702  155 GLY A O     
1271 N N     . ASP A 156 ? 0.7351 1.5619 0.5988 -0.0287 -0.2404 0.0781  156 ASP A N     
1272 C CA    . ASP A 156 ? 0.7438 1.5522 0.5803 -0.0343 -0.2393 0.0808  156 ASP A CA    
1273 C C     . ASP A 156 ? 0.7572 1.5478 0.5776 -0.0274 -0.2420 0.0885  156 ASP A C     
1274 O O     . ASP A 156 ? 0.7580 1.5485 0.5891 -0.0187 -0.2437 0.0914  156 ASP A O     
1275 C CB    . ASP A 156 ? 0.7309 1.5322 0.5619 -0.0418 -0.2261 0.0772  156 ASP A CB    
1276 C CG    . ASP A 156 ? 0.7380 1.5278 0.5469 -0.0498 -0.2261 0.0761  156 ASP A CG    
1277 O OD1   . ASP A 156 ? 0.7515 1.5423 0.5511 -0.0511 -0.2360 0.0768  156 ASP A OD1   
1278 O OD2   . ASP A 156 ? 0.7306 1.5106 0.5318 -0.0545 -0.2163 0.0740  156 ASP A OD2   
1279 N N     . GLU A 157 ? 0.7691 1.5454 0.5640 -0.0317 -0.2431 0.0915  157 GLU A N     
1280 C CA    . GLU A 157 ? 0.7842 1.5432 0.5596 -0.0279 -0.2454 0.0994  157 GLU A CA    
1281 C C     . GLU A 157 ? 0.7780 1.5219 0.5391 -0.0316 -0.2322 0.0994  157 GLU A C     
1282 O O     . GLU A 157 ? 0.7690 1.5134 0.5264 -0.0386 -0.2250 0.0936  157 GLU A O     
1283 C CB    . GLU A 157 ? 0.8042 1.5602 0.5598 -0.0307 -0.2563 0.1026  157 GLU A CB    
1284 C CG    . GLU A 157 ? 0.8118 1.5832 0.5800 -0.0280 -0.2706 0.1023  157 GLU A CG    
1285 C CD    . GLU A 157 ? 0.8019 1.5898 0.5824 -0.0344 -0.2711 0.0937  157 GLU A CD    
1286 O OE1   . GLU A 157 ? 0.7965 1.5805 0.5673 -0.0424 -0.2638 0.0889  157 GLU A OE1   
1287 O OE2   . GLU A 157 ? 0.8002 1.6051 0.6011 -0.0315 -0.2791 0.0918  157 GLU A OE2   
1288 N N     . LYS A 158 ? 0.7838 1.5143 0.5376 -0.0268 -0.2300 0.1059  158 LYS A N     
1289 C CA    . LYS A 158 ? 0.7791 1.4953 0.5202 -0.0295 -0.2179 0.1068  158 LYS A CA    
1290 C C     . LYS A 158 ? 0.7953 1.4955 0.5204 -0.0262 -0.2202 0.1163  158 LYS A C     
1291 O O     . LYS A 158 ? 0.8042 1.5032 0.5367 -0.0193 -0.2287 0.1219  158 LYS A O     
1292 C CB    . LYS A 158 ? 0.7589 1.4791 0.5195 -0.0276 -0.2078 0.1023  158 LYS A CB    
1293 C CG    . LYS A 158 ? 0.7570 1.4625 0.5117 -0.0253 -0.1991 0.1061  158 LYS A CG    
1294 C CD    . LYS A 158 ? 0.7390 1.4496 0.5140 -0.0225 -0.1906 0.1017  158 LYS A CD    
1295 C CE    . LYS A 158 ? 0.7401 1.4355 0.5097 -0.0194 -0.1842 0.1060  158 LYS A CE    
1296 N NZ    . LYS A 158 ? 0.7419 1.4243 0.4903 -0.0257 -0.1762 0.1074  158 LYS A NZ    
1297 N N     . TRP A 159 ? 0.7990 1.4871 0.5036 -0.0313 -0.2124 0.1179  159 TRP A N     
1298 C CA    . TRP A 159 ? 0.8149 1.4876 0.5023 -0.0305 -0.2131 0.1273  159 TRP A CA    
1299 C C     . TRP A 159 ? 0.8078 1.4719 0.5056 -0.0256 -0.2071 0.1302  159 TRP A C     
1300 O O     . TRP A 159 ? 0.7889 1.4568 0.5007 -0.0252 -0.1978 0.1239  159 TRP A O     
1301 C CB    . TRP A 159 ? 0.8213 1.4869 0.4837 -0.0384 -0.2061 0.1268  159 TRP A CB    
1302 C CG    . TRP A 159 ? 0.8362 1.5064 0.4821 -0.0429 -0.2136 0.1262  159 TRP A CG    
1303 C CD1   . TRP A 159 ? 0.8319 1.5091 0.4726 -0.0484 -0.2109 0.1175  159 TRP A CD1   
1304 C CD2   . TRP A 159 ? 0.8596 1.5270 0.4913 -0.0425 -0.2257 0.1347  159 TRP A CD2   
1305 N NE1   . TRP A 159 ? 0.8506 1.5304 0.4748 -0.0513 -0.2201 0.1192  159 TRP A NE1   
1306 C CE2   . TRP A 159 ? 0.8678 1.5421 0.4858 -0.0480 -0.2293 0.1300  159 TRP A CE2   
1307 C CE3   . TRP A 159 ? 0.8757 1.5347 0.5049 -0.0381 -0.2346 0.1458  159 TRP A CE3   
1308 C CZ2   . TRP A 159 ? 0.8912 1.5654 0.4923 -0.0495 -0.2411 0.1362  159 TRP A CZ2   
1309 C CZ3   . TRP A 159 ? 0.8994 1.5573 0.5119 -0.0397 -0.2468 0.1527  159 TRP A CZ3   
1310 C CH2   . TRP A 159 ? 0.9068 1.5728 0.5050 -0.0455 -0.2497 0.1479  159 TRP A CH2   
1311 N N     . ILE A 160 ? 0.8247 1.4763 0.5144 -0.0224 -0.2129 0.1399  160 ILE A N     
1312 C CA    . ILE A 160 ? 0.8224 1.4625 0.5183 -0.0184 -0.2081 0.1435  160 ILE A CA    
1313 C C     . ILE A 160 ? 0.8425 1.4657 0.5146 -0.0223 -0.2088 0.1539  160 ILE A C     
1314 O O     . ILE A 160 ? 0.8639 1.4808 0.5266 -0.0210 -0.2207 0.1627  160 ILE A O     
1315 C CB    . ILE A 160 ? 0.8241 1.4661 0.5421 -0.0082 -0.2174 0.1451  160 ILE A CB    
1316 C CG1   . ILE A 160 ? 0.8023 1.4626 0.5460 -0.0048 -0.2141 0.1343  160 ILE A CG1   
1317 C CG2   . ILE A 160 ? 0.8286 1.4549 0.5489 -0.0041 -0.2152 0.1504  160 ILE A CG2   
1318 C CD1   . ILE A 160 ? 0.8021 1.4689 0.5704 0.0055  -0.2224 0.1331  160 ILE A CD1   
1319 N N     . PHE A 161 ? 0.8368 1.4528 0.4993 -0.0274 -0.1968 0.1532  161 PHE A N     
1320 C CA    . PHE A 161 ? 0.8559 1.4577 0.4948 -0.0330 -0.1960 0.1627  161 PHE A CA    
1321 C C     . PHE A 161 ? 0.8646 1.4517 0.5098 -0.0280 -0.1997 0.1708  161 PHE A C     
1322 O O     . PHE A 161 ? 0.8499 1.4378 0.5164 -0.0216 -0.1967 0.1661  161 PHE A O     
1323 C CB    . PHE A 161 ? 0.8467 1.4486 0.4737 -0.0407 -0.1817 0.1579  161 PHE A CB    
1324 C CG    . PHE A 161 ? 0.8432 1.4568 0.4606 -0.0460 -0.1791 0.1504  161 PHE A CG    
1325 C CD1   . PHE A 161 ? 0.8240 1.4500 0.4576 -0.0441 -0.1768 0.1398  161 PHE A CD1   
1326 C CD2   . PHE A 161 ? 0.8602 1.4726 0.4521 -0.0535 -0.1788 0.1536  161 PHE A CD2   
1327 C CE1   . PHE A 161 ? 0.8225 1.4573 0.4475 -0.0489 -0.1754 0.1327  161 PHE A CE1   
1328 C CE2   . PHE A 161 ? 0.8581 1.4810 0.4416 -0.0578 -0.1768 0.1453  161 PHE A CE2   
1329 C CZ    . PHE A 161 ? 0.8394 1.4726 0.4398 -0.0553 -0.1755 0.1349  161 PHE A CZ    
1330 N N     . PHE A 162 ? 0.8897 1.4635 0.5161 -0.0312 -0.2067 0.1828  162 PHE A N     
1331 C CA    . PHE A 162 ? 0.9022 1.4591 0.5328 -0.0270 -0.2121 0.1916  162 PHE A CA    
1332 C C     . PHE A 162 ? 0.8909 1.4403 0.5239 -0.0294 -0.1990 0.1895  162 PHE A C     
1333 O O     . PHE A 162 ? 0.8914 1.4306 0.5377 -0.0236 -0.2011 0.1915  162 PHE A O     
1334 C CB    . PHE A 162 ? 0.9347 1.4778 0.5426 -0.0314 -0.2235 0.2064  162 PHE A CB    
1335 C CG    . PHE A 162 ? 0.9499 1.4935 0.5633 -0.0246 -0.2410 0.2112  162 PHE A CG    
1336 C CD1   . PHE A 162 ? 0.9419 1.5026 0.5615 -0.0224 -0.2449 0.2041  162 PHE A CD1   
1337 C CD2   . PHE A 162 ? 0.9737 1.4999 0.5863 -0.0206 -0.2545 0.2230  162 PHE A CD2   
1338 C CE1   . PHE A 162 ? 0.9560 1.5182 0.5816 -0.0161 -0.2614 0.2083  162 PHE A CE1   
1339 C CE2   . PHE A 162 ? 0.9886 1.5152 0.6072 -0.0137 -0.2716 0.2274  162 PHE A CE2   
1340 C CZ    . PHE A 162 ? 0.9793 1.5246 0.6046 -0.0114 -0.2749 0.2199  162 PHE A CZ    
1341 N N     . VAL A 163 ? 0.8821 1.4364 0.5025 -0.0378 -0.1863 0.1853  163 VAL A N     
1342 C CA    . VAL A 163 ? 0.8660 1.4178 0.4919 -0.0397 -0.1728 0.1803  163 VAL A CA    
1343 C C     . VAL A 163 ? 0.8410 1.4085 0.4749 -0.0407 -0.1622 0.1673  163 VAL A C     
1344 O O     . VAL A 163 ? 0.8407 1.4183 0.4651 -0.0446 -0.1619 0.1636  163 VAL A O     
1345 C CB    . VAL A 163 ? 0.8798 1.4208 0.4842 -0.0492 -0.1667 0.1879  163 VAL A CB    
1346 C CG1   . VAL A 163 ? 0.9055 1.4283 0.5029 -0.0490 -0.1773 0.2017  163 VAL A CG1   
1347 C CG2   . VAL A 163 ? 0.8866 1.4362 0.4684 -0.0585 -0.1625 0.1874  163 VAL A CG2   
1348 N N     . ASN A 164 ? 0.8215 1.3900 0.4724 -0.0375 -0.1540 0.1605  164 ASN A N     
1349 C CA    . ASN A 164 ? 0.7980 1.3793 0.4583 -0.0383 -0.1443 0.1488  164 ASN A CA    
1350 C C     . ASN A 164 ? 0.7875 1.3639 0.4478 -0.0416 -0.1320 0.1461  164 ASN A C     
1351 O O     . ASN A 164 ? 0.7725 1.3496 0.4500 -0.0374 -0.1277 0.1411  164 ASN A O     
1352 C CB    . ASN A 164 ? 0.7833 1.3743 0.4678 -0.0303 -0.1478 0.1422  164 ASN A CB    
1353 C CG    . ASN A 164 ? 0.7956 1.3898 0.4838 -0.0254 -0.1615 0.1460  164 ASN A CG    
1354 O OD1   . ASN A 164 ? 0.7933 1.3989 0.4813 -0.0263 -0.1650 0.1423  164 ASN A OD1   
1355 N ND2   . ASN A 164 ? 0.8099 1.3933 0.5017 -0.0200 -0.1700 0.1534  164 ASN A ND2   
1356 N N     . PRO A 165 ? 0.7959 1.3684 0.4372 -0.0494 -0.1263 0.1491  165 PRO A N     
1357 C CA    . PRO A 165 ? 0.7862 1.3554 0.4278 -0.0528 -0.1149 0.1461  165 PRO A CA    
1358 C C     . PRO A 165 ? 0.7631 1.3430 0.4158 -0.0525 -0.1064 0.1345  165 PRO A C     
1359 O O     . PRO A 165 ? 0.7581 1.3481 0.4100 -0.0531 -0.1074 0.1288  165 PRO A O     
1360 C CB    . PRO A 165 ? 0.8015 1.3685 0.4199 -0.0616 -0.1115 0.1509  165 PRO A CB    
1361 C CG    . PRO A 165 ? 0.8242 1.3864 0.4302 -0.0622 -0.1228 0.1607  165 PRO A CG    
1362 C CD    . PRO A 165 ? 0.8173 1.3877 0.4356 -0.0555 -0.1306 0.1563  165 PRO A CD    
