data_5HP1
# 
_entry.id   5HP1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HP1         
WWPDB D_1000217399 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5HLF 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HP1 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Das, K.'    1 
'Arnold, E.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Chem.Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1554-8937 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                2158 
_citation.page_last                 2164 
_citation.title                     
'Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acschembio.6b00187 
_citation.pdbx_database_id_PubMed   27192549 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Das, K.'         1 
primary 'Balzarini, J.'   2 
primary 'Miller, M.T.'    3 
primary 'Maguire, A.R.'   4 
primary 'DeStefano, J.J.' 5 
primary 'Arnold, E.'      6 
# 
_cell.entry_id           5HP1 
_cell.length_a           90.325 
_cell.length_b           129.069 
_cell.length_c           131.542 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5HP1 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT'     63875.117 2 2.7.7.49 ? ? ? 
2  polymer     man 'HIV-1 REVERSE TRANSCRIPTASE P51 SUBUNIT'     51928.629 2 2.7.7.49 ? ? ? 
3  polymer     syn 'DNA (38-MER)'                                11748.526 2 ?        ? ? ? 
4  non-polymer syn 'MAGNESIUM ION'                               24.305    8 ?        ? ? ? 
5  non-polymer syn 'PHOSPHONOFORMIC ACID'                        126.005   2 ?        ? ? ? 
6  non-polymer syn 'SULFATE ION'                                 96.063    2 ?        ? ? ? 
7  non-polymer man SUCROSE                                       342.296   2 ?        ? ? ? 
8  non-polymer syn GLYCEROL                                      92.094    2 ?        ? ? ? 
9  non-polymer syn "3'-AZIDO-3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 347.221   2 ?        ? ? ? 
10 water       nat water                                         18.015    2 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Pr160Gag-Pol 
2 Pr160Gag-Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
;
A,C ? 
2 'polypeptide(L)'        no no  
;MAHHHHHHALEVLFQGPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIK
KKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKE
PPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELA
ENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWG
KTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
;MAHHHHHHALEVLFQGPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIK
KKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKE
PPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELA
ENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWG
KTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
B,D ? 
3 polydeoxyribonucleotide no yes 
;(DT)(DA)(DA)(DT)(DA)(DC)(OMC)(DC)(OMC)(DC)(DC)(DC)(DT)(DT)(DC)(DG)(DG)(DT)(DG)
(DC)(DT)(DT)(DT)(DG)(DC)(DA)(DC)(DC)(DG)(DA)(DA)(DG)(DG)(DG)(DG)(DG)(DG)(DG)
;
TAATACCCCCCCTTCGGTGCTTTGCACCGAAGGGGGGG F,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 LYS n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 SER n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 LYS n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 PRO n 
1 469 LEU n 
1 470 THR n 
1 471 ASN n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 LYS n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
2 1   MET n 
2 2   ALA n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   ALA n 
2 10  LEU n 
2 11  GLU n 
2 12  VAL n 
2 13  LEU n 
2 14  PHE n 
2 15  GLN n 
2 16  GLY n 
2 17  PRO n 
2 18  ILE n 
2 19  SER n 
2 20  PRO n 
2 21  ILE n 
2 22  GLU n 
2 23  THR n 
2 24  VAL n 
2 25  PRO n 
2 26  VAL n 
2 27  LYS n 
2 28  LEU n 
2 29  LYS n 
2 30  PRO n 
2 31  GLY n 
2 32  MET n 
2 33  ASP n 
2 34  GLY n 
2 35  PRO n 
2 36  LYS n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  TRP n 
2 41  PRO n 
2 42  LEU n 
2 43  THR n 
2 44  GLU n 
2 45  GLU n 
2 46  LYS n 
2 47  ILE n 
2 48  LYS n 
2 49  ALA n 
2 50  LEU n 
2 51  VAL n 
2 52  GLU n 
2 53  ILE n 
2 54  CYS n 
2 55  THR n 
2 56  GLU n 
2 57  MET n 
2 58  GLU n 
2 59  LYS n 
2 60  GLU n 
2 61  GLY n 
2 62  LYS n 
2 63  ILE n 
2 64  SER n 
2 65  LYS n 
2 66  ILE n 
2 67  GLY n 
2 68  PRO n 
2 69  GLU n 
2 70  ASN n 
2 71  PRO n 
2 72  TYR n 
2 73  ASN n 
2 74  THR n 
2 75  PRO n 
2 76  VAL n 
2 77  PHE n 
2 78  ALA n 
2 79  ILE n 
2 80  LYS n 
2 81  LYS n 
2 82  LYS n 
2 83  ASP n 
2 84  SER n 
2 85  THR n 
2 86  LYS n 
2 87  TRP n 
2 88  ARG n 
2 89  LYS n 
2 90  LEU n 
2 91  VAL n 
2 92  ASP n 
2 93  PHE n 
2 94  ARG n 
2 95  GLU n 
2 96  LEU n 
2 97  ASN n 
2 98  LYS n 
2 99  ARG n 
2 100 THR n 
2 101 GLN n 
2 102 ASP n 
2 103 PHE n 
2 104 TRP n 
2 105 GLU n 
2 106 VAL n 
2 107 GLN n 
2 108 LEU n 
2 109 GLY n 
2 110 ILE n 
2 111 PRO n 
2 112 HIS n 
2 113 PRO n 
2 114 ALA n 
2 115 GLY n 
2 116 LEU n 
2 117 LYS n 
2 118 LYS n 
2 119 LYS n 
2 120 LYS n 
2 121 SER n 
2 122 VAL n 
2 123 THR n 
2 124 VAL n 
2 125 LEU n 
2 126 ASP n 
2 127 VAL n 
2 128 GLY n 
2 129 ASP n 
2 130 ALA n 
2 131 TYR n 
2 132 PHE n 
2 133 SER n 
2 134 VAL n 
2 135 PRO n 
2 136 LEU n 
2 137 ASP n 
2 138 GLU n 
2 139 ASP n 
2 140 PHE n 
2 141 ARG n 
2 142 LYS n 
2 143 TYR n 
2 144 THR n 
2 145 ALA n 
2 146 PHE n 
2 147 THR n 
2 148 ILE n 
2 149 PRO n 
2 150 SER n 
2 151 ILE n 
2 152 ASN n 
2 153 ASN n 
2 154 GLU n 
2 155 THR n 
2 156 PRO n 
2 157 GLY n 
2 158 ILE n 
2 159 ARG n 
2 160 TYR n 
2 161 GLN n 
2 162 TYR n 
2 163 ASN n 
2 164 VAL n 
2 165 LEU n 
2 166 PRO n 
2 167 GLN n 
2 168 GLY n 
2 169 TRP n 
2 170 LYS n 
2 171 GLY n 
2 172 SER n 
2 173 PRO n 
2 174 ALA n 
2 175 ILE n 
2 176 PHE n 
2 177 GLN n 
2 178 SER n 
2 179 SER n 
2 180 MET n 
2 181 THR n 
2 182 LYS n 
2 183 ILE n 
2 184 LEU n 
2 185 GLU n 
2 186 PRO n 
2 187 PHE n 
2 188 LYS n 
2 189 LYS n 
2 190 GLN n 
2 191 ASN n 
2 192 PRO n 
2 193 ASP n 
2 194 ILE n 
2 195 VAL n 
2 196 ILE n 
2 197 TYR n 
2 198 GLN n 
2 199 TYR n 
2 200 MET n 
2 201 ASP n 
2 202 ASP n 
2 203 LEU n 
2 204 TYR n 
2 205 VAL n 
2 206 GLY n 
2 207 SER n 
2 208 ASP n 
2 209 LEU n 
2 210 GLU n 
2 211 ILE n 
2 212 GLY n 
2 213 GLN n 
2 214 HIS n 
2 215 ARG n 
2 216 THR n 
2 217 LYS n 
2 218 ILE n 
2 219 GLU n 
2 220 GLU n 
2 221 LEU n 
2 222 ARG n 
2 223 GLN n 
2 224 HIS n 
2 225 LEU n 
2 226 LEU n 
2 227 ARG n 
2 228 TRP n 
2 229 GLY n 
2 230 LEU n 
2 231 THR n 
2 232 THR n 
2 233 PRO n 
2 234 ASP n 
2 235 LYS n 
2 236 LYS n 
2 237 HIS n 
2 238 GLN n 
2 239 LYS n 
2 240 GLU n 
2 241 PRO n 
2 242 PRO n 
2 243 PHE n 
2 244 LEU n 
2 245 TRP n 
2 246 MET n 
2 247 GLY n 
2 248 TYR n 
2 249 GLU n 
2 250 LEU n 
2 251 HIS n 
2 252 PRO n 
2 253 ASP n 
2 254 LYS n 
2 255 TRP n 
2 256 THR n 
2 257 VAL n 
2 258 GLN n 
2 259 PRO n 
2 260 ILE n 
2 261 VAL n 
2 262 LEU n 
2 263 PRO n 
2 264 GLU n 
2 265 LYS n 
2 266 ASP n 
2 267 SER n 
2 268 TRP n 
2 269 THR n 
2 270 VAL n 
2 271 ASN n 
2 272 ASP n 
2 273 ILE n 
2 274 GLN n 
2 275 LYS n 
2 276 LEU n 
2 277 VAL n 
2 278 GLY n 
2 279 LYS n 
2 280 LEU n 
2 281 ASN n 
2 282 TRP n 
2 283 ALA n 
2 284 SER n 
2 285 GLN n 
2 286 ILE n 
2 287 TYR n 
2 288 PRO n 
2 289 GLY n 
2 290 ILE n 
2 291 LYS n 
2 292 VAL n 
2 293 ARG n 
2 294 GLN n 
2 295 LEU n 
2 296 SER n 
2 297 LYS n 
2 298 LEU n 
2 299 LEU n 
2 300 ARG n 
2 301 GLY n 
2 302 THR n 
2 303 LYS n 
2 304 ALA n 
2 305 LEU n 
2 306 THR n 
2 307 GLU n 
2 308 VAL n 
2 309 ILE n 
2 310 PRO n 
2 311 LEU n 
2 312 THR n 
2 313 GLU n 
2 314 GLU n 
2 315 ALA n 
2 316 GLU n 
2 317 LEU n 
2 318 GLU n 
2 319 LEU n 
2 320 ALA n 
2 321 GLU n 
2 322 ASN n 
2 323 ARG n 
2 324 GLU n 
2 325 ILE n 
2 326 LEU n 
2 327 LYS n 
2 328 GLU n 
2 329 PRO n 
2 330 VAL n 
2 331 HIS n 
2 332 GLY n 
2 333 VAL n 
2 334 TYR n 
2 335 TYR n 
2 336 ASP n 
2 337 PRO n 
2 338 SER n 
2 339 LYS n 
2 340 ASP n 
2 341 LEU n 
2 342 ILE n 
2 343 ALA n 
2 344 GLU n 
2 345 ILE n 
2 346 GLN n 
2 347 LYS n 
2 348 GLN n 
2 349 GLY n 
2 350 GLN n 
2 351 GLY n 
2 352 GLN n 
2 353 TRP n 
2 354 THR n 
2 355 TYR n 
2 356 GLN n 
2 357 ILE n 
2 358 TYR n 
2 359 GLN n 
2 360 GLU n 
2 361 PRO n 
2 362 PHE n 
2 363 LYS n 
2 364 ASN n 
2 365 LEU n 
2 366 LYS n 
2 367 THR n 
2 368 GLY n 
2 369 LYS n 
2 370 TYR n 
2 371 ALA n 
2 372 ARG n 
2 373 MET n 
2 374 ARG n 
2 375 GLY n 
2 376 ALA n 
2 377 HIS n 
2 378 THR n 
2 379 ASN n 
2 380 ASP n 
2 381 VAL n 
2 382 LYS n 
2 383 GLN n 
2 384 LEU n 
2 385 THR n 
2 386 GLU n 
2 387 ALA n 
2 388 VAL n 
2 389 GLN n 
2 390 LYS n 
2 391 ILE n 
2 392 THR n 
2 393 THR n 
2 394 GLU n 
2 395 SER n 
2 396 ILE n 
2 397 VAL n 
2 398 ILE n 
2 399 TRP n 
2 400 GLY n 
2 401 LYS n 
2 402 THR n 
2 403 PRO n 
2 404 LYS n 
2 405 PHE n 
2 406 LYS n 
2 407 LEU n 
2 408 PRO n 
2 409 ILE n 
2 410 GLN n 
2 411 LYS n 
2 412 GLU n 
2 413 THR n 
2 414 TRP n 
2 415 GLU n 
2 416 THR n 
2 417 TRP n 
2 418 TRP n 
2 419 THR n 
2 420 GLU n 
2 421 TYR n 
2 422 TRP n 
2 423 GLN n 
2 424 ALA n 
2 425 THR n 
2 426 TRP n 
2 427 ILE n 
2 428 PRO n 
2 429 GLU n 
2 430 TRP n 
2 431 GLU n 
2 432 PHE n 
2 433 VAL n 
2 434 ASN n 
2 435 THR n 
2 436 PRO n 
2 437 PRO n 
2 438 LEU n 
2 439 VAL n 
2 440 LYS n 
2 441 LEU n 
2 442 TRP n 
2 443 TYR n 
2 444 GLN n 
3 1   DT  n 
3 2   DA  n 
3 3   DA  n 
3 4   DT  n 
3 5   DA  n 
3 6   DC  n 
3 7   OMC n 
3 8   DC  n 
3 9   OMC n 
3 10  DC  n 
3 11  DC  n 
3 12  DC  n 
3 13  DT  n 
3 14  DT  n 
3 15  DC  n 
3 16  DG  n 
3 17  DG  n 
3 18  DT  n 
3 19  DG  n 
3 20  DC  n 
3 21  DT  n 
3 22  DT  n 
3 23  DT  n 
3 24  DG  n 
3 25  DC  n 
3 26  DA  n 
3 27  DC  n 
3 28  DC  n 
3 29  DG  n 
3 30  DA  n 
3 31  DA  n 
3 32  DG  n 
3 33  DG  n 
3 34  DG  n 
3 35  DG  n 
3 36  DG  n 
3 37  DG  n 
3 38  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 555 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 444 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       38 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1B1 P03366 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
;
600 
2 UNP POL_HV1B1 P03366 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
600 
3 PDB 5HP1      5HP1   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HP1 A 1  ? 555 ? P03366 600 ? 1154 ? 1  555 
2 2 5HP1 B 17 ? 444 ? P03366 600 ? 1027 ? 1  428 
3 1 5HP1 C 1  ? 555 ? P03366 600 ? 1154 ? 1  555 
4 3 5HP1 F 1  ? 38  ? 5HP1   -4  ? 33   ? -4 33  
5 2 5HP1 D 17 ? 444 ? P03366 600 ? 1027 ? 1  428 
6 3 5HP1 E 1  ? 38  ? 5HP1   -4  ? 33   ? -4 33  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HP1 SER A 280 ? UNP P03366 CYS 879 'engineered mutation'   280 1  
2 5HP1 MET B 1   ? UNP P03366 ?   ?   'initiating methionine' -15 2  
2 5HP1 ALA B 2   ? UNP P03366 ?   ?   'expression tag'        -14 3  
2 5HP1 HIS B 3   ? UNP P03366 ?   ?   'expression tag'        -13 4  
2 5HP1 HIS B 4   ? UNP P03366 ?   ?   'expression tag'        -12 5  
2 5HP1 HIS B 5   ? UNP P03366 ?   ?   'expression tag'        -11 6  
2 5HP1 HIS B 6   ? UNP P03366 ?   ?   'expression tag'        -10 7  
2 5HP1 HIS B 7   ? UNP P03366 ?   ?   'expression tag'        -9  8  
2 5HP1 HIS B 8   ? UNP P03366 ?   ?   'expression tag'        -8  9  
2 5HP1 ALA B 9   ? UNP P03366 ?   ?   'expression tag'        -7  10 
2 5HP1 LEU B 10  ? UNP P03366 ?   ?   'expression tag'        -6  11 
2 5HP1 GLU B 11  ? UNP P03366 ?   ?   'expression tag'        -5  12 
2 5HP1 VAL B 12  ? UNP P03366 ?   ?   'expression tag'        -4  13 
2 5HP1 LEU B 13  ? UNP P03366 ?   ?   'expression tag'        -3  14 
2 5HP1 PHE B 14  ? UNP P03366 ?   ?   'expression tag'        -2  15 
2 5HP1 GLN B 15  ? UNP P03366 ?   ?   'expression tag'        -1  16 
2 5HP1 GLY B 16  ? UNP P03366 ?   ?   'expression tag'        0   17 
2 5HP1 SER B 296 ? UNP P03366 CYS 879 'engineered mutation'   280 18 
3 5HP1 SER C 280 ? UNP P03366 CYS 879 'engineered mutation'   280 19 
5 5HP1 MET D 1   ? UNP P03366 ?   ?   'initiating methionine' -15 20 
5 5HP1 ALA D 2   ? UNP P03366 ?   ?   'expression tag'        -14 21 
5 5HP1 HIS D 3   ? UNP P03366 ?   ?   'expression tag'        -13 22 
5 5HP1 HIS D 4   ? UNP P03366 ?   ?   'expression tag'        -12 23 
5 5HP1 HIS D 5   ? UNP P03366 ?   ?   'expression tag'        -11 24 
5 5HP1 HIS D 6   ? UNP P03366 ?   ?   'expression tag'        -10 25 
5 5HP1 HIS D 7   ? UNP P03366 ?   ?   'expression tag'        -9  26 
5 5HP1 HIS D 8   ? UNP P03366 ?   ?   'expression tag'        -8  27 
5 5HP1 ALA D 9   ? UNP P03366 ?   ?   'expression tag'        -7  28 
5 5HP1 LEU D 10  ? UNP P03366 ?   ?   'expression tag'        -6  29 
5 5HP1 GLU D 11  ? UNP P03366 ?   ?   'expression tag'        -5  30 
5 5HP1 VAL D 12  ? UNP P03366 ?   ?   'expression tag'        -4  31 
5 5HP1 LEU D 13  ? UNP P03366 ?   ?   'expression tag'        -3  32 
5 5HP1 PHE D 14  ? UNP P03366 ?   ?   'expression tag'        -2  33 
5 5HP1 GLN D 15  ? UNP P03366 ?   ?   'expression tag'        -1  34 
5 5HP1 GLY D 16  ? UNP P03366 ?   ?   'expression tag'        0   35 
5 5HP1 SER D 296 ? UNP P03366 CYS 879 'engineered mutation'   280 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                      ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4'      133.103 
ATM 'DNA linking'       n "3'-AZIDO-3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
CYS 'L-peptide linking' y CYSTEINE                                      ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                     ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                         ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                               'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ?                               'Mg 2'            24.305  
OMC 'RNA linking'       n "O2'-METHYLYCYTIDINE-5'-MONOPHOSPHATE"        ?                               'C10 H16 N3 O8 P' 337.223 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                               'C9 H11 N O2'     165.189 
PPF non-polymer         . 'PHOSPHONOFORMIC ACID'                        ?                               'C H3 O5 P'       126.005 
PRO 'L-peptide linking' y PROLINE                                       ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                        ?                               'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                 ?                               'O4 S -2'         96.063  
SUC saccharide          . SUCROSE                                       ?                               'C12 H22 O11'     342.296 
THR 'L-peptide linking' y THREONINE                                     ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                        ?                               'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HP1 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.05 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.73 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '7% PEG 8000, 25mM, BISTRIS-PROPANE, 50 MM AMMONIUM SULFATE, 5% GLYCEROL, 5% SUCROSE' 
_exptl_crystal_grow.pdbx_pH_range   '6.8 - 7.4' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-02 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9179 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9179 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5HP1 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       63660 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -1 
_reflns.percent_possible_obs             96.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.0 
_reflns.pdbx_Rmerge_I_obs                0.103 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.37 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        89.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.686 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5HP1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     63560 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.643 
_refine.ls_d_res_high                            2.900 
_refine.ls_percent_reflns_obs                    96.71 
_refine.ls_R_factor_obs                          0.2474 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2464 
_refine.ls_R_factor_R_free                       0.2726 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.02 
_refine.ls_number_reflns_R_free                  2558 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      5D3G 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.44 
_refine.pdbx_overall_phase_error                 30.70 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15804 
_refine_hist.pdbx_number_atoms_nucleic_acid   1440 
_refine_hist.pdbx_number_atoms_ligand         134 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               17380 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        45.643 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 18023 'X-RAY DIFFRACTION' ? 
f_angle_d          0.891  ? ? 24746 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.702 ? ? 10529 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.051  ? ? 2698  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 2859  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.9000 2.9558  3122 0.3800 89.00  0.3518 . . 124 . . 
'X-RAY DIFFRACTION' . 2.9558 3.0161  3152 0.3703 90.00  0.3940 . . 141 . . 
'X-RAY DIFFRACTION' . 3.0161 3.0817  3266 0.3612 93.00  0.3915 . . 137 . . 
'X-RAY DIFFRACTION' . 3.0817 3.1533  3318 0.3523 95.00  0.3324 . . 119 . . 
'X-RAY DIFFRACTION' . 3.1533 3.2322  3331 0.3429 95.00  0.3947 . . 135 . . 
'X-RAY DIFFRACTION' . 3.2322 3.3195  3326 0.3257 96.00  0.3626 . . 131 . . 
'X-RAY DIFFRACTION' . 3.3195 3.4172  3353 0.3091 96.00  0.3227 . . 153 . . 
'X-RAY DIFFRACTION' . 3.4172 3.5275  3400 0.2983 97.00  0.3264 . . 147 . . 
'X-RAY DIFFRACTION' . 3.5275 3.6535  3378 0.2798 97.00  0.3236 . . 141 . . 
'X-RAY DIFFRACTION' . 3.6535 3.7997  3429 0.2899 98.00  0.3247 . . 137 . . 
'X-RAY DIFFRACTION' . 3.7997 3.9725  3439 0.2592 99.00  0.3027 . . 136 . . 
'X-RAY DIFFRACTION' . 3.9725 4.1818  3438 0.2351 99.00  0.2492 . . 165 . . 
'X-RAY DIFFRACTION' . 4.1818 4.4436  3494 0.2247 100.00 0.2260 . . 160 . . 
'X-RAY DIFFRACTION' . 4.4436 4.7864  3503 0.2113 100.00 0.2239 . . 149 . . 
'X-RAY DIFFRACTION' . 4.7864 5.2674  3509 0.2069 100.00 0.2780 . . 153 . . 
'X-RAY DIFFRACTION' . 5.2674 6.0282  3500 0.2247 100.00 0.2836 . . 149 . . 
'X-RAY DIFFRACTION' . 6.0282 7.5892  3520 0.2160 100.00 0.2396 . . 148 . . 
'X-RAY DIFFRACTION' . 7.5892 45.6484 3524 0.1741 98.00  0.1820 . . 133 . . 
# 
_struct.entry_id                     5HP1 
_struct.title                        
'STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE In COMPLEX WITH A DNA aptamer and FOSCARNET, a Pyrophosphate analog' 
_struct.pdbx_descriptor              'HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT, HIV-1 REVERSE TRANSCRIPTASE P51 SUBUNIT/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HP1 
_struct_keywords.text            
;RT, DNA APTAMER, Foscavir, N site complex, pyrophosphate, pyrophosphorolysis, phosphonoformic acid, PFA, 2-O-METHYLCYTIDINE, P51, P66, TRANSFERASE, TRANSFERASE-INHIBITOR-DNA complex
;
_struct_keywords.pdbx_keywords   TRANSFERASE/INHIBITOR/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 1  ? 
D N N 3  ? 
E N N 2  ? 
F N N 3  ? 
G N N 4  ? 
H N N 5  ? 
I N N 4  ? 
J N N 4  ? 
K N N 4  ? 
L N N 6  ? 
M N N 7  ? 
N N N 8  ? 
O N N 8  ? 
P N N 5  ? 
Q N N 4  ? 
R N N 4  ? 
S N N 4  ? 
T N N 6  ? 
U N N 4  ? 
V N N 9  ? 
W N N 7  ? 
X N N 9  ? 
Y N N 10 ? 
Z N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 27  ? GLY A 45  ? THR A 27  GLY A 45  1 ? 19 
HELX_P HELX_P2  AA2 PHE A 77  ? THR A 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 96  ? LEU A 100 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 114 ? VAL A 118 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 GLU A 122 ? ALA A 129 ? GLU A 122 ALA A 129 5 ? 8  
HELX_P HELX_P6  AA6 GLY A 155 ? GLN A 174 ? GLY A 155 GLN A 174 1 ? 20 
HELX_P HELX_P7  AA7 GLU A 194 ? TRP A 212 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 217 ? HIS A 221 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P9  AA9 THR A 253 ? SER A 268 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 276 ? ARG A 284 ? VAL A 276 ARG A 284 1 ? 9  
HELX_P HELX_P11 AB2 THR A 296 ? GLU A 312 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P12 AB3 ASN A 363 ? GLY A 384 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 394 ? TYR A 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 473 ? ASP A 488 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 AB6 SER A 499 ? ALA A 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 515 ? LYS A 528 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 ILE A 542 ? VAL A 552 ? ILE A 542 VAL A 552 1 ? 11 
HELX_P HELX_P18 AB9 THR B 43  ? GLU B 60  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 93  ? THR B 100 ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 ASP B 102 ? GLN B 107 ? ASP B 86  GLN B 91  1 ? 6  
HELX_P HELX_P21 AC3 GLY B 115 ? LYS B 119 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P22 AC4 GLY B 128 ? VAL B 134 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P23 AC5 PHE B 140 ? ALA B 145 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P24 AC6 SER B 150 ? GLU B 154 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 LYS B 170 ? ASN B 191 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P26 AC8 GLU B 210 ? THR B 232 ? GLU B 194 THR B 216 1 ? 23 
HELX_P HELX_P27 AC9 HIS B 251 ? TRP B 255 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P28 AD1 THR B 269 ? SER B 284 ? THR B 253 SER B 268 1 ? 16 
HELX_P HELX_P29 AD2 VAL B 292 ? LEU B 298 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P30 AD3 THR B 312 ? GLU B 328 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P31 AD4 ASN B 379 ? GLY B 400 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P32 AD5 GLN B 410 ? TRP B 418 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P33 AD6 THR B 419 ? TYR B 421 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P34 AD7 THR C 27  ? GLY C 45  ? THR C 27  GLY C 45  1 ? 19 
HELX_P HELX_P35 AD8 PHE C 77  ? THR C 84  ? PHE C 77  THR C 84  1 ? 8  
HELX_P HELX_P36 AD9 HIS C 96  ? LEU C 100 ? HIS C 96  LEU C 100 5 ? 5  
HELX_P HELX_P37 AE1 ALA C 114 ? VAL C 118 ? ALA C 114 VAL C 118 5 ? 5  
HELX_P HELX_P38 AE2 GLU C 122 ? ALA C 129 ? GLU C 122 ALA C 129 5 ? 8  
HELX_P HELX_P39 AE3 GLY C 155 ? GLN C 174 ? GLY C 155 GLN C 174 1 ? 20 
HELX_P HELX_P40 AE4 GLU C 194 ? TRP C 212 ? GLU C 194 TRP C 212 1 ? 19 
HELX_P HELX_P41 AE5 PRO C 217 ? HIS C 221 ? PRO C 217 HIS C 221 5 ? 5  
HELX_P HELX_P42 AE6 THR C 253 ? SER C 268 ? THR C 253 SER C 268 1 ? 16 
HELX_P HELX_P43 AE7 VAL C 276 ? ARG C 284 ? VAL C 276 ARG C 284 1 ? 9  
HELX_P HELX_P44 AE8 THR C 296 ? GLU C 312 ? THR C 296 GLU C 312 1 ? 17 
HELX_P HELX_P45 AE9 ASN C 363 ? GLY C 384 ? ASN C 363 GLY C 384 1 ? 22 
HELX_P HELX_P46 AF1 GLN C 394 ? TYR C 405 ? GLN C 394 TYR C 405 1 ? 12 
HELX_P HELX_P47 AF2 THR C 473 ? ASP C 488 ? THR C 473 ASP C 488 1 ? 16 
HELX_P HELX_P48 AF3 SER C 499 ? ALA C 508 ? SER C 499 ALA C 508 1 ? 10 
HELX_P HELX_P49 AF4 SER C 515 ? LYS C 528 ? SER C 515 LYS C 528 1 ? 14 
HELX_P HELX_P50 AF5 GLY C 544 ? SER C 553 ? GLY C 544 SER C 553 1 ? 10 
HELX_P HELX_P51 AF6 THR E 43  ? GLU E 60  ? THR D 27  GLU D 44  1 ? 18 
HELX_P HELX_P52 AF7 PHE E 93  ? THR E 100 ? PHE D 77  THR D 84  1 ? 8  
HELX_P HELX_P53 AF8 GLY E 115 ? LYS E 119 ? GLY D 99  LYS D 103 5 ? 5  
HELX_P HELX_P54 AF9 GLY E 128 ? VAL E 134 ? GLY D 112 VAL D 118 5 ? 7  
HELX_P HELX_P55 AG1 ASP E 137 ? LYS E 142 ? ASP D 121 LYS D 126 1 ? 6  
HELX_P HELX_P56 AG2 TYR E 143 ? ALA E 145 ? TYR D 127 ALA D 129 5 ? 3  
HELX_P HELX_P57 AG3 SER E 150 ? GLU E 154 ? SER D 134 GLU D 138 5 ? 5  
HELX_P HELX_P58 AG4 LYS E 170 ? ASN E 191 ? LYS D 154 ASN D 175 1 ? 22 
HELX_P HELX_P59 AG5 GLU E 210 ? GLY E 229 ? GLU D 194 GLY D 213 1 ? 20 
HELX_P HELX_P60 AG6 HIS E 251 ? TRP E 255 ? HIS D 235 TRP D 239 5 ? 5  
HELX_P HELX_P61 AG7 THR E 269 ? SER E 284 ? THR D 253 SER D 268 1 ? 16 
HELX_P HELX_P62 AG8 VAL E 292 ? LEU E 298 ? VAL D 276 LEU D 282 1 ? 7  
HELX_P HELX_P63 AG9 THR E 312 ? GLU E 328 ? THR D 296 GLU D 312 1 ? 17 
HELX_P HELX_P64 AH1 ASN E 379 ? GLY E 400 ? ASN D 363 GLY D 384 1 ? 22 
HELX_P HELX_P65 AH2 GLN E 410 ? TRP E 422 ? GLN D 394 TRP D 406 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 110 OD1   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 110 A MG  604 1_555 ? ? ? ? ? ? ?            1.956 ? 
metalc2  metalc ?    ? A ASP 110 OD2   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 110 A MG  603 1_555 ? ? ? ? ? ? ?            2.062 ? 
metalc3  metalc ?    ? A VAL 111 O     ? ? ? 1_555 J MG  .  MG  ? ? A VAL 111 A MG  604 1_555 ? ? ? ? ? ? ?            2.564 ? 
metalc4  metalc ?    ? A ASP 185 OD1   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 185 A MG  603 1_555 ? ? ? ? ? ? ?            2.121 ? 
metalc5  metalc ?    ? A ASP 185 OD2   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 185 A MG  603 1_555 ? ? ? ? ? ? ?            2.577 ? 
metalc6  metalc ?    ? A ASP 185 OD2   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 185 A MG  604 1_555 ? ? ? ? ? ? ?            2.079 ? 
metalc7  metalc ?    ? A ASP 186 OD2   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 186 A MG  603 1_555 ? ? ? ? ? ? ?            1.990 ? 
metalc8  metalc ?    ? A ASP 443 OD1   ? ? ? 1_555 K MG  .  MG  ? ? A ASP 443 A MG  605 1_555 ? ? ? ? ? ? ?            2.076 ? 
metalc9  metalc ?    ? A ASP 443 OD2   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 443 A MG  601 1_555 ? ? ? ? ? ? ?            2.184 ? 
metalc10 metalc ?    ? A ASP 498 OD1   ? ? ? 1_555 K MG  .  MG  ? ? A ASP 498 A MG  605 1_555 ? ? ? ? ? ? ?            2.153 ? 
metalc11 metalc ?    ? A ASP 549 OD1   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 549 A MG  601 1_555 ? ? ? ? ? ? ?            2.162 ? 
metalc12 metalc ?    ? C ASP 110 OD1   ? ? ? 1_555 R MG  .  MG  ? ? C ASP 110 C MG  603 1_555 ? ? ? ? ? ? ?            2.028 ? 
metalc13 metalc ?    ? C ASP 110 OD2   ? ? ? 1_555 S MG  .  MG  ? ? C ASP 110 C MG  604 1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc14 metalc ?    ? C VAL 111 O     ? ? ? 1_555 S MG  .  MG  ? ? C VAL 111 C MG  604 1_555 ? ? ? ? ? ? ?            2.467 ? 
metalc15 metalc ?    ? C ASP 185 OD1   ? ? ? 1_555 R MG  .  MG  ? ? C ASP 185 C MG  603 1_555 ? ? ? ? ? ? ?            2.081 ? 
metalc16 metalc ?    ? C ASP 185 OD2   ? ? ? 1_555 S MG  .  MG  ? ? C ASP 185 C MG  604 1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc17 metalc ?    ? C ASP 185 OD2   ? ? ? 1_555 R MG  .  MG  ? ? C ASP 185 C MG  603 1_555 ? ? ? ? ? ? ?            2.443 ? 
metalc18 metalc ?    ? C ASP 186 OD1   ? ? ? 1_555 R MG  .  MG  ? ? C ASP 186 C MG  603 1_555 ? ? ? ? ? ? ?            2.054 ? 
metalc19 metalc ?    ? C ASP 443 OD1   ? ? ? 1_555 U MG  .  MG  ? ? C ASP 443 C MG  606 1_555 ? ? ? ? ? ? ?            2.024 ? 
metalc20 metalc ?    ? C ASP 443 OD2   ? ? ? 1_555 Q MG  .  MG  ? ? C ASP 443 C MG  602 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc21 metalc ?    ? C ASP 498 OD1   ? ? ? 1_555 U MG  .  MG  ? ? C ASP 498 C MG  606 1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc22 metalc ?    ? C ASP 549 OD1   ? ? ? 1_555 Q MG  .  MG  ? ? C ASP 549 C MG  602 1_555 ? ? ? ? ? ? ?            2.211 ? 
covale1  covale both ? D DC  6   "O3'" ? ? ? 1_555 D OMC 7  P   ? ? F DC  1   F OMC 2   1_555 ? ? ? ? ? ? ?            1.606 ? 
covale2  covale both ? D OMC 7   "O3'" ? ? ? 1_555 D DC  8  P   ? ? F OMC 2   F DC  3   1_555 ? ? ? ? ? ? ?            1.610 ? 
covale3  covale both ? D DC  8   "O3'" ? ? ? 1_555 D OMC 9  P   ? ? F DC  3   F OMC 4   1_555 ? ? ? ? ? ? ?            1.607 ? 
covale4  covale both ? D OMC 9   "O3'" ? ? ? 1_555 D DC  10 P   ? ? F OMC 4   F DC  5   1_555 ? ? ? ? ? ? ?            1.606 ? 
covale5  covale both ? D DG  38  "O3'" ? ? ? 1_555 V ATM .  P   ? ? F DG  33  F ATM 101 1_555 ? ? ? ? ? ? ?            1.556 ? 
metalc23 metalc ?    ? D DG  38  "O3'" ? ? ? 1_555 I MG  .  MG  ? ? F DG  33  A MG  603 1_555 ? ? ? ? ? ? ?            1.955 ? 
covale6  covale both ? F DC  6   "O3'" ? ? ? 1_555 F OMC 7  P   ? ? E DC  1   E OMC 2   1_555 ? ? ? ? ? ? ?            1.608 ? 
covale7  covale both ? F OMC 7   "O3'" ? ? ? 1_555 F DC  8  P   ? ? E OMC 2   E DC  3   1_555 ? ? ? ? ? ? ?            1.608 ? 
covale8  covale both ? F DC  8   "O3'" ? ? ? 1_555 F OMC 9  P   ? ? E DC  3   E OMC 4   1_555 ? ? ? ? ? ? ?            1.609 ? 
covale9  covale both ? F OMC 9   "O3'" ? ? ? 1_555 F DC  10 P   ? ? E OMC 4   E DC  5   1_555 ? ? ? ? ? ? ?            1.608 ? 
metalc24 metalc ?    ? F DG  38  "O3'" ? ? ? 1_555 R MG  .  MG  ? ? E DG  33  C MG  603 1_555 ? ? ? ? ? ? ?            1.935 ? 
covale10 covale both ? F DG  38  "O3'" ? ? ? 1_555 X ATM .  P   ? ? E DG  33  E ATM 101 1_555 ? ? ? ? ? ? ?            1.556 ? 
metalc25 metalc ?    ? G MG  .   MG    ? ? ? 1_555 Y HOH .  O   ? ? A MG  601 A HOH 701 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc26 metalc ?    ? H PPF .   O2    ? ? ? 1_555 J MG  .  MG  ? ? A PPF 602 A MG  604 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc27 metalc ?    ? H PPF .   O4    ? ? ? 1_555 J MG  .  MG  ? ? A PPF 602 A MG  604 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc28 metalc ?    ? I MG  .   MG    ? ? ? 1_555 V ATM .  OP2 ? ? A MG  603 F ATM 101 1_555 ? ? ? ? ? ? ?            2.069 ? 
metalc29 metalc ?    ? J MG  .   MG    ? ? ? 1_555 V ATM .  OP2 ? ? A MG  604 F ATM 101 1_555 ? ? ? ? ? ? ?            2.513 ? 
metalc30 metalc ?    ? P PPF .   O2    ? ? ? 1_555 S MG  .  MG  ? ? C PPF 601 C MG  604 1_555 ? ? ? ? ? ? ?            2.004 ? 
metalc31 metalc ?    ? P PPF .   O4    ? ? ? 1_555 S MG  .  MG  ? ? C PPF 601 C MG  604 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc32 metalc ?    ? Q MG  .   MG    ? ? ? 1_555 Z HOH .  O   ? ? C MG  602 C HOH 701 1_555 ? ? ? ? ? ? ?            2.442 ? 
metalc33 metalc ?    ? R MG  .   MG    ? ? ? 1_555 X ATM .  OP2 ? ? C MG  603 E ATM 101 1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc34 metalc ?    ? S MG  .   MG    ? ? ? 1_555 X ATM .  OP2 ? ? C MG  604 E ATM 101 1_555 ? ? ? ? ? ? ?            2.525 ? 
hydrog1  hydrog ?    ? F DC  6   N3    ? ? ? 1_555 F DG  38 N1  ? ? E DC  1   E DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? F DC  6   N4    ? ? ? 1_555 F DG  38 O6  ? ? E DC  1   E DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? F DC  6   O2    ? ? ? 1_555 F DG  38 N2  ? ? E DC  1   E DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? F OMC 7   N3    ? ? ? 1_555 F DG  37 N1  ? ? E OMC 2   E DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? F OMC 7   N4    ? ? ? 1_555 F DG  37 O6  ? ? E OMC 2   E DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? F OMC 7   O2    ? ? ? 1_555 F DG  37 N2  ? ? E OMC 2   E DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? F DC  8   N3    ? ? ? 1_555 F DG  36 N1  ? ? E DC  3   E DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? F DC  8   N4    ? ? ? 1_555 F DG  36 O6  ? ? E DC  3   E DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? F DC  8   O2    ? ? ? 1_555 F DG  36 N2  ? ? E DC  3   E DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? F OMC 9   N3    ? ? ? 1_555 F DG  35 N1  ? ? E OMC 4   E DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? F OMC 9   N4    ? ? ? 1_555 F DG  35 O6  ? ? E OMC 4   E DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? F OMC 9   O2    ? ? ? 1_555 F DG  35 N2  ? ? E OMC 4   E DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? F DC  10  N3    ? ? ? 1_555 F DG  34 N1  ? ? E DC  5   E DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? F DC  10  N4    ? ? ? 1_555 F DG  34 O6  ? ? E DC  5   E DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? F DC  10  O2    ? ? ? 1_555 F DG  34 N2  ? ? E DC  5   E DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? F DC  11  N3    ? ? ? 1_555 F DG  33 N1  ? ? E DC  6   E DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? F DC  11  N4    ? ? ? 1_555 F DG  33 O6  ? ? E DC  6   E DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? F DC  11  O2    ? ? ? 1_555 F DG  33 N2  ? ? E DC  6   E DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? F DC  12  N3    ? ? ? 1_555 F DG  32 N1  ? ? E DC  7   E DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? F DC  12  N4    ? ? ? 1_555 F DG  32 O6  ? ? E DC  7   E DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? F DC  12  O2    ? ? ? 1_555 F DG  32 N2  ? ? E DC  7   E DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? F DT  13  N3    ? ? ? 1_555 F DA  31 N1  ? ? E DT  8   E DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? F DT  13  O4    ? ? ? 1_555 F DA  31 N6  ? ? E DT  8   E DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? F DT  14  N3    ? ? ? 1_555 F DA  30 N1  ? ? E DT  9   E DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? F DT  14  O4    ? ? ? 1_555 F DA  30 N6  ? ? E DT  9   E DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? F DC  15  N3    ? ? ? 1_555 F DG  29 N1  ? ? E DC  10  E DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? F DC  15  N4    ? ? ? 1_555 F DG  29 O6  ? ? E DC  10  E DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? F DC  15  O2    ? ? ? 1_555 F DG  29 N2  ? ? E DC  10  E DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? F DG  16  N1    ? ? ? 1_555 F DC  28 N3  ? ? E DG  11  E DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? F DG  16  N2    ? ? ? 1_555 F DC  28 O2  ? ? E DG  11  E DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? F DG  16  O6    ? ? ? 1_555 F DC  28 N4  ? ? E DG  11  E DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? F DG  17  N1    ? ? ? 1_555 F DC  27 N3  ? ? E DG  12  E DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? F DG  17  N2    ? ? ? 1_555 F DC  27 O2  ? ? E DG  12  E DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? F DG  17  O6    ? ? ? 1_555 F DC  27 N4  ? ? E DG  12  E DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? F DT  18  N3    ? ? ? 1_555 F DA  26 N1  ? ? E DT  13  E DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? F DT  18  O4    ? ? ? 1_555 F DA  26 N6  ? ? E DT  13  E DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? F DG  19  N1    ? ? ? 1_555 F DC  25 N3  ? ? E DG  14  E DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? F DG  19  N2    ? ? ? 1_555 F DC  25 O2  ? ? E DG  14  E DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? F DG  19  O6    ? ? ? 1_555 F DC  25 N4  ? ? E DG  14  E DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? F DC  20  N3    ? ? ? 1_555 F DG  24 N1  ? ? E DC  15  E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? F DC  20  N4    ? ? ? 1_555 F DG  24 O6  ? ? E DC  15  E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? F DC  20  O2    ? ? ? 1_555 F DG  24 N2  ? ? E DC  15  E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? D DC  6   N3    ? ? ? 1_555 D DG  38 N1  ? ? F DC  1   F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? D DC  6   N4    ? ? ? 1_555 D DG  38 O6  ? ? F DC  1   F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? D DC  6   O2    ? ? ? 1_555 D DG  38 N2  ? ? F DC  1   F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? D OMC 7   N3    ? ? ? 1_555 D DG  37 N1  ? ? F OMC 2   F DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? D OMC 7   N4    ? ? ? 1_555 D DG  37 O6  ? ? F OMC 2   F DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? D OMC 7   O2    ? ? ? 1_555 D DG  37 N2  ? ? F OMC 2   F DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? D DC  8   N3    ? ? ? 1_555 D DG  36 N1  ? ? F DC  3   F DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? D DC  8   N4    ? ? ? 1_555 D DG  36 O6  ? ? F DC  3   F DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? D DC  8   O2    ? ? ? 1_555 D DG  36 N2  ? ? F DC  3   F DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? D OMC 9   N3    ? ? ? 1_555 D DG  35 N1  ? ? F OMC 4   F DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? D OMC 9   N4    ? ? ? 1_555 D DG  35 O6  ? ? F OMC 4   F DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? D OMC 9   O2    ? ? ? 1_555 D DG  35 N2  ? ? F OMC 4   F DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? D DC  10  N3    ? ? ? 1_555 D DG  34 N1  ? ? F DC  5   F DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?    ? D DC  10  N4    ? ? ? 1_555 D DG  34 O6  ? ? F DC  5   F DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?    ? D DC  10  O2    ? ? ? 1_555 D DG  34 N2  ? ? F DC  5   F DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?    ? D DC  11  N3    ? ? ? 1_555 D DG  33 N1  ? ? F DC  6   F DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?    ? D DC  11  N4    ? ? ? 1_555 D DG  33 O6  ? ? F DC  6   F DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?    ? D DC  11  O2    ? ? ? 1_555 D DG  33 N2  ? ? F DC  6   F DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?    ? D DC  12  N3    ? ? ? 1_555 D DG  32 N1  ? ? F DC  7   F DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?    ? D DC  12  N4    ? ? ? 1_555 D DG  32 O6  ? ? F DC  7   F DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ?    ? D DC  12  O2    ? ? ? 1_555 D DG  32 N2  ? ? F DC  7   F DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ?    ? D DT  13  N3    ? ? ? 1_555 D DA  31 N1  ? ? F DT  8   F DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ?    ? D DT  13  O4    ? ? ? 1_555 D DA  31 N6  ? ? F DT  8   F DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ?    ? D DT  14  N3    ? ? ? 1_555 D DA  30 N1  ? ? F DT  9   F DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ?    ? D DT  14  O4    ? ? ? 1_555 D DA  30 N6  ? ? F DT  9   F DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ?    ? D DC  15  N3    ? ? ? 1_555 D DG  29 N1  ? ? F DC  10  F DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ?    ? D DC  15  N4    ? ? ? 1_555 D DG  29 O6  ? ? F DC  10  F DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ?    ? D DC  15  O2    ? ? ? 1_555 D DG  29 N2  ? ? F DC  10  F DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ?    ? D DG  16  N1    ? ? ? 1_555 D DC  28 N3  ? ? F DG  11  F DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ?    ? D DG  16  N2    ? ? ? 1_555 D DC  28 O2  ? ? F DG  11  F DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ?    ? D DG  16  O6    ? ? ? 1_555 D DC  28 N4  ? ? F DG  11  F DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ?    ? D DG  17  N1    ? ? ? 1_555 D DC  27 N3  ? ? F DG  12  F DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ?    ? D DG  17  N2    ? ? ? 1_555 D DC  27 O2  ? ? F DG  12  F DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ?    ? D DG  17  O6    ? ? ? 1_555 D DC  27 N4  ? ? F DG  12  F DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ?    ? D DT  18  N3    ? ? ? 1_555 D DA  26 N1  ? ? F DT  13  F DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ?    ? D DT  18  O4    ? ? ? 1_555 D DA  26 N6  ? ? F DT  13  F DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79 hydrog ?    ? D DG  19  N1    ? ? ? 1_555 D DC  25 N3  ? ? F DG  14  F DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80 hydrog ?    ? D DG  19  N2    ? ? ? 1_555 D DC  25 O2  ? ? F DG  14  F DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81 hydrog ?    ? D DG  19  O6    ? ? ? 1_555 D DC  25 N4  ? ? F DG  14  F DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82 hydrog ?    ? D DC  20  N3    ? ? ? 1_555 D DG  24 N1  ? ? F DC  15  F DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83 hydrog ?    ? D DC  20  N4    ? ? ? 1_555 D DG  24 O6  ? ? F DC  15  F DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84 hydrog ?    ? D DC  20  O2    ? ? ? 1_555 D DG  24 N2  ? ? F DC  15  F DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 225 A . ? PRO 225 A PRO 226 A ? PRO 226 A 1 2.93  
2 PRO 420 A . ? PRO 420 A PRO 421 A ? PRO 421 A 1 -1.06 
3 PRO 225 C . ? PRO 225 C PRO 226 C ? PRO 226 C 1 3.10  
4 PRO 420 C . ? PRO 420 C PRO 421 C ? PRO 421 C 1 -1.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 5 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
AB6 ? 3 ? 
AB7 ? 5 ? 
AB8 ? 2 ? 
AB9 ? 5 ? 
AC1 ? 3 ? 
AC2 ? 2 ? 
AC3 ? 4 ? 
AC4 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB7 4 5 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? parallel      
AC4 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 47  ? SER A 48  ? ILE A 47  SER A 48  
AA1 2 ILE A 142 ? TYR A 146 ? ILE A 142 TYR A 146 
AA1 3 PHE A 130 ? ILE A 132 ? PHE A 130 ILE A 132 
AA2 1 VAL A 60  ? LYS A 64  ? VAL A 60  LYS A 64  
AA2 2 TRP A 71  ? VAL A 75  ? TRP A 71  VAL A 75  
AA3 1 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
AA3 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
AA3 3 VAL A 179 ? TYR A 183 ? VAL A 179 TYR A 183 
AA4 1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
AA4 2 TYR A 232 ? LEU A 234 ? TYR A 232 LEU A 234 
AA4 3 TRP A 239 ? VAL A 241 ? TRP A 239 VAL A 241 
AA5 1 LYS A 347 ? TYR A 354 ? LYS A 347 TYR A 354 
AA5 2 TRP A 337 ? GLU A 344 ? TRP A 337 GLU A 344 
AA5 3 ILE A 326 ? LYS A 331 ? ILE A 326 LYS A 331 
AA5 4 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
AA5 5 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
AA6 1 HIS A 361 ? THR A 362 ? HIS A 361 THR A 362 
AA6 2 LYS A 512 ? SER A 513 ? LYS A 512 SER A 513 
AA7 1 GLN A 464 ? THR A 470 ? GLN A 464 THR A 470 
AA7 2 LEU A 452 ? THR A 459 ? LEU A 452 THR A 459 
AA7 3 GLU A 438 ? ALA A 446 ? GLU A 438 ALA A 446 
AA7 4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
AA7 5 LYS A 530 ? TRP A 535 ? LYS A 530 TRP A 535 
AA8 1 ILE B 63  ? LYS B 65  ? ILE B 47  LYS B 49  
AA8 2 ILE B 158 ? TYR B 162 ? ILE B 142 TYR B 146 
AA8 3 PHE B 146 ? ILE B 148 ? PHE B 130 ILE B 132 
AA9 1 VAL B 76  ? ILE B 79  ? VAL B 60  ILE B 63  
AA9 2 ARG B 88  ? VAL B 91  ? ARG B 72  VAL B 75  
AB1 1 VAL B 195 ? TYR B 199 ? VAL B 179 TYR B 183 
AB1 2 ASP B 202 ? SER B 207 ? ASP B 186 SER B 191 
AB1 3 SER B 121 ? ASP B 126 ? SER B 105 ASP B 110 
AB1 4 TYR B 248 ? LEU B 250 ? TYR B 232 LEU B 234 
AB2 1 LYS B 363 ? ALA B 371 ? LYS B 347 ALA B 355 
AB2 2 GLN B 352 ? GLU B 360 ? GLN B 336 GLU B 344 
AB2 3 ILE B 342 ? GLY B 349 ? ILE B 326 GLY B 333 
AB2 4 LYS B 404 ? PRO B 408 ? LYS B 388 PRO B 392 
AB2 5 TRP B 430 ? VAL B 433 ? TRP B 414 VAL B 417 
AB3 1 ILE C 47  ? ILE C 50  ? ILE C 47  ILE C 50  
AB3 2 ARG C 143 ? TYR C 146 ? ARG C 143 TYR C 146 
AB4 1 VAL C 60  ? ILE C 63  ? VAL C 60  ILE C 63  
AB4 2 ARG C 72  ? VAL C 75  ? ARG C 72  VAL C 75  
AB5 1 SER C 105 ? ASP C 110 ? SER C 105 ASP C 110 
AB5 2 ASP C 186 ? SER C 191 ? ASP C 186 SER C 191 
AB5 3 VAL C 179 ? TYR C 183 ? VAL C 179 TYR C 183 
AB6 1 PHE C 227 ? TRP C 229 ? PHE C 227 TRP C 229 
AB6 2 TYR C 232 ? LEU C 234 ? TYR C 232 LEU C 234 
AB6 3 TRP C 239 ? VAL C 241 ? TRP C 239 VAL C 241 
AB7 1 LYS C 347 ? TYR C 354 ? LYS C 347 TYR C 354 
AB7 2 TRP C 337 ? GLU C 344 ? TRP C 337 GLU C 344 
AB7 3 ILE C 326 ? LYS C 331 ? ILE C 326 LYS C 331 
AB7 4 LYS C 388 ? LEU C 391 ? LYS C 388 LEU C 391 
AB7 5 TRP C 414 ? PHE C 416 ? TRP C 414 PHE C 416 
AB8 1 HIS C 361 ? THR C 362 ? HIS C 361 THR C 362 
AB8 2 LYS C 512 ? SER C 513 ? LYS C 512 SER C 513 
AB9 1 GLN C 464 ? THR C 470 ? GLN C 464 THR C 470 
AB9 2 LEU C 452 ? THR C 459 ? LEU C 452 THR C 459 
AB9 3 GLU C 438 ? ALA C 446 ? GLU C 438 ALA C 446 
AB9 4 GLU C 492 ? THR C 497 ? GLU C 492 THR C 497 
AB9 5 LYS C 530 ? TRP C 535 ? LYS C 530 TRP C 535 
AC1 1 ILE E 63  ? ILE E 66  ? ILE D 47  ILE D 50  
AC1 2 ILE E 158 ? TYR E 162 ? ILE D 142 TYR D 146 
AC1 3 PHE E 146 ? ILE E 148 ? PHE D 130 ILE D 132 
AC2 1 VAL E 76  ? LYS E 80  ? VAL D 60  LYS D 64  
AC2 2 TRP E 87  ? VAL E 91  ? TRP D 71  VAL D 75  
AC3 1 VAL E 195 ? TYR E 199 ? VAL D 179 TYR D 183 
AC3 2 ASP E 202 ? SER E 207 ? ASP D 186 SER D 191 
AC3 3 SER E 121 ? ASP E 126 ? SER D 105 ASP D 110 
AC3 4 TYR E 248 ? LEU E 250 ? TYR D 232 LEU D 234 
AC4 1 LYS E 363 ? ALA E 371 ? LYS D 347 ALA D 355 
AC4 2 GLN E 352 ? GLU E 360 ? GLN D 336 GLU D 344 
AC4 3 ILE E 342 ? GLY E 349 ? ILE D 326 GLY D 333 
AC4 4 LYS E 404 ? PRO E 408 ? LYS D 388 PRO D 392 
AC4 5 TRP E 430 ? VAL E 433 ? TRP D 414 VAL D 417 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 48  ? N SER A 48  O GLN A 145 ? O GLN A 145 
AA1 2 3 O TYR A 144 ? O TYR A 144 N PHE A 130 ? N PHE A 130 
AA2 1 2 N PHE A 61  ? N PHE A 61  O LEU A 74  ? O LEU A 74  
AA3 1 2 N THR A 107 ? N THR A 107 O VAL A 189 ? O VAL A 189 
AA3 2 3 O ASP A 186 ? O ASP A 186 N TYR A 183 ? N TYR A 183 
AA4 1 2 N PHE A 227 ? N PHE A 227 O LEU A 234 ? O LEU A 234 
AA4 2 3 N GLU A 233 ? N GLU A 233 O THR A 240 ? O THR A 240 
AA5 1 2 O LYS A 350 ? O LYS A 350 N ILE A 341 ? N ILE A 341 
AA5 2 3 O TYR A 342 ? O TYR A 342 N ILE A 326 ? N ILE A 326 
AA5 3 4 N ALA A 327 ? N ALA A 327 O LYS A 388 ? O LYS A 388 
AA5 4 5 N LEU A 391 ? N LEU A 391 O GLU A 415 ? O GLU A 415 
AA6 1 2 N THR A 362 ? N THR A 362 O LYS A 512 ? O LYS A 512 
AA7 1 2 O LEU A 469 ? O LEU A 469 N GLY A 453 ? N GLY A 453 
AA7 2 3 O VAL A 458 ? O VAL A 458 N TYR A 441 ? N TYR A 441 
AA7 3 4 N PHE A 440 ? N PHE A 440 O ASN A 494 ? O ASN A 494 
AA7 4 5 N ILE A 495 ? N ILE A 495 O TYR A 532 ? O TYR A 532 
AA8 1 2 N SER B 64  ? N SER B 48  O GLN B 161 ? O GLN B 145 
AA8 2 3 O ILE B 158 ? O ILE B 142 N ILE B 148 ? N ILE B 132 
AA9 1 2 N PHE B 77  ? N PHE B 61  O LEU B 90  ? O LEU B 74  
AB1 1 2 N TYR B 197 ? N TYR B 181 O TYR B 204 ? O TYR B 188 
AB1 2 3 O VAL B 205 ? O VAL B 189 N THR B 123 ? N THR B 107 
AB1 3 4 N VAL B 122 ? N VAL B 106 O LEU B 250 ? O LEU B 234 
AB2 1 2 O TYR B 370 ? O TYR B 354 N TRP B 353 ? N TRP B 337 
AB2 2 3 O TYR B 358 ? O TYR B 342 N ILE B 342 ? N ILE B 326 
AB2 3 4 N ALA B 343 ? N ALA B 327 O LYS B 406 ? O LYS B 390 
AB2 4 5 N LEU B 407 ? N LEU B 391 O GLU B 431 ? O GLU B 415 
AB3 1 2 N SER C 48  ? N SER C 48  O GLN C 145 ? O GLN C 145 
AB4 1 2 N PHE C 61  ? N PHE C 61  O LEU C 74  ? O LEU C 74  
AB5 1 2 N THR C 107 ? N THR C 107 O VAL C 189 ? O VAL C 189 
AB5 2 3 O ASP C 186 ? O ASP C 186 N TYR C 183 ? N TYR C 183 
AB6 1 2 N PHE C 227 ? N PHE C 227 O LEU C 234 ? O LEU C 234 
AB6 2 3 N GLU C 233 ? N GLU C 233 O THR C 240 ? O THR C 240 
AB7 1 2 O LYS C 350 ? O LYS C 350 N ILE C 341 ? N ILE C 341 
AB7 2 3 O TYR C 342 ? O TYR C 342 N ILE C 326 ? N ILE C 326 
AB7 3 4 N ALA C 327 ? N ALA C 327 O LYS C 388 ? O LYS C 388 
AB7 4 5 N LEU C 391 ? N LEU C 391 O GLU C 415 ? O GLU C 415 
AB8 1 2 N THR C 362 ? N THR C 362 O LYS C 512 ? O LYS C 512 
AB9 1 2 O VAL C 467 ? O VAL C 467 N ALA C 455 ? N ALA C 455 
AB9 2 3 O VAL C 458 ? O VAL C 458 N TYR C 441 ? N TYR C 441 
AB9 3 4 N PHE C 440 ? N PHE C 440 O ASN C 494 ? O ASN C 494 
AB9 4 5 N ILE C 495 ? N ILE C 495 O TYR C 532 ? O TYR C 532 
AC1 1 2 N ILE E 66  ? N ILE D 50  O ARG E 159 ? O ARG D 143 
AC1 2 3 O ILE E 158 ? O ILE D 142 N ILE E 148 ? N ILE D 132 
AC2 1 2 N ILE E 79  ? N ILE D 63  O ARG E 88  ? O ARG D 72  
AC3 1 2 N TYR E 197 ? N TYR D 181 O TYR E 204 ? O TYR D 188 
AC3 2 3 O VAL E 205 ? O VAL D 189 N THR E 123 ? N THR D 107 
AC3 3 4 N VAL E 122 ? N VAL D 106 O LEU E 250 ? O LEU D 234 
AC4 1 2 O TYR E 370 ? O TYR D 354 N TRP E 353 ? N TRP D 337 
AC4 2 3 O GLN E 352 ? O GLN D 336 N GLN E 348 ? N GLN D 332 
AC4 3 4 N ALA E 343 ? N ALA D 327 O LYS E 406 ? O LYS D 390 
AC4 4 5 N LEU E 407 ? N LEU D 391 O GLU E 431 ? O GLU D 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601  ? 3  'binding site for residue MG A 601'                    
AC2 Software A PPF 602  ? 10 'binding site for residue PPF A 602'                   
AC3 Software A MG  603  ? 6  'binding site for residue MG A 603'                    
AC4 Software A MG  604  ? 6  'binding site for residue MG A 604'                    
AC5 Software A MG  605  ? 2  'binding site for residue MG A 605'                    
AC6 Software A SO4 606  ? 2  'binding site for residue SO4 A 606'                   
AC7 Software B SUC 2001 ? 8  'binding site for residue SUC B 2001'                  
AC8 Software B GOL 2002 ? 5  'binding site for residue GOL B 2002'                  
AC9 Software B GOL 2003 ? 3  'binding site for residue GOL B 2003'                  
AD1 Software C PPF 601  ? 8  'binding site for residue PPF C 601'                   
AD2 Software C MG  602  ? 4  'binding site for residue MG C 602'                    
AD3 Software C MG  603  ? 6  'binding site for residue MG C 603'                    
AD4 Software C MG  604  ? 6  'binding site for residue MG C 604'                    
AD5 Software C SO4 605  ? 3  'binding site for residue SO4 C 605'                   
AD6 Software C MG  606  ? 3  'binding site for residue MG C 606'                    
AD7 Software D SUC 501  ? 9  'binding site for residue SUC D 501'                   
AD8 Software E DC  1    ? 11 'binding site for Di-nucleotide DC E 1 and OMC E 2'    
AD9 Software E OMC 2    ? 11 'binding site for Di-nucleotide OMC E 2 and DC E 3'    
AE1 Software E DC  3    ? 9  'binding site for Di-nucleotide DC E 3 and OMC E 4'    
AE2 Software E OMC 4    ? 8  'binding site for Di-nucleotide OMC E 4 and DC E 5'    
AE3 Software E ATM 101  ? 14 'binding site for Di-nucleotide ATM E 101 and DG E 33' 
AE4 Software F DC  1    ? 11 'binding site for Di-nucleotide DC F 1 and OMC F 2'    
AE5 Software F OMC 2    ? 11 'binding site for Di-nucleotide OMC F 2 and DC F 3'    
AE6 Software F DC  3    ? 10 'binding site for Di-nucleotide DC F 3 and OMC F 4'    
AE7 Software F OMC 4    ? 8  'binding site for Di-nucleotide OMC F 4 and DC F 5'    
AE8 Software F ATM 101  ? 16 'binding site for Di-nucleotide ATM F 101 and DG F 33' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3  ASP A 443 ? ASP A 443 . ? 1_555 ? 
2   AC1 3  ASP A 549 ? ASP A 549 . ? 1_555 ? 
3   AC1 3  HOH Y .   ? HOH A 701 . ? 1_555 ? 
4   AC2 10 LYS A 65  ? LYS A 65  . ? 1_555 ? 
5   AC2 10 ARG A 72  ? ARG A 72  . ? 1_555 ? 
6   AC2 10 ASP A 110 ? ASP A 110 . ? 1_555 ? 
7   AC2 10 VAL A 111 ? VAL A 111 . ? 1_555 ? 
8   AC2 10 GLY A 112 ? GLY A 112 . ? 1_555 ? 
9   AC2 10 ASP A 113 ? ASP A 113 . ? 1_555 ? 
10  AC2 10 ALA A 114 ? ALA A 114 . ? 1_555 ? 
11  AC2 10 ASP A 185 ? ASP A 185 . ? 1_555 ? 
12  AC2 10 MG  J .   ? MG  A 604 . ? 1_555 ? 
13  AC2 10 ATM V .   ? ATM F 101 . ? 1_555 ? 
14  AC3 6  ASP A 110 ? ASP A 110 . ? 1_555 ? 
15  AC3 6  ASP A 185 ? ASP A 185 . ? 1_555 ? 
16  AC3 6  ASP A 186 ? ASP A 186 . ? 1_555 ? 
17  AC3 6  MG  J .   ? MG  A 604 . ? 1_555 ? 
18  AC3 6  DG  D 38  ? DG  F 33  . ? 1_555 ? 
19  AC3 6  ATM V .   ? ATM F 101 . ? 1_555 ? 
20  AC4 6  ASP A 110 ? ASP A 110 . ? 1_555 ? 
21  AC4 6  VAL A 111 ? VAL A 111 . ? 1_555 ? 
22  AC4 6  ASP A 185 ? ASP A 185 . ? 1_555 ? 
23  AC4 6  PPF H .   ? PPF A 602 . ? 1_555 ? 
24  AC4 6  MG  I .   ? MG  A 603 . ? 1_555 ? 
25  AC4 6  ATM V .   ? ATM F 101 . ? 1_555 ? 
26  AC5 2  ASP A 443 ? ASP A 443 . ? 1_555 ? 
27  AC5 2  ASP A 498 ? ASP A 498 . ? 1_555 ? 
28  AC6 2  LYS A 331 ? LYS A 331 . ? 1_555 ? 
29  AC6 2  GLN A 334 ? GLN A 334 . ? 1_555 ? 
30  AC7 8  VAL B 37  ? VAL B 21  . ? 1_555 ? 
31  AC7 8  ARG B 94  ? ARG B 78  . ? 1_555 ? 
32  AC7 8  GLU B 95  ? GLU B 79  . ? 1_555 ? 
33  AC7 8  LYS B 98  ? LYS B 82  . ? 1_555 ? 
34  AC7 8  LYS B 411 ? LYS B 395 . ? 1_555 ? 
35  AC7 8  GLU B 415 ? GLU B 399 . ? 1_555 ? 
36  AC7 8  GLU B 429 ? GLU B 413 . ? 1_555 ? 
37  AC7 8  TRP B 430 ? TRP B 414 . ? 1_555 ? 
38  AC8 5  GLY B 332 ? GLY B 316 . ? 1_555 ? 
39  AC8 5  VAL B 333 ? VAL B 317 . ? 1_555 ? 
40  AC8 5  TYR B 334 ? TYR B 318 . ? 1_555 ? 
41  AC8 5  LYS B 339 ? LYS B 323 . ? 1_555 ? 
42  AC8 5  ASN C 418 ? ASN C 418 . ? 1_555 ? 
43  AC9 3  TRP B 40  ? TRP B 24  . ? 1_555 ? 
44  AC9 3  GLU B 415 ? GLU B 399 . ? 1_555 ? 
45  AC9 3  TRP B 418 ? TRP B 402 . ? 1_555 ? 
46  AD1 8  LYS C 65  ? LYS C 65  . ? 1_555 ? 
47  AD1 8  ARG C 72  ? ARG C 72  . ? 1_555 ? 
48  AD1 8  ASP C 110 ? ASP C 110 . ? 1_555 ? 
49  AD1 8  VAL C 111 ? VAL C 111 . ? 1_555 ? 
50  AD1 8  ASP C 113 ? ASP C 113 . ? 1_555 ? 
51  AD1 8  LYS C 220 ? LYS C 220 . ? 1_555 ? 
52  AD1 8  MG  S .   ? MG  C 604 . ? 1_555 ? 
53  AD1 8  ATM X .   ? ATM E 101 . ? 1_555 ? 
54  AD2 4  ASP C 443 ? ASP C 443 . ? 1_555 ? 
55  AD2 4  ASP C 549 ? ASP C 549 . ? 1_555 ? 
56  AD2 4  MG  U .   ? MG  C 606 . ? 1_555 ? 
57  AD2 4  HOH Z .   ? HOH C 701 . ? 1_555 ? 
58  AD3 6  ASP C 110 ? ASP C 110 . ? 1_555 ? 
59  AD3 6  ASP C 185 ? ASP C 185 . ? 1_555 ? 
60  AD3 6  ASP C 186 ? ASP C 186 . ? 1_555 ? 
61  AD3 6  MG  S .   ? MG  C 604 . ? 1_555 ? 
62  AD3 6  DG  F 38  ? DG  E 33  . ? 1_555 ? 
63  AD3 6  ATM X .   ? ATM E 101 . ? 1_555 ? 
64  AD4 6  ASP C 110 ? ASP C 110 . ? 1_555 ? 
65  AD4 6  VAL C 111 ? VAL C 111 . ? 1_555 ? 
66  AD4 6  ASP C 185 ? ASP C 185 . ? 1_555 ? 
67  AD4 6  PPF P .   ? PPF C 601 . ? 1_555 ? 
68  AD4 6  MG  R .   ? MG  C 603 . ? 1_555 ? 
69  AD4 6  ATM X .   ? ATM E 101 . ? 1_555 ? 
70  AD5 3  LYS C 331 ? LYS C 331 . ? 1_555 ? 
71  AD5 3  GLY C 333 ? GLY C 333 . ? 1_555 ? 
72  AD5 3  GLN C 334 ? GLN C 334 . ? 1_555 ? 
73  AD6 3  ASP C 443 ? ASP C 443 . ? 1_555 ? 
74  AD6 3  ASP C 498 ? ASP C 498 . ? 1_555 ? 
75  AD6 3  MG  Q .   ? MG  C 602 . ? 1_555 ? 
76  AD7 9  VAL E 37  ? VAL D 21  . ? 1_555 ? 
77  AD7 9  ARG E 94  ? ARG D 78  . ? 1_555 ? 
78  AD7 9  GLU E 95  ? GLU D 79  . ? 1_555 ? 
79  AD7 9  LYS E 98  ? LYS D 82  . ? 1_555 ? 
80  AD7 9  LYS E 411 ? LYS D 395 . ? 1_555 ? 
81  AD7 9  GLU E 415 ? GLU D 399 . ? 1_555 ? 
82  AD7 9  GLU E 429 ? GLU D 413 . ? 1_555 ? 
83  AD7 9  TRP E 430 ? TRP D 414 . ? 1_555 ? 
84  AD7 9  PHE E 432 ? PHE D 416 . ? 1_555 ? 
85  AD8 11 ARG C 78  ? ARG C 78  . ? 1_555 ? 
86  AD8 11 ASN C 81  ? ASN C 81  . ? 1_555 ? 
87  AD8 11 GLU C 89  ? GLU C 89  . ? 1_555 ? 
88  AD8 11 GLY C 152 ? GLY C 152 . ? 1_555 ? 
89  AD8 11 LYS C 154 ? LYS C 154 . ? 1_555 ? 
90  AD8 11 PRO C 157 ? PRO C 157 . ? 1_555 ? 
91  AD8 11 GLN C 161 ? GLN C 161 . ? 1_555 ? 
92  AD8 11 DA  F 5   ? DA  E 0   . ? 1_555 ? 
93  AD8 11 DC  F 8   ? DC  E 3   . ? 1_555 ? 
94  AD8 11 DG  F 37  ? DG  E 32  . ? 1_555 ? 
95  AD8 11 DG  F 38  ? DG  E 33  . ? 1_555 ? 
96  AD9 11 GLU C 89  ? GLU C 89  . ? 1_555 ? 
97  AD9 11 GLN C 91  ? GLN C 91  . ? 1_555 ? 
98  AD9 11 ILE C 94  ? ILE C 94  . ? 1_555 ? 
99  AD9 11 LYS C 154 ? LYS C 154 . ? 1_555 ? 
100 AD9 11 PRO C 157 ? PRO C 157 . ? 1_555 ? 
101 AD9 11 GLN C 161 ? GLN C 161 . ? 1_555 ? 
102 AD9 11 DC  F 6   ? DC  E 1   . ? 1_555 ? 
103 AD9 11 OMC F 9   ? OMC E 4   . ? 1_555 ? 
104 AD9 11 DG  F 36  ? DG  E 31  . ? 1_555 ? 
105 AD9 11 DG  F 37  ? DG  E 32  . ? 1_555 ? 
106 AD9 11 DG  F 38  ? DG  E 33  . ? 1_555 ? 
107 AE1 9  GLN C 91  ? GLN C 91  . ? 1_555 ? 
108 AE1 9  LEU C 92  ? LEU C 92  . ? 1_555 ? 
109 AE1 9  ILE C 94  ? ILE C 94  . ? 1_555 ? 
110 AE1 9  LYS E 38  ? LYS D 22  . ? 1_555 ? 
111 AE1 9  OMC F 7   ? OMC E 2   . ? 1_555 ? 
112 AE1 9  DC  F 10  ? DC  E 5   . ? 1_555 ? 
113 AE1 9  DG  F 35  ? DG  E 30  . ? 1_555 ? 
114 AE1 9  DG  F 36  ? DG  E 31  . ? 1_555 ? 
115 AE1 9  DG  F 37  ? DG  E 32  . ? 1_555 ? 
116 AE2 8  LEU C 92  ? LEU C 92  . ? 1_555 ? 
117 AE2 8  ILE C 94  ? ILE C 94  . ? 1_555 ? 
118 AE2 8  LYS E 38  ? LYS D 22  . ? 1_555 ? 
119 AE2 8  DC  F 8   ? DC  E 3   . ? 1_555 ? 
120 AE2 8  DC  F 11  ? DC  E 6   . ? 1_555 ? 
121 AE2 8  DG  F 34  ? DG  E 29  . ? 1_555 ? 
122 AE2 8  DG  F 35  ? DG  E 30  . ? 1_555 ? 
123 AE2 8  DG  F 36  ? DG  E 31  . ? 1_555 ? 
124 AE3 14 ASP C 110 ? ASP C 110 . ? 1_555 ? 
125 AE3 14 ASP C 113 ? ASP C 113 . ? 1_555 ? 
126 AE3 14 ALA C 114 ? ALA C 114 . ? 1_555 ? 
127 AE3 14 TYR C 115 ? TYR C 115 . ? 1_555 ? 
128 AE3 14 TYR C 183 ? TYR C 183 . ? 1_555 ? 
129 AE3 14 ASP C 185 ? ASP C 185 . ? 1_555 ? 
130 AE3 14 ASP C 186 ? ASP C 186 . ? 1_555 ? 
131 AE3 14 PPF P .   ? PPF C 601 . ? 1_555 ? 
132 AE3 14 MG  R .   ? MG  C 603 . ? 1_555 ? 
133 AE3 14 MG  S .   ? MG  C 604 . ? 1_555 ? 
134 AE3 14 DA  F 5   ? DA  E 0   . ? 1_555 ? 
135 AE3 14 DC  F 6   ? DC  E 1   . ? 1_555 ? 
136 AE3 14 OMC F 7   ? OMC E 2   . ? 1_555 ? 
137 AE3 14 DG  F 37  ? DG  E 32  . ? 1_555 ? 
138 AE4 11 ARG A 78  ? ARG A 78  . ? 1_555 ? 
139 AE4 11 ASN A 81  ? ASN A 81  . ? 1_555 ? 
140 AE4 11 GLU A 89  ? GLU A 89  . ? 1_555 ? 
141 AE4 11 GLY A 152 ? GLY A 152 . ? 1_555 ? 
142 AE4 11 LYS A 154 ? LYS A 154 . ? 1_555 ? 
143 AE4 11 PRO A 157 ? PRO A 157 . ? 1_555 ? 
144 AE4 11 DA  D 5   ? DA  F 0   . ? 1_555 ? 
145 AE4 11 DC  D 8   ? DC  F 3   . ? 1_555 ? 
146 AE4 11 DG  D 37  ? DG  F 32  . ? 1_555 ? 
147 AE4 11 DG  D 38  ? DG  F 33  . ? 1_555 ? 
148 AE4 11 ATM V .   ? ATM F 101 . ? 1_555 ? 
149 AE5 11 GLU A 89  ? GLU A 89  . ? 1_555 ? 
150 AE5 11 GLN A 91  ? GLN A 91  . ? 1_555 ? 
151 AE5 11 ILE A 94  ? ILE A 94  . ? 1_555 ? 
152 AE5 11 LYS A 154 ? LYS A 154 . ? 1_555 ? 
153 AE5 11 PRO A 157 ? PRO A 157 . ? 1_555 ? 
154 AE5 11 TYR A 183 ? TYR A 183 . ? 1_555 ? 
155 AE5 11 DC  D 6   ? DC  F 1   . ? 1_555 ? 
156 AE5 11 OMC D 9   ? OMC F 4   . ? 1_555 ? 
157 AE5 11 DG  D 36  ? DG  F 31  . ? 1_555 ? 
158 AE5 11 DG  D 37  ? DG  F 32  . ? 1_555 ? 
159 AE5 11 DG  D 38  ? DG  F 33  . ? 1_555 ? 
160 AE6 10 GLN A 91  ? GLN A 91  . ? 1_555 ? 
161 AE6 10 LEU A 92  ? LEU A 92  . ? 1_555 ? 
162 AE6 10 ILE A 94  ? ILE A 94  . ? 1_555 ? 
163 AE6 10 TYR A 183 ? TYR A 183 . ? 1_555 ? 
164 AE6 10 LYS B 38  ? LYS B 22  . ? 1_555 ? 
165 AE6 10 OMC D 7   ? OMC F 2   . ? 1_555 ? 
166 AE6 10 DC  D 10  ? DC  F 5   . ? 1_555 ? 
167 AE6 10 DG  D 35  ? DG  F 30  . ? 1_555 ? 
168 AE6 10 DG  D 36  ? DG  F 31  . ? 1_555 ? 
169 AE6 10 DG  D 37  ? DG  F 32  . ? 1_555 ? 
170 AE7 8  LEU A 92  ? LEU A 92  . ? 1_555 ? 
171 AE7 8  ILE A 94  ? ILE A 94  . ? 1_555 ? 
172 AE7 8  LYS B 38  ? LYS B 22  . ? 1_555 ? 
173 AE7 8  DC  D 8   ? DC  F 3   . ? 1_555 ? 
174 AE7 8  DC  D 11  ? DC  F 6   . ? 1_555 ? 
175 AE7 8  DG  D 34  ? DG  F 29  . ? 1_555 ? 
176 AE7 8  DG  D 35  ? DG  F 30  . ? 1_555 ? 
177 AE7 8  DG  D 36  ? DG  F 31  . ? 1_555 ? 
178 AE8 16 ARG A 72  ? ARG A 72  . ? 1_555 ? 
179 AE8 16 ASP A 110 ? ASP A 110 . ? 1_555 ? 
180 AE8 16 ASP A 113 ? ASP A 113 . ? 1_555 ? 
181 AE8 16 ALA A 114 ? ALA A 114 . ? 1_555 ? 
182 AE8 16 TYR A 115 ? TYR A 115 . ? 1_555 ? 
183 AE8 16 GLN A 151 ? GLN A 151 . ? 1_555 ? 
184 AE8 16 TYR A 183 ? TYR A 183 . ? 1_555 ? 
185 AE8 16 ASP A 185 ? ASP A 185 . ? 1_555 ? 
186 AE8 16 ASP A 186 ? ASP A 186 . ? 1_555 ? 
187 AE8 16 PPF H .   ? PPF A 602 . ? 1_555 ? 
188 AE8 16 MG  I .   ? MG  A 603 . ? 1_555 ? 
189 AE8 16 MG  J .   ? MG  A 604 . ? 1_555 ? 
190 AE8 16 DA  D 5   ? DA  F 0   . ? 1_555 ? 
191 AE8 16 DC  D 6   ? DC  F 1   . ? 1_555 ? 
192 AE8 16 OMC D 7   ? OMC F 2   . ? 1_555 ? 
193 AE8 16 DG  D 37  ? DG  F 32  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5HP1 
_atom_sites.fract_transf_matrix[1][1]   0.011071 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002152 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007748 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  1   ? 25.856  22.656  145.236 1.00 172.57 ? 1    PRO A N     1 
ATOM   2     C  CA    . PRO A 1  1   ? 25.497  21.541  144.351 1.00 179.61 ? 1    PRO A CA    1 
ATOM   3     C  C     . PRO A 1  1   ? 25.030  20.341  145.158 1.00 192.05 ? 1    PRO A C     1 
ATOM   4     O  O     . PRO A 1  1   ? 25.856  19.544  145.605 1.00 191.97 ? 1    PRO A O     1 
ATOM   5     C  CB    . PRO A 1  1   ? 26.808  21.224  143.621 1.00 174.39 ? 1    PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  1   ? 27.725  22.362  143.928 1.00 172.09 ? 1    PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  1   ? 27.295  22.950  145.213 1.00 171.85 ? 1    PRO A CD    1 
ATOM   8     N  N     . ILE A 1  2   ? 23.721  20.222  145.351 1.00 199.87 ? 2    ILE A N     1 
ATOM   9     C  CA    . ILE A 1  2   ? 23.194  19.201  146.247 1.00 194.78 ? 2    ILE A CA    1 
ATOM   10    C  C     . ILE A 1  2   ? 23.210  17.828  145.588 1.00 201.76 ? 2    ILE A C     1 
ATOM   11    O  O     . ILE A 1  2   ? 23.080  17.684  144.366 1.00 200.94 ? 2    ILE A O     1 
ATOM   12    C  CB    . ILE A 1  2   ? 21.768  19.578  146.702 1.00 191.80 ? 2    ILE A CB    1 
ATOM   13    C  CG1   . ILE A 1  2   ? 20.750  19.293  145.594 1.00 194.44 ? 2    ILE A CG1   1 
ATOM   14    C  CG2   . ILE A 1  2   ? 21.708  21.040  147.111 1.00 191.69 ? 2    ILE A CG2   1 
ATOM   15    C  CD1   . ILE A 1  2   ? 19.309  19.325  146.058 1.00 189.63 ? 2    ILE A CD1   1 
ATOM   16    N  N     . SER A 1  3   ? 23.413  16.812  146.417 1.00 213.75 ? 3    SER A N     1 
ATOM   17    C  CA    . SER A 1  3   ? 23.189  15.400  146.136 1.00 211.29 ? 3    SER A CA    1 
ATOM   18    C  C     . SER A 1  3   ? 21.702  15.162  146.353 1.00 207.58 ? 3    SER A C     1 
ATOM   19    O  O     . SER A 1  3   ? 21.226  15.280  147.490 1.00 202.86 ? 3    SER A O     1 
ATOM   20    C  CB    . SER A 1  3   ? 24.034  14.471  146.999 1.00 206.17 ? 3    SER A CB    1 
ATOM   21    O  OG    . SER A 1  3   ? 25.419  14.703  146.802 1.00 205.13 ? 3    SER A OG    1 
ATOM   22    N  N     . PRO A 1  4   ? 20.932  14.833  145.326 1.00 182.78 ? 4    PRO A N     1 
ATOM   23    C  CA    . PRO A 1  4   ? 19.478  14.877  145.468 1.00 157.39 ? 4    PRO A CA    1 
ATOM   24    C  C     . PRO A 1  4   ? 18.967  13.657  146.214 1.00 140.09 ? 4    PRO A C     1 
ATOM   25    O  O     . PRO A 1  4   ? 19.527  12.561  146.144 1.00 141.18 ? 4    PRO A O     1 
ATOM   26    C  CB    . PRO A 1  4   ? 18.991  14.890  144.016 1.00 158.67 ? 4    PRO A CB    1 
ATOM   27    C  CG    . PRO A 1  4   ? 20.025  14.081  143.289 1.00 160.97 ? 4    PRO A CG    1 
ATOM   28    C  CD    . PRO A 1  4   ? 21.342  14.263  144.030 1.00 174.74 ? 4    PRO A CD    1 
ATOM   29    N  N     . ILE A 1  5   ? 17.883  13.884  146.950 1.00 139.11 ? 5    ILE A N     1 
ATOM   30    C  CA    . ILE A 1  5   ? 17.280  12.847  147.778 1.00 128.75 ? 5    ILE A CA    1 
ATOM   31    C  C     . ILE A 1  5   ? 16.588  11.830  146.884 1.00 121.13 ? 5    ILE A C     1 
ATOM   32    O  O     . ILE A 1  5   ? 15.689  12.168  146.107 1.00 118.91 ? 5    ILE A O     1 
ATOM   33    C  CB    . ILE A 1  5   ? 16.292  13.459  148.778 1.00 114.60 ? 5    ILE A CB    1 
ATOM   34    C  CG1   . ILE A 1  5   ? 16.973  14.562  149.591 1.00 117.76 ? 5    ILE A CG1   1 
ATOM   35    C  CG2   . ILE A 1  5   ? 15.736  12.384  149.700 1.00 108.33 ? 5    ILE A CG2   1 
ATOM   36    C  CD1   . ILE A 1  5   ? 16.010  15.391  150.409 1.00 108.91 ? 5    ILE A CD1   1 
ATOM   37    N  N     . GLU A 1  6   ? 17.039  10.581  146.971 1.00 111.16 ? 6    GLU A N     1 
ATOM   38    C  CA    . GLU A 1  6   ? 16.441  9.495   146.214 1.00 114.48 ? 6    GLU A CA    1 
ATOM   39    C  C     . GLU A 1  6   ? 14.945  9.412   146.485 1.00 118.18 ? 6    GLU A C     1 
ATOM   40    O  O     . GLU A 1  6   ? 14.473  9.677   147.594 1.00 118.19 ? 6    GLU A O     1 
ATOM   41    C  CB    . GLU A 1  6   ? 17.105  8.172   146.593 1.00 110.16 ? 6    GLU A CB    1 
ATOM   42    C  CG    . GLU A 1  6   ? 18.617  8.191   146.507 1.00 121.48 ? 6    GLU A CG    1 
ATOM   43    C  CD    . GLU A 1  6   ? 19.250  7.037   147.259 1.00 132.63 ? 6    GLU A CD    1 
ATOM   44    O  OE1   . GLU A 1  6   ? 19.462  7.171   148.484 1.00 124.23 ? 6    GLU A OE1   1 
ATOM   45    O  OE2   . GLU A 1  6   ? 19.533  5.996   146.628 1.00 138.29 ? 6    GLU A OE2   1 
ATOM   46    N  N     . THR A 1  7   ? 14.200  9.033   145.454 1.00 115.59 ? 7    THR A N     1 
ATOM   47    C  CA    . THR A 1  7   ? 12.751  9.071   145.504 1.00 116.45 ? 7    THR A CA    1 
ATOM   48    C  C     . THR A 1  7   ? 12.243  7.861   146.279 1.00 111.29 ? 7    THR A C     1 
ATOM   49    O  O     . THR A 1  7   ? 12.973  6.896   146.520 1.00 111.72 ? 7    THR A O     1 
ATOM   50    C  CB    . THR A 1  7   ? 12.155  9.095   144.095 1.00 120.16 ? 7    THR A CB    1 
ATOM   51    O  OG1   . THR A 1  7   ? 12.633  7.966   143.353 1.00 127.64 ? 7    THR A OG1   1 
ATOM   52    C  CG2   . THR A 1  7   ? 12.548  10.376  143.371 1.00 120.58 ? 7    THR A CG2   1 
ATOM   53    N  N     . VAL A 1  8   ? 10.984  7.920   146.683 1.00 109.13 ? 8    VAL A N     1 
ATOM   54    C  CA    . VAL A 1  8   ? 10.353  6.799   147.370 1.00 106.36 ? 8    VAL A CA    1 
ATOM   55    C  C     . VAL A 1  8   ? 9.289   6.219   146.446 1.00 103.51 ? 8    VAL A C     1 
ATOM   56    O  O     . VAL A 1  8   ? 8.325   6.916   146.099 1.00 102.95 ? 8    VAL A O     1 
ATOM   57    C  CB    . VAL A 1  8   ? 9.745   7.228   148.716 1.00 103.58 ? 8    VAL A CB    1 
ATOM   58    C  CG1   . VAL A 1  8   ? 8.682   6.236   149.168 1.00 100.19 ? 8    VAL A CG1   1 
ATOM   59    C  CG2   . VAL A 1  8   ? 10.835  7.367   149.767 1.00 102.89 ? 8    VAL A CG2   1 
ATOM   60    N  N     . PRO A 1  9   ? 9.449   4.978   145.991 1.00 108.47 ? 9    PRO A N     1 
ATOM   61    C  CA    . PRO A 1  9   ? 8.482   4.373   145.059 1.00 105.26 ? 9    PRO A CA    1 
ATOM   62    C  C     . PRO A 1  9   ? 7.088   4.305   145.662 1.00 107.60 ? 9    PRO A C     1 
ATOM   63    O  O     . PRO A 1  9   ? 6.862   3.626   146.667 1.00 106.26 ? 9    PRO A O     1 
ATOM   64    C  CB    . PRO A 1  9   ? 9.054   2.972   144.809 1.00 99.55  ? 9    PRO A CB    1 
ATOM   65    C  CG    . PRO A 1  9   ? 10.053  2.737   145.901 1.00 98.59  ? 9    PRO A CG    1 
ATOM   66    C  CD    . PRO A 1  9   ? 10.555  4.070   146.336 1.00 95.38  ? 9    PRO A CD    1 
ATOM   67    N  N     . VAL A 1  10  ? 6.143   5.008   145.043 1.00 104.10 ? 10   VAL A N     1 
ATOM   68    C  CA    . VAL A 1  10  ? 4.786   5.090   145.566 1.00 103.49 ? 10   VAL A CA    1 
ATOM   69    C  C     . VAL A 1  10  ? 3.820   4.735   144.444 1.00 113.62 ? 10   VAL A C     1 
ATOM   70    O  O     . VAL A 1  10  ? 3.936   5.257   143.330 1.00 121.58 ? 10   VAL A O     1 
ATOM   71    C  CB    . VAL A 1  10  ? 4.477   6.493   146.124 1.00 99.49  ? 10   VAL A CB    1 
ATOM   72    C  CG1   . VAL A 1  10  ? 3.004   6.622   146.459 1.00 104.91 ? 10   VAL A CG1   1 
ATOM   73    C  CG2   . VAL A 1  10  ? 5.330   6.778   147.348 1.00 103.73 ? 10   VAL A CG2   1 
ATOM   74    N  N     . LYS A 1  11  ? 2.869   3.856   144.744 1.00 107.44 ? 11   LYS A N     1 
ATOM   75    C  CA    . LYS A 1  11  ? 1.886   3.363   143.791 1.00 106.34 ? 11   LYS A CA    1 
ATOM   76    C  C     . LYS A 1  11  ? 0.484   3.769   144.223 1.00 108.32 ? 11   LYS A C     1 
ATOM   77    O  O     . LYS A 1  11  ? 0.258   4.217   145.350 1.00 112.62 ? 11   LYS A O     1 
ATOM   78    C  CB    . LYS A 1  11  ? 1.969   1.837   143.643 1.00 111.45 ? 11   LYS A CB    1 
ATOM   79    C  CG    . LYS A 1  11  ? 3.381   1.280   143.586 1.00 114.74 ? 11   LYS A CG    1 
ATOM   80    C  CD    . LYS A 1  11  ? 3.362   -0.214  143.292 1.00 119.11 ? 11   LYS A CD    1 
ATOM   81    C  CE    . LYS A 1  11  ? 3.690   -0.488  141.830 1.00 125.64 ? 11   LYS A CE    1 
ATOM   82    N  NZ    . LYS A 1  11  ? 3.682   -1.943  141.505 1.00 126.59 ? 11   LYS A NZ    1 
ATOM   83    N  N     . LEU A 1  12  ? -0.465  3.602   143.310 1.00 110.37 ? 12   LEU A N     1 
ATOM   84    C  CA    . LEU A 1  12  ? -1.868  3.748   143.656 1.00 110.12 ? 12   LEU A CA    1 
ATOM   85    C  C     . LEU A 1  12  ? -2.430  2.386   144.046 1.00 114.25 ? 12   LEU A C     1 
ATOM   86    O  O     . LEU A 1  12  ? -1.848  1.342   143.743 1.00 121.82 ? 12   LEU A O     1 
ATOM   87    C  CB    . LEU A 1  12  ? -2.665  4.331   142.490 1.00 115.35 ? 12   LEU A CB    1 
ATOM   88    C  CG    . LEU A 1  12  ? -2.408  5.798   142.157 1.00 121.50 ? 12   LEU A CG    1 
ATOM   89    C  CD1   . LEU A 1  12  ? -3.050  6.161   140.829 1.00 126.05 ? 12   LEU A CD1   1 
ATOM   90    C  CD2   . LEU A 1  12  ? -2.932  6.685   143.272 1.00 120.45 ? 12   LEU A CD2   1 
ATOM   91    N  N     . LYS A 1  13  ? -3.561  2.405   144.741 1.00 112.06 ? 13   LYS A N     1 
ATOM   92    C  CA    . LYS A 1  13  ? -4.227  1.155   145.081 1.00 112.27 ? 13   LYS A CA    1 
ATOM   93    C  C     . LYS A 1  13  ? -4.576  0.379   143.813 1.00 115.43 ? 13   LYS A C     1 
ATOM   94    O  O     . LYS A 1  13  ? -5.150  0.955   142.878 1.00 116.47 ? 13   LYS A O     1 
ATOM   95    C  CB    . LYS A 1  13  ? -5.471  1.404   145.932 1.00 111.83 ? 13   LYS A CB    1 
ATOM   96    C  CG    . LYS A 1  13  ? -5.129  1.843   147.352 1.00 112.11 ? 13   LYS A CG    1 
ATOM   97    C  CD    . LYS A 1  13  ? -6.344  1.866   148.264 1.00 115.40 ? 13   LYS A CD    1 
ATOM   98    C  CE    . LYS A 1  13  ? -5.938  2.187   149.697 1.00 105.77 ? 13   LYS A CE    1 
ATOM   99    N  NZ    . LYS A 1  13  ? -7.077  2.076   150.650 1.00 108.28 ? 13   LYS A NZ    1 
ATOM   100   N  N     . PRO A 1  14  ? -4.215  -0.917  143.736 1.00 114.71 ? 14   PRO A N     1 
ATOM   101   C  CA    . PRO A 1  14  ? -4.467  -1.737  142.540 1.00 120.39 ? 14   PRO A CA    1 
ATOM   102   C  C     . PRO A 1  14  ? -5.767  -1.473  141.792 1.00 115.94 ? 14   PRO A C     1 
ATOM   103   O  O     . PRO A 1  14  ? -6.855  -1.512  142.374 1.00 114.50 ? 14   PRO A O     1 
ATOM   104   C  CB    . PRO A 1  14  ? -4.457  -3.159  143.112 1.00 117.02 ? 14   PRO A CB    1 
ATOM   105   C  CG    . PRO A 1  14  ? -3.514  -3.084  144.305 1.00 111.87 ? 14   PRO A CG    1 
ATOM   106   C  CD    . PRO A 1  14  ? -3.339  -1.622  144.686 1.00 111.13 ? 14   PRO A CD    1 
ATOM   107   N  N     . GLY A 1  15  ? -5.650  -1.195  140.496 1.00 117.68 ? 15   GLY A N     1 
ATOM   108   C  CA    . GLY A 1  15  ? -6.814  -0.974  139.659 1.00 123.40 ? 15   GLY A CA    1 
ATOM   109   C  C     . GLY A 1  15  ? -7.618  0.268   139.965 1.00 113.25 ? 15   GLY A C     1 
ATOM   110   O  O     . GLY A 1  15  ? -8.820  0.302   139.683 1.00 104.44 ? 15   GLY A O     1 
ATOM   111   N  N     . MET A 1  16  ? -6.994  1.292   140.534 1.00 110.63 ? 16   MET A N     1 
ATOM   112   C  CA    . MET A 1  16  ? -7.620  2.595   140.683 1.00 111.19 ? 16   MET A CA    1 
ATOM   113   C  C     . MET A 1  16  ? -6.782  3.638   139.960 1.00 115.14 ? 16   MET A C     1 
ATOM   114   O  O     . MET A 1  16  ? -5.569  3.477   139.794 1.00 118.86 ? 16   MET A O     1 
ATOM   115   C  CB    . MET A 1  16  ? -7.791  2.975   142.156 1.00 112.55 ? 16   MET A CB    1 
ATOM   116   C  CG    . MET A 1  16  ? -8.547  1.940   142.967 1.00 110.48 ? 16   MET A CG    1 
ATOM   117   S  SD    . MET A 1  16  ? -9.101  2.585   144.556 1.00 153.44 ? 16   MET A SD    1 
ATOM   118   C  CE    . MET A 1  16  ? -9.076  1.102   145.562 1.00 124.84 ? 16   MET A CE    1 
ATOM   119   N  N     . ASP A 1  17  ? -7.438  4.711   139.533 1.00 118.57 ? 17   ASP A N     1 
ATOM   120   C  CA    . ASP A 1  17  ? -6.814  5.719   138.692 1.00 129.69 ? 17   ASP A CA    1 
ATOM   121   C  C     . ASP A 1  17  ? -6.817  7.052   139.431 1.00 129.17 ? 17   ASP A C     1 
ATOM   122   O  O     . ASP A 1  17  ? -7.493  7.221   140.450 1.00 128.58 ? 17   ASP A O     1 
ATOM   123   C  CB    . ASP A 1  17  ? -7.539  5.825   137.341 1.00 129.11 ? 17   ASP A CB    1 
ATOM   124   C  CG    . ASP A 1  17  ? -6.767  6.641   136.319 1.00 129.16 ? 17   ASP A CG    1 
ATOM   125   O  OD1   . ASP A 1  17  ? -5.562  6.887   136.538 1.00 128.75 ? 17   ASP A OD1   1 
ATOM   126   O  OD2   . ASP A 1  17  ? -7.365  7.030   135.293 1.00 129.59 ? 17   ASP A OD2   1 
ATOM   127   N  N     . GLY A 1  18  ? -6.044  8.003   138.909 1.00 138.77 ? 18   GLY A N     1 
ATOM   128   C  CA    . GLY A 1  18  ? -5.854  9.282   139.551 1.00 138.68 ? 18   GLY A CA    1 
ATOM   129   C  C     . GLY A 1  18  ? -7.112  10.096  139.791 1.00 143.12 ? 18   GLY A C     1 
ATOM   130   O  O     . GLY A 1  18  ? -8.213  9.757   139.344 1.00 141.17 ? 18   GLY A O     1 
ATOM   131   N  N     . PRO A 1  19  ? -6.953  11.205  140.511 1.00 137.74 ? 19   PRO A N     1 
ATOM   132   C  CA    . PRO A 1  19  ? -8.098  12.061  140.846 1.00 136.76 ? 19   PRO A CA    1 
ATOM   133   C  C     . PRO A 1  19  ? -8.556  12.909  139.669 1.00 146.70 ? 19   PRO A C     1 
ATOM   134   O  O     . PRO A 1  19  ? -7.749  13.393  138.871 1.00 153.00 ? 19   PRO A O     1 
ATOM   135   C  CB    . PRO A 1  19  ? -7.556  12.936  141.981 1.00 136.79 ? 19   PRO A CB    1 
ATOM   136   C  CG    . PRO A 1  19  ? -6.087  13.000  141.719 1.00 139.36 ? 19   PRO A CG    1 
ATOM   137   C  CD    . PRO A 1  19  ? -5.693  11.698  141.092 1.00 137.16 ? 19   PRO A CD    1 
ATOM   138   N  N     . LYS A 1  20  ? -9.883  13.086  139.565 1.00 147.55 ? 20   LYS A N     1 
ATOM   139   C  CA    . LYS A 1  20  ? -10.505 13.985  138.582 1.00 147.73 ? 20   LYS A CA    1 
ATOM   140   C  C     . LYS A 1  20  ? -11.611 14.766  139.304 1.00 153.80 ? 20   LYS A C     1 
ATOM   141   O  O     . LYS A 1  20  ? -12.803 14.495  139.138 1.00 153.83 ? 20   LYS A O     1 
ATOM   142   C  CB    . LYS A 1  20  ? -11.036 13.209  137.377 1.00 146.32 ? 20   LYS A CB    1 
ATOM   143   C  CG    . LYS A 1  20  ? -9.938  12.615  136.500 1.00 145.46 ? 20   LYS A CG    1 
ATOM   144   C  CD    . LYS A 1  20  ? -10.450 11.462  135.648 1.00 147.67 ? 20   LYS A CD    1 
ATOM   145   C  CE    . LYS A 1  20  ? -9.320  10.829  134.845 1.00 144.83 ? 20   LYS A CE    1 
ATOM   146   N  NZ    . LYS A 1  20  ? -9.735  9.560   134.184 1.00 145.97 ? 20   LYS A NZ    1 
ATOM   147   N  N     . VAL A 1  21  ? -11.206 15.745  140.113 1.00 154.50 ? 21   VAL A N     1 
ATOM   148   C  CA    . VAL A 1  21  ? -12.121 16.603  140.867 1.00 158.95 ? 21   VAL A CA    1 
ATOM   149   C  C     . VAL A 1  21  ? -11.825 18.061  140.532 1.00 160.73 ? 21   VAL A C     1 
ATOM   150   O  O     . VAL A 1  21  ? -10.731 18.560  140.827 1.00 158.11 ? 21   VAL A O     1 
ATOM   151   C  CB    . VAL A 1  21  ? -12.009 16.364  142.381 1.00 153.15 ? 21   VAL A CB    1 
ATOM   152   C  CG1   . VAL A 1  21  ? -13.018 17.223  143.129 1.00 147.17 ? 21   VAL A CG1   1 
ATOM   153   C  CG2   . VAL A 1  21  ? -12.206 14.890  142.707 1.00 148.39 ? 21   VAL A CG2   1 
ATOM   154   N  N     . LYS A 1  22  ? -12.789 18.739  139.906 1.00 164.04 ? 22   LYS A N     1 
ATOM   155   C  CA    . LYS A 1  22  ? -12.551 20.077  139.381 1.00 156.71 ? 22   LYS A CA    1 
ATOM   156   C  C     . LYS A 1  22  ? -12.623 21.141  140.477 1.00 154.82 ? 22   LYS A C     1 
ATOM   157   O  O     . LYS A 1  22  ? -13.367 21.022  141.455 1.00 150.03 ? 22   LYS A O     1 
ATOM   158   C  CB    . LYS A 1  22  ? -13.551 20.401  138.269 1.00 147.28 ? 22   LYS A CB    1 
ATOM   159   C  CG    . LYS A 1  22  ? -13.122 19.898  136.896 1.00 146.58 ? 22   LYS A CG    1 
ATOM   160   C  CD    . LYS A 1  22  ? -11.788 20.499  136.475 1.00 148.81 ? 22   LYS A CD    1 
ATOM   161   C  CE    . LYS A 1  22  ? -11.251 19.837  135.214 1.00 139.90 ? 22   LYS A CE    1 
ATOM   162   N  NZ    . LYS A 1  22  ? -9.877  20.307  134.880 1.00 144.56 ? 22   LYS A NZ    1 
ATOM   163   N  N     . GLN A 1  23  ? -11.819 22.187  140.287 1.00 156.23 ? 23   GLN A N     1 
ATOM   164   C  CA    . GLN A 1  23  ? -11.642 23.274  141.248 1.00 155.50 ? 23   GLN A CA    1 
ATOM   165   C  C     . GLN A 1  23  ? -12.953 23.977  141.614 1.00 160.07 ? 23   GLN A C     1 
ATOM   166   O  O     . GLN A 1  23  ? -13.686 24.433  140.732 1.00 157.21 ? 23   GLN A O     1 
ATOM   167   C  CB    . GLN A 1  23  ? -10.667 24.295  140.657 1.00 150.59 ? 23   GLN A CB    1 
ATOM   168   C  CG    . GLN A 1  23  ? -10.253 25.390  141.609 1.00 152.55 ? 23   GLN A CG    1 
ATOM   169   C  CD    . GLN A 1  23  ? -9.401  24.841  142.731 1.00 156.01 ? 23   GLN A CD    1 
ATOM   170   O  OE1   . GLN A 1  23  ? -8.485  24.056  142.490 1.00 158.79 ? 23   GLN A OE1   1 
ATOM   171   N  NE2   . GLN A 1  23  ? -9.709  25.221  143.961 1.00 157.57 ? 23   GLN A NE2   1 
ATOM   172   N  N     . TRP A 1  24  ? -13.255 24.065  142.916 1.00 168.77 ? 24   TRP A N     1 
ATOM   173   C  CA    . TRP A 1  24  ? -14.418 24.832  143.364 1.00 171.96 ? 24   TRP A CA    1 
ATOM   174   C  C     . TRP A 1  24  ? -14.123 26.321  143.190 1.00 174.09 ? 24   TRP A C     1 
ATOM   175   O  O     . TRP A 1  24  ? -12.963 26.707  143.064 1.00 171.76 ? 24   TRP A O     1 
ATOM   176   C  CB    . TRP A 1  24  ? -14.740 24.581  144.836 1.00 172.48 ? 24   TRP A CB    1 
ATOM   177   C  CG    . TRP A 1  24  ? -13.941 23.532  145.514 1.00 172.92 ? 24   TRP A CG    1 
ATOM   178   C  CD1   . TRP A 1  24  ? -13.895 22.203  145.217 1.00 173.25 ? 24   TRP A CD1   1 
ATOM   179   C  CD2   . TRP A 1  24  ? -13.020 23.738  146.589 1.00 174.95 ? 24   TRP A CD2   1 
ATOM   180   N  NE1   . TRP A 1  24  ? -13.029 21.562  146.068 1.00 174.07 ? 24   TRP A NE1   1 
ATOM   181   C  CE2   . TRP A 1  24  ? -12.471 22.485  146.914 1.00 173.46 ? 24   TRP A CE2   1 
ATOM   182   C  CE3   . TRP A 1  24  ? -12.614 24.863  147.315 1.00 173.97 ? 24   TRP A CE3   1 
ATOM   183   C  CZ2   . TRP A 1  24  ? -11.534 22.323  147.931 1.00 167.91 ? 24   TRP A CZ2   1 
ATOM   184   C  CZ3   . TRP A 1  24  ? -11.687 24.700  148.326 1.00 173.14 ? 24   TRP A CZ3   1 
ATOM   185   C  CH2   . TRP A 1  24  ? -11.157 23.440  148.625 1.00 169.81 ? 24   TRP A CH2   1 
ATOM   186   N  N     . PRO A 1  25  ? -15.148 27.169  143.071 1.00 175.26 ? 25   PRO A N     1 
ATOM   187   C  CA    . PRO A 1  25  ? -14.878 28.606  142.898 1.00 174.59 ? 25   PRO A CA    1 
ATOM   188   C  C     . PRO A 1  25  ? -14.057 29.215  144.037 1.00 174.67 ? 25   PRO A C     1 
ATOM   189   O  O     . PRO A 1  25  ? -14.303 28.961  145.218 1.00 173.04 ? 25   PRO A O     1 
ATOM   190   C  CB    . PRO A 1  25  ? -16.282 29.226  142.836 1.00 171.09 ? 25   PRO A CB    1 
ATOM   191   C  CG    . PRO A 1  25  ? -17.229 28.141  143.286 1.00 167.40 ? 25   PRO A CG    1 
ATOM   192   C  CD    . PRO A 1  25  ? -16.577 26.858  142.908 1.00 171.03 ? 25   PRO A CD    1 
ATOM   193   N  N     . LEU A 1  26  ? -13.078 30.034  143.654 1.00 174.53 ? 26   LEU A N     1 
ATOM   194   C  CA    . LEU A 1  26  ? -12.126 30.715  144.535 1.00 175.18 ? 26   LEU A CA    1 
ATOM   195   C  C     . LEU A 1  26  ? -12.453 32.200  144.654 1.00 177.23 ? 26   LEU A C     1 
ATOM   196   O  O     . LEU A 1  26  ? -12.615 32.880  143.636 1.00 180.45 ? 26   LEU A O     1 
ATOM   197   C  CB    . LEU A 1  26  ? -10.678 30.472  144.104 1.00 175.36 ? 26   LEU A CB    1 
ATOM   198   C  CG    . LEU A 1  26  ? -10.103 29.231  144.809 1.00 170.32 ? 26   LEU A CG    1 
ATOM   199   C  CD1   . LEU A 1  26  ? -10.899 28.001  144.598 1.00 167.89 ? 26   LEU A CD1   1 
ATOM   200   C  CD2   . LEU A 1  26  ? -8.714  28.957  144.312 1.00 167.82 ? 26   LEU A CD2   1 
ATOM   201   N  N     . THR A 1  27  ? -12.576 32.696  145.883 1.00 177.33 ? 27   THR A N     1 
ATOM   202   C  CA    . THR A 1  27  ? -12.742 34.132  146.077 1.00 179.74 ? 27   THR A CA    1 
ATOM   203   C  C     . THR A 1  27  ? -11.492 34.903  145.648 1.00 177.23 ? 27   THR A C     1 
ATOM   204   O  O     . THR A 1  27  ? -10.361 34.428  145.782 1.00 172.64 ? 27   THR A O     1 
ATOM   205   C  CB    . THR A 1  27  ? -13.050 34.445  147.542 1.00 171.36 ? 27   THR A CB    1 
ATOM   206   O  OG1   . THR A 1  27  ? -11.824 34.565  148.275 1.00 167.86 ? 27   THR A OG1   1 
ATOM   207   C  CG2   . THR A 1  27  ? -13.897 33.343  148.159 1.00 165.50 ? 27   THR A CG2   1 
ATOM   208   N  N     . GLU A 1  28  ? -11.727 36.126  145.155 1.00 181.12 ? 28   GLU A N     1 
ATOM   209   C  CA    . GLU A 1  28  ? -10.716 36.956  144.493 1.00 181.46 ? 28   GLU A CA    1 
ATOM   210   C  C     . GLU A 1  28  ? -9.394  37.037  145.250 1.00 179.06 ? 28   GLU A C     1 
ATOM   211   O  O     . GLU A 1  28  ? -8.349  36.626  144.732 1.00 179.22 ? 28   GLU A O     1 
ATOM   212   C  CB    . GLU A 1  28  ? -11.251 38.366  144.231 1.00 185.63 ? 28   GLU A CB    1 
ATOM   213   C  CG    . GLU A 1  28  ? -12.011 38.509  142.921 1.00 186.01 ? 28   GLU A CG    1 
ATOM   214   C  CD    . GLU A 1  28  ? -13.249 39.364  143.055 1.00 188.07 ? 28   GLU A CD    1 
ATOM   215   O  OE1   . GLU A 1  28  ? -13.124 40.506  143.544 1.00 189.31 ? 28   GLU A OE1   1 
ATOM   216   O  OE2   . GLU A 1  28  ? -14.343 38.901  142.671 1.00 188.05 ? 28   GLU A OE2   1 
ATOM   217   N  N     . GLU A 1  29  ? -9.418  37.583  146.472 1.00 174.36 ? 29   GLU A N     1 
ATOM   218   C  CA    . GLU A 1  29  ? -8.212  37.769  147.278 1.00 167.75 ? 29   GLU A CA    1 
ATOM   219   C  C     . GLU A 1  29  ? -7.322  36.538  147.254 1.00 165.57 ? 29   GLU A C     1 
ATOM   220   O  O     . GLU A 1  29  ? -6.100  36.661  147.118 1.00 163.06 ? 29   GLU A O     1 
ATOM   221   C  CB    . GLU A 1  29  ? -8.569  38.105  148.727 1.00 166.56 ? 29   GLU A CB    1 
ATOM   222   C  CG    . GLU A 1  29  ? -7.443  37.797  149.708 1.00 165.25 ? 29   GLU A CG    1 
ATOM   223   C  CD    . GLU A 1  29  ? -7.675  38.380  151.084 1.00 168.49 ? 29   GLU A CD    1 
ATOM   224   O  OE1   . GLU A 1  29  ? -8.724  39.022  151.293 1.00 169.21 ? 29   GLU A OE1   1 
ATOM   225   O  OE2   . GLU A 1  29  ? -6.804  38.193  151.961 1.00 168.09 ? 29   GLU A OE2   1 
ATOM   226   N  N     . LYS A 1  30  ? -7.907  35.350  147.390 1.00 176.66 ? 30   LYS A N     1 
ATOM   227   C  CA    . LYS A 1  30  ? -7.081  34.152  147.367 1.00 167.91 ? 30   LYS A CA    1 
ATOM   228   C  C     . LYS A 1  30  ? -6.437  33.994  145.993 1.00 170.98 ? 30   LYS A C     1 
ATOM   229   O  O     . LYS A 1  30  ? -5.220  33.800  145.892 1.00 164.10 ? 30   LYS A O     1 
ATOM   230   C  CB    . LYS A 1  30  ? -7.910  32.931  147.762 1.00 154.83 ? 30   LYS A CB    1 
ATOM   231   C  CG    . LYS A 1  30  ? -8.688  33.159  149.053 1.00 152.69 ? 30   LYS A CG    1 
ATOM   232   C  CD    . LYS A 1  30  ? -9.495  31.948  149.476 1.00 140.39 ? 30   LYS A CD    1 
ATOM   233   C  CE    . LYS A 1  30  ? -10.210 32.217  150.792 1.00 131.45 ? 30   LYS A CE    1 
ATOM   234   N  NZ    . LYS A 1  30  ? -11.067 31.077  151.217 1.00 128.45 ? 30   LYS A NZ    1 
ATOM   235   N  N     . ILE A 1  31  ? -7.243  34.081  144.921 1.00 173.11 ? 31   ILE A N     1 
ATOM   236   C  CA    . ILE A 1  31  ? -6.753  33.841  143.559 1.00 174.00 ? 31   ILE A CA    1 
ATOM   237   C  C     . ILE A 1  31  ? -5.455  34.582  143.284 1.00 173.11 ? 31   ILE A C     1 
ATOM   238   O  O     . ILE A 1  31  ? -4.587  34.070  142.572 1.00 171.40 ? 31   ILE A O     1 
ATOM   239   C  CB    . ILE A 1  31  ? -7.822  34.188  142.506 1.00 175.52 ? 31   ILE A CB    1 
ATOM   240   C  CG1   . ILE A 1  31  ? -9.212  33.842  143.018 1.00 177.44 ? 31   ILE A CG1   1 
ATOM   241   C  CG2   . ILE A 1  31  ? -7.535  33.463  141.201 1.00 180.68 ? 31   ILE A CG2   1 
ATOM   242   C  CD1   . ILE A 1  31  ? -10.282 34.164  142.039 1.00 184.63 ? 31   ILE A CD1   1 
ATOM   243   N  N     . LYS A 1  32  ? -5.279  35.780  143.849 1.00 165.12 ? 32   LYS A N     1 
ATOM   244   C  CA    . LYS A 1  32  ? -4.085  36.544  143.504 1.00 164.22 ? 32   LYS A CA    1 
ATOM   245   C  C     . LYS A 1  32  ? -2.898  35.955  144.249 1.00 158.80 ? 32   LYS A C     1 
ATOM   246   O  O     . LYS A 1  32  ? -1.912  35.539  143.629 1.00 159.33 ? 32   LYS A O     1 
ATOM   247   C  CB    . LYS A 1  32  ? -4.248  38.039  143.817 1.00 165.28 ? 32   LYS A CB    1 
ATOM   248   C  CG    . LYS A 1  32  ? -5.157  38.838  142.878 1.00 160.68 ? 32   LYS A CG    1 
ATOM   249   C  CD    . LYS A 1  32  ? -6.642  38.663  143.102 1.00 165.73 ? 32   LYS A CD    1 
ATOM   250   C  CE    . LYS A 1  32  ? -7.407  39.283  141.937 1.00 163.55 ? 32   LYS A CE    1 
ATOM   251   N  NZ    . LYS A 1  32  ? -8.874  39.056  142.006 1.00 163.16 ? 32   LYS A NZ    1 
ATOM   252   N  N     . ALA A 1  33  ? -2.953  35.960  145.584 1.00 162.67 ? 33   ALA A N     1 
ATOM   253   C  CA    . ALA A 1  33  ? -1.851  35.415  146.366 1.00 153.24 ? 33   ALA A CA    1 
ATOM   254   C  C     . ALA A 1  33  ? -1.511  34.009  145.881 1.00 152.39 ? 33   ALA A C     1 
ATOM   255   O  O     . ALA A 1  33  ? -0.343  33.614  145.844 1.00 148.77 ? 33   ALA A O     1 
ATOM   256   C  CB    . ALA A 1  33  ? -2.207  35.406  147.853 1.00 158.69 ? 33   ALA A CB    1 
ATOM   257   N  N     . LEU A 1  34  ? -2.539  33.237  145.515 1.00 149.71 ? 34   LEU A N     1 
ATOM   258   C  CA    . LEU A 1  34  ? -2.350  31.929  144.893 1.00 149.85 ? 34   LEU A CA    1 
ATOM   259   C  C     . LEU A 1  34  ? -1.448  31.982  143.661 1.00 153.92 ? 34   LEU A C     1 
ATOM   260   O  O     . LEU A 1  34  ? -0.490  31.208  143.552 1.00 153.90 ? 34   LEU A O     1 
ATOM   261   C  CB    . LEU A 1  34  ? -3.714  31.347  144.528 1.00 151.22 ? 34   LEU A CB    1 
ATOM   262   C  CG    . LEU A 1  34  ? -4.521  30.752  145.677 1.00 150.45 ? 34   LEU A CG    1 
ATOM   263   C  CD1   . LEU A 1  34  ? -5.945  30.611  145.246 1.00 152.37 ? 34   LEU A CD1   1 
ATOM   264   C  CD2   . LEU A 1  34  ? -3.961  29.393  146.048 1.00 149.24 ? 34   LEU A CD2   1 
ATOM   265   N  N     . VAL A 1  35  ? -1.744  32.880  142.714 1.00 153.86 ? 35   VAL A N     1 
ATOM   266   C  CA    . VAL A 1  35  ? -0.953  32.937  141.482 1.00 153.69 ? 35   VAL A CA    1 
ATOM   267   C  C     . VAL A 1  35  ? 0.502   33.278  141.776 1.00 154.19 ? 35   VAL A C     1 
ATOM   268   O  O     . VAL A 1  35  ? 1.419   32.684  141.197 1.00 155.35 ? 35   VAL A O     1 
ATOM   269   C  CB    . VAL A 1  35  ? -1.570  33.924  140.472 1.00 152.97 ? 35   VAL A CB    1 
ATOM   270   C  CG1   . VAL A 1  35  ? -0.760  33.927  139.188 1.00 150.73 ? 35   VAL A CG1   1 
ATOM   271   C  CG2   . VAL A 1  35  ? -2.984  33.510  140.133 1.00 158.36 ? 35   VAL A CG2   1 
ATOM   272   N  N     . GLU A 1  36  ? 0.742   34.245  142.664 1.00 153.87 ? 36   GLU A N     1 
ATOM   273   C  CA    . GLU A 1  36  ? 2.121   34.621  142.959 1.00 154.71 ? 36   GLU A CA    1 
ATOM   274   C  C     . GLU A 1  36  ? 2.880   33.479  143.634 1.00 153.70 ? 36   GLU A C     1 
ATOM   275   O  O     . GLU A 1  36  ? 4.054   33.245  143.324 1.00 153.91 ? 36   GLU A O     1 
ATOM   276   C  CB    . GLU A 1  36  ? 2.152   35.913  143.786 1.00 152.20 ? 36   GLU A CB    1 
ATOM   277   C  CG    . GLU A 1  36  ? 1.607   35.830  145.199 1.00 150.74 ? 36   GLU A CG    1 
ATOM   278   C  CD    . GLU A 1  36  ? 2.593   36.317  146.239 1.00 151.82 ? 36   GLU A CD    1 
ATOM   279   O  OE1   . GLU A 1  36  ? 3.443   37.168  145.900 1.00 152.35 ? 36   GLU A OE1   1 
ATOM   280   O  OE2   . GLU A 1  36  ? 2.514   35.858  147.397 1.00 151.90 ? 36   GLU A OE2   1 
ATOM   281   N  N     . ILE A 1  37  ? 2.237   32.765  144.565 1.00 160.68 ? 37   ILE A N     1 
ATOM   282   C  CA    . ILE A 1  37  ? 2.884   31.611  145.191 1.00 160.85 ? 37   ILE A CA    1 
ATOM   283   C  C     . ILE A 1  37  ? 3.217   30.541  144.157 1.00 164.30 ? 37   ILE A C     1 
ATOM   284   O  O     . ILE A 1  37  ? 4.298   29.939  144.189 1.00 157.15 ? 37   ILE A O     1 
ATOM   285   C  CB    . ILE A 1  37  ? 1.985   31.039  146.304 1.00 150.56 ? 37   ILE A CB    1 
ATOM   286   C  CG1   . ILE A 1  37  ? 1.728   32.079  147.389 1.00 148.08 ? 37   ILE A CG1   1 
ATOM   287   C  CG2   . ILE A 1  37  ? 2.603   29.785  146.909 1.00 148.89 ? 37   ILE A CG2   1 
ATOM   288   C  CD1   . ILE A 1  37  ? 0.612   31.684  148.310 1.00 159.70 ? 37   ILE A CD1   1 
ATOM   289   N  N     . CYS A 1  38  ? 2.289   30.281  143.231 1.00 172.67 ? 38   CYS A N     1 
ATOM   290   C  CA    . CYS A 1  38  ? 2.547   29.365  142.122 1.00 172.44 ? 38   CYS A CA    1 
ATOM   291   C  C     . CYS A 1  38  ? 3.816   29.724  141.356 1.00 173.95 ? 38   CYS A C     1 
ATOM   292   O  O     . CYS A 1  38  ? 4.723   28.897  141.213 1.00 173.89 ? 38   CYS A O     1 
ATOM   293   C  CB    . CYS A 1  38  ? 1.340   29.327  141.183 1.00 173.74 ? 38   CYS A CB    1 
ATOM   294   S  SG    . CYS A 1  38  ? -0.134  28.554  141.897 1.00 172.74 ? 38   CYS A SG    1 
ATOM   295   N  N     . THR A 1  39  ? 3.905   30.971  140.881 1.00 166.52 ? 39   THR A N     1 
ATOM   296   C  CA    . THR A 1  39  ? 5.050   31.399  140.077 1.00 165.67 ? 39   THR A CA    1 
ATOM   297   C  C     . THR A 1  39  ? 6.371   31.232  140.821 1.00 160.84 ? 39   THR A C     1 
ATOM   298   O  O     . THR A 1  39  ? 7.374   30.825  140.222 1.00 159.25 ? 39   THR A O     1 
ATOM   299   C  CB    . THR A 1  39  ? 4.862   32.846  139.627 1.00 164.39 ? 39   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  39  ? 3.463   33.151  139.576 1.00 161.45 ? 39   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  39  ? 5.467   33.049  138.246 1.00 164.13 ? 39   THR A CG2   1 
ATOM   302   N  N     . GLU A 1  40  ? 6.405   31.570  142.112 1.00 158.34 ? 40   GLU A N     1 
ATOM   303   C  CA    . GLU A 1  40  ? 7.599   31.313  142.914 1.00 159.00 ? 40   GLU A CA    1 
ATOM   304   C  C     . GLU A 1  40  ? 8.003   29.849  142.803 1.00 162.91 ? 40   GLU A C     1 
ATOM   305   O  O     . GLU A 1  40  ? 9.134   29.524  142.426 1.00 166.18 ? 40   GLU A O     1 
ATOM   306   C  CB    . GLU A 1  40  ? 7.357   31.709  144.370 1.00 158.44 ? 40   GLU A CB    1 
ATOM   307   C  CG    . GLU A 1  40  ? 7.091   33.185  144.549 1.00 156.79 ? 40   GLU A CG    1 
ATOM   308   C  CD    . GLU A 1  40  ? 8.294   34.023  144.167 1.00 160.86 ? 40   GLU A CD    1 
ATOM   309   O  OE1   . GLU A 1  40  ? 9.283   34.031  144.929 1.00 160.82 ? 40   GLU A OE1   1 
ATOM   310   O  OE2   . GLU A 1  40  ? 8.254   34.666  143.097 1.00 164.19 ? 40   GLU A OE2   1 
ATOM   311   N  N     . MET A 1  41  ? 7.075   28.955  143.143 1.00 167.33 ? 41   MET A N     1 
ATOM   312   C  CA    . MET A 1  41  ? 7.329   27.521  143.072 1.00 166.23 ? 41   MET A CA    1 
ATOM   313   C  C     . MET A 1  41  ? 7.827   27.134  141.685 1.00 164.04 ? 41   MET A C     1 
ATOM   314   O  O     . MET A 1  41  ? 8.704   26.275  141.543 1.00 161.65 ? 41   MET A O     1 
ATOM   315   C  CB    . MET A 1  41  ? 6.055   26.749  143.413 1.00 158.97 ? 41   MET A CB    1 
ATOM   316   C  CG    . MET A 1  41  ? 5.596   26.864  144.854 1.00 150.64 ? 41   MET A CG    1 
ATOM   317   S  SD    . MET A 1  41  ? 4.199   25.772  145.176 1.00 148.12 ? 41   MET A SD    1 
ATOM   318   C  CE    . MET A 1  41  ? 3.883   26.119  146.901 1.00 144.58 ? 41   MET A CE    1 
ATOM   319   N  N     . GLU A 1  42  ? 7.263   27.760  140.648 1.00 164.08 ? 42   GLU A N     1 
ATOM   320   C  CA    . GLU A 1  42  ? 7.666   27.471  139.276 1.00 167.87 ? 42   GLU A CA    1 
ATOM   321   C  C     . GLU A 1  42  ? 9.118   27.853  139.022 1.00 166.77 ? 42   GLU A C     1 
ATOM   322   O  O     . GLU A 1  42  ? 9.862   27.101  138.381 1.00 163.90 ? 42   GLU A O     1 
ATOM   323   C  CB    . GLU A 1  42  ? 6.795   28.293  138.332 1.00 170.35 ? 42   GLU A CB    1 
ATOM   324   C  CG    . GLU A 1  42  ? 5.323   28.027  138.374 1.00 171.51 ? 42   GLU A CG    1 
ATOM   325   C  CD    . GLU A 1  42  ? 4.629   28.601  137.170 1.00 176.45 ? 42   GLU A CD    1 
ATOM   326   O  OE1   . GLU A 1  42  ? 5.242   28.634  136.083 1.00 179.92 ? 42   GLU A OE1   1 
ATOM   327   O  OE2   . GLU A 1  42  ? 3.488   29.082  137.327 1.00 177.64 ? 42   GLU A OE2   1 
ATOM   328   N  N     . LYS A 1  43  ? 9.537   29.023  139.509 1.00 164.61 ? 43   LYS A N     1 
ATOM   329   C  CA    . LYS A 1  43  ? 10.936  29.421  139.382 1.00 161.54 ? 43   LYS A CA    1 
ATOM   330   C  C     . LYS A 1  43  ? 11.853  28.458  140.124 1.00 166.92 ? 43   LYS A C     1 
ATOM   331   O  O     . LYS A 1  43  ? 12.925  28.094  139.627 1.00 162.58 ? 43   LYS A O     1 
ATOM   332   C  CB    . LYS A 1  43  ? 11.116  30.852  139.888 1.00 159.42 ? 43   LYS A CB    1 
ATOM   333   C  CG    . LYS A 1  43  ? 12.560  31.293  140.036 1.00 154.72 ? 43   LYS A CG    1 
ATOM   334   C  CD    . LYS A 1  43  ? 12.644  32.779  140.341 1.00 146.55 ? 43   LYS A CD    1 
ATOM   335   C  CE    . LYS A 1  43  ? 13.689  33.067  141.403 1.00 147.04 ? 43   LYS A CE    1 
ATOM   336   N  NZ    . LYS A 1  43  ? 15.061  32.742  140.925 1.00 137.59 ? 43   LYS A NZ    1 
ATOM   337   N  N     . GLU A 1  44  ? 11.434  28.027  141.315 1.00 180.72 ? 44   GLU A N     1 
ATOM   338   C  CA    . GLU A 1  44  ? 12.243  27.149  142.150 1.00 177.79 ? 44   GLU A CA    1 
ATOM   339   C  C     . GLU A 1  44  ? 12.360  25.737  141.594 1.00 176.94 ? 44   GLU A C     1 
ATOM   340   O  O     . GLU A 1  44  ? 13.294  25.018  141.965 1.00 173.67 ? 44   GLU A O     1 
ATOM   341   C  CB    . GLU A 1  44  ? 11.662  27.079  143.566 1.00 176.47 ? 44   GLU A CB    1 
ATOM   342   C  CG    . GLU A 1  44  ? 12.151  28.158  144.524 1.00 176.44 ? 44   GLU A CG    1 
ATOM   343   C  CD    . GLU A 1  44  ? 11.607  29.534  144.193 1.00 182.73 ? 44   GLU A CD    1 
ATOM   344   O  OE1   . GLU A 1  44  ? 10.601  29.939  144.815 1.00 182.57 ? 44   GLU A OE1   1 
ATOM   345   O  OE2   . GLU A 1  44  ? 12.181  30.212  143.316 1.00 183.93 ? 44   GLU A OE2   1 
ATOM   346   N  N     . GLY A 1  45  ? 11.451  25.323  140.713 1.00 175.90 ? 45   GLY A N     1 
ATOM   347   C  CA    . GLY A 1  45  ? 11.462  23.959  140.234 1.00 162.88 ? 45   GLY A CA    1 
ATOM   348   C  C     . GLY A 1  45  ? 10.564  23.050  141.040 1.00 163.81 ? 45   GLY A C     1 
ATOM   349   O  O     . GLY A 1  45  ? 10.515  21.842  140.771 1.00 150.07 ? 45   GLY A O     1 
ATOM   350   N  N     . LYS A 1  46  ? 9.854   23.606  142.024 1.00 161.48 ? 46   LYS A N     1 
ATOM   351   C  CA    . LYS A 1  46  ? 8.997   22.849  142.926 1.00 158.93 ? 46   LYS A CA    1 
ATOM   352   C  C     . LYS A 1  46  ? 7.756   22.302  142.231 1.00 159.90 ? 46   LYS A C     1 
ATOM   353   O  O     . LYS A 1  46  ? 7.162   21.338  142.726 1.00 159.25 ? 46   LYS A O     1 
ATOM   354   C  CB    . LYS A 1  46  ? 8.590   23.736  144.105 1.00 158.40 ? 46   LYS A CB    1 
ATOM   355   C  CG    . LYS A 1  46  ? 9.761   24.224  144.958 1.00 152.35 ? 46   LYS A CG    1 
ATOM   356   C  CD    . LYS A 1  46  ? 10.862  23.183  145.070 1.00 151.00 ? 46   LYS A CD    1 
ATOM   357   C  CE    . LYS A 1  46  ? 12.156  23.790  145.595 1.00 158.15 ? 46   LYS A CE    1 
ATOM   358   N  NZ    . LYS A 1  46  ? 13.305  22.843  145.490 1.00 156.94 ? 46   LYS A NZ    1 
ATOM   359   N  N     . ILE A 1  47  ? 7.361   22.880  141.098 1.00 150.12 ? 47   ILE A N     1 
ATOM   360   C  CA    . ILE A 1  47  ? 6.169   22.462  140.359 1.00 147.98 ? 47   ILE A CA    1 
ATOM   361   C  C     . ILE A 1  47  ? 6.467   22.638  138.877 1.00 149.07 ? 47   ILE A C     1 
ATOM   362   O  O     . ILE A 1  47  ? 7.005   23.667  138.458 1.00 155.74 ? 47   ILE A O     1 
ATOM   363   C  CB    . ILE A 1  47  ? 4.882   23.236  140.735 1.00 149.99 ? 47   ILE A CB    1 
ATOM   364   C  CG1   . ILE A 1  47  ? 5.005   24.734  140.432 1.00 153.97 ? 47   ILE A CG1   1 
ATOM   365   C  CG2   . ILE A 1  47  ? 4.499   23.005  142.195 1.00 147.82 ? 47   ILE A CG2   1 
ATOM   366   C  CD1   . ILE A 1  47  ? 3.874   25.567  141.002 1.00 155.99 ? 47   ILE A CD1   1 
ATOM   367   N  N     . SER A 1  48  ? 6.159   21.612  138.088 1.00 150.51 ? 48   SER A N     1 
ATOM   368   C  CA    . SER A 1  48  ? 6.371   21.679  136.652 1.00 149.91 ? 48   SER A CA    1 
ATOM   369   C  C     . SER A 1  48  ? 5.107   22.122  135.924 1.00 156.21 ? 48   SER A C     1 
ATOM   370   O  O     . SER A 1  48  ? 3.981   21.863  136.358 1.00 154.89 ? 48   SER A O     1 
ATOM   371   C  CB    . SER A 1  48  ? 6.829   20.323  136.111 1.00 144.59 ? 48   SER A CB    1 
ATOM   372   O  OG    . SER A 1  48  ? 8.168   20.383  135.649 1.00 138.96 ? 48   SER A OG    1 
ATOM   373   N  N     . LYS A 1  49  ? 5.324   22.806  134.801 1.00 159.88 ? 49   LYS A N     1 
ATOM   374   C  CA    . LYS A 1  49  ? 4.284   23.562  134.113 1.00 162.40 ? 49   LYS A CA    1 
ATOM   375   C  C     . LYS A 1  49  ? 3.355   22.688  133.279 1.00 162.54 ? 49   LYS A C     1 
ATOM   376   O  O     . LYS A 1  49  ? 2.203   23.073  133.053 1.00 163.13 ? 49   LYS A O     1 
ATOM   377   C  CB    . LYS A 1  49  ? 4.915   24.639  133.223 1.00 164.52 ? 49   LYS A CB    1 
ATOM   378   C  CG    . LYS A 1  49  ? 5.950   24.130  132.216 1.00 168.59 ? 49   LYS A CG    1 
ATOM   379   C  CD    . LYS A 1  49  ? 7.334   23.963  132.839 1.00 166.10 ? 49   LYS A CD    1 
ATOM   380   C  CE    . LYS A 1  49  ? 8.001   22.680  132.370 1.00 160.19 ? 49   LYS A CE    1 
ATOM   381   N  NZ    . LYS A 1  49  ? 9.248   22.396  133.134 1.00 152.38 ? 49   LYS A NZ    1 
ATOM   382   N  N     . ILE A 1  50  ? 3.841   21.539  132.796 1.00 159.08 ? 50   ILE A N     1 
ATOM   383   C  CA    . ILE A 1  50  ? 3.111   20.765  131.797 1.00 161.16 ? 50   ILE A CA    1 
ATOM   384   C  C     . ILE A 1  50  ? 1.679   20.492  132.245 1.00 159.30 ? 50   ILE A C     1 
ATOM   385   O  O     . ILE A 1  50  ? 1.421   20.143  133.402 1.00 153.16 ? 50   ILE A O     1 
ATOM   386   C  CB    . ILE A 1  50  ? 3.864   19.451  131.514 1.00 159.86 ? 50   ILE A CB    1 
ATOM   387   C  CG1   . ILE A 1  50  ? 5.264   19.747  130.968 1.00 160.03 ? 50   ILE A CG1   1 
ATOM   388   C  CG2   . ILE A 1  50  ? 3.078   18.566  130.555 1.00 158.93 ? 50   ILE A CG2   1 
ATOM   389   C  CD1   . ILE A 1  50  ? 5.876   18.606  130.179 1.00 155.36 ? 50   ILE A CD1   1 
ATOM   390   N  N     . GLY A 1  51  ? 0.740   20.655  131.311 1.00 164.33 ? 51   GLY A N     1 
ATOM   391   C  CA    . GLY A 1  51  ? -0.642  20.303  131.532 1.00 163.49 ? 51   GLY A CA    1 
ATOM   392   C  C     . GLY A 1  51  ? -1.516  19.885  130.348 1.00 164.64 ? 51   GLY A C     1 
ATOM   393   O  O     . GLY A 1  51  ? -2.729  19.747  130.516 1.00 163.49 ? 51   GLY A O     1 
ATOM   394   N  N     . PRO A 1  52  ? -0.970  19.671  129.141 1.00 167.09 ? 52   PRO A N     1 
ATOM   395   C  CA    . PRO A 1  52  ? -1.881  19.280  128.050 1.00 166.16 ? 52   PRO A CA    1 
ATOM   396   C  C     . PRO A 1  52  ? -2.331  17.839  128.172 1.00 162.58 ? 52   PRO A C     1 
ATOM   397   O  O     . PRO A 1  52  ? -3.489  17.514  127.876 1.00 150.93 ? 52   PRO A O     1 
ATOM   398   C  CB    . PRO A 1  52  ? -1.047  19.514  126.784 1.00 162.53 ? 52   PRO A CB    1 
ATOM   399   C  CG    . PRO A 1  52  ? 0.339   19.360  127.228 1.00 158.31 ? 52   PRO A CG    1 
ATOM   400   C  CD    . PRO A 1  52  ? 0.392   19.903  128.616 1.00 158.85 ? 52   PRO A CD    1 
ATOM   401   N  N     . GLU A 1  53  ? -1.423  16.966  128.598 1.00 163.08 ? 53   GLU A N     1 
ATOM   402   C  CA    . GLU A 1  53  ? -1.530  15.523  128.466 1.00 162.45 ? 53   GLU A CA    1 
ATOM   403   C  C     . GLU A 1  53  ? -2.043  14.815  129.715 1.00 166.97 ? 53   GLU A C     1 
ATOM   404   O  O     . GLU A 1  53  ? -2.278  13.603  129.657 1.00 161.29 ? 53   GLU A O     1 
ATOM   405   C  CB    . GLU A 1  53  ? -0.157  14.953  128.092 1.00 159.51 ? 53   GLU A CB    1 
ATOM   406   C  CG    . GLU A 1  53  ? 0.961   15.974  128.266 1.00 154.77 ? 53   GLU A CG    1 
ATOM   407   C  CD    . GLU A 1  53  ? 2.339   15.353  128.257 1.00 162.34 ? 53   GLU A CD    1 
ATOM   408   O  OE1   . GLU A 1  53  ? 2.465   14.180  128.663 1.00 163.90 ? 53   GLU A OE1   1 
ATOM   409   O  OE2   . GLU A 1  53  ? 3.297   16.043  127.850 1.00 167.72 ? 53   GLU A OE2   1 
ATOM   410   N  N     . ASN A 1  54  ? -2.233  15.516  130.834 1.00 174.32 ? 54   ASN A N     1 
ATOM   411   C  CA    . ASN A 1  54  ? -2.628  14.827  132.060 1.00 170.80 ? 54   ASN A CA    1 
ATOM   412   C  C     . ASN A 1  54  ? -4.066  15.125  132.461 1.00 169.87 ? 54   ASN A C     1 
ATOM   413   O  O     . ASN A 1  54  ? -4.381  16.262  132.847 1.00 171.98 ? 54   ASN A O     1 
ATOM   414   C  CB    . ASN A 1  54  ? -1.681  15.204  133.202 1.00 169.35 ? 54   ASN A CB    1 
ATOM   415   C  CG    . ASN A 1  54  ? -0.282  14.657  133.005 1.00 169.85 ? 54   ASN A CG    1 
ATOM   416   O  OD1   . ASN A 1  54  ? -0.063  13.757  132.196 1.00 170.46 ? 54   ASN A OD1   1 
ATOM   417   N  ND2   . ASN A 1  54  ? 0.674   15.196  133.753 1.00 168.44 ? 54   ASN A ND2   1 
ATOM   418   N  N     . PRO A 1  55  ? -4.959  14.133  132.385 1.00 159.38 ? 55   PRO A N     1 
ATOM   419   C  CA    . PRO A 1  55  ? -6.396  14.378  132.592 1.00 158.41 ? 55   PRO A CA    1 
ATOM   420   C  C     . PRO A 1  55  ? -6.770  14.786  134.013 1.00 161.26 ? 55   PRO A C     1 
ATOM   421   O  O     . PRO A 1  55  ? -7.932  15.149  134.242 1.00 155.07 ? 55   PRO A O     1 
ATOM   422   C  CB    . PRO A 1  55  ? -7.034  13.034  132.217 1.00 151.88 ? 55   PRO A CB    1 
ATOM   423   C  CG    . PRO A 1  55  ? -5.963  12.032  132.503 1.00 150.86 ? 55   PRO A CG    1 
ATOM   424   C  CD    . PRO A 1  55  ? -4.676  12.711  132.118 1.00 152.17 ? 55   PRO A CD    1 
ATOM   425   N  N     . TYR A 1  56  ? -5.840  14.742  134.964 1.00 161.16 ? 56   TYR A N     1 
ATOM   426   C  CA    . TYR A 1  56  ? -6.168  14.808  136.383 1.00 158.46 ? 56   TYR A CA    1 
ATOM   427   C  C     . TYR A 1  56  ? -6.182  16.242  136.897 1.00 158.81 ? 56   TYR A C     1 
ATOM   428   O  O     . TYR A 1  56  ? -5.384  17.078  136.469 1.00 162.79 ? 56   TYR A O     1 
ATOM   429   C  CB    . TYR A 1  56  ? -5.148  13.996  137.182 1.00 153.87 ? 56   TYR A CB    1 
ATOM   430   C  CG    . TYR A 1  56  ? -4.889  12.615  136.622 1.00 144.39 ? 56   TYR A CG    1 
ATOM   431   C  CD1   . TYR A 1  56  ? -5.829  11.601  136.746 1.00 141.55 ? 56   TYR A CD1   1 
ATOM   432   C  CD2   . TYR A 1  56  ? -3.703  12.332  135.956 1.00 143.56 ? 56   TYR A CD2   1 
ATOM   433   C  CE1   . TYR A 1  56  ? -5.592  10.341  136.224 1.00 140.23 ? 56   TYR A CE1   1 
ATOM   434   C  CE2   . TYR A 1  56  ? -3.456  11.076  135.435 1.00 144.17 ? 56   TYR A CE2   1 
ATOM   435   C  CZ    . TYR A 1  56  ? -4.404  10.084  135.571 1.00 144.65 ? 56   TYR A CZ    1 
ATOM   436   O  OH    . TYR A 1  56  ? -4.161  8.830   135.056 1.00 142.33 ? 56   TYR A OH    1 
ATOM   437   N  N     . ASN A 1  57  ? -7.096  16.514  137.832 1.00 159.23 ? 57   ASN A N     1 
ATOM   438   C  CA    . ASN A 1  57  ? -7.100  17.753  138.599 1.00 164.85 ? 57   ASN A CA    1 
ATOM   439   C  C     . ASN A 1  57  ? -7.546  17.488  140.030 1.00 167.45 ? 57   ASN A C     1 
ATOM   440   O  O     . ASN A 1  57  ? -8.427  16.658  140.273 1.00 155.70 ? 57   ASN A O     1 
ATOM   441   C  CB    . ASN A 1  57  ? -8.019  18.808  137.971 1.00 165.80 ? 57   ASN A CB    1 
ATOM   442   C  CG    . ASN A 1  57  ? -8.167  20.039  138.845 1.00 169.25 ? 57   ASN A CG    1 
ATOM   443   O  OD1   . ASN A 1  57  ? -7.297  20.907  138.868 1.00 175.84 ? 57   ASN A OD1   1 
ATOM   444   N  ND2   . ASN A 1  57  ? -9.271  20.113  139.579 1.00 160.75 ? 57   ASN A ND2   1 
ATOM   445   N  N     . THR A 1  58  ? -6.923  18.201  140.973 1.00 171.63 ? 58   THR A N     1 
ATOM   446   C  CA    . THR A 1  58  ? -7.333  18.278  142.366 1.00 168.41 ? 58   THR A CA    1 
ATOM   447   C  C     . THR A 1  58  ? -7.541  19.724  142.808 1.00 169.81 ? 58   THR A C     1 
ATOM   448   O  O     . THR A 1  58  ? -6.750  20.604  142.452 1.00 170.57 ? 58   THR A O     1 
ATOM   449   C  CB    . THR A 1  58  ? -6.291  17.622  143.279 1.00 166.84 ? 58   THR A CB    1 
ATOM   450   O  OG1   . THR A 1  58  ? -5.149  18.479  143.387 1.00 171.81 ? 58   THR A OG1   1 
ATOM   451   C  CG2   . THR A 1  58  ? -5.858  16.294  142.708 1.00 163.71 ? 58   THR A CG2   1 
ATOM   452   N  N     . PRO A 1  59  ? -8.608  20.000  143.560 1.00 163.00 ? 59   PRO A N     1 
ATOM   453   C  CA    . PRO A 1  59  ? -8.842  21.362  144.062 1.00 157.17 ? 59   PRO A CA    1 
ATOM   454   C  C     . PRO A 1  59  ? -7.715  21.855  144.964 1.00 154.11 ? 59   PRO A C     1 
ATOM   455   O  O     . PRO A 1  59  ? -7.135  21.091  145.739 1.00 149.54 ? 59   PRO A O     1 
ATOM   456   C  CB    . PRO A 1  59  ? -10.158 21.230  144.833 1.00 154.58 ? 59   PRO A CB    1 
ATOM   457   C  CG    . PRO A 1  59  ? -10.823 20.021  144.253 1.00 154.68 ? 59   PRO A CG    1 
ATOM   458   C  CD    . PRO A 1  59  ? -9.712  19.086  143.895 1.00 160.84 ? 59   PRO A CD    1 
ATOM   459   N  N     . VAL A 1  60  ? -7.406  23.151  144.851 1.00 163.48 ? 60   VAL A N     1 
ATOM   460   C  CA    . VAL A 1  60  ? -6.426  23.819  145.701 1.00 160.60 ? 60   VAL A CA    1 
ATOM   461   C  C     . VAL A 1  60  ? -7.087  24.967  146.469 1.00 170.95 ? 60   VAL A C     1 
ATOM   462   O  O     . VAL A 1  60  ? -8.113  25.514  146.055 1.00 165.03 ? 60   VAL A O     1 
ATOM   463   C  CB    . VAL A 1  60  ? -5.238  24.334  144.853 1.00 148.15 ? 60   VAL A CB    1 
ATOM   464   C  CG1   . VAL A 1  60  ? -4.112  24.884  145.717 1.00 154.99 ? 60   VAL A CG1   1 
ATOM   465   C  CG2   . VAL A 1  60  ? -4.726  23.232  143.942 1.00 150.57 ? 60   VAL A CG2   1 
ATOM   466   N  N     . PHE A 1  61  ? -6.480  25.327  147.606 1.00 186.09 ? 61   PHE A N     1 
ATOM   467   C  CA    . PHE A 1  61  ? -6.877  26.501  148.383 1.00 188.08 ? 61   PHE A CA    1 
ATOM   468   C  C     . PHE A 1  61  ? -5.636  27.067  149.075 1.00 185.77 ? 61   PHE A C     1 
ATOM   469   O  O     . PHE A 1  61  ? -4.524  26.559  148.904 1.00 185.59 ? 61   PHE A O     1 
ATOM   470   C  CB    . PHE A 1  61  ? -8.007  26.185  149.377 1.00 188.82 ? 61   PHE A CB    1 
ATOM   471   C  CG    . PHE A 1  61  ? -7.660  25.153  150.419 1.00 185.25 ? 61   PHE A CG    1 
ATOM   472   C  CD1   . PHE A 1  61  ? -7.401  23.837  150.069 1.00 180.61 ? 61   PHE A CD1   1 
ATOM   473   C  CD2   . PHE A 1  61  ? -7.614  25.504  151.758 1.00 183.32 ? 61   PHE A CD2   1 
ATOM   474   C  CE1   . PHE A 1  61  ? -7.094  22.897  151.032 1.00 174.82 ? 61   PHE A CE1   1 
ATOM   475   C  CE2   . PHE A 1  61  ? -7.306  24.569  152.725 1.00 179.27 ? 61   PHE A CE2   1 
ATOM   476   C  CZ    . PHE A 1  61  ? -7.048  23.264  152.362 1.00 175.90 ? 61   PHE A CZ    1 
ATOM   477   N  N     . ALA A 1  62  ? -5.828  28.129  149.865 1.00 174.03 ? 62   ALA A N     1 
ATOM   478   C  CA    . ALA A 1  62  ? -4.709  28.833  150.491 1.00 174.36 ? 62   ALA A CA    1 
ATOM   479   C  C     . ALA A 1  62  ? -5.072  29.410  151.855 1.00 169.06 ? 62   ALA A C     1 
ATOM   480   O  O     . ALA A 1  62  ? -6.127  30.036  151.995 1.00 165.54 ? 62   ALA A O     1 
ATOM   481   C  CB    . ALA A 1  62  ? -4.203  29.957  149.581 1.00 175.99 ? 62   ALA A CB    1 
ATOM   482   N  N     . ILE A 1  63  ? -4.203  29.203  152.855 1.00 170.48 ? 63   ILE A N     1 
ATOM   483   C  CA    . ILE A 1  63  ? -4.386  29.796  154.180 1.00 163.77 ? 63   ILE A CA    1 
ATOM   484   C  C     . ILE A 1  63  ? -3.061  30.353  154.698 1.00 173.26 ? 63   ILE A C     1 
ATOM   485   O  O     . ILE A 1  63  ? -1.980  29.877  154.340 1.00 178.82 ? 63   ILE A O     1 
ATOM   486   C  CB    . ILE A 1  63  ? -4.953  28.778  155.198 1.00 156.55 ? 63   ILE A CB    1 
ATOM   487   C  CG1   . ILE A 1  63  ? -3.886  27.741  155.561 1.00 155.30 ? 63   ILE A CG1   1 
ATOM   488   C  CG2   . ILE A 1  63  ? -6.220  28.116  154.674 1.00 157.38 ? 63   ILE A CG2   1 
ATOM   489   C  CD1   . ILE A 1  63  ? -3.997  27.208  156.968 1.00 149.96 ? 63   ILE A CD1   1 
ATOM   490   N  N     . LYS A 1  64  ? -3.159  31.389  155.538 1.00 166.04 ? 64   LYS A N     1 
ATOM   491   C  CA    . LYS A 1  64  ? -1.988  32.054  156.108 1.00 167.10 ? 64   LYS A CA    1 
ATOM   492   C  C     . LYS A 1  64  ? -1.244  31.166  157.109 1.00 162.36 ? 64   LYS A C     1 
ATOM   493   O  O     . LYS A 1  64  ? -1.848  30.355  157.811 1.00 153.61 ? 64   LYS A O     1 
ATOM   494   C  CB    . LYS A 1  64  ? -2.409  33.362  156.789 1.00 161.93 ? 64   LYS A CB    1 
ATOM   495   C  CG    . LYS A 1  64  ? -3.222  33.187  158.063 1.00 162.34 ? 64   LYS A CG    1 
ATOM   496   C  CD    . LYS A 1  64  ? -2.712  34.106  159.163 1.00 164.92 ? 64   LYS A CD    1 
ATOM   497   C  CE    . LYS A 1  64  ? -3.195  33.661  160.535 1.00 158.57 ? 64   LYS A CE    1 
ATOM   498   N  NZ    . LYS A 1  64  ? -2.674  34.540  161.619 1.00 150.17 ? 64   LYS A NZ    1 
ATOM   499   N  N     . LYS A 1  65  ? 0.084   31.302  157.162 1.00 169.74 ? 65   LYS A N     1 
ATOM   500   C  CA    . LYS A 1  65  ? 0.843   30.646  158.229 1.00 167.74 ? 65   LYS A CA    1 
ATOM   501   C  C     . LYS A 1  65  ? 0.420   31.193  159.591 1.00 165.78 ? 65   LYS A C     1 
ATOM   502   O  O     . LYS A 1  65  ? -0.197  32.258  159.711 1.00 167.30 ? 65   LYS A O     1 
ATOM   503   C  CB    . LYS A 1  65  ? 2.364   30.835  158.086 1.00 168.75 ? 65   LYS A CB    1 
ATOM   504   C  CG    . LYS A 1  65  ? 3.002   30.253  156.848 1.00 165.31 ? 65   LYS A CG    1 
ATOM   505   C  CD    . LYS A 1  65  ? 4.506   30.127  157.037 1.00 164.64 ? 65   LYS A CD    1 
ATOM   506   C  CE    . LYS A 1  65  ? 5.107   29.562  155.798 1.00 165.11 ? 65   LYS A CE    1 
ATOM   507   N  NZ    . LYS A 1  65  ? 6.550   29.219  155.872 1.00 163.40 ? 65   LYS A NZ    1 
ATOM   508   N  N     . LYS A 1  66  ? 0.776   30.446  160.628 1.00 162.06 ? 66   LYS A N     1 
ATOM   509   C  CA    . LYS A 1  66  ? 0.433   30.842  161.984 1.00 160.93 ? 66   LYS A CA    1 
ATOM   510   C  C     . LYS A 1  66  ? 1.234   32.080  162.386 1.00 158.03 ? 66   LYS A C     1 
ATOM   511   O  O     . LYS A 1  66  ? 2.471   32.055  162.408 1.00 149.53 ? 66   LYS A O     1 
ATOM   512   C  CB    . LYS A 1  66  ? 0.689   29.684  162.945 1.00 156.06 ? 66   LYS A CB    1 
ATOM   513   C  CG    . LYS A 1  66  ? 0.206   29.922  164.375 1.00 144.42 ? 66   LYS A CG    1 
ATOM   514   C  CD    . LYS A 1  66  ? 0.585   28.762  165.289 1.00 125.30 ? 66   LYS A CD    1 
ATOM   515   C  CE    . LYS A 1  66  ? 0.166   29.018  166.728 1.00 117.14 ? 66   LYS A CE    1 
ATOM   516   N  NZ    . LYS A 1  66  ? 0.524   27.879  167.621 1.00 118.51 ? 66   LYS A NZ    1 
ATOM   517   N  N     . ASP A 1  67  ? 0.520   33.164  162.687 1.00 157.49 ? 67   ASP A N     1 
ATOM   518   C  CA    . ASP A 1  67  ? 1.090   34.441  163.117 1.00 153.83 ? 67   ASP A CA    1 
ATOM   519   C  C     . ASP A 1  67  ? 2.033   35.052  162.084 1.00 152.48 ? 67   ASP A C     1 
ATOM   520   O  O     . ASP A 1  67  ? 2.922   35.832  162.444 1.00 150.61 ? 67   ASP A O     1 
ATOM   521   C  CB    . ASP A 1  67  ? 1.823   34.288  164.454 1.00 152.21 ? 67   ASP A CB    1 
ATOM   522   C  CG    . ASP A 1  67  ? 0.891   33.943  165.594 1.00 153.01 ? 67   ASP A CG    1 
ATOM   523   O  OD1   . ASP A 1  67  ? -0.135  34.636  165.756 1.00 152.09 ? 67   ASP A OD1   1 
ATOM   524   O  OD2   . ASP A 1  67  ? 1.178   32.966  166.318 1.00 149.31 ? 67   ASP A OD2   1 
ATOM   525   N  N     . SER A 1  68  ? 1.876   34.719  160.806 1.00 160.80 ? 68   SER A N     1 
ATOM   526   C  CA    . SER A 1  68  ? 2.794   35.189  159.781 1.00 157.27 ? 68   SER A CA    1 
ATOM   527   C  C     . SER A 1  68  ? 2.044   35.941  158.687 1.00 157.42 ? 68   SER A C     1 
ATOM   528   O  O     . SER A 1  68  ? 0.834   35.781  158.501 1.00 151.71 ? 68   SER A O     1 
ATOM   529   C  CB    . SER A 1  68  ? 3.595   34.031  159.169 1.00 155.41 ? 68   SER A CB    1 
ATOM   530   O  OG    . SER A 1  68  ? 4.571   34.514  158.259 1.00 148.88 ? 68   SER A OG    1 
ATOM   531   N  N     . THR A 1  69  ? 2.797   36.771  157.963 1.00 155.84 ? 69   THR A N     1 
ATOM   532   C  CA    . THR A 1  69  ? 2.236   37.608  156.910 1.00 159.16 ? 69   THR A CA    1 
ATOM   533   C  C     . THR A 1  69  ? 1.897   36.797  155.662 1.00 160.46 ? 69   THR A C     1 
ATOM   534   O  O     . THR A 1  69  ? 1.112   37.258  154.826 1.00 162.44 ? 69   THR A O     1 
ATOM   535   C  CB    . THR A 1  69  ? 3.215   38.741  156.571 1.00 158.79 ? 69   THR A CB    1 
ATOM   536   O  OG1   . THR A 1  69  ? 3.563   39.441  157.772 1.00 155.54 ? 69   THR A OG1   1 
ATOM   537   C  CG2   . THR A 1  69  ? 2.598   39.739  155.594 1.00 161.51 ? 69   THR A CG2   1 
ATOM   538   N  N     . LYS A 1  70  ? 2.426   35.584  155.542 1.00 159.40 ? 70   LYS A N     1 
ATOM   539   C  CA    . LYS A 1  70  ? 2.505   34.884  154.270 1.00 161.78 ? 70   LYS A CA    1 
ATOM   540   C  C     . LYS A 1  70  ? 1.271   34.015  154.020 1.00 176.41 ? 70   LYS A C     1 
ATOM   541   O  O     . LYS A 1  70  ? 0.503   33.690  154.926 1.00 175.58 ? 70   LYS A O     1 
ATOM   542   C  CB    . LYS A 1  70  ? 3.792   34.056  154.230 1.00 154.07 ? 70   LYS A CB    1 
ATOM   543   C  CG    . LYS A 1  70  ? 4.908   34.690  155.065 1.00 144.44 ? 70   LYS A CG    1 
ATOM   544   C  CD    . LYS A 1  70  ? 6.147   33.821  155.194 1.00 140.01 ? 70   LYS A CD    1 
ATOM   545   C  CE    . LYS A 1  70  ? 7.197   34.521  156.051 1.00 137.66 ? 70   LYS A CE    1 
ATOM   546   N  NZ    . LYS A 1  70  ? 8.563   33.955  155.874 1.00 134.07 ? 70   LYS A NZ    1 
ATOM   547   N  N     . TRP A 1  71  ? 1.108   33.631  152.756 1.00 198.64 ? 71   TRP A N     1 
ATOM   548   C  CA    . TRP A 1  71  ? 0.014   32.794  152.266 1.00 200.23 ? 71   TRP A CA    1 
ATOM   549   C  C     . TRP A 1  71  ? 0.545   31.421  151.872 1.00 201.05 ? 71   TRP A C     1 
ATOM   550   O  O     . TRP A 1  71  ? 1.587   31.320  151.215 1.00 202.50 ? 71   TRP A O     1 
ATOM   551   C  CB    . TRP A 1  71  ? -0.666  33.455  151.067 1.00 202.49 ? 71   TRP A CB    1 
ATOM   552   C  CG    . TRP A 1  71  ? -1.705  34.471  151.421 1.00 202.81 ? 71   TRP A CG    1 
ATOM   553   C  CD1   . TRP A 1  71  ? -1.529  35.820  151.545 1.00 203.84 ? 71   TRP A CD1   1 
ATOM   554   C  CD2   . TRP A 1  71  ? -3.095  34.224  151.649 1.00 201.59 ? 71   TRP A CD2   1 
ATOM   555   N  NE1   . TRP A 1  71  ? -2.720  36.424  151.869 1.00 204.90 ? 71   TRP A NE1   1 
ATOM   556   C  CE2   . TRP A 1  71  ? -3.698  35.465  151.934 1.00 202.77 ? 71   TRP A CE2   1 
ATOM   557   C  CE3   . TRP A 1  71  ? -3.887  33.073  151.651 1.00 200.33 ? 71   TRP A CE3   1 
ATOM   558   C  CZ2   . TRP A 1  71  ? -5.057  35.586  152.219 1.00 203.12 ? 71   TRP A CZ2   1 
ATOM   559   C  CZ3   . TRP A 1  71  ? -5.235  33.194  151.935 1.00 201.17 ? 71   TRP A CZ3   1 
ATOM   560   C  CH2   . TRP A 1  71  ? -5.807  34.441  152.214 1.00 202.86 ? 71   TRP A CH2   1 
ATOM   561   N  N     . ARG A 1  72  ? -0.131  30.366  152.321 1.00 208.72 ? 72   ARG A N     1 
ATOM   562   C  CA    . ARG A 1  72  ? 0.379   29.020  152.143 1.00 205.44 ? 72   ARG A CA    1 
ATOM   563   C  C     . ARG A 1  72  ? -0.579  28.197  151.284 1.00 205.88 ? 72   ARG A C     1 
ATOM   564   O  O     . ARG A 1  72  ? -1.800  28.244  151.479 1.00 204.38 ? 72   ARG A O     1 
ATOM   565   C  CB    . ARG A 1  72  ? 0.590   28.379  153.494 1.00 201.20 ? 72   ARG A CB    1 
ATOM   566   C  CG    . ARG A 1  72  ? 0.860   26.941  153.474 1.00 203.98 ? 72   ARG A CG    1 
ATOM   567   C  CD    . ARG A 1  72  ? 2.340   26.820  153.591 1.00 206.72 ? 72   ARG A CD    1 
ATOM   568   N  NE    . ARG A 1  72  ? 2.733   25.920  154.668 1.00 200.01 ? 72   ARG A NE    1 
ATOM   569   C  CZ    . ARG A 1  72  ? 3.923   25.910  155.268 1.00 194.63 ? 72   ARG A CZ    1 
ATOM   570   N  NH1   . ARG A 1  72  ? 4.892   26.748  154.923 1.00 192.55 ? 72   ARG A NH1   1 
ATOM   571   N  NH2   . ARG A 1  72  ? 4.152   25.027  156.225 1.00 193.08 ? 72   ARG A NH2   1 
ATOM   572   N  N     . LYS A 1  73  ? -0.020  27.447  150.333 1.00 192.55 ? 73   LYS A N     1 
ATOM   573   C  CA    . LYS A 1  73  ? -0.789  26.653  149.380 1.00 179.34 ? 73   LYS A CA    1 
ATOM   574   C  C     . LYS A 1  73  ? -1.123  25.289  149.970 1.00 172.01 ? 73   LYS A C     1 
ATOM   575   O  O     . LYS A 1  73  ? -0.234  24.577  150.448 1.00 172.02 ? 73   LYS A O     1 
ATOM   576   C  CB    . LYS A 1  73  ? -0.001  26.452  148.086 1.00 169.32 ? 73   LYS A CB    1 
ATOM   577   C  CG    . LYS A 1  73  ? -0.745  25.630  147.052 1.00 163.49 ? 73   LYS A CG    1 
ATOM   578   C  CD    . LYS A 1  73  ? 0.216   25.109  146.010 1.00 161.20 ? 73   LYS A CD    1 
ATOM   579   C  CE    . LYS A 1  73  ? -0.493  24.280  144.968 1.00 158.63 ? 73   LYS A CE    1 
ATOM   580   N  NZ    . LYS A 1  73  ? 0.519   23.637  144.104 1.00 158.85 ? 73   LYS A NZ    1 
ATOM   581   N  N     . LEU A 1  74  ? -2.401  24.923  149.921 1.00 166.94 ? 74   LEU A N     1 
ATOM   582   C  CA    . LEU A 1  74  ? -2.844  23.617  150.380 1.00 157.45 ? 74   LEU A CA    1 
ATOM   583   C  C     . LEU A 1  74  ? -3.605  22.936  149.254 1.00 154.31 ? 74   LEU A C     1 
ATOM   584   O  O     . LEU A 1  74  ? -4.424  23.563  148.578 1.00 161.02 ? 74   LEU A O     1 
ATOM   585   C  CB    . LEU A 1  74  ? -3.728  23.753  151.619 1.00 159.36 ? 74   LEU A CB    1 
ATOM   586   C  CG    . LEU A 1  74  ? -2.992  24.060  152.923 1.00 156.53 ? 74   LEU A CG    1 
ATOM   587   C  CD1   . LEU A 1  74  ? -3.961  24.116  154.092 1.00 141.56 ? 74   LEU A CD1   1 
ATOM   588   C  CD2   . LEU A 1  74  ? -1.898  23.036  153.172 1.00 151.57 ? 74   LEU A CD2   1 
ATOM   589   N  N     . VAL A 1  75  ? -3.339  21.646  149.069 1.00 150.04 ? 75   VAL A N     1 
ATOM   590   C  CA    . VAL A 1  75  ? -3.994  20.833  148.052 1.00 144.27 ? 75   VAL A CA    1 
ATOM   591   C  C     . VAL A 1  75  ? -4.947  19.855  148.723 1.00 138.79 ? 75   VAL A C     1 
ATOM   592   O  O     . VAL A 1  75  ? -4.563  19.143  149.659 1.00 132.32 ? 75   VAL A O     1 
ATOM   593   C  CB    . VAL A 1  75  ? -2.968  20.092  147.180 1.00 134.98 ? 75   VAL A CB    1 
ATOM   594   C  CG1   . VAL A 1  75  ? -3.649  19.531  145.950 1.00 134.47 ? 75   VAL A CG1   1 
ATOM   595   C  CG2   . VAL A 1  75  ? -1.832  21.024  146.789 1.00 140.94 ? 75   VAL A CG2   1 
ATOM   596   N  N     . ASP A 1  76  ? -6.187  19.819  148.242 1.00 138.32 ? 76   ASP A N     1 
ATOM   597   C  CA    . ASP A 1  76  ? -7.186  18.869  148.725 1.00 133.22 ? 76   ASP A CA    1 
ATOM   598   C  C     . ASP A 1  76  ? -6.997  17.571  147.951 1.00 123.79 ? 76   ASP A C     1 
ATOM   599   O  O     . ASP A 1  76  ? -7.434  17.440  146.806 1.00 130.37 ? 76   ASP A O     1 
ATOM   600   C  CB    . ASP A 1  76  ? -8.596  19.422  148.556 1.00 140.10 ? 76   ASP A CB    1 
ATOM   601   C  CG    . ASP A 1  76  ? -9.626  18.644  149.355 1.00 131.82 ? 76   ASP A CG    1 
ATOM   602   O  OD1   . ASP A 1  76  ? -9.466  17.416  149.513 1.00 123.51 ? 76   ASP A OD1   1 
ATOM   603   O  OD2   . ASP A 1  76  ? -10.598 19.264  149.828 1.00 138.43 ? 76   ASP A OD2   1 
ATOM   604   N  N     . PHE A 1  77  ? -6.333  16.607  148.585 1.00 123.08 ? 77   PHE A N     1 
ATOM   605   C  CA    . PHE A 1  77  ? -5.900  15.378  147.938 1.00 115.71 ? 77   PHE A CA    1 
ATOM   606   C  C     . PHE A 1  77  ? -6.658  14.147  148.419 1.00 118.89 ? 77   PHE A C     1 
ATOM   607   O  O     . PHE A 1  77  ? -6.230  13.026  148.125 1.00 121.92 ? 77   PHE A O     1 
ATOM   608   C  CB    . PHE A 1  77  ? -4.400  15.175  148.162 1.00 122.02 ? 77   PHE A CB    1 
ATOM   609   C  CG    . PHE A 1  77  ? -3.540  15.685  147.043 1.00 122.52 ? 77   PHE A CG    1 
ATOM   610   C  CD1   . PHE A 1  77  ? -3.908  15.501  145.722 1.00 123.24 ? 77   PHE A CD1   1 
ATOM   611   C  CD2   . PHE A 1  77  ? -2.354  16.346  147.316 1.00 124.30 ? 77   PHE A CD2   1 
ATOM   612   C  CE1   . PHE A 1  77  ? -3.106  15.967  144.696 1.00 138.12 ? 77   PHE A CE1   1 
ATOM   613   C  CE2   . PHE A 1  77  ? -1.553  16.814  146.295 1.00 127.43 ? 77   PHE A CE2   1 
ATOM   614   C  CZ    . PHE A 1  77  ? -1.929  16.625  144.984 1.00 138.31 ? 77   PHE A CZ    1 
ATOM   615   N  N     . ARG A 1  78  ? -7.760  14.322  149.162 1.00 114.51 ? 78   ARG A N     1 
ATOM   616   C  CA    . ARG A 1  78  ? -8.426  13.179  149.789 1.00 114.96 ? 78   ARG A CA    1 
ATOM   617   C  C     . ARG A 1  78  ? -8.812  12.114  148.775 1.00 122.99 ? 78   ARG A C     1 
ATOM   618   O  O     . ARG A 1  78  ? -8.854  10.925  149.113 1.00 124.33 ? 78   ARG A O     1 
ATOM   619   C  CB    . ARG A 1  78  ? -9.672  13.619  150.554 1.00 112.78 ? 78   ARG A CB    1 
ATOM   620   C  CG    . ARG A 1  78  ? -9.387  14.417  151.794 1.00 122.92 ? 78   ARG A CG    1 
ATOM   621   C  CD    . ARG A 1  78  ? -10.661 14.985  152.385 1.00 117.71 ? 78   ARG A CD    1 
ATOM   622   N  NE    . ARG A 1  78  ? -11.287 15.960  151.500 1.00 124.41 ? 78   ARG A NE    1 
ATOM   623   C  CZ    . ARG A 1  78  ? -12.238 16.806  151.879 1.00 138.20 ? 78   ARG A CZ    1 
ATOM   624   N  NH1   . ARG A 1  78  ? -12.669 16.803  153.134 1.00 129.98 ? 78   ARG A NH1   1 
ATOM   625   N  NH2   . ARG A 1  78  ? -12.753 17.662  151.006 1.00 145.79 ? 78   ARG A NH2   1 
ATOM   626   N  N     . GLU A 1  79  ? -9.094  12.511  147.535 1.00 126.02 ? 79   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  79  ? -9.422  11.524  146.514 1.00 127.01 ? 79   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  79  ? -8.186  10.711  146.157 1.00 122.95 ? 79   GLU A C     1 
ATOM   629   O  O     . GLU A 1  79  ? -8.212  9.475   146.182 1.00 120.20 ? 79   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  79  ? -10.004 12.211  145.279 1.00 126.14 ? 79   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  79  ? -10.725 11.258  144.345 1.00 128.42 ? 79   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  79  ? -11.854 10.513  145.037 1.00 130.70 ? 79   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  79  ? -12.103 9.344   144.676 1.00 130.82 ? 79   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  79  ? -12.497 11.097  145.937 1.00 123.12 ? 79   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  80  ? -7.094  11.397  145.815 1.00 112.62 ? 80   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  80  ? -5.807  10.732  145.649 1.00 117.04 ? 80   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  80  ? -5.466  9.892   146.876 1.00 116.34 ? 80   LEU A C     1 