1363 N N     . LYS A 166 ? 0.7509 1.3275 0.4133 -0.0518 -0.0988 0.1314  166 LYS A N     
1364 C CA    . LYS A 166 ? 0.7308 1.3151 0.4021 -0.0524 -0.0903 0.1215  166 LYS A CA    
1365 C C     . LYS A 166 ? 0.7288 1.3082 0.3946 -0.0570 -0.0810 0.1212  166 LYS A C     
1366 O O     . LYS A 166 ? 0.7382 1.3075 0.4007 -0.0579 -0.0808 0.1279  166 LYS A O     
1367 C CB    . LYS A 166 ? 0.7155 1.3030 0.4079 -0.0464 -0.0905 0.1169  166 LYS A CB    
1368 C CG    . LYS A 166 ? 0.7173 1.3108 0.4187 -0.0412 -0.0998 0.1172  166 LYS A CG    
1369 C CD    . LYS A 166 ? 0.7093 1.3148 0.4116 -0.0430 -0.1004 0.1108  166 LYS A CD    
1370 C CE    . LYS A 166 ? 0.7190 1.3293 0.4211 -0.0404 -0.1110 0.1134  166 LYS A CE    
1371 N NZ    . LYS A 166 ? 0.7099 1.3320 0.4163 -0.0421 -0.1118 0.1065  166 LYS A NZ    
1372 N N     . ARG A 167 ? 0.7168 1.3029 0.3830 -0.0597 -0.0738 0.1133  167 ARG A N     
1373 C CA    . ARG A 167 ? 0.7129 1.2966 0.3762 -0.0637 -0.0648 0.1114  167 ARG A CA    
1374 C C     . ARG A 167 ? 0.7030 1.2810 0.3802 -0.0608 -0.0616 0.1111  167 ARG A C     
1375 O O     . ARG A 167 ? 0.6904 1.2718 0.3818 -0.0565 -0.0625 0.1067  167 ARG A O     
1376 C CB    . ARG A 167 ? 0.7024 1.2948 0.3652 -0.0660 -0.0592 0.1020  167 ARG A CB    
1377 C CG    . ARG A 167 ? 0.7129 1.3115 0.3611 -0.0694 -0.0608 0.1003  167 ARG A CG    
1378 C CD    . ARG A 167 ? 0.7028 1.3090 0.3533 -0.0702 -0.0570 0.0897  167 ARG A CD    
1379 N NE    . ARG A 167 ? 0.6997 1.3069 0.3481 -0.0733 -0.0484 0.0860  167 ARG A NE    
1380 C CZ    . ARG A 167 ? 0.6915 1.3040 0.3431 -0.0736 -0.0446 0.0765  167 ARG A CZ    
1381 N NH1   . ARG A 167 ? 0.6862 1.3024 0.3425 -0.0715 -0.0486 0.0700  167 ARG A NH1   
1382 N NH2   . ARG A 167 ? 0.6894 1.3034 0.3402 -0.0761 -0.0372 0.0733  167 ARG A NH2   
1383 N N     . LYS A 168 ? 0.7097 1.2796 0.3823 -0.0638 -0.0579 0.1157  168 LYS A N     
1384 C CA    . LYS A 168 ? 0.7025 1.2660 0.3867 -0.0615 -0.0549 0.1153  168 LYS A CA    
1385 C C     . LYS A 168 ? 0.6859 1.2553 0.3767 -0.0630 -0.0468 0.1069  168 LYS A C     
1386 O O     . LYS A 168 ? 0.6830 1.2592 0.3676 -0.0663 -0.0432 0.1025  168 LYS A O     
1387 C CB    . LYS A 168 ? 0.7173 1.2694 0.3937 -0.0651 -0.0545 0.1234  168 LYS A CB    
1388 C CG    . LYS A 168 ? 0.7368 1.2804 0.4058 -0.0642 -0.0637 0.1331  168 LYS A CG    
1389 C CD    . LYS A 168 ? 0.7344 1.2755 0.4177 -0.0557 -0.0714 0.1329  168 LYS A CD    
1390 C CE    . LYS A 168 ? 0.7557 1.2863 0.4326 -0.0543 -0.0816 0.1430  168 LYS A CE    
1391 N NZ    . LYS A 168 ? 0.7687 1.3028 0.4284 -0.0588 -0.0852 0.1479  168 LYS A NZ    
1392 N N     . LYS A 169 ? 0.6760 1.2427 0.3795 -0.0602 -0.0445 0.1043  169 LYS A N     
1393 C CA    . LYS A 169 ? 0.6620 1.2325 0.3716 -0.0618 -0.0374 0.0975  169 LYS A CA    
1394 C C     . LYS A 169 ? 0.6630 1.2253 0.3761 -0.0627 -0.0337 0.0993  169 LYS A C     
1395 O O     . LYS A 169 ? 0.6626 1.2200 0.3846 -0.0587 -0.0362 0.1002  169 LYS A O     
1396 C CB    . LYS A 169 ? 0.6478 1.2252 0.3696 -0.0582 -0.0384 0.0913  169 LYS A CB    
1397 C CG    . LYS A 169 ? 0.6447 1.2305 0.3634 -0.0589 -0.0405 0.0877  169 LYS A CG    
1398 C CD    . LYS A 169 ? 0.6358 1.2278 0.3658 -0.0557 -0.0440 0.0845  169 LYS A CD    
1399 C CE    . LYS A 169 ? 0.6307 1.2298 0.3594 -0.0576 -0.0452 0.0796  169 LYS A CE    
1400 N NZ    . LYS A 169 ? 0.6257 1.2316 0.3636 -0.0555 -0.0499 0.0782  169 LYS A NZ    
1401 N N     . SER A 170 ? 0.6649 1.2265 0.3716 -0.0680 -0.0280 0.0993  170 SER A N     
1402 C CA    . SER A 170 ? 0.6687 1.2220 0.3767 -0.0703 -0.0248 0.1019  170 SER A CA    
1403 C C     . SER A 170 ? 0.6539 1.2107 0.3716 -0.0702 -0.0194 0.0947  170 SER A C     
1404 O O     . SER A 170 ? 0.6442 1.2095 0.3628 -0.0709 -0.0166 0.0888  170 SER A O     
1405 C CB    . SER A 170 ? 0.6810 1.2330 0.3760 -0.0773 -0.0216 0.1064  170 SER A CB    
1406 O OG    . SER A 170 ? 0.6983 1.2444 0.3828 -0.0787 -0.0270 0.1150  170 SER A OG    
1407 N N     . TYR A 171 ? 0.6535 1.2030 0.3784 -0.0691 -0.0186 0.0952  171 TYR A N     
1408 C CA    . TYR A 171 ? 0.6424 1.1937 0.3750 -0.0700 -0.0135 0.0895  171 TYR A CA    
1409 C C     . TYR A 171 ? 0.6497 1.1963 0.3771 -0.0759 -0.0093 0.0922  171 TYR A C     
1410 O O     . TYR A 171 ? 0.6609 1.1972 0.3870 -0.0772 -0.0108 0.0976  171 TYR A O     
1411 C CB    . TYR A 171 ? 0.6372 1.1853 0.3814 -0.0653 -0.0151 0.0869  171 TYR A CB    
1412 C CG    . TYR A 171 ? 0.6262 1.1830 0.3773 -0.0613 -0.0169 0.0820  171 TYR A CG    
1413 C CD1   . TYR A 171 ? 0.6149 1.1803 0.3670 -0.0630 -0.0142 0.0769  171 TYR A CD1   
1414 C CD2   . TYR A 171 ? 0.6279 1.1847 0.3852 -0.0560 -0.0216 0.0823  171 TYR A CD2   
1415 C CE1   . TYR A 171 ? 0.6064 1.1794 0.3642 -0.0607 -0.0162 0.0733  171 TYR A CE1   
1416 C CE2   . TYR A 171 ? 0.6183 1.1849 0.3821 -0.0534 -0.0229 0.0780  171 TYR A CE2   
1417 C CZ    . TYR A 171 ? 0.6078 1.1822 0.3713 -0.0563 -0.0202 0.0740  171 TYR A CZ    
1418 O OH    . TYR A 171 ? 0.5999 1.1835 0.3692 -0.0551 -0.0218 0.0706  171 TYR A OH    
1419 N N     . VAL A 172 ? 0.6442 1.1987 0.3692 -0.0796 -0.0043 0.0883  172 VAL A N     
1420 C CA    . VAL A 172 ? 0.6513 1.2053 0.3708 -0.0861 0.0001  0.0904  172 VAL A CA    
1421 C C     . VAL A 172 ? 0.6397 1.2030 0.3639 -0.0877 0.0054  0.0828  172 VAL A C     
1422 O O     . VAL A 172 ? 0.6293 1.1996 0.3573 -0.0845 0.0048  0.0770  172 VAL A O     
1423 C CB    . VAL A 172 ? 0.6649 1.2207 0.3711 -0.0900 -0.0005 0.0960  172 VAL A CB    
1424 C CG1   . VAL A 172 ? 0.6591 1.2272 0.3617 -0.0894 0.0006  0.0904  172 VAL A CG1   
1425 C CG2   . VAL A 172 ? 0.6774 1.2302 0.3766 -0.0979 0.0031  0.1012  172 VAL A CG2   
1426 N N     . ASP A 173 ? 0.6425 1.2056 0.3671 -0.0928 0.0098  0.0829  173 ASP A N     
1427 C CA    . ASP A 173 ? 0.6332 1.2058 0.3628 -0.0944 0.0144  0.0757  173 ASP A CA    
1428 C C     . ASP A 173 ? 0.6314 1.2154 0.3567 -0.0942 0.0155  0.0712  173 ASP A C     
1429 O O     . ASP A 173 ? 0.6413 1.2272 0.3568 -0.0962 0.0152  0.0749  173 ASP A O     
1430 C CB    . ASP A 173 ? 0.6400 1.2126 0.3686 -0.1013 0.0191  0.0776  173 ASP A CB    
1431 C CG    . ASP A 173 ? 0.6427 1.2035 0.3762 -0.1019 0.0180  0.0808  173 ASP A CG    
1432 O OD1   . ASP A 173 ? 0.6327 1.1911 0.3749 -0.0975 0.0164  0.0766  173 ASP A OD1   
1433 O OD2   . ASP A 173 ? 0.6559 1.2099 0.3842 -0.1073 0.0184  0.0874  173 ASP A OD2   
1434 N N     . PRO A 174 ? 0.6202 1.2114 0.3525 -0.0917 0.0163  0.0632  174 PRO A N     
1435 C CA    . PRO A 174 ? 0.6196 1.2212 0.3490 -0.0908 0.0167  0.0576  174 PRO A CA    
1436 C C     . PRO A 174 ? 0.6289 1.2394 0.3517 -0.0964 0.0221  0.0573  174 PRO A C     
1437 O O     . PRO A 174 ? 0.6307 1.2426 0.3559 -0.1008 0.0262  0.0579  174 PRO A O     
1438 C CB    . PRO A 174 ? 0.6076 1.2130 0.3473 -0.0876 0.0160  0.0495  174 PRO A CB    
1439 C CG    . PRO A 174 ? 0.6013 1.1984 0.3479 -0.0864 0.0145  0.0516  174 PRO A CG    
1440 C CD    . PRO A 174 ? 0.6094 1.1999 0.3524 -0.0901 0.0166  0.0586  174 PRO A CD    
1441 N N     . GLY A 175 ? 0.6358 1.2529 0.3499 -0.0968 0.0220  0.0564  175 GLY A N     
1442 C CA    . GLY A 175 ? 0.6469 1.2740 0.3526 -0.1029 0.0273  0.0565  175 GLY A CA    
1443 C C     . GLY A 175 ? 0.6620 1.2831 0.3549 -0.1083 0.0270  0.0674  175 GLY A C     
1444 O O     . GLY A 175 ? 0.6737 1.3035 0.3561 -0.1137 0.0304  0.0684  175 GLY A O     
1445 N N     . GLN A 176 ? 0.6632 1.2698 0.3566 -0.1069 0.0225  0.0752  176 GLN A N     
1446 C CA    . GLN A 176 ? 0.6789 1.2769 0.3606 -0.1108 0.0199  0.0861  176 GLN A CA    
1447 C C     . GLN A 176 ? 0.6825 1.2801 0.3570 -0.1069 0.0145  0.0875  176 GLN A C     
1448 O O     . GLN A 176 ? 0.6712 1.2701 0.3522 -0.1004 0.0115  0.0817  176 GLN A O     
1449 C CB    . GLN A 176 ? 0.6798 1.2620 0.3666 -0.1097 0.0163  0.0928  176 GLN A CB    
1450 C CG    . GLN A 176 ? 0.6777 1.2580 0.3715 -0.1137 0.0206  0.0923  176 GLN A CG    
1451 C CD    . GLN A 176 ? 0.6885 1.2777 0.3749 -0.1231 0.0266  0.0940  176 GLN A CD    
1452 O OE1   . GLN A 176 ? 0.6815 1.2826 0.3736 -0.1249 0.0321  0.0866  176 GLN A OE1   
1453 N NE2   . GLN A 176 ? 0.7067 1.2910 0.3801 -0.1293 0.0253  0.1037  176 GLN A NE2   
1454 N N     . PRO A 177 ? 0.6995 1.2950 0.3600 -0.1116 0.0128  0.0958  177 PRO A N     
1455 C CA    . PRO A 177 ? 0.7048 1.2991 0.3578 -0.1083 0.0069  0.0981  177 PRO A CA    
1456 C C     . PRO A 177 ? 0.7036 1.2838 0.3616 -0.1027 -0.0006 0.1039  177 PRO A C     
1457 O O     . PRO A 177 ? 0.7039 1.2735 0.3679 -0.1027 -0.0015 0.1082  177 PRO A O     
1458 C CB    . PRO A 177 ? 0.7252 1.3224 0.3609 -0.1166 0.0079  0.1056  177 PRO A CB    
1459 C CG    . PRO A 177 ? 0.7329 1.3236 0.3683 -0.1234 0.0110  0.1123  177 PRO A CG    
1460 C CD    . PRO A 177 ? 0.7160 1.3105 0.3664 -0.1211 0.0161  0.1037  177 PRO A CD    
1461 N N     . ALA A 178 ? 0.7027 1.2837 0.3590 -0.0979 -0.0061 0.1031  178 ALA A N     
1462 C CA    . ALA A 178 ? 0.7035 1.2740 0.3640 -0.0925 -0.0138 0.1083  178 ALA A CA    
1463 C C     . ALA A 178 ? 0.7236 1.2877 0.3708 -0.0955 -0.0194 0.1188  178 ALA A C     
1464 O O     . ALA A 178 ? 0.7363 1.3062 0.3692 -0.1017 -0.0176 0.1214  178 ALA A O     
1465 C CB    . ALA A 178 ? 0.6910 1.2670 0.3586 -0.0860 -0.0171 0.1015  178 ALA A CB    
1466 N N     . THR A 179 ? 0.7273 1.2802 0.3792 -0.0909 -0.0266 0.1244  179 THR A N     
1467 C CA    . THR A 179 ? 0.7467 1.2918 0.3875 -0.0920 -0.0343 0.1346  179 THR A CA    
1468 C C     . THR A 179 ? 0.7488 1.3040 0.3811 -0.0914 -0.0370 0.1324  179 THR A C     
1469 O O     . THR A 179 ? 0.7377 1.2968 0.3785 -0.0849 -0.0403 0.1271  179 THR A O     
1470 C CB    . THR A 179 ? 0.7480 1.2807 0.3993 -0.0850 -0.0423 0.1385  179 THR A CB    
1471 O OG1   . THR A 179 ? 0.7505 1.2723 0.4075 -0.0864 -0.0407 0.1413  179 THR A OG1   
1472 C CG2   . THR A 179 ? 0.7675 1.2929 0.4090 -0.0846 -0.0521 0.1483  179 THR A CG2   
1473 N N     . SER A 180 ? 0.7637 1.3237 0.3790 -0.0987 -0.0353 0.1361  180 SER A N     
1474 C CA    . SER A 180 ? 0.7706 1.3386 0.3750 -0.0988 -0.0390 0.1353  180 SER A CA    
1475 C C     . SER A 180 ? 0.7839 1.3424 0.3846 -0.0957 -0.0501 0.1445  180 SER A C     
1476 O O     . SER A 180 ? 0.7947 1.3397 0.3957 -0.0961 -0.0547 0.1536  180 SER A O     
1477 C CB    . SER A 180 ? 0.7846 1.3619 0.3709 -0.1081 -0.0337 0.1364  180 SER A CB    
1478 O OG    . SER A 180 ? 0.8033 1.3720 0.3790 -0.1158 -0.0339 0.1479  180 SER A OG    
1479 N N     . THR A 181 ? 0.7839 1.3492 0.3815 -0.0927 -0.0550 0.1416  181 THR A N     
1480 C CA    . THR A 181 ? 0.7957 1.3545 0.3907 -0.0890 -0.0663 0.1490  181 THR A CA    
1481 C C     . THR A 181 ? 0.8120 1.3778 0.3878 -0.0941 -0.0692 0.1517  181 THR A C     
1482 O O     . THR A 181 ? 0.8074 1.3858 0.3774 -0.0968 -0.0633 0.1434  181 THR A O     
1483 C CB    . THR A 181 ? 0.7786 1.3410 0.3906 -0.0799 -0.0704 0.1419  181 THR A CB    
1484 O OG1   . THR A 181 ? 0.7617 1.3209 0.3911 -0.0758 -0.0661 0.1372  181 THR A OG1   
1485 C CG2   . THR A 181 ? 0.7890 1.3454 0.4026 -0.0749 -0.0824 0.1486  181 THR A CG2   
1486 N N     . ALA A 182 ? 0.8319 1.3892 0.3981 -0.0948 -0.0790 0.1627  182 ALA A N     
1487 C CA    . ALA A 182 ? 0.8508 1.4136 0.3970 -0.0998 -0.0836 0.1669  182 ALA A CA    
1488 C C     . ALA A 182 ? 0.8443 1.4151 0.3948 -0.0937 -0.0899 0.1606  182 ALA A C     
1489 O O     . ALA A 182 ? 0.8410 1.4063 0.4036 -0.0862 -0.0986 0.1626  182 ALA A O     
1490 C CB    . ALA A 182 ? 0.8770 1.4261 0.4103 -0.1039 -0.0925 0.1824  182 ALA A CB    
1491 N N     . ARG A 183 ? 0.8436 1.4281 0.3844 -0.0970 -0.0856 0.1528  183 ARG A N     
1492 C CA    . ARG A 183 ? 0.8345 1.4283 0.3804 -0.0922 -0.0893 0.1438  183 ARG A CA    
1493 C C     . ARG A 183 ? 0.8486 1.4392 0.3896 -0.0896 -0.1023 0.1510  183 ARG A C     
1494 O O     . ARG A 183 ? 0.8710 1.4552 0.3963 -0.0942 -0.1078 0.1625  183 ARG A O     
1495 C CB    . ARG A 183 ? 0.8356 1.4433 0.3695 -0.0972 -0.0822 0.1341  183 ARG A CB    
1496 C CG    . ARG A 183 ? 0.8284 1.4456 0.3657 -0.0935 -0.0855 0.1238  183 ARG A CG    
1497 C CD    . ARG A 183 ? 0.8359 1.4659 0.3582 -0.0988 -0.0801 0.1152  183 ARG A CD    
1498 N NE    . ARG A 183 ? 0.8291 1.4642 0.3521 -0.1020 -0.0684 0.1086  183 ARG A NE    
1499 C CZ    . ARG A 183 ? 0.8086 1.4458 0.3481 -0.0979 -0.0627 0.0983  183 ARG A CZ    
1500 N NH1   . ARG A 183 ? 0.8050 1.4477 0.3440 -0.1011 -0.0526 0.0928  183 ARG A NH1   
1501 N NH2   . ARG A 183 ? 0.7925 1.4267 0.3490 -0.0911 -0.0670 0.0937  183 ARG A NH2   
1502 N N     . PRO A 184 ? 0.8366 1.4316 0.3910 -0.0828 -0.1078 0.1449  184 PRO A N     
1503 C CA    . PRO A 184 ? 0.8491 1.4416 0.4017 -0.0796 -0.1208 0.1516  184 PRO A CA    
1504 C C     . PRO A 184 ? 0.8676 1.4672 0.3988 -0.0850 -0.1250 0.1525  184 PRO A C     
1505 O O     . PRO A 184 ? 0.8624 1.4728 0.3886 -0.0876 -0.1192 0.1424  184 PRO A O     
1506 C CB    . PRO A 184 ? 0.8290 1.4271 0.4031 -0.0718 -0.1236 0.1430  184 PRO A CB    
1507 C CG    . PRO A 184 ? 0.8071 1.4086 0.3935 -0.0712 -0.1125 0.1331  184 PRO A CG    
1508 C CD    . PRO A 184 ? 0.8133 1.4163 0.3841 -0.0784 -0.1033 0.1320  184 PRO A CD    
1509 N N     . ASN A 185 ? 0.8898 1.4833 0.4089 -0.0864 -0.1355 0.1641  185 ASN A N     
1510 C CA    . ASN A 185 ? 0.9092 1.5097 0.4078 -0.0912 -0.1416 0.1656  185 ASN A CA    
1511 C C     . ASN A 185 ? 0.8997 1.5084 0.4095 -0.0852 -0.1486 0.1577  185 ASN A C     
1512 O O     . ASN A 185 ? 0.8983 1.5025 0.4213 -0.0787 -0.1582 0.1619  185 ASN A O     
1513 C CB    . ASN A 185 ? 0.9374 1.5276 0.4203 -0.0942 -0.1529 0.1816  185 ASN A CB    
1514 C CG    . ASN A 185 ? 0.9500 1.5288 0.4230 -0.1005 -0.1486 0.1923  185 ASN A CG    
1515 O OD1   . ASN A 185 ? 0.9687 1.5339 0.4368 -0.1009 -0.1581 0.2061  185 ASN A OD1   
1516 N ND2   . ASN A 185 ? 0.9413 1.5253 0.4113 -0.1056 -0.1349 0.1862  185 ASN A ND2   
1517 N N     . ARG A 186 ? 0.8946 1.5154 0.3996 -0.0874 -0.1444 0.1462  186 ARG A N     
1518 C CA    . ARG A 186 ? 0.8864 1.5148 0.4019 -0.0827 -0.1512 0.1383  186 ARG A CA    
1519 C C     . ARG A 186 ? 0.9075 1.5358 0.4120 -0.0829 -0.1653 0.1465  186 ARG A C     
1520 O O     . ARG A 186 ? 0.9027 1.5355 0.4184 -0.0782 -0.1736 0.1434  186 ARG A O     
1521 C CB    . ARG A 186 ? 0.8768 1.5163 0.3908 -0.0849 -0.1440 0.1234  186 ARG A CB    
1522 C CG    . ARG A 186 ? 0.8901 1.5390 0.3906 -0.0874 -0.1509 0.1180  186 ARG A CG    
1523 C CD    . ARG A 186 ? 0.8755 1.5295 0.3940 -0.0824 -0.1561 0.1090  186 ARG A CD    
1524 N NE    . ARG A 186 ? 0.8835 1.5467 0.3912 -0.0854 -0.1587 0.0990  186 ARG A NE    
1525 C CZ    . ARG A 186 ? 0.8768 1.5451 0.3952 -0.0830 -0.1650 0.0914  186 ARG A CZ    
1526 N NH1   . ARG A 186 ? 0.8869 1.5626 0.3932 -0.0862 -0.1671 0.0821  186 ARG A NH1   
1527 N NH2   . ARG A 186 ? 0.8612 1.5282 0.4022 -0.0780 -0.1692 0.0924  186 ARG A NH2   
1528 N N     . PHE A 187 ? 0.9316 1.5552 0.4138 -0.0889 -0.1677 0.1571  187 PHE A N     
1529 C CA    . PHE A 187 ? 0.9550 1.5752 0.4251 -0.0897 -0.1816 0.1681  187 PHE A CA    
1530 C C     . PHE A 187 ? 0.9676 1.5725 0.4365 -0.0892 -0.1864 0.1833  187 PHE A C     
1531 O O     . PHE A 187 ? 0.9934 1.5929 0.4406 -0.0956 -0.1914 0.1947  187 PHE A O     
1532 C CB    . PHE A 187 ? 0.9766 1.6048 0.4181 -0.0986 -0.1812 0.1675  187 PHE A CB    
1533 C CG    . PHE A 187 ? 0.9653 1.6073 0.4071 -0.0994 -0.1749 0.1511  187 PHE A CG    
1534 C CD1   . PHE A 187 ? 0.9508 1.5981 0.4101 -0.0932 -0.1802 0.1424  187 PHE A CD1   
1535 C CD2   . PHE A 187 ? 0.9697 1.6195 0.3954 -0.1064 -0.1639 0.1440  187 PHE A CD2   
1536 C CE1   . PHE A 187 ? 0.9422 1.6002 0.4021 -0.0941 -0.1756 0.1275  187 PHE A CE1   
1537 C CE2   . PHE A 187 ? 0.9608 1.6222 0.3879 -0.1063 -0.1591 0.1281  187 PHE A CE2   
1538 C CZ    . PHE A 187 ? 0.9473 1.6116 0.3914 -0.1001 -0.1653 0.1201  187 PHE A CZ    
1539 N N     . GLY A 188 ? 0.9501 1.5481 0.4428 -0.0818 -0.1854 0.1832  188 GLY A N     
1540 C CA    . GLY A 188 ? 0.9611 1.5438 0.4583 -0.0786 -0.1932 0.1962  188 GLY A CA    
1541 C C     . GLY A 188 ? 0.9629 1.5455 0.4746 -0.0699 -0.2078 0.1983  188 GLY A C     
1542 O O     . GLY A 188 ? 0.9554 1.5503 0.4725 -0.0676 -0.2111 0.1901  188 GLY A O     
1543 N N     . LYS A 189 ? 0.9729 1.5419 0.4921 -0.0650 -0.2168 0.2086  189 LYS A N     
1544 C CA    . LYS A 189 ? 0.9761 1.5445 0.5113 -0.0557 -0.2316 0.2111  189 LYS A CA    
1545 C C     . LYS A 189 ? 0.9469 1.5272 0.5113 -0.0471 -0.2283 0.1979  189 LYS A C     
1546 O O     . LYS A 189 ? 0.9261 1.5067 0.5046 -0.0452 -0.2171 0.1912  189 LYS A O     