ATOM   638   O  O     . LEU A 1  80  ? -4.962  8.770   146.752 1.00 116.74 ? 80   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  80  ? -4.720  11.776  145.386 1.00 115.88 ? 80   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  80  ? -3.290  11.281  145.175 1.00 113.58 ? 80   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  80  ? -3.270  10.206  144.107 1.00 113.48 ? 80   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  80  ? -2.375  12.433  144.798 1.00 119.33 ? 80   LEU A CD2   1 
ATOM   643   N  N     . ASN A 1  81  ? -5.734  10.430  148.070 1.00 116.89 ? 81   ASN A N     1 
ATOM   644   C  CA    . ASN A 1  81  ? -5.475  9.717   149.321 1.00 111.79 ? 81   ASN A CA    1 
ATOM   645   C  C     . ASN A 1  81  ? -6.149  8.350   149.345 1.00 110.57 ? 81   ASN A C     1 
ATOM   646   O  O     . ASN A 1  81  ? -5.526  7.342   149.698 1.00 107.92 ? 81   ASN A O     1 
ATOM   647   C  CB    . ASN A 1  81  ? -5.947  10.560  150.504 1.00 110.03 ? 81   ASN A CB    1 
ATOM   648   C  CG    . ASN A 1  81  ? -5.080  11.777  150.734 1.00 109.80 ? 81   ASN A CG    1 
ATOM   649   O  OD1   . ASN A 1  81  ? -3.976  11.882  150.197 1.00 102.98 ? 81   ASN A OD1   1 
ATOM   650   N  ND2   . ASN A 1  81  ? -5.584  12.714  151.523 1.00 109.37 ? 81   ASN A ND2   1 
ATOM   651   N  N     . LYS A 1  82  ? -7.437  8.302   148.996 1.00 112.82 ? 82   LYS A N     1 
ATOM   652   C  CA    . LYS A 1  82  ? -8.143  7.025   148.944 1.00 112.08 ? 82   LYS A CA    1 
ATOM   653   C  C     . LYS A 1  82  ? -7.519  6.085   147.921 1.00 113.58 ? 82   LYS A C     1 
ATOM   654   O  O     . LYS A 1  82  ? -7.466  4.868   148.136 1.00 109.10 ? 82   LYS A O     1 
ATOM   655   C  CB    . LYS A 1  82  ? -9.620  7.253   148.625 1.00 107.29 ? 82   LYS A CB    1 
ATOM   656   C  CG    . LYS A 1  82  ? -10.409 7.919   149.740 1.00 116.42 ? 82   LYS A CG    1 
ATOM   657   C  CD    . LYS A 1  82  ? -11.825 8.248   149.287 1.00 118.10 ? 82   LYS A CD    1 
ATOM   658   C  CE    . LYS A 1  82  ? -12.584 9.025   150.350 1.00 106.22 ? 82   LYS A CE    1 
ATOM   659   N  NZ    . LYS A 1  82  ? -13.888 9.527   149.836 1.00 103.48 ? 82   LYS A NZ    1 
ATOM   660   N  N     . ARG A 1  83  ? -7.055  6.626   146.795 1.00 113.34 ? 83   ARG A N     1 
ATOM   661   C  CA    . ARG A 1  83  ? -6.525  5.799   145.717 1.00 112.40 ? 83   ARG A CA    1 
ATOM   662   C  C     . ARG A 1  83  ? -5.056  5.436   145.912 1.00 112.97 ? 83   ARG A C     1 
ATOM   663   O  O     . ARG A 1  83  ? -4.568  4.514   145.250 1.00 112.27 ? 83   ARG A O     1 
ATOM   664   C  CB    . ARG A 1  83  ? -6.699  6.524   144.381 1.00 119.86 ? 83   ARG A CB    1 
ATOM   665   C  CG    . ARG A 1  83  ? -8.129  6.540   143.855 1.00 127.02 ? 83   ARG A CG    1 
ATOM   666   C  CD    . ARG A 1  83  ? -8.504  7.951   143.416 1.00 133.00 ? 83   ARG A CD    1 
ATOM   667   N  NE    . ARG A 1  83  ? -9.942  8.138   143.242 1.00 134.39 ? 83   ARG A NE    1 
ATOM   668   C  CZ    . ARG A 1  83  ? -10.596 7.908   142.109 1.00 132.27 ? 83   ARG A CZ    1 
ATOM   669   N  NH1   . ARG A 1  83  ? -9.943  7.471   141.040 1.00 127.77 ? 83   ARG A NH1   1 
ATOM   670   N  NH2   . ARG A 1  83  ? -11.905 8.112   142.044 1.00 130.24 ? 83   ARG A NH2   1 
ATOM   671   N  N     . THR A 1  84  ? -4.344  6.144   146.786 1.00 117.21 ? 84   THR A N     1 
ATOM   672   C  CA    . THR A 1  84  ? -2.933  5.877   147.039 1.00 113.79 ? 84   THR A CA    1 
ATOM   673   C  C     . THR A 1  84  ? -2.738  4.709   148.004 1.00 108.79 ? 84   THR A C     1 
ATOM   674   O  O     . THR A 1  84  ? -3.538  4.486   148.918 1.00 104.69 ? 84   THR A O     1 
ATOM   675   C  CB    . THR A 1  84  ? -2.247  7.127   147.597 1.00 110.12 ? 84   THR A CB    1 
ATOM   676   O  OG1   . THR A 1  84  ? -2.703  8.283   146.883 1.00 110.74 ? 84   THR A OG1   1 
ATOM   677   C  CG2   . THR A 1  84  ? -0.735  7.023   147.457 1.00 103.78 ? 84   THR A CG2   1 
ATOM   678   N  N     . GLN A 1  85  ? -1.665  3.949   147.766 1.00 102.26 ? 85   GLN A N     1 
ATOM   679   C  CA    . GLN A 1  85  ? -1.218  2.899   148.676 1.00 102.37 ? 85   GLN A CA    1 
ATOM   680   C  C     . GLN A 1  85  ? -1.199  3.391   150.119 1.00 101.46 ? 85   GLN A C     1 
ATOM   681   O  O     . GLN A 1  85  ? -0.916  4.561   150.397 1.00 99.79  ? 85   GLN A O     1 
ATOM   682   C  CB    . GLN A 1  85  ? 0.179   2.406   148.283 1.00 98.32  ? 85   GLN A CB    1 
ATOM   683   C  CG    . GLN A 1  85  ? 1.278   3.448   148.456 1.00 101.67 ? 85   GLN A CG    1 
ATOM   684   C  CD    . GLN A 1  85  ? 2.664   2.836   148.567 1.00 104.55 ? 85   GLN A CD    1 
ATOM   685   O  OE1   . GLN A 1  85  ? 3.450   2.872   147.620 1.00 109.77 ? 85   GLN A OE1   1 
ATOM   686   N  NE2   . GLN A 1  85  ? 2.970   2.273   149.731 1.00 104.48 ? 85   GLN A NE2   1 
ATOM   687   N  N     . ASP A 1  86  ? -1.508  2.488   151.046 1.00 102.25 ? 86   ASP A N     1 
ATOM   688   C  CA    . ASP A 1  86  ? -1.339  2.808   152.454 1.00 94.03  ? 86   ASP A CA    1 
ATOM   689   C  C     . ASP A 1  86  ? 0.142   2.965   152.781 1.00 94.54  ? 86   ASP A C     1 
ATOM   690   O  O     . ASP A 1  86  ? 1.013   2.404   152.111 1.00 90.30  ? 86   ASP A O     1 
ATOM   691   C  CB    . ASP A 1  86  ? -1.944  1.707   153.325 1.00 82.51  ? 86   ASP A CB    1 
ATOM   692   C  CG    . ASP A 1  86  ? -3.455  1.674   153.260 1.00 95.55  ? 86   ASP A CG    1 
ATOM   693   O  OD1   . ASP A 1  86  ? -4.078  2.757   153.264 1.00 95.84  ? 86   ASP A OD1   1 
ATOM   694   O  OD2   . ASP A 1  86  ? -4.019  0.561   153.204 1.00 101.72 ? 86   ASP A OD2   1 
ATOM   695   N  N     . PHE A 1  87  ? 0.424   3.740   153.825 1.00 97.76  ? 87   PHE A N     1 
ATOM   696   C  CA    . PHE A 1  87  ? 1.776   3.916   154.331 1.00 91.01  ? 87   PHE A CA    1 
ATOM   697   C  C     . PHE A 1  87  ? 1.829   3.503   155.793 1.00 93.48  ? 87   PHE A C     1 
ATOM   698   O  O     . PHE A 1  87  ? 0.819   3.557   156.501 1.00 91.37  ? 87   PHE A O     1 
ATOM   699   C  CB    . PHE A 1  87  ? 2.236   5.375   154.205 1.00 93.85  ? 87   PHE A CB    1 
ATOM   700   C  CG    . PHE A 1  87  ? 2.500   5.813   152.796 1.00 95.24  ? 87   PHE A CG    1 
ATOM   701   C  CD1   . PHE A 1  87  ? 3.730   5.579   152.202 1.00 97.93  ? 87   PHE A CD1   1 
ATOM   702   C  CD2   . PHE A 1  87  ? 1.523   6.473   152.070 1.00 89.30  ? 87   PHE A CD2   1 
ATOM   703   C  CE1   . PHE A 1  87  ? 3.976   5.986   150.905 1.00 102.11 ? 87   PHE A CE1   1 
ATOM   704   C  CE2   . PHE A 1  87  ? 1.763   6.882   150.774 1.00 96.29  ? 87   PHE A CE2   1 
ATOM   705   C  CZ    . PHE A 1  87  ? 2.991   6.639   150.190 1.00 101.48 ? 87   PHE A CZ    1 
ATOM   706   N  N     . TRP A 1  88  ? 3.003   3.070   156.244 1.00 89.60  ? 88   TRP A N     1 
ATOM   707   C  CA    . TRP A 1  88  ? 3.234   2.852   157.666 1.00 89.25  ? 88   TRP A CA    1 
ATOM   708   C  C     . TRP A 1  88  ? 3.905   4.088   158.259 1.00 88.55  ? 88   TRP A C     1 
ATOM   709   O  O     . TRP A 1  88  ? 5.007   4.459   157.841 1.00 91.07  ? 88   TRP A O     1 
ATOM   710   C  CB    . TRP A 1  88  ? 4.081   1.610   157.929 1.00 82.67  ? 88   TRP A CB    1 
ATOM   711   C  CG    . TRP A 1  88  ? 4.111   1.310   159.387 1.00 82.47  ? 88   TRP A CG    1 
ATOM   712   C  CD1   . TRP A 1  88  ? 5.111   1.598   160.267 1.00 81.75  ? 88   TRP A CD1   1 
ATOM   713   C  CD2   . TRP A 1  88  ? 3.060   0.711   160.154 1.00 79.89  ? 88   TRP A CD2   1 
ATOM   714   N  NE1   . TRP A 1  88  ? 4.758   1.191   161.532 1.00 79.34  ? 88   TRP A NE1   1 
ATOM   715   C  CE2   . TRP A 1  88  ? 3.502   0.647   161.489 1.00 79.38  ? 88   TRP A CE2   1 
ATOM   716   C  CE3   . TRP A 1  88  ? 1.792   0.213   159.838 1.00 78.05  ? 88   TRP A CE3   1 
ATOM   717   C  CZ2   . TRP A 1  88  ? 2.721   0.104   162.509 1.00 74.39  ? 88   TRP A CZ2   1 
ATOM   718   C  CZ3   . TRP A 1  88  ? 1.020   -0.327  160.849 1.00 66.63  ? 88   TRP A CZ3   1 
ATOM   719   C  CH2   . TRP A 1  88  ? 1.487   -0.380  162.168 1.00 71.40  ? 88   TRP A CH2   1 
ATOM   720   N  N     . GLU A 1  89  ? 3.245   4.717   159.227 1.00 84.74  ? 89   GLU A N     1 
ATOM   721   C  CA    . GLU A 1  89  ? 3.722   5.975   159.786 1.00 81.58  ? 89   GLU A CA    1 
ATOM   722   C  C     . GLU A 1  89  ? 4.874   5.734   160.754 1.00 79.47  ? 89   GLU A C     1 
ATOM   723   O  O     . GLU A 1  89  ? 4.790   4.861   161.623 1.00 86.92  ? 89   GLU A O     1 
ATOM   724   C  CB    . GLU A 1  89  ? 2.580   6.711   160.486 1.00 85.86  ? 89   GLU A CB    1 
ATOM   725   C  CG    . GLU A 1  89  ? 1.371   6.974   159.598 1.00 83.16  ? 89   GLU A CG    1 
ATOM   726   C  CD    . GLU A 1  89  ? 1.663   7.929   158.448 1.00 92.47  ? 89   GLU A CD    1 
ATOM   727   O  OE1   . GLU A 1  89  ? 2.780   8.488   158.380 1.00 92.62  ? 89   GLU A OE1   1 
ATOM   728   O  OE2   . GLU A 1  89  ? 0.772   8.105   157.593 1.00 95.30  ? 89   GLU A OE2   1 
ATOM   729   N  N     . VAL A 1  90  ? 5.962   6.493   160.589 1.00 80.27  ? 90   VAL A N     1 
ATOM   730   C  CA    . VAL A 1  90  ? 7.131   6.338   161.456 1.00 81.21  ? 90   VAL A CA    1 
ATOM   731   C  C     . VAL A 1  90  ? 7.103   7.257   162.673 1.00 81.38  ? 90   VAL A C     1 
ATOM   732   O  O     . VAL A 1  90  ? 7.950   7.107   163.568 1.00 70.54  ? 90   VAL A O     1 
ATOM   733   C  CB    . VAL A 1  90  ? 8.435   6.573   160.670 1.00 79.98  ? 90   VAL A CB    1 
ATOM   734   C  CG1   . VAL A 1  90  ? 8.820   5.320   159.901 1.00 69.40  ? 90   VAL A CG1   1 
ATOM   735   C  CG2   . VAL A 1  90  ? 8.276   7.754   159.729 1.00 91.31  ? 90   VAL A CG2   1 
ATOM   736   N  N     . GLN A 1  91  ? 6.152   8.187   162.747 1.00 83.73  ? 91   GLN A N     1 
ATOM   737   C  CA    . GLN A 1  91  ? 5.975   9.054   163.913 1.00 84.07  ? 91   GLN A CA    1 
ATOM   738   C  C     . GLN A 1  91  ? 5.128   8.340   164.958 1.00 82.34  ? 91   GLN A C     1 
ATOM   739   O  O     . GLN A 1  91  ? 3.903   8.262   164.838 1.00 79.03  ? 91   GLN A O     1 
ATOM   740   C  CB    . GLN A 1  91  ? 5.342   10.383  163.514 1.00 86.71  ? 91   GLN A CB    1 
ATOM   741   C  CG    . GLN A 1  91  ? 5.331   11.433  164.628 1.00 87.75  ? 91   GLN A CG    1 
ATOM   742   C  CD    . GLN A 1  91  ? 6.719   11.877  165.061 1.00 91.08  ? 91   GLN A CD    1 
ATOM   743   O  OE1   . GLN A 1  91  ? 7.620   12.035  164.241 1.00 91.83  ? 91   GLN A OE1   1 
ATOM   744   N  NE2   . GLN A 1  91  ? 6.896   12.076  166.362 1.00 89.00  ? 91   GLN A NE2   1 
ATOM   745   N  N     . LEU A 1  92  ? 5.785   7.816   165.994 1.00 76.57  ? 92   LEU A N     1 
ATOM   746   C  CA    . LEU A 1  92  ? 5.152   6.885   166.918 1.00 69.46  ? 92   LEU A CA    1 
ATOM   747   C  C     . LEU A 1  92  ? 4.588   7.584   168.147 1.00 80.23  ? 92   LEU A C     1 
ATOM   748   O  O     . LEU A 1  92  ? 3.641   7.077   168.758 1.00 90.50  ? 92   LEU A O     1 
ATOM   749   C  CB    . LEU A 1  92  ? 6.139   5.797   167.350 1.00 61.95  ? 92   LEU A CB    1 
ATOM   750   C  CG    . LEU A 1  92  ? 6.950   5.082   166.268 1.00 64.50  ? 92   LEU A CG    1 
ATOM   751   C  CD1   . LEU A 1  92  ? 7.620   3.847   166.849 1.00 62.63  ? 92   LEU A CD1   1 
ATOM   752   C  CD2   . LEU A 1  92  ? 6.079   4.708   165.081 1.00 63.17  ? 92   LEU A CD2   1 
ATOM   753   N  N     . GLY A 1  93  ? 5.146   8.733   168.520 1.00 82.21  ? 93   GLY A N     1 
ATOM   754   C  CA    . GLY A 1  93  ? 4.723   9.452   169.707 1.00 81.62  ? 93   GLY A CA    1 
ATOM   755   C  C     . GLY A 1  93  ? 5.257   10.865  169.633 1.00 84.47  ? 93   GLY A C     1 
ATOM   756   O  O     . GLY A 1  93  ? 5.889   11.259  168.651 1.00 89.40  ? 93   GLY A O     1 
ATOM   757   N  N     . ILE A 1  94  ? 4.995   11.635  170.679 1.00 84.35  ? 94   ILE A N     1 
ATOM   758   C  CA    . ILE A 1  94  ? 5.386   13.043  170.738 1.00 79.79  ? 94   ILE A CA    1 
ATOM   759   C  C     . ILE A 1  94  ? 6.458   13.222  171.804 1.00 91.08  ? 94   ILE A C     1 
ATOM   760   O  O     . ILE A 1  94  ? 6.253   12.803  172.950 1.00 94.01  ? 94   ILE A O     1 
ATOM   761   C  CB    . ILE A 1  94  ? 4.182   13.960  171.029 1.00 68.57  ? 94   ILE A CB    1 
ATOM   762   C  CG1   . ILE A 1  94  ? 2.987   13.596  170.144 1.00 80.41  ? 94   ILE A CG1   1 
ATOM   763   C  CG2   . ILE A 1  94  ? 4.561   15.416  170.830 1.00 71.09  ? 94   ILE A CG2   1 
ATOM   764   C  CD1   . ILE A 1  94  ? 3.321   13.463  168.667 1.00 88.20  ? 94   ILE A CD1   1 
ATOM   765   N  N     . PRO A 1  95  ? 7.608   13.810  171.467 1.00 83.46  ? 95   PRO A N     1 
ATOM   766   C  CA    . PRO A 1  95  ? 8.625   14.118  172.483 1.00 77.58  ? 95   PRO A CA    1 
ATOM   767   C  C     . PRO A 1  95  ? 8.048   14.985  173.593 1.00 77.39  ? 95   PRO A C     1 
ATOM   768   O  O     . PRO A 1  95  ? 7.201   15.848  173.351 1.00 76.58  ? 95   PRO A O     1 
ATOM   769   C  CB    . PRO A 1  95  ? 9.711   14.862  171.695 1.00 81.40  ? 95   PRO A CB    1 
ATOM   770   C  CG    . PRO A 1  95  ? 9.451   14.565  170.262 1.00 87.30  ? 95   PRO A CG    1 
ATOM   771   C  CD    . PRO A 1  95  ? 7.996   14.257  170.119 1.00 83.76  ? 95   PRO A CD    1 
ATOM   772   N  N     . HIS A 1  96  ? 8.503   14.750  174.822 1.00 81.75  ? 96   HIS A N     1 
ATOM   773   C  CA    . HIS A 1  96  ? 8.002   15.527  175.946 1.00 86.82  ? 96   HIS A CA    1 
ATOM   774   C  C     . HIS A 1  96  ? 9.175   16.162  176.684 1.00 91.66  ? 96   HIS A C     1 
ATOM   775   O  O     . HIS A 1  96  ? 10.185  15.485  176.950 1.00 86.05  ? 96   HIS A O     1 
ATOM   776   C  CB    . HIS A 1  96  ? 7.171   14.676  176.914 1.00 91.72  ? 96   HIS A CB    1 
ATOM   777   C  CG    . HIS A 1  96  ? 6.326   15.489  177.848 1.00 88.06  ? 96   HIS A CG    1 
ATOM   778   N  ND1   . HIS A 1  96  ? 6.789   15.953  179.060 1.00 87.89  ? 96   HIS A ND1   1 
ATOM   779   C  CD2   . HIS A 1  96  ? 5.050   15.931  177.739 1.00 87.20  ? 96   HIS A CD2   1 
ATOM   780   C  CE1   . HIS A 1  96  ? 5.835   16.643  179.659 1.00 88.47  ? 96   HIS A CE1   1 
ATOM   781   N  NE2   . HIS A 1  96  ? 4.769   16.644  178.879 1.00 78.00  ? 96   HIS A NE2   1 
ATOM   782   N  N     . PRO A 1  97  ? 9.080   17.452  177.022 1.00 85.45  ? 97   PRO A N     1 
ATOM   783   C  CA    . PRO A 1  97  ? 10.199  18.154  177.674 1.00 82.45  ? 97   PRO A CA    1 
ATOM   784   C  C     . PRO A 1  97  ? 10.766  17.445  178.890 1.00 80.77  ? 97   PRO A C     1 
ATOM   785   O  O     . PRO A 1  97  ? 11.966  17.574  179.160 1.00 85.93  ? 97   PRO A O     1 
ATOM   786   C  CB    . PRO A 1  97  ? 9.587   19.513  178.051 1.00 90.45  ? 97   PRO A CB    1 
ATOM   787   C  CG    . PRO A 1  97  ? 8.103   19.385  177.794 1.00 89.69  ? 97   PRO A CG    1 
ATOM   788   C  CD    . PRO A 1  97  ? 7.969   18.365  176.722 1.00 88.61  ? 97   PRO A CD    1 
ATOM   789   N  N     . ALA A 1  98  ? 9.955   16.692  179.627 1.00 76.37  ? 98   ALA A N     1 
ATOM   790   C  CA    . ALA A 1  98  ? 10.435  16.090  180.862 1.00 77.68  ? 98   ALA A CA    1 
ATOM   791   C  C     . ALA A 1  98  ? 11.298  14.864  180.611 1.00 71.59  ? 98   ALA A C     1 
ATOM   792   O  O     . ALA A 1  98  ? 11.838  14.296  181.567 1.00 60.62  ? 98   ALA A O     1 
ATOM   793   C  CB    . ALA A 1  98  ? 9.253   15.718  181.761 1.00 79.89  ? 98   ALA A CB    1 
ATOM   794   N  N     . GLY A 1  99  ? 11.430  14.445  179.356 1.00 84.03  ? 99   GLY A N     1 
ATOM   795   C  CA    . GLY A 1  99  ? 12.334  13.379  178.978 1.00 82.37  ? 99   GLY A CA    1 
ATOM   796   C  C     . GLY A 1  99  ? 13.717  13.868  178.597 1.00 85.84  ? 99   GLY A C     1 
ATOM   797   O  O     . GLY A 1  99  ? 14.674  13.088  178.595 1.00 86.61  ? 99   GLY A O     1 
ATOM   798   N  N     . LEU A 1  100 ? 13.833  15.152  178.258 1.00 92.98  ? 100  LEU A N     1 
ATOM   799   C  CA    . LEU A 1  100 ? 15.137  15.743  177.979 1.00 95.62  ? 100  LEU A CA    1 
ATOM   800   C  C     . LEU A 1  100 ? 16.015  15.807  179.224 1.00 98.21  ? 100  LEU A C     1 
ATOM   801   O  O     . LEU A 1  100 ? 15.546  16.116  180.323 1.00 95.50  ? 100  LEU A O     1 
ATOM   802   C  CB    . LEU A 1  100 ? 14.962  17.153  177.414 1.00 81.35  ? 100  LEU A CB    1 
ATOM   803   C  CG    . LEU A 1  100 ? 13.824  17.359  176.414 1.00 80.94  ? 100  LEU A CG    1 
ATOM   804   C  CD1   . LEU A 1  100 ? 13.528  18.842  176.240 1.00 78.73  ? 100  LEU A CD1   1 
ATOM   805   C  CD2   . LEU A 1  100 ? 14.155  16.711  175.079 1.00 84.79  ? 100  LEU A CD2   1 
ATOM   806   N  N     . LYS A 1  101 ? 17.302  15.517  179.037 1.00 86.52  ? 101  LYS A N     1 
ATOM   807   C  CA    . LYS A 1  101 ? 18.336  15.847  180.004 1.00 90.28  ? 101  LYS A CA    1 
ATOM   808   C  C     . LYS A 1  101 ? 18.762  17.306  179.850 1.00 100.48 ? 101  LYS A C     1 
ATOM   809   O  O     . LYS A 1  101 ? 18.477  17.961  178.844 1.00 99.04  ? 101  LYS A O     1 
ATOM   810   C  CB    . LYS A 1  101 ? 19.549  14.935  179.821 1.00 88.32  ? 101  LYS A CB    1 
ATOM   811   C  CG    . LYS A 1  101 ? 19.315  13.484  180.202 1.00 83.62  ? 101  LYS A CG    1 
ATOM   812   C  CD    . LYS A 1  101 ? 20.401  12.597  179.606 1.00 89.81  ? 101  LYS A CD    1 
ATOM   813   C  CE    . LYS A 1  101 ? 19.849  11.250  179.167 1.00 92.77  ? 101  LYS A CE    1 
ATOM   814   N  NZ    . LYS A 1  101 ? 20.916  10.215  179.066 1.00 76.78  ? 101  LYS A NZ    1 
ATOM   815   N  N     . LYS A 1  102 ? 19.463  17.814  180.863 1.00 110.87 ? 102  LYS A N     1 
ATOM   816   C  CA    . LYS A 1  102 ? 19.906  19.202  180.840 1.00 115.83 ? 102  LYS A CA    1 
ATOM   817   C  C     . LYS A 1  102 ? 21.127  19.327  179.941 1.00 113.48 ? 102  LYS A C     1 
ATOM   818   O  O     . LYS A 1  102 ? 22.055  18.516  180.027 1.00 108.27 ? 102  LYS A O     1 
ATOM   819   C  CB    . LYS A 1  102 ? 20.249  19.713  182.238 1.00 119.42 ? 102  LYS A CB    1 
ATOM   820   C  CG    . LYS A 1  102 ? 20.443  21.226  182.259 1.00 124.12 ? 102  LYS A CG    1 
ATOM   821   C  CD    . LYS A 1  102 ? 21.322  21.695  183.404 1.00 130.26 ? 102  LYS A CD    1 
ATOM   822   C  CE    . LYS A 1  102 ? 21.683  23.167  183.236 1.00 128.84 ? 102  LYS A CE    1 
ATOM   823   N  NZ    . LYS A 1  102 ? 22.808  23.378  182.281 1.00 123.71 ? 102  LYS A NZ    1 
ATOM   824   N  N     . LYS A 1  103 ? 21.130  20.337  179.077 1.00 118.76 ? 103  LYS A N     1 
ATOM   825   C  CA    . LYS A 1  103 ? 22.258  20.575  178.193 1.00 119.92 ? 103  LYS A CA    1 
ATOM   826   C  C     . LYS A 1  103 ? 22.842  21.954  178.473 1.00 122.48 ? 103  LYS A C     1 
ATOM   827   O  O     . LYS A 1  103 ? 22.105  22.925  178.677 1.00 118.95 ? 103  LYS A O     1 
ATOM   828   C  CB    . LYS A 1  103 ? 21.842  20.441  176.727 1.00 114.88 ? 103  LYS A CB    1 
ATOM   829   C  CG    . LYS A 1  103 ? 21.589  18.994  176.317 1.00 112.87 ? 103  LYS A CG    1 
ATOM   830   C  CD    . LYS A 1  103 ? 22.817  18.122  176.551 1.00 114.41 ? 103  LYS A CD    1 
ATOM   831   C  CE    . LYS A 1  103 ? 22.449  16.643  176.578 1.00 102.50 ? 103  LYS A CE    1 
ATOM   832   N  NZ    . LYS A 1  103 ? 23.534  15.798  177.151 1.00 95.54  ? 103  LYS A NZ    1 
ATOM   833   N  N     . LYS A 1  104 ? 24.176  22.019  178.496 1.00 123.65 ? 104  LYS A N     1 
ATOM   834   C  CA    . LYS A 1  104 ? 24.884  23.296  178.548 1.00 127.38 ? 104  LYS A CA    1 
ATOM   835   C  C     . LYS A 1  104 ? 24.503  24.209  177.386 1.00 129.64 ? 104  LYS A C     1 
ATOM   836   O  O     . LYS A 1  104 ? 24.181  25.386  177.586 1.00 129.83 ? 104  LYS A O     1 
ATOM   837   C  CB    . LYS A 1  104 ? 26.391  23.037  178.570 1.00 126.02 ? 104  LYS A CB    1 
ATOM   838   C  CG    . LYS A 1  104 ? 27.257  24.253  178.310 1.00 130.19 ? 104  LYS A CG    1 
ATOM   839   C  CD    . LYS A 1  104 ? 28.628  23.840  177.799 1.00 134.39 ? 104  LYS A CD    1 
ATOM   840   C  CE    . LYS A 1  104 ? 29.288  22.809  178.703 1.00 132.76 ? 104  LYS A CE    1 
ATOM   841   N  NZ    . LYS A 1  104 ? 30.770  22.958  178.724 1.00 132.96 ? 104  LYS A NZ    1 
ATOM   842   N  N     . SER A 1  105 ? 24.541  23.688  176.161 1.00 135.39 ? 105  SER A N     1 
ATOM   843   C  CA    . SER A 1  105 ? 24.266  24.467  174.959 1.00 130.62 ? 105  SER A CA    1 
ATOM   844   C  C     . SER A 1  105 ? 23.123  23.832  174.180 1.00 123.75 ? 105  SER A C     1 
ATOM   845   O  O     . SER A 1  105 ? 23.106  22.614  173.973 1.00 125.18 ? 105  SER A O     1 
ATOM   846   C  CB    . SER A 1  105 ? 25.516  24.587  174.082 1.00 136.89 ? 105  SER A CB    1 
ATOM   847   O  OG    . SER A 1  105 ? 26.468  25.456  174.675 1.00 128.51 ? 105  SER A OG    1 
ATOM   848   N  N     . VAL A 1  106 ? 22.177  24.661  173.746 1.00 107.41 ? 106  VAL A N     1 
ATOM   849   C  CA    . VAL A 1  106 ? 20.974  24.199  173.064 1.00 110.24 ? 106  VAL A CA    1 
ATOM   850   C  C     . VAL A 1  106 ? 20.708  25.099  171.866 1.00 116.32 ? 106  VAL A C     1 
ATOM   851   O  O     . VAL A 1  106 ? 20.892  26.318  171.939 1.00 116.98 ? 106  VAL A O     1 
ATOM   852   C  CB    . VAL A 1  106 ? 19.763  24.186  174.023 1.00 108.60 ? 106  VAL A CB    1 
ATOM   853   C  CG1   . VAL A 1  106 ? 18.450  24.090  173.255 1.00 109.40 ? 106  VAL A CG1   1 
ATOM   854   C  CG2   . VAL A 1  106 ? 19.885  23.043  175.015 1.00 119.62 ? 106  VAL A CG2   1 
ATOM   855   N  N     . THR A 1  107 ? 20.291  24.494  170.754 1.00 118.15 ? 107  THR A N     1 
ATOM   856   C  CA    . THR A 1  107 ? 19.810  25.239  169.602 1.00 114.84 ? 107  THR A CA    1 
ATOM   857   C  C     . THR A 1  107 ? 18.498  24.624  169.139 1.00 111.24 ? 107  THR A C     1 
ATOM   858   O  O     . THR A 1  107 ? 18.294  23.410  169.232 1.00 110.95 ? 107  THR A O     1 
ATOM   859   C  CB    . THR A 1  107 ? 20.833  25.225  168.458 1.00 116.06 ? 107  THR A CB    1 
ATOM   860   O  OG1   . THR A 1  107 ? 22.139  25.497  168.981 1.00 117.87 ? 107  THR A OG1   1 
ATOM   861   C  CG2   . THR A 1  107 ? 20.489  26.275  167.421 1.00 121.32 ? 107  THR A CG2   1 
ATOM   862   N  N     . VAL A 1  108 ? 17.611  25.474  168.629 1.00 112.12 ? 108  VAL A N     1 
ATOM   863   C  CA    . VAL A 1  108 ? 16.380  25.051  167.971 1.00 113.72 ? 108  VAL A CA    1 
ATOM   864   C  C     . VAL A 1  108 ? 16.278  25.721  166.610 1.00 119.32 ? 108  VAL A C     1 
ATOM   865   O  O     . VAL A 1  108 ? 16.191  26.952  166.530 1.00 127.53 ? 108  VAL A O     1 
ATOM   866   C  CB    . VAL A 1  108 ? 15.132  25.370  168.811 1.00 107.31 ? 108  VAL A CB    1 
ATOM   867   C  CG1   . VAL A 1  108 ? 13.880  24.925  168.076 1.00 101.67 ? 108  VAL A CG1   1 
ATOM   868   C  CG2   . VAL A 1  108 ? 15.215  24.693  170.167 1.00 110.88 ? 108  VAL A CG2   1 
ATOM   869   N  N     . LEU A 1  109 ? 16.293  24.927  165.543 1.00 112.82 ? 109  LEU A N     1 
ATOM   870   C  CA    . LEU A 1  109 ? 16.158  25.481  164.207 1.00 115.80 ? 109  LEU A CA    1 
ATOM   871   C  C     . LEU A 1  109 ? 15.143  24.640  163.447 1.00 110.51 ? 109  LEU A C     1 
ATOM   872   O  O     . LEU A 1  109 ? 14.946  23.457  163.739 1.00 109.66 ? 109  LEU A O     1 
ATOM   873   C  CB    . LEU A 1  109 ? 17.504  25.526  163.453 1.00 121.12 ? 109  LEU A CB    1 
ATOM   874   C  CG    . LEU A 1  109 ? 18.588  24.477  163.727 1.00 116.06 ? 109  LEU A CG    1 
ATOM   875   C  CD1   . LEU A 1  109 ? 18.187  23.100  163.223 1.00 119.65 ? 109  LEU A CD1   1 
ATOM   876   C  CD2   . LEU A 1  109 ? 19.908  24.910  163.105 1.00 109.37 ? 109  LEU A CD2   1 
ATOM   877   N  N     . ASP A 1  110 ? 14.492  25.270  162.475 1.00 115.08 ? 110  ASP A N     1 
ATOM   878   C  CA    . ASP A 1  110 ? 13.504  24.613  161.635 1.00 116.42 ? 110  ASP A CA    1 
ATOM   879   C  C     . ASP A 1  110 ? 13.956  24.558  160.182 1.00 121.87 ? 110  ASP A C     1 
ATOM   880   O  O     . ASP A 1  110 ? 14.524  25.523  159.660 1.00 115.69 ? 110  ASP A O     1 
ATOM   881   C  CB    . ASP A 1  110 ? 12.160  25.331  161.747 1.00 111.72 ? 110  ASP A CB    1 
ATOM   882   C  CG    . ASP A 1  110 ? 11.028  24.530  161.162 1.00 117.02 ? 110  ASP A CG    1 
ATOM   883   O  OD1   . ASP A 1  110 ? 10.549  24.901  160.074 1.00 116.70 ? 110  ASP A OD1   1 
ATOM   884   O  OD2   . ASP A 1  110 ? 10.627  23.526  161.788 1.00 124.66 ? 110  ASP A OD2   1 
ATOM   885   N  N     . VAL A 1  111 ? 13.703  23.420  159.533 1.00 119.13 ? 111  VAL A N     1 
ATOM   886   C  CA    . VAL A 1  111 ? 13.905  23.325  158.094 1.00 118.57 ? 111  VAL A CA    1 
ATOM   887   C  C     . VAL A 1  111 ? 12.853  24.173  157.391 1.00 122.66 ? 111  VAL A C     1 
ATOM   888   O  O     . VAL A 1  111 ? 11.670  24.167  157.764 1.00 121.73 ? 111  VAL A O     1 
ATOM   889   C  CB    . VAL A 1  111 ? 13.844  21.855  157.644 1.00 118.32 ? 111  VAL A CB    1 
ATOM   890   C  CG1   . VAL A 1  111 ? 13.465  21.746  156.172 1.00 120.39 ? 111  VAL A CG1   1 
ATOM   891   C  CG2   . VAL A 1  111 ? 15.171  21.163  157.914 1.00 116.91 ? 111  VAL A CG2   1 
ATOM   892   N  N     . GLY A 1  112 ? 13.276  24.918  156.371 1.00 134.57 ? 112  GLY A N     1 
ATOM   893   C  CA    . GLY A 1  112 ? 12.388  25.817  155.656 1.00 127.30 ? 112  GLY A CA    1 
ATOM   894   C  C     . GLY A 1  112 ? 11.858  25.191  154.379 1.00 126.67 ? 112  GLY A C     1 
ATOM   895   O  O     . GLY A 1  112 ? 12.617  24.613  153.596 1.00 126.62 ? 112  GLY A O     1 
ATOM   896   N  N     . ASP A 1  113 ? 10.549  25.334  154.174 1.00 120.20 ? 113  ASP A N     1 
ATOM   897   C  CA    . ASP A 1  113 ? 9.818   24.667  153.095 1.00 127.18 ? 113  ASP A CA    1 
ATOM   898   C  C     . ASP A 1  113 ? 10.202  23.186  153.001 1.00 133.32 ? 113  ASP A C     1 
ATOM   899   O  O     . ASP A 1  113 ? 10.884  22.736  152.081 1.00 134.79 ? 113  ASP A O     1 
ATOM   900   C  CB    . ASP A 1  113 ? 10.032  25.401  151.769 1.00 127.80 ? 113  ASP A CB    1 
ATOM   901   C  CG    . ASP A 1  113 ? 8.920   26.389  151.475 1.00 124.52 ? 113  ASP A CG    1 
ATOM   902   O  OD1   . ASP A 1  113 ? 7.738   25.987  151.534 1.00 122.18 ? 113  ASP A OD1   1 
ATOM   903   O  OD2   . ASP A 1  113 ? 9.223   27.567  151.197 1.00 124.82 ? 113  ASP A OD2   1 
ATOM   904   N  N     . ALA A 1  114 ? 9.736   22.443  154.006 1.00 130.49 ? 114  ALA A N     1 
ATOM   905   C  CA    . ALA A 1  114 ? 10.145  21.052  154.180 1.00 127.99 ? 114  ALA A CA    1 
ATOM   906   C  C     . ALA A 1  114 ? 9.688   20.181  153.013 1.00 127.52 ? 114  ALA A C     1 
ATOM   907   O  O     . ALA A 1  114 ? 10.510  19.599  152.297 1.00 124.06 ? 114  ALA A O     1 
ATOM   908   C  CB    . ALA A 1  114 ? 9.591   20.522  155.501 1.00 131.04 ? 114  ALA A CB    1 
ATOM   909   N  N     . TYR A 1  115 ? 8.370   20.075  152.815 1.00 134.04 ? 115  TYR A N     1 
ATOM   910   C  CA    . TYR A 1  115 ? 7.826   19.172  151.801 1.00 134.93 ? 115  TYR A CA    1 
ATOM   911   C  C     . TYR A 1  115 ? 8.363   19.478  150.410 1.00 134.60 ? 115  TYR A C     1 
ATOM   912   O  O     . TYR A 1  115 ? 8.573   18.560  149.609 1.00 131.86 ? 115  TYR A O     1 
ATOM   913   C  CB    . TYR A 1  115 ? 6.296   19.212  151.799 1.00 140.67 ? 115  TYR A CB    1 
ATOM   914   C  CG    . TYR A 1  115 ? 5.641   18.622  153.029 1.00 140.66 ? 115  TYR A CG    1 
ATOM   915   C  CD1   . TYR A 1  115 ? 6.401   18.068  154.053 1.00 132.01 ? 115  TYR A CD1   1 
ATOM   916   C  CD2   . TYR A 1  115 ? 4.259   18.580  153.144 1.00 131.16 ? 115  TYR A CD2   1 
ATOM   917   C  CE1   . TYR A 1  115 ? 5.804   17.519  155.166 1.00 122.02 ? 115  TYR A CE1   1 
ATOM   918   C  CE2   . TYR A 1  115 ? 3.654   18.028  154.252 1.00 131.75 ? 115  TYR A CE2   1 
ATOM   919   C  CZ    . TYR A 1  115 ? 4.430   17.500  155.260 1.00 126.87 ? 115  TYR A CZ    1 
ATOM   920   O  OH    . TYR A 1  115 ? 3.829   16.953  156.368 1.00 125.71 ? 115  TYR A OH    1 
ATOM   921   N  N     . PHE A 1  116 ? 8.595   20.749  150.106 1.00 129.84 ? 116  PHE A N     1 
ATOM   922   C  CA    . PHE A 1  116 ? 9.001   21.157  148.770 1.00 125.49 ? 116  PHE A CA    1 
ATOM   923   C  C     . PHE A 1  116 ? 10.487  20.960  148.510 1.00 123.86 ? 116  PHE A C     1 
ATOM   924   O  O     . PHE A 1  116 ? 10.949  21.250  147.403 1.00 130.10 ? 116  PHE A O     1 
ATOM   925   C  CB    . PHE A 1  116 ? 8.607   22.617  148.526 1.00 122.49 ? 116  PHE A CB    1 
ATOM   926   C  CG    . PHE A 1  116 ? 7.151   22.902  148.776 1.00 127.32 ? 116  PHE A CG    1 
ATOM   927   C  CD1   . PHE A 1  116 ? 6.198   21.903  148.638 1.00 129.07 ? 116  PHE A CD1   1 
ATOM   928   C  CD2   . PHE A 1  116 ? 6.736   24.161  149.173 1.00 131.60 ? 116  PHE A CD2   1 
ATOM   929   C  CE1   . PHE A 1  116 ? 4.859   22.160  148.871 1.00 130.49 ? 116  PHE A CE1   1 
ATOM   930   C  CE2   . PHE A 1  116 ? 5.400   24.422  149.416 1.00 131.61 ? 116  PHE A CE2   1 
ATOM   931   C  CZ    . PHE A 1  116 ? 4.460   23.421  149.261 1.00 129.90 ? 116  PHE A CZ    1 
ATOM   932   N  N     . SER A 1  117 ? 11.243  20.464  149.484 1.00 117.82 ? 117  SER A N     1 
ATOM   933   C  CA    . SER A 1  117 ? 12.647  20.135  149.292 1.00 111.02 ? 117  SER A CA    1 
ATOM   934   C  C     . SER A 1  117 ? 12.899  18.643  149.090 1.00 107.67 ? 117  SER A C     1 
ATOM   935   O  O     . SER A 1  117 ? 14.061  18.229  149.029 1.00 108.40 ? 117  SER A O     1 
ATOM   936   C  CB    . SER A 1  117 ? 13.468  20.650  150.473 1.00 117.20 ? 117  SER A CB    1 
ATOM   937   O  OG    . SER A 1  117 ? 12.931  21.860  150.977 1.00 118.41 ? 117  SER A OG    1 
ATOM   938   N  N     . VAL A 1  118 ? 11.853  17.826  148.987 1.00 106.39 ? 118  VAL A N     1 
ATOM   939   C  CA    . VAL A 1  118 ? 12.045  16.386  148.822 1.00 115.10 ? 118  VAL A CA    1 
ATOM   940   C  C     . VAL A 1  118 ? 11.343  15.926  147.548 1.00 121.94 ? 118  VAL A C     1 
ATOM   941   O  O     . VAL A 1  118 ? 10.107  15.960  147.468 1.00 120.51 ? 118  VAL A O     1 
ATOM   942   C  CB    . VAL A 1  118 ? 11.535  15.613  150.049 1.00 121.75 ? 118  VAL A CB    1 
ATOM   943   C  CG1   . VAL A 1  118 ? 11.466  14.119  149.753 1.00 121.17 ? 118  VAL A CG1   1 
ATOM   944   C  CG2   . VAL A 1  118 ? 12.429  15.882  151.250 1.00 118.82 ? 118  VAL A CG2   1 
ATOM   945   N  N     . PRO A 1  119 ? 12.095  15.457  146.551 1.00 113.74 ? 119  PRO A N     1 
ATOM   946   C  CA    . PRO A 1  119 ? 11.517  15.120  145.237 1.00 114.85 ? 119  PRO A CA    1 
ATOM   947   C  C     . PRO A 1  119 ? 10.538  13.955  145.288 1.00 119.93 ? 119  PRO A C     1 
ATOM   948   O  O     . PRO A 1  119 ? 10.880  12.852  145.721 1.00 124.57 ? 119  PRO A O     1 
ATOM   949   C  CB    . PRO A 1  119 ? 12.749  14.784  144.388 1.00 123.68 ? 119  PRO A CB    1 
ATOM   950   C  CG    . PRO A 1  119 ? 13.767  14.357  145.374 1.00 117.85 ? 119  PRO A CG    1 
ATOM   951   C  CD    . PRO A 1  119 ? 13.542  15.193  146.598 1.00 112.66 ? 119  PRO A CD    1 
ATOM   952   N  N     . LEU A 1  120 ? 9.308   14.220  144.852 1.00 115.02 ? 120  LEU A N     1 
ATOM   953   C  CA    . LEU A 1  120 ? 8.285   13.196  144.684 1.00 119.29 ? 120  LEU A CA    1 
ATOM   954   C  C     . LEU A 1  120 ? 8.768   12.086  143.748 1.00 129.71 ? 120  LEU A C     1 
ATOM   955   O  O     . LEU A 1  120 ? 9.671   12.271  142.928 1.00 135.22 ? 120  LEU A O     1 
ATOM   956   C  CB    . LEU A 1  120 ? 7.000   13.817  144.133 1.00 119.17 ? 120  LEU A CB    1 
ATOM   957   C  CG    . LEU A 1  120 ? 5.697   13.020  144.244 1.00 124.04 ? 120  LEU A CG    1 
ATOM   958   C  CD1   . LEU A 1  120 ? 5.427   12.604  145.681 1.00 115.80 ? 120  LEU A CD1   1 
ATOM   959   C  CD2   . LEU A 1  120 ? 4.531   13.817  143.680 1.00 126.92 ? 120  LEU A CD2   1 
ATOM   960   N  N     . ASP A 1  121 ? 8.149   10.914  143.886 1.00 129.87 ? 121  ASP A N     1 
ATOM   961   C  CA    . ASP A 1  121 ? 8.393   9.818   142.956 1.00 132.11 ? 121  ASP A CA    1 
ATOM   962   C  C     . ASP A 1  121 ? 8.020   10.245  141.540 1.00 137.49 ? 121  ASP A C     1 
ATOM   963   O  O     . ASP A 1  121 ? 6.935   10.787  141.309 1.00 137.07 ? 121  ASP A O     1 
ATOM   964   C  CB    . ASP A 1  121 ? 7.593   8.583   143.374 1.00 131.00 ? 121  ASP A CB    1 
ATOM   965   C  CG    . ASP A 1  121 ? 7.620   7.487   142.326 1.00 130.43 ? 121  ASP A CG    1 
ATOM   966   O  OD1   . ASP A 1  121 ? 8.696   6.887   142.122 1.00 128.49 ? 121  ASP A OD1   1 
ATOM   967   O  OD2   . ASP A 1  121 ? 6.565   7.226   141.709 1.00 128.91 ? 121  ASP A OD2   1 
ATOM   968   N  N     . GLU A 1  122 ? 8.941   10.009  140.601 1.00 142.28 ? 122  GLU A N     1 
ATOM   969   C  CA    . GLU A 1  122 ? 8.779   10.456  139.218 1.00 140.99 ? 122  GLU A CA    1 
ATOM   970   C  C     . GLU A 1  122 ? 7.422   10.081  138.630 1.00 141.89 ? 122  GLU A C     1 
ATOM   971   O  O     . GLU A 1  122 ? 6.688   10.945  138.138 1.00 144.99 ? 122  GLU A O     1 
ATOM   972   C  CB    . GLU A 1  122 ? 9.902   9.872   138.358 1.00 145.23 ? 122  GLU A CB    1 
ATOM   973   C  CG    . GLU A 1  122 ? 9.840   10.263  136.888 1.00 150.69 ? 122  GLU A CG    1 
ATOM   974   C  CD    . GLU A 1  122 ? 11.194  10.189  136.208 1.00 151.26 ? 122  GLU A CD    1 
ATOM   975   O  OE1   . GLU A 1  122 ? 12.142  9.663   136.826 1.00 150.73 ? 122  GLU A OE1   1 
ATOM   976   O  OE2   . GLU A 1  122 ? 11.309  10.651  135.053 1.00 155.68 ? 122  GLU A OE2   1 
ATOM   977   N  N     . ASP A 1  123 ? 7.070   8.795   138.671 1.00 141.63 ? 123  ASP A N     1 
ATOM   978   C  CA    . ASP A 1  123 ? 5.841   8.354   138.016 1.00 142.39 ? 123  ASP A CA    1 
ATOM   979   C  C     . ASP A 1  123 ? 4.591   8.891   138.703 1.00 143.26 ? 123  ASP A C     1 
ATOM   980   O  O     . ASP A 1  123 ? 3.574   9.121   138.038 1.00 145.04 ? 123  ASP A O     1 
ATOM   981   C  CB    . ASP A 1  123 ? 5.791   6.827   137.970 1.00 141.21 ? 123  ASP A CB    1 
ATOM   982   C  CG    . ASP A 1  123 ? 7.151   6.206   137.722 1.00 139.49 ? 123  ASP A CG    1 
ATOM   983   O  OD1   . ASP A 1  123 ? 8.164   6.798   138.149 1.00 135.60 ? 123  ASP A OD1   1 
ATOM   984   O  OD2   . ASP A 1  123 ? 7.206   5.126   137.099 1.00 141.01 ? 123  ASP A OD2   1 
ATOM   985   N  N     . PHE A 1  124 ? 4.644   9.104   140.018 1.00 139.46 ? 124  PHE A N     1 
ATOM   986   C  CA    . PHE A 1  124 ? 3.460   9.543   140.749 1.00 135.27 ? 124  PHE A CA    1 
ATOM   987   C  C     . PHE A 1  124 ? 3.135   11.013  140.506 1.00 136.89 ? 124  PHE A C     1 
ATOM   988   O  O     . PHE A 1  124 ? 2.000   11.433  140.758 1.00 139.72 ? 124  PHE A O     1 
ATOM   989   C  CB    . PHE A 1  124 ? 3.656   9.273   142.242 1.00 130.17 ? 124  PHE A CB    1 
ATOM   990   C  CG    . PHE A 1  124 ? 2.375   9.216   143.022 1.00 121.63 ? 124  PHE A CG    1 
ATOM   991   C  CD1   . PHE A 1  124 ? 1.685   8.021   143.146 1.00 115.63 ? 124  PHE A CD1   1 
ATOM   992   C  CD2   . PHE A 1  124 ? 1.869   10.345  143.644 1.00 120.07 ? 124  PHE A CD2   1 
ATOM   993   C  CE1   . PHE A 1  124 ? 0.507   7.954   143.863 1.00 116.13 ? 124  PHE A CE1   1 
ATOM   994   C  CE2   . PHE A 1  124 ? 0.690   10.284  144.364 1.00 119.19 ? 124  PHE A CE2   1 
ATOM   995   C  CZ    . PHE A 1  124 ? 0.010   9.086   144.474 1.00 119.03 ? 124  PHE A CZ    1 
ATOM   996   N  N     . ARG A 1  125 ? 4.106   11.793  140.026 1.00 138.61 ? 125  ARG A N     1 
ATOM   997   C  CA    . ARG A 1  125 ? 3.964   13.245  139.923 1.00 133.65 ? 125  ARG A CA    1 
ATOM   998   C  C     . ARG A 1  125 ? 2.713   13.651  139.145 1.00 137.08 ? 125  ARG A C     1 
ATOM   999   O  O     . ARG A 1  125 ? 1.996   14.576  139.543 1.00 133.98 ? 125  ARG A O     1 
ATOM   1000  C  CB    . ARG A 1  125 ? 5.218   13.826  139.266 1.00 133.06 ? 125  ARG A CB    1 
ATOM   1001  C  CG    . ARG A 1  125 ? 6.472   13.716  140.128 1.00 131.12 ? 125  ARG A CG    1 
ATOM   1002  C  CD    . ARG A 1  125 ? 7.677   14.404  139.495 1.00 130.56 ? 125  ARG A CD    1 
ATOM   1003  N  NE    . ARG A 1  125 ? 8.929   13.767  139.905 1.00 126.30 ? 125  ARG A NE    1 
ATOM   1004  C  CZ    . ARG A 1  125 ? 9.999   14.420  140.347 1.00 120.71 ? 125  ARG A CZ    1 
ATOM   1005  N  NH1   . ARG A 1  125 ? 9.987   15.742  140.429 1.00 117.42 ? 125  ARG A NH1   1 
ATOM   1006  N  NH2   . ARG A 1  125 ? 11.088  13.749  140.699 1.00 117.99 ? 125  ARG A NH2   1 
ATOM   1007  N  N     . LYS A 1  126 ? 2.446   12.968  138.027 1.00 144.73 ? 126  LYS A N     1 
ATOM   1008  C  CA    . LYS A 1  126 ? 1.299   13.278  137.172 1.00 147.32 ? 126  LYS A CA    1 
ATOM   1009  C  C     . LYS A 1  126 ? -0.038  13.267  137.914 1.00 146.39 ? 126  LYS A C     1 
ATOM   1010  O  O     . LYS A 1  126 ? -0.968  13.973  137.506 1.00 150.19 ? 126  LYS A O     1 
ATOM   1011  C  CB    . LYS A 1  126 ? 1.274   12.318  135.981 1.00 146.06 ? 126  LYS A CB    1 
ATOM   1012  C  CG    . LYS A 1  126 ? 0.320   11.147  136.104 1.00 145.13 ? 126  LYS A CG    1 
ATOM   1013  C  CD    . LYS A 1  126 ? 0.692   10.058  135.109 1.00 144.78 ? 126  LYS A CD    1 
ATOM   1014  C  CE    . LYS A 1  126 ? 2.172   9.711   135.206 1.00 141.10 ? 126  LYS A CE    1 
ATOM   1015  N  NZ    . LYS A 1  126 ? 2.499   8.418   134.545 1.00 135.63 ? 126  LYS A NZ    1 
ATOM   1016  N  N     . TYR A 1  127 ? -0.169  12.491  138.994 1.00 144.25 ? 127  TYR A N     1 
ATOM   1017  C  CA    . TYR A 1  127 ? -1.452  12.430  139.693 1.00 142.61 ? 127  TYR A CA    1 
ATOM   1018  C  C     . TYR A 1  127 ? -1.678  13.616  140.621 1.00 141.98 ? 127  TYR A C     1 
ATOM   1019  O  O     . TYR A 1  127 ? -2.819  13.853  141.034 1.00 139.92 ? 127  TYR A O     1 
ATOM   1020  C  CB    . TYR A 1  127 ? -1.584  11.125  140.484 1.00 131.95 ? 127  TYR A CB    1 
ATOM   1021  C  CG    . TYR A 1  127 ? -1.302  9.882   139.674 1.00 131.62 ? 127  TYR A CG    1 
ATOM   1022  C  CD1   . TYR A 1  127 ? -2.291  9.314   138.881 1.00 133.08 ? 127  TYR A CD1   1 
ATOM   1023  C  CD2   . TYR A 1  127 ? -0.056  9.273   139.703 1.00 135.88 ? 127  TYR A CD2   1 
ATOM   1024  C  CE1   . TYR A 1  127 ? -2.044  8.178   138.135 1.00 135.96 ? 127  TYR A CE1   1 
ATOM   1025  C  CE2   . TYR A 1  127 ? 0.200   8.135   138.962 1.00 133.75 ? 127  TYR A CE2   1 
ATOM   1026  C  CZ    . TYR A 1  127 ? -0.797  7.592   138.180 1.00 134.28 ? 127  TYR A CZ    1 
ATOM   1027  O  OH    . TYR A 1  127 ? -0.546  6.457   137.443 1.00 137.67 ? 127  TYR A OH    1 
ATOM   1028  N  N     . THR A 1  128 ? -0.629  14.362  140.953 1.00 142.41 ? 128  THR A N     1 
ATOM   1029  C  CA    . THR A 1  128 ? -0.753  15.553  141.783 1.00 143.43 ? 128  THR A CA    1 
ATOM   1030  C  C     . THR A 1  128 ? -1.290  16.744  141.000 1.00 152.26 ? 128  THR A C     1 
ATOM   1031  O  O     . THR A 1  128 ? -1.426  17.832  141.571 1.00 149.12 ? 128  THR A O     1 
ATOM   1032  C  CB    . THR A 1  128 ? 0.597   15.911  142.412 1.00 141.31 ? 128  THR A CB    1 
ATOM   1033  O  OG1   . THR A 1  128 ? 1.594   16.018  141.388 1.00 139.01 ? 128  THR A OG1   1 
ATOM   1034  C  CG2   . THR A 1  128 ? 1.015   14.845  143.415 1.00 133.21 ? 128  THR A CG2   1 
ATOM   1035  N  N     . ALA A 1  129 ? -1.569  16.553  139.708 1.00 165.80 ? 129  ALA A N     1 
ATOM   1036  C  CA    . ALA A 1  129 ? -1.970  17.632  138.812 1.00 170.08 ? 129  ALA A CA    1 
ATOM   1037  C  C     . ALA A 1  129 ? -3.131  18.438  139.381 1.00 172.10 ? 129  ALA A C     1 
ATOM   1038  O  O     . ALA A 1  129 ? -4.055  17.894  139.992 1.00 168.26 ? 129  ALA A O     1 
ATOM   1039  C  CB    . ALA A 1  129 ? -2.347  17.061  137.444 1.00 171.51 ? 129  ALA A CB    1 
ATOM   1040  N  N     . PHE A 1  130 ? -3.064  19.752  139.174 1.00 170.77 ? 130  PHE A N     1 
ATOM   1041  C  CA    . PHE A 1  130 ? -4.079  20.684  139.639 1.00 174.14 ? 130  PHE A CA    1 
ATOM   1042  C  C     . PHE A 1  130 ? -4.139  21.870  138.686 1.00 181.08 ? 130  PHE A C     1 
ATOM   1043  O  O     . PHE A 1  130 ? -3.263  22.063  137.840 1.00 176.70 ? 130  PHE A O     1 
ATOM   1044  C  CB    . PHE A 1  130 ? -3.779  21.192  141.054 1.00 167.06 ? 130  PHE A CB    1 
ATOM   1045  C  CG    . PHE A 1  130 ? -2.517  22.007  141.143 1.00 163.29 ? 130  PHE A CG    1 
ATOM   1046  C  CD1   . PHE A 1  130 ? -1.272  21.400  141.098 1.00 157.97 ? 130  PHE A CD1   1 
ATOM   1047  C  CD2   . PHE A 1  130 ? -2.578  23.389  141.223 1.00 162.24 ? 130  PHE A CD2   1 
ATOM   1048  C  CE1   . PHE A 1  130 ? -0.118  22.153  141.166 1.00 147.27 ? 130  PHE A CE1   1 
ATOM   1049  C  CE2   . PHE A 1  130 ? -1.428  24.146  141.287 1.00 154.83 ? 130  PHE A CE2   1 
ATOM   1050  C  CZ    . PHE A 1  130 ? -0.198  23.529  141.253 1.00 150.02 ? 130  PHE A CZ    1 
ATOM   1051  N  N     . THR A 1  131 ? -5.193  22.670  138.838 1.00 202.78 ? 131  THR A N     1 
ATOM   1052  C  CA    . THR A 1  131 ? -5.521  23.758  137.925 1.00 206.00 ? 131  THR A CA    1 
ATOM   1053  C  C     . THR A 1  131 ? -5.854  24.957  138.797 1.00 206.58 ? 131  THR A C     1 
ATOM   1054  O  O     . THR A 1  131 ? -6.625  24.830  139.754 1.00 206.94 ? 131  THR A O     1 
ATOM   1055  C  CB    . THR A 1  131 ? -6.707  23.415  137.014 1.00 208.11 ? 131  THR A CB    1 
ATOM   1056  O  OG1   . THR A 1  131 ? -7.840  23.057  137.816 1.00 207.51 ? 131  THR A OG1   1 
ATOM   1057  C  CG2   . THR A 1  131 ? -6.369  22.253  136.102 1.00 202.77 ? 131  THR A CG2   1 
ATOM   1058  N  N     . ILE A 1  132 ? -5.290  26.115  138.471 1.00 185.06 ? 132  ILE A N     1 
ATOM   1059  C  CA    . ILE A 1  132 ? -5.606  27.352  139.173 1.00 174.06 ? 132  ILE A CA    1 
ATOM   1060  C  C     . ILE A 1  132 ? -6.188  28.393  138.224 1.00 183.00 ? 132  ILE A C     1 
ATOM   1061  O  O     . ILE A 1  132 ? -5.571  28.720  137.206 1.00 185.81 ? 132  ILE A O     1 
ATOM   1062  C  CB    . ILE A 1  132 ? -4.375  27.925  139.896 1.00 159.94 ? 132  ILE A CB    1 
ATOM   1063  C  CG1   . ILE A 1  132 ? -4.696  29.315  140.451 1.00 152.10 ? 132  ILE A CG1   1 
ATOM   1064  C  CG2   . ILE A 1  132 ? -3.155  27.944  138.977 1.00 156.65 ? 132  ILE A CG2   1 
ATOM   1065  C  CD1   . ILE A 1  132 ? -3.585  29.918  141.263 1.00 146.86 ? 132  ILE A CD1   1 
ATOM   1066  N  N     . PRO A 1  133 ? -7.379  28.918  138.508 1.00 184.83 ? 133  PRO A N     1 
ATOM   1067  C  CA    . PRO A 1  133 ? -8.006  29.908  137.620 1.00 191.18 ? 133  PRO A CA    1 
ATOM   1068  C  C     . PRO A 1  133 ? -7.150  31.162  137.531 1.00 199.42 ? 133  PRO A C     1 
ATOM   1069  O  O     . PRO A 1  133 ? -6.902  31.837  138.533 1.00 192.67 ? 133  PRO A O     1 
ATOM   1070  C  CB    . PRO A 1  133 ? -9.362  30.178  138.284 1.00 192.91 ? 133  PRO A CB    1 
ATOM   1071  C  CG    . PRO A 1  133 ? -9.591  29.015  139.195 1.00 186.62 ? 133  PRO A CG    1 
ATOM   1072  C  CD    . PRO A 1  133 ? -8.234  28.595  139.661 1.00 181.87 ? 133  PRO A CD    1 
ATOM   1073  N  N     . SER A 1  134 ? -6.681  31.457  136.318 1.00 220.46 ? 134  SER A N     1 
ATOM   1074  C  CA    . SER A 1  134 ? -5.685  32.507  136.114 1.00 222.91 ? 134  SER A CA    1 
ATOM   1075  C  C     . SER A 1  134 ? -6.229  33.791  136.732 1.00 226.17 ? 134  SER A C     1 
ATOM   1076  O  O     . SER A 1  134 ? -5.598  34.372  137.622 1.00 226.35 ? 134  SER A O     1 
ATOM   1077  C  CB    . SER A 1  134 ? -5.297  32.596  134.640 1.00 220.00 ? 134  SER A CB    1 
ATOM   1078  O  OG    . SER A 1  134 ? -6.339  33.172  133.889 1.00 220.92 ? 134  SER A OG    1 
ATOM   1079  N  N     . ILE A 1  135 ? -7.398  34.249  136.280 1.00 213.38 ? 135  ILE A N     1 
ATOM   1080  C  CA    . ILE A 1  135 ? -8.016  35.438  136.862 1.00 202.26 ? 135  ILE A CA    1 
ATOM   1081  C  C     . ILE A 1  135 ? -9.516  35.276  137.077 1.00 202.42 ? 135  ILE A C     1 
ATOM   1082  O  O     . ILE A 1  135 ? -10.334 35.841  136.344 1.00 198.24 ? 135  ILE A O     1 
ATOM   1083  C  CB    . ILE A 1  135 ? -7.742  36.612  135.899 1.00 197.21 ? 135  ILE A CB    1 
ATOM   1084  C  CG1   . ILE A 1  135 ? -7.446  36.097  134.485 1.00 204.57 ? 135  ILE A CG1   1 
ATOM   1085  C  CG2   . ILE A 1  135 ? -6.603  37.481  136.418 1.00 186.40 ? 135  ILE A CG2   1 
ATOM   1086  C  CD1   . ILE A 1  135 ? -6.601  37.030  133.639 1.00 195.10 ? 135  ILE A CD1   1 
ATOM   1087  N  N     . ASN A 1  136 ? -9.868  34.515  138.119 1.00 203.18 ? 136  ASN A N     1 
ATOM   1088  C  CA    . ASN A 1  136 ? -11.250 34.294  138.558 1.00 204.05 ? 136  ASN A CA    1 
ATOM   1089  C  C     . ASN A 1  136 ? -12.126 33.743  137.435 1.00 207.15 ? 136  ASN A C     1 
ATOM   1090  O  O     . ASN A 1  136 ? -13.215 34.252  137.160 1.00 208.72 ? 136  ASN A O     1 
ATOM   1091  C  CB    . ASN A 1  136 ? -11.851 35.585  139.124 1.00 204.06 ? 136  ASN A CB    1 
ATOM   1092  C  CG    . ASN A 1  136 ? -12.944 35.326  140.147 1.00 202.31 ? 136  ASN A CG    1 
ATOM   1093  O  OD1   . ASN A 1  136 ? -12.844 35.746  141.299 1.00 196.42 ? 136  ASN A OD1   1 
ATOM   1094  N  ND2   . ASN A 1  136 ? -13.992 34.627  139.729 1.00 204.36 ? 136  ASN A ND2   1 
ATOM   1095  N  N     . ASN A 1  137 ? -11.632 32.692  136.779 1.00 203.82 ? 137  ASN A N     1 
ATOM   1096  C  CA    . ASN A 1  137 ? -12.370 31.995  135.725 1.00 200.43 ? 137  ASN A CA    1 
ATOM   1097  C  C     . ASN A 1  137 ? -12.676 32.928  134.559 1.00 204.04 ? 137  ASN A C     1 
ATOM   1098  O  O     . ASN A 1  137 ? -13.661 32.747  133.839 1.00 199.69 ? 137  ASN A O     1 
ATOM   1099  C  CB    . ASN A 1  137 ? -13.650 31.348  136.265 1.00 195.05 ? 137  ASN A CB    1 
ATOM   1100  C  CG    . ASN A 1  137 ? -13.455 30.732  137.638 1.00 193.05 ? 137  ASN A CG    1 
ATOM   1101  O  OD1   . ASN A 1  137 ? -12.865 29.659  137.771 1.00 189.28 ? 137  ASN A OD1   1 
ATOM   1102  N  ND2   . ASN A 1  137 ? -13.950 31.409  138.666 1.00 194.49 ? 137  ASN A ND2   1 
ATOM   1103  N  N     . GLU A 1  138 ? -11.817 33.928  134.365 1.00 205.83 ? 138  GLU A N     1 
ATOM   1104  C  CA    . GLU A 1  138 ? -11.860 34.761  133.169 1.00 205.59 ? 138  GLU A CA    1 
ATOM   1105  C  C     . GLU A 1  138 ? -11.198 34.015  132.017 1.00 206.06 ? 138  GLU A C     1 
ATOM   1106  O  O     . GLU A 1  138 ? -11.806 33.816  130.961 1.00 203.39 ? 138  GLU A O     1 
ATOM   1107  C  CB    . GLU A 1  138 ? -11.239 36.134  133.457 1.00 207.16 ? 138  GLU A CB    1 
ATOM   1108  C  CG    . GLU A 1  138 ? -10.898 37.006  132.267 1.00 210.68 ? 138  GLU A CG    1 
ATOM   1109  C  CD    . GLU A 1  138 ? -9.815  38.020  132.592 1.00 211.62 ? 138  GLU A CD    1 
ATOM   1110  O  OE1   . GLU A 1  138 ? -9.876  38.615  133.690 1.00 211.20 ? 138  GLU A OE1   1 
ATOM   1111  O  OE2   . GLU A 1  138 ? -8.923  38.245  131.748 1.00 212.92 ? 138  GLU A OE2   1 
ATOM   1112  N  N     . THR A 1  139 ? -9.953  33.602  132.199 1.00 211.83 ? 139  THR A N     1 
ATOM   1113  C  CA    . THR A 1  139 ? -9.240  32.827  131.203 1.00 209.59 ? 139  THR A CA    1 
ATOM   1114  C  C     . THR A 1  139 ? -9.077  31.400  131.730 1.00 206.20 ? 139  THR A C     1 
ATOM   1115  O  O     . THR A 1  139 ? -9.292  31.139  132.918 1.00 205.73 ? 139  THR A O     1 
ATOM   1116  C  CB    . THR A 1  139 ? -7.870  33.460  130.919 1.00 207.20 ? 139  THR A CB    1 
ATOM   1117  O  OG1   . THR A 1  139 ? -7.134  33.574  132.138 1.00 206.08 ? 139  THR A OG1   1 
ATOM   1118  C  CG2   . THR A 1  139 ? -8.037  34.846  130.324 1.00 205.07 ? 139  THR A CG2   1 
ATOM   1119  N  N     . PRO A 1  140 ? -8.718  30.429  130.853 1.00 194.30 ? 140  PRO A N     1 
ATOM   1120  C  CA    . PRO A 1  140 ? -8.610  29.023  131.286 1.00 186.98 ? 140  PRO A CA    1 
ATOM   1121  C  C     . PRO A 1  140 ? -7.894  28.775  132.607 1.00 190.29 ? 140  PRO A C     1 
ATOM   1122  O  O     . PRO A 1  140 ? -8.408  28.071  133.482 1.00 180.92 ? 140  PRO A O     1 
ATOM   1123  C  CB    . PRO A 1  140 ? -7.857  28.358  130.121 1.00 177.79 ? 140  PRO A CB    1 
ATOM   1124  C  CG    . PRO A 1  140 ? -7.502  29.476  129.156 1.00 175.49 ? 140  PRO A CG    1 
ATOM   1125  C  CD    . PRO A 1  140 ? -8.512  30.540  129.402 1.00 183.23 ? 140  PRO A CD    1 
ATOM   1126  N  N     . GLY A 1  141 ? -6.709  29.347  132.756 1.00 198.46 ? 141  GLY A N     1 
ATOM   1127  C  CA    . GLY A 1  141 ? -5.809  29.028  133.847 1.00 193.92 ? 141  GLY A CA    1 
ATOM   1128  C  C     . GLY A 1  141 ? -4.739  28.053  133.395 1.00 191.67 ? 141  GLY A C     1 
ATOM   1129  O  O     . GLY A 1  141 ? -4.731  27.561  132.263 1.00 193.21 ? 141  GLY A O     1 
ATOM   1130  N  N     . ILE A 1  142 ? -3.819  27.761  134.308 1.00 171.24 ? 142  ILE A N     1 
ATOM   1131  C  CA    . ILE A 1  142 ? -2.683  26.902  134.001 1.00 168.67 ? 142  ILE A CA    1 
ATOM   1132  C  C     . ILE A 1  142 ? -2.733  25.629  134.838 1.00 169.52 ? 142  ILE A C     1 
ATOM   1133  O  O     . ILE A 1  142 ? -3.059  25.661  136.030 1.00 168.78 ? 142  ILE A O     1 
ATOM   1134  C  CB    . ILE A 1  142 ? -1.345  27.641  134.190 1.00 164.96 ? 142  ILE A CB    1 
ATOM   1135  C  CG1   . ILE A 1  142 ? -1.358  28.943  133.389 1.00 165.63 ? 142  ILE A CG1   1 
ATOM   1136  C  CG2   . ILE A 1  142 ? -0.211  26.785  133.651 1.00 165.16 ? 142  ILE A CG2   1 
ATOM   1137  C  CD1   . ILE A 1  142 ? 0.015   29.512  133.095 1.00 161.77 ? 142  ILE A CD1   1 
ATOM   1138  N  N     . ARG A 1  143 ? -2.400  24.514  134.197 1.00 169.32 ? 143  ARG A N     1 
ATOM   1139  C  CA    . ARG A 1  143 ? -2.311  23.194  134.802 1.00 169.14 ? 143  ARG A CA    1 
ATOM   1140  C  C     . ARG A 1  143 ? -0.898  23.025  135.349 1.00 165.01 ? 143  ARG A C     1 
ATOM   1141  O  O     . ARG A 1  143 ? 0.062   23.560  134.789 1.00 165.07 ? 143  ARG A O     1 
ATOM   1142  C  CB    . ARG A 1  143 ? -2.604  22.109  133.765 1.00 166.48 ? 143  ARG A CB    1 
ATOM   1143  C  CG    . ARG A 1  143 ? -4.070  21.758  133.573 1.00 167.93 ? 143  ARG A CG    1 
ATOM   1144  C  CD    . ARG A 1  143 ? -4.226  20.350  133.024 1.00 169.91 ? 143  ARG A CD    1 
ATOM   1145  N  NE    . ARG A 1  143 ? -5.593  19.843  133.091 1.00 176.71 ? 143  ARG A NE    1 
ATOM   1146  C  CZ    . ARG A 1  143 ? -6.056  19.061  134.058 1.00 168.93 ? 143  ARG A CZ    1 
ATOM   1147  N  NH1   . ARG A 1  143 ? -5.255  18.687  135.043 1.00 169.04 ? 143  ARG A NH1   1 
ATOM   1148  N  NH2   . ARG A 1  143 ? -7.315  18.644  134.034 1.00 163.09 ? 143  ARG A NH2   1 
ATOM   1149  N  N     . TYR A 1  144 ? -0.764  22.281  136.446 1.00 163.52 ? 144  TYR A N     1 
ATOM   1150  C  CA    . TYR A 1  144 ? 0.558   22.143  137.038 1.00 156.05 ? 144  TYR A CA    1 
ATOM   1151  C  C     . TYR A 1  144 ? 0.652   20.790  137.725 1.00 151.99 ? 144  TYR A C     1 
ATOM   1152  O  O     . TYR A 1  144 ? -0.357  20.199  138.111 1.00 156.68 ? 144  TYR A O     1 
ATOM   1153  C  CB    . TYR A 1  144 ? 0.822   23.253  138.058 1.00 155.10 ? 144  TYR A CB    1 
ATOM   1154  C  CG    . TYR A 1  144 ? 1.214   24.560  137.432 1.00 155.67 ? 144  TYR A CG    1 
ATOM   1155  C  CD1   . TYR A 1  144 ? 2.451   24.738  136.837 1.00 160.12 ? 144  TYR A CD1   1 
ATOM   1156  C  CD2   . TYR A 1  144 ? 0.327   25.626  137.442 1.00 156.74 ? 144  TYR A CD2   1 
ATOM   1157  C  CE1   . TYR A 1  144 ? 2.787   25.945  136.258 1.00 166.15 ? 144  TYR A CE1   1 
ATOM   1158  C  CE2   . TYR A 1  144 ? 0.655   26.827  136.882 1.00 161.14 ? 144  TYR A CE2   1 
ATOM   1159  C  CZ    . TYR A 1  144 ? 1.880   26.984  136.283 1.00 168.20 ? 144  TYR A CZ    1 
ATOM   1160  O  OH    . TYR A 1  144 ? 2.191   28.195  135.711 1.00 174.40 ? 144  TYR A OH    1 
ATOM   1161  N  N     . GLN A 1  145 ? 1.884   20.311  137.888 1.00 149.94 ? 145  GLN A N     1 
ATOM   1162  C  CA    . GLN A 1  145 ? 2.152   19.110  138.664 1.00 144.87 ? 145  GLN A CA    1 
ATOM   1163  C  C     . GLN A 1  145 ? 3.267   19.341  139.674 1.00 146.22 ? 145  GLN A C     1 
ATOM   1164  O  O     . GLN A 1  145 ? 4.160   20.167  139.467 1.00 147.28 ? 145  GLN A O     1 
ATOM   1165  C  CB    . GLN A 1  145 ? 2.539   17.944  137.737 1.00 137.19 ? 145  GLN A CB    1 
ATOM   1166  C  CG    . GLN A 1  145 ? 3.968   18.032  137.206 1.00 134.20 ? 145  GLN A CG    1 
ATOM   1167  C  CD    . GLN A 1  145 ? 4.381   16.820  136.394 1.00 134.32 ? 145  GLN A CD    1 
ATOM   1168  O  OE1   . GLN A 1  145 ? 3.575   15.926  136.137 1.00 134.95 ? 145  GLN A OE1   1 
ATOM   1169  N  NE2   . GLN A 1  145 ? 5.645   16.785  135.984 1.00 129.07 ? 145  GLN A NE2   1 
ATOM   1170  N  N     . TYR A 1  146 ? 3.183   18.613  140.785 1.00 137.82 ? 146  TYR A N     1 
ATOM   1171  C  CA    . TYR A 1  146 ? 4.162   18.731  141.854 1.00 134.10 ? 146  TYR A CA    1 
ATOM   1172  C  C     . TYR A 1  146 ? 5.413   17.916  141.552 1.00 128.16 ? 146  TYR A C     1 
ATOM   1173  O  O     . TYR A 1  146 ? 5.340   16.801  141.028 1.00 124.82 ? 146  TYR A O     1 
ATOM   1174  C  CB    . TYR A 1  146 ? 3.568   18.259  143.183 1.00 131.46 ? 146  TYR A CB    1 
ATOM   1175  C  CG    . TYR A 1  146 ? 3.045   19.350  144.092 1.00 130.89 ? 146  TYR A CG    1 
ATOM   1176  C  CD1   . TYR A 1  146 ? 3.893   19.989  144.990 1.00 125.98 ? 146  TYR A CD1   1 
ATOM   1177  C  CD2   . TYR A 1  146 ? 1.710   19.730  144.067 1.00 131.99 ? 146  TYR A CD2   1 
ATOM   1178  C  CE1   . TYR A 1  146 ? 3.428   20.979  145.833 1.00 131.23 ? 146  TYR A CE1   1 
ATOM   1179  C  CE2   . TYR A 1  146 ? 1.235   20.721  144.909 1.00 133.38 ? 146  TYR A CE2   1 
ATOM   1180  C  CZ    . TYR A 1  146 ? 2.100   21.342  145.789 1.00 134.34 ? 146  TYR A CZ    1 
ATOM   1181  O  OH    . TYR A 1  146 ? 1.638   22.329  146.629 1.00 135.77 ? 146  TYR A OH    1 
ATOM   1182  N  N     . ASN A 1  147 ? 6.563   18.485  141.901 1.00 128.75 ? 147  ASN A N     1 
ATOM   1183  C  CA    . ASN A 1  147 ? 7.865   17.860  141.719 1.00 128.31 ? 147  ASN A CA    1 
ATOM   1184  C  C     . ASN A 1  147 ? 8.404   17.335  143.035 1.00 124.17 ? 147  ASN A C     1 
ATOM   1185  O  O     . ASN A 1  147 ? 9.448   16.674  143.054 1.00 121.63 ? 147  ASN A O     1 
ATOM   1186  C  CB    . ASN A 1  147 ? 8.871   18.850  141.118 1.00 137.32 ? 147  ASN A CB    1 
ATOM   1187  C  CG    . ASN A 1  147 ? 8.686   19.041  139.628 1.00 137.18 ? 147  ASN A CG    1 
ATOM   1188  O  OD1   . ASN A 1  147 ? 7.792   18.454  139.020 1.00 136.80 ? 147  ASN A OD1   1 
ATOM   1189  N  ND2   . ASN A 1  147 ? 9.539   19.864  139.029 1.00 136.93 ? 147  ASN A ND2   1 
ATOM   1190  N  N     . VAL A 1  148 ? 7.704   17.629  144.124 1.00 127.46 ? 148  VAL A N     1 
ATOM   1191  C  CA    . VAL A 1  148 ? 8.087   17.295  145.480 1.00 125.25 ? 148  VAL A CA    1 
ATOM   1192  C  C     . VAL A 1  148 ? 6.836   16.863  146.237 1.00 126.11 ? 148  VAL A C     1 
ATOM   1193  O  O     . VAL A 1  148 ? 5.734   16.821  145.684 1.00 124.68 ? 148  VAL A O     1 
ATOM   1194  C  CB    . VAL A 1  148 ? 8.764   18.488  146.175 1.00 124.02 ? 148  VAL A CB    1 
ATOM   1195  C  CG1   . VAL A 1  148 ? 10.152  18.708  145.604 1.00 123.06 ? 148  VAL A CG1   1 
ATOM   1196  C  CG2   . VAL A 1  148 ? 7.921   19.720  145.922 1.00 128.80 ? 148  VAL A CG2   1 
ATOM   1197  N  N     . LEU A 1  149 ? 7.013   16.540  147.513 1.00 129.28 ? 149  LEU A N     1 
ATOM   1198  C  CA    . LEU A 1  149 ? 5.898   16.144  148.366 1.00 115.92 ? 149  LEU A CA    1 
ATOM   1199  C  C     . LEU A 1  149 ? 4.899   17.287  148.514 1.00 113.48 ? 149  LEU A C     1 
ATOM   1200  O  O     . LEU A 1  149 ? 5.272   18.370  148.988 1.00 118.62 ? 149  LEU A O     1 
ATOM   1201  C  CB    . LEU A 1  149 ? 6.410   15.712  149.736 1.00 116.99 ? 149  LEU A CB    1 
ATOM   1202  C  CG    . LEU A 1  149 ? 7.624   14.785  149.722 1.00 111.03 ? 149  LEU A CG    1 
ATOM   1203  C  CD1   . LEU A 1  149 ? 8.029   14.427  151.133 1.00 115.68 ? 149  LEU A CD1   1 
ATOM   1204  C  CD2   . LEU A 1  149 ? 7.318   13.530  148.925 1.00 119.94 ? 149  LEU A CD2   1 
ATOM   1205  N  N     . PRO A 1  150 ? 3.645   17.108  148.100 1.00 116.25 ? 150  PRO A N     1 
ATOM   1206  C  CA    . PRO A 1  150 ? 2.660   18.188  148.219 1.00 127.88 ? 150  PRO A CA    1 
ATOM   1207  C  C     . PRO A 1  150 ? 1.890   18.154  149.531 1.00 132.65 ? 150  PRO A C     1 
ATOM   1208  O  O     . PRO A 1  150 ? 1.503   17.097  150.033 1.00 127.08 ? 150  PRO A O     1 
ATOM   1209  C  CB    . PRO A 1  150 ? 1.718   17.912  147.041 1.00 128.20 ? 150  PRO A CB    1 
ATOM   1210  C  CG    . PRO A 1  150 ? 1.774   16.428  146.877 1.00 121.33 ? 150  PRO A CG    1 
ATOM   1211  C  CD    . PRO A 1  150 ? 3.155   15.990  147.277 1.00 116.86 ? 150  PRO A CD    1 
ATOM   1212  N  N     . GLN A 1  151 ? 1.688   19.341  150.100 1.00 151.11 ? 151  GLN A N     1 
ATOM   1213  C  CA    . GLN A 1  151 ? 0.796   19.493  151.245 1.00 149.06 ? 151  GLN A CA    1 
ATOM   1214  C  C     . GLN A 1  151 ? -0.609  19.007  150.906 1.00 147.91 ? 151  GLN A C     1 
ATOM   1215  O  O     . GLN A 1  151 ? -1.172  19.376  149.872 1.00 150.39 ? 151  GLN A O     1 
ATOM   1216  C  CB    . GLN A 1  151 ? 0.754   20.954  151.691 1.00 149.25 ? 151  GLN A CB    1 
ATOM   1217  C  CG    . GLN A 1  151 ? 1.969   21.399  152.485 1.00 151.50 ? 151  GLN A CG    1 
ATOM   1218  C  CD    . GLN A 1  151 ? 1.985   22.895  152.728 1.00 160.67 ? 151  GLN A CD    1 
ATOM   1219  O  OE1   . GLN A 1  151 ? 2.747   23.393  153.555 1.00 168.33 ? 151  GLN A OE1   1 
ATOM   1220  N  NE2   . GLN A 1  151 ? 1.150   23.620  151.997 1.00 165.80 ? 151  GLN A NE2   1 
ATOM   1221  N  N     . GLY A 1  152 ? -1.177  18.175  151.780 1.00 133.71 ? 152  GLY A N     1 
ATOM   1222  C  CA    . GLY A 1  152 ? -2.499  17.615  151.582 1.00 128.53 ? 152  GLY A CA    1 
ATOM   1223  C  C     . GLY A 1  152 ? -2.513  16.153  151.191 1.00 116.40 ? 152  GLY A C     1 
ATOM   1224  O  O     . GLY A 1  152 ? -3.566  15.509  151.288 1.00 112.91 ? 152  GLY A O     1 
ATOM   1225  N  N     . TRP A 1  153 ? -1.380  15.615  150.752 1.00 125.31 ? 153  TRP A N     1 
ATOM   1226  C  CA    . TRP A 1  153 ? -1.264  14.211  150.384 1.00 115.91 ? 153  TRP A CA    1 
ATOM   1227  C  C     . TRP A 1  153 ? -0.929  13.373  151.610 1.00 116.75 ? 153  TRP A C     1 
ATOM   1228  O  O     . TRP A 1  153 ? -0.034  13.728  152.386 1.00 114.30 ? 153  TRP A O     1 
ATOM   1229  C  CB    . TRP A 1  153 ? -0.189  14.040  149.310 1.00 110.71 ? 153  TRP A CB    1 
ATOM   1230  C  CG    . TRP A 1  153 ? -0.057  12.648  148.782 1.00 102.49 ? 153  TRP A CG    1 
ATOM   1231  C  CD1   . TRP A 1  153 ? -1.058  11.843  148.323 1.00 105.35 ? 153  TRP A CD1   1 
ATOM   1232  C  CD2   . TRP A 1  153 ? 1.157   11.901  148.641 1.00 98.04  ? 153  TRP A CD2   1 
ATOM   1233  N  NE1   . TRP A 1  153 ? -0.542  10.636  147.914 1.00 103.48 ? 153  TRP A NE1   1 
ATOM   1234  C  CE2   . TRP A 1  153 ? 0.816   10.648  148.098 1.00 96.53  ? 153  TRP A CE2   1 
ATOM   1235  C  CE3   . TRP A 1  153 ? 2.500   12.171  148.924 1.00 95.52  ? 153  TRP A CE3   1 
ATOM   1236  C  CZ2   . TRP A 1  153 ? 1.767   9.666   147.834 1.00 96.57  ? 153  TRP A CZ2   1 
ATOM   1237  C  CZ3   . TRP A 1  153 ? 3.443   11.196  148.660 1.00 90.72  ? 153  TRP A CZ3   1 
ATOM   1238  C  CH2   . TRP A 1  153 ? 3.072   9.959   148.121 1.00 93.13  ? 153  TRP A CH2   1 
ATOM   1239  N  N     . LYS A 1  154 ? -1.657  12.265  151.787 1.00 102.44 ? 154  LYS A N     1 
ATOM   1240  C  CA    . LYS A 1  154 ? -1.530  11.493  153.017 1.00 104.64 ? 154  LYS A CA    1 
ATOM   1241  C  C     . LYS A 1  154 ? -0.149  10.871  153.158 1.00 102.23 ? 154  LYS A C     1 
ATOM   1242  O  O     . LYS A 1  154 ? 0.223   10.455  154.260 1.00 110.73 ? 154  LYS A O     1 
ATOM   1243  C  CB    . LYS A 1  154 ? -2.601  10.402  153.071 1.00 106.32 ? 154  LYS A CB    1 
ATOM   1244  C  CG    . LYS A 1  154 ? -2.122  9.034   152.610 1.00 95.28  ? 154  LYS A CG    1 
ATOM   1245  C  CD    . LYS A 1  154 ? -3.282  8.070   152.443 1.00 94.03  ? 154  LYS A CD    1 
ATOM   1246  C  CE    . LYS A 1  154 ? -2.808  6.739   151.888 1.00 92.74  ? 154  LYS A CE    1 
ATOM   1247  N  NZ    . LYS A 1  154 ? -3.943  5.827   151.585 1.00 101.45 ? 154  LYS A NZ    1 
ATOM   1248  N  N     . GLY A 1  155 ? 0.616   10.806  152.074 1.00 102.69 ? 155  GLY A N     1 
ATOM   1249  C  CA    . GLY A 1  155 ? 1.912   10.176  152.083 1.00 97.37  ? 155  GLY A CA    1 
ATOM   1250  C  C     . GLY A 1  155 ? 3.043   11.161  152.214 1.00 105.40 ? 155  GLY A C     1 
ATOM   1251  O  O     . GLY A 1  155 ? 4.208   10.754  152.219 1.00 106.71 ? 155  GLY A O     1 
ATOM   1252  N  N     . SER A 1  156 ? 2.738   12.449  152.334 1.00 102.49 ? 156  SER A N     1 
ATOM   1253  C  CA    . SER A 1  156 ? 3.768   13.477  152.377 1.00 111.09 ? 156  SER A CA    1 
ATOM   1254  C  C     . SER A 1  156 ? 4.462   13.495  153.739 1.00 112.81 ? 156  SER A C     1 
ATOM   1255  O  O     . SER A 1  156 ? 5.698   13.548  153.783 1.00 115.83 ? 156  SER A O     1 
ATOM   1256  C  CB    . SER A 1  156 ? 3.177   14.850  152.039 1.00 113.84 ? 156  SER A CB    1 
ATOM   1257  O  OG    . SER A 1  156 ? 2.927   14.973  150.650 1.00 116.00 ? 156  SER A OG    1 
ATOM   1258  N  N     . PRO A 1  157 ? 3.731   13.476  154.866 1.00 113.14 ? 157  PRO A N     1 
ATOM   1259  C  CA    . PRO A 1  157 ? 4.435   13.440  156.160 1.00 114.26 ? 157  PRO A CA    1 
ATOM   1260  C  C     . PRO A 1  157 ? 5.377   12.257  156.307 1.00 112.45 ? 157  PRO A C     1 
ATOM   1261  O  O     . PRO A 1  157 ? 6.559   12.441  156.621 1.00 113.28 ? 157  PRO A O     1 
ATOM   1262  C  CB    . PRO A 1  157 ? 3.280   13.370  157.166 1.00 107.82 ? 157  PRO A CB    1 
ATOM   1263  C  CG    . PRO A 1  157 ? 2.203   14.131  156.515 1.00 107.41 ? 157  PRO A CG    1 
ATOM   1264  C  CD    . PRO A 1  157 ? 2.289   13.728  155.064 1.00 109.39 ? 157  PRO A CD    1 
ATOM   1265  N  N     . ALA A 1  158 ? 4.874   11.040  156.082 1.00 115.09 ? 158  ALA A N     1 
ATOM   1266  C  CA    . ALA A 1  158 ? 5.697   9.843   156.228 1.00 110.82 ? 158  ALA A CA    1 
ATOM   1267  C  C     . ALA A 1  158 ? 6.945   9.885   155.352 1.00 108.37 ? 158  ALA A C     1 
ATOM   1268  O  O     . ALA A 1  158 ? 8.032   9.497   155.795 1.00 102.66 ? 158  ALA A O     1 
ATOM   1269  C  CB    . ALA A 1  158 ? 4.864   8.601   155.910 1.00 109.77 ? 158  ALA A CB    1 
ATOM   1270  N  N     . ILE A 1  159 ? 6.813   10.344  154.104 1.00 102.84 ? 159  ILE A N     1 
ATOM   1271  C  CA    . ILE A 1  159 ? 7.962   10.317  153.201 1.00 103.63 ? 159  ILE A CA    1 
ATOM   1272  C  C     . ILE A 1  159 ? 8.994   11.367  153.597 1.00 105.13 ? 159  ILE A C     1 
ATOM   1273  O  O     . ILE A 1  159 ? 10.198  11.086  153.627 1.00 106.67 ? 159  ILE A O     1 
ATOM   1274  C  CB    . ILE A 1  159 ? 7.504   10.485  151.741 1.00 100.32 ? 159  ILE A CB    1 
ATOM   1275  C  CG1   . ILE A 1  159 ? 6.737   9.243   151.286 1.00 95.64  ? 159  ILE A CG1   1 
ATOM   1276  C  CG2   . ILE A 1  159 ? 8.699   10.722  150.831 1.00 95.68  ? 159  ILE A CG2   1 
ATOM   1277  C  CD1   . ILE A 1  159 ? 6.203   9.335   149.877 1.00 93.61  ? 159  ILE A CD1   1 
ATOM   1278  N  N     . PHE A 1  160 ? 8.549   12.589  153.906 1.00 109.78 ? 160  PHE A N     1 
ATOM   1279  C  CA    . PHE A 1  160 ? 9.481   13.609  154.379 1.00 113.22 ? 160  PHE A CA    1 
ATOM   1280  C  C     . PHE A 1  160 ? 10.168  13.167  155.661 1.00 112.02 ? 160  PHE A C     1 
ATOM   1281  O  O     . PHE A 1  160 ? 11.398  13.217  155.778 1.00 106.93 ? 160  PHE A O     1 
ATOM   1282  C  CB    . PHE A 1  160 ? 8.773   14.943  154.611 1.00 116.38 ? 160  PHE A CB    1 
ATOM   1283  C  CG    . PHE A 1  160 ? 9.665   15.976  155.235 1.00 114.43 ? 160  PHE A CG    1 
ATOM   1284  C  CD1   . PHE A 1  160 ? 10.759  16.467  154.544 1.00 122.30 ? 160  PHE A CD1   1 
ATOM   1285  C  CD2   . PHE A 1  160 ? 9.447   16.412  156.531 1.00 117.74 ? 160  PHE A CD2   1 
ATOM   1286  C  CE1   . PHE A 1  160 ? 11.600  17.400  155.118 1.00 122.69 ? 160  PHE A CE1   1 
ATOM   1287  C  CE2   . PHE A 1  160 ? 10.286  17.345  157.112 1.00 119.57 ? 160  PHE A CE2   1 
ATOM   1288  C  CZ    . PHE A 1  160 ? 11.367  17.834  156.405 1.00 117.16 ? 160  PHE A CZ    1 
ATOM   1289  N  N     . GLN A 1  161 ? 9.368   12.763  156.646 1.00 119.57 ? 161  GLN A N     1 
ATOM   1290  C  CA    . GLN A 1  161 ? 9.880   12.306  157.931 1.00 120.41 ? 161  GLN A CA    1 
ATOM   1291  C  C     . GLN A 1  161 ? 10.947  11.230  157.763 1.00 118.70 ? 161  GLN A C     1 
ATOM   1292  O  O     . GLN A 1  161 ? 12.000  11.278  158.408 1.00 122.94 ? 161  GLN A O     1 
ATOM   1293  C  CB    . GLN A 1  161 ? 8.705   11.796  158.758 1.00 118.03 ? 161  GLN A CB    1 
ATOM   1294  C  CG    . GLN A 1  161 ? 9.029   11.261  160.111 1.00 116.56 ? 161  GLN A CG    1 
ATOM   1295  C  CD    . GLN A 1  161 ? 7.806   11.280  160.992 1.00 114.46 ? 161  GLN A CD    1 
ATOM   1296  O  OE1   . GLN A 1  161 ? 6.790   10.661  160.673 1.00 111.31 ? 161  GLN A OE1   1 
ATOM   1297  N  NE2   . GLN A 1  161 ? 7.882   12.015  162.090 1.00 115.34 ? 161  GLN A NE2   1 
ATOM   1298  N  N     . SER A 1  162 ? 10.689  10.242  156.903 1.00 107.76 ? 162  SER A N     1 
ATOM   1299  C  CA    . SER A 1  162 ? 11.657  9.164   156.727 1.00 105.91 ? 162  SER A CA    1 
ATOM   1300  C  C     . SER A 1  162 ? 12.907  9.653   156.003 1.00 104.29 ? 162  SER A C     1 
ATOM   1301  O  O     . SER A 1  162 ? 14.026  9.263   156.357 1.00 102.90 ? 162  SER A O     1 
ATOM   1302  C  CB    . SER A 1  162 ? 11.018  8.001   155.972 1.00 96.98  ? 162  SER A CB    1 
ATOM   1303  O  OG    . SER A 1  162 ? 11.882  6.877   155.949 1.00 92.38  ? 162  SER A OG    1 
ATOM   1304  N  N     . SER A 1  163 ? 12.736  10.496  154.980 1.00 100.08 ? 163  SER A N     1 
ATOM   1305  C  CA    . SER A 1  163 ? 13.884  11.069  154.281 1.00 104.72 ? 163  SER A CA    1 
ATOM   1306  C  C     . SER A 1  163 ? 14.736  11.901  155.231 1.00 108.81 ? 163  SER A C     1 
ATOM   1307  O  O     . SER A 1  163 ? 15.967  11.783  155.249 1.00 111.25 ? 163  SER A O     1 
ATOM   1308  C  CB    . SER A 1  163 ? 13.417  11.916  153.096 1.00 108.32 ? 163  SER A CB    1 
ATOM   1309  O  OG    . SER A 1  163 ? 12.288  11.345  152.460 1.00 109.31 ? 163  SER A OG    1 
ATOM   1310  N  N     . MET A 1  164 ? 14.087  12.776  156.005 1.00 111.00 ? 164  MET A N     1 
ATOM   1311  C  CA    . MET A 1  164 ? 14.774  13.598  156.999 1.00 104.44 ? 164  MET A CA    1 
ATOM   1312  C  C     . MET A 1  164 ? 15.681  12.745  157.883 1.00 103.14 ? 164  MET A C     1 
ATOM   1313  O  O     . MET A 1  164 ? 16.813  13.134  158.193 1.00 94.35  ? 164  MET A O     1 
ATOM   1314  C  CB    . MET A 1  164 ? 13.743  14.353  157.841 1.00 106.75 ? 164  MET A CB    1 
ATOM   1315  C  CG    . MET A 1  164 ? 14.306  15.210  158.970 1.00 108.57 ? 164  MET A CG    1 
ATOM   1316  S  SD    . MET A 1  164 ? 15.022  16.778  158.426 1.00 101.18 ? 164  MET A SD    1 
ATOM   1317  C  CE    . MET A 1  164 ? 16.721  16.331  158.113 1.00 92.82  ? 164  MET A CE    1 
ATOM   1318  N  N     . THR A 1  165 ? 15.182  11.584  158.315 1.00 106.24 ? 165  THR A N     1 
ATOM   1319  C  CA    . THR A 1  165 ? 15.948  10.703  159.193 1.00 103.77 ? 165  THR A CA    1 
ATOM   1320  C  C     . THR A 1  165 ? 17.149  10.091  158.477 1.00 108.72 ? 165  THR A C     1 
ATOM   1321  O  O     . THR A 1  165 ? 18.234  9.983   159.060 1.00 112.80 ? 165  THR A O     1 
ATOM   1322  C  CB    . THR A 1  165 ? 15.042  9.601   159.744 1.00 96.68  ? 165  THR A CB    1 
ATOM   1323  O  OG1   . THR A 1  165 ? 13.892  10.189  160.364 1.00 98.37  ? 165  THR A OG1   1 
ATOM   1324  C  CG2   . THR A 1  165 ? 15.784  8.758   160.772 1.00 89.45  ? 165  THR A CG2   1 
ATOM   1325  N  N     . LYS A 1  166 ? 16.982  9.697   157.212 1.00 117.09 ? 166  LYS A N     1 
ATOM   1326  C  CA    . LYS A 1  166 ? 18.106  9.153   156.454 1.00 120.71 ? 166  LYS A CA    1 
ATOM   1327  C  C     . LYS A 1  166 ? 19.197  10.196  156.237 1.00 123.54 ? 166  LYS A C     1 
ATOM   1328  O  O     . LYS A 1  166 ? 20.389  9.866   156.244 1.00 122.36 ? 166  LYS A O     1 
ATOM   1329  C  CB    . LYS A 1  166 ? 17.622  8.617   155.106 1.00 119.54 ? 166  LYS A CB    1 
ATOM   1330  C  CG    . LYS A 1  166 ? 16.838  7.317   155.177 1.00 120.00 ? 166  LYS A CG    1 
ATOM   1331  C  CD    . LYS A 1  166 ? 16.457  6.837   153.783 1.00 124.78 ? 166  LYS A CD    1 
ATOM   1332  C  CE    . LYS A 1  166 ? 15.977  5.395   153.802 1.00 128.50 ? 166  LYS A CE    1 
ATOM   1333  N  NZ    . LYS A 1  166 ? 14.962  5.167   154.869 1.00 118.71 ? 166  LYS A NZ    1 
ATOM   1334  N  N     . ILE A 1  167 ? 18.812  11.456  156.037 1.00 121.45 ? 167  ILE A N     1 
ATOM   1335  C  CA    . ILE A 1  167 ? 19.801  12.525  155.925 1.00 105.38 ? 167  ILE A CA    1 
ATOM   1336  C  C     . ILE A 1  167 ? 20.507  12.748  157.258 1.00 116.99 ? 167  ILE A C     1 
ATOM   1337  O  O     . ILE A 1  167 ? 21.736  12.864  157.315 1.00 120.51 ? 167  ILE A O     1 
ATOM   1338  C  CB    . ILE A 1  167 ? 19.132  13.815  155.419 1.00 97.94  ? 167  ILE A CB    1 
ATOM   1339  C  CG1   . ILE A 1  167 ? 18.753  13.671  153.946 1.00 108.77 ? 167  ILE A CG1   1 
ATOM   1340  C  CG2   . ILE A 1  167 ? 20.045  15.010  155.626 1.00 98.24  ? 167  ILE A CG2   1 
ATOM   1341  C  CD1   . ILE A 1  167 ? 17.665  14.617  153.508 1.00 97.39  ? 167  ILE A CD1   1 
ATOM   1342  N  N     . LEU A 1  168 ? 19.741  12.836  158.347 1.00 111.73 ? 168  LEU A N     1 
ATOM   1343  C  CA    . LEU A 1  168 ? 20.335  13.041  159.664 1.00 110.85 ? 168  LEU A CA    1 
ATOM   1344  C  C     . LEU A 1  168 ? 21.158  11.853  160.143 1.00 110.16 ? 168  LEU A C     1 
ATOM   1345  O  O     . LEU A 1  168 ? 22.038  12.039  160.990 1.00 113.76 ? 168  LEU A O     1 
ATOM   1346  C  CB    . LEU A 1  168 ? 19.256  13.345  160.704 1.00 111.07 ? 168  LEU A CB    1 
ATOM   1347  C  CG    . LEU A 1  168 ? 18.569  14.706  160.647 1.00 110.72 ? 168  LEU A CG    1 
ATOM   1348  C  CD1   . LEU A 1  168 ? 17.178  14.621  161.252 1.00 109.55 ? 168  LEU A CD1   1 
ATOM   1349  C  CD2   . LEU A 1  168 ? 19.401  15.756  161.363 1.00 111.75 ? 168  LEU A CD2   1 
ATOM   1350  N  N     . GLU A 1  169 ? 20.895  10.647  159.625 1.00 102.47 ? 169  GLU A N     1 
ATOM   1351  C  CA    . GLU A 1  169 ? 21.522  9.413   160.096 1.00 104.70 ? 169  GLU A CA    1 
ATOM   1352  C  C     . GLU A 1  169 ? 23.040  9.553   160.219 1.00 104.01 ? 169  GLU A C     1 
ATOM   1353  O  O     . GLU A 1  169 ? 23.574  9.335   161.314 1.00 106.89 ? 169  GLU A O     1 
ATOM   1354  C  CB    . GLU A 1  169 ? 21.149  8.235   159.188 1.00 108.63 ? 169  GLU A CB    1 
ATOM   1355  C  CG    . GLU A 1  169 ? 21.396  6.864   159.812 1.00 112.61 ? 169  GLU A CG    1 
ATOM   1356  C  CD    . GLU A 1  169 ? 22.836  6.400   159.714 1.00 114.20 ? 169  GLU A CD    1 
ATOM   1357  O  OE1   . GLU A 1  169 ? 23.572  6.896   158.836 1.00 117.18 ? 169  GLU A OE1   1 
ATOM   1358  O  OE2   . GLU A 1  169 ? 23.231  5.537   160.525 1.00 112.18 ? 169  GLU A OE2   1 
ATOM   1359  N  N     . PRO A 1  170 ? 23.782  9.889   159.155 1.00 111.75 ? 170  PRO A N     1 
ATOM   1360  C  CA    . PRO A 1  170 ? 25.246  9.900   159.299 1.00 117.59 ? 170  PRO A CA    1 
ATOM   1361  C  C     . PRO A 1  170 ? 25.752  11.019  160.197 1.00 118.22 ? 170  PRO A C     1 
ATOM   1362  O  O     . PRO A 1  170 ? 26.787  10.846  160.852 1.00 117.64 ? 170  PRO A O     1 
ATOM   1363  C  CB    . PRO A 1  170 ? 25.741  10.056  157.856 1.00 121.77 ? 170  PRO A CB    1 
ATOM   1364  C  CG    . PRO A 1  170 ? 24.655  10.781  157.169 1.00 112.39 ? 170  PRO A CG    1 
ATOM   1365  C  CD    . PRO A 1  170 ? 23.371  10.327  157.807 1.00 114.00 ? 170  PRO A CD    1 
ATOM   1366  N  N     . PHE A 1  171 ? 25.053  12.157  160.255 1.00 117.91 ? 171  PHE A N     1 
ATOM   1367  C  CA    . PHE A 1  171 ? 25.491  13.257  161.111 1.00 117.34 ? 171  PHE A CA    1 
ATOM   1368  C  C     . PHE A 1  171 ? 25.462  12.866  162.584 1.00 116.30 ? 171  PHE A C     1 
ATOM   1369  O  O     . PHE A 1  171 ? 26.368  13.225  163.346 1.00 112.95 ? 171  PHE A O     1 
ATOM   1370  C  CB    . PHE A 1  171 ? 24.615  14.488  160.874 1.00 123.47 ? 171  PHE A CB    1 
ATOM   1371  C  CG    . PHE A 1  171 ? 25.138  15.742  161.523 1.00 127.69 ? 171  PHE A CG    1 
ATOM   1372  C  CD1   . PHE A 1  171 ? 26.076  16.533  160.886 1.00 135.38 ? 171  PHE A CD1   1 
ATOM   1373  C  CD2   . PHE A 1  171 ? 24.684  16.129  162.773 1.00 122.14 ? 171  PHE A CD2   1 
ATOM   1374  C  CE1   . PHE A 1  171 ? 26.556  17.685  161.482 1.00 133.81 ? 171  PHE A CE1   1 
ATOM   1375  C  CE2   . PHE A 1  171 ? 25.160  17.280  163.375 1.00 120.87 ? 171  PHE A CE2   1 
ATOM   1376  C  CZ    . PHE A 1  171 ? 26.097  18.058  162.728 1.00 124.68 ? 171  PHE A CZ    1 
ATOM   1377  N  N     . LYS A 1  172 ? 24.431  12.128  163.001 1.00 121.27 ? 172  LYS A N     1 
ATOM   1378  C  CA    . LYS A 1  172 ? 24.366  11.654  164.380 1.00 118.79 ? 172  LYS A CA    1 
ATOM   1379  C  C     . LYS A 1  172 ? 25.467  10.641  164.665 1.00 118.71 ? 172  LYS A C     1 
ATOM   1380  O  O     . LYS A 1  172 ? 26.146  10.723  165.694 1.00 122.92 ? 172  LYS A O     1 
ATOM   1381  C  CB    . LYS A 1  172 ? 22.990  11.055  164.685 1.00 121.62 ? 172  LYS A CB    1 
ATOM   1382  C  CG    . LYS A 1  172 ? 21.811  11.955  164.337 1.00 116.06 ? 172  LYS A CG    1 
ATOM   1383  C  CD    . LYS A 1  172 ? 20.696  11.856  165.379 1.00 108.73 ? 172  LYS A CD    1 
ATOM   1384  C  CE    . LYS A 1  172 ? 20.328  10.417  165.709 1.00 99.21  ? 172  LYS A CE    1 
ATOM   1385  N  NZ    . LYS A 1  172 ? 19.608  10.333  167.014 1.00 88.73  ? 172  LYS A NZ    1 
ATOM   1386  N  N     . LYS A 1  173 ? 25.657  9.675   163.762 1.00 121.68 ? 173  LYS A N     1 
ATOM   1387  C  CA    . LYS A 1  173 ? 26.617  8.607   164.020 1.00 125.86 ? 173  LYS A CA    1 
ATOM   1388  C  C     . LYS A 1  173 ? 28.027  9.161   164.177 1.00 132.34 ? 173  LYS A C     1 
ATOM   1389  O  O     . LYS A 1  173 ? 28.812  8.645   164.981 1.00 132.44 ? 173  LYS A O     1 
ATOM   1390  C  CB    . LYS A 1  173 ? 26.559  7.577   162.891 1.00 129.43 ? 173  LYS A CB    1 
ATOM   1391  C  CG    . LYS A 1  173 ? 27.701  6.575   162.880 1.00 138.03 ? 173  LYS A CG    1 
ATOM   1392  C  CD    . LYS A 1  173 ? 27.202  5.176   162.541 1.00 136.68 ? 173  LYS A CD    1 
ATOM   1393  C  CE    . LYS A 1  173 ? 26.367  5.176   161.268 1.00 130.00 ? 173  LYS A CE    1 
ATOM   1394  N  NZ    . LYS A 1  173 ? 25.453  4.002   161.197 1.00 121.25 ? 173  LYS A NZ    1 
ATOM   1395  N  N     . GLN A 1  174 ? 28.361  10.216  163.438 1.00 127.13 ? 174  GLN A N     1 
ATOM   1396  C  CA    . GLN A 1  174 ? 29.718  10.735  163.388 1.00 123.88 ? 174  GLN A CA    1 
ATOM   1397  C  C     . GLN A 1  174 ? 29.880  11.945  164.294 1.00 117.50 ? 174  GLN A C     1 
ATOM   1398  O  O     . GLN A 1  174 ? 30.937  12.584  164.288 1.00 125.69 ? 174  GLN A O     1 
ATOM   1399  C  CB    . GLN A 1  174 ? 30.092  11.099  161.950 1.00 134.66 ? 174  GLN A CB    1 
ATOM   1400  C  CG    . GLN A 1  174 ? 29.809  10.000  160.937 1.00 137.05 ? 174  GLN A CG    1 
ATOM   1401  C  CD    . GLN A 1  174 ? 29.860  10.500  159.505 1.00 137.91 ? 174  GLN A CD    1 
ATOM   1402  O  OE1   . GLN A 1  174 ? 30.664  11.368  159.164 1.00 154.15 ? 174  GLN A OE1   1 
ATOM   1403  N  NE2   . GLN A 1  174 ? 28.996  9.953   158.657 1.00 134.06 ? 174  GLN A NE2   1 
ATOM   1404  N  N     . ASN A 1  175 ? 28.847  12.272  165.066 1.00 126.07 ? 175  ASN A N     1 
ATOM   1405  C  CA    . ASN A 1  175 ? 28.923  13.242  166.158 1.00 127.66 ? 175  ASN A CA    1 
ATOM   1406  C  C     . ASN A 1  175 ? 28.239  12.665  167.395 1.00 131.12 ? 175  ASN A C     1 
ATOM   1407  O  O     . ASN A 1  175 ? 27.220  13.185  167.855 1.00 131.92 ? 175  ASN A O     1 
ATOM   1408  C  CB    . ASN A 1  175 ? 28.286  14.565  165.738 1.00 124.20 ? 175  ASN A CB    1 
ATOM   1409  C  CG    . ASN A 1  175 ? 29.100  15.293  164.687 1.00 118.42 ? 175  ASN A CG    1 
ATOM   1410  O  OD1   . ASN A 1  175 ? 30.162  15.841  164.977 1.00 123.58 ? 175  ASN A OD1   1 
ATOM   1411  N  ND2   . ASN A 1  175 ? 28.608  15.292  163.454 1.00 122.56 ? 175  ASN A ND2   1 
ATOM   1412  N  N     . PRO A 1  176 ? 28.775  11.580  167.964 1.00 124.92 ? 176  PRO A N     1 
ATOM   1413  C  CA    . PRO A 1  176 ? 28.038  10.847  169.010 1.00 130.02 ? 176  PRO A CA    1 
ATOM   1414  C  C     . PRO A 1  176 ? 27.822  11.621  170.304 1.00 139.48 ? 176  PRO A C     1 
ATOM   1415  O  O     . PRO A 1  176 ? 27.198  11.081  171.225 1.00 133.90 ? 176  PRO A O     1 
ATOM   1416  C  CB    . PRO A 1  176 ? 28.915  9.606   169.258 1.00 127.23 ? 176  PRO A CB    1 
ATOM   1417  C  CG    . PRO A 1  176 ? 29.905  9.573   168.126 1.00 126.39 ? 176  PRO A CG    1 
ATOM   1418  C  CD    . PRO A 1  176 ? 30.100  10.992  167.715 1.00 127.65 ? 176  PRO A CD    1 
ATOM   1419  N  N     . ASP A 1  177 ? 28.302  12.859  170.412 1.00 155.16 ? 177  ASP A N     1 
ATOM   1420  C  CA    . ASP A 1  177 ? 28.163  13.658  171.624 1.00 150.78 ? 177  ASP A CA    1 
ATOM   1421  C  C     . ASP A 1  177 ? 27.242  14.845  171.376 1.00 146.66 ? 177  ASP A C     1 
ATOM   1422  O  O     . ASP A 1  177 ? 27.327  15.871  172.056 1.00 143.98 ? 177  ASP A O     1 
ATOM   1423  C  CB    . ASP A 1  177 ? 29.527  14.137  172.114 1.00 157.87 ? 177  ASP A CB    1 
ATOM   1424  C  CG    . ASP A 1  177 ? 30.479  12.996  172.393 1.00 159.49 ? 177  ASP A CG    1 
ATOM   1425  O  OD1   . ASP A 1  177 ? 30.021  11.945  172.888 1.00 158.26 ? 177  ASP A OD1   1 
ATOM   1426  O  OD2   . ASP A 1  177 ? 31.685  13.147  172.108 1.00 161.69 ? 177  ASP A OD2   1 
ATOM   1427  N  N     . ILE A 1  178 ? 26.346  14.697  170.407 1.00 131.05 ? 178  ILE A N     1 
ATOM   1428  C  CA    . ILE A 1  178 ? 25.239  15.609  170.174 1.00 126.15 ? 178  ILE A CA    1 
ATOM   1429  C  C     . ILE A 1  178 ? 23.944  14.823  170.311 1.00 125.41 ? 178  ILE A C     1 
ATOM   1430  O  O     . ILE A 1  178 ? 23.913  13.602  170.120 1.00 126.86 ? 178  ILE A O     1 
ATOM   1431  C  CB    . ILE A 1  178 ? 25.377  16.254  168.777 1.00 124.21 ? 178  ILE A CB    1 
ATOM   1432  C  CG1   . ILE A 1  178 ? 24.492  17.482  168.611 1.00 119.72 ? 178  ILE A CG1   1 
ATOM   1433  C  CG2   . ILE A 1  178 ? 25.016  15.250  167.693 1.00 128.34 ? 178  ILE A CG2   1 
ATOM   1434  C  CD1   . ILE A 1  178 ? 24.217  17.772  167.153 1.00 127.83 ? 178  ILE A CD1   1 
ATOM   1435  N  N     . VAL A 1  179 ? 22.873  15.525  170.668 1.00 120.27 ? 179  VAL A N     1 
ATOM   1436  C  CA    . VAL A 1  179 ? 21.537  14.947  170.744 1.00 107.88 ? 179  VAL A CA    1 
ATOM   1437  C  C     . VAL A 1  179 ? 20.625  15.779  169.858 1.00 108.61 ? 179  VAL A C     1 
ATOM   1438  O  O     . VAL A 1  179 ? 20.525  17.000  170.036 1.00 108.43 ? 179  VAL A O     1 
ATOM   1439  C  CB    . VAL A 1  179 ? 21.010  14.899  172.186 1.00 102.30 ? 179  VAL A CB    1 
ATOM   1440  C  CG1   . VAL A 1  179 ? 19.499  14.737  172.193 1.00 101.83 ? 179  VAL A CG1   1 
ATOM   1441  C  CG2   . VAL A 1  179 ? 21.675  13.769  172.951 1.00 109.73 ? 179  VAL A CG2   1 
ATOM   1442  N  N     . ILE A 1  180 ? 19.968  15.128  168.903 1.00 110.27 ? 180  ILE A N     1 
ATOM   1443  C  CA    . ILE A 1  180 ? 19.055  15.808  167.995 1.00 107.52 ? 180  ILE A CA    1 
ATOM   1444  C  C     . ILE A 1  180 ? 17.682  15.162  168.095 1.00 113.36 ? 180  ILE A C     1 
ATOM   1445  O  O     . ILE A 1  180 ? 17.532  13.956  167.858 1.00 109.04 ? 180  ILE A O     1 
ATOM   1446  C  CB    . ILE A 1  180 ? 19.559  15.782  166.544 1.00 103.14 ? 180  ILE A CB    1 
ATOM   1447  C  CG1   . ILE A 1  180 ? 21.010  16.257  166.472 1.00 113.22 ? 180  ILE A CG1   1 
ATOM   1448  C  CG2   . ILE A 1  180 ? 18.669  16.644  165.660 1.00 101.22 ? 180  ILE A CG2   1 
ATOM   1449  C  CD1   . ILE A 1  180 ? 21.524  16.435  165.059 1.00 117.20 ? 180  ILE A CD1   1 
ATOM   1450  N  N     . TYR A 1  181 ? 16.688  15.968  168.458 1.00 109.21 ? 181  TYR A N     1 
ATOM   1451  C  CA    . TYR A 1  181 ? 15.292  15.557  168.524 1.00 106.87 ? 181  TYR A CA    1 
ATOM   1452  C  C     . TYR A 1  181 ? 14.650  16.068  167.244 1.00 108.34 ? 181  TYR A C     1 
ATOM   1453  O  O     . TYR A 1  181 ? 14.419  17.273  167.101 1.00 110.44 ? 181  TYR A O     1 
ATOM   1454  C  CB    . TYR A 1  181 ? 14.591  16.133  169.753 1.00 105.44 ? 181  TYR A CB    1 
ATOM   1455  C  CG    . TYR A 1  181 ? 14.596  15.244  170.975 1.00 101.35 ? 181  TYR A CG    1 
ATOM   1456  C  CD1   . TYR A 1  181 ? 15.770  14.978  171.665 1.00 102.54 ? 181  TYR A CD1   1 
ATOM   1457  C  CD2   . TYR A 1  181 ? 13.416  14.682  171.446 1.00 96.97  ? 181  TYR A CD2   1 
ATOM   1458  C  CE1   . TYR A 1  181 ? 15.768  14.177  172.795 1.00 111.20 ? 181  TYR A CE1   1 
ATOM   1459  C  CE2   . TYR A 1  181 ? 13.406  13.874  172.567 1.00 94.28  ? 181  TYR A CE2   1 
ATOM   1460  C  CZ    . TYR A 1  181 ? 14.583  13.626  173.240 1.00 98.39  ? 181  TYR A CZ    1 
ATOM   1461  O  OH    . TYR A 1  181 ? 14.575  12.815  174.352 1.00 87.45  ? 181  TYR A OH    1 
ATOM   1462  N  N     . GLN A 1  182 ? 14.352  15.167  166.317 1.00 101.08 ? 182  GLN A N     1 
ATOM   1463  C  CA    . GLN A 1  182 ? 13.649  15.551  165.103 1.00 99.96  ? 182  GLN A CA    1 
ATOM   1464  C  C     . GLN A 1  182 ? 12.169  15.205  165.209 1.00 102.24 ? 182  GLN A C     1 
ATOM   1465  O  O     . GLN A 1  182 ? 11.801  14.062  165.505 1.00 102.66 ? 182  GLN A O     1 
ATOM   1466  C  CB    . GLN A 1  182 ? 14.312  14.879  163.896 1.00 98.03  ? 182  GLN A CB    1 
ATOM   1467  C  CG    . GLN A 1  182 ? 13.968  13.411  163.700 1.00 100.40 ? 182  GLN A CG    1 
ATOM   1468  C  CD    . GLN A 1  182 ? 14.240  12.905  162.304 1.00 92.36  ? 182  GLN A CD    1 
ATOM   1469  O  OE1   . GLN A 1  182 ? 15.140  12.090  162.093 1.00 80.09  ? 182  GLN A OE1   1 
ATOM   1470  N  NE2   . GLN A 1  182 ? 13.431  13.345  161.349 1.00 99.77  ? 182  GLN A NE2   1 
ATOM   1471  N  N     . TYR A 1  183 ? 11.328  16.221  165.040 1.00 95.28  ? 183  TYR A N     1 
ATOM   1472  C  CA    . TYR A 1  183 ? 9.884   16.064  164.905 1.00 97.10  ? 183  TYR A CA    1 
ATOM   1473  C  C     . TYR A 1  183 ? 9.494   16.679  163.564 1.00 110.17 ? 183  TYR A C     1 
ATOM   1474  O  O     . TYR A 1  183 ? 9.398   17.906  163.455 1.00 109.13 ? 183  TYR A O     1 
ATOM   1475  C  CB    . TYR A 1  183 ? 9.143   16.704  166.072 1.00 90.47  ? 183  TYR A CB    1 
ATOM   1476  C  CG    . TYR A 1  183 ? 7.646   16.546  165.982 1.00 94.45  ? 183  TYR A CG    1 
ATOM   1477  C  CD1   . TYR A 1  183 ? 7.037   15.368  166.393 1.00 92.66  ? 183  TYR A CD1   1 
ATOM   1478  C  CD2   . TYR A 1  183 ? 6.839   17.570  165.505 1.00 97.46  ? 183  TYR A CD2   1 
ATOM   1479  C  CE1   . TYR A 1  183 ? 5.671   15.209  166.324 1.00 94.75  ? 183  TYR A CE1   1 
ATOM   1480  C  CE2   . TYR A 1  183 ? 5.467   17.419  165.431 1.00 96.15  ? 183  TYR A CE2   1 
ATOM   1481  C  CZ    . TYR A 1  183 ? 4.890   16.236  165.844 1.00 96.47  ? 183  TYR A CZ    1 
ATOM   1482  O  OH    . TYR A 1  183 ? 3.526   16.072  165.772 1.00 93.11  ? 183  TYR A OH    1 
ATOM   1483  N  N     . MET A 1  184 ? 9.279   15.839  162.550 1.00 121.29 ? 184  MET A N     1 
ATOM   1484  C  CA    . MET A 1  184 ? 9.065   16.303  161.181 1.00 123.03 ? 184  MET A CA    1 
ATOM   1485  C  C     . MET A 1  184 ? 10.255  17.138  160.710 1.00 124.72 ? 184  MET A C     1 
ATOM   1486  O  O     . MET A 1  184 ? 11.321  16.588  160.412 1.00 120.87 ? 184  MET A O     1 
ATOM   1487  C  CB    . MET A 1  184 ? 7.749   17.092  161.088 1.00 118.24 ? 184  MET A CB    1 
ATOM   1488  C  CG    . MET A 1  184 ? 7.288   17.449  159.678 1.00 121.68 ? 184  MET A CG    1 
ATOM   1489  S  SD    . MET A 1  184 ? 6.740   16.014  158.732 1.00 122.77 ? 184  MET A SD    1 
ATOM   1490  C  CE    . MET A 1  184 ? 5.184   15.640  159.538 1.00 112.10 ? 184  MET A CE    1 
ATOM   1491  N  N     . ASP A 1  185 ? 10.091  18.464  160.648 1.00 125.74 ? 185  ASP A N     1 
ATOM   1492  C  CA    . ASP A 1  185 ? 11.149  19.372  160.216 1.00 116.12 ? 185  ASP A CA    1 
ATOM   1493  C  C     . ASP A 1  185 ? 11.795  20.121  161.372 1.00 114.12 ? 185  ASP A C     1 
ATOM   1494  O  O     . ASP A 1  185 ? 12.834  20.758  161.174 1.00 113.59 ? 185  ASP A O     1 
ATOM   1495  C  CB    . ASP A 1  185 ? 10.631  20.398  159.200 1.00 116.91 ? 185  ASP A CB    1 
ATOM   1496  C  CG    . ASP A 1  185 ? 9.602   21.345  159.786 1.00 126.19 ? 185  ASP A CG    1 
ATOM   1497  O  OD1   . ASP A 1  185 ? 9.077   21.075  160.887 1.00 129.09 ? 185  ASP A OD1   1 
ATOM   1498  O  OD2   . ASP A 1  185 ? 9.345   22.388  159.150 1.00 131.55 ? 185  ASP A OD2   1 
ATOM   1499  N  N     . ASP A 1  186 ? 11.209  20.060  162.564 1.00 113.19 ? 186  ASP A N     1 
ATOM   1500  C  CA    . ASP A 1  186 ? 11.733  20.792  163.705 1.00 110.27 ? 186  ASP A CA    1 
ATOM   1501  C  C     . ASP A 1  186 ? 12.835  19.989  164.369 1.00 112.11 ? 186  ASP A C     1 
ATOM   1502  O  O     . ASP A 1  186 ? 12.642  18.825  164.735 1.00 110.12 ? 186  ASP A O     1 
ATOM   1503  C  CB    . ASP A 1  186 ? 10.634  21.078  164.727 1.00 106.99 ? 186  ASP A CB    1 
ATOM   1504  C  CG    . ASP A 1  186 ? 9.636   22.090  164.239 1.00 109.30 ? 186  ASP A CG    1 
ATOM   1505  O  OD1   . ASP A 1  186 ? 9.325   23.036  164.992 1.00 108.33 ? 186  ASP A OD1   1 
ATOM   1506  O  OD2   . ASP A 1  186 ? 9.152   21.931  163.105 1.00 115.32 ? 186  ASP A OD2   1 
ATOM   1507  N  N     . LEU A 1  187 ? 13.992  20.617  164.518 1.00 108.38 ? 187  LEU A N     1 
ATOM   1508  C  CA    . LEU A 1  187 ? 15.154  19.983  165.111 1.00 104.04 ? 187  LEU A CA    1 
ATOM   1509  C  C     . LEU A 1  187 ? 15.457  20.699  166.416 1.00 109.08 ? 187  LEU A C     1 
ATOM   1510  O  O     . LEU A 1  187 ? 15.494  21.933  166.462 1.00 118.08 ? 187  LEU A O     1 
ATOM   1511  C  CB    . LEU A 1  187 ? 16.362  20.056  164.174 1.00 97.91  ? 187  LEU A CB    1 
ATOM   1512  C  CG    . LEU A 1  187 ? 16.307  19.300  162.844 1.00 100.08 ? 187  LEU A CG    1 
ATOM   1513  C  CD1   . LEU A 1  187 ? 17.707  18.933  162.376 1.00 105.44 ? 187  LEU A CD1   1 
ATOM   1514  C  CD2   . LEU A 1  187 ? 15.442  18.065  162.950 1.00 105.32 ? 187  LEU A CD2   1 
ATOM   1515  N  N     . TYR A 1  188 ? 15.687  19.920  167.463 1.00 107.55 ? 188  TYR A N     1 
ATOM   1516  C  CA    . TYR A 1  188 ? 16.267  20.404  168.703 1.00 107.86 ? 188  TYR A CA    1 
ATOM   1517  C  C     . TYR A 1  188 ? 17.665  19.822  168.783 1.00 111.54 ? 188  TYR A C     1 
ATOM   1518  O  O     . TYR A 1  188 ? 17.869  18.638  168.503 1.00 110.45 ? 188  TYR A O     1 
ATOM   1519  C  CB    . TYR A 1  188 ? 15.398  20.002  169.909 1.00 102.28 ? 188  TYR A CB    1 
ATOM   1520  C  CG    . TYR A 1  188 ? 16.066  19.950  171.278 1.00 88.25  ? 188  TYR A CG    1 
ATOM   1521  C  CD1   . TYR A 1  188 ? 16.962  18.938  171.613 1.00 89.27  ? 188  TYR A CD1   1 
ATOM   1522  C  CD2   . TYR A 1  188 ? 15.775  20.904  172.245 1.00 89.54  ? 188  TYR A CD2   1 
ATOM   1523  C  CE1   . TYR A 1  188 ? 17.566  18.895  172.857 1.00 90.69  ? 188  TYR A CE1   1 
ATOM   1524  C  CE2   . TYR A 1  188 ? 16.368  20.863  173.497 1.00 77.04  ? 188  TYR A CE2   1 
ATOM   1525  C  CZ    . TYR A 1  188 ? 17.263  19.858  173.796 1.00 77.87  ? 188  TYR A CZ    1 
ATOM   1526  O  OH    . TYR A 1  188 ? 17.846  19.805  175.041 1.00 76.22  ? 188  TYR A OH    1 
ATOM   1527  N  N     . VAL A 1  189 ? 18.628  20.658  169.150 1.00 111.54 ? 189  VAL A N     1 
ATOM   1528  C  CA    . VAL A 1  189 ? 20.023  20.252  169.155 1.00 111.72 ? 189  VAL A CA    1 
ATOM   1529  C  C     . VAL A 1  189 ? 20.666  20.690  170.458 1.00 112.09 ? 189  VAL A C     1 
ATOM   1530  O  O     . VAL A 1  189 ? 20.733  21.890  170.752 1.00 114.80 ? 189  VAL A O     1 
ATOM   1531  C  CB    . VAL A 1  189 ? 20.784  20.860  167.965 1.00 115.24 ? 189  VAL A CB    1 
ATOM   1532  C  CG1   . VAL A 1  189 ? 22.150  20.275  167.881 1.00 113.73 ? 189  VAL A CG1   1 
ATOM   1533  C  CG2   . VAL A 1  189 ? 20.030  20.632  166.658 1.00 116.68 ? 189  VAL A CG2   1 
ATOM   1534  N  N     . GLY A 1  190 ? 21.146  19.728  171.223 1.00 107.33 ? 190  GLY A N     1 
ATOM   1535  C  CA    . GLY A 1  190 ? 21.680  20.002  172.546 1.00 110.15 ? 190  GLY A CA    1 
ATOM   1536  C  C     . GLY A 1  190 ? 23.028  19.335  172.689 1.00 110.40 ? 190  GLY A C     1 
ATOM   1537  O  O     . GLY A 1  190 ? 23.245  18.234  172.184 1.00 103.06 ? 190  GLY A O     1 
ATOM   1538  N  N     . SER A 1  191 ? 23.931  20.010  173.392 1.00 119.95 ? 191  SER A N     1 
ATOM   1539  C  CA    . SER A 1  191 ? 25.261  19.471  173.615 1.00 123.88 ? 191  SER A CA    1 
ATOM   1540  C  C     . SER A 1  191 ? 25.784  19.978  174.946 1.00 122.14 ? 191  SER A C     1 
ATOM   1541  O  O     . SER A 1  191 ? 25.300  20.977  175.484 1.00 120.32 ? 191  SER A O     1 
ATOM   1542  C  CB    . SER A 1  191 ? 26.221  19.855  172.484 1.00 130.13 ? 191  SER A CB    1 
ATOM   1543  O  OG    . SER A 1  191 ? 26.529  21.238  172.529 1.00 131.74 ? 191  SER A OG    1 
ATOM   1544  N  N     . ASP A 1  192 ? 26.784  19.280  175.475 1.00 122.33 ? 192  ASP A N     1 
ATOM   1545  C  CA    . ASP A 1  192 ? 27.562  19.803  176.593 1.00 128.35 ? 192  ASP A CA    1 
ATOM   1546  C  C     . ASP A 1  192 ? 28.905  20.318  176.091 1.00 133.23 ? 192  ASP A C     1 
ATOM   1547  O  O     . ASP A 1  192 ? 29.937  20.204  176.760 1.00 131.84 ? 192  ASP A O     1 
ATOM   1548  C  CB    . ASP A 1  192 ? 27.744  18.729  177.661 1.00 128.09 ? 192  ASP A CB    1 
ATOM   1549  C  CG    . ASP A 1  192 ? 26.501  18.539  178.518 1.00 122.07 ? 192  ASP A CG    1 
ATOM   1550  O  OD1   . ASP A 1  192 ? 25.681  19.479  178.603 1.00 117.59 ? 192  ASP A OD1   1 
ATOM   1551  O  OD2   . ASP A 1  192 ? 26.341  17.447  179.103 1.00 117.07 ? 192  ASP A OD2   1 
ATOM   1552  N  N     . LEU A 1  193 ? 28.886  20.899  174.893 1.00 141.01 ? 193  LEU A N     1 
ATOM   1553  C  CA    . LEU A 1  193 ? 30.030  21.545  174.267 1.00 128.58 ? 193  LEU A CA    1 
ATOM   1554  C  C     . LEU A 1  193 ? 30.067  23.038  174.563 1.00 131.01 ? 193  LEU A C     1 
ATOM   1555  O  O     . LEU A 1  193 ? 29.033  23.683  174.755 1.00 129.58 ? 193  LEU A O     1 
ATOM   1556  C  CB    . LEU A 1  193 ? 30.014  21.328  172.753 1.00 124.92 ? 193  LEU A CB    1 
ATOM   1557  C  CG    . LEU A 1  193 ? 30.305  19.912  172.256 1.00 120.34 ? 193  LEU A CG    1 
ATOM   1558  C  CD1   . LEU A 1  193 ? 30.371  19.882  170.734 1.00 114.44 ? 193  LEU A CD1   1 
ATOM   1559  C  CD2   . LEU A 1  193 ? 31.593  19.384  172.869 1.00 118.97 ? 193  LEU A CD2   1 
ATOM   1560  N  N     . GLU A 1  194 ? 31.280  23.585  174.563 1.00 129.55 ? 194  GLU A N     1 
ATOM   1561  C  CA    . GLU A 1  194 ? 31.467  25.028  174.632 1.00 132.37 ? 194  GLU A CA    1 
ATOM   1562  C  C     . GLU A 1  194 ? 30.736  25.706  173.481 1.00 133.75 ? 194  GLU A C     1 
ATOM   1563  O  O     . GLU A 1  194 ? 30.816  25.257  172.334 1.00 143.41 ? 194  GLU A O     1 
ATOM   1564  C  CB    . GLU A 1  194 ? 32.964  25.352  174.604 1.00 137.55 ? 194  GLU A CB    1 
ATOM   1565  C  CG    . GLU A 1  194 ? 33.325  26.827  174.665 1.00 144.94 ? 194  GLU A CG    1 
ATOM   1566  C  CD    . GLU A 1  194 ? 33.569  27.446  173.312 1.00 148.46 ? 194  GLU A CD    1 
ATOM   1567  O  OE1   . GLU A 1  194 ? 33.712  26.685  172.336 1.00 150.13 ? 194  GLU A OE1   1 
ATOM   1568  O  OE2   . GLU A 1  194 ? 33.625  28.691  173.226 1.00 143.21 ? 194  GLU A OE2   1 
ATOM   1569  N  N     . ILE A 1  195 ? 29.988  26.767  173.802 1.00 124.15 ? 195  ILE A N     1 
ATOM   1570  C  CA    . ILE A 1  195 ? 29.062  27.413  172.872 1.00 135.92 ? 195  ILE A CA    1 
ATOM   1571  C  C     . ILE A 1  195 ? 29.749  27.736  171.549 1.00 154.02 ? 195  ILE A C     1 
ATOM   1572  O  O     . ILE A 1  195 ? 29.090  27.872  170.514 1.00 151.63 ? 195  ILE A O     1 
ATOM   1573  C  CB    . ILE A 1  195 ? 28.450  28.681  173.501 1.00 130.16 ? 195  ILE A CB    1 
ATOM   1574  C  CG1   . ILE A 1  195 ? 27.221  29.144  172.710 1.00 125.77 ? 195  ILE A CG1   1 
ATOM   1575  C  CG2   . ILE A 1  195 ? 29.482  29.795  173.596 1.00 133.76 ? 195  ILE A CG2   1 
ATOM   1576  C  CD1   . ILE A 1  195 ? 26.053  28.181  172.765 1.00 127.20 ? 195  ILE A CD1   1 
ATOM   1577  N  N     . GLY A 1  196 ? 31.074  27.841  171.567 1.00 187.92 ? 196  GLY A N     1 
ATOM   1578  C  CA    . GLY A 1  196 ? 31.845  28.002  170.351 1.00 191.13 ? 196  GLY A CA    1 
ATOM   1579  C  C     . GLY A 1  196 ? 31.776  26.735  169.525 1.00 188.70 ? 196  GLY A C     1 
ATOM   1580  O  O     . GLY A 1  196 ? 31.270  26.744  168.399 1.00 189.85 ? 196  GLY A O     1 
ATOM   1581  N  N     . GLN A 1  197 ? 32.304  25.636  170.079 1.00 153.06 ? 197  GLN A N     1 
ATOM   1582  C  CA    . GLN A 1  197 ? 32.222  24.347  169.400 1.00 144.10 ? 197  GLN A CA    1 
ATOM   1583  C  C     . GLN A 1  197 ? 30.778  23.958  169.116 1.00 141.78 ? 197  GLN A C     1 
ATOM   1584  O  O     . GLN A 1  197 ? 30.514  23.205  168.171 1.00 137.15 ? 197  GLN A O     1 
ATOM   1585  C  CB    . GLN A 1  197 ? 32.897  23.257  170.235 1.00 133.40 ? 197  GLN A CB    1 
ATOM   1586  C  CG    . GLN A 1  197 ? 33.890  23.768  171.261 1.00 135.83 ? 197  GLN A CG    1 
ATOM   1587  C  CD    . GLN A 1  197 ? 34.222  22.731  172.318 1.00 134.53 ? 197  GLN A CD    1 
ATOM   1588  O  OE1   . GLN A 1  197 ? 33.468  22.533  173.272 1.00 132.87 ? 197  GLN A OE1   1 
ATOM   1589  N  NE2   . GLN A 1  197 ? 35.360  22.067  172.158 1.00 136.94 ? 197  GLN A NE2   1 
ATOM   1590  N  N     . HIS A 1  198 ? 29.832  24.450  169.921 1.00 136.46 ? 198  HIS A N     1 
ATOM   1591  C  CA    . HIS A 1  198 ? 28.428  24.166  169.649 1.00 136.19 ? 198  HIS A CA    1 
ATOM   1592  C  C     . HIS A 1  198 ? 27.976  24.908  168.398 1.00 136.13 ? 198  HIS A C     1 
ATOM   1593  O  O     . HIS A 1  198 ? 27.403  24.303  167.484 1.00 135.86 ? 198  HIS A O     1 
ATOM   1594  C  CB    . HIS A 1  198 ? 27.568  24.540  170.861 1.00 136.73 ? 198  HIS A CB    1 
ATOM   1595  C  CG    . HIS A 1  198 ? 26.094  24.390  170.636 1.00 130.10 ? 198  HIS A CG    1 
ATOM   1596  N  ND1   . HIS A 1  198 ? 25.416  23.221  170.911 1.00 123.53 ? 198  HIS A ND1   1 
ATOM   1597  C  CD2   . HIS A 1  198 ? 25.164  25.264  170.182 1.00 128.86 ? 198  HIS A CD2   1 
ATOM   1598  C  CE1   . HIS A 1  198 ? 24.136  23.378  170.627 1.00 119.66 ? 198  HIS A CE1   1 
ATOM   1599  N  NE2   . HIS A 1  198 ? 23.956  24.609  170.182 1.00 120.83 ? 198  HIS A NE2   1 
ATOM   1600  N  N     . ARG A 1  199 ? 28.236  26.222  168.332 1.00 139.33 ? 199  ARG A N     1 
ATOM   1601  C  CA    . ARG A 1  199 ? 27.822  26.993  167.162 1.00 134.33 ? 199  ARG A CA    1 
ATOM   1602  C  C     . ARG A 1  199 ? 28.435  26.407  165.901 1.00 137.73 ? 199  ARG A C     1 
ATOM   1603  O  O     . ARG A 1  199 ? 27.813  26.428  164.833 1.00 135.95 ? 199  ARG A O     1 
ATOM   1604  C  CB    . ARG A 1  199 ? 28.213  28.465  167.307 1.00 138.39 ? 199  ARG A CB    1 
ATOM   1605  C  CG    . ARG A 1  199 ? 27.420  29.234  168.352 1.00 135.12 ? 199  ARG A CG    1 
ATOM   1606  C  CD    . ARG A 1  199 ? 26.055  29.652  167.841 1.00 135.31 ? 199  ARG A CD    1 
ATOM   1607  N  NE    . ARG A 1  199 ? 25.030  29.439  168.860 1.00 140.13 ? 199  ARG A NE    1 
ATOM   1608  C  CZ    . ARG A 1  199 ? 23.806  28.984  168.612 1.00 139.27 ? 199  ARG A CZ    1 
ATOM   1609  N  NH1   . ARG A 1  199 ? 23.439  28.700  167.370 1.00 134.32 ? 199  ARG A NH1   1 
ATOM   1610  N  NH2   . ARG A 1  199 ? 22.945  28.822  169.609 1.00 135.24 ? 199  ARG A NH2   1 
ATOM   1611  N  N     . THR A 1  200 ? 29.661  25.891  166.014 1.00 142.98 ? 200  THR A N     1 
ATOM   1612  C  CA    . THR A 1  200 ? 30.326  25.242  164.892 1.00 141.93 ? 200  THR A CA    1 
ATOM   1613  C  C     . THR A 1  200 ? 29.513  24.041  164.432 1.00 135.84 ? 200  THR A C     1 
ATOM   1614  O  O     . THR A 1  200 ? 29.057  23.981  163.284 1.00 134.66 ? 200  THR A O     1 
ATOM   1615  C  CB    . THR A 1  200 ? 31.745  24.824  165.286 1.00 143.46 ? 200  THR A CB    1 
ATOM   1616  O  OG1   . THR A 1  200 ? 32.518  25.988  165.605 1.00 146.47 ? 200  THR A OG1   1 
ATOM   1617  C  CG2   . THR A 1  200 ? 32.417  24.077  164.145 1.00 140.84 ? 200  THR A CG2   1 
ATOM   1618  N  N     . LYS A 1  201 ? 29.329  23.068  165.331 1.00 132.89 ? 201  LYS A N     1 
ATOM   1619  C  CA    . LYS A 1  201 ? 28.538  21.878  165.035 1.00 125.67 ? 201  LYS A CA    1 
ATOM   1620  C  C     . LYS A 1  201 ? 27.201  22.246  164.402 1.00 122.84 ? 201  LYS A C     1 
ATOM   1621  O  O     . LYS A 1  201 ? 26.775  21.624  163.423 1.00 125.30 ? 201  LYS A O     1 
ATOM   1622  C  CB    . LYS A 1  201 ? 28.319  21.073  166.317 1.00 121.99 ? 201  LYS A CB    1 
ATOM   1623  C  CG    . LYS A 1  201 ? 29.548  20.328  166.813 1.00 121.09 ? 201  LYS A CG    1 
ATOM   1624  C  CD    . LYS A 1  201 ? 30.156  19.466  165.722 1.00 129.71 ? 201  LYS A CD    1 
ATOM   1625  C  CE    . LYS A 1  201 ? 31.387  18.730  166.227 1.00 136.95 ? 201  LYS A CE    1 
ATOM   1626  N  NZ    . LYS A 1  201 ? 31.068  17.832  167.372 1.00 126.47 ? 201  LYS A NZ    1 
ATOM   1627  N  N     . ILE A 1  202 ? 26.503  23.232  164.977 1.00 126.65 ? 202  ILE A N     1 
ATOM   1628  C  CA    . ILE A 1  202 ? 25.267  23.721  164.365 1.00 129.32 ? 202  ILE A CA    1 
ATOM   1629  C  C     . ILE A 1  202 ? 25.510  24.118  162.914 1.00 140.97 ? 202  ILE A C     1 
ATOM   1630  O  O     . ILE A 1  202 ? 24.788  23.690  162.007 1.00 138.56 ? 202  ILE A O     1 
ATOM   1631  C  CB    . ILE A 1  202 ? 24.688  24.896  165.175 1.00 124.62 ? 202  ILE A CB    1 
ATOM   1632  C  CG1   . ILE A 1  202 ? 24.464  24.485  166.628 1.00 125.93 ? 202  ILE A CG1   1 
ATOM   1633  C  CG2   . ILE A 1  202 ? 23.395  25.399  164.549 1.00 118.99 ? 202  ILE A CG2   1 
ATOM   1634  C  CD1   . ILE A 1  202 ? 23.437  23.402  166.784 1.00 123.41 ? 202  ILE A CD1   1 
ATOM   1635  N  N     . GLU A 1  203 ? 26.528  24.951  162.675 1.00 145.85 ? 203  GLU A N     1 
ATOM   1636  C  CA    . GLU A 1  203 ? 26.817  25.379  161.309 1.00 149.80 ? 203  GLU A CA    1 
ATOM   1637  C  C     . GLU A 1  203 ? 27.164  24.191  160.419 1.00 151.05 ? 203  GLU A C     1 
ATOM   1638  O  O     . GLU A 1  203 ? 26.812  24.169  159.233 1.00 149.71 ? 203  GLU A O     1 
ATOM   1639  C  CB    . GLU A 1  203 ? 27.944  26.411  161.308 1.00 155.02 ? 203  GLU A CB    1 
ATOM   1640  C  CG    . GLU A 1  203 ? 27.556  27.747  161.930 1.00 157.08 ? 203  GLU A CG    1 
ATOM   1641  C  CD    . GLU A 1  203 ? 26.301  28.340  161.316 1.00 158.86 ? 203  GLU A CD    1 
ATOM   1642  O  OE1   . GLU A 1  203 ? 26.275  28.534  160.082 1.00 167.02 ? 203  GLU A OE1   1 
ATOM   1643  O  OE2   . GLU A 1  203 ? 25.339  28.611  162.066 1.00 153.37 ? 203  GLU A OE2   1 
ATOM   1644  N  N     . GLU A 1  204 ? 27.862  23.194  160.973 1.00 140.13 ? 204  GLU A N     1 
ATOM   1645  C  CA    . GLU A 1  204 ? 28.105  21.957  160.237 1.00 135.26 ? 204  GLU A CA    1 
ATOM   1646  C  C     . GLU A 1  204 ? 26.795  21.259  159.902 1.00 132.66 ? 204  GLU A C     1 
ATOM   1647  O  O     . GLU A 1  204 ? 26.653  20.660  158.829 1.00 127.28 ? 204  GLU A O     1 
ATOM   1648  C  CB    . GLU A 1  204 ? 29.012  21.037  161.051 1.00 137.95 ? 204  GLU A CB    1 
ATOM   1649  C  CG    . GLU A 1  204 ? 30.262  21.716  161.573 1.00 136.37 ? 204  GLU A CG    1 
ATOM   1650  C  CD    . GLU A 1  204 ? 31.185  20.761  162.289 1.00 145.14 ? 204  GLU A CD    1 
ATOM   1651  O  OE1   . GLU A 1  204 ? 32.315  21.165  162.634 1.00 148.99 ? 204  GLU A OE1   1 
ATOM   1652  O  OE2   . GLU A 1  204 ? 30.778  19.604  162.518 1.00 149.21 ? 204  GLU A OE2   1 
ATOM   1653  N  N     . LEU A 1  205 ? 25.826  21.323  160.818 1.00 134.85 ? 205  LEU A N     1 
ATOM   1654  C  CA    . LEU A 1  205 ? 24.538  20.676  160.599 1.00 131.10 ? 205  LEU A CA    1 
ATOM   1655  C  C     . LEU A 1  205 ? 23.787  21.350  159.459 1.00 126.09 ? 205  LEU A C     1 
ATOM   1656  O  O     . LEU A 1  205 ? 23.224  20.676  158.589 1.00 125.67 ? 205  LEU A O     1 
ATOM   1657  C  CB    . LEU A 1  205 ? 23.713  20.689  161.887 1.00 130.17 ? 205  LEU A CB    1 
ATOM   1658  C  CG    . LEU A 1  205 ? 22.291  20.133  161.797 1.00 122.25 ? 205  LEU A CG    1 
ATOM   1659  C  CD1   . LEU A 1  205 ? 22.320  18.667  161.391 1.00 116.45 ? 205  LEU A CD1   1 
ATOM   1660  C  CD2   . LEU A 1  205 ? 21.556  20.315  163.117 1.00 115.20 ? 205  LEU A CD2   1 
ATOM   1661  N  N     . ARG A 1  206 ? 23.764  22.688  159.451 1.00 129.34 ? 206  ARG A N     1 
ATOM   1662  C  CA    . ARG A 1  206 ? 23.028  23.401  158.412 1.00 129.28 ? 206  ARG A CA    1 
ATOM   1663  C  C     . ARG A 1  206 ? 23.648  23.152  157.044 1.00 135.99 ? 206  ARG A C     1 
ATOM   1664  O  O     . ARG A 1  206 ? 22.932  23.065  156.039 1.00 139.14 ? 206  ARG A O     1 
ATOM   1665  C  CB    . ARG A 1  206 ? 22.989  24.898  158.722 1.00 120.31 ? 206  ARG A CB    1 
ATOM   1666  C  CG    . ARG A 1  206 ? 22.752  25.225  160.184 1.00 122.99 ? 206  ARG A CG    1 
ATOM   1667  C  CD    . ARG A 1  206 ? 22.822  26.722  160.437 1.00 124.91 ? 206  ARG A CD    1 
ATOM   1668  N  NE    . ARG A 1  206 ? 21.545  27.384  160.190 1.00 128.97 ? 206  ARG A NE    1 
ATOM   1669  C  CZ    . ARG A 1  206 ? 21.425  28.601  159.670 1.00 131.23 ? 206  ARG A CZ    1 
ATOM   1670  N  NH1   . ARG A 1  206 ? 22.507  29.280  159.311 1.00 138.07 ? 206  ARG A NH1   1 
ATOM   1671  N  NH2   . ARG A 1  206 ? 20.224  29.130  159.483 1.00 126.66 ? 206  ARG A NH2   1 
ATOM   1672  N  N     . GLN A 1  207 ? 24.977  23.031  156.982 1.00 132.44 ? 207  GLN A N     1 
ATOM   1673  C  CA    . GLN A 1  207 ? 25.629  22.781  155.700 1.00 134.03 ? 207  GLN A CA    1 
ATOM   1674  C  C     . GLN A 1  207 ? 25.235  21.411  155.168 1.00 135.73 ? 207  GLN A C     1 
ATOM   1675  O  O     . GLN A 1  207 ? 24.737  21.290  154.043 1.00 143.65 ? 207  GLN A O     1 
ATOM   1676  C  CB    . GLN A 1  207 ? 27.151  22.893  155.837 1.00 138.64 ? 207  GLN A CB    1 
ATOM   1677  C  CG    . GLN A 1  207 ? 27.678  24.295  156.093 1.00 139.28 ? 207  GLN A CG    1 
ATOM   1678  C  CD    . GLN A 1  207 ? 27.290  25.262  154.988 1.00 137.55 ? 207  GLN A CD    1 
ATOM   1679  O  OE1   . GLN A 1  207 ? 27.237  24.888  153.815 1.00 141.81 ? 207  GLN A OE1   1 
ATOM   1680  N  NE2   . GLN A 1  207 ? 27.031  26.511  155.353 1.00 137.55 ? 207  GLN A NE2   1 
ATOM   1681  N  N     . HIS A 1  208 ? 25.495  20.362  155.954 1.00 133.55 ? 208  HIS A N     1 
ATOM   1682  C  CA    . HIS A 1  208 ? 25.000  19.025  155.643 1.00 133.53 ? 208  HIS A CA    1 
ATOM   1683  C  C     . HIS A 1  208 ? 23.542  19.076  155.187 1.00 136.92 ? 208  HIS A C     1 
ATOM   1684  O  O     . HIS A 1  208 ? 23.168  18.435  154.201 1.00 147.12 ? 208  HIS A O     1 
ATOM   1685  C  CB    . HIS A 1  208 ? 25.182  18.099  156.848 1.00 126.35 ? 208  HIS A CB    1 
ATOM   1686  C  CG    . HIS A 1  208 ? 24.588  16.738  156.658 1.00 122.86 ? 208  HIS A CG    1 
ATOM   1687  N  ND1   . HIS A 1  208 ? 25.306  15.685  156.132 1.00 133.45 ? 208  HIS A ND1   1 
ATOM   1688  C  CD2   . HIS A 1  208 ? 23.355  16.251  156.933 1.00 124.60 ? 208  HIS A CD2   1 
ATOM   1689  C  CE1   . HIS A 1  208 ? 24.540  14.611  156.085 1.00 130.84 ? 208  HIS A CE1   1 
ATOM   1690  N  NE2   . HIS A 1  208 ? 23.351  14.927  156.565 1.00 126.25 ? 208  HIS A NE2   1 
ATOM   1691  N  N     . LEU A 1  209 ? 22.696  19.824  155.909 1.00 126.11 ? 209  LEU A N     1 
ATOM   1692  C  CA    . LEU A 1  209 ? 21.285  19.891  155.533 1.00 130.50 ? 209  LEU A CA    1 
ATOM   1693  C  C     . LEU A 1  209 ? 21.104  20.650  154.224 1.00 135.43 ? 209  LEU A C     1 
ATOM   1694  O  O     . LEU A 1  209 ? 20.279  20.265  153.387 1.00 133.79 ? 209  LEU A O     1 
ATOM   1695  C  CB    . LEU A 1  209 ? 20.463  20.541  156.645 1.00 128.13 ? 209  LEU A CB    1 
ATOM   1696  C  CG    . LEU A 1  209 ? 20.150  19.656  157.850 1.00 126.18 ? 209  LEU A CG    1 
ATOM   1697  C  CD1   . LEU A 1  209 ? 19.215  20.369  158.815 1.00 112.37 ? 209  LEU A CD1   1 
ATOM   1698  C  CD2   . LEU A 1  209 ? 19.557  18.337  157.392 1.00 120.60 ? 209  LEU A CD2   1 
ATOM   1699  N  N     . LEU A 1  210 ? 21.874  21.723  154.022 1.00 139.45 ? 210  LEU A N     1 
ATOM   1700  C  CA    . LEU A 1  210 ? 21.736  22.494  152.791 1.00 141.55 ? 210  LEU A CA    1 
ATOM   1701  C  C     . LEU A 1  210 ? 22.272  21.672  151.635 1.00 153.45 ? 210  LEU A C     1 
ATOM   1702  O  O     . LEU A 1  210 ? 21.764  21.746  150.511 1.00 149.23 ? 210  LEU A O     1 
ATOM   1703  C  CB    . LEU A 1  210 ? 22.473  23.828  152.898 1.00 136.30 ? 210  LEU A CB    1 
ATOM   1704  C  CG    . LEU A 1  210 ? 22.021  24.918  151.924 1.00 131.74 ? 210  LEU A CG    1 
ATOM   1705  C  CD1   . LEU A 1  210 ? 20.517  25.096  151.987 1.00 132.42 ? 210  LEU A CD1   1 
ATOM   1706  C  CD2   . LEU A 1  210 ? 22.732  26.234  152.203 1.00 129.01 ? 210  LEU A CD2   1 
ATOM   1707  N  N     . ARG A 1  211 ? 23.311  20.891  151.924 1.00 188.34 ? 211  ARG A N     1 
ATOM   1708  C  CA    . ARG A 1  211 ? 23.832  19.885  151.016 1.00 189.59 ? 211  ARG A CA    1 
ATOM   1709  C  C     . ARG A 1  211 ? 22.803  18.899  150.457 1.00 188.46 ? 211  ARG A C     1 
ATOM   1710  O  O     . ARG A 1  211 ? 22.972  18.409  149.333 1.00 192.12 ? 211  ARG A O     1 
ATOM   1711  C  CB    . ARG A 1  211 ? 24.934  19.138  151.761 1.00 188.00 ? 211  ARG A CB    1 
ATOM   1712  C  CG    . ARG A 1  211 ? 24.882  17.744  151.372 1.00 189.92 ? 211  ARG A CG    1 
ATOM   1713  C  CD    . ARG A 1  211 ? 25.927  16.814  151.750 1.00 191.92 ? 211  ARG A CD    1 
ATOM   1714  N  NE    . ARG A 1  211 ? 25.326  15.534  151.412 1.00 192.53 ? 211  ARG A NE    1 
ATOM   1715  C  CZ    . ARG A 1  211 ? 25.167  15.097  150.173 1.00 194.80 ? 211  ARG A CZ    1 
ATOM   1716  N  NH1   . ARG A 1  211 ? 25.584  15.839  149.154 1.00 200.83 ? 211  ARG A NH1   1 
ATOM   1717  N  NH2   . ARG A 1  211 ? 24.621  13.914  149.952 1.00 190.97 ? 211  ARG A NH2   1 
ATOM   1718  N  N     . TRP A 1  212 ? 21.707  18.642  151.164 1.00 158.65 ? 212  TRP A N     1 
ATOM   1719  C  CA    . TRP A 1  212 ? 20.662  17.772  150.634 1.00 145.62 ? 212  TRP A CA    1 
ATOM   1720  C  C     . TRP A 1  212 ? 19.431  18.564  150.218 1.00 140.95 ? 212  TRP A C     1 
ATOM   1721  O  O     . TRP A 1  212 ? 18.353  17.988  150.037 1.00 126.40 ? 212  TRP A O     1 
ATOM   1722  C  CB    . TRP A 1  212 ? 20.277  16.681  151.637 1.00 131.14 ? 212  TRP A CB    1 
ATOM   1723  C  CG    . TRP A 1  212 ? 21.364  15.704  152.043 1.00 134.72 ? 212  TRP A CG    1 
ATOM   1724  C  CD1   . TRP A 1  212 ? 22.332  15.892  152.984 1.00 135.98 ? 212  TRP A CD1   1 
ATOM   1725  C  CD2   . TRP A 1  212 ? 21.511  14.348  151.588 1.00 130.28 ? 212  TRP A CD2   1 
ATOM   1726  N  NE1   . TRP A 1  212 ? 23.103  14.760  153.108 1.00 130.52 ? 212  TRP A NE1   1 
ATOM   1727  C  CE2   . TRP A 1  212 ? 22.617  13.796  152.266 1.00 126.42 ? 212  TRP A CE2   1 
ATOM   1728  C  CE3   . TRP A 1  212 ? 20.827  13.556  150.659 1.00 129.42 ? 212  TRP A CE3   1 
ATOM   1729  C  CZ2   . TRP A 1  212 ? 23.053  12.488  152.047 1.00 126.14 ? 212  TRP A CZ2   1 
ATOM   1730  C  CZ3   . TRP A 1  212 ? 21.264  12.259  150.440 1.00 127.42 ? 212  TRP A CZ3   1 
ATOM   1731  C  CH2   . TRP A 1  212 ? 22.368  11.741  151.129 1.00 124.93 ? 212  TRP A CH2   1 
ATOM   1732  N  N     . GLY A 1  213 ? 19.579  19.873  150.048 1.00 139.10 ? 213  GLY A N     1 
ATOM   1733  C  CA    . GLY A 1  213 ? 18.507  20.705  149.555 1.00 135.89 ? 213  GLY A CA    1 
ATOM   1734  C  C     . GLY A 1  213 ? 17.560  21.154  150.637 1.00 122.21 ? 213  GLY A C     1 
ATOM   1735  O  O     . GLY A 1  213 ? 16.472  21.653  150.328 1.00 118.44 ? 213  GLY A O     1 
ATOM   1736  N  N     . LEU A 1  214 ? 17.952  20.997  151.899 1.00 127.95 ? 214  LEU A N     1 
ATOM   1737  C  CA    . LEU A 1  214 ? 17.134  21.344  153.053 1.00 124.32 ? 214  LEU A CA    1 
ATOM   1738  C  C     . LEU A 1  214 ? 17.679  22.635  153.650 1.00 123.33 ? 214  LEU A C     1 
ATOM   1739  O  O     . LEU A 1  214 ? 18.756  22.640  154.256 1.00 122.79 ? 214  LEU A O     1 
ATOM   1740  C  CB    . LEU A 1  214 ? 17.151  20.214  154.080 1.00 127.30 ? 214  LEU A CB    1 
ATOM   1741  C  CG    . LEU A 1  214 ? 16.446  18.913  153.694 1.00 121.85 ? 214  LEU A CG    1 
ATOM   1742  C  CD1   . LEU A 1  214 ? 16.455  17.940  154.856 1.00 120.32 ? 214  LEU A CD1   1 
ATOM   1743  C  CD2   . LEU A 1  214 ? 15.024  19.194  153.261 1.00 112.64 ? 214  LEU A CD2   1 
ATOM   1744  N  N     . THR A 1  215 ? 16.939  23.724  153.484 1.00 119.34 ? 215  THR A N     1 
ATOM   1745  C  CA    . THR A 1  215 ? 17.378  24.997  154.028 1.00 121.34 ? 215  THR A CA    1 
ATOM   1746  C  C     . THR A 1  215 ? 16.993  25.100  155.500 1.00 120.28 ? 215  THR A C     1 
ATOM   1747  O  O     . THR A 1  215 ? 16.056  24.452  155.973 1.00 120.84 ? 215  THR A O     1 
ATOM   1748  C  CB    . THR A 1  215 ? 16.761  26.163  153.254 1.00 119.76 ? 215  THR A CB    1 
ATOM   1749  O  OG1   . THR A 1  215 ? 15.339  26.157  153.436 1.00 118.71 ? 215  THR A OG1   1 
ATOM   1750  C  CG2   . THR A 1  215 ? 17.069  26.046  151.772 1.00 122.83 ? 215  THR A CG2   1 
ATOM   1751  N  N     . THR A 1  216 ? 17.736  25.930  156.229 1.00 125.39 ? 216  THR A N     1 
ATOM   1752  C  CA    . THR A 1  216 ? 17.412  26.272  157.613 1.00 122.56 ? 216  THR A CA    1 
ATOM   1753  C  C     . THR A 1  216 ? 17.457  27.789  157.729 1.00 124.29 ? 216  THR A C     1 
ATOM   1754  O  O     . THR A 1  216 ? 18.481  28.369  158.118 1.00 122.87 ? 216  THR A O     1 
ATOM   1755  C  CB    . THR A 1  216 ? 18.376  25.601  158.593 1.00 117.38 ? 216  THR A CB    1 
ATOM   1756  O  OG1   . THR A 1  216 ? 19.719  25.716  158.104 1.00 111.24 ? 216  THR A OG1   1 
ATOM   1757  C  CG2   . THR A 1  216 ? 18.026  24.130  158.759 1.00 120.97 ? 216  THR A CG2   1 
ATOM   1758  N  N     . PRO A 1  217 ? 16.360  28.463  157.382 1.00 128.78 ? 217  PRO A N     1 
ATOM   1759  C  CA    . PRO A 1  217 ? 16.341  29.931  157.400 1.00 131.80 ? 217  PRO A CA    1 
ATOM   1760  C  C     . PRO A 1  217 ? 16.692  30.510  158.763 1.00 134.81 ? 217  PRO A C     1 
ATOM   1761  O  O     . PRO A 1  217 ? 16.423  29.913  159.808 1.00 136.19 ? 217  PRO A O     1 
ATOM   1762  C  CB    . PRO A 1  217 ? 14.896  30.277  157.010 1.00 125.97 ? 217  PRO A CB    1 
ATOM   1763  C  CG    . PRO A 1  217 ? 14.130  28.986  157.067 1.00 122.02 ? 217  PRO A CG    1 
ATOM   1764  C  CD    . PRO A 1  217 ? 15.115  27.896  156.842 1.00 125.96 ? 217  PRO A CD    1 
ATOM   1765  N  N     . ASP A 1  218 ? 17.316  31.692  158.738 1.00 137.44 ? 218  ASP A N     1 
ATOM   1766  C  CA    . ASP A 1  218 ? 17.731  32.333  159.981 1.00 141.46 ? 218  ASP A CA    1 
ATOM   1767  C  C     . ASP A 1  218 ? 16.520  32.751  160.806 1.00 147.52 ? 218  ASP A C     1 
ATOM   1768  O  O     . ASP A 1  218 ? 16.607  32.834  162.036 1.00 142.72 ? 218  ASP A O     1 
ATOM   1769  C  CB    . ASP A 1  218 ? 18.639  33.527  159.686 1.00 143.54 ? 218  ASP A CB    1 
ATOM   1770  C  CG    . ASP A 1  218 ? 20.107  33.140  159.645 1.00 137.83 ? 218  ASP A CG    1 
ATOM   1771  O  OD1   . ASP A 1  218 ? 20.463  32.097  160.236 1.00 133.69 ? 218  ASP A OD1   1 
ATOM   1772  O  OD2   . ASP A 1  218 ? 20.903  33.872  159.020 1.00 134.60 ? 218  ASP A OD2   1 
ATOM   1773  N  N     . LYS A 1  219 ? 15.394  33.030  160.140 1.00 160.77 ? 219  LYS A N     1 
ATOM   1774  C  CA    . LYS A 1  219 ? 14.186  33.481  160.820 1.00 159.72 ? 219  LYS A CA    1 
ATOM   1775  C  C     . LYS A 1  219 ? 13.661  32.431  161.788 1.00 156.35 ? 219  LYS A C     1 
ATOM   1776  O  O     . LYS A 1  219 ? 12.983  32.776  162.763 1.00 157.83 ? 219  LYS A O     1 
ATOM   1777  C  CB    . LYS A 1  219 ? 13.112  33.807  159.774 1.00 160.67 ? 219  LYS A CB    1 
ATOM   1778  C  CG    . LYS A 1  219 ? 11.709  34.055  160.315 1.00 159.50 ? 219  LYS A CG    1 
ATOM   1779  C  CD    . LYS A 1  219 ? 10.854  34.838  159.331 1.00 161.03 ? 219  LYS A CD    1 
ATOM   1780  C  CE    . LYS A 1  219 ? 9.524   35.233  159.950 1.00 154.73 ? 219  LYS A CE    1 
ATOM   1781  N  NZ    . LYS A 1  219 ? 8.970   36.480  159.354 1.00 156.00 ? 219  LYS A NZ    1 
ATOM   1782  N  N     . LYS A 1  220 ? 13.998  31.163  161.559 1.00 138.43 ? 220  LYS A N     1 
ATOM   1783  C  CA    . LYS A 1  220 ? 13.577  30.054  162.402 1.00 124.81 ? 220  LYS A CA    1 
ATOM   1784  C  C     . LYS A 1  220 ? 14.712  29.524  163.267 1.00 125.31 ? 220  LYS A C     1 
ATOM   1785  O  O     . LYS A 1  220 ? 14.549  28.489  163.922 1.00 125.85 ? 220  LYS A O     1 
ATOM   1786  C  CB    . LYS A 1  220 ? 13.001  28.930  161.537 1.00 152.58 ? 220  LYS A CB    1 
ATOM   1787  N  N     . HIS A 1  221 ? 15.856  30.202  163.284 1.00 133.20 ? 221  HIS A N     1 
ATOM   1788  C  CA    . HIS A 1  221 ? 17.045  29.721  163.981 1.00 136.35 ? 221  HIS A CA    1 
ATOM   1789  C  C     . HIS A 1  221 ? 17.087  30.396  165.349 1.00 135.07 ? 221  HIS A C     1 
ATOM   1790  O  O     . HIS A 1  221 ? 17.559  31.528  165.483 1.00 138.90 ? 221  HIS A O     1 
ATOM   1791  C  CB    . HIS A 1  221 ? 18.283  30.029  163.141 1.00 140.37 ? 221  HIS A CB    1 
ATOM   1792  C  CG    . HIS A 1  221 ? 19.551  29.410  163.646 1.00 140.26 ? 221  HIS A CG    1 
ATOM   1793  N  ND1   . HIS A 1  221 ? 19.828  29.243  164.985 1.00 138.58 ? 221  HIS A ND1   1 
ATOM   1794  C  CD2   . HIS A 1  221 ? 20.623  28.923  162.977 1.00 144.44 ? 221  HIS A CD2   1 
ATOM   1795  C  CE1   . HIS A 1  221 ? 21.016  28.679  165.119 1.00 140.91 ? 221  HIS A CE1   1 
ATOM   1796  N  NE2   . HIS A 1  221 ? 21.518  28.472  163.916 1.00 143.05 ? 221  HIS A NE2   1 
ATOM   1797  N  N     . GLN A 1  222 ? 16.583  29.697  166.365 1.00 131.61 ? 222  GLN A N     1 
ATOM   1798  C  CA    . GLN A 1  222 ? 16.628  30.187  167.737 1.00 132.47 ? 222  GLN A CA    1 
ATOM   1799  C  C     . GLN A 1  222 ? 17.995  29.918  168.349 1.00 134.15 ? 222  GLN A C     1 
ATOM   1800  O  O     . GLN A 1  222 ? 18.520  28.804  168.250 1.00 132.72 ? 222  GLN A O     1 
ATOM   1801  C  CB    . GLN A 1  222 ? 15.540  29.536  168.589 1.00 130.57 ? 222  GLN A CB    1 
ATOM   1802  C  CG    . GLN A 1  222 ? 14.143  29.620  168.012 1.00 125.38 ? 222  GLN A CG    1 
ATOM   1803  C  CD    . GLN A 1  222 ? 13.134  28.878  168.862 1.00 121.33 ? 222  GLN A CD    1 
ATOM   1804  O  OE1   . GLN A 1  222 ? 13.009  29.135  170.059 1.00 119.91 ? 222  GLN A OE1   1 
ATOM   1805  N  NE2   . GLN A 1  222 ? 12.412  27.947  168.250 1.00 123.56 ? 222  GLN A NE2   1 
ATOM   1806  N  N     . LYS A 1  223 ? 18.571  30.935  168.986 1.00 137.53 ? 223  LYS A N     1 
ATOM   1807  C  CA    . LYS A 1  223 ? 19.903  30.792  169.557 1.00 138.06 ? 223  LYS A CA    1 
ATOM   1808  C  C     . LYS A 1  223 ? 19.898  31.184  171.031 1.00 144.22 ? 223  LYS A C     1 
ATOM   1809  O  O     . LYS A 1  223 ? 20.738  30.714  171.805 1.00 142.98 ? 223  LYS A O     1 
ATOM   1810  C  CB    . LYS A 1  223 ? 20.920  31.631  168.775 1.00 137.40 ? 223  LYS A CB    1 
ATOM   1811  C  CG    . LYS A 1  223 ? 20.750  31.572  167.260 1.00 138.16 ? 223  LYS A CG    1 
ATOM   1812  C  CD    . LYS A 1  223 ? 21.879  32.299  166.537 1.00 143.14 ? 223  LYS A CD    1 
ATOM   1813  C  CE    . LYS A 1  223 ? 21.634  32.359  165.033 1.00 146.78 ? 223  LYS A CE    1 
ATOM   1814  N  NZ    . LYS A 1  223 ? 22.466  33.402  164.367 1.00 142.51 ? 223  LYS A NZ    1 
ATOM   1815  N  N     . GLU A 1  224 ? 18.953  32.037  171.429 1.00 151.18 ? 224  GLU A N     1 
ATOM   1816  C  CA    . GLU A 1  224 ? 18.833  32.486  172.809 1.00 151.47 ? 224  GLU A CA    1 
ATOM   1817  C  C     . GLU A 1  224 ? 17.546  31.984  173.447 1.00 145.32 ? 224  GLU A C     1 
ATOM   1818  O  O     . GLU A 1  224 ? 16.474  32.098  172.837 1.00 143.45 ? 224  GLU A O     1 
ATOM   1819  C  CB    . GLU A 1  224 ? 18.883  34.016  172.881 1.00 153.30 ? 224  GLU A CB    1 
ATOM   1820  C  CG    . GLU A 1  224 ? 20.132  34.628  172.270 1.00 161.79 ? 224  GLU A CG    1 
ATOM   1821  C  CD    . GLU A 1  224 ? 21.405  34.144  172.939 1.00 164.71 ? 224  GLU A CD    1 
ATOM   1822  O  OE1   . GLU A 1  224 ? 21.442  34.092  174.186 1.00 163.56 ? 224  GLU A OE1   1 
ATOM   1823  O  OE2   . GLU A 1  224 ? 22.371  33.818  172.217 1.00 167.21 ? 224  GLU A OE2   1 
ATOM   1824  N  N     . PRO A 1  225 ? 17.610  31.411  174.662 1.00 137.02 ? 225  PRO A N     1 
ATOM   1825  C  CA    . PRO A 1  225 ? 16.447  31.032  175.476 1.00 124.07 ? 225  PRO A CA    1 
ATOM   1826  C  C     . PRO A 1  225 ? 15.552  32.242  175.761 1.00 123.14 ? 225  PRO A C     1 
ATOM   1827  O  O     . PRO A 1  225 ? 16.061  33.361  175.802 1.00 120.16 ? 225  PRO A O     1 
ATOM   1828  C  CB    . PRO A 1  225 ? 17.075  30.491  176.769 1.00 116.50 ? 225  PRO A CB    1 
ATOM   1829  C  CG    . PRO A 1  225 ? 18.495  30.958  176.752 1.00 114.57 ? 225  PRO A CG    1 
ATOM   1830  C  CD    . PRO A 1  225 ? 18.875  31.032  175.312 1.00 136.05 ? 225  PRO A CD    1 
ATOM   1831  N  N     . PRO A 1  226 ? 14.240  32.026  175.963 1.00 123.04 ? 226  PRO A N     1 
ATOM   1832  C  CA    . PRO A 1  226 ? 13.567  30.725  175.999 1.00 119.79 ? 226  PRO A CA    1 
ATOM   1833  C  C     . PRO A 1  226 ? 13.264  30.148  174.622 1.00 119.71 ? 226  PRO A C     1 
ATOM   1834  O  O     . PRO A 1  226 ? 12.636  30.797  173.784 1.00 119.42 ? 226  PRO A O     1 
ATOM   1835  C  CB    . PRO A 1  226 ? 12.277  31.040  176.754 1.00 121.66 ? 226  PRO A CB    1 
ATOM   1836  C  CG    . PRO A 1  226 ? 11.949  32.430  176.320 1.00 119.57 ? 226  PRO A CG    1 
ATOM   1837  C  CD    . PRO A 1  226 ? 13.281  33.135  176.126 1.00 124.52 ? 226  PRO A CD    1 
ATOM   1838  N  N     . PHE A 1  227 ? 13.734  28.926  174.395 1.00 123.49 ? 227  PHE A N     1 
ATOM   1839  C  CA    . PHE A 1  227 ? 13.492  28.257  173.127 1.00 114.18 ? 227  PHE A CA    1 
ATOM   1840  C  C     . PHE A 1  227 ? 12.033  27.843  173.003 1.00 115.55 ? 227  PHE A C     1 
ATOM   1841  O  O     . PHE A 1  227 ? 11.464  27.248  173.923 1.00 116.89 ? 227  PHE A O     1 
ATOM   1842  C  CB    . PHE A 1  227 ? 14.394  27.032  173.007 1.00 105.72 ? 227  PHE A CB    1 
ATOM   1843  C  CG    . PHE A 1  227 ? 15.853  27.359  173.021 1.00 111.02 ? 227  PHE A CG    1 
ATOM   1844  C  CD1   . PHE A 1  227 ? 16.547  27.425  174.217 1.00 110.07 ? 227  PHE A CD1   1 
ATOM   1845  C  CD2   . PHE A 1  227 ? 16.532  27.603  171.841 1.00 119.48 ? 227  PHE A CD2   1 
ATOM   1846  C  CE1   . PHE A 1  227 ? 17.892  27.729  174.236 1.00 116.33 ? 227  PHE A CE1   1 
ATOM   1847  C  CE2   . PHE A 1  227 ? 17.878  27.906  171.852 1.00 125.01 ? 227  PHE A CE2   1 
ATOM   1848  C  CZ    . PHE A 1  227 ? 18.559  27.970  173.053 1.00 125.31 ? 227  PHE A CZ    1 
ATOM   1849  N  N     . LEU A 1  228 ? 11.425  28.169  171.867 1.00 113.41 ? 228  LEU A N     1 
ATOM   1850  C  CA    . LEU A 1  228 ? 10.044  27.794  171.599 1.00 106.43 ? 228  LEU A CA    1 
ATOM   1851  C  C     . LEU A 1  228 ? 10.070  26.466  170.854 1.00 110.14 ? 228  LEU A C     1 
ATOM   1852  O  O     . LEU A 1  228 ? 10.664  26.369  169.774 1.00 109.05 ? 228  LEU A O     1 
ATOM   1853  C  CB    . LEU A 1  228 ? 9.306   28.867  170.798 1.00 104.53 ? 228  LEU A CB    1 
ATOM   1854  C  CG    . LEU A 1  228 ? 8.700   30.052  171.565 1.00 108.69 ? 228  LEU A CG    1 
ATOM   1855  C  CD1   . LEU A 1  228 ? 9.717   30.774  172.441 1.00 113.22 ? 228  LEU A CD1   1 
ATOM   1856  C  CD2   . LEU A 1  228 ? 8.020   31.026  170.611 1.00 110.95 ? 228  LEU A CD2   1 
ATOM   1857  N  N     . TRP A 1  229 ? 9.434   25.447  171.425 1.00 108.89 ? 229  TRP A N     1 
ATOM   1858  C  CA    . TRP A 1  229 ? 9.621   24.081  170.946 1.00 103.39 ? 229  TRP A CA    1 
ATOM   1859  C  C     . TRP A 1  229 ? 8.428   23.234  171.340 1.00 99.88  ? 229  TRP A C     1 
ATOM   1860  O  O     . TRP A 1  229 ? 8.179   23.037  172.535 1.00 104.40 ? 229  TRP A O     1 
ATOM   1861  C  CB    . TRP A 1  229 ? 10.905  23.488  171.525 1.00 96.69  ? 229  TRP A CB    1 
ATOM   1862  C  CG    . TRP A 1  229 ? 11.193  22.098  171.059 1.00 97.89  ? 229  TRP A CG    1 
ATOM   1863  C  CD1   . TRP A 1  229 ? 11.761  21.721  169.878 1.00 98.12  ? 229  TRP A CD1   1 
ATOM   1864  C  CD2   . TRP A 1  229 ? 10.923  20.889  171.779 1.00 100.11 ? 229  TRP A CD2   1 
ATOM   1865  N  NE1   . TRP A 1  229 ? 11.861  20.351  169.818 1.00 97.72  ? 229  TRP A NE1   1 
ATOM   1866  C  CE2   . TRP A 1  229 ? 11.356  19.817  170.974 1.00 100.35 ? 229  TRP A CE2   1 
ATOM   1867  C  CE3   . TRP A 1  229 ? 10.359  20.610  173.028 1.00 97.20  ? 229  TRP A CE3   1 
ATOM   1868  C  CZ2   . TRP A 1  229 ? 11.239  18.488  171.377 1.00 104.00 ? 229  TRP A CZ2   1 
ATOM   1869  C  CZ3   . TRP A 1  229 ? 10.245  19.291  173.426 1.00 95.57  ? 229  TRP A CZ3   1 
ATOM   1870  C  CH2   . TRP A 1  229 ? 10.683  18.246  172.603 1.00 96.08  ? 229  TRP A CH2   1 
ATOM   1871  N  N     . MET A 1  230 ? 7.694   22.741  170.342 1.00 92.84  ? 230  MET A N     1 
ATOM   1872  C  CA    . MET A 1  230 ? 6.612   21.785  170.557 1.00 100.02 ? 230  MET A CA    1 
ATOM   1873  C  C     . MET A 1  230 ? 5.542   22.368  171.475 1.00 103.57 ? 230  MET A C     1 
ATOM   1874  O  O     . MET A 1  230 ? 4.843   21.634  172.176 1.00 106.91 ? 230  MET A O     1 
ATOM   1875  C  CB    . MET A 1  230 ? 7.150   20.463  171.115 1.00 98.93  ? 230  MET A CB    1 
ATOM   1876  C  CG    . MET A 1  230 ? 8.058   19.708  170.149 1.00 97.50  ? 230  MET A CG    1 
ATOM   1877  S  SD    . MET A 1  230 ? 7.291   19.309  168.566 1.00 100.11 ? 230  MET A SD    1 
ATOM   1878  C  CE    . MET A 1  230 ? 5.875   18.368  169.123 1.00 103.09 ? 230  MET A CE    1 
ATOM   1879  N  N     . GLY A 1  231 ? 5.396   23.690  171.467 1.00 98.63  ? 231  GLY A N     1 
ATOM   1880  C  CA    . GLY A 1  231 ? 4.392   24.347  172.274 1.00 97.06  ? 231  GLY A CA    1 
ATOM   1881  C  C     . GLY A 1  231 ? 4.845   24.658  173.683 1.00 105.84 ? 231  GLY A C     1 
ATOM   1882  O  O     . GLY A 1  231 ? 4.032   25.120  174.493 1.00 106.17 ? 231  GLY A O     1 
ATOM   1883  N  N     . TYR A 1  232 ? 6.113   24.411  173.999 1.00 97.56  ? 232  TYR A N     1 
ATOM   1884  C  CA    . TYR A 1  232 ? 6.715   24.697  175.292 1.00 100.21 ? 232  TYR A CA    1 
ATOM   1885  C  C     . TYR A 1  232 ? 7.762   25.800  175.175 1.00 107.49 ? 232  TYR A C     1 
ATOM   1886  O  O     . TYR A 1  232 ? 8.127   26.242  174.083 1.00 110.05 ? 232  TYR A O     1 
ATOM   1887  C  CB    . TYR A 1  232 ? 7.350   23.432  175.880 1.00 105.31 ? 232  TYR A CB    1 
ATOM   1888  C  CG    . TYR A 1  232 ? 6.432   22.234  175.892 1.00 100.45 ? 232  TYR A CG    1 
ATOM   1889  C  CD1   . TYR A 1  232 ? 5.529   22.038  176.929 1.00 105.16 ? 232  TYR A CD1   1 
ATOM   1890  C  CD2   . TYR A 1  232 ? 6.465   21.299  174.866 1.00 95.09  ? 232  TYR A CD2   1 
ATOM   1891  C  CE1   . TYR A 1  232 ? 4.684   20.943  176.945 1.00 103.91 ? 232  TYR A CE1   1 
ATOM   1892  C  CE2   . TYR A 1  232 ? 5.624   20.201  174.873 1.00 98.33  ? 232  TYR A CE2   1 
ATOM   1893  C  CZ    . TYR A 1  232 ? 4.735   20.027  175.914 1.00 95.83  ? 232  TYR A CZ    1 
ATOM   1894  O  OH    . TYR A 1  232 ? 3.898   18.936  175.927 1.00 85.43  ? 232  TYR A OH    1 
ATOM   1895  N  N     . GLU A 1  233 ? 8.242   26.238  176.340 1.00 113.51 ? 233  GLU A N     1 
ATOM   1896  C  CA    . GLU A 1  233 ? 9.323   27.212  176.470 1.00 114.60 ? 233  GLU A CA    1 
ATOM   1897  C  C     . GLU A 1  233 ? 10.432  26.532  177.263 1.00 111.35 ? 233  GLU A C     1 
ATOM   1898  O  O     . GLU A 1  233 ? 10.246  26.202  178.439 1.00 111.91 ? 233  GLU A O     1 
ATOM   1899  C  CB    . GLU A 1  233 ? 8.847   28.490  177.162 1.00 118.82 ? 233  GLU A CB    1 
ATOM   1900  C  CG    . GLU A 1  233 ? 8.009   29.406  176.280 1.00 120.34 ? 233  GLU A CG    1 
ATOM   1901  C  CD    . GLU A 1  233 ? 7.230   30.438  177.078 1.00 121.34 ? 233  GLU A CD    1 
ATOM   1902  O  OE1   . GLU A 1  233 ? 7.075   30.254  178.304 1.00 118.97 ? 233  GLU A OE1   1 
ATOM   1903  O  OE2   . GLU A 1  233 ? 6.773   31.434  176.477 1.00 122.09 ? 233  GLU A OE2   1 
ATOM   1904  N  N     . LEU A 1  234 ? 11.573  26.306  176.618 1.00 112.44 ? 234  LEU A N     1 
ATOM   1905  C  CA    . LEU A 1  234 ? 12.719  25.669  177.256 1.00 115.08 ? 234  LEU A CA    1 
ATOM   1906  C  C     . LEU A 1  234 ? 13.737  26.689  177.755 1.00 116.43 ? 234  LEU A C     1 
ATOM   1907  O  O     . LEU A 1  234 ? 14.335  27.422  176.960 1.00 113.76 ? 234  LEU A O     1 
ATOM   1908  C  CB    . LEU A 1  234 ? 13.391  24.701  176.282 1.00 112.84 ? 234  LEU A CB    1 
ATOM   1909  C  CG    . LEU A 1  234 ? 12.450  23.745  175.551 1.00 111.08 ? 234  LEU A CG    1 
ATOM   1910  C  CD1   . LEU A 1  234 ? 13.221  22.869  174.578 1.00 101.02 ? 234  LEU A CD1   1 
ATOM   1911  C  CD2   . LEU A 1  234 ? 11.694  22.896  176.557 1.00 106.09 ? 234  LEU A CD2   1 
ATOM   1912  N  N     . HIS A 1  235 ? 13.925  26.724  179.065 1.00 116.55 ? 235  HIS A N     1 
ATOM   1913  C  CA    . HIS A 1  235 ? 14.971  27.459  179.758 1.00 118.85 ? 235  HIS A CA    1 
ATOM   1914  C  C     . HIS A 1  235 ? 16.092  26.488  180.109 1.00 114.94 ? 235  HIS A C     1 
ATOM   1915  O  O     . HIS A 1  235 ? 15.964  25.281  179.891 1.00 111.37 ? 235  HIS A O     1 
ATOM   1916  C  CB    . HIS A 1  235 ? 14.396  28.129  181.011 1.00 118.77 ? 235  HIS A CB    1 
ATOM   1917  C  CG    . HIS A 1  235 ? 13.197  28.986  180.742 1.00 119.14 ? 235  HIS A CG    1 
ATOM   1918  N  ND1   . HIS A 1  235 ? 11.919  28.475  180.662 1.00 119.76 ? 235  HIS A ND1   1 
ATOM   1919  C  CD2   . HIS A 1  235 ? 13.082  30.319  180.537 1.00 120.82 ? 235  HIS A CD2   1 
ATOM   1920  C  CE1   . HIS A 1  235 ? 11.069  29.457  180.417 1.00 123.41 ? 235  HIS A CE1   1 
ATOM   1921  N  NE2   . HIS A 1  235 ? 11.749  30.586  180.336 1.00 121.22 ? 235  HIS A NE2   1 
ATOM   1922  N  N     . PRO A 1  236 ? 17.228  26.964  180.652 1.00 112.99 ? 236  PRO A N     1 
ATOM   1923  C  CA    . PRO A 1  236 ? 18.361  26.036  180.779 1.00 117.74 ? 236  PRO A CA    1 
ATOM   1924  C  C     . PRO A 1  236 ? 18.195  25.057  181.932 1.00 115.58 ? 236  PRO A C     1 
ATOM   1925  O  O     . PRO A 1  236 ? 18.760  23.960  181.887 1.00 112.34 ? 236  PRO A O     1 
ATOM   1926  C  CB    . PRO A 1  236 ? 19.555  26.969  181.014 1.00 115.28 ? 236  PRO A CB    1 
ATOM   1927  C  CG    . PRO A 1  236 ? 19.149  28.254  180.400 1.00 118.06 ? 236  PRO A CG    1 
ATOM   1928  C  CD    . PRO A 1  236 ? 17.681  28.367  180.685 1.00 114.91 ? 236  PRO A CD    1 
ATOM   1929  N  N     . ASP A 1  237 ? 17.433  25.421  182.967 1.00 115.08 ? 237  ASP A N     1 
ATOM   1930  C  CA    . ASP A 1  237 ? 17.268  24.548  184.120 1.00 113.41 ? 237  ASP A CA    1 
ATOM   1931  C  C     . ASP A 1  237 ? 15.810  24.243  184.434 1.00 108.09 ? 237  ASP A C     1 
ATOM   1932  O  O     . ASP A 1  237 ? 15.536  23.539  185.414 1.00 96.08  ? 237  ASP A O     1 
ATOM   1933  C  CB    . ASP A 1  237 ? 17.934  25.165  185.359 1.00 113.01 ? 237  ASP A CB    1 
ATOM   1934  C  CG    . ASP A 1  237 ? 19.443  25.028  185.340 1.00 125.14 ? 237  ASP A CG    1 
ATOM   1935  O  OD1   . ASP A 1  237 ? 20.088  25.684  184.496 1.00 135.34 ? 237  ASP A OD1   1 
ATOM   1936  O  OD2   . ASP A 1  237 ? 19.984  24.263  186.165 1.00 123.83 ? 237  ASP A OD2   1 
ATOM   1937  N  N     . LYS A 1  238 ? 14.872  24.735  183.630 1.00 107.55 ? 238  LYS A N     1 
ATOM   1938  C  CA    . LYS A 1  238 ? 13.452  24.491  183.843 1.00 104.90 ? 238  LYS A CA    1 
ATOM   1939  C  C     . LYS A 1  238 ? 12.720  24.672  182.520 1.00 114.41 ? 238  LYS A C     1 
ATOM   1940  O  O     . LYS A 1  238 ? 13.198  25.364  181.619 1.00 117.66 ? 238  LYS A O     1 
ATOM   1941  C  CB    . LYS A 1  238 ? 12.890  25.401  184.944 1.00 107.06 ? 238  LYS A CB    1 
ATOM   1942  C  CG    . LYS A 1  238 ? 12.421  26.778  184.498 1.00 109.19 ? 238  LYS A CG    1 
ATOM   1943  C  CD    . LYS A 1  238 ? 12.158  27.659  185.717 1.00 114.11 ? 238  LYS A CD    1 
ATOM   1944  C  CE    . LYS A 1  238 ? 11.900  29.110  185.341 1.00 117.87 ? 238  LYS A CE    1 
ATOM   1945  N  NZ    . LYS A 1  238 ? 12.499  30.050  186.334 1.00 104.57 ? 238  LYS A NZ    1 
ATOM   1946  N  N     . TRP A 1  239 ? 11.562  24.024  182.403 1.00 108.65 ? 239  TRP A N     1 
ATOM   1947  C  CA    . TRP A 1  239 ? 10.715  24.162  181.227 1.00 105.02 ? 239  TRP A CA    1 
ATOM   1948  C  C     . TRP A 1  239 ? 9.319   24.566  181.677 1.00 102.88 ? 239  TRP A C     1 
ATOM   1949  O  O     . TRP A 1  239 ? 8.969   24.441  182.853 1.00 104.54 ? 239  TRP A O     1 
ATOM   1950  C  CB    . TRP A 1  239 ? 10.662  22.860  180.407 1.00 103.20 ? 239  TRP A CB    1 
ATOM   1951  C  CG    . TRP A 1  239 ? 9.961   21.712  181.090 1.00 96.06  ? 239  TRP A CG    1 
ATOM   1952  C  CD1   . TRP A 1  239 ? 10.538  20.730  181.842 1.00 94.41  ? 239  TRP A CD1   1 
ATOM   1953  C  CD2   . TRP A 1  239 ? 8.565   21.386  181.011 1.00 90.10  ? 239  TRP A CD2   1 
ATOM   1954  N  NE1   . TRP A 1  239 ? 9.584   19.841  182.275 1.00 90.73  ? 239  TRP A NE1   1 
ATOM   1955  C  CE2   . TRP A 1  239 ? 8.366   20.218  181.774 1.00 89.01  ? 239  TRP A CE2   1 
ATOM   1956  C  CE3   . TRP A 1  239 ? 7.464   21.975  180.383 1.00 95.47  ? 239  TRP A CE3   1 
ATOM   1957  C  CZ2   . TRP A 1  239 ? 7.110   19.632  181.929 1.00 91.49  ? 239  TRP A CZ2   1 
ATOM   1958  C  CZ3   . TRP A 1  239 ? 6.218   21.394  180.540 1.00 90.87  ? 239  TRP A CZ3   1 
ATOM   1959  C  CH2   . TRP A 1  239 ? 6.051   20.234  181.305 1.00 90.18  ? 239  TRP A CH2   1 
ATOM   1960  N  N     . THR A 1  240 ? 8.516   25.041  180.729 1.00 101.68 ? 240  THR A N     1 
ATOM   1961  C  CA    . THR A 1  240 ? 7.103   25.284  180.995 1.00 108.21 ? 240  THR A CA    1 
ATOM   1962  C  C     . THR A 1  240 ? 6.356   25.342  179.669 1.00 103.99 ? 240  THR A C     1 
ATOM   1963  O  O     . THR A 1  240 ? 6.949   25.262  178.591 1.00 102.60 ? 240  THR A O     1 
ATOM   1964  C  CB    . THR A 1  240 ? 6.896   26.573  181.796 1.00 110.48 ? 240  THR A CB    1 
ATOM   1965  O  OG1   . THR A 1  240 ? 5.520   26.676  182.187 1.00 103.15 ? 240  THR A OG1   1 
ATOM   1966  C  CG2   . THR A 1  240 ? 7.273   27.786  180.957 1.00 114.99 ? 240  THR A CG2   1 
ATOM   1967  N  N     . VAL A 1  241 ? 5.046   25.497  179.765 1.00 98.83  ? 241  VAL A N     1 
ATOM   1968  C  CA    . VAL A 1  241 ? 4.154   25.504  178.614 1.00 101.12 ? 241  VAL A CA    1 
ATOM   1969  C  C     . VAL A 1  241 ? 4.028   26.931  178.100 1.00 105.27 ? 241  VAL A C     1 
ATOM   1970  O  O     . VAL A 1  241 ? 4.203   27.899  178.848 1.00 104.81 ? 241  VAL A O     1 
ATOM   1971  C  CB    . VAL A 1  241 ? 2.784   24.902  178.998 1.00 102.51 ? 241  VAL A CB    1 
ATOM   1972  C  CG1   . VAL A 1  241 ? 2.152   25.698  180.132 1.00 113.70 ? 241  VAL A CG1   1 
ATOM   1973  C  CG2   . VAL A 1  241 ? 1.855   24.802  177.793 1.00 106.89 ? 241  VAL A CG2   1 
ATOM   1974  N  N     . GLN A 1  242 ? 3.716   27.072  176.814 1.00 117.36 ? 242  GLN A N     1 
ATOM   1975  C  CA    . GLN A 1  242 ? 3.386   28.385  176.288 1.00 112.84 ? 242  GLN A CA    1 
ATOM   1976  C  C     . GLN A 1  242 ? 1.994   28.801  176.764 1.00 114.37 ? 242  GLN A C     1 
ATOM   1977  O  O     . GLN A 1  242 ? 1.086   27.966  176.825 1.00 116.65 ? 242  GLN A O     1 
ATOM   1978  C  CB    . GLN A 1  242 ? 3.451   28.383  174.762 1.00 101.37 ? 242  GLN A CB    1 
ATOM   1979  C  CG    . GLN A 1  242 ? 4.863   28.204  174.218 1.00 110.96 ? 242  GLN A CG    1 
ATOM   1980  C  CD    . GLN A 1  242 ? 4.893   27.941  172.725 1.00 115.06 ? 242  GLN A CD    1 
ATOM   1981  O  OE1   . GLN A 1  242 ? 3.908   28.171  172.021 1.00 97.90  ? 242  GLN A OE1   1 
ATOM   1982  N  NE2   . GLN A 1  242 ? 6.030   27.458  172.232 1.00 106.24 ? 242  GLN A NE2   1 
ATOM   1983  N  N     . PRO A 1  243 ? 1.812   30.085  177.129 1.00 117.50 ? 243  PRO A N     1 
ATOM   1984  C  CA    . PRO A 1  243 ? 0.574   30.557  177.777 1.00 121.02 ? 243  PRO A CA    1 
ATOM   1985  C  C     . PRO A 1  243 ? -0.740  29.913  177.353 1.00 119.42 ? 243  PRO A C     1 
ATOM   1986  O  O     . PRO A 1  243 ? -1.015  29.731  176.163 1.00 118.34 ? 243  PRO A O     1 
ATOM   1987  C  CB    . PRO A 1  243 ? 0.567   32.058  177.436 1.00 120.21 ? 243  PRO A CB    1 
ATOM   1988  C  CG    . PRO A 1  243 ? 1.886   32.331  176.684 1.00 118.85 ? 243  PRO A CG    1 
ATOM   1989  C  CD    . PRO A 1  243 ? 2.780   31.181  176.991 1.00 115.76 ? 243  PRO A CD    1 
ATOM   1990  N  N     . ILE A 1  244 ? -1.556  29.569  178.345 1.00 124.74 ? 244  ILE A N     1 
ATOM   1991  C  CA    . ILE A 1  244 ? -2.874  28.980  178.134 1.00 123.98 ? 244  ILE A CA    1 
ATOM   1992  C  C     . ILE A 1  244 ? -3.904  30.102  178.145 1.00 129.77 ? 244  ILE A C     1 
ATOM   1993  O  O     . ILE A 1  244 ? -3.950  30.903  179.086 1.00 134.24 ? 244  ILE A O     1 
ATOM   1994  C  CB    . ILE A 1  244 ? -3.188  27.924  179.207 1.00 123.64 ? 244  ILE A CB    1 
ATOM   1995  C  CG1   . ILE A 1  244 ? -1.893  27.321  179.754 1.00 120.09 ? 244  ILE A CG1   1 
ATOM   1996  C  CG2   . ILE A 1  244 ? -4.092  26.839  178.636 1.00 118.95 ? 244  ILE A CG2   1 
ATOM   1997  C  CD1   . ILE A 1  244 ? -1.296  26.252  178.866 1.00 114.40 ? 244  ILE A CD1   1 
ATOM   1998  N  N     . VAL A 1  245 ? -4.730  30.168  177.106 1.00 129.62 ? 245  VAL A N     1 
ATOM   1999  C  CA    . VAL A 1  245 ? -5.788  31.168  177.010 1.00 132.77 ? 245  VAL A CA    1 
ATOM   2000  C  C     . VAL A 1  245 ? -7.109  30.507  177.387 1.00 135.05 ? 245  VAL A C     1 
ATOM   2001  O  O     . VAL A 1  245 ? -7.643  29.684  176.635 1.00 135.20 ? 245  VAL A O     1 
ATOM   2002  C  CB    . VAL A 1  245 ? -5.855  31.780  175.604 1.00 136.37 ? 245  VAL A CB    1 
ATOM   2003  C  CG1   . VAL A 1  245 ? -7.111  32.625  175.447 1.00 137.65 ? 245  VAL A CG1   1 
ATOM   2004  C  CG2   . VAL A 1  245 ? -4.607  32.600  175.323 1.00 134.91 ? 245  VAL A CG2   1 
ATOM   2005  N  N     . LEU A 1  246 ? -7.638  30.869  178.561 1.00 143.59 ? 246  LEU A N     1 
ATOM   2006  C  CA    . LEU A 1  246 ? -8.916  30.345  179.029 1.00 140.60 ? 246  LEU A CA    1 
ATOM   2007  C  C     . LEU A 1  246 ? -10.052 31.256  178.591 1.00 146.08 ? 246  LEU A C     1 
ATOM   2008  O  O     . LEU A 1  246 ? -10.096 32.420  179.022 1.00 142.02 ? 246  LEU A O     1 
ATOM   2009  C  CB    . LEU A 1  246 ? -8.924  30.225  180.544 1.00 126.23 ? 246  LEU A CB    1 
ATOM   2010  C  CG    . LEU A 1  246 ? -8.551  28.928  181.248 1.00 116.41 ? 246  LEU A CG    1 
ATOM   2011  C  CD1   . LEU A 1  246 ? -8.486  29.212  182.735 1.00 120.24 ? 246  LEU A CD1   1 
ATOM   2012  C  CD2   . LEU A 1  246 ? -9.557  27.836  180.945 1.00 111.86 ? 246  LEU A CD2   1 
ATOM   2013  N  N     . PRO A 1  247 ? -10.962 30.803  177.733 1.00 156.19 ? 247  PRO A N     1 
ATOM   2014  C  CA    . PRO A 1  247 ? -12.172 31.586  177.457 1.00 164.60 ? 247  PRO A CA    1 
ATOM   2015  C  C     . PRO A 1  247 ? -12.883 31.950  178.753 1.00 164.68 ? 247  PRO A C     1 
ATOM   2016  O  O     . PRO A 1  247 ? -13.134 31.092  179.603 1.00 161.84 ? 247  PRO A O     1 
ATOM   2017  C  CB    . PRO A 1  247 ? -13.013 30.643  176.591 1.00 162.01 ? 247  PRO A CB    1 
ATOM   2018  C  CG    . PRO A 1  247 ? -12.022 29.724  175.962 1.00 158.44 ? 247  PRO A CG    1 
ATOM   2019  C  CD    . PRO A 1  247 ? -10.929 29.541  176.975 1.00 152.85 ? 247  PRO A CD    1 
ATOM   2020  N  N     . GLU A 1  248 ? -13.206 33.233  178.914 1.00 158.32 ? 248  GLU A N     1 
ATOM   2021  C  CA    . GLU A 1  248 ? -13.897 33.698  180.111 1.00 154.77 ? 248  GLU A CA    1 
ATOM   2022  C  C     . GLU A 1  248 ? -15.351 34.051  179.822 1.00 158.75 ? 248  GLU A C     1 
ATOM   2023  O  O     . GLU A 1  248 ? -16.041 34.584  180.699 1.00 152.29 ? 248  GLU A O     1 
ATOM   2024  C  CB    . GLU A 1  248 ? -13.159 34.894  180.721 1.00 150.92 ? 248  GLU A CB    1 
ATOM   2025  C  CG    . GLU A 1  248 ? -13.273 34.988  182.239 1.00 150.62 ? 248  GLU A CG    1 
ATOM   2026  C  CD    . GLU A 1  248 ? -12.051 35.619  182.883 1.00 149.25 ? 248  GLU A CD    1 
ATOM   2027  O  OE1   . GLU A 1  248 ? -11.173 36.113  182.144 1.00 149.95 ? 248  GLU A OE1   1 
ATOM   2028  O  OE2   . GLU A 1  248 ? -11.969 35.621  184.130 1.00 142.66 ? 248  GLU A OE2   1 
ATOM   2029  N  N     . LYS A 1  249 ? -15.807 33.785  178.594 1.00 155.74 ? 249  LYS A N     1 
ATOM   2030  C  CA    . LYS A 1  249 ? -17.174 34.019  178.140 1.00 156.21 ? 249  LYS A CA    1 
ATOM   2031  C  C     . LYS A 1  249 ? -18.207 33.699  179.214 1.00 163.03 ? 249  LYS A C     1 
ATOM   2032  O  O     . LYS A 1  249 ? -18.092 32.703  179.931 1.00 163.22 ? 249  LYS A O     1 
ATOM   2033  C  CB    . LYS A 1  249 ? -17.449 33.176  176.892 1.00 155.43 ? 249  LYS A CB    1 
ATOM   2034  C  CG    . LYS A 1  249 ? -16.235 32.995  175.995 1.00 155.34 ? 249  LYS A CG    1 
ATOM   2035  C  CD    . LYS A 1  249 ? -16.559 32.121  174.796 1.00 157.21 ? 249  LYS A CD    1 
ATOM   2036  C  CE    . LYS A 1  249 ? -15.348 31.957  173.890 1.00 158.82 ? 249  LYS A CE    1 
ATOM   2037  N  NZ    . LYS A 1  249 ? -15.650 31.107  172.705 1.00 151.11 ? 249  LYS A NZ    1 
ATOM   2038  N  N     . ASP A 1  250 ? -19.221 34.558  179.322 1.00 171.67 ? 250  ASP A N     1 
ATOM   2039  C  CA    . ASP A 1  250 ? -20.298 34.315  180.275 1.00 168.83 ? 250  ASP A CA    1 
ATOM   2040  C  C     . ASP A 1  250 ? -21.345 33.362  179.707 1.00 169.42 ? 250  ASP A C     1 
ATOM   2041  O  O     . ASP A 1  250 ? -21.988 32.628  180.466 1.00 161.96 ? 250  ASP A O     1 
ATOM   2042  C  CB    . ASP A 1  250 ? -20.940 35.640  180.694 1.00 167.44 ? 250  ASP A CB    1 
ATOM   2043  C  CG    . ASP A 1  250 ? -21.449 36.450  179.512 1.00 175.03 ? 250  ASP A CG    1 
ATOM   2044  O  OD1   . ASP A 1  250 ? -21.463 35.929  178.377 1.00 173.93 ? 250  ASP A OD1   1 
ATOM   2045  O  OD2   . ASP A 1  250 ? -21.833 37.620  179.722 1.00 174.76 ? 250  ASP A OD2   1 
ATOM   2046  N  N     . SER A 1  251 ? -21.530 33.368  178.389 1.00 179.02 ? 251  SER A N     1 
ATOM   2047  C  CA    . SER A 1  251 ? -22.408 32.432  177.700 1.00 180.21 ? 251  SER A CA    1 
ATOM   2048  C  C     . SER A 1  251 ? -21.564 31.303  177.117 1.00 178.10 ? 251  SER A C     1 
ATOM   2049  O  O     . SER A 1  251 ? -20.620 31.558  176.360 1.00 176.12 ? 251  SER A O     1 
ATOM   2050  C  CB    . SER A 1  251 ? -23.200 33.137  176.600 1.00 181.69 ? 251  SER A CB    1 
ATOM   2051  O  OG    . SER A 1  251 ? -22.333 33.680  175.619 1.00 181.36 ? 251  SER A OG    1 
ATOM   2052  N  N     . TRP A 1  252 ? -21.901 30.065  177.469 1.00 164.54 ? 252  TRP A N     1 
ATOM   2053  C  CA    . TRP A 1  252 ? -21.184 28.884  177.006 1.00 147.10 ? 252  TRP A CA    1 
ATOM   2054  C  C     . TRP A 1  252 ? -22.083 28.060  176.099 1.00 139.10 ? 252  TRP A C     1 
ATOM   2055  O  O     . TRP A 1  252 ? -23.211 27.731  176.477 1.00 138.30 ? 252  TRP A O     1 
ATOM   2056  C  CB    . TRP A 1  252 ? -20.746 28.015  178.185 1.00 142.28 ? 252  TRP A CB    1 
ATOM   2057  C  CG    . TRP A 1  252 ? -20.033 28.739  179.272 1.00 145.30 ? 252  TRP A CG    1 
ATOM   2058  C  CD1   . TRP A 1  252 ? -20.586 29.275  180.398 1.00 147.25 ? 252  TRP A CD1   1 
ATOM   2059  C  CD2   . TRP A 1  252 ? -18.623 28.963  179.372 1.00 147.26 ? 252  TRP A CD2   1 
ATOM   2060  N  NE1   . TRP A 1  252 ? -19.611 29.843  181.180 1.00 148.99 ? 252  TRP A NE1   1 
ATOM   2061  C  CE2   . TRP A 1  252 ? -18.396 29.662  180.574 1.00 147.85 ? 252  TRP A CE2   1 
ATOM   2062  C  CE3   . TRP A 1  252 ? -17.531 28.650  178.556 1.00 143.31 ? 252  TRP A CE3   1 
ATOM   2063  C  CZ2   . TRP A 1  252 ? -17.121 30.052  180.981 1.00 145.74 ? 252  TRP A CZ2   1 
ATOM   2064  C  CZ3   . TRP A 1  252 ? -16.267 29.040  178.960 1.00 142.56 ? 252  TRP A CZ3   1 
ATOM   2065  C  CH2   . TRP A 1  252 ? -16.073 29.735  180.161 1.00 148.67 ? 252  TRP A CH2   1 
ATOM   2066  N  N     . THR A 1  253 ? -21.580 27.708  174.918 1.00 142.73 ? 253  THR A N     1 
ATOM   2067  C  CA    . THR A 1  253 ? -22.251 26.722  174.087 1.00 141.89 ? 253  THR A CA    1 
ATOM   2068  C  C     . THR A 1  253 ? -21.676 25.339  174.395 1.00 137.29 ? 253  THR A C     1 
ATOM   2069  O  O     . THR A 1  253 ? -20.928 25.157  175.361 1.00 130.37 ? 253  THR A O     1 
ATOM   2070  C  CB    . THR A 1  253 ? -22.099 27.080  172.608 1.00 139.66 ? 253  THR A CB    1 
ATOM   2071  O  OG1   . THR A 1  253 ? -20.721 26.973  172.227 1.00 134.25 ? 253  THR A OG1   1 
ATOM   2072  C  CG2   . THR A 1  253 ? -22.569 28.503  172.356 1.00 140.68 ? 253  THR A CG2   1 
ATOM   2073  N  N     . VAL A 1  254 ? -22.026 24.340  173.582 1.00 141.89 ? 254  VAL A N     1 
ATOM   2074  C  CA    . VAL A 1  254 ? -21.347 23.051  173.677 1.00 131.15 ? 254  VAL A CA    1 
ATOM   2075  C  C     . VAL A 1  254 ? -19.880 23.217  173.305 1.00 131.34 ? 254  VAL A C     1 
ATOM   2076  O  O     . VAL A 1  254 ? -18.977 22.798  174.039 1.00 123.98 ? 254  VAL A O     1 
ATOM   2077  C  CB    . VAL A 1  254 ? -22.043 22.003  172.788 1.00 127.91 ? 254  VAL A CB    1 
ATOM   2078  C  CG1   . VAL A 1  254 ? -21.052 20.940  172.336 1.00 129.41 ? 254  VAL A CG1   1 
ATOM   2079  C  CG2   . VAL A 1  254 ? -23.201 21.361  173.523 1.00 124.58 ? 254  VAL A CG2   1 
ATOM   2080  N  N     . ASN A 1  255 ? -19.630 23.839  172.147 1.00 125.25 ? 255  ASN A N     1 
ATOM   2081  C  CA    . ASN A 1  255 ? -18.276 23.982  171.624 1.00 122.86 ? 255  ASN A CA    1 
ATOM   2082  C  C     . ASN A 1  255 ? -17.371 24.755  172.574 1.00 121.55 ? 255  ASN A C     1 
ATOM   2083  O  O     . ASN A 1  255 ? -16.172 24.465  172.659 1.00 118.27 ? 255  ASN A O     1 
ATOM   2084  C  CB    . ASN A 1  255 ? -18.321 24.669  170.259 1.00 126.81 ? 255  ASN A CB    1 
ATOM   2085  C  CG    . ASN A 1  255 ? -17.266 24.145  169.309 1.00 129.95 ? 255  ASN A CG    1 
ATOM   2086  O  OD1   . ASN A 1  255 ? -16.106 24.552  169.364 1.00 128.24 ? 255  ASN A OD1   1 
ATOM   2087  N  ND2   . ASN A 1  255 ? -17.666 23.238  168.426 1.00 127.85 ? 255  ASN A ND2   1 
ATOM   2088  N  N     . ASP A 1  256 ? -17.918 25.740  173.293 1.00 130.09 ? 256  ASP A N     1 
ATOM   2089  C  CA    . ASP A 1  256 ? -17.117 26.466  174.273 1.00 129.91 ? 256  ASP A CA    1 
ATOM   2090  C  C     . ASP A 1  256 ? -16.622 25.540  175.375 1.00 123.71 ? 256  ASP A C     1 
ATOM   2091  O  O     . ASP A 1  256 ? -15.473 25.647  175.817 1.00 120.62 ? 256  ASP A O     1 
ATOM   2092  C  CB    . ASP A 1  256 ? -17.929 27.615  174.871 1.00 135.43 ? 256  ASP A CB    1 
ATOM   2093  C  CG    . ASP A 1  256 ? -18.441 28.577  173.820 1.00 141.52 ? 256  ASP A CG    1 
ATOM   2094  O  OD1   . ASP A 1  256 ? -17.741 28.779  172.805 1.00 144.02 ? 256  ASP A OD1   1 
ATOM   2095  O  OD2   . ASP A 1  256 ? -19.542 29.134  174.011 1.00 142.36 ? 256  ASP A OD2   1 
ATOM   2096  N  N     . ILE A 1  257 ? -17.470 24.612  175.818 1.00 125.42 ? 257  ILE A N     1 
ATOM   2097  C  CA    . ILE A 1  257 ? -17.088 23.728  176.913 1.00 123.22 ? 257  ILE A CA    1 
ATOM   2098  C  C     . ILE A 1  257 ? -16.086 22.692  176.419 1.00 117.96 ? 257  ILE A C     1 
ATOM   2099  O  O     . ILE A 1  257 ? -15.124 22.352  177.119 1.00 108.78 ? 257  ILE A O     1 
ATOM   2100  C  CB    . ILE A 1  257 ? -18.333 23.078  177.540 1.00 120.49 ? 257  ILE A CB    1 
ATOM   2101  C  CG1   . ILE A 1  257 ? -19.259 24.153  178.107 1.00 121.08 ? 257  ILE A CG1   1 
ATOM   2102  C  CG2   . ILE A 1  257 ? -17.924 22.159  178.676 1.00 117.19 ? 257  ILE A CG2   1 
ATOM   2103  C  CD1   . ILE A 1  257 ? -18.610 25.020  179.164 1.00 124.23 ? 257  ILE A CD1   1 
ATOM   2104  N  N     . GLN A 1  258 ? -16.301 22.176  175.206 1.00 115.74 ? 258  GLN A N     1 
ATOM   2105  C  CA    . GLN A 1  258 ? -15.346 21.262  174.586 1.00 113.04 ? 258  GLN A CA    1 
ATOM   2106  C  C     . GLN A 1  258 ? -13.963 21.897  174.494 1.00 108.97 ? 258  GLN A C     1 
ATOM   2107  O  O     . GLN A 1  258 ? -12.976 21.331  174.976 1.00 109.21 ? 258  GLN A O     1 
ATOM   2108  C  CB    . GLN A 1  258 ? -15.847 20.848  173.202 1.00 108.80 ? 258  GLN A CB    1 
ATOM   2109  C  CG    . GLN A 1  258 ? -17.210 20.187  173.204 1.00 111.13 ? 258  GLN A CG    1 
ATOM   2110  C  CD    . GLN A 1  258 ? -17.661 19.781  171.820 1.00 117.22 ? 258  GLN A CD    1 
ATOM   2111  O  OE1   . GLN A 1  258 ? -17.247 20.374  170.824 1.00 127.83 ? 258  GLN A OE1   1 
ATOM   2112  N  NE2   . GLN A 1  258 ? -18.504 18.757  171.746 1.00 105.98 ? 258  GLN A NE2   1 
ATOM   2113  N  N     . LYS A 1  259 ? -13.868 23.064  173.848 1.00 107.25 ? 259  LYS A N     1 
ATOM   2114  C  CA    . LYS A 1  259 ? -12.592 23.771  173.786 1.00 107.04 ? 259  LYS A CA    1 
ATOM   2115  C  C     . LYS A 1  259 ? -12.012 23.955  175.183 1.00 106.92 ? 259  LYS A C     1 
ATOM   2116  O  O     . LYS A 1  259 ? -10.826 23.701  175.420 1.00 104.05 ? 259  LYS A O     1 
ATOM   2117  C  CB    . LYS A 1  259 ? -12.776 25.129  173.105 1.00 107.78 ? 259  LYS A CB    1 
ATOM   2118  C  CG    . LYS A 1  259 ? -13.206 25.071  171.648 1.00 117.13 ? 259  LYS A CG    1 
ATOM   2119  C  CD    . LYS A 1  259 ? -12.903 26.386  170.941 1.00 115.97 ? 259  LYS A CD    1 
ATOM   2120  C  CE    . LYS A 1  259 ? -13.264 26.330  169.464 1.00 118.48 ? 259  LYS A CE    1 
ATOM   2121  N  NZ    . LYS A 1  259 ? -14.726 26.498  169.232 1.00 116.53 ? 259  LYS A NZ    1 
ATOM   2122  N  N     . LEU A 1  260 ? -12.845 24.422  176.116 1.00 106.39 ? 260  LEU A N     1 
ATOM   2123  C  CA    . LEU A 1  260 ? -12.402 24.665  177.486 1.00 107.83 ? 260  LEU A CA    1 
ATOM   2124  C  C     . LEU A 1  260 ? -11.830 23.399  178.120 1.00 105.08 ? 260  LEU A C     1 
ATOM   2125  O  O     . LEU A 1  260 ? -10.706 23.400  178.635 1.00 95.69  ? 260  LEU A O     1 
ATOM   2126  C  CB    . LEU A 1  260 ? -13.567 25.218  178.309 1.00 109.34 ? 260  LEU A CB    1 
ATOM   2127  C  CG    . LEU A 1  260 ? -13.591 24.981  179.816 1.00 110.07 ? 260  LEU A CG    1 
ATOM   2128  C  CD1   . LEU A 1  260 ? -12.599 25.903  180.499 1.00 103.84 ? 260  LEU A CD1   1 
ATOM   2129  C  CD2   . LEU A 1  260 ? -14.993 25.203  180.356 1.00 112.67 ? 260  LEU A CD2   1 
ATOM   2130  N  N     . VAL A 1  261 ? -12.605 22.309  178.097 1.00 107.93 ? 261  VAL A N     1 
ATOM   2131  C  CA    . VAL A 1  261 ? -12.164 21.039  178.675 1.00 107.09 ? 261  VAL A CA    1 
ATOM   2132  C  C     . VAL A 1  261 ? -10.892 20.543  177.999 1.00 105.78 ? 261  VAL A C     1 
ATOM   2133  O  O     . VAL A 1  261 ? -9.968  20.056  178.665 1.00 97.37  ? 261  VAL A O     1 
ATOM   2134  C  CB    . VAL A 1  261 ? -13.295 19.996  178.591 1.00 106.24 ? 261  VAL A CB    1 
ATOM   2135  C  CG1   . VAL A 1  261 ? -12.729 18.584  178.475 1.00 106.32 ? 261  VAL A CG1   1 
ATOM   2136  C  CG2   . VAL A 1  261 ? -14.201 20.103  179.803 1.00 110.09 ? 261  VAL A CG2   1 
ATOM   2137  N  N     . GLY A 1  262 ? -10.819 20.660  176.671 1.00 104.72 ? 262  GLY A N     1 
ATOM   2138  C  CA    . GLY A 1  262 ? -9.598  20.286  175.973 1.00 104.49 ? 262  GLY A CA    1 
ATOM   2139  C  C     . GLY A 1  262 ? -8.388  21.059  176.462 1.00 103.59 ? 262  GLY A C     1 
ATOM   2140  O  O     . GLY A 1  262 ? -7.322  20.484  176.696 1.00 100.12 ? 262  GLY A O     1 
ATOM   2141  N  N     . LYS A 1  263 ? -8.533  22.378  176.609 1.00 106.05 ? 263  LYS A N     1 
ATOM   2142  C  CA    . LYS A 1  263 ? -7.405  23.195  177.042 1.00 106.54 ? 263  LYS A CA    1 
ATOM   2143  C  C     . LYS A 1  263 ? -6.957  22.804  178.445 1.00 104.54 ? 263  LYS A C     1 
ATOM   2144  O  O     . LYS A 1  263 ? -5.755  22.758  178.734 1.00 98.75  ? 263  LYS A O     1 
ATOM   2145  C  CB    . LYS A 1  263 ? -7.772  24.679  176.982 1.00 103.13 ? 263  LYS A CB    1 
ATOM   2146  C  CG    . LYS A 1  263 ? -7.549  25.317  175.618 1.00 110.30 ? 263  LYS A CG    1 
ATOM   2147  C  CD    . LYS A 1  263 ? -6.850  26.665  175.745 1.00 118.04 ? 263  LYS A CD    1 
ATOM   2148  C  CE    . LYS A 1  263 ? -6.606  27.302  174.383 1.00 118.51 ? 263  LYS A CE    1 
ATOM   2149  N  NZ    . LYS A 1  263 ? -5.698  28.483  174.472 1.00 120.55 ? 263  LYS A NZ    1 
ATOM   2150  N  N     . LEU A 1  264 ? -7.915  22.519  179.330 1.00 98.37  ? 264  LEU A N     1 
ATOM   2151  C  CA    . LEU A 1  264 ? -7.582  22.073  180.679 1.00 95.51  ? 264  LEU A CA    1 
ATOM   2152  C  C     . LEU A 1  264 ? -6.822  20.752  180.651 1.00 99.84  ? 264  LEU A C     1 
ATOM   2153  O  O     . LEU A 1  264 ? -5.824  20.583  181.362 1.00 95.63  ? 264  LEU A O     1 
ATOM   2154  C  CB    . LEU A 1  264 ? -8.855  21.939  181.511 1.00 94.87  ? 264  LEU A CB    1 
ATOM   2155  C  CG    . LEU A 1  264 ? -9.561  23.243  181.875 1.00 96.00  ? 264  LEU A CG    1 
ATOM   2156  C  CD1   . LEU A 1  264 ? -11.059 23.019  181.932 1.00 102.91 ? 264  LEU A CD1   1 
ATOM   2157  C  CD2   . LEU A 1  264 ? -9.042  23.780  183.197 1.00 103.10 ? 264  LEU A CD2   1 
ATOM   2158  N  N     . ASN A 1  265 ? -7.298  19.797  179.844 1.00 97.11  ? 265  ASN A N     1 
ATOM   2159  C  CA    . ASN A 1  265 ? -6.541  18.576  179.578 1.00 93.42  ? 265  ASN A CA    1 
ATOM   2160  C  C     . ASN A 1  265 ? -5.086  18.886  179.249 1.00 90.91  ? 265  ASN A C     1 
ATOM   2161  O  O     . ASN A 1  265 ? -4.166  18.349  179.876 1.00 87.73  ? 265  ASN A O     1 
ATOM   2162  C  CB    . ASN A 1  265 ? -7.185  17.806  178.423 1.00 95.14  ? 265  ASN A CB    1 
ATOM   2163  C  CG    . ASN A 1  265 ? -8.384  16.992  178.858 1.00 92.63  ? 265  ASN A CG    1 
ATOM   2164  O  OD1   . ASN A 1  265 ? -8.367  16.356  179.907 1.00 84.02  ? 265  ASN A OD1   1 
ATOM   2165  N  ND2   . ASN A 1  265 ? -9.433  16.999  178.041 1.00 92.66  ? 265  ASN A ND2   1 
ATOM   2166  N  N     . TRP A 1  266 ? -4.864  19.748  178.253 1.00 98.04  ? 266  TRP A N     1 
ATOM   2167  C  CA    . TRP A 1  266 ? -3.504  20.110  177.865 1.00 99.68  ? 266  TRP A CA    1 
ATOM   2168  C  C     . TRP A 1  266 ? -2.730  20.743  179.015 1.00 96.82  ? 266  TRP A C     1 
ATOM   2169  O  O     . TRP A 1  266 ? -1.513  20.553  179.121 1.00 86.18  ? 266  TRP A O     1 
ATOM   2170  C  CB    . TRP A 1  266 ? -3.538  21.062  176.668 1.00 93.71  ? 266  TRP A CB    1 
ATOM   2171  C  CG    . TRP A 1  266 ? -2.201  21.658  176.343 1.00 96.65  ? 266  TRP A CG    1 
ATOM   2172  C  CD1   . TRP A 1  266 ? -1.768  22.913  176.655 1.00 99.28  ? 266  TRP A CD1   1 
ATOM   2173  C  CD2   . TRP A 1  266 ? -1.124  21.027  175.638 1.00 95.43  ? 266  TRP A CD2   1 
ATOM   2174  N  NE1   . TRP A 1  266 ? -0.489  23.102  176.193 1.00 95.96  ? 266  TRP A NE1   1 
ATOM   2175  C  CE2   . TRP A 1  266 ? -0.071  21.959  175.564 1.00 94.30  ? 266  TRP A CE2   1 
ATOM   2176  C  CE3   . TRP A 1  266 ? -0.949  19.765  175.063 1.00 96.42  ? 266  TRP A CE3   1 
ATOM   2177  C  CZ2   . TRP A 1  266 ? 1.140   21.670  174.940 1.00 95.07  ? 266  TRP A CZ2   1 
ATOM   2178  C  CZ3   . TRP A 1  266 ? 0.254   19.480  174.444 1.00 94.63  ? 266  TRP A CZ3   1 
ATOM   2179  C  CH2   . TRP A 1  266 ? 1.283   20.428  174.387 1.00 93.54  ? 266  TRP A CH2   1 
ATOM   2180  N  N     . ALA A 1  267 ? -3.415  21.481  179.893 1.00 94.91  ? 267  ALA A N     1 
ATOM   2181  C  CA    . ALA A 1  267 ? -2.741  22.095  181.033 1.00 92.97  ? 267  ALA A CA    1 
ATOM   2182  C  C     . ALA A 1  267 ? -2.393  21.082  182.116 1.00 91.64  ? 267  ALA A C     1 
ATOM   2183  O  O     . ALA A 1  267 ? -1.450  21.304  182.885 1.00 93.77  ? 267  ALA A O     1 
ATOM   2184  C  CB    . ALA A 1  267 ? -3.611  23.208  181.616 1.00 99.61  ? 267  ALA A CB    1 
ATOM   2185  N  N     . SER A 1  268 ? -3.137  19.978  182.199 1.00 87.37  ? 268  SER A N     1 
ATOM   2186  C  CA    . SER A 1  268 ? -2.955  19.023  183.288 1.00 88.87  ? 268  SER A CA    1 
ATOM   2187  C  C     . SER A 1  268 ? -1.563  18.393  183.308 1.00 85.56  ? 268  SER A C     1 
ATOM   2188  O  O     . SER A 1  268 ? -1.174  17.813  184.329 1.00 76.33  ? 268  SER A O     1 
ATOM   2189  C  CB    . SER A 1  268 ? -4.032  17.938  183.209 1.00 87.13  ? 268  SER A CB    1 
ATOM   2190  O  OG    . SER A 1  268 ? -3.819  17.078  182.103 1.00 104.72 ? 268  SER A OG    1 
ATOM   2191  N  N     . GLN A 1  269 ? -0.809  18.477  182.208 1.00 90.37  ? 269  GLN A N     1 
ATOM   2192  C  CA    . GLN A 1  269 ? 0.504   17.841  182.156 1.00 91.93  ? 269  GLN A CA    1 
ATOM   2193  C  C     . GLN A 1  269 ? 1.538   18.496  183.066 1.00 87.23  ? 269  GLN A C     1 
ATOM   2194  O  O     . GLN A 1  269 ? 2.577   17.881  183.332 1.00 87.34  ? 269  GLN A O     1 
ATOM   2195  C  CB    . GLN A 1  269 ? 1.049   17.841  180.725 1.00 86.66  ? 269  GLN A CB    1 
ATOM   2196  C  CG    . GLN A 1  269 ? 1.214   19.226  180.120 1.00 75.19  ? 269  GLN A CG    1 
ATOM   2197  C  CD    . GLN A 1  269 ? 1.647   19.183  178.666 1.00 78.34  ? 269  GLN A CD    1 
ATOM   2198  O  OE1   . GLN A 1  269 ? 2.722   18.675  178.342 1.00 75.45  ? 269  GLN A OE1   1 
ATOM   2199  N  NE2   . GLN A 1  269 ? 0.813   19.719  177.783 1.00 77.90  ? 269  GLN A NE2   1 
ATOM   2200  N  N     . ILE A 1  270 ? 1.298   19.717  183.548 1.00 86.82  ? 270  ILE A N     1 
ATOM   2201  C  CA    . ILE A 1  270 ? 2.269   20.353  184.435 1.00 92.52  ? 270  ILE A CA    1 
ATOM   2202  C  C     . ILE A 1  270 ? 1.593   21.112  185.575 1.00 97.97  ? 270  ILE A C     1 
ATOM   2203  O  O     . ILE A 1  270 ? 2.171   21.262  186.656 1.00 100.53 ? 270  ILE A O     1 
ATOM   2204  C  CB    . ILE A 1  270 ? 3.208   21.275  183.632 1.00 80.04  ? 270  ILE A CB    1 
ATOM   2205  C  CG1   . ILE A 1  270 ? 4.286   21.869  184.539 1.00 87.73  ? 270  ILE A CG1   1 
ATOM   2206  C  CG2   . ILE A 1  270 ? 2.419   22.375  182.939 1.00 86.26  ? 270  ILE A CG2   1 
ATOM   2207  C  CD1   . ILE A 1  270 ? 5.081   20.820  185.296 1.00 90.81  ? 270  ILE A CD1   1 
ATOM   2208  N  N     . TYR A 1  271 ? 0.367   21.586  185.352 1.00 105.86 ? 271  TYR A N     1 
ATOM   2209  C  CA    . TYR A 1  271 ? -0.432  22.220  186.398 1.00 110.17 ? 271  TYR A CA    1 
ATOM   2210  C  C     . TYR A 1  271 ? -1.151  21.200  187.279 1.00 108.96 ? 271  TYR A C     1 
ATOM   2211  O  O     . TYR A 1  271 ? -2.211  20.689  186.895 1.00 107.23 ? 271  TYR A O     1 
ATOM   2212  C  CB    . TYR A 1  271 ? -1.455  23.175  185.775 1.00 117.35 ? 271  TYR A CB    1 
ATOM   2213  C  CG    . TYR A 1  271 ? -0.881  24.456  185.198 1.00 124.47 ? 271  TYR A CG    1 
ATOM   2214  C  CD1   . TYR A 1  271 ? -0.673  25.570  186.003 1.00 131.99 ? 271  TYR A CD1   1 
ATOM   2215  C  CD2   . TYR A 1  271 ? -0.559  24.556  183.851 1.00 122.94 ? 271  TYR A CD2   1 
ATOM   2216  C  CE1   . TYR A 1  271 ? -0.156  26.746  185.484 1.00 135.31 ? 271  TYR A CE1   1 
ATOM   2217  C  CE2   . TYR A 1  271 ? -0.041  25.730  183.322 1.00 128.53 ? 271  TYR A CE2   1 
ATOM   2218  C  CZ    . TYR A 1  271 ? 0.159   26.820  184.144 1.00 133.92 ? 271  TYR A CZ    1 
ATOM   2219  O  OH    . TYR A 1  271 ? 0.672   27.989  183.627 1.00 137.47 ? 271  TYR A OH    1 
ATOM   2220  N  N     . PRO A 1  272 ? -0.593  20.858  188.443 1.00 99.66  ? 272  PRO A N     1 
ATOM   2221  C  CA    . PRO A 1  272 ? -1.175  19.782  189.261 1.00 97.38  ? 272  PRO A CA    1 
ATOM   2222  C  C     . PRO A 1  272 ? -2.615  20.080  189.664 1.00 103.32 ? 272  PRO A C     1 
ATOM   2223  O  O     . PRO A 1  272 ? -2.977  21.224  189.944 1.00 102.58 ? 272  PRO A O     1 
ATOM   2224  C  CB    . PRO A 1  272 ? -0.256  19.726  190.489 1.00 87.93  ? 272  PRO A CB    1 
ATOM   2225  C  CG    . PRO A 1  272 ? 0.943   20.557  190.151 1.00 91.98  ? 272  PRO A CG    1 
ATOM   2226  C  CD    . PRO A 1  272 ? 0.489   21.563  189.148 1.00 93.69  ? 272  PRO A CD    1 
ATOM   2227  N  N     . GLY A 1  273 ? -3.437  19.030  189.699 1.00 100.76 ? 273  GLY A N     1 
ATOM   2228  C  CA    . GLY A 1  273 ? -4.754  19.116  190.296 1.00 88.48  ? 273  GLY A CA    1 
ATOM   2229  C  C     . GLY A 1  273 ? -5.901  19.480  189.375 1.00 95.54  ? 273  GLY A C     1 
ATOM   2230  O  O     . GLY A 1  273 ? -7.029  19.631  189.862 1.00 100.56 ? 273  GLY A O     1 
ATOM   2231  N  N     . ILE A 1  274 ? -5.657  19.649  188.073 1.00 92.99  ? 274  ILE A N     1 
ATOM   2232  C  CA    . ILE A 1  274 ? -6.739  19.985  187.152 1.00 96.65  ? 274  ILE A CA    1 
ATOM   2233  C  C     . ILE A 1  274 ? -7.821  18.914  187.202 1.00 101.40 ? 274  ILE A C     1 
ATOM   2234  O  O     . ILE A 1  274 ? -7.535  17.711  187.156 1.00 99.37  ? 274  ILE A O     1 
ATOM   2235  C  CB    . ILE A 1  274 ? -6.187  20.171  185.732 1.00 95.83  ? 274  ILE A CB    1 
ATOM   2236  C  CG1   . ILE A 1  274 ? -5.219  21.353  185.702 1.00 100.58 ? 274  ILE A CG1   1 
ATOM   2237  C  CG2   . ILE A 1  274 ? -7.317  20.395  184.739 1.00 96.27  ? 274  ILE A CG2   1 
ATOM   2238  C  CD1   . ILE A 1  274 ? -5.901  22.698  185.835 1.00 108.97 ? 274  ILE A CD1   1 
ATOM   2239  N  N     . LYS A 1  275 ? -9.077  19.353  187.302 1.00 99.47  ? 275  LYS A N     1 
ATOM   2240  C  CA    . LYS A 1  275 ? -10.240 18.475  187.294 1.00 98.57  ? 275  LYS A CA    1 
ATOM   2241  C  C     . LYS A 1  275 ? -11.198 18.903  186.189 1.00 100.27 ? 275  LYS A C     1 
ATOM   2242  O  O     . LYS A 1  275 ? -11.386 20.101  185.954 1.00 104.86 ? 275  LYS A O     1 
ATOM   2243  C  CB    . LYS A 1  275 ? -10.953 18.518  188.651 1.00 102.51 ? 275  LYS A CB    1 
ATOM   2244  C  CG    . LYS A 1  275 ? -10.051 18.207  189.841 1.00 100.29 ? 275  LYS A CG    1 
ATOM   2245  C  CD    . LYS A 1  275 ? -10.795 18.363  191.164 1.00 99.55  ? 275  LYS A CD    1 
ATOM   2246  C  CE    . LYS A 1  275 ? -9.865  18.174  192.356 1.00 92.48  ? 275  LYS A CE    1 
ATOM   2247  N  NZ    . LYS A 1  275 ? -10.586 18.197  193.660 1.00 91.77  ? 275  LYS A NZ    1 
ATOM   2248  N  N     . VAL A 1  276 ? -11.795 17.928  185.499 1.00 100.00 ? 276  VAL A N     1 
ATOM   2249  C  CA    . VAL A 1  276 ? -12.716 18.207  184.403 1.00 104.15 ? 276  VAL A CA    1 
ATOM   2250  C  C     . VAL A 1  276 ? -14.026 17.436  184.497 1.00 116.72 ? 276  VAL A C     1 
ATOM   2251  O  O     . VAL A 1  276 ? -14.844 17.529  183.581 1.00 113.18 ? 276  VAL A O     1 
ATOM   2252  C  CB    . VAL A 1  276 ? -12.056 17.948  183.033 1.00 100.45 ? 276  VAL A CB    1 
ATOM   2253  C  CG1   . VAL A 1  276 ? -10.955 18.964  182.769 1.00 104.37 ? 276  VAL A CG1   1 
ATOM   2254  C  CG2   . VAL A 1  276 ? -11.522 16.527  182.965 1.00 102.87 ? 276  VAL A CG2   1 
ATOM   2255  N  N     . ARG A 1  277 ? -14.250 16.659  185.562 1.00 120.66 ? 277  ARG A N     1 
ATOM   2256  C  CA    . ARG A 1  277 ? -15.449 15.822  185.648 1.00 116.05 ? 277  ARG A CA    1 
ATOM   2257  C  C     . ARG A 1  277 ? -16.739 16.625  185.506 1.00 117.79 ? 277  ARG A C     1 
ATOM   2258  O  O     . ARG A 1  277 ? -17.572 16.330  184.641 1.00 117.72 ? 277  ARG A O     1 
ATOM   2259  C  CB    . ARG A 1  277 ? -15.457 15.039  186.961 1.00 114.11 ? 277  ARG A CB    1 
ATOM   2260  C  CG    . ARG A 1  277 ? -16.760 14.289  187.208 1.00 114.41 ? 277  ARG A CG    1 
ATOM   2261  C  CD    . ARG A 1  277 ? -16.838 13.028  186.368 1.00 121.77 ? 277  ARG A CD    1 
ATOM   2262  N  NE    . ARG A 1  277 ? -15.976 11.970  186.879 1.00 116.59 ? 277  ARG A NE    1 
ATOM   2263  C  CZ    . ARG A 1  277 ? -15.097 11.305  186.136 1.00 105.00 ? 277  ARG A CZ    1 
ATOM   2264  N  NH1   . ARG A 1  277 ? -14.980 11.575  184.842 1.00 98.00  ? 277  ARG A NH1   1 
ATOM   2265  N  NH2   . ARG A 1  277 ? -14.349 10.357  186.684 1.00 100.95 ? 277  ARG A NH2   1 
ATOM   2266  N  N     . GLN A 1  278 ? -16.930 17.638  186.357 1.00 121.80 ? 278  GLN A N     1 
ATOM   2267  C  CA    . GLN A 1  278 ? -18.158 18.430  186.295 1.00 119.20 ? 278  GLN A CA    1 
ATOM   2268  C  C     . GLN A 1  278 ? -18.329 19.094  184.934 1.00 122.78 ? 278  GLN A C     1 
ATOM   2269  O  O     . GLN A 1  278 ? -19.418 19.060  184.348 1.00 111.57 ? 278  GLN A O     1 
ATOM   2270  C  CB    . GLN A 1  278 ? -18.168 19.470  187.413 1.00 110.12 ? 278  GLN A CB    1 
ATOM   2271  C  CG    . GLN A 1  278 ? -17.855 18.915  188.790 1.00 111.91 ? 278  GLN A CG    1 
ATOM   2272  C  CD    . GLN A 1  278 ? -18.811 17.807  189.199 1.00 109.08 ? 278  GLN A CD    1 
ATOM   2273  O  OE1   . GLN A 1  278 ? -19.987 17.815  188.829 1.00 102.94 ? 278  GLN A OE1   1 
ATOM   2274  N  NE2   . GLN A 1  278 ? -18.312 16.851  189.974 1.00 103.93 ? 278  GLN A NE2   1 
ATOM   2275  N  N     . LEU A 1  279 ? -17.264 19.715  184.422 1.00 112.33 ? 279  LEU A N     1 
ATOM   2276  C  CA    . LEU A 1  279 ? -17.342 20.345  183.109 1.00 108.33 ? 279  LEU A CA    1 
ATOM   2277  C  C     . LEU A 1  279 ? -17.692 19.319  182.039 1.00 109.77 ? 279  LEU A C     1 
ATOM   2278  O  O     . LEU A 1  279 ? -18.508 19.587  181.150 1.00 108.40 ? 279  LEU A O     1 
ATOM   2279  C  CB    . LEU A 1  279 ? -16.027 21.053  182.792 1.00 112.84 ? 279  LEU A CB    1 
ATOM   2280  C  CG    . LEU A 1  279 ? -15.639 22.118  183.820 1.00 110.34 ? 279  LEU A CG    1 
ATOM   2281  C  CD1   . LEU A 1  279 ? -14.132 22.305  183.871 1.00 115.69 ? 279  LEU A CD1   1 
ATOM   2282  C  CD2   . LEU A 1  279 ? -16.341 23.433  183.515 1.00 114.87 ? 279  LEU A CD2   1 
ATOM   2283  N  N     . SER A 1  280 ? -17.085 18.134  182.117 1.00 108.71 ? 280  SER A N     1 
ATOM   2284  C  CA    . SER A 1  280 ? -17.337 17.092  181.127 1.00 107.06 ? 280  SER A CA    1 
ATOM   2285  C  C     . SER A 1  280 ? -18.774 16.596  181.221 1.00 109.81 ? 280  SER A C     1 
ATOM   2286  O  O     . SER A 1  280 ? -19.393 16.275  180.200 1.00 111.64 ? 280  SER A O     1 
ATOM   2287  C  CB    . SER A 1  280 ? -16.344 15.947  181.303 1.00 110.35 ? 280  SER A CB    1 
ATOM   2288  O  OG    . SER A 1  280 ? -15.010 16.427  181.246 1.00 106.51 ? 280  SER A OG    1 
ATOM   2289  N  N     . LYS A 1  281 ? -19.318 16.523  182.440 1.00 112.17 ? 281  LYS A N     1 
ATOM   2290  C  CA    . LYS A 1  281 ? -20.709 16.112  182.616 1.00 113.16 ? 281  LYS A CA    1 
ATOM   2291  C  C     . LYS A 1  281 ? -21.632 17.048  181.849 1.00 112.45 ? 281  LYS A C     1 
ATOM   2292  O  O     . LYS A 1  281 ? -22.541 16.600  181.140 1.00 107.03 ? 281  LYS A O     1 
ATOM   2293  C  CB    . LYS A 1  281 ? -21.082 16.068  184.101 1.00 115.83 ? 281  LYS A CB    1 
ATOM   2294  C  CG    . LYS A 1  281 ? -20.676 14.776  184.813 1.00 119.98 ? 281  LYS A CG    1 
ATOM   2295  C  CD    . LYS A 1  281 ? -21.717 14.322  185.843 1.00 101.13 ? 281  LYS A CD    1 
ATOM   2296  C  CE    . LYS A 1  281 ? -21.990 15.369  186.914 1.00 92.75  ? 281  LYS A CE    1 
ATOM   2297  N  NZ    . LYS A 1  281 ? -20.754 16.053  187.382 1.00 92.85  ? 281  LYS A NZ    1 
ATOM   2298  N  N     . LEU A 1  282 ? -21.430 18.358  182.008 1.00 109.12 ? 282  LEU A N     1 
ATOM   2299  C  CA    . LEU A 1  282 ? -22.169 19.339  181.220 1.00 111.31 ? 282  LEU A CA    1 
ATOM   2300  C  C     . LEU A 1  282 ? -22.187 18.960  179.742 1.00 113.53 ? 282  LEU A C     1 
ATOM   2301  O  O     . LEU A 1  282 ? -23.218 19.089  179.071 1.00 110.99 ? 282  LEU A O     1 
ATOM   2302  C  CB    . LEU A 1  282 ? -21.551 20.728  181.394 1.00 109.34 ? 282  LEU A CB    1 
ATOM   2303  C  CG    . LEU A 1  282 ? -21.416 21.308  182.802 1.00 117.80 ? 282  LEU A CG    1 
ATOM   2304  C  CD1   . LEU A 1  282 ? -20.532 22.546  182.769 1.00 121.63 ? 282  LEU A CD1   1 
ATOM   2305  C  CD2   . LEU A 1  282 ? -22.776 21.634  183.390 1.00 125.91 ? 282  LEU A CD2   1 
ATOM   2306  N  N     . LEU A 1  283 ? -21.048 18.501  179.214 1.00 115.10 ? 283  LEU A N     1 
ATOM   2307  C  CA    . LEU A 1  283 ? -20.980 18.109  177.811 1.00 111.24 ? 283  LEU A CA    1 
ATOM   2308  C  C     . LEU A 1  283 ? -21.807 16.873  177.483 1.00 114.85 ? 283  LEU A C     1 
ATOM   2309  O  O     . LEU A 1  283 ? -22.197 16.706  176.323 1.00 114.96 ? 283  LEU A O     1 
ATOM   2310  C  CB    . LEU A 1  283 ? -19.530 17.825  177.421 1.00 108.80 ? 283  LEU A CB    1 
ATOM   2311  C  CG    . LEU A 1  283 ? -18.597 19.011  177.224 1.00 110.22 ? 283  LEU A CG    1 
ATOM   2312  C  CD1   . LEU A 1  283 ? -17.196 18.535  176.887 1.00 115.86 ? 283  LEU A CD1   1 
ATOM   2313  C  CD2   . LEU A 1  283 ? -19.148 19.881  176.118 1.00 109.20 ? 283  LEU A CD2   1 
ATOM   2314  N  N     . ARG A 1  284 ? -22.086 16.005  178.454 1.00 119.19 ? 284  ARG A N     1 
ATOM   2315  C  CA    . ARG A 1  284 ? -22.682 14.717  178.118 1.00 119.19 ? 284  ARG A CA    1 
ATOM   2316  C  C     . ARG A 1  284 ? -24.145 14.923  177.736 1.00 121.13 ? 284  ARG A C     1 
ATOM   2317  O  O     . ARG A 1  284 ? -24.925 15.507  178.496 1.00 123.14 ? 284  ARG A O     1 
ATOM   2318  C  CB    . ARG A 1  284 ? -22.515 13.710  179.261 1.00 115.31 ? 284  ARG A CB    1 
ATOM   2319  C  CG    . ARG A 1  284 ? -23.471 13.801  180.438 1.00 118.12 ? 284  ARG A CG    1 
ATOM   2320  C  CD    . ARG A 1  284 ? -23.244 12.639  181.396 1.00 120.18 ? 284  ARG A CD    1 
ATOM   2321  N  NE    . ARG A 1  284 ? -21.898 12.662  181.965 1.00 115.04 ? 284  ARG A NE    1 
ATOM   2322  C  CZ    . ARG A 1  284 ? -21.208 11.578  182.307 1.00 110.49 ? 284  ARG A CZ    1 
ATOM   2323  N  NH1   . ARG A 1  284 ? -21.727 10.371  182.127 1.00 118.17 ? 284  ARG A NH1   1 
ATOM   2324  N  NH2   . ARG A 1  284 ? -19.991 11.700  182.820 1.00 108.63 ? 284  ARG A NH2   1 
ATOM   2325  N  N     . GLY A 1  285 ? -24.497 14.501  176.535 1.00 128.21 ? 285  GLY A N     1 
ATOM   2326  C  CA    . GLY A 1  285 ? -25.863 14.604  176.061 1.00 132.90 ? 285  GLY A CA    1 
ATOM   2327  C  C     . GLY A 1  285 ? -25.895 14.764  174.557 1.00 134.93 ? 285  GLY A C     1 
ATOM   2328  O  O     . GLY A 1  285 ? -24.869 14.894  173.893 1.00 129.74 ? 285  GLY A O     1 
ATOM   2329  N  N     . THR A 1  286 ? -27.115 14.759  174.023 1.00 132.85 ? 286  THR A N     1 
ATOM   2330  C  CA    . THR A 1  286 ? -27.325 14.925  172.591 1.00 127.97 ? 286  THR A CA    1 
ATOM   2331  C  C     . THR A 1  286 ? -27.217 16.374  172.137 1.00 128.33 ? 286  THR A C     1 
ATOM   2332  O  O     . THR A 1  286 ? -27.396 16.643  170.943 1.00 126.77 ? 286  THR A O     1 
ATOM   2333  C  CB    . THR A 1  286 ? -28.693 14.362  172.193 1.00 115.87 ? 286  THR A CB    1 
ATOM   2334  N  N     . LYS A 1  287 ? -26.925 17.301  173.050 1.00 137.56 ? 287  LYS A N     1 
ATOM   2335  C  CA    . LYS A 1  287 ? -26.884 18.720  172.718 1.00 132.89 ? 287  LYS A CA    1 
ATOM   2336  C  C     . LYS A 1  287 ? -25.908 18.988  171.580 1.00 134.68 ? 287  LYS A C     1 
ATOM   2337  O  O     . LYS A 1  287 ? -24.762 18.530  171.606 1.00 129.62 ? 287  LYS A O     1 
ATOM   2338  C  CB    . LYS A 1  287 ? -26.491 19.531  173.953 1.00 123.49 ? 287  LYS A CB    1 
ATOM   2339  N  N     . ALA A 1  288 ? -26.371 19.730  170.576 1.00 134.29 ? 288  ALA A N     1 
ATOM   2340  C  CA    . ALA A 1  288 ? -25.542 20.073  169.434 1.00 134.44 ? 288  ALA A CA    1 
ATOM   2341  C  C     . ALA A 1  288 ? -24.592 21.216  169.787 1.00 142.70 ? 288  ALA A C     1 
ATOM   2342  O  O     . ALA A 1  288 ? -24.749 21.902  170.800 1.00 141.99 ? 288  ALA A O     1 
ATOM   2343  C  CB    . ALA A 1  288 ? -26.411 20.446  168.234 1.00 134.04 ? 288  ALA A CB    1 
ATOM   2344  N  N     . LEU A 1  289 ? -23.589 21.413  168.923 1.00 140.34 ? 289  LEU A N     1 
ATOM   2345  C  CA    . LEU A 1  289 ? -22.466 22.290  169.250 1.00 138.84 ? 289  LEU A CA    1 
ATOM   2346  C  C     . LEU A 1  289 ? -22.910 23.711  169.578 1.00 148.23 ? 289  LEU A C     1 
ATOM   2347  O  O     . LEU A 1  289 ? -22.254 24.398  170.371 1.00 144.65 ? 289  LEU A O     1 
ATOM   2348  C  CB    . LEU A 1  289 ? -21.471 22.312  168.089 1.00 138.44 ? 289  LEU A CB    1 
ATOM   2349  C  CG    . LEU A 1  289 ? -20.883 20.972  167.642 1.00 138.01 ? 289  LEU A CG    1 
ATOM   2350  C  CD1   . LEU A 1  289 ? -19.664 21.191  166.760 1.00 131.55 ? 289  LEU A CD1   1 
ATOM   2351  C  CD2   . LEU A 1  289 ? -20.531 20.101  168.837 1.00 129.55 ? 289  LEU A CD2   1 
ATOM   2352  N  N     . THR A 1  290 ? -24.010 24.170  168.980 1.00 166.16 ? 290  THR A N     1 
ATOM   2353  C  CA    . THR A 1  290 ? -24.417 25.567  169.105 1.00 166.06 ? 290  THR A CA    1 
ATOM   2354  C  C     . THR A 1  290 ? -25.170 25.870  170.398 1.00 165.82 ? 290  THR A C     1 
ATOM   2355  O  O     . THR A 1  290 ? -25.041 26.978  170.931 1.00 168.99 ? 290  THR A O     1 
ATOM   2356  C  CB    . THR A 1  290 ? -25.275 25.968  167.904 1.00 166.48 ? 290  THR A CB    1 
ATOM   2357  O  OG1   . THR A 1  290 ? -26.537 25.293  167.968 1.00 165.37 ? 290  THR A OG1   1 
ATOM   2358  C  CG2   . THR A 1  290 ? -24.573 25.597  166.607 1.00 163.18 ? 290  THR A CG2   1 
ATOM   2359  N  N     . GLU A 1  291 ? -25.963 24.925  170.904 1.00 155.17 ? 291  GLU A N     1 
ATOM   2360  C  CA    . GLU A 1  291 ? -26.835 25.198  172.043 1.00 143.26 ? 291  GLU A CA    1 
ATOM   2361  C  C     . GLU A 1  291 ? -26.055 25.648  173.277 1.00 137.02 ? 291  GLU A C     1 
ATOM   2362  O  O     . GLU A 1  291 ? -24.994 25.109  173.605 1.00 137.15 ? 291  GLU A O     1 
ATOM   2363  C  CB    . GLU A 1  291 ? -27.690 23.963  172.360 1.00 133.61 ? 291  GLU A CB    1 
ATOM   2364  C  CG    . GLU A 1  291 ? -27.308 23.192  173.616 1.00 131.11 ? 291  GLU A CG    1 
ATOM   2365  C  CD    . GLU A 1  291 ? -28.456 22.364  174.161 1.00 129.86 ? 291  GLU A CD    1 
ATOM   2366  O  OE1   . GLU A 1  291 ? -28.957 21.485  173.429 1.00 122.73 ? 291  GLU A OE1   1 
ATOM   2367  O  OE2   . GLU A 1  291 ? -28.854 22.590  175.323 1.00 133.15 ? 291  GLU A OE2   1 
ATOM   2368  N  N     . VAL A 1  292 ? -26.583 26.681  173.936 1.00 139.64 ? 292  VAL A N     1 
ATOM   2369  C  CA    . VAL A 1  292 ? -25.952 27.304  175.096 1.00 140.77 ? 292  VAL A CA    1 
ATOM   2370  C  C     . VAL A 1  292 ? -26.319 26.510  176.343 1.00 136.89 ? 292  VAL A C     1 
ATOM   2371  O  O     . VAL A 1  292 ? -27.439 25.996  176.456 1.00 130.00 ? 292  VAL A O     1 
ATOM   2372  C  CB    . VAL A 1  292 ? -26.378 28.781  175.209 1.00 136.32 ? 292  VAL A CB    1 
ATOM   2373  C  CG1   . VAL A 1  292 ? -26.057 29.350  176.588 1.00 132.50 ? 292  VAL A CG1   1 
ATOM   2374  C  CG2   . VAL A 1  292 ? -25.705 29.610  174.125 1.00 133.05 ? 292  VAL A CG2   1 
ATOM   2375  N  N     . ILE A 1  293 ? -25.383 26.393  177.288 1.00 129.89 ? 293  ILE A N     1 
ATOM   2376  C  CA    . ILE A 1  293 ? -25.540 25.510  178.433 1.00 131.44 ? 293  ILE A CA    1 
ATOM   2377  C  C     . ILE A 1  293 ? -25.135 26.204  179.729 1.00 131.92 ? 293  ILE A C     1 
ATOM   2378  O  O     . ILE A 1  293 ? -23.985 26.630  179.871 1.00 130.08 ? 293  ILE A O     1 
ATOM   2379  C  CB    . ILE A 1  293 ? -24.740 24.206  178.271 1.00 131.03 ? 293  ILE A CB    1 
ATOM   2380  C  CG1   . ILE A 1  293 ? -25.322 23.352  177.146 1.00 127.74 ? 293  ILE A CG1   1 
ATOM   2381  C  CG2   . ILE A 1  293 ? -24.715 23.426  179.576 1.00 135.47 ? 293  ILE A CG2   1 
ATOM   2382  C  CD1   . ILE A 1  293 ? -24.389 22.274  176.676 1.00 123.67 ? 293  ILE A CD1   1 
ATOM   2383  N  N     . PRO A 1  294 ? -26.046 26.349  180.690 1.00 131.55 ? 294  PRO A N     1 
ATOM   2384  C  CA    . PRO A 1  294 ? -25.716 27.004  181.961 1.00 136.50 ? 294  PRO A CA    1 
ATOM   2385  C  C     . PRO A 1  294 ? -24.824 26.123  182.823 1.00 138.86 ? 294  PRO A C     1 
ATOM   2386  O  O     . PRO A 1  294 ? -25.029 24.911  182.918 1.00 137.33 ? 294  PRO A O     1 
ATOM   2387  C  CB    . PRO A 1  294 ? -27.086 27.219  182.609 1.00 135.51 ? 294  PRO A CB    1 
ATOM   2388  C  CG    . PRO A 1  294 ? -27.910 26.092  182.076 1.00 133.80 ? 294  PRO A CG    1 
ATOM   2389  C  CD    . PRO A 1  294 ? -27.445 25.887  180.655 1.00 129.08 ? 294  PRO A CD    1 
ATOM   2390  N  N     . LEU A 1  295 ? -23.824 26.735  183.452 1.00 149.86 ? 295  LEU A N     1 
ATOM   2391  C  CA    . LEU A 1  295 ? -22.895 25.953  184.256 1.00 150.54 ? 295  LEU A CA    1 
ATOM   2392  C  C     . LEU A 1  295 ? -23.565 25.545  185.560 1.00 153.04 ? 295  LEU A C     1 
ATOM   2393  O  O     . LEU A 1  295 ? -24.167 26.372  186.252 1.00 156.80 ? 295  LEU A O     1 
ATOM   2394  C  CB    . LEU A 1  295 ? -21.631 26.757  184.556 1.00 152.62 ? 295  LEU A CB    1 
ATOM   2395  C  CG    . LEU A 1  295 ? -20.889 27.412  183.395 1.00 157.85 ? 295  LEU A CG    1 
ATOM   2396  C  CD1   . LEU A 1  295 ? -19.553 27.948  183.879 1.00 159.59 ? 295  LEU A CD1   1 
ATOM   2397  C  CD2   . LEU A 1  295 ? -20.691 26.408  182.274 1.00 153.47 ? 295  LEU A CD2   1 
ATOM   2398  N  N     . THR A 1  296 ? -23.461 24.259  185.885 1.00 143.40 ? 296  THR A N     1 
ATOM   2399  C  CA    . THR A 1  296 ? -23.928 23.752  187.166 1.00 140.33 ? 296  THR A CA    1 
ATOM   2400  C  C     . THR A 1  296 ? -23.136 24.388  188.305 1.00 138.79 ? 296  THR A C     1 
ATOM   2401  O  O     . THR A 1  296 ? -21.968 24.750  188.149 1.00 140.79 ? 296  THR A O     1 
ATOM   2402  C  CB    . THR A 1  296 ? -23.801 22.225  187.196 1.00 140.16 ? 296  THR A CB    1 
ATOM   2403  O  OG1   . THR A 1  296 ? -24.539 21.670  186.102 1.00 136.37 ? 296  THR A OG1   1 
ATOM   2404  C  CG2   . THR A 1  296 ? -24.381 21.656  188.474 1.00 134.63 ? 296  THR A CG2   1 
ATOM   2405  N  N     . GLU A 1  297 ? -23.804 24.550  189.452 1.00 139.17 ? 297  GLU A N     1 
ATOM   2406  C  CA    . GLU A 1  297 ? -23.158 25.087  190.648 1.00 141.81 ? 297  GLU A CA    1 
ATOM   2407  C  C     . GLU A 1  297 ? -21.821 24.403  190.913 1.00 146.07 ? 297  GLU A C     1 
ATOM   2408  O  O     . GLU A 1  297 ? -20.786 25.064  191.052 1.00 142.64 ? 297  GLU A O     1 
ATOM   2409  C  CB    . GLU A 1  297 ? -24.095 24.931  191.846 1.00 140.65 ? 297  GLU A CB    1 
ATOM   2410  C  CG    . GLU A 1  297 ? -23.472 25.257  193.189 1.00 135.89 ? 297  GLU A CG    1 
ATOM   2411  C  CD    . GLU A 1  297 ? -24.442 25.047  194.334 1.00 139.87 ? 297  GLU A CD    1 
ATOM   2412  O  OE1   . GLU A 1  297 ? -25.556 25.610  194.282 1.00 143.14 ? 297  GLU A OE1   1 
ATOM   2413  O  OE2   . GLU A 1  297 ? -24.095 24.311  195.282 1.00 142.46 ? 297  GLU A OE2   1 
ATOM   2414  N  N     . GLU A 1  298 ? -21.828 23.073  190.986 1.00 159.13 ? 298  GLU A N     1 
ATOM   2415  C  CA    . GLU A 1  298 ? -20.591 22.327  191.198 1.00 155.16 ? 298  GLU A CA    1 
ATOM   2416  C  C     . GLU A 1  298 ? -19.672 22.391  189.982 1.00 154.30 ? 298  GLU A C     1 
ATOM   2417  O  O     . GLU A 1  298 ? -18.452 22.255  190.125 1.00 150.86 ? 298  GLU A O     1 
ATOM   2418  C  CB    . GLU A 1  298 ? -20.898 20.875  191.575 1.00 150.87 ? 298  GLU A CB    1 
ATOM   2419  C  CG    . GLU A 1  298 ? -21.822 20.703  192.785 1.00 155.94 ? 298  GLU A CG    1 
ATOM   2420  C  CD    . GLU A 1  298 ? -23.299 20.775  192.448 1.00 159.22 ? 298  GLU A CD    1 
ATOM   2421  O  OE1   . GLU A 1  298 ? -23.647 21.357  191.404 1.00 160.59 ? 298  GLU A OE1   1 
ATOM   2422  O  OE2   . GLU A 1  298 ? -24.114 20.252  193.236 1.00 159.50 ? 298  GLU A OE2   1 
ATOM   2423  N  N     . ALA A 1  299 ? -20.233 22.586  188.784 1.00 149.61 ? 299  ALA A N     1 
ATOM   2424  C  CA    . ALA A 1  299 ? -19.404 22.741  187.590 1.00 135.09 ? 299  ALA A CA    1 
ATOM   2425  C  C     . ALA A 1  299 ? -18.569 24.019  187.619 1.00 131.99 ? 299  ALA A C     1 
ATOM   2426  O  O     . ALA A 1  299 ? -17.384 23.992  187.268 1.00 127.67 ? 299  ALA A O     1 
ATOM   2427  C  CB    . ALA A 1  299 ? -20.281 22.706  186.339 1.00 126.54 ? 299  ALA A CB    1 
ATOM   2428  N  N     . GLU A 1  300 ? -19.151 25.146  188.032 1.00 129.32 ? 300  GLU A N     1 
ATOM   2429  C  CA    . GLU A 1  300 ? -18.369 26.379  188.088 1.00 129.96 ? 300  GLU A CA    1 
ATOM   2430  C  C     . GLU A 1  300 ? -17.514 26.489  189.346 1.00 128.16 ? 300  GLU A C     1 
ATOM   2431  O  O     . GLU A 1  300 ? -16.630 27.351  189.399 1.00 129.26 ? 300  GLU A O     1 
ATOM   2432  C  CB    . GLU A 1  300 ? -19.272 27.609  187.946 1.00 134.04 ? 300  GLU A CB    1 
ATOM   2433  C  CG    . GLU A 1  300 ? -20.618 27.532  188.628 1.00 141.70 ? 300  GLU A CG    1 
ATOM   2434  C  CD    . GLU A 1  300 ? -21.585 28.566  188.080 1.00 151.57 ? 300  GLU A CD    1 
ATOM   2435  O  OE1   . GLU A 1  300 ? -21.225 29.249  187.097 1.00 151.16 ? 300  GLU A OE1   1 
ATOM   2436  O  OE2   . GLU A 1  300 ? -22.699 28.699  188.631 1.00 151.31 ? 300  GLU A OE2   1 
ATOM   2437  N  N     . LEU A 1  301 ? -17.757 25.652  190.357 1.00 130.12 ? 301  LEU A N     1 
ATOM   2438  C  CA    . LEU A 1  301 ? -16.789 25.491  191.439 1.00 124.07 ? 301  LEU A CA    1 
ATOM   2439  C  C     . LEU A 1  301 ? -15.495 24.881  190.912 1.00 129.47 ? 301  LEU A C     1 
ATOM   2440  O  O     . LEU A 1  301 ? -14.396 25.319  191.275 1.00 131.91 ? 301  LEU A O     1 
ATOM   2441  C  CB    . LEU A 1  301 ? -17.379 24.633  192.558 1.00 129.53 ? 301  LEU A CB    1 
ATOM   2442  C  CG    . LEU A 1  301 ? -16.431 24.153  193.663 1.00 124.34 ? 301  LEU A CG    1 
ATOM   2443  C  CD1   . LEU A 1  301 ? -15.657 25.312  194.280 1.00 115.89 ? 301  LEU A CD1   1 
ATOM   2444  C  CD2   . LEU A 1  301 ? -17.204 23.399  194.733 1.00 121.87 ? 301  LEU A CD2   1 
ATOM   2445  N  N     . GLU A 1  302 ? -15.613 23.854  190.069 1.00 128.08 ? 302  GLU A N     1 
ATOM   2446  C  CA    . GLU A 1  302 ? -14.449 23.247  189.429 1.00 125.73 ? 302  GLU A CA    1 
ATOM   2447  C  C     . GLU A 1  302 ? -13.660 24.281  188.637 1.00 119.32 ? 302  GLU A C     1 
ATOM   2448  O  O     . GLU A 1  302 ? -12.444 24.420  188.812 1.00 122.56 ? 302  GLU A O     1 
ATOM   2449  C  CB    . GLU A 1  302 ? -14.898 22.106  188.519 1.00 123.78 ? 302  GLU A CB    1 
ATOM   2450  C  CG    . GLU A 1  302 ? -13.793 21.167  188.082 1.00 114.19 ? 302  GLU A CG    1 
ATOM   2451  C  CD    . GLU A 1  302 ? -14.341 19.889  187.483 1.00 116.06 ? 302  GLU A CD    1 
ATOM   2452  O  OE1   . GLU A 1  302 ? -14.837 19.937  186.337 1.00 117.11 ? 302  GLU A OE1   1 
ATOM   2453  O  OE2   . GLU A 1  302 ? -14.283 18.839  188.158 1.00 110.59 ? 302  GLU A OE2   1 
ATOM   2454  N  N     . LEU A 1  303 ? -14.339 25.000  187.740 1.00 123.64 ? 303  LEU A N     1 
ATOM   2455  C  CA    . LEU A 1  303 ? -13.691 26.049  186.958 1.00 119.91 ? 303  LEU A CA    1 
ATOM   2456  C  C     . LEU A 1  303 ? -12.959 27.045  187.851 1.00 124.92 ? 303  LEU A C     1 
ATOM   2457  O  O     . LEU A 1  303 ? -11.852 27.484  187.522 1.00 126.97 ? 303  LEU A O     1 
ATOM   2458  C  CB    . LEU A 1  303 ? -14.730 26.770  186.098 1.00 104.35 ? 303  LEU A CB    1 
ATOM   2459  C  CG    . LEU A 1  303 ? -14.216 27.773  185.065 1.00 107.83 ? 303  LEU A CG    1 
ATOM   2460  C  CD1   . LEU A 1  303 ? -12.965 27.256  184.370 1.00 116.88 ? 303  LEU A CD1   1 
ATOM   2461  C  CD2   . LEU A 1  303 ? -15.304 28.094  184.052 1.00 111.93 ? 303  LEU A CD2   1 
ATOM   2462  N  N     . ALA A 1  304 ? -13.548 27.393  188.996 1.00 124.54 ? 304  ALA A N     1 
ATOM   2463  C  CA    . ALA A 1  304 ? -12.900 28.326  189.913 1.00 125.98 ? 304  ALA A CA    1 
ATOM   2464  C  C     . ALA A 1  304 ? -11.627 27.731  190.508 1.00 130.52 ? 304  ALA A C     1 
ATOM   2465  O  O     . ALA A 1  304 ? -10.587 28.399  190.560 1.00 131.48 ? 304  ALA A O     1 
ATOM   2466  C  CB    . ALA A 1  304 ? -13.873 28.734  191.019 1.00 130.24 ? 304  ALA A CB    1 
ATOM   2467  N  N     . GLU A 1  305 ? -11.693 26.484  190.986 1.00 140.37 ? 305  GLU A N     1 
ATOM   2468  C  CA    . GLU A 1  305 ? -10.490 25.824  191.490 1.00 139.29 ? 305  GLU A CA    1 
ATOM   2469  C  C     . GLU A 1  305 ? -9.425  25.716  190.404 1.00 137.23 ? 305  GLU A C     1 
ATOM   2470  O  O     . GLU A 1  305 ? -8.225  25.814  190.684 1.00 135.57 ? 305  GLU A O     1 
ATOM   2471  C  CB    . GLU A 1  305 ? -10.843 24.435  192.023 1.00 137.80 ? 305  GLU A CB    1 
ATOM   2472  C  CG    . GLU A 1  305 ? -11.693 24.432  193.283 1.00 139.00 ? 305  GLU A CG    1 
ATOM   2473  C  CD    . GLU A 1  305 ? -12.509 23.160  193.428 1.00 135.19 ? 305  GLU A CD    1 
ATOM   2474  O  OE1   . GLU A 1  305 ? -12.519 22.581  194.535 1.00 136.49 ? 305  GLU A OE1   1 
ATOM   2475  O  OE2   . GLU A 1  305 ? -13.137 22.737  192.434 1.00 132.00 ? 305  GLU A OE2   1 
ATOM   2476  N  N     . ASN A 1  306 ? -9.853  25.503  189.159 1.00 128.98 ? 306  ASN A N     1 
ATOM   2477  C  CA    . ASN A 1  306 ? -8.937  25.470  188.022 1.00 125.14 ? 306  ASN A CA    1 
ATOM   2478  C  C     . ASN A 1  306 ? -8.198  26.794  187.855 1.00 124.42 ? 306  ASN A C     1 
ATOM   2479  O  O     . ASN A 1  306 ? -6.963  26.825  187.788 1.00 121.83 ? 306  ASN A O     1 
ATOM   2480  C  CB    . ASN A 1  306 ? -9.702  25.107  186.750 1.00 119.67 ? 306  ASN A CB    1 
ATOM   2481  C  CG    . ASN A 1  306 ? -9.965  23.618  186.634 1.00 112.64 ? 306  ASN A CG    1 
ATOM   2482  O  OD1   . ASN A 1  306 ? -9.255  22.802  187.223 1.00 111.25 ? 306  ASN A OD1   1 
ATOM   2483  N  ND2   . ASN A 1  306 ? -10.999 23.257  185.883 1.00 109.81 ? 306  ASN A ND2   1 
ATOM   2484  N  N     . ARG A 1  307 ? -8.949  27.896  187.754 1.00 130.41 ? 307  ARG A N     1 
ATOM   2485  C  CA    . ARG A 1  307 ? -8.364  29.237  187.742 1.00 122.29 ? 307  ARG A CA    1 
ATOM   2486  C  C     . ARG A 1  307 ? -7.314  29.402  188.835 1.00 126.71 ? 307  ARG A C     1 
ATOM   2487  O  O     . ARG A 1  307 ? -6.199  29.865  188.571 1.00 127.15 ? 307  ARG A O     1 
ATOM   2488  C  CB    . ARG A 1  307 ? -9.466  30.283  187.911 1.00 118.18 ? 307  ARG A CB    1 
ATOM   2489  C  CG    . ARG A 1  307 ? -10.591 30.174  186.898 1.00 116.57 ? 307  ARG A CG    1 
ATOM   2490  C  CD    . ARG A 1  307 ? -10.328 30.877  185.586 1.00 113.09 ? 307  ARG A CD    1 
ATOM   2491  N  NE    . ARG A 1  307 ? -11.539 30.862  184.769 1.00 109.08 ? 307  ARG A NE    1 
ATOM   2492  C  CZ    . ARG A 1  307 ? -11.641 31.400  183.559 1.00 127.14 ? 307  ARG A CZ    1 
ATOM   2493  N  NH1   . ARG A 1  307 ? -10.601 32.011  183.009 1.00 139.52 ? 307  ARG A NH1   1 
ATOM   2494  N  NH2   . ARG A 1  307 ? -12.791 31.330  182.901 1.00 121.36 ? 307  ARG A NH2   1 
ATOM   2495  N  N     . GLU A 1  308 ? -7.660  29.039  190.075 1.00 128.55 ? 308  GLU A N     1 
ATOM   2496  C  CA    . GLU A 1  308 ? -6.705  29.160  191.175 1.00 126.64 ? 308  GLU A CA    1 
ATOM   2497  C  C     . GLU A 1  308 ? -5.419  28.406  190.876 1.00 130.70 ? 308  GLU A C     1 
ATOM   2498  O  O     . GLU A 1  308 ? -4.342  28.813  191.328 1.00 133.06 ? 308  GLU A O     1 
ATOM   2499  C  CB    . GLU A 1  308 ? -7.326  28.690  192.489 1.00 125.47 ? 308  GLU A CB    1 
ATOM   2500  C  CG    . GLU A 1  308 ? -8.416  29.621  192.997 1.00 128.32 ? 308  GLU A CG    1 
ATOM   2501  C  CD    . GLU A 1  308 ? -7.852  30.853  193.692 1.00 127.08 ? 308  GLU A CD    1 
ATOM   2502  O  OE1   . GLU A 1  308 ? -6.612  31.007  193.738 1.00 124.09 ? 308  GLU A OE1   1 
ATOM   2503  O  OE2   . GLU A 1  308 ? -8.652  31.676  194.186 1.00 120.66 ? 308  GLU A OE2   1 
ATOM   2504  N  N     . ILE A 1  309 ? -5.505  27.310  190.123 1.00 126.13 ? 309  ILE A N     1 
ATOM   2505  C  CA    . ILE A 1  309 ? -4.294  26.581  189.776 1.00 133.89 ? 309  ILE A CA    1 
ATOM   2506  C  C     . ILE A 1  309 ? -3.559  27.323  188.670 1.00 136.19 ? 309  ILE A C     1 
ATOM   2507  O  O     . ILE A 1  309 ? -2.335  27.485  188.723 1.00 136.75 ? 309  ILE A O     1 
ATOM   2508  C  CB    . ILE A 1  309 ? -4.629  25.136  189.363 1.00 130.75 ? 309  ILE A CB    1 
ATOM   2509  C  CG1   . ILE A 1  309 ? -5.384  24.416  190.481 1.00 124.09 ? 309  ILE A CG1   1 
ATOM   2510  C  CG2   . ILE A 1  309 ? -3.363  24.377  188.988 1.00 120.12 ? 309  ILE A CG2   1 
ATOM   2511  C  CD1   . ILE A 1  309 ? -6.187  23.227  190.000 1.00 116.10 ? 309  ILE A CD1   1 
ATOM   2512  N  N     . LEU A 1  310 ? -4.288  27.784  187.653 1.00 128.99 ? 310  LEU A N     1 
ATOM   2513  C  CA    . LEU A 1  310 ? -3.647  28.442  186.526 1.00 131.07 ? 310  LEU A CA    1 
ATOM   2514  C  C     . LEU A 1  310 ? -3.209  29.860  186.871 1.00 138.56 ? 310  LEU A C     1 
ATOM   2515  O  O     . LEU A 1  310 ? -2.581  30.522  186.037 1.00 142.56 ? 310  LEU A O     1 
ATOM   2516  C  CB    . LEU A 1  310 ? -4.609  28.464  185.335 1.00 132.20 ? 310  LEU A CB    1 
ATOM   2517  C  CG    . LEU A 1  310 ? -4.808  27.128  184.614 1.00 132.09 ? 310  LEU A CG    1 
ATOM   2518  C  CD1   . LEU A 1  310 ? -5.706  27.281  183.407 1.00 119.25 ? 310  LEU A CD1   1 
ATOM   2519  C  CD2   . LEU A 1  310 ? -3.477  26.548  184.194 1.00 133.30 ? 310  LEU A CD2   1 
ATOM   2520  N  N     . LYS A 1  311 ? -3.532  30.333  188.079 1.00 143.09 ? 311  LYS A N     1 
ATOM   2521  C  CA    . LYS A 1  311 ? -3.092  31.646  188.540 1.00 149.81 ? 311  LYS A CA    1 
ATOM   2522  C  C     . LYS A 1  311 ? -1.574  31.697  188.659 1.00 148.80 ? 311  LYS A C     1 
ATOM   2523  O  O     . LYS A 1  311 ? -0.908  32.534  188.039 1.00 144.45 ? 311  LYS A O     1 
ATOM   2524  C  CB    . LYS A 1  311 ? -3.761  31.992  189.873 1.00 144.57 ? 311  LYS A CB    1 
ATOM   2525  C  CG    . LYS A 1  311 ? -5.130  32.650  189.728 1.00 138.57 ? 311  LYS A CG    1 
ATOM   2526  C  CD    . LYS A 1  311 ? -5.748  32.968  191.082 1.00 140.44 ? 311  LYS A CD    1 
ATOM   2527  C  CE    . LYS A 1  311 ? -7.069  33.711  190.930 1.00 139.79 ? 311  LYS A CE    1 
ATOM   2528  N  NZ    . LYS A 1  311 ? -8.134  32.870  190.320 1.00 140.91 ? 311  LYS A NZ    1 
ATOM   2529  N  N     . GLU A 1  312 ? -1.012  30.795  189.468 1.00 163.36 ? 312  GLU A N     1 
ATOM   2530  C  CA    . GLU A 1  312 ? 0.423   30.707  189.649 1.00 164.80 ? 312  GLU A CA    1 
ATOM   2531  C  C     . GLU A 1  312 ? 1.076   30.313  188.325 1.00 161.15 ? 312  GLU A C     1 
ATOM   2532  O  O     . GLU A 1  312 ? 0.410   29.799  187.422 1.00 157.02 ? 312  GLU A O     1 
ATOM   2533  C  CB    . GLU A 1  312 ? 0.724   29.686  190.752 1.00 161.64 ? 312  GLU A CB    1 
ATOM   2534  C  CG    . GLU A 1  312 ? 2.033   29.850  191.513 1.00 161.39 ? 312  GLU A CG    1 
ATOM   2535  C  CD    . GLU A 1  312 ? 3.181   29.092  190.877 1.00 161.11 ? 312  GLU A CD    1 
ATOM   2536  O  OE1   . GLU A 1  312 ? 2.910   28.126  190.134 1.00 156.83 ? 312  GLU A OE1   1 
ATOM   2537  O  OE2   . GLU A 1  312 ? 4.350   29.455  191.123 1.00 163.39 ? 312  GLU A OE2   1 
ATOM   2538  N  N     . PRO A 1  313 ? 2.380   30.542  188.181 1.00 150.05 ? 313  PRO A N     1 
ATOM   2539  C  CA    . PRO A 1  313 ? 3.087   29.948  187.042 1.00 142.17 ? 313  PRO A CA    1 
ATOM   2540  C  C     . PRO A 1  313 ? 3.968   28.777  187.438 1.00 141.11 ? 313  PRO A C     1 
ATOM   2541  O  O     . PRO A 1  313 ? 4.875   28.910  188.268 1.00 140.41 ? 313  PRO A O     1 
ATOM   2542  C  CB    . PRO A 1  313 ? 3.923   31.119  186.516 1.00 134.72 ? 313  PRO A CB    1 
ATOM   2543  C  CG    . PRO A 1  313 ? 4.238   31.920  187.753 1.00 139.46 ? 313  PRO A CG    1 
ATOM   2544  C  CD    . PRO A 1  313 ? 3.112   31.693  188.742 1.00 144.12 ? 313  PRO A CD    1 
ATOM   2545  N  N     . VAL A 1  314 ? 3.701   27.618  186.852 1.00 125.40 ? 314  VAL A N     1 
ATOM   2546  C  CA    . VAL A 1  314 ? 4.421   26.411  187.193 1.00 116.63 ? 314  VAL A CA    1 
ATOM   2547  C  C     . VAL A 1  314 ? 5.496   26.154  186.149 1.00 110.00 ? 314  VAL A C     1 
ATOM   2548  O  O     . VAL A 1  314 ? 5.435   26.623  185.010 1.00 111.98 ? 314  VAL A O     1 
ATOM   2549  C  CB    . VAL A 1  314 ? 3.471   25.198  187.322 1.00 118.54 ? 314  VAL A CB    1 
ATOM   2550  C  CG1   . VAL A 1  314 ? 4.099   24.109  188.182 1.00 107.42 ? 314  VAL A CG1   1 
ATOM   2551  C  CG2   . VAL A 1  314 ? 2.150   25.636  187.918 1.00 126.17 ? 314  VAL A CG2   1 
ATOM   2552  N  N     . HIS A 1  315 ? 6.503   25.393  186.558 1.00 105.34 ? 315  HIS A N     1 
ATOM   2553  C  CA    . HIS A 1  315 ? 7.615   25.004  185.713 1.00 100.10 ? 315  HIS A CA    1 
ATOM   2554  C  C     . HIS A 1  315 ? 7.920   23.547  186.018 1.00 99.25  ? 315  HIS A C     1 
ATOM   2555  O  O     . HIS A 1  315 ? 7.734   23.089  187.148 1.00 99.54  ? 315  HIS A O     1 
ATOM   2556  C  CB    . HIS A 1  315 ? 8.846   25.897  185.935 1.00 104.90 ? 315  HIS A CB    1 
ATOM   2557  C  CG    . HIS A 1  315 ? 9.423   25.804  187.313 1.00 106.30 ? 315  HIS A CG    1 
ATOM   2558  N  ND1   . HIS A 1  315 ? 10.517  25.019  187.613 1.00 101.10 ? 315  HIS A ND1   1 
ATOM   2559  C  CD2   . HIS A 1  315 ? 9.061   26.402  188.472 1.00 112.48 ? 315  HIS A CD2   1 
ATOM   2560  C  CE1   . HIS A 1  315 ? 10.800  25.136  188.898 1.00 106.31 ? 315  HIS A CE1   1 
ATOM   2561  N  NE2   . HIS A 1  315 ? 9.932   25.970  189.442 1.00 115.25 ? 315  HIS A NE2   1 
ATOM   2562  N  N     . GLY A 1  316 ? 8.381   22.816  185.011 1.00 96.23  ? 316  GLY A N     1 
ATOM   2563  C  CA    . GLY A 1  316 ? 8.896   21.486  185.234 1.00 94.43  ? 316  GLY A CA    1 
ATOM   2564  C  C     . GLY A 1  316 ? 10.408  21.492  185.200 1.00 91.92  ? 316  GLY A C     1 
ATOM   2565  O  O     . GLY A 1  316 ? 11.031  22.410  184.673 1.00 95.43  ? 316  GLY A O     1 
ATOM   2566  N  N     . VAL A 1  317 ? 11.003  20.452  185.778 1.00 84.77  ? 317  VAL A N     1 
ATOM   2567  C  CA    . VAL A 1  317 ? 12.438  20.255  185.634 1.00 83.63  ? 317  VAL A CA    1 
ATOM   2568  C  C     . VAL A 1  317 ? 12.720  19.218  184.556 1.00 85.45  ? 317  VAL A C     1 
ATOM   2569  O  O     . VAL A 1  317 ? 11.796  18.696  183.922 1.00 80.51  ? 317  VAL A O     1 
ATOM   2570  C  CB    . VAL A 1  317 ? 13.062  19.838  186.977 1.00 85.72  ? 317  VAL A CB    1 
ATOM   2571  C  CG1   . VAL A 1  317 ? 12.695  20.842  188.058 1.00 96.78  ? 317  VAL A CG1   1 
ATOM   2572  C  CG2   . VAL A 1  317 ? 12.595  18.446  187.364 1.00 90.04  ? 317  VAL A CG2   1 
ATOM   2573  N  N     . TYR A 1  318 ? 13.999  18.914  184.352 1.00 83.52  ? 318  TYR A N     1 
ATOM   2574  C  CA    . TYR A 1  318 ? 14.473  17.968  183.353 1.00 74.33  ? 318  TYR A CA    1 
ATOM   2575  C  C     . TYR A 1  318 ? 14.925  16.686  184.047 1.00 71.70  ? 318  TYR A C     1 
ATOM   2576  O  O     . TYR A 1  318 ? 14.962  16.599  185.278 1.00 71.85  ? 318  TYR A O     1 
ATOM   2577  C  CB    . TYR A 1  318 ? 15.587  18.589  182.505 1.00 83.67  ? 318  TYR A CB    1 
ATOM   2578  C  CG    . TYR A 1  318 ? 15.172  19.852  181.775 1.00 88.30  ? 318  TYR A CG    1 
ATOM   2579  C  CD1   . TYR A 1  318 ? 14.313  19.791  180.683 1.00 93.04  ? 318  TYR A CD1   1 
ATOM   2580  C  CD2   . TYR A 1  318 ? 15.629  21.101  182.177 1.00 94.57  ? 318  TYR A CD2   1 
ATOM   2581  C  CE1   . TYR A 1  318 ? 13.925  20.936  180.008 1.00 95.86  ? 318  TYR A CE1   1 
ATOM   2582  C  CE2   . TYR A 1  318 ? 15.244  22.255  181.507 1.00 99.94  ? 318  TYR A CE2   1 
ATOM   2583  C  CZ    . TYR A 1  318 ? 14.392  22.165  180.423 1.00 99.17  ? 318  TYR A CZ    1 
ATOM   2584  O  OH    . TYR A 1  318 ? 14.005  23.303  179.751 1.00 95.91  ? 318  TYR A OH    1 
ATOM   2585  N  N     . TYR A 1  319 ? 15.294  15.689  183.249 1.00 71.29  ? 319  TYR A N     1 
ATOM   2586  C  CA    . TYR A 1  319 ? 15.447  14.327  183.743 1.00 71.99  ? 319  TYR A CA    1 
ATOM   2587  C  C     . TYR A 1  319 ? 16.917  14.041  184.020 1.00 75.31  ? 319  TYR A C     1 
ATOM   2588  O  O     . TYR A 1  319 ? 17.785  14.366  183.203 1.00 80.49  ? 319  TYR A O     1 
ATOM   2589  C  CB    . TYR A 1  319 ? 14.874  13.320  182.743 1.00 69.73  ? 319  TYR A CB    1 
ATOM   2590  C  CG    . TYR A 1  319 ? 15.175  11.872  183.064 1.00 66.50  ? 319  TYR A CG    1 
ATOM   2591  C  CD1   . TYR A 1  319 ? 14.751  11.300  184.257 1.00 68.75  ? 319  TYR A CD1   1 
ATOM   2592  C  CD2   . TYR A 1  319 ? 15.841  11.064  182.155 1.00 69.15  ? 319  TYR A CD2   1 
ATOM   2593  C  CE1   . TYR A 1  319 ? 15.019  9.973   184.552 1.00 67.89  ? 319  TYR A CE1   1 
ATOM   2594  C  CE2   . TYR A 1  319 ? 16.104  9.736   182.435 1.00 66.45  ? 319  TYR A CE2   1 
ATOM   2595  C  CZ    . TYR A 1  319 ? 15.691  9.196   183.634 1.00 64.09  ? 319  TYR A CZ    1 
ATOM   2596  O  OH    . TYR A 1  319 ? 15.954  7.873   183.913 1.00 73.46  ? 319  TYR A OH    1 
ATOM   2597  N  N     . ASP A 1  320 ? 17.186  13.425  185.170 1.00 79.20  ? 320  ASP A N     1 
ATOM   2598  C  CA    . ASP A 1  320 ? 18.530  13.019  185.567 1.00 80.06  ? 320  ASP A CA    1 
ATOM   2599  C  C     . ASP A 1  320 ? 18.573  11.498  185.618 1.00 77.67  ? 320  ASP A C     1 
ATOM   2600  O  O     . ASP A 1  320 ? 18.191  10.904  186.638 1.00 80.08  ? 320  ASP A O     1 
ATOM   2601  C  CB    . ASP A 1  320 ? 18.894  13.627  186.927 1.00 85.92  ? 320  ASP A CB    1 
ATOM   2602  C  CG    . ASP A 1  320 ? 20.263  13.182  187.444 1.00 90.24  ? 320  ASP A CG    1 
ATOM   2603  O  OD1   . ASP A 1  320 ? 20.849  12.205  186.934 1.00 82.16  ? 320  ASP A OD1   1 
ATOM   2604  O  OD2   . ASP A 1  320 ? 20.768  13.833  188.381 1.00 96.22  ? 320  ASP A OD2   1 
ATOM   2605  N  N     . PRO A 1  321 ? 19.014  10.819  184.548 1.00 70.45  ? 321  PRO A N     1 
ATOM   2606  C  CA    . PRO A 1  321 ? 18.968  9.344   184.512 1.00 80.76  ? 321  PRO A CA    1 
ATOM   2607  C  C     . PRO A 1  321 ? 19.559  8.630   185.724 1.00 79.37  ? 321  PRO A C     1 
ATOM   2608  O  O     . PRO A 1  321 ? 19.409  7.412   185.861 1.00 83.29  ? 321  PRO A O     1 
ATOM   2609  C  CB    . PRO A 1  321 ? 19.762  8.999   183.241 1.00 73.02  ? 321  PRO A CB    1 
ATOM   2610  C  CG    . PRO A 1  321 ? 20.185  10.309  182.625 1.00 74.71  ? 321  PRO A CG    1 
ATOM   2611  C  CD    . PRO A 1  321 ? 19.393  11.398  183.252 1.00 66.26  ? 321  PRO A CD    1 
ATOM   2612  N  N     . SER A 1  322 ? 20.219  9.366   186.613 1.00 80.43  ? 322  SER A N     1 
ATOM   2613  C  CA    . SER A 1  322 ? 20.918  8.765   187.740 1.00 90.39  ? 322  SER A CA    1 
ATOM   2614  C  C     . SER A 1  322 ? 20.043  8.701   188.980 1.00 102.16 ? 322  SER A C     1 
ATOM   2615  O  O     . SER A 1  322 ? 20.359  7.954   189.915 1.00 104.05 ? 322  SER A O     1 
ATOM   2616  C  CB    . SER A 1  322 ? 22.195  9.544   188.067 1.00 84.94  ? 322  SER A CB    1 
ATOM   2617  O  OG    . SER A 1  322 ? 21.905  10.901  188.353 1.00 76.08  ? 322  SER A OG    1 
ATOM   2618  N  N     . LYS A 1  323 ? 18.971  9.485   189.009 1.00 98.99  ? 323  LYS A N     1 
ATOM   2619  C  CA    . LYS A 1  323 ? 18.014  9.526   190.101 1.00 99.85  ? 323  LYS A CA    1 
ATOM   2620  C  C     . LYS A 1  323 ? 16.788  8.678   189.779 1.00 96.92  ? 323  LYS A C     1 
ATOM   2621  O  O     . LYS A 1  323 ? 16.401  8.533   188.615 1.00 95.19  ? 323  LYS A O     1 
ATOM   2622  C  CB    . LYS A 1  323 ? 17.567  10.972  190.320 1.00 97.34  ? 323  LYS A CB    1 
ATOM   2623  C  CG    . LYS A 1  323 ? 18.689  11.964  190.583 1.00 98.73  ? 323  LYS A CG    1 
ATOM   2624  C  CD    . LYS A 1  323 ? 18.146  13.255  191.174 1.00 107.11 ? 323  LYS A CD    1 
ATOM   2625  C  CE    . LYS A 1  323 ? 19.133  14.400  191.000 1.00 107.86 ? 323  LYS A CE    1 
ATOM   2626  N  NZ    . LYS A 1  323 ? 18.502  15.730  191.230 1.00 106.63 ? 323  LYS A NZ    1 
ATOM   2627  N  N     . ASP A 1  324 ? 16.188  8.103   190.820 1.00 93.63  ? 324  ASP A N     1 
ATOM   2628  C  CA    . ASP A 1  324 ? 14.984  7.306   190.634 1.00 87.94  ? 324  ASP A CA    1 
ATOM   2629  C  C     . ASP A 1  324 ? 13.859  8.192   190.108 1.00 85.12  ? 324  ASP A C     1 
ATOM   2630  O  O     . ASP A 1  324 ? 13.871  9.415   190.277 1.00 89.05  ? 324  ASP A O     1 
ATOM   2631  C  CB    . ASP A 1  324 ? 14.568  6.628   191.939 1.00 82.10  ? 324  ASP A CB    1 
ATOM   2632  C  CG    . ASP A 1  324 ? 15.268  5.300   192.155 1.00 83.05  ? 324  ASP A CG    1 
ATOM   2633  O  OD1   . ASP A 1  324 ? 15.638  4.653   191.154 1.00 85.19  ? 324  ASP A OD1   1 
ATOM   2634  O  OD2   . ASP A 1  324 ? 15.441  4.900   193.324 1.00 82.52  ? 324  ASP A OD2   1 
ATOM   2635  N  N     . LEU A 1  325 ? 12.867  7.570   189.474 1.00 78.14  ? 325  LEU A N     1 
ATOM   2636  C  CA    . LEU A 1  325 ? 11.609  8.260   189.227 1.00 71.00  ? 325  LEU A CA    1 
ATOM   2637  C  C     . LEU A 1  325 ? 10.610  7.963   190.338 1.00 75.76  ? 325  LEU A C     1 
ATOM   2638  O  O     . LEU A 1  325 ? 10.558  6.847   190.865 1.00 76.37  ? 325  LEU A O     1 
ATOM   2639  C  CB    . LEU A 1  325 ? 11.016  7.834   187.883 1.00 66.49  ? 325  LEU A CB    1 
ATOM   2640  C  CG    . LEU A 1  325 ? 11.628  8.338   186.577 1.00 70.20  ? 325  LEU A CG    1 
ATOM   2641  C  CD1   . LEU A 1  325 ? 11.166  7.469   185.422 1.00 77.86  ? 325  LEU A CD1   1 
ATOM   2642  C  CD2   . LEU A 1  325 ? 11.241  9.776   186.329 1.00 58.63  ? 325  LEU A CD2   1 
ATOM   2643  N  N     . ILE A 1  326 ? 9.812   8.971   190.685 1.00 70.89  ? 326  ILE A N     1 
ATOM   2644  C  CA    . ILE A 1  326 ? 8.826   8.870   191.755 1.00 68.42  ? 326  ILE A CA    1 
ATOM   2645  C  C     . ILE A 1  326 ? 7.479   9.339   191.227 1.00 72.15  ? 326  ILE A C     1 
ATOM   2646  O  O     . ILE A 1  326 ? 7.383   10.424  190.643 1.00 68.83  ? 326  ILE A O     1 
ATOM   2647  C  CB    . ILE A 1  326 ? 9.227   9.691   192.996 1.00 69.62  ? 326  ILE A CB    1 
ATOM   2648  C  CG1   . ILE A 1  326 ? 10.676  9.403   193.392 1.00 70.32  ? 326  ILE A CG1   1 
ATOM   2649  C  CG2   . ILE A 1  326 ? 8.276   9.407   194.145 1.00 77.80  ? 326  ILE A CG2   1 
ATOM   2650  C  CD1   . ILE A 1  326 ? 10.846  8.153   194.234 1.00 56.79  ? 326  ILE A CD1   1 
ATOM   2651  N  N     . ALA A 1  327 ? 6.441   8.539   191.445 1.00 76.05  ? 327  ALA A N     1 
ATOM   2652  C  CA    . ALA A 1  327 ? 5.082   8.929   191.100 1.00 71.70  ? 327  ALA A CA    1 
ATOM   2653  C  C     . ALA A 1  327 ? 4.242   8.955   192.369 1.00 68.28  ? 327  ALA A C     1 
ATOM   2654  O  O     . ALA A 1  327 ? 4.256   7.996   193.149 1.00 61.84  ? 327  ALA A O     1 
ATOM   2655  C  CB    . ALA A 1  327 ? 4.477   7.976   190.066 1.00 74.72  ? 327  ALA A CB    1 
ATOM   2656  N  N     . GLU A 1  328 ? 3.502   10.045  192.565 1.00 62.02  ? 328  GLU A N     1 
ATOM   2657  C  CA    . GLU A 1  328 ? 2.651   10.222  193.734 1.00 68.74  ? 328  GLU A CA    1 
ATOM   2658  C  C     . GLU A 1  328 ? 1.246   10.529  193.245 1.00 71.42  ? 328  GLU A C     1 
ATOM   2659  O  O     . GLU A 1  328 ? 1.065   11.406  192.397 1.00 67.45  ? 328  GLU A O     1 
ATOM   2660  C  CB    . GLU A 1  328 ? 3.167   11.350  194.635 1.00 79.12  ? 328  GLU A CB    1 
ATOM   2661  C  CG    . GLU A 1  328 ? 2.428   11.484  195.959 1.00 84.48  ? 328  GLU A CG    1 
ATOM   2662  C  CD    . GLU A 1  328 ? 3.178   12.339  196.968 1.00 87.72  ? 328  GLU A CD    1 
ATOM   2663  O  OE1   . GLU A 1  328 ? 4.387   12.579  196.768 1.00 86.40  ? 328  GLU A OE1   1 
ATOM   2664  O  OE2   . GLU A 1  328 ? 2.556   12.775  197.961 1.00 90.37  ? 328  GLU A OE2   1 
ATOM   2665  N  N     . ILE A 1  329 ? 0.257   9.832   193.801 1.00 76.90  ? 329  ILE A N     1 
ATOM   2666  C  CA    . ILE A 1  329 ? -1.135  9.947   193.383 1.00 74.02  ? 329  ILE A CA    1 
ATOM   2667  C  C     . ILE A 1  329 ? -1.972  10.446  194.554 1.00 76.27  ? 329  ILE A C     1 
ATOM   2668  O  O     . ILE A 1  329 ? -1.746  10.046  195.701 1.00 77.35  ? 329  ILE A O     1 
ATOM   2669  C  CB    . ILE A 1  329 ? -1.682  8.594   192.885 1.00 65.95  ? 329  ILE A CB    1 
ATOM   2670  C  CG1   . ILE A 1  329 ? -0.761  7.987   191.830 1.00 54.05  ? 329  ILE A CG1   1 
ATOM   2671  C  CG2   . ILE A 1  329 ? -3.077  8.767   192.302 1.00 73.16  ? 329  ILE A CG2   1 
ATOM   2672  C  CD1   . ILE A 1  329 ? -1.359  6.778   191.143 1.00 60.53  ? 329  ILE A CD1   1 
ATOM   2673  N  N     . GLN A 1  330 ? -2.927  11.329  194.270 1.00 70.13  ? 330  GLN A N     1 
ATOM   2674  C  CA    . GLN A 1  330 ? -3.941  11.701  195.246 1.00 75.57  ? 330  GLN A CA    1 
ATOM   2675  C  C     . GLN A 1  330 ? -5.327  11.433  194.674 1.00 73.97  ? 330  GLN A C     1 
ATOM   2676  O  O     . GLN A 1  330 ? -5.582  11.677  193.490 1.00 73.49  ? 330  GLN A O     1 
ATOM   2677  C  CB    . GLN A 1  330 ? -3.828  13.175  195.663 1.00 77.29  ? 330  GLN A CB    1 
ATOM   2678  C  CG    . GLN A 1  330 ? -2.456  13.596  196.164 1.00 79.15  ? 330  GLN A CG    1 
ATOM   2679  C  CD    . GLN A 1  330 ? -1.525  14.004  195.046 1.00 82.50  ? 330  GLN A CD    1 
ATOM   2680  O  OE1   . GLN A 1  330 ? -1.923  14.706  194.115 1.00 82.26  ? 330  GLN A OE1   1 
ATOM   2681  N  NE2   . GLN A 1  330 ? -0.273  13.568  195.130 1.00 84.05  ? 330  GLN A NE2   1 
ATOM   2682  N  N     . LYS A 1  331 ? -6.211  10.911  195.521 1.00 66.67  ? 331  LYS A N     1 
ATOM   2683  C  CA    . LYS A 1  331 ? -7.626  10.814  195.186 1.00 69.76  ? 331  LYS A CA    1 
ATOM   2684  C  C     . LYS A 1  331 ? -8.282  12.188  195.241 1.00 70.74  ? 331  LYS A C     1 
ATOM   2685  O  O     . LYS A 1  331 ? -8.105  12.930  196.211 1.00 73.30  ? 331  LYS A O     1 
ATOM   2686  C  CB    . LYS A 1  331 ? -8.343  9.849   196.126 1.00 70.63  ? 331  LYS A CB    1 
ATOM   2687  C  CG    . LYS A 1  331 ? -9.831  9.727   195.825 1.00 78.85  ? 331  LYS A CG    1 
ATOM   2688  C  CD    . LYS A 1  331 ? -10.584 9.036   196.946 1.00 74.91  ? 331  LYS A CD    1 
ATOM   2689  C  CE    . LYS A 1  331 ? -12.073 8.993   196.655 1.00 68.82  ? 331  LYS A CE    1 
ATOM   2690  N  NZ    . LYS A 1  331 ? -12.788 8.067   197.575 1.00 74.98  ? 331  LYS A NZ    1 
ATOM   2691  N  N     . GLN A 1  332 ? -9.028  12.540  194.195 1.00 73.63  ? 332  GLN A N     1 
ATOM   2692  C  CA    . GLN A 1  332 ? -9.718  13.822  194.153 1.00 78.43  ? 332  GLN A CA    1 
ATOM   2693  C  C     . GLN A 1  332 ? -11.232 13.680  194.209 1.00 80.04  ? 332  GLN A C     1 
ATOM   2694  O  O     . GLN A 1  332 ? -11.943 14.672  194.020 1.00 84.34  ? 332  GLN A O     1 
ATOM   2695  C  CB    . GLN A 1  332 ? -9.337  14.596  192.894 1.00 85.17  ? 332  GLN A CB    1 
ATOM   2696  C  CG    . GLN A 1  332 ? -7.923  15.107  192.863 1.00 80.36  ? 332  GLN A CG    1 
ATOM   2697  C  CD    . GLN A 1  332 ? -7.581  15.695  191.515 1.00 90.58  ? 332  GLN A CD    1 
ATOM   2698  O  OE1   . GLN A 1  332 ? -7.871  15.100  190.476 1.00 93.95  ? 332  GLN A OE1   1 
ATOM   2699  N  NE2   . GLN A 1  332 ? -6.982  16.879  191.519 1.00 97.56  ? 332  GLN A NE2   1 
ATOM   2700  N  N     . GLY A 1  333 ? -11.744 12.478  194.459 1.00 82.29  ? 333  GLY A N     1 
ATOM   2701  C  CA    . GLY A 1  333 ? -13.178 12.278  194.555 1.00 94.15  ? 333  GLY A CA    1 
ATOM   2702  C  C     . GLY A 1  333 ? -13.917 12.136  193.240 1.00 92.88  ? 333  GLY A C     1 
ATOM   2703  O  O     . GLY A 1  333 ? -13.506 12.694  192.217 1.00 87.32  ? 333  GLY A O     1 
ATOM   2704  N  N     . GLN A 1  334 ? -15.000 11.354  193.262 1.00 94.88  ? 334  GLN A N     1 
ATOM   2705  C  CA    . GLN A 1  334 ? -15.869 11.148  192.101 1.00 97.19  ? 334  GLN A CA    1 
ATOM   2706  C  C     . GLN A 1  334 ? -15.092 10.535  190.941 1.00 93.58  ? 334  GLN A C     1 
ATOM   2707  O  O     . GLN A 1  334 ? -15.307 10.876  189.777 1.00 97.34  ? 334  GLN A O     1 
ATOM   2708  C  CB    . GLN A 1  334 ? -16.553 12.448  191.669 1.00 101.11 ? 334  GLN A CB    1 
ATOM   2709  C  CG    . GLN A 1  334 ? -17.282 13.189  192.781 1.00 99.65  ? 334  GLN A CG    1 
ATOM   2710  C  CD    . GLN A 1  334 ? -16.622 14.511  193.133 1.00 103.97 ? 334  GLN A CD    1 
ATOM   2711  O  OE1   . GLN A 1  334 ? -16.623 15.450  192.334 1.00 102.37 ? 334  GLN A OE1   1 
ATOM   2712  N  NE2   . GLN A 1  334 ? -16.061 14.594  194.336 1.00 97.22  ? 334  GLN A NE2   1 
ATOM   2713  N  N     . GLY A 1  335 ? -14.182 9.620   191.262 1.00 90.39  ? 335  GLY A N     1 
ATOM   2714  C  CA    . GLY A 1  335 ? -13.398 8.965   190.234 1.00 90.77  ? 335  GLY A CA    1 
ATOM   2715  C  C     . GLY A 1  335 ? -12.405 9.872   189.542 1.00 88.26  ? 335  GLY A C     1 
ATOM   2716  O  O     . GLY A 1  335 ? -12.142 9.692   188.349 1.00 90.27  ? 335  GLY A O     1 
ATOM   2717  N  N     . GLN A 1  336 ? -11.829 10.831  190.260 1.00 79.46  ? 336  GLN A N     1 
ATOM   2718  C  CA    . GLN A 1  336 ? -10.793 11.697  189.718 1.00 80.76  ? 336  GLN A CA    1 
ATOM   2719  C  C     . GLN A 1  336 ? -9.500  11.480  190.483 1.00 81.03  ? 336  GLN A C     1 
ATOM   2720  O  O     . GLN A 1  336 ? -9.496  11.410  191.717 1.00 81.79  ? 336  GLN A O     1 
ATOM   2721  C  CB    . GLN A 1  336 ? -11.171 13.180  189.786 1.00 84.11  ? 336  GLN A CB    1 
ATOM   2722  C  CG    . GLN A 1  336 ? -12.225 13.619  188.795 1.00 93.96  ? 336  GLN A CG    1 
ATOM   2723  C  CD    . GLN A 1  336 ? -12.797 14.979  189.137 1.00 104.09 ? 336  GLN A CD    1 
ATOM   2724  O  OE1   . GLN A 1  336 ? -12.782 15.893  188.313 1.00 102.59 ? 336  GLN A OE1   1 
ATOM   2725  N  NE2   . GLN A 1  336 ? -13.302 15.121  190.358 1.00 108.44 ? 336  GLN A NE2   1 
ATOM   2726  N  N     . TRP A 1  337 ? -8.406  11.371  189.741 1.00 77.17  ? 337  TRP A N     1 
ATOM   2727  C  CA    . TRP A 1  337 ? -7.095  11.177  190.330 1.00 74.90  ? 337  TRP A CA    1 
ATOM   2728  C  C     . TRP A 1  337 ? -6.110  12.089  189.617 1.00 74.92  ? 337  TRP A C     1 
ATOM   2729  O  O     . TRP A 1  337 ? -6.171  12.232  188.394 1.00 75.73  ? 337  TRP A O     1 
ATOM   2730  C  CB    . TRP A 1  337 ? -6.643  9.715   190.208 1.00 68.65  ? 337  TRP A CB    1 
ATOM   2731  C  CG    . TRP A 1  337 ? -7.688  8.722   190.638 1.00 60.50  ? 337  TRP A CG    1 
ATOM   2732  C  CD1   . TRP A 1  337 ? -8.810  8.367   189.947 1.00 72.08  ? 337  TRP A CD1   1 
ATOM   2733  C  CD2   . TRP A 1  337 ? -7.723  7.979   191.862 1.00 55.90  ? 337  TRP A CD2   1 
ATOM   2734  N  NE1   . TRP A 1  337 ? -9.532  7.439   190.656 1.00 72.97  ? 337  TRP A NE1   1 
ATOM   2735  C  CE2   . TRP A 1  337 ? -8.886  7.185   191.837 1.00 56.28  ? 337  TRP A CE2   1 
ATOM   2736  C  CE3   . TRP A 1  337 ? -6.880  7.902   192.974 1.00 65.06  ? 337  TRP A CE3   1 
ATOM   2737  C  CZ2   . TRP A 1  337 ? -9.228  6.328   192.878 1.00 57.48  ? 337  TRP A CZ2   1 
ATOM   2738  C  CZ3   . TRP A 1  337 ? -7.222  7.050   194.007 1.00 66.25  ? 337  TRP A CZ3   1 
ATOM   2739  C  CH2   . TRP A 1  337 ? -8.386  6.276   193.952 1.00 63.19  ? 337  TRP A CH2   1 
ATOM   2740  N  N     . THR A 1  338 ? -5.217  12.714  190.379 1.00 71.69  ? 338  THR A N     1 
ATOM   2741  C  CA    . THR A 1  338 ? -4.076  13.396  189.792 1.00 73.50  ? 338  THR A CA    1 
ATOM   2742  C  C     . THR A 1  338 ? -2.802  12.766  190.325 1.00 75.07  ? 338  THR A C     1 
ATOM   2743  O  O     . THR A 1  338 ? -2.796  12.102  191.366 1.00 72.47  ? 338  THR A O     1 
ATOM   2744  C  CB    . THR A 1  338 ? -4.057  14.900  190.097 1.00 76.95  ? 338  THR A CB    1 
ATOM   2745  O  OG1   . THR A 1  338 ? -4.448  15.125  191.457 1.00 77.55  ? 338  THR A OG1   1 
ATOM   2746  C  CG2   . THR A 1  338 ? -4.973  15.658  189.142 1.00 79.64  ? 338  THR A CG2   1 
ATOM   2747  N  N     . TYR A 1  339 ? -1.714  12.999  189.600 1.00 74.95  ? 339  TYR A N     1 
ATOM   2748  C  CA    . TYR A 1  339 ? -0.413  12.504  190.003 1.00 72.03  ? 339  TYR A CA    1 
ATOM   2749  C  C     . TYR A 1  339 ? 0.670   13.507  189.646 1.00 70.78  ? 339  TYR A C     1 
ATOM   2750  O  O     . TYR A 1  339 ? 0.469   14.431  188.853 1.00 72.88  ? 339  TYR A O     1 
ATOM   2751  C  CB    . TYR A 1  339 ? -0.128  11.144  189.356 1.00 66.66  ? 339  TYR A CB    1 
ATOM   2752  C  CG    . TYR A 1  339 ? -0.119  11.200  187.846 1.00 70.34  ? 339  TYR A CG    1 
ATOM   2753  C  CD1   . TYR A 1  339 ? 1.046   11.468  187.143 1.00 69.88  ? 339  TYR A CD1   1 
ATOM   2754  C  CD2   . TYR A 1  339 ? -1.285  10.986  187.123 1.00 71.09  ? 339  TYR A CD2   1 
ATOM   2755  C  CE1   . TYR A 1  339 ? 1.049   11.514  185.766 1.00 67.56  ? 339  TYR A CE1   1 
ATOM   2756  C  CE2   . TYR A 1  339 ? -1.291  11.035  185.748 1.00 64.64  ? 339  TYR A CE2   1 
ATOM   2757  C  CZ    . TYR A 1  339 ? -0.123  11.297  185.075 1.00 61.41  ? 339  TYR A CZ    1 
ATOM   2758  O  OH    . TYR A 1  339 ? -0.132  11.359  183.703 1.00 76.06  ? 339  TYR A OH    1 
ATOM   2759  N  N     . GLN A 1  340 ? 1.836   13.295  190.242 1.00 65.13  ? 340  GLN A N     1 
ATOM   2760  C  CA    . GLN A 1  340 ? 3.048   14.039  189.951 1.00 70.61  ? 340  GLN A CA    1 
ATOM   2761  C  C     . GLN A 1  340 ? 4.158   13.025  189.741 1.00 73.20  ? 340  GLN A C     1 
ATOM   2762  O  O     . GLN A 1  340 ? 4.264   12.050  190.492 1.00 72.73  ? 340  GLN A O     1 
ATOM   2763  C  CB    . GLN A 1  340 ? 3.419   15.021  191.074 1.00 72.48  ? 340  GLN A CB    1 
ATOM   2764  C  CG    . GLN A 1  340 ? 2.304   15.976  191.466 1.00 73.68  ? 340  GLN A CG    1 
ATOM   2765  C  CD    . GLN A 1  340 ? 1.283   15.329  192.375 1.00 74.72  ? 340  GLN A CD    1 
ATOM   2766  O  OE1   . GLN A 1  340 ? 1.636   14.583  193.288 1.00 74.52  ? 340  GLN A OE1   1 
ATOM   2767  N  NE2   . GLN A 1  340 ? 0.007   15.592  192.114 1.00 76.07  ? 340  GLN A NE2   1 
ATOM   2768  N  N     . ILE A 1  341 ? 4.995   13.255  188.736 1.00 83.74  ? 341  ILE A N     1 
ATOM   2769  C  CA    . ILE A 1  341 ? 6.215   12.482  188.564 1.00 86.13  ? 341  ILE A CA    1 
ATOM   2770  C  C     . ILE A 1  341 ? 7.397   13.410  188.781 1.00 88.81  ? 341  ILE A C     1 
ATOM   2771  O  O     . ILE A 1  341 ? 7.453   14.509  188.215 1.00 75.96  ? 341  ILE A O     1 
ATOM   2772  C  CB    . ILE A 1  341 ? 6.274   11.820  187.178 1.00 80.83  ? 341  ILE A CB    1 
ATOM   2773  C  CG1   . ILE A 1  341 ? 4.933   11.162  186.855 1.00 73.19  ? 341  ILE A CG1   1 
ATOM   2774  C  CG2   . ILE A 1  341 ? 7.381   10.778  187.145 1.00 70.92  ? 341  ILE A CG2   1 
ATOM   2775  C  CD1   . ILE A 1  341 ? 4.799   10.725  185.417 1.00 65.54  ? 341  ILE A CD1   1 
ATOM   2776  N  N     . TYR A 1  342 ? 8.334   12.963  189.609 1.00 77.64  ? 342  TYR A N     1 
ATOM   2777  C  CA    . TYR A 1  342 ? 9.426   13.804  190.067 1.00 80.28  ? 342  TYR A CA    1 
ATOM   2778  C  C     . TYR A 1  342 ? 10.554  12.911  190.556 1.00 84.44  ? 342  TYR A C     1 
ATOM   2779  O  O     . TYR A 1  342 ? 10.392  11.701  190.730 1.00 81.61  ? 342  TYR A O     1 
ATOM   2780  C  CB    . TYR A 1  342 ? 8.970   14.759  191.178 1.00 84.11  ? 342  TYR A CB    1 
ATOM   2781  C  CG    . TYR A 1  342 ? 8.517   14.077  192.459 1.00 85.08  ? 342  TYR A CG    1 
ATOM   2782  C  CD1   . TYR A 1  342 ? 9.441   13.579  193.374 1.00 86.04  ? 342  TYR A CD1   1 
ATOM   2783  C  CD2   . TYR A 1  342 ? 7.168   13.949  192.763 1.00 82.15  ? 342  TYR A CD2   1 
ATOM   2784  C  CE1   . TYR A 1  342 ? 9.037   12.957  194.541 1.00 83.39  ? 342  TYR A CE1   1 
ATOM   2785  C  CE2   . TYR A 1  342 ? 6.753   13.333  193.934 1.00 79.71  ? 342  TYR A CE2   1 
ATOM   2786  C  CZ    . TYR A 1  342 ? 7.693   12.839  194.818 1.00 81.69  ? 342  TYR A CZ    1 
ATOM   2787  O  OH    . TYR A 1  342 ? 7.294   12.229  195.986 1.00 81.07  ? 342  TYR A OH    1 
ATOM   2788  N  N     . GLN A 1  343 ? 11.703  13.539  190.786 1.00 95.51  ? 343  GLN A N     1 
ATOM   2789  C  CA    . GLN A 1  343 ? 12.892  12.868  191.282 1.00 90.25  ? 343  GLN A CA    1 
ATOM   2790  C  C     . GLN A 1  343 ? 13.402  13.523  192.548 1.00 85.88  ? 343  GLN A C     1 
ATOM   2791  O  O     . GLN A 1  343 ? 14.090  12.864  193.335 1.00 78.61  ? 343  GLN A O     1 
ATOM   2792  C  CB    . GLN A 1  343 ? 14.017  12.863  190.236 1.00 86.46  ? 343  GLN A CB    1 
ATOM   2793  C  CG    . GLN A 1  343 ? 13.605  12.388  188.860 1.00 84.16  ? 343  GLN A CG    1 
ATOM   2794  C  CD    . GLN A 1  343 ? 14.756  12.417  187.877 1.00 83.66  ? 343  GLN A CD    1 
ATOM   2795  O  OE1   . GLN A 1  343 ? 15.043  13.448  187.267 1.00 80.53  ? 343  GLN A OE1   1 
ATOM   2796  N  NE2   . GLN A 1  343 ? 15.422  11.278  187.713 1.00 80.10  ? 343  GLN A NE2   1 
ATOM   2797  N  N     . GLU A 1  344 ? 13.094  14.803  192.752 1.00 84.04  ? 344  GLU A N     1 
ATOM   2798  C  CA    . GLU A 1  344 ? 13.397  15.560  193.950 1.00 96.05  ? 344  GLU A CA    1 
ATOM   2799  C  C     . GLU A 1  344 ? 12.155  16.323  194.395 1.00 97.77  ? 344  GLU A C     1 
ATOM   2800  O  O     . GLU A 1  344 ? 11.388  16.816  193.557 1.00 92.14  ? 344  GLU A O     1 
ATOM   2801  C  CB    . GLU A 1  344 ? 14.566  16.530  193.724 1.00 95.78  ? 344  GLU A CB    1 
ATOM   2802  C  CG    . GLU A 1  344 ? 15.856  15.837  193.312 1.00 103.39 ? 344  GLU A CG    1 
ATOM   2803  C  CD    . GLU A 1  344 ? 17.051  16.295  194.124 1.00 111.46 ? 344  GLU A CD    1 
ATOM   2804  O  OE1   . GLU A 1  344 ? 16.935  17.319  194.830 1.00 110.51 ? 344  GLU A OE1   1 
ATOM   2805  O  OE2   . GLU A 1  344 ? 18.106  15.627  194.058 1.00 106.40 ? 344  GLU A OE2   1 
ATOM   2806  N  N     . PRO A 1  345 ? 11.921  16.396  195.705 1.00 90.88  ? 345  PRO A N     1 
ATOM   2807  C  CA    . PRO A 1  345 ? 10.688  16.994  196.242 1.00 97.02  ? 345  PRO A CA    1 
ATOM   2808  C  C     . PRO A 1  345 ? 10.318  18.336  195.621 1.00 99.32  ? 345  PRO A C     1 
ATOM   2809  O  O     . PRO A 1  345 ? 11.161  19.221  195.459 1.00 97.89  ? 345  PRO A O     1 
ATOM   2810  C  CB    . PRO A 1  345 ? 11.008  17.135  197.732 1.00 101.75 ? 345  PRO A CB    1 
ATOM   2811  C  CG    . PRO A 1  345 ? 11.898  15.965  197.999 1.00 97.12  ? 345  PRO A CG    1 
ATOM   2812  C  CD    . PRO A 1  345 ? 12.773  15.848  196.776 1.00 87.11  ? 345  PRO A CD    1 
ATOM   2813  N  N     . PHE A 1  346 ? 9.037   18.473  195.260 1.00 108.86 ? 346  PHE A N     1 
ATOM   2814  C  CA    . PHE A 1  346 ? 8.465   19.723  194.759 1.00 106.98 ? 346  PHE A CA    1 
ATOM   2815  C  C     . PHE A 1  346 ? 9.097   20.208  193.458 1.00 105.68 ? 346  PHE A C     1 
ATOM   2816  O  O     . PHE A 1  346 ? 8.757   21.290  192.969 1.00 104.30 ? 346  PHE A O     1 
ATOM   2817  C  CB    . PHE A 1  346 ? 8.542   20.831  195.821 1.00 113.65 ? 346  PHE A CB    1 
ATOM   2818  C  CG    . PHE A 1  346 ? 8.234   20.367  197.222 1.00 117.97 ? 346  PHE A CG    1 
ATOM   2819  C  CD1   . PHE A 1  346 ? 6.920   20.197  197.633 1.00 118.56 ? 346  PHE A CD1   1 
ATOM   2820  C  CD2   . PHE A 1  346 ? 9.249   20.137  198.138 1.00 120.25 ? 346  PHE A CD2   1 
ATOM   2821  C  CE1   . PHE A 1  346 ? 6.625   19.781  198.920 1.00 117.84 ? 346  PHE A CE1   1 
ATOM   2822  C  CE2   . PHE A 1  346 ? 8.961   19.720  199.427 1.00 120.81 ? 346  PHE A CE2   1 
ATOM   2823  C  CZ    . PHE A 1  346 ? 7.647   19.543  199.818 1.00 122.39 ? 346  PHE A CZ    1 
ATOM   2824  N  N     . LYS A 1  347 ? 10.014  19.429  192.890 1.00 102.30 ? 347  LYS A N     1 
ATOM   2825  C  CA    . LYS A 1  347 ? 10.511  19.665  191.537 1.00 107.79 ? 347  LYS A CA    1 
ATOM   2826  C  C     . LYS A 1  347 ? 9.900   18.597  190.631 1.00 103.12 ? 347  LYS A C     1 
ATOM   2827  O  O     . LYS A 1  347 ? 10.550  17.623  190.247 1.00 94.80  ? 347  LYS A O     1 
ATOM   2828  C  CB    . LYS A 1  347 ? 12.042  19.626  191.516 1.00 102.57 ? 347  LYS A CB    1 
ATOM   2829  C  CG    . LYS A 1  347 ? 12.704  20.759  192.284 1.00 100.92 ? 347  LYS A CG    1 
ATOM   2830  C  CD    . LYS A 1  347 ? 14.163  20.440  192.570 1.00 105.80 ? 347  LYS A CD    1 
ATOM   2831  C  CE    . LYS A 1  347 ? 15.043  21.670  192.453 1.00 117.55 ? 347  LYS A CE    1 
ATOM   2832  N  NZ    . LYS A 1  347 ? 16.437  21.382  192.891 1.00 120.45 ? 347  LYS A NZ    1 
ATOM   2833  N  N     . ASN A 1  348 ? 8.629   18.801  190.282 1.00 95.88  ? 348  ASN A N     1 
ATOM   2834  C  CA    . ASN A 1  348 ? 7.910   17.891  189.397 1.00 92.43  ? 348  ASN A CA    1 
ATOM   2835  C  C     . ASN A 1  348 ? 8.529   17.900  188.004 1.00 94.37  ? 348  ASN A C     1 
ATOM   2836  O  O     . ASN A 1  348 ? 8.662   18.962  187.386 1.00 97.50  ? 348  ASN A O     1 
ATOM   2837  C  CB    . ASN A 1  348 ? 6.436   18.286  189.318 1.00 91.43  ? 348  ASN A CB    1 
ATOM   2838  C  CG    . ASN A 1  348 ? 5.701   18.089  190.631 1.00 91.93  ? 348  ASN A CG    1 
ATOM   2839  O  OD1   . ASN A 1  348 ? 6.102   17.280  191.468 1.00 92.41  ? 348  ASN A OD1   1 
ATOM   2840  N  ND2   . ASN A 1  348 ? 4.611   18.827  190.813 1.00 87.05  ? 348  ASN A ND2   1 
ATOM   2841  N  N     . LEU A 1  349 ? 8.921   16.721  187.515 1.00 95.02  ? 349  LEU A N     1 
ATOM   2842  C  CA    . LEU A 1  349 ? 9.136   16.554  186.080 1.00 83.10  ? 349  LEU A CA    1 
ATOM   2843  C  C     . LEU A 1  349 ? 7.871   16.873  185.294 1.00 88.88  ? 349  LEU A C     1 
ATOM   2844  O  O     . LEU A 1  349 ? 7.887   17.702  184.377 1.00 87.47  ? 349  LEU A O     1 
ATOM   2845  C  CB    . LEU A 1  349 ? 9.604   15.133  185.781 1.00 74.01  ? 349  LEU A CB    1 
ATOM   2846  C  CG    . LEU A 1  349 ? 11.000  14.791  186.283 1.00 73.00  ? 349  LEU A CG    1 
ATOM   2847  C  CD1   . LEU A 1  349 ? 11.188  13.298  186.334 1.00 69.35  ? 349  LEU A CD1   1 
ATOM   2848  C  CD2   . LEU A 1  349 ? 12.009  15.412  185.352 1.00 74.74  ? 349  LEU A CD2   1 
ATOM   2849  N  N     . LYS A 1  350 ? 6.759   16.233  185.650 1.00 85.87  ? 350  LYS A N     1 
ATOM   2850  C  CA    . LYS A 1  350 ? 5.466   16.563  185.066 1.00 81.27  ? 350  LYS A CA    1 
ATOM   2851  C  C     . LYS A 1  350 ? 4.370   16.098  186.011 1.00 76.51  ? 350  LYS A C     1 
ATOM   2852  O  O     . LYS A 1  350 ? 4.624   15.434  187.019 1.00 74.28  ? 350  LYS A O     1 
ATOM   2853  C  CB    . LYS A 1  350 ? 5.278   15.912  183.692 1.00 76.80  ? 350  LYS A CB    1 
ATOM   2854  C  CG    . LYS A 1  350 ? 5.091   14.401  183.762 1.00 72.05  ? 350  LYS A CG    1 
ATOM   2855  C  CD    . LYS A 1  350 ? 5.160   13.750  182.392 1.00 67.46  ? 350  LYS A CD    1 
ATOM   2856  C  CE    . LYS A 1  350 ? 4.048   14.250  181.484 1.00 65.38  ? 350  LYS A CE    1 
ATOM   2857  N  NZ    . LYS A 1  350 ? 2.692   13.922  182.006 1.00 72.15  ? 350  LYS A NZ    1 
ATOM   2858  N  N     . THR A 1  351 ? 3.140   16.457  185.660 1.00 77.40  ? 351  THR A N     1 
ATOM   2859  C  CA    . THR A 1  351 ? 1.943   16.045  186.374 1.00 78.61  ? 351  THR A CA    1 
ATOM   2860  C  C     . THR A 1  351 ? 0.981   15.400  185.383 1.00 81.21  ? 351  THR A C     1 
ATOM   2861  O  O     . THR A 1  351 ? 1.237   15.350  184.176 1.00 83.59  ? 351  THR A O     1 
ATOM   2862  C  CB    . THR A 1  351 ? 1.285   17.230  187.087 1.00 86.13  ? 351  THR A CB    1 
ATOM   2863  O  OG1   . THR A 1  351 ? 0.807   18.163  186.112 1.00 87.18  ? 351  THR A OG1   1 
ATOM   2864  C  CG2   . THR A 1  351 ? 2.286   17.922  188.002 1.00 91.77  ? 351  THR A CG2   1 
ATOM   2865  N  N     . GLY A 1  352 ? -0.139  14.906  185.898 1.00 74.64  ? 352  GLY A N     1 
ATOM   2866  C  CA    . GLY A 1  352 ? -1.221  14.501  185.021 1.00 70.79  ? 352  GLY A CA    1 
ATOM   2867  C  C     . GLY A 1  352 ? -2.454  14.152  185.821 1.00 71.37  ? 352  GLY A C     1 
ATOM   2868  O  O     . GLY A 1  352 ? -2.485  14.274  187.049 1.00 70.76  ? 352  GLY A O     1 
ATOM   2869  N  N     . LYS A 1  353 ? -3.474  13.692  185.099 1.00 78.25  ? 353  LYS A N     1 
ATOM   2870  C  CA    . LYS A 1  353 ? -4.719  13.238  185.700 1.00 72.26  ? 353  LYS A CA    1 
ATOM   2871  C  C     . LYS A 1  353 ? -5.200  11.955  185.039 1.00 71.05  ? 353  LYS A C     1 
ATOM   2872  O  O     . LYS A 1  353 ? -5.015  11.745  183.837 1.00 76.23  ? 353  LYS A O     1 
ATOM   2873  C  CB    . LYS A 1  353 ? -5.812  14.309  185.614 1.00 68.81  ? 353  LYS A CB    1 
ATOM   2874  C  CG    . LYS A 1  353 ? -6.170  14.704  184.202 1.00 73.40  ? 353  LYS A CG    1 
ATOM   2875  C  CD    . LYS A 1  353 ? -7.284  15.727  184.190 1.00 83.94  ? 353  LYS A CD    1 
ATOM   2876  C  CE    . LYS A 1  353 ? -8.000  15.712  182.859 1.00 90.71  ? 353  LYS A CE    1 
ATOM   2877  N  NZ    . LYS A 1  353 ? -8.863  14.512  182.685 1.00 88.75  ? 353  LYS A NZ    1 
ATOM   2878  N  N     . TYR A 1  354 ? -5.823  11.101  185.846 1.00 82.28  ? 354  TYR A N     1 
ATOM   2879  C  CA    . TYR A 1  354 ? -6.587  9.955   185.367 1.00 75.45  ? 354  TYR A CA    1 
ATOM   2880  C  C     . TYR A 1  354 ? -7.992  10.046  185.938 1.00 81.23  ? 354  TYR A C     1 
ATOM   2881  O  O     . TYR A 1  354 ? -8.167  10.143  187.158 1.00 77.63  ? 354  TYR A O     1 
ATOM   2882  C  CB    . TYR A 1  354 ? -5.939  8.625   185.763 1.00 67.85  ? 354  TYR A CB    1 
ATOM   2883  C  CG    . TYR A 1  354 ? -6.757  7.417   185.343 1.00 78.29  ? 354  TYR A CG    1 
ATOM   2884  C  CD1   . TYR A 1  354 ? -6.726  6.946   184.034 1.00 83.23  ? 354  TYR A CD1   1 
ATOM   2885  C  CD2   . TYR A 1  354 ? -7.555  6.739   186.265 1.00 76.08  ? 354  TYR A CD2   1 
ATOM   2886  C  CE1   . TYR A 1  354 ? -7.482  5.844   183.649 1.00 90.05  ? 354  TYR A CE1   1 
ATOM   2887  C  CE2   . TYR A 1  354 ? -8.309  5.634   185.893 1.00 70.41  ? 354  TYR A CE2   1 
ATOM   2888  C  CZ    . TYR A 1  354 ? -8.271  5.191   184.583 1.00 82.65  ? 354  TYR A CZ    1 
ATOM   2889  O  OH    . TYR A 1  354 ? -9.015  4.092   184.201 1.00 76.02  ? 354  TYR A OH    1 
ATOM   2890  N  N     . ALA A 1  355 ? -8.987  10.041  185.050 1.00 74.71  ? 355  ALA A N     1 
ATOM   2891  C  CA    . ALA A 1  355 ? -10.373 10.181  185.471 1.00 81.68  ? 355  ALA A CA    1 
ATOM   2892  C  C     . ALA A 1  355 ? -11.298 9.249   184.703 1.00 85.21  ? 355  ALA A C     1 
ATOM   2893  O  O     . ALA A 1  355 ? -12.521 9.339   184.873 1.00 93.02  ? 355  ALA A O     1 
ATOM   2894  C  CB    . ALA A 1  355 ? -10.844 11.630  185.307 1.00 85.03  ? 355  ALA A CB    1 
ATOM   2895  N  N     . ARG A 1  356 ? -10.758 8.373   183.859 1.00 78.28  ? 356  ARG A N     1 
ATOM   2896  C  CA    . ARG A 1  356 ? -11.590 7.465   183.084 1.00 76.17  ? 356  ARG A CA    1 
ATOM   2897  C  C     . ARG A 1  356 ? -12.470 6.626   184.000 1.00 77.15  ? 356  ARG A C     1 
ATOM   2898  O  O     . ARG A 1  356 ? -11.978 5.971   184.924 1.00 77.44  ? 356  ARG A O     1 
ATOM   2899  C  CB    . ARG A 1  356 ? -10.707 6.553   182.238 1.00 74.53  ? 356  ARG A CB    1 
ATOM   2900  C  CG    . ARG A 1  356 ? -11.466 5.665   181.279 1.00 73.88  ? 356  ARG A CG    1 
ATOM   2901  C  CD    . ARG A 1  356 ? -10.530 4.645   180.673 1.00 82.76  ? 356  ARG A CD    1 
ATOM   2902  N  NE    . ARG A 1  356 ? -11.042 4.088   179.427 1.00 100.89 ? 356  ARG A NE    1 
ATOM   2903  C  CZ    . ARG A 1  356 ? -10.430 3.131   178.736 1.00 108.41 ? 356  ARG A CZ    1 
ATOM   2904  N  NH1   . ARG A 1  356 ? -9.283  2.626   179.175 1.00 106.86 ? 356  ARG A NH1   1 
ATOM   2905  N  NH2   . ARG A 1  356 ? -10.960 2.679   177.608 1.00 103.47 ? 356  ARG A NH2   1 
ATOM   2906  N  N     . MET A 1  357 ? -13.772 6.646   183.746 1.00 81.26  ? 357  MET A N     1 
ATOM   2907  C  CA    . MET A 1  357 ? -14.717 5.808   184.477 1.00 81.35  ? 357  MET A CA    1 
ATOM   2908  C  C     . MET A 1  357 ? -15.095 4.680   183.528 1.00 77.40  ? 357  MET A C     1 
ATOM   2909  O  O     . MET A 1  357 ? -15.906 4.869   182.617 1.00 81.06  ? 357  MET A O     1 
ATOM   2910  C  CB    . MET A 1  357 ? -15.935 6.608   184.932 1.00 93.82  ? 357  MET A CB    1 
ATOM   2911  C  CG    . MET A 1  357 ? -17.131 5.769   185.408 1.00 108.25 ? 357  MET A CG    1 
ATOM   2912  S  SD    . MET A 1  357 ? -16.838 4.704   186.842 1.00 102.38 ? 357  MET A SD    1 
ATOM   2913  C  CE    . MET A 1  357 ? -18.516 4.471   187.440 1.00 82.61  ? 357  MET A CE    1 
ATOM   2914  N  N     . ARG A 1  358 ? -14.488 3.515   183.715 1.00 74.82  ? 358  ARG A N     1 
ATOM   2915  C  CA    . ARG A 1  358 ? -14.824 2.343   182.922 1.00 84.60  ? 358  ARG A CA    1 
ATOM   2916  C  C     . ARG A 1  358 ? -15.548 1.327   183.795 1.00 84.03  ? 358  ARG A C     1 
ATOM   2917  O  O     . ARG A 1  358 ? -15.125 1.053   184.924 1.00 73.55  ? 358  ARG A O     1 
ATOM   2918  C  CB    . ARG A 1  358 ? -13.572 1.736   182.279 1.00 81.00  ? 358  ARG A CB    1 
ATOM   2919  C  CG    . ARG A 1  358 ? -12.617 1.026   183.223 1.00 75.84  ? 358  ARG A CG    1 
ATOM   2920  C  CD    . ARG A 1  358 ? -11.241 0.897   182.595 1.00 82.18  ? 358  ARG A CD    1 
ATOM   2921  N  NE    . ARG A 1  358 ? -11.338 0.657   181.160 1.00 83.61  ? 358  ARG A NE    1 
ATOM   2922  C  CZ    . ARG A 1  358 ? -10.956 -0.466  180.564 1.00 88.88  ? 358  ARG A CZ    1 
ATOM   2923  N  NH1   . ARG A 1  358 ? -11.079 -0.597  179.250 1.00 87.94  ? 358  ARG A NH1   1 
ATOM   2924  N  NH2   . ARG A 1  358 ? -10.454 -1.461  181.284 1.00 90.07  ? 358  ARG A NH2   1 
ATOM   2925  N  N     . GLY A 1  359 ? -16.648 0.788   183.276 1.00 83.51  ? 359  GLY A N     1 
ATOM   2926  C  CA    . GLY A 1  359 ? -17.479 -0.110  184.052 1.00 73.23  ? 359  GLY A CA    1 
ATOM   2927  C  C     . GLY A 1  359 ? -18.670 0.541   184.723 1.00 72.78  ? 359  GLY A C     1 
ATOM   2928  O  O     . GLY A 1  359 ? -18.580 1.673   185.208 1.00 80.12  ? 359  GLY A O     1 
ATOM   2929  N  N     . ALA A 1  360 ? -19.804 -0.161  184.738 1.00 76.75  ? 360  ALA A N     1 
ATOM   2930  C  CA    . ALA A 1  360 ? -20.986 0.359   185.416 1.00 78.01  ? 360  ALA A CA    1 
ATOM   2931  C  C     . ALA A 1  360 ? -20.785 0.387   186.926 1.00 67.70  ? 360  ALA A C     1 
ATOM   2932  O  O     . ALA A 1  360 ? -21.314 1.272   187.608 1.00 70.24  ? 360  ALA A O     1 
ATOM   2933  C  CB    . ALA A 1  360 ? -22.216 -0.473  185.056 1.00 76.61  ? 360  ALA A CB    1 
ATOM   2934  N  N     . HIS A 1  361 ? -20.029 -0.571  187.458 1.00 59.55  ? 361  HIS A N     1 
ATOM   2935  C  CA    . HIS A 1  361 ? -19.833 -0.732  188.893 1.00 66.00  ? 361  HIS A CA    1 
ATOM   2936  C  C     . HIS A 1  361 ? -18.352 -0.968  189.133 1.00 64.23  ? 361  HIS A C     1 
ATOM   2937  O  O     . HIS A 1  361 ? -17.785 -1.929  188.603 1.00 71.14  ? 361  HIS A O     1 
ATOM   2938  C  CB    . HIS A 1  361 ? -20.648 -1.908  189.439 1.00 65.52  ? 361  HIS A CB    1 
ATOM   2939  C  CG    . HIS A 1  361 ? -21.953 -2.118  188.737 1.00 57.97  ? 361  HIS A CG    1 
ATOM   2940  N  ND1   . HIS A 1  361 ? -23.007 -1.237  188.838 1.00 64.45  ? 361  HIS A ND1   1 
ATOM   2941  C  CD2   . HIS A 1  361 ? -22.377 -3.120  187.930 1.00 51.81  ? 361  HIS A CD2   1 
ATOM   2942  C  CE1   . HIS A 1  361 ? -24.020 -1.681  188.116 1.00 63.29  ? 361  HIS A CE1   1 
ATOM   2943  N  NE2   . HIS A 1  361 ? -23.663 -2.822  187.554 1.00 54.37  ? 361  HIS A NE2   1 
ATOM   2944  N  N     . THR A 1  362 ? -17.729 -0.110  189.938 1.00 58.21  ? 362  THR A N     1 
ATOM   2945  C  CA    . THR A 1  362 ? -16.301 -0.215  190.198 1.00 58.96  ? 362  THR A CA    1 
ATOM   2946  C  C     . THR A 1  362 ? -16.026 0.243   191.623 1.00 55.72  ? 362  THR A C     1 
ATOM   2947  O  O     . THR A 1  362 ? -16.943 0.576   192.377 1.00 57.55  ? 362  THR A O     1 
ATOM   2948  C  CB    . THR A 1  362 ? -15.496 0.618   189.199 1.00 60.14  ? 362  THR A CB    1 
ATOM   2949  O  OG1   . THR A 1  362 ? -14.102 0.320   189.344 1.00 65.97  ? 362  THR A OG1   1 
ATOM   2950  C  CG2   . THR A 1  362 ? -15.726 2.107   189.447 1.00 56.77  ? 362  THR A CG2   1 
ATOM   2951  N  N     . ASN A 1  363 ? -14.745 0.253   191.992 1.00 56.50  ? 363  ASN A N     1 
ATOM   2952  C  CA    . ASN A 1  363 ? -14.320 0.821   193.262 1.00 56.11  ? 363  ASN A CA    1 
ATOM   2953  C  C     . ASN A 1  363 ? -13.015 1.586   193.095 1.00 54.17  ? 363  ASN A C     1 
ATOM   2954  O  O     . ASN A 1  363 ? -12.405 1.604   192.022 1.00 53.87  ? 363  ASN A O     1 
ATOM   2955  C  CB    . ASN A 1  363 ? -14.175 -0.274  194.333 1.00 48.45  ? 363  ASN A CB    1 
ATOM   2956  C  CG    . ASN A 1  363 ? -13.098 -1.299  193.995 1.00 46.84  ? 363  ASN A CG    1 
ATOM   2957  O  OD1   . ASN A 1  363 ? -12.014 -0.961  193.518 1.00 58.36  ? 363  ASN A OD1   1 
ATOM   2958  N  ND2   . ASN A 1  363 ? -13.404 -2.569  194.238 1.00 43.12  ? 363  ASN A ND2   1 
ATOM   2959  N  N     . ASP A 1  364 ? -12.602 2.234   194.187 1.00 53.84  ? 364  ASP A N     1 
ATOM   2960  C  CA    . ASP A 1  364 ? -11.423 3.093   194.152 1.00 54.92  ? 364  ASP A CA    1 
ATOM   2961  C  C     . ASP A 1  364 ? -10.162 2.282   193.890 1.00 53.90  ? 364  ASP A C     1 
ATOM   2962  O  O     . ASP A 1  364 ? -9.248  2.749   193.199 1.00 55.67  ? 364  ASP A O     1 
ATOM   2963  C  CB    . ASP A 1  364 ? -11.289 3.876   195.457 1.00 55.98  ? 364  ASP A CB    1 
ATOM   2964  C  CG    . ASP A 1  364 ? -12.249 5.044   195.542 1.00 57.19  ? 364  ASP A CG    1 
ATOM   2965  O  OD1   . ASP A 1  364 ? -12.775 5.463   194.488 1.00 60.10  ? 364  ASP A OD1   1 
ATOM   2966  O  OD2   . ASP A 1  364 ? -12.465 5.552   196.663 1.00 59.14  ? 364  ASP A OD2   1 
ATOM   2967  N  N     . VAL A 1  365 ? -10.098 1.064   194.434 1.00 48.83  ? 365  VAL A N     1 
ATOM   2968  C  CA    . VAL A 1  365 ? -8.925  0.217   194.244 1.00 44.27  ? 365  VAL A CA    1 
ATOM   2969  C  C     . VAL A 1  365 ? -8.725  -0.108  192.770 1.00 52.65  ? 365  VAL A C     1 
ATOM   2970  O  O     . VAL A 1  365 ? -7.617  0.032   192.235 1.00 52.48  ? 365  VAL A O     1 
ATOM   2971  C  CB    . VAL A 1  365 ? -9.051  -1.067  195.080 1.00 42.78  ? 365  VAL A CB    1 
ATOM   2972  C  CG1   . VAL A 1  365 ? -7.748  -1.836  195.048 1.00 43.97  ? 365  VAL A CG1   1 
ATOM   2973  C  CG2   . VAL A 1  365 ? -9.453  -0.737  196.503 1.00 53.81  ? 365  VAL A CG2   1 
ATOM   2974  N  N     . LYS A 1  366 ? -9.794  -0.521  192.082 1.00 55.99  ? 366  LYS A N     1 
ATOM   2975  C  CA    . LYS A 1  366 ? -9.686  -0.716  190.638 1.00 58.30  ? 366  LYS A CA    1 
ATOM   2976  C  C     . LYS A 1  366 ? -9.211  0.554   189.948 1.00 56.99  ? 366  LYS A C     1 
ATOM   2977  O  O     . LYS A 1  366 ? -8.353  0.503   189.060 1.00 58.59  ? 366  LYS A O     1 
ATOM   2978  C  CB    . LYS A 1  366 ? -11.020 -1.169  190.044 1.00 63.76  ? 366  LYS A CB    1 
ATOM   2979  C  CG    . LYS A 1  366 ? -11.515 -2.537  190.488 1.00 56.21  ? 366  LYS A CG    1 
ATOM   2980  C  CD    . LYS A 1  366 ? -12.923 -2.757  189.954 1.00 63.37  ? 366  LYS A CD    1 
ATOM   2981  C  CE    . LYS A 1  366 ? -13.401 -4.187  190.136 1.00 71.15  ? 366  LYS A CE    1 
ATOM   2982  N  NZ    . LYS A 1  366 ? -14.814 -4.337  189.663 1.00 65.89  ? 366  LYS A NZ    1 
ATOM   2983  N  N     . GLN A 1  367 ? -9.750  1.706   190.349 1.00 56.71  ? 367  GLN A N     1 
ATOM   2984  C  CA    . GLN A 1  367 ? -9.414  2.939   189.651 1.00 56.18  ? 367  GLN A CA    1 
ATOM   2985  C  C     . GLN A 1  367 ? -7.963  3.315   189.908 1.00 56.71  ? 367  GLN A C     1 
ATOM   2986  O  O     . GLN A 1  367 ? -7.256  3.758   188.994 1.00 61.18  ? 367  GLN A O     1 
ATOM   2987  C  CB    . GLN A 1  367 ? -10.359 4.063   190.071 1.00 55.91  ? 367  GLN A CB    1 
ATOM   2988  C  CG    . GLN A 1  367 ? -11.764 3.917   189.505 1.00 50.53  ? 367  GLN A CG    1 
ATOM   2989  C  CD    . GLN A 1  367 ? -12.677 5.061   189.896 1.00 63.17  ? 367  GLN A CD    1 
ATOM   2990  O  OE1   . GLN A 1  367 ? -12.389 5.814   190.827 1.00 65.54  ? 367  GLN A OE1   1 
ATOM   2991  N  NE2   . GLN A 1  367 ? -13.784 5.204   189.176 1.00 69.22  ? 367  GLN A NE2   1 
ATOM   2992  N  N     . LEU A 1  368 ? -7.500  3.137   191.149 1.00 58.78  ? 368  LEU A N     1 
ATOM   2993  C  CA    . LEU A 1  368 ? -6.099  3.399   191.459 1.00 58.76  ? 368  LEU A CA    1 
ATOM   2994  C  C     . LEU A 1  368 ? -5.180  2.496   190.646 1.00 52.28  ? 368  LEU A C     1 
ATOM   2995  O  O     . LEU A 1  368 ? -4.154  2.952   190.128 1.00 51.68  ? 368  LEU A O     1 
ATOM   2996  C  CB    . LEU A 1  368 ? -5.849  3.225   192.955 1.00 57.52  ? 368  LEU A CB    1 
ATOM   2997  C  CG    . LEU A 1  368 ? -4.397  3.399   193.392 1.00 52.15  ? 368  LEU A CG    1 
ATOM   2998  C  CD1   . LEU A 1  368 ? -3.945  4.813   193.087 1.00 46.78  ? 368  LEU A CD1   1 
ATOM   2999  C  CD2   . LEU A 1  368 ? -4.262  3.101   194.878 1.00 58.48  ? 368  LEU A CD2   1 
ATOM   3000  N  N     . THR A 1  369 ? -5.534  1.213   190.513 1.00 48.72  ? 369  THR A N     1 
ATOM   3001  C  CA    . THR A 1  369 ? -4.715  0.309   189.710 1.00 49.69  ? 369  THR A CA    1 
ATOM   3002  C  C     . THR A 1  369 ? -4.643  0.787   188.268 1.00 52.78  ? 369  THR A C     1 
ATOM   3003  O  O     . THR A 1  369 ? -3.569  0.783   187.654 1.00 53.06  ? 369  THR A O     1 
ATOM   3004  C  CB    . THR A 1  369 ? -5.261  -1.119  189.772 1.00 46.83  ? 369  THR A CB    1 
ATOM   3005  O  OG1   . THR A 1  369 ? -5.394  -1.529  191.138 1.00 50.04  ? 369  THR A OG1   1 
ATOM   3006  C  CG2   . THR A 1  369 ? -4.333  -2.085  189.039 1.00 49.00  ? 369  THR A CG2   1 
ATOM   3007  N  N     . GLU A 1  370 ? -5.780  1.197   187.708 1.00 49.44  ? 370  GLU A N     1 
ATOM   3008  C  CA    . GLU A 1  370 ? -5.778  1.751   186.362 1.00 50.15  ? 370  GLU A CA    1 
ATOM   3009  C  C     . GLU A 1  370 ? -4.885  2.983   186.281 1.00 54.80  ? 370  GLU A C     1 
ATOM   3010  O  O     . GLU A 1  370 ? -4.087  3.121   185.348 1.00 66.16  ? 370  GLU A O     1 
ATOM   3011  C  CB    . GLU A 1  370 ? -7.205  2.081   185.935 1.00 54.81  ? 370  GLU A CB    1 
ATOM   3012  C  CG    . GLU A 1  370 ? -8.105  0.865   185.871 1.00 62.05  ? 370  GLU A CG    1 
ATOM   3013  C  CD    . GLU A 1  370 ? -9.570  1.222   185.944 1.00 57.36  ? 370  GLU A CD    1 
ATOM   3014  O  OE1   . GLU A 1  370 ? -9.895  2.424   185.853 1.00 67.11  ? 370  GLU A OE1   1 
ATOM   3015  O  OE2   . GLU A 1  370 ? -10.396 0.298   186.092 1.00 53.28  ? 370  GLU A OE2   1 
ATOM   3016  N  N     . ALA A 1  371 ? -5.021  3.904   187.242 1.00 58.70  ? 371  ALA A N     1 
ATOM   3017  C  CA    . ALA A 1  371 ? -4.150  5.076   187.252 1.00 57.51  ? 371  ALA A CA    1 
ATOM   3018  C  C     . ALA A 1  371 ? -2.681  4.675   187.318 1.00 53.66  ? 371  ALA A C     1 
ATOM   3019  O  O     . ALA A 1  371 ? -1.844  5.254   186.615 1.00 53.55  ? 371  ALA A O     1 
ATOM   3020  C  CB    . ALA A 1  371 ? -4.512  5.991   188.421 1.00 58.39  ? 371  ALA A CB    1 
ATOM   3021  N  N     . VAL A 1  372 ? -2.347  3.684   188.151 1.00 45.62  ? 372  VAL A N     1 
ATOM   3022  C  CA    . VAL A 1  372 ? -0.974  3.182   188.198 1.00 50.41  ? 372  VAL A CA    1 
ATOM   3023  C  C     . VAL A 1  372 ? -0.555  2.694   186.819 1.00 50.33  ? 372  VAL A C     1 
ATOM   3024  O  O     . VAL A 1  372 ? 0.569   2.945   186.364 1.00 49.28  ? 372  VAL A O     1 
ATOM   3025  C  CB    . VAL A 1  372 ? -0.820  2.092   189.275 1.00 46.88  ? 372  VAL A CB    1 
ATOM   3026  C  CG1   . VAL A 1  372 ? 0.461   1.315   189.058 1.00 40.87  ? 372  VAL A CG1   1 
ATOM   3027  C  CG2   . VAL A 1  372 ? -0.783  2.733   190.651 1.00 47.71  ? 372  VAL A CG2   1 
ATOM   3028  N  N     . GLN A 1  373 ? -1.459  1.995   186.132 1.00 49.99  ? 373  GLN A N     1 
ATOM   3029  C  CA    . GLN A 1  373 ? -1.127  1.389   184.848 1.00 47.35  ? 373  GLN A CA    1 
ATOM   3030  C  C     . GLN A 1  373 ? -0.883  2.462   183.795 1.00 48.59  ? 373  GLN A C     1 
ATOM   3031  O  O     . GLN A 1  373 ? 0.075   2.367   183.020 1.00 47.88  ? 373  GLN A O     1 
ATOM   3032  C  CB    . GLN A 1  373 ? -2.241  0.437   184.424 1.00 46.91  ? 373  GLN A CB    1 
ATOM   3033  C  CG    . GLN A 1  373 ? -2.227  -0.861  185.212 1.00 58.68  ? 373  GLN A CG    1 
ATOM   3034  C  CD    . GLN A 1  373 ? -3.537  -1.617  185.130 1.00 56.81  ? 373  GLN A CD    1 
ATOM   3035  O  OE1   . GLN A 1  373 ? -3.708  -2.652  185.777 1.00 52.49  ? 373  GLN A OE1   1 
ATOM   3036  N  NE2   . GLN A 1  373 ? -4.465  -1.111  184.323 1.00 58.28  ? 373  GLN A NE2   1 
ATOM   3037  N  N     . LYS A 1  374 ? -1.747  3.481   183.740 1.00 50.40  ? 374  LYS A N     1 
ATOM   3038  C  CA    . LYS A 1  374 ? -1.512  4.598   182.828 1.00 49.24  ? 374  LYS A CA    1 
ATOM   3039  C  C     . LYS A 1  374 ? -0.178  5.267   183.122 1.00 51.41  ? 374  LYS A C     1 
ATOM   3040  O  O     . LYS A 1  374 ? 0.575   5.598   182.199 1.00 59.42  ? 374  LYS A O     1 
ATOM   3041  C  CB    . LYS A 1  374 ? -2.647  5.618   182.920 1.00 51.55  ? 374  LYS A CB    1 
ATOM   3042  C  CG    . LYS A 1  374 ? -3.953  5.161   182.297 1.00 72.03  ? 374  LYS A CG    1 
ATOM   3043  C  CD    . LYS A 1  374 ? -3.793  4.953   180.797 1.00 78.05  ? 374  LYS A CD    1 
ATOM   3044  C  CE    . LYS A 1  374 ? -5.137  4.974   180.083 1.00 86.72  ? 374  LYS A CE    1 
ATOM   3045  N  NZ    . LYS A 1  374 ? -4.969  4.849   178.607 1.00 94.71  ? 374  LYS A NZ    1 
ATOM   3046  N  N     . ILE A 1  375 ? 0.137   5.468   184.403 1.00 57.92  ? 375  ILE A N     1 
ATOM   3047  C  CA    . ILE A 1  375 ? 1.355   6.192   184.755 1.00 61.50  ? 375  ILE A CA    1 
ATOM   3048  C  C     . ILE A 1  375 ? 2.580   5.354   184.416 1.00 57.74  ? 375  ILE A C     1 
ATOM   3049  O  O     . ILE A 1  375 ? 3.595   5.880   183.946 1.00 60.40  ? 375  ILE A O     1 
ATOM   3050  C  CB    . ILE A 1  375 ? 1.334   6.590   186.241 1.00 59.58  ? 375  ILE A CB    1 
ATOM   3051  C  CG1   . ILE A 1  375 ? 0.230   7.612   186.504 1.00 66.96  ? 375  ILE A CG1   1 
ATOM   3052  C  CG2   . ILE A 1  375 ? 2.666   7.182   186.656 1.00 65.28  ? 375  ILE A CG2   1 
ATOM   3053  C  CD1   . ILE A 1  375 ? -0.074  7.792   187.969 1.00 54.58  ? 375  ILE A CD1   1 
ATOM   3054  N  N     . THR A 1  376 ? 2.504   4.037   184.635 1.00 52.40  ? 376  THR A N     1 
ATOM   3055  C  CA    . THR A 1  376 ? 3.606   3.162   184.246 1.00 46.07  ? 376  THR A CA    1 
ATOM   3056  C  C     . THR A 1  376 ? 3.895   3.283   182.757 1.00 51.24  ? 376  THR A C     1 
ATOM   3057  O  O     . THR A 1  376 ? 5.056   3.381   182.345 1.00 62.53  ? 376  THR A O     1 
ATOM   3058  C  CB    . THR A 1  376 ? 3.277   1.712   184.594 1.00 41.36  ? 376  THR A CB    1 
ATOM   3059  O  OG1   . THR A 1  376 ? 3.256   1.550   186.014 1.00 44.48  ? 376  THR A OG1   1 
ATOM   3060  C  CG2   . THR A 1  376 ? 4.317   0.782   183.997 1.00 52.76  ? 376  THR A CG2   1 
ATOM   3061  N  N     . THR A 1  377 ? 2.845   3.288   181.934 1.00 48.28  ? 377  THR A N     1 
ATOM   3062  C  CA    . THR A 1  377 ? 3.031   3.297   180.488 1.00 54.22  ? 377  THR A CA    1 
ATOM   3063  C  C     . THR A 1  377 ? 3.530   4.656   180.015 1.00 62.12  ? 377  THR A C     1 
ATOM   3064  O  O     . THR A 1  377 ? 4.488   4.739   179.237 1.00 54.16  ? 377  THR A O     1 
ATOM   3065  C  CB    . THR A 1  377 ? 1.734   2.907   179.779 1.00 58.31  ? 377  THR A CB    1 
ATOM   3066  O  OG1   . THR A 1  377 ? 1.544   1.492   179.892 1.00 73.76  ? 377  THR A OG1   1 
ATOM   3067  C  CG2   . THR A 1  377 ? 1.791   3.283   178.306 1.00 53.62  ? 377  THR A CG2   1 
ATOM   3068  N  N     . GLU A 1  378 ? 2.867   5.734   180.453 1.00 60.10  ? 378  GLU A N     1 
ATOM   3069  C  CA    . GLU A 1  378 ? 3.353   7.079   180.156 1.00 58.85  ? 378  GLU A CA    1 
ATOM   3070  C  C     . GLU A 1  378 ? 4.822   7.227   180.536 1.00 60.67  ? 378  GLU A C     1 
ATOM   3071  O  O     . GLU A 1  378 ? 5.597   7.865   179.814 1.00 60.42  ? 378  GLU A O     1 
ATOM   3072  C  CB    . GLU A 1  378 ? 2.503   8.116   180.894 1.00 55.98  ? 378  GLU A CB    1 
ATOM   3073  C  CG    . GLU A 1  378 ? 3.028   9.543   180.799 1.00 59.39  ? 378  GLU A CG    1 
ATOM   3074  C  CD    . GLU A 1  378 ? 2.067   10.566  181.385 1.00 61.60  ? 378  GLU A CD    1 
ATOM   3075  O  OE1   . GLU A 1  378 ? 1.268   11.151  180.623 1.00 62.63  ? 378  GLU A OE1   1 
ATOM   3076  O  OE2   . GLU A 1  378 ? 2.125   10.799  182.610 1.00 61.48  ? 378  GLU A OE2   1 
ATOM   3077  N  N     . SER A 1  379 ? 5.229   6.625   181.658 1.00 60.71  ? 379  SER A N     1 
ATOM   3078  C  CA    . SER A 1  379 ? 6.612   6.751   182.108 1.00 58.07  ? 379  SER A CA    1 
ATOM   3079  C  C     . SER A 1  379 ? 7.564   5.999   181.189 1.00 61.34  ? 379  SER A C     1 
ATOM   3080  O  O     . SER A 1  379 ? 8.659   6.488   180.887 1.00 70.03  ? 379  SER A O     1 
ATOM   3081  C  CB    . SER A 1  379 ? 6.758   6.247   183.543 1.00 56.72  ? 379  SER A CB    1 
ATOM   3082  O  OG    . SER A 1  379 ? 6.028   7.048   184.456 1.00 60.51  ? 379  SER A OG    1 
ATOM   3083  N  N     . ILE A 1  380 ? 7.178   4.798   180.751 1.00 62.21  ? 380  ILE A N     1 
ATOM   3084  C  CA    . ILE A 1  380 ? 8.033   4.044   179.840 1.00 59.63  ? 380  ILE A CA    1 
ATOM   3085  C  C     . ILE A 1  380 ? 8.167   4.770   178.508 1.00 61.39  ? 380  ILE A C     1 
ATOM   3086  O  O     . ILE A 1  380 ? 9.209   4.686   177.847 1.00 68.78  ? 380  ILE A O     1 
ATOM   3087  C  CB    . ILE A 1  380 ? 7.485   2.610   179.676 1.00 49.69  ? 380  ILE A CB    1 
ATOM   3088  C  CG1   . ILE A 1  380 ? 7.784   1.789   180.930 1.00 52.71  ? 380  ILE A CG1   1 
ATOM   3089  C  CG2   . ILE A 1  380 ? 8.060   1.930   178.448 1.00 57.90  ? 380  ILE A CG2   1 
ATOM   3090  C  CD1   . ILE A 1  380 ? 7.033   0.484   181.001 1.00 50.10  ? 380  ILE A CD1   1 
ATOM   3091  N  N     . VAL A 1  381 ? 7.138   5.515   178.105 1.00 58.90  ? 381  VAL A N     1 
ATOM   3092  C  CA    . VAL A 1  381 ? 7.225   6.272   176.861 1.00 55.56  ? 381  VAL A CA    1 
ATOM   3093  C  C     . VAL A 1  381 ? 8.242   7.403   176.985 1.00 68.97  ? 381  VAL A C     1 
ATOM   3094  O  O     . VAL A 1  381 ? 9.030   7.650   176.064 1.00 76.13  ? 381  VAL A O     1 
ATOM   3095  C  CB    . VAL A 1  381 ? 5.833   6.790   176.454 1.00 52.48  ? 381  VAL A CB    1 
ATOM   3096  C  CG1   . VAL A 1  381 ? 5.942   7.758   175.296 1.00 63.61  ? 381  VAL A CG1   1 
ATOM   3097  C  CG2   . VAL A 1  381 ? 4.943   5.628   176.065 1.00 51.31  ? 381  VAL A CG2   1 
ATOM   3098  N  N     . ILE A 1  382 ? 8.264   8.091   178.126 1.00 70.12  ? 382  ILE A N     1 
ATOM   3099  C  CA    . ILE A 1  382 ? 9.093   9.286   178.255 1.00 70.53  ? 382  ILE A CA    1 
ATOM   3100  C  C     . ILE A 1  382 ? 10.487  8.979   178.806 1.00 70.84  ? 382  ILE A C     1 
ATOM   3101  O  O     . ILE A 1  382 ? 11.458  9.651   178.440 1.00 77.66  ? 382  ILE A O     1 
ATOM   3102  C  CB    . ILE A 1  382 ? 8.369   10.326  179.132 1.00 69.10  ? 382  ILE A CB    1 
ATOM   3103  C  CG1   . ILE A 1  382 ? 7.025   10.709  178.510 1.00 64.40  ? 382  ILE A CG1   1 
ATOM   3104  C  CG2   . ILE A 1  382 ? 9.217   11.573  179.319 1.00 74.02  ? 382  ILE A CG2   1 
ATOM   3105  C  CD1   . ILE A 1  382 ? 6.164   11.569  179.408 1.00 65.36  ? 382  ILE A CD1   1 
ATOM   3106  N  N     . TRP A 1  383 ? 10.620  7.965   179.661 1.00 70.39  ? 383  TRP A N     1 
ATOM   3107  C  CA    . TRP A 1  383 ? 11.901  7.664   180.282 1.00 62.43  ? 383  TRP A CA    1 
ATOM   3108  C  C     . TRP A 1  383 ? 12.343  6.220   180.097 1.00 63.19  ? 383  TRP A C     1 
ATOM   3109  O  O     . TRP A 1  383 ? 13.491  5.903   180.425 1.00 79.39  ? 383  TRP A O     1 
ATOM   3110  C  CB    . TRP A 1  383 ? 11.856  7.982   181.785 1.00 69.02  ? 383  TRP A CB    1 
ATOM   3111  C  CG    . TRP A 1  383 ? 11.472  9.404   182.064 1.00 67.13  ? 383  TRP A CG    1 
ATOM   3112  C  CD1   . TRP A 1  383 ? 12.233  10.517  181.867 1.00 68.07  ? 383  TRP A CD1   1 
ATOM   3113  C  CD2   . TRP A 1  383 ? 10.224  9.860   182.602 1.00 73.20  ? 383  TRP A CD2   1 
ATOM   3114  N  NE1   . TRP A 1  383 ? 11.532  11.641  182.238 1.00 67.09  ? 383  TRP A NE1   1 
ATOM   3115  C  CE2   . TRP A 1  383 ? 10.297  11.263  182.695 1.00 72.49  ? 383  TRP A CE2   1 
ATOM   3116  C  CE3   . TRP A 1  383 ? 9.051   9.218   183.011 1.00 63.81  ? 383  TRP A CE3   1 
ATOM   3117  C  CZ2   . TRP A 1  383 ? 9.242   12.035  183.181 1.00 70.39  ? 383  TRP A CZ2   1 
ATOM   3118  C  CZ3   . TRP A 1  383 ? 8.008   9.984   183.490 1.00 63.93  ? 383  TRP A CZ3   1 
ATOM   3119  C  CH2   . TRP A 1  383 ? 8.109   11.378  183.572 1.00 65.15  ? 383  TRP A CH2   1 
ATOM   3120  N  N     . GLY A 1  384 ? 11.478  5.341   179.603 1.00 65.77  ? 384  GLY A N     1 
ATOM   3121  C  CA    . GLY A 1  384 ? 11.826  3.942   179.440 1.00 63.25  ? 384  GLY A CA    1 
ATOM   3122  C  C     . GLY A 1  384 ? 12.000  3.155   180.720 1.00 66.12  ? 384  GLY A C     1 
ATOM   3123  O  O     . GLY A 1  384 ? 12.715  2.148   180.721 1.00 67.02  ? 384  GLY A O     1 
ATOM   3124  N  N     . LYS A 1  385 ? 11.347  3.564   181.805 1.00 73.01  ? 385  LYS A N     1 
ATOM   3125  C  CA    . LYS A 1  385 ? 11.407  2.792   183.040 1.00 72.74  ? 385  LYS A CA    1 
ATOM   3126  C  C     . LYS A 1  385 ? 10.173  3.086   183.880 1.00 76.16  ? 385  LYS A C     1 
ATOM   3127  O  O     . LYS A 1  385 ? 9.469   4.077   183.663 1.00 74.38  ? 385  LYS A O     1 
ATOM   3128  C  CB    . LYS A 1  385 ? 12.696  3.072   183.827 1.00 71.50  ? 385  LYS A CB    1 
ATOM   3129  C  CG    . LYS A 1  385 ? 12.744  4.391   184.585 1.00 76.99  ? 385  LYS A CG    1 
ATOM   3130  C  CD    . LYS A 1  385 ? 14.172  4.688   185.054 1.00 87.89  ? 385  LYS A CD    1 