1547 C CB    . LYS A 189 ? 0.9916 1.5415 0.5315 -0.0514 -0.2408 0.2234  189 LYS A CB    
1548 C CG    . LYS A 189 ? 1.0245 1.5606 0.5356 -0.0604 -0.2467 0.2390  189 LYS A CG    
1549 C CD    . LYS A 189 ? 1.0462 1.5643 0.5623 -0.0545 -0.2631 0.2520  189 LYS A CD    
1550 C CE    . LYS A 189 ? 1.0362 1.5415 0.5720 -0.0484 -0.2594 0.2520  189 LYS A CE    
1551 N NZ    . LYS A 189 ? 1.0531 1.5420 0.5704 -0.0578 -0.2549 0.2629  189 LYS A NZ    
1552 N N     . LYS A 190 ? 0.9463 1.5370 0.5195 -0.0426 -0.2381 0.1945  190 LYS A N     
1553 C CA    . LYS A 190 ? 0.9206 1.5246 0.5207 -0.0358 -0.2356 0.1824  190 LYS A CA    
1554 C C     . LYS A 190 ? 0.9259 1.5385 0.5382 -0.0294 -0.2505 0.1823  190 LYS A C     
1555 O O     . LYS A 190 ? 0.9493 1.5591 0.5467 -0.0309 -0.2629 0.1905  190 LYS A O     
1556 C CB    . LYS A 190 ? 0.9031 1.5190 0.4997 -0.0416 -0.2233 0.1706  190 LYS A CB    
1557 C CG    . LYS A 190 ? 0.9183 1.5399 0.4912 -0.0491 -0.2264 0.1704  190 LYS A CG    
1558 C CD    . LYS A 190 ? 0.9021 1.5345 0.4733 -0.0538 -0.2153 0.1577  190 LYS A CD    
1559 C CE    . LYS A 190 ? 0.9192 1.5577 0.4673 -0.0605 -0.2195 0.1564  190 LYS A CE    
1560 N NZ    . LYS A 190 ? 0.9147 1.5568 0.4491 -0.0674 -0.2071 0.1481  190 LYS A NZ    
1561 N N     . THR A 191 ? 0.9045 1.5285 0.5440 -0.0227 -0.2492 0.1731  191 THR A N     
1562 C CA    . THR A 191 ? 0.9058 1.5407 0.5624 -0.0157 -0.2621 0.1714  191 THR A CA    
1563 C C     . THR A 191 ? 0.8821 1.5355 0.5555 -0.0161 -0.2559 0.1583  191 THR A C     
1564 O O     . THR A 191 ? 0.8610 1.5176 0.5483 -0.0154 -0.2444 0.1512  191 THR A O     
1565 C CB    . THR A 191 ? 0.9059 1.5358 0.5852 -0.0049 -0.2688 0.1742  191 THR A CB    
1566 O OG1   . THR A 191 ? 0.9240 1.5334 0.5900 -0.0052 -0.2709 0.1854  191 THR A OG1   
1567 C CG2   . THR A 191 ? 0.9159 1.5542 0.6077 0.0020  -0.2852 0.1755  191 THR A CG2   
1568 N N     . MET A 192 ? 0.8866 1.5519 0.5586 -0.0177 -0.2640 0.1554  192 MET A N     
1569 C CA    . MET A 192 ? 0.8665 1.5496 0.5573 -0.0178 -0.2609 0.1440  192 MET A CA    
1570 C C     . MET A 192 ? 0.8585 1.5514 0.5793 -0.0081 -0.2674 0.1419  192 MET A C     
1571 O O     . MET A 192 ? 0.8738 1.5667 0.5990 -0.0021 -0.2814 0.1476  192 MET A O     
1572 C CB    . MET A 192 ? 0.8745 1.5672 0.5538 -0.0235 -0.2674 0.1410  192 MET A CB    
1573 C CG    . MET A 192 ? 0.8563 1.5672 0.5563 -0.0240 -0.2663 0.1301  192 MET A CG    
1574 S SD    . MET A 192 ? 0.8606 1.5791 0.5445 -0.0335 -0.2675 0.1234  192 MET A SD    
1575 C CE    . MET A 192 ? 0.8473 1.5577 0.5195 -0.0404 -0.2497 0.1173  192 MET A CE    
1576 N N     . LEU A 193 ? 0.8354 1.5368 0.5766 -0.0067 -0.2572 0.1335  193 LEU A N     
1577 C CA    . LEU A 193 ? 0.8246 1.5390 0.5959 0.0016  -0.2603 0.1289  193 LEU A CA    
1578 C C     . LEU A 193 ? 0.8129 1.5489 0.5987 -0.0012 -0.2618 0.1201  193 LEU A C     
1579 O O     . LEU A 193 ? 0.7968 1.5388 0.5842 -0.0077 -0.2511 0.1132  193 LEU A O     
1580 C CB    . LEU A 193 ? 0.8073 1.5188 0.5910 0.0038  -0.2475 0.1249  193 LEU A CB    
1581 C CG    . LEU A 193 ? 0.7953 1.5219 0.6105 0.0123  -0.2487 0.1186  193 LEU A CG    
1582 C CD1   . LEU A 193 ? 0.8114 1.5300 0.6339 0.0230  -0.2604 0.1247  193 LEU A CD1   
1583 C CD2   . LEU A 193 ? 0.7746 1.5034 0.6003 0.0110  -0.2336 0.1119  193 LEU A CD2   
1584 N N     . CYS A 194 ? 0.8220 1.5692 0.6187 0.0034  -0.2755 0.1207  194 CYS A N     
1585 C CA    . CYS A 194 ? 0.8117 1.5815 0.6263 0.0015  -0.2782 0.1126  194 CYS A CA    
1586 C C     . CYS A 194 ? 0.8002 1.5850 0.6465 0.0101  -0.2786 0.1075  194 CYS A C     
1587 O O     . CYS A 194 ? 0.8109 1.5940 0.6669 0.0199  -0.2883 0.1113  194 CYS A O     
1588 C CB    . CYS A 194 ? 0.8295 1.6039 0.6363 0.0008  -0.2934 0.1159  194 CYS A CB    
1589 S SG    . CYS A 194 ? 0.8475 1.6034 0.6148 -0.0080 -0.2936 0.1223  194 CYS A SG    
1590 N N     . VAL A 195 ? 0.7796 1.5793 0.6419 0.0062  -0.2682 0.0988  195 VAL A N     
1591 C CA    . VAL A 195 ? 0.7667 1.5818 0.6581 0.0132  -0.2649 0.0926  195 VAL A CA    
1592 C C     . VAL A 195 ? 0.7499 1.5895 0.6593 0.0067  -0.2597 0.0834  195 VAL A C     
1593 O O     . VAL A 195 ? 0.7415 1.5796 0.6404 -0.0036 -0.2514 0.0813  195 VAL A O     
1594 C CB    . VAL A 195 ? 0.7589 1.5604 0.6487 0.0157  -0.2531 0.0930  195 VAL A CB    
1595 C CG1   . VAL A 195 ? 0.7476 1.5406 0.6210 0.0050  -0.2392 0.0917  195 VAL A CG1   
1596 C CG2   . VAL A 195 ? 0.7468 1.5652 0.6664 0.0233  -0.2497 0.0855  195 VAL A CG2   
1597 N N     . TRP A 196 ? 0.7466 1.6086 0.6832 0.0129  -0.2654 0.0781  196 TRP A N     
1598 C CA    . TRP A 196 ? 0.7321 1.6207 0.6889 0.0070  -0.2613 0.0696  196 TRP A CA    
1599 C C     . TRP A 196 ? 0.7211 1.6261 0.7052 0.0146  -0.2560 0.0628  196 TRP A C     
1600 O O     . TRP A 196 ? 0.7287 1.6300 0.7217 0.0268  -0.2619 0.0639  196 TRP A O     
1601 C CB    . TRP A 196 ? 0.7402 1.6454 0.7045 0.0056  -0.2745 0.0685  196 TRP A CB    
1602 C CG    . TRP A 196 ? 0.7543 1.6432 0.6914 -0.0003 -0.2815 0.0749  196 TRP A CG    
1603 C CD1   . TRP A 196 ? 0.7524 1.6415 0.6769 -0.0124 -0.2793 0.0734  196 TRP A CD1   
1604 C CD2   . TRP A 196 ? 0.7740 1.6442 0.6927 0.0053  -0.2921 0.0833  196 TRP A CD2   
1605 N NE1   . TRP A 196 ? 0.7691 1.6418 0.6688 -0.0141 -0.2873 0.0794  196 TRP A NE1   
1606 C CE2   . TRP A 196 ? 0.7827 1.6441 0.6777 -0.0038 -0.2950 0.0860  196 TRP A CE2   
1607 C CE3   . TRP A 196 ? 0.7866 1.6460 0.7062 0.0169  -0.2998 0.0890  196 TRP A CE3   
1608 C CZ2   . TRP A 196 ? 0.8032 1.6474 0.6749 -0.0021 -0.3046 0.0940  196 TRP A CZ2   
1609 C CZ3   . TRP A 196 ? 0.8074 1.6483 0.7037 0.0181  -0.3099 0.0981  196 TRP A CZ3   
1610 C CH2   . TRP A 196 ? 0.8154 1.6497 0.6877 0.0083  -0.3119 0.1006  196 TRP A CH2   
1611 N N     . TRP A 197 ? 0.7046 1.6272 0.7010 0.0071  -0.2451 0.0558  197 TRP A N     
1612 C CA    . TRP A 197 ? 0.6927 1.6302 0.7110 0.0121  -0.2364 0.0486  197 TRP A CA    
1613 C C     . TRP A 197 ? 0.6782 1.6448 0.7146 0.0026  -0.2290 0.0406  197 TRP A C     
1614 O O     . TRP A 197 ? 0.6738 1.6402 0.6995 -0.0103 -0.2250 0.0417  197 TRP A O     
1615 C CB    . TRP A 197 ? 0.6881 1.6033 0.6923 0.0126  -0.2250 0.0511  197 TRP A CB    
1616 C CG    . TRP A 197 ? 0.6809 1.5837 0.6643 -0.0004 -0.2149 0.0536  197 TRP A CG    
1617 C CD1   . TRP A 197 ? 0.6883 1.5729 0.6472 -0.0070 -0.2178 0.0598  197 TRP A CD1   
1618 C CD2   . TRP A 197 ? 0.6661 1.5737 0.6517 -0.0079 -0.2009 0.0495  197 TRP A CD2   
1619 N NE1   . TRP A 197 ? 0.6788 1.5563 0.6258 -0.0176 -0.2068 0.0593  197 TRP A NE1   
1620 C CE2   . TRP A 197 ? 0.6654 1.5561 0.6280 -0.0186 -0.1966 0.0537  197 TRP A CE2   
1621 C CE3   . TRP A 197 ? 0.6543 1.5794 0.6590 -0.0068 -0.1917 0.0424  197 TRP A CE3   
1622 C CZ2   . TRP A 197 ? 0.6538 1.5432 0.6120 -0.0279 -0.1846 0.0518  197 TRP A CZ2   
1623 C CZ3   . TRP A 197 ? 0.6429 1.5671 0.6416 -0.0169 -0.1791 0.0409  197 TRP A CZ3   
1624 C CH2   . TRP A 197 ? 0.6429 1.5487 0.6188 -0.0272 -0.1762 0.0460  197 TRP A CH2   
1625 N N     . ASP A 198 ? 0.6723 1.6641 0.7365 0.0092  -0.2276 0.0325  198 ASP A N     
1626 C CA    . ASP A 198 ? 0.6595 1.6828 0.7438 0.0010  -0.2201 0.0243  198 ASP A CA    
1627 C C     . ASP A 198 ? 0.6478 1.6696 0.7318 -0.0015 -0.2049 0.0210  198 ASP A C     
1628 O O     . ASP A 198 ? 0.6499 1.6482 0.7215 0.0046  -0.2016 0.0243  198 ASP A O     
1629 C CB    . ASP A 198 ? 0.6614 1.7139 0.7771 0.0119  -0.2276 0.0163  198 ASP A CB    
1630 C CG    . ASP A 198 ? 0.6522 1.7424 0.7905 0.0031  -0.2242 0.0083  198 ASP A CG    
1631 O OD1   . ASP A 198 ? 0.6433 1.7386 0.7751 -0.0118 -0.2144 0.0084  198 ASP A OD1   
1632 O OD2   . ASP A 198 ? 0.6550 1.7702 0.8189 0.0116  -0.2319 0.0018  198 ASP A OD2   
1633 N N     . GLN A 199 ? 0.6366 1.6840 0.7342 -0.0111 -0.1959 0.0148  199 GLN A N     
1634 C CA    . GLN A 199 ? 0.6263 1.6780 0.7277 -0.0126 -0.1821 0.0102  199 GLN A CA    
1635 C C     . GLN A 199 ? 0.6271 1.6860 0.7469 0.0034  -0.1818 0.0032  199 GLN A C     
1636 O O     . GLN A 199 ? 0.6218 1.6737 0.7387 0.0051  -0.1718 0.0009  199 GLN A O     
1637 C CB    . GLN A 199 ? 0.6162 1.6958 0.7282 -0.0271 -0.1730 0.0053  199 GLN A CB    
1638 C CG    . GLN A 199 ? 0.6146 1.7340 0.7560 -0.0268 -0.1765 -0.0031 199 GLN A CG    
1639 C CD    . GLN A 199 ? 0.6046 1.7516 0.7565 -0.0403 -0.1643 -0.0086 199 GLN A CD    