ATOM   3131  C  CE    . LYS A 1  385 ? 14.215  5.363   186.422 1.00 87.40  ? 385  LYS A CE    1 
ATOM   3132  N  NZ    . LYS A 1  385 ? 15.444  6.199   186.602 1.00 81.17  ? 385  LYS A NZ    1 
ATOM   3133  N  N     . THR A 1  386 ? 9.911   2.186   184.842 1.00 71.46  ? 386  THR A N     1 
ATOM   3134  C  CA    . THR A 1  386 ? 8.771   2.280   185.745 1.00 55.99  ? 386  THR A CA    1 
ATOM   3135  C  C     . THR A 1  386 ? 9.162   3.097   186.969 1.00 61.99  ? 386  THR A C     1 
ATOM   3136  O  O     . THR A 1  386 ? 10.158  2.775   187.627 1.00 55.86  ? 386  THR A O     1 
ATOM   3137  C  CB    . THR A 1  386 ? 8.308   0.896   186.179 1.00 63.35  ? 386  THR A CB    1 
ATOM   3138  O  OG1   . THR A 1  386 ? 7.853   0.162   185.035 1.00 68.92  ? 386  THR A OG1   1 
ATOM   3139  C  CG2   . THR A 1  386 ? 7.180   1.001   187.192 1.00 60.65  ? 386  THR A CG2   1 
ATOM   3140  N  N     . PRO A 1  387 ? 8.399   4.131   187.316 1.00 68.17  ? 387  PRO A N     1 
ATOM   3141  C  CA    . PRO A 1  387 ? 8.680   4.877   188.546 1.00 65.76  ? 387  PRO A CA    1 
ATOM   3142  C  C     . PRO A 1  387 ? 8.269   4.139   189.807 1.00 61.85  ? 387  PRO A C     1 
ATOM   3143  O  O     . PRO A 1  387 ? 7.335   3.335   189.818 1.00 55.70  ? 387  PRO A O     1 
ATOM   3144  C  CB    . PRO A 1  387 ? 7.850   6.153   188.373 1.00 63.72  ? 387  PRO A CB    1 
ATOM   3145  C  CG    . PRO A 1  387 ? 6.690   5.709   187.552 1.00 61.02  ? 387  PRO A CG    1 
ATOM   3146  C  CD    . PRO A 1  387 ? 7.233   4.672   186.599 1.00 62.47  ? 387  PRO A CD    1 
ATOM   3147  N  N     . LYS A 1  388 ? 9.007   4.418   190.879 1.00 70.03  ? 388  LYS A N     1 
ATOM   3148  C  CA    . LYS A 1  388 ? 8.563   4.067   192.219 1.00 70.19  ? 388  LYS A CA    1 
ATOM   3149  C  C     . LYS A 1  388 ? 7.295   4.848   192.545 1.00 69.79  ? 388  LYS A C     1 
ATOM   3150  O  O     . LYS A 1  388 ? 7.225   6.060   192.320 1.00 68.59  ? 388  LYS A O     1 
ATOM   3151  C  CB    . LYS A 1  388 ? 9.657   4.371   193.243 1.00 72.42  ? 388  LYS A CB    1 
ATOM   3152  C  CG    . LYS A 1  388 ? 10.954  3.593   193.044 1.00 79.37  ? 388  LYS A CG    1 
ATOM   3153  C  CD    . LYS A 1  388 ? 10.789  2.101   193.289 1.00 79.58  ? 388  LYS A CD    1 
ATOM   3154  C  CE    . LYS A 1  388 ? 11.918  1.310   192.628 1.00 85.06  ? 388  LYS A CE    1 
ATOM   3155  N  NZ    . LYS A 1  388 ? 11.949  1.453   191.142 1.00 82.49  ? 388  LYS A NZ    1 
ATOM   3156  N  N     . PHE A 1  389 ? 6.287   4.156   193.066 1.00 72.66  ? 389  PHE A N     1 
ATOM   3157  C  CA    . PHE A 1  389 ? 4.988   4.758   193.333 1.00 67.77  ? 389  PHE A CA    1 
ATOM   3158  C  C     . PHE A 1  389 ? 4.811   5.079   194.809 1.00 62.74  ? 389  PHE A C     1 
ATOM   3159  O  O     . PHE A 1  389 ? 5.312   4.376   195.691 1.00 60.83  ? 389  PHE A O     1 
ATOM   3160  C  CB    . PHE A 1  389 ? 3.839   3.861   192.871 1.00 57.52  ? 389  PHE A CB    1 
ATOM   3161  C  CG    . PHE A 1  389 ? 3.628   3.858   191.387 1.00 49.18  ? 389  PHE A CG    1 
ATOM   3162  C  CD1   . PHE A 1  389 ? 4.228   2.907   190.583 1.00 47.19  ? 389  PHE A CD1   1 
ATOM   3163  C  CD2   . PHE A 1  389 ? 2.804   4.804   190.798 1.00 55.16  ? 389  PHE A CD2   1 
ATOM   3164  C  CE1   . PHE A 1  389 ? 4.020   2.907   189.215 1.00 40.85  ? 389  PHE A CE1   1 
ATOM   3165  C  CE2   . PHE A 1  389 ? 2.593   4.811   189.432 1.00 50.67  ? 389  PHE A CE2   1 
ATOM   3166  C  CZ    . PHE A 1  389 ? 3.202   3.861   188.640 1.00 43.85  ? 389  PHE A CZ    1 
ATOM   3167  N  N     . LYS A 1  390 ? 4.079   6.161   195.060 1.00 63.51  ? 390  LYS A N     1 
ATOM   3168  C  CA    . LYS A 1  390 ? 3.660   6.578   196.395 1.00 69.68  ? 390  LYS A CA    1 
ATOM   3169  C  C     . LYS A 1  390 ? 2.142   6.700   196.360 1.00 66.06  ? 390  LYS A C     1 
ATOM   3170  O  O     . LYS A 1  390 ? 1.603   7.570   195.668 1.00 66.01  ? 390  LYS A O     1 
ATOM   3171  C  CB    . LYS A 1  390 ? 4.311   7.916   196.739 1.00 72.43  ? 390  LYS A CB    1 
ATOM   3172  C  CG    . LYS A 1  390 ? 5.834   7.880   196.828 1.00 74.93  ? 390  LYS A CG    1 
ATOM   3173  C  CD    . LYS A 1  390 ? 6.403   9.185   197.377 1.00 80.29  ? 390  LYS A CD    1 
ATOM   3174  C  CE    . LYS A 1  390 ? 5.573   9.759   198.508 1.00 96.16  ? 390  LYS A CE    1 
ATOM   3175  N  NZ    . LYS A 1  390 ? 6.022   11.140  198.849 1.00 89.77  ? 390  LYS A NZ    1 
ATOM   3176  N  N     . LEU A 1  391 ? 1.454   5.847   197.112 1.00 66.10  ? 391  LEU A N     1 
ATOM   3177  C  CA    . LEU A 1  391 ? 0.015   5.749   196.927 1.00 67.58  ? 391  LEU A CA    1 
ATOM   3178  C  C     . LEU A 1  391 ? -0.736  5.947   198.236 1.00 65.43  ? 391  LEU A C     1 
ATOM   3179  O  O     . LEU A 1  391 ? -0.256  5.563   199.308 1.00 56.71  ? 391  LEU A O     1 
ATOM   3180  C  CB    . LEU A 1  391 ? -0.382  4.395   196.319 1.00 64.39  ? 391  LEU A CB    1 
ATOM   3181  C  CG    . LEU A 1  391 ? 0.365   3.941   195.065 1.00 58.71  ? 391  LEU A CG    1 
ATOM   3182  C  CD1   . LEU A 1  391 ? 0.077   2.473   194.769 1.00 56.23  ? 391  LEU A CD1   1 
ATOM   3183  C  CD2   . LEU A 1  391 ? -0.019  4.820   193.881 1.00 49.38  ? 391  LEU A CD2   1 
ATOM   3184  N  N     . PRO A 1  392 ? -1.952  6.550   198.165 1.00 54.13  ? 392  PRO A N     1 
ATOM   3185  C  CA    . PRO A 1  392 ? -2.803  6.778   199.343 1.00 52.50  ? 392  PRO A CA    1 
ATOM   3186  C  C     . PRO A 1  392 ? -3.587  5.532   199.732 1.00 49.72  ? 392  PRO A C     1 
ATOM   3187  O  O     . PRO A 1  392 ? -4.818  5.533   199.784 1.00 51.05  ? 392  PRO A O     1 
ATOM   3188  C  CB    . PRO A 1  392 ? -3.711  7.918   198.879 1.00 55.42  ? 392  PRO A CB    1 
ATOM   3189  C  CG    . PRO A 1  392 ? -3.796  7.762   197.415 1.00 57.20  ? 392  PRO A CG    1 
ATOM   3190  C  CD    . PRO A 1  392 ? -2.466  7.242   196.967 1.00 58.67  ? 392  PRO A CD    1 
ATOM   3191  N  N     . ILE A 1  393 ? -2.885  4.417   199.920 1.00 51.79  ? 393  ILE A N     1 
ATOM   3192  C  CA    . ILE A 1  393 ? -3.572  3.169   200.262 1.00 46.71  ? 393  ILE A CA    1 
ATOM   3193  C  C     . ILE A 1  393 ? -2.702  2.336   201.190 1.00 51.94  ? 393  ILE A C     1 
ATOM   3194  O  O     . ILE A 1  393 ? -1.487  2.206   200.982 1.00 64.99  ? 393  ILE A O     1 
ATOM   3195  C  CB    . ILE A 1  393 ? -3.957  2.368   199.005 1.00 51.98  ? 393  ILE A CB    1 
ATOM   3196  C  CG1   . ILE A 1  393 ? -4.702  1.089   199.395 1.00 50.16  ? 393  ILE A CG1   1 
ATOM   3197  C  CG2   . ILE A 1  393 ? -2.742  2.074   198.137 1.00 53.84  ? 393  ILE A CG2   1 
ATOM   3198  C  CD1   . ILE A 1  393 ? -5.265  0.330   198.221 1.00 60.39  ? 393  ILE A CD1   1 
ATOM   3199  N  N     . GLN A 1  394 ? -3.314  1.807   202.241 1.00 56.24  ? 394  GLN A N     1 
ATOM   3200  C  CA    . GLN A 1  394 ? -2.579  1.023   203.227 1.00 59.83  ? 394  GLN A CA    1 
ATOM   3201  C  C     . GLN A 1  394 ? -2.089  -0.276  202.604 1.00 56.10  ? 394  GLN A C     1 
ATOM   3202  O  O     . GLN A 1  394 ? -2.751  -0.850  201.728 1.00 55.40  ? 394  GLN A O     1 
ATOM   3203  C  CB    . GLN A 1  394 ? -3.474  0.717   204.427 1.00 58.37  ? 394  GLN A CB    1 
ATOM   3204  C  CG    . GLN A 1  394 ? -2.746  0.717   205.750 1.00 68.12  ? 394  GLN A CG    1 
ATOM   3205  C  CD    . GLN A 1  394 ? -2.309  2.108   206.150 1.00 71.24  ? 394  GLN A CD    1 
ATOM   3206  O  OE1   . GLN A 1  394 ? -3.117  3.035   206.203 1.00 65.35  ? 394  GLN A OE1   1 
ATOM   3207  N  NE2   . GLN A 1  394 ? -1.021  2.263   206.429 1.00 76.63  ? 394  GLN A NE2   1 
ATOM   3208  N  N     . LYS A 1  395 ? -0.903  -0.718  203.015 1.00 56.89  ? 395  LYS A N     1 
ATOM   3209  C  CA    . LYS A 1  395 ? -0.389  -2.003  202.546 1.00 65.39  ? 395  LYS A CA    1 
ATOM   3210  C  C     . LYS A 1  395 ? -1.393  -3.123  202.817 1.00 59.81  ? 395  LYS A C     1 
ATOM   3211  O  O     . LYS A 1  395 ? -1.631  -3.984  201.961 1.00 51.44  ? 395  LYS A O     1 
ATOM   3212  C  CB    . LYS A 1  395 ? 0.953   -2.309  203.214 1.00 69.42  ? 395  LYS A CB    1 
ATOM   3213  C  CG    . LYS A 1  395 ? 2.150   -1.647  202.534 1.00 63.22  ? 395  LYS A CG    1 
ATOM   3214  C  CD    . LYS A 1  395 ? 2.653   -2.397  201.315 1.00 66.44  ? 395  LYS A CD    1 
ATOM   3215  C  CE    . LYS A 1  395 ? 3.406   -1.445  200.390 1.00 60.79  ? 395  LYS A CE    1 
ATOM   3216  N  NZ    . LYS A 1  395 ? 4.191   -2.152  199.345 1.00 55.93  ? 395  LYS A NZ    1 
ATOM   3217  N  N     . GLU A 1  396 ? -1.990  -3.119  204.011 1.00 78.38  ? 396  GLU A N     1 
ATOM   3218  C  CA    . GLU A 1  396 ? -2.985  -4.125  204.377 1.00 79.64  ? 396  GLU A CA    1 
ATOM   3219  C  C     . GLU A 1  396 ? -4.182  -4.110  203.435 1.00 73.24  ? 396  GLU A C     1 
ATOM   3220  O  O     . GLU A 1  396 ? -4.672  -5.171  203.026 1.00 68.20  ? 396  GLU A O     1 
ATOM   3221  C  CB    . GLU A 1  396 ? -3.447  -3.895  205.815 1.00 82.22  ? 396  GLU A CB    1 
ATOM   3222  C  CG    . GLU A 1  396 ? -2.829  -4.827  206.839 1.00 92.15  ? 396  GLU A CG    1 
ATOM   3223  C  CD    . GLU A 1  396 ? -3.043  -4.338  208.260 1.00 112.39 ? 396  GLU A CD    1 
ATOM   3224  O  OE1   . GLU A 1  396 ? -3.708  -3.293  208.434 1.00 110.98 ? 396  GLU A OE1   1 
ATOM   3225  O  OE2   . GLU A 1  396 ? -2.532  -4.984  209.201 1.00 113.00 ? 396  GLU A OE2   1 
ATOM   3226  N  N     . THR A 1  397 ? -4.670  -2.916  203.081 1.00 61.29  ? 397  THR A N     1 
ATOM   3227  C  CA    . THR A 1  397 ? -5.807  -2.813  202.168 1.00 45.20  ? 397  THR A CA    1 
ATOM   3228  C  C     . THR A 1  397 ? -5.507  -3.494  200.840 1.00 56.13  ? 397  THR A C     1 
ATOM   3229  O  O     . THR A 1  397 ? -6.279  -4.346  200.383 1.00 42.15  ? 397  THR A O     1 
ATOM   3230  C  CB    . THR A 1  397 ? -6.165  -1.343  201.932 1.00 40.47  ? 397  THR A CB    1 
ATOM   3231  O  OG1   . THR A 1  397 ? -6.384  -0.679  203.183 1.00 41.83  ? 397  THR A OG1   1 
ATOM   3232  C  CG2   . THR A 1  397 ? -7.399  -1.228  201.063 1.00 42.73  ? 397  THR A CG2   1 
ATOM   3233  N  N     . TRP A 1  398 ? -4.400  -3.104  200.193 1.00 58.24  ? 398  TRP A N     1 
ATOM   3234  C  CA    . TRP A 1  398 ? -4.007  -3.718  198.928 1.00 39.48  ? 398  TRP A CA    1 
ATOM   3235  C  C     . TRP A 1  398 ? -3.902  -5.234  199.049 1.00 42.27  ? 398  TRP A C     1 
ATOM   3236  O  O     . TRP A 1  398 ? -4.430  -5.973  198.209 1.00 41.87  ? 398  TRP A O     1 
ATOM   3237  C  CB    . TRP A 1  398 ? -2.679  -3.146  198.445 1.00 50.43  ? 398  TRP A CB    1 
ATOM   3238  C  CG    . TRP A 1  398 ? -2.232  -3.801  197.181 1.00 43.74  ? 398  TRP A CG    1 
ATOM   3239  C  CD1   . TRP A 1  398 ? -1.124  -4.568  197.017 1.00 35.48  ? 398  TRP A CD1   1 
ATOM   3240  C  CD2   . TRP A 1  398 ? -2.883  -3.757  195.905 1.00 48.00  ? 398  TRP A CD2   1 
ATOM   3241  N  NE1   . TRP A 1  398 ? -1.044  -5.016  195.724 1.00 36.77  ? 398  TRP A NE1   1 
ATOM   3242  C  CE2   . TRP A 1  398 ? -2.110  -4.528  195.018 1.00 41.13  ? 398  TRP A CE2   1 
ATOM   3243  C  CE3   . TRP A 1  398 ? -4.044  -3.141  195.426 1.00 47.35  ? 398  TRP A CE3   1 
ATOM   3244  C  CZ2   . TRP A 1  398 ? -2.455  -4.701  193.678 1.00 57.75  ? 398  TRP A CZ2   1 
ATOM   3245  C  CZ3   . TRP A 1  398 ? -4.386  -3.314  194.091 1.00 57.17  ? 398  TRP A CZ3   1 
ATOM   3246  C  CH2   . TRP A 1  398 ? -3.594  -4.087  193.235 1.00 52.66  ? 398  TRP A CH2   1 
ATOM   3247  N  N     . GLU A 1  399 ? -3.214  -5.713  200.090 1.00 45.23  ? 399  GLU A N     1 
ATOM   3248  C  CA    . GLU A 1  399 ? -3.055  -7.153  200.268 1.00 45.89  ? 399  GLU A CA    1 
ATOM   3249  C  C     . GLU A 1  399 ? -4.407  -7.844  200.341 1.00 48.55  ? 399  GLU A C     1 
ATOM   3250  O  O     . GLU A 1  399 ? -4.615  -8.886  199.709 1.00 54.06  ? 399  GLU A O     1 
ATOM   3251  C  CB    . GLU A 1  399 ? -2.238  -7.451  201.528 1.00 51.79  ? 399  GLU A CB    1 
ATOM   3252  C  CG    . GLU A 1  399 ? -1.872  -8.927  201.698 1.00 47.77  ? 399  GLU A CG    1 
ATOM   3253  C  CD    . GLU A 1  399 ? -0.637  -9.343  200.908 1.00 76.07  ? 399  GLU A CD    1 
ATOM   3254  O  OE1   . GLU A 1  399 ? -0.058  -8.498  200.189 1.00 69.09  ? 399  GLU A OE1   1 
ATOM   3255  O  OE2   . GLU A 1  399 ? -0.254  -10.532 200.994 1.00 79.78  ? 399  GLU A OE2   1 
ATOM   3256  N  N     . THR A 1  400 ? -5.340  -7.277  201.107 1.00 47.85  ? 400  THR A N     1 
ATOM   3257  C  CA    . THR A 1  400 ? -6.662  -7.879  201.237 1.00 48.43  ? 400  THR A CA    1 
ATOM   3258  C  C     . THR A 1  400 ? -7.399  -7.892  199.902 1.00 44.71  ? 400  THR A C     1 
ATOM   3259  O  O     . THR A 1  400 ? -7.999  -8.903  199.519 1.00 46.32  ? 400  THR A O     1 
ATOM   3260  C  CB    . THR A 1  400 ? -7.470  -7.128  202.294 1.00 56.35  ? 400  THR A CB    1 
ATOM   3261  O  OG1   . THR A 1  400 ? -6.867  -7.320  203.580 1.00 65.90  ? 400  THR A OG1   1 
ATOM   3262  C  CG2   . THR A 1  400 ? -8.904  -7.629  202.327 1.00 62.34  ? 400  THR A CG2   1 
ATOM   3263  N  N     . TRP A 1  401 ? -7.363  -6.775  199.178 1.00 42.28  ? 401  TRP A N     1 
ATOM   3264  C  CA    . TRP A 1  401 ? -7.925  -6.704  197.834 1.00 42.89  ? 401  TRP A CA    1 
ATOM   3265  C  C     . TRP A 1  401 ? -7.355  -7.735  196.864 1.00 50.63  ? 401  TRP A C     1 
ATOM   3266  O  O     . TRP A 1  401 ? -8.090  -8.610  196.394 1.00 47.45  ? 401  TRP A O     1 
ATOM   3267  C  CB    . TRP A 1  401 ? -7.740  -5.312  197.238 1.00 42.47  ? 401  TRP A CB    1 
ATOM   3268  C  CG    . TRP A 1  401 ? -8.201  -5.264  195.827 1.00 38.49  ? 401  TRP A CG    1 
ATOM   3269  C  CD1   . TRP A 1  401 ? -7.421  -5.122  194.724 1.00 43.28  ? 401  TRP A CD1   1 
ATOM   3270  C  CD2   . TRP A 1  401 ? -9.550  -5.387  195.353 1.00 51.81  ? 401  TRP A CD2   1 
ATOM   3271  N  NE1   . TRP A 1  401 ? -8.195  -5.134  193.591 1.00 54.96  ? 401  TRP A NE1   1 
ATOM   3272  C  CE2   . TRP A 1  401 ? -9.507  -5.296  193.948 1.00 52.31  ? 401  TRP A CE2   1 
ATOM   3273  C  CE3   . TRP A 1  401 ? -10.791 -5.558  195.980 1.00 62.93  ? 401  TRP A CE3   1 
ATOM   3274  C  CZ2   . TRP A 1  401 ? -10.654 -5.370  193.155 1.00 55.27  ? 401  TRP A CZ2   1 
ATOM   3275  C  CZ3   . TRP A 1  401 ? -11.934 -5.632  195.189 1.00 57.68  ? 401  TRP A CZ3   1 
ATOM   3276  C  CH2   . TRP A 1  401 ? -11.855 -5.537  193.792 1.00 59.62  ? 401  TRP A CH2   1 
ATOM   3277  N  N     . TRP A 1  402 ? -6.061  -7.628  196.529 1.00 55.63  ? 402  TRP A N     1 
ATOM   3278  C  CA    . TRP A 1  402 ? -5.542  -8.390  195.394 1.00 53.79  ? 402  TRP A CA    1 
ATOM   3279  C  C     . TRP A 1  402 ? -5.494  -9.883  195.682 1.00 48.17  ? 402  TRP A C     1 
ATOM   3280  O  O     . TRP A 1  402 ? -5.659  -10.690 194.759 1.00 47.15  ? 402  TRP A O     1 
ATOM   3281  C  CB    . TRP A 1  402 ? -4.154  -7.884  194.965 1.00 56.75  ? 402  TRP A CB    1 
ATOM   3282  C  CG    . TRP A 1  402 ? -2.956  -8.331  195.786 1.00 54.13  ? 402  TRP A CG    1 
ATOM   3283  C  CD1   . TRP A 1  402 ? -2.299  -7.607  196.739 1.00 47.31  ? 402  TRP A CD1   1 
ATOM   3284  C  CD2   . TRP A 1  402 ? -2.239  -9.574  195.670 1.00 51.36  ? 402  TRP A CD2   1 
ATOM   3285  N  NE1   . TRP A 1  402 ? -1.245  -8.327  197.243 1.00 36.11  ? 402  TRP A NE1   1 
ATOM   3286  C  CE2   . TRP A 1  402 ? -1.187  -9.537  196.604 1.00 42.79  ? 402  TRP A CE2   1 
ATOM   3287  C  CE3   . TRP A 1  402 ? -2.396  -10.716 194.878 1.00 55.24  ? 402  TRP A CE3   1 
ATOM   3288  C  CZ2   . TRP A 1  402 ? -0.300  -10.598 196.771 1.00 47.28  ? 402  TRP A CZ2   1 
ATOM   3289  C  CZ3   . TRP A 1  402 ? -1.509  -11.769 195.044 1.00 44.86  ? 402  TRP A CZ3   1 
ATOM   3290  C  CH2   . TRP A 1  402 ? -0.477  -11.701 195.983 1.00 43.76  ? 402  TRP A CH2   1 
ATOM   3291  N  N     . THR A 1  403 ? -5.294  -10.279 196.939 1.00 45.08  ? 403  THR A N     1 
ATOM   3292  C  CA    . THR A 1  403 ? -5.249  -11.709 197.215 1.00 50.44  ? 403  THR A CA    1 
ATOM   3293  C  C     . THR A 1  403 ? -6.629  -12.338 197.148 1.00 49.46  ? 403  THR A C     1 
ATOM   3294  O  O     . THR A 1  403 ? -6.748  -13.522 196.813 1.00 54.79  ? 403  THR A O     1 
ATOM   3295  C  CB    . THR A 1  403 ? -4.659  -11.969 198.597 1.00 54.18  ? 403  THR A CB    1 
ATOM   3296  O  OG1   . THR A 1  403 ? -5.442  -11.280 199.580 1.00 44.40  ? 403  THR A OG1   1 
ATOM   3297  C  CG2   . THR A 1  403 ? -3.218  -11.482 198.659 1.00 55.00  ? 403  THR A CG2   1 
ATOM   3298  N  N     . GLU A 1  404 ? -7.679  -11.573 197.445 1.00 53.36  ? 404  GLU A N     1 
ATOM   3299  C  CA    . GLU A 1  404 ? -9.017  -12.145 197.436 1.00 46.40  ? 404  GLU A CA    1 
ATOM   3300  C  C     . GLU A 1  404 ? -9.726  -11.986 196.101 1.00 42.97  ? 404  GLU A C     1 
ATOM   3301  O  O     . GLU A 1  404 ? -10.637 -12.765 195.807 1.00 52.87  ? 404  GLU A O     1 
ATOM   3302  C  CB    . GLU A 1  404 ? -9.868  -11.511 198.539 1.00 48.14  ? 404  GLU A CB    1 
ATOM   3303  C  CG    . GLU A 1  404 ? -9.367  -11.771 199.954 1.00 46.28  ? 404  GLU A CG    1 
ATOM   3304  C  CD    . GLU A 1  404 ? -9.416  -13.239 200.341 1.00 53.61  ? 404  GLU A CD    1 
ATOM   3305  O  OE1   . GLU A 1  404 ? -10.163 -14.011 199.702 1.00 59.20  ? 404  GLU A OE1   1 
ATOM   3306  O  OE2   . GLU A 1  404 ? -8.708  -13.622 201.297 1.00 70.67  ? 404  GLU A OE2   1 
ATOM   3307  N  N     . TYR A 1  405 ? -9.302  -11.040 195.271 1.00 49.00  ? 405  TYR A N     1 
ATOM   3308  C  CA    . TYR A 1  405 ? -9.980  -10.798 194.009 1.00 46.98  ? 405  TYR A CA    1 
ATOM   3309  C  C     . TYR A 1  405 ? -9.760  -11.973 193.069 1.00 49.52  ? 405  TYR A C     1 
ATOM   3310  O  O     . TYR A 1  405 ? -8.754  -12.678 193.153 1.00 52.50  ? 405  TYR A O     1 
ATOM   3311  C  CB    . TYR A 1  405 ? -9.475  -9.505  193.370 1.00 51.56  ? 405  TYR A CB    1 
ATOM   3312  C  CG    . TYR A 1  405 ? -10.336 -9.004  192.235 1.00 53.22  ? 405  TYR A CG    1 
ATOM   3313  C  CD1   . TYR A 1  405 ? -11.720 -9.048  192.315 1.00 55.74  ? 405  TYR A CD1   1 
ATOM   3314  C  CD2   . TYR A 1  405 ? -9.762  -8.485  191.082 1.00 52.48  ? 405  TYR A CD2   1 
ATOM   3315  C  CE1   . TYR A 1  405 ? -12.512 -8.600  191.271 1.00 55.90  ? 405  TYR A CE1   1 
ATOM   3316  C  CE2   . TYR A 1  405 ? -10.544 -8.024  190.036 1.00 60.50  ? 405  TYR A CE2   1 
ATOM   3317  C  CZ    . TYR A 1  405 ? -11.921 -8.086  190.136 1.00 64.34  ? 405  TYR A CZ    1 
ATOM   3318  O  OH    . TYR A 1  405 ? -12.710 -7.627  189.104 1.00 75.93  ? 405  TYR A OH    1 
ATOM   3319  N  N     . TRP A 1  406 ? -10.735 -12.221 192.200 1.00 55.02  ? 406  TRP A N     1 
ATOM   3320  C  CA    . TRP A 1  406 ? -10.665 -13.420 191.378 1.00 53.88  ? 406  TRP A CA    1 
ATOM   3321  C  C     . TRP A 1  406 ? -9.928  -13.199 190.065 1.00 47.79  ? 406  TRP A C     1 
ATOM   3322  O  O     . TRP A 1  406 ? -9.594  -14.177 189.389 1.00 47.28  ? 406  TRP A O     1 
ATOM   3323  C  CB    . TRP A 1  406 ? -12.070 -13.958 191.082 1.00 56.69  ? 406  TRP A CB    1 
ATOM   3324  C  CG    . TRP A 1  406 ? -12.968 -12.989 190.371 1.00 52.11  ? 406  TRP A CG    1 
ATOM   3325  C  CD1   . TRP A 1  406 ? -12.982 -12.713 189.034 1.00 51.71  ? 406  TRP A CD1   1 
ATOM   3326  C  CD2   . TRP A 1  406 ? -14.013 -12.199 190.953 1.00 71.27  ? 406  TRP A CD2   1 
ATOM   3327  N  NE1   . TRP A 1  406 ? -13.951 -11.782 188.752 1.00 57.71  ? 406  TRP A NE1   1 
ATOM   3328  C  CE2   . TRP A 1  406 ? -14.601 -11.452 189.912 1.00 69.33  ? 406  TRP A CE2   1 
ATOM   3329  C  CE3   . TRP A 1  406 ? -14.503 -12.044 192.256 1.00 71.45  ? 406  TRP A CE3   1 
ATOM   3330  C  CZ2   . TRP A 1  406 ? -15.656 -10.565 190.133 1.00 69.91  ? 406  TRP A CZ2   1 
ATOM   3331  C  CZ3   . TRP A 1  406 ? -15.550 -11.160 192.472 1.00 59.83  ? 406  TRP A CZ3   1 
ATOM   3332  C  CH2   . TRP A 1  406 ? -16.114 -10.433 191.416 1.00 60.30  ? 406  TRP A CH2   1 
ATOM   3333  N  N     . GLN A 1  407 ? -9.663  -11.952 189.691 1.00 45.79  ? 407  GLN A N     1 
ATOM   3334  C  CA    . GLN A 1  407 ? -8.767  -11.657 188.585 1.00 50.71  ? 407  GLN A CA    1 
ATOM   3335  C  C     . GLN A 1  407 ? -7.352  -11.392 189.080 1.00 56.37  ? 407  GLN A C     1 
ATOM   3336  O  O     . GLN A 1  407 ? -7.136  -10.919 190.200 1.00 52.27  ? 407  GLN A O     1 
ATOM   3337  C  CB    . GLN A 1  407 ? -9.263  -10.454 187.785 1.00 48.32  ? 407  GLN A CB    1 
ATOM   3338  C  CG    . GLN A 1  407 ? -10.673 -10.611 187.251 1.00 54.70  ? 407  GLN A CG    1 
ATOM   3339  C  CD    . GLN A 1  407 ? -10.840 -10.009 185.868 1.00 67.17  ? 407  GLN A CD    1 
ATOM   3340  O  OE1   . GLN A 1  407 ? -11.009 -10.731 184.886 1.00 68.36  ? 407  GLN A OE1   1 
ATOM   3341  N  NE2   . GLN A 1  407 ? -10.802 -8.680  185.786 1.00 72.29  ? 407  GLN A NE2   1 
ATOM   3342  N  N     . ALA A 1  408 ? -6.384  -11.729 188.237 1.00 51.35  ? 408  ALA A N     1 
ATOM   3343  C  CA    . ALA A 1  408 ? -4.998  -11.424 188.544 1.00 46.66  ? 408  ALA A CA    1 
ATOM   3344  C  C     . ALA A 1  408 ? -4.815  -9.914  188.518 1.00 47.52  ? 408  ALA A C     1 
ATOM   3345  O  O     . ALA A 1  408 ? -5.253  -9.242  187.579 1.00 53.61  ? 408  ALA A O     1 
ATOM   3346  C  CB    . ALA A 1  408 ? -4.066  -12.102 187.541 1.00 39.57  ? 408  ALA A CB    1 
ATOM   3347  N  N     . THR A 1  409 ? -4.187  -9.371  189.554 1.00 41.76  ? 409  THR A N     1 
ATOM   3348  C  CA    . THR A 1  409 ? -3.906  -7.947  189.568 1.00 48.46  ? 409  THR A CA    1 
ATOM   3349  C  C     . THR A 1  409 ? -2.623  -7.732  190.354 1.00 52.92  ? 409  THR A C     1 
ATOM   3350  O  O     . THR A 1  409 ? -2.226  -8.568  191.173 1.00 48.97  ? 409  THR A O     1 
ATOM   3351  C  CB    . THR A 1  409 ? -5.091  -7.150  190.141 1.00 43.70  ? 409  THR A CB    1 
ATOM   3352  O  OG1   . THR A 1  409 ? -4.856  -5.744  189.987 1.00 52.08  ? 409  THR A OG1   1 
ATOM   3353  C  CG2   . THR A 1  409 ? -5.312  -7.477  191.607 1.00 40.60  ? 409  THR A CG2   1 
ATOM   3354  N  N     . TRP A 1  410 ? -1.970  -6.601  190.090 1.00 48.45  ? 410  TRP A N     1 
ATOM   3355  C  CA    . TRP A 1  410 ? -0.673  -6.337  190.693 1.00 45.36  ? 410  TRP A CA    1 
ATOM   3356  C  C     . TRP A 1  410 ? -0.320  -4.865  190.567 1.00 46.89  ? 410  TRP A C     1 
ATOM   3357  O  O     . TRP A 1  410 ? -0.816  -4.156  189.686 1.00 46.20  ? 410  TRP A O     1 
ATOM   3358  C  CB    . TRP A 1  410 ? 0.400   -7.212  190.036 1.00 54.60  ? 410  TRP A CB    1 
ATOM   3359  C  CG    . TRP A 1  410 ? 1.765   -7.123  190.634 1.00 52.71  ? 410  TRP A CG    1 
ATOM   3360  C  CD1   . TRP A 1  410 ? 2.182   -7.669  191.806 1.00 53.01  ? 410  TRP A CD1   1 
ATOM   3361  C  CD2   . TRP A 1  410 ? 2.920   -6.519  190.040 1.00 51.05  ? 410  TRP A CD2   1 
ATOM   3362  N  NE1   . TRP A 1  410 ? 3.516   -7.410  192.006 1.00 40.70  ? 410  TRP A NE1   1 
ATOM   3363  C  CE2   . TRP A 1  410 ? 3.993   -6.706  190.933 1.00 48.09  ? 410  TRP A CE2   1 
ATOM   3364  C  CE3   . TRP A 1  410 ? 3.146   -5.822  188.849 1.00 51.33  ? 410  TRP A CE3   1 
ATOM   3365  C  CZ2   . TRP A 1  410 ? 5.271   -6.222  190.672 1.00 42.95  ? 410  TRP A CZ2   1 
ATOM   3366  C  CZ3   . TRP A 1  410 ? 4.415   -5.343  188.593 1.00 51.85  ? 410  TRP A CZ3   1 
ATOM   3367  C  CH2   . TRP A 1  410 ? 5.462   -5.549  189.498 1.00 43.38  ? 410  TRP A CH2   1 
ATOM   3368  N  N     . ILE A 1  411 ? 0.547   -4.417  191.470 1.00 48.94  ? 411  ILE A N     1 
ATOM   3369  C  CA    . ILE A 1  411 ? 1.117   -3.075  191.409 1.00 54.25  ? 411  ILE A CA    1 
ATOM   3370  C  C     . ILE A 1  411 ? 2.620   -3.167  191.664 1.00 51.71  ? 411  ILE A C     1 
ATOM   3371  O  O     . ILE A 1  411 ? 3.048   -3.821  192.627 1.00 52.22  ? 411  ILE A O     1 
ATOM   3372  C  CB    . ILE A 1  411 ? 0.420   -2.136  192.409 1.00 49.86  ? 411  ILE A CB    1 
ATOM   3373  C  CG1   . ILE A 1  411 ? -0.924  -1.674  191.850 1.00 47.95  ? 411  ILE A CG1   1 
ATOM   3374  C  CG2   . ILE A 1  411 ? 1.278   -0.927  192.722 1.00 54.64  ? 411  ILE A CG2   1 
ATOM   3375  C  CD1   . ILE A 1  411 ? -1.839  -1.075  192.886 1.00 52.47  ? 411  ILE A CD1   1 
ATOM   3376  N  N     . PRO A 1  412 ? 3.458   -2.551  190.823 1.00 54.58  ? 412  PRO A N     1 
ATOM   3377  C  CA    . PRO A 1  412 ? 4.911   -2.610  191.042 1.00 50.88  ? 412  PRO A CA    1 
ATOM   3378  C  C     . PRO A 1  412 ? 5.345   -1.864  192.295 1.00 54.16  ? 412  PRO A C     1 
ATOM   3379  O  O     . PRO A 1  412 ? 4.499   -1.323  193.013 1.00 54.20  ? 412  PRO A O     1 
ATOM   3380  C  CB    . PRO A 1  412 ? 5.474   -1.977  189.767 1.00 48.47  ? 412  PRO A CB    1 
ATOM   3381  C  CG    . PRO A 1  412 ? 4.438   -0.996  189.368 1.00 49.92  ? 412  PRO A CG    1 
ATOM   3382  C  CD    . PRO A 1  412 ? 3.108   -1.619  189.735 1.00 53.70  ? 412  PRO A CD    1 
ATOM   3383  N  N     . GLU A 1  413 ? 6.652   -1.852  192.572 1.00 59.82  ? 413  GLU A N     1 
ATOM   3384  C  CA    . GLU A 1  413 ? 7.170   -1.426  193.870 1.00 55.25  ? 413  GLU A CA    1 
ATOM   3385  C  C     . GLU A 1  413 ? 6.578   -0.082  194.278 1.00 55.58  ? 413  GLU A C     1 
ATOM   3386  O  O     . GLU A 1  413 ? 6.623   0.890   193.519 1.00 56.02  ? 413  GLU A O     1 
ATOM   3387  C  CB    . GLU A 1  413 ? 8.697   -1.344  193.827 1.00 59.25  ? 413  GLU A CB    1 
ATOM   3388  C  CG    . GLU A 1  413 ? 9.383   -1.932  195.056 1.00 63.53  ? 413  GLU A CG    1 
ATOM   3389  C  CD    . GLU A 1  413 ? 10.901  -1.933  194.950 1.00 66.11  ? 413  GLU A CD    1 
ATOM   3390  O  OE1   . GLU A 1  413 ? 11.430  -2.352  193.898 1.00 68.45  ? 413  GLU A OE1   1 
ATOM   3391  O  OE2   . GLU A 1  413 ? 11.565  -1.514  195.922 1.00 67.87  ? 413  GLU A OE2   1 
ATOM   3392  N  N     . TRP A 1  414 ? 5.999   -0.043  195.476 1.00 60.61  ? 414  TRP A N     1 
ATOM   3393  C  CA    . TRP A 1  414 ? 5.294   1.137   195.954 1.00 57.10  ? 414  TRP A CA    1 
ATOM   3394  C  C     . TRP A 1  414 ? 5.336   1.185   197.475 1.00 54.29  ? 414  TRP A C     1 
ATOM   3395  O  O     . TRP A 1  414 ? 5.595   0.181   198.143 1.00 44.83  ? 414  TRP A O     1 
ATOM   3396  C  CB    . TRP A 1  414 ? 3.840   1.119   195.463 1.00 69.82  ? 414  TRP A CB    1 
ATOM   3397  C  CG    . TRP A 1  414 ? 3.027   0.010   196.106 1.00 67.06  ? 414  TRP A CG    1 
ATOM   3398  C  CD1   . TRP A 1  414 ? 3.030   -1.313  195.758 1.00 60.64  ? 414  TRP A CD1   1 
ATOM   3399  C  CD2   . TRP A 1  414 ? 2.094   0.133   197.189 1.00 57.34  ? 414  TRP A CD2   1 
ATOM   3400  N  NE1   . TRP A 1  414 ? 2.172   -2.020  196.564 1.00 48.40  ? 414  TRP A NE1   1 
ATOM   3401  C  CE2   . TRP A 1  414 ? 1.582   -1.156  197.449 1.00 55.28  ? 414  TRP A CE2   1 
ATOM   3402  C  CE3   . TRP A 1  414 ? 1.645   1.206   197.965 1.00 62.91  ? 414  TRP A CE3   1 
ATOM   3403  C  CZ2   . TRP A 1  414 ? 0.638   -1.400  198.447 1.00 61.12  ? 414  TRP A CZ2   1 
ATOM   3404  C  CZ3   . TRP A 1  414 ? 0.710   0.961   198.959 1.00 67.56  ? 414  TRP A CZ3   1 
ATOM   3405  C  CH2   . TRP A 1  414 ? 0.218   -0.332  199.192 1.00 60.58  ? 414  TRP A CH2   1 
ATOM   3406  N  N     . GLU A 1  415 ? 5.050   2.369   198.017 1.00 73.34  ? 415  GLU A N     1 
ATOM   3407  C  CA    . GLU A 1  415 ? 4.959   2.544   199.457 1.00 78.53  ? 415  GLU A CA    1 
ATOM   3408  C  C     . GLU A 1  415 ? 3.795   3.462   199.803 1.00 78.14  ? 415  GLU A C     1 
ATOM   3409  O  O     . GLU A 1  415 ? 3.383   4.309   199.005 1.00 78.15  ? 415  GLU A O     1 
ATOM   3410  C  CB    . GLU A 1  415 ? 6.273   3.105   200.021 1.00 84.31  ? 415  GLU A CB    1 
ATOM   3411  C  CG    . GLU A 1  415 ? 6.536   4.559   199.655 1.00 90.38  ? 415  GLU A CG    1 
ATOM   3412  C  CD    . GLU A 1  415 ? 7.904   5.038   200.104 1.00 100.98 ? 415  GLU A CD    1 
ATOM   3413  O  OE1   . GLU A 1  415 ? 8.883   4.279   199.943 1.00 112.64 ? 415  GLU A OE1   1 
ATOM   3414  O  OE2   . GLU A 1  415 ? 8.002   6.175   200.611 1.00 100.77 ? 415  GLU A OE2   1 
ATOM   3415  N  N     . PHE A 1  416 ? 3.270   3.272   201.012 1.00 65.88  ? 416  PHE A N     1 
ATOM   3416  C  CA    . PHE A 1  416 ? 2.135   4.044   201.502 1.00 66.83  ? 416  PHE A CA    1 
ATOM   3417  C  C     . PHE A 1  416 ? 2.524   5.496   201.761 1.00 66.81  ? 416  PHE A C     1 
ATOM   3418  O  O     . PHE A 1  416 ? 3.507   5.764   202.457 1.00 77.48  ? 416  PHE A O     1 
ATOM   3419  C  CB    . PHE A 1  416 ? 1.601   3.409   202.784 1.00 66.18  ? 416  PHE A CB    1 
ATOM   3420  C  CG    . PHE A 1  416 ? 0.551   4.225   203.478 1.00 70.63  ? 416  PHE A CG    1 
ATOM   3421  C  CD1   . PHE A 1  416 ? -0.582  4.638   202.795 1.00 70.45  ? 416  PHE A CD1   1 
ATOM   3422  C  CD2   . PHE A 1  416 ? 0.691   4.577   204.809 1.00 69.38  ? 416  PHE A CD2   1 
ATOM   3423  C  CE1   . PHE A 1  416 ? -1.557  5.382   203.427 1.00 69.74  ? 416  PHE A CE1   1 
ATOM   3424  C  CE2   . PHE A 1  416 ? -0.280  5.325   205.446 1.00 69.88  ? 416  PHE A CE2   1 
ATOM   3425  C  CZ    . PHE A 1  416 ? -1.407  5.723   204.755 1.00 77.01  ? 416  PHE A CZ    1 
ATOM   3426  N  N     . VAL A 1  417 ? 1.765   6.439   201.207 1.00 65.29  ? 417  VAL A N     1 
ATOM   3427  C  CA    . VAL A 1  417 ? 1.910   7.848   201.563 1.00 68.58  ? 417  VAL A CA    1 
ATOM   3428  C  C     . VAL A 1  417 ? 0.634   8.284   202.277 1.00 74.95  ? 417  VAL A C     1 
ATOM   3429  O  O     . VAL A 1  417 ? -0.460  8.254   201.699 1.00 81.85  ? 417  VAL A O     1 
ATOM   3430  C  CB    . VAL A 1  417 ? 2.223   8.731   200.340 1.00 72.22  ? 417  VAL A CB    1 
ATOM   3431  C  CG1   . VAL A 1  417 ? 1.175   8.590   199.245 1.00 74.58  ? 417  VAL A CG1   1 
ATOM   3432  C  CG2   . VAL A 1  417 ? 2.355   10.186  200.762 1.00 75.23  ? 417  VAL A CG2   1 
ATOM   3433  N  N     . ASN A 1  418 ? 0.771   8.646   203.553 1.00 76.33  ? 418  ASN A N     1 
ATOM   3434  C  CA    . ASN A 1  418 ? -0.377  8.935   204.414 1.00 78.30  ? 418  ASN A CA    1 
ATOM   3435  C  C     . ASN A 1  418 ? -0.986  10.300  204.079 1.00 79.73  ? 418  ASN A C     1 
ATOM   3436  O  O     . ASN A 1  418 ? -0.889  11.266  204.837 1.00 85.59  ? 418  ASN A O     1 
ATOM   3437  C  CB    . ASN A 1  418 ? 0.028   8.853   205.879 1.00 80.65  ? 418  ASN A CB    1 
ATOM   3438  C  CG    . ASN A 1  418 ? -1.168  8.750   206.813 1.00 82.97  ? 418  ASN A CG    1 
ATOM   3439  O  OD1   . ASN A 1  418 ? -2.275  9.178   206.481 1.00 82.84  ? 418  ASN A OD1   1 
ATOM   3440  N  ND2   . ASN A 1  418 ? -0.947  8.181   207.993 1.00 86.83  ? 418  ASN A ND2   1 
ATOM   3441  N  N     . THR A 1  419 ? -1.615  10.382  202.910 1.00 70.50  ? 419  THR A N     1 
ATOM   3442  C  CA    . THR A 1  419 ? -2.229  11.637  202.473 1.00 66.18  ? 419  THR A CA    1 
ATOM   3443  C  C     . THR A 1  419 ? -3.705  11.415  202.184 1.00 73.79  ? 419  THR A C     1 
ATOM   3444  O  O     . THR A 1  419 ? -4.060  10.912  201.103 1.00 80.04  ? 419  THR A O     1 
ATOM   3445  C  CB    . THR A 1  419 ? -1.523  12.195  201.240 1.00 66.25  ? 419  THR A CB    1 
ATOM   3446  O  OG1   . THR A 1  419 ? -0.168  12.514  201.575 1.00 71.18  ? 419  THR A OG1   1 
ATOM   3447  C  CG2   . THR A 1  419 ? -2.230  13.455  200.753 1.00 68.66  ? 419  THR A CG2   1 
ATOM   3448  N  N     . PRO A 1  420 ? -4.607  11.755  203.118 1.00 70.47  ? 420  PRO A N     1 
ATOM   3449  C  CA    . PRO A 1  420 ? -6.056  11.632  202.924 1.00 70.66  ? 420  PRO A CA    1 
ATOM   3450  C  C     . PRO A 1  420 ? -6.553  12.358  201.671 1.00 70.39  ? 420  PRO A C     1 
ATOM   3451  O  O     . PRO A 1  420 ? -5.915  13.321  201.250 1.00 75.40  ? 420  PRO A O     1 
ATOM   3452  C  CB    . PRO A 1  420 ? -6.621  12.277  204.191 1.00 74.60  ? 420  PRO A CB    1 
ATOM   3453  C  CG    . PRO A 1  420 ? -5.583  11.987  205.221 1.00 74.05  ? 420  PRO A CG    1 
ATOM   3454  C  CD    . PRO A 1  420 ? -4.278  12.174  204.492 1.00 75.40  ? 420  PRO A CD    1 
ATOM   3455  N  N     . PRO A 1  421 ? -7.680  11.912  201.087 1.00 71.52  ? 421  PRO A N     1 
ATOM   3456  C  CA    . PRO A 1  421 ? -8.480  10.765  201.530 1.00 65.77  ? 421  PRO A CA    1 
ATOM   3457  C  C     . PRO A 1  421 ? -7.852  9.439   201.111 1.00 68.83  ? 421  PRO A C     1 
ATOM   3458  O  O     . PRO A 1  421 ? -7.519  9.254   199.939 1.00 68.44  ? 421  PRO A O     1 
ATOM   3459  C  CB    . PRO A 1  421 ? -9.821  10.982  200.831 1.00 62.79  ? 421  PRO A CB    1 
ATOM   3460  C  CG    . PRO A 1  421 ? -9.485  11.744  199.599 1.00 67.62  ? 421  PRO A CG    1 
ATOM   3461  C  CD    . PRO A 1  421 ? -8.260  12.568  199.900 1.00 69.04  ? 421  PRO A CD    1 
ATOM   3462  N  N     . LEU A 1  422 ? -7.693  8.528   202.066 1.00 60.98  ? 422  LEU A N     1 
ATOM   3463  C  CA    . LEU A 1  422 ? -7.101  7.235   201.762 1.00 56.16  ? 422  LEU A CA    1 
ATOM   3464  C  C     . LEU A 1  422 ? -8.083  6.338   201.017 1.00 57.96  ? 422  LEU A C     1 
ATOM   3465  O  O     . LEU A 1  422 ? -9.298  6.404   201.213 1.00 75.77  ? 422  LEU A O     1 
ATOM   3466  C  CB    . LEU A 1  422 ? -6.643  6.545   203.043 1.00 43.64  ? 422  LEU A CB    1 
ATOM   3467  C  CG    . LEU A 1  422 ? -5.687  7.359   203.912 1.00 55.82  ? 422  LEU A CG    1 
ATOM   3468  C  CD1   . LEU A 1  422 ? -5.201  6.529   205.087 1.00 65.36  ? 422  LEU A CD1   1 
ATOM   3469  C  CD2   . LEU A 1  422 ? -4.517  7.863   203.091 1.00 68.36  ? 422  LEU A CD2   1 
ATOM   3470  N  N     . VAL A 1  423 ? -7.537  5.504   200.143 1.00 53.42  ? 423  VAL A N     1 
ATOM   3471  C  CA    . VAL A 1  423 ? -8.303  4.460   199.474 1.00 52.31  ? 423  VAL A CA    1 
ATOM   3472  C  C     . VAL A 1  423 ? -8.475  3.278   200.418 1.00 59.75  ? 423  VAL A C     1 
ATOM   3473  O  O     . VAL A 1  423 ? -7.511  2.822   201.046 1.00 42.46  ? 423  VAL A O     1 
ATOM   3474  C  CB    . VAL A 1  423 ? -7.618  4.031   198.169 1.00 59.66  ? 423  VAL A CB    1 
ATOM   3475  C  CG1   . VAL A 1  423 ? -8.354  2.848   197.553 1.00 66.57  ? 423  VAL A CG1   1 
ATOM   3476  C  CG2   . VAL A 1  423 ? -7.565  5.200   197.196 1.00 64.87  ? 423  VAL A CG2   1 
ATOM   3477  N  N     . LYS A 1  424 ? -9.710  2.797   200.550 1.00 60.07  ? 424  LYS A N     1 
ATOM   3478  C  CA    . LYS A 1  424 ? -9.962  1.621   201.369 1.00 58.08  ? 424  LYS A CA    1 
ATOM   3479  C  C     . LYS A 1  424 ? -11.134 0.841   200.791 1.00 56.38  ? 424  LYS A C     1 
ATOM   3480  O  O     . LYS A 1  424 ? -11.873 1.325   199.930 1.00 57.72  ? 424  LYS A O     1 
ATOM   3481  C  CB    . LYS A 1  424 ? -10.251 2.009   202.822 1.00 58.59  ? 424  LYS A CB    1 
ATOM   3482  C  CG    . LYS A 1  424 ? -11.633 2.618   203.032 1.00 65.74  ? 424  LYS A CG    1 
ATOM   3483  C  CD    . LYS A 1  424 ? -11.900 2.905   204.506 1.00 71.68  ? 424  LYS A CD    1 
ATOM   3484  C  CE    . LYS A 1  424 ? -13.306 3.443   204.729 1.00 66.82  ? 424  LYS A CE    1 
ATOM   3485  N  NZ    . LYS A 1  424 ? -13.421 4.156   206.032 1.00 73.37  ? 424  LYS A NZ    1 
ATOM   3486  N  N     . LEU A 1  425 ? -11.300 -0.378  201.294 1.00 45.63  ? 425  LEU A N     1 
ATOM   3487  C  CA    . LEU A 1  425 ? -12.427 -1.221  200.932 1.00 42.64  ? 425  LEU A CA    1 
ATOM   3488  C  C     . LEU A 1  425 ? -13.550 -0.916  201.907 1.00 56.28  ? 425  LEU A C     1 
ATOM   3489  O  O     . LEU A 1  425 ? -13.319 -0.847  203.120 1.00 55.09  ? 425  LEU A O     1 
ATOM   3490  C  CB    . LEU A 1  425 ? -12.060 -2.703  200.980 1.00 47.12  ? 425  LEU A CB    1 
ATOM   3491  C  CG    . LEU A 1  425 ? -10.970 -3.193  200.030 1.00 47.36  ? 425  LEU A CG    1 
ATOM   3492  C  CD1   . LEU A 1  425 ? -10.622 -4.642  200.337 1.00 49.12  ? 425  LEU A CD1   1 
ATOM   3493  C  CD2   . LEU A 1  425 ? -11.414 -3.038  198.587 1.00 52.79  ? 425  LEU A CD2   1 
ATOM   3494  N  N     . TRP A 1  426 ? -14.759 -0.728  201.390 1.00 47.29  ? 426  TRP A N     1 
ATOM   3495  C  CA    . TRP A 1  426 ? -15.815 -0.217  202.246 1.00 46.54  ? 426  TRP A CA    1 
ATOM   3496  C  C     . TRP A 1  426 ? -16.615 -1.312  202.937 1.00 44.40  ? 426  TRP A C     1 
ATOM   3497  O  O     . TRP A 1  426 ? -17.338 -1.015  203.893 1.00 46.43  ? 426  TRP A O     1 
ATOM   3498  C  CB    . TRP A 1  426 ? -16.735 0.680   201.424 1.00 48.83  ? 426  TRP A CB    1 
ATOM   3499  C  CG    . TRP A 1  426 ? -16.034 1.930   201.019 1.00 56.34  ? 426  TRP A CG    1 
ATOM   3500  C  CD1   . TRP A 1  426 ? -15.246 2.105   199.920 1.00 61.61  ? 426  TRP A CD1   1 
ATOM   3501  C  CD2   . TRP A 1  426 ? -15.997 3.164   201.741 1.00 65.14  ? 426  TRP A CD2   1 
ATOM   3502  N  NE1   . TRP A 1  426 ? -14.748 3.384   199.894 1.00 67.48  ? 426  TRP A NE1   1 
ATOM   3503  C  CE2   . TRP A 1  426 ? -15.193 4.054   201.003 1.00 68.52  ? 426  TRP A CE2   1 
ATOM   3504  C  CE3   . TRP A 1  426 ? -16.581 3.609   202.930 1.00 70.21  ? 426  TRP A CE3   1 
ATOM   3505  C  CZ2   . TRP A 1  426 ? -14.957 5.363   201.416 1.00 72.70  ? 426  TRP A CZ2   1 
ATOM   3506  C  CZ3   . TRP A 1  426 ? -16.345 4.907   203.339 1.00 77.28  ? 426  TRP A CZ3   1 
ATOM   3507  C  CH2   . TRP A 1  426 ? -15.540 5.770   202.584 1.00 74.91  ? 426  TRP A CH2   1 
ATOM   3508  N  N     . TYR A 1  427 ? -16.465 -2.565  202.516 1.00 38.43  ? 427  TYR A N     1 
ATOM   3509  C  CA    . TYR A 1  427 ? -17.114 -3.689  203.175 1.00 40.05  ? 427  TYR A CA    1 
ATOM   3510  C  C     . TYR A 1  427 ? -16.427 -4.960  202.708 1.00 42.54  ? 427  TYR A C     1 
ATOM   3511  O  O     . TYR A 1  427 ? -15.743 -4.972  201.683 1.00 44.48  ? 427  TYR A O     1 
ATOM   3512  C  CB    . TYR A 1  427 ? -18.618 -3.730  202.872 1.00 44.66  ? 427  TYR A CB    1 
ATOM   3513  C  CG    . TYR A 1  427 ? -18.932 -3.788  201.395 1.00 34.11  ? 427  TYR A CG    1 
ATOM   3514  C  CD1   . TYR A 1  427 ? -19.069 -2.621  200.653 1.00 32.46  ? 427  TYR A CD1   1 
ATOM   3515  C  CD2   . TYR A 1  427 ? -19.097 -5.003  200.745 1.00 25.64  ? 427  TYR A CD2   1 
ATOM   3516  C  CE1   . TYR A 1  427 ? -19.360 -2.660  199.311 1.00 28.38  ? 427  TYR A CE1   1 
ATOM   3517  C  CE2   . TYR A 1  427 ? -19.379 -5.052  199.398 1.00 29.87  ? 427  TYR A CE2   1 
ATOM   3518  C  CZ    . TYR A 1  427 ? -19.509 -3.876  198.688 1.00 29.52  ? 427  TYR A CZ    1 
ATOM   3519  O  OH    . TYR A 1  427 ? -19.781 -3.915  197.343 1.00 33.64  ? 427  TYR A OH    1 
ATOM   3520  N  N     . GLN A 1  428 ? -16.627 -6.037  203.460 1.00 47.75  ? 428  GLN A N     1 
ATOM   3521  C  CA    . GLN A 1  428 ? -16.037 -7.315  203.091 1.00 49.28  ? 428  GLN A CA    1 
ATOM   3522  C  C     . GLN A 1  428 ? -17.031 -8.438  203.332 1.00 49.42  ? 428  GLN A C     1 
ATOM   3523  O  O     . GLN A 1  428 ? -17.571 -8.566  204.436 1.00 50.81  ? 428  GLN A O     1 
ATOM   3524  C  CB    . GLN A 1  428 ? -14.745 -7.558  203.882 1.00 55.12  ? 428  GLN A CB    1 
ATOM   3525  C  CG    . GLN A 1  428 ? -13.584 -8.081  203.045 1.00 59.80  ? 428  GLN A CG    1 
ATOM   3526  C  CD    . GLN A 1  428 ? -12.317 -8.275  203.860 1.00 62.47  ? 428  GLN A CD    1 
ATOM   3527  O  OE1   . GLN A 1  428 ? -11.890 -7.375  204.586 1.00 57.90  ? 428  GLN A OE1   1 
ATOM   3528  N  NE2   . GLN A 1  428 ? -11.716 -9.454  203.753 1.00 63.34  ? 428  GLN A NE2   1 
ATOM   3529  N  N     . LEU A 1  429 ? -17.278 -9.239  202.299 1.00 37.23  ? 429  LEU A N     1 
ATOM   3530  C  CA    . LEU A 1  429 ? -18.202 -10.354 202.437 1.00 38.80  ? 429  LEU A CA    1 
ATOM   3531  C  C     . LEU A 1  429 ? -17.545 -11.462 203.250 1.00 39.60  ? 429  LEU A C     1 
ATOM   3532  O  O     . LEU A 1  429 ? -16.341 -11.706 203.147 1.00 59.24  ? 429  LEU A O     1 
ATOM   3533  C  CB    . LEU A 1  429 ? -18.643 -10.878 201.073 1.00 36.97  ? 429  LEU A CB    1 
ATOM   3534  C  CG    . LEU A 1  429 ? -19.200 -9.822  200.117 1.00 31.14  ? 429  LEU A CG    1 
ATOM   3535  C  CD1   . LEU A 1  429 ? -19.565 -10.445 198.777 1.00 40.62  ? 429  LEU A CD1   1 
ATOM   3536  C  CD2   . LEU A 1  429 ? -20.387 -9.107  200.727 1.00 41.46  ? 429  LEU A CD2   1 
ATOM   3537  N  N     . GLU A 1  430 ? -18.353 -12.156 204.040 1.00 43.56  ? 430  GLU A N     1 
ATOM   3538  C  CA    . GLU A 1  430 ? -17.841 -13.267 204.827 1.00 52.24  ? 430  GLU A CA    1 
ATOM   3539  C  C     . GLU A 1  430 ? -17.429 -14.429 203.930 1.00 54.62  ? 430  GLU A C     1 
ATOM   3540  O  O     . GLU A 1  430 ? -17.926 -14.598 202.813 1.00 45.41  ? 430  GLU A O     1 
ATOM   3541  C  CB    . GLU A 1  430 ? -18.892 -13.731 205.833 1.00 39.69  ? 430  GLU A CB    1 
ATOM   3542  C  CG    . GLU A 1  430 ? -19.203 -12.696 206.887 1.00 43.82  ? 430  GLU A CG    1 
ATOM   3543  C  CD    . GLU A 1  430 ? -18.038 -12.458 207.821 1.00 51.96  ? 430  GLU A CD    1 
ATOM   3544  O  OE1   . GLU A 1  430 ? -17.604 -11.294 207.954 1.00 62.87  ? 430  GLU A OE1   1 
ATOM   3545  O  OE2   . GLU A 1  430 ? -17.581 -13.437 208.449 1.00 46.02  ? 430  GLU A OE2   1 
ATOM   3546  N  N     . LYS A 1  431 ? -16.489 -15.224 204.435 1.00 59.13  ? 431  LYS A N     1 
ATOM   3547  C  CA    . LYS A 1  431 ? -16.030 -16.414 203.737 1.00 67.62  ? 431  LYS A CA    1 
ATOM   3548  C  C     . LYS A 1  431 ? -16.890 -17.625 204.058 1.00 56.71  ? 431  LYS A C     1 
ATOM   3549  O  O     . LYS A 1  431 ? -17.044 -18.515 203.213 1.00 55.51  ? 431  LYS A O     1 
ATOM   3550  C  CB    . LYS A 1  431 ? -14.577 -16.706 204.134 1.00 84.21  ? 431  LYS A CB    1 
ATOM   3551  C  CG    . LYS A 1  431 ? -13.584 -15.578 203.838 1.00 80.25  ? 431  LYS A CG    1 
ATOM   3552  C  CD    . LYS A 1  431 ? -12.213 -15.874 204.451 1.00 86.17  ? 431  LYS A CD    1 
ATOM   3553  C  CE    . LYS A 1  431 ? -11.210 -14.759 204.175 1.00 75.11  ? 431  LYS A CE    1 
ATOM   3554  N  NZ    . LYS A 1  431 ? -10.101 -14.738 205.176 1.00 84.19  ? 431  LYS A NZ    1 
ATOM   3555  N  N     . GLU A 1  432 ? -17.467 -17.661 205.252 1.00 59.15  ? 432  GLU A N     1 
ATOM   3556  C  CA    . GLU A 1  432 ? -18.305 -18.744 205.732 1.00 63.14  ? 432  GLU A CA    1 
ATOM   3557  C  C     . GLU A 1  432 ? -19.654 -18.216 206.199 1.00 59.31  ? 432  GLU A C     1 
ATOM   3558  O  O     . GLU A 1  432 ? -19.763 -17.058 206.617 1.00 55.75  ? 432  GLU A O     1 
ATOM   3559  C  CB    . GLU A 1  432 ? -17.620 -19.507 206.874 1.00 64.84  ? 432  GLU A CB    1 
ATOM   3560  C  CG    . GLU A 1  432 ? -16.320 -20.168 206.456 1.00 65.37  ? 432  GLU A CG    1 
ATOM   3561  C  CD    . GLU A 1  432 ? -16.536 -21.320 205.494 1.00 68.20  ? 432  GLU A CD    1 
ATOM   3562  O  OE1   . GLU A 1  432 ? -17.567 -22.015 205.613 1.00 66.58  ? 432  GLU A OE1   1 
ATOM   3563  O  OE2   . GLU A 1  432 ? -15.671 -21.532 204.619 1.00 78.96  ? 432  GLU A OE2   1 
ATOM   3564  N  N     . PRO A 1  433 ? -20.706 -19.033 206.094 1.00 55.63  ? 433  PRO A N     1 
ATOM   3565  C  CA    . PRO A 1  433 ? -22.013 -18.642 206.638 1.00 54.01  ? 433  PRO A CA    1 
ATOM   3566  C  C     . PRO A 1  433 ? -21.921 -18.279 208.115 1.00 53.19  ? 433  PRO A C     1 
ATOM   3567  O  O     . PRO A 1  433 ? -21.133 -18.849 208.873 1.00 60.18  ? 433  PRO A O     1 
ATOM   3568  C  CB    . PRO A 1  433 ? -22.878 -19.888 206.416 1.00 55.21  ? 433  PRO A CB    1 
ATOM   3569  C  CG    . PRO A 1  433 ? -21.896 -21.014 206.255 1.00 54.80  ? 433  PRO A CG    1 
ATOM   3570  C  CD    . PRO A 1  433 ? -20.734 -20.397 205.542 1.00 60.29  ? 433  PRO A CD    1 
ATOM   3571  N  N     . ILE A 1  434 ? -22.738 -17.306 208.513 1.00 53.52  ? 434  ILE A N     1 
ATOM   3572  C  CA    . ILE A 1  434 ? -22.721 -16.758 209.866 1.00 54.40  ? 434  ILE A CA    1 
ATOM   3573  C  C     . ILE A 1  434 ? -23.686 -17.534 210.758 1.00 59.54  ? 434  ILE A C     1 
ATOM   3574  O  O     . ILE A 1  434 ? -24.902 -17.513 210.549 1.00 63.87  ? 434  ILE A O     1 
ATOM   3575  C  CB    . ILE A 1  434 ? -23.086 -15.270 209.845 1.00 49.89  ? 434  ILE A CB    1 
ATOM   3576  C  CG1   . ILE A 1  434 ? -22.303 -14.566 208.736 1.00 44.14  ? 434  ILE A CG1   1 
ATOM   3577  C  CG2   . ILE A 1  434 ? -22.849 -14.638 211.211 1.00 36.97  ? 434  ILE A CG2   1 
ATOM   3578  C  CD1   . ILE A 1  434 ? -22.855 -13.224 208.362 1.00 45.65  ? 434  ILE A CD1   1 
ATOM   3579  N  N     . VAL A 1  435 ? -23.130 -18.224 211.757 1.00 57.88  ? 435  VAL A N     1 
ATOM   3580  C  CA    . VAL A 1  435 ? -23.931 -18.912 212.765 1.00 61.29  ? 435  VAL A CA    1 
ATOM   3581  C  C     . VAL A 1  435 ? -24.798 -17.914 213.518 1.00 68.19  ? 435  VAL A C     1 
ATOM   3582  O  O     . VAL A 1  435 ? -24.311 -16.883 214.003 1.00 54.04  ? 435  VAL A O     1 
ATOM   3583  C  CB    . VAL A 1  435 ? -23.026 -19.693 213.728 1.00 67.81  ? 435  VAL A CB    1 
ATOM   3584  C  CG1   . VAL A 1  435 ? -23.865 -20.425 214.764 1.00 64.61  ? 435  VAL A CG1   1 
ATOM   3585  C  CG2   . VAL A 1  435 ? -22.151 -20.669 212.963 1.00 72.67  ? 435  VAL A CG2   1 
ATOM   3586  N  N     . GLY A 1  436 ? -26.090 -18.223 213.639 1.00 71.92  ? 436  GLY A N     1 
ATOM   3587  C  CA    . GLY A 1  436 ? -26.995 -17.354 214.359 1.00 65.49  ? 436  GLY A CA    1 
ATOM   3588  C  C     . GLY A 1  436 ? -27.449 -16.112 213.627 1.00 65.72  ? 436  GLY A C     1 
ATOM   3589  O  O     . GLY A 1  436 ? -28.172 -15.300 214.219 1.00 72.88  ? 436  GLY A O     1 
ATOM   3590  N  N     . ALA A 1  437 ? -27.060 -15.926 212.370 1.00 61.86  ? 437  ALA A N     1 
ATOM   3591  C  CA    . ALA A 1  437 ? -27.637 -14.857 211.570 1.00 63.66  ? 437  ALA A CA    1 
ATOM   3592  C  C     . ALA A 1  437 ? -28.806 -15.383 210.747 1.00 64.38  ? 437  ALA A C     1 
ATOM   3593  O  O     . ALA A 1  437 ? -28.792 -16.522 210.269 1.00 61.15  ? 437  ALA A O     1 
ATOM   3594  C  CB    . ALA A 1  437 ? -26.583 -14.243 210.648 1.00 56.38  ? 437  ALA A CB    1 
ATOM   3595  N  N     . GLU A 1  438 ? -29.822 -14.539 210.600 1.00 53.64  ? 438  GLU A N     1 
ATOM   3596  C  CA    . GLU A 1  438 ? -31.013 -14.897 209.844 1.00 58.20  ? 438  GLU A CA    1 
ATOM   3597  C  C     . GLU A 1  438 ? -30.639 -15.174 208.390 1.00 51.74  ? 438  GLU A C     1 
ATOM   3598  O  O     . GLU A 1  438 ? -29.920 -14.390 207.765 1.00 51.02  ? 438  GLU A O     1 
ATOM   3599  C  CB    . GLU A 1  438 ? -32.030 -13.760 209.974 1.00 62.26  ? 438  GLU A CB    1 
ATOM   3600  C  CG    . GLU A 1  438 ? -33.484 -14.104 209.716 1.00 54.68  ? 438  GLU A CG    1 
ATOM   3601  C  CD    . GLU A 1  438 ? -34.409 -12.946 210.078 1.00 60.83  ? 438  GLU A CD    1 
ATOM   3602  O  OE1   . GLU A 1  438 ? -33.988 -12.074 210.867 1.00 66.76  ? 438  GLU A OE1   1 
ATOM   3603  O  OE2   . GLU A 1  438 ? -35.553 -12.898 209.585 1.00 61.55  ? 438  GLU A OE2   1 
ATOM   3604  N  N     . THR A 1  439 ? -31.110 -16.302 207.855 1.00 50.09  ? 439  THR A N     1 
ATOM   3605  C  CA    . THR A 1  439 ? -30.899 -16.627 206.449 1.00 48.81  ? 439  THR A CA    1 
ATOM   3606  C  C     . THR A 1  439 ? -32.067 -16.123 205.603 1.00 42.86  ? 439  THR A C     1 
ATOM   3607  O  O     . THR A 1  439 ? -33.198 -16.591 205.760 1.00 45.14  ? 439  THR A O     1 
ATOM   3608  C  CB    . THR A 1  439 ? -30.747 -18.140 206.295 1.00 47.90  ? 439  THR A CB    1 
ATOM   3609  O  OG1   . THR A 1  439 ? -29.689 -18.603 207.144 1.00 47.17  ? 439  THR A OG1   1 
ATOM   3610  C  CG2   . THR A 1  439 ? -30.420 -18.497 204.860 1.00 45.63  ? 439  THR A CG2   1 
ATOM   3611  N  N     . PHE A 1  440 ? -31.786 -15.193 204.691 1.00 43.43  ? 440  PHE A N     1 
ATOM   3612  C  CA    . PHE A 1  440 ? -32.760 -14.690 203.722 1.00 36.56  ? 440  PHE A CA    1 
ATOM   3613  C  C     . PHE A 1  440 ? -32.579 -15.371 202.366 1.00 41.29  ? 440  PHE A C     1 
ATOM   3614  O  O     . PHE A 1  440 ? -31.579 -15.132 201.683 1.00 47.07  ? 440  PHE A O     1 
ATOM   3615  C  CB    . PHE A 1  440 ? -32.630 -13.176 203.573 1.00 37.39  ? 440  PHE A CB    1 
ATOM   3616  C  CG    . PHE A 1  440 ? -33.113 -12.403 204.763 1.00 39.43  ? 440  PHE A CG    1 
ATOM   3617  C  CD1   . PHE A 1  440 ? -32.461 -12.498 205.980 1.00 41.02  ? 440  PHE A CD1   1 
ATOM   3618  C  CD2   . PHE A 1  440 ? -34.213 -11.567 204.661 1.00 48.54  ? 440  PHE A CD2   1 
ATOM   3619  C  CE1   . PHE A 1  440 ? -32.900 -11.780 207.077 1.00 55.53  ? 440  PHE A CE1   1 
ATOM   3620  C  CE2   . PHE A 1  440 ? -34.659 -10.846 205.754 1.00 49.25  ? 440  PHE A CE2   1 
ATOM   3621  C  CZ    . PHE A 1  440 ? -34.002 -10.953 206.965 1.00 53.84  ? 440  PHE A CZ    1 
ATOM   3622  N  N     . TYR A 1  441 ? -33.533 -16.205 201.961 1.00 44.26  ? 441  TYR A N     1 
ATOM   3623  C  CA    . TYR A 1  441 ? -33.560 -16.723 200.593 1.00 43.57  ? 441  TYR A CA    1 
ATOM   3624  C  C     . TYR A 1  441 ? -34.318 -15.738 199.702 1.00 44.20  ? 441  TYR A C     1 
ATOM   3625  O  O     . TYR A 1  441 ? -35.538 -15.599 199.827 1.00 50.75  ? 441  TYR A O     1 
ATOM   3626  C  CB    . TYR A 1  441 ? -34.191 -18.112 200.530 1.00 44.14  ? 441  TYR A CB    1 
ATOM   3627  C  CG    . TYR A 1  441 ? -33.510 -19.179 201.359 1.00 45.21  ? 441  TYR A CG    1 
ATOM   3628  C  CD1   . TYR A 1  441 ? -33.687 -19.249 202.734 1.00 47.81  ? 441  TYR A CD1   1 
ATOM   3629  C  CD2   . TYR A 1  441 ? -32.723 -20.150 200.749 1.00 47.93  ? 441  TYR A CD2   1 
ATOM   3630  C  CE1   . TYR A 1  441 ? -33.069 -20.239 203.483 1.00 54.36  ? 441  TYR A CE1   1 
ATOM   3631  C  CE2   . TYR A 1  441 ? -32.106 -21.144 201.486 1.00 49.28  ? 441  TYR A CE2   1 
ATOM   3632  C  CZ    . TYR A 1  441 ? -32.281 -21.183 202.853 1.00 55.68  ? 441  TYR A CZ    1 
ATOM   3633  O  OH    . TYR A 1  441 ? -31.674 -22.171 203.593 1.00 51.25  ? 441  TYR A OH    1 
ATOM   3634  N  N     . VAL A 1  442 ? -33.600 -15.045 198.806 1.00 39.97  ? 442  VAL A N     1 
ATOM   3635  C  CA    . VAL A 1  442 ? -34.187 -13.985 197.986 1.00 37.56  ? 442  VAL A CA    1 
ATOM   3636  C  C     . VAL A 1  442 ? -34.425 -14.509 196.577 1.00 46.03  ? 442  VAL A C     1 
ATOM   3637  O  O     . VAL A 1  442 ? -33.737 -15.426 196.106 1.00 51.23  ? 442  VAL A O     1 
ATOM   3638  C  CB    . VAL A 1  442 ? -33.314 -12.713 197.960 1.00 39.79  ? 442  VAL A CB    1 
ATOM   3639  C  CG1   . VAL A 1  442 ? -32.916 -12.322 199.367 1.00 49.48  ? 442  VAL A CG1   1 
ATOM   3640  C  CG2   . VAL A 1  442 ? -32.089 -12.919 197.089 1.00 47.90  ? 442  VAL A CG2   1 
ATOM   3641  N  N     . ASP A 1  443 ? -35.415 -13.923 195.900 1.00 47.62  ? 443  ASP A N     1 
ATOM   3642  C  CA    . ASP A 1  443 ? -35.615 -14.084 194.463 1.00 48.26  ? 443  ASP A CA    1 
ATOM   3643  C  C     . ASP A 1  443 ? -36.485 -12.959 193.924 1.00 48.83  ? 443  ASP A C     1 
ATOM   3644  O  O     . ASP A 1  443 ? -37.153 -12.243 194.676 1.00 48.59  ? 443  ASP A O     1 
ATOM   3645  C  CB    . ASP A 1  443 ? -36.242 -15.433 194.089 1.00 52.69  ? 443  ASP A CB    1 
ATOM   3646  C  CG    . ASP A 1  443 ? -36.040 -15.774 192.614 1.00 54.14  ? 443  ASP A CG    1 
ATOM   3647  O  OD1   . ASP A 1  443 ? -35.069 -15.263 192.024 1.00 72.49  ? 443  ASP A OD1   1 
ATOM   3648  O  OD2   . ASP A 1  443 ? -36.840 -16.538 192.038 1.00 62.64  ? 443  ASP A OD2   1 
ATOM   3649  N  N     . GLY A 1  444 ? -36.403 -12.773 192.611 1.00 44.22  ? 444  GLY A N     1 
ATOM   3650  C  CA    . GLY A 1  444 ? -37.107 -11.718 191.915 1.00 51.94  ? 444  GLY A CA    1 
ATOM   3651  C  C     . GLY A 1  444 ? -37.438 -12.188 190.513 1.00 56.28  ? 444  GLY A C     1 
ATOM   3652  O  O     . GLY A 1  444 ? -36.651 -12.930 189.916 1.00 62.80  ? 444  GLY A O     1 
ATOM   3653  N  N     . ALA A 1  445 ? -38.601 -11.814 189.982 1.00 58.27  ? 445  ALA A N     1 
ATOM   3654  C  CA    . ALA A 1  445 ? -38.909 -12.109 188.590 1.00 65.96  ? 445  ALA A CA    1 
ATOM   3655  C  C     . ALA A 1  445 ? -39.706 -10.969 187.978 1.00 55.50  ? 445  ALA A C     1 
ATOM   3656  O  O     . ALA A 1  445 ? -40.455 -10.275 188.669 1.00 54.05  ? 445  ALA A O     1 
ATOM   3657  C  CB    . ALA A 1  445 ? -39.695 -13.421 188.459 1.00 65.14  ? 445  ALA A CB    1 
ATOM   3658  N  N     . ALA A 1  446 ? -39.548 -10.792 186.667 1.00 58.70  ? 446  ALA A N     1 
ATOM   3659  C  CA    . ALA A 1  446 ? -40.332 -9.831  185.908 1.00 67.22  ? 446  ALA A CA    1 
ATOM   3660  C  C     . ALA A 1  446 ? -40.978 -10.523 184.715 1.00 81.87  ? 446  ALA A C     1 
ATOM   3661  O  O     . ALA A 1  446 ? -40.485 -11.537 184.215 1.00 83.61  ? 446  ALA A O     1 
ATOM   3662  C  CB    . ALA A 1  446 ? -39.476 -8.648  185.435 1.00 64.18  ? 446  ALA A CB    1 
ATOM   3663  N  N     . ASN A 1  447 ? -42.080 -9.941  184.247 1.00 75.88  ? 447  ASN A N     1 
ATOM   3664  C  CA    . ASN A 1  447 ? -42.783 -10.429 183.067 1.00 86.63  ? 447  ASN A CA    1 
ATOM   3665  C  C     . ASN A 1  447 ? -42.257 -9.731  181.819 1.00 92.60  ? 447  ASN A C     1 
ATOM   3666  O  O     . ASN A 1  447 ? -42.347 -8.504  181.708 1.00 89.41  ? 447  ASN A O     1 
ATOM   3667  C  CB    . ASN A 1  447 ? -44.290 -10.220 183.197 1.00 102.33 ? 447  ASN A CB    1 
ATOM   3668  C  CG    . ASN A 1  447 ? -45.065 -10.872 182.065 1.00 105.87 ? 447  ASN A CG    1 
ATOM   3669  O  OD1   . ASN A 1  447 ? -45.124 -10.347 180.952 1.00 100.61 ? 447  ASN A OD1   1 
ATOM   3670  N  ND2   . ASN A 1  447 ? -45.657 -12.029 182.342 1.00 108.87 ? 447  ASN A ND2   1 
ATOM   3671  N  N     . ARG A 1  448 ? -41.680 -10.514 180.902 1.00 105.16 ? 448  ARG A N     1 
ATOM   3672  C  CA    . ARG A 1  448 ? -40.991 -9.951  179.743 1.00 109.09 ? 448  ARG A CA    1 
ATOM   3673  C  C     . ARG A 1  448 ? -41.883 -9.004  178.945 1.00 112.38 ? 448  ARG A C     1 
ATOM   3674  O  O     . ARG A 1  448 ? -41.397 -8.006  178.398 1.00 110.95 ? 448  ARG A O     1 
ATOM   3675  C  CB    . ARG A 1  448 ? -40.499 -11.096 178.849 1.00 110.31 ? 448  ARG A CB    1 
ATOM   3676  C  CG    . ARG A 1  448 ? -39.670 -10.694 177.636 1.00 114.59 ? 448  ARG A CG    1 
ATOM   3677  C  CD    . ARG A 1  448 ? -38.736 -11.828 177.213 1.00 121.04 ? 448  ARG A CD    1 
ATOM   3678  N  NE    . ARG A 1  448 ? -38.342 -11.718 175.810 1.00 128.42 ? 448  ARG A NE    1 
ATOM   3679  C  CZ    . ARG A 1  448 ? -37.590 -12.607 175.168 1.00 130.92 ? 448  ARG A CZ    1 
ATOM   3680  N  NH1   . ARG A 1  448 ? -37.134 -13.679 175.803 1.00 131.59 ? 448  ARG A NH1   1 
ATOM   3681  N  NH2   . ARG A 1  448 ? -37.292 -12.424 173.888 1.00 124.91 ? 448  ARG A NH2   1 
ATOM   3682  N  N     . GLU A 1  449 ? -43.185 -9.290  178.875 1.00 111.10 ? 449  GLU A N     1 
ATOM   3683  C  CA    . GLU A 1  449 ? -44.135 -8.478  178.120 1.00 110.07 ? 449  GLU A CA    1 
ATOM   3684  C  C     . GLU A 1  449 ? -44.688 -7.295  178.916 1.00 107.51 ? 449  GLU A C     1 
ATOM   3685  O  O     . GLU A 1  449 ? -44.657 -6.157  178.439 1.00 107.29 ? 449  GLU A O     1 
ATOM   3686  C  CB    . GLU A 1  449 ? -45.287 -9.360  177.620 1.00 113.53 ? 449  GLU A CB    1 
ATOM   3687  C  CG    . GLU A 1  449 ? -44.871 -10.733 177.079 1.00 113.64 ? 449  GLU A CG    1 
ATOM   3688  C  CD    . GLU A 1  449 ? -44.136 -10.685 175.740 1.00 116.36 ? 449  GLU A CD    1 
ATOM   3689  O  OE1   . GLU A 1  449 ? -43.595 -9.622  175.365 1.00 114.01 ? 449  GLU A OE1   1 
ATOM   3690  O  OE2   . GLU A 1  449 ? -44.101 -11.729 175.055 1.00 117.34 ? 449  GLU A OE2   1 
ATOM   3691  N  N     . THR A 1  450 ? -45.215 -7.552  180.119 1.00 102.45 ? 450  THR A N     1 
ATOM   3692  C  CA    . THR A 1  450 ? -45.769 -6.479  180.944 1.00 93.13  ? 450  THR A CA    1 
ATOM   3693  C  C     . THR A 1  450 ? -44.703 -5.519  181.452 1.00 102.88 ? 450  THR A C     1 
ATOM   3694  O  O     . THR A 1  450 ? -45.009 -4.350  181.721 1.00 94.22  ? 450  THR A O     1 
ATOM   3695  C  CB    . THR A 1  450 ? -46.528 -7.059  182.139 1.00 92.63  ? 450  THR A CB    1 
ATOM   3696  O  OG1   . THR A 1  450 ? -46.794 -8.449  181.916 1.00 101.65 ? 450  THR A OG1   1 
ATOM   3697  C  CG2   . THR A 1  450 ? -47.837 -6.318  182.353 1.00 87.81  ? 450  THR A CG2   1 
ATOM   3698  N  N     . LYS A 1  451 ? -43.465 -5.996  181.615 1.00 95.48  ? 451  LYS A N     1 
ATOM   3699  C  CA    . LYS A 1  451 ? -42.425 -5.293  182.372 1.00 87.44  ? 451  LYS A CA    1 
ATOM   3700  C  C     . LYS A 1  451 ? -42.870 -5.032  183.809 1.00 83.61  ? 451  LYS A C     1 
ATOM   3701  O  O     . LYS A 1  451 ? -42.442 -4.065  184.443 1.00 79.82  ? 451  LYS A O     1 
ATOM   3702  C  CB    . LYS A 1  451 ? -42.018 -3.987  181.683 1.00 87.57  ? 451  LYS A CB    1 
ATOM   3703  C  CG    . LYS A 1  451 ? -41.468 -4.187  180.280 1.00 87.53  ? 451  LYS A CG    1 
ATOM   3704  C  CD    . LYS A 1  451 ? -40.830 -2.920  179.736 1.00 96.23  ? 451  LYS A CD    1 
ATOM   3705  C  CE    . LYS A 1  451 ? -40.209 -3.167  178.370 1.00 98.53  ? 451  LYS A CE    1 
ATOM   3706  N  NZ    . LYS A 1  451 ? -40.506 -4.541  177.873 1.00 99.12  ? 451  LYS A NZ    1 
ATOM   3707  N  N     . LEU A 1  452 ? -43.735 -5.902  184.323 1.00 83.79  ? 452  LEU A N     1 
ATOM   3708  C  CA    . LEU A 1  452 ? -44.177 -5.895  185.709 1.00 76.88  ? 452  LEU A CA    1 
ATOM   3709  C  C     . LEU A 1  452 ? -43.510 -7.038  186.462 1.00 70.97  ? 452  LEU A C     1 
ATOM   3710  O  O     . LEU A 1  452 ? -43.299 -8.116  185.898 1.00 77.64  ? 452  LEU A O     1 
ATOM   3711  C  CB    . LEU A 1  452 ? -45.699 -6.052  185.786 1.00 81.93  ? 452  LEU A CB    1 
ATOM   3712  C  CG    . LEU A 1  452 ? -46.579 -4.830  185.521 1.00 83.02  ? 452  LEU A CG    1 
ATOM   3713  C  CD1   . LEU A 1  452 ? -48.037 -5.156  185.803 1.00 89.98  ? 452  LEU A CD1   1 
ATOM   3714  C  CD2   . LEU A 1  452 ? -46.128 -3.652  186.351 1.00 81.35  ? 452  LEU A CD2   1 
ATOM   3715  N  N     . GLY A 1  453 ? -43.169 -6.812  187.732 1.00 62.44  ? 453  GLY A N     1 
ATOM   3716  C  CA    . GLY A 1  453 ? -42.406 -7.816  188.443 1.00 68.22  ? 453  GLY A CA    1 
ATOM   3717  C  C     . GLY A 1  453 ? -42.690 -7.848  189.931 1.00 69.06  ? 453  GLY A C     1 
ATOM   3718  O  O     . GLY A 1  453 ? -43.453 -7.039  190.464 1.00 59.57  ? 453  GLY A O     1 
ATOM   3719  N  N     . LYS A 1  454 ? -42.051 -8.808  190.603 1.00 62.81  ? 454  LYS A N     1 
ATOM   3720  C  CA    . LYS A 1  454 ? -42.074 -8.910  192.055 1.00 61.92  ? 454  LYS A CA    1 
ATOM   3721  C  C     . LYS A 1  454 ? -40.684 -9.232  192.586 1.00 58.43  ? 454  LYS A C     1 
ATOM   3722  O  O     . LYS A 1  454 ? -39.887 -9.899  191.921 1.00 59.53  ? 454  LYS A O     1 
ATOM   3723  C  CB    . LYS A 1  454 ? -43.055 -9.989  192.524 1.00 63.04  ? 454  LYS A CB    1 
ATOM   3724  C  CG    . LYS A 1  454 ? -44.517 -9.612  192.401 1.00 68.91  ? 454  LYS A CG    1 
ATOM   3725  C  CD    . LYS A 1  454 ? -45.385 -10.850 192.537 1.00 68.90  ? 454  LYS A CD    1 
ATOM   3726  C  CE    . LYS A 1  454 ? -46.859 -10.511 192.528 1.00 68.64  ? 454  LYS A CE    1 
ATOM   3727  N  NZ    . LYS A 1  454 ? -47.655 -11.662 193.027 1.00 79.02  ? 454  LYS A NZ    1 
ATOM   3728  N  N     . ALA A 1  455 ? -40.405 -8.754  193.797 1.00 51.45  ? 455  ALA A N     1 
ATOM   3729  C  CA    . ALA A 1  455 ? -39.197 -9.094  194.537 1.00 52.73  ? 455  ALA A CA    1 
ATOM   3730  C  C     . ALA A 1  455 ? -39.589 -9.480  195.954 1.00 51.40  ? 455  ALA A C     1 
ATOM   3731  O  O     . ALA A 1  455 ? -40.463 -8.846  196.550 1.00 49.76  ? 455  ALA A O     1 
ATOM   3732  C  CB    . ALA A 1  455 ? -38.199 -7.933  194.564 1.00 47.96  ? 455  ALA A CB    1 
ATOM   3733  N  N     . GLY A 1  456 ? -38.944 -10.503 196.499 1.00 52.00  ? 456  GLY A N     1 
ATOM   3734  C  CA    . GLY A 1  456 ? -39.213 -10.838 197.882 1.00 49.57  ? 456  GLY A CA    1 
ATOM   3735  C  C     . GLY A 1  456 ? -38.200 -11.800 198.461 1.00 50.31  ? 456  GLY A C     1 
ATOM   3736  O  O     . GLY A 1  456 ? -37.148 -12.057 197.875 1.00 51.94  ? 456  GLY A O     1 
ATOM   3737  N  N     . TYR A 1  457 ? -38.555 -12.349 199.623 1.00 46.89  ? 457  TYR A N     1 
ATOM   3738  C  CA    . TYR A 1  457 ? -37.713 -13.307 200.325 1.00 44.78  ? 457  TYR A CA    1 
ATOM   3739  C  C     . TYR A 1  457 ? -38.537 -14.111 201.321 1.00 47.64  ? 457  TYR A C     1 
ATOM   3740  O  O     . TYR A 1  457 ? -39.627 -13.703 201.730 1.00 56.74  ? 457  TYR A O     1 
ATOM   3741  C  CB    . TYR A 1  457 ? -36.566 -12.579 201.039 1.00 48.85  ? 457  TYR A CB    1 
ATOM   3742  C  CG    . TYR A 1  457 ? -37.038 -11.575 202.079 1.00 48.74  ? 457  TYR A CG    1 
ATOM   3743  C  CD1   . TYR A 1  457 ? -37.585 -11.980 203.295 1.00 47.65  ? 457  TYR A CD1   1 
ATOM   3744  C  CD2   . TYR A 1  457 ? -36.966 -10.213 201.820 1.00 46.25  ? 457  TYR A CD2   1 
ATOM   3745  C  CE1   . TYR A 1  457 ? -38.032 -11.052 204.223 1.00 43.70  ? 457  TYR A CE1   1 
ATOM   3746  C  CE2   . TYR A 1  457 ? -37.404 -9.283  202.742 1.00 40.52  ? 457  TYR A CE2   1 
ATOM   3747  C  CZ    . TYR A 1  457 ? -37.933 -9.706  203.938 1.00 37.54  ? 457  TYR A CZ    1 
ATOM   3748  O  OH    . TYR A 1  457 ? -38.360 -8.775  204.848 1.00 40.22  ? 457  TYR A OH    1 
ATOM   3749  N  N     . VAL A 1  458 ? -37.991 -15.262 201.711 1.00 53.53  ? 458  VAL A N     1 
ATOM   3750  C  CA    . VAL A 1  458 ? -38.478 -16.030 202.848 1.00 53.00  ? 458  VAL A CA    1 
ATOM   3751  C  C     . VAL A 1  458 ? -37.287 -16.324 203.752 1.00 49.06  ? 458  VAL A C     1 
ATOM   3752  O  O     . VAL A 1  458 ? -36.139 -16.365 203.301 1.00 49.88  ? 458  VAL A O     1 
ATOM   3753  C  CB    . VAL A 1  458 ? -39.190 -17.334 202.408 1.00 52.08  ? 458  VAL A CB    1 
ATOM   3754  C  CG1   . VAL A 1  458 ? -38.213 -18.280 201.734 1.00 55.84  ? 458  VAL A CG1   1 
ATOM   3755  C  CG2   . VAL A 1  458 ? -39.890 -18.009 203.583 1.00 64.33  ? 458  VAL A CG2   1 
ATOM   3756  N  N     . THR A 1  459 ? -37.561 -16.508 205.038 1.00 50.42  ? 459  THR A N     1 
ATOM   3757  C  CA    . THR A 1  459 ? -36.533 -16.529 206.064 1.00 40.17  ? 459  THR A CA    1 
ATOM   3758  C  C     . THR A 1  459 ? -36.693 -17.790 206.907 1.00 46.47  ? 459  THR A C     1 
ATOM   3759  O  O     . THR A 1  459 ? -37.775 -18.376 206.969 1.00 69.43  ? 459  THR A O     1 
ATOM   3760  C  CB    . THR A 1  459 ? -36.637 -15.240 206.910 1.00 48.54  ? 459  THR A CB    1 
ATOM   3761  O  OG1   . THR A 1  459 ? -35.671 -14.282 206.459 1.00 53.93  ? 459  THR A OG1   1 
ATOM   3762  C  CG2   . THR A 1  459 ? -36.482 -15.492 208.394 1.00 45.03  ? 459  THR A CG2   1 
ATOM   3763  N  N     . ASN A 1  460 ? -35.607 -18.219 207.559 1.00 51.20  ? 460  ASN A N     1 
ATOM   3764  C  CA    . ASN A 1  460 ? -35.674 -19.460 208.323 1.00 56.56  ? 460  ASN A CA    1 
ATOM   3765  C  C     . ASN A 1  460 ? -36.525 -19.319 209.578 1.00 50.72  ? 460  ASN A C     1 
ATOM   3766  O  O     . ASN A 1  460 ? -36.840 -20.329 210.215 1.00 47.01  ? 460  ASN A O     1 
ATOM   3767  C  CB    . ASN A 1  460 ? -34.272 -19.924 208.722 1.00 52.26  ? 460  ASN A CB    1 
ATOM   3768  C  CG    . ASN A 1  460 ? -33.563 -18.925 209.618 1.00 50.13  ? 460  ASN A CG    1 
ATOM   3769  O  OD1   . ASN A 1  460 ? -33.306 -17.787 209.223 1.00 45.18  ? 460  ASN A OD1   1 
ATOM   3770  N  ND2   . ASN A 1  460 ? -33.259 -19.345 210.841 1.00 44.29  ? 460  ASN A ND2   1 
ATOM   3771  N  N     . LYS A 1  461 ? -36.914 -18.099 209.934 1.00 58.72  ? 461  LYS A N     1 
ATOM   3772  C  CA    . LYS A 1  461 ? -37.740 -17.836 211.098 1.00 65.83  ? 461  LYS A CA    1 
ATOM   3773  C  C     . LYS A 1  461 ? -39.182 -17.563 210.714 1.00 69.48  ? 461  LYS A C     1 
ATOM   3774  O  O     . LYS A 1  461 ? -39.983 -17.185 211.575 1.00 73.08  ? 461  LYS A O     1 
ATOM   3775  C  CB    . LYS A 1  461 ? -37.193 -16.645 211.888 1.00 66.22  ? 461  LYS A CB    1 
ATOM   3776  C  CG    . LYS A 1  461 ? -35.802 -16.823 212.456 1.00 64.94  ? 461  LYS A CG    1 
ATOM   3777  C  CD    . LYS A 1  461 ? -35.137 -15.470 212.670 1.00 75.30  ? 461  LYS A CD    1 
ATOM   3778  C  CE    . LYS A 1  461 ? -34.975 -15.156 214.153 1.00 75.86  ? 461  LYS A CE    1 
ATOM   3779  N  NZ    . LYS A 1  461 ? -34.413 -13.793 214.378 1.00 78.37  ? 461  LYS A NZ    1 
ATOM   3780  N  N     . GLY A 1  462 ? -39.528 -17.738 209.441 1.00 57.28  ? 462  GLY A N     1 
ATOM   3781  C  CA    . GLY A 1  462 ? -40.864 -17.477 208.965 1.00 58.92  ? 462  GLY A CA    1 
ATOM   3782  C  C     . GLY A 1  462 ? -41.068 -16.104 208.363 1.00 58.89  ? 462  GLY A C     1 
ATOM   3783  O  O     . GLY A 1  462 ? -42.125 -15.864 207.767 1.00 59.55  ? 462  GLY A O     1 
ATOM   3784  N  N     . ARG A 1  463 ? -40.104 -15.197 208.506 1.00 57.23  ? 463  ARG A N     1 
ATOM   3785  C  CA    . ARG A 1  463 ? -40.273 -13.860 207.959 1.00 55.41  ? 463  ARG A CA    1 
ATOM   3786  C  C     . ARG A 1  463 ? -40.334 -13.907 206.438 1.00 57.94  ? 463  ARG A C     1 
ATOM   3787  O  O     . ARG A 1  463 ? -39.614 -14.671 205.790 1.00 56.41  ? 463  ARG A O     1 
ATOM   3788  C  CB    . ARG A 1  463 ? -39.138 -12.944 208.404 1.00 53.87  ? 463  ARG A CB    1 
ATOM   3789  C  CG    . ARG A 1  463 ? -39.320 -11.504 207.957 1.00 55.54  ? 463  ARG A CG    1 
ATOM   3790  C  CD    . ARG A 1  463 ? -38.062 -10.697 208.160 1.00 55.75  ? 463  ARG A CD    1 
ATOM   3791  N  NE    . ARG A 1  463 ? -37.362 -11.107 209.371 1.00 56.89  ? 463  ARG A NE    1 
ATOM   3792  C  CZ    . ARG A 1  463 ? -37.246 -10.359 210.461 1.00 59.46  ? 463  ARG A CZ    1 
ATOM   3793  N  NH1   . ARG A 1  463 ? -37.751 -9.134  210.484 1.00 66.68  ? 463  ARG A NH1   1 
ATOM   3794  N  NH2   . ARG A 1  463 ? -36.588 -10.823 211.515 1.00 65.48  ? 463  ARG A NH2   1 
ATOM   3795  N  N     . GLN A 1  464 ? -41.205 -13.078 205.871 1.00 55.63  ? 464  GLN A N     1 
ATOM   3796  C  CA    . GLN A 1  464 ? -41.507 -13.135 204.452 1.00 51.01  ? 464  GLN A CA    1 
ATOM   3797  C  C     . GLN A 1  464 ? -41.885 -11.737 203.986 1.00 50.26  ? 464  GLN A C     1 
ATOM   3798  O  O     . GLN A 1  464 ? -42.316 -10.899 204.781 1.00 49.89  ? 464  GLN A O     1 
ATOM   3799  C  CB    . GLN A 1  464 ? -42.617 -14.159 204.177 1.00 52.67  ? 464  GLN A CB    1 
ATOM   3800  C  CG    . GLN A 1  464 ? -42.966 -14.366 202.712 1.00 58.37  ? 464  GLN A CG    1 
ATOM   3801  C  CD    . GLN A 1  464 ? -44.310 -13.764 202.332 1.00 64.05  ? 464  GLN A CD    1 
ATOM   3802  O  OE1   . GLN A 1  464 ? -44.571 -12.584 202.577 1.00 62.53  ? 464  GLN A OE1   1 
ATOM   3803  N  NE2   . GLN A 1  464 ? -45.169 -14.577 201.723 1.00 62.01  ? 464  GLN A NE2   1 
ATOM   3804  N  N     . LYS A 1  465 ? -41.689 -11.485 202.696 1.00 40.55  ? 465  LYS A N     1 
ATOM   3805  C  CA    . LYS A 1  465 ? -42.107 -10.242 202.064 1.00 41.52  ? 465  LYS A CA    1 
ATOM   3806  C  C     . LYS A 1  465 ? -42.130 -10.456 200.558 1.00 53.36  ? 465  LYS A C     1 
ATOM   3807  O  O     . LYS A 1  465 ? -41.319 -11.208 200.014 1.00 55.45  ? 465  LYS A O     1 
ATOM   3808  C  CB    . LYS A 1  465 ? -41.182 -9.067  202.419 1.00 34.65  ? 465  LYS A CB    1 
ATOM   3809  C  CG    . LYS A 1  465 ? -41.393 -7.836  201.527 1.00 34.87  ? 465  LYS A CG    1 
ATOM   3810  C  CD    . LYS A 1  465 ? -40.456 -6.679  201.827 1.00 34.14  ? 465  LYS A CD    1 
ATOM   3811  C  CE    . LYS A 1  465 ? -41.124 -5.627  202.684 1.00 38.99  ? 465  LYS A CE    1 
ATOM   3812  N  NZ    . LYS A 1  465 ? -40.146 -4.705  203.313 1.00 47.28  ? 465  LYS A NZ    1 
ATOM   3813  N  N     . VAL A 1  466 ? -43.081 -9.794  199.899 1.00 52.43  ? 466  VAL A N     1 
ATOM   3814  C  CA    . VAL A 1  466 ? -43.162 -9.706  198.445 1.00 45.67  ? 466  VAL A CA    1 
ATOM   3815  C  C     . VAL A 1  466 ? -43.545 -8.275  198.100 1.00 46.70  ? 466  VAL A C     1 
ATOM   3816  O  O     . VAL A 1  466 ? -44.424 -7.688  198.738 1.00 53.43  ? 466  VAL A O     1 
ATOM   3817  C  CB    . VAL A 1  466 ? -44.174 -10.703 197.842 1.00 37.61  ? 466  VAL A CB    1 
ATOM   3818  C  CG1   . VAL A 1  466 ? -44.193 -10.574 196.333 1.00 37.62  ? 466  VAL A CG1   1 
ATOM   3819  C  CG2   . VAL A 1  466 ? -43.840 -12.127 198.241 1.00 39.74  ? 466  VAL A CG2   1 
ATOM   3820  N  N     . VAL A 1  467 ? -42.871 -7.701  197.110 1.00 51.73  ? 467  VAL A N     1 
ATOM   3821  C  CA    . VAL A 1  467 ? -43.133 -6.318  196.730 1.00 53.00  ? 467  VAL A CA    1 
ATOM   3822  C  C     . VAL A 1  467 ? -43.453 -6.270  195.241 1.00 59.15  ? 467  VAL A C     1 
ATOM   3823  O  O     . VAL A 1  467 ? -42.697 -6.814  194.423 1.00 59.69  ? 467  VAL A O     1 
ATOM   3824  C  CB    . VAL A 1  467 ? -41.936 -5.415  197.068 1.00 52.37  ? 467  VAL A CB    1 
ATOM   3825  C  CG1   . VAL A 1  467 ? -42.047 -4.081  196.342 1.00 56.08  ? 467  VAL A CG1   1 
ATOM   3826  C  CG2   . VAL A 1  467 ? -41.822 -5.219  198.570 1.00 56.95  ? 467  VAL A CG2   1 
ATOM   3827  N  N     . PRO A 1  468 ? -44.560 -5.646  194.849 1.00 66.43  ? 468  PRO A N     1 
ATOM   3828  C  CA    . PRO A 1  468 ? -44.833 -5.451  193.421 1.00 61.90  ? 468  PRO A CA    1 
ATOM   3829  C  C     . PRO A 1  468 ? -43.967 -4.352  192.825 1.00 52.04  ? 468  PRO A C     1 
ATOM   3830  O  O     . PRO A 1  468 ? -43.733 -3.313  193.447 1.00 50.05  ? 468  PRO A O     1 
ATOM   3831  C  CB    . PRO A 1  468 ? -46.317 -5.072  193.397 1.00 54.84  ? 468  PRO A CB    1 
ATOM   3832  C  CG    . PRO A 1  468 ? -46.543 -4.424  194.723 1.00 55.23  ? 468  PRO A CG    1 
ATOM   3833  C  CD    . PRO A 1  468 ? -45.676 -5.180  195.692 1.00 57.96  ? 468  PRO A CD    1 
ATOM   3834  N  N     . LEU A 1  469 ? -43.490 -4.594  191.605 1.00 49.43  ? 469  LEU A N     1 
ATOM   3835  C  CA    . LEU A 1  469 ? -42.565 -3.695  190.929 1.00 64.44  ? 469  LEU A CA    1 
ATOM   3836  C  C     . LEU A 1  469 ? -43.077 -3.439  189.520 1.00 75.68  ? 469  LEU A C     1 
ATOM   3837  O  O     . LEU A 1  469 ? -43.584 -4.349  188.856 1.00 69.97  ? 469  LEU A O     1 
ATOM   3838  C  CB    . LEU A 1  469 ? -41.149 -4.279  190.873 1.00 67.59  ? 469  LEU A CB    1 
ATOM   3839  C  CG    . LEU A 1  469 ? -40.423 -4.460  192.206 1.00 56.95  ? 469  LEU A CG    1 
ATOM   3840  C  CD1   . LEU A 1  469 ? -39.192 -5.330  192.012 1.00 62.24  ? 469  LEU A CD1   1 
ATOM   3841  C  CD2   . LEU A 1  469 ? -40.047 -3.106  192.799 1.00 36.89  ? 469  LEU A CD2   1 
ATOM   3842  N  N     . THR A 1  470 ? -42.903 -2.205  189.056 1.00 77.26  ? 470  THR A N     1 
ATOM   3843  C  CA    . THR A 1  470 ? -43.307 -1.798  187.721 1.00 78.92  ? 470  THR A CA    1 
ATOM   3844  C  C     . THR A 1  470 ? -42.110 -1.360  186.892 1.00 80.91  ? 470  THR A C     1 
ATOM   3845  O  O     . THR A 1  470 ? -41.133 -0.816  187.417 1.00 85.01  ? 470  THR A O     1 
ATOM   3846  C  CB    . THR A 1  470 ? -44.316 -0.650  187.786 1.00 85.32  ? 470  THR A CB    1 
ATOM   3847  O  OG1   . THR A 1  470 ? -43.676 0.512   188.327 1.00 85.77  ? 470  THR A OG1   1 
ATOM   3848  C  CG2   . THR A 1  470 ? -45.484 -1.023  188.684 1.00 87.66  ? 470  THR A CG2   1 
ATOM   3849  N  N     . ASN A 1  471 ? -42.203 -1.609  185.585 1.00 82.93  ? 471  ASN A N     1 
ATOM   3850  C  CA    . ASN A 1  471 ? -41.253 -1.106  184.595 1.00 87.15  ? 471  ASN A CA    1 
ATOM   3851  C  C     . ASN A 1  471 ? -39.830 -1.557  184.935 1.00 84.02  ? 471  ASN A C     1 
ATOM   3852  O  O     . ASN A 1  471 ? -38.942 -0.766  185.259 1.00 84.42  ? 471  ASN A O     1 
ATOM   3853  C  CB    . ASN A 1  471 ? -41.348 0.422   184.495 1.00 82.74  ? 471  ASN A CB    1 
ATOM   3854  C  CG    . ASN A 1  471 ? -40.596 0.976   183.305 1.00 97.31  ? 471  ASN A CG    1 
ATOM   3855  O  OD1   . ASN A 1  471 ? -40.440 0.304   182.285 1.00 109.21 ? 471  ASN A OD1   1 
ATOM   3856  N  ND2   . ASN A 1  471 ? -40.126 2.212   183.428 1.00 102.07 ? 471  ASN A ND2   1 
ATOM   3857  N  N     . THR A 1  472 ? -39.647 -2.872  184.858 1.00 86.12  ? 472  THR A N     1 
ATOM   3858  C  CA    . THR A 1  472 ? -38.516 -3.534  185.483 1.00 67.06  ? 472  THR A CA    1 
ATOM   3859  C  C     . THR A 1  472 ? -38.069 -4.684  184.592 1.00 70.50  ? 472  THR A C     1 
ATOM   3860  O  O     . THR A 1  472 ? -38.640 -4.934  183.526 1.00 76.64  ? 472  THR A O     1 
ATOM   3861  C  CB    . THR A 1  472 ? -38.867 -4.013  186.897 1.00 77.82  ? 472  THR A CB    1 
ATOM   3862  O  OG1   . THR A 1  472 ? -37.664 -4.207  187.653 1.00 68.97  ? 472  THR A OG1   1 
ATOM   3863  C  CG2   . THR A 1  472 ? -39.663 -5.312  186.848 1.00 77.82  ? 472  THR A CG2   1 
ATOM   3864  N  N     . THR A 1  473 ? -37.036 -5.390  185.040 1.00 62.15  ? 473  THR A N     1 
ATOM   3865  C  CA    . THR A 1  473 ? -36.498 -6.538  184.331 1.00 58.37  ? 473  THR A CA    1 
ATOM   3866  C  C     . THR A 1  473 ? -36.154 -7.605  185.356 1.00 58.96  ? 473  THR A C     1 
ATOM   3867  O  O     . THR A 1  473 ? -36.087 -7.330  186.557 1.00 59.86  ? 473  THR A O     1 
ATOM   3868  C  CB    . THR A 1  473 ? -35.244 -6.180  183.525 1.00 64.66  ? 473  THR A CB    1 
ATOM   3869  O  OG1   . THR A 1  473 ? -34.249 -5.654  184.412 1.00 66.50  ? 473  THR A OG1   1 
ATOM   3870  C  CG2   . THR A 1  473 ? -35.561 -5.144  182.455 1.00 57.90  ? 473  THR A CG2   1 
ATOM   3871  N  N     . ASN A 1  474 ? -35.968 -8.837  184.872 1.00 56.47  ? 474  ASN A N     1 
ATOM   3872  C  CA    . ASN A 1  474 ? -35.456 -9.910  185.720 1.00 58.29  ? 474  ASN A CA    1 
ATOM   3873  C  C     . ASN A 1  474 ? -34.293 -9.427  186.576 1.00 63.13  ? 474  ASN A C     1 
ATOM   3874  O  O     . ASN A 1  474 ? -34.285 -9.604  187.799 1.00 54.03  ? 474  ASN A O     1 
ATOM   3875  C  CB    . ASN A 1  474 ? -35.013 -11.093 184.859 1.00 62.76  ? 474  ASN A CB    1 
ATOM   3876  C  CG    . ASN A 1  474 ? -36.167 -11.962 184.429 1.00 64.37  ? 474  ASN A CG    1 
ATOM   3877  O  OD1   . ASN A 1  474 ? -37.259 -11.888 184.991 1.00 72.22  ? 474  ASN A OD1   1 
ATOM   3878  N  ND2   . ASN A 1  474 ? -35.931 -12.801 183.427 1.00 86.26  ? 474  ASN A ND2   1 
ATOM   3879  N  N     . GLN A 1  475 ? -33.291 -8.825  185.932 1.00 62.58  ? 475  GLN A N     1 
ATOM   3880  C  CA    . GLN A 1  475 ? -32.046 -8.519  186.624 1.00 54.74  ? 475  GLN A CA    1 
ATOM   3881  C  C     . GLN A 1  475 ? -32.259 -7.450  187.687 1.00 53.65  ? 475  GLN A C     1 
ATOM   3882  O  O     . GLN A 1  475 ? -31.736 -7.566  188.802 1.00 52.32  ? 475  GLN A O     1 
ATOM   3883  C  CB    . GLN A 1  475 ? -30.975 -8.086  185.624 1.00 56.01  ? 475  GLN A CB    1 
ATOM   3884  C  CG    . GLN A 1  475 ? -30.559 -9.185  184.660 1.00 62.73  ? 475  GLN A CG    1 
ATOM   3885  C  CD    . GLN A 1  475 ? -31.252 -9.083  183.318 1.00 70.46  ? 475  GLN A CD    1 
ATOM   3886  O  OE1   . GLN A 1  475 ? -32.464 -8.876  183.243 1.00 64.98  ? 475  GLN A OE1   1 
ATOM   3887  N  NE2   . GLN A 1  475 ? -30.485 -9.237  182.245 1.00 79.88  ? 475  GLN A NE2   1 
ATOM   3888  N  N     . LYS A 1  476 ? -33.036 -6.409  187.367 1.00 54.06  ? 476  LYS A N     1 
ATOM   3889  C  CA    . LYS A 1  476 ? -33.401 -5.428  188.385 1.00 52.75  ? 476  LYS A CA    1 
ATOM   3890  C  C     . LYS A 1  476 ? -34.087 -6.084  189.575 1.00 49.49  ? 476  LYS A C     1 
ATOM   3891  O  O     . LYS A 1  476 ? -33.772 -5.763  190.727 1.00 45.83  ? 476  LYS A O     1 
ATOM   3892  C  CB    . LYS A 1  476 ? -34.260 -4.315  187.784 1.00 51.09  ? 476  LYS A CB    1 
ATOM   3893  C  CG    . LYS A 1  476 ? -33.515 -3.519  186.724 1.00 54.61  ? 476  LYS A CG    1 
ATOM   3894  C  CD    . LYS A 1  476 ? -34.259 -2.267  186.301 1.00 59.04  ? 476  LYS A CD    1 
ATOM   3895  C  CE    . LYS A 1  476 ? -33.420 -1.457  185.321 1.00 71.18  ? 476  LYS A CE    1 
ATOM   3896  N  NZ    . LYS A 1  476 ? -33.741 -0.002  185.370 1.00 87.42  ? 476  LYS A NZ    1 
ATOM   3897  N  N     . THR A 1  477 ? -35.017 -7.012  189.330 1.00 55.50  ? 477  THR A N     1 
ATOM   3898  C  CA    . THR A 1  477 ? -35.758 -7.570  190.457 1.00 53.47  ? 477  THR A CA    1 
ATOM   3899  C  C     . THR A 1  477 ? -34.822 -8.395  191.325 1.00 45.19  ? 477  THR A C     1 
ATOM   3900  O  O     . THR A 1  477 ? -34.953 -8.414  192.554 1.00 45.40  ? 477  THR A O     1 
ATOM   3901  C  CB    . THR A 1  477 ? -36.928 -8.430  189.969 1.00 54.33  ? 477  THR A CB    1 
ATOM   3902  O  OG1   . THR A 1  477 ? -36.460 -9.387  189.012 1.00 59.69  ? 477  THR A OG1   1 
ATOM   3903  C  CG2   . THR A 1  477 ? -37.990 -7.565  189.317 1.00 61.54  ? 477  THR A CG2   1 
ATOM   3904  N  N     . GLU A 1  478 ? -33.880 -9.092  190.686 1.00 52.98  ? 478  GLU A N     1 
ATOM   3905  C  CA    . GLU A 1  478 ? -32.881 -9.874  191.406 1.00 51.16  ? 478  GLU A CA    1 
ATOM   3906  C  C     . GLU A 1  478 ? -32.067 -8.990  192.345 1.00 39.39  ? 478  GLU A C     1 
ATOM   3907  O  O     . GLU A 1  478 ? -31.829 -9.352  193.503 1.00 36.33  ? 478  GLU A O     1 
ATOM   3908  C  CB    . GLU A 1  478 ? -32.001 -10.612 190.403 1.00 48.37  ? 478  GLU A CB    1 
ATOM   3909  C  CG    . GLU A 1  478 ? -32.699 -11.845 189.860 1.00 50.21  ? 478  GLU A CG    1 
ATOM   3910  C  CD    . GLU A 1  478 ? -32.110 -12.331 188.563 1.00 67.09  ? 478  GLU A CD    1 
ATOM   3911  O  OE1   . GLU A 1  478 ? -30.906 -12.100 188.331 1.00 77.78  ? 478  GLU A OE1   1 
ATOM   3912  O  OE2   . GLU A 1  478 ? -32.857 -12.946 187.772 1.00 60.33  ? 478  GLU A OE2   1 
ATOM   3913  N  N     . LEU A 1  479 ? -31.613 -7.830  191.855 1.00 35.74  ? 479  LEU A N     1 
ATOM   3914  C  CA    . LEU A 1  479 ? -30.954 -6.875  192.742 1.00 46.99  ? 479  LEU A CA    1 
ATOM   3915  C  C     . LEU A 1  479 ? -31.912 -6.396  193.821 1.00 49.61  ? 479  LEU A C     1 
ATOM   3916  O  O     . LEU A 1  479 ? -31.532 -6.271  194.994 1.00 45.67  ? 479  LEU A O     1 
ATOM   3917  C  CB    . LEU A 1  479 ? -30.397 -5.689  191.954 1.00 46.10  ? 479  LEU A CB    1 
ATOM   3918  C  CG    . LEU A 1  479 ? -29.252 -6.000  190.991 1.00 48.98  ? 479  LEU A CG    1 
ATOM   3919  C  CD1   . LEU A 1  479 ? -28.814 -4.751  190.249 1.00 48.12  ? 479  LEU A CD1   1 
ATOM   3920  C  CD2   . LEU A 1  479 ? -28.087 -6.588  191.773 1.00 34.72  ? 479  LEU A CD2   1 
ATOM   3921  N  N     . GLN A 1  480 ? -33.172 -6.168  193.446 1.00 51.38  ? 480  GLN A N     1 
ATOM   3922  C  CA    . GLN A 1  480 ? -34.158 -5.639  194.381 1.00 47.68  ? 480  GLN A CA    1 
ATOM   3923  C  C     . GLN A 1  480 ? -34.332 -6.588  195.559 1.00 45.88  ? 480  GLN A C     1 
ATOM   3924  O  O     . GLN A 1  480 ? -34.354 -6.160  196.719 1.00 47.40  ? 480  GLN A O     1 
ATOM   3925  C  CB    . GLN A 1  480 ? -35.488 -5.401  193.662 1.00 48.69  ? 480  GLN A CB    1 
ATOM   3926  C  CG    . GLN A 1  480 ? -36.403 -4.384  194.335 1.00 50.07  ? 480  GLN A CG    1 
ATOM   3927  C  CD    . GLN A 1  480 ? -35.928 -2.951  194.182 1.00 51.11  ? 480  GLN A CD    1 
ATOM   3928  O  OE1   . GLN A 1  480 ? -35.565 -2.516  193.090 1.00 48.37  ? 480  GLN A OE1   1 
ATOM   3929  N  NE2   . GLN A 1  480 ? -35.939 -2.205  195.281 1.00 54.82  ? 480  GLN A NE2   1 
ATOM   3930  N  N     . ALA A 1  481 ? -34.497 -7.883  195.275 1.00 38.76  ? 481  ALA A N     1 
ATOM   3931  C  CA    . ALA A 1  481 ? -34.647 -8.861  196.346 1.00 41.30  ? 481  ALA A CA    1 
ATOM   3932  C  C     . ALA A 1  481 ? -33.472 -8.815  197.319 1.00 47.88  ? 481  ALA A C     1 
ATOM   3933  O  O     . ALA A 1  481 ? -33.668 -8.902  198.538 1.00 47.12  ? 481  ALA A O     1 
ATOM   3934  C  CB    . ALA A 1  481 ? -34.793 -10.262 195.753 1.00 40.77  ? 481  ALA A CB    1 
ATOM   3935  N  N     . ILE A 1  482 ? -32.240 -8.712  196.807 1.00 50.13  ? 482  ILE A N     1 
ATOM   3936  C  CA    . ILE A 1  482 ? -31.095 -8.588  197.706 1.00 46.70  ? 482  ILE A CA    1 
ATOM   3937  C  C     . ILE A 1  482 ? -31.202 -7.311  198.530 1.00 44.39  ? 482  ILE A C     1 
ATOM   3938  O  O     . ILE A 1  482 ? -30.928 -7.306  199.737 1.00 42.51  ? 482  ILE A O     1 
ATOM   3939  C  CB    . ILE A 1  482 ? -29.777 -8.642  196.916 1.00 47.45  ? 482  ILE A CB    1 
ATOM   3940  C  CG1   . ILE A 1  482 ? -29.609 -10.014 196.265 1.00 43.19  ? 482  ILE A CG1   1 
ATOM   3941  C  CG2   . ILE A 1  482 ? -28.595 -8.344  197.833 1.00 37.08  ? 482  ILE A CG2   1 
ATOM   3942  C  CD1   . ILE A 1  482 ? -28.403 -10.111 195.369 1.00 40.67  ? 482  ILE A CD1   1 
ATOM   3943  N  N     . TYR A 1  483 ? -31.607 -6.210  197.892 1.00 39.68  ? 483  TYR A N     1 
ATOM   3944  C  CA    . TYR A 1  483 ? -31.859 -4.967  198.617 1.00 46.20  ? 483  TYR A CA    1 
ATOM   3945  C  C     . TYR A 1  483 ? -32.857 -5.170  199.754 1.00 51.50  ? 483  TYR A C     1 
ATOM   3946  O  O     . TYR A 1  483 ? -32.627 -4.720  200.883 1.00 48.08  ? 483  TYR A O     1 
ATOM   3947  C  CB    . TYR A 1  483 ? -32.333 -3.882  197.651 1.00 50.58  ? 483  TYR A CB    1 
ATOM   3948  C  CG    . TYR A 1  483 ? -32.439 -2.520  198.291 1.00 52.61  ? 483  TYR A CG    1 
ATOM   3949  C  CD1   . TYR A 1  483 ? -31.600 -2.151  199.330 1.00 51.89  ? 483  TYR A CD1   1 
ATOM   3950  C  CD2   . TYR A 1  483 ? -33.391 -1.607  197.862 1.00 62.39  ? 483  TYR A CD2   1 
ATOM   3951  C  CE1   . TYR A 1  483 ? -31.708 -0.909  199.925 1.00 61.57  ? 483  TYR A CE1   1 
ATOM   3952  C  CE2   . TYR A 1  483 ? -33.503 -0.363  198.446 1.00 59.07  ? 483  TYR A CE2   1 
ATOM   3953  C  CZ    . TYR A 1  483 ? -32.662 -0.019  199.478 1.00 53.15  ? 483  TYR A CZ    1 
ATOM   3954  O  OH    . TYR A 1  483 ? -32.774 1.223   200.055 1.00 48.06  ? 483  TYR A OH    1 
ATOM   3955  N  N     . LEU A 1  484 ? -33.981 -5.837  199.471 1.00 45.24  ? 484  LEU A N     1 
ATOM   3956  C  CA    . LEU A 1  484 ? -34.973 -6.076  200.516 1.00 49.40  ? 484  LEU A CA    1 
ATOM   3957  C  C     . LEU A 1  484 ? -34.380 -6.876  201.667 1.00 47.10  ? 484  LEU A C     1 
ATOM   3958  O  O     . LEU A 1  484 ? -34.629 -6.562  202.837 1.00 50.20  ? 484  LEU A O     1 
ATOM   3959  C  CB    . LEU A 1  484 ? -36.202 -6.789  199.953 1.00 52.47  ? 484  LEU A CB    1 
ATOM   3960  C  CG    . LEU A 1  484 ? -36.975 -6.115  198.820 1.00 51.61  ? 484  LEU A CG    1 
ATOM   3961  C  CD1   . LEU A 1  484 ? -37.981 -7.088  198.224 1.00 46.93  ? 484  LEU A CD1   1 
ATOM   3962  C  CD2   . LEU A 1  484 ? -37.664 -4.853  199.321 1.00 46.37  ? 484  LEU A CD2   1 
ATOM   3963  N  N     . ALA A 1  485 ? -33.623 -7.935  201.360 1.00 42.27  ? 485  ALA A N     1 
ATOM   3964  C  CA    . ALA A 1  485 ? -33.027 -8.733  202.427 1.00 46.13  ? 485  ALA A CA    1 
ATOM   3965  C  C     . ALA A 1  485 ? -32.161 -7.858  203.322 1.00 46.33  ? 485  ALA A C     1 
ATOM   3966  O  O     . ALA A 1  485 ? -32.137 -8.035  204.547 1.00 45.95  ? 485  ALA A O     1 
ATOM   3967  C  CB    . ALA A 1  485 ? -32.212 -9.883  201.842 1.00 35.57  ? 485  ALA A CB    1 
ATOM   3968  N  N     . LEU A 1  486 ? -31.419 -6.928  202.724 1.00 40.52  ? 486  LEU A N     1 
ATOM   3969  C  CA    . LEU A 1  486 ? -30.460 -6.159  203.504 1.00 48.93  ? 486  LEU A CA    1 
ATOM   3970  C  C     . LEU A 1  486 ? -31.192 -5.129  204.353 1.00 48.34  ? 486  LEU A C     1 
ATOM   3971  O  O     . LEU A 1  486 ? -30.840 -4.904  205.518 1.00 45.08  ? 486  LEU A O     1 
ATOM   3972  C  CB    . LEU A 1  486 ? -29.447 -5.490  202.575 1.00 47.60  ? 486  LEU A CB    1 
ATOM   3973  C  CG    . LEU A 1  486 ? -28.458 -6.452  201.908 1.00 42.50  ? 486  LEU A CG    1 
ATOM   3974  C  CD1   . LEU A 1  486 ? -27.788 -5.811  200.693 1.00 44.78  ? 486  LEU A CD1   1 
ATOM   3975  C  CD2   . LEU A 1  486 ? -27.426 -6.959  202.901 1.00 41.56  ? 486  LEU A CD2   1 
ATOM   3976  N  N     . GLN A 1  487 ? -32.226 -4.508  203.772 1.00 51.57  ? 487  GLN A N     1 
ATOM   3977  C  CA    . GLN A 1  487 ? -33.053 -3.529  204.475 1.00 49.12  ? 487  GLN A CA    1 
ATOM   3978  C  C     . GLN A 1  487 ? -33.704 -4.110  205.723 1.00 47.28  ? 487  GLN A C     1 
ATOM   3979  O  O     . GLN A 1  487 ? -33.823 -3.424  206.744 1.00 51.22  ? 487  GLN A O     1 
ATOM   3980  C  CB    . GLN A 1  487 ? -34.133 -2.990  203.543 1.00 49.78  ? 487  GLN A CB    1 
ATOM   3981  C  CG    . GLN A 1  487 ? -33.659 -1.957  202.560 1.00 56.15  ? 487  GLN A CG    1 
ATOM   3982  C  CD    . GLN A 1  487 ? -34.814 -1.228  201.922 1.00 63.35  ? 487  GLN A CD    1 
ATOM   3983  O  OE1   . GLN A 1  487 ? -35.018 -0.038  202.160 1.00 77.67  ? 487  GLN A OE1   1 
ATOM   3984  N  NE2   . GLN A 1  487 ? -35.599 -1.945  201.126 1.00 59.21  ? 487  GLN A NE2   1 
ATOM   3985  N  N     . ASP A 1  488 ? -34.135 -5.367  205.661 1.00 44.73  ? 488  ASP A N     1 
ATOM   3986  C  CA    . ASP A 1  488 ? -34.980 -5.957  206.689 1.00 46.67  ? 488  ASP A CA    1 
ATOM   3987  C  C     . ASP A 1  488 ? -34.231 -6.898  207.627 1.00 46.58  ? 488  ASP A C     1 
ATOM   3988  O  O     . ASP A 1  488 ? -34.866 -7.557  208.456 1.00 54.27  ? 488  ASP A O     1 
ATOM   3989  C  CB    . ASP A 1  488 ? -36.165 -6.688  206.044 1.00 50.62  ? 488  ASP A CB    1 
ATOM   3990  C  CG    . ASP A 1  488 ? -37.022 -5.776  205.165 1.00 50.40  ? 488  ASP A CG    1 
ATOM   3991  O  OD1   . ASP A 1  488 ? -36.873 -4.537  205.252 1.00 53.07  ? 488  ASP A OD1   1 
ATOM   3992  O  OD2   . ASP A 1  488 ? -37.854 -6.301  204.392 1.00 42.77  ? 488  ASP A OD2   1 
ATOM   3993  N  N     . SER A 1  489 ? -32.908 -6.973  207.531 1.00 49.91  ? 489  SER A N     1 
ATOM   3994  C  CA    . SER A 1  489 ? -32.125 -7.880  208.356 1.00 47.20  ? 489  SER A CA    1 
ATOM   3995  C  C     . SER A 1  489 ? -31.403 -7.093  209.441 1.00 38.92  ? 489  SER A C     1 
ATOM   3996  O  O     . SER A 1  489 ? -31.278 -5.867  209.370 1.00 40.54  ? 489  SER A O     1 
ATOM   3997  C  CB    . SER A 1  489 ? -31.109 -8.655  207.517 1.00 40.25  ? 489  SER A CB    1 
ATOM   3998  O  OG    . SER A 1  489 ? -30.291 -7.765  206.781 1.00 42.58  ? 489  SER A OG    1 
ATOM   3999  N  N     . GLY A 1  490 ? -30.949 -7.806  210.466 1.00 33.01  ? 490  GLY A N     1 
ATOM   4000  C  CA    . GLY A 1  490 ? -30.059 -7.203  211.431 1.00 37.63  ? 490  GLY A CA    1 
ATOM   4001  C  C     . GLY A 1  490 ? -28.676 -6.910  210.869 1.00 51.97  ? 490  GLY A C     1 
ATOM   4002  O  O     . GLY A 1  490 ? -28.416 -6.952  209.665 1.00 54.75  ? 490  GLY A O     1 
ATOM   4003  N  N     . LEU A 1  491 ? -27.763 -6.610  211.797 1.00 52.71  ? 491  LEU A N     1 
ATOM   4004  C  CA    . LEU A 1  491 ? -26.399 -6.248  211.430 1.00 49.92  ? 491  LEU A CA    1 
ATOM   4005  C  C     . LEU A 1  491 ? -25.620 -7.409  210.823 1.00 46.51  ? 491  LEU A C     1 
ATOM   4006  O  O     . LEU A 1  491 ? -24.602 -7.182  210.163 1.00 46.21  ? 491  LEU A O     1 
ATOM   4007  C  CB    . LEU A 1  491 ? -25.665 -5.711  212.658 1.00 48.79  ? 491  LEU A CB    1 
ATOM   4008  C  CG    . LEU A 1  491 ? -26.178 -4.376  213.201 1.00 46.57  ? 491  LEU A CG    1 
ATOM   4009  C  CD1   . LEU A 1  491 ? -25.691 -4.157  214.623 1.00 58.01  ? 491  LEU A CD1   1 
ATOM   4010  C  CD2   . LEU A 1  491 ? -25.761 -3.223  212.307 1.00 55.08  ? 491  LEU A CD2   1 
ATOM   4011  N  N     . GLU A 1  492 ? -26.089 -8.639  211.011 1.00 49.53  ? 492  GLU A N     1 
ATOM   4012  C  CA    . GLU A 1  492 ? -25.465 -9.837  210.467 1.00 43.52  ? 492  GLU A CA    1 
ATOM   4013  C  C     . GLU A 1  492 ? -26.517 -10.647 209.732 1.00 45.56  ? 492  GLU A C     1 
ATOM   4014  O  O     . GLU A 1  492 ? -27.597 -10.893 210.278 1.00 61.56  ? 492  GLU A O     1 
ATOM   4015  C  CB    . GLU A 1  492 ? -24.835 -10.673 211.580 1.00 46.44  ? 492  GLU A CB    1 
ATOM   4016  C  CG    . GLU A 1  492 ? -23.715 -9.967  212.320 1.00 50.74  ? 492  GLU A CG    1 
ATOM   4017  C  CD    . GLU A 1  492 ? -23.125 -10.821 213.423 1.00 58.62  ? 492  GLU A CD    1 
ATOM   4018  O  OE1   . GLU A 1  492 ? -23.490 -12.013 213.513 1.00 55.05  ? 492  GLU A OE1   1 
ATOM   4019  O  OE2   . GLU A 1  492 ? -22.298 -10.301 214.201 1.00 66.98  ? 492  GLU A OE2   1 
ATOM   4020  N  N     . VAL A 1  493 ? -26.222 -11.055 208.500 1.00 45.44  ? 493  VAL A N     1 
ATOM   4021  C  CA    . VAL A 1  493 ? -27.241 -11.701 207.681 1.00 49.39  ? 493  VAL A CA    1 
ATOM   4022  C  C     . VAL A 1  493 ? -26.598 -12.629 206.661 1.00 42.63  ? 493  VAL A C     1 
ATOM   4023  O  O     . VAL A 1  493 ? -25.535 -12.341 206.105 1.00 42.65  ? 493  VAL A O     1 
ATOM   4024  C  CB    . VAL A 1  493 ? -28.128 -10.654 206.972 1.00 46.75  ? 493  VAL A CB    1 
ATOM   4025  C  CG1   . VAL A 1  493 ? -27.294 -9.788  206.037 1.00 37.34  ? 493  VAL A CG1   1 
ATOM   4026  C  CG2   . VAL A 1  493 ? -29.220 -11.348 206.182 1.00 39.08  ? 493  VAL A CG2   1 
ATOM   4027  N  N     . ASN A 1  494 ? -27.237 -13.779 206.476 1.00 44.37  ? 494  ASN A N     1 
ATOM   4028  C  CA    . ASN A 1  494 ? -26.940 -14.723 205.411 1.00 42.20  ? 494  ASN A CA    1 
ATOM   4029  C  C     . ASN A 1  494 ? -27.979 -14.546 204.309 1.00 43.16  ? 494  ASN A C     1 
ATOM   4030  O  O     . ASN A 1  494 ? -29.180 -14.518 204.597 1.00 39.13  ? 494  ASN A O     1 
ATOM   4031  C  CB    . ASN A 1  494 ? -26.982 -16.153 205.949 1.00 45.29  ? 494  ASN A CB    1 
ATOM   4032  C  CG    . ASN A 1  494 ? -25.908 -16.415 206.977 1.00 44.75  ? 494  ASN A CG    1 
ATOM   4033  O  OD1   . ASN A 1  494 ? -24.759 -16.010 206.810 1.00 57.62  ? 494  ASN A OD1   1 
ATOM   4034  N  ND2   . ASN A 1  494 ? -26.283 -17.072 208.066 1.00 42.64  ? 494  ASN A ND2   1 
ATOM   4035  N  N     . ILE A 1  495 ? -27.535 -14.417 203.060 1.00 39.06  ? 495  ILE A N     1 
ATOM   4036  C  CA    . ILE A 1  495 ? -28.453 -14.232 201.939 1.00 35.51  ? 495  ILE A CA    1 
ATOM   4037  C  C     . ILE A 1  495 ? -28.124 -15.272 200.880 1.00 37.79  ? 495  ILE A C     1 
ATOM   4038  O  O     . ILE A 1  495 ? -26.962 -15.420 200.490 1.00 46.77  ? 495  ILE A O     1 
ATOM   4039  C  CB    . ILE A 1  495 ? -28.382 -12.813 201.340 1.00 35.19  ? 495  ILE A CB    1 
ATOM   4040  C  CG1   . ILE A 1  495 ? -28.792 -11.764 202.372 1.00 28.42  ? 495  ILE A CG1   1 
ATOM   4041  C  CG2   . ILE A 1  495 ? -29.262 -12.701 200.099 1.00 32.19  ? 495  ILE A CG2   1 
ATOM   4042  C  CD1   . ILE A 1  495 ? -28.458 -10.348 201.957 1.00 25.19  ? 495  ILE A CD1   1 
ATOM   4043  N  N     . VAL A 1  496 ? -29.146 -15.969 200.396 1.00 35.75  ? 496  VAL A N     1 
ATOM   4044  C  CA    . VAL A 1  496 ? -28.992 -16.996 199.374 1.00 37.85  ? 496  VAL A CA    1 
ATOM   4045  C  C     . VAL A 1  496 ? -29.749 -16.556 198.131 1.00 36.60  ? 496  VAL A C     1 
ATOM   4046  O  O     . VAL A 1  496 ? -30.978 -16.418 198.166 1.00 49.12  ? 496  VAL A O     1 
ATOM   4047  C  CB    . VAL A 1  496 ? -29.487 -18.366 199.862 1.00 37.37  ? 496  VAL A CB    1 
ATOM   4048  C  CG1   . VAL A 1  496 ? -29.405 -19.387 198.741 1.00 38.83  ? 496  VAL A CG1   1 
ATOM   4049  C  CG2   . VAL A 1  496 ? -28.668 -18.819 201.052 1.00 37.70  ? 496  VAL A CG2   1 
ATOM   4050  N  N     . THR A 1  497 ? -29.027 -16.319 197.044 1.00 36.81  ? 497  THR A N     1 
ATOM   4051  C  CA    . THR A 1  497 ? -29.650 -15.961 195.781 1.00 33.08  ? 497  THR A CA    1 
ATOM   4052  C  C     . THR A 1  497 ? -29.320 -17.008 194.724 1.00 40.96  ? 497  THR A C     1 
ATOM   4053  O  O     . THR A 1  497 ? -28.449 -17.862 194.904 1.00 45.99  ? 497  THR A O     1 
ATOM   4054  C  CB    . THR A 1  497 ? -29.179 -14.578 195.317 1.00 38.97  ? 497  THR A CB    1 
ATOM   4055  O  OG1   . THR A 1  497 ? -29.683 -14.306 194.003 1.00 39.77  ? 497  THR A OG1   1 
ATOM   4056  C  CG2   . THR A 1  497 ? -27.664 -14.521 195.300 1.00 52.57  ? 497  THR A CG2   1 
ATOM   4057  N  N     . ASP A 1  498 ? -30.042 -16.938 193.607 1.00 44.62  ? 498  ASP A N     1 
ATOM   4058  C  CA    . ASP A 1  498 ? -29.706 -17.681 192.401 1.00 44.16  ? 498  ASP A CA    1 
ATOM   4059  C  C     . ASP A 1  498 ? -29.335 -16.759 191.250 1.00 46.85  ? 498  ASP A C     1 
ATOM   4060  O  O     . ASP A 1  498 ? -29.246 -17.219 190.105 1.00 57.26  ? 498  ASP A O     1 
ATOM   4061  C  CB    . ASP A 1  498 ? -30.865 -18.608 192.003 1.00 53.76  ? 498  ASP A CB    1 
ATOM   4062  C  CG    . ASP A 1  498 ? -32.167 -17.859 191.740 1.00 60.04  ? 498  ASP A CG    1 
ATOM   4063  O  OD1   . ASP A 1  498 ? -32.260 -17.039 190.823 1.00 60.55  ? 498  ASP A OD1   1 
ATOM   4064  O  OD2   . ASP A 1  498 ? -33.180 -18.139 192.553 1.00 57.19  ? 498  ASP A OD2   1 
ATOM   4065  N  N     . SER A 1  499 ? -29.092 -15.480 191.522 1.00 46.17  ? 499  SER A N     1 
ATOM   4066  C  CA    . SER A 1  499 ? -28.764 -14.522 190.470 1.00 55.21  ? 499  SER A CA    1 
ATOM   4067  C  C     . SER A 1  499 ? -27.260 -14.445 190.237 1.00 63.18  ? 499  SER A C     1 
ATOM   4068  O  O     . SER A 1  499 ? -26.526 -13.820 191.008 1.00 59.67  ? 499  SER A O     1 
ATOM   4069  C  CB    . SER A 1  499 ? -29.319 -13.148 190.824 1.00 53.68  ? 499  SER A CB    1 
ATOM   4070  O  OG    . SER A 1  499 ? -28.945 -12.191 189.847 1.00 58.45  ? 499  SER A OG    1 
ATOM   4071  N  N     . GLN A 1  500 ? -26.802 -15.094 189.164 1.00 76.43  ? 500  GLN A N     1 
ATOM   4072  C  CA    . GLN A 1  500 ? -25.409 -14.956 188.756 1.00 72.10  ? 500  GLN A CA    1 
ATOM   4073  C  C     . GLN A 1  500 ? -25.081 -13.493 188.486 1.00 65.61  ? 500  GLN A C     1 
ATOM   4074  O  O     . GLN A 1  500 ? -24.038 -12.988 188.916 1.00 57.69  ? 500  GLN A O     1 
ATOM   4075  C  CB    . GLN A 1  500 ? -25.139 -15.809 187.517 1.00 69.28  ? 500  GLN A CB    1 
ATOM   4076  C  CG    . GLN A 1  500 ? -25.359 -17.294 187.735 1.00 66.80  ? 500  GLN A CG    1 
ATOM   4077  C  CD    . GLN A 1  500 ? -24.955 -18.129 186.539 1.00 81.92  ? 500  GLN A CD    1 
ATOM   4078  O  OE1   . GLN A 1  500 ? -24.017 -17.788 185.813 1.00 106.16 ? 500  GLN A OE1   1 
ATOM   4079  N  NE2   . GLN A 1  500 ? -25.663 -19.232 186.323 1.00 83.60  ? 500  GLN A NE2   1 
ATOM   4080  N  N     . TYR A 1  501 ? -25.984 -12.801 187.780 1.00 69.56  ? 501  TYR A N     1 
ATOM   4081  C  CA    . TYR A 1  501 ? -25.864 -11.365 187.538 1.00 65.46  ? 501  TYR A CA    1 
ATOM   4082  C  C     . TYR A 1  501 ? -25.616 -10.576 188.817 1.00 64.18  ? 501  TYR A C     1 
ATOM   4083  O  O     . TYR A 1  501 ? -24.673 -9.780  188.897 1.00 65.15  ? 501  TYR A O     1 
ATOM   4084  C  CB    . TYR A 1  501 ? -27.141 -10.860 186.866 1.00 64.54  ? 501  TYR A CB    1 
ATOM   4085  C  CG    . TYR A 1  501 ? -27.219 -9.357  186.773 1.00 57.16  ? 501  TYR A CG    1 
ATOM   4086  C  CD1   . TYR A 1  501 ? -26.444 -8.656  185.863 1.00 65.42  ? 501  TYR A CD1   1 
ATOM   4087  C  CD2   . TYR A 1  501 ? -28.051 -8.636  187.621 1.00 50.33  ? 501  TYR A CD2   1 
ATOM   4088  C  CE1   . TYR A 1  501 ? -26.508 -7.276  185.785 1.00 62.53  ? 501  TYR A CE1   1 
ATOM   4089  C  CE2   . TYR A 1  501 ? -28.122 -7.258  187.553 1.00 48.66  ? 501  TYR A CE2   1 
ATOM   4090  C  CZ    . TYR A 1  501 ? -27.349 -6.583  186.631 1.00 58.50  ? 501  TYR A CZ    1 
ATOM   4091  O  OH    . TYR A 1  501 ? -27.409 -5.210  186.554 1.00 56.19  ? 501  TYR A OH    1 
ATOM   4092  N  N     . ALA A 1  502 ? -26.440 -10.798 189.839 1.00 60.61  ? 502  ALA A N     1 
ATOM   4093  C  CA    . ALA A 1  502 ? -26.332 -9.983  191.043 1.00 59.73  ? 502  ALA A CA    1 
ATOM   4094  C  C     . ALA A 1  502 ? -25.056 -10.306 191.806 1.00 57.74  ? 502  ALA A C     1 
ATOM   4095  O  O     . ALA A 1  502 ? -24.326 -9.401  192.226 1.00 53.74  ? 502  ALA A O     1 
ATOM   4096  C  CB    . ALA A 1  502 ? -27.561 -10.184 191.927 1.00 51.67  ? 502  ALA A CB    1 
ATOM   4097  N  N     . LEU A 1  503 ? -24.764 -11.595 191.978 1.00 55.61  ? 503  LEU A N     1 
ATOM   4098  C  CA    . LEU A 1  503 ? -23.597 -11.987 192.757 1.00 53.99  ? 503  LEU A CA    1 
ATOM   4099  C  C     . LEU A 1  503 ? -22.313 -11.529 192.085 1.00 55.19  ? 503  LEU A C     1 
ATOM   4100  O  O     . LEU A 1  503 ? -21.363 -11.115 192.760 1.00 54.22  ? 503  LEU A O     1 
ATOM   4101  C  CB    . LEU A 1  503 ? -23.590 -13.499 192.961 1.00 52.76  ? 503  LEU A CB    1 
ATOM   4102  C  CG    . LEU A 1  503 ? -23.490 -13.892 194.430 1.00 65.32  ? 503  LEU A CG    1 
ATOM   4103  C  CD1   . LEU A 1  503 ? -24.397 -13.004 195.271 1.00 60.09  ? 503  LEU A CD1   1 
ATOM   4104  C  CD2   . LEU A 1  503 ? -23.850 -15.344 194.615 1.00 61.50  ? 503  LEU A CD2   1 
ATOM   4105  N  N     . GLY A 1  504 ? -22.271 -11.591 190.754 1.00 58.15  ? 504  GLY A N     1 
ATOM   4106  C  CA    . GLY A 1  504 ? -21.140 -11.042 190.023 1.00 52.11  ? 504  GLY A CA    1 
ATOM   4107  C  C     . GLY A 1  504 ? -20.831 -9.611  190.412 1.00 53.37  ? 504  GLY A C     1 
ATOM   4108  O  O     . GLY A 1  504 ? -19.692 -9.276  190.748 1.00 56.86  ? 504  GLY A O     1 
ATOM   4109  N  N     . ILE A 1  505 ? -21.846 -8.746  190.377 1.00 49.94  ? 505  ILE A N     1 
ATOM   4110  C  CA    . ILE A 1  505 ? -21.644 -7.336  190.704 1.00 48.65  ? 505  ILE A CA    1 
ATOM   4111  C  C     . ILE A 1  505 ? -21.201 -7.166  192.154 1.00 53.63  ? 505  ILE A C     1 
ATOM   4112  O  O     . ILE A 1  505 ? -20.163 -6.555  192.434 1.00 54.26  ? 505  ILE A O     1 
ATOM   4113  C  CB    . ILE A 1  505 ? -22.927 -6.536  190.413 1.00 53.40  ? 505  ILE A CB    1 
ATOM   4114  C  CG1   . ILE A 1  505 ? -23.159 -6.442  188.906 1.00 54.38  ? 505  ILE A CG1   1 
ATOM   4115  C  CG2   . ILE A 1  505 ? -22.858 -5.153  191.042 1.00 54.32  ? 505  ILE A CG2   1 
ATOM   4116  C  CD1   . ILE A 1  505 ? -24.563 -6.051  188.532 1.00 51.60  ? 505  ILE A CD1   1 
ATOM   4117  N  N     . ILE A 1  506 ? -21.974 -7.709  193.097 1.00 58.10  ? 506  ILE A N     1 
ATOM   4118  C  CA    . ILE A 1  506 ? -21.706 -7.427  194.507 1.00 55.52  ? 506  ILE A CA    1 
ATOM   4119  C  C     . ILE A 1  506 ? -20.380 -8.023  194.964 1.00 55.24  ? 506  ILE A C     1 
ATOM   4120  O  O     . ILE A 1  506 ? -19.708 -7.453  195.833 1.00 57.07  ? 506  ILE A O     1 
ATOM   4121  C  CB    . ILE A 1  506 ? -22.880 -7.908  195.384 1.00 56.56  ? 506  ILE A CB    1 
ATOM   4122  C  CG1   . ILE A 1  506 ? -24.168 -7.196  194.960 1.00 51.81  ? 506  ILE A CG1   1 
ATOM   4123  C  CG2   . ILE A 1  506 ? -22.594 -7.659  196.862 1.00 30.14  ? 506  ILE A CG2   1 
ATOM   4124  C  CD1   . ILE A 1  506 ? -25.432 -7.792  195.538 1.00 37.46  ? 506  ILE A CD1   1 
ATOM   4125  N  N     . GLN A 1  507 ? -19.950 -9.142  194.376 1.00 56.24  ? 507  GLN A N     1 
ATOM   4126  C  CA    . GLN A 1  507 ? -18.760 -9.807  194.897 1.00 58.61  ? 507  GLN A CA    1 
ATOM   4127  C  C     . GLN A 1  507 ? -17.480 -9.065  194.539 1.00 56.12  ? 507  GLN A C     1 
ATOM   4128  O  O     . GLN A 1  507 ? -16.448 -9.296  195.177 1.00 55.19  ? 507  GLN A O     1 
ATOM   4129  C  CB    . GLN A 1  507 ? -18.689 -11.252 194.401 1.00 57.78  ? 507  GLN A CB    1 
ATOM   4130  C  CG    . GLN A 1  507 ? -19.445 -12.227 195.297 1.00 63.87  ? 507  GLN A CG    1 
ATOM   4131  C  CD    . GLN A 1  507 ? -19.319 -13.672 194.850 1.00 74.31  ? 507  GLN A CD    1 
ATOM   4132  O  OE1   . GLN A 1  507 ? -18.743 -13.963 193.802 1.00 74.70  ? 507  GLN A OE1   1 
ATOM   4133  N  NE2   . GLN A 1  507 ? -19.870 -14.585 195.643 1.00 70.03  ? 507  GLN A NE2   1 
ATOM   4134  N  N     . ALA A 1  508 ? -17.534 -8.146  193.578 1.00 50.94  ? 508  ALA A N     1 
ATOM   4135  C  CA    . ALA A 1  508 ? -16.387 -7.311  193.252 1.00 43.09  ? 508  ALA A CA    1 
ATOM   4136  C  C     . ALA A 1  508 ? -16.272 -6.087  194.150 1.00 46.99  ? 508  ALA A C     1 
ATOM   4137  O  O     . ALA A 1  508 ? -15.537 -5.156  193.803 1.00 49.29  ? 508  ALA A O     1 
ATOM   4138  C  CB    . ALA A 1  508 ? -16.451 -6.873  191.787 1.00 53.46  ? 508  ALA A CB    1 
ATOM   4139  N  N     . GLN A 1  509 ? -17.011 -6.058  195.259 1.00 45.72  ? 509  GLN A N     1 
ATOM   4140  C  CA    . GLN A 1  509 ? -16.964 -4.973  196.233 1.00 45.33  ? 509  GLN A CA    1 
ATOM   4141  C  C     . GLN A 1  509 ? -17.009 -3.569  195.622 1.00 44.56  ? 509  GLN A C     1 
ATOM   4142  O  O     . GLN A 1  509 ? -16.174 -2.724  195.952 1.00 46.44  ? 509  GLN A O     1 
ATOM   4143  C  CB    . GLN A 1  509 ? -15.721 -5.111  197.103 1.00 45.10  ? 509  GLN A CB    1 
ATOM   4144  C  CG    . GLN A 1  509 ? -15.725 -6.252  198.095 1.00 42.52  ? 509  GLN A CG    1 
ATOM   4145  C  CD    . GLN A 1  509 ? -14.321 -6.596  198.561 1.00 49.83  ? 509  GLN A CD    1 
ATOM   4146  O  OE1   . GLN A 1  509 ? -13.554 -7.237  197.840 1.00 60.49  ? 509  GLN A OE1   1 
ATOM   4147  N  NE2   . GLN A 1  509 ? -13.972 -6.158  199.763 1.00 49.97  ? 509  GLN A NE2   1 
ATOM   4148  N  N     . PRO A 1  510 ? -17.968 -3.284  194.740 1.00 46.00  ? 510  PRO A N     1 
ATOM   4149  C  CA    . PRO A 1  510 ? -18.060 -1.914  194.225 1.00 48.01  ? 510  PRO A CA    1 
ATOM   4150  C  C     . PRO A 1  510 ? -18.376 -0.927  195.338 1.00 47.84  ? 510  PRO A C     1 
ATOM   4151  O  O     . PRO A 1  510 ? -18.990 -1.270  196.352 1.00 48.69  ? 510  PRO A O     1 
ATOM   4152  C  CB    . PRO A 1  510 ? -19.205 -1.991  193.208 1.00 45.31  ? 510  PRO A CB    1 
ATOM   4153  C  CG    . PRO A 1  510 ? -20.051 -3.104  193.705 1.00 38.18  ? 510  PRO A CG    1 
ATOM   4154  C  CD    . PRO A 1  510 ? -19.075 -4.118  194.233 1.00 42.33  ? 510  PRO A CD    1 
ATOM   4155  N  N     . ASP A 1  511 ? -17.923 0.309   195.149 1.00 46.27  ? 511  ASP A N     1 
ATOM   4156  C  CA    . ASP A 1  511 ? -18.190 1.386   196.089 1.00 45.85  ? 511  ASP A CA    1 
ATOM   4157  C  C     . ASP A 1  511 ? -18.906 2.539   195.413 1.00 44.64  ? 511  ASP A C     1 
ATOM   4158  O  O     . ASP A 1  511 ? -19.226 3.534   196.072 1.00 55.26  ? 511  ASP A O     1 
ATOM   4159  C  CB    . ASP A 1  511 ? -16.891 1.871   196.757 1.00 50.79  ? 511  ASP A CB    1 
ATOM   4160  C  CG    . ASP A 1  511 ? -15.914 2.523   195.782 1.00 53.14  ? 511  ASP A CG    1 
ATOM   4161  O  OD1   . ASP A 1  511 ? -16.291 2.863   194.642 1.00 50.06  ? 511  ASP A OD1   1 
ATOM   4162  O  OD2   . ASP A 1  511 ? -14.739 2.692   196.168 1.00 67.02  ? 511  ASP A OD2   1 
ATOM   4163  N  N     . LYS A 1  512 ? -19.163 2.421   194.115 1.00 40.75  ? 512  LYS A N     1 
ATOM   4164  C  CA    . LYS A 1  512 ? -19.819 3.437   193.313 1.00 51.74  ? 512  LYS A CA    1 
ATOM   4165  C  C     . LYS A 1  512 ? -20.435 2.726   192.120 1.00 55.05  ? 512  LYS A C     1 
ATOM   4166  O  O     . LYS A 1  512 ? -19.899 1.724   191.639 1.00 55.93  ? 512  LYS A O     1 
ATOM   4167  C  CB    . LYS A 1  512 ? -18.829 4.522   192.858 1.00 57.95  ? 512  LYS A CB    1 
ATOM   4168  C  CG    . LYS A 1  512 ? -17.811 4.042   191.816 1.00 66.32  ? 512  LYS A CG    1 
ATOM   4169  C  CD    . LYS A 1  512 ? -16.934 5.169   191.276 1.00 60.06  ? 512  LYS A CD    1 
ATOM   4170  C  CE    . LYS A 1  512 ? -16.076 5.806   192.362 1.00 70.37  ? 512  LYS A CE    1 
ATOM   4171  N  NZ    . LYS A 1  512 ? -15.344 4.791   193.178 1.00 61.63  ? 512  LYS A NZ    1 
ATOM   4172  N  N     . SER A 1  513 ? -21.583 3.220   191.669 1.00 58.38  ? 513  SER A N     1 
ATOM   4173  C  CA    . SER A 1  513 ? -22.232 2.585   190.534 1.00 62.63  ? 513  SER A CA    1 
ATOM   4174  C  C     . SER A 1  513 ? -23.002 3.610   189.722 1.00 62.40  ? 513  SER A C     1 
ATOM   4175  O  O     . SER A 1  513 ? -23.465 4.625   190.247 1.00 62.02  ? 513  SER A O     1 
ATOM   4176  C  CB    . SER A 1  513 ? -23.184 1.472   190.974 1.00 65.13  ? 513  SER A CB    1 
ATOM   4177  O  OG    . SER A 1  513 ? -23.822 0.889   189.849 1.00 70.26  ? 513  SER A OG    1 
ATOM   4178  N  N     . GLU A 1  514 ? -23.135 3.322   188.430 1.00 72.47  ? 514  GLU A N     1 
ATOM   4179  C  CA    . GLU A 1  514 ? -23.996 4.108   187.564 1.00 78.91  ? 514  GLU A CA    1 
ATOM   4180  C  C     . GLU A 1  514 ? -25.471 3.810   187.800 1.00 81.53  ? 514  GLU A C     1 
ATOM   4181  O  O     . GLU A 1  514 ? -26.323 4.558   187.308 1.00 86.95  ? 514  GLU A O     1 
ATOM   4182  C  CB    . GLU A 1  514 ? -23.642 3.850   186.099 1.00 78.78  ? 514  GLU A CB    1 
ATOM   4183  C  CG    . GLU A 1  514 ? -22.397 4.576   185.621 1.00 91.67  ? 514  GLU A CG    1 
ATOM   4184  C  CD    . GLU A 1  514 ? -21.963 4.131   184.235 1.00 111.28 ? 514  GLU A CD    1 
ATOM   4185  O  OE1   . GLU A 1  514 ? -22.753 3.435   183.562 1.00 110.92 ? 514  GLU A OE1   1 
ATOM   4186  O  OE2   . GLU A 1  514 ? -20.834 4.475   183.818 1.00 106.11 ? 514  GLU A OE2   1 
ATOM   4187  N  N     . SER A 1  515 ? -25.787 2.755   188.552 1.00 72.69  ? 515  SER A N     1 
ATOM   4188  C  CA    . SER A 1  515 ? -27.161 2.379   188.865 1.00 65.97  ? 515  SER A CA    1 
ATOM   4189  C  C     . SER A 1  515 ? -27.517 2.777   190.291 1.00 68.42  ? 515  SER A C     1 
ATOM   4190  O  O     . SER A 1  515 ? -26.849 2.362   191.244 1.00 67.10  ? 515  SER A O     1 
ATOM   4191  C  CB    . SER A 1  515 ? -27.361 0.874   188.684 1.00 68.17  ? 515  SER A CB    1 
ATOM   4192  O  OG    . SER A 1  515 ? -28.363 0.383   189.562 1.00 52.23  ? 515  SER A OG    1 
ATOM   4193  N  N     . GLU A 1  516 ? -28.580 3.577   190.424 1.00 70.63  ? 516  GLU A N     1 
ATOM   4194  C  CA    . GLU A 1  516 ? -28.999 4.065   191.733 1.00 66.25  ? 516  GLU A CA    1 
ATOM   4195  C  C     . GLU A 1  516 ? -29.268 2.911   192.690 1.00 66.17  ? 516  GLU A C     1 
ATOM   4196  O  O     . GLU A 1  516 ? -28.909 2.977   193.872 1.00 66.97  ? 516  GLU A O     1 
ATOM   4197  C  CB    . GLU A 1  516 ? -30.239 4.948   191.581 1.00 69.54  ? 516  GLU A CB    1 
ATOM   4198  C  CG    . GLU A 1  516 ? -30.957 5.273   192.883 1.00 85.03  ? 516  GLU A CG    1 
ATOM   4199  C  CD    . GLU A 1  516 ? -32.443 4.935   192.840 1.00 87.77  ? 516  GLU A CD    1 
ATOM   4200  O  OE1   . GLU A 1  516 ? -32.798 3.830   192.376 1.00 87.70  ? 516  GLU A OE1   1 
ATOM   4201  O  OE2   . GLU A 1  516 ? -33.259 5.777   193.273 1.00 90.96  ? 516  GLU A OE2   1 
ATOM   4202  N  N     . LEU A 1  517 ? -29.895 1.841   192.194 1.00 59.03  ? 517  LEU A N     1 
ATOM   4203  C  CA    . LEU A 1  517 ? -30.223 0.702   193.048 1.00 58.43  ? 517  LEU A CA    1 
ATOM   4204  C  C     . LEU A 1  517 ? -28.964 0.020   193.574 1.00 55.79  ? 517  LEU A C     1 
ATOM   4205  O  O     . LEU A 1  517 ? -28.889 -0.329  194.759 1.00 49.98  ? 517  LEU A O     1 
ATOM   4206  C  CB    . LEU A 1  517 ? -31.097 -0.288  192.273 1.00 52.54  ? 517  LEU A CB    1 
ATOM   4207  C  CG    . LEU A 1  517 ? -31.302 -1.703  192.823 1.00 47.67  ? 517  LEU A CG    1 
ATOM   4208  C  CD1   . LEU A 1  517 ? -31.876 -1.693  194.233 1.00 47.19  ? 517  LEU A CD1   1 
ATOM   4209  C  CD2   . LEU A 1  517 ? -32.190 -2.502  191.886 1.00 44.82  ? 517  LEU A CD2   1 
ATOM   4210  N  N     . VAL A 1  518 ? -27.971 -0.194  192.707 1.00 60.13  ? 518  VAL A N     1 
ATOM   4211  C  CA    . VAL A 1  518 ? -26.702 -0.760  193.161 1.00 62.89  ? 518  VAL A CA    1 
ATOM   4212  C  C     . VAL A 1  518 ? -26.081 0.121   194.239 1.00 53.09  ? 518  VAL A C     1 
ATOM   4213  O  O     . VAL A 1  518 ? -25.613 -0.375  195.274 1.00 36.74  ? 518  VAL A O     1 
ATOM   4214  C  CB    . VAL A 1  518 ? -25.740 -0.964  191.975 1.00 61.81  ? 518  VAL A CB    1 
ATOM   4215  C  CG1   . VAL A 1  518 ? -24.409 -1.509  192.466 1.00 54.63  ? 518  VAL A CG1   1 
ATOM   4216  C  CG2   . VAL A 1  518 ? -26.346 -1.901  190.945 1.00 58.42  ? 518  VAL A CG2   1 
ATOM   4217  N  N     . ASN A 1  519 ? -26.105 1.444   194.032 1.00 52.28  ? 519  ASN A N     1 
ATOM   4218  C  CA    . ASN A 1  519 ? -25.630 2.373   195.054 1.00 50.10  ? 519  ASN A CA    1 
ATOM   4219  C  C     . ASN A 1  519 ? -26.378 2.172   196.361 1.00 52.24  ? 519  ASN A C     1 
ATOM   4220  O  O     . ASN A 1  519 ? -25.793 2.290   197.445 1.00 51.85  ? 519  ASN A O     1 
ATOM   4221  C  CB    . ASN A 1  519 ? -25.778 3.814   194.572 1.00 46.72  ? 519  ASN A CB    1 
ATOM   4222  C  CG    . ASN A 1  519 ? -24.723 4.199   193.558 1.00 58.78  ? 519  ASN A CG    1 
ATOM   4223  O  OD1   . ASN A 1  519 ? -23.553 3.836   193.690 1.00 66.54  ? 519  ASN A OD1   1 
ATOM   4224  N  ND2   . ASN A 1  519 ? -25.129 4.948   192.540 1.00 61.33  ? 519  ASN A ND2   1 
ATOM   4225  N  N     . GLN A 1  520 ? -27.677 1.884   196.279 1.00 51.18  ? 520  GLN A N     1 
ATOM   4226  C  CA    . GLN A 1  520 ? -28.469 1.705   197.488 1.00 51.99  ? 520  GLN A CA    1 
ATOM   4227  C  C     . GLN A 1  520 ? -28.031 0.446   198.223 1.00 50.44  ? 520  GLN A C     1 
ATOM   4228  O  O     . GLN A 1  520 ? -27.967 0.426   199.458 1.00 50.03  ? 520  GLN A O     1 
ATOM   4229  C  CB    . GLN A 1  520 ? -29.953 1.641   197.138 1.00 58.59  ? 520  GLN A CB    1 
ATOM   4230  C  CG    . GLN A 1  520 ? -30.541 2.974   196.722 1.00 62.12  ? 520  GLN A CG    1 
ATOM   4231  C  CD    . GLN A 1  520 ? -32.005 2.866   196.365 1.00 58.26  ? 520  GLN A CD    1 
ATOM   4232  O  OE1   . GLN A 1  520 ? -32.358 2.517   195.239 1.00 66.77  ? 520  GLN A OE1   1 
ATOM   4233  N  NE2   . GLN A 1  520 ? -32.869 3.165   197.324 1.00 62.56  ? 520  GLN A NE2   1 
ATOM   4234  N  N     . ILE A 1  521 ? -27.756 -0.623  197.472 1.00 53.82  ? 521  ILE A N     1 
ATOM   4235  C  CA    . ILE A 1  521 ? -27.273 -1.863  198.070 1.00 47.97  ? 521  ILE A CA    1 
ATOM   4236  C  C     . ILE A 1  521 ? -25.911 -1.645  198.721 1.00 46.82  ? 521  ILE A C     1 
ATOM   4237  O  O     . ILE A 1  521 ? -25.653 -2.124  199.833 1.00 44.07  ? 521  ILE A O     1 
ATOM   4238  C  CB    . ILE A 1  521 ? -27.224 -2.965  196.996 1.00 51.72  ? 521  ILE A CB    1 
ATOM   4239  C  CG1   . ILE A 1  521 ? -28.640 -3.445  196.666 1.00 50.54  ? 521  ILE A CG1   1 
ATOM   4240  C  CG2   . ILE A 1  521 ? -26.349 -4.123  197.445 1.00 51.13  ? 521  ILE A CG2   1 
ATOM   4241  C  CD1   . ILE A 1  521 ? -28.753 -4.148  195.327 1.00 51.68  ? 521  ILE A CD1   1 
ATOM   4242  N  N     . ILE A 1  522 ? -25.013 -0.932  198.031 1.00 48.19  ? 522  ILE A N     1 
ATOM   4243  C  CA    . ILE A 1  522 ? -23.699 -0.614  198.591 1.00 46.37  ? 522  ILE A CA    1 
ATOM   4244  C  C     . ILE A 1  522 ? -23.838 0.100   199.931 1.00 47.37  ? 522  ILE A C     1 
ATOM   4245  O  O     . ILE A 1  522 ? -23.170 -0.243  200.913 1.00 45.64  ? 522  ILE A O     1 
ATOM   4246  C  CB    . ILE A 1  522 ? -22.878 0.229   197.595 1.00 47.59  ? 522  ILE A CB    1 
ATOM   4247  C  CG1   . ILE A 1  522 ? -22.276 -0.652  196.501 1.00 40.75  ? 522  ILE A CG1   1 
ATOM   4248  C  CG2   . ILE A 1  522 ? -21.775 0.991   198.312 1.00 51.59  ? 522  ILE A CG2   1 
ATOM   4249  C  CD1   . ILE A 1  522 ? -22.151 0.051   195.172 1.00 42.29  ? 522  ILE A CD1   1 
ATOM   4250  N  N     . GLU A 1  523 ? -24.721 1.099   199.988 1.00 48.74  ? 523  GLU A N     1 
ATOM   4251  C  CA    . GLU A 1  523 ? -24.959 1.836   201.226 1.00 50.48  ? 523  GLU A CA    1 
ATOM   4252  C  C     . GLU A 1  523 ? -25.407 0.921   202.361 1.00 52.42  ? 523  GLU A C     1 
ATOM   4253  O  O     . GLU A 1  523 ? -24.948 1.065   203.500 1.00 52.99  ? 523  GLU A O     1 
ATOM   4254  C  CB    . GLU A 1  523 ? -25.994 2.932   200.972 1.00 51.61  ? 523  GLU A CB    1 
ATOM   4255  C  CG    . GLU A 1  523 ? -26.394 3.742   202.193 1.00 71.23  ? 523  GLU A CG    1 
ATOM   4256  C  CD    . GLU A 1  523 ? -27.772 4.374   202.040 1.00 89.94  ? 523  GLU A CD    1 
ATOM   4257  O  OE1   . GLU A 1  523 ? -28.128 4.761   200.904 1.00 86.08  ? 523  GLU A OE1   1 
ATOM   4258  O  OE2   . GLU A 1  523 ? -28.501 4.480   203.052 1.00 95.15  ? 523  GLU A OE2   1 
ATOM   4259  N  N     . GLN A 1  524 ? -26.305 -0.023  202.072 1.00 49.75  ? 524  GLN A N     1 
ATOM   4260  C  CA    . GLN A 1  524 ? -26.693 -1.010  203.076 1.00 49.68  ? 524  GLN A CA    1 
ATOM   4261  C  C     . GLN A 1  524 ? -25.523 -1.891  203.495 1.00 46.37  ? 524  GLN A C     1 
ATOM   4262  O  O     . GLN A 1  524 ? -25.298 -2.108  204.692 1.00 45.31  ? 524  GLN A O     1 
ATOM   4263  C  CB    . GLN A 1  524 ? -27.832 -1.876  202.533 1.00 54.06  ? 524  GLN A CB    1 
ATOM   4264  C  CG    . GLN A 1  524 ? -29.179 -1.185  202.506 1.00 47.70  ? 524  GLN A CG    1 
ATOM   4265  C  CD    . GLN A 1  524 ? -29.640 -0.786  203.889 1.00 51.92  ? 524  GLN A CD    1 
ATOM   4266  O  OE1   . GLN A 1  524 ? -29.544 -1.566  204.836 1.00 50.65  ? 524  GLN A OE1   1 
ATOM   4267  N  NE2   . GLN A 1  524 ? -30.131 0.440   204.018 1.00 64.43  ? 524  GLN A NE2   1 
ATOM   4268  N  N     . LEU A 1  525 ? -24.744 -2.370  202.526 1.00 49.82  ? 525  LEU A N     1 
ATOM   4269  C  CA    . LEU A 1  525 ? -23.606 -3.234  202.831 1.00 48.39  ? 525  LEU A CA    1 
ATOM   4270  C  C     . LEU A 1  525 ? -22.600 -2.551  203.749 1.00 49.56  ? 525  LEU A C     1 
ATOM   4271  O  O     . LEU A 1  525 ? -22.033 -3.190  204.644 1.00 45.36  ? 525  LEU A O     1 
ATOM   4272  C  CB    . LEU A 1  525 ? -22.940 -3.691  201.536 1.00 37.00  ? 525  LEU A CB    1 
ATOM   4273  C  CG    . LEU A 1  525 ? -23.780 -4.713  200.770 1.00 41.15  ? 525  LEU A CG    1 
ATOM   4274  C  CD1   . LEU A 1  525 ? -23.265 -4.897  199.353 1.00 33.44  ? 525  LEU A CD1   1 
ATOM   4275  C  CD2   . LEU A 1  525 ? -23.811 -6.037  201.526 1.00 35.80  ? 525  LEU A CD2   1 
ATOM   4276  N  N     . ILE A 1  526 ? -22.354 -1.258  203.538 1.00 50.03  ? 526  ILE A N     1 
ATOM   4277  C  CA    . ILE A 1  526 ? -21.412 -0.546  204.393 1.00 45.87  ? 526  ILE A CA    1 
ATOM   4278  C  C     . ILE A 1  526 ? -21.912 -0.469  205.831 1.00 58.78  ? 526  ILE A C     1 
ATOM   4279  O  O     . ILE A 1  526 ? -21.112 -0.556  206.773 1.00 58.76  ? 526  ILE A O     1 
ATOM   4280  C  CB    . ILE A 1  526 ? -21.150 0.854   203.804 1.00 48.16  ? 526  ILE A CB    1 
ATOM   4281  C  CG1   . ILE A 1  526 ? -20.288 0.740   202.542 1.00 56.49  ? 526  ILE A CG1   1 
ATOM   4282  C  CG2   . ILE A 1  526 ? -20.509 1.769   204.834 1.00 45.90  ? 526  ILE A CG2   1 
ATOM   4283  C  CD1   . ILE A 1  526 ? -20.480 1.875   201.556 1.00 52.96  ? 526  ILE A CD1   1 
ATOM   4284  N  N     . LYS A 1  527 ? -23.232 -0.352  206.038 1.00 57.62  ? 527  LYS A N     1 
ATOM   4285  C  CA    . LYS A 1  527 ? -23.750 -0.319  207.404 1.00 55.87  ? 527  LYS A CA    1 
ATOM   4286  C  C     . LYS A 1  527 ? -23.704 -1.671  208.102 1.00 52.64  ? 527  LYS A C     1 
ATOM   4287  O  O     . LYS A 1  527 ? -23.800 -1.713  209.332 1.00 55.17  ? 527  LYS A O     1 
ATOM   4288  C  CB    . LYS A 1  527 ? -25.193 0.193   207.448 1.00 59.60  ? 527  LYS A CB    1 
ATOM   4289  C  CG    . LYS A 1  527 ? -25.454 1.562   206.844 1.00 68.64  ? 527  LYS A CG    1 
ATOM   4290  C  CD    . LYS A 1  527 ? -26.841 2.047   207.279 1.00 69.61  ? 527  LYS A CD    1 
ATOM   4291  C  CE    . LYS A 1  527 ? -26.887 3.548   207.547 1.00 76.37  ? 527  LYS A CE    1 
ATOM   4292  N  NZ    . LYS A 1  527 ? -26.875 4.366   206.304 1.00 83.67  ? 527  LYS A NZ    1 
ATOM   4293  N  N     . LYS A 1  528 ? -23.544 -2.769  207.370 1.00 46.30  ? 528  LYS A N     1 
ATOM   4294  C  CA    . LYS A 1  528 ? -23.678 -4.062  208.022 1.00 48.57  ? 528  LYS A CA    1 
ATOM   4295  C  C     . LYS A 1  528 ? -22.384 -4.426  208.744 1.00 49.97  ? 528  LYS A C     1 
ATOM   4296  O  O     . LYS A 1  528 ? -21.338 -3.799  208.563 1.00 52.54  ? 528  LYS A O     1 
ATOM   4297  C  CB    . LYS A 1  528 ? -24.038 -5.151  207.011 1.00 48.49  ? 528  LYS A CB    1 
ATOM   4298  C  CG    . LYS A 1  528 ? -25.393 -4.997  206.338 1.00 50.88  ? 528  LYS A CG    1 
ATOM   4299  C  CD    . LYS A 1  528 ? -26.528 -5.401  207.271 1.00 57.04  ? 528  LYS A CD    1 
ATOM   4300  C  CE    . LYS A 1  528 ? -27.872 -4.933  206.735 1.00 54.65  ? 528  LYS A CE    1 
ATOM   4301  N  NZ    . LYS A 1  528 ? -28.997 -5.283  207.642 1.00 45.02  ? 528  LYS A NZ    1 
ATOM   4302  N  N     . GLU A 1  529 ? -22.463 -5.462  209.575 1.00 48.49  ? 529  GLU A N     1 
ATOM   4303  C  CA    . GLU A 1  529 ? -21.283 -5.982  210.250 1.00 49.03  ? 529  GLU A CA    1 
ATOM   4304  C  C     . GLU A 1  529 ? -20.781 -7.288  209.658 1.00 44.58  ? 529  GLU A C     1 
ATOM   4305  O  O     . GLU A 1  529 ? -19.570 -7.526  209.655 1.00 55.55  ? 529  GLU A O     1 
ATOM   4306  C  CB    . GLU A 1  529 ? -21.568 -6.172  211.742 1.00 49.18  ? 529  GLU A CB    1 
ATOM   4307  C  CG    . GLU A 1  529 ? -20.929 -5.103  212.601 1.00 55.62  ? 529  GLU A CG    1 
ATOM   4308  C  CD    . GLU A 1  529 ? -21.600 -4.956  213.944 1.00 64.90  ? 529  GLU A CD    1 
ATOM   4309  O  OE1   . GLU A 1  529 ? -21.843 -3.803  214.360 1.00 65.90  ? 529  GLU A OE1   1 
ATOM   4310  O  OE2   . GLU A 1  529 ? -21.887 -5.991  214.582 1.00 73.91  ? 529  GLU A OE2   1 
ATOM   4311  N  N     . LYS A 1  530 ? -21.678 -8.131  209.151 1.00 36.86  ? 530  LYS A N     1 
ATOM   4312  C  CA    . LYS A 1  530 ? -21.305 -9.387  208.512 1.00 44.67  ? 530  LYS A CA    1 
ATOM   4313  C  C     . LYS A 1  530 ? -22.382 -9.762  207.505 1.00 40.28  ? 530  LYS A C     1 
ATOM   4314  O  O     . LYS A 1  530 ? -23.565 -9.802  207.848 1.00 50.36  ? 530  LYS A O     1 
ATOM   4315  C  CB    . LYS A 1  530 ? -21.140 -10.518 209.535 1.00 43.61  ? 530  LYS A CB    1 
ATOM   4316  C  CG    . LYS A 1  530 ? -19.992 -10.391 210.519 1.00 46.69  ? 530  LYS A CG    1 
ATOM   4317  C  CD    . LYS A 1  530 ? -19.864 -11.670 211.326 1.00 55.56  ? 530  LYS A CD    1 
ATOM   4318  C  CE    . LYS A 1  530 ? -18.695 -11.635 212.290 1.00 47.67  ? 530  LYS A CE    1 
ATOM   4319  N  NZ    . LYS A 1  530 ? -18.386 -13.011 212.761 1.00 48.25  ? 530  LYS A NZ    1 
ATOM   4320  N  N     . VAL A 1  531 ? -21.974 -10.030 206.270 1.00 45.33  ? 531  VAL A N     1 
ATOM   4321  C  CA    . VAL A 1  531 ? -22.885 -10.399 205.195 1.00 38.46  ? 531  VAL A CA    1 
ATOM   4322  C  C     . VAL A 1  531 ? -22.296 -11.609 204.490 1.00 43.27  ? 531  VAL A C     1 
ATOM   4323  O  O     . VAL A 1  531 ? -21.132 -11.577 204.079 1.00 50.00  ? 531  VAL A O     1 
ATOM   4324  C  CB    . VAL A 1  531 ? -23.080 -9.244  204.194 1.00 33.24  ? 531  VAL A CB    1 
ATOM   4325  C  CG1   . VAL A 1  531 ? -23.860 -9.715  202.978 1.00 36.72  ? 531  VAL A CG1   1 
ATOM   4326  C  CG2   . VAL A 1  531 ? -23.758 -8.062  204.859 1.00 38.07  ? 531  VAL A CG2   1 
ATOM   4327  N  N     . TYR A 1  532 ? -23.090 -12.664 204.327 1.00 40.48  ? 532  TYR A N     1 
ATOM   4328  C  CA    . TYR A 1  532 ? -22.626 -13.840 203.605 1.00 37.09  ? 532  TYR A CA    1 
ATOM   4329  C  C     . TYR A 1  532 ? -23.566 -14.095 202.438 1.00 44.33  ? 532  TYR A C     1 
ATOM   4330  O  O     . TYR A 1  532 ? -24.755 -14.362 202.640 1.00 55.32  ? 532  TYR A O     1 
ATOM   4331  C  CB    . TYR A 1  532 ? -22.551 -15.072 204.506 1.00 43.93  ? 532  TYR A CB    1 
ATOM   4332  C  CG    . TYR A 1  532 ? -22.238 -16.339 203.739 1.00 54.58  ? 532  TYR A CG    1 
ATOM   4333  C  CD1   . TYR A 1  532 ? -20.948 -16.587 203.291 1.00 57.15  ? 532  TYR A CD1   1 
ATOM   4334  C  CD2   . TYR A 1  532 ? -23.217 -17.283 203.461 1.00 55.33  ? 532  TYR A CD2   1 
ATOM   4335  C  CE1   . TYR A 1  532 ? -20.636 -17.738 202.598 1.00 59.25  ? 532  TYR A CE1   1 
ATOM   4336  C  CE2   . TYR A 1  532 ? -22.913 -18.441 202.759 1.00 56.37  ? 532  TYR A CE2   1 
ATOM   4337  C  CZ    . TYR A 1  532 ? -21.619 -18.662 202.334 1.00 59.21  ? 532  TYR A CZ    1 
ATOM   4338  O  OH    . TYR A 1  532 ? -21.301 -19.802 201.629 1.00 66.36  ? 532  TYR A OH    1 
ATOM   4339  N  N     . LEU A 1  533 ? -23.036 -13.989 201.230 1.00 45.79  ? 533  LEU A N     1 
ATOM   4340  C  CA    . LEU A 1  533 ? -23.767 -14.270 200.006 1.00 35.49  ? 533  LEU A CA    1 
ATOM   4341  C  C     . LEU A 1  533 ? -23.459 -15.681 199.531 1.00 40.07  ? 533  LEU A C     1 
ATOM   4342  O  O     . LEU A 1  533 ? -22.304 -16.115 199.559 1.00 65.11  ? 533  LEU A O     1 
ATOM   4343  C  CB    . LEU A 1  533 ? -23.390 -13.269 198.917 1.00 38.10  ? 533  LEU A CB    1 
ATOM   4344  C  CG    . LEU A 1  533 ? -24.064 -11.906 199.003 1.00 47.07  ? 533  LEU A CG    1 
ATOM   4345  C  CD1   . LEU A 1  533 ? -23.365 -10.939 198.066 1.00 44.40  ? 533  LEU A CD1   1 
ATOM   4346  C  CD2   . LEU A 1  533 ? -25.543 -12.021 198.669 1.00 41.09  ? 533  LEU A CD2   1 
ATOM   4347  N  N     . ALA A 1  534 ? -24.487 -16.399 199.095 1.00 42.61  ? 534  ALA A N     1 
ATOM   4348  C  CA    . ALA A 1  534 ? -24.307 -17.765 198.629 1.00 46.49  ? 534  ALA A CA    1 
ATOM   4349  C  C     . ALA A 1  534 ? -25.185 -17.974 197.406 1.00 45.76  ? 534  ALA A C     1 
ATOM   4350  O  O     . ALA A 1  534 ? -26.330 -17.514 197.373 1.00 43.19  ? 534  ALA A O     1 
ATOM   4351  C  CB    . ALA A 1  534 ? -24.650 -18.792 199.715 1.00 42.27  ? 534  ALA A CB    1 
ATOM   4352  N  N     . TRP A 1  535 ? -24.641 -18.651 196.399 1.00 42.98  ? 535  TRP A N     1 
ATOM   4353  C  CA    . TRP A 1  535 ? -25.367 -18.906 195.165 1.00 43.14  ? 535  TRP A CA    1 
ATOM   4354  C  C     . TRP A 1  535 ? -25.857 -20.346 195.175 1.00 45.61  ? 535  TRP A C     1 
ATOM   4355  O  O     . TRP A 1  535 ? -25.163 -21.246 195.657 1.00 49.63  ? 535  TRP A O     1 
ATOM   4356  C  CB    . TRP A 1  535 ? -24.490 -18.656 193.936 1.00 54.04  ? 535  TRP A CB    1 
ATOM   4357  C  CG    . TRP A 1  535 ? -25.142 -18.980 192.617 1.00 50.75  ? 535  TRP A CG    1 
ATOM   4358  C  CD1   . TRP A 1  535 ? -25.884 -18.129 191.844 1.00 50.97  ? 535  TRP A CD1   1 
ATOM   4359  C  CD2   . TRP A 1  535 ? -25.102 -20.225 191.912 1.00 45.13  ? 535  TRP A CD2   1 
ATOM   4360  N  NE1   . TRP A 1  535 ? -26.311 -18.770 190.707 1.00 49.48  ? 535  TRP A NE1   1 
ATOM   4361  C  CE2   . TRP A 1  535 ? -25.844 -20.058 190.725 1.00 48.53  ? 535  TRP A CE2   1 
ATOM   4362  C  CE3   . TRP A 1  535 ? -24.514 -21.466 192.170 1.00 44.06  ? 535  TRP A CE3   1 
ATOM   4363  C  CZ2   . TRP A 1  535 ? -26.012 -21.084 189.800 1.00 50.11  ? 535  TRP A CZ2   1 
ATOM   4364  C  CZ3   . TRP A 1  535 ? -24.683 -22.482 191.250 1.00 39.92  ? 535  TRP A CZ3   1 
ATOM   4365  C  CH2   . TRP A 1  535 ? -25.425 -22.286 190.081 1.00 41.18  ? 535  TRP A CH2   1 
ATOM   4366  N  N     . VAL A 1  536 ? -27.061 -20.555 194.652 1.00 49.97  ? 536  VAL A N     1 
ATOM   4367  C  CA    . VAL A 1  536 ? -27.609 -21.892 194.432 1.00 52.08  ? 536  VAL A CA    1 
ATOM   4368  C  C     . VAL A 1  536 ? -28.219 -21.907 193.037 1.00 44.74  ? 536  VAL A C     1 
ATOM   4369  O  O     . VAL A 1  536 ? -28.675 -20.860 192.556 1.00 45.61  ? 536  VAL A O     1 
ATOM   4370  C  CB    . VAL A 1  536 ? -28.646 -22.277 195.504 1.00 51.73  ? 536  VAL A CB    1 
ATOM   4371  C  CG1   . VAL A 1  536 ? -28.021 -22.286 196.894 1.00 43.39  ? 536  VAL A CG1   1 
ATOM   4372  C  CG2   . VAL A 1  536 ? -29.842 -21.339 195.460 1.00 49.83  ? 536  VAL A CG2   1 
ATOM   4373  N  N     . PRO A 1  537 ? -28.191 -23.033 192.327 1.00 46.99  ? 537  PRO A N     1 
ATOM   4374  C  CA    . PRO A 1  537 ? -28.820 -23.064 191.004 1.00 50.26  ? 537  PRO A CA    1 
ATOM   4375  C  C     . PRO A 1  537 ? -30.322 -22.905 191.154 1.00 58.65  ? 537  PRO A C     1 
ATOM   4376  O  O     . PRO A 1  537 ? -30.924 -23.400 192.110 1.00 63.03  ? 537  PRO A O     1 
ATOM   4377  C  CB    . PRO A 1  537 ? -28.450 -24.448 190.460 1.00 51.38  ? 537  PRO A CB    1 
ATOM   4378  C  CG    . PRO A 1  537 ? -28.222 -25.281 191.680 1.00 48.87  ? 537  PRO A CG    1 
ATOM   4379  C  CD    . PRO A 1  537 ? -27.711 -24.359 192.753 1.00 44.24  ? 537  PRO A CD    1 
ATOM   4380  N  N     . ALA A 1  538 ? -30.927 -22.204 190.207 1.00 60.52  ? 538  ALA A N     1 
ATOM   4381  C  CA    . ALA A 1  538 ? -32.373 -22.088 190.247 1.00 62.01  ? 538  ALA A CA    1 
ATOM   4382  C  C     . ALA A 1  538 ? -33.023 -23.380 189.765 1.00 63.46  ? 538  ALA A C     1 
ATOM   4383  O  O     . ALA A 1  538 ? -32.392 -24.225 189.122 1.00 69.87  ? 538  ALA A O     1 
ATOM   4384  C  CB    . ALA A 1  538 ? -32.845 -20.909 189.395 1.00 54.18  ? 538  ALA A CB    1 
ATOM   4385  N  N     . HIS A 1  539 ? -34.294 -23.542 190.127 1.00 55.57  ? 539  HIS A N     1 
ATOM   4386  C  CA    . HIS A 1  539 ? -35.170 -24.599 189.633 1.00 64.29  ? 539  HIS A CA    1 
ATOM   4387  C  C     . HIS A 1  539 ? -34.750 -26.001 190.053 1.00 71.20  ? 539  HIS A C     1 
ATOM   4388  O  O     . HIS A 1  539 ? -35.221 -26.980 189.462 1.00 84.55  ? 539  HIS A O     1 
ATOM   4389  C  CB    . HIS A 1  539 ? -35.305 -24.525 188.111 1.00 54.29  ? 539  HIS A CB    1 
ATOM   4390  C  CG    . HIS A 1  539 ? -35.975 -23.272 187.646 1.00 67.70  ? 539  HIS A CG    1 
ATOM   4391  N  ND1   . HIS A 1  539 ? -37.214 -22.879 188.106 1.00 74.85  ? 539  HIS A ND1   1 
ATOM   4392  C  CD2   . HIS A 1  539 ? -35.573 -22.313 186.779 1.00 75.46  ? 539  HIS A CD2   1 
ATOM   4393  C  CE1   . HIS A 1  539 ? -37.548 -21.735 187.537 1.00 85.40  ? 539  HIS A CE1   1 
ATOM   4394  N  NE2   . HIS A 1  539 ? -36.571 -21.371 186.727 1.00 83.92  ? 539  HIS A NE2   1 
ATOM   4395  N  N     . LYS A 1  540 ? -33.848 -26.134 191.020 1.00 65.55  ? 540  LYS A N     1 
ATOM   4396  C  CA    . LYS A 1  540 ? -33.421 -27.439 191.501 1.00 72.20  ? 540  LYS A CA    1 
ATOM   4397  C  C     . LYS A 1  540 ? -34.106 -27.824 192.805 1.00 86.24  ? 540  LYS A C     1 
ATOM   4398  O  O     . LYS A 1  540 ? -33.689 -28.788 193.454 1.00 88.63  ? 540  LYS A O     1 
ATOM   4399  C  CB    . LYS A 1  540 ? -31.902 -27.475 191.653 1.00 70.40  ? 540  LYS A CB    1 
ATOM   4400  C  CG    . LYS A 1  540 ? -31.199 -27.422 190.312 1.00 68.01  ? 540  LYS A CG    1 
ATOM   4401  C  CD    . LYS A 1  540 ? -31.537 -28.657 189.491 1.00 64.80  ? 540  LYS A CD    1 
ATOM   4402  C  CE    . LYS A 1  540 ? -30.909 -28.599 188.113 1.00 67.86  ? 540  LYS A CE    1 
ATOM   4403  N  NZ    . LYS A 1  540 ? -31.128 -29.851 187.336 1.00 74.58  ? 540  LYS A NZ    1 
ATOM   4404  N  N     . GLY A 1  541 ? -35.143 -27.084 193.197 1.00 85.70  ? 541  GLY A N     1 
ATOM   4405  C  CA    . GLY A 1  541 ? -35.866 -27.281 194.440 1.00 85.45  ? 541  GLY A CA    1 
ATOM   4406  C  C     . GLY A 1  541 ? -34.959 -27.315 195.649 1.00 85.37  ? 541  GLY A C     1 
ATOM   4407  O  O     . GLY A 1  541 ? -34.871 -28.323 196.355 1.00 90.40  ? 541  GLY A O     1 
ATOM   4408  N  N     . ILE A 1  542 ? -34.293 -26.193 195.899 1.00 84.98  ? 542  ILE A N     1 
ATOM   4409  C  CA    . ILE A 1  542 ? -33.415 -26.013 197.046 1.00 82.84  ? 542  ILE A CA    1 
ATOM   4410  C  C     . ILE A 1  542 ? -34.077 -25.063 198.032 1.00 77.62  ? 542  ILE A C     1 
ATOM   4411  O  O     . ILE A 1  542 ? -34.701 -24.076 197.623 1.00 72.63  ? 542  ILE A O     1 
ATOM   4412  C  CB    . ILE A 1  542 ? -32.045 -25.474 196.590 1.00 72.62  ? 542  ILE A CB    1 
ATOM   4413  C  CG1   . ILE A 1  542 ? -31.210 -26.594 195.976 1.00 65.48  ? 542  ILE A CG1   1 
ATOM   4414  C  CG2   . ILE A 1  542 ? -31.296 -24.813 197.739 1.00 66.80  ? 542  ILE A CG2   1 
ATOM   4415  C  CD1   . ILE A 1  542 ? -29.888 -26.117 195.428 1.00 71.99  ? 542  ILE A CD1   1 
ATOM   4416  N  N     . GLY A 1  543 ? -33.947 -25.363 199.324 1.00 83.46  ? 543  GLY A N     1 
ATOM   4417  C  CA    . GLY A 1  543 ? -34.128 -24.378 200.378 1.00 81.62  ? 543  GLY A CA    1 
ATOM   4418  C  C     . GLY A 1  543 ? -35.430 -23.622 200.256 1.00 75.25  ? 543  GLY A C     1 
ATOM   4419  O  O     . GLY A 1  543 ? -36.430 -24.103 199.713 1.00 75.57  ? 543  GLY A O     1 
ATOM   4420  N  N     . GLY A 1  544 ? -35.417 -22.406 200.788 1.00 88.12  ? 544  GLY A N     1 
ATOM   4421  C  CA    . GLY A 1  544 ? -36.469 -21.471 200.479 1.00 84.48  ? 544  GLY A CA    1 
ATOM   4422  C  C     . GLY A 1  544 ? -36.380 -20.913 199.082 1.00 83.09  ? 544  GLY A C     1 
ATOM   4423  O  O     . GLY A 1  544 ? -37.279 -20.186 198.653 1.00 88.38  ? 544  GLY A O     1 
ATOM   4424  N  N     . ASN A 1  545 ? -35.312 -21.260 198.358 1.00 82.71  ? 545  ASN A N     1 
ATOM   4425  C  CA    . ASN A 1  545 ? -35.152 -20.819 196.978 1.00 80.66  ? 545  ASN A CA    1 
ATOM   4426  C  C     . ASN A 1  545 ? -36.290 -21.319 196.099 1.00 72.99  ? 545  ASN A C     1 
ATOM   4427  O  O     . ASN A 1  545 ? -36.814 -20.569 195.269 1.00 68.51  ? 545  ASN A O     1 
ATOM   4428  C  CB    . ASN A 1  545 ? -33.809 -21.299 196.425 1.00 62.61  ? 545  ASN A CB    1 
ATOM   4429  C  CG    . ASN A 1  545 ? -33.664 -21.029 194.944 1.00 61.27  ? 545  ASN A CG    1 
ATOM   4430  O  OD1   . ASN A 1  545 ? -33.521 -19.880 194.524 1.00 60.85  ? 545  ASN A OD1   1 
ATOM   4431  N  ND2   . ASN A 1  545 ? -33.730 -22.086 194.138 1.00 56.18  ? 545  ASN A ND2   1 
ATOM   4432  N  N     . GLU A 1  546 ? -36.709 -22.572 196.286 1.00 67.63  ? 546  GLU A N     1 
ATOM   4433  C  CA    . GLU A 1  546 ? -37.899 -23.045 195.588 1.00 73.81  ? 546  GLU A CA    1 
ATOM   4434  C  C     . GLU A 1  546 ? -39.173 -22.481 196.206 1.00 78.91  ? 546  GLU A C     1 
ATOM   4435  O  O     . GLU A 1  546 ? -40.195 -22.371 195.517 1.00 67.57  ? 546  GLU A O     1 
ATOM   4436  C  CB    . GLU A 1  546 ? -37.925 -24.577 195.585 1.00 72.80  ? 546  GLU A CB    1 
ATOM   4437  C  CG    . GLU A 1  546 ? -38.861 -25.196 194.551 1.00 91.26  ? 546  GLU A CG    1 
ATOM   4438  C  CD    . GLU A 1  546 ? -39.632 -26.399 195.082 1.00 102.36 ? 546  GLU A CD    1 
ATOM   4439  O  OE1   . GLU A 1  546 ? -39.706 -26.572 196.318 1.00 101.39 ? 546  GLU A OE1   1 
ATOM   4440  O  OE2   . GLU A 1  546 ? -40.171 -27.171 194.259 1.00 106.76 ? 546  GLU A OE2   1 
ATOM   4441  N  N     . GLN A 1  547 ? -39.135 -22.114 197.490 1.00 82.07  ? 547  GLN A N     1 
ATOM   4442  C  CA    . GLN A 1  547 ? -40.304 -21.531 198.145 1.00 67.94  ? 547  GLN A CA    1 
ATOM   4443  C  C     . GLN A 1  547 ? -40.480 -20.050 197.818 1.00 64.68  ? 547  GLN A C     1 
ATOM   4444  O  O     . GLN A 1  547 ? -41.616 -19.570 197.742 1.00 77.83  ? 547  GLN A O     1 
ATOM   4445  C  CB    . GLN A 1  547 ? -40.203 -21.722 199.658 1.00 62.19  ? 547  GLN A CB    1 
ATOM   4446  C  CG    . GLN A 1  547 ? -39.612 -23.062 200.061 1.00 79.23  ? 547  GLN A CG    1 
ATOM   4447  C  CD    . GLN A 1  547 ? -40.609 -24.199 200.008 1.00 90.53  ? 547  GLN A CD    1 
ATOM   4448  O  OE1   . GLN A 1  547 ? -41.821 -23.980 199.966 1.00 108.56 ? 547  GLN A OE1   1 
ATOM   4449  N  NE2   . GLN A 1  547 ? -40.101 -25.428 199.999 1.00 80.00  ? 547  GLN A NE2   1 
ATOM   4450  N  N     . VAL A 1  548 ? -39.384 -19.319 197.607 1.00 67.19  ? 548  VAL A N     1 
ATOM   4451  C  CA    . VAL A 1  548 ? -39.470 -17.922 197.189 1.00 62.53  ? 548  VAL A CA    1 
ATOM   4452  C  C     . VAL A 1  548 ? -39.610 -17.792 195.676 1.00 63.83  ? 548  VAL A C     1 
ATOM   4453  O  O     . VAL A 1  548 ? -40.086 -16.755 195.191 1.00 57.72  ? 548  VAL A O     1 
ATOM   4454  C  CB    . VAL A 1  548 ? -38.247 -17.122 197.687 1.00 63.02  ? 548  VAL A CB    1 
ATOM   4455  C  CG1   . VAL A 1  548 ? -36.968 -17.575 196.982 1.00 54.50  ? 548  VAL A CG1   1 
ATOM   4456  C  CG2   . VAL A 1  548 ? -38.467 -15.616 197.544 1.00 50.61  ? 548  VAL A CG2   1 
ATOM   4457  N  N     . ASP A 1  549 ? -39.219 -18.818 194.918 1.00 73.74  ? 549  ASP A N     1 
ATOM   4458  C  CA    . ASP A 1  549 ? -39.385 -18.787 193.469 1.00 72.80  ? 549  ASP A CA    1 
ATOM   4459  C  C     . ASP A 1  549 ? -40.856 -18.787 193.085 1.00 79.69  ? 549  ASP A C     1 
ATOM   4460  O  O     . ASP A 1  549 ? -41.234 -18.176 192.079 1.00 85.00  ? 549  ASP A O     1 
ATOM   4461  C  CB    . ASP A 1  549 ? -38.676 -19.976 192.825 1.00 69.87  ? 549  ASP A CB    1 
ATOM   4462  C  CG    . ASP A 1  549 ? -38.778 -19.964 191.315 1.00 77.46  ? 549  ASP A CG    1 
ATOM   4463  O  OD1   . ASP A 1  549 ? -38.456 -18.923 190.701 1.00 76.88  ? 549  ASP A OD1   1 
ATOM   4464  O  OD2   . ASP A 1  549 ? -39.187 -20.997 190.744 1.00 84.47  ? 549  ASP A OD2   1 
ATOM   4465  N  N     . LYS A 1  550 ? -41.698 -19.436 193.887 1.00 82.47  ? 550  LYS A N     1 
ATOM   4466  C  CA    . LYS A 1  550 ? -43.127 -19.504 193.621 1.00 83.95  ? 550  LYS A CA    1 
ATOM   4467  C  C     . LYS A 1  550 ? -43.883 -18.296 194.154 1.00 78.67  ? 550  LYS A C     1 
ATOM   4468  O  O     . LYS A 1  550 ? -44.969 -17.992 193.648 1.00 85.60  ? 550  LYS A O     1 
ATOM   4469  C  CB    . LYS A 1  550 ? -43.708 -20.775 194.255 1.00 82.89  ? 550  LYS A CB    1 
ATOM   4470  C  CG    . LYS A 1  550 ? -43.363 -22.061 193.519 1.00 89.66  ? 550  LYS A CG    1 
ATOM   4471  C  CD    . LYS A 1  550 ? -43.741 -23.292 194.339 1.00 92.49  ? 550  LYS A CD    1 
ATOM   4472  C  CE    . LYS A 1  550 ? -43.152 -24.563 193.733 1.00 92.75  ? 550  LYS A CE    1 
ATOM   4473  N  NZ    . LYS A 1  550 ? -43.244 -25.736 194.651 1.00 88.84  ? 550  LYS A NZ    1 
ATOM   4474  N  N     . LEU A 1  551 ? -43.317 -17.581 195.128 1.00 72.32  ? 551  LEU A N     1 
ATOM   4475  C  CA    . LEU A 1  551 ? -43.919 -16.331 195.582 1.00 65.73  ? 551  LEU A CA    1 
ATOM   4476  C  C     . LEU A 1  551 ? -43.914 -15.275 194.484 1.00 68.56  ? 551  LEU A C     1 
ATOM   4477  O  O     . LEU A 1  551 ? -44.925 -14.604 194.251 1.00 73.70  ? 551  LEU A O     1 
ATOM   4478  C  CB    . LEU A 1  551 ? -43.191 -15.814 196.822 1.00 58.65  ? 551  LEU A CB    1 
ATOM   4479  C  CG    . LEU A 1  551 ? -43.475 -16.508 198.150 1.00 54.03  ? 551  LEU A CG    1 
ATOM   4480  C  CD1   . LEU A 1  551 ? -42.683 -15.847 199.255 1.00 59.86  ? 551  LEU A CD1   1 
ATOM   4481  C  CD2   . LEU A 1  551 ? -44.954 -16.427 198.458 1.00 72.37  ? 551  LEU A CD2   1 
ATOM   4482  N  N     . VAL A 1  552 ? -42.789 -15.113 193.790 1.00 69.55  ? 552  VAL A N     1 
ATOM   4483  C  CA    . VAL A 1  552 ? -42.613 -13.980 192.889 1.00 68.56  ? 552  VAL A CA    1 
ATOM   4484  C  C     . VAL A 1  552 ? -42.737 -14.386 191.424 1.00 68.06  ? 552  VAL A C     1 
ATOM   4485  O  O     . VAL A 1  552 ? -42.528 -13.553 190.538 1.00 66.84  ? 552  VAL A O     1 
ATOM   4486  C  CB    . VAL A 1  552 ? -41.267 -13.278 193.142 1.00 65.30  ? 552  VAL A CB    1 
ATOM   4487  C  CG1   . VAL A 1  552 ? -41.094 -12.961 194.622 1.00 48.13  ? 552  VAL A CG1   1 
ATOM   4488  C  CG2   . VAL A 1  552 ? -40.115 -14.134 192.636 1.00 68.28  ? 552  VAL A CG2   1 
ATOM   4489  N  N     . SER A 1  553 ? -43.131 -15.626 191.148 1.00 81.93  ? 553  SER A N     1 
ATOM   4490  C  CA    . SER A 1  553 ? -43.525 -16.010 189.794 1.00 81.29  ? 553  SER A CA    1 
ATOM   4491  C  C     . SER A 1  553 ? -45.035 -16.043 189.620 1.00 92.97  ? 553  SER A C     1 
ATOM   4492  O  O     . SER A 1  553 ? -45.535 -15.873 188.508 1.00 96.50  ? 553  SER A O     1 
ATOM   4493  C  CB    . SER A 1  553 ? -42.941 -17.378 189.436 1.00 87.08  ? 553  SER A CB    1 
ATOM   4494  O  OG    . SER A 1  553 ? -41.530 -17.319 189.310 1.00 92.55  ? 553  SER A OG    1 
ATOM   4495  N  N     . PRO B 2  20  ? 24.445  -19.598 147.578 1.00 145.15 ? 4    PRO B N     1 
ATOM   4496  C  CA    . PRO B 2  20  ? 23.712  -19.855 146.333 1.00 145.66 ? 4    PRO B CA    1 
ATOM   4497  C  C     . PRO B 2  20  ? 22.480  -20.735 146.540 1.00 146.21 ? 4    PRO B C     1 
ATOM   4498  O  O     . PRO B 2  20  ? 22.178  -21.577 145.693 1.00 142.98 ? 4    PRO B O     1 
ATOM   4499  C  CB    . PRO B 2  20  ? 24.750  -20.568 145.463 1.00 145.14 ? 4    PRO B CB    1 
ATOM   4500  C  CG    . PRO B 2  20  ? 26.057  -20.044 145.948 1.00 141.96 ? 4    PRO B CG    1 
ATOM   4501  C  CD    . PRO B 2  20  ? 25.891  -19.846 147.429 1.00 146.96 ? 4    PRO B CD    1 
ATOM   4502  N  N     . ILE B 2  21  ? 21.776  -20.534 147.652 1.00 147.67 ? 5    ILE B N     1 
ATOM   4503  C  CA    . ILE B 2  21  ? 20.597  -21.324 147.988 1.00 145.09 ? 5    ILE B CA    1 
ATOM   4504  C  C     . ILE B 2  21  ? 19.364  -20.661 147.390 1.00 146.38 ? 5    ILE B C     1 
ATOM   4505  O  O     . ILE B 2  21  ? 19.193  -19.439 147.474 1.00 134.42 ? 5    ILE B O     1 
ATOM   4506  C  CB    . ILE B 2  21  ? 20.464  -21.484 149.514 1.00 133.93 ? 5    ILE B CB    1 
ATOM   4507  C  CG1   . ILE B 2  21  ? 21.801  -21.911 150.125 1.00 120.28 ? 5    ILE B CG1   1 
ATOM   4508  C  CG2   . ILE B 2  21  ? 19.381  -22.498 149.850 1.00 138.74 ? 5    ILE B CG2   1 
ATOM   4509  C  CD1   . ILE B 2  21  ? 21.759  -22.099 151.625 1.00 111.34 ? 5    ILE B CD1   1 
ATOM   4510  N  N     . GLU B 2  22  ? 18.501  -21.471 146.781 1.00 164.13 ? 6    GLU B N     1 
ATOM   4511  C  CA    . GLU B 2  22  ? 17.288  -20.967 146.150 1.00 164.48 ? 6    GLU B CA    1 
ATOM   4512  C  C     . GLU B 2  22  ? 16.172  -20.815 147.179 1.00 160.19 ? 6    GLU B C     1 
ATOM   4513  O  O     . GLU B 2  22  ? 15.947  -21.704 148.006 1.00 161.13 ? 6    GLU B O     1 
ATOM   4514  C  CB    . GLU B 2  22  ? 16.858  -21.891 145.008 1.00 169.35 ? 6    GLU B CB    1 
ATOM   4515  C  CG    . GLU B 2  22  ? 16.504  -23.317 145.416 1.00 173.02 ? 6    GLU B CG    1 
ATOM   4516  C  CD    . GLU B 2  22  ? 17.724  -24.209 145.581 1.00 176.10 ? 6    GLU B CD    1 
ATOM   4517  O  OE1   . GLU B 2  22  ? 18.766  -23.725 146.071 1.00 173.51 ? 6    GLU B OE1   1 
ATOM   4518  O  OE2   . GLU B 2  22  ? 17.641  -25.400 145.215 1.00 182.10 ? 6    GLU B OE2   1 
ATOM   4519  N  N     . THR B 2  23  ? 15.485  -19.676 147.132 1.00 136.64 ? 7    THR B N     1 
ATOM   4520  C  CA    . THR B 2  23  ? 14.469  -19.349 148.124 1.00 118.85 ? 7    THR B CA    1 
ATOM   4521  C  C     . THR B 2  23  ? 13.161  -20.082 147.849 1.00 109.22 ? 7    THR B C     1 
ATOM   4522  O  O     . THR B 2  23  ? 12.699  -20.157 146.707 1.00 109.30 ? 7    THR B O     1 
ATOM   4523  C  CB    . THR B 2  23  ? 14.217  -17.842 148.147 1.00 113.02 ? 7    THR B CB    1 
ATOM   4524  O  OG1   . THR B 2  23  ? 13.353  -17.482 147.060 1.00 111.71 ? 7    THR B OG1   1 
ATOM   4525  C  CG2   . THR B 2  23  ? 15.527  -17.079 148.021 1.00 107.12 ? 7    THR B CG2   1 
ATOM   4526  N  N     . VAL B 2  24  ? 12.571  -20.626 148.909 1.00 105.55 ? 8    VAL B N     1 
ATOM   4527  C  CA    . VAL B 2  24  ? 11.266  -21.281 148.844 1.00 99.16  ? 8    VAL B CA    1 
ATOM   4528  C  C     . VAL B 2  24  ? 10.167  -20.225 148.759 1.00 107.05 ? 8    VAL B C     1 
ATOM   4529  O  O     . VAL B 2  24  ? 10.000  -19.431 149.697 1.00 112.07 ? 8    VAL B O     1 
ATOM   4530  C  CB    . VAL B 2  24  ? 11.052  -22.202 150.055 1.00 92.46  ? 8    VAL B CB    1 
ATOM   4531  C  CG1   . VAL B 2  24  ? 9.698   -22.888 149.971 1.00 92.11  ? 8    VAL B CG1   1 
ATOM   4532  C  CG2   . VAL B 2  24  ? 12.178  -23.221 150.149 1.00 90.77  ? 8    VAL B CG2   1 
ATOM   4533  N  N     . PRO B 2  25  ? 9.422   -20.159 147.654 1.00 106.41 ? 9    PRO B N     1 
ATOM   4534  C  CA    . PRO B 2  25  ? 8.298   -19.214 147.565 1.00 102.86 ? 9    PRO B CA    1 
ATOM   4535  C  C     . PRO B 2  25  ? 7.301   -19.398 148.700 1.00 116.56 ? 9    PRO B C     1 
ATOM   4536  O  O     . PRO B 2  25  ? 7.058   -20.513 149.169 1.00 124.90 ? 9    PRO B O     1 
ATOM   4537  C  CB    . PRO B 2  25  ? 7.660   -19.544 146.208 1.00 99.72  ? 9    PRO B CB    1 
ATOM   4538  C  CG    . PRO B 2  25  ? 8.234   -20.872 145.804 1.00 94.72  ? 9    PRO B CG    1 
ATOM   4539  C  CD    . PRO B 2  25  ? 9.587   -20.944 146.421 1.00 99.79  ? 9    PRO B CD    1 
ATOM   4540  N  N     . VAL B 2  26  ? 6.716   -18.284 149.144 1.00 111.27 ? 10   VAL B N     1 
ATOM   4541  C  CA    . VAL B 2  26  ? 5.741   -18.285 150.232 1.00 110.31 ? 10   VAL B CA    1 
ATOM   4542  C  C     . VAL B 2  26  ? 4.633   -17.295 149.893 1.00 111.23 ? 10   VAL B C     1 
ATOM   4543  O  O     . VAL B 2  26  ? 4.898   -16.190 149.407 1.00 108.48 ? 10   VAL B O     1 
ATOM   4544  C  CB    . VAL B 2  26  ? 6.379   -17.926 151.594 1.00 108.69 ? 10   VAL B CB    1 
ATOM   4545  C  CG1   . VAL B 2  26  ? 5.345   -18.016 152.706 1.00 108.67 ? 10   VAL B CG1   1 
ATOM   4546  C  CG2   . VAL B 2  26  ? 7.564   -18.831 151.909 1.00 108.64 ? 10   VAL B CG2   1 
ATOM   4547  N  N     . LYS B 2  27  ? 3.387   -17.703 150.134 1.00 120.04 ? 11   LYS B N     1 
ATOM   4548  C  CA    . LYS B 2  27  ? 2.209   -16.883 149.885 1.00 122.50 ? 11   LYS B CA    1 
ATOM   4549  C  C     . LYS B 2  27  ? 1.344   -16.811 151.134 1.00 119.91 ? 11   LYS B C     1 
ATOM   4550  O  O     . LYS B 2  27  ? 1.211   -17.802 151.854 1.00 122.64 ? 11   LYS B O     1 
ATOM   4551  C  CB    . LYS B 2  27  ? 1.379   -17.443 148.724 1.00 125.47 ? 11   LYS B CB    1 
ATOM   4552  C  CG    . LYS B 2  27  ? 1.969   -17.190 147.353 1.00 131.67 ? 11   LYS B CG    1 
ATOM   4553  C  CD    . LYS B 2  27  ? 1.835   -15.721 146.996 1.00 134.46 ? 11   LYS B CD    1 
ATOM   4554  C  CE    . LYS B 2  27  ? 0.372   -15.299 146.986 1.00 126.74 ? 11   LYS B CE    1 
ATOM   4555  N  NZ    . LYS B 2  27  ? 0.212   -13.819 146.951 1.00 122.42 ? 11   LYS B NZ    1 
ATOM   4556  N  N     . LEU B 2  28  ? 0.779   -15.639 151.412 1.00 116.25 ? 12   LEU B N     1 
ATOM   4557  C  CA    . LEU B 2  28  ? -0.241  -15.580 152.450 1.00 115.25 ? 12   LEU B CA    1 
ATOM   4558  C  C     . LEU B 2  28  ? -1.499  -16.313 151.991 1.00 128.73 ? 12   LEU B C     1 
ATOM   4559  O  O     . LEU B 2  28  ? -1.695  -16.584 150.801 1.00 127.92 ? 12   LEU B O     1 
ATOM   4560  C  CB    . LEU B 2  28  ? -0.588  -14.137 152.824 1.00 102.72 ? 12   LEU B CB    1 
ATOM   4561  C  CG    . LEU B 2  28  ? 0.499   -13.070 152.924 1.00 100.12 ? 12   LEU B CG    1 
ATOM   4562  C  CD1   . LEU B 2  28  ? -0.132  -11.685 152.899 1.00 94.47  ? 12   LEU B CD1   1 
ATOM   4563  C  CD2   . LEU B 2  28  ? 1.305   -13.270 154.197 1.00 88.66  ? 12   LEU B CD2   1 
ATOM   4564  N  N     . LYS B 2  29  ? -2.349  -16.653 152.955 1.00 121.46 ? 13   LYS B N     1 
ATOM   4565  C  CA    . LYS B 2  29  ? -3.643  -17.237 152.630 1.00 123.16 ? 13   LYS B CA    1 
ATOM   4566  C  C     . LYS B 2  29  ? -4.419  -16.303 151.703 1.00 123.38 ? 13   LYS B C     1 
ATOM   4567  O  O     . LYS B 2  29  ? -4.493  -15.095 151.969 1.00 120.43 ? 13   LYS B O     1 
ATOM   4568  C  CB    . LYS B 2  29  ? -4.451  -17.525 153.897 1.00 121.38 ? 13   LYS B CB    1 
ATOM   4569  C  CG    . LYS B 2  29  ? -3.731  -18.410 154.908 1.00 121.08 ? 13   LYS B CG    1 
ATOM   4570  C  CD    . LYS B 2  29  ? -4.697  -18.970 155.945 1.00 121.64 ? 13   LYS B CD    1 
ATOM   4571  C  CE    . LYS B 2  29  ? -4.055  -20.091 156.754 1.00 129.51 ? 13   LYS B CE    1 
ATOM   4572  N  NZ    . LYS B 2  29  ? -4.990  -20.665 157.764 1.00 134.82 ? 13   LYS B NZ    1 
ATOM   4573  N  N     . PRO B 2  30  ? -4.972  -16.810 150.602 1.00 122.12 ? 14   PRO B N     1 
ATOM   4574  C  CA    . PRO B 2  30  ? -5.760  -15.966 149.693 1.00 123.79 ? 14   PRO B CA    1 
ATOM   4575  C  C     . PRO B 2  30  ? -6.839  -15.171 150.414 1.00 118.12 ? 14   PRO B C     1 
ATOM   4576  O  O     . PRO B 2  30  ? -7.608  -15.710 151.215 1.00 109.07 ? 14   PRO B O     1 
ATOM   4577  C  CB    . PRO B 2  30  ? -6.366  -16.983 148.722 1.00 130.15 ? 14   PRO B CB    1 
ATOM   4578  C  CG    . PRO B 2  30  ? -5.359  -18.083 148.679 1.00 123.99 ? 14   PRO B CG    1 
ATOM   4579  C  CD    . PRO B 2  30  ? -4.805  -18.178 150.080 1.00 118.79 ? 14   PRO B CD    1 
ATOM   4580  N  N     . GLY B 2  31  ? -6.889  -13.871 150.127 1.00 118.08 ? 15   GLY B N     1 
ATOM   4581  C  CA    . GLY B 2  31  ? -7.868  -13.005 150.752 1.00 115.08 ? 15   GLY B CA    1 
ATOM   4582  C  C     . GLY B 2  31  ? -7.468  -12.465 152.104 1.00 114.17 ? 15   GLY B C     1 
ATOM   4583  O  O     . GLY B 2  31  ? -8.340  -12.140 152.917 1.00 120.80 ? 15   GLY B O     1 
ATOM   4584  N  N     . MET B 2  32  ? -6.168  -12.359 152.372 1.00 114.35 ? 16   MET B N     1 
ATOM   4585  C  CA    . MET B 2  32  ? -5.669  -11.772 153.607 1.00 113.95 ? 16   MET B CA    1 
ATOM   4586  C  C     . MET B 2  32  ? -4.475  -10.875 153.326 1.00 105.10 ? 16   MET B C     1 
ATOM   4587  O  O     . MET B 2  32  ? -3.580  -11.235 152.556 1.00 99.32  ? 16   MET B O     1 
ATOM   4588  C  CB    . MET B 2  32  ? -5.267  -12.841 154.631 1.00 105.27 ? 16   MET B CB    1 
ATOM   4589  C  CG    . MET B 2  32  ? -6.413  -13.369 155.473 1.00 101.14 ? 16   MET B CG    1 
ATOM   4590  S  SD    . MET B 2  32  ? -5.971  -14.891 156.328 1.00 116.53 ? 16   MET B SD    1 
ATOM   4591  C  CE    . MET B 2  32  ? -7.525  -15.292 157.123 1.00 107.28 ? 16   MET B CE    1 
ATOM   4592  N  N     . ASP B 2  33  ? -4.475  -9.704  153.957 1.00 101.53 ? 17   ASP B N     1 
ATOM   4593  C  CA    . ASP B 2  33  ? -3.374  -8.765  153.845 1.00 103.03 ? 17   ASP B CA    1 
ATOM   4594  C  C     . ASP B 2  33  ? -2.286  -9.155  154.845 1.00 103.81 ? 17   ASP B C     1 
ATOM   4595  O  O     . ASP B 2  33  ? -2.487  -10.010 155.709 1.00 105.20 ? 17   ASP B O     1 
ATOM   4596  C  CB    . ASP B 2  33  ? -3.868  -7.342  154.099 1.00 100.78 ? 17   ASP B CB    1 
ATOM   4597  C  CG    . ASP B 2  33  ? -3.095  -6.305  153.315 1.00 102.96 ? 17   ASP B CG    1 
ATOM   4598  O  OD1   . ASP B 2  33  ? -2.221  -6.693  152.514 1.00 104.49 ? 17   ASP B OD1   1 
ATOM   4599  O  OD2   . ASP B 2  33  ? -3.366  -5.099  153.500 1.00 103.83 ? 17   ASP B OD2   1 
ATOM   4600  N  N     . GLY B 2  34  ? -1.108  -8.538  154.718 1.00 90.18  ? 18   GLY B N     1 
ATOM   4601  C  CA    . GLY B 2  34  ? -0.083  -8.731  155.704 1.00 85.13  ? 18   GLY B CA    1 
ATOM   4602  C  C     . GLY B 2  34  ? -0.426  -8.093  157.043 1.00 82.79  ? 18   GLY B C     1 
ATOM   4603  O  O     . GLY B 2  34  ? -1.443  -7.401  157.193 1.00 83.87  ? 18   GLY B O     1 
ATOM   4604  N  N     . PRO B 2  35  ? 0.442   -8.314  158.032 1.00 79.92  ? 19   PRO B N     1 
ATOM   4605  C  CA    . PRO B 2  35  ? 0.188   -7.771  159.372 1.00 72.96  ? 19   PRO B CA    1 
ATOM   4606  C  C     . PRO B 2  35  ? 0.406   -6.267  159.410 1.00 71.45  ? 19   PRO B C     1 
ATOM   4607  O  O     . PRO B 2  35  ? 1.340   -5.742  158.803 1.00 83.35  ? 19   PRO B O     1 
ATOM   4608  C  CB    . PRO B 2  35  ? 1.201   -8.510  160.252 1.00 72.44  ? 19   PRO B CB    1 
ATOM   4609  C  CG    . PRO B 2  35  ? 2.322   -8.847  159.326 1.00 74.56  ? 19   PRO B CG    1 
ATOM   4610  C  CD    . PRO B 2  35  ? 1.718   -9.050  157.959 1.00 77.02  ? 19   PRO B CD    1 
ATOM   4611  N  N     . LYS B 2  36  ? -0.474  -5.570  160.127 1.00 70.26  ? 20   LYS B N     1 
ATOM   4612  C  CA    . LYS B 2  36  ? -0.315  -4.141  160.384 1.00 69.48  ? 20   LYS B CA    1 
ATOM   4613  C  C     . LYS B 2  36  ? -0.497  -3.867  161.881 1.00 67.50  ? 20   LYS B C     1 
ATOM   4614  O  O     . LYS B 2  36  ? -1.420  -3.167  162.294 1.00 63.40  ? 20   LYS B O     1 
ATOM   4615  C  CB    . LYS B 2  36  ? -1.309  -3.336  159.550 1.00 71.71  ? 20   LYS B CB    1 
ATOM   4616  C  CG    . LYS B 2  36  ? -1.011  -3.297  158.055 1.00 70.38  ? 20   LYS B CG    1 
ATOM   4617  C  CD    . LYS B 2  36  ? -2.247  -2.838  157.287 1.00 79.77  ? 20   LYS B CD    1 
ATOM   4618  C  CE    . LYS B 2  36  ? -2.035  -2.830  155.783 1.00 84.23  ? 20   LYS B CE    1 
ATOM   4619  N  NZ    . LYS B 2  36  ? -3.161  -2.137  155.090 1.00 75.28  ? 20   LYS B NZ    1 
ATOM   4620  N  N     . VAL B 2  37  ? 0.393   -4.420  162.706 1.00 73.81  ? 21   VAL B N     1 
ATOM   4621  C  CA    . VAL B 2  37  ? 0.279   -4.313  164.158 1.00 65.38  ? 21   VAL B CA    1 
ATOM   4622  C  C     . VAL B 2  37  ? 1.245   -3.247  164.661 1.00 69.55  ? 21   VAL B C     1 
ATOM   4623  O  O     . VAL B 2  37  ? 2.440   -3.278  164.338 1.00 76.07  ? 21   VAL B O     1 
ATOM   4624  C  CB    . VAL B 2  37  ? 0.558   -5.668  164.830 1.00 65.31  ? 21   VAL B CB    1 
ATOM   4625  C  CG1   . VAL B 2  37  ? 0.093   -5.648  166.273 1.00 73.57  ? 21   VAL B CG1   1 
ATOM   4626  C  CG2   . VAL B 2  37  ? -0.104  -6.799  164.052 1.00 66.77  ? 21   VAL B CG2   1 
ATOM   4627  N  N     . LYS B 2  38  ? 0.730   -2.315  165.465 1.00 55.28  ? 22   LYS B N     1 
ATOM   4628  C  CA    . LYS B 2  38  ? 1.532   -1.199  165.957 1.00 53.82  ? 22   LYS B CA    1 
ATOM   4629  C  C     . LYS B 2  38  ? 2.575   -1.652  166.973 1.00 53.56  ? 22   LYS B C     1 
ATOM   4630  O  O     . LYS B 2  38  ? 2.316   -2.523  167.808 1.00 58.59  ? 22   LYS B O     1 
ATOM   4631  C  CB    . LYS B 2  38  ? 0.632   -0.130  166.574 1.00 52.29  ? 22   LYS B CB    1 
ATOM   4632  C  CG    . LYS B 2  38  ? -0.117  0.697   165.542 1.00 57.85  ? 22   LYS B CG    1 
ATOM   4633  C  CD    . LYS B 2  38  ? -0.450  2.087   166.064 1.00 71.02  ? 22   LYS B CD    1 
ATOM   4634  C  CE    . LYS B 2  38  ? -1.734  2.616   165.437 1.00 86.37  ? 22   LYS B CE    1 
ATOM   4635  N  NZ    . LYS B 2  38  ? -2.228  3.857   166.102 1.00 79.88  ? 22   LYS B NZ    1 
ATOM   4636  N  N     . GLN B 2  39  ? 3.766   -1.063  166.886 1.00 53.27  ? 23   GLN B N     1 
ATOM   4637  C  CA    . GLN B 2  39  ? 4.807   -1.302  167.879 1.00 53.94  ? 23   GLN B CA    1 
ATOM   4638  C  C     . GLN B 2  39  ? 4.423   -0.696  169.223 1.00 57.75  ? 23   GLN B C     1 
ATOM   4639  O  O     . GLN B 2  39  ? 4.004   0.464   169.294 1.00 54.44  ? 23   GLN B O     1 
ATOM   4640  C  CB    . GLN B 2  39  ? 6.138   -0.723  167.409 1.00 52.23  ? 23   GLN B CB    1 
ATOM   4641  C  CG    . GLN B 2  39  ? 7.239   -0.848  168.444 1.00 46.66  ? 23   GLN B CG    1 
ATOM   4642  C  CD    . GLN B 2  39  ? 7.620   -2.287  168.724 1.00 52.31  ? 23   GLN B CD    1 
ATOM   4643  O  OE1   . GLN B 2  39  ? 7.639   -3.126  167.822 1.00 58.33  ? 23   GLN B OE1   1 
ATOM   4644  N  NE2   . GLN B 2  39  ? 7.923   -2.583  169.983 1.00 49.72  ? 23   GLN B NE2   1 
ATOM   4645  N  N     . TRP B 2  40  ? 4.578   -1.479  170.297 1.00 51.98  ? 24   TRP B N     1 
ATOM   4646  C  CA    . TRP B 2  40  ? 4.268   -0.958  171.619 1.00 49.87  ? 24   TRP B CA    1 
ATOM   4647  C  C     . TRP B 2  40  ? 5.516   -0.387  172.290 1.00 52.40  ? 24   TRP B C     1 
ATOM   4648  O  O     . TRP B 2  40  ? 6.645   -0.687  171.888 1.00 55.59  ? 24   TRP B O     1 
ATOM   4649  C  CB    . TRP B 2  40  ? 3.642   -2.056  172.484 1.00 53.46  ? 24   TRP B CB    1 
ATOM   4650  C  CG    . TRP B 2  40  ? 4.486   -3.275  172.727 1.00 55.35  ? 24   TRP B CG    1 
ATOM   4651  C  CD1   . TRP B 2  40  ? 5.611   -3.353  173.497 1.00 59.07  ? 24   TRP B CD1   1 
ATOM   4652  C  CD2   . TRP B 2  40  ? 4.223   -4.608  172.269 1.00 56.50  ? 24   TRP B CD2   1 
ATOM   4653  N  NE1   . TRP B 2  40  ? 6.088   -4.641  173.513 1.00 56.15  ? 24   TRP B NE1   1 
ATOM   4654  C  CE2   . TRP B 2  40  ? 5.252   -5.432  172.768 1.00 54.57  ? 24   TRP B CE2   1 
ATOM   4655  C  CE3   . TRP B 2  40  ? 3.231   -5.181  171.467 1.00 56.04  ? 24   TRP B CE3   1 
ATOM   4656  C  CZ2   . TRP B 2  40  ? 5.315   -6.795  172.496 1.00 49.84  ? 24   TRP B CZ2   1 
ATOM   4657  C  CZ3   . TRP B 2  40  ? 3.293   -6.536  171.201 1.00 52.33  ? 24   TRP B CZ3   1 
ATOM   4658  C  CH2   . TRP B 2  40  ? 4.329   -7.327  171.713 1.00 54.56  ? 24   TRP B CH2   1 
ATOM   4659  N  N     . PRO B 2  41  ? 5.339   0.469   173.304 1.00 51.50  ? 25   PRO B N     1 
ATOM   4660  C  CA    . PRO B 2  41  ? 6.493   1.096   173.972 1.00 55.45  ? 25   PRO B CA    1 
ATOM   4661  C  C     . PRO B 2  41  ? 7.434   0.087   174.623 1.00 50.19  ? 25   PRO B C     1 
ATOM   4662  O  O     . PRO B 2  41  ? 7.004   -0.917  175.192 1.00 57.19  ? 25   PRO B O     1 
ATOM   4663  C  CB    . PRO B 2  41  ? 5.841   2.008   175.019 1.00 48.86  ? 25   PRO B CB    1 
ATOM   4664  C  CG    . PRO B 2  41  ? 4.468   2.256   174.497 1.00 43.22  ? 25   PRO B CG    1 
ATOM   4665  C  CD    . PRO B 2  41  ? 4.066   0.977   173.843 1.00 48.76  ? 25   PRO B CD    1 
ATOM   4666  N  N     . LEU B 2  42  ? 8.733   0.371   174.540 1.00 50.64  ? 26   LEU B N     1 
ATOM   4667  C  CA    . LEU B 2  42  ? 9.774   -0.500  175.069 1.00 55.90  ? 26   LEU B CA    1 
ATOM   4668  C  C     . LEU B 2  42  ? 10.560  0.221   176.159 1.00 60.06  ? 26   LEU B C     1 
ATOM   4669  O  O     . LEU B 2  42  ? 10.803  1.429   176.063 1.00 54.32  ? 26   LEU B O     1 
ATOM   4670  C  CB    . LEU B 2  42  ? 10.718  -0.950  173.954 1.00 53.48  ? 26   LEU B CB    1 
ATOM   4671  C  CG    . LEU B 2  42  ? 10.080  -1.774  172.838 1.00 61.79  ? 26   LEU B CG    1 
ATOM   4672  C  CD1   . LEU B 2  42  ? 11.128  -2.248  171.849 1.00 55.16  ? 26   LEU B CD1   1 
ATOM   4673  C  CD2   . LEU B 2  42  ? 9.323   -2.951  173.429 1.00 65.81  ? 26   LEU B CD2   1 
ATOM   4674  N  N     . THR B 2  43  ? 10.940  -0.518  177.203 1.00 61.25  ? 27   THR B N     1 
ATOM   4675  C  CA    . THR B 2  43  ? 11.811  0.027   178.237 1.00 63.99  ? 27   THR B CA    1 
ATOM   4676  C  C     . THR B 2  43  ? 13.200  0.333   177.678 1.00 71.07  ? 27   THR B C     1 
ATOM   4677  O  O     . THR B 2  43  ? 13.611  -0.186  176.636 1.00 72.35  ? 27   THR B O     1 
ATOM   4678  C  CB    . THR B 2  43  ? 11.924  -0.939  179.422 1.00 63.81  ? 27   THR B CB    1 
ATOM   4679  O  OG1   . THR B 2  43  ? 12.562  -2.155  179.010 1.00 58.93  ? 27   THR B OG1   1 
ATOM   4680  C  CG2   . THR B 2  43  ? 10.553  -1.257  179.983 1.00 78.30  ? 27   THR B CG2   1 
ATOM   4681  N  N     . GLU B 2  44  ? 13.927  1.191   178.402 1.00 78.03  ? 28   GLU B N     1 
ATOM   4682  C  CA    . GLU B 2  44  ? 15.255  1.624   177.966 1.00 77.68  ? 28   GLU B CA    1 
ATOM   4683  C  C     . GLU B 2  44  ? 16.191  0.447   177.722 1.00 77.11  ? 28   GLU B C     1 
ATOM   4684  O  O     . GLU B 2  44  ? 16.857  0.376   176.683 1.00 74.55  ? 28   GLU B O     1 
ATOM   4685  C  CB    . GLU B 2  44  ? 15.869  2.566   179.000 1.00 82.50  ? 28   GLU B CB    1 
ATOM   4686  C  CG    . GLU B 2  44  ? 17.352  2.810   178.760 1.00 96.21  ? 28   GLU B CG    1 
ATOM   4687  C  CD    . GLU B 2  44  ? 17.913  3.938   179.597 1.00 111.85 ? 28   GLU B CD    1 
ATOM   4688  O  OE1   . GLU B 2  44  ? 17.759  3.893   180.836 1.00 125.30 ? 28   GLU B OE1   1 
ATOM   4689  O  OE2   . GLU B 2  44  ? 18.516  4.864   179.014 1.00 115.15 ? 28   GLU B OE2   1 
ATOM   4690  N  N     . GLU B 2  45  ? 16.242  -0.497  178.661 1.00 67.58  ? 29   GLU B N     1 
ATOM   4691  C  CA    . GLU B 2  45  ? 17.139  -1.635  178.498 1.00 64.68  ? 29   GLU B CA    1 
ATOM   4692  C  C     . GLU B 2  45  ? 16.747  -2.485  177.298 1.00 65.83  ? 29   GLU B C     1 
ATOM   4693  O  O     . GLU B 2  45  ? 17.616  -3.053  176.627 1.00 69.42  ? 29   GLU B O     1 
ATOM   4694  C  CB    . GLU B 2  45  ? 17.158  -2.460  179.787 1.00 62.01  ? 29   GLU B CB    1 
ATOM   4695  C  CG    . GLU B 2  45  ? 15.879  -3.233  180.065 1.00 79.54  ? 29   GLU B CG    1 
ATOM   4696  C  CD    . GLU B 2  45  ? 15.843  -3.831  181.459 1.00 82.42  ? 29   GLU B CD    1 
ATOM   4697  O  OE1   . GLU B 2  45  ? 14.733  -4.138  181.947 1.00 98.51  ? 29   GLU B OE1   1 
ATOM   4698  O  OE2   . GLU B 2  45  ? 16.920  -3.994  182.069 1.00 85.71  ? 29   GLU B OE2   1 
ATOM   4699  N  N     . LYS B 2  46  ? 15.450  -2.598  177.024 1.00 67.18  ? 30   LYS B N     1 
ATOM   4700  C  CA    . LYS B 2  46  ? 14.993  -3.382  175.883 1.00 65.96  ? 30   LYS B CA    1 
ATOM   4701  C  C     . LYS B 2  46  ? 15.319  -2.693  174.557 1.00 63.49  ? 30   LYS B C     1 
ATOM   4702  O  O     . LYS B 2  46  ? 15.740  -3.352  173.599 1.00 66.03  ? 30   LYS B O     1 
ATOM   4703  C  CB    . LYS B 2  46  ? 13.504  -3.687  176.033 1.00 64.51  ? 30   LYS B CB    1 
ATOM   4704  C  CG    . LYS B 2  46  ? 13.287  -4.828  177.024 1.00 64.07  ? 30   LYS B CG    1 
ATOM   4705  C  CD    . LYS B 2  46  ? 11.835  -5.212  177.229 1.00 69.10  ? 30   LYS B CD    1 
ATOM   4706  C  CE    . LYS B 2  46  ? 11.724  -6.189  178.395 1.00 62.59  ? 30   LYS B CE    1 
ATOM   4707  N  NZ    . LYS B 2  46  ? 10.711  -7.249  178.159 1.00 57.81  ? 30   LYS B NZ    1 
ATOM   4708  N  N     . ILE B 2  47  ? 15.120  -1.372  174.477 1.00 62.23  ? 31   ILE B N     1 
ATOM   4709  C  CA    . ILE B 2  47  ? 15.493  -0.628  173.272 1.00 61.36  ? 31   ILE B CA    1 
ATOM   4710  C  C     . ILE B 2  47  ? 16.991  -0.718  173.008 1.00 63.37  ? 31   ILE B C     1 
ATOM   4711  O  O     . ILE B 2  47  ? 17.420  -0.877  171.859 1.00 67.99  ? 31   ILE B O     1 
ATOM   4712  C  CB    . ILE B 2  47  ? 15.046  0.842   173.381 1.00 65.18  ? 31   ILE B CB    1 
ATOM   4713  C  CG1   . ILE B 2  47  ? 13.526  0.948   173.453 1.00 62.44  ? 31   ILE B CG1   1 
ATOM   4714  C  CG2   . ILE B 2  47  ? 15.570  1.653   172.201 1.00 56.12  ? 31   ILE B CG2   1 
ATOM   4715  C  CD1   . ILE B 2  47  ? 13.020  2.370   173.548 1.00 59.22  ? 31   ILE B CD1   1 
ATOM   4716  N  N     . LYS B 2  48  ? 17.810  -0.639  174.059 1.00 71.55  ? 32   LYS B N     1 
ATOM   4717  C  CA    . LYS B 2  48  ? 19.254  -0.752  173.868 1.00 66.74  ? 32   LYS B CA    1 
ATOM   4718  C  C     . LYS B 2  48  ? 19.620  -2.123  173.318 1.00 67.73  ? 32   LYS B C     1 
ATOM   4719  O  O     . LYS B 2  48  ? 20.423  -2.235  172.385 1.00 80.83  ? 32   LYS B O     1 
ATOM   4720  C  CB    . LYS B 2  48  ? 19.988  -0.485  175.182 1.00 69.55  ? 32   LYS B CB    1 
ATOM   4721  C  CG    . LYS B 2  48  ? 20.073  0.986   175.571 1.00 76.73  ? 32   LYS B CG    1 
ATOM   4722  C  CD    . LYS B 2  48  ? 20.961  1.172   176.797 1.00 94.06  ? 32   LYS B CD    1 
ATOM   4723  C  CE    . LYS B 2  48  ? 20.731  2.518   177.475 1.00 105.61 ? 32   LYS B CE    1 
ATOM   4724  N  NZ    . LYS B 2  48  ? 20.445  3.617   176.510 1.00 94.17  ? 32   LYS B NZ    1 
ATOM   4725  N  N     . ALA B 2  49  ? 19.035  -3.178  173.883 1.00 57.13  ? 33   ALA B N     1 
ATOM   4726  C  CA    . ALA B 2  49  ? 19.321  -4.526  173.406 1.00 65.57  ? 33   ALA B CA    1 
ATOM   4727  C  C     . ALA B 2  49  ? 18.939  -4.678  171.939 1.00 71.47  ? 33   ALA B C     1 
ATOM   4728  O  O     . ALA B 2  49  ? 19.681  -5.278  171.154 1.00 72.54  ? 33   ALA B O     1 
ATOM   4729  C  CB    . ALA B 2  49  ? 18.588  -5.554  174.264 1.00 75.27  ? 33   ALA B CB    1 
ATOM   4730  N  N     . LEU B 2  50  ? 17.787  -4.131  171.549 1.00 71.84  ? 34   LEU B N     1 
ATOM   4731  C  CA    . LEU B 2  50  ? 17.326  -4.283  170.174 1.00 72.69  ? 34   LEU B CA    1 
ATOM   4732  C  C     . LEU B 2  50  ? 18.192  -3.495  169.205 1.00 71.14  ? 34   LEU B C     1 
ATOM   4733  O  O     . LEU B 2  50  ? 18.477  -3.967  168.099 1.00 74.06  ? 34   LEU B O     1 
ATOM   4734  C  CB    . LEU B 2  50  ? 15.870  -3.845  170.048 1.00 64.14  ? 34   LEU B CB    1 
ATOM   4735  C  CG    . LEU B 2  50  ? 14.871  -4.901  170.495 1.00 65.98  ? 34   LEU B CG    1 
ATOM   4736  C  CD1   . LEU B 2  50  ? 13.458  -4.414  170.272 1.00 77.28  ? 34   LEU B CD1   1 
ATOM   4737  C  CD2   . LEU B 2  50  ? 15.131  -6.175  169.719 1.00 68.88  ? 34   LEU B CD2   1 
ATOM   4738  N  N     . VAL B 2  51  ? 18.614  -2.292  169.593 1.00 72.29  ? 35   VAL B N     1 
ATOM   4739  C  CA    . VAL B 2  51  ? 19.446  -1.491  168.701 1.00 82.30  ? 35   VAL B CA    1 
ATOM   4740  C  C     . VAL B 2  51  ? 20.771  -2.198  168.450 1.00 81.46  ? 35   VAL B C     1 
ATOM   4741  O  O     . VAL B 2  51  ? 21.237  -2.294  167.308 1.00 79.22  ? 35   VAL B O     1 
ATOM   4742  C  CB    . VAL B 2  51  ? 19.650  -0.079  169.280 1.00 75.55  ? 35   VAL B CB    1 
ATOM   4743  C  CG1   . VAL B 2  51  ? 20.798  0.624   168.576 1.00 74.00  ? 35   VAL B CG1   1 
ATOM   4744  C  CG2   . VAL B 2  51  ? 18.366  0.732   169.158 1.00 61.64  ? 35   VAL B CG2   1 
ATOM   4745  N  N     . GLU B 2  52  ? 21.405  -2.696  169.514 1.00 83.87  ? 36   GLU B N     1 
ATOM   4746  C  CA    . GLU B 2  52  ? 22.640  -3.454  169.341 1.00 85.65  ? 36   GLU B CA    1 
ATOM   4747  C  C     . GLU B 2  52  ? 22.412  -4.703  168.495 1.00 82.75  ? 36   GLU B C     1 
ATOM   4748  O  O     . GLU B 2  52  ? 23.148  -4.958  167.536 1.00 89.48  ? 36   GLU B O     1 
ATOM   4749  C  CB    . GLU B 2  52  ? 23.226  -3.829  170.703 1.00 85.32  ? 36   GLU B CB    1 
ATOM   4750  C  CG    . GLU B 2  52  ? 23.927  -5.181  170.717 1.00 89.09  ? 36   GLU B CG    1 
ATOM   4751  C  CD    . GLU B 2  52  ? 24.751  -5.405  171.965 1.00 99.44  ? 36   GLU B CD    1 
ATOM   4752  O  OE1   . GLU B 2  52  ? 24.919  -4.446  172.748 1.00 109.46 ? 36   GLU B OE1   1 
ATOM   4753  O  OE2   . GLU B 2  52  ? 25.236  -6.540  172.159 1.00 100.61 ? 36   GLU B OE2   1 
ATOM   4754  N  N     . ILE B 2  53  ? 21.387  -5.494  168.833 1.00 84.15  ? 37   ILE B N     1 
ATOM   4755  C  CA    . ILE B 2  53  ? 21.111  -6.723  168.087 1.00 85.13  ? 37   ILE B CA    1 
ATOM   4756  C  C     . ILE B 2  53  ? 20.831  -6.419  166.619 1.00 84.32  ? 37   ILE B C     1 
ATOM   4757  O  O     . ILE B 2  53  ? 21.356  -7.089  165.722 1.00 86.10  ? 37   ILE B O     1 
ATOM   4758  C  CB    . ILE B 2  53  ? 19.956  -7.505  168.743 1.00 78.01  ? 37   ILE B CB    1 
ATOM   4759  C  CG1   . ILE B 2  53  ? 20.434  -8.160  170.043 1.00 65.61  ? 37   ILE B CG1   1 
ATOM   4760  C  CG2   . ILE B 2  53  ? 19.400  -8.549  167.787 1.00 76.91  ? 37   ILE B CG2   1 
ATOM   4761  C  CD1   . ILE B 2  53  ? 19.323  -8.580  170.971 1.00 63.03  ? 37   ILE B CD1   1 
ATOM   4762  N  N     . CYS B 2  54  ? 20.000  -5.409  166.348 1.00 80.07  ? 38   CYS B N     1 
ATOM   4763  C  CA    . CYS B 2  54  ? 19.675  -5.098  164.958 1.00 83.09  ? 38   CYS B CA    1 
ATOM   4764  C  C     . CYS B 2  54  ? 20.876  -4.530  164.217 1.00 87.89  ? 38   CYS B C     1 
ATOM   4765  O  O     . CYS B 2  54  ? 21.018  -4.756  163.009 1.00 91.15  ? 38   CYS B O     1 
ATOM   4766  C  CB    . CYS B 2  54  ? 18.473  -4.162  164.875 1.00 82.25  ? 38   CYS B CB    1 
ATOM   4767  S  SG    . CYS B 2  54  ? 16.926  -5.004  165.274 1.00 82.70  ? 38   CYS B SG    1 
ATOM   4768  N  N     . THR B 2  55  ? 21.730  -3.769  164.905 1.00 89.41  ? 39   THR B N     1 
ATOM   4769  C  CA    . THR B 2  55  ? 22.950  -3.283  164.271 1.00 86.99  ? 39   THR B CA    1 
ATOM   4770  C  C     . THR B 2  55  ? 23.795  -4.460  163.800 1.00 80.78  ? 39   THR B C     1 
ATOM   4771  O  O     . THR B 2  55  ? 24.199  -4.525  162.633 1.00 84.23  ? 39   THR B O     1 
ATOM   4772  C  CB    . THR B 2  55  ? 23.736  -2.397  165.240 1.00 88.62  ? 39   THR B CB    1 
ATOM   4773  O  OG1   . THR B 2  55  ? 23.047  -1.153  165.421 1.00 81.73  ? 39   THR B OG1   1 
ATOM   4774  C  CG2   . THR B 2  55  ? 25.127  -2.119  164.695 1.00 96.32  ? 39   THR B CG2   1 
ATOM   4775  N  N     . GLU B 2  56  ? 24.068  -5.406  164.705 1.00 76.15  ? 40   GLU B N     1 
ATOM   4776  C  CA    . GLU B 2  56  ? 24.870  -6.574  164.358 1.00 78.17  ? 40   GLU B CA    1 
ATOM   4777  C  C     . GLU B 2  56  ? 24.207  -7.387  163.254 1.00 83.88  ? 40   GLU B C     1 
ATOM   4778  O  O     . GLU B 2  56  ? 24.891  -7.961  162.399 1.00 94.51  ? 40   GLU B O     1 
ATOM   4779  C  CB    . GLU B 2  56  ? 25.114  -7.439  165.592 1.00 80.45  ? 40   GLU B CB    1 
ATOM   4780  C  CG    . GLU B 2  56  ? 26.217  -8.461  165.402 1.00 81.85  ? 40   GLU B CG    1 
ATOM   4781  C  CD    . GLU B 2  56  ? 27.574  -7.817  165.186 1.00 94.94  ? 40   GLU B CD    1 
ATOM   4782  O  OE1   . GLU B 2  56  ? 28.453  -8.470  164.586 1.00 104.31 ? 40   GLU B OE1   1 
ATOM   4783  O  OE2   . GLU B 2  56  ? 27.764  -6.659  165.618 1.00 91.38  ? 40   GLU B OE2   1 
ATOM   4784  N  N     . MET B 2  57  ? 22.874  -7.467  163.267 1.00 90.06  ? 41   MET B N     1 
ATOM   4785  C  CA    . MET B 2  57  ? 22.183  -8.268  162.264 1.00 92.40  ? 41   MET B CA    1 
ATOM   4786  C  C     . MET B 2  57  ? 22.248  -7.583  160.908 1.00 91.42  ? 41   MET B C     1 
ATOM   4787  O  O     . MET B 2  57  ? 22.292  -8.254  159.871 1.00 93.47  ? 41   MET B O     1 
ATOM   4788  C  CB    . MET B 2  57  ? 20.723  -8.484  162.673 1.00 101.51 ? 41   MET B CB    1 
ATOM   4789  C  CG    . MET B 2  57  ? 20.494  -9.521  163.767 1.00 98.83  ? 41   MET B CG    1 
ATOM   4790  S  SD    . MET B 2  57  ? 18.746  -9.682  164.210 1.00 76.74  ? 41   MET B SD    1 
ATOM   4791  C  CE    . MET B 2  57  ? 18.123  -10.707 162.880 1.00 81.45  ? 41   MET B CE    1 
ATOM   4792  N  N     . GLU B 2  58  ? 22.243  -6.248  160.903 1.00 94.74  ? 42   GLU B N     1 
ATOM   4793  C  CA    . GLU B 2  58  ? 22.273  -5.493  159.657 1.00 96.46  ? 42   GLU B CA    1 
ATOM   4794  C  C     . GLU B 2  58  ? 23.635  -5.602  158.983 1.00 103.05 ? 42   GLU B C     1 
ATOM   4795  O  O     . GLU B 2  58  ? 23.720  -5.720  157.755 1.00 106.25 ? 42   GLU B O     1 
ATOM   4796  C  CB    . GLU B 2  58  ? 21.915  -4.030  159.929 1.00 100.09 ? 42   GLU B CB    1 
ATOM   4797  C  CG    . GLU B 2  58  ? 21.887  -3.141  158.696 1.00 103.77 ? 42   GLU B CG    1 
ATOM   4798  C  CD    . GLU B 2  58  ? 21.619  -1.683  159.033 1.00 106.72 ? 42   GLU B CD    1 
ATOM   4799  O  OE1   . GLU B 2  58  ? 21.988  -1.246  160.143 1.00 108.15 ? 42   GLU B OE1   1 
ATOM   4800  O  OE2   . GLU B 2  58  ? 21.046  -0.971  158.183 1.00 105.16 ? 42   GLU B OE2   1 
ATOM   4801  N  N     . LYS B 2  59  ? 24.715  -5.552  159.774 1.00 100.54 ? 43   LYS B N     1 
ATOM   4802  C  CA    . LYS B 2  59  ? 26.056  -5.764  159.236 1.00 94.20  ? 43   LYS B CA    1 
ATOM   4803  C  C     . LYS B 2  59  ? 26.197  -7.124  158.564 1.00 94.50  ? 43   LYS B C     1 
ATOM   4804  O  O     . LYS B 2  59  ? 27.022  -7.285  157.659 1.00 104.66 ? 43   LYS B O     1 
ATOM   4805  C  CB    . LYS B 2  59  ? 27.096  -5.644  160.353 1.00 94.95  ? 43   LYS B CB    1 
ATOM   4806  C  CG    . LYS B 2  59  ? 27.625  -4.244  160.639 1.00 95.18  ? 43   LYS B CG    1 
ATOM   4807  C  CD    . LYS B 2  59  ? 28.459  -4.263  161.922 1.00 100.11 ? 43   LYS B CD    1 
ATOM   4808  C  CE    . LYS B 2  59  ? 28.988  -2.889  162.316 1.00 96.73  ? 43   LYS B CE    1 
ATOM   4809  N  NZ    . LYS B 2  59  ? 27.917  -1.910  162.638 1.00 90.88  ? 43   LYS B NZ    1 
ATOM   4810  N  N     . GLU B 2  60  ? 25.402  -8.107  158.980 1.00 87.22  ? 44   GLU B N     1 
ATOM   4811  C  CA    . GLU B 2  60  ? 25.511  -9.469  158.479 1.00 89.92  ? 44   GLU B CA    1 
ATOM   4812  C  C     . GLU B 2  60  ? 24.468  -9.787  157.418 1.00 90.30  ? 44   GLU B C     1 
ATOM   4813  O  O     . GLU B 2  60  ? 24.365  -10.941 156.991 1.00 90.01  ? 44   GLU B O     1 
ATOM   4814  C  CB    . GLU B 2  60  ? 25.396  -10.461 159.636 1.00 91.89  ? 44   GLU B CB    1 
ATOM   4815  C  CG    . GLU B 2  60  ? 26.517  -10.364 160.654 1.00 95.44  ? 44   GLU B CG    1 
ATOM   4816  C  CD    . GLU B 2  60  ? 26.152  -10.998 161.986 1.00 107.68 ? 44   GLU B CD    1 
ATOM   4817  O  OE1   . GLU B 2  60  ? 27.074  -11.372 162.742 1.00 107.43 ? 44   GLU B OE1   1 
ATOM   4818  O  OE2   . GLU B 2  60  ? 24.944  -11.106 162.289 1.00 104.52 ? 44   GLU B OE2   1 
ATOM   4819  N  N     . GLY B 2  61  ? 23.688  -8.797  156.994 1.00 86.89  ? 45   GLY B N     1 
ATOM   4820  C  CA    . GLY B 2  61  ? 22.716  -8.981  155.940 1.00 87.29  ? 45   GLY B CA    1 
ATOM   4821  C  C     . GLY B 2  61  ? 21.427  -9.641  156.378 1.00 103.78 ? 45   GLY B C     1 
ATOM   4822  O  O     . GLY B 2  61  ? 20.538  -9.842  155.540 1.00 100.27 ? 45   GLY B O     1 
ATOM   4823  N  N     . LYS B 2  62  ? 21.305  -9.993  157.662 1.00 95.68  ? 46   LYS B N     1 
ATOM   4824  C  CA    . LYS B 2  62  ? 20.127  -10.704 158.149 1.00 87.29  ? 46   LYS B CA    1 
ATOM   4825  C  C     . LYS B 2  62  ? 18.863  -9.862  158.022 1.00 86.50  ? 46   LYS B C     1 
ATOM   4826  O  O     . LYS B 2  62  ? 17.783  -10.401 157.749 1.00 86.33  ? 46   LYS B O     1 
ATOM   4827  C  CB    . LYS B 2  62  ? 20.346  -11.135 159.599 1.00 84.80  ? 46   LYS B CB    1 
ATOM   4828  C  CG    . LYS B 2  62  ? 21.480  -12.137 159.774 1.00 90.61  ? 46   LYS B CG    1 
ATOM   4829  C  CD    . LYS B 2  62  ? 21.815  -12.358 161.243 1.00 93.97  ? 46   LYS B CD    1 
ATOM   4830  C  CE    . LYS B 2  62  ? 22.889  -13.424 161.411 1.00 99.14  ? 46   LYS B CE    1 
ATOM   4831  N  NZ    . LYS B 2  62  ? 23.271  -13.622 162.837 1.00 102.29 ? 46   LYS B NZ    1 
ATOM   4832  N  N     . ILE B 2  63  ? 18.977  -8.545  158.195 1.00 85.80  ? 47   ILE B N     1 
ATOM   4833  C  CA    . ILE B 2  63  ? 17.872  -7.613  158.022 1.00 86.17  ? 47   ILE B CA    1 
ATOM   4834  C  C     . ILE B 2  63  ? 18.369  -6.433  157.193 1.00 84.43  ? 47   ILE B C     1 
ATOM   4835  O  O     . ILE B 2  63  ? 19.571  -6.241  157.009 1.00 90.90  ? 47   ILE B O     1 
ATOM   4836  C  CB    . ILE B 2  63  ? 17.295  -7.143  159.376 1.00 86.03  ? 47   ILE B CB    1 
ATOM   4837  C  CG1   . ILE B 2  63  ? 18.403  -6.563  160.256 1.00 88.34  ? 47   ILE B CG1   1 
ATOM   4838  C  CG2   . ILE B 2  63  ? 16.597  -8.292  160.092 1.00 76.46  ? 47   ILE B CG2   1 
ATOM   4839  C  CD1   . ILE B 2  63  ? 17.899  -5.680  161.369 1.00 89.10  ? 47   ILE B CD1   1 
ATOM   4840  N  N     . SER B 2  64  ? 17.428  -5.628  156.697 1.00 83.68  ? 48   SER B N     1 
ATOM   4841  C  CA    . SER B 2  64  ? 17.806  -4.411  155.990 1.00 85.14  ? 48   SER B CA    1 
ATOM   4842  C  C     . SER B 2  64  ? 16.794  -3.297  156.215 1.00 83.43  ? 48   SER B C     1 
ATOM   4843  O  O     . SER B 2  64  ? 15.608  -3.542  156.450 1.00 85.05  ? 48   SER B O     1 
ATOM   4844  C  CB    . SER B 2  64  ? 17.949  -4.669  154.485 1.00 92.10  ? 48   SER B CB    1 
ATOM   4845  O  OG    . SER B 2  64  ? 19.076  -5.481  154.210 1.00 103.02 ? 48   SER B OG    1 
ATOM   4846  N  N     . LYS B 2  65  ? 17.291  -2.067  156.119 1.00 92.00  ? 49   LYS B N     1 
ATOM   4847  C  CA    . LYS B 2  65  ? 16.512  -0.869  156.395 1.00 91.10  ? 49   LYS B CA    1 
ATOM   4848  C  C     . LYS B 2  65  ? 15.430  -0.679  155.333 1.00 89.81  ? 49   LYS B C     1 
ATOM   4849  O  O     . LYS B 2  65  ? 15.626  -0.999  154.158 1.00 96.03  ? 49   LYS B O     1 
ATOM   4850  C  CB    . LYS B 2  65  ? 17.443  0.344   156.391 1.00 97.24  ? 49   LYS B CB    1 
ATOM   4851  C  CG    . LYS B 2  65  ? 18.026  0.747   157.737 1.00 101.02 ? 49   LYS B CG    1 
ATOM   4852  C  CD    . LYS B 2  65  ? 19.207  1.692   157.507 1.00 114.20 ? 49   LYS B CD    1 
ATOM   4853  C  CE    . LYS B 2  65  ? 19.706  2.341   158.786 1.00 112.02 ? 49   LYS B CE    1 
ATOM   4854  N  NZ    . LYS B 2  65  ? 20.990  1.724   159.234 1.00 113.23 ? 49   LYS B NZ    1 
ATOM   4855  N  N     . ILE B 2  66  ? 14.277  -0.145  155.747 1.00 81.88  ? 50   ILE B N     1 
ATOM   4856  C  CA    . ILE B 2  66  ? 13.143  0.057   154.847 1.00 74.88  ? 50   ILE B CA    1 
ATOM   4857  C  C     . ILE B 2  66  ? 12.473  1.382   155.194 1.00 69.86  ? 50   ILE B C     1 
ATOM   4858  O  O     . ILE B 2  66  ? 12.803  2.029   156.189 1.00 75.57  ? 50   ILE B O     1 
ATOM   4859  C  CB    . ILE B 2  66  ? 12.121  -1.102  154.891 1.00 76.31  ? 50   ILE B CB    1 
ATOM   4860  C  CG1   . ILE B 2  66  ? 11.723  -1.434  156.326 1.00 83.45  ? 50   ILE B CG1   1 
ATOM   4861  C  CG2   . ILE B 2  66  ? 12.676  -2.339  154.200 1.00 75.89  ? 50   ILE B CG2   1 
ATOM   4862  C  CD1   . ILE B 2  66  ? 10.316  -1.993  156.449 1.00 80.11  ? 50   ILE B CD1   1 
ATOM   4863  N  N     . GLY B 2  67  ? 11.523  1.787   154.350 1.00 74.75  ? 51   GLY B N     1 
ATOM   4864  C  CA    . GLY B 2  67  ? 10.855  3.060   154.511 1.00 77.19  ? 51   GLY B CA    1 
ATOM   4865  C  C     . GLY B 2  67  ? 9.382   2.953   154.862 1.00 77.91  ? 51   GLY B C     1 
ATOM   4866  O  O     . GLY B 2  67  ? 8.870   1.880   155.197 1.00 78.04  ? 51   GLY B O     1 
ATOM   4867  N  N     . PRO B 2  68  ? 8.668   4.079   154.777 1.00 77.39  ? 52   PRO B N     1 
ATOM   4868  C  CA    . PRO B 2  68  ? 7.236   4.093   155.105 1.00 81.81  ? 52   PRO B CA    1 
ATOM   4869  C  C     . PRO B 2  68  ? 6.339   3.574   153.994 1.00 92.82  ? 52   PRO B C     1 
ATOM   4870  O  O     . PRO B 2  68  ? 5.122   3.487   154.193 1.00 98.57  ? 52   PRO B O     1 
ATOM   4871  C  CB    . PRO B 2  68  ? 6.961   5.579   155.369 1.00 84.73  ? 52   PRO B CB    1 
ATOM   4872  C  CG    . PRO B 2  68  ? 7.953   6.292   154.526 1.00 87.75  ? 52   PRO B CG    1 
ATOM   4873  C  CD    . PRO B 2  68  ? 9.179   5.422   154.456 1.00 80.32  ? 52   PRO B CD    1 
ATOM   4874  N  N     . GLU B 2  69  ? 6.904   3.239   152.835 1.00 88.59  ? 53   GLU B N     1 
ATOM   4875  C  CA    . GLU B 2  69  ? 6.123   2.754   151.704 1.00 92.95  ? 53   GLU B CA    1 
ATOM   4876  C  C     . GLU B 2  69  ? 5.794   1.269   151.805 1.00 93.36  ? 53   GLU B C     1 
ATOM   4877  O  O     . GLU B 2  69  ? 4.876   0.806   151.119 1.00 95.75  ? 53   GLU B O     1 
ATOM   4878  C  CB    . GLU B 2  69  ? 6.852   3.049   150.387 1.00 93.18  ? 53   GLU B CB    1 
ATOM   4879  C  CG    . GLU B 2  69  ? 8.039   2.144   150.082 1.00 92.20  ? 53   GLU B CG    1 
ATOM   4880  C  CD    . GLU B 2  69  ? 9.302   2.563   150.815 1.00 93.51  ? 53   GLU B CD    1 
ATOM   4881  O  OE1   . GLU B 2  69  ? 9.229   3.482   151.658 1.00 94.38  ? 53   GLU B OE1   1 
ATOM   4882  O  OE2   . GLU B 2  69  ? 10.372  1.975   150.546 1.00 91.67  ? 53   GLU B OE2   1 
ATOM   4883  N  N     . ASN B 2  70  ? 6.516   0.518   152.628 1.00 86.44  ? 54   ASN B N     1 
ATOM   4884  C  CA    . ASN B 2  70  ? 6.042   -0.792  153.063 1.00 82.49  ? 54   ASN B CA    1 
ATOM   4885  C  C     . ASN B 2  70  ? 4.976   -0.615  154.141 1.00 82.22  ? 54   ASN B C     1 
ATOM   4886  O  O     . ASN B 2  70  ? 5.276   -0.084  155.216 1.00 85.18  ? 54   ASN B O     1 
ATOM   4887  C  CB    . ASN B 2  70  ? 7.222   -1.624  153.572 1.00 80.23  ? 54   ASN B CB    1 
ATOM   4888  C  CG    . ASN B 2  70  ? 6.814   -2.978  154.156 1.00 79.50  ? 54   ASN B CG    1 
ATOM   4889  O  OD1   . ASN B 2  70  ? 5.686   -3.191  154.599 1.00 77.36  ? 54   ASN B OD1   1 
ATOM   4890  N  ND2   . ASN B 2  70  ? 7.755   -3.915  154.137 1.00 83.00  ? 54   ASN B ND2   1 
ATOM   4891  N  N     . PRO B 2  71  ? 3.733   -1.038  153.895 1.00 80.95  ? 55   PRO B N     1 
ATOM   4892  C  CA    . PRO B 2  71  ? 2.625   -0.743  154.813 1.00 84.52  ? 55   PRO B CA    1 
ATOM   4893  C  C     . PRO B 2  71  ? 2.480   -1.718  155.971 1.00 83.49  ? 55   PRO B C     1 
ATOM   4894  O  O     . PRO B 2  71  ? 1.523   -1.589  156.744 1.00 83.33  ? 55   PRO B O     1 
ATOM   4895  C  CB    . PRO B 2  71  ? 1.408   -0.824  153.886 1.00 85.79  ? 55   PRO B CB    1 
ATOM   4896  C  CG    . PRO B 2  71  ? 1.778   -1.916  152.935 1.00 80.04  ? 55   PRO B CG    1 
ATOM   4897  C  CD    . PRO B 2  71  ? 3.282   -1.835  152.740 1.00 81.37  ? 55   PRO B CD    1 
ATOM   4898  N  N     . TYR B 2  72  ? 3.373   -2.690  156.106 1.00 80.87  ? 56   TYR B N     1 
ATOM   4899  C  CA    . TYR B 2  72  ? 3.226   -3.763  157.076 1.00 78.36  ? 56   TYR B CA    1 
ATOM   4900  C  C     . TYR B 2  72  ? 4.079   -3.488  158.309 1.00 82.78  ? 56   TYR B C     1 
ATOM   4901  O  O     . TYR B 2  72  ? 5.084   -2.777  158.243 1.00 88.85  ? 56   TYR B O     1 
ATOM   4902  C  CB    . TYR B 2  72  ? 3.613   -5.100  156.444 1.00 79.54  ? 56   TYR B CB    1 
ATOM   4903  C  CG    . TYR B 2  72  ? 2.855   -5.369  155.164 1.00 86.44  ? 56   TYR B CG    1 
ATOM   4904  C  CD1   . TYR B 2  72  ? 1.477   -5.538  155.174 1.00 94.67  ? 56   TYR B CD1   1 
ATOM   4905  C  CD2   . TYR B 2  72  ? 3.515   -5.436  153.944 1.00 78.43  ? 56   TYR B CD2   1 
ATOM   4906  C  CE1   . TYR B 2  72  ? 0.778   -5.773  154.003 1.00 96.74  ? 56   TYR B CE1   1 
ATOM   4907  C  CE2   . TYR B 2  72  ? 2.826   -5.673  152.770 1.00 75.30  ? 56   TYR B CE2   1 
ATOM   4908  C  CZ    . TYR B 2  72  ? 1.458   -5.841  152.805 1.00 83.52  ? 56   TYR B CZ    1 
ATOM   4909  O  OH    . TYR B 2  72  ? 0.769   -6.081  151.639 1.00 91.67  ? 56   TYR B OH    1 
ATOM   4910  N  N     . ASN B 2  73  ? 3.663   -4.056  159.441 1.00 80.61  ? 57   ASN B N     1 
ATOM   4911  C  CA    . ASN B 2  73  ? 4.456   -3.972  160.659 1.00 76.00  ? 57   ASN B CA    1 
ATOM   4912  C  C     . ASN B 2  73  ? 4.084   -5.076  161.634 1.00 72.97  ? 57   ASN B C     1 
ATOM   4913  O  O     . ASN B 2  73  ? 2.915   -5.454  161.745 1.00 73.15  ? 57   ASN B O     1 
ATOM   4914  C  CB    . ASN B 2  73  ? 4.271   -2.623  161.350 1.00 71.90  ? 57   ASN B CB    1 
ATOM   4915  C  CG    . ASN B 2  73  ? 5.395   -2.310  162.302 1.00 73.98  ? 57   ASN B CG    1 
ATOM   4916  O  OD1   . ASN B 2  73  ? 6.524   -2.057  161.886 1.00 81.83  ? 57   ASN B OD1   1 
ATOM   4917  N  ND2   . ASN B 2  73  ? 5.101   -2.357  163.596 1.00 67.69  ? 57   ASN B ND2   1 
ATOM   4918  N  N     . THR B 2  74  ? 5.096   -5.571  162.346 1.00 69.18  ? 58   THR B N     1 
ATOM   4919  C  CA    . THR B 2  74  ? 4.942   -6.609  163.350 1.00 64.41  ? 58   THR B CA    1 
ATOM   4920  C  C     . THR B 2  74  ? 5.696   -6.181  164.605 1.00 63.92  ? 58   THR B C     1 
ATOM   4921  O  O     . THR B 2  74  ? 6.858   -5.752  164.507 1.00 71.51  ? 58   THR B O     1 
ATOM   4922  C  CB    . THR B 2  74  ? 5.483   -7.940  162.815 1.00 57.99  ? 58   THR B CB    1 
ATOM   4923  O  OG1   . THR B 2  74  ? 4.596   -8.449  161.813 1.00 72.40  ? 58   THR B OG1   1 
ATOM   4924  C  CG2   . THR B 2  74  ? 5.569   -8.944  163.921 1.00 57.82  ? 58   THR B CG2   1 
ATOM   4925  N  N     . PRO B 2  75  ? 5.080   -6.238  165.787 1.00 67.62  ? 59   PRO B N     1 
ATOM   4926  C  CA    . PRO B 2  75  ? 5.770   -5.762  166.994 1.00 63.48  ? 59   PRO B CA    1 
ATOM   4927  C  C     . PRO B 2  75  ? 6.996   -6.605  167.313 1.00 57.23  ? 59   PRO B C     1 
ATOM   4928  O  O     . PRO B 2  75  ? 7.016   -7.819  167.097 1.00 62.38  ? 59   PRO B O     1 
ATOM   4929  C  CB    . PRO B 2  75  ? 4.707   -5.894  168.092 1.00 57.54  ? 59   PRO B CB    1 
ATOM   4930  C  CG    . PRO B 2  75  ? 3.414   -6.060  167.376 1.00 62.96  ? 59   PRO B CG    1 
ATOM   4931  C  CD    . PRO B 2  75  ? 3.740   -6.759  166.097 1.00 67.15  ? 59   PRO B CD    1 
ATOM   4932  N  N     . VAL B 2  76  ? 8.028   -5.943  167.836 1.00 55.13  ? 60   VAL B N     1 
ATOM   4933  C  CA    . VAL B 2  76  ? 9.221   -6.620  168.325 1.00 61.50  ? 60   VAL B CA    1 
ATOM   4934  C  C     . VAL B 2  76  ? 9.522   -6.136  169.739 1.00 60.78  ? 60   VAL B C     1 
ATOM   4935  O  O     . VAL B 2  76  ? 9.209   -4.998  170.103 1.00 57.15  ? 60   VAL B O     1 
ATOM   4936  C  CB    . VAL B 2  76  ? 10.429  -6.383  167.382 1.00 61.39  ? 60   VAL B CB    1 
ATOM   4937  C  CG1   . VAL B 2  76  ? 10.783  -4.903  167.320 1.00 57.74  ? 60   VAL B CG1   1 
ATOM   4938  C  CG2   . VAL B 2  76  ? 11.632  -7.223  167.794 1.00 61.02  ? 60   VAL B CG2   1 
ATOM   4939  N  N     . PHE B 2  77  ? 10.121  -7.012  170.540 1.00 62.47  ? 61   PHE B N     1 
ATOM   4940  C  CA    . PHE B 2  77  ? 10.650  -6.638  171.850 1.00 57.44  ? 61   PHE B CA    1 
ATOM   4941  C  C     . PHE B 2  77  ? 11.779  -7.611  172.186 1.00 60.46  ? 61   PHE B C     1 
ATOM   4942  O  O     . PHE B 2  77  ? 12.311  -8.287  171.299 1.00 56.73  ? 61   PHE B O     1 
ATOM   4943  C  CB    . PHE B 2  77  ? 9.528   -6.572  172.906 1.00 60.23  ? 61   PHE B CB    1 
ATOM   4944  C  CG    . PHE B 2  77  ? 8.939   -7.905  173.286 1.00 57.66  ? 61   PHE B CG    1 
ATOM   4945  C  CD1   . PHE B 2  77  ? 8.160   -8.623  172.392 1.00 58.79  ? 61   PHE B CD1   1 
ATOM   4946  C  CD2   . PHE B 2  77  ? 9.117   -8.410  174.565 1.00 55.71  ? 61   PHE B CD2   1 
ATOM   4947  C  CE1   . PHE B 2  77  ? 7.604   -9.839  172.753 1.00 56.79  ? 61   PHE B CE1   1 
ATOM   4948  C  CE2   . PHE B 2  77  ? 8.562   -9.622  174.933 1.00 55.10  ? 61   PHE B CE2   1 
ATOM   4949  C  CZ    . PHE B 2  77  ? 7.807   -10.339 174.026 1.00 56.14  ? 61   PHE B CZ    1 
ATOM   4950  N  N     . ALA B 2  78  ? 12.136  -7.703  173.466 1.00 62.97  ? 62   ALA B N     1 
ATOM   4951  C  CA    . ALA B 2  78  ? 13.282  -8.500  173.882 1.00 60.21  ? 62   ALA B CA    1 
ATOM   4952  C  C     . ALA B 2  78  ? 13.003  -9.158  175.224 1.00 47.78  ? 62   ALA B C     1 
ATOM   4953  O  O     . ALA B 2  78  ? 12.300  -8.603  176.072 1.00 50.84  ? 62   ALA B O     1 
ATOM   4954  C  CB    . ALA B 2  78  ? 14.555  -7.648  173.972 1.00 65.51  ? 62   ALA B CB    1 
ATOM   4955  N  N     . ILE B 2  79  ? 13.599  -10.338 175.420 1.00 48.23  ? 63   ILE B N     1 
ATOM   4956  C  CA    . ILE B 2  79  ? 13.398  -11.142 176.618 1.00 56.29  ? 63   ILE B CA    1 
ATOM   4957  C  C     . ILE B 2  79  ? 14.723  -11.744 177.057 1.00 52.40  ? 63   ILE B C     1 
ATOM   4958  O  O     . ILE B 2  79  ? 15.697  -11.782 176.304 1.00 61.55  ? 63   ILE B O     1 
ATOM   4959  C  CB    . ILE B 2  79  ? 12.397  -12.299 176.402 1.00 55.64  ? 63   ILE B CB    1 
ATOM   4960  C  CG1   . ILE B 2  79  ? 12.948  -13.270 175.358 1.00 49.50  ? 63   ILE B CG1   1 
ATOM   4961  C  CG2   . ILE B 2  79  ? 11.037  -11.779 175.976 1.00 54.95  ? 63   ILE B CG2   1 
ATOM   4962  C  CD1   . ILE B 2  79  ? 12.472  -14.692 175.541 1.00 54.17  ? 63   ILE B CD1   1 
ATOM   4963  N  N     . LYS B 2  80  ? 14.753  -12.192 178.310 1.00 64.32  ? 64   LYS B N     1 
ATOM   4964  C  CA    . LYS B 2  80  ? 15.818  -13.036 178.833 1.00 49.22  ? 64   LYS B CA    1 
ATOM   4965  C  C     . LYS B 2  80  ? 15.205  -14.380 179.194 1.00 53.35  ? 64   LYS B C     1 
ATOM   4966  O  O     . LYS B 2  80  ? 14.225  -14.432 179.943 1.00 75.10  ? 64   LYS B O     1 
ATOM   4967  C  CB    . LYS B 2  80  ? 16.473  -12.421 180.071 1.00 48.56  ? 64   LYS B CB    1 
ATOM   4968  C  CG    . LYS B 2  80  ? 17.513  -11.362 179.782 1.00 66.47  ? 64   LYS B CG    1 
ATOM   4969  C  CD    . LYS B 2  80  ? 17.666  -10.414 180.962 1.00 65.77  ? 64   LYS B CD    1 
ATOM   4970  C  CE    . LYS B 2  80  ? 18.802  -9.429  180.738 1.00 70.46  ? 64   LYS B CE    1 
ATOM   4971  N  NZ    . LYS B 2  80  ? 18.985  -8.508  181.895 1.00 77.40  ? 64   LYS B NZ    1 
ATOM   4972  N  N     . LYS B 2  81  ? 15.775  -15.463 178.676 1.00 62.16  ? 65   LYS B N     1 
ATOM   4973  C  CA    . LYS B 2  81  ? 15.237  -16.775 178.997 1.00 61.05  ? 65   LYS B CA    1 
ATOM   4974  C  C     . LYS B 2  81  ? 15.529  -17.113 180.460 1.00 62.56  ? 65   LYS B C     1 
ATOM   4975  O  O     . LYS B 2  81  ? 16.226  -16.380 181.168 1.00 63.78  ? 65   LYS B O     1 
ATOM   4976  C  CB    . LYS B 2  81  ? 15.815  -17.838 178.064 1.00 73.94  ? 65   LYS B CB    1 
ATOM   4977  C  CG    . LYS B 2  81  ? 15.590  -17.569 176.585 1.00 79.02  ? 65   LYS B CG    1 
ATOM   4978  C  CD    . LYS B 2  81  ? 15.959  -18.776 175.732 1.00 89.16  ? 65   LYS B CD    1 
ATOM   4979  C  CE    . LYS B 2  81  ? 14.977  -19.919 175.957 1.00 90.40  ? 65   LYS B CE    1 
ATOM   4980  N  NZ    . LYS B 2  81  ? 15.241  -21.097 175.081 1.00 90.43  ? 65   LYS B NZ    1 
ATOM   4981  N  N     . LYS B 2  82  ? 14.943  -18.214 180.930 1.00 71.37  ? 66   LYS B N     1 
ATOM   4982  C  CA    . LYS B 2  82  ? 15.116  -18.613 182.324 1.00 75.46  ? 66   LYS B CA    1 
ATOM   4983  C  C     . LYS B 2  82  ? 16.588  -18.781 182.678 1.00 80.22  ? 66   LYS B C     1 
ATOM   4984  O  O     . LYS B 2  82  ? 17.318  -19.532 182.025 1.00 79.90  ? 66   LYS B O     1 
ATOM   4985  C  CB    . LYS B 2  82  ? 14.355  -19.904 182.616 1.00 70.42  ? 66   LYS B CB    1 
ATOM   4986  C  CG    . LYS B 2  82  ? 13.075  -19.668 183.379 1.00 58.63  ? 66   LYS B CG    1 
ATOM   4987  C  CD    . LYS B 2  82  ? 12.368  -20.957 183.728 1.00 61.34  ? 66   LYS B CD    1 
ATOM   4988  C  CE    . LYS B 2  82  ? 10.879  -20.802 183.513 1.00 54.23  ? 66   LYS B CE    1 
ATOM   4989  N  NZ    . LYS B 2  82  ? 10.322  -19.826 184.489 1.00 55.49  ? 66   LYS B NZ    1 
ATOM   4990  N  N     . ASP B 2  83  ? 17.012  -18.072 183.724 1.00 80.60  ? 67   ASP B N     1 
ATOM   4991  C  CA    . ASP B 2  83  ? 18.378  -18.134 184.246 1.00 73.10  ? 67   ASP B CA    1 
ATOM   4992  C  C     . ASP B 2  83  ? 19.402  -17.739 183.185 1.00 76.93  ? 67   ASP B C     1 
ATOM   4993  O  O     . ASP B 2  83  ? 20.489  -18.313 183.100 1.00 84.62  ? 67   ASP B O     1 
ATOM   4994  C  CB    . ASP B 2  83  ? 18.697  -19.520 184.814 1.00 67.59  ? 67   ASP B CB    1 
ATOM   4995  C  CG    . ASP B 2  83  ? 17.943  -19.816 186.094 1.00 70.68  ? 67   ASP B CG    1 
ATOM   4996  O  OD1   . ASP B 2  83  ? 17.535  -18.856 186.780 1.00 75.05  ? 67   ASP B OD1   1 
ATOM   4997  O  OD2   . ASP B 2  83  ? 17.768  -21.009 186.420 1.00 67.22  ? 67   ASP B OD2   1 
ATOM   4998  N  N     . SER B 2  84  ? 19.051  -16.761 182.357 1.00 77.55  ? 68   SER B N     1 
ATOM   4999  C  CA    . SER B 2  84  ? 19.929  -16.287 181.300 1.00 80.17  ? 68   SER B CA    1 
ATOM   5000  C  C     . SER B 2  84  ? 20.159  -14.798 181.492 1.00 84.82  ? 68   SER B C     1 
ATOM   5001  O  O     . SER B 2  84  ? 19.248  -14.072 181.904 1.00 84.75  ? 68   SER B O     1 
ATOM   5002  C  CB    . SER B 2  84  ? 19.342  -16.554 179.912 1.00 79.28  ? 68   SER B CB    1 
ATOM   5003  O  OG    . SER B 2  84  ? 20.069  -15.859 178.913 1.00 93.71  ? 68   SER B OG    1 
ATOM   5004  N  N     . THR B 2  85  ? 21.372  -14.339 181.200 1.00 82.74  ? 69   THR B N     1 
ATOM   5005  C  CA    . THR B 2  85  ? 21.709  -12.940 181.403 1.00 75.01  ? 69   THR B CA    1 
ATOM   5006  C  C     . THR B 2  85  ? 21.797  -12.160 180.102 1.00 74.76  ? 69   THR B C     1 
ATOM   5007  O  O     . THR B 2  85  ? 21.960  -10.935 180.139 1.00 73.48  ? 69   THR B O     1 
ATOM   5008  C  CB    . THR B 2  85  ? 23.035  -12.820 182.160 1.00 78.14  ? 69   THR B CB    1 
ATOM   5009  O  OG1   . THR B 2  85  ? 23.213  -11.467 182.597 1.00 80.36  ? 69   THR B OG1   1 
ATOM   5010  C  CG2   . THR B 2  85  ? 24.198  -13.221 181.261 1.00 83.08  ? 69   THR B CG2   1 
ATOM   5011  N  N     . LYS B 2  86  ? 21.663  -12.826 178.959 1.00 79.20  ? 70   LYS B N     1 
ATOM   5012  C  CA    . LYS B 2  86  ? 21.819  -12.194 177.656 1.00 87.12  ? 70   LYS B CA    1 
ATOM   5013  C  C     . LYS B 2  86  ? 20.470  -12.000 176.970 1.00 75.85  ? 70   LYS B C     1 
ATOM   5014  O  O     . LYS B 2  86  ? 19.671  -12.937 176.860 1.00 72.19  ? 70   LYS B O     1 
ATOM   5015  C  CB    . LYS B 2  86  ? 22.804  -12.987 176.787 1.00 92.55  ? 70   LYS B CB    1 
ATOM   5016  C  CG    . LYS B 2  86  ? 22.341  -14.346 176.312 1.00 107.57 ? 70   LYS B CG    1 
ATOM   5017  C  CD    . LYS B 2  86  ? 23.424  -15.051 175.498 1.00 121.51 ? 70   LYS B CD    1 
ATOM   5018  C  CE    . LYS B 2  86  ? 24.220  -14.071 174.646 1.00 116.57 ? 70   LYS B CE    1 
ATOM   5019  N  NZ    . LYS B 2  86  ? 23.452  -13.608 173.457 1.00 127.77 ? 70   LYS B NZ    1 
ATOM   5020  N  N     . TRP B 2  87  ? 20.219  -10.762 176.556 1.00 62.66  ? 71   TRP B N     1 
ATOM   5021  C  CA    . TRP B 2  87  ? 19.013  -10.384 175.834 1.00 60.83  ? 71   TRP B CA    1 
ATOM   5022  C  C     . TRP B 2  87  ? 18.835  -11.174 174.542 1.00 68.89  ? 71   TRP B C     1 
ATOM   5023  O  O     . TRP B 2  87  ? 19.802  -11.562 173.881 1.00 90.07  ? 71   TRP B O     1 
ATOM   5024  C  CB    . TRP B 2  87  ? 19.033  -8.895  175.503 1.00 63.17  ? 71   TRP B CB    1 
ATOM   5025  C  CG    . TRP B 2  87  ? 18.830  -8.020  176.681 1.00 72.52  ? 71   TRP B CG    1 
ATOM   5026  C  CD1   . TRP B 2  87  ? 19.775  -7.285  177.333 1.00 72.14  ? 71   TRP B CD1   1 
ATOM   5027  C  CD2   . TRP B 2  87  ? 17.602  -7.816  177.386 1.00 81.05  ? 71   TRP B CD2   1 
ATOM   5028  N  NE1   . TRP B 2  87  ? 19.204  -6.611  178.387 1.00 77.17  ? 71   TRP B NE1   1 
ATOM   5029  C  CE2   . TRP B 2  87  ? 17.871  -6.924  178.443 1.00 77.82  ? 71   TRP B CE2   1 
ATOM   5030  C  CE3   . TRP B 2  87  ? 16.297  -8.296  177.221 1.00 73.20  ? 71   TRP B CE3   1 
ATOM   5031  C  CZ2   . TRP B 2  87  ? 16.884  -6.502  179.331 1.00 82.37  ? 71   TRP B CZ2   1 
ATOM   5032  C  CZ3   . TRP B 2  87  ? 15.319  -7.876  178.102 1.00 71.13  ? 71   TRP B CZ3   1 
ATOM   5033  C  CH2   . TRP B 2  87  ? 15.617  -6.987  179.145 1.00 84.04  ? 71   TRP B CH2   1 
ATOM   5034  N  N     . ARG B 2  88  ? 17.573  -11.416 174.191 1.00 69.22  ? 72   ARG B N     1 
ATOM   5035  C  CA    . ARG B 2  88  ? 17.205  -12.221 173.034 1.00 64.73  ? 72   ARG B CA    1 
ATOM   5036  C  C     . ARG B 2  88  ? 16.098  -11.474 172.315 1.00 57.50  ? 72   ARG B C     1 
ATOM   5037  O  O     . ARG B 2  88  ? 15.084  -11.127 172.927 1.00 63.68  ? 72   ARG B O     1 
ATOM   5038  C  CB    . ARG B 2  88  ? 16.704  -13.611 173.446 1.00 65.12  ? 72   ARG B CB    1 
ATOM   5039  C  CG    . ARG B 2  88  ? 16.832  -14.677 172.378 1.00 63.01  ? 72   ARG B CG    1 
ATOM   5040  C  CD    . ARG B 2  88  ? 15.600  -14.845 171.525 1.00 60.34  ? 72   ARG B CD    1 
ATOM   5041  N  NE    . ARG B 2  88  ? 15.566  -16.169 170.905 1.00 63.92  ? 72   ARG B NE    1 
ATOM   5042  C  CZ    . ARG B 2  88  ? 14.630  -16.574 170.050 1.00 72.43  ? 72   ARG B CZ    1 
ATOM   5043  N  NH1   . ARG B 2  88  ? 13.627  -15.768 169.727 1.00 71.00  ? 72   ARG B NH1   1 
ATOM   5044  N  NH2   . ARG B 2  88  ? 14.684  -17.797 169.536 1.00 70.59  ? 72   ARG B NH2   1 
ATOM   5045  N  N     . LYS B 2  89  ? 16.281  -11.239 171.021 1.00 58.54  ? 73   LYS B N     1 
ATOM   5046  C  CA    . LYS B 2  89  ? 15.254  -10.542 170.265 1.00 53.47  ? 73   LYS B CA    1 
ATOM   5047  C  C     . LYS B 2  89  ? 14.059  -11.464 170.082 1.00 50.84  ? 73   LYS B C     1 
ATOM   5048  O  O     . LYS B 2  89  ? 14.210  -12.655 169.796 1.00 49.48  ? 73   LYS B O     1 
ATOM   5049  C  CB    . LYS B 2  89  ? 15.829  -10.072 168.930 1.00 54.29  ? 73   LYS B CB    1 
ATOM   5050  C  CG    . LYS B 2  89  ? 14.899  -9.285  168.029 1.00 57.53  ? 73   LYS B CG    1 
ATOM   5051  C  CD    . LYS B 2  89  ? 15.719  -8.656  166.903 1.00 72.57  ? 73   LYS B CD    1 
ATOM   5052  C  CE    . LYS B 2  89  ? 15.153  -8.920  165.521 1.00 69.59  ? 73   LYS B CE    1 
ATOM   5053  N  NZ    . LYS B 2  89  ? 13.926  -8.140  165.201 1.00 70.70  ? 73   LYS B NZ    1 
ATOM   5054  N  N     . LEU B 2  90  ? 12.861  -10.905 170.231 1.00 55.18  ? 74   LEU B N     1 
ATOM   5055  C  CA    . LEU B 2  90  ? 11.628  -11.656 170.040 1.00 61.88  ? 74   LEU B CA    1 
ATOM   5056  C  C     . LEU B 2  90  ? 10.668  -10.826 169.207 1.00 57.78  ? 74   LEU B C     1 
ATOM   5057  O  O     . LEU B 2  90  ? 10.356  -9.686  169.567 1.00 53.45  ? 74   LEU B O     1 
ATOM   5058  C  CB    . LEU B 2  90  ? 11.001  -12.020 171.389 1.00 59.25  ? 74   LEU B CB    1 
ATOM   5059  C  CG    . LEU B 2  90  ? 9.703   -12.820 171.366 1.00 47.53  ? 74   LEU B CG    1 
ATOM   5060  C  CD1   . LEU B 2  90  ? 9.784   -13.917 170.317 1.00 55.56  ? 74   LEU B CD1   1 
ATOM   5061  C  CD2   . LEU B 2  90  ? 9.442   -13.410 172.740 1.00 57.98  ? 74   LEU B CD2   1 
ATOM   5062  N  N     . VAL B 2  91  ? 10.224  -11.383 168.087 1.00 59.25  ? 75   VAL B N     1 
ATOM   5063  C  CA    . VAL B 2  91  ? 9.216   -10.754 167.248 1.00 63.79  ? 75   VAL B CA    1 
ATOM   5064  C  C     . VAL B 2  91  ? 7.864   -11.405 167.519 1.00 60.90  ? 75   VAL B C     1 
ATOM   5065  O  O     . VAL B 2  91  ? 7.757   -12.637 167.562 1.00 56.41  ? 75   VAL B O     1 
ATOM   5066  C  CB    . VAL B 2  91  ? 9.599   -10.865 165.765 1.00 62.24  ? 75   VAL B CB    1 
ATOM   5067  C  CG1   . VAL B 2  91  ? 8.561   -10.197 164.911 1.00 63.72  ? 75   VAL B CG1   1 
ATOM   5068  C  CG2   . VAL B 2  91  ? 10.970  -10.254 165.532 1.00 64.02  ? 75   VAL B CG2   1 
ATOM   5069  N  N     . ASP B 2  92  ? 6.832   -10.580 167.704 1.00 54.42  ? 76   ASP B N     1 
ATOM   5070  C  CA    . ASP B 2  92  ? 5.466   -11.067 167.908 1.00 60.23  ? 76   ASP B CA    1 
ATOM   5071  C  C     . ASP B 2  92  ? 4.880   -11.349 166.527 1.00 63.07  ? 76   ASP B C     1 
ATOM   5072  O  O     . ASP B 2  92  ? 4.064   -10.593 165.994 1.00 68.22  ? 76   ASP B O     1 
ATOM   5073  C  CB    . ASP B 2  92  ? 4.630   -10.059 168.690 1.00 65.34  ? 76   ASP B CB    1 
ATOM   5074  C  CG    . ASP B 2  92  ? 3.203   -10.545 168.948 1.00 66.92  ? 76   ASP B CG    1 
ATOM   5075  O  OD1   . ASP B 2  92  ? 2.909   -11.728 168.672 1.00 58.76  ? 76   ASP B OD1   1 
ATOM   5076  O  OD2   . ASP B 2  92  ? 2.372   -9.739  169.425 1.00 66.04  ? 76   ASP B OD2   1 
ATOM   5077  N  N     . PHE B 2  93  ? 5.275   -12.485 165.950 1.00 68.50  ? 77   PHE B N     1 
ATOM   5078  C  CA    . PHE B 2  93  ? 4.779   -12.850 164.628 1.00 69.71  ? 77   PHE B CA    1 
ATOM   5079  C  C     . PHE B 2  93  ? 3.421   -13.524 164.647 1.00 68.73  ? 77   PHE B C     1 
ATOM   5080  O  O     . PHE B 2  93  ? 3.095   -14.221 163.680 1.00 70.10  ? 77   PHE B O     1 
ATOM   5081  C  CB    . PHE B 2  93  ? 5.770   -13.778 163.919 1.00 72.11  ? 77   PHE B CB    1 
ATOM   5082  C  CG    . PHE B 2  93  ? 6.883   -13.066 163.211 1.00 66.33  ? 77   PHE B CG    1 
ATOM   5083  C  CD1   . PHE B 2  93  ? 6.609   -12.035 162.330 1.00 64.83  ? 77   PHE B CD1   1 
ATOM   5084  C  CD2   . PHE B 2  93  ? 8.196   -13.463 163.384 1.00 64.83  ? 77   PHE B CD2   1 
ATOM   5085  C  CE1   . PHE B 2  93  ? 7.626   -11.389 161.663 1.00 59.82  ? 77   PHE B CE1   1 
ATOM   5086  C  CE2   . PHE B 2  93  ? 9.217   -12.823 162.716 1.00 68.10  ? 77   PHE B CE2   1 
ATOM   5087  C  CZ    . PHE B 2  93  ? 8.930   -11.784 161.853 1.00 62.83  ? 77   PHE B CZ    1 
ATOM   5088  N  N     . ARG B 2  94  ? 2.628   -13.350 165.707 1.00 71.94  ? 78   ARG B N     1 
ATOM   5089  C  CA    . ARG B 2  94  ? 1.357   -14.061 165.796 1.00 67.47  ? 78   ARG B CA    1 
ATOM   5090  C  C     . ARG B 2  94  ? 0.466   -13.714 164.608 1.00 72.92  ? 78   ARG B C     1 
ATOM   5091  O  O     . ARG B 2  94  ? -0.121  -14.598 163.972 1.00 74.75  ? 78   ARG B O     1 
ATOM   5092  C  CB    . ARG B 2  94  ? 0.659   -13.746 167.120 1.00 64.85  ? 78   ARG B CB    1 
ATOM   5093  C  CG    . ARG B 2  94  ? 1.101   -14.650 168.264 1.00 51.19  ? 78   ARG B CG    1 
ATOM   5094  C  CD    . ARG B 2  94  ? 0.480   -14.242 169.595 1.00 57.79  ? 78   ARG B CD    1 
ATOM   5095  N  NE    . ARG B 2  94  ? 0.801   -12.869 169.973 1.00 65.48  ? 78   ARG B NE    1 
ATOM   5096  C  CZ    . ARG B 2  94  ? 0.313   -12.261 171.050 1.00 61.49  ? 78   ARG B CZ    1 
ATOM   5097  N  NH1   . ARG B 2  94  ? -0.510  -12.910 171.863 1.00 56.43  ? 78   ARG B NH1   1 
ATOM   5098  N  NH2   . ARG B 2  94  ? 0.650   -11.007 171.318 1.00 68.12  ? 78   ARG B NH2   1 
ATOM   5099  N  N     . GLU B 2  95  ? 0.356   -12.419 164.297 1.00 63.93  ? 79   GLU B N     1 
ATOM   5100  C  CA    . GLU B 2  95  ? -0.436  -11.974 163.153 1.00 66.19  ? 79   GLU B CA    1 
ATOM   5101  C  C     . GLU B 2  95  ? 0.092   -12.549 161.843 1.00 72.42  ? 79   GLU B C     1 
ATOM   5102  O  O     . GLU B 2  95  ? -0.669  -13.114 161.049 1.00 77.84  ? 79   GLU B O     1 
ATOM   5103  C  CB    . GLU B 2  95  ? -0.451  -10.446 163.101 1.00 73.63  ? 79   GLU B CB    1 
ATOM   5104  C  CG    . GLU B 2  95  ? -1.664  -9.841  162.411 1.00 76.57  ? 79   GLU B CG    1 
ATOM   5105  C  CD    . GLU B 2  95  ? -2.979  -10.434 162.878 1.00 79.52  ? 79   GLU B CD    1 
ATOM   5106  O  OE1   . GLU B 2  95  ? -3.102  -10.765 164.077 1.00 72.99  ? 79   GLU B OE1   1 
ATOM   5107  O  OE2   . GLU B 2  95  ? -3.896  -10.567 162.039 1.00 96.16  ? 79   GLU B OE2   1 
ATOM   5108  N  N     . LEU B 2  96  ? 1.393   -12.390 161.586 1.00 76.89  ? 80   LEU B N     1 
ATOM   5109  C  CA    . LEU B 2  96  ? 1.993   -12.972 160.387 1.00 78.97  ? 80   LEU B CA    1 
ATOM   5110  C  C     . LEU B 2  96  ? 1.788   -14.482 160.328 1.00 78.37  ? 80   LEU B C     1 
ATOM   5111  O  O     . LEU B 2  96  ? 1.477   -15.029 159.263 1.00 89.32  ? 80   LEU B O     1 
ATOM   5112  C  CB    . LEU B 2  96  ? 3.483   -12.636 160.313 1.00 77.72  ? 80   LEU B CB    1 
ATOM   5113  C  CG    . LEU B 2  96  ? 4.151   -13.061 158.999 1.00 71.83  ? 80   LEU B CG    1 
ATOM   5114  C  CD1   . LEU B 2  96  ? 3.518   -12.344 157.816 1.00 71.08  ? 80   LEU B CD1   1 
ATOM   5115  C  CD2   . LEU B 2  96  ? 5.651   -12.820 159.028 1.00 68.82  ? 80   LEU B CD2   1 
ATOM   5116  N  N     . ASN B 2  97  ? 1.974   -15.172 161.455 1.00 67.06  ? 81   ASN B N     1 
ATOM   5117  C  CA    . ASN B 2  97  ? 1.778   -16.619 161.482 1.00 75.34  ? 81   ASN B CA    1 
ATOM   5118  C  C     . ASN B 2  97  ? 0.355   -17.013 161.096 1.00 88.53  ? 81   ASN B C     1 
ATOM   5119  O  O     . ASN B 2  97  ? 0.155   -17.999 160.377 1.00 93.81  ? 81   ASN B O     1 
ATOM   5120  C  CB    . ASN B 2  97  ? 2.126   -17.165 162.866 1.00 76.17  ? 81   ASN B CB    1 
ATOM   5121  C  CG    . ASN B 2  97  ? 3.613   -17.118 163.153 1.00 76.63  ? 81   ASN B CG    1 
ATOM   5122  O  OD1   . ASN B 2  97  ? 4.440   -17.227 162.246 1.00 81.71  ? 81   ASN B OD1   1 
ATOM   5123  N  ND2   . ASN B 2  97  ? 3.962   -16.938 164.420 1.00 79.50  ? 81   ASN B ND2   1 
ATOM   5124  N  N     . LYS B 2  98  ? -0.648  -16.265 161.560 1.00 82.28  ? 82   LYS B N     1 
ATOM   5125  C  CA    . LYS B 2  98  ? -2.023  -16.601 161.211 1.00 80.74  ? 82   LYS B CA    1 
ATOM   5126  C  C     . LYS B 2  98  ? -2.427  -16.122 159.826 1.00 83.05  ? 82   LYS B C     1 
ATOM   5127  O  O     . LYS B 2  98  ? -3.512  -16.482 159.357 1.00 90.55  ? 82   LYS B O     1 
ATOM   5128  C  CB    . LYS B 2  98  ? -2.986  -15.956 162.204 1.00 79.07  ? 82   LYS B CB    1 
ATOM   5129  C  CG    . LYS B 2  98  ? -2.945  -16.467 163.614 1.00 81.47  ? 82   LYS B CG    1 
ATOM   5130  C  CD    . LYS B 2  98  ? -4.109  -15.852 164.352 1.00 80.16  ? 82   LYS B CD    1 
ATOM   5131  C  CE    . LYS B 2  98  ? -3.829  -14.370 164.586 1.00 78.06  ? 82   LYS B CE    1 
ATOM   5132  N  NZ    . LYS B 2  98  ? -5.028  -13.622 165.056 1.00 77.16  ? 82   LYS B NZ    1 
ATOM   5133  N  N     . ARG B 2  99  ? -1.586  -15.342 159.156 1.00 86.84  ? 83   ARG B N     1 
ATOM   5134  C  CA    . ARG B 2  99  ? -1.846  -14.919 157.790 1.00 90.19  ? 83   ARG B CA    1 
ATOM   5135  C  C     . ARG B 2  99  ? -0.985  -15.646 156.772 1.00 99.47  ? 83   ARG B C     1 
ATOM   5136  O  O     . ARG B 2  99  ? -1.143  -15.416 155.569 1.00 105.42 ? 83   ARG B O     1 
ATOM   5137  C  CB    . ARG B 2  99  ? -1.643  -13.405 157.667 1.00 82.79  ? 83   ARG B CB    1 
ATOM   5138  C  CG    . ARG B 2  99  ? -2.785  -12.592 158.247 1.00 78.77  ? 83   ARG B CG    1 
ATOM   5139  C  CD    . ARG B 2  99  ? -2.355  -11.172 158.549 1.00 77.00  ? 83   ARG B CD    1 
ATOM   5140  N  NE    . ARG B 2  99  ? -3.324  -10.482 159.392 1.00 76.60  ? 83   ARG B NE    1 
ATOM   5141  C  CZ    . ARG B 2  99  ? -4.243  -9.642  158.928 1.00 88.63  ? 83   ARG B CZ    1 
ATOM   5142  N  NH1   . ARG B 2  99  ? -4.292  -9.364  157.633 1.00 90.02  ? 83   ARG B NH1   1 
ATOM   5143  N  NH2   . ARG B 2  99  ? -5.094  -9.055  159.762 1.00 93.80  ? 83   ARG B NH2   1 
ATOM   5144  N  N     . THR B 2  100 ? -0.096  -16.526 157.212 1.00 96.02  ? 84   THR B N     1 
ATOM   5145  C  CA    . THR B 2  100 ? 0.815   -17.216 156.317 1.00 101.59 ? 84   THR B CA    1 
ATOM   5146  C  C     . THR B 2  100 ? 0.253   -18.587 155.978 1.00 116.50 ? 84   THR B C     1 
ATOM   5147  O  O     . THR B 2  100 ? -0.312  -19.266 156.843 1.00 113.81 ? 84   THR B O     1 
ATOM   5148  C  CB    . THR B 2  100 ? 2.198   -17.357 156.958 1.00 92.30  ? 84   THR B CB    1 
ATOM   5149  O  OG1   . THR B 2  100 ? 2.720   -16.057 157.259 1.00 88.68  ? 84   THR B OG1   1 
ATOM   5150  C  CG2   . THR B 2  100 ? 3.158   -18.081 156.028 1.00 99.07  ? 84   THR B CG2   1 
ATOM   5151  N  N     . GLN B 2  101 ? 0.375   -18.963 154.704 1.00 126.08 ? 85   GLN B N     1 
ATOM   5152  C  CA    . GLN B 2  101 ? -0.111  -20.241 154.203 1.00 131.16 ? 85   GLN B CA    1 
ATOM   5153  C  C     . GLN B 2  101 ? 0.200   -21.367 155.176 1.00 131.31 ? 85   GLN B C     1 
ATOM   5154  O  O     . GLN B 2  101 ? 1.314   -21.466 155.697 1.00 131.72 ? 85   GLN B O     1 
ATOM   5155  C  CB    . GLN B 2  101 ? 0.510   -20.533 152.829 1.00 135.74 ? 85   GLN B CB    1 
ATOM   5156  C  CG    . GLN B 2  101 ? 1.987   -20.935 152.853 1.00 136.68 ? 85   GLN B CG    1 
ATOM   5157  C  CD    . GLN B 2  101 ? 2.602   -21.031 151.467 1.00 141.42 ? 85   GLN B CD    1 
ATOM   5158  O  OE1   . GLN B 2  101 ? 2.618   -20.058 150.713 1.00 139.95 ? 85   GLN B OE1   1 
ATOM   5159  N  NE2   . GLN B 2  101 ? 3.129   -22.202 151.133 1.00 142.39 ? 85   GLN B NE2   1 
ATOM   5160  N  N     . ASP B 2  102 ? -0.805  -22.183 155.467 1.00 123.73 ? 86   ASP B N     1 
ATOM   5161  C  CA    . ASP B 2  102 ? -0.537  -23.358 156.275 1.00 125.94 ? 86   ASP B CA    1 
ATOM   5162  C  C     . ASP B 2  102 ? 0.353   -24.273 155.453 1.00 133.91 ? 86   ASP B C     1 
ATOM   5163  O  O     . ASP B 2  102 ? 0.088   -24.508 154.270 1.00 142.08 ? 86   ASP B O     1 
ATOM   5164  C  CB    . ASP B 2  102 ? -1.836  -24.056 156.669 1.00 129.59 ? 86   ASP B CB    1 
ATOM   5165  C  CG    . ASP B 2  102 ? -2.479  -23.436 157.892 1.00 124.56 ? 86   ASP B CG    1 
ATOM   5166  O  OD1   . ASP B 2  102 ? -1.737  -22.928 158.759 1.00 126.09 ? 86   ASP B OD1   1 
ATOM   5167  O  OD2   . ASP B 2  102 ? -3.724  -23.457 157.990 1.00 135.11 ? 86   ASP B OD2   1 
ATOM   5168  N  N     . PHE B 2  103 ? 1.416   -24.779 156.063 1.00 135.13 ? 87   PHE B N     1 
ATOM   5169  C  CA    . PHE B 2  103 ? 2.315   -25.642 155.317 1.00 139.53 ? 87   PHE B CA    1 
ATOM   5170  C  C     . PHE B 2  103 ? 1.889   -27.101 155.369 1.00 156.99 ? 87   PHE B C     1 
ATOM   5171  O  O     . PHE B 2  103 ? 2.559   -27.951 154.773 1.00 156.94 ? 87   PHE B O     1 
ATOM   5172  C  CB    . PHE B 2  103 ? 3.748   -25.457 155.821 1.00 131.67 ? 87   PHE B CB    1 
ATOM   5173  C  CG    . PHE B 2  103 ? 4.346   -24.126 155.440 1.00 126.87 ? 87   PHE B CG    1 
ATOM   5174  C  CD1   . PHE B 2  103 ? 4.000   -22.974 156.129 1.00 115.50 ? 87   PHE B CD1   1 
ATOM   5175  C  CD2   . PHE B 2  103 ? 5.223   -24.020 154.374 1.00 129.99 ? 87   PHE B CD2   1 
ATOM   5176  C  CE1   . PHE B 2  103 ? 4.537   -21.747 155.776 1.00 110.72 ? 87   PHE B CE1   1 
ATOM   5177  C  CE2   . PHE B 2  103 ? 5.763   -22.796 154.016 1.00 115.41 ? 87   PHE B CE2   1 
ATOM   5178  C  CZ    . PHE B 2  103 ? 5.419   -21.659 154.718 1.00 110.17 ? 87   PHE B CZ    1 
ATOM   5179  N  N     . TRP B 2  104 ? 0.792   -27.403 156.071 1.00 153.00 ? 88   TRP B N     1 
ATOM   5180  C  CA    . TRP B 2  104 ? 0.240   -28.751 156.042 1.00 152.22 ? 88   TRP B CA    1 
ATOM   5181  C  C     . TRP B 2  104 ? -0.214  -29.079 154.629 1.00 155.16 ? 88   TRP B C     1 
ATOM   5182  O  O     . TRP B 2  104 ? -0.009  -30.193 154.133 1.00 160.24 ? 88   TRP B O     1 
ATOM   5183  C  CB    . TRP B 2  104 ? -0.917  -28.875 157.034 1.00 149.54 ? 88   TRP B CB    1 
ATOM   5184  N  N     . GLU B 2  105 ? -0.839  -28.099 153.971 1.00 157.90 ? 89   GLU B N     1 
ATOM   5185  C  CA    . GLU B 2  105 ? -1.262  -28.239 152.583 1.00 161.33 ? 89   GLU B CA    1 
ATOM   5186  C  C     . GLU B 2  105 ? -0.056  -28.436 151.676 1.00 165.69 ? 89   GLU B C     1 
ATOM   5187  O  O     . GLU B 2  105 ? -0.103  -29.220 150.720 1.00 170.14 ? 89   GLU B O     1 
ATOM   5188  C  CB    . GLU B 2  105 ? -2.045  -26.997 152.158 1.00 158.90 ? 89   GLU B CB    1 
ATOM   5189  C  CG    . GLU B 2  105 ? -3.267  -26.700 153.012 1.00 156.73 ? 89   GLU B CG    1 
ATOM   5190  C  CD    . GLU B 2  105 ? -3.909  -25.371 152.660 1.00 156.74 ? 89   GLU B CD    1 
ATOM   5191  O  OE1   . GLU B 2  105 ? -3.279  -24.587 151.919 1.00 161.89 ? 89   GLU B OE1   1 
ATOM   5192  O  OE2   . GLU B 2  105 ? -5.036  -25.106 153.130 1.00 152.36 ? 89   GLU B OE2   1 
ATOM   5193  N  N     . VAL B 2  106 ? 1.031   -27.715 151.957 1.00 169.99 ? 90   VAL B N     1 
ATOM   5194  C  CA    . VAL B 2  106 ? 2.261   -27.837 151.184 1.00 172.22 ? 90   VAL B CA    1 
ATOM   5195  C  C     . VAL B 2  106 ? 2.890   -29.213 151.377 1.00 172.64 ? 90   VAL B C     1 
ATOM   5196  O  O     . VAL B 2  106 ? 3.573   -29.717 150.476 1.00 174.69 ? 90   VAL B O     1 
ATOM   5197  C  CB    . VAL B 2  106 ? 3.228   -26.701 151.569 1.00 167.64 ? 90   VAL B CB    1 
ATOM   5198  C  CG1   . VAL B 2  106 ? 4.566   -26.860 150.866 1.00 168.76 ? 90   VAL B CG1   1 
ATOM   5199  C  CG2   . VAL B 2  106 ? 2.608   -25.355 151.249 1.00 164.44 ? 90   VAL B CG2   1 
ATOM   5200  N  N     . GLN B 2  107 ? 2.668   -29.838 152.539 1.00 169.62 ? 91   GLN B N     1 
ATOM   5201  C  CA    . GLN B 2  107 ? 3.238   -31.097 153.050 1.00 169.15 ? 91   GLN B CA    1 
ATOM   5202  C  C     . GLN B 2  107 ? 4.562   -30.842 153.760 1.00 168.51 ? 91   GLN B C     1 
ATOM   5203  O  O     . GLN B 2  107 ? 5.225   -31.801 154.170 1.00 169.55 ? 91   GLN B O     1 
ATOM   5204  C  CB    . GLN B 2  107 ? 3.455   -32.164 151.960 1.00 171.64 ? 91   GLN B CB    1 
ATOM   5205  C  CG    . GLN B 2  107 ? 2.175   -32.677 151.320 1.00 172.32 ? 91   GLN B CG    1 
ATOM   5206  C  CD    . GLN B 2  107 ? 2.444   -33.547 150.106 1.00 170.80 ? 91   GLN B CD    1 
ATOM   5207  O  OE1   . GLN B 2  107 ? 3.586   -33.918 149.833 1.00 171.63 ? 91   GLN B OE1   1 
ATOM   5208  N  NE2   . GLN B 2  107 ? 1.391   -33.864 149.360 1.00 164.89 ? 91   GLN B NE2   1 
ATOM   5209  N  N     . LEU B 2  108 ? 4.967   -29.582 153.912 1.00 158.06 ? 92   LEU B N     1 
ATOM   5210  C  CA    . LEU B 2  108 ? 6.143   -29.239 154.704 1.00 147.77 ? 92   LEU B CA    1 
ATOM   5211  C  C     . LEU B 2  108 ? 5.954   -29.505 156.196 1.00 140.87 ? 92   LEU B C     1 
ATOM   5212  O  O     . LEU B 2  108 ? 6.942   -29.750 156.898 1.00 133.37 ? 92   LEU B O     1 
ATOM   5213  C  CB    . LEU B 2  108 ? 6.541   -27.781 154.468 1.00 133.94 ? 92   LEU B CB    1 
ATOM   5214  C  CG    . LEU B 2  108 ? 7.404   -27.561 153.222 1.00 131.38 ? 92   LEU B CG    1 
ATOM   5215  C  CD1   . LEU B 2  108 ? 7.443   -26.098 152.814 1.00 128.17 ? 92   LEU B CD1   1 
ATOM   5216  C  CD2   . LEU B 2  108 ? 8.812   -28.093 153.448 1.00 130.84 ? 92   LEU B CD2   1 
ATOM   5217  N  N     . GLY B 2  109 ? 4.723   -29.440 156.702 1.00 137.70 ? 93   GLY B N     1 
ATOM   5218  C  CA    . GLY B 2  109 ? 4.529   -29.464 158.145 1.00 133.23 ? 93   GLY B CA    1 
ATOM   5219  C  C     . GLY B 2  109 ? 5.102   -30.705 158.814 1.00 126.99 ? 93   GLY B C     1 
ATOM   5220  O  O     . GLY B 2  109 ? 5.075   -31.812 158.270 1.00 127.79 ? 93   GLY B O     1 
ATOM   5221  N  N     . ILE B 2  110 ? 5.614   -30.488 160.020 1.00 122.76 ? 94   ILE B N     1 
ATOM   5222  C  CA    . ILE B 2  110 ? 6.278   -31.495 160.854 1.00 112.34 ? 94   ILE B CA    1 
ATOM   5223  C  C     . ILE B 2  110 ? 5.241   -32.414 161.498 1.00 116.65 ? 94   ILE B C     1 
ATOM   5224  O  O     . ILE B 2  110 ? 4.234   -31.921 162.031 1.00 114.68 ? 94   ILE B O     1 
ATOM   5225  C  CB    . ILE B 2  110 ? 7.140   -30.814 161.913 1.00 103.89 ? 94   ILE B CB    1 
ATOM   5226  C  CG1   . ILE B 2  110 ? 8.059   -29.778 161.257 1.00 106.27 ? 94   ILE B CG1   1 
ATOM   5227  C  CG2   . ILE B 2  110 ? 7.949   -31.837 162.696 1.00 103.25 ? 94   ILE B CG2   1 
ATOM   5228  C  CD1   . ILE B 2  110 ? 8.734   -28.842 162.236 1.00 94.32  ? 94   ILE B CD1   1 
ATOM   5229  N  N     . PRO B 2  111 ? 5.441   -33.731 161.469 1.00 108.94 ? 95   PRO B N     1 
ATOM   5230  C  CA    . PRO B 2  111 ? 4.532   -34.647 162.164 1.00 104.02 ? 95   PRO B CA    1 
ATOM   5231  C  C     . PRO B 2  111 ? 4.857   -34.671 163.655 1.00 100.47 ? 95   PRO B C     1 
ATOM   5232  O  O     . PRO B 2  111 ? 5.972   -34.358 164.077 1.00 104.20 ? 95   PRO B O     1 
ATOM   5233  C  CB    . PRO B 2  111 ? 4.829   -35.991 161.497 1.00 101.59 ? 95   PRO B CB    1 
ATOM   5234  C  CG    . PRO B 2  111 ? 6.294   -35.903 161.236 1.00 106.85 ? 95   PRO B CG    1 
ATOM   5235  C  CD    . PRO B 2  111 ? 6.497   -34.471 160.753 1.00 108.29 ? 95   PRO B CD    1 
ATOM   5236  N  N     . HIS B 2  112 ? 3.862   -35.051 164.465 1.00 96.46  ? 96   HIS B N     1 
ATOM   5237  C  CA    . HIS B 2  112 ? 4.039   -35.031 165.919 1.00 86.39  ? 96   HIS B CA    1 
ATOM   5238  C  C     . HIS B 2  112 ? 4.155   -36.425 166.526 1.00 78.04  ? 96   HIS B C     1 
ATOM   5239  O  O     . HIS B 2  112 ? 3.266   -37.268 166.334 1.00 80.91  ? 96   HIS B O     1 
ATOM   5240  C  CB    . HIS B 2  112 ? 2.886   -34.278 166.579 1.00 82.33  ? 96   HIS B CB    1 
ATOM   5241  C  CG    . HIS B 2  112 ? 2.943   -34.296 168.075 1.00 71.15  ? 96   HIS B CG    1 
ATOM   5242  N  ND1   . HIS B 2  112 ? 3.832   -33.525 168.791 1.00 68.30  ? 96   HIS B ND1   1 
ATOM   5243  C  CD2   . HIS B 2  112 ? 2.248   -35.016 168.987 1.00 63.73  ? 96   HIS B CD2   1 
ATOM   5244  C  CE1   . HIS B 2  112 ? 3.670   -33.754 170.082 1.00 61.34  ? 96   HIS B CE1   1 
ATOM   5245  N  NE2   . HIS B 2  112 ? 2.717   -34.656 170.228 1.00 61.96  ? 96   HIS B NE2   1 
ATOM   5246  N  N     . PRO B 2  113 ? 5.237   -36.688 167.263 1.00 75.07  ? 97   PRO B N     1 
ATOM   5247  C  CA    . PRO B 2  113 ? 5.493   -38.008 167.863 1.00 82.56  ? 97   PRO B CA    1 
ATOM   5248  C  C     . PRO B 2  113 ? 4.757   -38.206 169.182 1.00 87.05  ? 97   PRO B C     1 
ATOM   5249  O  O     . PRO B 2  113 ? 5.035   -37.527 170.176 1.00 86.45  ? 97   PRO B O     1 
ATOM   5250  C  CB    . PRO B 2  113 ? 7.016   -38.005 168.061 1.00 73.98  ? 97   PRO B CB    1 
ATOM   5251  C  CG    . PRO B 2  113 ? 7.358   -36.566 168.234 1.00 78.67  ? 97   PRO B CG    1 
ATOM   5252  C  CD    . PRO B 2  113 ? 6.401   -35.793 167.372 1.00 75.03  ? 97   PRO B CD    1 
ATOM   5253  N  N     . ALA B 2  114 ? 3.801   -39.138 169.189 1.00 90.59  ? 98   ALA B N     1 
ATOM   5254  C  CA    . ALA B 2  114 ? 3.086   -39.496 170.414 1.00 92.44  ? 98   ALA B CA    1 
ATOM   5255  C  C     . ALA B 2  114 ? 4.005   -39.961 171.544 1.00 92.36  ? 98   ALA B C     1 
ATOM   5256  O  O     . ALA B 2  114 ? 3.584   -39.956 172.705 1.00 93.39  ? 98   ALA B O     1 
ATOM   5257  C  CB    . ALA B 2  114 ? 2.055   -40.585 170.117 1.00 92.67  ? 98   ALA B CB    1 
ATOM   5258  N  N     . GLY B 2  115 ? 5.244   -40.360 171.240 1.00 87.41  ? 99   GLY B N     1 
ATOM   5259  C  CA    . GLY B 2  115 ? 6.137   -40.892 172.259 1.00 81.74  ? 99   GLY B CA    1 
ATOM   5260  C  C     . GLY B 2  115 ? 6.875   -39.859 173.084 1.00 78.60  ? 99   GLY B C     1 
ATOM   5261  O  O     . GLY B 2  115 ? 7.309   -40.172 174.197 1.00 74.26  ? 99   GLY B O     1 
ATOM   5262  N  N     . LEU B 2  116 ? 7.050   -38.648 172.548 1.00 86.21  ? 100  LEU B N     1 
ATOM   5263  C  CA    . LEU B 2  116 ? 7.747   -37.577 173.260 1.00 79.36  ? 100  LEU B CA    1 
ATOM   5264  C  C     . LEU B 2  116 ? 7.229   -37.399 174.685 1.00 79.56  ? 100  LEU B C     1 
ATOM   5265  O  O     . LEU B 2  116 ? 8.016   -37.321 175.636 1.00 76.18  ? 100  LEU B O     1 
ATOM   5266  C  CB    . LEU B 2  116 ? 7.632   -36.272 172.470 1.00 67.38  ? 100  LEU B CB    1 
ATOM   5267  C  CG    . LEU B 2  116 ? 8.438   -35.083 172.990 1.00 62.49  ? 100  LEU B CG    1 
ATOM   5268  C  CD1   . LEU B 2  116 ? 9.927   -35.361 172.904 1.00 80.81  ? 100  LEU B CD1   1 
ATOM   5269  C  CD2   . LEU B 2  116 ? 8.086   -33.840 172.190 1.00 52.29  ? 100  LEU B CD2   1 
ATOM   5270  N  N     . LYS B 2  117 ? 5.904   -37.306 174.851 1.00 79.12  ? 101  LYS B N     1 
ATOM   5271  C  CA    . LYS B 2  117 ? 5.329   -37.139 176.185 1.00 76.87  ? 101  LYS B CA    1 
ATOM   5272  C  C     . LYS B 2  117 ? 5.597   -38.330 177.098 1.00 82.41  ? 101  LYS B C     1 
ATOM   5273  O  O     . LYS B 2  117 ? 5.458   -38.202 178.319 1.00 77.56  ? 101  LYS B O     1 
ATOM   5274  C  CB    . LYS B 2  117 ? 3.821   -36.888 176.100 1.00 73.21  ? 101  LYS B CB    1 
ATOM   5275  C  CG    . LYS B 2  117 ? 2.979   -38.094 175.703 1.00 80.62  ? 101  LYS B CG    1 
ATOM   5276  C  CD    . LYS B 2  117 ? 1.497   -37.724 175.670 1.00 75.04  ? 101  LYS B CD    1 
ATOM   5277  C  CE    . LYS B 2  117 ? 0.657   -38.727 174.889 1.00 74.52  ? 101  LYS B CE    1 
ATOM   5278  N  NZ    . LYS B 2  117 ? 1.025   -38.801 173.449 1.00 95.96  ? 101  LYS B NZ    1 
ATOM   5279  N  N     . LYS B 2  118 ? 5.940   -39.490 176.543 1.00 83.83  ? 102  LYS B N     1 
ATOM   5280  C  CA    . LYS B 2  118 ? 6.160   -40.686 177.345 1.00 80.82  ? 102  LYS B CA    1 
ATOM   5281  C  C     . LYS B 2  118 ? 7.591   -40.816 177.852 1.00 84.99  ? 102  LYS B C     1 
ATOM   5282  O  O     . LYS B 2  118 ? 7.842   -41.632 178.746 1.00 88.66  ? 102  LYS B O     1 
ATOM   5283  C  CB    . LYS B 2  118 ? 5.799   -41.933 176.533 1.00 81.37  ? 102  LYS B CB    1 
ATOM   5284  C  CG    . LYS B 2  118 ? 4.345   -41.994 176.095 1.00 87.67  ? 102  LYS B CG    1 
ATOM   5285  C  CD    . LYS B 2  118 ? 4.123   -43.134 175.113 1.00 92.42  ? 102  LYS B CD    1 
ATOM   5286  C  CE    . LYS B 2  118 ? 2.746   -43.067 174.474 1.00 88.18  ? 102  LYS B CE    1 
ATOM   5287  N  NZ    . LYS B 2  118 ? 1.667   -43.319 175.464 1.00 101.03 ? 102  LYS B NZ    1 
ATOM   5288  N  N     . LYS B 2  119 ? 8.523   -40.027 177.325 1.00 81.95  ? 103  LYS B N     1 
ATOM   5289  C  CA    . LYS B 2  119 ? 9.919   -40.116 177.733 1.00 81.98  ? 103  LYS B CA    1 
ATOM   5290  C  C     . LYS B 2  119 ? 10.139  -39.540 179.128 1.00 83.26  ? 103  LYS B C     1 
ATOM   5291  O  O     . LYS B 2  119 ? 9.404   -38.663 179.591 1.00 88.79  ? 103  LYS B O     1 
ATOM   5292  C  CB    . LYS B 2  119 ? 10.814  -39.405 176.718 1.00 84.01  ? 103  LYS B CB    1 
ATOM   5293  C  CG    . LYS B 2  119 ? 10.862  -40.097 175.362 1.00 89.05  ? 103  LYS B CG    1 
ATOM   5294  C  CD    . LYS B 2  119 ? 11.507  -41.475 175.493 1.00 90.79  ? 103  LYS B CD    1 
ATOM   5295  C  CE    . LYS B 2  119 ? 11.237  -42.364 174.288 1.00 92.75  ? 103  LYS B CE    1 
ATOM   5296  N  NZ    . LYS B 2  119 ? 9.786   -42.653 174.109 1.00 85.90  ? 103  LYS B NZ    1 
ATOM   5297  N  N     . LYS B 2  120 ? 11.179  -40.050 179.797 1.00 92.73  ? 104  LYS B N     1 
ATOM   5298  C  CA    . LYS B 2  120 ? 11.454  -39.666 181.178 1.00 91.01  ? 104  LYS B CA    1 
ATOM   5299  C  C     . LYS B 2  120 ? 12.051  -38.270 181.274 1.00 89.83  ? 104  LYS B C     1 
ATOM   5300  O  O     . LYS B 2  120 ? 11.794  -37.553 182.247 1.00 85.56  ? 104  LYS B O     1 
ATOM   5301  C  CB    . LYS B 2  120 ? 12.403  -40.676 181.822 1.00 90.84  ? 104  LYS B CB    1 
ATOM   5302  C  CG    . LYS B 2  120 ? 11.789  -42.041 182.057 1.00 96.13  ? 104  LYS B CG    1 
ATOM   5303  C  CD    . LYS B 2  120 ? 12.724  -42.944 182.842 1.00 90.34  ? 104  LYS B CD    1 
ATOM   5304  C  CE    . LYS B 2  120 ? 11.995  -44.189 183.318 1.00 103.83 ? 104  LYS B CE    1 
ATOM   5305  N  NZ    . LYS B 2  120 ? 12.807  -44.990 184.272 1.00 112.41 ? 104  LYS B NZ    1 
ATOM   5306  N  N     . SER B 2  121 ? 12.857  -37.876 180.297 1.00 82.48  ? 105  SER B N     1 
ATOM   5307  C  CA    . SER B 2  121 ? 13.439  -36.545 180.262 1.00 82.30  ? 105  SER B CA    1 
ATOM   5308  C  C     . SER B 2  121 ? 13.306  -35.988 178.853 1.00 80.35  ? 105  SER B C     1 
ATOM   5309  O  O     . SER B 2  121 ? 13.539  -36.701 177.874 1.00 86.17  ? 105  SER B O     1 
ATOM   5310  C  CB    . SER B 2  121 ? 14.904  -36.577 180.698 1.00 88.27  ? 105  SER B CB    1 
ATOM   5311  O  OG    . SER B 2  121 ? 15.011  -37.012 182.042 1.00 91.66  ? 105  SER B OG    1 
ATOM   5312  N  N     . VAL B 2  122 ? 12.915  -34.719 178.757 1.00 74.10  ? 106  VAL B N     1 
ATOM   5313  C  CA    . VAL B 2  122 ? 12.820  -34.005 177.487 1.00 78.22  ? 106  VAL B CA    1 
ATOM   5314  C  C     . VAL B 2  122 ? 13.527  -32.664 177.632 1.00 81.11  ? 106  VAL B C     1 
ATOM   5315  O  O     . VAL B 2  122 ? 13.161  -31.856 178.495 1.00 82.20  ? 106  VAL B O     1 
ATOM   5316  C  CB    . VAL B 2  122 ? 11.364  -33.809 177.032 1.00 68.64  ? 106  VAL B CB    1 
ATOM   5317  C  CG1   . VAL B 2  122 ? 11.319  -32.966 175.768 1.00 67.21  ? 106  VAL B CG1   1 
ATOM   5318  C  CG2   . VAL B 2  122 ? 10.705  -35.157 176.779 1.00 67.74  ? 106  VAL B CG2   1 
ATOM   5319  N  N     . THR B 2  123 ? 14.545  -32.435 176.808 1.00 82.18  ? 107  THR B N     1 
ATOM   5320  C  CA    . THR B 2  123 ? 15.317  -31.201 176.839 1.00 87.38  ? 107  THR B CA    1 
ATOM   5321  C  C     . THR B 2  123 ? 14.915  -30.304 175.673 1.00 88.21  ? 107  THR B C     1 
ATOM   5322  O  O     . THR B 2  123 ? 14.734  -30.774 174.545 1.00 70.74  ? 107  THR B O     1 
ATOM   5323  C  CB    . THR B 2  123 ? 16.821  -31.483 176.790 1.00 86.79  ? 107  THR B CB    1 
ATOM   5324  O  OG1   . THR B 2  123 ? 17.177  -32.378 177.851 1.00 86.21  ? 107  THR B OG1   1 
ATOM   5325  C  CG2   . THR B 2  123 ? 17.614  -30.192 176.947 1.00 92.55  ? 107  THR B CG2   1 
ATOM   5326  N  N     . VAL B 2  124 ? 14.799  -29.007 175.950 1.00 86.18  ? 108  VAL B N     1 
ATOM   5327  C  CA    . VAL B 2  124 ? 14.375  -28.011 174.971 1.00 85.89  ? 108  VAL B CA    1 
ATOM   5328  C  C     . VAL B 2  124 ? 15.612  -27.232 174.559 1.00 82.23  ? 108  VAL B C     1 
ATOM   5329  O  O     . VAL B 2  124 ? 16.293  -26.638 175.404 1.00 95.02  ? 108  VAL B O     1 
ATOM   5330  C  CB    . VAL B 2  124 ? 13.301  -27.074 175.545 1.00 89.06  ? 108  VAL B CB    1 
ATOM   5331  C  CG1   . VAL B 2  124 ? 12.880  -26.043 174.509 1.00 77.57  ? 108  VAL B CG1   1 
ATOM   5332  C  CG2   . VAL B 2  124 ? 12.113  -27.874 176.044 1.00 80.95  ? 108  VAL B CG2   1 
ATOM   5333  N  N     . LEU B 2  125 ? 15.889  -27.217 173.259 1.00 86.54  ? 109  LEU B N     1 
ATOM   5334  C  CA    . LEU B 2  125 ? 17.081  -26.581 172.723 1.00 90.40  ? 109  LEU B CA    1 
ATOM   5335  C  C     . LEU B 2  125 ? 16.693  -25.436 171.805 1.00 87.26  ? 109  LEU B C     1 
ATOM   5336  O  O     . LEU B 2  125 ? 15.823  -25.599 170.944 1.00 88.53  ? 109  LEU B O     1 
ATOM   5337  C  CB    . LEU B 2  125 ? 17.898  -27.597 171.929 1.00 92.81  ? 109  LEU B CB    1 
ATOM   5338  C  CG    . LEU B 2  125 ? 18.588  -28.667 172.768 1.00 99.09  ? 109  LEU B CG    1 
ATOM   5339  C  CD1   . LEU B 2  125 ? 19.227  -29.727 171.885 1.00 102.37 ? 109  LEU B CD1   1 
ATOM   5340  C  CD2   . LEU B 2  125 ? 19.556  -28.080 173.737 1.00 111.21 ? 109  LEU B CD2   1 
ATOM   5341  N  N     . ASP B 2  126 ? 17.337  -24.285 171.975 1.00 80.97  ? 110  ASP B N     1 
ATOM   5342  C  CA    . ASP B 2  126 ? 17.086  -23.167 171.077 1.00 72.10  ? 110  ASP B CA    1 
ATOM   5343  C  C     . ASP B 2  126 ? 17.968  -23.350 169.849 1.00 81.39  ? 110  ASP B C     1 
ATOM   5344  O  O     . ASP B 2  126 ? 19.198  -23.404 169.963 1.00 104.98 ? 110  ASP B O     1 
ATOM   5345  C  CB    . ASP B 2  126 ? 17.381  -21.838 171.772 1.00 71.84  ? 110  ASP B CB    1 
ATOM   5346  C  CG    . ASP B 2  126 ? 16.973  -20.628 170.941 1.00 79.71  ? 110  ASP B CG    1 
ATOM   5347  O  OD1   . ASP B 2  126 ? 16.765  -20.769 169.717 1.00 75.69  ? 110  ASP B OD1   1 
ATOM   5348  O  OD2   . ASP B 2  126 ? 16.869  -19.524 171.516 1.00 91.59  ? 110  ASP B OD2   1 
ATOM   5349  N  N     . VAL B 2  127 ? 17.349  -23.442 168.676 1.00 77.11  ? 111  VAL B N     1 
ATOM   5350  C  CA    . VAL B 2  127 ? 18.103  -23.679 167.452 1.00 76.65  ? 111  VAL B CA    1 
ATOM   5351  C  C     . VAL B 2  127 ? 17.726  -22.621 166.428 1.00 83.51  ? 111  VAL B C     1 
ATOM   5352  O  O     . VAL B 2  127 ? 18.054  -22.745 165.243 1.00 87.78  ? 111  VAL B O     1 
ATOM   5353  C  CB    . VAL B 2  127 ? 17.861  -25.099 166.906 1.00 70.00  ? 111  VAL B CB    1 
ATOM   5354  C  CG1   . VAL B 2  127 ? 18.428  -26.143 167.860 1.00 67.48  ? 111  VAL B CG1   1 
ATOM   5355  C  CG2   . VAL B 2  127 ? 16.378  -25.333 166.676 1.00 65.84  ? 111  VAL B CG2   1 
ATOM   5356  N  N     . GLY B 2  128 ? 17.021  -21.579 166.881 1.00 82.19  ? 112  GLY B N     1 
ATOM   5357  C  CA    . GLY B 2  128 ? 16.585  -20.531 165.973 1.00 83.96  ? 112  GLY B CA    1 
ATOM   5358  C  C     . GLY B 2  128 ? 17.722  -19.913 165.186 1.00 88.65  ? 112  GLY B C     1 
ATOM   5359  O  O     . GLY B 2  128 ? 17.518  -19.429 164.069 1.00 88.85  ? 112  GLY B O     1 
ATOM   5360  N  N     . ASP B 2  129 ? 18.927  -19.909 165.763 1.00 93.32  ? 113  ASP B N     1 
ATOM   5361  C  CA    . ASP B 2  129 ? 20.072  -19.269 165.125 1.00 90.51  ? 113  ASP B CA    1 
ATOM   5362  C  C     . ASP B 2  129 ? 20.335  -19.857 163.745 1.00 93.95  ? 113  ASP B C     1 
ATOM   5363  O  O     . ASP B 2  129 ? 20.617  -19.122 162.791 1.00 93.65  ? 113  ASP B O     1 
ATOM   5364  C  CB    . ASP B 2  129 ? 21.309  -19.398 166.011 1.00 91.44  ? 113  ASP B CB    1 
ATOM   5365  C  CG    . ASP B 2  129 ? 22.372  -18.379 165.667 1.00 104.15 ? 113  ASP B CG    1 
ATOM   5366  O  OD1   . ASP B 2  129 ? 22.022  -17.188 165.528 1.00 101.71 ? 113  ASP B OD1   1 
ATOM   5367  O  OD2   . ASP B 2  129 ? 23.552  -18.765 165.529 1.00 116.11 ? 113  ASP B OD2   1 
ATOM   5368  N  N     . ALA B 2  130 ? 20.269  -21.187 163.631 1.00 100.53 ? 114  ALA B N     1 
ATOM   5369  C  CA    . ALA B 2  130 ? 20.327  -21.904 162.361 1.00 93.08  ? 114  ALA B CA    1 
ATOM   5370  C  C     . ALA B 2  130 ? 19.536  -21.218 161.253 1.00 96.23  ? 114  ALA B C     1 
ATOM   5371  O  O     . ALA B 2  130 ? 20.020  -21.120 160.121 1.00 98.87  ? 114  ALA B O     1 
ATOM   5372  C  CB    . ALA B 2  130 ? 19.827  -23.338 162.544 1.00 85.69  ? 114  ALA B CB    1 
ATOM   5373  N  N     . TYR B 2  131 ? 18.324  -20.740 161.555 1.00 102.80 ? 115  TYR B N     1 
ATOM   5374  C  CA    . TYR B 2  131 ? 17.440  -20.281 160.488 1.00 102.55 ? 115  TYR B CA    1 
ATOM   5375  C  C     . TYR B 2  131 ? 17.983  -19.059 159.766 1.00 101.18 ? 115  TYR B C     1 
ATOM   5376  O  O     . TYR B 2  131 ? 17.523  -18.754 158.661 1.00 103.45 ? 115  TYR B O     1 
ATOM   5377  C  CB    . TYR B 2  131 ? 16.043  -19.956 161.022 1.00 95.92  ? 115  TYR B CB    1 
ATOM   5378  C  CG    . TYR B 2  131 ? 15.347  -21.086 161.738 1.00 95.69  ? 115  TYR B CG    1 
ATOM   5379  C  CD1   . TYR B 2  131 ? 15.714  -22.406 161.517 1.00 96.87  ? 115  TYR B CD1   1 
ATOM   5380  C  CD2   . TYR B 2  131 ? 14.301  -20.833 162.613 1.00 94.46  ? 115  TYR B CD2   1 
ATOM   5381  C  CE1   . TYR B 2  131 ? 15.071  -23.440 162.161 1.00 98.54  ? 115  TYR B CE1   1 
ATOM   5382  C  CE2   . TYR B 2  131 ? 13.651  -21.862 163.262 1.00 90.66  ? 115  TYR B CE2   1 
ATOM   5383  C  CZ    . TYR B 2  131 ? 14.040  -23.163 163.031 1.00 92.86  ? 115  TYR B CZ    1 
ATOM   5384  O  OH    . TYR B 2  131 ? 13.398  -24.195 163.673 1.00 92.55  ? 115  TYR B OH    1 
ATOM   5385  N  N     . PHE B 2  132 ? 18.950  -18.356 160.351 1.00 91.01  ? 116  PHE B N     1 
ATOM   5386  C  CA    . PHE B 2  132 ? 19.462  -17.161 159.700 1.00 93.33  ? 116  PHE B CA    1 
ATOM   5387  C  C     . PHE B 2  132 ? 20.374  -17.492 158.527 1.00 98.41  ? 116  PHE B C     1 
ATOM   5388  O  O     . PHE B 2  132 ? 20.783  -16.580 157.801 1.00 98.15  ? 116  PHE B O     1 
ATOM   5389  C  CB    . PHE B 2  132 ? 20.218  -16.300 160.715 1.00 93.83  ? 116  PHE B CB    1 
ATOM   5390  C  CG    . PHE B 2  132 ? 19.342  -15.714 161.789 1.00 95.71  ? 116  PHE B CG    1 
ATOM   5391  C  CD1   . PHE B 2  132 ? 18.051  -15.298 161.504 1.00 94.80  ? 116  PHE B CD1   1 
ATOM   5392  C  CD2   . PHE B 2  132 ? 19.814  -15.575 163.085 1.00 95.62  ? 116  PHE B CD2   1 
ATOM   5393  C  CE1   . PHE B 2  132 ? 17.247  -14.756 162.492 1.00 84.79  ? 116  PHE B CE1   1 
ATOM   5394  C  CE2   . PHE B 2  132 ? 19.016  -15.034 164.076 1.00 88.31  ? 116  PHE B CE2   1 
ATOM   5395  C  CZ    . PHE B 2  132 ? 17.731  -14.624 163.778 1.00 85.68  ? 116  PHE B CZ    1 
ATOM   5396  N  N     . SER B 2  133 ? 20.698  -18.772 158.334 1.00 95.18  ? 117  SER B N     1 
ATOM   5397  C  CA    . SER B 2  133 ? 21.538  -19.217 157.230 1.00 80.96  ? 117  SER B CA    1 
ATOM   5398  C  C     . SER B 2  133 ? 20.813  -19.279 155.890 1.00 87.51  ? 117  SER B C     1 
ATOM   5399  O  O     . SER B 2  133 ? 21.480  -19.356 154.852 1.00 97.50  ? 117  SER B O     1 
ATOM   5400  C  CB    . SER B 2  133 ? 22.131  -20.593 157.547 1.00 84.10  ? 117  SER B CB    1 
ATOM   5401  O  OG    . SER B 2  133 ? 21.180  -21.619 157.330 1.00 85.49  ? 117  SER B OG    1 
ATOM   5402  N  N     . VAL B 2  134 ? 19.486  -19.243 155.873 1.00 81.74  ? 118  VAL B N     1 
ATOM   5403  C  CA    . VAL B 2  134 ? 18.711  -19.584 154.682 1.00 84.15  ? 118  VAL B CA    1 
ATOM   5404  C  C     . VAL B 2  134 ? 18.017  -18.333 154.152 1.00 89.36  ? 118  VAL B C     1 
ATOM   5405  O  O     . VAL B 2  134 ? 17.304  -17.657 154.905 1.00 94.26  ? 118  VAL B O     1 
ATOM   5406  C  CB    . VAL B 2  134 ? 17.683  -20.687 154.975 1.00 81.67  ? 118  VAL B CB    1 
ATOM   5407  C  CG1   . VAL B 2  134 ? 16.689  -20.802 153.824 1.00 72.88  ? 118  VAL B CG1   1 
ATOM   5408  C  CG2   . VAL B 2  134 ? 18.380  -22.014 155.228 1.00 80.69  ? 118  VAL B CG2   1 
ATOM   5409  N  N     . PRO B 2  135 ? 18.221  -17.977 152.883 1.00 90.33  ? 119  PRO B N     1 
ATOM   5410  C  CA    . PRO B 2  135 ? 17.554  -16.802 152.307 1.00 97.82  ? 119  PRO B CA    1 
ATOM   5411  C  C     . PRO B 2  135 ? 16.035  -16.930 152.324 1.00 95.75  ? 119  PRO B C     1 
ATOM   5412  O  O     . PRO B 2  135 ? 15.477  -18.021 152.193 1.00 91.14  ? 119  PRO B O     1 
ATOM   5413  C  CB    . PRO B 2  135 ? 18.089  -16.760 150.872 1.00 93.76  ? 119  PRO B CB    1 
ATOM   5414  C  CG    . PRO B 2  135 ? 19.408  -17.444 150.947 1.00 100.61 ? 119  PRO B CG    1 
ATOM   5415  C  CD    . PRO B 2  135 ? 19.258  -18.519 151.989 1.00 94.14  ? 119  PRO B CD    1 
ATOM   5416  N  N     . LEU B 2  136 ? 15.369  -15.789 152.491 1.00 93.90  ? 120  LEU B N     1 
ATOM   5417  C  CA    . LEU B 2  136 ? 13.915  -15.699 152.447 1.00 91.88  ? 120  LEU B CA    1 
ATOM   5418  C  C     . LEU B 2  136 ? 13.470  -15.152 151.096 1.00 93.91  ? 120  LEU B C     1 
ATOM   5419  O  O     . LEU B 2  136 ? 14.074  -14.215 150.565 1.00 96.30  ? 120  LEU B O     1 
ATOM   5420  C  CB    . LEU B 2  136 ? 13.388  -14.803 153.570 1.00 92.33  ? 120  LEU B CB    1 
ATOM   5421  C  CG    . LEU B 2  136 ? 11.867  -14.688 153.701 1.00 93.12  ? 120  LEU B CG    1 
ATOM   5422  C  CD1   . LEU B 2  136 ? 11.258  -16.010 154.147 1.00 90.74  ? 120  LEU B CD1   1 
ATOM   5423  C  CD2   . LEU B 2  136 ? 11.487  -13.564 154.653 1.00 86.91  ? 120  LEU B CD2   1 
ATOM   5424  N  N     . ASP B 2  137 ? 12.419  -15.758 150.540 1.00 95.49  ? 121  ASP B N     1 
ATOM   5425  C  CA    . ASP B 2  137 ? 11.824  -15.329 149.276 1.00 99.50  ? 121  ASP B CA    1 
ATOM   5426  C  C     . ASP B 2  137 ? 11.621  -13.819 149.220 1.00 99.86  ? 121  ASP B C     1 
ATOM   5427  O  O     . ASP B 2  137 ? 10.903  -13.244 150.043 1.00 99.67  ? 121  ASP B O     1 
ATOM   5428  C  CB    . ASP B 2  137 ? 10.490  -16.052 149.060 1.00 104.43 ? 121  ASP B CB    1 
ATOM   5429  C  CG    . ASP B 2  137 ? 9.701   -15.496 147.882 1.00 107.95 ? 121  ASP B CG    1 
ATOM   5430  O  OD1   . ASP B 2  137 ? 10.320  -15.020 146.906 1.00 110.10 ? 121  ASP B OD1   1 
ATOM   5431  O  OD2   . ASP B 2  137 ? 8.453   -15.540 147.930 1.00 110.54 ? 121  ASP B OD2   1 
ATOM   5432  N  N     . GLU B 2  138 ? 12.285  -13.192 148.244 1.00 99.18  ? 122  GLU B N     1 
ATOM   5433  C  CA    . GLU B 2  138 ? 12.207  -11.751 148.011 1.00 100.52 ? 122  GLU B CA    1 
ATOM   5434  C  C     . GLU B 2  138 ? 10.799  -11.176 148.108 1.00 99.95  ? 122  GLU B C     1 
ATOM   5435  O  O     . GLU B 2  138 ? 10.585  -10.135 148.737 1.00 97.96  ? 122  GLU B O     1 
ATOM   5436  C  CB    . GLU B 2  138 ? 12.802  -11.424 146.639 1.00 104.89 ? 122  GLU B CB    1 
ATOM   5437  C  CG    . GLU B 2  138 ? 13.087  -9.944  146.432 1.00 105.49 ? 122  GLU B CG    1 
ATOM   5438  C  CD    . GLU B 2  138 ? 14.107  -9.397  147.408 1.00 105.69 ? 122  GLU B CD    1 
ATOM   5439  O  OE1   . GLU B 2  138 ? 15.203  -9.985  147.518 1.00 107.33 ? 122  GLU B OE1   1 
ATOM   5440  O  OE2   . GLU B 2  138 ? 13.811  -8.376  148.066 1.00 102.47 ? 122  GLU B OE2   1 
ATOM   5441  N  N     . ASP B 2  139 ? 9.821   -11.840 147.493 1.00 99.86  ? 123  ASP B N     1 
ATOM   5442  C  CA    . ASP B 2  139 ? 8.475   -11.283 147.470 1.00 102.48 ? 123  ASP B CA    1 
ATOM   5443  C  C     . ASP B 2  139 ? 7.779   -11.342 148.824 1.00 100.12 ? 123  ASP B C     1 
ATOM   5444  O  O     . ASP B 2  139 ? 6.751   -10.681 148.999 1.00 95.46  ? 123  ASP B O     1 
ATOM   5445  C  CB    . ASP B 2  139 ? 7.649   -11.999 146.408 1.00 108.92 ? 123  ASP B CB    1 
ATOM   5446  C  CG    . ASP B 2  139 ? 7.951   -11.494 145.014 1.00 109.26 ? 123  ASP B CG    1 
ATOM   5447  O  OD1   . ASP B 2  139 ? 7.466   -10.399 144.660 1.00 107.75 ? 123  ASP B OD1   1 
ATOM   5448  O  OD2   . ASP B 2  139 ? 8.689   -12.185 144.280 1.00 115.54 ? 123  ASP B OD2   1 
ATOM   5449  N  N     . PHE B 2  140 ? 8.303   -12.116 149.773 1.00 104.02 ? 124  PHE B N     1 
ATOM   5450  C  CA    . PHE B 2  140 ? 7.665   -12.301 151.068 1.00 99.22  ? 124  PHE B CA    1 
ATOM   5451  C  C     . PHE B 2  140 ? 8.276   -11.410 152.139 1.00 93.47  ? 124  PHE B C     1 
ATOM   5452  O  O     . PHE B 2  140 ? 7.636   -11.166 153.168 1.00 96.63  ? 124  PHE B O     1 
ATOM   5453  C  CB    . PHE B 2  140 ? 7.747   -13.764 151.519 1.00 98.85  ? 124  PHE B CB    1 
ATOM   5454  C  CG    . PHE B 2  140 ? 6.894   -14.070 152.716 1.00 92.78  ? 124  PHE B CG    1 
ATOM   5455  C  CD1   . PHE B 2  140 ? 5.519   -14.181 152.595 1.00 86.84  ? 124  PHE B CD1   1 
ATOM   5456  C  CD2   . PHE B 2  140 ? 7.467   -14.230 153.967 1.00 86.91  ? 124  PHE B CD2   1 
ATOM   5457  C  CE1   . PHE B 2  140 ? 4.733   -14.453 153.696 1.00 84.22  ? 124  PHE B CE1   1 
ATOM   5458  C  CE2   . PHE B 2  140 ? 6.685   -14.501 155.071 1.00 88.00  ? 124  PHE B CE2   1 
ATOM   5459  C  CZ    . PHE B 2  140 ? 5.317   -14.615 154.936 1.00 84.02  ? 124  PHE B CZ    1 
ATOM   5460  N  N     . ARG B 2  141 ? 9.506   -10.943 151.909 1.00 88.14  ? 125  ARG B N     1 
ATOM   5461  C  CA    . ARG B 2  141 ? 10.257  -10.176 152.897 1.00 87.89  ? 125  ARG B CA    1 
ATOM   5462  C  C     . ARG B 2  141 ? 9.464   -8.995  153.443 1.00 81.41  ? 125  ARG B C     1 
ATOM   5463  O  O     . ARG B 2  141 ? 9.545   -8.691  154.638 1.00 82.92  ? 125  ARG B O     1 
ATOM   5464  C  CB    . ARG B 2  141 ? 11.571  -9.712  152.276 1.00 91.61  ? 125  ARG B CB    1 
ATOM   5465  C  CG    . ARG B 2  141 ? 12.383  -10.874 151.744 1.00 95.55  ? 125  ARG B CG    1 
ATOM   5466  C  CD    . ARG B 2  141 ? 13.665  -10.436 151.084 1.00 94.06  ? 125  ARG B CD    1 
ATOM   5467  N  NE    . ARG B 2  141 ? 14.465  -11.592 150.697 1.00 92.03  ? 125  ARG B NE    1 
ATOM   5468  C  CZ    . ARG B 2  141 ? 15.725  -11.524 150.285 1.00 102.98 ? 125  ARG B CZ    1 
ATOM   5469  N  NH1   . ARG B 2  141 ? 16.330  -10.348 150.195 1.00 102.89 ? 125  ARG B NH1   1 
ATOM   5470  N  NH2   . ARG B 2  141 ? 16.376  -12.631 149.954 1.00 104.88 ? 125  ARG B NH2   1 
ATOM   5471  N  N     . LYS B 2  142 ? 8.713   -8.300  152.582 1.00 85.10  ? 126  LYS B N     1 
ATOM   5472  C  CA    . LYS B 2  142 ? 8.017   -7.092  153.017 1.00 82.55  ? 126  LYS B CA    1 
ATOM   5473  C  C     . LYS B 2  142 ? 7.084   -7.356  154.193 1.00 83.21  ? 126  LYS B C     1 
ATOM   5474  O  O     . LYS B 2  142 ? 6.784   -6.428  154.952 1.00 81.54  ? 126  LYS B O     1 
ATOM   5475  C  CB    . LYS B 2  142 ? 7.224   -6.475  151.862 1.00 85.51  ? 126  LYS B CB    1 
ATOM   5476  C  CG    . LYS B 2  142 ? 6.224   -7.409  151.197 1.00 87.96  ? 126  LYS B CG    1 
ATOM   5477  C  CD    . LYS B 2  142 ? 5.368   -6.656  150.182 1.00 87.48  ? 126  LYS B CD    1 
ATOM   5478  C  CE    . LYS B 2  142 ? 4.503   -7.601  149.360 1.00 91.36  ? 126  LYS B CE    1 
ATOM   5479  N  NZ    . LYS B 2  142 ? 5.315   -8.515  148.509 1.00 99.63  ? 126  LYS B NZ    1 
ATOM   5480  N  N     . TYR B 2  143 ? 6.611   -8.592  154.357 1.00 86.17  ? 127  TYR B N     1 
ATOM   5481  C  CA    . TYR B 2  143 ? 5.668   -8.908  155.421 1.00 78.83  ? 127  TYR B CA    1 
ATOM   5482  C  C     . TYR B 2  143 ? 6.327   -9.017  156.790 1.00 77.17  ? 127  TYR B C     1 
ATOM   5483  O  O     . TYR B 2  143 ? 5.611   -9.084  157.796 1.00 85.98  ? 127  TYR B O     1 
ATOM   5484  C  CB    . TYR B 2  143 ? 4.925   -10.204 155.097 1.00 76.79  ? 127  TYR B CB    1 
ATOM   5485  C  CG    . TYR B 2  143 ? 4.099   -10.110 153.840 1.00 76.48  ? 127  TYR B CG    1 
ATOM   5486  C  CD1   . TYR B 2  143 ? 3.081   -9.173  153.731 1.00 80.72  ? 127  TYR B CD1   1 
ATOM   5487  C  CD2   . TYR B 2  143 ? 4.328   -10.959 152.767 1.00 83.42  ? 127  TYR B CD2   1 
ATOM   5488  C  CE1   . TYR B 2  143 ? 2.318   -9.078  152.586 1.00 87.49  ? 127  TYR B CE1   1 
ATOM   5489  C  CE2   . TYR B 2  143 ? 3.568   -10.872 151.615 1.00 87.03  ? 127  TYR B CE2   1 
ATOM   5490  C  CZ    . TYR B 2  143 ? 2.565   -9.929  151.531 1.00 88.17  ? 127  TYR B CZ    1 
ATOM   5491  O  OH    . TYR B 2  143 ? 1.800   -9.833  150.391 1.00 98.64  ? 127  TYR B OH    1 
ATOM   5492  N  N     . THR B 2  144 ? 7.659   -9.037  156.862 1.00 77.24  ? 128  THR B N     1 
ATOM   5493  C  CA    . THR B 2  144 ? 8.370   -9.196  158.124 1.00 77.05  ? 128  THR B CA    1 
ATOM   5494  C  C     . THR B 2  144 ? 8.833   -7.862  158.699 1.00 73.28  ? 128  THR B C     1 
ATOM   5495  O  O     . THR B 2  144 ? 9.777   -7.827  159.494 1.00 74.28  ? 128  THR B O     1 
ATOM   5496  C  CB    . THR B 2  144 ? 9.568   -10.129 157.945 1.00 75.58  ? 128  THR B CB    1 
ATOM   5497  O  OG1   . THR B 2  144 ? 10.536  -9.504  157.092 1.00 81.22  ? 128  THR B OG1   1 
ATOM   5498  C  CG2   . THR B 2  144 ? 9.131   -11.442 157.320 1.00 80.38  ? 128  THR B CG2   1 
ATOM   5499  N  N     . ALA B 2  145 ? 8.187   -6.768  158.308 1.00 74.07  ? 129  ALA B N     1 
ATOM   5500  C  CA    . ALA B 2  145 ? 8.603   -5.434  158.718 1.00 74.68  ? 129  ALA B CA    1 
ATOM   5501  C  C     . ALA B 2  145 ? 8.364   -5.219  160.209 1.00 72.31  ? 129  ALA B C     1 
ATOM   5502  O  O     . ALA B 2  145 ? 7.294   -5.549  160.729 1.00 72.76  ? 129  ALA B O     1 
ATOM   5503  C  CB    . ALA B 2  145 ? 7.861   -4.378  157.903 1.00 75.53  ? 129  ALA B CB    1 
ATOM   5504  N  N     . PHE B 2  146 ? 9.361   -4.664  160.898 1.00 80.50  ? 130  PHE B N     1 
ATOM   5505  C  CA    . PHE B 2  146 ? 9.182   -4.210  162.270 1.00 79.13  ? 130  PHE B CA    1 
ATOM   5506  C  C     . PHE B 2  146 ? 9.833   -2.843  162.439 1.00 73.33  ? 130  PHE B C     1 
ATOM   5507  O  O     . PHE B 2  146 ? 10.673  -2.430  161.638 1.00 77.40  ? 130  PHE B O     1 
ATOM   5508  C  CB    . PHE B 2  146 ? 9.776   -5.206  163.277 1.00 72.04  ? 130  PHE B CB    1 
ATOM   5509  C  CG    . PHE B 2  146 ? 11.251  -5.436  163.103 1.00 72.17  ? 130  PHE B CG    1 
ATOM   5510  C  CD1   . PHE B 2  146 ? 11.715  -6.395  162.218 1.00 74.80  ? 130  PHE B CD1   1 
ATOM   5511  C  CD2   . PHE B 2  146 ? 12.174  -4.687  163.816 1.00 76.73  ? 130  PHE B CD2   1 
ATOM   5512  C  CE1   . PHE B 2  146 ? 13.072  -6.611  162.055 1.00 77.95  ? 130  PHE B CE1   1 
ATOM   5513  C  CE2   . PHE B 2  146 ? 13.533  -4.895  163.654 1.00 76.71  ? 130  PHE B CE2   1 
ATOM   5514  C  CZ    . PHE B 2  146 ? 13.982  -5.859  162.774 1.00 73.72  ? 130  PHE B CZ    1 
ATOM   5515  N  N     . THR B 2  147 ? 9.429   -2.144  163.501 1.00 68.73  ? 131  THR B N     1 
ATOM   5516  C  CA    . THR B 2  147 ? 9.874   -0.781  163.790 1.00 64.08  ? 131  THR B CA    1 
ATOM   5517  C  C     . THR B 2  147 ? 10.464  -0.713  165.192 1.00 66.07  ? 131  THR B C     1 
ATOM   5518  O  O     . THR B 2  147 ? 9.740   -0.895  166.176 1.00 72.29  ? 131  THR B O     1 
ATOM   5519  C  CB    . THR B 2  147 ? 8.720   0.208   163.650 1.00 58.16  ? 131  THR B CB    1 
ATOM   5520  O  OG1   . THR B 2  147 ? 8.100   0.040   162.372 1.00 63.80  ? 131  THR B OG1   1 
ATOM   5521  C  CG2   . THR B 2  147 ? 9.223   1.618   163.781 1.00 60.43  ? 131  THR B CG2   1 
ATOM   5522  N  N     . ILE B 2  148 ? 11.764  -0.466  165.292 1.00 68.92  ? 132  ILE B N     1 
ATOM   5523  C  CA    . ILE B 2  148 ? 12.357  -0.155  166.602 1.00 64.30  ? 132  ILE B CA    1 
ATOM   5524  C  C     . ILE B 2  148 ? 11.961  1.256   167.033 1.00 68.24  ? 132  ILE B C     1 
ATOM   5525  O  O     . ILE B 2  148 ? 12.202  2.222   166.285 1.00 65.65  ? 132  ILE B O     1 
ATOM   5526  C  CB    . ILE B 2  148 ? 13.872  -0.296  166.545 1.00 58.77  ? 132  ILE B CB    1 
ATOM   5527  C  CG1   . ILE B 2  148 ? 14.257  -1.714  166.141 1.00 65.46  ? 132  ILE B CG1   1 
ATOM   5528  C  CG2   . ILE B 2  148 ? 14.481  0.049   167.893 1.00 54.98  ? 132  ILE B CG2   1 
ATOM   5529  C  CD1   . ILE B 2  148 ? 15.739  -1.914  166.078 1.00 76.21  ? 132  ILE B CD1   1 
ATOM   5530  N  N     . PRO B 2  149 ? 11.397  1.432   168.238 1.00 64.39  ? 133  PRO B N     1 
ATOM   5531  C  CA    . PRO B 2  149 ? 10.999  2.767   168.706 1.00 59.24  ? 133  PRO B CA    1 
ATOM   5532  C  C     . PRO B 2  149 ? 12.133  3.438   169.468 1.00 65.64  ? 133  PRO B C     1 
ATOM   5533  O  O     . PRO B 2  149 ? 13.198  2.832   169.625 1.00 71.25  ? 133  PRO B O     1 
ATOM   5534  C  CB    . PRO B 2  149 ? 9.808   2.461   169.612 1.00 50.05  ? 133  PRO B CB    1 
ATOM   5535  C  CG    . PRO B 2  149 ? 10.207  1.156   170.248 1.00 49.30  ? 133  PRO B CG    1 
ATOM   5536  C  CD    . PRO B 2  149 ? 11.009  0.388   169.205 1.00 51.71  ? 133  PRO B CD    1 
ATOM   5537  N  N     . SER B 2  150 ? 11.948  4.674   169.936 1.00 58.25  ? 134  SER B N     1 
ATOM   5538  C  CA    . SER B 2  150 ? 12.998  5.337   170.697 1.00 63.95  ? 134  SER B CA    1 
ATOM   5539  C  C     . SER B 2  150 ? 12.404  6.030   171.915 1.00 64.79  ? 134  SER B C     1 
ATOM   5540  O  O     . SER B 2  150 ? 11.273  6.521   171.883 1.00 73.21  ? 134  SER B O     1 
ATOM   5541  C  CB    . SER B 2  150 ? 13.748  6.370   169.845 1.00 72.41  ? 134  SER B CB    1 
ATOM   5542  O  OG    . SER B 2  150 ? 12.917  7.480   169.550 1.00 71.16  ? 134  SER B OG    1 
ATOM   5543  N  N     . ILE B 2  151 ? 13.199  6.068   172.990 1.00 57.98  ? 135  ILE B N     1 
ATOM   5544  C  CA    . ILE B 2  151 ? 12.799  6.737   174.225 1.00 54.09  ? 135  ILE B CA    1 
ATOM   5545  C  C     . ILE B 2  151 ? 12.421  8.187   173.963 1.00 64.22  ? 135  ILE B C     1 
ATOM   5546  O  O     . ILE B 2  151 ? 13.132  8.920   173.265 1.00 72.97  ? 135  ILE B O     1 
ATOM   5547  C  CB    . ILE B 2  151 ? 13.917  6.630   175.271 1.00 54.14  ? 135  ILE B CB    1 
ATOM   5548  C  CG1   . ILE B 2  151 ? 14.237  5.161   175.544 1.00 60.81  ? 135  ILE B CG1   1 
ATOM   5549  C  CG2   . ILE B 2  151 ? 13.516  7.338   176.556 1.00 64.72  ? 135  ILE B CG2   1 
ATOM   5550  C  CD1   . ILE B 2  151 ? 15.447  4.960   176.409 1.00 72.13  ? 135  ILE B CD1   1 
ATOM   5551  N  N     . ASN B 2  152 ? 11.299  8.609   174.547 1.00 71.13  ? 136  ASN B N     1 
ATOM   5552  C  CA    . ASN B 2  152 ? 10.765  9.967   174.429 1.00 72.14  ? 136  ASN B CA    1 
ATOM   5553  C  C     . ASN B 2  152 ? 10.596  10.397  172.974 1.00 70.25  ? 136  ASN B C     1 
ATOM   5554  O  O     . ASN B 2  152 ? 10.506  11.592  172.681 1.00 73.94  ? 136  ASN B O     1 
ATOM   5555  C  CB    . ASN B 2  152 ? 11.629  10.977  175.193 1.00 73.19  ? 136  ASN B CB    1 
ATOM   5556  C  CG    . ASN B 2  152 ? 10.895  12.283  175.465 1.00 79.94  ? 136  ASN B CG    1 
ATOM   5557  O  OD1   . ASN B 2  152 ? 9.663   12.330  175.459 1.00 70.80  ? 136  ASN B OD1   1 
ATOM   5558  N  ND2   . ASN B 2  152 ? 11.649  13.348  175.705 1.00 89.37  ? 136  ASN B ND2   1 
ATOM   5559  N  N     . ASN B 2  153 ? 10.542  9.432   172.058 1.00 67.50  ? 137  ASN B N     1 
ATOM   5560  C  CA    . ASN B 2  153 ? 10.350  9.700   170.637 1.00 79.42  ? 137  ASN B CA    1 
ATOM   5561  C  C     . ASN B 2  153 ? 11.386  10.688  170.106 1.00 86.35  ? 137  ASN B C     1 
ATOM   5562  O  O     . ASN B 2  153 ? 11.067  11.647  169.398 1.00 81.38  ? 137  ASN B O     1 
ATOM   5563  C  CB    . ASN B 2  153 ? 8.930   10.194  170.375 1.00 80.98  ? 137  ASN B CB    1 
ATOM   5564  C  CG    . ASN B 2  153 ? 7.899   9.124   170.634 1.00 80.66  ? 137  ASN B CG    1 
ATOM   5565  O  OD1   . ASN B 2  153 ? 7.715   8.219   169.821 1.00 89.01  ? 137  ASN B OD1   1 
ATOM   5566  N  ND2   . ASN B 2  153 ? 7.227   9.209   171.779 1.00 74.47  ? 137  ASN B ND2   1 
ATOM   5567  N  N     . GLU B 2  154 ? 12.649  10.445  170.466 1.00 90.85  ? 138  GLU B N     1 
ATOM   5568  C  CA    . GLU B 2  154 ? 13.727  11.290  169.967 1.00 93.25  ? 138  GLU B CA    1 
ATOM   5569  C  C     . GLU B 2  154 ? 13.810  11.222  168.452 1.00 96.13  ? 138  GLU B C     1 
ATOM   5570  O  O     . GLU B 2  154 ? 14.117  12.222  167.792 1.00 100.69 ? 138  GLU B O     1 
ATOM   5571  C  CB    . GLU B 2  154 ? 15.057  10.839  170.570 1.00 99.15  ? 138  GLU B CB    1 
ATOM   5572  C  CG    . GLU B 2  154 ? 16.274  11.510  169.963 1.00 104.50 ? 138  GLU B CG    1 
ATOM   5573  C  CD    . GLU B 2  154 ? 17.563  11.081  170.625 1.00 107.46 ? 138  GLU B CD    1 
ATOM   5574  O  OE1   . GLU B 2  154 ? 17.694  11.258  171.853 1.00 108.12 ? 138  GLU B OE1   1 
ATOM   5575  O  OE2   . GLU B 2  154 ? 18.444  10.556  169.911 1.00 112.42 ? 138  GLU B OE2   1 
ATOM   5576  N  N     . THR B 2  155 ? 13.511  10.060  167.891 1.00 93.32  ? 139  THR B N     1 
ATOM   5577  C  CA    . THR B 2  155 ? 13.633  9.757   166.481 1.00 83.24  ? 139  THR B CA    1 
ATOM   5578  C  C     . THR B 2  155 ? 12.329  9.120   166.030 1.00 81.45  ? 139  THR B C     1 
ATOM   5579  O  O     . THR B 2  155 ? 11.641  8.485   166.837 1.00 83.73  ? 139  THR B O     1 
ATOM   5580  C  CB    . THR B 2  155 ? 14.805  8.788   166.244 1.00 78.41  ? 139  THR B CB    1 
ATOM   5581  O  OG1   . THR B 2  155 ? 16.003  9.351   166.791 1.00 89.73  ? 139  THR B OG1   1 
ATOM   5582  C  CG2   . THR B 2  155 ? 15.037  8.531   164.763 1.00 84.02  ? 139  THR B CG2   1 
ATOM   5583  N  N     . PRO B 2  156 ? 11.949  9.279   164.766 1.00 80.89  ? 140  PRO B N     1 
ATOM   5584  C  CA    . PRO B 2  156 ? 10.899  8.417   164.223 1.00 80.89  ? 140  PRO B CA    1 
ATOM   5585  C  C     . PRO B 2  156 ? 11.373  6.974   164.244 1.00 75.17  ? 140  PRO B C     1 
ATOM   5586  O  O     . PRO B 2  156 ? 12.556  6.681   164.425 1.00 78.14  ? 140  PRO B O     1 
ATOM   5587  C  CB    . PRO B 2  156 ? 10.705  8.943   162.798 1.00 83.10  ? 140  PRO B CB    1 
ATOM   5588  C  CG    . PRO B 2  156 ? 11.131  10.369  162.884 1.00 82.20  ? 140  PRO B CG    1 
ATOM   5589  C  CD    . PRO B 2  156 ? 12.285  10.371  163.839 1.00 89.25  ? 140  PRO B CD    1 
ATOM   5590  N  N     . GLY B 2  157 ? 10.432  6.053   164.077 1.00 71.76  ? 141  GLY B N     1 
ATOM   5591  C  CA    . GLY B 2  157 ? 10.778  4.654   164.191 1.00 75.38  ? 141  GLY B CA    1 
ATOM   5592  C  C     . GLY B 2  157 ? 11.720  4.237   163.080 1.00 78.61  ? 141  GLY B C     1 
ATOM   5593  O  O     . GLY B 2  157 ? 11.686  4.769   161.971 1.00 77.44  ? 141  GLY B O     1 
ATOM   5594  N  N     . ILE B 2  158 ? 12.579  3.268   163.381 1.00 78.52  ? 142  ILE B N     1 
ATOM   5595  C  CA    . ILE B 2  158 ? 13.529  2.757   162.402 1.00 84.11  ? 142  ILE B CA    1 
ATOM   5596  C  C     . ILE B 2  158 ? 13.055  1.381   161.962 1.00 84.05  ? 142  ILE B C     1 
ATOM   5597  O  O     . ILE B 2  158 ? 13.047  0.427   162.750 1.00 85.50  ? 142  ILE B O     1 
ATOM   5598  C  CB    . ILE B 2  158 ? 14.954  2.702   162.969 1.00 86.66  ? 142  ILE B CB    1 
ATOM   5599  C  CG1   . ILE B 2  158 ? 15.348  4.068   163.532 1.00 87.12  ? 142  ILE B CG1   1 
ATOM   5600  C  CG2   . ILE B 2  158 ? 15.937  2.264   161.898 1.00 84.77  ? 142  ILE B CG2   1 
ATOM   5601  C  CD1   . ILE B 2  158 ? 15.155  5.211   162.551 1.00 87.06  ? 142  ILE B CD1   1 
ATOM   5602  N  N     . ARG B 2  159 ? 12.667  1.286   160.692 1.00 88.94  ? 143  ARG B N     1 
ATOM   5603  C  CA    . ARG B 2  159 ? 12.021  0.102   160.145 1.00 80.63  ? 143  ARG B CA    1 
ATOM   5604  C  C     . ARG B 2  159 ? 13.048  -0.809  159.485 1.00 79.74  ? 143  ARG B C     1 
ATOM   5605  O  O     . ARG B 2  159 ? 13.877  -0.349  158.692 1.00 81.40  ? 143  ARG B O     1 
ATOM   5606  C  CB    . ARG B 2  159 ? 10.928  0.493   159.151 1.00 74.51  ? 143  ARG B CB    1 
ATOM   5607  C  CG    . ARG B 2  159 ? 9.722   1.138   159.806 1.00 81.58  ? 143  ARG B CG    1 
ATOM   5608  C  CD    . ARG B 2  159 ? 8.713   1.647   158.786 1.00 88.33  ? 143  ARG B CD    1 
ATOM   5609  N  NE    . ARG B 2  159 ? 8.218   0.598   157.894 1.00 88.44  ? 143  ARG B NE    1 
ATOM   5610  C  CZ    . ARG B 2  159 ? 7.440   -0.417  158.262 1.00 83.03  ? 143  ARG B CZ    1 
ATOM   5611  N  NH1   . ARG B 2  159 ? 7.071   -0.568  159.527 1.00 80.65  ? 143  ARG B NH1   1 
ATOM   5612  N  NH2   . ARG B 2  159 ? 7.047   -1.302  157.357 1.00 86.12  ? 143  ARG B NH2   1 
ATOM   5613  N  N     . TYR B 2  160 ? 13.003  -2.091  159.826 1.00 76.11  ? 144  TYR B N     1 
ATOM   5614  C  CA    . TYR B 2  160 ? 13.776  -3.103  159.128 1.00 78.36  ? 144  TYR B CA    1 
ATOM   5615  C  C     . TYR B 2  160 ? 12.825  -4.137  158.540 1.00 79.05  ? 144  TYR B C     1 
ATOM   5616  O  O     . TYR B 2  160 ? 11.649  -4.207  158.904 1.00 82.46  ? 144  TYR B O     1 
ATOM   5617  C  CB    . TYR B 2  160 ? 14.773  -3.779  160.075 1.00 81.77  ? 144  TYR B CB    1 
ATOM   5618  C  CG    . TYR B 2  160 ? 15.714  -2.811  160.753 1.00 89.66  ? 144  TYR B CG    1 
ATOM   5619  C  CD1   . TYR B 2  160 ? 15.310  -2.100  161.877 1.00 89.85  ? 144  TYR B CD1   1 
ATOM   5620  C  CD2   . TYR B 2  160 ? 16.990  -2.583  160.257 1.00 90.10  ? 144  TYR B CD2   1 
ATOM   5621  C  CE1   . TYR B 2  160 ? 16.159  -1.213  162.505 1.00 93.88  ? 144  TYR B CE1   1 
ATOM   5622  C  CE2   . TYR B 2  160 ? 17.847  -1.692  160.877 1.00 92.21  ? 144  TYR B CE2   1 