1640 O OE1   . GLN A 199 ? 0.6020 1.7432 0.7395 -0.0562 -0.1596 -0.0035 199 GLN A OE1   
1641 N NE2   . GLN A 199 ? 0.6000 1.7769 0.7767 -0.0342 -0.1594 -0.0190 199 GLN A NE2   
1642 N N     . SER A 200 ? 0.6346 1.7069 0.7732 0.0151  -0.1933 -0.0004 200 SER A N     
1643 C CA    . SER A 200 ? 0.6392 1.7138 0.7950 0.0325  -0.1966 -0.0067 200 SER A CA    
1644 C C     . SER A 200 ? 0.6475 1.6839 0.7834 0.0410  -0.1987 0.0005  200 SER A C     
1645 O O     . SER A 200 ? 0.6440 1.6739 0.7809 0.0456  -0.1905 -0.0031 200 SER A O     
1646 C CB    . SER A 200 ? 0.6483 1.7406 0.8258 0.0433  -0.2114 -0.0104 200 SER A CB    
1647 O OG    . SER A 200 ? 0.6410 1.7726 0.8414 0.0370  -0.2094 -0.0188 200 SER A OG    
1648 N N     . GLY A 201 ? 0.6592 1.6714 0.7770 0.0425  -0.2096 0.0105  201 GLY A N     
1649 C CA    . GLY A 201 ? 0.6690 1.6450 0.7661 0.0489  -0.2122 0.0187  201 GLY A CA    
1650 C C     . GLY A 201 ? 0.6801 1.6355 0.7544 0.0448  -0.2220 0.0299  201 GLY A C     
1651 O O     . GLY A 201 ? 0.6769 1.6416 0.7462 0.0341  -0.2227 0.0313  201 GLY A O     
1652 N N     . VAL A 202 ? 0.6942 1.6215 0.7538 0.0525  -0.2296 0.0378  202 VAL A N     
1653 C CA    . VAL A 202 ? 0.7088 1.6198 0.7496 0.0511  -0.2418 0.0476  202 VAL A CA    
1654 C C     . VAL A 202 ? 0.7177 1.6481 0.7795 0.0595  -0.2566 0.0446  202 VAL A C     
1655 O O     . VAL A 202 ? 0.7185 1.6630 0.8053 0.0710  -0.2600 0.0374  202 VAL A O     
1656 C CB    . VAL A 202 ? 0.7232 1.5992 0.7415 0.0559  -0.2457 0.0577  202 VAL A CB    
1657 C CG1   . VAL A 202 ? 0.7414 1.6038 0.7426 0.0558  -0.2601 0.0675  202 VAL A CG1   
1658 C CG2   . VAL A 202 ? 0.7145 1.5725 0.7111 0.0465  -0.2316 0.0608  202 VAL A CG2   
1659 N N     . ILE A 203 ? 0.7248 1.6564 0.7770 0.0538  -0.2655 0.0495  203 ILE A N     
1660 C CA    . ILE A 203 ? 0.7348 1.6833 0.8046 0.0611  -0.2809 0.0478  203 ILE A CA    
1661 C C     . ILE A 203 ? 0.7572 1.6797 0.8106 0.0688  -0.2959 0.0584  203 ILE A C     
1662 O O     . ILE A 203 ? 0.7684 1.6891 0.8360 0.0824  -0.3061 0.0580  203 ILE A O     
1663 C CB    . ILE A 203 ? 0.7295 1.6987 0.8012 0.0497  -0.2825 0.0458  203 ILE A CB    
1664 C CG1   . ILE A 203 ? 0.7095 1.7067 0.8000 0.0420  -0.2689 0.0355  203 ILE A CG1   
1665 C CG2   . ILE A 203 ? 0.7423 1.7261 0.8288 0.0569  -0.3003 0.0454  203 ILE A CG2   
1666 C CD1   . ILE A 203 ? 0.7040 1.7192 0.7947 0.0285  -0.2689 0.0340  203 ILE A CD1   
1667 N N     . TYR A 204 ? 0.7647 1.6680 0.7885 0.0596  -0.2974 0.0677  204 TYR A N     
1668 C CA    . TYR A 204 ? 0.7876 1.6679 0.7919 0.0638  -0.3117 0.0788  204 TYR A CA    
1669 C C     . TYR A 204 ? 0.7900 1.6448 0.7593 0.0530  -0.3042 0.0871  204 TYR A C     
1670 O O     . TYR A 204 ? 0.7757 1.6347 0.7371 0.0418  -0.2920 0.0839  204 TYR A O     
1671 C CB    . TYR A 204 ? 0.7979 1.6937 0.8088 0.0643  -0.3271 0.0793  204 TYR A CB    
1672 C CG    . TYR A 204 ? 0.8222 1.6958 0.8079 0.0649  -0.3415 0.0914  204 TYR A CG    
1673 C CD1   . TYR A 204 ? 0.8417 1.6975 0.8258 0.0764  -0.3536 0.0986  204 TYR A CD1   
1674 C CD2   . TYR A 204 ? 0.8271 1.6977 0.7902 0.0535  -0.3435 0.0956  204 TYR A CD2   
1675 C CE1   . TYR A 204 ? 0.8657 1.7015 0.8252 0.0756  -0.3669 0.1106  204 TYR A CE1   
1676 C CE2   . TYR A 204 ? 0.8503 1.7023 0.7893 0.0533  -0.3563 0.1063  204 TYR A CE2   
1677 C CZ    . TYR A 204 ? 0.8697 1.7045 0.8063 0.0639  -0.3678 0.1143  204 TYR A CZ    
1678 O OH    . TYR A 204 ? 0.8944 1.7111 0.8058 0.0627  -0.3807 0.1258  204 TYR A OH    
1679 N N     . TYR A 205 ? 0.8090 1.6376 0.7579 0.0565  -0.3115 0.0976  205 TYR A N     
1680 C CA    . TYR A 205 ? 0.8143 1.6202 0.7296 0.0467  -0.3058 0.1056  205 TYR A CA    
1681 C C     . TYR A 205 ? 0.8409 1.6247 0.7355 0.0501  -0.3196 0.1178  205 TYR A C     
1682 O O     . TYR A 205 ? 0.8543 1.6332 0.7600 0.0612  -0.3311 0.1210  205 TYR A O     
1683 C CB    . TYR A 205 ? 0.8014 1.5953 0.7112 0.0441  -0.2895 0.1041  205 TYR A CB    
1684 C CG    . TYR A 205 ? 0.8116 1.5868 0.7221 0.0536  -0.2919 0.1090  205 TYR A CG    
1685 C CD1   . TYR A 205 ? 0.8107 1.5956 0.7494 0.0660  -0.2967 0.1034  205 TYR A CD1   
1686 C CD2   . TYR A 205 ? 0.8232 1.5712 0.7067 0.0500  -0.2897 0.1187  205 TYR A CD2   
1687 C CE1   . TYR A 205 ? 0.8217 1.5874 0.7613 0.0748  -0.2997 0.1074  205 TYR A CE1   
1688 C CE2   . TYR A 205 ? 0.8339 1.5633 0.7176 0.0577  -0.2923 0.1236  205 TYR A CE2   
1689 C CZ    . TYR A 205 ? 0.8334 1.5707 0.7451 0.0703  -0.2977 0.1180  205 TYR A CZ    
1690 O OH    . TYR A 205 ? 0.8456 1.5626 0.7575 0.0779  -0.3010 0.1226  205 TYR A OH    
1691 N N     . GLU A 206 ? 0.8493 1.6202 0.7139 0.0401  -0.3185 0.1243  206 GLU A N     
1692 C CA    . GLU A 206 ? 0.8754 1.6243 0.7142 0.0400  -0.3292 0.1368  206 GLU A CA    
1693 C C     . GLU A 206 ? 0.8754 1.6033 0.6876 0.0322  -0.3166 0.1419  206 GLU A C     
1694 O O     . GLU A 206 ? 0.8557 1.5873 0.6681 0.0261  -0.3012 0.1354  206 GLU A O     
1695 C CB    . GLU A 206 ? 0.8891 1.6449 0.7156 0.0352  -0.3411 0.1396  206 GLU A CB    
1696 C CG    . GLU A 206 ? 0.9082 1.6680 0.7463 0.0449  -0.3613 0.1440  206 GLU A CG    
1697 C CD    . GLU A 206 ? 0.9148 1.6900 0.7506 0.0408  -0.3718 0.1425  206 GLU A CD    
1698 O OE1   . GLU A 206 ? 0.8964 1.6937 0.7489 0.0375  -0.3664 0.1322  206 GLU A OE1   
1699 O OE2   . GLU A 206 ? 0.9394 1.7050 0.7573 0.0406  -0.3861 0.1519  206 GLU A OE2   
1700 N N     . LEU A 207 ? 0.8986 1.6052 0.6885 0.0320  -0.3241 0.1538  207 LEU A N     
1701 C CA    . LEU A 207 ? 0.9028 1.5892 0.6666 0.0247  -0.3139 0.1599  207 LEU A CA    
1702 C C     . LEU A 207 ? 0.9280 1.6034 0.6607 0.0180  -0.3229 0.1703  207 LEU A C     
1703 O O     . LEU A 207 ? 0.9520 1.6151 0.6777 0.0222  -0.3368 0.1808  207 LEU A O     
1704 C CB    . LEU A 207 ? 0.9075 1.5764 0.6759 0.0313  -0.3126 0.1649  207 LEU A CB    
1705 C CG    . LEU A 207 ? 0.8839 1.5562 0.6726 0.0348  -0.2984 0.1561  207 LEU A CG    
1706 C CD1   . LEU A 207 ? 0.8926 1.5507 0.6931 0.0448  -0.3031 0.1598  207 LEU A CD1   
1707 C CD2   . LEU A 207 ? 0.8737 1.5384 0.6425 0.0241  -0.2821 0.1556  207 LEU A CD2   
1708 N N     . LEU A 208 ? 0.9237 1.6034 0.6378 0.0075  -0.3152 0.1672  208 LEU A N     
1709 C CA    . LEU A 208 ? 0.9466 1.6202 0.6308 0.0001  -0.3226 0.1747  208 LEU A CA    
1710 C C     . LEU A 208 ? 0.9601 1.6135 0.6165 -0.0062 -0.3163 0.1839  208 LEU A C     
1711 O O     . LEU A 208 ? 0.9450 1.5951 0.5982 -0.0104 -0.3007 0.1796  208 LEU A O     
1712 C CB    . LEU A 208 ? 0.9369 1.6249 0.6141 -0.0081 -0.3173 0.1657  208 LEU A CB    
1713 C CG    . LEU A 208 ? 0.9324 1.6404 0.6269 -0.0058 -0.3267 0.1588  208 LEU A CG    
1714 C CD1   . LEU A 208 ? 0.9180 1.6377 0.6479 0.0044  -0.3298 0.1540  208 LEU A CD1   
1715 C CD2   . LEU A 208 ? 0.9177 1.6369 0.6081 -0.0145 -0.3171 0.1483  208 LEU A CD2   
1716 N N     . LYS A 209 ? 0.9893 1.6300 0.6250 -0.0076 -0.3286 0.1965  209 LYS A N     
1717 C CA    . LYS A 209 ? 1.0055 1.6298 0.6105 -0.0164 -0.3231 0.2056  209 LYS A CA    
1718 C C     . LYS A 209 ? 1.0050 1.6382 0.5880 -0.0271 -0.3158 0.2002  209 LYS A C     
1719 O O     . LYS A 209 ? 1.0064 1.6528 0.5903 -0.0278 -0.3228 0.1954  209 LYS A O     
1720 C CB    . LYS A 209 ? 1.0395 1.6476 0.6276 -0.0160 -0.3391 0.2217  209 LYS A CB    
1721 C CG    . LYS A 209 ? 1.0451 1.6410 0.6534 -0.0050 -0.3485 0.2279  209 LYS A CG    
1722 C CD    . LYS A 209 ? 1.0522 1.6565 0.6804 0.0051  -0.3668 0.2278  209 LYS A CD    
1723 C CE    . LYS A 209 ? 1.0697 1.6575 0.7098 0.0152  -0.3808 0.2373  209 LYS A CE    
1724 N NZ    . LYS A 209 ? 1.0864 1.6798 0.7365 0.0229  -0.4019 0.2406  209 LYS A NZ    
1725 N N     . PRO A 210 ? 1.0038 1.6303 0.5674 -0.0354 -0.3021 0.2003  210 PRO A N     
1726 C CA    . PRO A 210 ? 1.0021 1.6382 0.5474 -0.0445 -0.2946 0.1928  210 PRO A CA    
1727 C C     . PRO A 210 ? 1.0327 1.6678 0.5508 -0.0503 -0.3069 0.2011  210 PRO A C     
1728 O O     . PRO A 210 ? 1.0568 1.6785 0.5589 -0.0520 -0.3142 0.2148  210 PRO A O     
1729 C CB    . PRO A 210 ? 0.9947 1.6234 0.5286 -0.0506 -0.2778 0.1917  210 PRO A CB    
1730 C CG    . PRO A 210 ? 1.0056 1.6172 0.5392 -0.0479 -0.2803 0.2039  210 PRO A CG    
1731 C CD    . PRO A 210 ? 1.0117 1.6208 0.5647 -0.0378 -0.2962 0.2093  210 PRO A CD    
1732 N N     . GLY A 211 ? 1.0328 1.6816 0.5459 -0.0534 -0.3097 0.1931  211 GLY A N     
1733 C CA    . GLY A 211 ? 1.0604 1.7116 0.5537 -0.0568 -0.3247 0.1995  211 GLY A CA    
1734 C C     . GLY A 211 ? 1.0597 1.7198 0.5741 -0.0489 -0.3401 0.1984  211 GLY A C     
1735 O O     . GLY A 211 ? 1.0832 1.7446 0.5845 -0.0501 -0.3550 0.2047  211 GLY A O     
1736 N N     . GLU A 212 ? 1.0335 1.7005 0.5808 -0.0408 -0.3368 0.1904  212 GLU A N     
1737 C CA    . GLU A 212 ? 1.0262 1.7074 0.5975 -0.0343 -0.3478 0.1849  212 GLU A CA    
1738 C C     . GLU A 212 ? 0.9989 1.6944 0.5848 -0.0365 -0.3360 0.1693  212 GLU A C     
1739 O O     . GLU A 212 ? 0.9747 1.6737 0.5852 -0.0319 -0.3274 0.1632  212 GLU A O     
1740 C CB    . GLU A 212 ? 1.0207 1.6990 0.6200 -0.0227 -0.3548 0.1891  212 GLU A CB    
1741 C CG    . GLU A 212 ? 1.0489 1.7112 0.6373 -0.0193 -0.3688 0.2047  212 GLU A CG    
1742 C CD    . GLU A 212 ? 1.0426 1.7002 0.6598 -0.0071 -0.3741 0.2072  212 GLU A CD    
1743 O OE1   . GLU A 212 ? 1.0646 1.7147 0.6828 -0.0012 -0.3912 0.2173  212 GLU A OE1   
1744 O OE2   . GLU A 212 ? 1.0171 1.6782 0.6557 -0.0032 -0.3618 0.1991  212 GLU A OE2   
1745 N N     . THR A 213 ? 1.0042 1.7072 0.5739 -0.0441 -0.3356 0.1630  213 THR A N     
1746 C CA    . THR A 213 ? 0.9820 1.6964 0.5628 -0.0473 -0.3257 0.1486  213 THR A CA    
1747 C C     . THR A 213 ? 0.9665 1.6958 0.5786 -0.0419 -0.3320 0.1421  213 THR A C     
1748 O O     . THR A 213 ? 0.9770 1.7114 0.5981 -0.0367 -0.3466 0.1471  213 THR A O     
1749 C CB    . THR A 213 ? 0.9943 1.7129 0.5504 -0.0564 -0.3257 0.1424  213 THR A CB    
1750 O OG1   . THR A 213 ? 0.9746 1.7038 0.5452 -0.0586 -0.3196 0.1287  213 THR A OG1   
1751 C CG2   . THR A 213 ? 1.0206 1.7437 0.5631 -0.0574 -0.3435 0.1479  213 THR A CG2   
1752 N N     . VAL A 214 ? 0.9426 1.6794 0.5707 -0.0437 -0.3212 0.1311  214 VAL A N     
1753 C CA    . VAL A 214 ? 0.9268 1.6797 0.5840 -0.0408 -0.3250 0.1239  214 VAL A CA    
1754 C C     . VAL A 214 ? 0.9346 1.6980 0.5847 -0.0471 -0.3324 0.1170  214 VAL A C     
1755 O O     . VAL A 214 ? 0.9280 1.6917 0.5708 -0.0539 -0.3243 0.1084  214 VAL A O     
1756 C CB    . VAL A 214 ? 0.8989 1.6543 0.5764 -0.0405 -0.3102 0.1165  214 VAL A CB    
1757 C CG1   . VAL A 214 ? 0.8833 1.6571 0.5881 -0.0405 -0.3127 0.1081  214 VAL A CG1   
1758 C CG2   . VAL A 214 ? 0.8925 1.6396 0.5801 -0.0332 -0.3053 0.1230  214 VAL A CG2   
1759 N N     . ASN A 215 ? 0.9499 1.7211 0.6021 -0.0446 -0.3485 0.1208  215 ASN A N     
1760 C CA    . ASN A 215 ? 0.9566 1.7401 0.6073 -0.0497 -0.3576 0.1140  215 ASN A CA    
1761 C C     . ASN A 215 ? 0.9402 1.7414 0.6251 -0.0462 -0.3618 0.1087  215 ASN A C     
1762 O O     . ASN A 215 ? 0.9299 1.7344 0.6368 -0.0385 -0.3615 0.1120  215 ASN A O     
1763 C CB    . ASN A 215 ? 0.9862 1.7682 0.6148 -0.0505 -0.3732 0.1209  215 ASN A CB    
1764 C CG    . ASN A 215 ? 1.0005 1.7739 0.6264 -0.0431 -0.3815 0.1344  215 ASN A CG    
1765 O OD1   . ASN A 215 ? 1.0006 1.7821 0.6477 -0.0359 -0.3925 0.1375  215 ASN A OD1   
1766 N ND2   . ASN A 215 ? 1.0136 1.7707 0.6140 -0.0450 -0.3767 0.1424  215 ASN A ND2   
1767 N N     . ALA A 216 ? 0.9382 1.7514 0.6281 -0.0523 -0.3656 0.0999  216 ALA A N     
1768 C CA    . ALA A 216 ? 0.9264 1.7592 0.6473 -0.0506 -0.3717 0.0951  216 ALA A CA    
1769 C C     . ALA A 216 ? 0.9370 1.7771 0.6700 -0.0415 -0.3862 0.1027  216 ALA A C     
1770 O O     . ALA A 216 ? 0.9237 1.7768 0.6860 -0.0356 -0.3871 0.1015  216 ALA A O     
1771 C CB    . ALA A 216 ? 0.9303 1.7730 0.6491 -0.0592 -0.3772 0.0863  216 ALA A CB    
1772 N N     . ALA A 217 ? 0.9619 1.7934 0.6718 -0.0404 -0.3972 0.1105  217 ALA A N     
1773 C CA    . ALA A 217 ? 0.9768 1.8113 0.6938 -0.0316 -0.4128 0.1193  217 ALA A CA    
1774 C C     . ALA A 217 ? 0.9689 1.7969 0.7011 -0.0216 -0.4089 0.1254  217 ALA A C     
1775 O O     . ALA A 217 ? 0.9680 1.8066 0.7247 -0.0128 -0.4184 0.1270  217 ALA A O     
1776 C CB    . ALA A 217 ? 1.0070 1.8299 0.6907 -0.0340 -0.4238 0.1276  217 ALA A CB    
1777 N N     . ARG A 218 ? 0.9639 1.7750 0.6821 -0.0228 -0.3953 0.1283  218 ARG A N     
1778 C CA    . ARG A 218 ? 0.9543 1.7582 0.6869 -0.0143 -0.3894 0.1326  218 ARG A CA    
1779 C C     . ARG A 218 ? 0.9267 1.7466 0.6932 -0.0115 -0.3806 0.1232  218 ARG A C     
1780 O O     . ARG A 218 ? 0.9215 1.7486 0.7128 -0.0020 -0.3846 0.1240  218 ARG A O     
1781 C CB    . ARG A 218 ? 0.9548 1.7379 0.6637 -0.0179 -0.3759 0.1369  218 ARG A CB    
1782 C CG    . ARG A 218 ? 0.9462 1.7200 0.6679 -0.0098 -0.3696 0.1412  218 ARG A CG    
1783 C CD    . ARG A 218 ? 0.9522 1.7050 0.6472 -0.0140 -0.3592 0.1473  218 ARG A CD    
1784 N NE    . ARG A 218 ? 0.9810 1.7193 0.6527 -0.0132 -0.3707 0.1600  218 ARG A NE    
1785 C CZ    . ARG A 218 ? 0.9927 1.7221 0.6712 -0.0046 -0.3800 0.1693  218 ARG A CZ    
1786 N NH1   . ARG A 218 ? 0.9777 1.7122 0.6868 0.0049  -0.3792 0.1664  218 ARG A NH1   
1787 N NH2   . ARG A 218 ? 1.0213 1.7365 0.6754 -0.0057 -0.3909 0.1817  218 ARG A NH2   
1788 N N     . TYR A 219 ? 0.9105 1.7356 0.6771 -0.0201 -0.3687 0.1143  219 TYR A N     
1789 C CA    . TYR A 219 ? 0.8846 1.7234 0.6790 -0.0202 -0.3581 0.1058  219 TYR A CA    
1790 C C     . TYR A 219 ? 0.8796 1.7429 0.7059 -0.0153 -0.3682 0.1015  219 TYR A C     
1791 O O     . TYR A 219 ? 0.8640 1.7381 0.7164 -0.0097 -0.3631 0.0982  219 TYR A O     
1792 C CB    . TYR A 219 ? 0.8731 1.7113 0.6586 -0.0315 -0.3464 0.0980  219 TYR A CB    
1793 C CG    . TYR A 219 ? 0.8480 1.6943 0.6553 -0.0329 -0.3329 0.0913  219 TYR A CG    
1794 C CD1   . TYR A 219 ? 0.8372 1.6741 0.6483 -0.0281 -0.3217 0.0937  219 TYR A CD1   
1795 C CD2   . TYR A 219 ? 0.8362 1.6996 0.6599 -0.0399 -0.3315 0.0830  219 TYR A CD2   
1796 C CE1   . TYR A 219 ? 0.8153 1.6604 0.6455 -0.0298 -0.3095 0.0877  219 TYR A CE1   
1797 C CE2   . TYR A 219 ? 0.8149 1.6862 0.6574 -0.0422 -0.3194 0.0777  219 TYR A CE2   
1798 C CZ    . TYR A 219 ? 0.8044 1.6669 0.6499 -0.0370 -0.3084 0.0800  219 TYR A CZ    
1799 O OH    . TYR A 219 ? 0.7845 1.6551 0.6472 -0.0398 -0.2964 0.0749  219 TYR A OH    
1800 N N     . GLN A 220 ? 0.8938 1.7667 0.7179 -0.0171 -0.3826 0.1014  220 GLN A N     
1801 C CA    . GLN A 220 ? 0.8923 1.7890 0.7460 -0.0118 -0.3942 0.0981  220 GLN A CA    
1802 C C     . GLN A 220 ? 0.8980 1.7937 0.7664 0.0019  -0.4016 0.1039  220 GLN A C     
1803 O O     . GLN A 220 ? 0.8850 1.7985 0.7848 0.0084  -0.4010 0.0988  220 GLN A O     
1804 C CB    . GLN A 220 ? 0.9101 1.8145 0.7551 -0.0159 -0.4099 0.0982  220 GLN A CB    
1805 C CG    . GLN A 220 ? 0.9052 1.8144 0.7418 -0.0289 -0.4052 0.0905  220 GLN A CG    
1806 C CD    . GLN A 220 ? 0.9264 1.8384 0.7477 -0.0334 -0.4206 0.0911  220 GLN A CD    
1807 O OE1   . GLN A 220 ? 0.9479 1.8463 0.7456 -0.0308 -0.4294 0.0990  220 GLN A OE1   
1808 N NE2   . GLN A 220 ? 0.9216 1.8509 0.7550 -0.0409 -0.4238 0.0831  220 GLN A NE2   
1809 N N     . GLN A 221 ? 0.9188 1.7938 0.7642 0.0061  -0.4089 0.1143  221 GLN A N     
1810 C CA    . GLN A 221 ? 0.9286 1.7971 0.7842 0.0191  -0.4175 0.1212  221 GLN A CA    
1811 C C     . GLN A 221 ? 0.9090 1.7768 0.7837 0.0250  -0.4040 0.1178  221 GLN A C     
1812 O O     . GLN A 221 ? 0.9075 1.7837 0.8078 0.0363  -0.4097 0.1167  221 GLN A O     
1813 C CB    . GLN A 221 ? 0.9550 1.7975 0.7773 0.0195  -0.4252 0.1341  221 GLN A CB    
1814 C CG    . GLN A 221 ? 0.9709 1.8032 0.8004 0.0322  -0.4375 0.1430  221 GLN A CG    
1815 C CD    . GLN A 221 ? 0.9766 1.8288 0.8344 0.0417  -0.4548 0.1406  221 GLN A CD    
1816 O OE1   . GLN A 221 ? 0.9821 1.8491 0.8407 0.0376  -0.4642 0.1377  221 GLN A OE1   
1817 N NE2   . GLN A 221 ? 0.9758 1.8288 0.8577 0.0546  -0.4593 0.1410  221 GLN A NE2   
1818 N N     . GLN A 222 ? 0.8945 1.7531 0.7573 0.0173  -0.3864 0.1153  222 GLN A N     
1819 C CA    . GLN A 222 ? 0.8741 1.7335 0.7538 0.0208  -0.3719 0.1108  222 GLN A CA    
1820 C C     . GLN A 222 ? 0.8534 1.7418 0.7668 0.0209  -0.3677 0.0994  222 GLN A C     
1821 O O     . GLN A 222 ? 0.8431 1.7406 0.7813 0.0293  -0.3644 0.0955  222 GLN A O     
1822 C CB    . GLN A 222 ? 0.8652 1.7072 0.7223 0.0121  -0.3549 0.1112  222 GLN A CB    
1823 C CG    . GLN A 222 ? 0.8853 1.7011 0.7082 0.0102  -0.3573 0.1218  222 GLN A CG    