ATOM   5623  C  CZ    . TYR B 2  160 ? 17.425  -1.010  162.000 1.00 94.37  ? 144  TYR B CZ    1 
ATOM   5624  O  OH    . TYR B 2  160 ? 18.269  -0.118  162.619 1.00 97.20  ? 144  TYR B OH    1 
ATOM   5625  N  N     . GLN B 2  161 ? 13.341  -4.953  157.623 1.00 87.46  ? 145  GLN B N     1 
ATOM   5626  C  CA    . GLN B 2  161 ? 12.650  -6.164  157.206 1.00 85.80  ? 145  GLN B CA    1 
ATOM   5627  C  C     . GLN B 2  161 ? 13.663  -7.297  157.122 1.00 80.89  ? 145  GLN B C     1 
ATOM   5628  O  O     . GLN B 2  161 ? 14.874  -7.069  157.089 1.00 77.24  ? 145  GLN B O     1 
ATOM   5629  C  CB    . GLN B 2  161 ? 11.916  -5.963  155.872 1.00 79.78  ? 145  GLN B CB    1 
ATOM   5630  C  CG    . GLN B 2  161 ? 12.792  -6.064  154.639 1.00 81.62  ? 145  GLN B CG    1 
ATOM   5631  C  CD    . GLN B 2  161 ? 12.031  -5.748  153.363 1.00 90.39  ? 145  GLN B CD    1 
ATOM   5632  O  OE1   . GLN B 2  161 ? 10.846  -5.410  153.399 1.00 87.87  ? 145  GLN B OE1   1 
ATOM   5633  N  NE2   . GLN B 2  161 ? 12.709  -5.862  152.226 1.00 86.58  ? 145  GLN B NE2   1 
ATOM   5634  N  N     . TYR B 2  162 ? 13.159  -8.526  157.075 1.00 80.98  ? 146  TYR B N     1 
ATOM   5635  C  CA    . TYR B 2  162 ? 14.026  -9.696  157.065 1.00 80.44  ? 146  TYR B CA    1 
ATOM   5636  C  C     . TYR B 2  162 ? 14.428  -10.111 155.656 1.00 91.10  ? 146  TYR B C     1 
ATOM   5637  O  O     . TYR B 2  162 ? 13.621  -10.065 154.722 1.00 87.99  ? 146  TYR B O     1 
ATOM   5638  C  CB    . TYR B 2  162 ? 13.341  -10.859 157.781 1.00 79.39  ? 146  TYR B CB    1 
ATOM   5639  C  CG    . TYR B 2  162 ? 13.565  -10.828 159.272 1.00 76.72  ? 146  TYR B CG    1 
ATOM   5640  C  CD1   . TYR B 2  162 ? 12.723  -10.100 160.104 1.00 73.71  ? 146  TYR B CD1   1 
ATOM   5641  C  CD2   . TYR B 2  162 ? 14.624  -11.516 159.846 1.00 71.72  ? 146  TYR B CD2   1 
ATOM   5642  C  CE1   . TYR B 2  162 ? 12.929  -10.061 161.466 1.00 69.00  ? 146  TYR B CE1   1 
ATOM   5643  C  CE2   . TYR B 2  162 ? 14.835  -11.486 161.205 1.00 77.30  ? 146  TYR B CE2   1 
ATOM   5644  C  CZ    . TYR B 2  162 ? 13.986  -10.758 162.009 1.00 73.49  ? 146  TYR B CZ    1 
ATOM   5645  O  OH    . TYR B 2  162 ? 14.195  -10.732 163.362 1.00 65.55  ? 146  TYR B OH    1 
ATOM   5646  N  N     . ASN B 2  163 ? 15.692  -10.516 155.516 1.00 96.17  ? 147  ASN B N     1 
ATOM   5647  C  CA    . ASN B 2  163 ? 16.216  -11.147 154.310 1.00 87.93  ? 147  ASN B CA    1 
ATOM   5648  C  C     . ASN B 2  163 ? 16.352  -12.657 154.443 1.00 86.09  ? 147  ASN B C     1 
ATOM   5649  O  O     . ASN B 2  163 ? 16.343  -13.363 153.430 1.00 88.09  ? 147  ASN B O     1 
ATOM   5650  C  CB    . ASN B 2  163 ? 17.576  -10.547 153.937 1.00 83.38  ? 147  ASN B CB    1 
ATOM   5651  C  CG    . ASN B 2  163 ? 17.512  -9.047  153.722 1.00 84.22  ? 147  ASN B CG    1 
ATOM   5652  O  OD1   . ASN B 2  163 ? 16.565  -8.534  153.123 1.00 81.51  ? 147  ASN B OD1   1 
ATOM   5653  N  ND2   . ASN B 2  163 ? 18.522  -8.335  154.207 1.00 84.08  ? 147  ASN B ND2   1 
ATOM   5654  N  N     . VAL B 2  164 ? 16.501  -13.158 155.665 1.00 89.06  ? 148  VAL B N     1 
ATOM   5655  C  CA    . VAL B 2  164 ? 16.638  -14.581 155.925 1.00 89.82  ? 148  VAL B CA    1 
ATOM   5656  C  C     . VAL B 2  164 ? 15.404  -15.062 156.685 1.00 85.24  ? 148  VAL B C     1 
ATOM   5657  O  O     . VAL B 2  164 ? 14.541  -14.277 157.075 1.00 84.94  ? 148  VAL B O     1 
ATOM   5658  C  CB    . VAL B 2  164 ? 17.935  -14.907 156.691 1.00 93.30  ? 148  VAL B CB    1 
ATOM   5659  C  CG1   . VAL B 2  164 ? 19.142  -14.422 155.908 1.00 93.86  ? 148  VAL B CG1   1 
ATOM   5660  C  CG2   . VAL B 2  164 ? 17.908  -14.272 158.068 1.00 93.68  ? 148  VAL B CG2   1 
ATOM   5661  N  N     . LEU B 2  165 ? 15.322  -16.374 156.880 1.00 85.80  ? 149  LEU B N     1 
ATOM   5662  C  CA    . LEU B 2  165 ? 14.300  -16.975 157.729 1.00 84.15  ? 149  LEU B CA    1 
ATOM   5663  C  C     . LEU B 2  165 ? 14.336  -16.375 159.134 1.00 91.88  ? 149  LEU B C     1 
ATOM   5664  O  O     . LEU B 2  165 ? 15.337  -16.549 159.847 1.00 88.78  ? 149  LEU B O     1 
ATOM   5665  C  CB    . LEU B 2  165 ? 14.516  -18.485 157.793 1.00 77.33  ? 149  LEU B CB    1 
ATOM   5666  C  CG    . LEU B 2  165 ? 14.296  -19.266 156.494 1.00 71.01  ? 149  LEU B CG    1 
ATOM   5667  C  CD1   . LEU B 2  165 ? 14.338  -20.767 156.748 1.00 73.86  ? 149  LEU B CD1   1 
ATOM   5668  C  CD2   . LEU B 2  165 ? 12.992  -18.865 155.827 1.00 70.62  ? 149  LEU B CD2   1 
ATOM   5669  N  N     . PRO B 2  166 ? 13.285  -15.678 159.573 1.00 84.63  ? 150  PRO B N     1 
ATOM   5670  C  CA    . PRO B 2  166 ? 13.318  -15.057 160.904 1.00 76.52  ? 150  PRO B CA    1 
ATOM   5671  C  C     . PRO B 2  166 ? 12.903  -16.032 161.994 1.00 75.93  ? 150  PRO B C     1 
ATOM   5672  O  O     . PRO B 2  166 ? 11.991  -16.845 161.814 1.00 70.49  ? 150  PRO B O     1 
ATOM   5673  C  CB    . PRO B 2  166 ? 12.299  -13.917 160.787 1.00 70.40  ? 150  PRO B CB    1 
ATOM   5674  C  CG    . PRO B 2  166 ? 11.364  -14.362 159.720 1.00 72.65  ? 150  PRO B CG    1 
ATOM   5675  C  CD    . PRO B 2  166 ? 12.130  -15.235 158.774 1.00 77.29  ? 150  PRO B CD    1 
ATOM   5676  N  N     . GLN B 2  167 ? 13.591  -15.947 163.134 1.00 71.71  ? 151  GLN B N     1 
ATOM   5677  C  CA    . GLN B 2  167 ? 13.123  -16.601 164.351 1.00 69.91  ? 151  GLN B CA    1 
ATOM   5678  C  C     . GLN B 2  167 ? 11.691  -16.192 164.683 1.00 69.81  ? 151  GLN B C     1 
ATOM   5679  O  O     . GLN B 2  167 ? 11.304  -15.032 164.519 1.00 72.06  ? 151  GLN B O     1 
ATOM   5680  C  CB    . GLN B 2  167 ? 14.048  -16.280 165.527 1.00 68.04  ? 151  GLN B CB    1 
ATOM   5681  C  CG    . GLN B 2  167 ? 15.464  -16.802 165.370 1.00 70.47  ? 151  GLN B CG    1 
ATOM   5682  C  CD    . GLN B 2  167 ? 16.354  -16.411 166.533 1.00 72.91  ? 151  GLN B CD    1 
ATOM   5683  O  OE1   . GLN B 2  167 ? 17.220  -17.180 166.955 1.00 67.18  ? 151  GLN B OE1   1 
ATOM   5684  N  NE2   . GLN B 2  167 ? 16.146  -15.210 167.059 1.00 74.84  ? 151  GLN B NE2   1 
ATOM   5685  N  N     . GLY B 2  168 ? 10.905  -17.155 165.160 1.00 55.35  ? 152  GLY B N     1 
ATOM   5686  C  CA    . GLY B 2  168 ? 9.552   -16.883 165.586 1.00 72.80  ? 152  GLY B CA    1 
ATOM   5687  C  C     . GLY B 2  168 ? 8.493   -16.992 164.511 1.00 78.07  ? 152  GLY B C     1 
ATOM   5688  O  O     . GLY B 2  168 ? 7.299   -16.941 164.838 1.00 78.79  ? 152  GLY B O     1 
ATOM   5689  N  N     . TRP B 2  169 ? 8.879   -17.135 163.247 1.00 69.79  ? 153  TRP B N     1 
ATOM   5690  C  CA    . TRP B 2  169 ? 7.924   -17.292 162.158 1.00 74.18  ? 153  TRP B CA    1 
ATOM   5691  C  C     . TRP B 2  169 ? 7.707   -18.769 161.863 1.00 82.58  ? 153  TRP B C     1 
ATOM   5692  O  O     . TRP B 2  169 ? 8.670   -19.532 161.738 1.00 80.58  ? 153  TRP B O     1 
ATOM   5693  C  CB    . TRP B 2  169 ? 8.404   -16.566 160.902 1.00 72.79  ? 153  TRP B CB    1 
ATOM   5694  C  CG    . TRP B 2  169 ? 7.484   -16.736 159.732 1.00 78.22  ? 153  TRP B CG    1 
ATOM   5695  C  CD1   . TRP B 2  169 ? 6.144   -16.484 159.695 1.00 80.20  ? 153  TRP B CD1   1 
ATOM   5696  C  CD2   . TRP B 2  169 ? 7.846   -17.180 158.417 1.00 83.67  ? 153  TRP B CD2   1 
ATOM   5697  N  NE1   . TRP B 2  169 ? 5.646   -16.755 158.442 1.00 86.47  ? 153  TRP B NE1   1 
ATOM   5698  C  CE2   . TRP B 2  169 ? 6.672   -17.181 157.638 1.00 87.50  ? 153  TRP B CE2   1 
ATOM   5699  C  CE3   . TRP B 2  169 ? 9.049   -17.576 157.823 1.00 78.01  ? 153  TRP B CE3   1 
ATOM   5700  C  CZ2   . TRP B 2  169 ? 6.664   -17.569 156.298 1.00 88.82  ? 153  TRP B CZ2   1 
ATOM   5701  C  CZ3   . TRP B 2  169 ? 9.040   -17.958 156.492 1.00 77.47  ? 153  TRP B CZ3   1 
ATOM   5702  C  CH2   . TRP B 2  169 ? 7.856   -17.950 155.745 1.00 81.50  ? 153  TRP B CH2   1 
ATOM   5703  N  N     . LYS B 2  170 ? 6.435   -19.165 161.746 1.00 83.88  ? 154  LYS B N     1 
ATOM   5704  C  CA    . LYS B 2  170 ? 6.096   -20.571 161.551 1.00 85.03  ? 154  LYS B CA    1 
ATOM   5705  C  C     . LYS B 2  170 ? 6.587   -21.103 160.213 1.00 86.90  ? 154  LYS B C     1 
ATOM   5706  O  O     . LYS B 2  170 ? 6.699   -22.322 160.046 1.00 88.01  ? 154  LYS B O     1 
ATOM   5707  C  CB    . LYS B 2  170 ? 4.582   -20.768 161.665 1.00 88.42  ? 154  LYS B CB    1 
ATOM   5708  C  CG    . LYS B 2  170 ? 3.822   -20.563 160.360 1.00 84.17  ? 154  LYS B CG    1 
ATOM   5709  C  CD    . LYS B 2  170 ? 2.496   -21.308 160.361 1.00 84.47  ? 154  LYS B CD    1 
ATOM   5710  C  CE    . LYS B 2  170 ? 1.677   -20.976 159.125 1.00 99.78  ? 154  LYS B CE    1 
ATOM   5711  N  NZ    . LYS B 2  170 ? 0.280   -21.482 159.226 1.00 110.25 ? 154  LYS B NZ    1 
ATOM   5712  N  N     . GLY B 2  171 ? 6.878   -20.215 159.262 1.00 81.50  ? 155  GLY B N     1 
ATOM   5713  C  CA    . GLY B 2  171 ? 7.449   -20.639 157.997 1.00 84.12  ? 155  GLY B CA    1 
ATOM   5714  C  C     . GLY B 2  171 ? 8.885   -21.115 158.103 1.00 84.56  ? 155  GLY B C     1 
ATOM   5715  O  O     . GLY B 2  171 ? 9.319   -21.958 157.312 1.00 80.81  ? 155  GLY B O     1 
ATOM   5716  N  N     . SER B 2  172 ? 9.642   -20.590 159.077 1.00 86.56  ? 156  SER B N     1 
ATOM   5717  C  CA    . SER B 2  172 ? 11.074  -20.890 159.119 1.00 81.94  ? 156  SER B CA    1 
ATOM   5718  C  C     . SER B 2  172 ? 11.371  -22.348 159.449 1.00 81.20  ? 156  SER B C     1 
ATOM   5719  O  O     . SER B 2  172 ? 12.216  -22.946 158.760 1.00 92.18  ? 156  SER B O     1 
ATOM   5720  C  CB    . SER B 2  172 ? 11.769  -19.942 160.102 1.00 80.82  ? 156  SER B CB    1 
ATOM   5721  O  OG    . SER B 2  172 ? 11.309  -18.611 159.943 1.00 73.41  ? 156  SER B OG    1 
ATOM   5722  N  N     . PRO B 2  173 ? 10.754  -22.981 160.454 1.00 83.99  ? 157  PRO B N     1 
ATOM   5723  C  CA    . PRO B 2  173 ? 11.049  -24.410 160.657 1.00 85.05  ? 157  PRO B CA    1 
ATOM   5724  C  C     . PRO B 2  173 ? 10.580  -25.271 159.496 1.00 89.88  ? 157  PRO B C     1 
ATOM   5725  O  O     . PRO B 2  173 ? 11.269  -26.227 159.120 1.00 94.99  ? 157  PRO B O     1 
ATOM   5726  C  CB    . PRO B 2  173 ? 10.316  -24.743 161.963 1.00 85.69  ? 157  PRO B CB    1 
ATOM   5727  C  CG    . PRO B 2  173 ? 9.249   -23.718 162.067 1.00 87.30  ? 157  PRO B CG    1 
ATOM   5728  C  CD    . PRO B 2  173 ? 9.830   -22.470 161.482 1.00 85.20  ? 157  PRO B CD    1 
ATOM   5729  N  N     . ALA B 2  174 ? 9.402   -24.965 158.942 1.00 91.32  ? 158  ALA B N     1 
ATOM   5730  C  CA    . ALA B 2  174 ? 8.905   -25.623 157.737 1.00 94.38  ? 158  ALA B CA    1 
ATOM   5731  C  C     . ALA B 2  174 ? 9.962   -25.661 156.637 1.00 103.72 ? 158  ALA B C     1 
ATOM   5732  O  O     . ALA B 2  174 ? 10.352  -26.732 156.158 1.00 111.08 ? 158  ALA B O     1 
ATOM   5733  C  CB    . ALA B 2  174 ? 7.640   -24.916 157.245 1.00 95.39  ? 158  ALA B CB    1 
ATOM   5734  N  N     . ILE B 2  175 ? 10.430  -24.482 156.223 1.00 90.67  ? 159  ILE B N     1 
ATOM   5735  C  CA    . ILE B 2  175 ? 11.372  -24.376 155.114 1.00 87.89  ? 159  ILE B CA    1 
ATOM   5736  C  C     . ILE B 2  175 ? 12.729  -24.971 155.478 1.00 86.04  ? 159  ILE B C     1 
ATOM   5737  O  O     . ILE B 2  175 ? 13.423  -25.523 154.615 1.00 96.65  ? 159  ILE B O     1 
ATOM   5738  C  CB    . ILE B 2  175 ? 11.482  -22.900 154.683 1.00 82.98  ? 159  ILE B CB    1 
ATOM   5739  C  CG1   . ILE B 2  175 ? 10.237  -22.488 153.893 1.00 86.19  ? 159  ILE B CG1   1 
ATOM   5740  C  CG2   . ILE B 2  175 ? 12.741  -22.649 153.866 1.00 83.01  ? 159  ILE B CG2   1 
ATOM   5741  C  CD1   . ILE B 2  175 ? 10.119  -20.997 153.667 1.00 88.41  ? 159  ILE B CD1   1 
ATOM   5742  N  N     . PHE B 2  176 ? 13.110  -24.922 156.753 1.00 85.75  ? 160  PHE B N     1 
ATOM   5743  C  CA    . PHE B 2  176 ? 14.404  -25.443 157.174 1.00 85.98  ? 160  PHE B CA    1 
ATOM   5744  C  C     . PHE B 2  176 ? 14.390  -26.944 157.443 1.00 99.04  ? 160  PHE B C     1 
ATOM   5745  O  O     . PHE B 2  176 ? 15.464  -27.529 157.616 1.00 105.83 ? 160  PHE B O     1 
ATOM   5746  C  CB    . PHE B 2  176 ? 14.867  -24.684 158.424 1.00 85.54  ? 160  PHE B CB    1 
ATOM   5747  C  CG    . PHE B 2  176 ? 16.302  -24.925 158.799 1.00 88.39  ? 160  PHE B CG    1 
ATOM   5748  C  CD1   . PHE B 2  176 ? 17.315  -24.179 158.221 1.00 94.31  ? 160  PHE B CD1   1 
ATOM   5749  C  CD2   . PHE B 2  176 ? 16.634  -25.862 159.763 1.00 95.84  ? 160  PHE B CD2   1 
ATOM   5750  C  CE1   . PHE B 2  176 ? 18.636  -24.388 158.570 1.00 89.23  ? 160  PHE B CE1   1 
ATOM   5751  C  CE2   . PHE B 2  176 ? 17.953  -26.076 160.116 1.00 102.08 ? 160  PHE B CE2   1 
ATOM   5752  C  CZ    . PHE B 2  176 ? 18.955  -25.335 159.519 1.00 92.51  ? 160  PHE B CZ    1 
ATOM   5753  N  N     . GLN B 2  177 ? 13.210  -27.573 157.481 1.00 103.07 ? 161  GLN B N     1 
ATOM   5754  C  CA    . GLN B 2  177 ? 13.104  -28.984 157.854 1.00 107.94 ? 161  GLN B CA    1 
ATOM   5755  C  C     . GLN B 2  177 ? 14.077  -29.865 157.078 1.00 112.47 ? 161  GLN B C     1 
ATOM   5756  O  O     . GLN B 2  177 ? 14.728  -30.745 157.655 1.00 109.83 ? 161  GLN B O     1 
ATOM   5757  C  CB    . GLN B 2  177 ? 11.679  -29.490 157.642 1.00 105.38 ? 161  GLN B CB    1 
ATOM   5758  C  CG    . GLN B 2  177 ? 11.363  -30.711 158.481 1.00 106.06 ? 161  GLN B CG    1 
ATOM   5759  C  CD    . GLN B 2  177 ? 9.913   -31.118 158.393 1.00 120.25 ? 161  GLN B CD    1 
ATOM   5760  O  OE1   . GLN B 2  177 ? 9.502   -32.119 158.979 1.00 128.08 ? 161  GLN B OE1   1 
ATOM   5761  N  NE2   . GLN B 2  177 ? 9.129   -30.350 157.646 1.00 119.83 ? 161  GLN B NE2   1 
ATOM   5762  N  N     . SER B 2  178 ? 14.158  -29.664 155.758 1.00 117.16 ? 162  SER B N     1 
ATOM   5763  C  CA    . SER B 2  178 ? 15.058  -30.455 154.922 1.00 116.70 ? 162  SER B CA    1 
ATOM   5764  C  C     . SER B 2  178 ? 16.479  -30.441 155.471 1.00 115.96 ? 162  SER B C     1 
ATOM   5765  O  O     . SER B 2  178 ? 17.069  -31.495 155.732 1.00 120.15 ? 162  SER B O     1 
ATOM   5766  C  CB    . SER B 2  178 ? 15.023  -29.934 153.484 1.00 115.45 ? 162  SER B CB    1 
ATOM   5767  O  OG    . SER B 2  178 ? 15.438  -28.581 153.419 1.00 112.39 ? 162  SER B OG    1 
ATOM   5768  N  N     . SER B 2  179 ? 17.054  -29.247 155.637 1.00 112.94 ? 163  SER B N     1 
ATOM   5769  C  CA    . SER B 2  179 ? 18.406  -29.164 156.175 1.00 108.09 ? 163  SER B CA    1 
ATOM   5770  C  C     . SER B 2  179 ? 18.476  -29.747 157.580 1.00 107.68 ? 163  SER B C     1 
ATOM   5771  O  O     . SER B 2  179 ? 19.473  -30.378 157.941 1.00 105.83 ? 163  SER B O     1 
ATOM   5772  C  CB    . SER B 2  179 ? 18.897  -27.714 156.171 1.00 97.37  ? 163  SER B CB    1 
ATOM   5773  O  OG    . SER B 2  179 ? 18.317  -26.978 155.108 1.00 97.05  ? 163  SER B OG    1 
ATOM   5774  N  N     . MET B 2  180 ? 17.412  -29.577 158.369 1.00 109.93 ? 164  MET B N     1 
ATOM   5775  C  CA    . MET B 2  180 ? 17.424  -30.013 159.763 1.00 111.57 ? 164  MET B CA    1 
ATOM   5776  C  C     . MET B 2  180 ? 17.445  -31.532 159.876 1.00 112.94 ? 164  MET B C     1 
ATOM   5777  O  O     . MET B 2  180 ? 18.200  -32.095 160.680 1.00 108.37 ? 164  MET B O     1 
ATOM   5778  C  CB    . MET B 2  180 ? 16.218  -29.441 160.505 1.00 102.46 ? 164  MET B CB    1 
ATOM   5779  C  CG    . MET B 2  180 ? 16.261  -29.729 161.987 1.00 96.16  ? 164  MET B CG    1 
ATOM   5780  S  SD    . MET B 2  180 ? 17.488  -28.659 162.759 1.00 91.51  ? 164  MET B SD    1 
ATOM   5781  C  CE    . MET B 2  180 ? 17.902  -29.595 164.222 1.00 96.71  ? 164  MET B CE    1 
ATOM   5782  N  N     . THR B 2  181 ? 16.609  -32.212 159.090 1.00 112.05 ? 165  THR B N     1 
ATOM   5783  C  CA    . THR B 2  181 ? 16.604  -33.672 159.097 1.00 110.41 ? 165  THR B CA    1 
ATOM   5784  C  C     . THR B 2  181 ? 17.953  -34.228 158.656 1.00 117.92 ? 165  THR B C     1 
ATOM   5785  O  O     . THR B 2  181 ? 18.468  -35.175 159.262 1.00 124.27 ? 165  THR B O     1 
ATOM   5786  C  CB    . THR B 2  181 ? 15.480  -34.196 158.205 1.00 111.28 ? 165  THR B CB    1 
ATOM   5787  O  OG1   . THR B 2  181 ? 15.616  -33.646 156.889 1.00 116.13 ? 165  THR B OG1   1 
ATOM   5788  C  CG2   . THR B 2  181 ? 14.121  -33.806 158.775 1.00 111.79 ? 165  THR B CG2   1 
ATOM   5789  N  N     . LYS B 2  182 ? 18.534  -33.658 157.597 1.00 116.72 ? 166  LYS B N     1 
ATOM   5790  C  CA    . LYS B 2  182 ? 19.854  -34.090 157.144 1.00 116.66 ? 166  LYS B CA    1 
ATOM   5791  C  C     . LYS B 2  182 ? 20.902  -33.934 158.243 1.00 113.24 ? 166  LYS B C     1 
ATOM   5792  O  O     . LYS B 2  182 ? 21.780  -34.791 158.397 1.00 122.18 ? 166  LYS B O     1 
ATOM   5793  C  CB    . LYS B 2  182 ? 20.272  -33.298 155.904 1.00 120.73 ? 166  LYS B CB    1 
ATOM   5794  C  CG    . LYS B 2  182 ? 19.655  -33.773 154.598 1.00 120.42 ? 166  LYS B CG    1 
ATOM   5795  C  CD    . LYS B 2  182 ? 19.885  -32.751 153.492 1.00 120.32 ? 166  LYS B CD    1 
ATOM   5796  C  CE    . LYS B 2  182 ? 19.060  -33.066 152.255 1.00 124.56 ? 166  LYS B CE    1 
ATOM   5797  N  NZ    . LYS B 2  182 ? 18.854  -31.859 151.406 1.00 119.17 ? 166  LYS B NZ    1 
ATOM   5798  N  N     . ILE B 2  183 ? 20.824  -32.851 159.020 1.00 113.72 ? 167  ILE B N     1 
ATOM   5799  C  CA    . ILE B 2  183 ? 21.822  -32.611 160.061 1.00 111.00 ? 167  ILE B CA    1 
ATOM   5800  C  C     . ILE B 2  183 ? 21.682  -33.624 161.191 1.00 118.75 ? 167  ILE B C     1 
ATOM   5801  O  O     . ILE B 2  183 ? 22.682  -34.138 161.706 1.00 117.01 ? 167  ILE B O     1 
ATOM   5802  C  CB    . ILE B 2  183 ? 21.716  -31.169 160.591 1.00 105.05 ? 167  ILE B CB    1 
ATOM   5803  C  CG1   . ILE B 2  183 ? 22.024  -30.157 159.490 1.00 108.05 ? 167  ILE B CG1   1 
ATOM   5804  C  CG2   . ILE B 2  183 ? 22.661  -30.960 161.765 1.00 106.36 ? 167  ILE B CG2   1 
ATOM   5805  C  CD1   . ILE B 2  183 ? 21.897  -28.723 159.943 1.00 113.51 ? 167  ILE B CD1   1 
ATOM   5806  N  N     . LEU B 2  184 ? 20.449  -33.940 161.589 1.00 116.22 ? 168  LEU B N     1 
ATOM   5807  C  CA    . LEU B 2  184 ? 20.259  -34.824 162.731 1.00 126.68 ? 168  LEU B CA    1 
ATOM   5808  C  C     . LEU B 2  184 ? 20.372  -36.297 162.366 1.00 137.77 ? 168  LEU B C     1 
ATOM   5809  O  O     . LEU B 2  184 ? 20.518  -37.129 163.268 1.00 140.42 ? 168  LEU B O     1 
ATOM   5810  C  CB    . LEU B 2  184 ? 18.891  -34.577 163.372 1.00 126.17 ? 168  LEU B CB    1 
ATOM   5811  C  CG    . LEU B 2  184 ? 18.572  -33.178 163.895 1.00 109.79 ? 168  LEU B CG    1 
ATOM   5812  C  CD1   . LEU B 2  184 ? 17.088  -33.076 164.215 1.00 101.90 ? 168  LEU B CD1   1 
ATOM   5813  C  CD2   . LEU B 2  184 ? 19.415  -32.853 165.118 1.00 100.44 ? 168  LEU B CD2   1 
ATOM   5814  N  N     . GLU B 2  185 ? 20.281  -36.633 161.076 1.00 155.78 ? 169  GLU B N     1 
ATOM   5815  C  CA    . GLU B 2  185 ? 20.324  -38.023 160.613 1.00 161.29 ? 169  GLU B CA    1 
ATOM   5816  C  C     . GLU B 2  185 ? 21.374  -38.899 161.291 1.00 162.82 ? 169  GLU B C     1 
ATOM   5817  O  O     . GLU B 2  185 ? 21.013  -39.991 161.752 1.00 163.89 ? 169  GLU B O     1 
ATOM   5818  C  CB    . GLU B 2  185 ? 20.501  -38.044 159.087 1.00 164.81 ? 169  GLU B CB    1 
ATOM   5819  C  CG    . GLU B 2  185 ? 19.258  -38.520 158.364 1.00 171.61 ? 169  GLU B CG    1 
ATOM   5820  C  CD    . GLU B 2  185 ? 18.715  -39.808 158.956 1.00 173.20 ? 169  GLU B CD    1 
ATOM   5821  O  OE1   . GLU B 2  185 ? 19.527  -40.705 159.268 1.00 176.36 ? 169  GLU B OE1   1 
ATOM   5822  O  OE2   . GLU B 2  185 ? 17.483  -39.919 159.128 1.00 168.35 ? 169  GLU B OE2   1 
ATOM   5823  N  N     . PRO B 2  186 ? 22.665  -38.513 161.380 1.00 145.16 ? 170  PRO B N     1 
ATOM   5824  C  CA    . PRO B 2  186 ? 23.641  -39.393 162.043 1.00 144.10 ? 170  PRO B CA    1 
ATOM   5825  C  C     . PRO B 2  186 ? 23.299  -39.676 163.497 1.00 139.98 ? 170  PRO B C     1 
ATOM   5826  O  O     . PRO B 2  186 ? 23.188  -40.838 163.901 1.00 140.18 ? 170  PRO B O     1 
ATOM   5827  C  CB    . PRO B 2  186 ? 24.957  -38.611 161.923 1.00 141.21 ? 170  PRO B CB    1 
ATOM   5828  C  CG    . PRO B 2  186 ? 24.745  -37.678 160.784 1.00 140.18 ? 170  PRO B CG    1 
ATOM   5829  C  CD    . PRO B 2  186 ? 23.307  -37.287 160.875 1.00 137.37 ? 170  PRO B CD    1 
ATOM   5830  N  N     . PHE B 2  187 ? 23.175  -38.609 164.292 1.00 141.55 ? 171  PHE B N     1 
ATOM   5831  C  CA    . PHE B 2  187 ? 22.831  -38.741 165.706 1.00 134.21 ? 171  PHE B CA    1 
ATOM   5832  C  C     . PHE B 2  187 ? 21.615  -39.640 165.912 1.00 139.41 ? 171  PHE B C     1 
ATOM   5833  O  O     . PHE B 2  187 ? 21.604  -40.486 166.814 1.00 134.40 ? 171  PHE B O     1 
ATOM   5834  C  CB    . PHE B 2  187 ? 22.587  -37.357 166.311 1.00 123.52 ? 171  PHE B CB    1 
ATOM   5835  C  CG    . PHE B 2  187 ? 22.322  -37.378 167.790 1.00 121.67 ? 171  PHE B CG    1 
ATOM   5836  C  CD1   . PHE B 2  187 ? 23.375  -37.417 168.690 1.00 117.23 ? 171  PHE B CD1   1 
ATOM   5837  C  CD2   . PHE B 2  187 ? 21.027  -37.361 168.281 1.00 119.09 ? 171  PHE B CD2   1 
ATOM   5838  C  CE1   . PHE B 2  187 ? 23.144  -37.435 170.052 1.00 111.68 ? 171  PHE B CE1   1 
ATOM   5839  C  CE2   . PHE B 2  187 ? 20.790  -37.380 169.643 1.00 119.96 ? 171  PHE B CE2   1 
ATOM   5840  C  CZ    . PHE B 2  187 ? 21.851  -37.418 170.530 1.00 112.39 ? 171  PHE B CZ    1 
ATOM   5841  N  N     . LYS B 2  188 ? 20.573  -39.454 165.095 1.00 135.07 ? 172  LYS B N     1 
ATOM   5842  C  CA    . LYS B 2  188 ? 19.370  -40.276 165.207 1.00 137.18 ? 172  LYS B CA    1 
ATOM   5843  C  C     . LYS B 2  188 ? 19.682  -41.757 165.021 1.00 142.54 ? 172  LYS B C     1 
ATOM   5844  O  O     . LYS B 2  188 ? 19.285  -42.595 165.837 1.00 133.85 ? 172  LYS B O     1 
ATOM   5845  C  CB    . LYS B 2  188 ? 18.332  -39.826 164.175 1.00 138.31 ? 172  LYS B CB    1 
ATOM   5846  C  CG    . LYS B 2  188 ? 17.580  -38.547 164.515 1.00 131.01 ? 172  LYS B CG    1 
ATOM   5847  C  CD    . LYS B 2  188 ? 16.394  -38.352 163.574 1.00 129.52 ? 172  LYS B CD    1 
ATOM   5848  C  CE    . LYS B 2  188 ? 15.613  -37.087 163.901 1.00 119.49 ? 172  LYS B CE    1 
ATOM   5849  N  NZ    . LYS B 2  188 ? 14.383  -36.953 163.069 1.00 113.43 ? 172  LYS B NZ    1 
ATOM   5850  N  N     . LYS B 2  189 ? 20.389  -42.095 163.941 1.00 155.08 ? 173  LYS B N     1 
ATOM   5851  C  CA    . LYS B 2  189 ? 20.732  -43.489 163.666 1.00 156.07 ? 173  LYS B CA    1 
ATOM   5852  C  C     . LYS B 2  189 ? 21.600  -44.096 164.762 1.00 156.10 ? 173  LYS B C     1 
ATOM   5853  O  O     . LYS B 2  189 ? 21.399  -45.253 165.150 1.00 152.81 ? 173  LYS B O     1 
ATOM   5854  C  CB    . LYS B 2  189 ? 21.399  -43.600 162.295 1.00 156.79 ? 173  LYS B CB    1 
ATOM   5855  C  CG    . LYS B 2  189 ? 20.456  -43.254 161.144 1.00 160.43 ? 173  LYS B CG    1 
ATOM   5856  C  CD    . LYS B 2  189 ? 19.014  -43.642 161.489 1.00 163.11 ? 173  LYS B CD    1 
ATOM   5857  C  CE    . LYS B 2  189 ? 18.010  -43.141 160.465 1.00 162.42 ? 173  LYS B CE    1 
ATOM   5858  N  NZ    . LYS B 2  189 ? 18.476  -43.357 159.069 1.00 168.20 ? 173  LYS B NZ    1 
ATOM   5859  N  N     . GLN B 2  190 ? 22.586  -43.345 165.256 1.00 140.86 ? 174  GLN B N     1 
ATOM   5860  C  CA    . GLN B 2  190 ? 23.400  -43.830 166.367 1.00 137.66 ? 174  GLN B CA    1 
ATOM   5861  C  C     . GLN B 2  190 ? 22.551  -44.116 167.604 1.00 140.47 ? 174  GLN B C     1 
ATOM   5862  O  O     . GLN B 2  190 ? 22.687  -45.174 168.230 1.00 140.83 ? 174  GLN B O     1 
ATOM   5863  C  CB    . GLN B 2  190 ? 24.509  -42.826 166.688 1.00 135.91 ? 174  GLN B CB    1 
ATOM   5864  C  CG    . GLN B 2  190 ? 25.544  -42.675 165.581 1.00 143.18 ? 174  GLN B CG    1 
ATOM   5865  C  CD    . GLN B 2  190 ? 26.876  -42.146 166.084 1.00 144.84 ? 174  GLN B CD    1 
ATOM   5866  O  OE1   . GLN B 2  190 ? 27.207  -42.279 167.263 1.00 142.17 ? 174  GLN B OE1   1 
ATOM   5867  N  NE2   . GLN B 2  190 ? 27.650  -41.545 165.188 1.00 139.42 ? 174  GLN B NE2   1 
ATOM   5868  N  N     . ASN B 2  191 ? 21.671  -43.183 167.979 1.00 135.78 ? 175  ASN B N     1 
ATOM   5869  C  CA    . ASN B 2  191 ? 20.810  -43.318 169.156 1.00 129.74 ? 175  ASN B CA    1 
ATOM   5870  C  C     . ASN B 2  191 ? 19.344  -43.380 168.741 1.00 127.80 ? 175  ASN B C     1 
ATOM   5871  O  O     . ASN B 2  191 ? 18.601  -42.399 168.899 1.00 127.63 ? 175  ASN B O     1 
ATOM   5872  C  CB    . ASN B 2  191 ? 21.050  -42.172 170.135 1.00 127.92 ? 175  ASN B CB    1 
ATOM   5873  C  CG    . ASN B 2  191 ? 22.520  -41.915 170.368 1.00 129.85 ? 175  ASN B CG    1 
ATOM   5874  O  OD1   . ASN B 2  191 ? 23.006  -40.799 170.185 1.00 129.19 ? 175  ASN B OD1   1 
ATOM   5875  N  ND2   . ASN B 2  191 ? 23.244  -42.956 170.759 1.00 133.59 ? 175  ASN B ND2   1 
ATOM   5876  N  N     . PRO B 2  192 ? 18.889  -44.518 168.206 1.00 132.27 ? 176  PRO B N     1 
ATOM   5877  C  CA    . PRO B 2  192 ? 17.539  -44.571 167.623 1.00 130.54 ? 176  PRO B CA    1 
ATOM   5878  C  C     . PRO B 2  192 ? 16.412  -44.561 168.645 1.00 125.23 ? 176  PRO B C     1 
ATOM   5879  O  O     . PRO B 2  192 ? 15.245  -44.487 168.241 1.00 120.59 ? 176  PRO B O     1 
ATOM   5880  C  CB    . PRO B 2  192 ? 17.562  -45.888 166.846 1.00 122.54 ? 176  PRO B CB    1 
ATOM   5881  C  CG    . PRO B 2  192 ? 18.429  -46.761 167.698 1.00 120.85 ? 176  PRO B CG    1 
ATOM   5882  C  CD    . PRO B 2  192 ? 19.517  -45.850 168.241 1.00 129.80 ? 176  PRO B CD    1 
ATOM   5883  N  N     . ASP B 2  193 ? 16.711  -44.638 169.941 1.00 124.97 ? 177  ASP B N     1 
ATOM   5884  C  CA    . ASP B 2  193 ? 15.665  -44.620 170.955 1.00 122.72 ? 177  ASP B CA    1 
ATOM   5885  C  C     . ASP B 2  193 ? 15.225  -43.210 171.325 1.00 118.68 ? 177  ASP B C     1 
ATOM   5886  O  O     . ASP B 2  193 ? 14.176  -43.051 171.959 1.00 120.27 ? 177  ASP B O     1 
ATOM   5887  C  CB    . ASP B 2  193 ? 16.136  -45.355 172.212 1.00 126.97 ? 177  ASP B CB    1 
ATOM   5888  C  CG    . ASP B 2  193 ? 15.632  -46.782 172.274 1.00 128.70 ? 177  ASP B CG    1 
ATOM   5889  O  OD1   . ASP B 2  193 ? 14.793  -47.153 171.428 1.00 127.14 ? 177  ASP B OD1   1 
ATOM   5890  O  OD2   . ASP B 2  193 ? 16.072  -47.531 173.171 1.00 131.77 ? 177  ASP B OD2   1 
ATOM   5891  N  N     . ILE B 2  194 ? 15.996  -42.198 170.949 1.00 115.39 ? 178  ILE B N     1 
ATOM   5892  C  CA    . ILE B 2  194 ? 15.758  -40.820 171.361 1.00 104.61 ? 178  ILE B CA    1 
ATOM   5893  C  C     . ILE B 2  194 ? 14.769  -40.154 170.414 1.00 107.88 ? 178  ILE B C     1 
ATOM   5894  O  O     . ILE B 2  194 ? 14.930  -40.210 169.189 1.00 99.44  ? 178  ILE B O     1 
ATOM   5895  C  CB    . ILE B 2  194 ? 17.078  -40.036 171.417 1.00 97.87  ? 178  ILE B CB    1 
ATOM   5896  C  CG1   . ILE B 2  194 ? 17.984  -40.603 172.510 1.00 99.69  ? 178  ILE B CG1   1 
ATOM   5897  C  CG2   . ILE B 2  194 ? 16.815  -38.561 171.636 1.00 88.66  ? 178  ILE B CG2   1 
ATOM   5898  C  CD1   . ILE B 2  194 ? 19.261  -39.824 172.697 1.00 105.39 ? 178  ILE B CD1   1 
ATOM   5899  N  N     . VAL B 2  195 ? 13.735  -39.531 170.982 1.00 96.32  ? 179  VAL B N     1 
ATOM   5900  C  CA    . VAL B 2  195 ? 12.721  -38.831 170.202 1.00 89.93  ? 179  VAL B CA    1 
ATOM   5901  C  C     . VAL B 2  195 ? 13.149  -37.378 170.047 1.00 86.09  ? 179  VAL B C     1 
ATOM   5902  O  O     . VAL B 2  195 ? 13.616  -36.748 171.005 1.00 82.69  ? 179  VAL B O     1 
ATOM   5903  C  CB    . VAL B 2  195 ? 11.343  -38.936 170.880 1.00 85.32  ? 179  VAL B CB    1 
ATOM   5904  C  CG1   . VAL B 2  195 ? 10.259  -38.371 169.977 1.00 79.39  ? 179  VAL B CG1   1 
ATOM   5905  C  CG2   . VAL B 2  195 ? 11.043  -40.380 171.244 1.00 93.55  ? 179  VAL B CG2   1 
ATOM   5906  N  N     . ILE B 2  196 ? 12.983  -36.837 168.841 1.00 83.48  ? 180  ILE B N     1 
ATOM   5907  C  CA    . ILE B 2  196 ? 13.305  -35.445 168.550 1.00 81.45  ? 180  ILE B CA    1 
ATOM   5908  C  C     . ILE B 2  196 ? 12.124  -34.811 167.827 1.00 87.68  ? 180  ILE B C     1 
ATOM   5909  O  O     . ILE B 2  196 ? 11.665  -35.331 166.803 1.00 86.40  ? 180  ILE B O     1 
ATOM   5910  C  CB    . ILE B 2  196 ? 14.589  -35.313 167.708 1.00 86.91  ? 180  ILE B CB    1 
ATOM   5911  C  CG1   . ILE B 2  196 ? 15.792  -35.864 168.476 1.00 85.15  ? 180  ILE B CG1   1 
ATOM   5912  C  CG2   . ILE B 2  196 ? 14.828  -33.861 167.316 1.00 83.53  ? 180  ILE B CG2   1 
ATOM   5913  C  CD1   . ILE B 2  196 ? 17.112  -35.666 167.762 1.00 99.87  ? 180  ILE B CD1   1 
ATOM   5914  N  N     . TYR B 2  197 ? 11.626  -33.700 168.368 1.00 82.36  ? 181  TYR B N     1 
ATOM   5915  C  CA    . TYR B 2  197 ? 10.506  -32.973 167.792 1.00 81.13  ? 181  TYR B CA    1 
ATOM   5916  C  C     . TYR B 2  197 ? 10.917  -31.517 167.622 1.00 81.77  ? 181  TYR B C     1 
ATOM   5917  O  O     . TYR B 2  197 ? 11.540  -30.936 168.517 1.00 71.07  ? 181  TYR B O     1 
ATOM   5918  C  CB    . TYR B 2  197 ? 9.256   -33.070 168.674 1.00 82.91  ? 181  TYR B CB    1 
ATOM   5919  C  CG    . TYR B 2  197 ? 8.070   -32.289 168.153 1.00 81.15  ? 181  TYR B CG    1 
ATOM   5920  C  CD1   . TYR B 2  197 ? 7.612   -32.479 166.856 1.00 83.51  ? 181  TYR B CD1   1 
ATOM   5921  C  CD2   . TYR B 2  197 ? 7.406   -31.367 168.954 1.00 82.48  ? 181  TYR B CD2   1 
ATOM   5922  C  CE1   . TYR B 2  197 ? 6.526   -31.779 166.370 1.00 88.51  ? 181  TYR B CE1   1 
ATOM   5923  C  CE2   . TYR B 2  197 ? 6.316   -30.658 168.473 1.00 78.44  ? 181  TYR B CE2   1 
ATOM   5924  C  CZ    . TYR B 2  197 ? 5.883   -30.870 167.180 1.00 81.63  ? 181  TYR B CZ    1 
ATOM   5925  O  OH    . TYR B 2  197 ? 4.802   -30.175 166.690 1.00 82.63  ? 181  TYR B OH    1 
ATOM   5926  N  N     . GLN B 2  198 ? 10.606  -30.940 166.465 1.00 84.40  ? 182  GLN B N     1 
ATOM   5927  C  CA    . GLN B 2  198 ? 10.913  -29.542 166.184 1.00 82.91  ? 182  GLN B CA    1 
ATOM   5928  C  C     . GLN B 2  198 ? 9.628   -28.726 166.261 1.00 80.94  ? 182  GLN B C     1 
ATOM   5929  O  O     . GLN B 2  198 ? 8.665   -29.015 165.543 1.00 84.24  ? 182  GLN B O     1 
ATOM   5930  C  CB    . GLN B 2  198 ? 11.571  -29.413 164.808 1.00 89.80  ? 182  GLN B CB    1 
ATOM   5931  C  CG    . GLN B 2  198 ? 12.379  -28.142 164.597 1.00 93.52  ? 182  GLN B CG    1 
ATOM   5932  C  CD    . GLN B 2  198 ? 12.699  -27.893 163.135 1.00 92.07  ? 182  GLN B CD    1 
ATOM   5933  O  OE1   . GLN B 2  198 ? 12.515  -28.770 162.291 1.00 95.79  ? 182  GLN B OE1   1 
ATOM   5934  N  NE2   . GLN B 2  198 ? 13.192  -26.698 162.830 1.00 88.78  ? 182  GLN B NE2   1 
ATOM   5935  N  N     . TYR B 2  199 ? 9.607   -27.719 167.137 1.00 77.35  ? 183  TYR B N     1 
ATOM   5936  C  CA    . TYR B 2  199 ? 8.507   -26.760 167.193 1.00 71.47  ? 183  TYR B CA    1 
ATOM   5937  C  C     . TYR B 2  199 ? 9.062   -25.343 167.186 1.00 67.06  ? 183  TYR B C     1 
ATOM   5938  O  O     . TYR B 2  199 ? 9.793   -24.961 168.106 1.00 76.35  ? 183  TYR B O     1 
ATOM   5939  C  CB    . TYR B 2  199 ? 7.630   -26.964 168.432 1.00 80.28  ? 183  TYR B CB    1 
ATOM   5940  C  CG    . TYR B 2  199 ? 6.340   -26.173 168.356 1.00 74.25  ? 183  TYR B CG    1 
ATOM   5941  C  CD1   . TYR B 2  199 ? 5.270   -26.644 167.610 1.00 67.43  ? 183  TYR B CD1   1 
ATOM   5942  C  CD2   . TYR B 2  199 ? 6.206   -24.940 168.986 1.00 67.00  ? 183  TYR B CD2   1 
ATOM   5943  C  CE1   . TYR B 2  199 ? 4.093   -25.933 167.515 1.00 74.32  ? 183  TYR B CE1   1 
ATOM   5944  C  CE2   . TYR B 2  199 ? 5.027   -24.213 168.892 1.00 70.59  ? 183  TYR B CE2   1 
ATOM   5945  C  CZ    . TYR B 2  199 ? 3.973   -24.719 168.153 1.00 78.77  ? 183  TYR B CZ    1 
ATOM   5946  O  OH    . TYR B 2  199 ? 2.791   -24.021 168.039 1.00 74.02  ? 183  TYR B OH    1 
ATOM   5947  N  N     . MET B 2  200 ? 8.711   -24.569 166.160 1.00 76.28  ? 184  MET B N     1 
ATOM   5948  C  CA    . MET B 2  200 ? 9.241   -23.222 165.969 1.00 81.13  ? 184  MET B CA    1 
ATOM   5949  C  C     . MET B 2  200 ? 10.758  -23.144 166.085 1.00 83.22  ? 184  MET B C     1 
ATOM   5950  O  O     . MET B 2  200 ? 11.478  -23.796 165.324 1.00 91.57  ? 184  MET B O     1 
ATOM   5951  C  CB    . MET B 2  200 ? 8.597   -22.253 166.963 1.00 82.17  ? 184  MET B CB    1 
ATOM   5952  C  CG    . MET B 2  200 ? 7.084   -22.203 166.881 1.00 80.97  ? 184  MET B CG    1 
ATOM   5953  S  SD    . MET B 2  200 ? 6.518   -21.583 165.288 1.00 89.18  ? 184  MET B SD    1 
ATOM   5954  C  CE    . MET B 2  200 ? 7.636   -20.207 165.040 1.00 82.74  ? 184  MET B CE    1 
ATOM   5955  N  N     . ASP B 2  201 ? 11.250  -22.351 167.038 1.00 73.89  ? 185  ASP B N     1 
ATOM   5956  C  CA    . ASP B 2  201 ? 12.681  -22.168 167.246 1.00 65.91  ? 185  ASP B CA    1 
ATOM   5957  C  C     . ASP B 2  201 ? 13.280  -23.188 168.206 1.00 68.09  ? 185  ASP B C     1 
ATOM   5958  O  O     . ASP B 2  201 ? 14.456  -23.065 168.559 1.00 75.79  ? 185  ASP B O     1 
ATOM   5959  C  CB    . ASP B 2  201 ? 12.965  -20.766 167.798 1.00 50.85  ? 185  ASP B CB    1 
ATOM   5960  C  CG    . ASP B 2  201 ? 12.416  -19.661 166.918 1.00 59.53  ? 185  ASP B CG    1 
ATOM   5961  O  OD1   . ASP B 2  201 ? 11.983  -19.951 165.784 1.00 69.69  ? 185  ASP B OD1   1 
ATOM   5962  O  OD2   . ASP B 2  201 ? 12.423  -18.494 167.365 1.00 55.87  ? 185  ASP B OD2   1 
ATOM   5963  N  N     . ASP B 2  202 ? 12.510  -24.176 168.646 1.00 71.91  ? 186  ASP B N     1 
ATOM   5964  C  CA    . ASP B 2  202 ? 12.948  -25.079 169.699 1.00 76.68  ? 186  ASP B CA    1 
ATOM   5965  C  C     . ASP B 2  202 ? 13.059  -26.516 169.203 1.00 77.56  ? 186  ASP B C     1 
ATOM   5966  O  O     . ASP B 2  202 ? 12.349  -26.933 168.282 1.00 75.26  ? 186  ASP B O     1 
ATOM   5967  C  CB    . ASP B 2  202 ? 11.994  -25.006 170.894 1.00 77.02  ? 186  ASP B CB    1 
ATOM   5968  C  CG    . ASP B 2  202 ? 12.106  -23.690 171.641 1.00 80.64  ? 186  ASP B CG    1 
ATOM   5969  O  OD1   . ASP B 2  202 ? 13.241  -23.192 171.811 1.00 75.60  ? 186  ASP B OD1   1 
ATOM   5970  O  OD2   . ASP B 2  202 ? 11.054  -23.143 172.039 1.00 83.10  ? 186  ASP B OD2   1 
ATOM   5971  N  N     . LEU B 2  203 ? 13.975  -27.265 169.819 1.00 75.78  ? 187  LEU B N     1 
ATOM   5972  C  CA    . LEU B 2  203 ? 14.131  -28.696 169.580 1.00 75.51  ? 187  LEU B CA    1 
ATOM   5973  C  C     . LEU B 2  203 ? 13.840  -29.440 170.875 1.00 73.91  ? 187  LEU B C     1 
ATOM   5974  O  O     . LEU B 2  203 ? 14.463  -29.165 171.906 1.00 70.32  ? 187  LEU B O     1 
ATOM   5975  C  CB    . LEU B 2  203 ? 15.540  -29.032 169.088 1.00 79.14  ? 187  LEU B CB    1 
ATOM   5976  C  CG    . LEU B 2  203 ? 15.663  -30.026 167.930 1.00 77.43  ? 187  LEU B CG    1 
ATOM   5977  C  CD1   . LEU B 2  203 ? 14.994  -29.501 166.669 1.00 83.73  ? 187  LEU B CD1   1 
ATOM   5978  C  CD2   . LEU B 2  203 ? 17.124  -30.363 167.675 1.00 91.44  ? 187  LEU B CD2   1 
ATOM   5979  N  N     . TYR B 2  204 ? 12.891  -30.369 170.822 1.00 67.14  ? 188  TYR B N     1 
ATOM   5980  C  CA    . TYR B 2  204 ? 12.499  -31.166 171.980 1.00 79.12  ? 188  TYR B CA    1 
ATOM   5981  C  C     . TYR B 2  204 ? 13.131  -32.546 171.830 1.00 76.91  ? 188  TYR B C     1 
ATOM   5982  O  O     . TYR B 2  204 ? 12.784  -33.297 170.913 1.00 80.84  ? 188  TYR B O     1 
ATOM   5983  C  CB    . TYR B 2  204 ? 10.976  -31.232 172.097 1.00 76.73  ? 188  TYR B CB    1 
ATOM   5984  C  CG    . TYR B 2  204 ? 10.364  -29.885 172.434 1.00 75.98  ? 188  TYR B CG    1 
ATOM   5985  C  CD1   . TYR B 2  204 ? 10.197  -28.914 171.453 1.00 77.38  ? 188  TYR B CD1   1 
ATOM   5986  C  CD2   . TYR B 2  204 ? 9.967   -29.579 173.731 1.00 71.05  ? 188  TYR B CD2   1 
ATOM   5987  C  CE1   . TYR B 2  204 ? 9.651   -27.679 171.749 1.00 76.49  ? 188  TYR B CE1   1 
ATOM   5988  C  CE2   . TYR B 2  204 ? 9.415   -28.344 174.036 1.00 66.29  ? 188  TYR B CE2   1 
ATOM   5989  C  CZ    . TYR B 2  204 ? 9.263   -27.398 173.040 1.00 73.27  ? 188  TYR B CZ    1 
ATOM   5990  O  OH    . TYR B 2  204 ? 8.723   -26.165 173.330 1.00 62.88  ? 188  TYR B OH    1 
ATOM   5991  N  N     . VAL B 2  205 ? 14.074  -32.869 172.712 1.00 73.61  ? 189  VAL B N     1 
ATOM   5992  C  CA    . VAL B 2  205 ? 14.843  -34.106 172.627 1.00 78.05  ? 189  VAL B CA    1 
ATOM   5993  C  C     . VAL B 2  205 ? 14.548  -34.946 173.865 1.00 78.16  ? 189  VAL B C     1 
ATOM   5994  O  O     . VAL B 2  205 ? 14.994  -34.611 174.970 1.00 69.43  ? 189  VAL B O     1 
ATOM   5995  C  CB    . VAL B 2  205 ? 16.347  -33.825 172.499 1.00 88.39  ? 189  VAL B CB    1 
ATOM   5996  C  CG1   . VAL B 2  205 ? 17.109  -35.105 172.218 1.00 90.90  ? 189  VAL B CG1   1 
ATOM   5997  C  CG2   . VAL B 2  205 ? 16.609  -32.789 171.411 1.00 80.15  ? 189  VAL B CG2   1 
ATOM   5998  N  N     . GLY B 2  206 ? 13.790  -36.024 173.689 1.00 75.21  ? 190  GLY B N     1 
ATOM   5999  C  CA    . GLY B 2  206 ? 13.345  -36.861 174.797 1.00 78.78  ? 190  GLY B CA    1 
ATOM   6000  C  C     . GLY B 2  206 ? 14.052  -38.206 174.792 1.00 77.64  ? 190  GLY B C     1 
ATOM   6001  O  O     . GLY B 2  206 ? 14.314  -38.770 173.727 1.00 83.64  ? 190  GLY B O     1 
ATOM   6002  N  N     . SER B 2  207 ? 14.341  -38.723 175.986 1.00 81.74  ? 191  SER B N     1 
ATOM   6003  C  CA    . SER B 2  207 ? 14.929  -40.051 176.114 1.00 90.02  ? 191  SER B CA    1 
ATOM   6004  C  C     . SER B 2  207 ? 14.546  -40.661 177.455 1.00 93.09  ? 191  SER B C     1 
ATOM   6005  O  O     . SER B 2  207 ? 14.133  -39.963 178.385 1.00 94.18  ? 191  SER B O     1 
ATOM   6006  C  CB    . SER B 2  207 ? 16.457  -40.015 175.980 1.00 99.18  ? 191  SER B CB    1 
ATOM   6007  O  OG    . SER B 2  207 ? 17.066  -39.599 177.191 1.00 95.82  ? 191  SER B OG    1 
ATOM   6008  N  N     . ASP B 2  208 ? 14.670  -41.985 177.536 1.00 88.45  ? 192  ASP B N     1 
ATOM   6009  C  CA    . ASP B 2  208 ? 14.443  -42.721 178.772 1.00 91.13  ? 192  ASP B CA    1 
ATOM   6010  C  C     . ASP B 2  208 ? 15.739  -43.010 179.520 1.00 97.80  ? 192  ASP B C     1 
ATOM   6011  O  O     . ASP B 2  208 ? 15.710  -43.711 180.536 1.00 101.57 ? 192  ASP B O     1 
ATOM   6012  C  CB    . ASP B 2  208 ? 13.703  -44.033 178.491 1.00 86.88  ? 192  ASP B CB    1 
ATOM   6013  C  CG    . ASP B 2  208 ? 12.309  -43.810 177.946 1.00 86.43  ? 192  ASP B CG    1 
ATOM   6014  O  OD1   . ASP B 2  208 ? 11.566  -42.997 178.533 1.00 94.44  ? 192  ASP B OD1   1 
ATOM   6015  O  OD2   . ASP B 2  208 ? 11.953  -44.449 176.935 1.00 95.77  ? 192  ASP B OD2   1 
ATOM   6016  N  N     . LEU B 2  209 ? 16.868  -42.496 179.035 1.00 97.73  ? 193  LEU B N     1 
ATOM   6017  C  CA    . LEU B 2  209 ? 18.156  -42.693 179.684 1.00 110.56 ? 193  LEU B CA    1 
ATOM   6018  C  C     . LEU B 2  209 ? 18.161  -42.104 181.091 1.00 118.52 ? 193  LEU B C     1 
ATOM   6019  O  O     . LEU B 2  209 ? 17.318  -41.280 181.456 1.00 116.56 ? 193  LEU B O     1 
ATOM   6020  C  CB    . LEU B 2  209 ? 19.282  -42.061 178.863 1.00 107.18 ? 193  LEU B CB    1 
ATOM   6021  C  CG    . LEU B 2  209 ? 19.285  -42.264 177.347 1.00 104.84 ? 193  LEU B CG    1 
ATOM   6022  C  CD1   . LEU B 2  209 ? 20.563  -41.701 176.745 1.00 106.01 ? 193  LEU B CD1   1 
ATOM   6023  C  CD2   . LEU B 2  209 ? 19.143  -43.739 177.005 1.00 103.16 ? 193  LEU B CD2   1 
ATOM   6024  N  N     . GLU B 2  210 ? 19.131  -42.544 181.888 1.00 130.93 ? 194  GLU B N     1 
ATOM   6025  C  CA    . GLU B 2  210 ? 19.372  -41.907 183.173 1.00 130.38 ? 194  GLU B CA    1 
ATOM   6026  C  C     . GLU B 2  210 ? 19.889  -40.494 182.926 1.00 126.70 ? 194  GLU B C     1 
ATOM   6027  O  O     . GLU B 2  210 ? 20.477  -40.203 181.880 1.00 127.25 ? 194  GLU B O     1 
ATOM   6028  C  CB    . GLU B 2  210 ? 20.349  -42.760 184.000 1.00 133.89 ? 194  GLU B CB    1 
ATOM   6029  C  CG    . GLU B 2  210 ? 21.007  -42.131 185.238 1.00 133.27 ? 194  GLU B CG    1 
ATOM   6030  C  CD    . GLU B 2  210 ? 22.127  -41.160 184.912 1.00 135.03 ? 194  GLU B CD    1 
ATOM   6031  O  OE1   . GLU B 2  210 ? 22.676  -41.236 183.793 1.00 133.58 ? 194  GLU B OE1   1 
ATOM   6032  O  OE2   . GLU B 2  210 ? 22.461  -40.322 185.776 1.00 136.38 ? 194  GLU B OE2   1 
ATOM   6033  N  N     . ILE B 2  211 ? 19.645  -39.609 183.899 1.00 125.25 ? 195  ILE B N     1 
ATOM   6034  C  CA    . ILE B 2  211 ? 19.803  -38.171 183.672 1.00 120.05 ? 195  ILE B CA    1 
ATOM   6035  C  C     . ILE B 2  211 ? 21.189  -37.855 183.116 1.00 121.72 ? 195  ILE B C     1 
ATOM   6036  O  O     . ILE B 2  211 ? 21.325  -37.131 182.123 1.00 112.29 ? 195  ILE B O     1 
ATOM   6037  C  CB    . ILE B 2  211 ? 19.502  -37.384 184.962 1.00 115.64 ? 195  ILE B CB    1 
ATOM   6038  C  CG1   . ILE B 2  211 ? 19.829  -35.902 184.772 1.00 103.40 ? 195  ILE B CG1   1 
ATOM   6039  C  CG2   . ILE B 2  211 ? 20.224  -37.983 186.165 1.00 123.38 ? 195  ILE B CG2   1 
ATOM   6040  C  CD1   . ILE B 2  211 ? 18.868  -35.203 183.832 1.00 106.14 ? 195  ILE B CD1   1 
ATOM   6041  N  N     . GLY B 2  212 ? 22.236  -38.364 183.769 1.00 122.16 ? 196  GLY B N     1 
ATOM   6042  C  CA    . GLY B 2  212 ? 23.596  -38.197 183.290 1.00 116.62 ? 196  GLY B CA    1 
ATOM   6043  C  C     . GLY B 2  212 ? 23.763  -38.506 181.815 1.00 114.77 ? 196  GLY B C     1 
ATOM   6044  O  O     . GLY B 2  212 ? 24.242  -37.663 181.052 1.00 112.93 ? 196  GLY B O     1 
ATOM   6045  N  N     . GLN B 2  213 ? 23.369  -39.717 181.399 1.00 118.83 ? 197  GLN B N     1 
ATOM   6046  C  CA    . GLN B 2  213 ? 23.517  -40.089 179.995 1.00 121.56 ? 197  GLN B CA    1 
ATOM   6047  C  C     . GLN B 2  213 ? 22.602  -39.266 179.102 1.00 117.99 ? 197  GLN B C     1 
ATOM   6048  O  O     . GLN B 2  213 ? 22.910  -39.062 177.922 1.00 118.68 ? 197  GLN B O     1 
ATOM   6049  C  CB    . GLN B 2  213 ? 23.234  -41.579 179.792 1.00 124.76 ? 197  GLN B CB    1 
ATOM   6050  C  CG    . GLN B 2  213 ? 24.339  -42.511 180.263 1.00 131.46 ? 197  GLN B CG    1 
ATOM   6051  C  CD    . GLN B 2  213 ? 24.025  -43.159 181.594 1.00 135.57 ? 197  GLN B CD    1 
ATOM   6052  O  OE1   . GLN B 2  213 ? 22.895  -43.580 181.841 1.00 135.92 ? 197  GLN B OE1   1 
ATOM   6053  N  NE2   . GLN B 2  213 ? 25.028  -43.251 182.460 1.00 139.43 ? 197  GLN B NE2   1 
ATOM   6054  N  N     . HIS B 2  214 ? 21.475  -38.796 179.640 1.00 119.06 ? 198  HIS B N     1 
ATOM   6055  C  CA    . HIS B 2  214 ? 20.593  -37.923 178.874 1.00 111.74 ? 198  HIS B CA    1 
ATOM   6056  C  C     . HIS B 2  214 ? 21.298  -36.612 178.549 1.00 108.15 ? 198  HIS B C     1 
ATOM   6057  O  O     . HIS B 2  214 ? 21.425  -36.231 177.379 1.00 99.78  ? 198  HIS B O     1 
ATOM   6058  C  CB    . HIS B 2  214 ? 19.295  -37.681 179.644 1.00 106.28 ? 198  HIS B CB    1 
ATOM   6059  C  CG    . HIS B 2  214 ? 18.305  -36.840 178.902 1.00 93.65  ? 198  HIS B CG    1 
ATOM   6060  N  ND1   . HIS B 2  214 ? 17.421  -37.370 177.987 1.00 86.07  ? 198  HIS B ND1   1 
ATOM   6061  C  CD2   . HIS B 2  214 ? 18.066  -35.508 178.929 1.00 91.21  ? 198  HIS B CD2   1 
ATOM   6062  C  CE1   . HIS B 2  214 ? 16.678  -36.401 177.485 1.00 86.20  ? 198  HIS B CE1   1 
ATOM   6063  N  NE2   . HIS B 2  214 ? 17.049  -35.261 178.039 1.00 88.77  ? 198  HIS B NE2   1 
ATOM   6064  N  N     . ARG B 2  215 ? 21.756  -35.901 179.586 1.00 110.43 ? 199  ARG B N     1 
ATOM   6065  C  CA    . ARG B 2  215 ? 22.454  -34.635 179.377 1.00 107.80 ? 199  ARG B CA    1 
ATOM   6066  C  C     . ARG B 2  215 ? 23.672  -34.848 178.495 1.00 112.24 ? 199  ARG B C     1 
ATOM   6067  O  O     . ARG B 2  215 ? 24.000  -34.006 177.651 1.00 120.11 ? 199  ARG B O     1 
ATOM   6068  C  CB    . ARG B 2  215 ? 22.864  -34.018 180.712 1.00 104.83 ? 199  ARG B CB    1 
ATOM   6069  C  CG    . ARG B 2  215 ? 21.750  -33.941 181.729 1.00 101.02 ? 199  ARG B CG    1 
ATOM   6070  C  CD    . ARG B 2  215 ? 22.131  -33.025 182.872 1.00 96.60  ? 199  ARG B CD    1 
ATOM   6071  N  NE    . ARG B 2  215 ? 21.033  -32.876 183.818 1.00 101.31 ? 199  ARG B NE    1 
ATOM   6072  C  CZ    . ARG B 2  215 ? 21.060  -32.080 184.880 1.00 105.07 ? 199  ARG B CZ    1 
ATOM   6073  N  NH1   . ARG B 2  215 ? 22.124  -31.326 185.119 1.00 108.94 ? 199  ARG B NH1   1 
ATOM   6074  N  NH2   . ARG B 2  215 ? 20.012  -32.019 185.689 1.00 111.08 ? 199  ARG B NH2   1 
ATOM   6075  N  N     . THR B 2  216 ? 24.367  -35.968 178.705 1.00 114.50 ? 200  THR B N     1 
ATOM   6076  C  CA    . THR B 2  216 ? 25.477  -36.355 177.845 1.00 117.32 ? 200  THR B CA    1 
ATOM   6077  C  C     . THR B 2  216 ? 25.036  -36.383 176.389 1.00 115.22 ? 200  THR B C     1 
ATOM   6078  O  O     . THR B 2  216 ? 25.655  -35.748 175.528 1.00 119.26 ? 200  THR B O     1 
ATOM   6079  C  CB    . THR B 2  216 ? 26.021  -37.721 178.269 1.00 115.79 ? 200  THR B CB    1 
ATOM   6080  O  OG1   . THR B 2  216 ? 26.728  -37.593 179.509 1.00 116.78 ? 200  THR B OG1   1 
ATOM   6081  C  CG2   . THR B 2  216 ? 26.963  -38.274 177.208 1.00 120.50 ? 200  THR B CG2   1 
ATOM   6082  N  N     . LYS B 2  217 ? 23.953  -37.111 176.098 1.00 111.46 ? 201  LYS B N     1 
ATOM   6083  C  CA    . LYS B 2  217 ? 23.481  -37.189 174.722 1.00 109.89 ? 201  LYS B CA    1 
ATOM   6084  C  C     . LYS B 2  217 ? 23.089  -35.811 174.204 1.00 120.70 ? 201  LYS B C     1 
ATOM   6085  O  O     . LYS B 2  217 ? 23.258  -35.525 173.013 1.00 120.41 ? 201  LYS B O     1 
ATOM   6086  C  CB    . LYS B 2  217 ? 22.289  -38.143 174.633 1.00 106.23 ? 201  LYS B CB    1 
ATOM   6087  C  CG    . LYS B 2  217 ? 22.613  -39.491 174.013 1.00 106.75 ? 201  LYS B CG    1 
ATOM   6088  C  CD    . LYS B 2  217 ? 23.889  -40.053 174.627 1.00 114.29 ? 201  LYS B CD    1 
ATOM   6089  C  CE    . LYS B 2  217 ? 24.373  -41.308 173.922 1.00 114.42 ? 201  LYS B CE    1 
ATOM   6090  N  NZ    . LYS B 2  217 ? 24.610  -41.077 172.474 1.00 115.36 ? 201  LYS B NZ    1 
ATOM   6091  N  N     . ILE B 2  218 ? 22.553  -34.950 175.076 1.00 119.76 ? 202  ILE B N     1 
ATOM   6092  C  CA    . ILE B 2  218 ? 22.217  -33.591 174.661 1.00 120.96 ? 202  ILE B CA    1 
ATOM   6093  C  C     . ILE B 2  218 ? 23.487  -32.821 174.321 1.00 135.99 ? 202  ILE B C     1 
ATOM   6094  O  O     . ILE B 2  218 ? 23.542  -32.081 173.330 1.00 133.48 ? 202  ILE B O     1 
ATOM   6095  C  CB    . ILE B 2  218 ? 21.406  -32.882 175.764 1.00 109.40 ? 202  ILE B CB    1 
ATOM   6096  C  CG1   . ILE B 2  218 ? 20.012  -33.494 175.894 1.00 99.16  ? 202  ILE B CG1   1 
ATOM   6097  C  CG2   . ILE B 2  218 ? 21.311  -31.388 175.490 1.00 107.80 ? 202  ILE B CG2   1 
ATOM   6098  C  CD1   . ILE B 2  218 ? 19.166  -33.329 174.660 1.00 85.97  ? 202  ILE B CD1   1 
ATOM   6099  N  N     . GLU B 2  219 ? 24.536  -33.007 175.129 1.00 151.00 ? 203  GLU B N     1 
ATOM   6100  C  CA    . GLU B 2  219 ? 25.824  -32.376 174.861 1.00 153.08 ? 203  GLU B CA    1 
ATOM   6101  C  C     . GLU B 2  219 ? 26.403  -32.854 173.537 1.00 155.68 ? 203  GLU B C     1 
ATOM   6102  O  O     . GLU B 2  219 ? 26.920  -32.052 172.750 1.00 156.47 ? 203  GLU B O     1 
ATOM   6103  C  CB    . GLU B 2  219 ? 26.789  -32.654 176.012 1.00 154.79 ? 203  GLU B CB    1 
ATOM   6104  C  CG    . GLU B 2  219 ? 28.151  -32.009 175.846 1.00 164.53 ? 203  GLU B CG    1 
ATOM   6105  C  CD    . GLU B 2  219 ? 28.063  -30.506 175.660 1.00 164.61 ? 203  GLU B CD    1 
ATOM   6106  O  OE1   . GLU B 2  219 ? 27.204  -29.871 176.309 1.00 162.50 ? 203  GLU B OE1   1 
ATOM   6107  O  OE2   . GLU B 2  219 ? 28.854  -29.959 174.864 1.00 167.11 ? 203  GLU B OE2   1 
ATOM   6108  N  N     . GLU B 2  220 ? 26.336  -34.164 173.284 1.00 136.24 ? 204  GLU B N     1 
ATOM   6109  C  CA    . GLU B 2  220 ? 26.740  -34.712 171.993 1.00 128.04 ? 204  GLU B CA    1 
ATOM   6110  C  C     . GLU B 2  220 ? 26.014  -34.000 170.860 1.00 132.52 ? 204  GLU B C     1 
ATOM   6111  O  O     . GLU B 2  220 ? 26.633  -33.552 169.888 1.00 131.58 ? 204  GLU B O     1 
ATOM   6112  C  CB    . GLU B 2  220 ? 26.456  -36.215 171.953 1.00 117.41 ? 204  GLU B CB    1 
ATOM   6113  C  CG    . GLU B 2  220 ? 27.202  -37.029 172.999 1.00 117.89 ? 204  GLU B CG    1 
ATOM   6114  C  CD    . GLU B 2  220 ? 27.113  -38.523 172.747 1.00 115.73 ? 204  GLU B CD    1 
ATOM   6115  O  OE1   . GLU B 2  220 ? 26.904  -38.919 171.581 1.00 114.83 ? 204  GLU B OE1   1 
ATOM   6116  O  OE2   . GLU B 2  220 ? 27.256  -39.301 173.714 1.00 115.13 ? 204  GLU B OE2   1 
ATOM   6117  N  N     . LEU B 2  221 ? 24.689  -33.897 170.975 1.00 133.63 ? 205  LEU B N     1 
ATOM   6118  C  CA    . LEU B 2  221 ? 23.888  -33.236 169.953 1.00 124.99 ? 205  LEU B CA    1 
ATOM   6119  C  C     . LEU B 2  221 ? 24.311  -31.781 169.773 1.00 135.69 ? 205  LEU B C     1 
ATOM   6120  O  O     . LEU B 2  221 ? 24.286  -31.256 168.654 1.00 130.06 ? 205  LEU B O     1 
ATOM   6121  C  CB    . LEU B 2  221 ? 22.402  -33.341 170.296 1.00 114.24 ? 205  LEU B CB    1 
ATOM   6122  C  CG    . LEU B 2  221 ? 21.460  -32.840 169.201 1.00 120.60 ? 205  LEU B CG    1 
ATOM   6123  C  CD1   . LEU B 2  221 ? 21.308  -33.900 168.129 1.00 118.01 ? 205  LEU B CD1   1 
ATOM   6124  C  CD2   . LEU B 2  221 ? 20.102  -32.489 169.775 1.00 107.22 ? 205  LEU B CD2   1 
ATOM   6125  N  N     . ARG B 2  222 ? 24.681  -31.104 170.865 1.00 152.97 ? 206  ARG B N     1 
ATOM   6126  C  CA    . ARG B 2  222 ? 25.095  -29.709 170.754 1.00 153.63 ? 206  ARG B CA    1 
ATOM   6127  C  C     . ARG B 2  222 ? 26.355  -29.576 169.920 1.00 156.91 ? 206  ARG B C     1 
ATOM   6128  O  O     . ARG B 2  222 ? 26.440  -28.734 169.019 1.00 154.58 ? 206  ARG B O     1 
ATOM   6129  C  CB    . ARG B 2  222 ? 25.410  -29.154 172.133 1.00 152.20 ? 206  ARG B CB    1 
ATOM   6130  C  CG    . ARG B 2  222 ? 24.272  -28.922 173.012 1.00 147.51 ? 206  ARG B CG    1 
ATOM   6131  C  CD    . ARG B 2  222 ? 24.721  -27.993 174.092 1.00 150.66 ? 206  ARG B CD    1 
ATOM   6132  N  NE    . ARG B 2  222 ? 23.713  -26.970 174.190 1.00 153.28 ? 206  ARG B NE    1 
ATOM   6133  C  CZ    . ARG B 2  222 ? 22.563  -27.151 174.814 1.00 160.41 ? 206  ARG B CZ    1 
ATOM   6134  N  NH1   . ARG B 2  222 ? 22.288  -28.306 175.402 1.00 149.61 ? 206  ARG B NH1   1 
ATOM   6135  N  NH2   . ARG B 2  222 ? 21.684  -26.178 174.828 1.00 170.49 ? 206  ARG B NH2   1 
ATOM   6136  N  N     . GLN B 2  223 ? 27.350  -30.406 170.219 1.00 148.52 ? 207  GLN B N     1 
ATOM   6137  C  CA    . GLN B 2  223 ? 28.598  -30.364 169.478 1.00 137.76 ? 207  GLN B CA    1 
ATOM   6138  C  C     . GLN B 2  223 ? 28.365  -30.806 168.045 1.00 130.36 ? 207  GLN B C     1 
ATOM   6139  O  O     . GLN B 2  223 ? 28.999  -30.292 167.117 1.00 138.02 ? 207  GLN B O     1 
ATOM   6140  C  CB    . GLN B 2  223 ? 29.619  -31.237 170.201 1.00 128.37 ? 207  GLN B CB    1 
ATOM   6141  C  CG    . GLN B 2  223 ? 30.155  -30.555 171.454 1.00 128.56 ? 207  GLN B CG    1 
ATOM   6142  C  CD    . GLN B 2  223 ? 30.689  -31.532 172.479 1.00 132.16 ? 207  GLN B CD    1 
ATOM   6143  O  OE1   . GLN B 2  223 ? 30.586  -32.746 172.308 1.00 135.90 ? 207  GLN B OE1   1 
ATOM   6144  N  NE2   . GLN B 2  223 ? 31.228  -31.006 173.573 1.00 128.91 ? 207  GLN B NE2   1 
ATOM   6145  N  N     . HIS B 2  224 ? 27.452  -31.760 167.864 1.00 126.35 ? 208  HIS B N     1 
ATOM   6146  C  CA    . HIS B 2  224 ? 27.054  -32.210 166.537 1.00 118.51 ? 208  HIS B CA    1 
ATOM   6147  C  C     . HIS B 2  224 ? 26.478  -31.065 165.706 1.00 126.41 ? 208  HIS B C     1 
ATOM   6148  O  O     . HIS B 2  224 ? 26.774  -30.944 164.512 1.00 131.48 ? 208  HIS B O     1 
ATOM   6149  C  CB    . HIS B 2  224 ? 26.040  -33.344 166.691 1.00 117.16 ? 208  HIS B CB    1 
ATOM   6150  C  CG    . HIS B 2  224 ? 25.640  -33.991 165.404 1.00 118.86 ? 208  HIS B CG    1 
ATOM   6151  N  ND1   . HIS B 2  224 ? 26.167  -35.193 164.985 1.00 118.66 ? 208  HIS B ND1   1 
ATOM   6152  C  CD2   . HIS B 2  224 ? 24.753  -33.616 164.453 1.00 117.15 ? 208  HIS B CD2   1 
ATOM   6153  C  CE1   . HIS B 2  224 ? 25.628  -35.527 163.827 1.00 122.65 ? 208  HIS B CE1   1 
ATOM   6154  N  NE2   . HIS B 2  224 ? 24.767  -34.586 163.481 1.00 123.43 ? 208  HIS B NE2   1 
ATOM   6155  N  N     . LEU B 2  225 ? 25.651  -30.216 166.325 1.00 128.39 ? 209  LEU B N     1 
ATOM   6156  C  CA    . LEU B 2  225 ? 25.104  -29.045 165.638 1.00 132.76 ? 209  LEU B CA    1 
ATOM   6157  C  C     . LEU B 2  225 ? 26.182  -28.027 165.283 1.00 142.73 ? 209  LEU B C     1 
ATOM   6158  O  O     . LEU B 2  225 ? 26.114  -27.388 164.226 1.00 145.29 ? 209  LEU B O     1 
ATOM   6159  C  CB    . LEU B 2  225 ? 24.019  -28.396 166.497 1.00 134.70 ? 209  LEU B CB    1 
ATOM   6160  C  CG    . LEU B 2  225 ? 22.585  -28.702 166.063 1.00 116.52 ? 209  LEU B CG    1 
ATOM   6161  C  CD1   . LEU B 2  225 ? 21.591  -28.233 167.110 1.00 113.14 ? 209  LEU B CD1   1 
ATOM   6162  C  CD2   . LEU B 2  225 ? 22.290  -28.066 164.714 1.00 111.80 ? 209  LEU B CD2   1 
ATOM   6163  N  N     . LEU B 2  226 ? 27.177  -27.856 166.155 1.00 144.39 ? 210  LEU B N     1 
ATOM   6164  C  CA    . LEU B 2  226 ? 28.267  -26.923 165.883 1.00 147.15 ? 210  LEU B CA    1 
ATOM   6165  C  C     . LEU B 2  226 ? 29.069  -27.364 164.666 1.00 150.99 ? 210  LEU B C     1 
ATOM   6166  O  O     . LEU B 2  226 ? 29.496  -26.530 163.858 1.00 152.45 ? 210  LEU B O     1 
ATOM   6167  C  CB    . LEU B 2  226 ? 29.170  -26.781 167.112 1.00 150.70 ? 210  LEU B CB    1 
ATOM   6168  C  CG    . LEU B 2  226 ? 30.591  -26.200 167.002 1.00 161.10 ? 210  LEU B CG    1 
ATOM   6169  C  CD1   . LEU B 2  226 ? 30.662  -24.913 166.170 1.00 164.53 ? 210  LEU B CD1   1 
ATOM   6170  C  CD2   . LEU B 2  226 ? 31.179  -25.961 168.385 1.00 164.13 ? 210  LEU B CD2   1 
ATOM   6171  N  N     . ARG B 2  227 ? 29.264  -28.674 164.503 1.00 144.02 ? 211  ARG B N     1 
ATOM   6172  C  CA    . ARG B 2  227 ? 30.078  -29.158 163.394 1.00 146.29 ? 211  ARG B CA    1 
ATOM   6173  C  C     . ARG B 2  227 ? 29.450  -28.781 162.058 1.00 154.66 ? 211  ARG B C     1 
ATOM   6174  O  O     . ARG B 2  227 ? 30.165  -28.443 161.107 1.00 166.13 ? 211  ARG B O     1 
ATOM   6175  C  CB    . ARG B 2  227 ? 30.240  -30.673 163.513 1.00 139.64 ? 211  ARG B CB    1 
ATOM   6176  C  CG    . ARG B 2  227 ? 31.032  -31.093 164.743 1.00 136.07 ? 211  ARG B CG    1 
ATOM   6177  C  CD    . ARG B 2  227 ? 31.186  -32.600 164.847 1.00 139.66 ? 211  ARG B CD    1 
ATOM   6178  N  NE    . ARG B 2  227 ? 31.926  -32.978 166.048 1.00 144.63 ? 211  ARG B NE    1 
ATOM   6179  C  CZ    . ARG B 2  227 ? 33.235  -33.200 166.089 1.00 156.75 ? 211  ARG B CZ    1 
ATOM   6180  N  NH1   . ARG B 2  227 ? 33.964  -33.094 164.987 1.00 156.69 ? 211  ARG B NH1   1 
ATOM   6181  N  NH2   . ARG B 2  227 ? 33.815  -33.537 167.234 1.00 154.27 ? 211  ARG B NH2   1 
ATOM   6182  N  N     . TRP B 2  228 ? 28.119  -28.846 161.953 1.00 145.34 ? 212  TRP B N     1 
ATOM   6183  C  CA    . TRP B 2  228 ? 27.479  -28.285 160.767 1.00 145.67 ? 212  TRP B CA    1 
ATOM   6184  C  C     . TRP B 2  228 ? 27.590  -26.765 160.758 1.00 153.54 ? 212  TRP B C     1 
ATOM   6185  O  O     . TRP B 2  228 ? 27.742  -26.152 159.694 1.00 158.89 ? 212  TRP B O     1 
ATOM   6186  C  CB    . TRP B 2  228 ? 26.010  -28.692 160.684 1.00 133.05 ? 212  TRP B CB    1 
ATOM   6187  C  CG    . TRP B 2  228 ? 25.278  -27.908 159.626 1.00 128.33 ? 212  TRP B CG    1 
ATOM   6188  C  CD1   . TRP B 2  228 ? 25.146  -28.226 158.305 1.00 127.45 ? 212  TRP B CD1   1 
ATOM   6189  C  CD2   . TRP B 2  228 ? 24.609  -26.651 159.803 1.00 130.18 ? 212  TRP B CD2   1 
ATOM   6190  N  NE1   . TRP B 2  228 ? 24.423  -27.253 157.654 1.00 126.81 ? 212  TRP B NE1   1 
ATOM   6191  C  CE2   . TRP B 2  228 ? 24.084  -26.275 158.552 1.00 129.58 ? 212  TRP B CE2   1 
ATOM   6192  C  CE3   . TRP B 2  228 ? 24.398  -25.811 160.903 1.00 129.86 ? 212  TRP B CE3   1 
ATOM   6193  C  CZ2   . TRP B 2  228 ? 23.360  -25.097 158.369 1.00 122.96 ? 212  TRP B CZ2   1 
ATOM   6194  C  CZ3   . TRP B 2  228 ? 23.681  -24.642 160.719 1.00 120.95 ? 212  TRP B CZ3   1 
ATOM   6195  C  CH2   . TRP B 2  228 ? 23.170  -24.296 159.463 1.00 112.80 ? 212  TRP B CH2   1 
ATOM   6196  N  N     . GLY B 2  229 ? 27.501  -26.143 161.937 1.00 146.75 ? 213  GLY B N     1 
ATOM   6197  C  CA    . GLY B 2  229 ? 27.589  -24.693 162.012 1.00 152.46 ? 213  GLY B CA    1 
ATOM   6198  C  C     . GLY B 2  229 ? 28.927  -24.169 161.532 1.00 172.83 ? 213  GLY B C     1 
ATOM   6199  O  O     . GLY B 2  229 ? 29.004  -23.107 160.909 1.00 170.33 ? 213  GLY B O     1 
ATOM   6200  N  N     . LEU B 2  230 ? 29.998  -24.910 161.815 1.00 189.38 ? 214  LEU B N     1 
ATOM   6201  C  CA    . LEU B 2  230 ? 31.322  -24.505 161.361 1.00 192.80 ? 214  LEU B CA    1 
ATOM   6202  C  C     . LEU B 2  230 ? 31.490  -24.719 159.860 1.00 194.17 ? 214  LEU B C     1 
ATOM   6203  O  O     . LEU B 2  230 ? 32.225  -23.967 159.209 1.00 196.55 ? 214  LEU B O     1 
ATOM   6204  C  CB    . LEU B 2  230 ? 32.389  -25.278 162.138 1.00 194.45 ? 214  LEU B CB    1 
ATOM   6205  C  CG    . LEU B 2  230 ? 33.699  -24.560 162.462 1.00 197.85 ? 214  LEU B CG    1 
ATOM   6206  C  CD1   . LEU B 2  230 ? 33.434  -23.332 163.317 1.00 193.02 ? 214  LEU B CD1   1 
ATOM   6207  C  CD2   . LEU B 2  230 ? 34.662  -25.506 163.164 1.00 203.00 ? 214  LEU B CD2   1 
ATOM   6208  N  N     . THR B 2  231 ? 30.805  -25.715 159.289 1.00 191.35 ? 215  THR B N     1 
ATOM   6209  C  CA    . THR B 2  231 ? 31.018  -26.098 157.896 1.00 193.86 ? 215  THR B CA    1 
ATOM   6210  C  C     . THR B 2  231 ? 29.974  -25.516 156.949 1.00 190.69 ? 215  THR B C     1 
ATOM   6211  O  O     . THR B 2  231 ? 30.276  -24.609 156.165 1.00 191.54 ? 215  THR B O     1 
ATOM   6212  C  CB    . THR B 2  231 ? 31.017  -27.620 157.748 1.00 195.12 ? 215  THR B CB    1 
ATOM   6213  O  OG1   . THR B 2  231 ? 31.899  -28.203 158.714 1.00 197.89 ? 215  THR B OG1   1 
ATOM   6214  C  CG2   . THR B 2  231 ? 31.476  -28.008 156.350 1.00 192.74 ? 215  THR B CG2   1 
ATOM   6215  N  N     . THR B 2  232 ? 28.756  -26.048 156.991 1.00 171.49 ? 216  THR B N     1 
ATOM   6216  C  CA    . THR B 2  232 ? 27.699  -25.592 156.093 1.00 154.59 ? 216  THR B CA    1 
ATOM   6217  C  C     . THR B 2  232 ? 26.764  -24.622 156.807 1.00 148.22 ? 216  THR B C     1 
ATOM   6218  O  O     . THR B 2  232 ? 27.089  -23.445 156.977 1.00 147.78 ? 216  THR B O     1 
ATOM   6219  C  CB    . THR B 2  232 ? 26.920  -26.778 155.539 1.00 139.71 ? 216  THR B CB    1 
ATOM   6220  N  N     . PRO B 2  242 ? 19.853  -16.515 174.002 1.00 178.37 ? 226  PRO B N     1 
ATOM   6221  C  CA    . PRO B 2  242 ? 19.527  -17.012 172.663 1.00 177.58 ? 226  PRO B CA    1 
ATOM   6222  C  C     . PRO B 2  242 ? 20.345  -18.222 172.268 1.00 184.14 ? 226  PRO B C     1 
ATOM   6223  O  O     . PRO B 2  242 ? 19.978  -18.948 171.345 1.00 185.00 ? 226  PRO B O     1 
ATOM   6224  C  CB    . PRO B 2  242 ? 19.892  -15.833 171.747 1.00 173.29 ? 226  PRO B CB    1 
ATOM   6225  C  CG    . PRO B 2  242 ? 20.368  -14.715 172.655 1.00 165.66 ? 226  PRO B CG    1 
ATOM   6226  C  CD    . PRO B 2  242 ? 19.929  -15.050 174.035 1.00 169.59 ? 226  PRO B CD    1 
ATOM   6227  N  N     . PHE B 2  243 ? 21.449  -18.434 172.970 1.00 167.56 ? 227  PHE B N     1 
ATOM   6228  C  CA    . PHE B 2  243 ? 22.512  -19.233 172.395 1.00 163.58 ? 227  PHE B CA    1 
ATOM   6229  C  C     . PHE B 2  243 ? 22.226  -20.722 172.546 1.00 157.98 ? 227  PHE B C     1 
ATOM   6230  O  O     . PHE B 2  243 ? 21.401  -21.157 173.354 1.00 155.22 ? 227  PHE B O     1 
ATOM   6231  C  CB    . PHE B 2  243 ? 23.862  -18.869 173.007 1.00 162.85 ? 227  PHE B CB    1 
ATOM   6232  C  CG    . PHE B 2  243 ? 24.655  -17.905 172.172 1.00 162.41 ? 227  PHE B CG    1 
ATOM   6233  C  CD1   . PHE B 2  243 ? 24.189  -16.621 171.943 1.00 161.56 ? 227  PHE B CD1   1 
ATOM   6234  C  CD2   . PHE B 2  243 ? 25.854  -18.291 171.595 1.00 167.34 ? 227  PHE B CD2   1 
ATOM   6235  C  CE1   . PHE B 2  243 ? 24.913  -15.733 171.167 1.00 160.05 ? 227  PHE B CE1   1 
ATOM   6236  C  CE2   . PHE B 2  243 ? 26.583  -17.409 170.818 1.00 168.32 ? 227  PHE B CE2   1 
ATOM   6237  C  CZ    . PHE B 2  243 ? 26.112  -16.128 170.603 1.00 163.03 ? 227  PHE B CZ    1 
ATOM   6238  N  N     . LEU B 2  244 ? 22.922  -21.501 171.720 1.00 156.44 ? 228  LEU B N     1 
ATOM   6239  C  CA    . LEU B 2  244 ? 22.686  -22.935 171.626 1.00 149.83 ? 228  LEU B CA    1 
ATOM   6240  C  C     . LEU B 2  244 ? 22.978  -23.658 172.939 1.00 160.11 ? 228  LEU B C     1 
ATOM   6241  O  O     . LEU B 2  244 ? 22.338  -24.671 173.238 1.00 158.79 ? 228  LEU B O     1 
ATOM   6242  C  CB    . LEU B 2  244 ? 23.530  -23.503 170.484 1.00 141.72 ? 228  LEU B CB    1 
ATOM   6243  C  CG    . LEU B 2  244 ? 23.462  -24.995 170.176 1.00 143.42 ? 228  LEU B CG    1 
ATOM   6244  C  CD1   . LEU B 2  244 ? 22.027  -25.391 169.889 1.00 139.13 ? 228  LEU B CD1   1 
ATOM   6245  C  CD2   . LEU B 2  244 ? 24.356  -25.323 168.991 1.00 143.26 ? 228  LEU B CD2   1 
ATOM   6246  N  N     . TRP B 2  245 ? 23.951  -23.169 173.718 1.00 168.90 ? 229  TRP B N     1 
ATOM   6247  C  CA    . TRP B 2  245 ? 24.390  -23.860 174.935 1.00 168.01 ? 229  TRP B CA    1 
ATOM   6248  C  C     . TRP B 2  245 ? 23.271  -24.069 175.962 1.00 169.05 ? 229  TRP B C     1 
ATOM   6249  O  O     . TRP B 2  245 ? 23.262  -25.089 176.660 1.00 167.42 ? 229  TRP B O     1 
ATOM   6250  C  CB    . TRP B 2  245 ? 25.551  -23.104 175.583 1.00 170.46 ? 229  TRP B CB    1 
ATOM   6251  C  CG    . TRP B 2  245 ? 25.180  -21.766 176.128 1.00 171.01 ? 229  TRP B CG    1 
ATOM   6252  C  CD1   . TRP B 2  245 ? 25.185  -20.577 175.467 1.00 170.76 ? 229  TRP B CD1   1 
ATOM   6253  C  CD2   . TRP B 2  245 ? 24.752  -21.481 177.465 1.00 169.29 ? 229  TRP B CD2   1 
ATOM   6254  N  NE1   . TRP B 2  245 ? 24.780  -19.566 176.306 1.00 169.59 ? 229  TRP B NE1   1 
ATOM   6255  C  CE2   . TRP B 2  245 ? 24.509  -20.096 177.540 1.00 168.69 ? 229  TRP B CE2   1 
ATOM   6256  C  CE3   . TRP B 2  245 ? 24.548  -22.265 178.605 1.00 169.48 ? 229  TRP B CE3   1 
ATOM   6257  C  CZ2   . TRP B 2  245 ? 24.074  -19.477 178.710 1.00 169.61 ? 229  TRP B CZ2   1 
ATOM   6258  C  CZ3   . TRP B 2  245 ? 24.116  -21.650 179.765 1.00 169.70 ? 229  TRP B CZ3   1 
ATOM   6259  C  CH2   . TRP B 2  245 ? 23.884  -20.270 179.809 1.00 169.66 ? 229  TRP B CH2   1 
ATOM   6260  N  N     . MET B 2  246 ? 22.364  -23.102 176.126 1.00 178.36 ? 230  MET B N     1 
ATOM   6261  C  CA    . MET B 2  246 ? 21.261  -23.260 177.080 1.00 174.40 ? 230  MET B CA    1 
ATOM   6262  C  C     . MET B 2  246 ? 20.445  -24.529 176.828 1.00 171.29 ? 230  MET B C     1 
ATOM   6263  O  O     . MET B 2  246 ? 20.307  -24.988 175.693 1.00 172.28 ? 230  MET B O     1 
ATOM   6264  C  CB    . MET B 2  246 ? 20.331  -22.050 177.025 1.00 170.98 ? 230  MET B CB    1 
ATOM   6265  C  CG    . MET B 2  246 ? 20.681  -20.944 177.998 1.00 171.39 ? 230  MET B CG    1 
ATOM   6266  S  SD    . MET B 2  246 ? 19.477  -19.608 177.921 1.00 166.99 ? 230  MET B SD    1 
ATOM   6267  C  CE    . MET B 2  246 ? 19.930  -18.834 176.373 1.00 159.95 ? 230  MET B CE    1 
ATOM   6268  N  N     . GLY B 2  247 ? 19.822  -25.047 177.891 1.00 146.99 ? 231  GLY B N     1 
ATOM   6269  C  CA    . GLY B 2  247 ? 18.924  -26.188 177.769 1.00 134.64 ? 231  GLY B CA    1 
ATOM   6270  C  C     . GLY B 2  247 ? 18.018  -26.401 178.970 1.00 133.75 ? 231  GLY B C     1 
ATOM   6271  O  O     . GLY B 2  247 ? 18.485  -26.356 180.112 1.00 139.23 ? 231  GLY B O     1 
ATOM   6272  N  N     . TYR B 2  248 ? 16.729  -26.650 178.729 1.00 129.72 ? 232  TYR B N     1 
ATOM   6273  C  CA    . TYR B 2  248 ? 15.735  -26.816 179.786 1.00 124.78 ? 232  TYR B CA    1 
ATOM   6274  C  C     . TYR B 2  248 ? 15.246  -28.258 179.853 1.00 124.49 ? 232  TYR B C     1 
ATOM   6275  O  O     . TYR B 2  248 ? 14.985  -28.876 178.818 1.00 121.25 ? 232  TYR B O     1 
ATOM   6276  C  CB    . TYR B 2  248 ? 14.553  -25.884 179.533 1.00 120.53 ? 232  TYR B CB    1 
ATOM   6277  C  CG    . TYR B 2  248 ? 14.970  -24.441 179.531 1.00 124.97 ? 232  TYR B CG    1 
ATOM   6278  C  CD1   . TYR B 2  248 ? 15.265  -23.782 180.712 1.00 122.44 ? 232  TYR B CD1   1 
ATOM   6279  C  CD2   . TYR B 2  248 ? 15.104  -23.745 178.337 1.00 129.22 ? 232  TYR B CD2   1 
ATOM   6280  C  CE1   . TYR B 2  248 ? 15.660  -22.467 180.709 1.00 117.81 ? 232  TYR B CE1   1 
ATOM   6281  C  CE2   . TYR B 2  248 ? 15.500  -22.428 178.324 1.00 127.25 ? 232  TYR B CE2   1 
ATOM   6282  C  CZ    . TYR B 2  248 ? 15.775  -21.794 179.514 1.00 122.22 ? 232  TYR B CZ    1 
ATOM   6283  O  OH    . TYR B 2  248 ? 16.174  -20.483 179.517 1.00 120.95 ? 232  TYR B OH    1 
ATOM   6284  N  N     . GLU B 2  249 ? 15.087  -28.785 181.072 1.00 104.96 ? 233  GLU B N     1 
ATOM   6285  C  CA    . GLU B 2  249 ? 14.796  -30.205 181.273 1.00 94.21  ? 233  GLU B CA    1 
ATOM   6286  C  C     . GLU B 2  249 ? 13.388  -30.439 181.818 1.00 86.79  ? 233  GLU B C     1 
ATOM   6287  O  O     . GLU B 2  249 ? 13.075  -30.040 182.945 1.00 81.47  ? 233  GLU B O     1 
ATOM   6288  C  CB    . GLU B 2  249 ? 15.833  -30.844 182.196 1.00 104.01 ? 233  GLU B CB    1 
ATOM   6289  C  CG    . GLU B 2  249 ? 17.269  -30.470 181.875 1.00 113.94 ? 233  GLU B CG    1 
ATOM   6290  C  CD    . GLU B 2  249 ? 18.267  -31.181 182.766 1.00 104.37 ? 233  GLU B CD    1 
ATOM   6291  O  OE1   . GLU B 2  249 ? 17.858  -31.694 183.829 1.00 105.66 ? 233  GLU B OE1   1 
ATOM   6292  O  OE2   . GLU B 2  249 ? 19.457  -31.238 182.395 1.00 105.20 ? 233  GLU B OE2   1 
ATOM   6293  N  N     . LEU B 2  250 ? 12.544  -31.066 181.002 1.00 86.24  ? 234  LEU B N     1 
ATOM   6294  C  CA    . LEU B 2  250 ? 11.180  -31.459 181.329 1.00 80.18  ? 234  LEU B CA    1 
ATOM   6295  C  C     . LEU B 2  250 ? 11.157  -32.924 181.756 1.00 80.81  ? 234  LEU B C     1 
ATOM   6296  O  O     . LEU B 2  250 ? 12.064  -33.698 181.439 1.00 83.04  ? 234  LEU B O     1 
ATOM   6297  C  CB    . LEU B 2  250 ? 10.227  -31.248 180.150 1.00 68.48  ? 234  LEU B CB    1 
ATOM   6298  C  CG    . LEU B 2  250 ? 10.252  -29.895 179.447 1.00 62.38  ? 234  LEU B CG    1 
ATOM   6299  C  CD1   . LEU B 2  250 ? 9.441   -29.970 178.171 1.00 68.21  ? 234  LEU B CD1   1 
ATOM   6300  C  CD2   . LEU B 2  250 ? 9.707   -28.821 180.366 1.00 60.95  ? 234  LEU B CD2   1 
ATOM   6301  N  N     . HIS B 2  251 ? 10.111  -33.305 182.490 1.00 86.37  ? 235  HIS B N     1 
ATOM   6302  C  CA    . HIS B 2  251 ? 9.843   -34.714 182.787 1.00 89.06  ? 235  HIS B CA    1 
ATOM   6303  C  C     . HIS B 2  251 ? 8.367   -35.003 182.550 1.00 85.40  ? 235  HIS B C     1 
ATOM   6304  O  O     . HIS B 2  251 ? 7.563   -35.048 183.490 1.00 89.98  ? 235  HIS B O     1 
ATOM   6305  C  CB    . HIS B 2  251 ? 10.280  -35.067 184.208 1.00 97.16  ? 235  HIS B CB    1 
ATOM   6306  C  CG    . HIS B 2  251 ? 11.710  -34.725 184.491 1.00 93.75  ? 235  HIS B CG    1 
ATOM   6307  N  ND1   . HIS B 2  251 ? 12.762  -35.459 183.986 1.00 86.79  ? 235  HIS B ND1   1 
ATOM   6308  C  CD2   . HIS B 2  251 ? 12.263  -33.723 185.214 1.00 92.05  ? 235  HIS B CD2   1 
ATOM   6309  C  CE1   . HIS B 2  251 ? 13.902  -34.926 184.389 1.00 90.19  ? 235  HIS B CE1   1 
ATOM   6310  N  NE2   . HIS B 2  251 ? 13.627  -33.872 185.136 1.00 98.16  ? 235  HIS B NE2   1 
ATOM   6311  N  N     . PRO B 2  252 ? 7.983   -35.202 181.285 1.00 85.75  ? 236  PRO B N     1 
ATOM   6312  C  CA    . PRO B 2  252 ? 6.564   -35.417 180.939 1.00 86.02  ? 236  PRO B CA    1 
ATOM   6313  C  C     . PRO B 2  252 ? 5.915   -36.618 181.610 1.00 89.75  ? 236  PRO B C     1 
ATOM   6314  O  O     . PRO B 2  252 ? 4.700   -36.604 181.844 1.00 99.10  ? 236  PRO B O     1 
ATOM   6315  C  CB    . PRO B 2  252 ? 6.608   -35.589 179.416 1.00 85.08  ? 236  PRO B CB    1 
ATOM   6316  C  CG    . PRO B 2  252 ? 7.835   -34.871 178.988 1.00 86.23  ? 236  PRO B CG    1 
ATOM   6317  C  CD    . PRO B 2  252 ? 8.831   -35.075 180.088 1.00 82.41  ? 236  PRO B CD    1 
ATOM   6318  N  N     . ASP B 2  253 ? 6.687   -37.663 181.910 1.00 95.12  ? 237  ASP B N     1 
ATOM   6319  C  CA    . ASP B 2  253 ? 6.144   -38.855 182.558 1.00 97.64  ? 237  ASP B CA    1 
ATOM   6320  C  C     . ASP B 2  253 ? 5.506   -38.548 183.909 1.00 98.44  ? 237  ASP B C     1 
ATOM   6321  O  O     . ASP B 2  253 ? 4.560   -39.234 184.312 1.00 103.72 ? 237  ASP B O     1 
ATOM   6322  C  CB    . ASP B 2  253 ? 7.238   -39.915 182.707 1.00 101.69 ? 237  ASP B CB    1 
ATOM   6323  C  CG    . ASP B 2  253 ? 8.355   -39.480 183.631 1.00 106.83 ? 237  ASP B CG    1 
ATOM   6324  O  OD1   . ASP B 2  253 ? 9.079   -38.521 183.292 1.00 109.03 ? 237  ASP B OD1   1 
ATOM   6325  O  OD2   . ASP B 2  253 ? 8.518   -40.113 184.694 1.00 109.91 ? 237  ASP B OD2   1 
ATOM   6326  N  N     . LYS B 2  254 ? 6.007   -37.545 184.626 1.00 94.28  ? 238  LYS B N     1 
ATOM   6327  C  CA    . LYS B 2  254 ? 5.505   -37.198 185.951 1.00 101.09 ? 238  LYS B CA    1 
ATOM   6328  C  C     . LYS B 2  254 ? 4.455   -36.083 185.945 1.00 100.38 ? 238  LYS B C     1 
ATOM   6329  O  O     . LYS B 2  254 ? 4.163   -35.528 187.008 1.00 105.46 ? 238  LYS B O     1 
ATOM   6330  C  CB    . LYS B 2  254 ? 6.671   -36.783 186.856 1.00 100.89 ? 238  LYS B CB    1 
ATOM   6331  C  CG    . LYS B 2  254 ? 7.853   -37.744 186.889 1.00 99.35  ? 238  LYS B CG    1 
ATOM   6332  C  CD    . LYS B 2  254 ? 7.580   -38.940 187.788 1.00 102.37 ? 238  LYS B CD    1 
ATOM   6333  C  CE    . LYS B 2  254 ? 8.754   -39.908 187.793 1.00 110.92 ? 238  LYS B CE    1 
ATOM   6334  N  NZ    . LYS B 2  254 ? 8.676   -40.885 188.914 1.00 114.71 ? 238  LYS B NZ    1 
ATOM   6335  N  N     . TRP B 2  255 ? 3.888   -35.734 184.790 1.00 96.60  ? 239  TRP B N     1 
ATOM   6336  C  CA    . TRP B 2  255 ? 2.867   -34.683 184.723 1.00 95.86  ? 239  TRP B CA    1 
ATOM   6337  C  C     . TRP B 2  255 ? 1.509   -35.151 185.250 1.00 101.47 ? 239  TRP B C     1 
ATOM   6338  O  O     . TRP B 2  255 ? 0.763   -35.847 184.556 1.00 104.94 ? 239  TRP B O     1 
ATOM   6339  C  CB    . TRP B 2  255 ? 2.727   -34.167 183.296 1.00 91.31  ? 239  TRP B CB    1 
ATOM   6340  C  CG    . TRP B 2  255 ? 3.899   -33.368 182.839 1.00 79.75  ? 239  TRP B CG    1 
ATOM   6341  C  CD1   . TRP B 2  255 ? 4.934   -32.922 183.607 1.00 79.72  ? 239  TRP B CD1   1 
ATOM   6342  C  CD2   . TRP B 2  255 ? 4.124   -32.855 181.523 1.00 71.50  ? 239  TRP B CD2   1 
ATOM   6343  N  NE1   . TRP B 2  255 ? 5.811   -32.194 182.840 1.00 80.43  ? 239  TRP B NE1   1 
ATOM   6344  C  CE2   . TRP B 2  255 ? 5.334   -32.134 181.558 1.00 71.25  ? 239  TRP B CE2   1 
ATOM   6345  C  CE3   . TRP B 2  255 ? 3.427   -32.946 180.314 1.00 64.71  ? 239  TRP B CE3   1 
ATOM   6346  C  CZ2   . TRP B 2  255 ? 5.864   -31.510 180.431 1.00 66.36  ? 239  TRP B CZ2   1 
ATOM   6347  C  CZ3   . TRP B 2  255 ? 3.954   -32.325 179.197 1.00 71.05  ? 239  TRP B CZ3   1 
ATOM   6348  C  CH2   . TRP B 2  255 ? 5.162   -31.616 179.263 1.00 69.08  ? 239  TRP B CH2   1 
ATOM   6349  N  N     . THR B 2  256 ? 1.194   -34.767 186.489 1.00 93.00  ? 240  THR B N     1 
ATOM   6350  C  CA    . THR B 2  256 ? -0.072  -35.098 187.139 1.00 98.32  ? 240  THR B CA    1 
ATOM   6351  C  C     . THR B 2  256 ? -1.264  -34.453 186.426 1.00 103.45 ? 240  THR B C     1 
ATOM   6352  O  O     . THR B 2  256 ? -1.128  -33.479 185.679 1.00 96.45  ? 240  THR B O     1 
ATOM   6353  C  CB    . THR B 2  256 ? -0.064  -34.654 188.602 1.00 92.34  ? 240  THR B CB    1 
ATOM   6354  O  OG1   . THR B 2  256 ? 0.401   -33.301 188.692 1.00 95.08  ? 240  THR B OG1   1 
ATOM   6355  C  CG2   . THR B 2  256 ? 0.826   -35.560 189.434 1.00 95.27  ? 240  THR B CG2   1 
ATOM   6356  N  N     . VAL B 2  257 ? -2.451  -35.012 186.675 1.00 106.77 ? 241  VAL B N     1 
ATOM   6357  C  CA    . VAL B 2  257 ? -3.720  -34.447 186.223 1.00 97.93  ? 241  VAL B CA    1 
ATOM   6358  C  C     . VAL B 2  257 ? -4.578  -34.150 187.447 1.00 91.89  ? 241  VAL B C     1 
ATOM   6359  O  O     . VAL B 2  257 ? -4.632  -34.950 188.387 1.00 98.59  ? 241  VAL B O     1 
ATOM   6360  C  CB    . VAL B 2  257 ? -4.467  -35.386 185.252 1.00 98.71  ? 241  VAL B CB    1 
ATOM   6361  C  CG1   . VAL B 2  257 ? -3.782  -35.399 183.895 1.00 100.97 ? 241  VAL B CG1   1 
ATOM   6362  C  CG2   . VAL B 2  257 ? -4.566  -36.793 185.829 1.00 96.68  ? 241  VAL B CG2   1 
ATOM   6363  N  N     . GLN B 2  258 ? -5.245  -32.990 187.438 1.00 81.19  ? 242  GLN B N     1 
ATOM   6364  C  CA    . GLN B 2  258 ? -6.070  -32.550 188.558 1.00 82.78  ? 242  GLN B CA    1 
ATOM   6365  C  C     . GLN B 2  258 ? -7.552  -32.734 188.244 1.00 81.11  ? 242  GLN B C     1 
ATOM   6366  O  O     . GLN B 2  258 ? -8.138  -31.902 187.535 1.00 75.80  ? 242  GLN B O     1 
ATOM   6367  C  CB    . GLN B 2  258 ? -5.771  -31.084 188.887 1.00 78.64  ? 242  GLN B CB    1 
ATOM   6368  C  CG    . GLN B 2  258 ? -6.601  -30.488 190.012 1.00 75.67  ? 242  GLN B CG    1 
ATOM   6369  C  CD    . GLN B 2  258 ? -6.089  -30.863 191.384 1.00 76.02  ? 242  GLN B CD    1 
ATOM   6370  O  OE1   . GLN B 2  258 ? -5.112  -31.600 191.517 1.00 82.92  ? 242  GLN B OE1   1 
ATOM   6371  N  NE2   . GLN B 2  258 ? -6.741  -30.345 192.418 1.00 76.91  ? 242  GLN B NE2   1 
ATOM   6372  N  N     . PRO B 2  259 ? -8.210  -33.781 188.755 1.00 89.32  ? 243  PRO B N     1 
ATOM   6373  C  CA    . PRO B 2  259 ? -9.605  -34.031 188.371 1.00 87.00  ? 243  PRO B CA    1 
ATOM   6374  C  C     . PRO B 2  259 ? -10.591 -33.277 189.252 1.00 84.82  ? 243  PRO B C     1 
ATOM   6375  O  O     . PRO B 2  259 ? -10.180 -32.527 190.143 1.00 87.30  ? 243  PRO B O     1 
ATOM   6376  C  CB    . PRO B 2  259 ? -9.729  -35.546 188.544 1.00 85.09  ? 243  PRO B CB    1 
ATOM   6377  C  CG    . PRO B 2  259 ? -8.842  -35.832 189.733 1.00 86.46  ? 243  PRO B CG    1 
ATOM   6378  C  CD    . PRO B 2  259 ? -7.733  -34.776 189.732 1.00 87.07  ? 243  PRO B CD    1 
ATOM   6379  N  N     . ILE B 2  260 ? -11.888 -33.488 189.039 1.00 77.39  ? 244  ILE B N     1 
ATOM   6380  C  CA    . ILE B 2  260 ? -12.917 -32.892 189.884 1.00 84.41  ? 244  ILE B CA    1 
ATOM   6381  C  C     . ILE B 2  260 ? -13.163 -33.814 191.067 1.00 90.16  ? 244  ILE B C     1 
ATOM   6382  O  O     . ILE B 2  260 ? -13.370 -35.022 190.895 1.00 86.95  ? 244  ILE B O     1 
ATOM   6383  C  CB    . ILE B 2  260 ? -14.216 -32.657 189.094 1.00 83.07  ? 244  ILE B CB    1 
ATOM   6384  C  CG1   . ILE B 2  260 ? -14.070 -31.461 188.155 1.00 78.78  ? 244  ILE B CG1   1 
ATOM   6385  C  CG2   . ILE B 2  260 ? -15.392 -32.451 190.039 1.00 81.90  ? 244  ILE B CG2   1 
ATOM   6386  C  CD1   . ILE B 2  260 ? -15.304 -31.194 187.314 1.00 72.36  ? 244  ILE B CD1   1 
ATOM   6387  N  N     . VAL B 2  261 ? -13.144 -33.247 192.271 1.00 86.55  ? 245  VAL B N     1 
ATOM   6388  C  CA    . VAL B 2  261 ? -13.276 -34.015 193.500 1.00 89.26  ? 245  VAL B CA    1 
ATOM   6389  C  C     . VAL B 2  261 ? -14.349 -33.386 194.376 1.00 91.42  ? 245  VAL B C     1 
ATOM   6390  O  O     . VAL B 2  261 ? -14.440 -32.157 194.479 1.00 92.66  ? 245  VAL B O     1 
ATOM   6391  C  CB    . VAL B 2  261 ? -11.934 -34.094 194.259 1.00 91.80  ? 245  VAL B CB    1 
ATOM   6392  C  CG1   . VAL B 2  261 ? -12.108 -34.804 195.595 1.00 103.19 ? 245  VAL B CG1   1 
ATOM   6393  C  CG2   . VAL B 2  261 ? -10.887 -34.796 193.411 1.00 94.57  ? 245  VAL B CG2   1 
ATOM   6394  N  N     . LEU B 2  262 ? -15.176 -34.237 194.998 1.00 96.71  ? 246  LEU B N     1 
ATOM   6395  C  CA    . LEU B 2  262 ? -16.165 -33.790 195.962 1.00 101.59 ? 246  LEU B CA    1 
ATOM   6396  C  C     . LEU B 2  262 ? -15.557 -33.822 197.357 1.00 107.65 ? 246  LEU B C     1 
ATOM   6397  O  O     . LEU B 2  262 ? -14.732 -34.691 197.660 1.00 105.26 ? 246  LEU B O     1 
ATOM   6398  C  CB    . LEU B 2  262 ? -17.402 -34.683 195.923 1.00 80.47  ? 246  LEU B CB    1 
ATOM   6399  C  CG    . LEU B 2  262 ? -18.016 -34.927 194.546 1.00 68.10  ? 246  LEU B CG    1 
ATOM   6400  C  CD1   . LEU B 2  262 ? -19.206 -35.861 194.645 1.00 85.86  ? 246  LEU B CD1   1 
ATOM   6401  C  CD2   . LEU B 2  262 ? -18.420 -33.612 193.907 1.00 71.72  ? 246  LEU B CD2   1 
ATOM   6402  N  N     . PRO B 2  263 ? -15.932 -32.891 198.231 1.00 107.12 ? 247  PRO B N     1 
ATOM   6403  C  CA    . PRO B 2  263 ? -15.388 -32.910 199.591 1.00 112.09 ? 247  PRO B CA    1 
ATOM   6404  C  C     . PRO B 2  263 ? -15.829 -34.163 200.328 1.00 107.45 ? 247  PRO B C     1 
ATOM   6405  O  O     . PRO B 2  263 ? -16.765 -34.858 199.928 1.00 104.32 ? 247  PRO B O     1 
ATOM   6406  C  CB    . PRO B 2  263 ? -15.975 -31.648 200.233 1.00 104.36 ? 247  PRO B CB    1 
ATOM   6407  C  CG    . PRO B 2  263 ? -17.212 -31.371 199.453 1.00 103.19 ? 247  PRO B CG    1 
ATOM   6408  C  CD    . PRO B 2  263 ? -16.942 -31.833 198.050 1.00 100.08 ? 247  PRO B CD    1 
ATOM   6409  N  N     . GLU B 2  264 ? -15.124 -34.463 201.412 1.00 115.41 ? 248  GLU B N     1 
ATOM   6410  C  CA    . GLU B 2  264 ? -15.498 -35.561 202.289 1.00 121.23 ? 248  GLU B CA    1 
ATOM   6411  C  C     . GLU B 2  264 ? -15.779 -35.002 203.671 1.00 120.12 ? 248  GLU B C     1 
ATOM   6412  O  O     . GLU B 2  264 ? -14.919 -34.346 204.269 1.00 113.25 ? 248  GLU B O     1 
ATOM   6413  C  CB    . GLU B 2  264 ? -14.406 -36.631 202.358 1.00 125.51 ? 248  GLU B CB    1 
ATOM   6414  C  CG    . GLU B 2  264 ? -14.697 -37.720 203.388 1.00 133.61 ? 248  GLU B CG    1 
ATOM   6415  C  CD    . GLU B 2  264 ? -15.566 -38.840 202.846 1.00 139.77 ? 248  GLU B CD    1 
ATOM   6416  O  OE1   . GLU B 2  264 ? -15.898 -38.810 201.644 1.00 139.22 ? 248  GLU B OE1   1 
ATOM   6417  O  OE2   . GLU B 2  264 ? -15.926 -39.746 203.629 1.00 138.98 ? 248  GLU B OE2   1 
ATOM   6418  N  N     . LYS B 2  265 ? -16.988 -35.250 204.165 1.00 121.53 ? 249  LYS B N     1 
ATOM   6419  C  CA    . LYS B 2  265 ? -17.408 -34.771 205.468 1.00 114.34 ? 249  LYS B CA    1 
ATOM   6420  C  C     . LYS B 2  265 ? -18.232 -35.861 206.131 1.00 121.68 ? 249  LYS B C     1 
ATOM   6421  O  O     . LYS B 2  265 ? -18.899 -36.655 205.462 1.00 122.25 ? 249  LYS B O     1 
ATOM   6422  C  CB    . LYS B 2  265 ? -18.238 -33.479 205.375 1.00 96.75  ? 249  LYS B CB    1 
ATOM   6423  C  CG    . LYS B 2  265 ? -17.604 -32.354 204.570 1.00 89.91  ? 249  LYS B CG    1 
ATOM   6424  C  CD    . LYS B 2  265 ? -18.512 -31.135 204.544 1.00 76.93  ? 249  LYS B CD    1 
ATOM   6425  C  CE    . LYS B 2  265 ? -17.859 -29.949 203.852 1.00 66.37  ? 249  LYS B CE    1 
ATOM   6426  N  NZ    . LYS B 2  265 ? -17.039 -29.141 204.796 1.00 60.90  ? 249  LYS B NZ    1 
ATOM   6427  N  N     . ASP B 2  266 ? -18.171 -35.894 207.455 1.00 129.71 ? 250  ASP B N     1 
ATOM   6428  C  CA    . ASP B 2  266 ? -19.086 -36.692 208.256 1.00 135.38 ? 250  ASP B CA    1 
ATOM   6429  C  C     . ASP B 2  266 ? -20.348 -35.924 208.632 1.00 135.92 ? 250  ASP B C     1 
ATOM   6430  O  O     . ASP B 2  266 ? -21.431 -36.514 208.707 1.00 137.43 ? 250  ASP B O     1 
ATOM   6431  C  CB    . ASP B 2  266 ? -18.367 -37.213 209.494 1.00 139.59 ? 250  ASP B CB    1 
ATOM   6432  C  CG    . ASP B 2  266 ? -17.258 -38.195 209.156 1.00 143.50 ? 250  ASP B CG    1 
ATOM   6433  O  OD1   . ASP B 2  266 ? -17.434 -38.988 208.206 1.00 146.60 ? 250  ASP B OD1   1 
ATOM   6434  O  OD2   . ASP B 2  266 ? -16.212 -38.176 209.836 1.00 142.92 ? 250  ASP B OD2   1 
ATOM   6435  N  N     . SER B 2  267 ? -20.226 -34.620 208.879 1.00 122.92 ? 251  SER B N     1 
ATOM   6436  C  CA    . SER B 2  267 ? -21.365 -33.750 209.135 1.00 105.74 ? 251  SER B CA    1 
ATOM   6437  C  C     . SER B 2  267 ? -21.422 -32.670 208.064 1.00 99.06  ? 251  SER B C     1 
ATOM   6438  O  O     . SER B 2  267 ? -20.412 -32.020 207.773 1.00 96.30  ? 251  SER B O     1 
ATOM   6439  C  CB    . SER B 2  267 ? -21.271 -33.110 210.523 1.00 101.23 ? 251  SER B CB    1 
ATOM   6440  O  OG    . SER B 2  267 ? -19.931 -32.769 210.834 1.00 105.66 ? 251  SER B OG    1 
ATOM   6441  N  N     . TRP B 2  268 ? -22.604 -32.493 207.482 1.00 96.09  ? 252  TRP B N     1 
ATOM   6442  C  CA    . TRP B 2  268 ? -22.854 -31.511 206.435 1.00 83.86  ? 252  TRP B CA    1 
ATOM   6443  C  C     . TRP B 2  268 ? -23.780 -30.420 206.954 1.00 77.63  ? 252  TRP B C     1 
ATOM   6444  O  O     . TRP B 2  268 ? -24.832 -30.719 207.529 1.00 88.10  ? 252  TRP B O     1 
ATOM   6445  C  CB    . TRP B 2  268 ? -23.480 -32.184 205.213 1.00 80.50  ? 252  TRP B CB    1 
ATOM   6446  C  CG    . TRP B 2  268 ? -22.622 -33.249 204.609 1.00 88.06  ? 252  TRP B CG    1 
ATOM   6447  C  CD1   . TRP B 2  268 ? -22.507 -34.542 205.031 1.00 96.45  ? 252  TRP B CD1   1 
ATOM   6448  C  CD2   . TRP B 2  268 ? -21.761 -33.120 203.474 1.00 89.21  ? 252  TRP B CD2   1 
ATOM   6449  N  NE1   . TRP B 2  268 ? -21.628 -35.226 204.228 1.00 93.85  ? 252  TRP B NE1   1 
ATOM   6450  C  CE2   . TRP B 2  268 ? -21.156 -34.375 203.264 1.00 88.45  ? 252  TRP B CE2   1 
ATOM   6451  C  CE3   . TRP B 2  268 ? -21.443 -32.066 202.613 1.00 81.48  ? 252  TRP B CE3   1 
ATOM   6452  C  CZ2   . TRP B 2  268 ? -20.253 -34.603 202.232 1.00 88.54  ? 252  TRP B CZ2   1 
ATOM   6453  C  CZ3   . TRP B 2  268 ? -20.548 -32.295 201.589 1.00 82.59  ? 252  TRP B CZ3   1 
ATOM   6454  C  CH2   . TRP B 2  268 ? -19.962 -33.553 201.407 1.00 92.50  ? 252  TRP B CH2   1 
ATOM   6455  N  N     . THR B 2  269 ? -23.391 -29.163 206.770 1.00 73.44  ? 253  THR B N     1 
ATOM   6456  C  CA    . THR B 2  269 ? -24.331 -28.082 207.024 1.00 74.28  ? 253  THR B CA    1 
ATOM   6457  C  C     . THR B 2  269 ? -25.177 -27.830 205.779 1.00 73.19  ? 253  THR B C     1 
ATOM   6458  O  O     . THR B 2  269 ? -24.866 -28.299 204.680 1.00 71.25  ? 253  THR B O     1 
ATOM   6459  C  CB    . THR B 2  269 ? -23.617 -26.793 207.438 1.00 71.73  ? 253  THR B CB    1 
ATOM   6460  O  OG1   . THR B 2  269 ? -22.780 -26.332 206.369 1.00 69.46  ? 253  THR B OG1   1 
ATOM   6461  C  CG2   . THR B 2  269 ? -22.780 -27.021 208.687 1.00 64.80  ? 253  THR B CG2   1 
ATOM   6462  N  N     . VAL B 2  270 ? -26.282 -27.103 205.975 1.00 65.45  ? 254  VAL B N     1 
ATOM   6463  C  CA    . VAL B 2  270 ? -27.110 -26.679 204.849 1.00 63.59  ? 254  VAL B CA    1 
ATOM   6464  C  C     . VAL B 2  270 ? -26.264 -25.971 203.802 1.00 64.42  ? 254  VAL B C     1 
ATOM   6465  O  O     . VAL B 2  270 ? -26.384 -26.236 202.598 1.00 63.93  ? 254  VAL B O     1 
ATOM   6466  C  CB    . VAL B 2  270 ? -28.261 -25.781 205.342 1.00 68.81  ? 254  VAL B CB    1 
ATOM   6467  C  CG1   . VAL B 2  270 ? -28.879 -25.016 204.180 1.00 62.84  ? 254  VAL B CG1   1 
ATOM   6468  C  CG2   . VAL B 2  270 ? -29.312 -26.607 206.064 1.00 66.38  ? 254  VAL B CG2   1 
ATOM   6469  N  N     . ASN B 2  271 ? -25.380 -25.074 204.247 1.00 66.29  ? 255  ASN B N     1 
ATOM   6470  C  CA    . ASN B 2  271 ? -24.457 -24.410 203.332 1.00 63.32  ? 255  ASN B CA    1 
ATOM   6471  C  C     . ASN B 2  271 ? -23.633 -25.425 202.550 1.00 61.76  ? 255  ASN B C     1 
ATOM   6472  O  O     . ASN B 2  271 ? -23.499 -25.320 201.325 1.00 61.61  ? 255  ASN B O     1 
ATOM   6473  C  CB    . ASN B 2  271 ? -23.551 -23.453 204.101 1.00 65.44  ? 255  ASN B CB    1 
ATOM   6474  C  CG    . ASN B 2  271 ? -22.629 -22.677 203.188 1.00 68.13  ? 255  ASN B CG    1 
ATOM   6475  O  OD1   . ASN B 2  271 ? -23.068 -21.792 202.453 1.00 63.88  ? 255  ASN B OD1   1 
ATOM   6476  N  ND2   . ASN B 2  271 ? -21.343 -23.007 203.225 1.00 72.17  ? 255  ASN B ND2   1 
ATOM   6477  N  N     . ASP B 2  272 ? -23.052 -26.403 203.248 1.00 61.70  ? 256  ASP B N     1 
ATOM   6478  C  CA    . ASP B 2  272 ? -22.233 -27.404 202.573 1.00 63.51  ? 256  ASP B CA    1 
ATOM   6479  C  C     . ASP B 2  272 ? -23.028 -28.130 201.494 1.00 58.40  ? 256  ASP B C     1 
ATOM   6480  O  O     . ASP B 2  272 ? -22.530 -28.339 200.381 1.00 57.95  ? 256  ASP B O     1 
ATOM   6481  C  CB    . ASP B 2  272 ? -21.678 -28.403 203.592 1.00 68.16  ? 256  ASP B CB    1 
ATOM   6482  C  CG    . ASP B 2  272 ? -20.706 -27.765 204.574 1.00 69.25  ? 256  ASP B CG    1 
ATOM   6483  O  OD1   . ASP B 2  272 ? -19.942 -26.867 204.161 1.00 77.94  ? 256  ASP B OD1   1 
ATOM   6484  O  OD2   . ASP B 2  272 ? -20.706 -28.163 205.759 1.00 60.89  ? 256  ASP B OD2   1 
ATOM   6485  N  N     . ILE B 2  273 ? -24.266 -28.525 201.805 1.00 65.37  ? 257  ILE B N     1 
ATOM   6486  C  CA    . ILE B 2  273 ? -25.065 -29.281 200.844 1.00 67.06  ? 257  ILE B CA    1 
ATOM   6487  C  C     . ILE B 2  273 ? -25.517 -28.399 199.684 1.00 60.15  ? 257  ILE B C     1 
ATOM   6488  O  O     . ILE B 2  273 ? -25.633 -28.872 198.545 1.00 47.56  ? 257  ILE B O     1 
ATOM   6489  C  CB    . ILE B 2  273 ? -26.254 -29.959 201.549 1.00 62.79  ? 257  ILE B CB    1 
ATOM   6490  C  CG1   . ILE B 2  273 ? -25.743 -30.999 202.540 1.00 66.41  ? 257  ILE B CG1   1 
ATOM   6491  C  CG2   . ILE B 2  273 ? -27.147 -30.662 200.545 1.00 62.70  ? 257  ILE B CG2   1 
ATOM   6492  C  CD1   . ILE B 2  273 ? -26.787 -31.479 203.499 1.00 64.41  ? 257  ILE B CD1   1 
ATOM   6493  N  N     . GLN B 2  274 ? -25.787 -27.114 199.939 1.00 57.62  ? 258  GLN B N     1 
ATOM   6494  C  CA    . GLN B 2  274 ? -26.069 -26.207 198.831 1.00 55.18  ? 258  GLN B CA    1 
ATOM   6495  C  C     . GLN B 2  274 ? -24.864 -26.092 197.912 1.00 57.30  ? 258  GLN B C     1 
ATOM   6496  O  O     . GLN B 2  274 ? -25.005 -26.099 196.682 1.00 52.08  ? 258  GLN B O     1 
ATOM   6497  C  CB    . GLN B 2  274 ? -26.470 -24.829 199.354 1.00 57.65  ? 258  GLN B CB    1 
ATOM   6498  C  CG    . GLN B 2  274 ? -27.858 -24.775 199.966 1.00 65.13  ? 258  GLN B CG    1 
ATOM   6499  C  CD    . GLN B 2  274 ? -28.123 -23.460 200.664 1.00 55.40  ? 258  GLN B CD    1 
ATOM   6500  O  OE1   . GLN B 2  274 ? -27.261 -22.583 200.706 1.00 59.29  ? 258  GLN B OE1   1 
ATOM   6501  N  NE2   . GLN B 2  274 ? -29.316 -23.319 201.229 1.00 62.33  ? 258  GLN B NE2   1 
ATOM   6502  N  N     . LYS B 2  275 ? -23.668 -25.989 198.495 1.00 69.58  ? 259  LYS B N     1 
ATOM   6503  C  CA    . LYS B 2  275 ? -22.453 -25.917 197.694 1.00 57.19  ? 259  LYS B CA    1 
ATOM   6504  C  C     . LYS B 2  275 ? -22.277 -27.207 196.904 1.00 53.92  ? 259  LYS B C     1 
ATOM   6505  O  O     . LYS B 2  275 ? -21.974 -27.187 195.704 1.00 43.64  ? 259  LYS B O     1 
ATOM   6506  C  CB    . LYS B 2  275 ? -21.259 -25.657 198.608 1.00 54.97  ? 259  LYS B CB    1 
ATOM   6507  C  CG    . LYS B 2  275 ? -21.236 -24.261 199.232 1.00 55.94  ? 259  LYS B CG    1 
ATOM   6508  C  CD    . LYS B 2  275 ? -21.379 -23.146 198.205 1.00 63.46  ? 259  LYS B CD    1 
ATOM   6509  C  CE    . LYS B 2  275 ? -21.262 -21.773 198.874 1.00 79.29  ? 259  LYS B CE    1 
ATOM   6510  N  NZ    . LYS B 2  275 ? -21.449 -20.631 197.919 1.00 71.98  ? 259  LYS B NZ    1 
ATOM   6511  N  N     . LEU B 2  276 ? -22.444 -28.346 197.585 1.00 54.04  ? 260  LEU B N     1 
ATOM   6512  C  CA    . LEU B 2  276 ? -22.267 -29.650 196.957 1.00 54.70  ? 260  LEU B CA    1 
ATOM   6513  C  C     . LEU B 2  276 ? -23.232 -29.829 195.791 1.00 62.54  ? 260  LEU B C     1 
ATOM   6514  O  O     . LEU B 2  276 ? -22.864 -30.379 194.746 1.00 64.84  ? 260  LEU B O     1 
ATOM   6515  C  CB    . LEU B 2  276 ? -22.454 -30.756 197.997 1.00 54.10  ? 260  LEU B CB    1 
ATOM   6516  C  CG    . LEU B 2  276 ? -22.494 -32.210 197.519 1.00 66.62  ? 260  LEU B CG    1 
ATOM   6517  C  CD1   . LEU B 2  276 ? -21.241 -32.567 196.742 1.00 70.94  ? 260  LEU B CD1   1 
ATOM   6518  C  CD2   . LEU B 2  276 ? -22.652 -33.135 198.710 1.00 70.37  ? 260  LEU B CD2   1 
ATOM   6519  N  N     . VAL B 2  277 ? -24.473 -29.362 195.951 1.00 59.53  ? 261  VAL B N     1 
ATOM   6520  C  CA    . VAL B 2  277 ? -25.472 -29.546 194.905 1.00 58.81  ? 261  VAL B CA    1 
ATOM   6521  C  C     . VAL B 2  277 ? -25.179 -28.627 193.727 1.00 59.74  ? 261  VAL B C     1 
ATOM   6522  O  O     . VAL B 2  277 ? -25.298 -29.031 192.563 1.00 60.00  ? 261  VAL B O     1 
ATOM   6523  C  CB    . VAL B 2  277 ? -26.883 -29.306 195.477 1.00 59.37  ? 261  VAL B CB    1 
ATOM   6524  C  CG1   . VAL B 2  277 ? -27.876 -28.960 194.367 1.00 57.90  ? 261  VAL B CG1   1 
ATOM   6525  C  CG2   . VAL B 2  277 ? -27.351 -30.517 196.268 1.00 65.37  ? 261  VAL B CG2   1 
ATOM   6526  N  N     . GLY B 2  278 ? -24.755 -27.392 194.003 1.00 52.99  ? 262  GLY B N     1 
ATOM   6527  C  CA    . GLY B 2  278 ? -24.386 -26.498 192.919 1.00 56.76  ? 262  GLY B CA    1 
ATOM   6528  C  C     . GLY B 2  278 ? -23.201 -27.029 192.140 1.00 68.28  ? 262  GLY B C     1 
ATOM   6529  O  O     . GLY B 2  278 ? -23.174 -26.965 190.908 1.00 74.96  ? 262  GLY B O     1 
ATOM   6530  N  N     . LYS B 2  279 ? -22.221 -27.594 192.851 1.00 67.79  ? 263  LYS B N     1 
ATOM   6531  C  CA    . LYS B 2  279 ? -21.044 -28.165 192.205 1.00 67.25  ? 263  LYS B CA    1 
ATOM   6532  C  C     . LYS B 2  279 ? -21.438 -29.354 191.341 1.00 68.96  ? 263  LYS B C     1 
ATOM   6533  O  O     . LYS B 2  279 ? -21.011 -29.469 190.186 1.00 67.62  ? 263  LYS B O     1 
ATOM   6534  C  CB    . LYS B 2  279 ? -20.014 -28.573 193.258 1.00 67.53  ? 263  LYS B CB    1 
ATOM   6535  C  CG    . LYS B 2  279 ? -18.641 -28.918 192.699 1.00 63.32  ? 263  LYS B CG    1 
ATOM   6536  C  CD    . LYS B 2  279 ? -17.587 -28.882 193.795 1.00 68.15  ? 263  LYS B CD    1 
ATOM   6537  C  CE    . LYS B 2  279 ? -16.224 -29.328 193.288 1.00 79.23  ? 263  LYS B CE    1 
ATOM   6538  N  NZ    . LYS B 2  279 ? -15.148 -29.093 194.298 1.00 83.77  ? 263  LYS B NZ    1 
ATOM   6539  N  N     . LEU B 2  280 ? -22.269 -30.246 191.889 1.00 72.69  ? 264  LEU B N     1 
ATOM   6540  C  CA    . LEU B 2  280 ? -22.656 -31.449 191.159 1.00 64.67  ? 264  LEU B CA    1 
ATOM   6541  C  C     . LEU B 2  280 ? -23.487 -31.083 189.942 1.00 64.61  ? 264  LEU B C     1 
ATOM   6542  O  O     . LEU B 2  280 ? -23.399 -31.740 188.899 1.00 66.96  ? 264  LEU B O     1 
ATOM   6543  C  CB    . LEU B 2  280 ? -23.437 -32.389 192.071 1.00 65.35  ? 264  LEU B CB    1 
ATOM   6544  C  CG    . LEU B 2  280 ? -22.644 -33.172 193.112 1.00 74.44  ? 264  LEU B CG    1 
ATOM   6545  C  CD1   . LEU B 2  280 ? -23.589 -33.711 194.170 1.00 72.70  ? 264  LEU B CD1   1 
ATOM   6546  C  CD2   . LEU B 2  280 ? -21.875 -34.300 192.445 1.00 72.06  ? 264  LEU B CD2   1 
ATOM   6547  N  N     . ASN B 2  281 ? -24.309 -30.042 190.060 1.00 61.04  ? 265  ASN B N     1 
ATOM   6548  C  CA    . ASN B 2  281 ? -25.156 -29.669 188.940 1.00 66.87  ? 265  ASN B CA    1 
ATOM   6549  C  C     . ASN B 2  281 ? -24.325 -29.045 187.829 1.00 69.21  ? 265  ASN B C     1 
ATOM   6550  O  O     . ASN B 2  281 ? -24.656 -29.197 186.647 1.00 74.95  ? 265  ASN B O     1 
ATOM   6551  C  CB    . ASN B 2  281 ? -26.255 -28.719 189.420 1.00 67.42  ? 265  ASN B CB    1 
ATOM   6552  C  CG    . ASN B 2  281 ? -26.920 -27.965 188.288 1.00 68.21  ? 265  ASN B CG    1 
ATOM   6553  O  OD1   . ASN B 2  281 ? -27.863 -28.455 187.671 1.00 58.32  ? 265  ASN B OD1   1 
ATOM   6554  N  ND2   . ASN B 2  281 ? -26.460 -26.742 188.041 1.00 73.75  ? 265  ASN B ND2   1 
ATOM   6555  N  N     . TRP B 2  282 ? -23.232 -28.368 188.181 1.00 76.53  ? 266  TRP B N     1 
ATOM   6556  C  CA    . TRP B 2  282 ? -22.301 -27.904 187.160 1.00 79.44  ? 266  TRP B CA    1 
ATOM   6557  C  C     . TRP B 2  282 ? -21.580 -29.077 186.509 1.00 78.97  ? 266  TRP B C     1 
ATOM   6558  O  O     . TRP B 2  282 ? -21.444 -29.136 185.282 1.00 76.56  ? 266  TRP B O     1 
ATOM   6559  C  CB    . TRP B 2  282 ? -21.274 -26.952 187.757 1.00 79.87  ? 266  TRP B CB    1 
ATOM   6560  C  CG    . TRP B 2  282 ? -20.600 -26.160 186.701 1.00 84.50  ? 266  TRP B CG    1 
ATOM   6561  C  CD1   . TRP B 2  282 ? -20.992 -24.948 186.215 1.00 96.51  ? 266  TRP B CD1   1 
ATOM   6562  C  CD2   . TRP B 2  282 ? -19.500 -26.581 185.887 1.00 84.88  ? 266  TRP B CD2   1 
ATOM   6563  N  NE1   . TRP B 2  282 ? -20.151 -24.549 185.205 1.00 100.65 ? 266  TRP B NE1   1 
ATOM   6564  C  CE2   . TRP B 2  282 ? -19.231 -25.538 184.979 1.00 91.92  ? 266  TRP B CE2   1 
ATOM   6565  C  CE3   . TRP B 2  282 ? -18.696 -27.725 185.858 1.00 87.67  ? 266  TRP B CE3   1 
ATOM   6566  C  CZ2   . TRP B 2  282 ? -18.190 -25.602 184.055 1.00 89.43  ? 266  TRP B CZ2   1 
ATOM   6567  C  CZ3   . TRP B 2  282 ? -17.659 -27.783 184.945 1.00 89.89  ? 266  TRP B CZ3   1 
ATOM   6568  C  CH2   . TRP B 2  282 ? -17.417 -26.731 184.053 1.00 87.34  ? 266  TRP B CH2   1 
ATOM   6569  N  N     . ALA B 2  283 ? -21.104 -30.019 187.331 1.00 80.65  ? 267  ALA B N     1 
ATOM   6570  C  CA    . ALA B 2  283 ? -20.393 -31.188 186.823 1.00 75.78  ? 267  ALA B CA    1 
ATOM   6571  C  C     . ALA B 2  283 ? -21.245 -31.982 185.846 1.00 86.72  ? 267  ALA B C     1 
ATOM   6572  O  O     . ALA B 2  283 ? -20.710 -32.585 184.907 1.00 92.12  ? 267  ALA B O     1 
ATOM   6573  C  CB    . ALA B 2  283 ? -19.943 -32.075 187.982 1.00 66.77  ? 267  ALA B CB    1 
ATOM   6574  N  N     . SER B 2  284 ? -22.565 -32.012 186.062 1.00 76.24  ? 268  SER B N     1 
ATOM   6575  C  CA    . SER B 2  284 ? -23.452 -32.822 185.234 1.00 75.80  ? 268  SER B CA    1 
ATOM   6576  C  C     . SER B 2  284 ? -23.302 -32.482 183.755 1.00 80.14  ? 268  SER B C     1 
ATOM   6577  O  O     . SER B 2  284 ? -23.580 -33.325 182.894 1.00 80.69  ? 268  SER B O     1 
ATOM   6578  C  CB    . SER B 2  284 ? -24.900 -32.636 185.684 1.00 73.64  ? 268  SER B CB    1 
ATOM   6579  O  OG    . SER B 2  284 ? -25.278 -31.272 185.619 1.00 80.33  ? 268  SER B OG    1 
ATOM   6580  N  N     . GLN B 2  285 ? -22.862 -31.259 183.442 1.00 76.16  ? 269  GLN B N     1 
ATOM   6581  C  CA    . GLN B 2  285 ? -22.552 -30.904 182.062 1.00 77.62  ? 269  GLN B CA    1 
ATOM   6582  C  C     . GLN B 2  285 ? -21.358 -31.678 181.521 1.00 78.67  ? 269  GLN B C     1 
ATOM   6583  O  O     . GLN B 2  285 ? -21.192 -31.762 180.300 1.00 79.71  ? 269  GLN B O     1 
ATOM   6584  C  CB    . GLN B 2  285 ? -22.262 -29.406 181.951 1.00 76.64  ? 269  GLN B CB    1 
ATOM   6585  C  CG    . GLN B 2  285 ? -23.421 -28.497 182.308 1.00 86.18  ? 269  GLN B CG    1 
ATOM   6586  C  CD    . GLN B 2  285 ? -22.982 -27.058 182.515 1.00 86.97  ? 269  GLN B CD    1 
ATOM   6587  O  OE1   . GLN B 2  285 ? -22.232 -26.753 183.443 1.00 84.35  ? 269  GLN B OE1   1 
ATOM   6588  N  NE2   . GLN B 2  285 ? -23.442 -26.168 181.642 1.00 82.37  ? 269  GLN B NE2   1 
ATOM   6589  N  N     . ILE B 2  286 ? -20.513 -32.216 182.393 1.00 89.27  ? 270  ILE B N     1 
ATOM   6590  C  CA    . ILE B 2  286 ? -19.350 -32.997 181.986 1.00 93.86  ? 270  ILE B CA    1 
ATOM   6591  C  C     . ILE B 2  286 ? -19.618 -34.494 182.086 1.00 95.09  ? 270  ILE B C     1 
ATOM   6592  O  O     . ILE B 2  286 ? -19.406 -35.237 181.127 1.00 92.03  ? 270  ILE B O     1 
ATOM   6593  C  CB    . ILE B 2  286 ? -18.113 -32.588 182.816 1.00 94.33  ? 270  ILE B CB    1 
ATOM   6594  C  CG1   . ILE B 2  286 ? -17.689 -31.163 182.465 1.00 81.65  ? 270  ILE B CG1   1 
ATOM   6595  C  CG2   . ILE B 2  286 ? -16.960 -33.530 182.545 1.00 91.33  ? 270  ILE B CG2   1 
ATOM   6596  C  CD1   . ILE B 2  286 ? -16.621 -30.614 183.379 1.00 72.78  ? 270  ILE B CD1   1 
ATOM   6597  N  N     . TYR B 2  287 ? -20.108 -34.949 183.237 1.00 88.50  ? 271  TYR B N     1 
ATOM   6598  C  CA    . TYR B 2  287 ? -20.591 -36.316 183.407 1.00 94.03  ? 271  TYR B CA    1 
ATOM   6599  C  C     . TYR B 2  287 ? -22.112 -36.320 183.488 1.00 99.46  ? 271  TYR B C     1 
ATOM   6600  O  O     . TYR B 2  287 ? -22.675 -35.911 184.518 1.00 97.65  ? 271  TYR B O     1 
ATOM   6601  C  CB    . TYR B 2  287 ? -19.989 -36.953 184.661 1.00 95.73  ? 271  TYR B CB    1 
ATOM   6602  C  CG    . TYR B 2  287 ? -18.476 -36.885 184.748 1.00 95.74  ? 271  TYR B CG    1 
ATOM   6603  C  CD1   . TYR B 2  287 ? -17.830 -35.714 185.125 1.00 92.34  ? 271  TYR B CD1   1 
ATOM   6604  C  CD2   . TYR B 2  287 ? -17.696 -37.999 184.462 1.00 100.88 ? 271  TYR B CD2   1 
ATOM   6605  C  CE1   . TYR B 2  287 ? -16.450 -35.654 185.210 1.00 95.46  ? 271  TYR B CE1   1 
ATOM   6606  C  CE2   . TYR B 2  287 ? -16.316 -37.946 184.543 1.00 100.63 ? 271  TYR B CE2   1 
ATOM   6607  C  CZ    . TYR B 2  287 ? -15.699 -36.772 184.917 1.00 98.07  ? 271  TYR B CZ    1 
ATOM   6608  O  OH    . TYR B 2  287 ? -14.328 -36.714 184.998 1.00 97.89  ? 271  TYR B OH    1 
ATOM   6609  N  N     . PRO B 2  288 ? -22.814 -36.777 182.446 1.00 101.80 ? 272  PRO B N     1 
ATOM   6610  C  CA    . PRO B 2  288 ? -24.281 -36.635 182.420 1.00 99.17  ? 272  PRO B CA    1 
ATOM   6611  C  C     . PRO B 2  288 ? -25.017 -37.530 183.403 1.00 101.24 ? 272  PRO B C     1 
ATOM   6612  O  O     . PRO B 2  288 ? -26.145 -37.193 183.784 1.00 100.29 ? 272  PRO B O     1 
ATOM   6613  C  CB    . PRO B 2  288 ? -24.639 -36.998 180.973 1.00 101.59 ? 272  PRO B CB    1 
ATOM   6614  C  CG    . PRO B 2  288 ? -23.514 -37.882 180.527 1.00 98.64  ? 272  PRO B CG    1 
ATOM   6615  C  CD    . PRO B 2  288 ? -22.289 -37.323 181.184 1.00 102.93 ? 272  PRO B CD    1 
ATOM   6616  N  N     . GLY B 2  289 ? -24.432 -38.648 183.828 1.00 106.92 ? 273  GLY B N     1 
ATOM   6617  C  CA    . GLY B 2  289 ? -25.141 -39.559 184.709 1.00 111.21 ? 273  GLY B CA    1 
ATOM   6618  C  C     . GLY B 2  289 ? -25.276 -39.095 186.143 1.00 110.70 ? 273  GLY B C     1 
ATOM   6619  O  O     . GLY B 2  289 ? -25.799 -39.841 186.975 1.00 110.50 ? 273  GLY B O     1 
ATOM   6620  N  N     . ILE B 2  290 ? -24.816 -37.891 186.451 1.00 114.87 ? 274  ILE B N     1 
ATOM   6621  C  CA    . ILE B 2  290 ? -24.802 -37.382 187.816 1.00 110.96 ? 274  ILE B CA    1 
ATOM   6622  C  C     . ILE B 2  290 ? -26.201 -36.914 188.201 1.00 116.07 ? 274  ILE B C     1 
ATOM   6623  O  O     . ILE B 2  290 ? -26.906 -36.292 187.396 1.00 116.42 ? 274  ILE B O     1 
ATOM   6624  C  CB    . ILE B 2  290 ? -23.766 -36.249 187.933 1.00 95.25  ? 274  ILE B CB    1 
ATOM   6625  C  CG1   . ILE B 2  290 ? -22.383 -36.828 188.228 1.00 93.63  ? 274  ILE B CG1   1 
ATOM   6626  C  CG2   . ILE B 2  290 ? -24.160 -35.247 189.008 1.00 89.75  ? 274  ILE B CG2   1 
ATOM   6627  C  CD1   . ILE B 2  290 ? -21.286 -35.792 188.264 1.00 82.81  ? 274  ILE B CD1   1 
ATOM   6628  N  N     . LYS B 2  291 ? -26.616 -37.220 189.433 1.00 112.46 ? 275  LYS B N     1 
ATOM   6629  C  CA    . LYS B 2  291 ? -27.964 -36.927 189.903 1.00 115.77 ? 275  LYS B CA    1 
ATOM   6630  C  C     . LYS B 2  291 ? -27.884 -36.172 191.223 1.00 114.41 ? 275  LYS B C     1 
ATOM   6631  O  O     . LYS B 2  291 ? -26.991 -36.415 192.039 1.00 112.29 ? 275  LYS B O     1 
ATOM   6632  C  CB    . LYS B 2  291 ? -28.795 -38.208 190.090 1.00 118.79 ? 275  LYS B CB    1 
ATOM   6633  C  CG    . LYS B 2  291 ? -28.932 -39.073 188.845 1.00 120.41 ? 275  LYS B CG    1 
ATOM   6634  C  CD    . LYS B 2  291 ? -29.451 -38.278 187.657 1.00 120.63 ? 275  LYS B CD    1 
ATOM   6635  C  CE    . LYS B 2  291 ? -29.146 -38.985 186.346 1.00 119.97 ? 275  LYS B CE    1 
ATOM   6636  N  NZ    . LYS B 2  291 ? -28.819 -38.026 185.254 1.00 118.64 ? 275  LYS B NZ    1 
ATOM   6637  N  N     . VAL B 2  292 ? -28.828 -35.251 191.430 1.00 119.08 ? 276  VAL B N     1 
ATOM   6638  C  CA    . VAL B 2  292 ? -28.876 -34.479 192.669 1.00 110.79 ? 276  VAL B CA    1 
ATOM   6639  C  C     . VAL B 2  292 ? -30.245 -34.542 193.337 1.00 119.71 ? 276  VAL B C     1 
ATOM   6640  O  O     . VAL B 2  292 ? -30.511 -33.783 194.276 1.00 111.47 ? 276  VAL B O     1 
ATOM   6641  C  CB    . VAL B 2  292 ? -28.487 -33.010 192.414 1.00 89.69  ? 276  VAL B CB    1 
ATOM   6642  C  CG1   . VAL B 2  292 ? -27.004 -32.892 192.140 1.00 86.62  ? 276  VAL B CG1   1 
ATOM   6643  C  CG2   . VAL B 2  292 ? -29.297 -32.437 191.260 1.00 92.06  ? 276  VAL B CG2   1 
ATOM   6644  N  N     . ARG B 2  293 ? -31.123 -35.434 192.870 1.00 114.65 ? 277  ARG B N     1 
ATOM   6645  C  CA    . ARG B 2  293 ? -32.481 -35.482 193.413 1.00 117.62 ? 277  ARG B CA    1 
ATOM   6646  C  C     . ARG B 2  293 ? -32.470 -35.753 194.914 1.00 116.54 ? 277  ARG B C     1 
ATOM   6647  O  O     . ARG B 2  293 ? -33.022 -34.978 195.703 1.00 116.57 ? 277  ARG B O     1 
ATOM   6648  C  CB    . ARG B 2  293 ? -33.326 -36.535 192.691 1.00 122.60 ? 277  ARG B CB    1 
ATOM   6649  C  CG    . ARG B 2  293 ? -34.709 -36.691 193.329 1.00 122.64 ? 277  ARG B CG    1 
ATOM   6650  C  CD    . ARG B 2  293 ? -35.565 -37.791 192.713 1.00 128.78 ? 277  ARG B CD    1 
ATOM   6651  N  NE    . ARG B 2  293 ? -36.964 -37.639 193.116 1.00 148.03 ? 277  ARG B NE    1 
ATOM   6652  C  CZ    . ARG B 2  293 ? -37.843 -38.634 193.202 1.00 147.89 ? 277  ARG B CZ    1 
ATOM   6653  N  NH1   . ARG B 2  293 ? -37.473 -39.879 192.935 1.00 143.91 ? 277  ARG B NH1   1 
ATOM   6654  N  NH2   . ARG B 2  293 ? -39.092 -38.385 193.578 1.00 140.22 ? 277  ARG B NH2   1 
ATOM   6655  N  N     . GLN B 2  294 ? -31.833 -36.852 195.325 1.00 113.16 ? 278  GLN B N     1 
ATOM   6656  C  CA    . GLN B 2  294 ? -31.812 -37.231 196.736 1.00 115.85 ? 278  GLN B CA    1 
ATOM   6657  C  C     . GLN B 2  294 ? -31.158 -36.158 197.597 1.00 102.80 ? 278  GLN B C     1 
ATOM   6658  O  O     . GLN B 2  294 ? -31.594 -35.906 198.726 1.00 105.41 ? 278  GLN B O     1 
ATOM   6659  C  CB    . GLN B 2  294 ? -31.103 -38.574 196.908 1.00 126.30 ? 278  GLN B CB    1 
ATOM   6660  C  CG    . GLN B 2  294 ? -31.833 -39.745 196.260 1.00 132.58 ? 278  GLN B CG    1 
ATOM   6661  C  CD    . GLN B 2  294 ? -33.329 -39.749 196.544 1.00 136.61 ? 278  GLN B CD    1 
ATOM   6662  O  OE1   . GLN B 2  294 ? -33.766 -39.484 197.666 1.00 139.00 ? 278  GLN B OE1   1 
ATOM   6663  N  NE2   . GLN B 2  294 ? -34.122 -40.049 195.520 1.00 140.35 ? 278  GLN B NE2   1 
ATOM   6664  N  N     . LEU B 2  295 ? -30.113 -35.517 197.085 1.00 114.98 ? 279  LEU B N     1 
ATOM   6665  C  CA    . LEU B 2  295 ? -29.428 -34.492 197.863 1.00 109.16 ? 279  LEU B CA    1 
ATOM   6666  C  C     . LEU B 2  295 ? -30.260 -33.217 197.934 1.00 109.13 ? 279  LEU B C     1 
ATOM   6667  O  O     . LEU B 2  295 ? -30.360 -32.593 198.997 1.00 101.42 ? 279  LEU B O     1 
ATOM   6668  C  CB    . LEU B 2  295 ? -28.051 -34.221 197.258 1.00 107.45 ? 279  LEU B CB    1 
ATOM   6669  C  CG    . LEU B 2  295 ? -27.024 -35.320 197.548 1.00 101.55 ? 279  LEU B CG    1 
ATOM   6670  C  CD1   . LEU B 2  295 ? -25.887 -35.285 196.544 1.00 99.89  ? 279  LEU B CD1   1 
ATOM   6671  C  CD2   . LEU B 2  295 ? -26.495 -35.209 198.969 1.00 97.55  ? 279  LEU B CD2   1 
ATOM   6672  N  N     . SER B 2  296 ? -30.869 -32.823 196.813 1.00 102.21 ? 280  SER B N     1 
ATOM   6673  C  CA    . SER B 2  296 ? -31.711 -31.630 196.786 1.00 97.85  ? 280  SER B CA    1 
ATOM   6674  C  C     . SER B 2  296 ? -32.875 -31.737 197.766 1.00 103.16 ? 280  SER B C     1 
ATOM   6675  O  O     . SER B 2  296 ? -33.216 -30.757 198.439 1.00 104.56 ? 280  SER B O     1 
ATOM   6676  C  CB    . SER B 2  296 ? -32.231 -31.386 195.369 1.00 98.21  ? 280  SER B CB    1 
ATOM   6677  O  OG    . SER B 2  296 ? -31.260 -30.741 194.564 1.00 93.99  ? 280  SER B OG    1 
ATOM   6678  N  N     . LYS B 2  297 ? -33.514 -32.910 197.840 1.00 109.12 ? 281  LYS B N     1 
ATOM   6679  C  CA    . LYS B 2  297 ? -34.543 -33.147 198.854 1.00 112.06 ? 281  LYS B CA    1 
ATOM   6680  C  C     . LYS B 2  297 ? -34.104 -32.724 200.251 1.00 110.01 ? 281  LYS B C     1 
ATOM   6681  O  O     . LYS B 2  297 ? -34.894 -32.136 200.996 1.00 112.94 ? 281  LYS B O     1 
ATOM   6682  C  CB    . LYS B 2  297 ? -34.993 -34.610 198.851 1.00 116.23 ? 281  LYS B CB    1 
ATOM   6683  C  CG    . LYS B 2  297 ? -36.079 -34.900 197.820 1.00 122.02 ? 281  LYS B CG    1 
ATOM   6684  C  CD    . LYS B 2  297 ? -36.319 -36.387 197.622 1.00 123.95 ? 281  LYS B CD    1 
ATOM   6685  C  CE    . LYS B 2  297 ? -37.122 -36.643 196.355 1.00 131.42 ? 281  LYS B CE    1 
ATOM   6686  N  NZ    . LYS B 2  297 ? -37.751 -37.994 196.358 1.00 136.55 ? 281  LYS B NZ    1 
ATOM   6687  N  N     . LEU B 2  298 ? -32.868 -33.034 200.648 1.00 105.99 ? 282  LEU B N     1 
ATOM   6688  C  CA    . LEU B 2  298 ? -32.459 -32.675 202.006 1.00 96.22  ? 282  LEU B CA    1 
ATOM   6689  C  C     . LEU B 2  298 ? -32.572 -31.177 202.275 1.00 99.94  ? 282  LEU B C     1 
ATOM   6690  O  O     . LEU B 2  298 ? -32.433 -30.756 203.429 1.00 84.26  ? 282  LEU B O     1 
ATOM   6691  C  CB    . LEU B 2  298 ? -31.023 -33.125 202.272 1.00 88.35  ? 282  LEU B CB    1 
ATOM   6692  C  CG    . LEU B 2  298 ? -30.557 -34.503 201.798 1.00 99.87  ? 282  LEU B CG    1 
ATOM   6693  C  CD1   . LEU B 2  298 ? -29.329 -34.896 202.580 1.00 96.93  ? 282  LEU B CD1   1 
ATOM   6694  C  CD2   . LEU B 2  298 ? -31.633 -35.556 201.962 1.00 109.72 ? 282  LEU B CD2   1 
ATOM   6695  N  N     . LEU B 2  299 ? -32.776 -30.370 201.234 1.00 89.35  ? 283  LEU B N     1 
ATOM   6696  C  CA    . LEU B 2  299 ? -32.867 -28.920 201.312 1.00 94.78  ? 283  LEU B CA    1 
ATOM   6697  C  C     . LEU B 2  299 ? -34.307 -28.400 201.226 1.00 107.26 ? 283  LEU B C     1 
ATOM   6698  O  O     . LEU B 2  299 ? -34.502 -27.241 200.855 1.00 101.92 ? 283  LEU B O     1 
ATOM   6699  C  CB    . LEU B 2  299 ? -32.008 -28.283 200.219 1.00 92.50  ? 283  LEU B CB    1 
ATOM   6700  C  CG    . LEU B 2  299 ? -30.514 -28.615 200.250 1.00 78.85  ? 283  LEU B CG    1 
ATOM   6701  C  CD1   . LEU B 2  299 ? -29.790 -27.948 199.093 1.00 69.70  ? 283  LEU B CD1   1 
ATOM   6702  C  CD2   . LEU B 2  299 ? -29.901 -28.202 201.578 1.00 76.27  ? 283  LEU B CD2   1 
ATOM   6703  N  N     . ARG B 2  300 ? -35.322 -29.224 201.517 1.00 121.15 ? 284  ARG B N     1 
ATOM   6704  C  CA    . ARG B 2  300 ? -36.700 -28.788 201.264 1.00 119.66 ? 284  ARG B CA    1 
ATOM   6705  C  C     . ARG B 2  300 ? -37.099 -27.593 202.124 1.00 116.23 ? 284  ARG B C     1 
ATOM   6706  O  O     . ARG B 2  300 ? -37.704 -26.638 201.624 1.00 116.44 ? 284  ARG B O     1 
ATOM   6707  C  CB    . ARG B 2  300 ? -37.700 -29.927 201.464 1.00 122.89 ? 284  ARG B CB    1 
ATOM   6708  C  CG    . ARG B 2  300 ? -37.634 -31.044 200.444 1.00 128.33 ? 284  ARG B CG    1 
ATOM   6709  C  CD    . ARG B 2  300 ? -38.579 -32.161 200.840 1.00 135.65 ? 284  ARG B CD    1 
ATOM   6710  N  NE    . ARG B 2  300 ? -38.566 -33.272 199.896 1.00 138.70 ? 284  ARG B NE    1 
ATOM   6711  C  CZ    . ARG B 2  300 ? -39.175 -34.433 200.112 1.00 142.08 ? 284  ARG B CZ    1 
ATOM   6712  N  NH1   . ARG B 2  300 ? -39.855 -34.625 201.234 1.00 145.72 ? 284  ARG B NH1   1 
ATOM   6713  N  NH2   . ARG B 2  300 ? -39.117 -35.396 199.203 1.00 142.47 ? 284  ARG B NH2   1 
ATOM   6714  N  N     . GLY B 2  301 ? -36.799 -27.628 203.415 1.00 96.58  ? 285  GLY B N     1 
ATOM   6715  C  CA    . GLY B 2  301 ? -37.286 -26.575 204.280 1.00 81.19  ? 285  GLY B CA    1 
ATOM   6716  C  C     . GLY B 2  301 ? -36.521 -25.280 204.077 1.00 75.39  ? 285  GLY B C     1 
ATOM   6717  O  O     . GLY B 2  301 ? -35.540 -25.202 203.338 1.00 96.46  ? 285  GLY B O     1 
ATOM   6718  N  N     . THR B 2  302 ? -36.989 -24.231 204.748 1.00 66.53  ? 286  THR B N     1 
ATOM   6719  C  CA    . THR B 2  302 ? -36.262 -22.963 204.813 1.00 59.87  ? 286  THR B CA    1 
ATOM   6720  C  C     . THR B 2  302 ? -35.433 -22.967 206.089 1.00 57.22  ? 286  THR B C     1 
ATOM   6721  O  O     . THR B 2  302 ? -35.866 -22.491 207.138 1.00 54.38  ? 286  THR B O     1 
ATOM   6722  C  CB    . THR B 2  302 ? -37.223 -21.783 204.759 1.00 66.66  ? 286  THR B CB    1 
ATOM   6723  O  OG1   . THR B 2  302 ? -38.102 -21.939 203.636 1.00 68.16  ? 286  THR B OG1   1 
ATOM   6724  C  CG2   . THR B 2  302 ? -36.460 -20.472 204.630 1.00 60.65  ? 286  THR B CG2   1 
ATOM   6725  N  N     . LYS B 2  303 ? -34.211 -23.486 205.992 1.00 61.50  ? 287  LYS B N     1 
ATOM   6726  C  CA    . LYS B 2  303 ? -33.373 -23.700 207.160 1.00 63.60  ? 287  LYS B CA    1 
ATOM   6727  C  C     . LYS B 2  303 ? -32.184 -22.748 207.182 1.00 57.80  ? 287  LYS B C     1 
ATOM   6728  O  O     . LYS B 2  303 ? -31.758 -22.224 206.148 1.00 51.42  ? 287  LYS B O     1 
ATOM   6729  C  CB    . LYS B 2  303 ? -32.856 -25.141 207.182 1.00 64.46  ? 287  LYS B CB    1 
ATOM   6730  C  CG    . LYS B 2  303 ? -33.928 -26.189 207.412 1.00 77.33  ? 287  LYS B CG    1 
ATOM   6731  C  CD    . LYS B 2  303 ? -33.324 -27.583 207.477 1.00 84.49  ? 287  LYS B CD    1 
ATOM   6732  C  CE    . LYS B 2  303 ? -34.391 -28.651 207.679 1.00 86.33  ? 287  LYS B CE    1 
ATOM   6733  N  NZ    . LYS B 2  303 ? -33.827 -30.026 207.573 1.00 81.99  ? 287  LYS B NZ    1 
ATOM   6734  N  N     . ALA B 2  304 ? -31.686 -22.505 208.394 1.00 60.47  ? 288  ALA B N     1 
ATOM   6735  C  CA    . ALA B 2  304 ? -30.468 -21.732 208.597 1.00 56.81  ? 288  ALA B CA    1 
ATOM   6736  C  C     . ALA B 2  304 ? -29.282 -22.382 207.894 1.00 63.01  ? 288  ALA B C     1 
ATOM   6737  O  O     . ALA B 2  304 ? -29.083 -23.598 207.989 1.00 64.96  ? 288  ALA B O     1 
ATOM   6738  C  CB    . ALA B 2  304 ? -30.179 -21.584 210.091 1.00 51.77  ? 288  ALA B CB    1 
ATOM   6739  N  N     . LEU B 2  305 ? -28.499 -21.565 207.181 1.00 59.33  ? 289  LEU B N     1 
ATOM   6740  C  CA    . LEU B 2  305 ? -27.360 -22.068 206.415 1.00 57.66  ? 289  LEU B CA    1 
ATOM   6741  C  C     . LEU B 2  305 ? -26.447 -22.926 207.276 1.00 66.37  ? 289  LEU B C     1 
ATOM   6742  O  O     . LEU B 2  305 ? -25.797 -23.852 206.777 1.00 65.98  ? 289  LEU B O     1 
ATOM   6743  C  CB    . LEU B 2  305 ? -26.565 -20.902 205.832 1.00 53.19  ? 289  LEU B CB    1 
ATOM   6744  C  CG    . LEU B 2  305 ? -27.220 -20.171 204.668 1.00 53.83  ? 289  LEU B CG    1 
ATOM   6745  C  CD1   . LEU B 2  305 ? -26.202 -19.302 203.957 1.00 59.13  ? 289  LEU B CD1   1 
ATOM   6746  C  CD2   . LEU B 2  305 ? -27.837 -21.177 203.709 1.00 53.62  ? 289  LEU B CD2   1 
ATOM   6747  N  N     . THR B 2  306 ? -26.384 -22.616 208.566 1.00 63.48  ? 290  THR B N     1 
ATOM   6748  C  CA    . THR B 2  306 ? -25.450 -23.179 209.523 1.00 56.96  ? 290  THR B CA    1 
ATOM   6749  C  C     . THR B 2  306 ? -25.957 -24.471 210.159 1.00 66.87  ? 290  THR B C     1 
ATOM   6750  O  O     . THR B 2  306 ? -25.173 -25.184 210.797 1.00 68.44  ? 290  THR B O     1 
ATOM   6751  C  CB    . THR B 2  306 ? -25.162 -22.098 210.588 1.00 58.06  ? 290  THR B CB    1 
ATOM   6752  O  OG1   . THR B 2  306 ? -23.824 -21.608 210.438 1.00 56.53  ? 290  THR B OG1   1 
ATOM   6753  C  CG2   . THR B 2  306 ? -25.407 -22.570 212.026 1.00 67.80  ? 290  THR B CG2   1 
ATOM   6754  N  N     . GLU B 2  307 ? -27.210 -24.845 209.910 1.00 76.76  ? 291  GLU B N     1 
ATOM   6755  C  CA    . GLU B 2  307 ? -27.766 -26.047 210.516 1.00 81.45  ? 291  GLU B CA    1 
ATOM   6756  C  C     . GLU B 2  307 ? -27.119 -27.317 209.971 1.00 81.20  ? 291  GLU B C     1 
ATOM   6757  O  O     . GLU B 2  307 ? -26.988 -27.498 208.757 1.00 81.98  ? 291  GLU B O     1 
ATOM   6758  C  CB    . GLU B 2  307 ? -29.272 -26.094 210.261 1.00 79.85  ? 291  GLU B CB    1 
ATOM   6759  C  CG    . GLU B 2  307 ? -29.999 -27.235 210.946 1.00 84.42  ? 291  GLU B CG    1 
ATOM   6760  C  CD    . GLU B 2  307 ? -31.501 -27.159 210.751 1.00 82.84  ? 291  GLU B CD    1 
ATOM   6761  O  OE1   . GLU B 2  307 ? -32.098 -26.117 211.094 1.00 78.44  ? 291  GLU B OE1   1 
ATOM   6762  O  OE2   . GLU B 2  307 ? -32.087 -28.153 210.276 1.00 85.40  ? 291  GLU B OE2   1 
ATOM   6763  N  N     . VAL B 2  308 ? -26.741 -28.202 210.889 1.00 86.33  ? 292  VAL B N     1 
ATOM   6764  C  CA    . VAL B 2  308 ? -26.243 -29.539 210.577 1.00 81.16  ? 292  VAL B CA    1 
ATOM   6765  C  C     . VAL B 2  308 ? -27.435 -30.441 210.299 1.00 79.52  ? 292  VAL B C     1 
ATOM   6766  O  O     . VAL B 2  308 ? -28.400 -30.459 211.073 1.00 97.42  ? 292  VAL B O     1 
ATOM   6767  C  CB    . VAL B 2  308 ? -25.382 -30.086 211.726 1.00 77.75  ? 292  VAL B CB    1 
ATOM   6768  C  CG1   . VAL B 2  308 ? -25.126 -31.575 211.532 1.00 79.32  ? 292  VAL B CG1   1 
ATOM   6769  C  CG2   . VAL B 2  308 ? -24.070 -29.318 211.819 1.00 65.69  ? 292  VAL B CG2   1 
ATOM   6770  N  N     . ILE B 2  309 ? -27.396 -31.182 209.192 1.00 69.22  ? 293  ILE B N     1 
ATOM   6771  C  CA    . ILE B 2  309 ? -28.467 -32.103 208.845 1.00 89.04  ? 293  ILE B CA    1 
ATOM   6772  C  C     . ILE B 2  309 ? -27.948 -33.482 208.448 1.00 93.36  ? 293  ILE B C     1 
ATOM   6773  O  O     . ILE B 2  309 ? -27.122 -33.595 207.538 1.00 87.19  ? 293  ILE B O     1 
ATOM   6774  C  CB    . ILE B 2  309 ? -29.368 -31.534 207.735 1.00 84.68  ? 293  ILE B CB    1 
ATOM   6775  C  CG1   . ILE B 2  309 ? -28.541 -31.029 206.556 1.00 75.55  ? 293  ILE B CG1   1 
ATOM   6776  C  CG2   . ILE B 2  309 ? -30.230 -30.404 208.282 1.00 90.21  ? 293  ILE B CG2   1 
ATOM   6777  C  CD1   . ILE B 2  309 ? -29.345 -30.192 205.583 1.00 85.77  ? 293  ILE B CD1   1 
ATOM   6778  N  N     . PRO B 2  310 ? -28.384 -34.549 209.123 1.00 99.67  ? 294  PRO B N     1 
ATOM   6779  C  CA    . PRO B 2  310 ? -27.932 -35.909 208.799 1.00 95.85  ? 294  PRO B CA    1 
ATOM   6780  C  C     . PRO B 2  310 ? -28.286 -36.292 207.370 1.00 97.61  ? 294  PRO B C     1 
ATOM   6781  O  O     . PRO B 2  310 ? -29.389 -36.020 206.892 1.00 106.48 ? 294  PRO B O     1 
ATOM   6782  C  CB    . PRO B 2  310 ? -28.675 -36.774 209.822 1.00 98.44  ? 294  PRO B CB    1 
ATOM   6783  C  CG    . PRO B 2  310 ? -29.924 -35.992 210.099 1.00 107.59 ? 294  PRO B CG    1 
ATOM   6784  C  CD    . PRO B 2  310 ? -29.441 -34.565 210.150 1.00 102.17 ? 294  PRO B CD    1 
ATOM   6785  N  N     . LEU B 2  311 ? -27.338 -36.922 206.679 1.00 97.31  ? 295  LEU B N     1 
ATOM   6786  C  CA    . LEU B 2  311 ? -27.620 -37.389 205.329 1.00 112.39 ? 295  LEU B CA    1 
ATOM   6787  C  C     . LEU B 2  311 ? -28.584 -38.572 205.383 1.00 119.08 ? 295  LEU B C     1 
ATOM   6788  O  O     . LEU B 2  311 ? -28.380 -39.519 206.148 1.00 120.55 ? 295  LEU B O     1 
ATOM   6789  C  CB    . LEU B 2  311 ? -26.304 -37.829 204.684 1.00 114.53 ? 295  LEU B CB    1 
ATOM   6790  C  CG    . LEU B 2  311 ? -25.447 -36.928 203.791 1.00 104.37 ? 295  LEU B CG    1 
ATOM   6791  C  CD1   . LEU B 2  311 ? -24.219 -37.697 203.321 1.00 105.60 ? 295  LEU B CD1   1 
ATOM   6792  C  CD2   . LEU B 2  311 ? -26.212 -36.397 202.606 1.00 109.15 ? 295  LEU B CD2   1 
ATOM   6793  N  N     . THR B 2  312 ? -29.618 -38.529 204.542 1.00 124.13 ? 296  THR B N     1 
ATOM   6794  C  CA    . THR B 2  312 ? -30.516 -39.660 204.349 1.00 130.52 ? 296  THR B CA    1 
ATOM   6795  C  C     . THR B 2  312 ? -29.831 -40.821 203.633 1.00 135.26 ? 296  THR B C     1 
ATOM   6796  O  O     . THR B 2  312 ? -28.830 -40.655 202.930 1.00 139.46 ? 296  THR B O     1 
ATOM   6797  C  CB    . THR B 2  312 ? -31.769 -39.240 203.576 1.00 135.68 ? 296  THR B CB    1 
ATOM   6798  O  OG1   . THR B 2  312 ? -31.418 -38.877 202.234 1.00 139.76 ? 296  THR B OG1   1 
ATOM   6799  C  CG2   . THR B 2  312 ? -32.467 -38.078 204.271 1.00 129.77 ? 296  THR B CG2   1 
ATOM   6800  N  N     . GLU B 2  313 ? -30.376 -42.022 203.857 1.00 145.90 ? 297  GLU B N     1 
ATOM   6801  C  CA    . GLU B 2  313 ? -29.810 -43.227 203.258 1.00 149.77 ? 297  GLU B CA    1 
ATOM   6802  C  C     . GLU B 2  313 ? -29.721 -43.091 201.740 1.00 155.68 ? 297  GLU B C     1 
ATOM   6803  O  O     . GLU B 2  313 ? -28.707 -43.452 201.130 1.00 143.19 ? 297  GLU B O     1 
ATOM   6804  C  CB    . GLU B 2  313 ? -30.666 -44.434 203.646 1.00 151.77 ? 297  GLU B CB    1 
ATOM   6805  C  CG    . GLU B 2  313 ? -30.149 -45.777 203.171 1.00 151.14 ? 297  GLU B CG    1 
ATOM   6806  C  CD    . GLU B 2  313 ? -29.083 -46.345 204.092 1.00 148.21 ? 297  GLU B CD    1 
ATOM   6807  O  OE1   . GLU B 2  313 ? -28.659 -45.635 205.028 1.00 143.67 ? 297  GLU B OE1   1 
ATOM   6808  O  OE2   . GLU B 2  313 ? -28.678 -47.508 203.886 1.00 146.95 ? 297  GLU B OE2   1 
ATOM   6809  N  N     . GLU B 2  314 ? -30.784 -42.568 201.121 1.00 166.86 ? 298  GLU B N     1 
ATOM   6810  C  CA    . GLU B 2  314 ? -30.810 -42.330 199.678 1.00 166.00 ? 298  GLU B CA    1 
ATOM   6811  C  C     . GLU B 2  314 ? -29.708 -41.366 199.255 1.00 162.33 ? 298  GLU B C     1 
ATOM   6812  O  O     . GLU B 2  314 ? -28.984 -41.609 198.282 1.00 162.60 ? 298  GLU B O     1 
ATOM   6813  C  CB    . GLU B 2  314 ? -32.181 -41.793 199.255 1.00 167.62 ? 298  GLU B CB    1 
ATOM   6814  C  CG    . GLU B 2  314 ? -33.346 -42.772 199.394 1.00 170.71 ? 298  GLU B CG    1 
ATOM   6815  C  CD    . GLU B 2  314 ? -33.857 -42.907 200.819 1.00 174.77 ? 298  GLU B CD    1 
ATOM   6816  O  OE1   . GLU B 2  314 ? -33.197 -42.400 201.751 1.00 173.17 ? 298  GLU B OE1   1 
ATOM   6817  O  OE2   . GLU B 2  314 ? -34.930 -43.519 201.005 1.00 182.79 ? 298  GLU B OE2   1 
ATOM   6818  N  N     . ALA B 2  315 ? -29.580 -40.258 199.986 1.00 167.11 ? 299  ALA B N     1 
ATOM   6819  C  CA    . ALA B 2  315 ? -28.565 -39.246 199.710 1.00 162.81 ? 299  ALA B CA    1 
ATOM   6820  C  C     . ALA B 2  315 ? -27.152 -39.811 199.783 1.00 161.29 ? 299  ALA B C     1 
ATOM   6821  O  O     . ALA B 2  315 ? -26.310 -39.494 198.935 1.00 156.65 ? 299  ALA B O     1 
ATOM   6822  C  CB    . ALA B 2  315 ? -28.721 -38.073 200.677 1.00 158.29 ? 299  ALA B CB    1 
ATOM   6823  N  N     . GLU B 2  316 ? -26.863 -40.632 200.794 1.00 146.35 ? 300  GLU B N     1 
ATOM   6824  C  CA    . GLU B 2  316 ? -25.539 -41.242 200.873 1.00 136.23 ? 300  GLU B CA    1 
ATOM   6825  C  C     . GLU B 2  316 ? -25.240 -42.091 199.642 1.00 125.34 ? 300  GLU B C     1 
ATOM   6826  O  O     . GLU B 2  316 ? -24.128 -42.031 199.104 1.00 107.82 ? 300  GLU B O     1 
ATOM   6827  C  CB    . GLU B 2  316 ? -25.425 -42.081 202.145 1.00 127.50 ? 300  GLU B CB    1 
ATOM   6828  C  CG    . GLU B 2  316 ? -25.680 -41.298 203.421 1.00 121.16 ? 300  GLU B CG    1 
ATOM   6829  C  CD    . GLU B 2  316 ? -24.433 -41.125 204.262 1.00 114.76 ? 300  GLU B CD    1 
ATOM   6830  O  OE1   . GLU B 2  316 ? -23.319 -41.198 203.700 1.00 99.44  ? 300  GLU B OE1   1 
ATOM   6831  O  OE2   . GLU B 2  316 ? -24.569 -40.917 205.486 1.00 121.56 ? 300  GLU B OE2   1 
ATOM   6832  N  N     . LEU B 2  317 ? -26.203 -42.896 199.181 1.00 131.26 ? 301  LEU B N     1 
ATOM   6833  C  CA    . LEU B 2  317 ? -25.953 -43.672 197.970 1.00 124.04 ? 301  LEU B CA    1 
ATOM   6834  C  C     . LEU B 2  317 ? -25.728 -42.749 196.781 1.00 123.92 ? 301  LEU B C     1 
ATOM   6835  O  O     . LEU B 2  317 ? -24.818 -42.972 195.974 1.00 120.25 ? 301  LEU B O     1 
ATOM   6836  C  CB    . LEU B 2  317 ? -27.109 -44.629 197.682 1.00 134.61 ? 301  LEU B CB    1 
ATOM   6837  C  CG    . LEU B 2  317 ? -26.915 -45.429 196.387 1.00 126.95 ? 301  LEU B CG    1 
ATOM   6838  C  CD1   . LEU B 2  317 ? -25.828 -46.484 196.550 1.00 121.98 ? 301  LEU B CD1   1 
ATOM   6839  C  CD2   . LEU B 2  317 ? -28.220 -46.060 195.919 1.00 118.90 ? 301  LEU B CD2   1 
ATOM   6840  N  N     . GLU B 2  318 ? -26.562 -41.711 196.651 1.00 128.55 ? 302  GLU B N     1 
ATOM   6841  C  CA    . GLU B 2  318 ? -26.433 -40.793 195.526 1.00 124.05 ? 302  GLU B CA    1 
ATOM   6842  C  C     . GLU B 2  318 ? -25.045 -40.168 195.506 1.00 119.63 ? 302  GLU B C     1 
ATOM   6843  O  O     . GLU B 2  318 ? -24.412 -40.073 194.448 1.00 119.01 ? 302  GLU B O     1 
ATOM   6844  C  CB    . GLU B 2  318 ? -27.515 -39.715 195.593 1.00 121.54 ? 302  GLU B CB    1 
ATOM   6845  C  CG    . GLU B 2  318 ? -27.605 -38.859 194.342 1.00 118.64 ? 302  GLU B CG    1 
ATOM   6846  C  CD    . GLU B 2  318 ? -28.674 -37.792 194.441 1.00 117.28 ? 302  GLU B CD    1 
ATOM   6847  O  OE1   . GLU B 2  318 ? -28.692 -37.060 195.450 1.00 117.48 ? 302  GLU B OE1   1 
ATOM   6848  O  OE2   . GLU B 2  318 ? -29.504 -37.693 193.514 1.00 119.46 ? 302  GLU B OE2   1 
ATOM   6849  N  N     . LEU B 2  319 ? -24.563 -39.729 196.671 1.00 128.44 ? 303  LEU B N     1 
ATOM   6850  C  CA    . LEU B 2  319 ? -23.237 -39.126 196.753 1.00 113.68 ? 303  LEU B CA    1 
ATOM   6851  C  C     . LEU B 2  319 ? -22.159 -40.131 196.367 1.00 115.86 ? 303  LEU B C     1 
ATOM   6852  O  O     . LEU B 2  319 ? -21.248 -39.816 195.593 1.00 113.81 ? 303  LEU B O     1 
ATOM   6853  C  CB    . LEU B 2  319 ? -22.998 -38.596 198.168 1.00 109.27 ? 303  LEU B CB    1 
ATOM   6854  C  CG    . LEU B 2  319 ? -21.606 -38.051 198.498 1.00 99.47  ? 303  LEU B CG    1 
ATOM   6855  C  CD1   . LEU B 2  319 ? -21.191 -36.974 197.511 1.00 85.45  ? 303  LEU B CD1   1 
ATOM   6856  C  CD2   . LEU B 2  319 ? -21.566 -37.521 199.925 1.00 93.18  ? 303  LEU B CD2   1 
ATOM   6857  N  N     . ALA B 2  320 ? -22.251 -41.353 196.899 1.00 122.55 ? 304  ALA B N     1 
ATOM   6858  C  CA    . ALA B 2  320 ? -21.260 -42.378 196.588 1.00 113.76 ? 304  ALA B CA    1 
ATOM   6859  C  C     . ALA B 2  320 ? -21.258 -42.705 195.101 1.00 124.17 ? 304  ALA B C     1 
ATOM   6860  O  O     . ALA B 2  320 ? -20.194 -42.834 194.484 1.00 124.56 ? 304  ALA B O     1 
ATOM   6861  C  CB    . ALA B 2  320 ? -21.525 -43.634 197.416 1.00 116.77 ? 304  ALA B CB    1 
ATOM   6862  N  N     . GLU B 2  321 ? -22.449 -42.843 194.512 1.00 126.72 ? 305  GLU B N     1 
ATOM   6863  C  CA    . GLU B 2  321 ? -22.562 -43.069 193.075 1.00 126.80 ? 305  GLU B CA    1 
ATOM   6864  C  C     . GLU B 2  321 ? -21.924 -41.940 192.277 1.00 126.60 ? 305  GLU B C     1 
ATOM   6865  O  O     . GLU B 2  321 ? -21.321 -42.187 191.226 1.00 125.71 ? 305  GLU B O     1 
ATOM   6866  C  CB    . GLU B 2  321 ? -24.032 -43.240 192.688 1.00 124.97 ? 305  GLU B CB    1 
ATOM   6867  C  CG    . GLU B 2  321 ? -24.312 -43.068 191.205 1.00 129.01 ? 305  GLU B CG    1 
ATOM   6868  C  CD    . GLU B 2  321 ? -24.374 -44.390 190.468 1.00 136.71 ? 305  GLU B CD    1 