1824 C CD    . GLN A 222 ? 0.8759 1.6752 0.6813 0.0042  -0.3404 0.1221  222 GLN A CD    
1825 O OE1   . GLN A 222 ? 0.8639 1.6664 0.6631 -0.0048 -0.3302 0.1160  222 GLN A OE1   
1826 N NE2   . GLN A 222 ? 0.8824 1.6634 0.6799 0.0093  -0.3381 0.1294  222 GLN A NE2   
1827 N N     . LEU A 223 ? 0.8484 1.7514 0.7626 0.0112  -0.3679 0.0938  223 LEU A N     
1828 C CA    . LEU A 223 ? 0.8313 1.7638 0.7765 0.0093  -0.3652 0.0838  223 LEU A CA    
1829 C C     . LEU A 223 ? 0.8361 1.7894 0.8105 0.0205  -0.3787 0.0815  223 LEU A C     
1830 O O     . LEU A 223 ? 0.8207 1.7969 0.8250 0.0234  -0.3739 0.0735  223 LEU A O     
1831 C CB    . LEU A 223 ? 0.8292 1.7712 0.7677 -0.0039 -0.3653 0.0793  223 LEU A CB    
1832 C CG    . LEU A 223 ? 0.8192 1.7483 0.7386 -0.0158 -0.3504 0.0775  223 LEU A CG    
1833 C CD1   . LEU A 223 ? 0.8225 1.7591 0.7351 -0.0276 -0.3546 0.0734  223 LEU A CD1   
1834 C CD2   . LEU A 223 ? 0.7968 1.7339 0.7340 -0.0172 -0.3347 0.0719  223 LEU A CD2   
1835 N N     . ILE A 224 ? 0.8580 1.8047 0.8240 0.0265  -0.3959 0.0883  224 ILE A N     
1836 C CA    . ILE A 224 ? 0.8652 1.8295 0.8586 0.0387  -0.4107 0.0867  224 ILE A CA    
1837 C C     . ILE A 224 ? 0.8613 1.8198 0.8699 0.0514  -0.4069 0.0868  224 ILE A C     
1838 O O     . ILE A 224 ? 0.8484 1.8303 0.8899 0.0579  -0.4046 0.0780  224 ILE A O     
1839 C CB    . ILE A 224 ? 0.8922 1.8478 0.8709 0.0424  -0.4312 0.0952  224 ILE A CB    
1840 C CG1   . ILE A 224 ? 0.8966 1.8602 0.8622 0.0300  -0.4357 0.0936  224 ILE A CG1   
1841 C CG2   . ILE A 224 ? 0.9002 1.8726 0.9092 0.0567  -0.4472 0.0936  224 ILE A CG2   
1842 C CD1   . ILE A 224 ? 0.9240 1.8700 0.8603 0.0292  -0.4508 0.1037  224 ILE A CD1   
1843 N N     . ASN A 225 ? 0.8725 1.8007 0.8570 0.0542  -0.4056 0.0962  225 ASN A N     
1844 C CA    . ASN A 225 ? 0.8712 1.7894 0.8669 0.0659  -0.4025 0.0970  225 ASN A CA    
1845 C C     . ASN A 225 ? 0.8452 1.7756 0.8587 0.0641  -0.3836 0.0872  225 ASN A C     
1846 O O     . ASN A 225 ? 0.8405 1.7752 0.8756 0.0749  -0.3818 0.0829  225 ASN A O     
1847 C CB    . ASN A 225 ? 0.8875 1.7702 0.8508 0.0659  -0.4027 0.1093  225 ASN A CB    
1848 C CG    . ASN A 225 ? 0.9160 1.7854 0.8607 0.0680  -0.4219 0.1202  225 ASN A CG    
1849 O OD1   . ASN A 225 ? 0.9281 1.8078 0.8909 0.0777  -0.4386 0.1204  225 ASN A OD1   
1850 N ND2   . ASN A 225 ? 0.9279 1.7752 0.8362 0.0588  -0.4200 0.1292  225 ASN A ND2   
1851 N N     . LEU A 226 ? 0.8301 1.7648 0.8336 0.0504  -0.3701 0.0836  226 LEU A N     
1852 C CA    . LEU A 226 ? 0.8060 1.7565 0.8266 0.0463  -0.3532 0.0741  226 LEU A CA    
1853 C C     . LEU A 226 ? 0.7967 1.7832 0.8544 0.0504  -0.3568 0.0636  226 LEU A C     
1854 O O     . LEU A 226 ? 0.7854 1.7852 0.8670 0.0573  -0.3501 0.0564  226 LEU A O     
1855 C CB    . LEU A 226 ? 0.7953 1.7417 0.7963 0.0302  -0.3408 0.0733  226 LEU A CB    
1856 C CG    . LEU A 226 ? 0.7718 1.7326 0.7865 0.0234  -0.3234 0.0649  226 LEU A CG    
1857 C CD1   . LEU A 226 ? 0.7645 1.7121 0.7796 0.0294  -0.3122 0.0651  226 LEU A CD1   
1858 C CD2   . LEU A 226 ? 0.7656 1.7210 0.7608 0.0078  -0.3152 0.0649  226 LEU A CD2   
1859 N N     . ASN A 227 ? 0.8016 1.8052 0.8646 0.0459  -0.3670 0.0620  227 ASN A N     
1860 C CA    . ASN A 227 ? 0.7936 1.8340 0.8927 0.0491  -0.3711 0.0519  227 ASN A CA    
1861 C C     . ASN A 227 ? 0.8018 1.8495 0.9257 0.0672  -0.3819 0.0497  227 ASN A C     
1862 O O     . ASN A 227 ? 0.7895 1.8634 0.9450 0.0728  -0.3772 0.0393  227 ASN A O     
1863 C CB    . ASN A 227 ? 0.7997 1.8559 0.8994 0.0411  -0.3819 0.0513  227 ASN A CB    
1864 C CG    . ASN A 227 ? 0.7881 1.8851 0.9246 0.0405  -0.3824 0.0400  227 ASN A CG    
1865 O OD1   . ASN A 227 ? 0.7710 1.8856 0.9272 0.0398  -0.3694 0.0320  227 ASN A OD1   
1866 N ND2   . ASN A 227 ? 0.7979 1.9113 0.9435 0.0403  -0.3974 0.0392  227 ASN A ND2   
1867 N N     . ARG A 228 ? 0.8235 1.8483 0.9330 0.0760  -0.3967 0.0591  228 ARG A N     
1868 C CA    . ARG A 228 ? 0.8348 1.8593 0.9644 0.0939  -0.4083 0.0585  228 ARG A CA    
1869 C C     . ARG A 228 ? 0.8210 1.8463 0.9654 0.1003  -0.3946 0.0518  228 ARG A C     
1870 O O     . ARG A 228 ? 0.8153 1.8647 0.9932 0.1105  -0.3960 0.0416  228 ARG A O     
1871 C CB    . ARG A 228 ? 0.8606 1.8517 0.9656 0.1005  -0.4227 0.0719  228 ARG A CB    
1872 C CG    . ARG A 228 ? 0.8766 1.8677 1.0038 0.1192  -0.4393 0.0718  228 ARG A CG    
1873 C CD    . ARG A 228 ? 0.8752 1.9025 1.0400 0.1274  -0.4507 0.0615  228 ARG A CD    
1874 N NE    . ARG A 228 ? 0.8528 1.9102 1.0516 0.1307  -0.4377 0.0464  228 ARG A NE    
1875 C CZ    . ARG A 228 ? 0.8428 1.9397 1.0749 0.1322  -0.4396 0.0344  228 ARG A CZ    
1876 N NH1   . ARG A 228 ? 0.8234 1.9464 1.0833 0.1344  -0.4262 0.0210  228 ARG A NH1   
1877 N NH2   . ARG A 228 ? 0.8523 1.9648 1.0907 0.1312  -0.4547 0.0352  228 ARG A NH2   
1878 N N     . ALA A 229 ? 0.8165 1.8158 0.9355 0.0941  -0.3815 0.0572  229 ALA A N     
1879 C CA    . ALA A 229 ? 0.8039 1.8005 0.9323 0.0986  -0.3675 0.0518  229 ALA A CA    
1880 C C     . ALA A 229 ? 0.7805 1.8117 0.9347 0.0935  -0.3536 0.0382  229 ALA A C     
1881 O O     . ALA A 229 ? 0.7738 1.8210 0.9549 0.1033  -0.3502 0.0287  229 ALA A O     
1882 C CB    . ALA A 229 ? 0.8032 1.7669 0.8976 0.0906  -0.3561 0.0605  229 ALA A CB    
1883 N N     . LEU A 230 ? 0.7694 1.8122 0.9155 0.0779  -0.3460 0.0373  230 LEU A N     
1884 C CA    . LEU A 230 ? 0.7482 1.8227 0.9149 0.0696  -0.3321 0.0261  230 LEU A CA    
1885 C C     . LEU A 230 ? 0.7455 1.8590 0.9517 0.0779  -0.3388 0.0146  230 LEU A C     
1886 O O     . LEU A 230 ? 0.7313 1.8692 0.9610 0.0790  -0.3278 0.0038  230 LEU A O     
1887 C CB    . LEU A 230 ? 0.7411 1.8174 0.8900 0.0509  -0.3258 0.0286  230 LEU A CB    
1888 C CG    . LEU A 230 ? 0.7224 1.8304 0.8888 0.0387  -0.3134 0.0194  230 LEU A CG    
1889 C CD1   . LEU A 230 ? 0.7069 1.8222 0.8838 0.0390  -0.2966 0.0127  230 LEU A CD1   
1890 C CD2   . LEU A 230 ? 0.7201 1.8194 0.8629 0.0210  -0.3095 0.0243  230 LEU A CD2   
1891 N N     . GLN A 231 ? 0.7596 1.8798 0.9727 0.0833  -0.3567 0.0167  231 GLN A N     
1892 C CA    . GLN A 231 ? 0.7592 1.9166 1.0105 0.0921  -0.3653 0.0059  231 GLN A CA    
1893 C C     . GLN A 231 ? 0.7622 1.9246 1.0389 0.1112  -0.3682 -0.0014 231 GLN A C     
1894 O O     . GLN A 231 ? 0.7532 1.9515 1.0643 0.1163  -0.3655 -0.0147 231 GLN A O     
1895 C CB    . GLN A 231 ? 0.7754 1.9361 1.0261 0.0935  -0.3852 0.0108  231 GLN A CB    
1896 C CG    . GLN A 231 ? 0.7710 1.9372 1.0059 0.0750  -0.3828 0.0139  231 GLN A CG    
1897 C CD    . GLN A 231 ? 0.7558 1.9651 1.0190 0.0663  -0.3767 0.0025  231 GLN A CD    
1898 O OE1   . GLN A 231 ? 0.7476 1.9600 0.9985 0.0493  -0.3684 0.0035  231 GLN A OE1   
1899 N NE2   . GLN A 231 ? 0.7529 1.9955 1.0540 0.0773  -0.3806 -0.0086 231 GLN A NE2   
1900 N N     . ARG A 232 ? 0.7757 1.9027 1.0355 0.1210  -0.3735 0.0066  232 ARG A N     
1901 C CA    . ARG A 232 ? 0.7818 1.9067 1.0627 0.1397  -0.3775 0.0005  232 ARG A CA    
1902 C C     . ARG A 232 ? 0.7673 1.8871 1.0476 0.1389  -0.3583 -0.0050 232 ARG A C     
1903 O O     . ARG A 232 ? 0.7658 1.8971 1.0713 0.1519  -0.3567 -0.0156 232 ARG A O     
1904 C CB    . ARG A 232 ? 0.8076 1.8970 1.0731 0.1516  -0.3961 0.0124  232 ARG A CB    
1905 C CG    . ARG A 232 ? 0.8148 1.8610 1.0382 0.1439  -0.3920 0.0273  232 ARG A CG    
1906 C CD    . ARG A 232 ? 0.8425 1.8570 1.0502 0.1534  -0.4117 0.0401  232 ARG A CD    
1907 N NE    . ARG A 232 ? 0.8481 1.8250 1.0156 0.1441  -0.4056 0.0535  232 ARG A NE    
1908 C CZ    . ARG A 232 ? 0.8447 1.8000 1.0017 0.1450  -0.3944 0.0551  232 ARG A CZ    
1909 N NH1   . ARG A 232 ? 0.8363 1.8020 1.0189 0.1552  -0.3882 0.0440  232 ARG A NH1   
1910 N NH2   . ARG A 232 ? 0.8500 1.7740 0.9708 0.1355  -0.3894 0.0672  232 ARG A NH2   
1911 N N     . LYS A 233 ? 0.7579 1.8598 1.0089 0.1238  -0.3443 0.0018  233 LYS A N     
1912 C CA    . LYS A 233 ? 0.7428 1.8414 0.9903 0.1197  -0.3250 -0.0028 233 LYS A CA    
1913 C C     . LYS A 233 ? 0.7214 1.8579 0.9872 0.1089  -0.3094 -0.0144 233 LYS A C     
1914 O O     . LYS A 233 ? 0.7102 1.8544 0.9849 0.1098  -0.2958 -0.0224 233 LYS A O     
1915 C CB    . LYS A 233 ? 0.7440 1.8036 0.9519 0.1098  -0.3175 0.0100  233 LYS A CB    