ATOM   6869  O  OE1   . GLU B 2  321 ? -24.232 -45.443 191.124 1.00 139.90 ? 305  GLU B OE1   1 
ATOM   6870  O  OE2   . GLU B 2  321 ? -24.555 -44.375 189.232 1.00 140.02 ? 305  GLU B OE2   1 
ATOM   6871  N  N     . ASN B 2  322 ? -22.014 -40.703 192.771 1.00 122.34 ? 306  ASN B N     1 
ATOM   6872  C  CA    . ASN B 2  322 ? -21.434 -39.582 192.040 1.00 116.57 ? 306  ASN B CA    1 
ATOM   6873  C  C     . ASN B 2  322 ? -19.913 -39.592 192.121 1.00 119.97 ? 306  ASN B C     1 
ATOM   6874  O  O     . ASN B 2  322 ? -19.237 -39.252 191.142 1.00 118.53 ? 306  ASN B O     1 
ATOM   6875  C  CB    . ASN B 2  322 ? -21.999 -38.261 192.564 1.00 98.38  ? 306  ASN B CB    1 
ATOM   6876  C  CG    . ASN B 2  322 ? -23.371 -37.952 191.999 1.00 98.57  ? 306  ASN B CG    1 
ATOM   6877  O  OD1   . ASN B 2  322 ? -23.700 -38.357 190.883 1.00 101.64 ? 306  ASN B OD1   1 
ATOM   6878  N  ND2   . ASN B 2  322 ? -24.176 -37.224 192.762 1.00 102.43 ? 306  ASN B ND2   1 
ATOM   6879  N  N     . ARG B 2  323 ? -19.351 -39.967 193.273 1.00 114.64 ? 307  ARG B N     1 
ATOM   6880  C  CA    . ARG B 2  323 ? -17.900 -40.109 193.352 1.00 117.19 ? 307  ARG B CA    1 
ATOM   6881  C  C     . ARG B 2  323 ? -17.409 -41.139 192.346 1.00 128.47 ? 307  ARG B C     1 
ATOM   6882  O  O     . ARG B 2  323 ? -16.397 -40.927 191.667 1.00 116.57 ? 307  ARG B O     1 
ATOM   6883  C  CB    . ARG B 2  323 ? -17.478 -40.513 194.763 1.00 108.27 ? 307  ARG B CB    1 
ATOM   6884  C  CG    . ARG B 2  323 ? -17.894 -39.555 195.854 1.00 97.67  ? 307  ARG B CG    1 
ATOM   6885  C  CD    . ARG B 2  323 ? -17.103 -39.824 197.120 1.00 105.69 ? 307  ARG B CD    1 
ATOM   6886  N  NE    . ARG B 2  323 ? -16.971 -38.638 197.957 1.00 107.88 ? 307  ARG B NE    1 
ATOM   6887  C  CZ    . ARG B 2  323 ? -17.534 -38.512 199.154 1.00 110.83 ? 307  ARG B CZ    1 
ATOM   6888  N  NH1   . ARG B 2  323 ? -18.287 -39.492 199.639 1.00 105.67 ? 307  ARG B NH1   1 
ATOM   6889  N  NH2   . ARG B 2  323 ? -17.365 -37.401 199.858 1.00 106.06 ? 307  ARG B NH2   1 
ATOM   6890  N  N     . GLU B 2  324 ? -18.118 -42.266 192.245 1.00 145.82 ? 308  GLU B N     1 
ATOM   6891  C  CA    . GLU B 2  324 ? -17.794 -43.287 191.255 1.00 147.44 ? 308  GLU B CA    1 
ATOM   6892  C  C     . GLU B 2  324 ? -17.792 -42.712 189.843 1.00 142.99 ? 308  GLU B C     1 
ATOM   6893  O  O     . GLU B 2  324 ? -16.839 -42.911 189.081 1.00 142.39 ? 308  GLU B O     1 
ATOM   6894  C  CB    . GLU B 2  324 ? -18.786 -44.446 191.360 1.00 150.33 ? 308  GLU B CB    1 
ATOM   6895  C  CG    . GLU B 2  324 ? -18.542 -45.388 192.531 1.00 156.76 ? 308  GLU B CG    1 
ATOM   6896  C  CD    . GLU B 2  324 ? -17.085 -45.453 192.945 1.00 158.42 ? 308  GLU B CD    1 
ATOM   6897  O  OE1   . GLU B 2  324 ? -16.277 -46.043 192.198 1.00 157.99 ? 308  GLU B OE1   1 
ATOM   6898  O  OE2   . GLU B 2  324 ? -16.749 -44.915 194.021 1.00 159.72 ? 308  GLU B OE2   1 
ATOM   6899  N  N     . ILE B 2  325 ? -18.864 -42.005 189.472 1.00 124.35 ? 309  ILE B N     1 
ATOM   6900  C  CA    . ILE B 2  325 ? -18.954 -41.427 188.132 1.00 121.55 ? 309  ILE B CA    1 
ATOM   6901  C  C     . ILE B 2  325 ? -17.800 -40.464 187.877 1.00 114.96 ? 309  ILE B C     1 
ATOM   6902  O  O     . ILE B 2  325 ? -17.187 -40.477 186.802 1.00 117.25 ? 309  ILE B O     1 
ATOM   6903  C  CB    . ILE B 2  325 ? -20.320 -40.739 187.941 1.00 117.55 ? 309  ILE B CB    1 
ATOM   6904  C  CG1   . ILE B 2  325 ? -21.452 -41.768 187.984 1.00 118.27 ? 309  ILE B CG1   1 
ATOM   6905  C  CG2   . ILE B 2  325 ? -20.361 -39.990 186.620 1.00 111.58 ? 309  ILE B CG2   1 
ATOM   6906  C  CD1   . ILE B 2  325 ? -22.838 -41.154 187.946 1.00 112.62 ? 309  ILE B CD1   1 
ATOM   6907  N  N     . LEU B 2  326 ? -17.485 -39.612 188.854 1.00 128.66 ? 310  LEU B N     1 
ATOM   6908  C  CA    . LEU B 2  326 ? -16.355 -38.700 188.710 1.00 118.40 ? 310  LEU B CA    1 
ATOM   6909  C  C     . LEU B 2  326 ? -15.014 -39.415 188.646 1.00 115.73 ? 310  LEU B C     1 
ATOM   6910  O  O     . LEU B 2  326 ? -14.048 -38.838 188.138 1.00 115.08 ? 310  LEU B O     1 
ATOM   6911  C  CB    . LEU B 2  326 ? -16.333 -37.691 189.855 1.00 105.67 ? 310  LEU B CB    1 
ATOM   6912  C  CG    . LEU B 2  326 ? -17.517 -36.733 189.886 1.00 99.57  ? 310  LEU B CG    1 
ATOM   6913  C  CD1   . LEU B 2  326 ? -17.397 -35.787 191.064 1.00 94.03  ? 310  LEU B CD1   1 
ATOM   6914  C  CD2   . LEU B 2  326 ? -17.562 -35.960 188.581 1.00 89.86  ? 310  LEU B CD2   1 
ATOM   6915  N  N     . LYS B 2  327 ? -14.926 -40.647 189.154 1.00 113.76 ? 311  LYS B N     1 
ATOM   6916  C  CA    . LYS B 2  327 ? -13.666 -41.381 189.083 1.00 119.17 ? 311  LYS B CA    1 
ATOM   6917  C  C     . LYS B 2  327 ? -13.350 -41.862 187.671 1.00 121.40 ? 311  LYS B C     1 
ATOM   6918  O  O     . LYS B 2  327 ? -12.173 -41.955 187.302 1.00 105.05 ? 311  LYS B O     1 
ATOM   6919  C  CB    . LYS B 2  327 ? -13.714 -42.567 190.046 1.00 117.67 ? 311  LYS B CB    1 
ATOM   6920  C  CG    . LYS B 2  327 ? -13.338 -42.223 191.478 1.00 116.61 ? 311  LYS B CG    1 
ATOM   6921  C  CD    . LYS B 2  327 ? -13.420 -43.445 192.377 1.00 121.04 ? 311  LYS B CD    1 
ATOM   6922  C  CE    . LYS B 2  327 ? -13.988 -43.083 193.740 1.00 124.49 ? 311  LYS B CE    1 
ATOM   6923  N  NZ    . LYS B 2  327 ? -13.044 -42.256 194.539 1.00 120.77 ? 311  LYS B NZ    1 
ATOM   6924  N  N     . GLU B 2  328 ? -14.370 -42.148 186.863 1.00 132.67 ? 312  GLU B N     1 
ATOM   6925  C  CA    . GLU B 2  328 ? -14.112 -42.689 185.538 1.00 129.77 ? 312  GLU B CA    1 
ATOM   6926  C  C     . GLU B 2  328 ? -13.909 -41.560 184.535 1.00 124.49 ? 312  GLU B C     1 
ATOM   6927  O  O     . GLU B 2  328 ? -14.315 -40.420 184.778 1.00 126.47 ? 312  GLU B O     1 
ATOM   6928  C  CB    . GLU B 2  328 ? -15.268 -43.596 185.109 1.00 132.13 ? 312  GLU B CB    1 
ATOM   6929  C  CG    . GLU B 2  328 ? -16.576 -42.884 184.809 1.00 132.99 ? 312  GLU B CG    1 
ATOM   6930  C  CD    . GLU B 2  328 ? -17.753 -43.842 184.717 1.00 133.28 ? 312  GLU B CD    1 
ATOM   6931  O  OE1   . GLU B 2  328 ? -17.638 -44.867 184.012 1.00 133.34 ? 312  GLU B OE1   1 
ATOM   6932  O  OE2   . GLU B 2  328 ? -18.795 -43.568 185.348 1.00 134.11 ? 312  GLU B OE2   1 
ATOM   6933  N  N     . PRO B 2  329 ? -13.273 -41.834 183.398 1.00 114.50 ? 313  PRO B N     1 
ATOM   6934  C  CA    . PRO B 2  329 ? -13.034 -40.767 182.424 1.00 111.09 ? 313  PRO B CA    1 
ATOM   6935  C  C     . PRO B 2  329 ? -14.292 -40.420 181.648 1.00 102.37 ? 313  PRO B C     1 
ATOM   6936  O  O     . PRO B 2  329 ? -15.207 -41.233 181.497 1.00 108.71 ? 313  PRO B O     1 
ATOM   6937  C  CB    . PRO B 2  329 ? -11.968 -41.373 181.504 1.00 110.67 ? 313  PRO B CB    1 
ATOM   6938  C  CG    . PRO B 2  329 ? -12.281 -42.829 181.532 1.00 107.00 ? 313  PRO B CG    1 
ATOM   6939  C  CD    . PRO B 2  329 ? -12.660 -43.105 182.967 1.00 114.92 ? 313  PRO B CD    1 
ATOM   6940  N  N     . VAL B 2  330 ? -14.329 -39.182 181.153 1.00 106.78 ? 314  VAL B N     1 
ATOM   6941  C  CA    . VAL B 2  330 ? -15.483 -38.737 180.387 1.00 98.30  ? 314  VAL B CA    1 
ATOM   6942  C  C     . VAL B 2  330 ? -15.551 -39.530 179.088 1.00 94.53  ? 314  VAL B C     1 
ATOM   6943  O  O     . VAL B 2  330 ? -14.526 -39.933 178.522 1.00 98.17  ? 314  VAL B O     1 
ATOM   6944  C  CB    . VAL B 2  330 ? -15.402 -37.221 180.124 1.00 91.46  ? 314  VAL B CB    1 
ATOM   6945  C  CG1   . VAL B 2  330 ? -16.657 -36.716 179.425 1.00 89.50  ? 314  VAL B CG1   1 
ATOM   6946  C  CG2   . VAL B 2  330 ? -15.180 -36.474 181.427 1.00 99.36  ? 314  VAL B CG2   1 
ATOM   6947  N  N     . HIS B 2  331 ? -16.768 -39.762 178.611 1.00 96.60  ? 315  HIS B N     1 
ATOM   6948  C  CA    . HIS B 2  331 ? -16.981 -40.566 177.418 1.00 101.23 ? 315  HIS B CA    1 
ATOM   6949  C  C     . HIS B 2  331 ? -16.895 -39.698 176.168 1.00 98.40  ? 315  HIS B C     1 
ATOM   6950  O  O     . HIS B 2  331 ? -17.420 -38.582 176.132 1.00 95.38  ? 315  HIS B O     1 
ATOM   6951  C  CB    . HIS B 2  331 ? -18.319 -41.301 177.462 1.00 105.71 ? 315  HIS B CB    1 
ATOM   6952  C  CG    . HIS B 2  331 ? -18.557 -42.166 176.264 1.00 116.09 ? 315  HIS B CG    1 
ATOM   6953  N  ND1   . HIS B 2  331 ? -19.398 -41.804 175.234 1.00 118.63 ? 315  HIS B ND1   1 
ATOM   6954  C  CD2   . HIS B 2  331 ? -18.029 -43.363 175.916 1.00 117.25 ? 315  HIS B CD2   1 
ATOM   6955  C  CE1   . HIS B 2  331 ? -19.395 -42.752 174.313 1.00 118.42 ? 315  HIS B CE1   1 
ATOM   6956  N  NE2   . HIS B 2  331 ? -18.571 -43.709 174.702 1.00 120.25 ? 315  HIS B NE2   1 
ATOM   6957  N  N     . GLY B 2  332 ? -16.224 -40.223 175.147 1.00 102.14 ? 316  GLY B N     1 
ATOM   6958  C  CA    . GLY B 2  332 ? -16.121 -39.559 173.863 1.00 90.95  ? 316  GLY B CA    1 
ATOM   6959  C  C     . GLY B 2  332 ? -15.357 -38.252 173.867 1.00 80.29  ? 316  GLY B C     1 
ATOM   6960  O  O     . GLY B 2  332 ? -15.786 -37.261 173.268 1.00 77.29  ? 316  GLY B O     1 
ATOM   6961  N  N     . VAL B 2  333 ? -14.194 -38.261 174.511 1.00 82.18  ? 317  VAL B N     1 
ATOM   6962  C  CA    . VAL B 2  333 ? -13.313 -37.103 174.589 1.00 71.32  ? 317  VAL B CA    1 
ATOM   6963  C  C     . VAL B 2  333 ? -11.966 -37.542 174.036 1.00 72.99  ? 317  VAL B C     1 
ATOM   6964  O  O     . VAL B 2  333 ? -11.359 -38.498 174.535 1.00 75.36  ? 317  VAL B O     1 
ATOM   6965  C  CB    . VAL B 2  333 ? -13.179 -36.553 176.020 1.00 76.74  ? 317  VAL B CB    1 
ATOM   6966  C  CG1   . VAL B 2  333 ? -14.505 -36.051 176.512 1.00 83.46  ? 317  VAL B CG1   1 
ATOM   6967  C  CG2   . VAL B 2  333 ? -12.662 -37.613 176.987 1.00 85.93  ? 317  VAL B CG2   1 
ATOM   6968  N  N     . TYR B 2  334 ? -11.527 -36.884 172.972 1.00 76.78  ? 318  TYR B N     1 
ATOM   6969  C  CA    . TYR B 2  334 ? -10.281 -37.269 172.333 1.00 73.56  ? 318  TYR B CA    1 
ATOM   6970  C  C     . TYR B 2  334 ? -9.776  -36.091 171.521 1.00 70.74  ? 318  TYR B C     1 
ATOM   6971  O  O     . TYR B 2  334 ? -10.514 -35.139 171.247 1.00 72.25  ? 318  TYR B O     1 
ATOM   6972  C  CB    . TYR B 2  334 ? -10.453 -38.522 171.460 1.00 68.64  ? 318  TYR B CB    1 
ATOM   6973  C  CG    . TYR B 2  334 ? -11.515 -38.423 170.380 1.00 68.71  ? 318  TYR B CG    1 
ATOM   6974  C  CD1   . TYR B 2  334 ? -12.840 -38.757 170.640 1.00 64.84  ? 318  TYR B CD1   1 
ATOM   6975  C  CD2   . TYR B 2  334 ? -11.184 -38.022 169.092 1.00 67.52  ? 318  TYR B CD2   1 
ATOM   6976  C  CE1   . TYR B 2  334 ? -13.807 -38.678 169.647 1.00 63.62  ? 318  TYR B CE1   1 
ATOM   6977  C  CE2   . TYR B 2  334 ? -12.143 -37.939 168.097 1.00 62.90  ? 318  TYR B CE2   1 
ATOM   6978  C  CZ    . TYR B 2  334 ? -13.449 -38.267 168.378 1.00 57.00  ? 318  TYR B CZ    1 
ATOM   6979  O  OH    . TYR B 2  334 ? -14.394 -38.182 167.382 1.00 53.77  ? 318  TYR B OH    1 
ATOM   6980  N  N     . TYR B 2  335 ? -8.500  -36.162 171.153 1.00 59.63  ? 319  TYR B N     1 
ATOM   6981  C  CA    . TYR B 2  335 ? -7.878  -35.073 170.420 1.00 58.04  ? 319  TYR B CA    1 
ATOM   6982  C  C     . TYR B 2  335 ? -8.245  -35.168 168.945 1.00 57.07  ? 319  TYR B C     1 
ATOM   6983  O  O     . TYR B 2  335 ? -8.078  -36.219 168.318 1.00 56.71  ? 319  TYR B O     1 
ATOM   6984  C  CB    . TYR B 2  335 ? -6.364  -35.119 170.610 1.00 58.28  ? 319  TYR B CB    1 
ATOM   6985  C  CG    . TYR B 2  335 ? -5.608  -34.158 169.732 1.00 55.92  ? 319  TYR B CG    1 
ATOM   6986  C  CD1   . TYR B 2  335 ? -5.686  -32.789 169.939 1.00 56.89  ? 319  TYR B CD1   1 
ATOM   6987  C  CD2   . TYR B 2  335 ? -4.812  -34.622 168.697 1.00 53.57  ? 319  TYR B CD2   1 
ATOM   6988  C  CE1   . TYR B 2  335 ? -4.994  -31.909 169.135 1.00 63.35  ? 319  TYR B CE1   1 
ATOM   6989  C  CE2   . TYR B 2  335 ? -4.118  -33.753 167.889 1.00 61.33  ? 319  TYR B CE2   1 
ATOM   6990  C  CZ    . TYR B 2  335 ? -4.211  -32.397 168.111 1.00 65.21  ? 319  TYR B CZ    1 
ATOM   6991  O  OH    . TYR B 2  335 ? -3.516  -31.528 167.303 1.00 69.68  ? 319  TYR B OH    1 
ATOM   6992  N  N     . ASP B 2  336 ? -8.750  -34.063 168.400 1.00 54.48  ? 320  ASP B N     1 
ATOM   6993  C  CA    . ASP B 2  336 ? -8.992  -33.911 166.974 1.00 57.68  ? 320  ASP B CA    1 
ATOM   6994  C  C     . ASP B 2  336 ? -7.912  -33.027 166.371 1.00 62.74  ? 320  ASP B C     1 
ATOM   6995  O  O     . ASP B 2  336 ? -7.845  -31.836 166.712 1.00 65.03  ? 320  ASP B O     1 
ATOM   6996  C  CB    . ASP B 2  336 ? -10.375 -33.311 166.724 1.00 59.03  ? 320  ASP B CB    1 
ATOM   6997  C  CG    . ASP B 2  336 ? -10.734 -33.235 165.244 1.00 64.39  ? 320  ASP B CG    1 
ATOM   6998  O  OD1   . ASP B 2  336 ? -9.832  -33.236 164.379 1.00 60.42  ? 320  ASP B OD1   1 
ATOM   6999  O  OD2   . ASP B 2  336 ? -11.944 -33.166 164.941 1.00 76.57  ? 320  ASP B OD2   1 
ATOM   7000  N  N     . PRO B 2  337 ? -7.050  -33.541 165.491 1.00 63.94  ? 321  PRO B N     1 
ATOM   7001  C  CA    . PRO B 2  337 ? -5.916  -32.731 165.021 1.00 62.17  ? 321  PRO B CA    1 
ATOM   7002  C  C     . PRO B 2  337 ? -6.338  -31.513 164.218 1.00 65.55  ? 321  PRO B C     1 
ATOM   7003  O  O     . PRO B 2  337 ? -5.515  -30.611 164.013 1.00 68.27  ? 321  PRO B O     1 
ATOM   7004  C  CB    . PRO B 2  337 ? -5.112  -33.713 164.156 1.00 53.29  ? 321  PRO B CB    1 
ATOM   7005  C  CG    . PRO B 2  337 ? -5.557  -35.069 164.603 1.00 65.06  ? 321  PRO B CG    1 
ATOM   7006  C  CD    . PRO B 2  337 ? -7.004  -34.909 164.953 1.00 57.81  ? 321  PRO B CD    1 
ATOM   7007  N  N     . SER B 2  338 ? -7.587  -31.449 163.760 1.00 56.78  ? 322  SER B N     1 
ATOM   7008  C  CA    . SER B 2  338 ? -8.032  -30.312 162.969 1.00 66.43  ? 322  SER B CA    1 
ATOM   7009  C  C     . SER B 2  338 ? -8.638  -29.193 163.809 1.00 79.42  ? 322  SER B C     1 
ATOM   7010  O  O     . SER B 2  338 ? -8.896  -28.112 163.268 1.00 83.32  ? 322  SER B O     1 
ATOM   7011  C  CB    . SER B 2  338 ? -9.044  -30.767 161.908 1.00 62.67  ? 322  SER B CB    1 
ATOM   7012  O  OG    . SER B 2  338 ? -10.182 -31.376 162.495 1.00 76.71  ? 322  SER B OG    1 
ATOM   7013  N  N     . LYS B 2  339 ? -8.898  -29.420 165.095 1.00 66.66  ? 323  LYS B N     1 
ATOM   7014  C  CA    . LYS B 2  339 ? -9.534  -28.409 165.926 1.00 65.90  ? 323  LYS B CA    1 
ATOM   7015  C  C     . LYS B 2  339 ? -8.483  -27.717 166.787 1.00 64.46  ? 323  LYS B C     1 
ATOM   7016  O  O     . LYS B 2  339 ? -7.454  -28.305 167.128 1.00 61.46  ? 323  LYS B O     1 
ATOM   7017  C  CB    . LYS B 2  339 ? -10.602 -29.027 166.833 1.00 67.77  ? 323  LYS B CB    1 
ATOM   7018  C  CG    . LYS B 2  339 ? -11.784 -29.652 166.114 1.00 69.76  ? 323  LYS B CG    1 
ATOM   7019  C  CD    . LYS B 2  339 ? -12.626 -30.474 167.082 1.00 71.13  ? 323  LYS B CD    1 
ATOM   7020  C  CE    . LYS B 2  339 ? -13.990 -30.799 166.500 1.00 80.47  ? 323  LYS B CE    1 
ATOM   7021  N  NZ    . LYS B 2  339 ? -14.782 -31.691 167.396 1.00 81.74  ? 323  LYS B NZ    1 
ATOM   7022  N  N     . ASP B 2  340 ? -8.754  -26.465 167.147 1.00 61.48  ? 324  ASP B N     1 
ATOM   7023  C  CA    . ASP B 2  340 ? -7.816  -25.719 167.973 1.00 60.69  ? 324  ASP B CA    1 
ATOM   7024  C  C     . ASP B 2  340 ? -7.916  -26.161 169.429 1.00 54.00  ? 324  ASP B C     1 
ATOM   7025  O  O     . ASP B 2  340 ? -8.939  -26.687 169.876 1.00 60.31  ? 324  ASP B O     1 
ATOM   7026  C  CB    . ASP B 2  340 ? -8.039  -24.210 167.861 1.00 59.54  ? 324  ASP B CB    1 
ATOM   7027  C  CG    . ASP B 2  340 ? -7.878  -23.701 166.445 1.00 68.15  ? 324  ASP B CG    1 
ATOM   7028  O  OD1   . ASP B 2  340 ? -6.793  -23.909 165.858 1.00 71.53  ? 324  ASP B OD1   1 
ATOM   7029  O  OD2   . ASP B 2  340 ? -8.822  -23.071 165.927 1.00 90.61  ? 324  ASP B OD2   1 
ATOM   7030  N  N     . LEU B 2  341 ? -6.832  -25.948 170.170 1.00 56.53  ? 325  LEU B N     1 
ATOM   7031  C  CA    . LEU B 2  341 ? -6.859  -26.138 171.612 1.00 52.81  ? 325  LEU B CA    1 
ATOM   7032  C  C     . LEU B 2  341 ? -7.193  -24.824 172.307 1.00 58.61  ? 325  LEU B C     1 
ATOM   7033  O  O     . LEU B 2  341 ? -6.728  -23.755 171.899 1.00 61.08  ? 325  LEU B O     1 
ATOM   7034  C  CB    . LEU B 2  341 ? -5.518  -26.668 172.123 1.00 58.95  ? 325  LEU B CB    1 
ATOM   7035  C  CG    . LEU B 2  341 ? -5.106  -28.068 171.668 1.00 57.19  ? 325  LEU B CG    1 
ATOM   7036  C  CD1   . LEU B 2  341 ? -3.635  -28.306 171.957 1.00 56.97  ? 325  LEU B CD1   1 
ATOM   7037  C  CD2   . LEU B 2  341 ? -5.967  -29.128 172.330 1.00 52.73  ? 325  LEU B CD2   1 
ATOM   7038  N  N     . ILE B 2  342 ? -7.998  -24.918 173.363 1.00 56.31  ? 326  ILE B N     1 
ATOM   7039  C  CA    . ILE B 2  342 ? -8.363  -23.786 174.205 1.00 47.89  ? 326  ILE B CA    1 
ATOM   7040  C  C     . ILE B 2  342 ? -7.947  -24.103 175.634 1.00 47.54  ? 326  ILE B C     1 
ATOM   7041  O  O     . ILE B 2  342 ? -8.132  -25.231 176.104 1.00 52.22  ? 326  ILE B O     1 
ATOM   7042  C  CB    . ILE B 2  342 ? -9.871  -23.480 174.111 1.00 53.67  ? 326  ILE B CB    1 
ATOM   7043  C  CG1   . ILE B 2  342 ? -10.226 -23.048 172.688 1.00 52.66  ? 326  ILE B CG1   1 
ATOM   7044  C  CG2   . ILE B 2  342 ? -10.271 -22.399 175.100 1.00 57.79  ? 326  ILE B CG2   1 
ATOM   7045  C  CD1   . ILE B 2  342 ? -11.706 -22.894 172.452 1.00 65.13  ? 326  ILE B CD1   1 
ATOM   7046  N  N     . ALA B 2  343 ? -7.385  -23.114 176.326 1.00 48.73  ? 327  ALA B N     1 
ATOM   7047  C  CA    . ALA B 2  343 ? -7.015  -23.255 177.728 1.00 50.43  ? 327  ALA B CA    1 
ATOM   7048  C  C     . ALA B 2  343 ? -7.684  -22.179 178.570 1.00 55.03  ? 327  ALA B C     1 
ATOM   7049  O  O     . ALA B 2  343 ? -7.639  -20.993 178.224 1.00 54.76  ? 327  ALA B O     1 
ATOM   7050  C  CB    . ALA B 2  343 ? -5.497  -23.186 177.903 1.00 56.72  ? 327  ALA B CB    1 
ATOM   7051  N  N     . GLU B 2  344 ? -8.306  -22.599 179.668 1.00 46.47  ? 328  GLU B N     1 
ATOM   7052  C  CA    . GLU B 2  344 ? -8.848  -21.702 180.677 1.00 46.21  ? 328  GLU B CA    1 
ATOM   7053  C  C     . GLU B 2  344 ? -8.020  -21.821 181.952 1.00 49.42  ? 328  GLU B C     1 
ATOM   7054  O  O     . GLU B 2  344 ? -7.633  -22.924 182.342 1.00 48.71  ? 328  GLU B O     1 
ATOM   7055  C  CB    . GLU B 2  344 ? -10.311 -22.043 180.955 1.00 57.97  ? 328  GLU B CB    1 
ATOM   7056  C  CG    . GLU B 2  344 ? -11.241 -21.729 179.794 1.00 58.06  ? 328  GLU B CG    1 
ATOM   7057  C  CD    . GLU B 2  344 ? -12.695 -22.003 180.126 1.00 65.82  ? 328  GLU B CD    1 
ATOM   7058  O  OE1   . GLU B 2  344 ? -13.527 -21.995 179.194 1.00 74.37  ? 328  GLU B OE1   1 
ATOM   7059  O  OE2   . GLU B 2  344 ? -13.002 -22.237 181.315 1.00 51.03  ? 328  GLU B OE2   1 
ATOM   7060  N  N     . ILE B 2  345 ? -7.767  -20.688 182.609 1.00 50.36  ? 329  ILE B N     1 
ATOM   7061  C  CA    . ILE B 2  345 ? -7.024  -20.630 183.867 1.00 49.66  ? 329  ILE B CA    1 
ATOM   7062  C  C     . ILE B 2  345 ? -7.882  -19.931 184.912 1.00 45.59  ? 329  ILE B C     1 
ATOM   7063  O  O     . ILE B 2  345 ? -8.439  -18.863 184.639 1.00 50.43  ? 329  ILE B O     1 
ATOM   7064  C  CB    . ILE B 2  345 ? -5.684  -19.891 183.697 1.00 50.29  ? 329  ILE B CB    1 
ATOM   7065  C  CG1   . ILE B 2  345 ? -4.834  -20.549 182.603 1.00 53.39  ? 329  ILE B CG1   1 
ATOM   7066  C  CG2   . ILE B 2  345 ? -4.950  -19.796 185.031 1.00 40.79  ? 329  ILE B CG2   1 
ATOM   7067  C  CD1   . ILE B 2  345 ? -3.481  -19.898 182.410 1.00 44.45  ? 329  ILE B CD1   1 
ATOM   7068  N  N     . GLN B 2  346 ? -7.980  -20.515 186.108 1.00 46.54  ? 330  GLN B N     1 
ATOM   7069  C  CA    . GLN B 2  346 ? -8.604  -19.831 187.234 1.00 45.76  ? 330  GLN B CA    1 
ATOM   7070  C  C     . GLN B 2  346 ? -7.581  -19.544 188.327 1.00 48.11  ? 330  GLN B C     1 
ATOM   7071  O  O     . GLN B 2  346 ? -6.759  -20.403 188.667 1.00 49.01  ? 330  GLN B O     1 
ATOM   7072  C  CB    . GLN B 2  346 ? -9.747  -20.659 187.829 1.00 42.11  ? 330  GLN B CB    1 
ATOM   7073  C  CG    . GLN B 2  346 ? -10.829 -21.044 186.843 1.00 38.96  ? 330  GLN B CG    1 
ATOM   7074  C  CD    . GLN B 2  346 ? -10.430 -22.236 185.999 1.00 50.12  ? 330  GLN B CD    1 
ATOM   7075  O  OE1   . GLN B 2  346 ? -9.779  -23.162 186.488 1.00 49.24  ? 330  GLN B OE1   1 
ATOM   7076  N  NE2   . GLN B 2  346 ? -10.800 -22.213 184.724 1.00 52.56  ? 330  GLN B NE2   1 
ATOM   7077  N  N     . LYS B 2  347 ? -7.669  -18.342 188.900 1.00 37.19  ? 331  LYS B N     1 
ATOM   7078  C  CA    . LYS B 2  347 ? -6.910  -17.970 190.087 1.00 36.00  ? 331  LYS B CA    1 
ATOM   7079  C  C     . LYS B 2  347 ? -7.624  -18.468 191.337 1.00 37.31  ? 331  LYS B C     1 
ATOM   7080  O  O     . LYS B 2  347 ? -8.737  -18.024 191.635 1.00 60.76  ? 331  LYS B O     1 
ATOM   7081  C  CB    . LYS B 2  347 ? -6.739  -16.453 190.126 1.00 38.40  ? 331  LYS B CB    1 
ATOM   7082  C  CG    . LYS B 2  347 ? -6.174  -15.892 191.416 1.00 42.33  ? 331  LYS B CG    1 
ATOM   7083  C  CD    . LYS B 2  347 ? -6.119  -14.369 191.344 1.00 45.45  ? 331  LYS B CD    1 
ATOM   7084  C  CE    . LYS B 2  347 ? -5.867  -13.751 192.711 1.00 58.11  ? 331  LYS B CE    1 
ATOM   7085  N  NZ    . LYS B 2  347 ? -5.892  -12.258 192.654 1.00 50.28  ? 331  LYS B NZ    1 
ATOM   7086  N  N     . GLN B 2  348 ? -6.991  -19.377 192.077 1.00 40.75  ? 332  GLN B N     1 
ATOM   7087  C  CA    . GLN B 2  348 ? -7.609  -19.956 193.264 1.00 37.26  ? 332  GLN B CA    1 
ATOM   7088  C  C     . GLN B 2  348 ? -7.161  -19.311 194.566 1.00 37.30  ? 332  GLN B C     1 
ATOM   7089  O  O     . GLN B 2  348 ? -7.691  -19.666 195.624 1.00 50.55  ? 332  GLN B O     1 
ATOM   7090  C  CB    . GLN B 2  348 ? -7.338  -21.463 193.334 1.00 43.90  ? 332  GLN B CB    1 
ATOM   7091  C  CG    . GLN B 2  348 ? -7.875  -22.234 192.145 1.00 59.77  ? 332  GLN B CG    1 
ATOM   7092  C  CD    . GLN B 2  348 ? -9.391  -22.303 192.104 1.00 59.81  ? 332  GLN B CD    1 
ATOM   7093  O  OE1   . GLN B 2  348 ? -10.084 -21.673 192.906 1.00 72.82  ? 332  GLN B OE1   1 
ATOM   7094  N  NE2   . GLN B 2  348 ? -9.916  -23.077 191.159 1.00 54.97  ? 332  GLN B NE2   1 
ATOM   7095  N  N     . GLY B 2  349 ? -6.182  -18.419 194.530 1.00 47.26  ? 333  GLY B N     1 
ATOM   7096  C  CA    . GLY B 2  349 ? -5.678  -17.817 195.744 1.00 45.74  ? 333  GLY B CA    1 
ATOM   7097  C  C     . GLY B 2  349 ? -4.557  -18.632 196.360 1.00 49.75  ? 333  GLY B C     1 
ATOM   7098  O  O     . GLY B 2  349 ? -4.393  -19.824 196.097 1.00 53.71  ? 333  GLY B O     1 
ATOM   7099  N  N     . GLN B 2  350 ? -3.758  -17.957 197.187 1.00 49.90  ? 334  GLN B N     1 
ATOM   7100  C  CA    . GLN B 2  350 ? -2.643  -18.591 197.890 1.00 55.72  ? 334  GLN B CA    1 
ATOM   7101  C  C     . GLN B 2  350 ? -1.641  -19.210 196.917 1.00 49.06  ? 334  GLN B C     1 
ATOM   7102  O  O     . GLN B 2  350 ? -1.052  -20.256 197.195 1.00 53.88  ? 334  GLN B O     1 
ATOM   7103  C  CB    . GLN B 2  350 ? -3.146  -19.636 198.891 1.00 58.05  ? 334  GLN B CB    1 
ATOM   7104  C  CG    . GLN B 2  350 ? -4.222  -19.108 199.824 1.00 54.99  ? 334  GLN B CG    1 
ATOM   7105  C  CD    . GLN B 2  350 ? -3.660  -18.347 201.008 1.00 71.08  ? 334  GLN B CD    1 
ATOM   7106  O  OE1   . GLN B 2  350 ? -2.795  -17.482 200.856 1.00 73.34  ? 334  GLN B OE1   1 
ATOM   7107  N  NE2   . GLN B 2  350 ? -4.155  -18.661 202.200 1.00 89.77  ? 334  GLN B NE2   1 
ATOM   7108  N  N     . GLY B 2  351 ? -1.472  -18.582 195.755 1.00 48.86  ? 335  GLY B N     1 
ATOM   7109  C  CA    . GLY B 2  351 ? -0.531  -19.049 194.757 1.00 46.23  ? 335  GLY B CA    1 
ATOM   7110  C  C     . GLY B 2  351 ? -0.945  -20.292 194.005 1.00 47.89  ? 335  GLY B C     1 
ATOM   7111  O  O     . GLY B 2  351 ? -0.094  -20.951 193.404 1.00 48.86  ? 335  GLY B O     1 
ATOM   7112  N  N     . GLN B 2  352 ? -2.226  -20.644 194.021 1.00 56.68  ? 336  GLN B N     1 
ATOM   7113  C  CA    . GLN B 2  352 ? -2.708  -21.837 193.341 1.00 51.28  ? 336  GLN B CA    1 
ATOM   7114  C  C     . GLN B 2  352 ? -3.497  -21.442 192.101 1.00 46.49  ? 336  GLN B C     1 
ATOM   7115  O  O     . GLN B 2  352 ? -4.348  -20.548 192.160 1.00 44.35  ? 336  GLN B O     1 
ATOM   7116  C  CB    . GLN B 2  352 ? -3.558  -22.691 194.281 1.00 49.92  ? 336  GLN B CB    1 
ATOM   7117  C  CG    . GLN B 2  352 ? -2.822  -23.059 195.558 1.00 56.71  ? 336  GLN B CG    1 
ATOM   7118  C  CD    . GLN B 2  352 ? -2.686  -24.556 195.743 1.00 61.35  ? 336  GLN B CD    1 
ATOM   7119  O  OE1   . GLN B 2  352 ? -3.309  -25.339 195.026 1.00 59.00  ? 336  GLN B OE1   1 
ATOM   7120  N  NE2   . GLN B 2  352 ? -1.851  -24.964 196.693 1.00 66.97  ? 336  GLN B NE2   1 
ATOM   7121  N  N     . TRP B 2  353 ? -3.180  -22.077 190.975 1.00 48.34  ? 337  TRP B N     1 
ATOM   7122  C  CA    . TRP B 2  353 ? -3.842  -21.810 189.704 1.00 49.14  ? 337  TRP B CA    1 
ATOM   7123  C  C     . TRP B 2  353 ? -4.280  -23.126 189.081 1.00 54.38  ? 337  TRP B C     1 
ATOM   7124  O  O     . TRP B 2  353 ? -3.487  -24.071 189.006 1.00 51.85  ? 337  TRP B O     1 
ATOM   7125  C  CB    . TRP B 2  353 ? -2.910  -21.041 188.764 1.00 38.76  ? 337  TRP B CB    1 
ATOM   7126  C  CG    . TRP B 2  353 ? -2.409  -19.799 189.398 1.00 33.72  ? 337  TRP B CG    1 
ATOM   7127  C  CD1   . TRP B 2  353 ? -1.469  -19.706 190.380 1.00 38.91  ? 337  TRP B CD1   1 
ATOM   7128  C  CD2   . TRP B 2  353 ? -2.808  -18.460 189.097 1.00 32.84  ? 337  TRP B CD2   1 
ATOM   7129  N  NE1   . TRP B 2  353 ? -1.269  -18.393 190.723 1.00 40.32  ? 337  TRP B NE1   1 
ATOM   7130  C  CE2   . TRP B 2  353 ? -2.075  -17.606 189.946 1.00 39.06  ? 337  TRP B CE2   1 
ATOM   7131  C  CE3   . TRP B 2  353 ? -3.713  -17.900 188.195 1.00 32.46  ? 337  TRP B CE3   1 
ATOM   7132  C  CZ2   . TRP B 2  353 ? -2.220  -16.222 189.921 1.00 40.34  ? 337  TRP B CZ2   1 
ATOM   7133  C  CZ3   . TRP B 2  353 ? -3.855  -16.525 188.169 1.00 39.84  ? 337  TRP B CZ3   1 
ATOM   7134  C  CH2   . TRP B 2  353 ? -3.113  -15.701 189.027 1.00 46.21  ? 337  TRP B CH2   1 
ATOM   7135  N  N     . THR B 2  354 ? -5.525  -23.177 188.613 1.00 51.97  ? 338  THR B N     1 
ATOM   7136  C  CA    . THR B 2  354 ? -6.069  -24.350 187.949 1.00 45.69  ? 338  THR B CA    1 
ATOM   7137  C  C     . THR B 2  354 ? -6.272  -24.051 186.472 1.00 44.83  ? 338  THR B C     1 
ATOM   7138  O  O     . THR B 2  354 ? -6.479  -22.898 186.081 1.00 42.70  ? 338  THR B O     1 
ATOM   7139  C  CB    . THR B 2  354 ? -7.391  -24.778 188.579 1.00 57.71  ? 338  THR B CB    1 
ATOM   7140  O  OG1   . THR B 2  354 ? -8.247  -23.634 188.714 1.00 56.50  ? 338  THR B OG1   1 
ATOM   7141  C  CG2   . THR B 2  354 ? -7.135  -25.398 189.947 1.00 47.47  ? 338  THR B CG2   1 
ATOM   7142  N  N     . TYR B 2  355 ? -6.220  -25.100 185.653 1.00 45.04  ? 339  TYR B N     1 
ATOM   7143  C  CA    . TYR B 2  355 ? -6.417  -24.933 184.221 1.00 48.66  ? 339  TYR B CA    1 
ATOM   7144  C  C     . TYR B 2  355 ? -7.050  -26.177 183.614 1.00 49.83  ? 339  TYR B C     1 
ATOM   7145  O  O     . TYR B 2  355 ? -6.950  -27.281 184.155 1.00 50.06  ? 339  TYR B O     1 
ATOM   7146  C  CB    . TYR B 2  355 ? -5.094  -24.618 183.507 1.00 60.16  ? 339  TYR B CB    1 
ATOM   7147  C  CG    . TYR B 2  355 ? -4.092  -25.755 183.531 1.00 51.71  ? 339  TYR B CG    1 
ATOM   7148  C  CD1   . TYR B 2  355 ? -3.219  -25.910 184.599 1.00 44.12  ? 339  TYR B CD1   1 
ATOM   7149  C  CD2   . TYR B 2  355 ? -4.017  -26.667 182.486 1.00 46.69  ? 339  TYR B CD2   1 
ATOM   7150  C  CE1   . TYR B 2  355 ? -2.304  -26.941 184.629 1.00 54.66  ? 339  TYR B CE1   1 
ATOM   7151  C  CE2   . TYR B 2  355 ? -3.105  -27.706 182.509 1.00 57.62  ? 339  TYR B CE2   1 
ATOM   7152  C  CZ    . TYR B 2  355 ? -2.249  -27.837 183.584 1.00 62.05  ? 339  TYR B CZ    1 
ATOM   7153  O  OH    . TYR B 2  355 ? -1.339  -28.869 183.620 1.00 60.93  ? 339  TYR B OH    1 
ATOM   7154  N  N     . GLN B 2  356 ? -7.731  -25.967 182.486 1.00 51.15  ? 340  GLN B N     1 
ATOM   7155  C  CA    . GLN B 2  356 ? -8.283  -27.035 181.666 1.00 49.33  ? 340  GLN B CA    1 
ATOM   7156  C  C     . GLN B 2  356 ? -7.935  -26.764 180.207 1.00 54.37  ? 340  GLN B C     1 
ATOM   7157  O  O     . GLN B 2  356 ? -7.999  -25.619 179.747 1.00 50.93  ? 340  GLN B O     1 
ATOM   7158  C  CB    . GLN B 2  356 ? -9.798  -27.162 181.860 1.00 58.69  ? 340  GLN B CB    1 
ATOM   7159  C  CG    . GLN B 2  356 ? -10.223 -27.303 183.323 1.00 57.67  ? 340  GLN B CG    1 
ATOM   7160  C  CD    . GLN B 2  356 ? -10.248 -25.979 184.067 1.00 53.77  ? 340  GLN B CD    1 
ATOM   7161  O  OE1   . GLN B 2  356 ? -10.685 -24.961 183.530 1.00 53.06  ? 340  GLN B OE1   1 
ATOM   7162  N  NE2   . GLN B 2  356 ? -9.760  -25.985 185.306 1.00 48.78  ? 340  GLN B NE2   1 
ATOM   7163  N  N     . ILE B 2  357 ? -7.588  -27.825 179.479 1.00 55.54  ? 341  ILE B N     1 
ATOM   7164  C  CA    . ILE B 2  357 ? -7.317  -27.765 178.046 1.00 54.91  ? 341  ILE B CA    1 
ATOM   7165  C  C     . ILE B 2  357 ? -8.361  -28.592 177.314 1.00 52.81  ? 341  ILE B C     1 
ATOM   7166  O  O     . ILE B 2  357 ? -8.548  -29.775 177.621 1.00 57.37  ? 341  ILE B O     1 
ATOM   7167  C  CB    . ILE B 2  357 ? -5.906  -28.281 177.709 1.00 61.57  ? 341  ILE B CB    1 
ATOM   7168  C  CG1   . ILE B 2  357 ? -4.840  -27.513 178.487 1.00 55.82  ? 341  ILE B CG1   1 
ATOM   7169  C  CG2   . ILE B 2  357 ? -5.647  -28.174 176.213 1.00 67.24  ? 341  ILE B CG2   1 
ATOM   7170  C  CD1   . ILE B 2  357 ? -3.440  -28.026 178.240 1.00 56.19  ? 341  ILE B CD1   1 
ATOM   7171  N  N     . TYR B 2  358 ? -9.043  -27.970 176.355 1.00 56.19  ? 342  TYR B N     1 
ATOM   7172  C  CA    . TYR B 2  358 ? -10.121 -28.636 175.641 1.00 58.31  ? 342  TYR B CA    1 
ATOM   7173  C  C     . TYR B 2  358 ? -10.215 -28.102 174.219 1.00 62.97  ? 342  TYR B C     1 
ATOM   7174  O  O     . TYR B 2  358 ? -9.698  -27.028 173.899 1.00 64.09  ? 342  TYR B O     1 
ATOM   7175  C  CB    . TYR B 2  358 ? -11.459 -28.442 176.362 1.00 64.93  ? 342  TYR B CB    1 
ATOM   7176  C  CG    . TYR B 2  358 ? -11.885 -26.992 176.445 1.00 58.54  ? 342  TYR B CG    1 
ATOM   7177  C  CD1   . TYR B 2  358 ? -12.636 -26.407 175.430 1.00 60.07  ? 342  TYR B CD1   1 
ATOM   7178  C  CD2   . TYR B 2  358 ? -11.540 -26.209 177.540 1.00 55.45  ? 342  TYR B CD2   1 
ATOM   7179  C  CE1   . TYR B 2  358 ? -13.030 -25.081 175.503 1.00 68.89  ? 342  TYR B CE1   1 
ATOM   7180  C  CE2   . TYR B 2  358 ? -11.929 -24.879 177.623 1.00 61.94  ? 342  TYR B CE2   1 
ATOM   7181  C  CZ    . TYR B 2  358 ? -12.676 -24.319 176.601 1.00 67.69  ? 342  TYR B CZ    1 
ATOM   7182  O  OH    . TYR B 2  358 ? -13.065 -22.995 176.671 1.00 54.95  ? 342  TYR B OH    1 
ATOM   7183  N  N     . GLN B 2  359 ? -10.922 -28.855 173.375 1.00 62.35  ? 343  GLN B N     1 
ATOM   7184  C  CA    . GLN B 2  359 ? -11.258 -28.419 172.026 1.00 65.03  ? 343  GLN B CA    1 
ATOM   7185  C  C     . GLN B 2  359 ? -12.741 -28.142 171.875 1.00 62.66  ? 343  GLN B C     1 
ATOM   7186  O  O     . GLN B 2  359 ? -13.123 -27.286 171.075 1.00 60.75  ? 343  GLN B O     1 
ATOM   7187  C  CB    . GLN B 2  359 ? -10.834 -29.460 170.980 1.00 69.53  ? 343  GLN B CB    1 
ATOM   7188  C  CG    . GLN B 2  359 ? -9.349  -29.779 170.964 1.00 65.51  ? 343  GLN B CG    1 
ATOM   7189  C  CD    . GLN B 2  359 ? -8.999  -30.869 169.967 1.00 64.31  ? 343  GLN B CD    1 
ATOM   7190  O  OE1   . GLN B 2  359 ? -9.464  -32.003 170.080 1.00 72.23  ? 343  GLN B OE1   1 
ATOM   7191  N  NE2   . GLN B 2  359 ? -8.178  -30.527 168.980 1.00 56.39  ? 343  GLN B NE2   1 
ATOM   7192  N  N     . GLU B 2  360 ? -13.575 -28.852 172.630 1.00 63.59  ? 344  GLU B N     1 
ATOM   7193  C  CA    . GLU B 2  360 ? -15.007 -28.644 172.667 1.00 67.26  ? 344  GLU B CA    1 
ATOM   7194  C  C     . GLU B 2  360 ? -15.416 -28.457 174.120 1.00 68.20  ? 344  GLU B C     1 
ATOM   7195  O  O     . GLU B 2  360 ? -14.921 -29.171 175.003 1.00 67.29  ? 344  GLU B O     1 
ATOM   7196  C  CB    . GLU B 2  360 ? -15.778 -29.816 172.044 1.00 69.38  ? 344  GLU B CB    1 
ATOM   7197  C  CG    . GLU B 2  360 ? -15.407 -30.087 170.601 1.00 76.26  ? 344  GLU B CG    1 
ATOM   7198  C  CD    . GLU B 2  360 ? -16.098 -29.139 169.637 1.00 80.46  ? 344  GLU B CD    1 
ATOM   7199  O  OE1   . GLU B 2  360 ? -16.611 -28.090 170.085 1.00 80.77  ? 344  GLU B OE1   1 
ATOM   7200  O  OE2   . GLU B 2  360 ? -16.124 -29.440 168.427 1.00 80.53  ? 344  GLU B OE2   1 
ATOM   7201  N  N     . PRO B 2  361 ? -16.311 -27.511 174.391 1.00 64.01  ? 345  PRO B N     1 
ATOM   7202  C  CA    . PRO B 2  361 ? -16.776 -27.275 175.763 1.00 56.85  ? 345  PRO B CA    1 
ATOM   7203  C  C     . PRO B 2  361 ? -17.167 -28.555 176.484 1.00 57.18  ? 345  PRO B C     1 
ATOM   7204  O  O     . PRO B 2  361 ? -17.831 -29.427 175.919 1.00 63.49  ? 345  PRO B O     1 
ATOM   7205  C  CB    . PRO B 2  361 ? -17.981 -26.357 175.557 1.00 62.02  ? 345  PRO B CB    1 
ATOM   7206  C  CG    . PRO B 2  361 ? -17.610 -25.569 174.347 1.00 63.94  ? 345  PRO B CG    1 
ATOM   7207  C  CD    . PRO B 2  361 ? -16.889 -26.543 173.442 1.00 63.55  ? 345  PRO B CD    1 
ATOM   7208  N  N     . PHE B 2  362 ? -16.710 -28.684 177.731 1.00 61.45  ? 346  PHE B N     1 
ATOM   7209  C  CA    . PHE B 2  362 ? -17.050 -29.797 178.613 1.00 68.43  ? 346  PHE B CA    1 
ATOM   7210  C  C     . PHE B 2  362 ? -16.447 -31.116 178.156 1.00 64.71  ? 346  PHE B C     1 
ATOM   7211  O  O     . PHE B 2  362 ? -16.738 -32.162 178.751 1.00 69.13  ? 346  PHE B O     1 
ATOM   7212  C  CB    . PHE B 2  362 ? -18.568 -29.937 178.769 1.00 70.82  ? 346  PHE B CB    1 
ATOM   7213  C  CG    . PHE B 2  362 ? -19.247 -28.654 179.141 1.00 66.97  ? 346  PHE B CG    1 
ATOM   7214  C  CD1   . PHE B 2  362 ? -19.183 -28.168 180.436 1.00 67.63  ? 346  PHE B CD1   1 
ATOM   7215  C  CD2   . PHE B 2  362 ? -19.912 -27.907 178.181 1.00 68.22  ? 346  PHE B CD2   1 
ATOM   7216  C  CE1   . PHE B 2  362 ? -19.798 -26.975 180.773 1.00 76.30  ? 346  PHE B CE1   1 
ATOM   7217  C  CE2   . PHE B 2  362 ? -20.525 -26.714 178.509 1.00 68.40  ? 346  PHE B CE2   1 
ATOM   7218  C  CZ    . PHE B 2  362 ? -20.469 -26.247 179.807 1.00 74.11  ? 346  PHE B CZ    1 
ATOM   7219  N  N     . LYS B 2  363 ? -15.601 -31.099 177.131 1.00 65.56  ? 347  LYS B N     1 
ATOM   7220  C  CA    . LYS B 2  363 ? -14.806 -32.257 176.751 1.00 63.44  ? 347  LYS B CA    1 
ATOM   7221  C  C     . LYS B 2  363 ? -13.329 -31.937 176.964 1.00 57.31  ? 347  LYS B C     1 
ATOM   7222  O  O     . LYS B 2  363 ? -12.560 -31.753 176.019 1.00 64.42  ? 347  LYS B O     1 
ATOM   7223  C  CB    . LYS B 2  363 ? -15.088 -32.604 175.276 1.00 66.01  ? 347  LYS B CB    1 
ATOM   7224  C  CG    . LYS B 2  363 ? -16.556 -32.867 174.915 1.00 65.33  ? 347  LYS B CG    1 
ATOM   7225  C  CD    . LYS B 2  363 ? -17.093 -34.172 175.470 1.00 72.96  ? 347  LYS B CD    1 
ATOM   7226  C  CE    . LYS B 2  363 ? -18.599 -34.285 175.298 1.00 89.17  ? 347  LYS B CE    1 
ATOM   7227  N  NZ    . LYS B 2  363 ? -19.117 -35.575 175.836 1.00 87.00  ? 347  LYS B NZ    1 
ATOM   7228  N  N     . ASN B 2  364 ? -12.933 -31.872 178.236 1.00 55.51  ? 348  ASN B N     1 
ATOM   7229  C  CA    . ASN B 2  364 ? -11.569 -31.496 178.597 1.00 56.42  ? 348  ASN B CA    1 
ATOM   7230  C  C     . ASN B 2  364 ? -10.583 -32.599 178.237 1.00 57.68  ? 348  ASN B C     1 
ATOM   7231  O  O     . ASN B 2  364 ? -10.744 -33.749 178.661 1.00 59.07  ? 348  ASN B O     1 
ATOM   7232  C  CB    . ASN B 2  364 ? -11.475 -31.183 180.089 1.00 57.98  ? 348  ASN B CB    1 
ATOM   7233  C  CG    . ASN B 2  364 ? -12.347 -30.019 180.496 1.00 64.43  ? 348  ASN B CG    1 
ATOM   7234  O  OD1   . ASN B 2  364 ? -12.427 -29.012 179.788 1.00 59.74  ? 348  ASN B OD1   1 
ATOM   7235  N  ND2   . ASN B 2  364 ? -13.002 -30.143 181.647 1.00 66.48  ? 348  ASN B ND2   1 
ATOM   7236  N  N     . LEU B 2  365 ? -9.560  -32.247 177.454 1.00 55.86  ? 349  LEU B N     1 
ATOM   7237  C  CA    . LEU B 2  365 ? -8.464  -33.173 177.190 1.00 57.95  ? 349  LEU B CA    1 
ATOM   7238  C  C     . LEU B 2  365 ? -7.508  -33.293 178.373 1.00 56.61  ? 349  LEU B C     1 
ATOM   7239  O  O     . LEU B 2  365 ? -6.906  -34.355 178.569 1.00 61.52  ? 349  LEU B O     1 
ATOM   7240  C  CB    . LEU B 2  365 ? -7.701  -32.733 175.939 1.00 52.39  ? 349  LEU B CB    1 
ATOM   7241  C  CG    . LEU B 2  365 ? -8.539  -32.749 174.660 1.00 54.64  ? 349  LEU B CG    1 
ATOM   7242  C  CD1   . LEU B 2  365 ? -7.766  -32.171 173.488 1.00 43.35  ? 349  LEU B CD1   1 
ATOM   7243  C  CD2   . LEU B 2  365 ? -9.020  -34.160 174.355 1.00 60.34  ? 349  LEU B CD2   1 
ATOM   7244  N  N     . LYS B 2  366 ? -7.357  -32.235 179.168 1.00 47.94  ? 350  LYS B N     1 
ATOM   7245  C  CA    . LYS B 2  366 ? -6.491  -32.279 180.338 1.00 52.50  ? 350  LYS B CA    1 
ATOM   7246  C  C     . LYS B 2  366 ? -6.928  -31.219 181.339 1.00 58.94  ? 350  LYS B C     1 
ATOM   7247  O  O     . LYS B 2  366 ? -7.400  -30.144 180.961 1.00 55.90  ? 350  LYS B O     1 
ATOM   7248  C  CB    . LYS B 2  366 ? -5.017  -32.074 179.958 1.00 56.74  ? 350  LYS B CB    1 
ATOM   7249  C  CG    . LYS B 2  366 ? -4.042  -32.146 181.135 1.00 64.11  ? 350  LYS B CG    1 
ATOM   7250  C  CD    . LYS B 2  366 ? -2.592  -31.993 180.687 1.00 75.35  ? 350  LYS B CD    1 
ATOM   7251  C  CE    . LYS B 2  366 ? -1.674  -31.672 181.861 1.00 71.52  ? 350  LYS B CE    1 
ATOM   7252  N  NZ    . LYS B 2  366 ? -1.761  -32.671 182.960 1.00 89.61  ? 350  LYS B NZ    1 
ATOM   7253  N  N     . THR B 2  367 ? -6.764  -31.543 182.621 1.00 56.47  ? 351  THR B N     1 
ATOM   7254  C  CA    . THR B 2  367 ? -7.017  -30.630 183.723 1.00 51.91  ? 351  THR B CA    1 
ATOM   7255  C  C     . THR B 2  367 ? -5.801  -30.654 184.638 1.00 62.43  ? 351  THR B C     1 
ATOM   7256  O  O     . THR B 2  367 ? -5.111  -31.672 184.739 1.00 74.90  ? 351  THR B O     1 
ATOM   7257  C  CB    . THR B 2  367 ? -8.283  -31.016 184.495 1.00 64.33  ? 351  THR B CB    1 
ATOM   7258  O  OG1   . THR B 2  367 ? -8.072  -32.268 185.161 1.00 75.71  ? 351  THR B OG1   1 
ATOM   7259  C  CG2   . THR B 2  367 ? -9.470  -31.141 183.549 1.00 50.59  ? 351  THR B CG2   1 
ATOM   7260  N  N     . GLY B 2  368 ? -5.558  -29.547 185.335 1.00 63.43  ? 352  GLY B N     1 
ATOM   7261  C  CA    . GLY B 2  368 ? -4.379  -29.499 186.182 1.00 72.78  ? 352  GLY B CA    1 
ATOM   7262  C  C     . GLY B 2  368 ? -4.405  -28.334 187.146 1.00 67.51  ? 352  GLY B C     1 
ATOM   7263  O  O     . GLY B 2  368 ? -5.297  -27.483 187.110 1.00 71.62  ? 352  GLY B O     1 
ATOM   7264  N  N     . LYS B 2  369 ? -3.371  -28.289 187.988 1.00 60.34  ? 353  LYS B N     1 
ATOM   7265  C  CA    . LYS B 2  369 ? -3.218  -27.257 189.004 1.00 51.51  ? 353  LYS B CA    1 
ATOM   7266  C  C     . LYS B 2  369 ? -1.740  -26.959 189.204 1.00 55.21  ? 353  LYS B C     1 
ATOM   7267  O  O     . LYS B 2  369 ? -0.920  -27.877 189.303 1.00 56.92  ? 353  LYS B O     1 
ATOM   7268  C  CB    . LYS B 2  369 ? -3.826  -27.698 190.339 1.00 49.33  ? 353  LYS B CB    1 
ATOM   7269  C  CG    . LYS B 2  369 ? -3.746  -26.647 191.431 1.00 52.56  ? 353  LYS B CG    1 
ATOM   7270  C  CD    . LYS B 2  369 ? -4.542  -27.064 192.652 1.00 64.41  ? 353  LYS B CD    1 
ATOM   7271  C  CE    . LYS B 2  369 ? -3.871  -28.226 193.367 1.00 59.61  ? 353  LYS B CE    1 
ATOM   7272  N  NZ    . LYS B 2  369 ? -2.719  -27.770 194.192 1.00 65.81  ? 353  LYS B NZ    1 
ATOM   7273  N  N     . TYR B 2  370 ? -1.411  -25.672 189.275 1.00 54.51  ? 354  TYR B N     1 
ATOM   7274  C  CA    . TYR B 2  370 ? -0.078  -25.220 189.637 1.00 50.93  ? 354  TYR B CA    1 
ATOM   7275  C  C     . TYR B 2  370 ? -0.103  -24.505 190.984 1.00 52.30  ? 354  TYR B C     1 
ATOM   7276  O  O     . TYR B 2  370 ? -1.072  -23.824 191.328 1.00 66.15  ? 354  TYR B O     1 
ATOM   7277  C  CB    . TYR B 2  370 ? 0.487   -24.275 188.573 1.00 58.89  ? 354  TYR B CB    1 
ATOM   7278  C  CG    . TYR B 2  370 ? 0.599   -24.873 187.184 1.00 51.99  ? 354  TYR B CG    1 
ATOM   7279  C  CD1   . TYR B 2  370 ? 0.989   -26.193 186.992 1.00 45.95  ? 354  TYR B CD1   1 
ATOM   7280  C  CD2   . TYR B 2  370 ? 0.349   -24.094 186.058 1.00 52.24  ? 354  TYR B CD2   1 
ATOM   7281  C  CE1   . TYR B 2  370 ? 1.100   -26.728 185.715 1.00 53.98  ? 354  TYR B CE1   1 
ATOM   7282  C  CE2   . TYR B 2  370 ? 0.459   -24.616 184.783 1.00 52.85  ? 354  TYR B CE2   1 
ATOM   7283  C  CZ    . TYR B 2  370 ? 0.837   -25.930 184.615 1.00 53.14  ? 354  TYR B CZ    1 
ATOM   7284  O  OH    . TYR B 2  370 ? 0.938   -26.441 183.340 1.00 50.52  ? 354  TYR B OH    1 
ATOM   7285  N  N     . ALA B 2  371 ? 0.979   -24.667 191.744 1.00 54.61  ? 355  ALA B N     1 
ATOM   7286  C  CA    . ALA B 2  371 ? 1.155   -23.998 193.025 1.00 55.46  ? 355  ALA B CA    1 
ATOM   7287  C  C     . ALA B 2  371 ? 2.619   -23.604 193.173 1.00 55.88  ? 355  ALA B C     1 
ATOM   7288  O  O     . ALA B 2  371 ? 3.508   -24.259 192.624 1.00 53.53  ? 355  ALA B O     1 
ATOM   7289  C  CB    . ALA B 2  371 ? 0.713   -24.879 194.201 1.00 55.69  ? 355  ALA B CB    1 
ATOM   7290  N  N     . ARG B 2  372 ? 2.860   -22.543 193.949 1.00 58.71  ? 356  ARG B N     1 
ATOM   7291  C  CA    . ARG B 2  372 ? 4.207   -22.166 194.388 1.00 53.12  ? 356  ARG B CA    1 
ATOM   7292  C  C     . ARG B 2  372 ? 5.134   -21.871 193.211 1.00 58.76  ? 356  ARG B C     1 
ATOM   7293  O  O     . ARG B 2  372 ? 6.305   -22.258 193.202 1.00 56.44  ? 356  ARG B O     1 
ATOM   7294  C  CB    . ARG B 2  372 ? 4.814   -23.240 195.291 1.00 54.68  ? 356  ARG B CB    1 
ATOM   7295  C  CG    . ARG B 2  372 ? 4.257   -23.240 196.685 1.00 59.82  ? 356  ARG B CG    1 
ATOM   7296  C  CD    . ARG B 2  372 ? 4.716   -24.445 197.478 1.00 67.33  ? 356  ARG B CD    1 
ATOM   7297  N  NE    . ARG B 2  372 ? 4.285   -25.682 196.833 1.00 87.80  ? 356  ARG B NE    1 
ATOM   7298  C  CZ    . ARG B 2  372 ? 3.083   -26.225 197.003 1.00 82.70  ? 356  ARG B CZ    1 
ATOM   7299  N  NH1   . ARG B 2  372 ? 2.183   -25.616 197.765 1.00 84.52  ? 356  ARG B NH1   1 
ATOM   7300  N  NH2   . ARG B 2  372 ? 2.764   -27.354 196.385 1.00 88.75  ? 356  ARG B NH2   1 
ATOM   7301  N  N     . MET B 2  373 ? 4.602   -21.183 192.206 1.00 60.66  ? 357  MET B N     1 
ATOM   7302  C  CA    . MET B 2  373 ? 5.404   -20.759 191.074 1.00 35.59  ? 357  MET B CA    1 
ATOM   7303  C  C     . MET B 2  373 ? 6.132   -19.465 191.430 1.00 37.30  ? 357  MET B C     1 
ATOM   7304  O  O     . MET B 2  373 ? 5.899   -18.865 192.484 1.00 38.61  ? 357  MET B O     1 
ATOM   7305  C  CB    . MET B 2  373 ? 4.536   -20.561 189.834 1.00 35.82  ? 357  MET B CB    1 
ATOM   7306  C  CG    . MET B 2  373 ? 3.827   -21.813 189.357 1.00 40.36  ? 357  MET B CG    1 
ATOM   7307  S  SD    . MET B 2  373 ? 2.717   -21.469 187.973 1.00 45.86  ? 357  MET B SD    1 
ATOM   7308  C  CE    . MET B 2  373 ? 1.377   -20.624 188.805 1.00 53.64  ? 357  MET B CE    1 
ATOM   7309  N  N     . ARG B 2  374 ? 7.046   -19.049 190.556 1.00 42.67  ? 358  ARG B N     1 
ATOM   7310  C  CA    . ARG B 2  374 ? 7.712   -17.764 190.741 1.00 43.98  ? 358  ARG B CA    1 
ATOM   7311  C  C     . ARG B 2  374 ? 6.680   -16.649 190.867 1.00 42.18  ? 358  ARG B C     1 
ATOM   7312  O  O     . ARG B 2  374 ? 5.711   -16.594 190.105 1.00 41.56  ? 358  ARG B O     1 
ATOM   7313  C  CB    . ARG B 2  374 ? 8.657   -17.476 189.569 1.00 42.25  ? 358  ARG B CB    1 
ATOM   7314  C  CG    . ARG B 2  374 ? 7.982   -17.388 188.205 1.00 38.29  ? 358  ARG B CG    1 
ATOM   7315  C  CD    . ARG B 2  374 ? 8.981   -17.071 187.108 1.00 41.21  ? 358  ARG B CD    1 
ATOM   7316  N  NE    . ARG B 2  374 ? 8.393   -17.182 185.776 1.00 42.35  ? 358  ARG B NE    1 
ATOM   7317  C  CZ    . ARG B 2  374 ? 8.466   -16.229 184.851 1.00 44.68  ? 358  ARG B CZ    1 
ATOM   7318  N  NH1   . ARG B 2  374 ? 9.096   -15.091 185.117 1.00 44.76  ? 358  ARG B NH1   1 
ATOM   7319  N  NH2   . ARG B 2  374 ? 7.903   -16.409 183.663 1.00 35.84  ? 358  ARG B NH2   1 
ATOM   7320  N  N     . GLY B 2  375 ? 6.866   -15.777 191.854 1.00 43.36  ? 359  GLY B N     1 
ATOM   7321  C  CA    . GLY B 2  375 ? 5.905   -14.719 192.074 1.00 49.31  ? 359  GLY B CA    1 
ATOM   7322  C  C     . GLY B 2  375 ? 4.798   -15.015 193.064 1.00 42.31  ? 359  GLY B C     1 
ATOM   7323  O  O     . GLY B 2  375 ? 3.959   -14.135 193.304 1.00 42.51  ? 359  GLY B O     1 
ATOM   7324  N  N     . ALA B 2  376 ? 4.753   -16.217 193.636 1.00 33.56  ? 360  ALA B N     1 
ATOM   7325  C  CA    . ALA B 2  376 ? 3.684   -16.550 194.568 1.00 37.99  ? 360  ALA B CA    1 
ATOM   7326  C  C     . ALA B 2  376 ? 3.655   -15.580 195.742 1.00 46.17  ? 360  ALA B C     1 
ATOM   7327  O  O     . ALA B 2  376 ? 4.693   -15.269 196.334 1.00 60.14  ? 360  ALA B O     1 
ATOM   7328  C  CB    . ALA B 2  376 ? 3.856   -17.982 195.073 1.00 42.15  ? 360  ALA B CB    1 
ATOM   7329  N  N     . HIS B 2  377 ? 2.452   -15.102 196.069 1.00 47.34  ? 361  HIS B N     1 
ATOM   7330  C  CA    . HIS B 2  377 ? 2.176   -14.136 197.130 1.00 43.21  ? 361  HIS B CA    1 
ATOM   7331  C  C     . HIS B 2  377 ? 2.707   -12.737 196.894 1.00 49.22  ? 361  HIS B C     1 
ATOM   7332  O  O     . HIS B 2  377 ? 2.651   -11.909 197.813 1.00 55.70  ? 361  HIS B O     1 
ATOM   7333  C  CB    . HIS B 2  377 ? 2.683   -14.605 198.484 1.00 39.70  ? 361  HIS B CB    1 
ATOM   7334  C  CG    . HIS B 2  377 ? 2.344   -16.020 198.778 1.00 46.49  ? 361  HIS B CG    1 
ATOM   7335  N  ND1   . HIS B 2  377 ? 3.028   -16.763 199.710 1.00 60.36  ? 361  HIS B ND1   1 
ATOM   7336  C  CD2   . HIS B 2  377 ? 1.373   -16.824 198.288 1.00 49.19  ? 361  HIS B CD2   1 
ATOM   7337  C  CE1   . HIS B 2  377 ? 2.486   -17.960 199.792 1.00 53.28  ? 361  HIS B CE1   1 
ATOM   7338  N  NE2   . HIS B 2  377 ? 1.492   -18.032 198.926 1.00 47.50  ? 361  HIS B NE2   1 
ATOM   7339  N  N     . THR B 2  378 ? 3.260   -12.441 195.730 1.00 46.46  ? 362  THR B N     1 
ATOM   7340  C  CA    . THR B 2  378 ? 3.581   -11.043 195.523 1.00 47.03  ? 362  THR B CA    1 
ATOM   7341  C  C     . THR B 2  378 ? 3.140   -10.528 194.165 1.00 46.66  ? 362  THR B C     1 
ATOM   7342  O  O     . THR B 2  378 ? 2.800   -9.348  194.046 1.00 50.70  ? 362  THR B O     1 
ATOM   7343  C  CB    . THR B 2  378 ? 5.078   -10.801 195.729 1.00 54.74  ? 362  THR B CB    1 
ATOM   7344  O  OG1   . THR B 2  378 ? 5.326   -9.389  195.752 1.00 61.12  ? 362  THR B OG1   1 
ATOM   7345  C  CG2   . THR B 2  378 ? 5.908   -11.467 194.640 1.00 48.58  ? 362  THR B CG2   1 
ATOM   7346  N  N     . ASN B 2  379 ? 3.132   -11.379 193.139 1.00 48.81  ? 363  ASN B N     1 
ATOM   7347  C  CA    . ASN B 2  379 ? 2.873   -10.897 191.784 1.00 47.47  ? 363  ASN B CA    1 
ATOM   7348  C  C     . ASN B 2  379 ? 1.966   -11.867 191.027 1.00 52.77  ? 363  ASN B C     1 
ATOM   7349  O  O     . ASN B 2  379 ? 2.432   -12.896 190.524 1.00 52.15  ? 363  ASN B O     1 
ATOM   7350  C  CB    . ASN B 2  379 ? 4.197   -10.676 191.059 1.00 41.02  ? 363  ASN B CB    1 
ATOM   7351  C  CG    . ASN B 2  379 ? 4.030   -10.032 189.696 1.00 48.27  ? 363  ASN B CG    1 
ATOM   7352  O  OD1   . ASN B 2  379 ? 3.042   -10.255 188.996 1.00 47.76  ? 363  ASN B OD1   1 
ATOM   7353  N  ND2   . ASN B 2  379 ? 5.008   -9.215  189.315 1.00 45.89  ? 363  ASN B ND2   1 
ATOM   7354  N  N     . ASP B 2  380 ? 0.663   -11.561 190.997 1.00 48.91  ? 364  ASP B N     1 
ATOM   7355  C  CA    . ASP B 2  380 ? -0.281  -12.383 190.242 1.00 48.21  ? 364  ASP B CA    1 
ATOM   7356  C  C     . ASP B 2  380 ? 0.128   -12.489 188.777 1.00 49.84  ? 364  ASP B C     1 
ATOM   7357  O  O     . ASP B 2  380 ? 0.048   -13.568 188.177 1.00 49.81  ? 364  ASP B O     1 
ATOM   7358  C  CB    . ASP B 2  380 ? -1.697  -11.808 190.332 1.00 50.10  ? 364  ASP B CB    1 
ATOM   7359  C  CG    . ASP B 2  380 ? -2.463  -12.291 191.547 1.00 49.62  ? 364  ASP B CG    1 
ATOM   7360  O  OD1   . ASP B 2  380 ? -2.070  -13.309 192.155 1.00 54.24  ? 364  ASP B OD1   1 
ATOM   7361  O  OD2   . ASP B 2  380 ? -3.476  -11.647 191.883 1.00 47.58  ? 364  ASP B OD2   1 
ATOM   7362  N  N     . VAL B 2  381 ? 0.614   -11.387 188.196 1.00 46.07  ? 365  VAL B N     1 
ATOM   7363  C  CA    . VAL B 2  381 ? 0.851   -11.354 186.757 1.00 39.77  ? 365  VAL B CA    1 
ATOM   7364  C  C     . VAL B 2  381 ? 2.034   -12.236 186.393 1.00 51.99  ? 365  VAL B C     1 
ATOM   7365  O  O     . VAL B 2  381 ? 2.020   -12.918 185.360 1.00 51.24  ? 365  VAL B O     1 
ATOM   7366  C  CB    . VAL B 2  381 ? 1.071   -9.904  186.285 1.00 37.71  ? 365  VAL B CB    1 
ATOM   7367  C  CG1   . VAL B 2  381 ? 1.270   -9.858  184.786 1.00 45.98  ? 365  VAL B CG1   1 
ATOM   7368  C  CG2   . VAL B 2  381 ? -0.084  -9.026  186.692 1.00 47.13  ? 365  VAL B CG2   1 
ATOM   7369  N  N     . LYS B 2  382 ? 3.076   -12.242 187.226 1.00 50.13  ? 366  LYS B N     1 
ATOM   7370  C  CA    . LYS B 2  382 ? 4.198   -13.133 186.960 1.00 52.17  ? 366  LYS B CA    1 
ATOM   7371  C  C     . LYS B 2  382 ? 3.747   -14.585 187.048 1.00 47.60  ? 366  LYS B C     1 
ATOM   7372  O  O     . LYS B 2  382 ? 4.031   -15.391 186.153 1.00 45.08  ? 366  LYS B O     1 
ATOM   7373  C  CB    . LYS B 2  382 ? 5.341   -12.857 187.938 1.00 57.40  ? 366  LYS B CB    1 
ATOM   7374  C  CG    . LYS B 2  382 ? 6.561   -13.749 187.735 1.00 45.15  ? 366  LYS B CG    1 
ATOM   7375  C  CD    . LYS B 2  382 ? 7.533   -13.635 188.899 1.00 47.20  ? 366  LYS B CD    1 
ATOM   7376  C  CE    . LYS B 2  382 ? 8.330   -12.339 188.824 1.00 53.47  ? 366  LYS B CE    1 
ATOM   7377  N  NZ    . LYS B 2  382 ? 9.464   -12.318 189.792 1.00 45.22  ? 366  LYS B NZ    1 
ATOM   7378  N  N     . GLN B 2  383 ? 3.010   -14.924 188.114 1.00 44.75  ? 367  GLN B N     1 
ATOM   7379  C  CA    . GLN B 2  383 ? 2.458   -16.269 188.259 1.00 45.57  ? 367  GLN B CA    1 
ATOM   7380  C  C     . GLN B 2  383 ? 1.651   -16.668 187.033 1.00 47.34  ? 367  GLN B C     1 
ATOM   7381  O  O     . GLN B 2  383 ? 1.781   -17.790 186.528 1.00 51.89  ? 367  GLN B O     1 
ATOM   7382  C  CB    . GLN B 2  383 ? 1.599   -16.354 189.512 1.00 47.60  ? 367  GLN B CB    1 
ATOM   7383  C  CG    . GLN B 2  383 ? 2.401   -16.327 190.782 1.00 46.60  ? 367  GLN B CG    1 
ATOM   7384  C  CD    . GLN B 2  383 ? 1.520   -16.395 191.998 1.00 43.49  ? 367  GLN B CD    1 
ATOM   7385  O  OE1   . GLN B 2  383 ? 0.960   -17.448 192.314 1.00 43.24  ? 367  GLN B OE1   1 
ATOM   7386  N  NE2   . GLN B 2  383 ? 1.338   -15.258 192.656 1.00 41.71  ? 367  GLN B NE2   1 
ATOM   7387  N  N     . LEU B 2  384 ? 0.771   -15.780 186.566 1.00 41.69  ? 368  LEU B N     1 
ATOM   7388  C  CA    . LEU B 2  384 ? -0.064  -16.147 185.430 1.00 47.62  ? 368  LEU B CA    1 
ATOM   7389  C  C     . LEU B 2  384 ? 0.796   -16.324 184.189 1.00 51.43  ? 368  LEU B C     1 
ATOM   7390  O  O     . LEU B 2  384 ? 0.556   -17.229 183.380 1.00 52.87  ? 368  LEU B O     1 
ATOM   7391  C  CB    . LEU B 2  384 ? -1.151  -15.099 185.197 1.00 48.22  ? 368  LEU B CB    1 
ATOM   7392  C  CG    . LEU B 2  384 ? -2.086  -15.341 184.008 1.00 36.63  ? 368  LEU B CG    1 
ATOM   7393  C  CD1   . LEU B 2  384 ? -2.839  -16.658 184.133 1.00 30.02  ? 368  LEU B CD1   1 
ATOM   7394  C  CD2   . LEU B 2  384 ? -3.053  -14.176 183.880 1.00 40.91  ? 368  LEU B CD2   1 
ATOM   7395  N  N     . THR B 2  385 ? 1.807   -15.466 184.027 1.00 49.74  ? 369  THR B N     1 
ATOM   7396  C  CA    . THR B 2  385 ? 2.704   -15.581 182.884 1.00 50.50  ? 369  THR B CA    1 
ATOM   7397  C  C     . THR B 2  385 ? 3.393   -16.939 182.887 1.00 45.46  ? 369  THR B C     1 
ATOM   7398  O  O     . THR B 2  385 ? 3.451   -17.625 181.860 1.00 46.30  ? 369  THR B O     1 
ATOM   7399  C  CB    . THR B 2  385 ? 3.735   -14.454 182.898 1.00 38.43  ? 369  THR B CB    1 
ATOM   7400  O  OG1   . THR B 2  385 ? 3.089   -13.206 182.622 1.00 41.75  ? 369  THR B OG1   1 
ATOM   7401  C  CG2   . THR B 2  385 ? 4.782   -14.699 181.833 1.00 41.03  ? 369  THR B CG2   1 
ATOM   7402  N  N     . GLU B 2  386 ? 3.906   -17.350 184.049 1.00 39.16  ? 370  GLU B N     1 
ATOM   7403  C  CA    . GLU B 2  386 ? 4.492   -18.680 184.175 1.00 42.24  ? 370  GLU B CA    1 
ATOM   7404  C  C     . GLU B 2  386 ? 3.475   -19.762 183.844 1.00 47.35  ? 370  GLU B C     1 
ATOM   7405  O  O     . GLU B 2  386 ? 3.777   -20.706 183.103 1.00 53.81  ? 370  GLU B O     1 
ATOM   7406  C  CB    . GLU B 2  386 ? 5.039   -18.888 185.587 1.00 42.20  ? 370  GLU B CB    1 
ATOM   7407  C  CG    . GLU B 2  386 ? 5.743   -20.226 185.769 1.00 50.53  ? 370  GLU B CG    1 
ATOM   7408  C  CD    . GLU B 2  386 ? 7.102   -20.286 185.086 1.00 53.43  ? 370  GLU B CD    1 
ATOM   7409  O  OE1   . GLU B 2  386 ? 7.518   -19.284 184.461 1.00 41.36  ? 370  GLU B OE1   1 
ATOM   7410  O  OE2   . GLU B 2  386 ? 7.743   -21.356 185.153 1.00 61.17  ? 370  GLU B OE2   1 
ATOM   7411  N  N     . ALA B 2  387 ? 2.271   -19.654 184.410 1.00 48.14  ? 371  ALA B N     1 
ATOM   7412  C  CA    . ALA B 2  387 ? 1.213   -20.617 184.123 1.00 47.14  ? 371  ALA B CA    1 
ATOM   7413  C  C     . ALA B 2  387 ? 0.994   -20.761 182.622 1.00 46.78  ? 371  ALA B C     1 
ATOM   7414  O  O     . ALA B 2  387 ? 0.980   -21.876 182.087 1.00 49.16  ? 371  ALA B O     1 
ATOM   7415  C  CB    . ALA B 2  387 ? -0.081  -20.199 184.824 1.00 50.46  ? 371  ALA B CB    1 
ATOM   7416  N  N     . VAL B 2  388 ? 0.826   -19.632 181.927 1.00 42.45  ? 372  VAL B N     1 
ATOM   7417  C  CA    . VAL B 2  388 ? 0.615   -19.659 180.481 1.00 46.97  ? 372  VAL B CA    1 
ATOM   7418  C  C     . VAL B 2  388 ? 1.781   -20.343 179.780 1.00 50.75  ? 372  VAL B C     1 
ATOM   7419  O  O     . VAL B 2  388 ? 1.584   -21.155 178.867 1.00 50.49  ? 372  VAL B O     1 
ATOM   7420  C  CB    . VAL B 2  388 ? 0.404   -18.232 179.942 1.00 50.58  ? 372  VAL B CB    1 
ATOM   7421  C  CG1   . VAL B 2  388 ? 0.420   -18.232 178.414 1.00 51.59  ? 372  VAL B CG1   1 
ATOM   7422  C  CG2   . VAL B 2  388 ? -0.887  -17.645 180.471 1.00 45.23  ? 372  VAL B CG2   1 
ATOM   7423  N  N     . GLN B 2  389 ? 3.012   -20.039 180.206 1.00 52.58  ? 373  GLN B N     1 
ATOM   7424  C  CA    . GLN B 2  389 ? 4.182   -20.680 179.612 1.00 50.32  ? 373  GLN B CA    1 
ATOM   7425  C  C     . GLN B 2  389 ? 4.206   -22.175 179.907 1.00 52.41  ? 373  GLN B C     1 
ATOM   7426  O  O     . GLN B 2  389 ? 4.498   -22.982 179.016 1.00 53.15  ? 373  GLN B O     1 
ATOM   7427  C  CB    . GLN B 2  389 ? 5.466   -20.028 180.129 1.00 51.92  ? 373  GLN B CB    1 
ATOM   7428  C  CG    . GLN B 2  389 ? 5.672   -18.571 179.731 1.00 50.24  ? 373  GLN B CG    1 
ATOM   7429  C  CD    . GLN B 2  389 ? 6.879   -17.943 180.423 1.00 53.22  ? 373  GLN B CD    1 
ATOM   7430  O  OE1   . GLN B 2  389 ? 7.339   -16.866 180.040 1.00 48.34  ? 373  GLN B OE1   1 
ATOM   7431  N  NE2   . GLN B 2  389 ? 7.428   -18.644 181.414 1.00 53.34  ? 373  GLN B NE2   1 
ATOM   7432  N  N     . LYS B 2  390 ? 3.886   -22.563 181.145 1.00 43.21  ? 374  LYS B N     1 
ATOM   7433  C  CA    . LYS B 2  390 ? 3.854   -23.980 181.499 1.00 48.80  ? 374  LYS B CA    1 
ATOM   7434  C  C     . LYS B 2  390 ? 2.811   -24.732 180.680 1.00 56.14  ? 374  LYS B C     1 
ATOM   7435  O  O     . LYS B 2  390 ? 3.081   -25.818 180.153 1.00 56.36  ? 374  LYS B O     1 
ATOM   7436  C  CB    . LYS B 2  390 ? 3.564   -24.143 182.992 1.00 58.53  ? 374  LYS B CB    1 
ATOM   7437  C  CG    . LYS B 2  390 ? 4.737   -23.906 183.923 1.00 51.02  ? 374  LYS B CG    1 
ATOM   7438  C  CD    . LYS B 2  390 ? 4.391   -24.378 185.331 1.00 41.35  ? 374  LYS B CD    1 
ATOM   7439  C  CE    . LYS B 2  390 ? 5.596   -24.324 186.256 1.00 61.97  ? 374  LYS B CE    1 
ATOM   7440  N  NZ    . LYS B 2  390 ? 6.753   -25.112 185.737 1.00 84.14  ? 374  LYS B NZ    1 
ATOM   7441  N  N     . ILE B 2  391 ? 1.610   -24.163 180.558 1.00 49.25  ? 375  ILE B N     1 
ATOM   7442  C  CA    . ILE B 2  391 ? 0.538   -24.845 179.839 1.00 57.68  ? 375  ILE B CA    1 
ATOM   7443  C  C     . ILE B 2  391 ? 0.890   -24.978 178.364 1.00 53.69  ? 375  ILE B C     1 
ATOM   7444  O  O     . ILE B 2  391 ? 0.694   -26.041 177.760 1.00 54.02  ? 375  ILE B O     1 
ATOM   7445  C  CB    . ILE B 2  391 ? -0.804  -24.119 180.050 1.00 55.71  ? 375  ILE B CB    1 
ATOM   7446  C  CG1   . ILE B 2  391 ? -1.211  -24.183 181.522 1.00 47.56  ? 375  ILE B CG1   1 
ATOM   7447  C  CG2   . ILE B 2  391 ? -1.890  -24.734 179.181 1.00 43.27  ? 375  ILE B CG2   1 
ATOM   7448  C  CD1   . ILE B 2  391 ? -2.298  -23.216 181.890 1.00 47.92  ? 375  ILE B CD1   1 
ATOM   7449  N  N     . THR B 2  392 ? 1.404   -23.904 177.758 1.00 52.26  ? 376  THR B N     1 
ATOM   7450  C  CA    . THR B 2  392 ? 1.811   -23.973 176.359 1.00 52.77  ? 376  THR B CA    1 
ATOM   7451  C  C     . THR B 2  392 ? 2.858   -25.061 176.150 1.00 54.97  ? 376  THR B C     1 
ATOM   7452  O  O     . THR B 2  392 ? 2.789   -25.822 175.177 1.00 57.50  ? 376  THR B O     1 
ATOM   7453  C  CB    . THR B 2  392 ? 2.358   -22.627 175.891 1.00 48.25  ? 376  THR B CB    1 
ATOM   7454  O  OG1   . THR B 2  392 ? 1.361   -21.614 176.051 1.00 49.99  ? 376  THR B OG1   1 
ATOM   7455  C  CG2   . THR B 2  392 ? 2.721   -22.705 174.428 1.00 54.27  ? 376  THR B CG2   1 
ATOM   7456  N  N     . THR B 2  393 ? 3.813   -25.176 177.078 1.00 52.85  ? 377  THR B N     1 
ATOM   7457  C  CA    . THR B 2  393 ? 4.861   -26.181 176.943 1.00 52.70  ? 377  THR B CA    1 
ATOM   7458  C  C     . THR B 2  393 ? 4.272   -27.584 176.988 1.00 56.88  ? 377  THR B C     1 
ATOM   7459  O  O     . THR B 2  393 ? 4.642   -28.450 176.186 1.00 67.19  ? 377  THR B O     1 
ATOM   7460  C  CB    . THR B 2  393 ? 5.904   -25.999 178.047 1.00 53.24  ? 377  THR B CB    1 
ATOM   7461  O  OG1   . THR B 2  393 ? 6.755   -24.891 177.728 1.00 49.26  ? 377  THR B OG1   1 
ATOM   7462  C  CG2   . THR B 2  393 ? 6.754   -27.256 178.207 1.00 49.67  ? 377  THR B CG2   1 
ATOM   7463  N  N     . GLU B 2  394 ? 3.344   -27.822 177.913 1.00 50.74  ? 378  GLU B N     1 
ATOM   7464  C  CA    . GLU B 2  394 ? 2.681   -29.119 177.991 1.00 54.73  ? 378  GLU B CA    1 
ATOM   7465  C  C     . GLU B 2  394 ? 1.914   -29.421 176.710 1.00 61.16  ? 378  GLU B C     1 
ATOM   7466  O  O     . GLU B 2  394 ? 1.943   -30.553 176.214 1.00 65.88  ? 378  GLU B O     1 
ATOM   7467  C  CB    . GLU B 2  394 ? 1.749   -29.171 179.200 1.00 58.40  ? 378  GLU B CB    1 
ATOM   7468  C  CG    . GLU B 2  394 ? 2.456   -29.087 180.536 1.00 54.16  ? 378  GLU B CG    1 
ATOM   7469  C  CD    . GLU B 2  394 ? 1.483   -29.074 181.688 1.00 58.14  ? 378  GLU B CD    1 
ATOM   7470  O  OE1   . GLU B 2  394 ? 1.926   -28.927 182.846 1.00 63.46  ? 378  GLU B OE1   1 
ATOM   7471  O  OE2   . GLU B 2  394 ? 0.270   -29.213 181.431 1.00 69.77  ? 378  GLU B OE2   1 
ATOM   7472  N  N     . SER B 2  395 ? 1.217   -28.420 176.163 1.00 55.75  ? 379  SER B N     1 
ATOM   7473  C  CA    . SER B 2  395 ? 0.445   -28.637 174.942 1.00 59.46  ? 379  SER B CA    1 
ATOM   7474  C  C     . SER B 2  395 ? 1.346   -28.966 173.759 1.00 58.10  ? 379  SER B C     1 
ATOM   7475  O  O     . SER B 2  395 ? 0.974   -29.774 172.899 1.00 64.48  ? 379  SER B O     1 
ATOM   7476  C  CB    . SER B 2  395 ? -0.402  -27.404 174.630 1.00 59.56  ? 379  SER B CB    1 
ATOM   7477  O  OG    . SER B 2  395 ? -1.139  -26.980 175.760 1.00 65.84  ? 379  SER B OG    1 
ATOM   7478  N  N     . ILE B 2  396 ? 2.531   -28.357 173.689 1.00 62.89  ? 380  ILE B N     1 
ATOM   7479  C  CA    . ILE B 2  396 ? 3.437   -28.650 172.581 1.00 66.47  ? 380  ILE B CA    1 
ATOM   7480  C  C     . ILE B 2  396 ? 3.916   -30.094 172.665 1.00 64.02  ? 380  ILE B C     1 
ATOM   7481  O  O     . ILE B 2  396 ? 3.925   -30.827 171.670 1.00 63.24  ? 380  ILE B O     1 
ATOM   7482  C  CB    . ILE B 2  396 ? 4.623   -27.667 172.565 1.00 58.56  ? 380  ILE B CB    1 
ATOM   7483  C  CG1   . ILE B 2  396 ? 4.177   -26.271 172.130 1.00 64.88  ? 380  ILE B CG1   1 
ATOM   7484  C  CG2   . ILE B 2  396 ? 5.711   -28.160 171.631 1.00 65.56  ? 380  ILE B CG2   1 
ATOM   7485  C  CD1   . ILE B 2  396 ? 5.113   -25.162 172.584 1.00 55.25  ? 380  ILE B CD1   1 
ATOM   7486  N  N     . VAL B 2  397 ? 4.345   -30.514 173.854 1.00 60.93  ? 381  VAL B N     1 
ATOM   7487  C  CA    . VAL B 2  397 ? 4.839   -31.874 174.037 1.00 53.80  ? 381  VAL B CA    1 
ATOM   7488  C  C     . VAL B 2  397 ? 3.738   -32.905 173.794 1.00 62.75  ? 381  VAL B C     1 
ATOM   7489  O  O     . VAL B 2  397 ? 3.937   -33.887 173.067 1.00 66.22  ? 381  VAL B O     1 
ATOM   7490  C  CB    . VAL B 2  397 ? 5.437   -32.027 175.448 1.00 59.58  ? 381  VAL B CB    1 
ATOM   7491  C  CG1   . VAL B 2  397 ? 5.612   -33.496 175.798 1.00 66.04  ? 381  VAL B CG1   1 
ATOM   7492  C  CG2   . VAL B 2  397 ? 6.754   -31.270 175.564 1.00 62.72  ? 381  VAL B CG2   1 
ATOM   7493  N  N     . ILE B 2  398 ? 2.553   -32.689 174.378 1.00 63.00  ? 382  ILE B N     1 
ATOM   7494  C  CA    . ILE B 2  398 ? 1.464   -33.662 174.247 1.00 56.79  ? 382  ILE B CA    1 
ATOM   7495  C  C     . ILE B 2  398 ? 0.826   -33.661 172.858 1.00 54.88  ? 382  ILE B C     1 
ATOM   7496  O  O     . ILE B 2  398 ? 0.550   -34.730 172.299 1.00 58.89  ? 382  ILE B O     1 
ATOM   7497  C  CB    . ILE B 2  398 ? 0.413   -33.421 175.345 1.00 60.44  ? 382  ILE B CB    1 
ATOM   7498  C  CG1   . ILE B 2  398 ? 1.032   -33.617 176.728 1.00 57.03  ? 382  ILE B CG1   1 
ATOM   7499  C  CG2   . ILE B 2  398 ? -0.753  -34.374 175.181 1.00 64.24  ? 382  ILE B CG2   1 
ATOM   7500  C  CD1   . ILE B 2  398 ? 0.200   -33.046 177.850 1.00 59.60  ? 382  ILE B CD1   1 
ATOM   7501  N  N     . TRP B 2  399 ? 0.543   -32.486 172.287 1.00 56.29  ? 383  TRP B N     1 
ATOM   7502  C  CA    . TRP B 2  399 ? -0.158  -32.435 171.005 1.00 60.08  ? 383  TRP B CA    1 
ATOM   7503  C  C     . TRP B 2  399 ? 0.573   -31.726 169.873 1.00 61.76  ? 383  TRP B C     1 
ATOM   7504  O  O     . TRP B 2  399 ? 0.097   -31.783 168.733 1.00 63.72  ? 383  TRP B O     1 
ATOM   7505  C  CB    . TRP B 2  399 ? -1.539  -31.777 171.166 1.00 63.05  ? 383  TRP B CB    1 
ATOM   7506  C  CG    . TRP B 2  399 ? -2.428  -32.450 172.162 1.00 63.66  ? 383  TRP B CG    1 
ATOM   7507  C  CD1   . TRP B 2  399 ? -3.155  -33.589 171.972 1.00 63.57  ? 383  TRP B CD1   1 
ATOM   7508  C  CD2   . TRP B 2  399 ? -2.694  -32.025 173.504 1.00 62.71  ? 383  TRP B CD2   1 
ATOM   7509  N  NE1   . TRP B 2  399 ? -3.855  -33.901 173.112 1.00 60.44  ? 383  TRP B NE1   1 
ATOM   7510  C  CE2   . TRP B 2  399 ? -3.590  -32.956 174.067 1.00 60.56  ? 383  TRP B CE2   1 
ATOM   7511  C  CE3   . TRP B 2  399 ? -2.259  -30.950 174.284 1.00 67.69  ? 383  TRP B CE3   1 
ATOM   7512  C  CZ2   . TRP B 2  399 ? -4.055  -32.847 175.375 1.00 67.86  ? 383  TRP B CZ2   1 
ATOM   7513  C  CZ3   . TRP B 2  399 ? -2.725  -30.841 175.583 1.00 70.50  ? 383  TRP B CZ3   1 
ATOM   7514  C  CH2   . TRP B 2  399 ? -3.613  -31.784 176.115 1.00 68.27  ? 383  TRP B CH2   1 
ATOM   7515  N  N     . GLY B 2  400 ? 1.695   -31.066 170.134 1.00 58.66  ? 384  GLY B N     1 
ATOM   7516  C  CA    . GLY B 2  400 ? 2.344   -30.308 169.081 1.00 63.11  ? 384  GLY B CA    1 
ATOM   7517  C  C     . GLY B 2  400 ? 1.613   -29.044 168.683 1.00 68.51  ? 384  GLY B C     1 
ATOM   7518  O  O     . GLY B 2  400 ? 1.758   -28.583 167.545 1.00 63.17  ? 384  GLY B O     1 
ATOM   7519  N  N     . LYS B 2  401 ? 0.813   -28.479 169.587 1.00 67.56  ? 385  LYS B N     1 
ATOM   7520  C  CA    . LYS B 2  401 ? 0.047   -27.272 169.317 1.00 58.93  ? 385  LYS B CA    1 
ATOM   7521  C  C     . LYS B 2  401 ? 0.102   -26.370 170.541 1.00 59.93  ? 385  LYS B C     1 
ATOM   7522  O  O     . LYS B 2  401 ? 0.312   -26.835 171.663 1.00 58.77  ? 385  LYS B O     1 
ATOM   7523  C  CB    . LYS B 2  401 ? -1.415  -27.591 168.984 1.00 58.87  ? 385  LYS B CB    1 
ATOM   7524  C  CG    . LYS B 2  401 ? -1.703  -27.872 167.524 1.00 65.37  ? 385  LYS B CG    1 
ATOM   7525  C  CD    . LYS B 2  401 ? -3.208  -27.879 167.282 1.00 64.95  ? 385  LYS B CD    1 
ATOM   7526  C  CE    . LYS B 2  401 ? -3.575  -28.678 166.046 1.00 64.95  ? 385  LYS B CE    1 
ATOM   7527  N  NZ    . LYS B 2  401 ? -5.043  -28.901 165.963 1.00 68.74  ? 385  LYS B NZ    1 
ATOM   7528  N  N     . THR B 2  402 ? -0.107  -25.070 170.324 1.00 55.91  ? 386  THR B N     1 
ATOM   7529  C  CA    . THR B 2  402 ? -0.226  -24.160 171.455 1.00 60.01  ? 386  THR B CA    1 
ATOM   7530  C  C     . THR B 2  402 ? -1.673  -23.721 171.583 1.00 60.86  ? 386  THR B C     1 
ATOM   7531  O  O     . THR B 2  402 ? -2.284  -23.326 170.580 1.00 60.91  ? 386  THR B O     1 
ATOM   7532  C  CB    . THR B 2  402 ? 0.683   -22.933 171.294 1.00 56.13  ? 386  THR B CB    1 
ATOM   7533  O  OG1   . THR B 2  402 ? 0.161   -22.069 170.278 1.00 61.90  ? 386  THR B OG1   1 
ATOM   7534  C  CG2   . THR B 2  402 ? 2.093   -23.356 170.930 1.00 56.03  ? 386  THR B CG2   1 
ATOM   7535  N  N     . PRO B 2  403 ? -2.246  -23.744 172.780 1.00 58.68  ? 387  PRO B N     1 
ATOM   7536  C  CA    . PRO B 2  403 ? -3.649  -23.353 172.933 1.00 54.84  ? 387  PRO B CA    1 
ATOM   7537  C  C     . PRO B 2  403 ? -3.840  -21.846 172.868 1.00 58.99  ? 387  PRO B C     1 
ATOM   7538  O  O     . PRO B 2  403 ? -2.905  -21.059 173.028 1.00 61.25  ? 387  PRO B O     1 
ATOM   7539  C  CB    . PRO B 2  403 ? -4.014  -23.880 174.325 1.00 55.04  ? 387  PRO B CB    1 
ATOM   7540  C  CG    . PRO B 2  403 ? -2.712  -23.957 175.065 1.00 58.17  ? 387  PRO B CG    1 
ATOM   7541  C  CD    . PRO B 2  403 ? -1.601  -24.075 174.062 1.00 52.07  ? 387  PRO B CD    1 
ATOM   7542  N  N     . LYS B 2  404 ? -5.088  -21.455 172.614 1.00 55.56  ? 388  LYS B N     1 
ATOM   7543  C  CA    . LYS B 2  404 ? -5.507  -20.071 172.780 1.00 52.73  ? 388  LYS B CA    1 
ATOM   7544  C  C     . LYS B 2  404 ? -6.024  -19.914 174.204 1.00 53.25  ? 388  LYS B C     1 
ATOM   7545  O  O     . LYS B 2  404 ? -6.897  -20.673 174.638 1.00 54.82  ? 388  LYS B O     1 
ATOM   7546  C  CB    . LYS B 2  404 ? -6.578  -19.681 171.760 1.00 50.96  ? 388  LYS B CB    1 
ATOM   7547  C  CG    . LYS B 2  404 ? -7.234  -18.334 172.047 1.00 54.07  ? 388  LYS B CG    1 
ATOM   7548  C  CD    . LYS B 2  404 ? -8.347  -18.014 171.059 1.00 60.59  ? 388  LYS B CD    1 
ATOM   7549  C  CE    . LYS B 2  404 ? -8.379  -16.525 170.732 1.00 58.56  ? 388  LYS B CE    1 
ATOM   7550  N  NZ    . LYS B 2  404 ? -9.618  -16.131 170.002 1.00 76.82  ? 388  LYS B NZ    1 
ATOM   7551  N  N     . PHE B 2  405 ? -5.482  -18.943 174.931 1.00 53.29  ? 389  PHE B N     1 
ATOM   7552  C  CA    . PHE B 2  405 ? -5.785  -18.796 176.349 1.00 56.67  ? 389  PHE B CA    1 
ATOM   7553  C  C     . PHE B 2  405 ? -6.939  -17.834 176.600 1.00 48.56  ? 389  PHE B C     1 
ATOM   7554  O  O     . PHE B 2  405 ? -7.078  -16.806 175.932 1.00 47.55  ? 389  PHE B O     1 
ATOM   7555  C  CB    . PHE B 2  405 ? -4.539  -18.354 177.116 1.00 47.91  ? 389  PHE B CB    1 
ATOM   7556  C  CG    . PHE B 2  405 ? -3.486  -19.421 177.204 1.00 52.64  ? 389  PHE B CG    1 
ATOM   7557  C  CD1   . PHE B 2  405 ? -2.629  -19.664 176.141 1.00 50.87  ? 389  PHE B CD1   1 
ATOM   7558  C  CD2   . PHE B 2  405 ? -3.359  -20.187 178.352 1.00 45.33  ? 389  PHE B CD2   1 
ATOM   7559  C  CE1   . PHE B 2  405 ? -1.669  -20.651 176.219 1.00 39.82  ? 389  PHE B CE1   1 
ATOM   7560  C  CE2   . PHE B 2  405 ? -2.397  -21.172 178.439 1.00 47.44  ? 389  PHE B CE2   1 
ATOM   7561  C  CZ    . PHE B 2  405 ? -1.551  -21.406 177.370 1.00 46.86  ? 389  PHE B CZ    1 
ATOM   7562  N  N     . LYS B 2  406 ? -7.783  -18.203 177.556 1.00 45.23  ? 390  LYS B N     1 
ATOM   7563  C  CA    . LYS B 2  406 ? -8.742  -17.301 178.179 1.00 55.78  ? 390  LYS B CA    1 
ATOM   7564  C  C     . LYS B 2  406 ? -8.110  -16.841 179.490 1.00 50.43  ? 390  LYS B C     1 
ATOM   7565  O  O     . LYS B 2  406 ? -8.060  -17.604 180.462 1.00 52.17  ? 390  LYS B O     1 
ATOM   7566  C  CB    . LYS B 2  406 ? -10.080 -18.009 178.394 1.00 57.56  ? 390  LYS B CB    1 
ATOM   7567  C  CG    . LYS B 2  406 ? -10.808 -18.334 177.082 1.00 52.52  ? 390  LYS B CG    1 
ATOM   7568  C  CD    . LYS B 2  406 ? -12.025 -19.228 177.293 1.00 62.04  ? 390  LYS B CD    1 
ATOM   7569  C  CE    . LYS B 2  406 ? -13.014 -19.131 176.132 1.00 59.76  ? 390  LYS B CE    1 
ATOM   7570  N  NZ    . LYS B 2  406 ? -14.094 -18.127 176.370 1.00 65.14  ? 390  LYS B NZ    1 
ATOM   7571  N  N     . LEU B 2  407 ? -7.630  -15.585 179.523 1.00 41.75  ? 391  LEU B N     1 
ATOM   7572  C  CA    . LEU B 2  407 ? -6.851  -15.166 180.687 1.00 37.77  ? 391  LEU B CA    1 
ATOM   7573  C  C     . LEU B 2  407 ? -7.730  -14.463 181.711 1.00 45.00  ? 391  LEU B C     1 
ATOM   7574  O  O     . LEU B 2  407 ? -8.445  -13.517 181.361 1.00 54.11  ? 391  LEU B O     1 
ATOM   7575  C  CB    . LEU B 2  407 ? -5.733  -14.226 180.266 1.00 39.72  ? 391  LEU B CB    1 
ATOM   7576  C  CG    . LEU B 2  407 ? -4.718  -14.792 179.279 1.00 38.89  ? 391  LEU B CG    1 
ATOM   7577  C  CD1   . LEU B 2  407 ? -3.717  -13.724 178.887 1.00 43.84  ? 391  LEU B CD1   1 
ATOM   7578  C  CD2   . LEU B 2  407 ? -4.015  -15.977 179.912 1.00 38.75  ? 391  LEU B CD2   1 
ATOM   7579  N  N     . PRO B 2  408 ? -7.666  -14.901 183.073 1.00 44.06  ? 392  PRO B N     1 
ATOM   7580  C  CA    . PRO B 2  408 ? -8.471  -14.262 184.133 1.00 42.20  ? 392  PRO B CA    1 
ATOM   7581  C  C     . PRO B 2  408 ? -7.835  -12.966 184.616 1.00 43.55  ? 392  PRO B C     1 
ATOM   7582  O  O     . PRO B 2  408 ? -7.325  -12.854 185.737 1.00 46.84  ? 392  PRO B O     1 
ATOM   7583  C  CB    . PRO B 2  408 ? -8.496  -15.345 185.218 1.00 35.21  ? 392  PRO B CB    1 
ATOM   7584  C  CG    . PRO B 2  408 ? -7.179  -16.015 185.078 1.00 45.21  ? 392  PRO B CG    1 
ATOM   7585  C  CD    . PRO B 2  408 ? -6.889  -16.041 183.589 1.00 45.71  ? 392  PRO B CD    1 
ATOM   7586  N  N     . ILE B 2  409 ? -7.903  -11.936 183.776 1.00 40.73  ? 393  ILE B N     1 
ATOM   7587  C  CA    . ILE B 2  409 ? -7.196  -10.690 184.050 1.00 48.75  ? 393  ILE B CA    1 
ATOM   7588  C  C     . ILE B 2  409 ? -7.686  -9.614  183.093 1.00 46.15  ? 393  ILE B C     1 
ATOM   7589  O  O     . ILE B 2  409 ? -8.060  -9.905  181.952 1.00 37.32  ? 393  ILE B O     1 
ATOM   7590  C  CB    . ILE B 2  409 ? -5.670  -10.885 183.926 1.00 53.68  ? 393  ILE B CB    1 
ATOM   7591  C  CG1   . ILE B 2  409 ? -4.916  -9.605  184.293 1.00 56.10  ? 393  ILE B CG1   1 
ATOM   7592  C  CG2   . ILE B 2  409 ? -5.290  -11.316 182.516 1.00 46.91  ? 393  ILE B CG2   1 
ATOM   7593  C  CD1   . ILE B 2  409 ? -3.416  -9.787  184.365 1.00 61.59  ? 393  ILE B CD1   1 
ATOM   7594  N  N     . GLN B 2  410 ? -7.698  -8.367  183.555 1.00 53.53  ? 394  GLN B N     1 
ATOM   7595  C  CA    . GLN B 2  410 ? -8.031  -7.256  182.682 1.00 52.87  ? 394  GLN B CA    1 
ATOM   7596  C  C     . GLN B 2  410 ? -6.991  -7.116  181.578 1.00 54.28  ? 394  GLN B C     1 
ATOM   7597  O  O     . GLN B 2  410 ? -5.800  -7.371  181.774 1.00 57.77  ? 394  GLN B O     1 
ATOM   7598  C  CB    . GLN B 2  410 ? -8.121  -5.955  183.477 1.00 56.79  ? 394  GLN B CB    1 
ATOM   7599  C  CG    . GLN B 2  410 ? -9.139  -4.973  182.925 1.00 65.58  ? 394  GLN B CG    1 
ATOM   7600  C  CD    . GLN B 2  410 ? -10.570 -5.459  183.102 1.00 75.29  ? 394  GLN B CD    1 
ATOM   7601  O  OE1   . GLN B 2  410 ? -10.852 -6.318  183.942 1.00 62.79  ? 394  GLN B OE1   1 
ATOM   7602  N  NE2   . GLN B 2  410 ? -11.481 -4.911  182.306 1.00 83.23  ? 394  GLN B NE2   1 
ATOM   7603  N  N     . LYS B 2  411 ? -7.466  -6.711  180.400 1.00 58.47  ? 395  LYS B N     1 
ATOM   7604  C  CA    . LYS B 2  411 ? -6.588  -6.497  179.254 1.00 55.01  ? 395  LYS B CA    1 
ATOM   7605  C  C     . LYS B 2  411 ? -5.471  -5.512  179.583 1.00 57.84  ? 395  LYS B C     1 
ATOM   7606  O  O     . LYS B 2  411 ? -4.286  -5.809  179.389 1.00 56.08  ? 395  LYS B O     1 
ATOM   7607  C  CB    . LYS B 2  411 ? -7.410  -5.996  178.067 1.00 58.87  ? 395  LYS B CB    1 
ATOM   7608  C  CG    . LYS B 2  411 ? -6.604  -5.293  176.991 1.00 58.19  ? 395  LYS B CG    1 
ATOM   7609  C  CD    . LYS B 2  411 ? -7.512  -4.828  175.874 1.00 58.27  ? 395  LYS B CD    1 
ATOM   7610  C  CE    . LYS B 2  411 ? -7.536  -5.823  174.734 1.00 65.71  ? 395  LYS B CE    1 
ATOM   7611  N  NZ    . LYS B 2  411 ? -6.256  -5.817  173.986 1.00 68.28  ? 395  LYS B NZ    1 
ATOM   7612  N  N     . GLU B 2  412 ? -5.841  -4.324  180.069 1.00 52.06  ? 396  GLU B N     1 
ATOM   7613  C  CA    . GLU B 2  412 ? -4.857  -3.298  180.402 1.00 50.23  ? 396  GLU B CA    1 
ATOM   7614  C  C     . GLU B 2  412 ? -3.807  -3.809  181.382 1.00 49.84  ? 396  GLU B C     1 
ATOM   7615  O  O     . GLU B 2  412 ? -2.611  -3.551  181.211 1.00 52.72  ? 396  GLU B O     1 
ATOM   7616  C  CB    . GLU B 2  412 ? -5.573  -2.092  181.006 1.00 63.11  ? 396  GLU B CB    1 
ATOM   7617  C  CG    . GLU B 2  412 ? -5.901  -0.984  180.034 1.00 70.61  ? 396  GLU B CG    1 
ATOM   7618  C  CD    . GLU B 2  412 ? -7.287  -1.164  179.435 1.00 89.44  ? 396  GLU B CD    1 
ATOM   7619  O  OE1   . GLU B 2  412 ? -7.975  -2.140  179.812 1.00 84.48  ? 396  GLU B OE1   1 
ATOM   7620  O  OE2   . GLU B 2  412 ? -7.692  -0.328  178.598 1.00 92.27  ? 396  GLU B OE2   1 
ATOM   7621  N  N     . THR B 2  413 ? -4.235  -4.537  182.415 1.00 48.14  ? 397  THR B N     1 
ATOM   7622  C  CA    . THR B 2  413 ? -3.287  -5.088  183.380 1.00 54.96  ? 397  THR B CA    1 
ATOM   7623  C  C     . THR B 2  413 ? -2.313  -6.059  182.721 1.00 60.66  ? 397  THR B C     1 
ATOM   7624  O  O     . THR B 2  413 ? -1.093  -5.945  182.891 1.00 57.45  ? 397  THR B O     1 
ATOM   7625  C  CB    . THR B 2  413 ? -4.034  -5.767  184.526 1.00 51.74  ? 397  THR B CB    1 
ATOM   7626  O  OG1   . THR B 2  413 ? -4.973  -4.846  185.093 1.00 63.42  ? 397  THR B OG1   1 
ATOM   7627  C  CG2   . THR B 2  413 ? -3.059  -6.200  185.602 1.00 55.43  ? 397  THR B CG2   1 
ATOM   7628  N  N     . TRP B 2  414 ? -2.836  -7.014  181.949 1.00 58.23  ? 398  TRP B N     1 
ATOM   7629  C  CA    . TRP B 2  414 ? -1.980  -7.975  181.257 1.00 57.35  ? 398  TRP B CA    1 
ATOM   7630  C  C     . TRP B 2  414 ? -1.003  -7.276  180.323 1.00 56.47  ? 398  TRP B C     1 
ATOM   7631  O  O     . TRP B 2  414 ? 0.203   -7.549  180.350 1.00 58.25  ? 398  TRP B O     1 
ATOM   7632  C  CB    . TRP B 2  414 ? -2.827  -8.983  180.488 1.00 60.09  ? 398  TRP B CB    1 
ATOM   7633  C  CG    . TRP B 2  414 ? -2.009  -9.997  179.754 1.00 44.58  ? 398  TRP B CG    1 
ATOM   7634  C  CD1   . TRP B 2  414 ? -1.785  -10.057 178.412 1.00 42.49  ? 398  TRP B CD1   1 
ATOM   7635  C  CD2   . TRP B 2  414 ? -1.296  -11.097 180.331 1.00 41.80  ? 398  TRP B CD2   1 
ATOM   7636  N  NE1   . TRP B 2  414 ? -0.985  -11.134 178.114 1.00 46.95  ? 398  TRP B NE1   1 
ATOM   7637  C  CE2   . TRP B 2  414 ? -0.671  -11.789 179.276 1.00 46.53  ? 398  TRP B CE2   1 
ATOM   7638  C  CE3   . TRP B 2  414 ? -1.132  -11.568 181.637 1.00 37.34  ? 398  TRP B CE3   1 
ATOM   7639  C  CZ2   . TRP B 2  414 ? 0.108   -12.926 179.487 1.00 46.21  ? 398  TRP B CZ2   1 
ATOM   7640  C  CZ3   . TRP B 2  414 ? -0.359  -12.696 181.845 1.00 42.17  ? 398  TRP B CZ3   1 
ATOM   7641  C  CH2   . TRP B 2  414 ? 0.251   -13.363 180.776 1.00 46.42  ? 398  TRP B CH2   1 
ATOM   7642  N  N     . GLU B 2  415 ? -1.504  -6.367  179.488 1.00 53.85  ? 399  GLU B N     1 
ATOM   7643  C  CA    . GLU B 2  415 ? -0.672  -5.781  178.443 1.00 58.98  ? 399  GLU B CA    1 
ATOM   7644  C  C     . GLU B 2  415 ? 0.425   -4.907  179.030 1.00 52.92  ? 399  GLU B C     1 
ATOM   7645  O  O     . GLU B 2  415 ? 1.487   -4.752  178.419 1.00 55.28  ? 399  GLU B O     1 
ATOM   7646  C  CB    . GLU B 2  415 ? -1.528  -4.965  177.477 1.00 59.22  ? 399  GLU B CB    1 
ATOM   7647  C  CG    . GLU B 2  415 ? -2.361  -5.794  176.526 1.00 61.54  ? 399  GLU B CG    1 
ATOM   7648  C  CD    . GLU B 2  415 ? -3.104  -4.936  175.529 1.00 62.61  ? 399  GLU B CD    1 
ATOM   7649  O  OE1   . GLU B 2  415 ? -3.252  -3.722  175.787 1.00 62.55  ? 399  GLU B OE1   1 
ATOM   7650  O  OE2   . GLU B 2  415 ? -3.523  -5.469  174.482 1.00 63.66  ? 399  GLU B OE2   1 
ATOM   7651  N  N     . THR B 2  416 ? 0.181   -4.325  180.203 1.00 59.92  ? 400  THR B N     1 
ATOM   7652  C  CA    . THR B 2  416 ? 1.186   -3.495  180.856 1.00 63.72  ? 400  THR B CA    1 
ATOM   7653  C  C     . THR B 2  416 ? 2.394   -4.307  181.327 1.00 60.00  ? 400  THR B C     1 
ATOM   7654  O  O     . THR B 2  416 ? 3.530   -3.824  181.245 1.00 67.16  ? 400  THR B O     1 
ATOM   7655  C  CB    . THR B 2  416 ? 0.551   -2.736  182.028 1.00 61.28  ? 400  THR B CB    1 
ATOM   7656  O  OG1   . THR B 2  416 ? -0.496  -1.883  181.544 1.00 45.73  ? 400  THR B OG1   1 
ATOM   7657  C  CG2   . THR B 2  416 ? 1.585   -1.887  182.753 1.00 68.46  ? 400  THR B CG2   1 
ATOM   7658  N  N     . TRP B 2  417 ? 2.197   -5.539  181.812 1.00 51.81  ? 401  TRP B N     1 
ATOM   7659  C  CA    . TRP B 2  417 ? 3.281   -6.204  182.526 1.00 53.74  ? 401  TRP B CA    1 
ATOM   7660  C  C     . TRP B 2  417 ? 3.823   -7.485  181.900 1.00 52.10  ? 401  TRP B C     1 
ATOM   7661  O  O     . TRP B 2  417 ? 4.945   -7.874  182.240 1.00 50.79  ? 401  TRP B O     1 
ATOM   7662  C  CB    . TRP B 2  417 ? 2.827   -6.575  183.948 1.00 53.30  ? 401  TRP B CB    1 
ATOM   7663  C  CG    . TRP B 2  417 ? 2.258   -5.445  184.735 1.00 58.08  ? 401  TRP B CG    1 
ATOM   7664  C  CD1   . TRP B 2  417 ? 0.982   -5.344  185.211 1.00 54.02  ? 401  TRP B CD1   1 
ATOM   7665  C  CD2   . TRP B 2  417 ? 2.922   -4.237  185.107 1.00 55.64  ? 401  TRP B CD2   1 
ATOM   7666  N  NE1   . TRP B 2  417 ? 0.818   -4.156  185.877 1.00 55.73  ? 401  TRP B NE1   1 
ATOM   7667  C  CE2   . TRP B 2  417 ? 1.995   -3.456  185.826 1.00 57.03  ? 401  TRP B CE2   1 
ATOM   7668  C  CE3   . TRP B 2  417 ? 4.213   -3.742  184.912 1.00 52.71  ? 401  TRP B CE3   1 
ATOM   7669  C  CZ2   . TRP B 2  417 ? 2.316   -2.209  186.347 1.00 56.32  ? 401  TRP B CZ2   1 
ATOM   7670  C  CZ3   . TRP B 2  417 ? 4.530   -2.505  185.431 1.00 60.70  ? 401  TRP B CZ3   1 
ATOM   7671  C  CH2   . TRP B 2  417 ? 3.586   -1.753  186.141 1.00 57.10  ? 401  TRP B CH2   1 
ATOM   7672  N  N     . TRP B 2  418 ? 3.079   -8.153  181.016 1.00 57.12  ? 402  TRP B N     1 
ATOM   7673  C  CA    . TRP B 2  418 ? 3.445   -9.523  180.650 1.00 53.23  ? 402  TRP B CA    1 
ATOM   7674  C  C     . TRP B 2  418 ? 4.834   -9.648  180.020 1.00 48.26  ? 402  TRP B C     1 
ATOM   7675  O  O     . TRP B 2  418 ? 5.513   -10.657 180.244 1.00 49.04  ? 402  TRP B O     1 
ATOM   7676  C  CB    . TRP B 2  418 ? 2.367   -10.131 179.747 1.00 49.22  ? 402  TRP B CB    1 
ATOM   7677  C  CG    . TRP B 2  418 ? 2.371   -9.698  178.320 1.00 45.14  ? 402  TRP B CG    1 
ATOM   7678  C  CD1   . TRP B 2  418 ? 1.673   -8.660  177.776 1.00 48.01  ? 402  TRP B CD1   1 
ATOM   7679  C  CD2   . TRP B 2  418 ? 3.063   -10.327 177.239 1.00 43.31  ? 402  TRP B CD2   1 
ATOM   7680  N  NE1   . TRP B 2  418 ? 1.906   -8.589  176.426 1.00 50.16  ? 402  TRP B NE1   1 
ATOM   7681  C  CE2   . TRP B 2  418 ? 2.758   -9.601  176.070 1.00 47.63  ? 402  TRP B CE2   1 
ATOM   7682  C  CE3   . TRP B 2  418 ? 3.923   -11.425 177.147 1.00 46.03  ? 402  TRP B CE3   1 
ATOM   7683  C  CZ2   . TRP B 2  418 ? 3.282   -9.938  174.824 1.00 46.04  ? 402  TRP B CZ2   1 
ATOM   7684  C  CZ3   . TRP B 2  418 ? 4.440   -11.760 175.910 1.00 48.81  ? 402  TRP B CZ3   1 
ATOM   7685  C  CH2   . TRP B 2  418 ? 4.118   -11.018 174.765 1.00 46.58  ? 402  TRP B CH2   1 
ATOM   7686  N  N     . THR B 2  419 ? 5.282   -8.664  179.233 1.00 50.65  ? 403  THR B N     1 
ATOM   7687  C  CA    . THR B 2  419 ? 6.611   -8.777  178.623 1.00 46.97  ? 403  THR B CA    1 
ATOM   7688  C  C     . THR B 2  419 ? 7.759   -8.718  179.630 1.00 46.25  ? 403  THR B C     1 
ATOM   7689  O  O     . THR B 2  419 ? 8.857   -9.186  179.320 1.00 50.24  ? 403  THR B O     1 
ATOM   7690  C  CB    . THR B 2  419 ? 6.830   -7.684  177.574 1.00 48.05  ? 403  THR B CB    1 
ATOM   7691  O  OG1   . THR B 2  419 ? 6.720   -6.397  178.190 1.00 62.21  ? 403  THR B OG1   1 
ATOM   7692  C  CG2   . THR B 2  419 ? 5.793   -7.792  176.464 1.00 53.32  ? 403  THR B CG2   1 
ATOM   7693  N  N     . GLU B 2  420 ? 7.533   -8.169  180.826 1.00 49.70  ? 404  GLU B N     1 
ATOM   7694  C  CA    . GLU B 2  420 ? 8.533   -8.227  181.891 1.00 40.56  ? 404  GLU B CA    1 
ATOM   7695  C  C     . GLU B 2  420 ? 8.823   -9.642  182.374 1.00 37.10  ? 404  GLU B C     1 
ATOM   7696  O  O     . GLU B 2  420 ? 9.883   -9.885  182.961 1.00 42.20  ? 404  GLU B O     1 
ATOM   7697  C  CB    . GLU B 2  420 ? 8.074   -7.383  183.077 1.00 56.11  ? 404  GLU B CB    1 
ATOM   7698  C  CG    . GLU B 2  420 ? 8.225   -5.901  182.878 1.00 63.76  ? 404  GLU B CG    1 
ATOM   7699  C  CD    . GLU B 2  420 ? 9.645   -5.520  182.575 1.00 62.93  ? 404  GLU B CD    1 
ATOM   7700  O  OE1   . GLU B 2  420 ? 9.921   -5.174  181.407 1.00 67.47  ? 404  GLU B OE1   1 
ATOM   7701  O  OE2   . GLU B 2  420 ? 10.485  -5.590  183.500 1.00 66.06  ? 404  GLU B OE2   1 
ATOM   7702  N  N     . TYR B 2  421 ? 7.884   -10.566 182.214 1.00 42.11  ? 405  TYR B N     1 
ATOM   7703  C  CA    . TYR B 2  421 ? 8.047   -11.910 182.747 1.00 45.95  ? 405  TYR B CA    1 
ATOM   7704  C  C     . TYR B 2  421 ? 8.144   -12.987 181.677 1.00 48.90  ? 405  TYR B C     1 
ATOM   7705  O  O     . TYR B 2  421 ? 8.371   -14.156 182.013 1.00 43.25  ? 405  TYR B O     1 
ATOM   7706  C  CB    . TYR B 2  421 ? 6.888   -12.203 183.701 1.00 42.56  ? 405  TYR B CB    1 
ATOM   7707  C  CG    . TYR B 2  421 ? 6.699   -11.073 184.684 1.00 55.47  ? 405  TYR B CG    1 
ATOM   7708  C  CD1   . TYR B 2  421 ? 7.721   -10.711 185.547 1.00 57.73  ? 405  TYR B CD1   1 
ATOM   7709  C  CD2   . TYR B 2  421 ? 5.527   -10.327 184.706 1.00 59.65  ? 405  TYR B CD2   1 
ATOM   7710  C  CE1   . TYR B 2  421 ? 7.576   -9.663  186.430 1.00 49.64  ? 405  TYR B CE1   1 
ATOM   7711  C  CE2   . TYR B 2  421 ? 5.369   -9.274  185.593 1.00 54.43  ? 405  TYR B CE2   1 
ATOM   7712  C  CZ    . TYR B 2  421 ? 6.402   -8.947  186.449 1.00 55.13  ? 405  TYR B CZ    1 
ATOM   7713  O  OH    . TYR B 2  421 ? 6.263   -7.912  187.344 1.00 64.43  ? 405  TYR B OH    1 
ATOM   7714  N  N     . TRP B 2  422 ? 7.998   -12.626 180.404 1.00 45.08  ? 406  TRP B N     1 
ATOM   7715  C  CA    . TRP B 2  422 ? 7.995   -13.615 179.335 1.00 50.14  ? 406  TRP B CA    1 
ATOM   7716  C  C     . TRP B 2  422 ? 9.392   -14.188 179.115 1.00 53.91  ? 406  TRP B C     1 
ATOM   7717  O  O     . TRP B 2  422 ? 10.361  -13.447 178.922 1.00 57.88  ? 406  TRP B O     1 
ATOM   7718  C  CB    . TRP B 2  422 ? 7.440   -13.018 178.044 1.00 51.45  ? 406  TRP B CB    1 
ATOM   7719  C  CG    . TRP B 2  422 ? 6.975   -14.091 177.112 1.00 52.87  ? 406  TRP B CG    1 
ATOM   7720  C  CD1   . TRP B 2  422 ? 7.589   -14.512 175.970 1.00 52.99  ? 406  TRP B CD1   1 
ATOM   7721  C  CD2   . TRP B 2  422 ? 5.829   -14.932 177.286 1.00 55.73  ? 406  TRP B CD2   1 
ATOM   7722  N  NE1   . TRP B 2  422 ? 6.877   -15.540 175.402 1.00 49.18  ? 406  TRP B NE1   1 
ATOM   7723  C  CE2   . TRP B 2  422 ? 5.794   -15.819 176.193 1.00 53.08  ? 406  TRP B CE2   1 
ATOM   7724  C  CE3   . TRP B 2  422 ? 4.821   -15.012 178.253 1.00 55.51  ? 406  TRP B CE3   1 
ATOM   7725  C  CZ2   . TRP B 2  422 ? 4.791   -16.772 176.040 1.00 55.09  ? 406  TRP B CZ2   1 
ATOM   7726  C  CZ3   . TRP B 2  422 ? 3.828   -15.958 178.099 1.00 51.96  ? 406  TRP B CZ3   1 
ATOM   7727  C  CH2   . TRP B 2  422 ? 3.821   -16.827 177.002 1.00 54.55  ? 406  TRP B CH2   1 
ATOM   7728  N  N     . GLN B 2  423 ? 9.492   -15.517 179.157 1.00 53.04  ? 407  GLN B N     1 
ATOM   7729  C  CA    . GLN B 2  423 ? 10.769  -16.209 179.043 1.00 48.89  ? 407  GLN B CA    1 
ATOM   7730  C  C     . GLN B 2  423 ? 10.794  -17.230 177.913 1.00 59.78  ? 407  GLN B C     1 
ATOM   7731  O  O     . GLN B 2  423 ? 11.751  -18.009 177.821 1.00 67.52  ? 407  GLN B O     1 
ATOM   7732  C  CB    . GLN B 2  423 ? 11.104  -16.899 180.365 1.00 50.07  ? 407  GLN B CB    1 
ATOM   7733  C  CG    . GLN B 2  423 ? 11.354  -15.953 181.519 1.00 48.62  ? 407  GLN B CG    1 
ATOM   7734  C  CD    . GLN B 2  423 ? 11.474  -16.687 182.839 1.00 43.37  ? 407  GLN B CD    1 
ATOM   7735  O  OE1   . GLN B 2  423 ? 10.743  -17.642 183.097 1.00 44.59  ? 407  GLN B OE1   1 
ATOM   7736  N  NE2   . GLN B 2  423 ? 12.406  -16.253 183.676 1.00 49.48  ? 407  GLN B NE2   1 
ATOM   7737  N  N     . ALA B 2  424 ? 9.768   -17.268 177.070 1.00 52.06  ? 408  ALA B N     1 
ATOM   7738  C  CA    . ALA B 2  424 ? 9.653   -18.256 176.009 1.00 57.74  ? 408  ALA B CA    1 
ATOM   7739  C  C     . ALA B 2  424 ? 9.850   -17.599 174.647 1.00 54.77  ? 408  ALA B C     1 
ATOM   7740  O  O     . ALA B 2  424 ? 9.712   -16.382 174.495 1.00 50.45  ? 408  ALA B O     1 
ATOM   7741  C  CB    . ALA B 2  424 ? 8.292   -18.960 176.060 1.00 49.42  ? 408  ALA B CB    1 
ATOM   7742  N  N     . THR B 2  425 ? 10.191  -18.414 173.650 1.00 54.46  ? 409  THR B N     1 
ATOM   7743  C  CA    . THR B 2  425 ? 10.516  -17.882 172.332 1.00 60.14  ? 409  THR B CA    1 
ATOM   7744  C  C     . THR B 2  425 ? 9.312   -17.879 171.399 1.00 55.63  ? 409  THR B C     1 
ATOM   7745  O  O     . THR B 2  425 ? 9.418   -17.384 170.272 1.00 52.96  ? 409  THR B O     1 
ATOM   7746  C  CB    . THR B 2  425 ? 11.662  -18.679 171.687 1.00 61.69  ? 409  THR B CB    1 
ATOM   7747  O  OG1   . THR B 2  425 ? 11.258  -20.041 171.485 1.00 55.08  ? 409  THR B OG1   1 
ATOM   7748  C  CG2   . THR B 2  425 ? 12.908  -18.641 172.563 1.00 55.81  ? 409  THR B CG2   1 
ATOM   7749  N  N     . TRP B 2  426 ? 8.182   -18.425 171.845 1.00 57.94  ? 410  TRP B N     1 
ATOM   7750  C  CA    . TRP B 2  426 ? 6.878   -18.315 171.204 1.00 58.47  ? 410  TRP B CA    1 
ATOM   7751  C  C     . TRP B 2  426 ? 5.936   -17.477 172.063 1.00 53.48  ? 410  TRP B C     1 
ATOM   7752  O  O     . TRP B 2  426 ? 6.186   -17.234 173.247 1.00 47.60  ? 410  TRP B O     1 
ATOM   7753  C  CB    . TRP B 2  426 ? 6.261   -19.692 170.924 1.00 53.83  ? 410  TRP B CB    1 
ATOM   7754  C  CG    . TRP B 2  426 ? 6.627   -20.754 171.906 1.00 54.62  ? 410  TRP B CG    1 
ATOM   7755  C  CD1   . TRP B 2  426 ? 7.471   -21.802 171.692 1.00 54.84  ? 410  TRP B CD1   1 
ATOM   7756  C  CD2   . TRP B 2  426 ? 6.200   -20.855 173.270 1.00 58.50  ? 410  TRP B CD2   1 
ATOM   7757  N  NE1   . TRP B 2  426 ? 7.574   -22.568 172.827 1.00 55.48  ? 410  TRP B NE1   1 
ATOM   7758  C  CE2   . TRP B 2  426 ? 6.809   -22.004 173.813 1.00 55.26  ? 410  TRP B CE2   1 
ATOM   7759  C  CE3   . TRP B 2  426 ? 5.357   -20.091 174.081 1.00 47.80  ? 410  TRP B CE3   1 
ATOM   7760  C  CZ2   . TRP B 2  426 ? 6.602   -22.407 175.128 1.00 51.03  ? 410  TRP B CZ2   1 
ATOM   7761  C  CZ3   . TRP B 2  426 ? 5.156   -20.491 175.387 1.00 50.30  ? 410  TRP B CZ3   1 
ATOM   7762  C  CH2   . TRP B 2  426 ? 5.774   -21.641 175.898 1.00 50.37  ? 410  TRP B CH2   1 
ATOM   7763  N  N     . ILE B 2  427 ? 4.839   -17.028 171.449 1.00 53.28  ? 411  ILE B N     1 
ATOM   7764  C  CA    . ILE B 2  427 ? 3.781   -16.323 172.155 1.00 57.42  ? 411  ILE B CA    1 
ATOM   7765  C  C     . ILE B 2  427 ? 2.428   -16.908 171.768 1.00 47.55  ? 411  ILE B C     1 
ATOM   7766  O  O     . ILE B 2  427 ? 2.040   -16.845 170.598 1.00 52.01  ? 411  ILE B O     1 
ATOM   7767  C  CB    . ILE B 2  427 ? 3.797   -14.813 171.855 1.00 56.52  ? 411  ILE B CB    1 
ATOM   7768  C  CG1   . ILE B 2  427 ? 5.231   -14.275 171.807 1.00 48.51  ? 411  ILE B CG1   1 
ATOM   7769  C  CG2   . ILE B 2  427 ? 2.935   -14.051 172.861 1.00 50.59  ? 411  ILE B CG2   1 
ATOM   7770  C  CD1   . ILE B 2  427 ? 5.317   -12.802 171.468 1.00 50.73  ? 411  ILE B CD1   1 
ATOM   7771  N  N     . PRO B 2  428 ? 1.676   -17.484 172.700 1.00 49.10  ? 412  PRO B N     1 
ATOM   7772  C  CA    . PRO B 2  428 ? 0.367   -18.041 172.354 1.00 55.10  ? 412  PRO B CA    1 
ATOM   7773  C  C     . PRO B 2  428 ? -0.639  -16.932 172.097 1.00 48.75  ? 412  PRO B C     1 
ATOM   7774  O  O     . PRO B 2  428 ? -0.446  -15.778 172.485 1.00 51.40  ? 412  PRO B O     1 
ATOM   7775  C  CB    . PRO B 2  428 ? -0.002  -18.858 173.593 1.00 52.67  ? 412  PRO B CB    1 
ATOM   7776  C  CG    . PRO B 2  428 ? 0.642   -18.110 174.707 1.00 51.19  ? 412  PRO B CG    1 
ATOM   7777  C  CD    . PRO B 2  428 ? 1.938   -17.559 174.147 1.00 47.10  ? 412  PRO B CD    1 
ATOM   7778  N  N     . GLU B 2  429 ? -1.721  -17.291 171.414 1.00 42.64  ? 413  GLU B N     1 
ATOM   7779  C  CA    . GLU B 2  429 ? -2.873  -16.403 171.368 1.00 52.30  ? 413  GLU B CA    1 
ATOM   7780  C  C     . GLU B 2  429 ? -3.561  -16.352 172.727 1.00 51.47  ? 413  GLU B C     1 
ATOM   7781  O  O     . GLU B 2  429 ? -3.507  -17.303 173.512 1.00 52.25  ? 413  GLU B O     1 
ATOM   7782  C  CB    . GLU B 2  429 ? -3.855  -16.853 170.294 1.00 53.03  ? 413  GLU B CB    1 
ATOM   7783  C  CG    . GLU B 2  429 ? -4.449  -15.697 169.534 1.00 63.77  ? 413  GLU B CG    1 
ATOM   7784  C  CD    . GLU B 2  429 ? -4.161  -15.744 168.055 1.00 77.61  ? 413  GLU B CD    1 
ATOM   7785  O  OE1   . GLU B 2  429 ? -3.210  -16.442 167.638 1.00 67.22  ? 413  GLU B OE1   1 
ATOM   7786  O  OE2   . GLU B 2  429 ? -4.901  -15.073 167.310 1.00 87.44  ? 413  GLU B OE2   1 
ATOM   7787  N  N     . TRP B 2  430 ? -4.236  -15.235 172.996 1.00 51.20  ? 414  TRP B N     1 
ATOM   7788  C  CA    . TRP B 2  430 ? -4.982  -15.117 174.240 1.00 55.64  ? 414  TRP B CA    1 
ATOM   7789  C  C     . TRP B 2  430 ? -6.145  -14.151 174.080 1.00 58.63  ? 414  TRP B C     1 
ATOM   7790  O  O     . TRP B 2  430 ? -6.184  -13.329 173.160 1.00 60.35  ? 414  TRP B O     1 
ATOM   7791  C  CB    . TRP B 2  430 ? -4.092  -14.651 175.403 1.00 51.60  ? 414  TRP B CB    1 
ATOM   7792  C  CG    . TRP B 2  430 ? -3.310  -13.405 175.120 1.00 48.15  ? 414  TRP B CG    1 
ATOM   7793  C  CD1   . TRP B 2  430 ? -3.807  -12.196 174.725 1.00 53.89  ? 414  TRP B CD1   1 
ATOM   7794  C  CD2   . TRP B 2  430 ? -1.893  -13.236 175.231 1.00 57.18  ? 414  TRP B CD2   1 
ATOM   7795  N  NE1   . TRP B 2  430 ? -2.789  -11.290 174.572 1.00 56.24  ? 414  TRP B NE1   1 
ATOM   7796  C  CE2   . TRP B 2  430 ? -1.602  -11.901 174.876 1.00 62.82  ? 414  TRP B CE2   1 
ATOM   7797  C  CE3   . TRP B 2  430 ? -0.839  -14.084 175.590 1.00 57.61  ? 414  TRP B CE3   1 
ATOM   7798  C  CZ2   . TRP B 2  430 ? -0.303  -11.395 174.869 1.00 56.16  ? 414  TRP B CZ2   1 
ATOM   7799  C  CZ3   . TRP B 2  430 ? 0.452   -13.578 175.585 1.00 48.63  ? 414  TRP B CZ3   1 
ATOM   7800  C  CH2   . TRP B 2  430 ? 0.708   -12.246 175.227 1.00 51.84  ? 414  TRP B CH2   1 
ATOM   7801  N  N     . GLU B 2  431 ? -7.096  -14.272 175.003 1.00 50.16  ? 415  GLU B N     1 
ATOM   7802  C  CA    . GLU B 2  431 ? -8.202  -13.342 175.145 1.00 49.82  ? 415  GLU B CA    1 
ATOM   7803  C  C     . GLU B 2  431 ? -8.464  -13.164 176.636 1.00 50.64  ? 415  GLU B C     1 
ATOM   7804  O  O     . GLU B 2  431 ? -7.941  -13.908 177.470 1.00 48.16  ? 415  GLU B O     1 
ATOM   7805  C  CB    . GLU B 2  431 ? -9.449  -13.839 174.400 1.00 56.61  ? 415  GLU B CB    1 
ATOM   7806  C  CG    . GLU B 2  431 ? -10.129 -15.036 175.055 1.00 65.25  ? 415  GLU B CG    1 
ATOM   7807  C  CD    . GLU B 2  431 ? -11.181 -15.683 174.166 1.00 66.30  ? 415  GLU B CD    1 
ATOM   7808  O  OE1   . GLU B 2  431 ? -11.015 -15.656 172.926 1.00 80.20  ? 415  GLU B OE1   1 
ATOM   7809  O  OE2   . GLU B 2  431 ? -12.165 -16.231 174.710 1.00 52.47  ? 415  GLU B OE2   1 
ATOM   7810  N  N     . PHE B 2  432 ? -9.299  -12.186 176.975 1.00 52.72  ? 416  PHE B N     1 
ATOM   7811  C  CA    . PHE B 2  432 ? -9.496  -11.785 178.362 1.00 49.34  ? 416  PHE B CA    1 
ATOM   7812  C  C     . PHE B 2  432 ? -10.927 -12.084 178.787 1.00 53.37  ? 416  PHE B C     1 
ATOM   7813  O  O     . PHE B 2  432 ? -11.874 -11.761 178.063 1.00 59.15  ? 416  PHE B O     1 
ATOM   7814  C  CB    . PHE B 2  432 ? -9.154  -10.304 178.536 1.00 52.86  ? 416  PHE B CB    1 
ATOM   7815  C  CG    . PHE B 2  432 ? -7.789  -9.940  178.010 1.00 52.57  ? 416  PHE B CG    1 
ATOM   7816  C  CD1   . PHE B 2  432 ? -6.643  -10.295 178.709 1.00 52.32  ? 416  PHE B CD1   1 
ATOM   7817  C  CD2   . PHE B 2  432 ? -7.651  -9.260  176.810 1.00 50.66  ? 416  PHE B CD2   1 
ATOM   7818  C  CE1   . PHE B 2  432 ? -5.388  -9.969  178.227 1.00 46.06  ? 416  PHE B CE1   1 
ATOM   7819  C  CE2   . PHE B 2  432 ? -6.398  -8.931  176.323 1.00 50.97  ? 416  PHE B CE2   1 
ATOM   7820  C  CZ    . PHE B 2  432 ? -5.266  -9.287  177.032 1.00 52.19  ? 416  PHE B CZ    1 
ATOM   7821  N  N     . VAL B 2  433 ? -11.076 -12.693 179.967 1.00 51.48  ? 417  VAL B N     1 
ATOM   7822  C  CA    . VAL B 2  433 ? -12.373 -13.025 180.538 1.00 59.66  ? 417  VAL B CA    1 
ATOM   7823  C  C     . VAL B 2  433 ? -12.462 -12.518 181.973 1.00 68.63  ? 417  VAL B C     1 
ATOM   7824  O  O     . VAL B 2  433 ? -11.450 -12.264 182.629 1.00 69.65  ? 417  VAL B O     1 
ATOM   7825  C  CB    . VAL B 2  433 ? -12.613 -14.548 180.503 1.00 63.03  ? 417  VAL B CB    1 
ATOM   7826  C  CG1   . VAL B 2  433 ? -12.700 -15.036 179.063 1.00 63.00  ? 417  VAL B CG1   1 
ATOM   7827  C  CG2   . VAL B 2  433 ? -11.499 -15.267 181.245 1.00 49.63  ? 417  VAL B CG2   1 
ATOM   7828  N  N     . ASN B 2  434 ? -13.702 -12.369 182.459 1.00 61.08  ? 418  ASN B N     1 
ATOM   7829  C  CA    . ASN B 2  434 ? -13.961 -12.007 183.860 1.00 64.19  ? 418  ASN B CA    1 
ATOM   7830  C  C     . ASN B 2  434 ? -15.115 -12.862 184.390 1.00 70.61  ? 418  ASN B C     1 
ATOM   7831  O  O     . ASN B 2  434 ? -16.285 -12.495 184.253 1.00 79.08  ? 418  ASN B O     1 
ATOM   7832  C  CB    . ASN B 2  434 ? -14.267 -10.520 183.998 1.00 66.36  ? 418  ASN B CB    1 
ATOM   7833  C  CG    . ASN B 2  434 ? -14.291 -10.056 185.451 1.00 71.20  ? 418  ASN B CG    1 
ATOM   7834  O  OD1   . ASN B 2  434 ? -14.308 -10.867 186.379 1.00 68.75  ? 418  ASN B OD1   1 
ATOM   7835  N  ND2   . ASN B 2  434 ? -14.318 -8.743  185.651 1.00 78.55  ? 418  ASN B ND2   1 
ATOM   7836  N  N     . THR B 2  435 ? -14.782 -13.997 185.007 1.00 74.09  ? 419  THR B N     1 
ATOM   7837  C  CA    . THR B 2  435 ? -15.765 -15.008 185.400 1.00 70.29  ? 419  THR B CA    1 
ATOM   7838  C  C     . THR B 2  435 ? -15.733 -15.150 186.914 1.00 73.93  ? 419  THR B C     1 
ATOM   7839  O  O     . THR B 2  435 ? -14.917 -15.917 187.450 1.00 78.35  ? 419  THR B O     1 
ATOM   7840  C  CB    . THR B 2  435 ? -15.488 -16.353 184.733 1.00 76.85  ? 419  THR B CB    1 
ATOM   7841  O  OG1   . THR B 2  435 ? -15.131 -16.149 183.361 1.00 91.07  ? 419  THR B OG1   1 
ATOM   7842  C  CG2   . THR B 2  435 ? -16.722 -17.243 184.813 1.00 90.13  ? 419  THR B CG2   1 
ATOM   7843  N  N     . PRO B 2  436 ? -16.587 -14.436 187.644 1.00 80.82  ? 420  PRO B N     1 
ATOM   7844  C  CA    . PRO B 2  436 ? -16.634 -14.599 189.106 1.00 85.33  ? 420  PRO B CA    1 
ATOM   7845  C  C     . PRO B 2  436 ? -16.870 -16.049 189.491 1.00 103.43 ? 420  PRO B C     1 
ATOM   7846  O  O     . PRO B 2  436 ? -17.754 -16.717 188.934 1.00 95.17  ? 420  PRO B O     1 
ATOM   7847  C  CB    . PRO B 2  436 ? -17.806 -13.701 189.526 1.00 74.18  ? 420  PRO B CB    1 
ATOM   7848  C  CG    . PRO B 2  436 ? -17.895 -12.676 188.440 1.00 66.02  ? 420  PRO B CG    1 
ATOM   7849  C  CD    . PRO B 2  436 ? -17.468 -13.354 187.171 1.00 71.22  ? 420  PRO B CD    1 
ATOM   7850  N  N     . PRO B 2  437 ? -16.091 -16.572 190.443 1.00 118.35 ? 421  PRO B N     1 
ATOM   7851  C  CA    . PRO B 2  437 ? -16.255 -17.970 190.864 1.00 119.98 ? 421  PRO B CA    1 
ATOM   7852  C  C     . PRO B 2  437 ? -17.455 -18.175 191.771 1.00 121.96 ? 421  PRO B C     1 
ATOM   7853  O  O     . PRO B 2  437 ? -17.393 -17.882 192.969 1.00 125.53 ? 421  PRO B O     1 
ATOM   7854  C  CB    . PRO B 2  437 ? -14.940 -18.267 191.593 1.00 120.83 ? 421  PRO B CB    1 
ATOM   7855  C  CG    . PRO B 2  437 ? -14.523 -16.945 192.148 1.00 117.16 ? 421  PRO B CG    1 
ATOM   7856  C  CD    . PRO B 2  437 ? -15.019 -15.889 191.188 1.00 112.11 ? 421  PRO B CD    1 
ATOM   7857  N  N     . LEU B 2  438 ? -18.551 -18.684 191.219 1.00 113.71 ? 422  LEU B N     1 
ATOM   7858  C  CA    . LEU B 2  438 ? -19.740 -18.907 192.028 1.00 117.69 ? 422  LEU B CA    1 
ATOM   7859  C  C     . LEU B 2  438 ? -19.740 -20.280 192.683 1.00 113.65 ? 422  LEU B C     1 
ATOM   7860  O  O     . LEU B 2  438 ? -20.265 -20.436 193.792 1.00 109.43 ? 422  LEU B O     1 
ATOM   7861  C  CB    . LEU B 2  438 ? -20.987 -18.755 191.153 1.00 112.69 ? 422  LEU B CB    1 
ATOM   7862  C  CG    . LEU B 2  438 ? -21.253 -17.346 190.615 1.00 113.14 ? 422  LEU B CG    1 
ATOM   7863  C  CD1   . LEU B 2  438 ? -22.604 -17.284 189.932 1.00 102.28 ? 422  LEU B CD1   1 
ATOM   7864  C  CD2   . LEU B 2  438 ? -21.155 -16.300 191.717 1.00 114.66 ? 422  LEU B CD2   1 
ATOM   7865  N  N     . VAL B 2  439 ? -19.173 -21.273 192.008 1.00 115.66 ? 423  VAL B N     1 
ATOM   7866  C  CA    . VAL B 2  439 ? -18.894 -22.591 192.565 1.00 102.15 ? 423  VAL B CA    1 
ATOM   7867  C  C     . VAL B 2  439 ? -17.384 -22.787 192.607 1.00 97.26  ? 423  VAL B C     1 
ATOM   7868  O  O     . VAL B 2  439 ? -16.689 -22.485 191.629 1.00 99.74  ? 423  VAL B O     1 
ATOM   7869  C  CB    . VAL B 2  439 ? -19.576 -23.705 191.750 1.00 95.81  ? 423  VAL B CB    1 
ATOM   7870  C  CG1   . VAL B 2  439 ? -19.054 -25.074 192.165 1.00 92.09  ? 423  VAL B CG1   1 
ATOM   7871  C  CG2   . VAL B 2  439 ? -21.085 -23.636 191.917 1.00 89.41  ? 423  VAL B CG2   1 
ATOM   7872  N  N     . LYS B 2  440 ? -16.871 -23.281 193.736 1.00 92.31  ? 424  LYS B N     1 
ATOM   7873  C  CA    . LYS B 2  440 ? -15.446 -23.602 193.838 1.00 95.44  ? 424  LYS B CA    1 
ATOM   7874  C  C     . LYS B 2  440 ? -15.324 -24.978 193.193 1.00 85.71  ? 424  LYS B C     1 
ATOM   7875  O  O     . LYS B 2  440 ? -15.273 -26.027 193.840 1.00 86.64  ? 424  LYS B O     1 
ATOM   7876  C  CB    . LYS B 2  440 ? -14.957 -23.570 195.282 1.00 99.63  ? 424  LYS B CB    1 
ATOM   7877  C  CG    . LYS B 2  440 ? -15.018 -22.191 195.929 1.00 92.33  ? 424  LYS B CG    1 
ATOM   7878  C  CD    . LYS B 2  440 ? -14.275 -22.154 197.261 1.00 94.23  ? 424  LYS B CD    1 
ATOM   7879  C  CE    . LYS B 2  440 ? -15.154 -22.698 198.381 1.00 118.62 ? 424  LYS B CE    1 
ATOM   7880  N  NZ    . LYS B 2  440 ? -14.434 -22.871 199.673 1.00 114.19 ? 424  LYS B NZ    1 
ATOM   7881  N  N     . LEU B 2  441 ? -15.281 -24.936 191.863 1.00 83.43  ? 425  LEU B N     1 
ATOM   7882  C  CA    . LEU B 2  441 ? -15.447 -26.098 191.001 1.00 73.66  ? 425  LEU B CA    1 
ATOM   7883  C  C     . LEU B 2  441 ? -14.184 -26.939 190.870 1.00 67.31  ? 425  LEU B C     1 
ATOM   7884  O  O     . LEU B 2  441 ? -14.235 -28.165 191.008 1.00 64.09  ? 425  LEU B O     1 
ATOM   7885  C  CB    . LEU B 2  441 ? -15.887 -25.594 189.633 1.00 78.52  ? 425  LEU B CB    1 
ATOM   7886  C  CG    . LEU B 2  441 ? -16.400 -26.494 188.530 1.00 83.98  ? 425  LEU B CG    1 
ATOM   7887  C  CD1   . LEU B 2  441 ? -17.608 -27.276 189.009 1.00 81.33  ? 425  LEU B CD1   1 
ATOM   7888  C  CD2   . LEU B 2  441 ? -16.734 -25.558 187.395 1.00 89.23  ? 425  LEU B CD2   1 
ATOM   7889  N  N     . TRP B 2  442 ? -13.047 -26.308 190.584 1.00 80.03  ? 426  TRP B N     1 
ATOM   7890  C  CA    . TRP B 2  442 ? -11.805 -27.035 190.351 1.00 71.82  ? 426  TRP B CA    1 
ATOM   7891  C  C     . TRP B 2  442 ? -10.881 -27.041 191.561 1.00 73.90  ? 426  TRP B C     1 
ATOM   7892  O  O     . TRP B 2  442 ? -9.771  -27.574 191.473 1.00 79.89  ? 426  TRP B O     1 
ATOM   7893  C  CB    . TRP B 2  442 ? -11.063 -26.446 189.150 1.00 61.59  ? 426  TRP B CB    1 
ATOM   7894  C  CG    . TRP B 2  442 ? -11.890 -26.354 187.902 1.00 64.72  ? 426  TRP B CG    1 
ATOM   7895  C  CD1   . TRP B 2  442 ? -12.494 -25.235 187.402 1.00 66.82  ? 426  TRP B CD1   1 
ATOM   7896  C  CD2   . TRP B 2  442 ? -12.203 -27.417 186.993 1.00 53.62  ? 426  TRP B CD2   1 
ATOM   7897  N  NE1   . TRP B 2  442 ? -13.160 -25.535 186.237 1.00 55.04  ? 426  TRP B NE1   1 
ATOM   7898  C  CE2   . TRP B 2  442 ? -12.997 -26.867 185.964 1.00 56.90  ? 426  TRP B CE2   1 
ATOM   7899  C  CE3   . TRP B 2  442 ? -11.888 -28.778 186.948 1.00 52.29  ? 426  TRP B CE3   1 
ATOM   7900  C  CZ2   . TRP B 2  442 ? -13.482 -27.632 184.904 1.00 61.03  ? 426  TRP B CZ2   1 
ATOM   7901  C  CZ3   . TRP B 2  442 ? -12.369 -29.536 185.892 1.00 58.40  ? 426  TRP B CZ3   1 
ATOM   7902  C  CH2   . TRP B 2  442 ? -13.159 -28.961 184.886 1.00 63.52  ? 426  TRP B CH2   1 
ATOM   7903  N  N     . TYR B 2  443 ? -11.313 -26.475 192.683 1.00 77.26  ? 427  TYR B N     1 
ATOM   7904  C  CA    . TYR B 2  443 ? -10.478 -26.372 193.871 1.00 85.04  ? 427  TYR B CA    1 
ATOM   7905  C  C     . TYR B 2  443 ? -11.387 -26.261 195.083 1.00 111.03 ? 427  TYR B C     1 
ATOM   7906  O  O     . TYR B 2  443 ? -12.346 -25.485 195.067 1.00 110.58 ? 427  TYR B O     1 
ATOM   7907  C  CB    . TYR B 2  443 ? -9.543  -25.160 193.777 1.00 71.01  ? 427  TYR B CB    1 
ATOM   7908  C  CG    . TYR B 2  443 ? -8.426  -25.143 194.793 1.00 84.56  ? 427  TYR B CG    1 
ATOM   7909  C  CD1   . TYR B 2  443 ? -7.305  -25.947 194.643 1.00 73.91  ? 427  TYR B CD1   1 
ATOM   7910  C  CD2   . TYR B 2  443 ? -8.492  -24.312 195.904 1.00 96.22  ? 427  TYR B CD2   1 
ATOM   7911  C  CE1   . TYR B 2  443 ? -6.284  -25.929 195.577 1.00 71.25  ? 427  TYR B CE1   1 
ATOM   7912  C  CE2   . TYR B 2  443 ? -7.476  -24.286 196.841 1.00 84.40  ? 427  TYR B CE2   1 
ATOM   7913  C  CZ    . TYR B 2  443 ? -6.374  -25.096 196.674 1.00 74.46  ? 427  TYR B CZ    1 
ATOM   7914  O  OH    . TYR B 2  443 ? -5.362  -25.071 197.606 1.00 78.61  ? 427  TYR B OH    1 
ATOM   7915  N  N     . GLN B 2  444 ? -11.089 -27.035 196.122 1.00 130.98 ? 428  GLN B N     1 
ATOM   7916  C  CA    . GLN B 2  444 ? -11.961 -27.104 197.289 1.00 141.83 ? 428  GLN B CA    1 
ATOM   7917  C  C     . GLN B 2  444 ? -11.560 -26.094 198.358 1.00 140.94 ? 428  GLN B C     1 
ATOM   7918  O  O     . GLN B 2  444 ? -12.351 -25.225 198.730 1.00 139.76 ? 428  GLN B O     1 
ATOM   7919  C  CB    . GLN B 2  444 ? -11.954 -28.519 197.870 1.00 144.52 ? 428  GLN B CB    1 
ATOM   7920  C  CG    . GLN B 2  444 ? -12.194 -29.603 196.833 1.00 144.31 ? 428  GLN B CG    1 
ATOM   7921  C  CD    . GLN B 2  444 ? -13.024 -30.751 197.367 1.00 146.29 ? 428  GLN B CD    1 
ATOM   7922  O  OE1   . GLN B 2  444 ? -14.167 -30.942 196.959 1.00 143.79 ? 428  GLN B OE1   1 
ATOM   7923  N  NE2   . GLN B 2  444 ? -12.451 -31.525 198.282 1.00 150.80 ? 428  GLN B NE2   1 
ATOM   7924  O  OXT   . GLN B 2  444 ? -10.441 -26.120 198.871 1.00 136.75 ? 428  GLN B OXT   1 
ATOM   7925  N  N     . PRO C 1  1   ? 10.093  -48.803 100.067 1.00 198.14 ? 1    PRO C N     1 
ATOM   7926  C  CA    . PRO C 1  1   ? 10.227  -50.213 100.457 1.00 193.25 ? 1    PRO C CA    1 
ATOM   7927  C  C     . PRO C 1  1   ? 10.088  -50.434 101.953 1.00 202.86 ? 1    PRO C C     1 
ATOM   7928  O  O     . PRO C 1  1   ? 11.049  -50.238 102.704 1.00 196.94 ? 1    PRO C O     1 
ATOM   7929  C  CB    . PRO C 1  1   ? 11.635  -50.574 99.969  1.00 183.48 ? 1    PRO C CB    1 
ATOM   7930  C  CG    . PRO C 1  1   ? 12.372  -49.285 100.010 1.00 184.83 ? 1    PRO C CG    1 
ATOM   7931  C  CD    . PRO C 1  1   ? 11.374  -48.227 99.624  1.00 188.00 ? 1    PRO C CD    1 
ATOM   7932  N  N     . ILE C 1  2   ? 8.899   -50.835 102.404 1.00 230.84 ? 2    ILE C N     1 
ATOM   7933  C  CA    . ILE C 1  2   ? 8.676   -50.974 103.836 1.00 229.71 ? 2    ILE C CA    1 
ATOM   7934  C  C     . ILE C 1  2   ? 9.399   -52.219 104.335 1.00 229.84 ? 2    ILE C C     1 
ATOM   7935  O  O     . ILE C 1  2   ? 9.501   -53.234 103.632 1.00 231.09 ? 2    ILE C O     1 
ATOM   7936  C  CB    . ILE C 1  2   ? 7.168   -51.011 104.151 1.00 226.76 ? 2    ILE C CB    1 
ATOM   7937  C  CG1   . ILE C 1  2   ? 6.548   -52.355 103.760 1.00 225.56 ? 2    ILE C CG1   1 
ATOM   7938  C  CG2   . ILE C 1  2   ? 6.448   -49.863 103.456 1.00 225.22 ? 2    ILE C CG2   1 
ATOM   7939  C  CD1   . ILE C 1  2   ? 5.151   -52.560 104.306 1.00 222.23 ? 2    ILE C CD1   1 
ATOM   7940  N  N     . SER C 1  3   ? 9.931   -52.129 105.547 1.00 220.43 ? 3    SER C N     1 
ATOM   7941  C  CA    . SER C 1  3   ? 10.580  -53.214 106.272 1.00 211.14 ? 3    SER C CA    1 
ATOM   7942  C  C     . SER C 1  3   ? 9.588   -54.108 106.997 1.00 205.95 ? 3    SER C C     1 
ATOM   7943  O  O     . SER C 1  3   ? 8.917   -53.660 107.936 1.00 203.03 ? 3    SER C O     1 
ATOM   7944  C  CB    . SER C 1  3   ? 11.592  -52.681 107.276 1.00 203.68 ? 3    SER C CB    1 
ATOM   7945  O  OG    . SER C 1  3   ? 12.605  -51.928 106.633 1.00 204.46 ? 3    SER C OG    1 
ATOM   7946  N  N     . PRO C 1  4   ? 9.459   -55.365 106.594 1.00 201.34 ? 4    PRO C N     1 
ATOM   7947  C  CA    . PRO C 1  4   ? 8.347   -56.177 107.078 1.00 192.56 ? 4    PRO C CA    1 
ATOM   7948  C  C     . PRO C 1  4   ? 8.633   -56.697 108.476 1.00 183.79 ? 4    PRO C C     1 
ATOM   7949  O  O     . PRO C 1  4   ? 9.777   -56.954 108.859 1.00 183.60 ? 4    PRO C O     1 
ATOM   7950  C  CB    . PRO C 1  4   ? 8.292   -57.322 106.062 1.00 188.44 ? 4    PRO C CB    1 
ATOM   7951  C  CG    . PRO C 1  4   ? 9.732   -57.505 105.658 1.00 195.62 ? 4    PRO C CG    1 
ATOM   7952  C  CD    . PRO C 1  4   ? 10.406  -56.149 105.782 1.00 201.42 ? 4    PRO C CD    1 
ATOM   7953  N  N     . ILE C 1  5   ? 7.558   -56.832 109.246 1.00 179.51 ? 5    ILE C N     1 
ATOM   7954  C  CA    . ILE C 1  5   ? 7.661   -57.284 110.627 1.00 168.28 ? 5    ILE C CA    1 
ATOM   7955  C  C     . ILE C 1  5   ? 7.973   -58.773 110.631 1.00 161.65 ? 5    ILE C C     1 
ATOM   7956  O  O     . ILE C 1  5   ? 7.204   -59.583 110.101 1.00 163.41 ? 5    ILE C O     1 
ATOM   7957  C  CB    . ILE C 1  5   ? 6.366   -56.982 111.389 1.00 170.67 ? 5    ILE C CB    1 
ATOM   7958  C  CG1   . ILE C 1  5   ? 6.019   -55.499 111.251 1.00 173.86 ? 5    ILE C CG1   1 
ATOM   7959  C  CG2   . ILE C 1  5   ? 6.507   -57.366 112.852 1.00 167.95 ? 5    ILE C CG2   1 
ATOM   7960  C  CD1   . ILE C 1  5   ? 4.636   -55.146 111.738 1.00 172.14 ? 5    ILE C CD1   1 
ATOM   7961  N  N     . GLU C 1  6   ? 9.116   -59.135 111.210 1.00 153.81 ? 6    GLU C N     1 
ATOM   7962  C  CA    . GLU C 1  6   ? 9.487   -60.538 111.314 1.00 150.42 ? 6    GLU C CA    1 
ATOM   7963  C  C     . GLU C 1  6   ? 8.389   -61.332 112.011 1.00 154.83 ? 6    GLU C C     1 
ATOM   7964  O  O     . GLU C 1  6   ? 7.711   -60.841 112.918 1.00 155.88 ? 6    GLU C O     1 
ATOM   7965  C  CB    . GLU C 1  6   ? 10.809  -60.683 112.069 1.00 139.37 ? 6    GLU C CB    1 
ATOM   7966  C  CG    . GLU C 1  6   ? 11.928  -59.815 111.518 1.00 137.38 ? 6    GLU C CG    1 
ATOM   7967  C  CD    . GLU C 1  6   ? 13.082  -59.661 112.488 1.00 130.35 ? 6    GLU C CD    1 
ATOM   7968  O  OE1   . GLU C 1  6   ? 13.460  -60.663 113.128 1.00 127.86 ? 6    GLU C OE1   1 
ATOM   7969  O  OE2   . GLU C 1  6   ? 13.609  -58.535 112.613 1.00 134.77 ? 6    GLU C OE2   1 
ATOM   7970  N  N     . THR C 1  7   ? 8.221   -62.576 111.577 1.00 155.82 ? 7    THR C N     1 
ATOM   7971  C  CA    . THR C 1  7   ? 7.106   -63.396 112.017 1.00 156.62 ? 7    THR C CA    1 
ATOM   7972  C  C     . THR C 1  7   ? 7.399   -63.967 113.404 1.00 153.92 ? 7    THR C C     1 
ATOM   7973  O  O     . THR C 1  7   ? 8.539   -63.958 113.877 1.00 149.41 ? 7    THR C O     1 
ATOM   7974  C  CB    . THR C 1  7   ? 6.831   -64.508 111.001 1.00 157.69 ? 7    THR C CB    1 
ATOM   7975  O  OG1   . THR C 1  7   ? 5.435   -64.827 111.003 1.00 152.24 ? 7    THR C OG1   1 
ATOM   7976  C  CG2   . THR C 1  7   ? 7.644   -65.756 111.318 1.00 154.67 ? 7    THR C CG2   1 
ATOM   7977  N  N     . VAL C 1  8   ? 6.357   -64.455 114.065 1.00 153.98 ? 8    VAL C N     1 
ATOM   7978  C  CA    . VAL C 1  8   ? 6.506   -65.098 115.367 1.00 145.25 ? 8    VAL C CA    1 
ATOM   7979  C  C     . VAL C 1  8   ? 6.190   -66.584 115.218 1.00 138.91 ? 8    VAL C C     1 
ATOM   7980  O  O     . VAL C 1  8   ? 5.053   -66.944 114.881 1.00 134.48 ? 8    VAL C O     1 
ATOM   7981  C  CB    . VAL C 1  8   ? 5.612   -64.447 116.434 1.00 142.07 ? 8    VAL C CB    1 
ATOM   7982  C  CG1   . VAL C 1  8   ? 5.393   -65.408 117.590 1.00 138.73 ? 8    VAL C CG1   1 
ATOM   7983  C  CG2   . VAL C 1  8   ? 6.233   -63.146 116.924 1.00 141.13 ? 8    VAL C CG2   1 
ATOM   7984  N  N     . PRO C 1  9   ? 7.165   -67.465 115.432 1.00 135.86 ? 9    PRO C N     1 
ATOM   7985  C  CA    . PRO C 1  9   ? 6.960   -68.917 115.270 1.00 136.26 ? 9    PRO C CA    1 
ATOM   7986  C  C     . PRO C 1  9   ? 5.881   -69.469 116.190 1.00 128.46 ? 9    PRO C C     1 
ATOM   7987  O  O     . PRO C 1  9   ? 6.004   -69.410 117.415 1.00 141.67 ? 9    PRO C O     1 
ATOM   7988  C  CB    . PRO C 1  9   ? 8.335   -69.509 115.610 1.00 128.67 ? 9    PRO C CB    1 
ATOM   7989  C  CG    . PRO C 1  9   ? 9.083   -68.428 116.316 1.00 117.52 ? 9    PRO C CG    1 
ATOM   7990  C  CD    . PRO C 1  9   ? 8.536   -67.127 115.848 1.00 122.78 ? 9    PRO C CD    1 
ATOM   7991  N  N     . VAL C 1  10  ? 4.813   -70.007 115.602 1.00 122.68 ? 10   VAL C N     1 
ATOM   7992  C  CA    . VAL C 1  10  ? 3.683   -70.497 116.384 1.00 132.30 ? 10   VAL C CA    1 
ATOM   7993  C  C     . VAL C 1  10  ? 3.365   -71.922 115.947 1.00 135.71 ? 10   VAL C C     1 
ATOM   7994  O  O     . VAL C 1  10  ? 3.260   -72.203 114.749 1.00 141.10 ? 10   VAL C O     1 
ATOM   7995  C  CB    . VAL C 1  10  ? 2.444   -69.594 116.217 1.00 141.77 ? 10   VAL C CB    1 
ATOM   7996  C  CG1   . VAL C 1  10  ? 1.218   -70.235 116.857 1.00 142.30 ? 10   VAL C CG1   1 
ATOM   7997  C  CG2   . VAL C 1  10  ? 2.704   -68.219 116.811 1.00 145.26 ? 10   VAL C CG2   1 
ATOM   7998  N  N     . LYS C 1  11  ? 3.205   -72.811 116.926 1.00 134.76 ? 11   LYS C N     1 
ATOM   7999  C  CA    . LYS C 1  11  ? 2.940   -74.232 116.737 1.00 126.84 ? 11   LYS C CA    1 
ATOM   8000  C  C     . LYS C 1  11  ? 1.583   -74.604 117.317 1.00 134.69 ? 11   LYS C C     1 
ATOM   8001  O  O     . LYS C 1  11  ? 0.953   -73.828 118.041 1.00 149.11 ? 11   LYS C O     1 
ATOM   8002  C  CB    . LYS C 1  11  ? 4.029   -75.102 117.380 1.00 121.56 ? 11   LYS C CB    1 
ATOM   8003  C  CG    . LYS C 1  11  ? 5.447   -74.610 117.182 1.00 129.03 ? 11   LYS C CG    1 
ATOM   8004  C  CD    . LYS C 1  11  ? 6.436   -75.627 117.733 1.00 126.19 ? 11   LYS C CD    1 
ATOM   8005  C  CE    . LYS C 1  11  ? 7.052   -76.456 116.616 1.00 129.83 ? 11   LYS C CE    1 
ATOM   8006  N  NZ    . LYS C 1  11  ? 8.025   -77.460 117.129 1.00 128.95 ? 11   LYS C NZ    1 
ATOM   8007  N  N     . LEU C 1  12  ? 1.126   -75.807 116.980 1.00 138.89 ? 12   LEU C N     1 
ATOM   8008  C  CA    . LEU C 1  12  ? -0.049  -76.354 117.633 1.00 147.85 ? 12   LEU C CA    1 
ATOM   8009  C  C     . LEU C 1  12  ? 0.359   -77.193 118.840 1.00 168.21 ? 12   LEU C C     1 
ATOM   8010  O  O     . LEU C 1  12  ? 1.504   -77.632 118.976 1.00 158.03 ? 12   LEU C O     1 
ATOM   8011  C  CB    . LEU C 1  12  ? -0.868  -77.211 116.665 1.00 148.80 ? 12   LEU C CB    1 
ATOM   8012  C  CG    . LEU C 1  12  ? -1.624  -76.502 115.542 1.00 149.16 ? 12   LEU C CG    1 
ATOM   8013  C  CD1   . LEU C 1  12  ? -2.143  -77.515 114.534 1.00 158.18 ? 12   LEU C CD1   1 
ATOM   8014  C  CD2   . LEU C 1  12  ? -2.768  -75.677 116.110 1.00 147.80 ? 12   LEU C CD2   1 
ATOM   8015  N  N     . LYS C 1  13  ? -0.613  -77.414 119.718 1.00 196.40 ? 13   LYS C N     1 
ATOM   8016  C  CA    . LYS C 1  13  ? -0.424  -78.270 120.879 1.00 196.49 ? 13   LYS C CA    1 
ATOM   8017  C  C     . LYS C 1  13  ? -0.029  -79.686 120.456 1.00 197.44 ? 13   LYS C C     1 
ATOM   8018  O  O     . LYS C 1  13  ? -0.603  -80.226 119.504 1.00 197.92 ? 13   LYS C O     1 
ATOM   8019  C  CB    . LYS C 1  13  ? -1.691  -78.293 121.731 1.00 191.54 ? 13   LYS C CB    1 
ATOM   8020  C  CG    . LYS C 1  13  ? -1.963  -76.986 122.485 1.00 187.07 ? 13   LYS C CG    1 
ATOM   8021  C  CD    . LYS C 1  13  ? -3.104  -77.143 123.486 1.00 189.57 ? 13   LYS C CD    1 
ATOM   8022  C  CE    . LYS C 1  13  ? -3.301  -75.889 124.330 1.00 185.45 ? 13   LYS C CE    1 
ATOM   8023  N  NZ    . LYS C 1  13  ? -4.316  -76.102 125.402 1.00 177.35 ? 13   LYS C NZ    1 
ATOM   8024  N  N     . PRO C 1  14  ? 1.040   -80.255 121.051 1.00 175.72 ? 14   PRO C N     1 
ATOM   8025  C  CA    . PRO C 1  14  ? 1.511   -81.605 120.692 1.00 173.44 ? 14   PRO C CA    1 
ATOM   8026  C  C     . PRO C 1  14  ? 0.427   -82.619 120.360 1.00 179.62 ? 14   PRO C C     1 
ATOM   8027  O  O     . PRO C 1  14  ? -0.486  -82.848 121.171 1.00 179.42 ? 14   PRO C O     1 
ATOM   8028  C  CB    . PRO C 1  14  ? 2.274   -82.033 121.949 1.00 165.29 ? 14   PRO C CB    1 
ATOM   8029  C  CG    . PRO C 1  14  ? 2.798   -80.739 122.539 1.00 159.09 ? 14   PRO C CG    1 
ATOM   8030  C  CD    . PRO C 1  14  ? 2.011   -79.582 121.935 1.00 164.25 ? 14   PRO C CD    1 
ATOM   8031  N  N     . GLY C 1  15  ? 0.504   -83.238 119.187 1.00 187.15 ? 15   GLY C N     1 
ATOM   8032  C  CA    . GLY C 1  15  ? -0.460  -84.257 118.815 1.00 188.96 ? 15   GLY C CA    1 
ATOM   8033  C  C     . GLY C 1  15  ? -1.869  -83.757 118.607 1.00 192.63 ? 15   GLY C C     1 
ATOM   8034  O  O     . GLY C 1  15  ? -2.824  -84.516 118.792 1.00 191.34 ? 15   GLY C O     1 
ATOM   8035  N  N     . MET C 1  16  ? -2.029  -82.486 118.245 1.00 188.74 ? 16   MET C N     1 
ATOM   8036  C  CA    . MET C 1  16  ? -3.315  -81.953 117.826 1.00 186.81 ? 16   MET C CA    1 
ATOM   8037  C  C     . MET C 1  16  ? -3.236  -81.400 116.409 1.00 188.06 ? 16   MET C C     1 
ATOM   8038  O  O     . MET C 1  16  ? -2.170  -80.993 115.937 1.00 185.63 ? 16   MET C O     1 
ATOM   8039  C  CB    . MET C 1  16  ? -3.810  -80.878 118.799 1.00 180.97 ? 16   MET C CB    1 
ATOM   8040  C  CG    . MET C 1  16  ? -3.875  -81.367 120.234 1.00 180.28 ? 16   MET C CG    1 
ATOM   8041  S  SD    . MET C 1  16  ? -4.833  -80.297 121.321 1.00 177.17 ? 16   MET C SD    1 
ATOM   8042  C  CE    . MET C 1  16  ? -4.002  -80.573 122.884 1.00 176.60 ? 16   MET C CE    1 
ATOM   8043  N  N     . ASP C 1  17  ? -4.384  -81.400 115.741 1.00 179.94 ? 17   ASP C N     1 
ATOM   8044  C  CA    . ASP C 1  17  ? -4.518  -81.026 114.342 1.00 179.19 ? 17   ASP C CA    1 
ATOM   8045  C  C     . ASP C 1  17  ? -5.431  -79.808 114.234 1.00 179.18 ? 17   ASP C C     1 
ATOM   8046  O  O     . ASP C 1  17  ? -6.118  -79.432 115.187 1.00 179.66 ? 17   ASP C O     1 
ATOM   8047  C  CB    . ASP C 1  17  ? -5.068  -82.202 113.520 1.00 179.87 ? 17   ASP C CB    1 
ATOM   8048  C  CG    . ASP C 1  17  ? -4.947  -81.986 112.022 1.00 183.52 ? 17   ASP C CG    1 
ATOM   8049  O  OD1   . ASP C 1  17  ? -4.187  -81.086 111.605 1.00 185.38 ? 17   ASP C OD1   1 
ATOM   8050  O  OD2   . ASP C 1  17  ? -5.612  -82.721 111.261 1.00 179.96 ? 17   ASP C OD2   1 
ATOM   8051  N  N     . GLY C 1  18  ? -5.420  -79.181 113.060 1.00 182.26 ? 18   GLY C N     1 
ATOM   8052  C  CA    . GLY C 1  18  ? -6.154  -77.958 112.826 1.00 185.56 ? 18   GLY C CA    1 
ATOM   8053  C  C     . GLY C 1  18  ? -7.660  -78.064 112.983 1.00 189.02 ? 18   GLY C C     1 
ATOM   8054  O  O     . GLY C 1  18  ? -8.226  -79.150 113.146 1.00 185.52 ? 18   GLY C O     1 
ATOM   8055  N  N     . PRO C 1  19  ? -8.338  -76.918 112.920 1.00 188.14 ? 19   PRO C N     1 
ATOM   8056  C  CA    . PRO C 1  19  ? -9.793  -76.897 113.115 1.00 189.13 ? 19   PRO C CA    1 
ATOM   8057  C  C     . PRO C 1  19  ? -10.549 -77.374 111.884 1.00 192.25 ? 19   PRO C C     1 
ATOM   8058  O  O     . PRO C 1  19  ? -10.185 -77.069 110.746 1.00 200.98 ? 19   PRO C O     1 
ATOM   8059  C  CB    . PRO C 1  19  ? -10.083 -75.418 113.397 1.00 190.20 ? 19   PRO C CB    1 
ATOM   8060  C  CG    . PRO C 1  19  ? -9.000  -74.693 112.666 1.00 184.44 ? 19   PRO C CG    1 
ATOM   8061  C  CD    . PRO C 1  19  ? -7.781  -75.571 112.704 1.00 183.88 ? 19   PRO C CD    1 
ATOM   8062  N  N     . LYS C 1  20  ? -11.634 -78.127 112.130 1.00 189.59 ? 20   LYS C N     1 
ATOM   8063  C  CA    . LYS C 1  20  ? -12.535 -78.614 111.078 1.00 194.97 ? 20   LYS C CA    1 
ATOM   8064  C  C     . LYS C 1  20  ? -13.975 -78.498 111.597 1.00 203.04 ? 20   LYS C C     1 
ATOM   8065  O  O     . LYS C 1  20  ? -14.588 -79.481 112.019 1.00 195.96 ? 20   LYS C O     1 
ATOM   8066  C  CB    . LYS C 1  20  ? -12.182 -80.045 110.673 1.00 183.81 ? 20   LYS C CB    1 
ATOM   8067  C  CG    . LYS C 1  20  ? -10.833 -80.167 109.970 1.00 191.23 ? 20   LYS C CG    1 
ATOM   8068  C  CD    . LYS C 1  20  ? -10.275 -81.580 110.056 1.00 183.81 ? 20   LYS C CD    1 
ATOM   8069  C  CE    . LYS C 1  20  ? -8.891  -81.664 109.426 1.00 191.56 ? 20   LYS C CE    1 
ATOM   8070  N  NZ    . LYS C 1  20  ? -8.224  -82.968 109.702 1.00 180.87 ? 20   LYS C NZ    1 
ATOM   8071  N  N     . VAL C 1  21  ? -14.519 -77.280 111.561 1.00 217.00 ? 21   VAL C N     1 
ATOM   8072  C  CA    . VAL C 1  21  ? -15.857 -76.989 112.066 1.00 218.71 ? 21   VAL C CA    1 
ATOM   8073  C  C     . VAL C 1  21  ? -16.701 -76.405 110.936 1.00 222.38 ? 21   VAL C C     1 
ATOM   8074  O  O     . VAL C 1  21  ? -16.177 -75.748 110.032 1.00 223.82 ? 21   VAL C O     1 
ATOM   8075  C  CB    . VAL C 1  21  ? -15.797 -76.024 113.271 1.00 218.61 ? 21   VAL C CB    1 
ATOM   8076  C  CG1   . VAL C 1  21  ? -17.183 -75.764 113.857 1.00 215.11 ? 21   VAL C CG1   1 
ATOM   8077  C  CG2   . VAL C 1  21  ? -14.847 -76.552 114.340 1.00 213.00 ? 21   VAL C CG2   1 
ATOM   8078  N  N     . LYS C 1  22  ? -18.018 -76.634 110.999 1.00 210.23 ? 22   LYS C N     1 
ATOM   8079  C  CA    . LYS C 1  22  ? -18.927 -76.295 109.914 1.00 205.56 ? 22   LYS C CA    1 
ATOM   8080  C  C     . LYS C 1  22  ? -19.250 -74.799 109.949 1.00 205.27 ? 22   LYS C C     1 
ATOM   8081  O  O     . LYS C 1  22  ? -18.569 -74.028 110.620 1.00 204.90 ? 22   LYS C O     1 
ATOM   8082  C  CB    . LYS C 1  22  ? -20.201 -77.140 109.999 1.00 195.47 ? 22   LYS C CB    1 
ATOM   8083  C  CG    . LYS C 1  22  ? -20.102 -78.493 109.331 1.00 191.64 ? 22   LYS C CG    1 
ATOM   8084  C  CD    . LYS C 1  22  ? -21.432 -79.208 109.415 1.00 184.33 ? 22   LYS C CD    1 
ATOM   8085  C  CE    . LYS C 1  22  ? -21.433 -80.472 108.576 1.00 187.17 ? 22   LYS C CE    1 
ATOM   8086  N  NZ    . LYS C 1  22  ? -21.135 -80.218 107.135 1.00 190.25 ? 22   LYS C NZ    1 
ATOM   8087  N  N     . GLN C 1  23  ? -20.307 -74.384 109.248 1.00 205.15 ? 23   GLN C N     1 
ATOM   8088  C  CA    . GLN C 1  23  ? -20.675 -72.983 109.088 1.00 209.99 ? 23   GLN C CA    1 
ATOM   8089  C  C     . GLN C 1  23  ? -22.168 -72.819 109.343 1.00 216.20 ? 23   GLN C C     1 
ATOM   8090  O  O     . GLN C 1  23  ? -22.972 -73.552 108.750 1.00 206.23 ? 23   GLN C O     1 
ATOM   8091  C  CB    . GLN C 1  23  ? -20.308 -72.491 107.694 1.00 209.70 ? 23   GLN C CB    1 
ATOM   8092  C  CG    . GLN C 1  23  ? -20.518 -71.019 107.545 1.00 209.20 ? 23   GLN C CG    1 
ATOM   8093  C  CD    . GLN C 1  23  ? -19.565 -70.224 108.394 1.00 201.17 ? 23   GLN C CD    1 
ATOM   8094  O  OE1   . GLN C 1  23  ? -18.372 -70.514 108.433 1.00 201.58 ? 23   GLN C OE1   1 
ATOM   8095  N  NE2   . GLN C 1  23  ? -20.077 -69.207 109.072 1.00 204.74 ? 23   GLN C NE2   1 
ATOM   8096  N  N     . TRP C 1  24  ? -22.550 -71.888 110.219 1.00 242.20 ? 24   TRP C N     1 
ATOM   8097  C  CA    . TRP C 1  24  ? -23.980 -71.681 110.412 1.00 243.97 ? 24   TRP C CA    1 
ATOM   8098  C  C     . TRP C 1  24  ? -24.567 -71.027 109.163 1.00 247.27 ? 24   TRP C C     1 
ATOM   8099  O  O     . TRP C 1  24  ? -23.835 -70.422 108.378 1.00 246.07 ? 24   TRP C O     1 
ATOM   8100  C  CB    . TRP C 1  24  ? -24.255 -70.676 111.530 1.00 241.83 ? 24   TRP C CB    1 
ATOM   8101  C  CG    . TRP C 1  24  ? -23.090 -70.115 112.322 1.00 239.00 ? 24   TRP C CG    1 
ATOM   8102  C  CD1   . TRP C 1  24  ? -22.714 -68.799 112.352 1.00 236.47 ? 24   TRP C CD1   1 
ATOM   8103  C  CD2   . TRP C 1  24  ? -22.170 -70.807 113.175 1.00 237.37 ? 24   TRP C CD2   1 
ATOM   8104  N  NE1   . TRP C 1  24  ? -21.628 -68.627 113.166 1.00 230.30 ? 24   TRP C NE1   1 
ATOM   8105  C  CE2   . TRP C 1  24  ? -21.270 -69.842 113.684 1.00 233.17 ? 24   TRP C CE2   1 
ATOM   8106  C  CE3   . TRP C 1  24  ? -22.012 -72.142 113.557 1.00 237.24 ? 24   TRP C CE3   1 
ATOM   8107  C  CZ2   . TRP C 1  24  ? -20.239 -70.170 114.559 1.00 230.31 ? 24   TRP C CZ2   1 
ATOM   8108  C  CZ3   . TRP C 1  24  ? -20.980 -72.463 114.424 1.00 233.11 ? 24   TRP C CZ3   1 
ATOM   8109  C  CH2   . TRP C 1  24  ? -20.108 -71.482 114.914 1.00 229.83 ? 24   TRP C CH2   1 
ATOM   8110  N  N     . PRO C 1  25  ? -25.859 -71.219 108.897 1.00 226.63 ? 25   PRO C N     1 
ATOM   8111  C  CA    . PRO C 1  25  ? -26.454 -70.573 107.721 1.00 222.42 ? 25   PRO C CA    1 
ATOM   8112  C  C     . PRO C 1  25  ? -26.327 -69.055 107.826 1.00 226.63 ? 25   PRO C C     1 
ATOM   8113  O  O     . PRO C 1  25  ? -26.565 -68.477 108.890 1.00 224.33 ? 25   PRO C O     1 
ATOM   8114  C  CB    . PRO C 1  25  ? -27.921 -71.023 107.764 1.00 218.11 ? 25   PRO C CB    1 