1916 C CG    . LYS A 233 ? 0.7654 1.7869 0.9546 0.1199  -0.3303 0.0214  233 LYS A CG    
1917 C CD    . LYS A 233 ? 0.7679 1.7555 0.9170 0.1080  -0.3246 0.0346  233 LYS A CD    
1918 C CE    . LYS A 233 ? 0.7916 1.7440 0.9211 0.1159  -0.3386 0.0471  233 LYS A CE    
1919 N NZ    . LYS A 233 ? 0.7974 1.7326 0.9326 0.1278  -0.3379 0.0460  233 LYS A NZ    
1920 N N     . ARG A 234 ? 0.7169 1.8760 0.9871 0.0980  -0.3114 -0.0151 234 ARG A N     
1921 C CA    . ARG A 234 ? 0.6991 1.8961 0.9874 0.0864  -0.2983 -0.0254 234 ARG A CA    
1922 C C     . ARG A 234 ? 0.7012 1.9343 1.0160 0.0870  -0.3092 -0.0317 234 ARG A C     
1923 O O     . ARG A 234 ? 0.6891 1.9602 1.0266 0.0801  -0.3012 -0.0419 234 ARG A O     
1924 C CB    . ARG A 234 ? 0.6892 1.8733 0.9488 0.0659  -0.2856 -0.0179 234 ARG A CB    
1925 C CG    . ARG A 234 ? 0.6903 1.8323 0.9160 0.0632  -0.2782 -0.0080 234 ARG A CG    
1926 C CD    . ARG A 234 ? 0.6759 1.8214 0.9024 0.0587  -0.2598 -0.0135 234 ARG A CD    
1927 N NE    . ARG A 234 ? 0.6759 1.7836 0.8699 0.0538  -0.2523 -0.0040 234 ARG A NE    
1928 C CZ    . ARG A 234 ? 0.6856 1.7623 0.8665 0.0644  -0.2561 0.0015  234 ARG A CZ    
1929 N NH1   . ARG A 234 ? 0.6978 1.7730 0.8939 0.0813  -0.2683 -0.0006 234 ARG A NH1   
1930 N NH2   . ARG A 234 ? 0.6842 1.7304 0.8365 0.0580  -0.2482 0.0095  234 ARG A NH2   
1931 N N     . ARG A 243 ? 0.6506 1.9721 0.9228 -0.0595 -0.2618 -0.0220 243 ARG A N     
1932 C CA    . ARG A 243 ? 0.6625 1.9521 0.9098 -0.0598 -0.2743 -0.0130 243 ARG A CA    
1933 C C     . ARG A 243 ? 0.6644 1.9087 0.8786 -0.0559 -0.2698 -0.0047 243 ARG A C     
1934 O O     . ARG A 243 ? 0.6560 1.8942 0.8674 -0.0539 -0.2572 -0.0058 243 ARG A O     
1935 C CB    . ARG A 243 ? 0.6648 1.9622 0.9075 -0.0798 -0.2768 -0.0108 243 ARG A CB    
1936 C CG    . ARG A 243 ? 0.6784 1.9522 0.9010 -0.0811 -0.2913 -0.0041 243 ARG A CG    
1937 C CD    . ARG A 243 ? 0.6823 1.9773 0.9139 -0.0969 -0.2978 -0.0056 243 ARG A CD    
1938 N NE    . ARG A 243 ? 0.6949 1.9626 0.9015 -0.1020 -0.3087 0.0007  243 ARG A NE    
1939 C CZ    . ARG A 243 ? 0.6973 1.9344 0.8755 -0.1128 -0.3044 0.0065  243 ARG A CZ    
1940 N NH1   . ARG A 243 ? 0.6880 1.9159 0.8580 -0.1201 -0.2898 0.0078  243 ARG A NH1   
1941 N NH2   . ARG A 243 ? 0.7100 1.9257 0.8679 -0.1160 -0.3153 0.0105  243 ARG A NH2   
1942 N N     . VAL A 244 ? 0.6758 1.8902 0.8659 -0.0545 -0.2800 0.0029  244 VAL A N     
1943 C CA    . VAL A 244 ? 0.6789 1.8515 0.8368 -0.0521 -0.2763 0.0107  244 VAL A CA    
1944 C C     . VAL A 244 ? 0.6806 1.8330 0.8133 -0.0687 -0.2734 0.0160  244 VAL A C     
1945 O O     . VAL A 244 ? 0.6866 1.8461 0.8189 -0.0785 -0.2813 0.0162  244 VAL A O     
1946 C CB    . VAL A 244 ? 0.6924 1.8439 0.8397 -0.0365 -0.2894 0.0155  244 VAL A CB    
1947 C CG1   . VAL A 244 ? 0.6990 1.8091 0.8103 -0.0375 -0.2881 0.0242  244 VAL A CG1   
1948 C CG2   . VAL A 244 ? 0.6906 1.8506 0.8570 -0.0191 -0.2892 0.0114  244 VAL A CG2   
1949 N N     . ILE A 245 ? 0.6758 1.8028 0.7883 -0.0711 -0.2624 0.0198  245 ILE A N     
1950 C CA    . ILE A 245 ? 0.6775 1.7810 0.7649 -0.0847 -0.2587 0.0244  245 ILE A CA    
1951 C C     . ILE A 245 ? 0.6823 1.7486 0.7419 -0.0772 -0.2574 0.0304  245 ILE A C     
1952 O O     . ILE A 245 ? 0.6756 1.7319 0.7320 -0.0711 -0.2480 0.0311  245 ILE A O     
1953 C CB    . ILE A 245 ? 0.6659 1.7781 0.7576 -0.0976 -0.2448 0.0226  245 ILE A CB    
1954 C CG1   . ILE A 245 ? 0.6627 1.8124 0.7801 -0.1077 -0.2458 0.0173  245 ILE A CG1   
1955 C CG2   . ILE A 245 ? 0.6688 1.7529 0.7343 -0.1096 -0.2416 0.0276  245 ILE A CG2   
1956 C CD1   . ILE A 245 ? 0.6527 1.8162 0.7770 -0.1208 -0.2325 0.0156  245 ILE A CD1   
1957 N N     . PHE A 246 ? 0.6946 1.7414 0.7341 -0.0784 -0.2668 0.0344  246 PHE A N     
1958 C CA    . PHE A 246 ? 0.7019 1.7165 0.7155 -0.0709 -0.2675 0.0400  246 PHE A CA    
1959 C C     . PHE A 246 ? 0.7005 1.6914 0.6909 -0.0812 -0.2597 0.0422  246 PHE A C     
1960 O O     . PHE A 246 ? 0.7021 1.6951 0.6897 -0.0940 -0.2610 0.0408  246 PHE A O     
1961 C CB    . PHE A 246 ? 0.7180 1.7271 0.7230 -0.0652 -0.2829 0.0426  246 PHE A CB    
1962 C CG    . PHE A 246 ? 0.7266 1.7131 0.7152 -0.0526 -0.2857 0.0482  246 PHE A CG    
1963 C CD1   . PHE A 246 ? 0.7232 1.7138 0.7249 -0.0398 -0.2840 0.0484  246 PHE A CD1   
1964 C CD2   . PHE A 246 ? 0.7394 1.7012 0.6998 -0.0537 -0.2904 0.0529  246 PHE A CD2   
1965 C CE1   . PHE A 246 ? 0.7329 1.7014 0.7192 -0.0292 -0.2872 0.0544  246 PHE A CE1   
1966 C CE2   . PHE A 246 ? 0.7487 1.6903 0.6931 -0.0436 -0.2929 0.0588  246 PHE A CE2   
1967 C CZ    . PHE A 246 ? 0.7458 1.6900 0.7029 -0.0316 -0.2916 0.0601  246 PHE A CZ    
1968 N N     . LEU A 247 ? 0.6984 1.6666 0.6730 -0.0756 -0.2521 0.0455  247 LEU A N     
1969 C CA    . LEU A 247 ? 0.6985 1.6417 0.6498 -0.0828 -0.2455 0.0476  247 LEU A CA    
1970 C C     . LEU A 247 ? 0.7066 1.6239 0.6354 -0.0737 -0.2463 0.0523  247 LEU A C     
1971 O O     . LEU A 247 ? 0.7047 1.6192 0.6365 -0.0631 -0.2438 0.0544  247 LEU A O     
1972 C CB    . LEU A 247 ? 0.6845 1.6297 0.6418 -0.0884 -0.2318 0.0462  247 LEU A CB    
1973 C CG    . LEU A 247 ? 0.6822 1.6008 0.6183 -0.0911 -0.2229 0.0486  247 LEU A CG    
1974 C CD1   . LEU A 247 ? 0.6893 1.5951 0.6103 -0.1024 -0.2263 0.0482  247 LEU A CD1   
1975 C CD2   . LEU A 247 ? 0.6687 1.5933 0.6142 -0.0942 -0.2104 0.0475  247 LEU A CD2   
1976 N N     . HIS A 248 ? 0.7168 1.6158 0.6232 -0.0782 -0.2501 0.0536  248 HIS A N     
1977 C CA    . HIS A 248 ? 0.7262 1.6021 0.6094 -0.0716 -0.2508 0.0579  248 HIS A CA    
1978 C C     . HIS A 248 ? 0.7335 1.5916 0.5942 -0.0796 -0.2507 0.0567  248 HIS A C     
1979 O O     . HIS A 248 ? 0.7360 1.5995 0.5984 -0.0888 -0.2548 0.0530  248 HIS A O     
1980 C CB    . HIS A 248 ? 0.7391 1.6185 0.6219 -0.0624 -0.2628 0.0612  248 HIS A CB    
1981 C CG    . HIS A 248 ? 0.7489 1.6408 0.6352 -0.0670 -0.2752 0.0589  248 HIS A CG    
1982 N ND1   . HIS A 248 ? 0.7657 1.6468 0.6319 -0.0671 -0.2846 0.0608  248 HIS A ND1   
1983 C CD2   . HIS A 248 ? 0.7448 1.6599 0.6522 -0.0721 -0.2797 0.0547  248 HIS A CD2   
1984 C CE1   . HIS A 248 ? 0.7715 1.6679 0.6464 -0.0718 -0.2949 0.0578  248 HIS A CE1   
1985 N NE2   . HIS A 248 ? 0.7589 1.6761 0.6592 -0.0749 -0.2922 0.0542  248 HIS A NE2   
1986 N N     . ASP A 249 ? 0.7376 1.5747 0.5776 -0.0760 -0.2461 0.0595  249 ASP A N     
1987 C CA    . ASP A 249 ? 0.7425 1.5627 0.5626 -0.0827 -0.2435 0.0570  249 ASP A CA    
1988 C C     . ASP A 249 ? 0.7589 1.5785 0.5670 -0.0860 -0.2552 0.0549  249 ASP A C     
1989 O O     . ASP A 249 ? 0.7687 1.5951 0.5769 -0.0810 -0.2646 0.0576  249 ASP A O     
1990 C CB    . ASP A 249 ? 0.7414 1.5419 0.5445 -0.0783 -0.2342 0.0598  249 ASP A CB    
1991 C CG    . ASP A 249 ? 0.7535 1.5464 0.5428 -0.0698 -0.2385 0.0654  249 ASP A CG    
1992 O OD1   . ASP A 249 ? 0.7633 1.5652 0.5557 -0.0667 -0.2492 0.0673  249 ASP A OD1   
1993 O OD2   . ASP A 249 ? 0.7541 1.5321 0.5295 -0.0666 -0.2315 0.0682  249 ASP A OD2   
1994 N N     . ASN A 250 ? 0.7629 1.5743 0.5613 -0.0943 -0.2554 0.0499  250 ASN A N     
1995 C CA    . ASN A 250 ? 0.7787 1.5901 0.5667 -0.0985 -0.2665 0.0463  250 ASN A CA    
1996 C C     . ASN A 250 ? 0.7942 1.5928 0.5571 -0.0938 -0.2695 0.0477  250 ASN A C     
1997 O O     . ASN A 250 ? 0.8045 1.5929 0.5509 -0.0981 -0.2713 0.0426  250 ASN A O     
1998 C CB    . ASN A 250 ? 0.7795 1.5847 0.5654 -0.1089 -0.2661 0.0396  250 ASN A CB    
1999 C CG    . ASN A 250 ? 0.7678 1.5861 0.5764 -0.1162 -0.2647 0.0386  250 ASN A CG    
2000 O OD1   . ASN A 250 ? 0.7597 1.5955 0.5870 -0.1139 -0.2649 0.0416  250 ASN A OD1   
2001 N ND2   . ASN A 250 ? 0.7683 1.5785 0.5755 -0.1253 -0.2636 0.0341  250 ASN A ND2   
2002 N N     . ALA A 251 ? 0.7975 1.5969 0.5575 -0.0854 -0.2708 0.0543  251 ALA A N     
2003 C CA    . ALA A 251 ? 0.8139 1.6022 0.5494 -0.0818 -0.2739 0.0571  251 ALA A CA    
2004 C C     . ALA A 251 ? 0.8313 1.6267 0.5599 -0.0844 -0.2879 0.0550  251 ALA A C     
2005 O O     . ALA A 251 ? 0.8292 1.6396 0.5754 -0.0867 -0.2955 0.0533  251 ALA A O     
2006 C CB    . ALA A 251 ? 0.8138 1.6000 0.5492 -0.0729 -0.2722 0.0657  251 ALA A CB    
2007 N N     . PRO A 252 ? 0.8490 1.6351 0.5523 -0.0846 -0.2914 0.0548  252 PRO A N     
2008 C CA    . PRO A 25