ATOM   8115  C  CG    . PRO C 1  25  ? -28.117 -71.637 109.126 1.00 213.90 ? 25   PRO C CG    1 
ATOM   8116  C  CD    . PRO C 1  25  ? -26.786 -72.180 109.518 1.00 218.04 ? 25   PRO C CD    1 
ATOM   8117  N  N     . LEU C 1  26  ? -25.952 -68.399 106.735 1.00 232.71 ? 26   LEU C N     1 
ATOM   8118  C  CA    . LEU C 1  26  ? -25.774 -66.950 106.743 1.00 233.34 ? 26   LEU C CA    1 
ATOM   8119  C  C     . LEU C 1  26  ? -26.939 -66.290 106.016 1.00 234.32 ? 26   LEU C C     1 
ATOM   8120  O  O     . LEU C 1  26  ? -27.223 -66.637 104.864 1.00 235.29 ? 26   LEU C O     1 
ATOM   8121  C  CB    . LEU C 1  26  ? -24.434 -66.532 106.136 1.00 233.27 ? 26   LEU C CB    1 
ATOM   8122  C  CG    . LEU C 1  26  ? -23.249 -66.420 107.104 1.00 224.27 ? 26   LEU C CG    1 
ATOM   8123  C  CD1   . LEU C 1  26  ? -22.976 -67.677 107.870 1.00 223.15 ? 26   LEU C CD1   1 
ATOM   8124  C  CD2   . LEU C 1  26  ? -22.016 -66.037 106.341 1.00 221.14 ? 26   LEU C CD2   1 
ATOM   8125  N  N     . THR C 1  27  ? -27.618 -65.352 106.675 1.00 226.17 ? 27   THR C N     1 
ATOM   8126  C  CA    . THR C 1  27  ? -28.631 -64.587 105.961 1.00 227.44 ? 27   THR C CA    1 
ATOM   8127  C  C     . THR C 1  27  ? -27.971 -63.700 104.908 1.00 234.01 ? 27   THR C C     1 
ATOM   8128  O  O     . THR C 1  27  ? -26.841 -63.233 105.081 1.00 228.28 ? 27   THR C O     1 
ATOM   8129  C  CB    . THR C 1  27  ? -29.463 -63.740 106.927 1.00 215.42 ? 27   THR C CB    1 
ATOM   8130  O  OG1   . THR C 1  27  ? -28.805 -62.490 107.169 1.00 212.64 ? 27   THR C OG1   1 
ATOM   8131  C  CG2   . THR C 1  27  ? -29.669 -64.473 108.244 1.00 210.07 ? 27   THR C CG2   1 
ATOM   8132  N  N     . GLU C 1  28  ? -28.689 -63.493 103.798 1.00 254.72 ? 28   GLU C N     1 
ATOM   8133  C  CA    . GLU C 1  28  ? -28.120 -62.833 102.622 1.00 255.24 ? 28   GLU C CA    1 
ATOM   8134  C  C     . GLU C 1  28  ? -27.389 -61.541 102.981 1.00 252.57 ? 28   GLU C C     1 
ATOM   8135  O  O     . GLU C 1  28  ? -26.219 -61.358 102.627 1.00 250.76 ? 28   GLU C O     1 
ATOM   8136  C  CB    . GLU C 1  28  ? -29.210 -62.587 101.580 1.00 256.25 ? 28   GLU C CB    1 
ATOM   8137  C  CG    . GLU C 1  28  ? -29.431 -63.797 100.682 1.00 259.13 ? 28   GLU C CG    1 
ATOM   8138  C  CD    . GLU C 1  28  ? -30.891 -64.066 100.403 1.00 269.05 ? 28   GLU C CD    1 
ATOM   8139  O  OE1   . GLU C 1  28  ? -31.588 -63.138 99.944  1.00 275.37 ? 28   GLU C OE1   1 
ATOM   8140  O  OE2   . GLU C 1  28  ? -31.344 -65.203 100.653 1.00 271.94 ? 28   GLU C OE2   1 
ATOM   8141  N  N     . GLU C 1  29  ? -28.076 -60.631 103.682 1.00 240.36 ? 29   GLU C N     1 
ATOM   8142  C  CA    . GLU C 1  29  ? -27.561 -59.315 104.059 1.00 236.61 ? 29   GLU C CA    1 
ATOM   8143  C  C     . GLU C 1  29  ? -26.137 -59.389 104.590 1.00 231.52 ? 29   GLU C C     1 
ATOM   8144  O  O     . GLU C 1  29  ? -25.298 -58.532 104.295 1.00 227.42 ? 29   GLU C O     1 
ATOM   8145  C  CB    . GLU C 1  29  ? -28.454 -58.678 105.127 1.00 233.52 ? 29   GLU C CB    1 
ATOM   8146  C  CG    . GLU C 1  29  ? -29.944 -58.794 104.870 1.00 237.28 ? 29   GLU C CG    1 
ATOM   8147  C  CD    . GLU C 1  29  ? -30.766 -58.431 106.091 1.00 231.46 ? 29   GLU C CD    1 
ATOM   8148  O  OE1   . GLU C 1  29  ? -30.180 -58.312 107.188 1.00 228.40 ? 29   GLU C OE1   1 
ATOM   8149  O  OE2   . GLU C 1  29  ? -31.996 -58.264 105.955 1.00 231.02 ? 29   GLU C OE2   1 
ATOM   8150  N  N     . LYS C 1  30  ? -25.872 -60.422 105.385 1.00 221.04 ? 30   LYS C N     1 
ATOM   8151  C  CA    . LYS C 1  30  ? -24.554 -60.608 105.975 1.00 209.85 ? 30   LYS C CA    1 
ATOM   8152  C  C     . LYS C 1  30  ? -23.556 -61.090 104.931 1.00 208.77 ? 30   LYS C C     1 
ATOM   8153  O  O     . LYS C 1  30  ? -22.436 -60.572 104.843 1.00 204.08 ? 30   LYS C O     1 
ATOM   8154  C  CB    . LYS C 1  30  ? -24.669 -61.595 107.133 1.00 205.82 ? 30   LYS C CB    1 
ATOM   8155  C  CG    . LYS C 1  30  ? -25.835 -61.251 108.044 1.00 198.25 ? 30   LYS C CG    1 
ATOM   8156  C  CD    . LYS C 1  30  ? -25.997 -62.222 109.191 1.00 189.36 ? 30   LYS C CD    1 
ATOM   8157  C  CE    . LYS C 1  30  ? -27.168 -61.806 110.066 1.00 190.85 ? 30   LYS C CE    1 
ATOM   8158  N  NZ    . LYS C 1  30  ? -27.416 -62.764 111.175 1.00 188.17 ? 30   LYS C NZ    1 
ATOM   8159  N  N     . ILE C 1  31  ? -23.952 -62.092 104.138 1.00 207.74 ? 31   ILE C N     1 
ATOM   8160  C  CA    . ILE C 1  31  ? -23.067 -62.687 103.135 1.00 205.78 ? 31   ILE C CA    1 
ATOM   8161  C  C     . ILE C 1  31  ? -22.424 -61.606 102.277 1.00 207.67 ? 31   ILE C C     1 
ATOM   8162  O  O     . ILE C 1  31  ? -21.205 -61.590 102.075 1.00 205.80 ? 31   ILE C O     1 
ATOM   8163  C  CB    . ILE C 1  31  ? -23.847 -63.692 102.266 1.00 208.38 ? 31   ILE C CB    1 
ATOM   8164  C  CG1   . ILE C 1  31  ? -24.375 -64.846 103.115 1.00 215.05 ? 31   ILE C CG1   1 
ATOM   8165  C  CG2   . ILE C 1  31  ? -22.981 -64.209 101.126 1.00 211.00 ? 31   ILE C CG2   1 
ATOM   8166  C  CD1   . ILE C 1  31  ? -25.145 -65.882 102.326 1.00 219.43 ? 31   ILE C CD1   1 
ATOM   8167  N  N     . LYS C 1  32  ? -23.239 -60.679 101.769 1.00 211.01 ? 32   LYS C N     1 
ATOM   8168  C  CA    . LYS C 1  32  ? -22.740 -59.658 100.852 1.00 202.05 ? 32   LYS C CA    1 
ATOM   8169  C  C     . LYS C 1  32  ? -21.653 -58.805 101.499 1.00 201.57 ? 32   LYS C C     1 
ATOM   8170  O  O     . LYS C 1  32  ? -20.538 -58.707 100.974 1.00 204.26 ? 32   LYS C O     1 
ATOM   8171  C  CB    . LYS C 1  32  ? -23.899 -58.803 100.333 1.00 197.04 ? 32   LYS C CB    1 
ATOM   8172  C  CG    . LYS C 1  32  ? -24.687 -59.466 99.196  1.00 194.87 ? 32   LYS C CG    1 
ATOM   8173  C  CD    . LYS C 1  32  ? -25.598 -60.590 99.667  1.00 205.39 ? 32   LYS C CD    1 
ATOM   8174  C  CE    . LYS C 1  32  ? -26.136 -61.395 98.492  1.00 195.81 ? 32   LYS C CE    1 
ATOM   8175  N  NZ    . LYS C 1  32  ? -26.930 -62.575 98.934  1.00 199.29 ? 32   LYS C NZ    1 
ATOM   8176  N  N     . ALA C 1  33  ? -21.965 -58.151 102.622 1.00 191.42 ? 33   ALA C N     1 
ATOM   8177  C  CA    . ALA C 1  33  ? -20.945 -57.347 103.289 1.00 192.83 ? 33   ALA C CA    1 
ATOM   8178  C  C     . ALA C 1  33  ? -19.704 -58.179 103.599 1.00 202.37 ? 33   ALA C C     1 
ATOM   8179  O  O     . ALA C 1  33  ? -18.575 -57.683 103.506 1.00 195.08 ? 33   ALA C O     1 
ATOM   8180  C  CB    . ALA C 1  33  ? -21.515 -56.732 104.567 1.00 179.83 ? 33   ALA C CB    1 
ATOM   8181  N  N     . LEU C 1  34  ? -19.900 -59.441 103.993 1.00 217.19 ? 34   LEU C N     1 
ATOM   8182  C  CA    . LEU C 1  34  ? -18.788 -60.376 104.159 1.00 215.75 ? 34   LEU C CA    1 
ATOM   8183  C  C     . LEU C 1  34  ? -17.941 -60.469 102.893 1.00 219.62 ? 34   LEU C C     1 
ATOM   8184  O  O     . LEU C 1  34  ? -16.711 -60.385 102.943 1.00 218.95 ? 34   LEU C O     1 
ATOM   8185  C  CB    . LEU C 1  34  ? -19.316 -61.745 104.578 1.00 212.03 ? 34   LEU C CB    1 
ATOM   8186  C  CG    . LEU C 1  34  ? -19.704 -61.755 106.056 1.00 206.95 ? 34   LEU C CG    1 
ATOM   8187  C  CD1   . LEU C 1  34  ? -20.576 -62.938 106.368 1.00 208.04 ? 34   LEU C CD1   1 
ATOM   8188  C  CD2   . LEU C 1  34  ? -18.464 -61.757 106.937 1.00 204.19 ? 34   LEU C CD2   1 
ATOM   8189  N  N     . VAL C 1  35  ? -18.589 -60.698 101.750 1.00 223.56 ? 35   VAL C N     1 
ATOM   8190  C  CA    . VAL C 1  35  ? -17.859 -60.854 100.494 1.00 226.14 ? 35   VAL C CA    1 
ATOM   8191  C  C     . VAL C 1  35  ? -17.088 -59.585 100.157 1.00 225.88 ? 35   VAL C C     1 
ATOM   8192  O  O     . VAL C 1  35  ? -15.934 -59.643 99.713  1.00 227.20 ? 35   VAL C O     1 
ATOM   8193  C  CB    . VAL C 1  35  ? -18.810 -61.256 99.351  1.00 227.71 ? 35   VAL C CB    1 
ATOM   8194  C  CG1   . VAL C 1  35  ? -18.026 -61.465 98.067  1.00 225.65 ? 35   VAL C CG1   1 
ATOM   8195  C  CG2   . VAL C 1  35  ? -19.541 -62.538 99.698  1.00 225.30 ? 35   VAL C CG2   1 
ATOM   8196  N  N     . GLU C 1  36  ? -17.710 -58.420 100.351 1.00 206.40 ? 36   GLU C N     1 
ATOM   8197  C  CA    . GLU C 1  36  ? -17.035 -57.174 100.008 1.00 202.78 ? 36   GLU C CA    1 
ATOM   8198  C  C     . GLU C 1  36  ? -15.799 -56.924 100.873 1.00 200.23 ? 36   GLU C C     1 
ATOM   8199  O  O     . GLU C 1  36  ? -14.763 -56.495 100.355 1.00 198.22 ? 36   GLU C O     1 
ATOM   8200  C  CB    . GLU C 1  36  ? -18.041 -56.023 100.124 1.00 198.42 ? 36   GLU C CB    1 
ATOM   8201  C  CG    . GLU C 1  36  ? -17.653 -54.859 101.025 1.00 193.85 ? 36   GLU C CG    1 
ATOM   8202  C  CD    . GLU C 1  36  ? -17.719 -53.525 100.311 1.00 195.45 ? 36   GLU C CD    1 
ATOM   8203  O  OE1   . GLU C 1  36  ? -16.675 -53.055 99.815  1.00 196.95 ? 36   GLU C OE1   1 
ATOM   8204  O  OE2   . GLU C 1  36  ? -18.827 -52.951 100.238 1.00 195.50 ? 36   GLU C OE2   1 
ATOM   8205  N  N     . ILE C 1  37  ? -15.874 -57.182 102.185 1.00 205.98 ? 37   ILE C N     1 
ATOM   8206  C  CA    . ILE C 1  37  ? -14.678 -57.029 103.016 1.00 190.54 ? 37   ILE C CA    1 
ATOM   8207  C  C     . ILE C 1  37  ? -13.578 -58.000 102.581 1.00 200.57 ? 37   ILE C C     1 
ATOM   8208  O  O     . ILE C 1  37  ? -12.394 -57.639 102.538 1.00 197.77 ? 37   ILE C O     1 
ATOM   8209  C  CB    . ILE C 1  37  ? -15.014 -57.141 104.519 1.00 177.66 ? 37   ILE C CB    1 
ATOM   8210  C  CG1   . ILE C 1  37  ? -13.793 -56.751 105.357 1.00 174.68 ? 37   ILE C CG1   1 
ATOM   8211  C  CG2   . ILE C 1  37  ? -15.490 -58.522 104.908 1.00 180.85 ? 37   ILE C CG2   1 
ATOM   8212  C  CD1   . ILE C 1  37  ? -13.195 -55.409 104.979 1.00 163.98 ? 37   ILE C CD1   1 
ATOM   8213  N  N     . CYS C 1  38  ? -13.949 -59.250 102.274 1.00 193.99 ? 38   CYS C N     1 
ATOM   8214  C  CA    . CYS C 1  38  ? -13.007 -60.230 101.729 1.00 195.38 ? 38   CYS C CA    1 
ATOM   8215  C  C     . CYS C 1  38  ? -12.265 -59.694 100.512 1.00 197.95 ? 38   CYS C C     1 
ATOM   8216  O  O     . CYS C 1  38  ? -11.029 -59.715 100.465 1.00 196.84 ? 38   CYS C O     1 
ATOM   8217  C  CB    . CYS C 1  38  ? -13.734 -61.531 101.383 1.00 196.21 ? 38   CYS C CB    1 
ATOM   8218  S  SG    . CYS C 1  38  ? -14.343 -62.453 102.812 1.00 200.78 ? 38   CYS C SG    1 
ATOM   8219  N  N     . THR C 1  39  ? -13.010 -59.230 99.505  1.00 201.28 ? 39   THR C N     1 
ATOM   8220  C  CA    . THR C 1  39  ? -12.387 -58.742 98.278  1.00 205.47 ? 39   THR C CA    1 
ATOM   8221  C  C     . THR C 1  39  ? -11.425 -57.607 98.589  1.00 205.29 ? 39   THR C C     1 
ATOM   8222  O  O     . THR C 1  39  ? -10.340 -57.520 98.001  1.00 205.30 ? 39   THR C O     1 
ATOM   8223  C  CB    . THR C 1  39  ? -13.454 -58.292 97.283  1.00 209.10 ? 39   THR C CB    1 
ATOM   8224  O  OG1   . THR C 1  39  ? -14.674 -58.998 97.542  1.00 208.98 ? 39   THR C OG1   1 
ATOM   8225  C  CG2   . THR C 1  39  ? -13.002 -58.580 95.860  1.00 215.66 ? 39   THR C CG2   1 
ATOM   8226  N  N     . GLU C 1  40  ? -11.822 -56.713 99.496  1.00 201.43 ? 40   GLU C N     1 
ATOM   8227  C  CA    . GLU C 1  40  ? -10.928 -55.666 99.972  1.00 197.68 ? 40   GLU C CA    1 
ATOM   8228  C  C     . GLU C 1  40  ? -9.627  -56.285 100.468 1.00 202.02 ? 40   GLU C C     1 
ATOM   8229  O  O     . GLU C 1  40  ? -8.540  -55.952 99.984  1.00 196.01 ? 40   GLU C O     1 
ATOM   8230  C  CB    . GLU C 1  40  ? -11.602 -54.851 101.079 1.00 189.98 ? 40   GLU C CB    1 
ATOM   8231  C  CG    . GLU C 1  40  ? -12.847 -54.100 100.638 1.00 184.75 ? 40   GLU C CG    1 
ATOM   8232  C  CD    . GLU C 1  40  ? -12.555 -53.030 99.608  1.00 182.68 ? 40   GLU C CD    1 
ATOM   8233  O  OE1   . GLU C 1  40  ? -11.979 -51.986 99.980  1.00 180.40 ? 40   GLU C OE1   1 
ATOM   8234  O  OE2   . GLU C 1  40  ? -12.902 -53.233 98.426  1.00 182.24 ? 40   GLU C OE2   1 
ATOM   8235  N  N     . MET C 1  41  ? -9.735  -57.220 101.419 1.00 217.66 ? 41   MET C N     1 
ATOM   8236  C  CA    . MET C 1  41  ? -8.559  -57.879 101.982 1.00 217.52 ? 41   MET C CA    1 
ATOM   8237  C  C     . MET C 1  41  ? -7.657  -58.477 100.907 1.00 217.56 ? 41   MET C C     1 
ATOM   8238  O  O     . MET C 1  41  ? -6.428  -58.419 101.030 1.00 216.27 ? 41   MET C O     1 
ATOM   8239  C  CB    . MET C 1  41  ? -8.984  -58.967 102.966 1.00 215.35 ? 41   MET C CB    1 
ATOM   8240  C  CG    . MET C 1  41  ? -9.627  -58.462 104.240 1.00 213.76 ? 41   MET C CG    1 
ATOM   8241  S  SD    . MET C 1  41  ? -9.911  -59.819 105.390 1.00 218.67 ? 41   MET C SD    1 
ATOM   8242  C  CE    . MET C 1  41  ? -10.656 -58.950 106.761 1.00 204.94 ? 41   MET C CE    1 
ATOM   8243  N  N     . GLU C 1  42  ? -8.230  -59.072 99.855  1.00 203.42 ? 42   GLU C N     1 
ATOM   8244  C  CA    . GLU C 1  42  ? -7.364  -59.624 98.816  1.00 196.16 ? 42   GLU C CA    1 
ATOM   8245  C  C     . GLU C 1  42  ? -6.578  -58.520 98.130  1.00 193.14 ? 42   GLU C C     1 
ATOM   8246  O  O     . GLU C 1  42  ? -5.383  -58.684 97.851  1.00 188.00 ? 42   GLU C O     1 
ATOM   8247  C  CB    . GLU C 1  42  ? -8.146  -60.416 97.771  1.00 191.10 ? 42   GLU C CB    1 
ATOM   8248  C  CG    . GLU C 1  42  ? -8.801  -61.684 98.242  1.00 188.26 ? 42   GLU C CG    1 
ATOM   8249  C  CD    . GLU C 1  42  ? -9.178  -62.557 97.064  1.00 184.28 ? 42   GLU C CD    1 
ATOM   8250  O  OE1   . GLU C 1  42  ? -10.241 -63.201 97.103  1.00 186.72 ? 42   GLU C OE1   1 
ATOM   8251  O  OE2   . GLU C 1  42  ? -8.417  -62.566 96.074  1.00 185.49 ? 42   GLU C OE2   1 
ATOM   8252  N  N     . LYS C 1  43  ? -7.229  -57.391 97.831  1.00 195.51 ? 43   LYS C N     1 
ATOM   8253  C  CA    . LYS C 1  43  ? -6.479  -56.277 97.265  1.00 195.08 ? 43   LYS C CA    1 
ATOM   8254  C  C     . LYS C 1  43  ? -5.421  -55.821 98.256  1.00 200.18 ? 43   LYS C C     1 
ATOM   8255  O  O     . LYS C 1  43  ? -4.280  -55.533 97.877  1.00 192.61 ? 43   LYS C O     1 
ATOM   8256  C  CB    . LYS C 1  43  ? -7.431  -55.135 96.906  1.00 191.39 ? 43   LYS C CB    1 
ATOM   8257  C  CG    . LYS C 1  43  ? -6.752  -53.823 96.543  1.00 189.44 ? 43   LYS C CG    1 
ATOM   8258  C  CD    . LYS C 1  43  ? -5.711  -53.992 95.452  1.00 185.88 ? 43   LYS C CD    1 
ATOM   8259  C  CE    . LYS C 1  43  ? -4.817  -52.767 95.379  1.00 181.84 ? 43   LYS C CE    1 
ATOM   8260  N  NZ    . LYS C 1  43  ? -3.593  -53.018 94.573  1.00 181.28 ? 43   LYS C NZ    1 
ATOM   8261  N  N     . GLU C 1  44  ? -5.782  -55.765 99.540  1.00 206.23 ? 44   GLU C N     1 
ATOM   8262  C  CA    . GLU C 1  44  ? -4.838  -55.317 100.549 1.00 202.14 ? 44   GLU C CA    1 
ATOM   8263  C  C     . GLU C 1  44  ? -3.755  -56.362 100.770 1.00 201.00 ? 44   GLU C C     1 
ATOM   8264  O  O     . GLU C 1  44  ? -2.676  -56.030 101.272 1.00 199.81 ? 44   GLU C O     1 
ATOM   8265  C  CB    . GLU C 1  44  ? -5.543  -55.013 101.873 1.00 203.32 ? 44   GLU C CB    1 
ATOM   8266  C  CG    . GLU C 1  44  ? -6.848  -54.237 101.761 1.00 203.09 ? 44   GLU C CG    1 
ATOM   8267  C  CD    . GLU C 1  44  ? -6.697  -52.903 101.060 1.00 203.59 ? 44   GLU C CD    1 
ATOM   8268  O  OE1   . GLU C 1  44  ? -6.295  -51.924 101.722 1.00 206.34 ? 44   GLU C OE1   1 
ATOM   8269  O  OE2   . GLU C 1  44  ? -6.982  -52.835 99.846  1.00 204.61 ? 44   GLU C OE2   1 
ATOM   8270  N  N     . GLY C 1  45  ? -4.023  -57.618 100.394 1.00 203.81 ? 45   GLY C N     1 
ATOM   8271  C  CA    . GLY C 1  45  ? -3.103  -58.704 100.639 1.00 188.43 ? 45   GLY C CA    1 
ATOM   8272  C  C     . GLY C 1  45  ? -3.355  -59.454 101.929 1.00 193.17 ? 45   GLY C C     1 
ATOM   8273  O  O     . GLY C 1  45  ? -2.589  -60.371 102.253 1.00 182.55 ? 45   GLY C O     1 
ATOM   8274  N  N     . LYS C 1  46  ? -4.406  -59.096 102.675 1.00 197.78 ? 46   LYS C N     1 
ATOM   8275  C  CA    . LYS C 1  46  ? -4.659  -59.715 103.972 1.00 194.46 ? 46   LYS C CA    1 
ATOM   8276  C  C     . LYS C 1  46  ? -5.111  -61.176 103.913 1.00 193.58 ? 46   LYS C C     1 
ATOM   8277  O  O     . LYS C 1  46  ? -4.936  -61.879 104.913 1.00 189.34 ? 46   LYS C O     1 
ATOM   8278  C  CB    . LYS C 1  46  ? -5.698  -58.879 104.722 1.00 198.23 ? 46   LYS C CB    1 
ATOM   8279  C  CG    . LYS C 1  46  ? -5.226  -57.457 105.005 1.00 193.48 ? 46   LYS C CG    1 
ATOM   8280  C  CD    . LYS C 1  46  ? -6.379  -56.464 104.972 1.00 194.47 ? 46   LYS C CD    1 
ATOM   8281  C  CE    . LYS C 1  46  ? -5.985  -55.134 105.598 1.00 188.27 ? 46   LYS C CE    1 
ATOM   8282  N  NZ    . LYS C 1  46  ? -7.154  -54.233 105.789 1.00 189.17 ? 46   LYS C NZ    1 
ATOM   8283  N  N     . ILE C 1  47  ? -5.679  -61.669 102.808 1.00 202.82 ? 47   ILE C N     1 
ATOM   8284  C  CA    . ILE C 1  47  ? -6.105  -63.074 102.785 1.00 202.94 ? 47   ILE C CA    1 
ATOM   8285  C  C     . ILE C 1  47  ? -5.927  -63.635 101.377 1.00 206.51 ? 47   ILE C C     1 
ATOM   8286  O  O     . ILE C 1  47  ? -6.345  -63.018 100.392 1.00 208.22 ? 47   ILE C O     1 
ATOM   8287  C  CB    . ILE C 1  47  ? -7.575  -63.268 103.241 1.00 201.94 ? 47   ILE C CB    1 
ATOM   8288  C  CG1   . ILE C 1  47  ? -8.555  -62.500 102.345 1.00 204.98 ? 47   ILE C CG1   1 
ATOM   8289  C  CG2   . ILE C 1  47  ? -7.782  -62.916 104.716 1.00 195.95 ? 47   ILE C CG2   1 
ATOM   8290  C  CD1   . ILE C 1  47  ? -9.972  -62.449 102.883 1.00 203.82 ? 47   ILE C CD1   1 
ATOM   8291  N  N     . SER C 1  48  ? -5.270  -64.792 101.282 1.00 193.78 ? 48   SER C N     1 
ATOM   8292  C  CA    . SER C 1  48  ? -5.066  -65.493 100.020 1.00 181.94 ? 48   SER C CA    1 
ATOM   8293  C  C     . SER C 1  48  ? -6.086  -66.608 99.785  1.00 185.29 ? 48   SER C C     1 
ATOM   8294  O  O     . SER C 1  48  ? -6.572  -67.237 100.728 1.00 194.17 ? 48   SER C O     1 
ATOM   8295  C  CB    . SER C 1  48  ? -3.654  -66.076 99.953  1.00 172.20 ? 48   SER C CB    1 
ATOM   8296  O  OG    . SER C 1  48  ? -2.886  -65.420 98.959  1.00 161.81 ? 48   SER C OG    1 
ATOM   8297  N  N     . LYS C 1  49  ? -6.409  -66.840 98.515  1.00 187.43 ? 49   LYS C N     1 
ATOM   8298  C  CA    . LYS C 1  49  ? -7.528  -67.700 98.148  1.00 193.82 ? 49   LYS C CA    1 
ATOM   8299  C  C     . LYS C 1  49  ? -7.093  -69.165 98.236  1.00 204.06 ? 49   LYS C C     1 
ATOM   8300  O  O     . LYS C 1  49  ? -5.909  -69.483 98.093  1.00 191.28 ? 49   LYS C O     1 
ATOM   8301  C  CB    . LYS C 1  49  ? -8.038  -67.376 96.741  1.00 186.15 ? 49   LYS C CB    1 
ATOM   8302  C  CG    . LYS C 1  49  ? -9.389  -68.009 96.412  1.00 190.49 ? 49   LYS C CG    1 
ATOM   8303  C  CD    . LYS C 1  49  ? -9.907  -67.579 95.048  1.00 187.41 ? 49   LYS C CD    1 
ATOM   8304  C  CE    . LYS C 1  49  ? -10.520 -68.751 94.294  1.00 183.33 ? 49   LYS C CE    1 
ATOM   8305  N  NZ    . LYS C 1  49  ? -10.834 -68.405 92.880  1.00 182.39 ? 49   LYS C NZ    1 
ATOM   8306  N  N     . ILE C 1  50  ? -8.050  -70.065 98.470  1.00 229.31 ? 50   ILE C N     1 
ATOM   8307  C  CA    . ILE C 1  50  ? -7.746  -71.464 98.773  1.00 228.49 ? 50   ILE C CA    1 
ATOM   8308  C  C     . ILE C 1  50  ? -8.748  -72.363 98.064  1.00 230.49 ? 50   ILE C C     1 
ATOM   8309  O  O     . ILE C 1  50  ? -9.953  -72.089 98.058  1.00 230.20 ? 50   ILE C O     1 
ATOM   8310  C  CB    . ILE C 1  50  ? -7.719  -71.793 100.281 1.00 224.50 ? 50   ILE C CB    1 
ATOM   8311  C  CG1   . ILE C 1  50  ? -6.643  -70.994 101.004 1.00 220.85 ? 50   ILE C CG1   1 
ATOM   8312  C  CG2   . ILE C 1  50  ? -7.511  -73.288 100.509 1.00 224.12 ? 50   ILE C CG2   1 
ATOM   8313  C  CD1   . ILE C 1  50  ? -6.233  -71.660 102.285 1.00 216.97 ? 50   ILE C CD1   1 
ATOM   8314  N  N     . GLY C 1  51  ? -8.242  -73.448 97.479  1.00 251.84 ? 51   GLY C N     1 
ATOM   8315  C  CA    . GLY C 1  51  ? -9.072  -74.465 96.882  1.00 254.30 ? 51   GLY C CA    1 
ATOM   8316  C  C     . GLY C 1  51  ? -9.377  -75.616 97.820  1.00 254.11 ? 51   GLY C C     1 
ATOM   8317  O  O     . GLY C 1  51  ? -9.426  -75.462 99.045  1.00 251.62 ? 51   GLY C O     1 
ATOM   8318  N  N     . PRO C 1  52  ? -9.585  -76.805 97.251  1.00 228.44 ? 52   PRO C N     1 
ATOM   8319  C  CA    . PRO C 1  52  ? -9.914  -77.986 98.057  1.00 221.66 ? 52   PRO C CA    1 
ATOM   8320  C  C     . PRO C 1  52  ? -8.752  -78.596 98.825  1.00 213.66 ? 52   PRO C C     1 
ATOM   8321  O  O     . PRO C 1  52  ? -8.929  -79.674 99.401  1.00 212.57 ? 52   PRO C O     1 
ATOM   8322  C  CB    . PRO C 1  52  ? -10.433 -78.979 97.004  1.00 223.62 ? 52   PRO C CB    1 
ATOM   8323  C  CG    . PRO C 1  52  ? -9.762  -78.572 95.748  1.00 227.44 ? 52   PRO C CG    1 
ATOM   8324  C  CD    . PRO C 1  52  ? -9.658  -77.079 95.806  1.00 229.09 ? 52   PRO C CD    1 
ATOM   8325  N  N     . GLU C 1  53  ? -7.574  -77.975 98.876  1.00 213.22 ? 53   GLU C N     1 
ATOM   8326  C  CA    . GLU C 1  53  ? -6.396  -78.712 99.310  1.00 202.41 ? 53   GLU C CA    1 
ATOM   8327  C  C     . GLU C 1  53  ? -6.089  -78.481 100.781 1.00 205.57 ? 53   GLU C C     1 
ATOM   8328  O  O     . GLU C 1  53  ? -5.193  -79.137 101.324 1.00 205.60 ? 53   GLU C O     1 
ATOM   8329  C  CB    . GLU C 1  53  ? -5.169  -78.343 98.462  1.00 187.24 ? 53   GLU C CB    1 
ATOM   8330  C  CG    . GLU C 1  53  ? -4.611  -76.952 98.703  1.00 181.28 ? 53   GLU C CG    1 
ATOM   8331  C  CD    . GLU C 1  53  ? -5.311  -75.893 97.880  1.00 192.89 ? 53   GLU C CD    1 
ATOM   8332  O  OE1   . GLU C 1  53  ? -5.798  -76.224 96.779  1.00 194.62 ? 53   GLU C OE1   1 
ATOM   8333  O  OE2   . GLU C 1  53  ? -5.365  -74.729 98.327  1.00 197.51 ? 53   GLU C OE2   1 
ATOM   8334  N  N     . ASN C 1  54  ? -6.805  -77.567 101.430 1.00 205.01 ? 54   ASN C N     1 
ATOM   8335  C  CA    . ASN C 1  54  ? -6.552  -77.230 102.822 1.00 203.37 ? 54   ASN C CA    1 
ATOM   8336  C  C     . ASN C 1  54  ? -7.745  -77.765 103.603 1.00 214.97 ? 54   ASN C C     1 
ATOM   8337  O  O     . ASN C 1  54  ? -8.856  -77.230 103.460 1.00 213.10 ? 54   ASN C O     1 
ATOM   8338  C  CB    . ASN C 1  54  ? -6.424  -75.708 102.962 1.00 199.40 ? 54   ASN C CB    1 
ATOM   8339  C  CG    . ASN C 1  54  ? -6.321  -75.231 104.398 1.00 201.58 ? 54   ASN C CG    1 
ATOM   8340  O  OD1   . ASN C 1  54  ? -6.635  -75.948 105.338 1.00 212.94 ? 54   ASN C OD1   1 
ATOM   8341  N  ND2   . ASN C 1  54  ? -5.882  -73.991 104.566 1.00 190.61 ? 54   ASN C ND2   1 
ATOM   8342  N  N     . PRO C 1  55  ? -7.585  -78.809 104.425 1.00 227.72 ? 55   PRO C N     1 
ATOM   8343  C  CA    . PRO C 1  55  ? -8.766  -79.442 105.040 1.00 228.10 ? 55   PRO C CA    1 
ATOM   8344  C  C     . PRO C 1  55  ? -9.499  -78.583 106.062 1.00 229.49 ? 55   PRO C C     1 
ATOM   8345  O  O     . PRO C 1  55  ? -10.598 -78.969 106.484 1.00 223.94 ? 55   PRO C O     1 
ATOM   8346  C  CB    . PRO C 1  55  ? -8.178  -80.696 105.700 1.00 224.27 ? 55   PRO C CB    1 
ATOM   8347  C  CG    . PRO C 1  55  ? -6.758  -80.321 105.994 1.00 221.98 ? 55   PRO C CG    1 
ATOM   8348  C  CD    . PRO C 1  55  ? -6.330  -79.464 104.833 1.00 222.06 ? 55   PRO C CD    1 
ATOM   8349  N  N     . TYR C 1  56  ? -8.945  -77.446 106.469 1.00 245.86 ? 56   TYR C N     1 
ATOM   8350  C  CA    . TYR C 1  56  ? -9.441  -76.740 107.644 1.00 240.60 ? 56   TYR C CA    1 
ATOM   8351  C  C     . TYR C 1  56  ? -10.493 -75.696 107.276 1.00 241.09 ? 56   TYR C C     1 
ATOM   8352  O  O     . TYR C 1  56  ? -10.442 -75.110 106.194 1.00 243.34 ? 56   TYR C O     1 
ATOM   8353  C  CB    . TYR C 1  56  ? -8.264  -76.119 108.401 1.00 234.80 ? 56   TYR C CB    1 
ATOM   8354  C  CG    . TYR C 1  56  ? -7.137  -77.123 108.602 1.00 233.49 ? 56   TYR C CG    1 
ATOM   8355  C  CD1   . TYR C 1  56  ? -7.257  -78.166 109.511 1.00 231.98 ? 56   TYR C CD1   1 
ATOM   8356  C  CD2   . TYR C 1  56  ? -5.948  -77.017 107.893 1.00 233.82 ? 56   TYR C CD2   1 
ATOM   8357  C  CE1   . TYR C 1  56  ? -6.233  -79.088 109.683 1.00 230.19 ? 56   TYR C CE1   1 
ATOM   8358  C  CE2   . TYR C 1  56  ? -4.921  -77.927 108.063 1.00 232.91 ? 56   TYR C CE2   1 
ATOM   8359  C  CZ    . TYR C 1  56  ? -5.065  -78.957 108.962 1.00 231.54 ? 56   TYR C CZ    1 
ATOM   8360  O  OH    . TYR C 1  56  ? -4.042  -79.862 109.135 1.00 230.16 ? 56   TYR C OH    1 
ATOM   8361  N  N     . ASN C 1  57  ? -11.494 -75.527 108.144 1.00 222.87 ? 57   ASN C N     1 
ATOM   8362  C  CA    . ASN C 1  57  ? -12.420 -74.400 108.058 1.00 219.80 ? 57   ASN C CA    1 
ATOM   8363  C  C     . ASN C 1  57  ? -12.819 -73.959 109.464 1.00 218.80 ? 57   ASN C C     1 
ATOM   8364  O  O     . ASN C 1  57  ? -12.972 -74.798 110.357 1.00 212.20 ? 57   ASN C O     1 
ATOM   8365  C  CB    . ASN C 1  57  ? -13.649 -74.720 107.198 1.00 221.41 ? 57   ASN C CB    1 
ATOM   8366  C  CG    . ASN C 1  57  ? -14.503 -75.812 107.778 1.00 221.17 ? 57   ASN C CG    1 
ATOM   8367  O  OD1   . ASN C 1  57  ? -14.000 -76.814 108.281 1.00 218.30 ? 57   ASN C OD1   1 
ATOM   8368  N  ND2   . ASN C 1  57  ? -15.816 -75.619 107.723 1.00 219.74 ? 57   ASN C ND2   1 
ATOM   8369  N  N     . THR C 1  58  ? -12.978 -72.642 109.665 1.00 228.65 ? 58   THR C N     1 
ATOM   8370  C  CA    . THR C 1  58  ? -13.571 -72.082 110.881 1.00 223.28 ? 58   THR C CA    1 
ATOM   8371  C  C     . THR C 1  58  ? -14.758 -71.169 110.575 1.00 221.31 ? 58   THR C C     1 
ATOM   8372  O  O     . THR C 1  58  ? -14.698 -70.366 109.642 1.00 223.49 ? 58   THR C O     1 
ATOM   8373  C  CB    . THR C 1  58  ? -12.525 -71.302 111.688 1.00 219.09 ? 58   THR C CB    1 
ATOM   8374  O  OG1   . THR C 1  58  ? -12.252 -70.053 111.041 1.00 220.02 ? 58   THR C OG1   1 
ATOM   8375  C  CG2   . THR C 1  58  ? -11.242 -72.104 111.804 1.00 214.47 ? 58   THR C CG2   1 
ATOM   8376  N  N     . PRO C 1  59  ? -15.846 -71.270 111.342 1.00 199.60 ? 59   PRO C N     1 
ATOM   8377  C  CA    . PRO C 1  59  ? -17.010 -70.393 111.121 1.00 191.20 ? 59   PRO C CA    1 
ATOM   8378  C  C     . PRO C 1  59  ? -16.715 -68.905 111.285 1.00 187.49 ? 59   PRO C C     1 
ATOM   8379  O  O     . PRO C 1  59  ? -15.941 -68.500 112.155 1.00 189.69 ? 59   PRO C O     1 
ATOM   8380  C  CB    . PRO C 1  59  ? -17.994 -70.852 112.200 1.00 194.78 ? 59   PRO C CB    1 
ATOM   8381  C  CG    . PRO C 1  59  ? -17.580 -72.218 112.545 1.00 197.29 ? 59   PRO C CG    1 
ATOM   8382  C  CD    . PRO C 1  59  ? -16.094 -72.251 112.410 1.00 200.11 ? 59   PRO C CD    1 
ATOM   8383  N  N     . VAL C 1  60  ? -17.343 -68.086 110.430 1.00 185.28 ? 60   VAL C N     1 
ATOM   8384  C  CA    . VAL C 1  60  ? -17.276 -66.630 110.520 1.00 188.25 ? 60   VAL C CA    1 
ATOM   8385  C  C     . VAL C 1  60  ? -18.682 -66.045 110.682 1.00 192.10 ? 60   VAL C C     1 
ATOM   8386  O  O     . VAL C 1  60  ? -19.681 -66.650 110.284 1.00 189.00 ? 60   VAL C O     1 
ATOM   8387  C  CB    . VAL C 1  60  ? -16.568 -66.042 109.275 1.00 183.43 ? 60   VAL C CB    1 
ATOM   8388  C  CG1   . VAL C 1  60  ? -16.325 -64.544 109.396 1.00 178.87 ? 60   VAL C CG1   1 
ATOM   8389  C  CG2   . VAL C 1  60  ? -15.249 -66.745 109.067 1.00 180.29 ? 60   VAL C CG2   1 
ATOM   8390  N  N     . PHE C 1  61  ? -18.750 -64.849 111.277 1.00 204.18 ? 61   PHE C N     1 
ATOM   8391  C  CA    . PHE C 1  61  ? -19.980 -64.060 111.360 1.00 204.94 ? 61   PHE C CA    1 
ATOM   8392  C  C     . PHE C 1  61  ? -19.576 -62.585 111.372 1.00 203.46 ? 61   PHE C C     1 
ATOM   8393  O  O     . PHE C 1  61  ? -18.395 -62.249 111.252 1.00 200.98 ? 61   PHE C O     1 
ATOM   8394  C  CB    . PHE C 1  61  ? -20.885 -64.459 112.540 1.00 202.17 ? 61   PHE C CB    1 
ATOM   8395  C  CG    . PHE C 1  61  ? -20.277 -64.279 113.898 1.00 200.90 ? 61   PHE C CG    1 
ATOM   8396  C  CD1   . PHE C 1  61  ? -19.278 -65.119 114.356 1.00 197.15 ? 61   PHE C CD1   1 
ATOM   8397  C  CD2   . PHE C 1  61  ? -20.763 -63.297 114.748 1.00 197.66 ? 61   PHE C CD2   1 
ATOM   8398  C  CE1   . PHE C 1  61  ? -18.746 -64.954 115.621 1.00 190.70 ? 61   PHE C CE1   1 
ATOM   8399  C  CE2   . PHE C 1  61  ? -20.239 -63.129 116.011 1.00 193.40 ? 61   PHE C CE2   1 
ATOM   8400  C  CZ    . PHE C 1  61  ? -19.229 -63.957 116.450 1.00 189.48 ? 61   PHE C CZ    1 
ATOM   8401  N  N     . ALA C 1  62  ? -20.562 -61.694 111.495 1.00 196.28 ? 62   ALA C N     1 
ATOM   8402  C  CA    . ALA C 1  62  ? -20.283 -60.264 111.413 1.00 192.77 ? 62   ALA C CA    1 
ATOM   8403  C  C     . ALA C 1  62  ? -21.222 -59.474 112.317 1.00 189.00 ? 62   ALA C C     1 
ATOM   8404  O  O     . ALA C 1  62  ? -22.429 -59.729 112.345 1.00 182.40 ? 62   ALA C O     1 
ATOM   8405  C  CB    . ALA C 1  62  ? -20.403 -59.757 109.971 1.00 191.58 ? 62   ALA C CB    1 
ATOM   8406  N  N     . ILE C 1  63  ? -20.655 -58.510 113.054 1.00 191.15 ? 63   ILE C N     1 
ATOM   8407  C  CA    . ILE C 1  63  ? -21.421 -57.594 113.894 1.00 188.97 ? 63   ILE C CA    1 
ATOM   8408  C  C     . ILE C 1  63  ? -20.900 -56.174 113.695 1.00 192.23 ? 63   ILE C C     1 
ATOM   8409  O  O     . ILE C 1  63  ? -19.799 -55.954 113.186 1.00 196.09 ? 63   ILE C O     1 
ATOM   8410  C  CB    . ILE C 1  63  ? -21.379 -57.972 115.395 1.00 185.39 ? 63   ILE C CB    1 
ATOM   8411  C  CG1   . ILE C 1  63  ? -19.981 -57.740 115.974 1.00 188.78 ? 63   ILE C CG1   1 
ATOM   8412  C  CG2   . ILE C 1  63  ? -21.845 -59.408 115.614 1.00 181.68 ? 63   ILE C CG2   1 
ATOM   8413  C  CD1   . ILE C 1  63  ? -19.983 -57.399 117.449 1.00 185.67 ? 63   ILE C CD1   1 
ATOM   8414  N  N     . LYS C 1  64  ? -21.711 -55.206 114.121 1.00 191.54 ? 64   LYS C N     1 
ATOM   8415  C  CA    . LYS C 1  64  ? -21.480 -53.800 113.806 1.00 193.81 ? 64   LYS C CA    1 
ATOM   8416  C  C     . LYS C 1  64  ? -20.360 -53.203 114.650 1.00 194.20 ? 64   LYS C C     1 
ATOM   8417  O  O     . LYS C 1  64  ? -20.281 -53.428 115.861 1.00 187.42 ? 64   LYS C O     1 
ATOM   8418  C  CB    . LYS C 1  64  ? -22.767 -52.998 114.013 1.00 184.66 ? 64   LYS C CB    1 
ATOM   8419  C  CG    . LYS C 1  64  ? -22.601 -51.480 113.994 1.00 179.94 ? 64   LYS C CG    1 
ATOM   8420  C  CD    . LYS C 1  64  ? -22.255 -50.950 112.609 1.00 187.42 ? 64   LYS C CD    1 
ATOM   8421  C  CE    . LYS C 1  64  ? -22.288 -49.428 112.582 1.00 178.49 ? 64   LYS C CE    1 
ATOM   8422  N  NZ    . LYS C 1  64  ? -21.886 -48.875 111.259 1.00 178.88 ? 64   LYS C NZ    1 
ATOM   8423  N  N     . LYS C 1  65  ? -19.498 -52.430 113.996 1.00 203.64 ? 65   LYS C N     1 
ATOM   8424  C  CA    . LYS C 1  65  ? -18.477 -51.669 114.700 1.00 203.15 ? 65   LYS C CA    1 
ATOM   8425  C  C     . LYS C 1  65  ? -19.110 -50.498 115.441 1.00 205.02 ? 65   LYS C C     1 
ATOM   8426  O  O     . LYS C 1  65  ? -19.999 -49.819 114.920 1.00 208.19 ? 65   LYS C O     1 
ATOM   8427  C  CB    . LYS C 1  65  ? -17.430 -51.166 113.711 1.00 202.40 ? 65   LYS C CB    1 
ATOM   8428  C  CG    . LYS C 1  65  ? -16.276 -50.433 114.336 1.00 198.01 ? 65   LYS C CG    1 
ATOM   8429  C  CD    . LYS C 1  65  ? -15.246 -50.106 113.282 1.00 198.25 ? 65   LYS C CD    1 
ATOM   8430  C  CE    . LYS C 1  65  ? -14.020 -49.516 113.916 1.00 191.32 ? 65   LYS C CE    1 
ATOM   8431  N  NZ    . LYS C 1  65  ? -12.965 -49.215 112.912 1.00 176.07 ? 65   LYS C NZ    1 
ATOM   8432  N  N     . LYS C 1  66  ? -18.644 -50.259 116.665 1.00 196.33 ? 66   LYS C N     1 
ATOM   8433  C  CA    . LYS C 1  66  ? -19.257 -49.249 117.519 1.00 193.01 ? 66   LYS C CA    1 
ATOM   8434  C  C     . LYS C 1  66  ? -18.991 -47.848 116.973 1.00 204.10 ? 66   LYS C C     1 
ATOM   8435  O  O     . LYS C 1  66  ? -17.834 -47.448 116.801 1.00 200.56 ? 66   LYS C O     1 
ATOM   8436  C  CB    . LYS C 1  66  ? -18.743 -49.387 118.952 1.00 178.45 ? 66   LYS C CB    1 
ATOM   8437  C  CG    . LYS C 1  66  ? -17.248 -49.656 119.074 1.00 170.05 ? 66   LYS C CG    1 
ATOM   8438  C  CD    . LYS C 1  66  ? -16.471 -48.388 119.398 1.00 160.24 ? 66   LYS C CD    1 
ATOM   8439  C  CE    . LYS C 1  66  ? -14.973 -48.621 119.309 1.00 147.67 ? 66   LYS C CE    1 
ATOM   8440  N  NZ    . LYS C 1  66  ? -14.203 -47.362 119.508 1.00 130.40 ? 66   LYS C NZ    1 
ATOM   8441  N  N     . ASP C 1  67  ? -20.071 -47.118 116.680 1.00 212.02 ? 67   ASP C N     1 
ATOM   8442  C  CA    . ASP C 1  67  ? -20.012 -45.703 116.303 1.00 213.21 ? 67   ASP C CA    1 
ATOM   8443  C  C     . ASP C 1  67  ? -19.042 -45.463 115.146 1.00 214.75 ? 67   ASP C C     1 
ATOM   8444  O  O     . ASP C 1  67  ? -18.239 -44.527 115.163 1.00 210.85 ? 67   ASP C O     1 
ATOM   8445  C  CB    . ASP C 1  67  ? -19.648 -44.837 117.511 1.00 209.36 ? 67   ASP C CB    1 
ATOM   8446  C  CG    . ASP C 1  67  ? -20.193 -43.423 117.405 1.00 208.29 ? 67   ASP C CG    1 
ATOM   8447  O  OD1   . ASP C 1  67  ? -20.350 -42.924 116.272 1.00 213.91 ? 67   ASP C OD1   1 
ATOM   8448  O  OD2   . ASP C 1  67  ? -20.465 -42.811 118.459 1.00 204.06 ? 67   ASP C OD2   1 
ATOM   8449  N  N     . SER C 1  68  ? -19.121 -46.314 114.126 1.00 208.72 ? 68   SER C N     1 
ATOM   8450  C  CA    . SER C 1  68  ? -18.231 -46.226 112.978 1.00 206.39 ? 68   SER C CA    1 
ATOM   8451  C  C     . SER C 1  68  ? -18.986 -46.628 111.719 1.00 209.89 ? 68   SER C C     1 
ATOM   8452  O  O     . SER C 1  68  ? -20.023 -47.293 111.777 1.00 208.15 ? 68   SER C O     1 
ATOM   8453  C  CB    . SER C 1  68  ? -16.989 -47.106 113.163 1.00 201.78 ? 68   SER C CB    1 
ATOM   8454  O  OG    . SER C 1  68  ? -16.112 -47.005 112.054 1.00 199.41 ? 68   SER C OG    1 
ATOM   8455  N  N     . THR C 1  69  ? -18.453 -46.206 110.569 1.00 203.74 ? 69   THR C N     1 
ATOM   8456  C  CA    . THR C 1  69  ? -19.114 -46.488 109.299 1.00 191.99 ? 69   THR C CA    1 
ATOM   8457  C  C     . THR C 1  69  ? -18.899 -47.931 108.853 1.00 195.73 ? 69   THR C C     1 
ATOM   8458  O  O     . THR C 1  69  ? -19.847 -48.591 108.413 1.00 189.68 ? 69   THR C O     1 
ATOM   8459  C  CB    . THR C 1  69  ? -18.624 -45.517 108.221 1.00 178.37 ? 69   THR C CB    1 
ATOM   8460  O  OG1   . THR C 1  69  ? -18.800 -44.169 108.672 1.00 171.40 ? 69   THR C OG1   1 
ATOM   8461  C  CG2   . THR C 1  69  ? -19.407 -45.716 106.930 1.00 170.77 ? 69   THR C CG2   1 
ATOM   8462  N  N     . LYS C 1  70  ? -17.674 -48.441 108.959 1.00 202.04 ? 70   LYS C N     1 
ATOM   8463  C  CA    . LYS C 1  70  ? -17.398 -49.808 108.541 1.00 202.49 ? 70   LYS C CA    1 
ATOM   8464  C  C     . LYS C 1  70  ? -17.861 -50.809 109.600 1.00 204.49 ? 70   LYS C C     1 
ATOM   8465  O  O     . LYS C 1  70  ? -18.045 -50.475 110.772 1.00 204.70 ? 70   LYS C O     1 
ATOM   8466  C  CB    . LYS C 1  70  ? -15.908 -50.001 108.252 1.00 197.95 ? 70   LYS C CB    1 
ATOM   8467  C  CG    . LYS C 1  70  ? -15.202 -48.775 107.696 1.00 197.32 ? 70   LYS C CG    1 
ATOM   8468  C  CD    . LYS C 1  70  ? -13.707 -49.025 107.566 1.00 195.36 ? 70   LYS C CD    1 
ATOM   8469  C  CE    . LYS C 1  70  ? -12.983 -47.813 107.005 1.00 192.33 ? 70   LYS C CE    1 
ATOM   8470  N  NZ    . LYS C 1  70  ? -11.632 -48.173 106.491 1.00 190.24 ? 70   LYS C NZ    1 
ATOM   8471  N  N     . TRP C 1  71  ? -18.050 -52.053 109.161 1.00 207.34 ? 71   TRP C N     1 
ATOM   8472  C  CA    . TRP C 1  71  ? -18.514 -53.148 110.001 1.00 208.53 ? 71   TRP C CA    1 
ATOM   8473  C  C     . TRP C 1  71  ? -17.326 -53.969 110.502 1.00 213.22 ? 71   TRP C C     1 
ATOM   8474  O  O     . TRP C 1  71  ? -16.171 -53.724 110.145 1.00 207.32 ? 71   TRP C O     1 
ATOM   8475  C  CB    . TRP C 1  71  ? -19.492 -54.034 109.226 1.00 203.17 ? 71   TRP C CB    1 
ATOM   8476  C  CG    . TRP C 1  71  ? -20.901 -53.528 109.200 1.00 197.59 ? 71   TRP C CG    1 
ATOM   8477  C  CD1   . TRP C 1  71  ? -21.370 -52.438 108.526 1.00 197.10 ? 71   TRP C CD1   1 
ATOM   8478  C  CD2   . TRP C 1  71  ? -22.032 -54.106 109.863 1.00 196.05 ? 71   TRP C CD2   1 
ATOM   8479  N  NE1   . TRP C 1  71  ? -22.720 -52.295 108.737 1.00 197.64 ? 71   TRP C NE1   1 
ATOM   8480  C  CE2   . TRP C 1  71  ? -23.151 -53.308 109.554 1.00 195.26 ? 71   TRP C CE2   1 
ATOM   8481  C  CE3   . TRP C 1  71  ? -22.206 -55.219 110.691 1.00 194.64 ? 71   TRP C CE3   1 
ATOM   8482  C  CZ2   . TRP C 1  71  ? -24.424 -53.586 110.045 1.00 194.45 ? 71   TRP C CZ2   1 
ATOM   8483  C  CZ3   . TRP C 1  71  ? -23.470 -55.493 111.178 1.00 190.84 ? 71   TRP C CZ3   1 
ATOM   8484  C  CH2   . TRP C 1  71  ? -24.563 -54.680 110.853 1.00 191.33 ? 71   TRP C CH2   1 
ATOM   8485  N  N     . ARG C 1  72  ? -17.619 -54.973 111.331 1.00 233.69 ? 72   ARG C N     1 
ATOM   8486  C  CA    . ARG C 1  72  ? -16.592 -55.861 111.868 1.00 230.37 ? 72   ARG C CA    1 
ATOM   8487  C  C     . ARG C 1  72  ? -16.947 -57.317 111.576 1.00 230.52 ? 72   ARG C C     1 
ATOM   8488  O  O     . ARG C 1  72  ? -17.953 -57.840 112.069 1.00 229.76 ? 72   ARG C O     1 
ATOM   8489  C  CB    . ARG C 1  72  ? -16.383 -55.621 113.364 1.00 223.89 ? 72   ARG C CB    1 
ATOM   8490  C  CG    . ARG C 1  72  ? -15.681 -54.300 113.667 1.00 222.70 ? 72   ARG C CG    1 
ATOM   8491  C  CD    . ARG C 1  72  ? -15.306 -54.188 115.133 1.00 213.58 ? 72   ARG C CD    1 
ATOM   8492  N  NE    . ARG C 1  72  ? -14.514 -52.993 115.422 1.00 207.29 ? 72   ARG C NE    1 
ATOM   8493  C  CZ    . ARG C 1  72  ? -13.197 -52.912 115.250 1.00 208.52 ? 72   ARG C CZ    1 
ATOM   8494  N  NH1   . ARG C 1  72  ? -12.520 -53.954 114.788 1.00 210.19 ? 72   ARG C NH1   1 
ATOM   8495  N  NH2   . ARG C 1  72  ? -12.553 -51.792 115.546 1.00 203.78 ? 72   ARG C NH2   1 
ATOM   8496  N  N     . LYS C 1  73  ? -16.128 -57.933 110.731 1.00 202.25 ? 73   LYS C N     1 
ATOM   8497  C  CA    . LYS C 1  73  ? -16.081 -59.373 110.501 1.00 193.10 ? 73   LYS C CA    1 
ATOM   8498  C  C     . LYS C 1  73  ? -15.540 -60.100 111.730 1.00 195.89 ? 73   LYS C C     1 
ATOM   8499  O  O     . LYS C 1  73  ? -14.503 -59.715 112.281 1.00 191.67 ? 73   LYS C O     1 
ATOM   8500  C  CB    . LYS C 1  73  ? -15.215 -59.680 109.272 1.00 186.40 ? 73   LYS C CB    1 
ATOM   8501  C  CG    . LYS C 1  73  ? -13.734 -59.290 109.403 1.00 182.71 ? 73   LYS C CG    1 
ATOM   8502  C  CD    . LYS C 1  73  ? -13.531 -57.778 109.405 1.00 181.12 ? 73   LYS C CD    1 
ATOM   8503  C  CE    . LYS C 1  73  ? -12.084 -57.394 109.541 1.00 171.55 ? 73   LYS C CE    1 
ATOM   8504  N  NZ    . LYS C 1  73  ? -11.921 -55.927 109.736 1.00 169.47 ? 73   LYS C NZ    1 
ATOM   8505  N  N     . LEU C 1  74  ? -16.245 -61.133 112.187 1.00 202.45 ? 74   LEU C N     1 
ATOM   8506  C  CA    . LEU C 1  74  ? -15.755 -61.919 113.312 1.00 198.85 ? 74   LEU C CA    1 
ATOM   8507  C  C     . LEU C 1  74  ? -15.662 -63.389 112.927 1.00 201.65 ? 74   LEU C C     1 
ATOM   8508  O  O     . LEU C 1  74  ? -16.591 -63.954 112.344 1.00 205.74 ? 74   LEU C O     1 
ATOM   8509  C  CB    . LEU C 1  74  ? -16.689 -61.765 114.511 1.00 192.11 ? 74   LEU C CB    1 
ATOM   8510  C  CG    . LEU C 1  74  ? -16.580 -60.444 115.269 1.00 187.84 ? 74   LEU C CG    1 
ATOM   8511  C  CD1   . LEU C 1  74  ? -17.514 -60.443 116.467 1.00 186.22 ? 74   LEU C CD1   1 
ATOM   8512  C  CD2   . LEU C 1  74  ? -15.143 -60.186 115.689 1.00 184.17 ? 74   LEU C CD2   1 
ATOM   8513  N  N     . VAL C 1  75  ? -14.555 -64.010 113.331 1.00 188.94 ? 75   VAL C N     1 
ATOM   8514  C  CA    . VAL C 1  75  ? -14.262 -65.420 113.090 1.00 177.00 ? 75   VAL C CA    1 
ATOM   8515  C  C     . VAL C 1  75  ? -14.358 -66.205 114.391 1.00 169.82 ? 75   VAL C C     1 
ATOM   8516  O  O     . VAL C 1  75  ? -13.757 -65.820 115.402 1.00 163.83 ? 75   VAL C O     1 
ATOM   8517  C  CB    . VAL C 1  75  ? -12.875 -65.600 112.450 1.00 169.38 ? 75   VAL C CB    1 
ATOM   8518  C  CG1   . VAL C 1  75  ? -12.726 -67.011 111.912 1.00 171.30 ? 75   VAL C CG1   1 
ATOM   8519  C  CG2   . VAL C 1  75  ? -12.657 -64.573 111.348 1.00 168.86 ? 75   VAL C CG2   1 
ATOM   8520  N  N     . ASP C 1  76  ? -15.101 -67.309 114.361 1.00 170.61 ? 76   ASP C N     1 
ATOM   8521  C  CA    . ASP C 1  76  ? -15.208 -68.208 115.509 1.00 163.18 ? 76   ASP C CA    1 
ATOM   8522  C  C     . ASP C 1  76  ? -14.033 -69.174 115.481 1.00 162.86 ? 76   ASP C C     1 
ATOM   8523  O  O     . ASP C 1  76  ? -14.037 -70.160 114.742 1.00 174.64 ? 76   ASP C O     1 
ATOM   8524  C  CB    . ASP C 1  76  ? -16.520 -68.981 115.491 1.00 173.56 ? 76   ASP C CB    1 
ATOM   8525  C  CG    . ASP C 1  76  ? -16.820 -69.651 116.823 1.00 173.65 ? 76   ASP C CG    1 
ATOM   8526  O  OD1   . ASP C 1  76  ? -15.871 -70.072 117.518 1.00 173.16 ? 76   ASP C OD1   1 
ATOM   8527  O  OD2   . ASP C 1  76  ? -18.006 -69.800 117.160 1.00 179.44 ? 76   ASP C OD2   1 
ATOM   8528  N  N     . PHE C 1  77  ? -13.021 -68.889 116.294 1.00 160.83 ? 77   PHE C N     1 
ATOM   8529  C  CA    . PHE C 1  77  ? -11.760 -69.612 116.256 1.00 164.38 ? 77   PHE C CA    1 
ATOM   8530  C  C     . PHE C 1  77  ? -11.562 -70.470 117.498 1.00 165.63 ? 77   PHE C C     1 
ATOM   8531  O  O     . PHE C 1  77  ? -10.455 -70.972 117.718 1.00 159.26 ? 77   PHE C O     1 
ATOM   8532  C  CB    . PHE C 1  77  ? -10.601 -68.620 116.124 1.00 161.65 ? 77   PHE C CB    1 
ATOM   8533  C  CG    . PHE C 1  77  ? -10.142 -68.391 114.712 1.00 164.90 ? 77   PHE C CG    1 
ATOM   8534  C  CD1   . PHE C 1  77  ? -10.035 -69.439 113.816 1.00 167.95 ? 77   PHE C CD1   1 
ATOM   8535  C  CD2   . PHE C 1  77  ? -9.827  -67.113 114.280 1.00 159.35 ? 77   PHE C CD2   1 
ATOM   8536  C  CE1   . PHE C 1  77  ? -9.607  -69.215 112.519 1.00 169.87 ? 77   PHE C CE1   1 
ATOM   8537  C  CE2   . PHE C 1  77  ? -9.405  -66.885 112.987 1.00 157.35 ? 77   PHE C CE2   1 
ATOM   8538  C  CZ    . PHE C 1  77  ? -9.296  -67.937 112.104 1.00 168.28 ? 77   PHE C CZ    1 
ATOM   8539  N  N     . ARG C 1  78  ? -12.608 -70.640 118.320 1.00 168.12 ? 78   ARG C N     1 
ATOM   8540  C  CA    . ARG C 1  78  ? -12.440 -71.310 119.607 1.00 165.91 ? 78   ARG C CA    1 
ATOM   8541  C  C     . ARG C 1  78  ? -11.856 -72.707 119.455 1.00 163.58 ? 78   ARG C C     1 
ATOM   8542  O  O     . ARG C 1  78  ? -11.150 -73.183 120.350 1.00 162.98 ? 78   ARG C O     1 
ATOM   8543  C  CB    . ARG C 1  78  ? -13.770 -71.386 120.362 1.00 167.34 ? 78   ARG C CB    1 
ATOM   8544  C  CG    . ARG C 1  78  ? -14.292 -70.050 120.868 1.00 167.16 ? 78   ARG C CG    1 
ATOM   8545  C  CD    . ARG C 1  78  ? -15.704 -70.175 121.430 1.00 167.83 ? 78   ARG C CD    1 
ATOM   8546  N  NE    . ARG C 1  78  ? -16.699 -70.537 120.425 1.00 173.53 ? 78   ARG C NE    1 
ATOM   8547  C  CZ    . ARG C 1  78  ? -18.012 -70.429 120.609 1.00 180.51 ? 78   ARG C CZ    1 
ATOM   8548  N  NH1   . ARG C 1  78  ? -18.486 -69.963 121.757 1.00 178.77 ? 78   ARG C NH1   1 
ATOM   8549  N  NH2   . ARG C 1  78  ? -18.852 -70.784 119.647 1.00 186.78 ? 78   ARG C NH2   1 
ATOM   8550  N  N     . GLU C 1  79  ? -12.139 -73.382 118.340 1.00 158.46 ? 79   GLU C N     1 
ATOM   8551  C  CA    . GLU C 1  79  ? -11.562 -74.705 118.128 1.00 159.35 ? 79   GLU C CA    1 
ATOM   8552  C  C     . GLU C 1  79  ? -10.064 -74.610 117.862 1.00 160.88 ? 79   GLU C C     1 
ATOM   8553  O  O     . GLU C 1  79  ? -9.264  -75.281 118.522 1.00 160.42 ? 79   GLU C O     1 
ATOM   8554  C  CB    . GLU C 1  79  ? -12.281 -75.423 116.987 1.00 166.31 ? 79   GLU C CB    1 
ATOM   8555  C  CG    . GLU C 1  79  ? -12.021 -76.923 116.952 1.00 166.63 ? 79   GLU C CG    1 
ATOM   8556  C  CD    . GLU C 1  79  ? -12.414 -77.621 118.246 1.00 160.97 ? 79   GLU C CD    1 
ATOM   8557  O  OE1   . GLU C 1  79  ? -13.392 -77.187 118.891 1.00 160.40 ? 79   GLU C OE1   1 
ATOM   8558  O  OE2   . GLU C 1  79  ? -11.740 -78.604 118.619 1.00 155.62 ? 79   GLU C OE2   1 
ATOM   8559  N  N     . LEU C 1  80  ? -9.671  -73.788 116.881 1.00 163.44 ? 80   LEU C N     1 
ATOM   8560  C  CA    . LEU C 1  80  ? -8.256  -73.481 116.677 1.00 160.76 ? 80   LEU C CA    1 
ATOM   8561  C  C     . LEU C 1  80  ? -7.608  -72.997 117.967 1.00 160.86 ? 80   LEU C C     1 
ATOM   8562  O  O     . LEU C 1  80  ? -6.473  -73.371 118.285 1.00 157.73 ? 80   LEU C O     1 
ATOM   8563  C  CB    . LEU C 1  80  ? -8.111  -72.429 115.576 1.00 162.86 ? 80   LEU C CB    1 
ATOM   8564  C  CG    . LEU C 1  80  ? -6.701  -71.971 115.204 1.00 154.75 ? 80   LEU C CG    1 
ATOM   8565  C  CD1   . LEU C 1  80  ? -5.813  -73.166 114.907 1.00 157.25 ? 80   LEU C CD1   1 
ATOM   8566  C  CD2   . LEU C 1  80  ? -6.747  -71.019 114.019 1.00 156.41 ? 80   LEU C CD2   1 
ATOM   8567  N  N     . ASN C 1  81  ? -8.315  -72.141 118.707 1.00 162.24 ? 81   ASN C N     1 
ATOM   8568  C  CA    . ASN C 1  81  ? -7.825  -71.625 119.982 1.00 158.57 ? 81   ASN C CA    1 
ATOM   8569  C  C     . ASN C 1  81  ? -7.458  -72.755 120.938 1.00 154.70 ? 81   ASN C C     1 
ATOM   8570  O  O     . ASN C 1  81  ? -6.381  -72.746 121.547 1.00 151.35 ? 81   ASN C O     1 
ATOM   8571  C  CB    . ASN C 1  81  ? -8.865  -70.691 120.598 1.00 159.01 ? 81   ASN C CB    1 
ATOM   8572  C  CG    . ASN C 1  81  ? -8.990  -69.386 119.836 1.00 157.43 ? 81   ASN C CG    1 
ATOM   8573  O  OD1   . ASN C 1  81  ? -8.139  -69.051 119.011 1.00 155.04 ? 81   ASN C OD1   1 
ATOM   8574  N  ND2   . ASN C 1  81  ? -10.061 -68.652 120.095 1.00 158.97 ? 81   ASN C ND2   1 
ATOM   8575  N  N     . LYS C 1  82  ? -8.352  -73.738 121.086 1.00 157.71 ? 82   LYS C N     1 
ATOM   8576  C  CA    . LYS C 1  82  ? -8.072  -74.885 121.947 1.00 148.38 ? 82   LYS C CA    1 
ATOM   8577  C  C     . LYS C 1  82  ? -6.850  -75.659 121.465 1.00 151.04 ? 82   LYS C C     1 
ATOM   8578  O  O     . LYS C 1  82  ? -6.068  -76.165 122.279 1.00 159.01 ? 82   LYS C O     1 
ATOM   8579  C  CB    . LYS C 1  82  ? -9.294  -75.808 121.990 1.00 136.29 ? 82   LYS C CB    1 
ATOM   8580  C  CG    . LYS C 1  82  ? -10.510 -75.249 122.723 1.00 136.57 ? 82   LYS C CG    1 
ATOM   8581  C  CD    . LYS C 1  82  ? -11.719 -76.175 122.574 1.00 138.16 ? 82   LYS C CD    1 
ATOM   8582  C  CE    . LYS C 1  82  ? -12.978 -75.574 123.194 1.00 127.44 ? 82   LYS C CE    1 
ATOM   8583  N  NZ    . LYS C 1  82  ? -14.206 -76.363 122.880 1.00 118.95 ? 82   LYS C NZ    1 
ATOM   8584  N  N     . ARG C 1  83  ? -6.670  -75.772 120.150 1.00 157.59 ? 83   ARG C N     1 
ATOM   8585  C  CA    . ARG C 1  83  ? -5.580  -76.569 119.600 1.00 159.32 ? 83   ARG C CA    1 
ATOM   8586  C  C     . ARG C 1  83  ? -4.263  -75.802 119.506 1.00 163.47 ? 83   ARG C C     1 
ATOM   8587  O  O     . ARG C 1  83  ? -3.209  -76.428 119.351 1.00 163.22 ? 83   ARG C O     1 
ATOM   8588  C  CB    . ARG C 1  83  ? -5.973  -77.101 118.218 1.00 152.13 ? 83   ARG C CB    1 
ATOM   8589  C  CG    . ARG C 1  83  ? -6.977  -78.249 118.264 1.00 153.86 ? 83   ARG C CG    1 
ATOM   8590  C  CD    . ARG C 1  83  ? -8.125  -78.030 117.284 1.00 162.52 ? 83   ARG C CD    1 
ATOM   8591  N  NE    . ARG C 1  83  ? -9.264  -78.904 117.562 1.00 161.14 ? 83   ARG C NE    1 
ATOM   8592  C  CZ    . ARG C 1  83  ? -9.416  -80.125 117.060 1.00 157.92 ? 83   ARG C CZ    1 
ATOM   8593  N  NH1   . ARG C 1  83  ? -8.496  -80.634 116.252 1.00 162.12 ? 83   ARG C NH1   1 
ATOM   8594  N  NH2   . ARG C 1  83  ? -10.488 -80.843 117.373 1.00 151.86 ? 83   ARG C NH2   1 
ATOM   8595  N  N     . THR C 1  84  ? -4.297  -74.473 119.587 1.00 158.48 ? 84   THR C N     1 
ATOM   8596  C  CA    . THR C 1  84  ? -3.091  -73.658 119.499 1.00 158.77 ? 84   THR C CA    1 
ATOM   8597  C  C     . THR C 1  84  ? -2.329  -73.596 120.822 1.00 155.30 ? 84   THR C C     1 
ATOM   8598  O  O     . THR C 1  84  ? -2.916  -73.622 121.908 1.00 156.10 ? 84   THR C O     1 
ATOM   8599  C  CB    . THR C 1  84  ? -3.446  -72.237 119.053 1.00 158.01 ? 84   THR C CB    1 
ATOM   8600  O  OG1   . THR C 1  84  ? -4.426  -72.293 118.009 1.00 161.58 ? 84   THR C OG1   1 
ATOM   8601  C  CG2   . THR C 1  84  ? -2.212  -71.508 118.541 1.00 156.96 ? 84   THR C CG2   1 
ATOM   8602  N  N     . GLN C 1  85  ? -0.998  -73.544 120.707 1.00 155.65 ? 85   GLN C N     1 
ATOM   8603  C  CA    . GLN C 1  85  ? -0.108  -73.305 121.840 1.00 147.85 ? 85   GLN C CA    1 
ATOM   8604  C  C     . GLN C 1  85  ? -0.586  -72.136 122.696 1.00 147.39 ? 85   GLN C C     1 
ATOM   8605  O  O     . GLN C 1  85  ? -1.152  -71.158 122.197 1.00 145.75 ? 85   GLN C O     1 
ATOM   8606  C  CB    . GLN C 1  85  ? 1.316   -73.031 121.352 1.00 136.21 ? 85   GLN C CB    1 
ATOM   8607  C  CG    . GLN C 1  85  ? 1.460   -71.736 120.569 1.00 132.62 ? 85   GLN C CG    1 
ATOM   8608  C  CD    . GLN C 1  85  ? 2.884   -71.226 120.544 1.00 135.32 ? 85   GLN C CD    1 
ATOM   8609  O  OE1   . GLN C 1  85  ? 3.584   -71.349 119.540 1.00 135.04 ? 85   GLN C OE1   1 
ATOM   8610  N  NE2   . GLN C 1  85  ? 3.321   -70.641 121.654 1.00 138.26 ? 85   GLN C NE2   1 
ATOM   8611  N  N     . ASP C 1  86  ? -0.362  -72.251 124.002 1.00 141.56 ? 86   ASP C N     1 
ATOM   8612  C  CA    . ASP C 1  86  ? -0.594  -71.140 124.915 1.00 134.48 ? 86   ASP C CA    1 
ATOM   8613  C  C     . ASP C 1  86  ? 0.400   -70.004 124.670 1.00 134.90 ? 86   ASP C C     1 
ATOM   8614  O  O     . ASP C 1  86  ? 1.509   -70.214 124.169 1.00 133.28 ? 86   ASP C O     1 
ATOM   8615  C  CB    . ASP C 1  86  ? -0.493  -71.626 126.359 1.00 131.44 ? 86   ASP C CB    1 
ATOM   8616  C  CG    . ASP C 1  86  ? -1.651  -72.523 126.747 1.00 140.50 ? 86   ASP C CG    1 
ATOM   8617  O  OD1   . ASP C 1  86  ? -2.798  -72.214 126.362 1.00 134.88 ? 86   ASP C OD1   1 
ATOM   8618  O  OD2   . ASP C 1  86  ? -1.413  -73.545 127.425 1.00 143.56 ? 86   ASP C OD2   1 
ATOM   8619  N  N     . PHE C 1  87  ? -0.008  -68.789 125.040 1.00 134.97 ? 87   PHE C N     1 
ATOM   8620  C  CA    . PHE C 1  87  ? 0.843   -67.608 124.972 1.00 130.36 ? 87   PHE C CA    1 
ATOM   8621  C  C     . PHE C 1  87  ? 0.966   -66.976 126.352 1.00 123.22 ? 87   PHE C C     1 
ATOM   8622  O  O     . PHE C 1  87  ? 0.069   -67.107 127.191 1.00 116.60 ? 87   PHE C O     1 
ATOM   8623  C  CB    . PHE C 1  87  ? 0.273   -66.560 124.005 1.00 127.60 ? 87   PHE C CB    1 
ATOM   8624  C  CG    . PHE C 1  87  ? 0.367   -66.944 122.560 1.00 133.76 ? 87   PHE C CG    1 
ATOM   8625  C  CD1   . PHE C 1  87  ? -0.631  -67.700 121.968 1.00 133.44 ? 87   PHE C CD1   1 
ATOM   8626  C  CD2   . PHE C 1  87  ? 1.441   -66.535 121.787 1.00 133.56 ? 87   PHE C CD2   1 
ATOM   8627  C  CE1   . PHE C 1  87  ? -0.555  -68.051 120.636 1.00 134.94 ? 87   PHE C CE1   1 
ATOM   8628  C  CE2   . PHE C 1  87  ? 1.523   -66.882 120.453 1.00 130.98 ? 87   PHE C CE2   1 
ATOM   8629  C  CZ    . PHE C 1  87  ? 0.524   -67.641 119.877 1.00 134.43 ? 87   PHE C CZ    1 
ATOM   8630  N  N     . TRP C 1  88  ? 2.079   -66.284 126.589 1.00 117.58 ? 88   TRP C N     1 
ATOM   8631  C  CA    . TRP C 1  88  ? 2.233   -65.460 127.782 1.00 116.63 ? 88   TRP C CA    1 
ATOM   8632  C  C     . TRP C 1  88  ? 1.877   -64.014 127.451 1.00 119.41 ? 88   TRP C C     1 
ATOM   8633  O  O     . TRP C 1  88  ? 2.525   -63.391 126.602 1.00 117.43 ? 88   TRP C O     1 
ATOM   8634  C  CB    . TRP C 1  88  ? 3.639   -65.540 128.371 1.00 115.74 ? 88   TRP C CB    1 
ATOM   8635  C  CG    . TRP C 1  88  ? 3.656   -64.852 129.690 1.00 119.87 ? 88   TRP C CG    1 
ATOM   8636  C  CD1   . TRP C 1  88  ? 4.117   -63.599 129.965 1.00 114.73 ? 88   TRP C CD1   1 
ATOM   8637  C  CD2   . TRP C 1  88  ? 3.094   -65.349 130.909 1.00 118.14 ? 88   TRP C CD2   1 
ATOM   8638  N  NE1   . TRP C 1  88  ? 3.921   -63.304 131.293 1.00 113.28 ? 88   TRP C NE1   1 
ATOM   8639  C  CE2   . TRP C 1  88  ? 3.287   -64.361 131.892 1.00 114.06 ? 88   TRP C CE2   1 
ATOM   8640  C  CE3   . TRP C 1  88  ? 2.461   -66.545 131.267 1.00 107.27 ? 88   TRP C CE3   1 
ATOM   8641  C  CZ2   . TRP C 1  88  ? 2.872   -64.531 133.211 1.00 105.64 ? 88   TRP C CZ2   1 
ATOM   8642  C  CZ3   . TRP C 1  88  ? 2.052   -66.712 132.574 1.00 102.36 ? 88   TRP C CZ3   1 
ATOM   8643  C  CH2   . TRP C 1  88  ? 2.260   -65.713 133.531 1.00 108.88 ? 88   TRP C CH2   1 
ATOM   8644  N  N     . GLU C 1  89  ? 0.870   -63.477 128.136 1.00 120.68 ? 89   GLU C N     1 
ATOM   8645  C  CA    . GLU C 1  89  ? 0.348   -62.154 127.819 1.00 120.97 ? 89   GLU C CA    1 
ATOM   8646  C  C     . GLU C 1  89  ? 1.263   -61.052 128.342 1.00 119.29 ? 89   GLU C C     1 
ATOM   8647  O  O     . GLU C 1  89  ? 1.679   -61.076 129.504 1.00 121.31 ? 89   GLU C O     1 
ATOM   8648  C  CB    . GLU C 1  89  ? -1.045  -61.987 128.427 1.00 123.96 ? 89   GLU C CB    1 
ATOM   8649  C  CG    . GLU C 1  89  ? -2.053  -63.045 128.012 1.00 124.05 ? 89   GLU C CG    1 
ATOM   8650  C  CD    . GLU C 1  89  ? -2.396  -63.009 126.534 1.00 128.46 ? 89   GLU C CD    1 
ATOM   8651  O  OE1   . GLU C 1  89  ? -1.938  -62.091 125.819 1.00 130.48 ? 89   GLU C OE1   1 
ATOM   8652  O  OE2   . GLU C 1  89  ? -3.115  -63.922 126.082 1.00 127.18 ? 89   GLU C OE2   1 
ATOM   8653  N  N     . VAL C 1  90  ? 1.588   -60.090 127.471 1.00 113.58 ? 90   VAL C N     1 
ATOM   8654  C  CA    . VAL C 1  90  ? 2.459   -58.978 127.848 1.00 114.45 ? 90   VAL C CA    1 
ATOM   8655  C  C     . VAL C 1  90  ? 1.674   -57.774 128.349 1.00 111.71 ? 90   VAL C C     1 
ATOM   8656  O  O     . VAL C 1  90  ? 2.281   -56.806 128.833 1.00 107.03 ? 90   VAL C O     1 
ATOM   8657  C  CB    . VAL C 1  90  ? 3.351   -58.536 126.671 1.00 112.97 ? 90   VAL C CB    1 
ATOM   8658  C  CG1   . VAL C 1  90  ? 4.558   -59.451 126.549 1.00 103.23 ? 90   VAL C CG1   1 
ATOM   8659  C  CG2   . VAL C 1  90  ? 2.546   -58.515 125.378 1.00 121.71 ? 90   VAL C CG2   1 
ATOM   8660  N  N     . GLN C 1  91  ? 0.348   -57.798 128.238 1.00 110.16 ? 91   GLN C N     1 
ATOM   8661  C  CA    . GLN C 1  91  ? -0.530  -56.754 128.763 1.00 113.08 ? 91   GLN C CA    1 
ATOM   8662  C  C     . GLN C 1  91  ? -0.834  -57.014 130.235 1.00 109.58 ? 91   GLN C C     1 
ATOM   8663  O  O     . GLN C 1  91  ? -1.659  -57.867 130.568 1.00 108.14 ? 91   GLN C O     1 
ATOM   8664  C  CB    . GLN C 1  91  ? -1.813  -56.684 127.942 1.00 114.98 ? 91   GLN C CB    1 
ATOM   8665  C  CG    . GLN C 1  91  ? -2.690  -55.481 128.251 1.00 115.14 ? 91   GLN C CG    1 
ATOM   8666  C  CD    . GLN C 1  91  ? -2.019  -54.166 127.894 1.00 117.67 ? 91   GLN C CD    1 
ATOM   8667  O  OE1   . GLN C 1  91  ? -1.333  -54.061 126.876 1.00 120.49 ? 91   GLN C OE1   1 
ATOM   8668  N  NE2   . GLN C 1  91  ? -2.215  -53.154 128.731 1.00 114.83 ? 91   GLN C NE2   1 
ATOM   8669  N  N     . LEU C 1  92  ? -0.163  -56.283 131.127 1.00 104.46 ? 92   LEU C N     1 
ATOM   8670  C  CA    . LEU C 1  92  ? -0.173  -56.626 132.544 1.00 100.18 ? 92   LEU C CA    1 
ATOM   8671  C  C     . LEU C 1  92  ? -1.242  -55.864 133.318 1.00 105.67 ? 92   LEU C C     1 
ATOM   8672  O  O     . LEU C 1  92  ? -1.713  -56.351 134.352 1.00 104.70 ? 92   LEU C O     1 
ATOM   8673  C  CB    . LEU C 1  92  ? 1.199   -56.358 133.175 1.00 94.44  ? 92   LEU C CB    1 
ATOM   8674  C  CG    . LEU C 1  92  ? 2.458   -56.876 132.476 1.00 93.21  ? 92   LEU C CG    1 
ATOM   8675  C  CD1   . LEU C 1  92  ? 3.654   -56.779 133.412 1.00 77.23  ? 92   LEU C CD1   1 
ATOM   8676  C  CD2   . LEU C 1  92  ? 2.268   -58.310 132.004 1.00 97.08  ? 92   LEU C CD2   1 
ATOM   8677  N  N     . GLY C 1  93  ? -1.630  -54.683 132.843 1.00 111.30 ? 93   GLY C N     1 
ATOM   8678  C  CA    . GLY C 1  93  ? -2.599  -53.845 133.525 1.00 106.03 ? 93   GLY C CA    1 
ATOM   8679  C  C     . GLY C 1  93  ? -3.102  -52.786 132.569 1.00 104.33 ? 93   GLY C C     1 
ATOM   8680  O  O     . GLY C 1  93  ? -2.729  -52.755 131.395 1.00 114.75 ? 93   GLY C O     1 
ATOM   8681  N  N     . ILE C 1  94  ? -3.956  -51.911 133.077 1.00 104.30 ? 94   ILE C N     1 
ATOM   8682  C  CA    . ILE C 1  94  ? -4.580  -50.858 132.276 1.00 102.31 ? 94   ILE C CA    1 
ATOM   8683  C  C     . ILE C 1  94  ? -4.052  -49.504 132.734 1.00 107.26 ? 94   ILE C C     1 
ATOM   8684  O  O     . ILE C 1  94  ? -4.117  -49.198 133.930 1.00 107.98 ? 94   ILE C O     1 
ATOM   8685  C  CB    . ILE C 1  94  ? -6.118  -50.894 132.375 1.00 95.88  ? 94   ILE C CB    1 
ATOM   8686  C  CG1   . ILE C 1  94  ? -6.657  -52.319 132.200 1.00 101.84 ? 94   ILE C CG1   1 
ATOM   8687  C  CG2   . ILE C 1  94  ? -6.739  -49.950 131.360 1.00 97.00  ? 94   ILE C CG2   1 
ATOM   8688  C  CD1   . ILE C 1  94  ? -6.108  -53.056 130.992 1.00 105.59 ? 94   ILE C CD1   1 
ATOM   8689  N  N     . PRO C 1  95  ? -3.517  -48.684 131.829 1.00 106.44 ? 95   PRO C N     1 
ATOM   8690  C  CA    . PRO C 1  95  ? -3.102  -47.321 132.189 1.00 105.07 ? 95   PRO C CA    1 
ATOM   8691  C  C     . PRO C 1  95  ? -4.245  -46.520 132.798 1.00 103.00 ? 95   PRO C C     1 
ATOM   8692  O  O     . PRO C 1  95  ? -5.409  -46.688 132.427 1.00 103.50 ? 95   PRO C O     1 
ATOM   8693  C  CB    . PRO C 1  95  ? -2.635  -46.719 130.857 1.00 108.72 ? 95   PRO C CB    1 
ATOM   8694  C  CG    . PRO C 1  95  ? -2.419  -47.872 129.943 1.00 114.95 ? 95   PRO C CG    1 
ATOM   8695  C  CD    . PRO C 1  95  ? -3.299  -48.987 130.405 1.00 111.60 ? 95   PRO C CD    1 
ATOM   8696  N  N     . HIS C 1  96  ? -3.914  -45.665 133.767 1.00 104.85 ? 96   HIS C N     1 
ATOM   8697  C  CA    . HIS C 1  96  ? -4.922  -44.849 134.430 1.00 100.02 ? 96   HIS C CA    1 
ATOM   8698  C  C     . HIS C 1  96  ? -4.536  -43.377 134.339 1.00 104.10 ? 96   HIS C C     1 
ATOM   8699  O  O     . HIS C 1  96  ? -3.369  -43.023 134.584 1.00 100.03 ? 96   HIS C O     1 
ATOM   8700  C  CB    . HIS C 1  96  ? -5.123  -45.239 135.894 1.00 101.36 ? 96   HIS C CB    1 
ATOM   8701  C  CG    . HIS C 1  96  ? -6.394  -44.703 136.473 1.00 97.91  ? 96   HIS C CG    1 
ATOM   8702  N  ND1   . HIS C 1  96  ? -6.477  -43.456 137.054 1.00 98.74  ? 96   HIS C ND1   1 
ATOM   8703  C  CD2   . HIS C 1  96  ? -7.638  -45.232 136.535 1.00 95.62  ? 96   HIS C CD2   1 
ATOM   8704  C  CE1   . HIS C 1  96  ? -7.716  -43.245 137.461 1.00 104.09 ? 96   HIS C CE1   1 
ATOM   8705  N  NE2   . HIS C 1  96  ? -8.441  -44.307 137.159 1.00 96.93  ? 96   HIS C NE2   1 
ATOM   8706  N  N     . PRO C 1  97  ? -5.483  -42.497 133.992 1.00 111.36 ? 97   PRO C N     1 
ATOM   8707  C  CA    . PRO C 1  97  ? -5.167  -41.068 133.811 1.00 113.18 ? 97   PRO C CA    1 
ATOM   8708  C  C     . PRO C 1  97  ? -4.410  -40.434 134.962 1.00 113.54 ? 97   PRO C C     1 
ATOM   8709  O  O     . PRO C 1  97  ? -3.632  -39.498 134.735 1.00 118.00 ? 97   PRO C O     1 
ATOM   8710  C  CB    . PRO C 1  97  ? -6.553  -40.423 133.640 1.00 118.47 ? 97   PRO C CB    1 
ATOM   8711  C  CG    . PRO C 1  97  ? -7.557  -41.502 133.978 1.00 117.30 ? 97   PRO C CG    1 
ATOM   8712  C  CD    . PRO C 1  97  ? -6.884  -42.789 133.661 1.00 117.88 ? 97   PRO C CD    1 
ATOM   8713  N  N     . ALA C 1  98  ? -4.613  -40.899 136.191 1.00 108.58 ? 98   ALA C N     1 
ATOM   8714  C  CA    . ALA C 1  98  ? -3.992  -40.251 137.337 1.00 107.64 ? 98   ALA C CA    1 
ATOM   8715  C  C     . ALA C 1  98  ? -2.520  -40.615 137.486 1.00 109.51 ? 98   ALA C C     1 
ATOM   8716  O  O     . ALA C 1  98  ? -1.851  -40.069 138.370 1.00 105.28 ? 98   ALA C O     1 
ATOM   8717  C  CB    . ALA C 1  98  ? -4.749  -40.606 138.619 1.00 98.97  ? 98   ALA C CB    1 
ATOM   8718  N  N     . GLY C 1  99  ? -2.006  -41.517 136.653 1.00 107.87 ? 99   GLY C N     1 
ATOM   8719  C  CA    . GLY C 1  99  ? -0.589  -41.824 136.632 1.00 109.05 ? 99   GLY C CA    1 
ATOM   8720  C  C     . GLY C 1  99  ? 0.180   -40.959 135.656 1.00 111.18 ? 99   GLY C C     1 
ATOM   8721  O  O     . GLY C 1  99  ? 1.403   -40.823 135.759 1.00 108.44 ? 99   GLY C O     1 
ATOM   8722  N  N     . LEU C 1  100 ? -0.534  -40.372 134.699 1.00 112.63 ? 100  LEU C N     1 
ATOM   8723  C  CA    . LEU C 1  100 ? 0.071   -39.425 133.773 1.00 121.61 ? 100  LEU C CA    1 
ATOM   8724  C  C     . LEU C 1  100 ? 0.498   -38.165 134.512 1.00 120.72 ? 100  LEU C C     1 
ATOM   8725  O  O     . LEU C 1  100 ? -0.202  -37.685 135.408 1.00 116.75 ? 100  LEU C O     1 
ATOM   8726  C  CB    . LEU C 1  100 ? -0.905  -39.064 132.653 1.00 120.33 ? 100  LEU C CB    1 
ATOM   8727  C  CG    . LEU C 1  100 ? -1.765  -40.179 132.057 1.00 119.13 ? 100  LEU C CG    1 
ATOM   8728  C  CD1   . LEU C 1  100 ? -2.915  -39.590 131.258 1.00 121.57 ? 100  LEU C CD1   1 
ATOM   8729  C  CD2   . LEU C 1  100 ? -0.924  -41.095 131.186 1.00 125.51 ? 100  LEU C CD2   1 
ATOM   8730  N  N     . LYS C 1  101 ? 1.651   -37.622 134.133 1.00 127.23 ? 101  LYS C N     1 
ATOM   8731  C  CA    . LYS C 1  101 ? 1.923   -36.261 134.553 1.00 130.84 ? 101  LYS C CA    1 
ATOM   8732  C  C     . LYS C 1  101 ? 1.195   -35.292 133.630 1.00 142.13 ? 101  LYS C C     1 
ATOM   8733  O  O     . LYS C 1  101 ? 0.741   -35.653 132.541 1.00 142.48 ? 101  LYS C O     1 
ATOM   8734  C  CB    . LYS C 1  101 ? 3.424   -35.972 134.505 1.00 125.62 ? 101  LYS C CB    1 
ATOM   8735  C  CG    . LYS C 1  101 ? 4.251   -36.708 135.538 1.00 122.54 ? 101  LYS C CG    1 
ATOM   8736  C  CD    . LYS C 1  101 ? 5.725   -36.690 135.155 1.00 124.47 ? 101  LYS C CD    1 
ATOM   8737  C  CE    . LYS C 1  101 ? 6.416   -37.994 135.524 1.00 126.17 ? 101  LYS C CE    1 
ATOM   8738  N  NZ    . LYS C 1  101 ? 7.892   -37.829 135.638 1.00 120.23 ? 101  LYS C NZ    1 
ATOM   8739  N  N     . LYS C 1  102 ? 1.083   -34.045 134.075 1.00 144.66 ? 102  LYS C N     1 
ATOM   8740  C  CA    . LYS C 1  102 ? 0.377   -33.051 133.284 1.00 148.49 ? 102  LYS C CA    1 
ATOM   8741  C  C     . LYS C 1  102 ? 1.310   -32.581 132.172 1.00 151.76 ? 102  LYS C C     1 
ATOM   8742  O  O     . LYS C 1  102 ? 2.476   -32.266 132.426 1.00 152.16 ? 102  LYS C O     1 
ATOM   8743  C  CB    . LYS C 1  102 ? -0.065  -31.913 134.203 1.00 151.38 ? 102  LYS C CB    1 
ATOM   8744  C  CG    . LYS C 1  102 ? -1.041  -30.913 133.641 1.00 150.75 ? 102  LYS C CG    1 
ATOM   8745  C  CD    . LYS C 1  102 ? -0.905  -29.613 134.411 1.00 152.52 ? 102  LYS C CD    1 
ATOM   8746  C  CE    . LYS C 1  102 ? -1.675  -28.499 133.757 1.00 158.50 ? 102  LYS C CE    1 
ATOM   8747  N  NZ    . LYS C 1  102 ? -0.952  -27.886 132.617 1.00 159.76 ? 102  LYS C NZ    1 
ATOM   8748  N  N     . LYS C 1  103 ? 0.801   -32.532 130.941 1.00 157.27 ? 103  LYS C N     1 
ATOM   8749  C  CA    . LYS C 1  103 ? 1.577   -32.079 129.792 1.00 167.31 ? 103  LYS C CA    1 
ATOM   8750  C  C     . LYS C 1  103 ? 0.957   -30.871 129.103 1.00 175.56 ? 103  LYS C C     1 
ATOM   8751  O  O     . LYS C 1  103 ? -0.265  -30.793 128.940 1.00 175.36 ? 103  LYS C O     1 
ATOM   8752  C  CB    . LYS C 1  103 ? 1.779   -33.221 128.793 1.00 161.03 ? 103  LYS C CB    1 
ATOM   8753  C  CG    . LYS C 1  103 ? 2.780   -34.261 129.286 1.00 157.21 ? 103  LYS C CG    1 
ATOM   8754  C  CD    . LYS C 1  103 ? 4.132   -33.607 129.576 1.00 152.83 ? 103  LYS C CD    1 
ATOM   8755  C  CE    . LYS C 1  103 ? 5.015   -34.467 130.469 1.00 144.22 ? 103  LYS C CE    1 
ATOM   8756  N  NZ    . LYS C 1  103 ? 6.157   -33.691 131.034 1.00 132.37 ? 103  LYS C NZ    1 
ATOM   8757  N  N     . LYS C 1  104 ? 1.814   -29.919 128.722 1.00 184.07 ? 104  LYS C N     1 
ATOM   8758  C  CA    . LYS C 1  104 ? 1.390   -28.819 127.858 1.00 187.66 ? 104  LYS C CA    1 
ATOM   8759  C  C     . LYS C 1  104 ? 0.792   -29.318 126.543 1.00 191.97 ? 104  LYS C C     1 
ATOM   8760  O  O     . LYS C 1  104 ? -0.285  -28.869 126.135 1.00 192.60 ? 104  LYS C O     1 
ATOM   8761  C  CB    . LYS C 1  104 ? 2.531   -27.832 127.610 1.00 186.87 ? 104  LYS C CB    1 
ATOM   8762  C  CG    . LYS C 1  104 ? 2.234   -26.909 126.434 1.00 192.87 ? 104  LYS C CG    1 
ATOM   8763  C  CD    . LYS C 1  104 ? 3.213   -25.762 126.301 1.00 190.86 ? 104  LYS C CD    1 
ATOM   8764  C  CE    . LYS C 1  104 ? 3.314   -25.019 127.624 1.00 188.85 ? 104  LYS C CE    1 
ATOM   8765  N  NZ    . LYS C 1  104 ? 3.562   -23.564 127.422 1.00 191.50 ? 104  LYS C NZ    1 
ATOM   8766  N  N     . SER C 1  105 ? 1.470   -30.242 125.859 1.00 178.90 ? 105  SER C N     1 
ATOM   8767  C  CA    . SER C 1  105 ? 1.014   -30.718 124.557 1.00 168.20 ? 105  SER C CA    1 
ATOM   8768  C  C     . SER C 1  105 ? 0.795   -32.224 124.593 1.00 158.50 ? 105  SER C C     1 
ATOM   8769  O  O     . SER C 1  105 ? 1.647   -32.977 125.076 1.00 159.18 ? 105  SER C O     1 
ATOM   8770  C  CB    . SER C 1  105 ? 2.024   -30.363 123.460 1.00 171.48 ? 105  SER C CB    1 
ATOM   8771  O  OG    . SER C 1  105 ? 2.011   -28.974 123.183 1.00 176.30 ? 105  SER C OG    1 
ATOM   8772  N  N     . VAL C 1  106 ? -0.350  -32.644 124.056 1.00 153.02 ? 106  VAL C N     1 
ATOM   8773  C  CA    . VAL C 1  106 ? -0.820  -34.025 124.067 1.00 148.54 ? 106  VAL C CA    1 
ATOM   8774  C  C     . VAL C 1  106 ? -1.379  -34.387 122.696 1.00 144.64 ? 106  VAL C C     1 
ATOM   8775  O  O     . VAL C 1  106 ? -2.022  -33.560 122.042 1.00 148.27 ? 106  VAL C O     1 
ATOM   8776  C  CB    . VAL C 1  106 ? -1.890  -34.232 125.163 1.00 146.57 ? 106  VAL C CB    1 
ATOM   8777  C  CG1   . VAL C 1  106 ? -2.665  -35.526 124.945 1.00 143.46 ? 106  VAL C CG1   1 
ATOM   8778  C  CG2   . VAL C 1  106 ? -1.253  -34.211 126.545 1.00 153.17 ? 106  VAL C CG2   1 
ATOM   8779  N  N     . THR C 1  107 ? -1.110  -35.613 122.245 1.00 145.66 ? 107  THR C N     1 
ATOM   8780  C  CA    . THR C 1  107 ? -1.754  -36.139 121.052 1.00 149.67 ? 107  THR C CA    1 
ATOM   8781  C  C     . THR C 1  107 ? -2.284  -37.531 121.367 1.00 154.79 ? 107  THR C C     1 
ATOM   8782  O  O     . THR C 1  107 ? -1.690  -38.276 122.151 1.00 152.02 ? 107  THR C O     1 
ATOM   8783  C  CB    . THR C 1  107 ? -0.781  -36.202 119.865 1.00 153.00 ? 107  THR C CB    1 
ATOM   8784  O  OG1   . THR C 1  107 ? -0.042  -34.977 119.783 1.00 153.17 ? 107  THR C OG1   1 
ATOM   8785  C  CG2   . THR C 1  107 ? -1.533  -36.417 118.564 1.00 158.49 ? 107  THR C CG2   1 
ATOM   8786  N  N     . VAL C 1  108 ? -3.412  -37.876 120.747 1.00 171.94 ? 108  VAL C N     1 
ATOM   8787  C  CA    . VAL C 1  108 ? -3.972  -39.224 120.783 1.00 172.97 ? 108  VAL C CA    1 
ATOM   8788  C  C     . VAL C 1  108 ? -4.254  -39.698 119.364 1.00 177.54 ? 108  VAL C C     1 
ATOM   8789  O  O     . VAL C 1  108 ? -5.092  -39.111 118.669 1.00 182.09 ? 108  VAL C O     1 
ATOM   8790  C  CB    . VAL C 1  108 ? -5.257  -39.289 121.627 1.00 172.34 ? 108  VAL C CB    1 
ATOM   8791  C  CG1   . VAL C 1  108 ? -5.819  -40.703 121.629 1.00 167.58 ? 108  VAL C CG1   1 
ATOM   8792  C  CG2   . VAL C 1  108 ? -4.991  -38.812 123.047 1.00 171.18 ? 108  VAL C CG2   1 
ATOM   8793  N  N     . LEU C 1  109 ? -3.563  -40.749 118.932 1.00 167.41 ? 109  LEU C N     1 
ATOM   8794  C  CA    . LEU C 1  109 ? -3.777  -41.307 117.605 1.00 162.82 ? 109  LEU C CA    1 
ATOM   8795  C  C     . LEU C 1  109 ? -3.872  -42.826 117.699 1.00 161.43 ? 109  LEU C C     1 
ATOM   8796  O  O     . LEU C 1  109 ? -3.333  -43.445 118.621 1.00 164.40 ? 109  LEU C O     1 
ATOM   8797  C  CB    . LEU C 1  109 ? -2.675  -40.846 116.637 1.00 156.73 ? 109  LEU C CB    1 
ATOM   8798  C  CG    . LEU C 1  109 ? -1.280  -40.562 117.208 1.00 154.73 ? 109  LEU C CG    1 
ATOM   8799  C  CD1   . LEU C 1  109 ? -0.565  -41.817 117.675 1.00 151.12 ? 109  LEU C CD1   1 
ATOM   8800  C  CD2   . LEU C 1  109 ? -0.439  -39.794 116.198 1.00 158.95 ? 109  LEU C CD2   1 
ATOM   8801  N  N     . ASP C 1  110 ? -4.580  -43.420 116.738 1.00 166.40 ? 110  ASP C N     1 
ATOM   8802  C  CA    . ASP C 1  110 ? -4.766  -44.863 116.651 1.00 168.29 ? 110  ASP C CA    1 
ATOM   8803  C  C     . ASP C 1  110 ? -4.128  -45.467 115.407 1.00 177.93 ? 110  ASP C C     1 
ATOM   8804  O  O     . ASP C 1  110 ? -4.204  -44.892 114.317 1.00 180.24 ? 110  ASP C O     1 
ATOM   8805  C  CB    . ASP C 1  110 ? -6.256  -45.205 116.657 1.00 167.57 ? 110  ASP C CB    1 
ATOM   8806  C  CG    . ASP C 1  110 ? -6.509  -46.680 116.840 1.00 167.11 ? 110  ASP C CG    1 
ATOM   8807  O  OD1   . ASP C 1  110 ? -6.324  -47.174 117.971 1.00 166.17 ? 110  ASP C OD1   1 
ATOM   8808  O  OD2   . ASP C 1  110 ? -6.882  -47.345 115.851 1.00 167.71 ? 110  ASP C OD2   1 
ATOM   8809  N  N     . VAL C 1  111 ? -3.503  -46.635 115.579 1.00 190.19 ? 111  VAL C N     1 
ATOM   8810  C  CA    . VAL C 1  111 ? -3.035  -47.413 114.437 1.00 193.38 ? 111  VAL C CA    1 
ATOM   8811  C  C     . VAL C 1  111 ? -4.238  -47.974 113.688 1.00 192.83 ? 111  VAL C C     1 
ATOM   8812  O  O     . VAL C 1  111 ? -5.202  -48.461 114.298 1.00 186.29 ? 111  VAL C O     1 
ATOM   8813  C  CB    . VAL C 1  111 ? -2.090  -48.537 114.901 1.00 191.81 ? 111  VAL C CB    1 
ATOM   8814  C  CG1   . VAL C 1  111 ? -2.059  -49.680 113.890 1.00 191.03 ? 111  VAL C CG1   1 
ATOM   8815  C  CG2   . VAL C 1  111 ? -0.689  -47.993 115.132 1.00 186.37 ? 111  VAL C CG2   1 
ATOM   8816  N  N     . GLY C 1  112 ? -4.195  -47.908 112.360 1.00 185.90 ? 112  GLY C N     1 
ATOM   8817  C  CA    . GLY C 1  112 ? -5.302  -48.355 111.535 1.00 178.54 ? 112  GLY C CA    1 
ATOM   8818  C  C     . GLY C 1  112 ? -5.075  -49.764 111.018 1.00 185.17 ? 112  GLY C C     1 
ATOM   8819  O  O     . GLY C 1  112 ? -3.995  -50.087 110.517 1.00 182.30 ? 112  GLY C O     1 
ATOM   8820  N  N     . ASP C 1  113 ? -6.117  -50.587 111.126 1.00 206.22 ? 113  ASP C N     1 
ATOM   8821  C  CA    . ASP C 1  113 ? -6.057  -52.021 110.842 1.00 207.86 ? 113  ASP C CA    1 
ATOM   8822  C  C     . ASP C 1  113 ? -4.825  -52.670 111.483 1.00 205.23 ? 113  ASP C C     1 
ATOM   8823  O  O     . ASP C 1  113 ? -3.864  -53.054 110.816 1.00 205.46 ? 113  ASP C O     1 
ATOM   8824  C  CB    . ASP C 1  113 ? -6.088  -52.261 109.330 1.00 211.87 ? 113  ASP C CB    1 
ATOM   8825  C  CG    . ASP C 1  113 ? -7.486  -52.541 108.818 1.00 214.29 ? 113  ASP C CG    1 
ATOM   8826  O  OD1   . ASP C 1  113 ? -8.162  -53.428 109.379 1.00 209.37 ? 113  ASP C OD1   1 
ATOM   8827  O  OD2   . ASP C 1  113 ? -7.910  -51.870 107.854 1.00 219.73 ? 113  ASP C OD2   1 
ATOM   8828  N  N     . ALA C 1  114 ? -4.879  -52.772 112.814 1.00 177.99 ? 114  ALA C N     1 
ATOM   8829  C  CA    . ALA C 1  114 ? -3.713  -53.205 113.580 1.00 171.91 ? 114  ALA C CA    1 
ATOM   8830  C  C     . ALA C 1  114 ? -3.325  -54.644 113.245 1.00 170.27 ? 114  ALA C C     1 
ATOM   8831  O  O     . ALA C 1  114 ? -2.219  -54.903 112.756 1.00 172.66 ? 114  ALA C O     1 
ATOM   8832  C  CB    . ALA C 1  114 ? -3.993  -53.054 115.075 1.00 167.95 ? 114  ALA C CB    1 
ATOM   8833  N  N     . TYR C 1  115 ? -4.221  -55.598 113.522 1.00 160.98 ? 115  TYR C N     1 
ATOM   8834  C  CA    . TYR C 1  115 ? -3.897  -57.014 113.342 1.00 160.79 ? 115  TYR C CA    1 
ATOM   8835  C  C     . TYR C 1  115 ? -3.489  -57.329 111.908 1.00 167.40 ? 115  TYR C C     1 
ATOM   8836  O  O     . TYR C 1  115 ? -2.625  -58.182 111.672 1.00 165.81 ? 115  TYR C O     1 
ATOM   8837  C  CB    . TYR C 1  115 ? -5.070  -57.905 113.755 1.00 155.49 ? 115  TYR C CB    1 
ATOM   8838  C  CG    . TYR C 1  115 ? -5.387  -57.929 115.231 1.00 148.97 ? 115  TYR C CG    1 
ATOM   8839  C  CD1   . TYR C 1  115 ? -4.641  -57.192 116.142 1.00 143.69 ? 115  TYR C CD1   1 
ATOM   8840  C  CD2   . TYR C 1  115 ? -6.406  -58.738 115.719 1.00 145.34 ? 115  TYR C CD2   1 
ATOM   8841  C  CE1   . TYR C 1  115 ? -4.927  -57.230 117.492 1.00 141.96 ? 115  TYR C CE1   1 
ATOM   8842  C  CE2   . TYR C 1  115 ? -6.694  -58.789 117.066 1.00 139.30 ? 115  TYR C CE2   1 
ATOM   8843  C  CZ    . TYR C 1  115 ? -5.951  -58.035 117.948 1.00 137.39 ? 115  TYR C CZ    1 
ATOM   8844  O  OH    . TYR C 1  115 ? -6.242  -58.081 119.290 1.00 134.53 ? 115  TYR C OH    1 
ATOM   8845  N  N     . PHE C 1  116 ? -4.100  -56.656 110.940 1.00 167.57 ? 116  PHE C N     1 
ATOM   8846  C  CA    . PHE C 1  116 ? -3.892  -56.944 109.528 1.00 160.80 ? 116  PHE C CA    1 
ATOM   8847  C  C     . PHE C 1  116 ? -2.627  -56.316 108.959 1.00 160.04 ? 116  PHE C C     1 
ATOM   8848  O  O     . PHE C 1  116 ? -2.349  -56.497 107.769 1.00 166.31 ? 116  PHE C O     1 
ATOM   8849  C  CB    . PHE C 1  116 ? -5.120  -56.501 108.734 1.00 165.90 ? 116  PHE C CB    1 
ATOM   8850  C  CG    . PHE C 1  116 ? -6.409  -57.080 109.251 1.00 166.61 ? 116  PHE C CG    1 
ATOM   8851  C  CD1   . PHE C 1  116 ? -6.422  -58.292 109.926 1.00 161.37 ? 116  PHE C CD1   1 
ATOM   8852  C  CD2   . PHE C 1  116 ? -7.600  -56.403 109.086 1.00 173.21 ? 116  PHE C CD2   1 
ATOM   8853  C  CE1   . PHE C 1  116 ? -7.600  -58.822 110.409 1.00 164.68 ? 116  PHE C CE1   1 
ATOM   8854  C  CE2   . PHE C 1  116 ? -8.778  -56.926 109.570 1.00 167.70 ? 116  PHE C CE2   1 
ATOM   8855  C  CZ    . PHE C 1  116 ? -8.780  -58.138 110.231 1.00 166.07 ? 116  PHE C CZ    1 
ATOM   8856  N  N     . SER C 1  117 ? -1.865  -55.586 109.768 1.00 171.24 ? 117  SER C N     1 
ATOM   8857  C  CA    . SER C 1  117 ? -0.577  -55.041 109.364 1.00 162.04 ? 117  SER C CA    1 
ATOM   8858  C  C     . SER C 1  117 ? 0.596   -55.864 109.892 1.00 173.26 ? 117  SER C C     1 
ATOM   8859  O  O     . SER C 1  117 ? 1.750   -55.455 109.730 1.00 159.10 ? 117  SER C O     1 
ATOM   8860  C  CB    . SER C 1  117 ? -0.450  -53.583 109.811 1.00 156.26 ? 117  SER C CB    1 
ATOM   8861  O  OG    . SER C 1  117 ? -1.703  -52.924 109.761 1.00 163.17 ? 117  SER C OG    1 
ATOM   8862  N  N     . VAL C 1  118 ? 0.327   -57.005 110.524 1.00 195.54 ? 118  VAL C N     1 
ATOM   8863  C  CA    . VAL C 1  118 ? 1.376   -57.853 111.089 1.00 196.17 ? 118  VAL C CA    1 
ATOM   8864  C  C     . VAL C 1  118 ? 1.257   -59.243 110.472 1.00 195.63 ? 118  VAL C C     1 
ATOM   8865  O  O     . VAL C 1  118 ? 0.248   -59.934 110.677 1.00 194.53 ? 118  VAL C O     1 
ATOM   8866  C  CB    . VAL C 1  118 ? 1.279   -57.919 112.622 1.00 192.67 ? 118  VAL C CB    1 
ATOM   8867  C  CG1   . VAL C 1  118 ? 2.177   -59.021 113.166 1.00 189.97 ? 118  VAL C CG1   1 
ATOM   8868  C  CG2   . VAL C 1  118 ? 1.634   -56.577 113.238 1.00 190.87 ? 118  VAL C CG2   1 
ATOM   8869  N  N     . PRO C 1  119 ? 2.253   -59.679 109.698 1.00 172.57 ? 119  PRO C N     1 
ATOM   8870  C  CA    . PRO C 1  119 ? 2.151   -60.951 108.961 1.00 164.08 ? 119  PRO C CA    1 
ATOM   8871  C  C     . PRO C 1  119 ? 2.083   -62.167 109.875 1.00 157.91 ? 119  PRO C C     1 
ATOM   8872  O  O     . PRO C 1  119 ? 2.986   -62.402 110.682 1.00 162.27 ? 119  PRO C O     1 
ATOM   8873  C  CB    . PRO C 1  119 ? 3.427   -60.964 108.110 1.00 168.54 ? 119  PRO C CB    1 
ATOM   8874  C  CG    . PRO C 1  119 ? 4.382   -60.098 108.863 1.00 166.80 ? 119  PRO C CG    1 
ATOM   8875  C  CD    . PRO C 1  119 ? 3.551   -59.017 109.485 1.00 166.85 ? 119  PRO C CD    1 
ATOM   8876  N  N     . LEU C 1  120 ? 1.001   -62.937 109.749 1.00 158.87 ? 120  LEU C N     1 
ATOM   8877  C  CA    . LEU C 1  120 ? 0.881   -64.214 110.442 1.00 153.19 ? 120  LEU C CA    1 
ATOM   8878  C  C     . LEU C 1  120 ? 2.048   -65.133 110.079 1.00 160.94 ? 120  LEU C C     1 
ATOM   8879  O  O     . LEU C 1  120 ? 2.692   -64.977 109.037 1.00 166.31 ? 120  LEU C O     1 
ATOM   8880  C  CB    . LEU C 1  120 ? -0.440  -64.893 110.080 1.00 148.93 ? 120  LEU C CB    1 
ATOM   8881  C  CG    . LEU C 1  120 ? -0.938  -66.031 110.972 1.00 146.70 ? 120  LEU C CG    1 
ATOM   8882  C  CD1   . LEU C 1  120 ? -1.023  -65.588 112.423 1.00 150.33 ? 120  LEU C CD1   1 
ATOM   8883  C  CD2   . LEU C 1  120 ? -2.279  -66.556 110.478 1.00 144.84 ? 120  LEU C CD2   1 
ATOM   8884  N  N     . ASP C 1  121 ? 2.335   -66.095 110.958 1.00 158.78 ? 121  ASP C N     1 
ATOM   8885  C  CA    . ASP C 1  121 ? 3.315   -67.117 110.611 1.00 157.95 ? 121  ASP C CA    1 
ATOM   8886  C  C     . ASP C 1  121 ? 2.841   -67.885 109.384 1.00 161.24 ? 121  ASP C C     1 
ATOM   8887  O  O     . ASP C 1  121 ? 1.701   -68.356 109.339 1.00 161.48 ? 121  ASP C O     1 
ATOM   8888  C  CB    . ASP C 1  121 ? 3.540   -68.077 111.776 1.00 159.00 ? 121  ASP C CB    1 
ATOM   8889  C  CG    . ASP C 1  121 ? 4.370   -69.282 111.376 1.00 160.83 ? 121  ASP C CG    1 
ATOM   8890  O  OD1   . ASP C 1  121 ? 5.585   -69.112 111.138 1.00 155.84 ? 121  ASP C OD1   1 
ATOM   8891  O  OD2   . ASP C 1  121 ? 3.804   -70.391 111.280 1.00 163.77 ? 121  ASP C OD2   1 
ATOM   8892  N  N     . GLU C 1  122 ? 3.725   -68.007 108.391 1.00 161.89 ? 122  GLU C N     1 
ATOM   8893  C  CA    . GLU C 1  122 ? 3.367   -68.634 107.119 1.00 160.49 ? 122  GLU C CA    1 
ATOM   8894  C  C     . GLU C 1  122 ? 2.698   -69.995 107.298 1.00 167.70 ? 122  GLU C C     1 
ATOM   8895  O  O     . GLU C 1  122 ? 1.603   -70.235 106.778 1.00 162.52 ? 122  GLU C O     1 
ATOM   8896  C  CB    . GLU C 1  122 ? 4.588   -68.751 106.209 1.00 160.62 ? 122  GLU C CB    1 
ATOM   8897  C  CG    . GLU C 1  122 ? 4.238   -69.405 104.881 1.00 159.96 ? 122  GLU C CG    1 
ATOM   8898  C  CD    . GLU C 1  122 ? 5.148   -68.982 103.752 1.00 159.21 ? 122  GLU C CD    1 
ATOM   8899  O  OE1   . GLU C 1  122 ? 6.170   -68.318 104.024 1.00 163.91 ? 122  GLU C OE1   1 
ATOM   8900  O  OE2   . GLU C 1  122 ? 4.833   -69.305 102.587 1.00 162.45 ? 122  GLU C OE2   1 
ATOM   8901  N  N     . ASP C 1  123 ? 3.349   -70.904 108.028 1.00 179.06 ? 123  ASP C N     1 
ATOM   8902  C  CA    . ASP C 1  123 ? 2.837   -72.268 108.130 1.00 179.35 ? 123  ASP C CA    1 
ATOM   8903  C  C     . ASP C 1  123 ? 1.521   -72.351 108.896 1.00 182.39 ? 123  ASP C C     1 
ATOM   8904  O  O     . ASP C 1  123 ? 0.704   -73.233 108.610 1.00 184.19 ? 123  ASP C O     1 
ATOM   8905  C  CB    . ASP C 1  123 ? 3.886   -73.164 108.791 1.00 173.88 ? 123  ASP C CB    1 
ATOM   8906  C  CG    . ASP C 1  123 ? 5.300   -72.814 108.368 1.00 174.62 ? 123  ASP C CG    1 
ATOM   8907  O  OD1   . ASP C 1  123 ? 5.562   -71.626 108.085 1.00 172.68 ? 123  ASP C OD1   1 
ATOM   8908  O  OD2   . ASP C 1  123 ? 6.151   -73.726 108.319 1.00 175.23 ? 123  ASP C OD2   1 
ATOM   8909  N  N     . PHE C 1  124 ? 1.288   -71.463 109.863 1.00 170.34 ? 124  PHE C N     1 
ATOM   8910  C  CA    . PHE C 1  124 ? 0.067   -71.561 110.655 1.00 169.38 ? 124  PHE C CA    1 
ATOM   8911  C  C     . PHE C 1  124 ? -1.152  -71.084 109.867 1.00 163.50 ? 124  PHE C C     1 
ATOM   8912  O  O     . PHE C 1  124 ? -2.286  -71.407 110.236 1.00 161.88 ? 124  PHE C O     1 
ATOM   8913  C  CB    . PHE C 1  124 ? 0.215   -70.780 111.964 1.00 167.16 ? 124  PHE C CB    1 
ATOM   8914  C  CG    . PHE C 1  124 ? -0.747  -71.214 113.038 1.00 164.33 ? 124  PHE C CG    1 
ATOM   8915  C  CD1   . PHE C 1  124 ? -0.405  -72.249 113.896 1.00 153.22 ? 124  PHE C CD1   1 
ATOM   8916  C  CD2   . PHE C 1  124 ? -1.980  -70.604 113.191 1.00 158.91 ? 124  PHE C CD2   1 
ATOM   8917  C  CE1   . PHE C 1  124 ? -1.270  -72.666 114.885 1.00 151.18 ? 124  PHE C CE1   1 
ATOM   8918  C  CE2   . PHE C 1  124 ? -2.853  -71.020 114.183 1.00 155.51 ? 124  PHE C CE2   1 
ATOM   8919  C  CZ    . PHE C 1  124 ? -2.495  -72.052 115.030 1.00 154.96 ? 124  PHE C CZ    1 
ATOM   8920  N  N     . ARG C 1  125 ? -0.920  -70.320 108.794 1.00 165.52 ? 125  ARG C N     1 
ATOM   8921  C  CA    . ARG C 1  125 ? -1.974  -69.644 108.038 1.00 157.40 ? 125  ARG C CA    1 
ATOM   8922  C  C     . ARG C 1  125 ? -3.069  -70.604 107.586 1.00 159.54 ? 125  ARG C C     1 
ATOM   8923  O  O     . ARG C 1  125 ? -4.260  -70.277 107.649 1.00 162.10 ? 125  ARG C O     1 
ATOM   8924  C  CB    . ARG C 1  125 ? -1.363  -68.949 106.822 1.00 155.46 ? 125  ARG C CB    1 
ATOM   8925  C  CG    . ARG C 1  125 ? -0.465  -67.773 107.149 1.00 148.88 ? 125  ARG C CG    1 
ATOM   8926  C  CD    . ARG C 1  125 ? -0.002  -67.084 105.878 1.00 152.15 ? 125  ARG C CD    1 
ATOM   8927  N  NE    . ARG C 1  125 ? 1.303   -66.452 106.052 1.00 149.62 ? 125  ARG C NE    1 
ATOM   8928  C  CZ    . ARG C 1  125 ? 1.598   -65.209 105.687 1.00 147.94 ? 125  ARG C CZ    1 
ATOM   8929  N  NH1   . ARG C 1  125 ? 0.682   -64.450 105.108 1.00 149.68 ? 125  ARG C NH1   1 
ATOM   8930  N  NH2   . ARG C 1  125 ? 2.817   -64.729 105.889 1.00 143.51 ? 125  ARG C NH2   1 
ATOM   8931  N  N     . LYS C 1  126 ? -2.676  -71.788 107.109 1.00 163.87 ? 126  LYS C N     1 
ATOM   8932  C  CA    . LYS C 1  126 ? -3.621  -72.782 106.605 1.00 165.67 ? 126  LYS C CA    1 
ATOM   8933  C  C     . LYS C 1  126 ? -4.718  -73.134 107.606 1.00 183.52 ? 126  LYS C C     1 
ATOM   8934  O  O     . LYS C 1  126 ? -5.819  -73.525 107.201 1.00 195.86 ? 126  LYS C O     1 
ATOM   8935  C  CB    . LYS C 1  126 ? -2.854  -74.034 106.165 1.00 163.00 ? 126  LYS C CB    1 
ATOM   8936  C  CG    . LYS C 1  126 ? -2.836  -75.181 107.160 1.00 164.58 ? 126  LYS C CG    1 
ATOM   8937  C  CD    . LYS C 1  126 ? -1.715  -76.162 106.833 1.00 157.33 ? 126  LYS C CD    1 
ATOM   8938  C  CE    . LYS C 1  126 ? -0.386  -75.439 106.655 1.00 149.89 ? 126  LYS C CE    1 
ATOM   8939  N  NZ    . LYS C 1  126 ? 0.786   -76.358 106.714 1.00 141.09 ? 126  LYS C NZ    1 
ATOM   8940  N  N     . TYR C 1  127 ? -4.453  -73.005 108.905 1.00 167.30 ? 127  TYR C N     1 
ATOM   8941  C  CA    . TYR C 1  127 ? -5.455  -73.367 109.901 1.00 170.84 ? 127  TYR C CA    1 
ATOM   8942  C  C     . TYR C 1  127 ? -6.517  -72.285 110.109 1.00 169.80 ? 127  TYR C C     1 
ATOM   8943  O  O     . TYR C 1  127 ? -7.571  -72.581 110.683 1.00 174.57 ? 127  TYR C O     1 
ATOM   8944  C  CB    . TYR C 1  127 ? -4.773  -73.720 111.226 1.00 167.26 ? 127  TYR C CB    1 
ATOM   8945  C  CG    . TYR C 1  127 ? -3.660  -74.741 111.083 1.00 169.85 ? 127  TYR C CG    1 
ATOM   8946  C  CD1   . TYR C 1  127 ? -3.945  -76.100 111.044 1.00 179.13 ? 127  TYR C CD1   1 
ATOM   8947  C  CD2   . TYR C 1  127 ? -2.329  -74.351 110.988 1.00 159.83 ? 127  TYR C CD2   1 
ATOM   8948  C  CE1   . TYR C 1  127 ? -2.941  -77.043 110.913 1.00 179.25 ? 127  TYR C CE1   1 
ATOM   8949  C  CE2   . TYR C 1  127 ? -1.315  -75.288 110.857 1.00 159.07 ? 127  TYR C CE2   1 
ATOM   8950  C  CZ    . TYR C 1  127 ? -1.628  -76.632 110.820 1.00 167.50 ? 127  TYR C CZ    1 
ATOM   8951  O  OH    . TYR C 1  127 ? -0.627  -77.569 110.693 1.00 162.67 ? 127  TYR C OH    1 
ATOM   8952  N  N     . THR C 1  128 ? -6.276  -71.051 109.655 1.00 165.46 ? 128  THR C N     1 
ATOM   8953  C  CA    . THR C 1  128 ? -7.251  -69.965 109.760 1.00 170.50 ? 128  THR C CA    1 
ATOM   8954  C  C     . THR C 1  128 ? -8.367  -70.052 108.718 1.00 181.27 ? 128  THR C C     1 
ATOM   8955  O  O     . THR C 1  128 ? -9.250  -69.188 108.702 1.00 184.27 ? 128  THR C O     1 
ATOM   8956  C  CB    . THR C 1  128 ? -6.543  -68.614 109.638 1.00 167.34 ? 128  THR C CB    1 
ATOM   8957  O  OG1   . THR C 1  128 ? -5.761  -68.591 108.437 1.00 166.60 ? 128  THR C OG1   1 
ATOM   8958  C  CG2   . THR C 1  128 ? -5.631  -68.384 110.834 1.00 166.64 ? 128  THR C CG2   1 
ATOM   8959  N  N     . ALA C 1  129 ? -8.323  -71.066 107.858 1.00 192.22 ? 129  ALA C N     1 
ATOM   8960  C  CA    . ALA C 1  129 ? -9.235  -71.250 106.731 1.00 194.97 ? 129  ALA C CA    1 
ATOM   8961  C  C     . ALA C 1  129 ? -10.703 -71.175 107.151 1.00 201.88 ? 129  ALA C C     1 
ATOM   8962  O  O     . ALA C 1  129 ? -11.068 -71.612 108.245 1.00 205.48 ? 129  ALA C O     1 
ATOM   8963  C  CB    . ALA C 1  129 ? -8.941  -72.577 106.037 1.00 195.28 ? 129  ALA C CB    1 
ATOM   8964  N  N     . PHE C 1  130 ? -11.548 -70.585 106.293 1.00 203.11 ? 130  PHE C N     1 
ATOM   8965  C  CA    . PHE C 1  130 ? -12.970 -70.471 106.612 1.00 208.83 ? 130  PHE C CA    1 
ATOM   8966  C  C     . PHE C 1  130 ? -13.833 -70.527 105.352 1.00 211.91 ? 130  PHE C C     1 
ATOM   8967  O  O     . PHE C 1  130 ? -13.349 -70.414 104.223 1.00 206.57 ? 130  PHE C O     1 
ATOM   8968  C  CB    . PHE C 1  130 ? -13.301 -69.169 107.348 1.00 202.83 ? 130  PHE C CB    1 
ATOM   8969  C  CG    . PHE C 1  130 ? -13.067 -67.925 106.540 1.00 196.42 ? 130  PHE C CG    1 
ATOM   8970  C  CD1   . PHE C 1  130 ? -11.790 -67.449 106.315 1.00 194.81 ? 130  PHE C CD1   1 
ATOM   8971  C  CD2   . PHE C 1  130 ? -14.137 -67.260 105.959 1.00 196.05 ? 130  PHE C CD2   1 
ATOM   8972  C  CE1   . PHE C 1  130 ? -11.588 -66.304 105.572 1.00 195.09 ? 130  PHE C CE1   1 
ATOM   8973  C  CE2   . PHE C 1  130 ? -13.942 -66.123 105.207 1.00 196.83 ? 130  PHE C CE2   1 
ATOM   8974  C  CZ    . PHE C 1  130 ? -12.666 -65.645 105.009 1.00 197.34 ? 130  PHE C CZ    1 
ATOM   8975  N  N     . THR C 1  131 ? -15.141 -70.704 105.587 1.00 226.07 ? 131  THR C N     1 
ATOM   8976  C  CA    . THR C 1  131 ? -16.164 -70.990 104.581 1.00 230.89 ? 131  THR C CA    1 
ATOM   8977  C  C     . THR C 1  131 ? -17.404 -70.128 104.795 1.00 233.36 ? 131  THR C C     1 
ATOM   8978  O  O     . THR C 1  131 ? -17.868 -69.996 105.929 1.00 231.42 ? 131  THR C O     1 
ATOM   8979  C  CB    . THR C 1  131 ? -16.588 -72.463 104.649 1.00 230.14 ? 131  THR C CB    1 
ATOM   8980  O  OG1   . THR C 1  131 ? -17.040 -72.763 105.975 1.00 225.97 ? 131  THR C OG1   1 
ATOM   8981  C  CG2   . THR C 1  131 ? -15.423 -73.369 104.346 1.00 226.63 ? 131  THR C CG2   1 
ATOM   8982  N  N     . ILE C 1  132 ? -17.941 -69.536 103.729 1.00 219.72 ? 132  ILE C N     1 
ATOM   8983  C  CA    . ILE C 1  132 ? -19.190 -68.787 103.812 1.00 206.27 ? 132  ILE C CA    1 
ATOM   8984  C  C     . ILE C 1  132 ? -20.216 -69.450 102.892 1.00 216.12 ? 132  ILE C C     1 
ATOM   8985  O  O     . ILE C 1  132 ? -19.963 -69.615 101.696 1.00 216.51 ? 132  ILE C O     1 
ATOM   8986  C  CB    . ILE C 1  132 ? -18.994 -67.303 103.455 1.00 190.32 ? 132  ILE C CB    1 
ATOM   8987  C  CG1   . ILE C 1  132 ? -20.338 -66.584 103.360 1.00 196.81 ? 132  ILE C CG1   1 
ATOM   8988  C  CG2   . ILE C 1  132 ? -18.171 -67.143 102.179 1.00 181.35 ? 132  ILE C CG2   1 
ATOM   8989  C  CD1   . ILE C 1  132 ? -20.201 -65.103 103.119 1.00 190.27 ? 132  ILE C CD1   1 
ATOM   8990  N  N     . PRO C 1  133 ? -21.379 -69.856 103.412 1.00 230.24 ? 133  PRO C N     1 
ATOM   8991  C  CA    . PRO C 1  133 ? -22.387 -70.569 102.604 1.00 232.71 ? 133  PRO C CA    1 
ATOM   8992  C  C     . PRO C 1  133 ? -23.004 -69.820 101.431 1.00 235.04 ? 133  PRO C C     1 
ATOM   8993  O  O     . PRO C 1  133 ? -23.689 -68.807 101.598 1.00 233.48 ? 133  PRO C O     1 
ATOM   8994  C  CB    . PRO C 1  133 ? -23.472 -70.911 103.634 1.00 233.96 ? 133  PRO C CB    1 
ATOM   8995  C  CG    . PRO C 1  133 ? -22.831 -70.793 104.952 1.00 231.12 ? 133  PRO C CG    1 
ATOM   8996  C  CD    . PRO C 1  133 ? -21.805 -69.712 104.808 1.00 228.79 ? 133  PRO C CD    1 
ATOM   8997  N  N     . SER C 1  134 ? -22.747 -70.344 100.233 1.00 236.07 ? 134  SER C N     1 
ATOM   8998  C  CA    . SER C 1  134 ? -23.129 -69.686 98.988  1.00 238.04 ? 134  SER C CA    1 
ATOM   8999  C  C     . SER C 1  134 ? -24.644 -69.504 98.905  1.00 241.57 ? 134  SER C C     1 
ATOM   9000  O  O     . SER C 1  134 ? -25.140 -68.438 98.520  1.00 242.58 ? 134  SER C O     1 
ATOM   9001  C  CB    . SER C 1  134 ? -22.612 -70.468 97.788  1.00 235.58 ? 134  SER C CB    1 
ATOM   9002  O  OG    . SER C 1  134 ? -23.369 -71.643 97.624  1.00 237.11 ? 134  SER C OG    1 
ATOM   9003  N  N     . ILE C 1  135 ? -25.393 -70.555 99.279  1.00 232.91 ? 135  ILE C N     1 
ATOM   9004  C  CA    . ILE C 1  135 ? -26.857 -70.611 99.308  1.00 224.07 ? 135  ILE C CA    1 
ATOM   9005  C  C     . ILE C 1  135 ? -27.310 -71.548 100.420 1.00 234.52 ? 135  ILE C C     1 
ATOM   9006  O  O     . ILE C 1  135 ? -27.785 -72.661 100.164 1.00 224.07 ? 135  ILE C O     1 
ATOM   9007  C  CB    . ILE C 1  135 ? -27.437 -71.141 97.978  1.00 211.45 ? 135  ILE C CB    1 
ATOM   9008  C  CG1   . ILE C 1  135 ? -26.469 -70.961 96.803  1.00 202.82 ? 135  ILE C CG1   1 
ATOM   9009  C  CG2   . ILE C 1  135 ? -28.818 -70.547 97.708  1.00 202.58 ? 135  ILE C CG2   1 
ATOM   9010  C  CD1   . ILE C 1  135 ? -27.136 -70.884 95.469  1.00 180.72 ? 135  ILE C CD1   1 
ATOM   9011  N  N     . ASN C 1  136 ? -27.163 -71.080 101.662 1.00 263.29 ? 136  ASN C N     1 
ATOM   9012  C  CA    . ASN C 1  136 ? -27.597 -71.776 102.879 1.00 264.93 ? 136  ASN C CA    1 
ATOM   9013  C  C     . ASN C 1  136 ? -26.976 -73.168 102.954 1.00 263.86 ? 136  ASN C C     1 
ATOM   9014  O  O     . ASN C 1  136 ? -27.650 -74.174 103.187 1.00 264.84 ? 136  ASN C O     1 
ATOM   9015  C  CB    . ASN C 1  136 ? -29.127 -71.860 102.959 1.00 263.96 ? 136  ASN C CB    1 
ATOM   9016  C  CG    . ASN C 1  136 ? -29.825 -70.815 102.102 1.00 262.08 ? 136  ASN C CG    1 
ATOM   9017  O  OD1   . ASN C 1  136 ? -29.270 -69.755 101.815 1.00 259.90 ? 136  ASN C OD1   1 
ATOM   9018  N  ND2   . ASN C 1  136 ? -31.050 -71.117 101.684 1.00 262.65 ? 136  ASN C ND2   1 
ATOM   9019  N  N     . ASN C 1  137 ? -25.661 -73.202 102.748 1.00 236.57 ? 137  ASN C N     1 
ATOM   9020  C  CA    . ASN C 1  137 ? -24.834 -74.403 102.838 1.00 213.48 ? 137  ASN C CA    1 
ATOM   9021  C  C     . ASN C 1  137 ? -25.274 -75.460 101.830 1.00 216.75 ? 137  ASN C C     1 
ATOM   9022  O  O     . ASN C 1  137 ? -25.063 -76.656 102.045 1.00 202.16 ? 137  ASN C O     1 
ATOM   9023  C  CB    . ASN C 1  137 ? -24.823 -74.988 104.258 1.00 195.17 ? 137  ASN C CB    1 
ATOM   9024  C  CG    . ASN C 1  137 ? -24.767 -73.920 105.341 1.00 202.75 ? 137  ASN C CG    1 
ATOM   9025  O  OD1   . ASN C 1  137 ? -25.748 -73.225 105.603 1.00 210.45 ? 137  ASN C OD1   1 
ATOM   9026  N  ND2   . ASN C 1  137 ? -23.616 -73.806 105.994 1.00 203.50 ? 137  ASN C ND2   1 
ATOM   9027  N  N     . GLU C 1  138 ? -25.877 -75.042 100.713 1.00 215.34 ? 138  GLU C N     1 
ATOM   9028  C  CA    . GLU C 1  138 ? -26.103 -75.980 99.620  1.00 216.59 ? 138  GLU C CA    1 
ATOM   9029  C  C     . GLU C 1  138 ? -24.822 -76.135 98.814  1.00 226.11 ? 138  GLU C C     1 
ATOM   9030  O  O     . GLU C 1  138 ? -24.294 -77.242 98.662  1.00 221.76 ? 138  GLU C O     1 
ATOM   9031  C  CB    . GLU C 1  138 ? -27.281 -75.529 98.753  1.00 211.73 ? 138  GLU C CB    1 
ATOM   9032  C  CG    . GLU C 1  138 ? -27.381 -76.239 97.418  1.00 212.77 ? 138  GLU C CG    1 
ATOM   9033  C  CD    . GLU C 1  138 ? -28.130 -75.429 96.384  1.00 206.46 ? 138  GLU C CD    1 
ATOM   9034  O  OE1   . GLU C 1  138 ? -27.608 -74.382 95.949  1.00 205.10 ? 138  GLU C OE1   1 
ATOM   9035  O  OE2   . GLU C 1  138 ? -29.253 -75.835 96.018  1.00 209.15 ? 138  GLU C OE2   1 
ATOM   9036  N  N     . THR C 1  139 ? -24.314 -75.027 98.284  1.00 252.39 ? 139  THR C N     1 
ATOM   9037  C  CA    . THR C 1  139 ? -23.060 -75.035 97.563  1.00 249.26 ? 139  THR C CA    1 
ATOM   9038  C  C     . THR C 1  139 ? -22.029 -74.285 98.399  1.00 248.25 ? 139  THR C C     1 
ATOM   9039  O  O     . THR C 1  139 ? -22.387 -73.560 99.334  1.00 247.84 ? 139  THR C O     1 
ATOM   9040  C  CB    . THR C 1  139 ? -23.205 -74.403 96.169  1.00 249.24 ? 139  THR C CB    1 
ATOM   9041  O  OG1   . THR C 1  139 ? -23.728 -73.076 96.285  1.00 248.56 ? 139  THR C OG1   1 
ATOM   9042  C  CG2   . THR C 1  139 ? -24.146 -75.229 95.307  1.00 249.88 ? 139  THR C CG2   1 
ATOM   9043  N  N     . PRO C 1  140 ? -20.752 -74.422 98.096  1.00 234.59 ? 140  PRO C N     1 
ATOM   9044  C  CA    . PRO C 1  140 ? -19.745 -73.764 98.940  1.00 226.47 ? 140  PRO C CA    1 
ATOM   9045  C  C     . PRO C 1  140 ? -19.181 -72.444 98.444  1.00 221.24 ? 140  PRO C C     1 
ATOM   9046  O  O     . PRO C 1  140 ? -18.807 -72.325 97.273  1.00 219.64 ? 140  PRO C O     1 
ATOM   9047  C  CB    . PRO C 1  140 ? -18.592 -74.784 98.967  1.00 220.04 ? 140  PRO C CB    1 
ATOM   9048  C  CG    . PRO C 1  140 ? -18.989 -75.874 98.023  1.00 221.19 ? 140  PRO C CG    1 
ATOM   9049  C  CD    . PRO C 1  140 ? -20.449 -75.853 97.966  1.00 228.22 ? 140  PRO C CD    1 
ATOM   9050  N  N     . GLY C 1  141 ? -19.115 -71.443 99.319  1.00 220.24 ? 141  GLY C N     1 
ATOM   9051  C  CA    . GLY C 1  141 ? -18.760 -70.106 98.905  1.00 220.15 ? 141  GLY C CA    1 
ATOM   9052  C  C     . GLY C 1  141 ? -17.251 -70.134 98.816  1.00 219.77 ? 141  GLY C C     1 
ATOM   9053  O  O     . GLY C 1  141 ? -16.626 -71.151 99.116  1.00 219.51 ? 141  GLY C O     1 
ATOM   9054  N  N     . ILE C 1  142 ? -16.631 -69.031 98.390  1.00 208.54 ? 142  ILE C N     1 
ATOM   9055  C  CA    . ILE C 1  142 ? -15.185 -69.128 98.246  1.00 207.72 ? 142  ILE C CA    1 
ATOM   9056  C  C     . ILE C 1  142 ? -14.579 -69.347 99.628  1.00 206.86 ? 142  ILE C C     1 
ATOM   9057  O  O     . ILE C 1  142 ? -14.976 -68.719 100.619 1.00 203.31 ? 142  ILE C O     1 
ATOM   9058  C  CB    . ILE C 1  142 ? -14.593 -67.892 97.549  1.00 200.63 ? 142  ILE C CB    1 
ATOM   9059  C  CG1   . ILE C 1  142 ? -15.304 -67.642 96.219  1.00 197.64 ? 142  ILE C CG1   1 
ATOM   9060  C  CG2   . ILE C 1  142 ? -13.114 -68.120 97.267  1.00 191.72 ? 142  ILE C CG2   1 
ATOM   9061  C  CD1   . ILE C 1  142 ? -14.514 -66.785 95.247  1.00 189.36 ? 142  ILE C CD1   1 
ATOM   9062  N  N     . ARG C 1  143 ? -13.607 -70.248 99.686  1.00 206.55 ? 143  ARG C N     1 
ATOM   9063  C  CA    . ARG C 1  143 ? -12.858 -70.581 100.886 1.00 202.47 ? 143  ARG C CA    1 
ATOM   9064  C  C     . ARG C 1  143 ? -11.647 -69.661 100.989 1.00 197.45 ? 143  ARG C C     1 
ATOM   9065  O  O     . ARG C 1  143 ? -11.071 -69.257 99.976  1.00 195.83 ? 143  ARG C O     1 
ATOM   9066  C  CB    . ARG C 1  143 ? -12.493 -72.066 100.873 1.00 204.22 ? 143  ARG C CB    1 
ATOM   9067  C  CG    . ARG C 1  143 ? -13.663 -72.858 101.464 1.00 201.80 ? 143  ARG C CG    1 
ATOM   9068  C  CD    . ARG C 1  143 ? -13.968 -74.177 100.759 1.00 198.78 ? 143  ARG C CD    1 
ATOM   9069  N  NE    . ARG C 1  143 ? -14.892 -75.010 101.533 1.00 195.78 ? 143  ARG C NE    1 
ATOM   9070  C  CZ    . ARG C 1  143 ? -14.545 -76.001 102.348 1.00 189.61 ? 143  ARG C CZ    1 
ATOM   9071  N  NH1   . ARG C 1  143 ? -13.270 -76.317 102.516 1.00 190.20 ? 143  ARG C NH1   1 
ATOM   9072  N  NH2   . ARG C 1  143 ? -15.485 -76.681 102.993 1.00 184.94 ? 143  ARG C NH2   1 
ATOM   9073  N  N     . TYR C 1  144 ? -11.249 -69.340 102.219 1.00 198.73 ? 144  TYR C N     1 
ATOM   9074  C  CA    . TYR C 1  144 ? -10.147 -68.403 102.379 1.00 195.66 ? 144  TYR C CA    1 
ATOM   9075  C  C     . TYR C 1  144 ? -9.380  -68.708 103.655 1.00 194.54 ? 144  TYR C C     1 
ATOM   9076  O  O     . TYR C 1  144 ? -9.910  -69.298 104.597 1.00 188.67 ? 144  TYR C O     1 
ATOM   9077  C  CB    . TYR C 1  144 ? -10.663 -66.963 102.430 1.00 196.00 ? 144  TYR C CB    1 
ATOM   9078  C  CG    . TYR C 1  144 ? -10.981 -66.383 101.080 1.00 193.13 ? 144  TYR C CG    1 
ATOM   9079  C  CD1   . TYR C 1  144 ? -9.978  -66.049 100.187 1.00 190.86 ? 144  TYR C CD1   1 
ATOM   9080  C  CD2   . TYR C 1  144 ? -12.299 -66.152 100.709 1.00 189.82 ? 144  TYR C CD2   1 
ATOM   9081  C  CE1   . TYR C 1  144 ? -10.280 -65.518 98.954  1.00 187.37 ? 144  TYR C CE1   1 
ATOM   9082  C  CE2   . TYR C 1  144 ? -12.611 -65.615 99.485  1.00 186.75 ? 144  TYR C CE2   1 
ATOM   9083  C  CZ    . TYR C 1  144 ? -11.599 -65.302 98.608  1.00 185.84 ? 144  TYR C CZ    1 
ATOM   9084  O  OH    . TYR C 1  144 ? -11.905 -64.773 97.376  1.00 183.40 ? 144  TYR C OH    1 
ATOM   9085  N  N     . GLN C 1  145 ? -8.125  -68.256 103.678 1.00 193.95 ? 145  GLN C N     1 
ATOM   9086  C  CA    . GLN C 1  145 ? -7.261  -68.304 104.850 1.00 190.01 ? 145  GLN C CA    1 
ATOM   9087  C  C     . GLN C 1  145 ? -6.645  -66.940 105.109 1.00 188.93 ? 145  GLN C C     1 
ATOM   9088  O  O     . GLN C 1  145 ? -6.457  -66.132 104.194 1.00 189.56 ? 145  GLN C O     1 
ATOM   9089  C  CB    . GLN C 1  145 ? -6.113  -69.302 104.676 1.00 188.37 ? 145  GLN C CB    1 
ATOM   9090  C  CG    . GLN C 1  145 ? -4.997  -68.765 103.769 1.00 186.46 ? 145  GLN C CG    1 
ATOM   9091  C  CD    . GLN C 1  145 ? -3.793  -69.678 103.674 1.00 181.53 ? 145  GLN C CD    1 
ATOM   9092  O  OE1   . GLN C 1  145 ? -3.792  -70.782 104.213 1.00 184.04 ? 145  GLN C OE1   1 
ATOM   9093  N  NE2   . GLN C 1  145 ? -2.759  -69.221 102.977 1.00 176.00 ? 145  GLN C NE2   1 
ATOM   9094  N  N     . TYR C 1  146 ? -6.371  -66.683 106.383 1.00 181.92 ? 146  TYR C N     1 
ATOM   9095  C  CA    . TYR C 1  146 ? -5.811  -65.410 106.800 1.00 175.10 ? 146  TYR C CA    1 
ATOM   9096  C  C     . TYR C 1  146 ? -4.303  -65.363 106.580 1.00 163.67 ? 146  TYR C C     1 
ATOM   9097  O  O     . TYR C 1  146 ? -3.591  -66.346 106.803 1.00 157.04 ? 146  TYR C O     1 
ATOM   9098  C  CB    . TYR C 1  146 ? -6.111  -65.184 108.281 1.00 165.20 ? 146  TYR C CB    1 
ATOM   9099  C  CG    . TYR C 1  146 ? -7.319  -64.324 108.555 1.00 159.23 ? 146  TYR C CG    1 
ATOM   9100  C  CD1   . TYR C 1  146 ? -7.219  -62.941 108.618 1.00 155.22 ? 146  TYR C CD1   1 
ATOM   9101  C  CD2   . TYR C 1  146 ? -8.565  -64.904 108.766 1.00 159.27 ? 146  TYR C CD2   1 
ATOM   9102  C  CE1   . TYR C 1  146 ? -8.328  -62.159 108.879 1.00 160.83 ? 146  TYR C CE1   1 
ATOM   9103  C  CE2   . TYR C 1  146 ? -9.677  -64.132 109.027 1.00 161.38 ? 146  TYR C CE2   1 
ATOM   9104  C  CZ    . TYR C 1  146 ? -9.555  -62.760 109.082 1.00 165.12 ? 146  TYR C CZ    1 
ATOM   9105  O  OH    . TYR C 1  146 ? -10.664 -61.988 109.342 1.00 163.35 ? 146  TYR C OH    1 
ATOM   9106  N  N     . ASN C 1  147 ? -3.826  -64.200 106.140 1.00 167.00 ? 147  ASN C N     1 
ATOM   9107  C  CA    . ASN C 1  147 ? -2.417  -63.936 105.882 1.00 163.38 ? 147  ASN C CA    1 
ATOM   9108  C  C     . ASN C 1  147 ? -1.792  -63.087 106.979 1.00 163.23 ? 147  ASN C C     1 
ATOM   9109  O  O     . ASN C 1  147 ? -0.576  -62.865 106.963 1.00 159.70 ? 147  ASN C O     1 
ATOM   9110  C  CB    . ASN C 1  147 ? -2.230  -63.249 104.523 1.00 172.33 ? 147  ASN C CB    1 
ATOM   9111  C  CG    . ASN C 1  147 ? -2.329  -64.218 103.361 1.00 172.14 ? 147  ASN C CG    1 
ATOM   9112  O  OD1   . ASN C 1  147 ? -2.557  -65.413 103.551 1.00 170.06 ? 147  ASN C OD1   1 
ATOM   9113  N  ND2   . ASN C 1  147 ? -2.154  -63.707 102.147 1.00 174.44 ? 147  ASN C ND2   1 
ATOM   9114  N  N     . VAL C 1  148 ? -2.607  -62.612 107.916 1.00 163.06 ? 148  VAL C N     1 
ATOM   9115  C  CA    . VAL C 1  148 ? -2.223  -61.722 108.999 1.00 159.69 ? 148  VAL C CA    1 
ATOM   9116  C  C     . VAL C 1  148 ? -2.961  -62.178 110.253 1.00 157.75 ? 148  VAL C C     1 
ATOM   9117  O  O     . VAL C 1  148 ? -3.694  -63.169 110.232 1.00 159.13 ? 148  VAL C O     1 
ATOM   9118  C  CB    . VAL C 1  148 ? -2.548  -60.251 108.676 1.00 162.06 ? 148  VAL C CB    1 
ATOM   9119  C  CG1   . VAL C 1  148 ? -1.599  -59.719 107.620 1.00 165.09 ? 148  VAL C CG1   1 
ATOM   9120  C  CG2   . VAL C 1  148 ? -3.981  -60.154 108.181 1.00 163.72 ? 148  VAL C CG2   1 
ATOM   9121  N  N     . LEU C 1  149 ? -2.757  -61.460 111.353 1.00 160.42 ? 149  LEU C N     1 
ATOM   9122  C  CA    . LEU C 1  149 ? -3.442  -61.800 112.596 1.00 154.76 ? 149  LEU C CA    1 
ATOM   9123  C  C     . LEU C 1  149 ? -4.952  -61.662 112.424 1.00 148.92 ? 149  LEU C C     1 
ATOM   9124  O  O     . LEU C 1  149 ? -5.438  -60.561 112.127 1.00 148.54 ? 149  LEU C O     1 
ATOM   9125  C  CB    . LEU C 1  149 ? -2.959  -60.898 113.731 1.00 153.29 ? 149  LEU C CB    1 
ATOM   9126  C  CG    . LEU C 1  149 ? -1.450  -60.669 113.854 1.00 156.54 ? 149  LEU C CG    1 
ATOM   9127  C  CD1   . LEU C 1  149 ? -1.139  -59.744 115.022 1.00 151.41 ? 149  LEU C CD1   1 
ATOM   9128  C  CD2   . LEU C 1  149 ? -0.709  -61.988 114.001 1.00 148.63 ? 149  LEU C CD2   1 
ATOM   9129  N  N     . PRO C 1  150 ? -5.721  -62.738 112.594 1.00 144.53 ? 150  PRO C N     1 
ATOM   9130  C  CA    . PRO C 1  150 ? -7.176  -62.654 112.425 1.00 149.74 ? 150  PRO C CA    1 
ATOM   9131  C  C     . PRO C 1  150 ? -7.911  -62.330 113.714 1.00 154.67 ? 150  PRO C C     1 
ATOM   9132  O  O     . PRO C 1  150 ? -7.576  -62.818 114.796 1.00 157.14 ? 150  PRO C O     1 
ATOM   9133  C  CB    . PRO C 1  150 ? -7.542  -64.066 111.952 1.00 151.11 ? 150  PRO C CB    1 
ATOM   9134  C  CG    . PRO C 1  150 ? -6.523  -64.937 112.596 1.00 144.30 ? 150  PRO C CG    1 
ATOM   9135  C  CD    . PRO C 1  150 ? -5.256  -64.132 112.704 1.00 144.43 ? 150  PRO C CD    1 
ATOM   9136  N  N     . GLN C 1  151 ? -8.912  -61.463 113.594 1.00 158.61 ? 151  GLN C N     1 
ATOM   9137  C  CA    . GLN C 1  151 ? -9.823  -61.233 114.705 1.00 153.90 ? 151  GLN C CA    1 
ATOM   9138  C  C     . GLN C 1  151 ? -10.480 -62.548 115.111 1.00 154.00 ? 151  GLN C C     1 
ATOM   9139  O  O     . GLN C 1  151 ? -10.988 -63.287 114.261 1.00 153.44 ? 151  GLN C O     1 
ATOM   9140  C  CB    . GLN C 1  151 ? -10.883 -60.209 114.305 1.00 157.94 ? 151  GLN C CB    1 
ATOM   9141  C  CG    . GLN C 1  151 ? -10.392 -58.773 114.306 1.00 157.54 ? 151  GLN C CG    1 
ATOM   9142  C  CD    . GLN C 1  151 ? -11.397 -57.818 113.695 1.00 164.39 ? 151  GLN C CD    1 
ATOM   9143  O  OE1   . GLN C 1  151 ? -11.279 -56.601 113.835 1.00 162.56 ? 151  GLN C OE1   1 
ATOM   9144  N  NE2   . GLN C 1  151 ? -12.390 -58.367 113.004 1.00 176.36 ? 151  GLN C NE2   1 
ATOM   9145  N  N     . GLY C 1  152 ? -10.466 -62.847 116.409 1.00 162.59 ? 152  GLY C N     1 
ATOM   9146  C  CA    . GLY C 1  152 ? -11.037 -64.072 116.930 1.00 158.03 ? 152  GLY C CA    1 
ATOM   9147  C  C     . GLY C 1  152 ? -10.031 -65.120 117.357 1.00 157.72 ? 152  GLY C C     1 
ATOM   9148  O  O     . GLY C 1  152 ? -10.400 -66.048 118.090 1.00 153.30 ? 152  GLY C O     1 
ATOM   9149  N  N     . TRP C 1  153 ? -8.774  -64.999 116.937 1.00 156.73 ? 153  TRP C N     1 
ATOM   9150  C  CA    . TRP C 1  153 ? -7.731  -65.939 117.326 1.00 149.72 ? 153  TRP C CA    1 
ATOM   9151  C  C     . TRP C 1  153 ? -7.105  -65.511 118.645 1.00 150.75 ? 153  TRP C C     1 
ATOM   9152  O  O     . TRP C 1  153 ? -6.757  -64.339 118.823 1.00 147.75 ? 153  TRP C O     1 
ATOM   9153  C  CB    . TRP C 1  153 ? -6.660  -66.037 116.239 1.00 146.29 ? 153  TRP C CB    1 
ATOM   9154  C  CG    . TRP C 1  153 ? -5.611  -67.069 116.519 1.00 141.27 ? 153  TRP C CG    1 
ATOM   9155  C  CD1   . TRP C 1  153 ? -5.817  -68.372 116.868 1.00 145.24 ? 153  TRP C CD1   1 
ATOM   9156  C  CD2   . TRP C 1  153 ? -4.190  -66.890 116.456 1.00 130.93 ? 153  TRP C CD2   1 
ATOM   9157  N  NE1   . TRP C 1  153 ? -4.613  -69.013 117.035 1.00 141.64 ? 153  TRP C NE1   1 
ATOM   9158  C  CE2   . TRP C 1  153 ? -3.599  -68.126 116.787 1.00 135.08 ? 153  TRP C CE2   1 
ATOM   9159  C  CE3   . TRP C 1  153 ? -3.361  -65.805 116.155 1.00 129.63 ? 153  TRP C CE3   1 
ATOM   9160  C  CZ2   . TRP C 1  153 ? -2.217  -68.305 116.826 1.00 136.54 ? 153  TRP C CZ2   1 
ATOM   9161  C  CZ3   . TRP C 1  153 ? -1.989  -65.986 116.195 1.00 127.91 ? 153  TRP C CZ3   1 
ATOM   9162  C  CH2   . TRP C 1  153 ? -1.431  -67.226 116.527 1.00 126.58 ? 153  TRP C CH2   1 
ATOM   9163  N  N     . LYS C 1  154 ? -6.961  -66.469 119.567 1.00 154.46 ? 154  LYS C N     1 
ATOM   9164  C  CA    . LYS C 1  154 ? -6.542  -66.137 120.923 1.00 152.42 ? 154  LYS C CA    1 
ATOM   9165  C  C     . LYS C 1  154 ? -5.122  -65.589 120.977 1.00 153.21 ? 154  LYS C C     1 
ATOM   9166  O  O     . LYS C 1  154 ? -4.745  -64.981 121.985 1.00 153.30 ? 154  LYS C O     1 
ATOM   9167  C  CB    . LYS C 1  154 ? -6.659  -67.369 121.827 1.00 149.65 ? 154  LYS C CB    1 
ATOM   9168  C  CG    . LYS C 1  154 ? -5.359  -68.136 122.018 1.00 149.38 ? 154  LYS C CG    1 
ATOM   9169  C  CD    . LYS C 1  154 ? -5.588  -69.475 122.702 1.00 148.86 ? 154  LYS C CD    1 
ATOM   9170  C  CE    . LYS C 1  154 ? -4.292  -70.268 122.794 1.00 148.31 ? 154  LYS C CE    1 
ATOM   9171  N  NZ    . LYS C 1  154 ? -4.503  -71.640 123.333 1.00 149.87 ? 154  LYS C NZ    1 
ATOM   9172  N  N     . GLY C 1  155 ? -4.336  -65.774 119.923 1.00 145.64 ? 155  GLY C N     1 
ATOM   9173  C  CA    . GLY C 1  155 ? -2.955  -65.352 119.916 1.00 138.73 ? 155  GLY C CA    1 
ATOM   9174  C  C     . GLY C 1  155 ? -2.709  -64.033 119.228 1.00 139.44 ? 155  GLY C C     1 
ATOM   9175  O  O     . GLY C 1  155 ? -1.562  -63.583 119.173 1.00 132.29 ? 155  GLY C O     1 
ATOM   9176  N  N     . SER C 1  156 ? -3.754  -63.378 118.732 1.00 139.22 ? 156  SER C N     1 
ATOM   9177  C  CA    . SER C 1  156 ? -3.620  -62.143 117.968 1.00 144.58 ? 156  SER C CA    1 
ATOM   9178  C  C     . SER C 1  156 ? -3.304  -60.945 118.862 1.00 143.17 ? 156  SER C C     1 
ATOM   9179  O  O     . SER C 1  156 ? -2.404  -60.164 118.525 1.00 142.96 ? 156  SER C O     1 
ATOM   9180  C  CB    . SER C 1  156 ? -4.883  -61.886 117.138 1.00 148.74 ? 156  SER C CB    1 
ATOM   9181  O  OG    . SER C 1  156 ? -4.934  -62.737 116.007 1.00 150.85 ? 156  SER C OG    1 
ATOM   9182  N  N     . PRO C 1  157 ? -4.008  -60.741 119.988 1.00 145.81 ? 157  PRO C N     1 
ATOM   9183  C  CA    . PRO C 1  157 ? -3.645  -59.602 120.853 1.00 141.60 ? 157  PRO C CA    1 
ATOM   9184  C  C     . PRO C 1  157 ? -2.196  -59.628 121.307 1.00 137.23 ? 157  PRO C C     1 
ATOM   9185  O  O     . PRO C 1  157 ? -1.481  -58.629 121.159 1.00 139.45 ? 157  PRO C O     1 
ATOM   9186  C  CB    . PRO C 1  157 ? -4.614  -59.758 122.030 1.00 137.60 ? 157  PRO C CB    1 
ATOM   9187  C  CG    . PRO C 1  157 ? -5.822  -60.345 121.415 1.00 138.09 ? 157  PRO C CG    1 
ATOM   9188  C  CD    . PRO C 1  157 ? -5.281  -61.348 120.426 1.00 143.08 ? 157  PRO C CD    1 
ATOM   9189  N  N     . ALA C 1  158 ? -1.754  -60.747 121.884 1.00 127.82 ? 158  ALA C N     1 
ATOM   9190  C  CA    . ALA C 1  158 ? -0.382  -60.858 122.372 1.00 129.67 ? 158  ALA C CA    1 
ATOM   9191  C  C     . ALA C 1  158 ? 0.639   -60.580 121.272 1.00 139.16 ? 158  ALA C C     1 
ATOM   9192  O  O     . ALA C 1  158 ? 1.647   -59.903 121.508 1.00 127.90 ? 158  ALA C O     1 
ATOM   9193  C  CB    . ALA C 1  158 ? -0.154  -62.244 122.975 1.00 120.35 ? 158  ALA C CB    1 
ATOM   9194  N  N     . ILE C 1  159 ? 0.395   -61.090 120.062 1.00 132.16 ? 159  ILE C N     1 
ATOM   9195  C  CA    . ILE C 1  159 ? 1.373   -60.948 118.986 1.00 129.24 ? 159  ILE C CA    1 
ATOM   9196  C  C     . ILE C 1  159 ? 1.445   -59.513 118.480 1.00 132.51 ? 159  ILE C C     1 
ATOM   9197  O  O     . ILE C 1  159 ? 2.541   -58.980 118.261 1.00 127.72 ? 159  ILE C O     1 
ATOM   9198  C  CB    . ILE C 1  159 ? 1.051   -61.924 117.838 1.00 127.53 ? 159  ILE C CB    1 
ATOM   9199  C  CG1   . ILE C 1  159 ? 1.301   -63.367 118.271 1.00 128.72 ? 159  ILE C CG1   1 
ATOM   9200  C  CG2   . ILE C 1  159 ? 1.881   -61.593 116.605 1.00 132.02 ? 159  ILE C CG2   1 
ATOM   9201  C  CD1   . ILE C 1  159 ? 2.671   -63.597 118.834 1.00 137.33 ? 159  ILE C CD1   1 
ATOM   9202  N  N     . PHE C 1  160 ? 0.297   -58.863 118.275 1.00 140.16 ? 160  PHE C N     1 
ATOM   9203  C  CA    . PHE C 1  160 ? 0.328   -57.464 117.859 1.00 142.18 ? 160  PHE C CA    1 
ATOM   9204  C  C     . PHE C 1  160 ? 1.031   -56.580 118.882 1.00 144.01 ? 160  PHE C C     1 
ATOM   9205  O  O     . PHE C 1  160 ? 1.939   -55.816 118.533 1.00 134.01 ? 160  PHE C O     1 
ATOM   9206  C  CB    . PHE C 1  160 ? -1.078  -56.928 117.598 1.00 136.49 ? 160  PHE C CB    1 
ATOM   9207  C  CG    . PHE C 1  160 ? -1.090  -55.456 117.305 1.00 142.74 ? 160  PHE C CG    1 
ATOM   9208  C  CD1   . PHE C 1  160 ? -0.485  -54.968 116.158 1.00 151.49 ? 160  PHE C CD1   1 
ATOM   9209  C  CD2   . PHE C 1  160 ? -1.651  -54.556 118.193 1.00 142.49 ? 160  PHE C CD2   1 
ATOM   9210  C  CE1   . PHE C 1  160 ? -0.465  -53.615 115.885 1.00 146.73 ? 160  PHE C CE1   1 
ATOM   9211  C  CE2   . PHE C 1  160 ? -1.634  -53.198 117.925 1.00 144.87 ? 160  PHE C CE2   1 
ATOM   9212  C  CZ    . PHE C 1  160 ? -1.037  -52.728 116.770 1.00 141.76 ? 160  PHE C CZ    1 
ATOM   9213  N  N     . GLN C 1  161 ? 0.609   -56.654 120.149 1.00 143.62 ? 161  GLN C N     1 
ATOM   9214  C  CA    . GLN C 1  161 ? 1.227   -55.844 121.197 1.00 140.78 ? 161  GLN C CA    1 
ATOM   9215  C  C     . GLN C 1  161 ? 2.742   -55.990 121.216 1.00 138.87 ? 161  GLN C C     1 
ATOM   9216  O  O     . GLN C 1  161 ? 3.470   -54.994 121.302 1.00 139.85 ? 161  GLN C O     1 
ATOM   9217  C  CB    . GLN C 1  161 ? 0.655   -56.203 122.567 1.00 134.66 ? 161  GLN C CB    1 
ATOM   9218  C  CG    . GLN C 1  161 ? -0.754  -55.714 122.820 1.00 134.01 ? 161  GLN C CG    1 
ATOM   9219  C  CD    . GLN C 1  161 ? -1.430  -56.497 123.923 1.00 132.58 ? 161  GLN C CD    1 
ATOM   9220  O  OE1   . GLN C 1  161 ? -2.640  -56.400 124.121 1.00 135.02 ? 161  GLN C OE1   1 
ATOM   9221  N  NE2   . GLN C 1  161 ? -0.643  -57.272 124.661 1.00 127.66 ? 161  GLN C NE2   1 
ATOM   9222  N  N     . SER C 1  162 ? 3.242   -57.224 121.138 1.00 134.18 ? 162  SER C N     1 
ATOM   9223  C  CA    . SER C 1  162 ? 4.687   -57.395 121.200 1.00 134.56 ? 162  SER C CA    1 
ATOM   9224  C  C     . SER C 1  162 ? 5.356   -56.873 119.936 1.00 140.38 ? 162  SER C C     1 
ATOM   9225  O  O     . SER C 1  162 ? 6.416   -56.240 120.009 1.00 141.99 ? 162  SER C O     1 
ATOM   9226  C  CB    . SER C 1  162 ? 5.033   -58.865 121.429 1.00 122.83 ? 162  SER C CB    1 
ATOM   9227  O  OG    . SER C 1  162 ? 6.419   -59.029 121.672 1.00 125.29 ? 162  SER C OG    1 
ATOM   9228  N  N     . SER C 1  163 ? 4.768   -57.138 118.765 1.00 136.19 ? 163  SER C N     1 
ATOM   9229  C  CA    . SER C 1  163 ? 5.330   -56.584 117.539 1.00 136.08 ? 163  SER C CA    1 
ATOM   9230  C  C     . SER C 1  163 ? 5.297   -55.061 117.578 1.00 137.34 ? 163  SER C C     1 
ATOM   9231  O  O     . SER C 1  163 ? 6.295   -54.393 117.286 1.00 139.94 ? 163  SER C O     1 
ATOM   9232  C  CB    . SER C 1  163 ? 4.562   -57.116 116.328 1.00 141.50 ? 163  SER C CB    1 
ATOM   9233  O  OG    . SER C 1  163 ? 4.176   -58.467 116.521 1.00 137.04 ? 163  SER C OG    1 
ATOM   9234  N  N     . MET C 1  164 ? 4.131   -54.502 117.925 1.00 136.58 ? 164  MET C N     1 
ATOM   9235  C  CA    . MET C 1  164 ? 3.960   -53.057 118.070 1.00 139.19 ? 164  MET C CA    1 
ATOM   9236  C  C     . MET C 1  164 ? 5.030   -52.447 118.969 1.00 150.32 ? 164  MET C C     1 
ATOM   9237  O  O     . MET C 1  164 ? 5.596   -51.392 118.658 1.00 144.69 ? 164  MET C O     1 
ATOM   9238  C  CB    . MET C 1  164 ? 2.564   -52.752 118.613 1.00 139.01 ? 164  MET C CB    1 
ATOM   9239  C  CG    . MET C 1  164 ? 2.312   -51.281 118.868 1.00 143.01 ? 164  MET C CG    1 
ATOM   9240  S  SD    . MET C 1  164 ? 2.008   -50.410 117.320 1.00 136.33 ? 164  MET C SD    1 
ATOM   9241  C  CE    . MET C 1  164 ? 1.865   -48.721 117.891 1.00 142.78 ? 164  MET C CE    1 
ATOM   9242  N  N     . THR C 1  165 ? 5.316   -53.112 120.090 1.00 154.84 ? 165  THR C N     1 
ATOM   9243  C  CA    . THR C 1  165 ? 6.287   -52.625 121.065 1.00 154.86 ? 165  THR C CA    1 
ATOM   9244  C  C     . THR C 1  165 ? 7.704   -52.661 120.511 1.00 158.11 ? 165  THR C C     1 
ATOM   9245  O  O     . THR C 1  165 ? 8.495   -51.742 120.752 1.00 158.87 ? 165  THR C O     1 
ATOM   9246  C  CB    . THR C 1  165 ? 6.188   -53.446 122.351 1.00 148.09 ? 165  THR C CB    1 
ATOM   9247  O  OG1   . THR C 1  165 ? 4.833   -53.440 122.817 1.00 145.77 ? 165  THR C OG1   1 
ATOM   9248  C  CG2   . THR C 1  165 ? 7.084   -52.856 123.431 1.00 142.67 ? 165  THR C CG2   1 
ATOM   9249  N  N     . LYS C 1  166 ? 8.041   -53.711 119.763 1.00 151.32 ? 166  LYS C N     1 
ATOM   9250  C  CA    . LYS C 1  166 ? 9.362   -53.792 119.150 1.00 157.96 ? 166  LYS C CA    1 
ATOM   9251  C  C     . LYS C 1  166 ? 9.562   -52.676 118.131 1.00 158.92 ? 166  LYS C C     1 
ATOM   9252  O  O     . LYS C 1  166 ? 10.670  -52.143 117.992 1.00 158.35 ? 166  LYS C O     1 
ATOM   9253  C  CB    . LYS C 1  166 ? 9.536   -55.158 118.483 1.00 153.16 ? 166  LYS C CB    1 
ATOM   9254  C  CG    . LYS C 1  166 ? 9.729   -56.316 119.453 1.00 149.90 ? 166  LYS C CG    1 
ATOM   9255  C  CD    . LYS C 1  166 ? 9.955   -57.632 118.715 1.00 147.76 ? 166  LYS C CD    1 
ATOM   9256  C  CE    . LYS C 1  166 ? 10.477  -58.711 119.654 1.00 142.79 ? 166  LYS C CE    1 
ATOM   9257  N  NZ    . LYS C 1  166 ? 10.577  -60.043 118.993 1.00 138.33 ? 166  LYS C NZ    1 
ATOM   9258  N  N     . ILE C 1  167 ? 8.501   -52.304 117.415 1.00 153.98 ? 167  ILE C N     1 
ATOM   9259  C  CA    . ILE C 1  167 ? 8.578   -51.176 116.490 1.00 157.47 ? 167  ILE C CA    1 
ATOM   9260  C  C     . ILE C 1  167 ? 8.766   -49.862 117.244 1.00 159.82 ? 167  ILE C C     1 
ATOM   9261  O  O     . ILE C 1  167 ? 9.615   -49.038 116.885 1.00 163.38 ? 167  ILE C O     1 
ATOM   9262  C  CB    . ILE C 1  167 ? 7.317   -51.130 115.608 1.00 157.58 ? 167  ILE C CB    1 
ATOM   9263  C  CG1   . ILE C 1  167 ? 7.320   -52.276 114.598 1.00 161.78 ? 167  ILE C CG1   1 
ATOM   9264  C  CG2   . ILE C 1  167 ? 7.202   -49.787 114.900 1.00 162.95 ? 167  ILE C CG2   1 
ATOM   9265  C  CD1   . ILE C 1  167 ? 5.943   -52.621 114.077 1.00 156.52 ? 167  ILE C CD1   1 
ATOM   9266  N  N     . LEU C 1  168 ? 7.974   -49.642 118.295 1.00 165.43 ? 168  LEU C N     1 
ATOM   9267  C  CA    . LEU C 1  168 ? 8.072   -48.411 119.077 1.00 161.32 ? 168  LEU C CA    1 
ATOM   9268  C  C     . LEU C 1  168 ? 9.376   -48.262 119.853 1.00 164.84 ? 168  LEU C C     1 
ATOM   9269  O  O     . LEU C 1  168 ? 9.742   -47.129 120.183 1.00 156.30 ? 168  LEU C O     1 
ATOM   9270  C  CB    . LEU C 1  168 ? 6.901   -48.310 120.055 1.00 155.86 ? 168  LEU C CB    1 
ATOM   9271  C  CG    . LEU C 1  168 ? 5.522   -48.012 119.468 1.00 143.05 ? 168  LEU C CG    1 
ATOM   9272  C  CD1   . LEU C 1  168 ? 4.441   -48.561 120.376 1.00 137.65 ? 168  LEU C CD1   1 
ATOM   9273  C  CD2   . LEU C 1  168 ? 5.345   -46.517 119.265 1.00 143.81 ? 168  LEU C CD2   1 
ATOM   9274  N  N     . GLU C 1  169 ? 10.076  -49.360 120.160 1.00 180.63 ? 169  GLU C N     1 
ATOM   9275  C  CA    . GLU C 1  169 ? 11.264  -49.306 121.014 1.00 182.60 ? 169  GLU C CA    1 
ATOM   9276  C  C     . GLU C 1  169 ? 12.263  -48.216 120.619 1.00 187.35 ? 169  GLU C C     1 
ATOM   9277  O  O     . GLU C 1  169 ? 12.577  -47.361 121.457 1.00 186.12 ? 169  GLU C O     1 
ATOM   9278  C  CB    . GLU C 1  169 ? 11.977  -50.662 121.066 1.00 182.50 ? 169  GLU C CB    1 
ATOM   9279  C  CG    . GLU C 1  169 ? 12.949  -50.765 122.240 1.00 181.16 ? 169  GLU C CG    1 
ATOM   9280  C  CD    . GLU C 1  169 ? 13.862  -51.973 122.165 1.00 177.91 ? 169  GLU C CD    1 
ATOM   9281  O  OE1   . GLU C 1  169 ? 13.509  -52.948 121.469 1.00 179.15 ? 169  GLU C OE1   1 
ATOM   9282  O  OE2   . GLU C 1  169 ? 14.931  -51.949 122.812 1.00 171.12 ? 169  GLU C OE2   1 
ATOM   9283  N  N     . PRO C 1  170 ? 12.799  -48.195 119.392 1.00 176.81 ? 170  PRO C N     1 
ATOM   9284  C  CA    . PRO C 1  170 ? 13.846  -47.201 119.106 1.00 168.95 ? 170  PRO C CA    1 
ATOM   9285  C  C     . PRO C 1  170 ? 13.334  -45.770 119.070 1.00 168.95 ? 170  PRO C C     1 
ATOM   9286  O  O     . PRO C 1  170 ? 14.090  -44.852 119.409 1.00 165.85 ? 170  PRO C O     1 
ATOM   9287  C  CB    . PRO C 1  170 ? 14.380  -47.640 117.737 1.00 166.67 ? 170  PRO C CB    1 
ATOM   9288  C  CG    . PRO C 1  170 ? 13.230  -48.315 117.094 1.00 165.42 ? 170  PRO C CG    1 
ATOM   9289  C  CD    . PRO C 1  170 ? 12.456  -48.984 118.192 1.00 166.48 ? 170  PRO C CD    1 
ATOM   9290  N  N     . PHE C 1  171 ? 12.079  -45.547 118.674 1.00 168.17 ? 171  PHE C N     1 
ATOM   9291  C  CA    . PHE C 1  171 ? 11.549  -44.187 118.641 1.00 166.77 ? 171  PHE C CA    1 
ATOM   9292  C  C     . PHE C 1  171 ? 11.482  -43.573 120.035 1.00 173.07 ? 171  PHE C C     1 
ATOM   9293  O  O     . PHE C 1  171 ? 11.791  -42.390 120.218 1.00 172.96 ? 171  PHE C O     1 
ATOM   9294  C  CB    . PHE C 1  171 ? 10.164  -44.168 117.995 1.00 171.14 ? 171  PHE C CB    1 
ATOM   9295  C  CG    . PHE C 1  171 ? 9.661   -42.783 117.695 1.00 172.93 ? 171  PHE C CG    1 
ATOM   9296  C  CD1   . PHE C 1  171 ? 10.006  -42.150 116.518 1.00 181.05 ? 171  PHE C CD1   1 
ATOM   9297  C  CD2   . PHE C 1  171 ? 8.862   -42.106 118.599 1.00 174.92 ? 171  PHE C CD2   1 
ATOM   9298  C  CE1   . PHE C 1  171 ? 9.560   -40.875 116.235 1.00 183.09 ? 171  PHE C CE1   1 
ATOM   9299  C  CE2   . PHE C 1  171 ? 8.410   -40.828 118.323 1.00 177.16 ? 171  PHE C CE2   1 
ATOM   9300  C  CZ    . PHE C 1  171 ? 8.761   -40.212 117.139 1.00 179.09 ? 171  PHE C CZ    1 
ATOM   9301  N  N     . LYS C 1  172 ? 11.086  -44.369 121.032 1.00 169.44 ? 172  LYS C N     1 
ATOM   9302  C  CA    . LYS C 1  172 ? 11.044  -43.893 122.414 1.00 171.74 ? 172  LYS C CA    1 
ATOM   9303  C  C     . LYS C 1  172 ? 12.442  -43.605 122.953 1.00 180.24 ? 172  LYS C C     1 
ATOM   9304  O  O     . LYS C 1  172 ? 12.666  -42.569 123.590 1.00 175.00 ? 172  LYS C O     1 
ATOM   9305  C  CB    . LYS C 1  172 ? 10.290  -44.902 123.286 1.00 170.56 ? 172  LYS C CB    1 
ATOM   9306  C  CG    . LYS C 1  172 ? 8.919   -45.260 122.700 1.00 164.49 ? 172  LYS C CG    1 
ATOM   9307  C  CD    . LYS C 1  172 ? 7.811   -45.430 123.739 1.00 142.82 ? 172  LYS C CD    1 
ATOM   9308  C  CE    . LYS C 1  172 ? 8.205   -46.329 124.893 1.00 139.33 ? 172  LYS C CE    1 
ATOM   9309  N  NZ    . LYS C 1  172 ? 7.315   -46.096 126.065 1.00 132.16 ? 172  LYS C NZ    1 
ATOM   9310  N  N     . LYS C 1  173 ? 13.392  -44.520 122.732 1.00 201.80 ? 173  LYS C N     1 
ATOM   9311  C  CA    . LYS C 1  173 ? 14.727  -44.359 123.304 1.00 202.37 ? 173  LYS C CA    1 
ATOM   9312  C  C     . LYS C 1  173 ? 15.401  -43.095 122.781 1.00 207.88 ? 173  LYS C C     1 
ATOM   9313  O  O     . LYS C 1  173 ? 16.150  -42.435 123.511 1.00 206.54 ? 173  LYS C O     1 
ATOM   9314  C  CB    . LYS C 1  173 ? 15.578  -45.593 122.991 1.00 202.83 ? 173  LYS C CB    1 
ATOM   9315  C  CG    . LYS C 1  173 ? 17.065  -45.431 123.269 1.00 207.48 ? 173  LYS C CG    1 
ATOM   9316  C  CD    . LYS C 1  173 ? 17.660  -46.686 123.895 1.00 207.99 ? 173  LYS C CD    1 
ATOM   9317  C  CE    . LYS C 1  173 ? 17.322  -47.926 123.082 1.00 204.97 ? 173  LYS C CE    1 
ATOM   9318  N  NZ    . LYS C 1  173 ? 17.409  -49.170 123.897 1.00 197.04 ? 173  LYS C NZ    1 
ATOM   9319  N  N     . GLN C 1  174 ? 15.135  -42.745 121.526 1.00 188.78 ? 174  GLN C N     1 
ATOM   9320  C  CA    . GLN C 1  174 ? 15.790  -41.674 120.788 1.00 184.86 ? 174  GLN C CA    1 
ATOM   9321  C  C     . GLN C 1  174 ? 14.961  -40.394 120.758 1.00 181.62 ? 174  GLN C C     1 
ATOM   9322  O  O     . GLN C 1  174 ? 15.325  -39.447 120.054 1.00 182.54 ? 174  GLN C O     1 
ATOM   9323  C  CB    . GLN C 1  174 ? 16.107  -42.126 119.362 1.00 186.24 ? 174  GLN C CB    1 
ATOM   9324  C  CG    . GLN C 1  174 ? 16.825  -43.458 119.279 1.00 187.86 ? 174  GLN C CG    1 
ATOM   9325  C  CD    . GLN C 1  174 ? 16.815  -44.032 117.878 1.00 183.76 ? 174  GLN C CD    1 
ATOM   9326  O  OE1   . GLN C 1  174 ? 16.892  -43.298 116.893 1.00 186.79 ? 174  GLN C OE1   1 
ATOM   9327  N  NE2   . GLN C 1  174 ? 16.721  -45.352 117.781 1.00 181.19 ? 174  GLN C NE2   1 
ATOM   9328  N  N     . ASN C 1  175 ? 13.859  -40.348 121.503 1.00 181.01 ? 175  ASN C N     1 
ATOM   9329  C  CA    . ASN C 1  175 ? 13.099  -39.119 121.740 1.00 175.51 ? 175  ASN C CA    1 
ATOM   9330  C  C     . ASN C 1  175 ? 12.788  -38.969 123.225 1.00 173.39 ? 175  ASN C C     1 
ATOM   9331  O  O     . ASN C 1  175 ? 11.624  -39.025 123.639 1.00 170.10 ? 175  ASN C O     1 
ATOM   9332  C  CB    . ASN C 1  175 ? 11.807  -39.126 120.921 1.00 170.49 ? 175  ASN C CB    1 
ATOM   9333  C  CG    . ASN C 1  175 ? 12.056  -38.992 119.432 1.00 170.39 ? 175  ASN C CG    1 
ATOM   9334  O  OD1   . ASN C 1  175 ? 12.413  -37.921 118.943 1.00 173.04 ? 175  ASN C OD1   1 
ATOM   9335  N  ND2   . ASN C 1  175 ? 11.861  -40.084 118.701 1.00 168.12 ? 175  ASN C ND2   1 
ATOM   9336  N  N     . PRO C 1  176 ? 13.818  -38.789 124.062 1.00 179.84 ? 176  PRO C N     1 
ATOM   9337  C  CA    . PRO C 1  176 ? 13.615  -38.863 125.518 1.00 174.22 ? 176  PRO C CA    1 
ATOM   9338  C  C     . PRO C 1  176 ? 12.734  -37.763 126.090 1.00 185.91 ? 176  PRO C C     1 
ATOM   9339  O  O     . PRO C 1  176 ? 12.506  -37.757 127.305 1.00 179.27 ? 176  PRO C O     1 
ATOM   9340  C  CB    . PRO C 1  176 ? 15.044  -38.753 126.080 1.00 165.14 ? 176  PRO C CB    1 
ATOM   9341  C  CG    . PRO C 1  176 ? 15.962  -38.937 124.906 1.00 163.85 ? 176  PRO C CG    1 
ATOM   9342  C  CD    . PRO C 1  176 ? 15.206  -38.443 123.720 1.00 169.32 ? 176  PRO C CD    1 
ATOM   9343  N  N     . ASP C 1  177 ? 12.231  -36.829 125.279 1.00 218.71 ? 177  ASP C N     1 
ATOM   9344  C  CA    . ASP C 1  177 ? 11.395  -35.751 125.791 1.00 216.90 ? 177  ASP C CA    1 
ATOM   9345  C  C     . ASP C 1  177 ? 9.973   -35.903 125.277 1.00 212.75 ? 177  ASP C C     1 
ATOM   9346  O  O     . ASP C 1  177 ? 9.228   -34.922 125.190 1.00 216.12 ? 177  ASP C O     1 
ATOM   9347  C  CB    . ASP C 1  177 ? 11.946  -34.387 125.371 1.00 223.24 ? 177  ASP C CB    1 
ATOM   9348  C  CG    . ASP C 1  177 ? 13.364  -34.154 125.837 1.00 223.49 ? 177  ASP C CG    1 
ATOM   9349  O  OD1   . ASP C 1  177 ? 13.707  -34.588 126.955 1.00 220.46 ? 177  ASP C OD1   1 
ATOM   9350  O  OD2   . ASP C 1  177 ? 14.138  -33.534 125.077 1.00 223.87 ? 177  ASP C OD2   1 
ATOM   9351  N  N     . ILE C 1  178 ? 9.596   -37.129 124.936 1.00 180.93 ? 178  ILE C N     1 
ATOM   9352  C  CA    . ILE C 1  178 ? 8.232   -37.540 124.654 1.00 171.41 ? 178  ILE C CA    1 
ATOM   9353  C  C     . ILE C 1  178 ? 7.861   -38.650 125.630 1.00 164.74 ? 178  ILE C C     1 
ATOM   9354  O  O     . ILE C 1  178 ? 8.728   -39.372 126.135 1.00 160.34 ? 178  ILE C O     1 
ATOM   9355  C  CB    . ILE C 1  178 ? 8.095   -37.980 123.172 1.00 157.88 ? 178  ILE C CB    1 
ATOM   9356  C  CG1   . ILE C 1  178 ? 7.944   -36.759 122.258 1.00 154.74 ? 178  ILE C CG1   1 
ATOM   9357  C  CG2   . ILE C 1  178 ? 6.935   -38.921 122.947 1.00 140.56 ? 178  ILE C CG2   1 
ATOM   9358  C  CD1   . ILE C 1  178 ? 9.246   -36.074 121.902 1.00 169.59 ? 178  ILE C CD1   1 
ATOM   9359  N  N     . VAL C 1  179 ? 6.568   -38.779 125.902 1.00 148.66 ? 179  VAL C N     1 
ATOM   9360  C  CA    . VAL C 1  179 ? 6.027   -39.856 126.719 1.00 144.46 ? 179  VAL C CA    1 
ATOM   9361  C  C     . VAL C 1  179 ? 4.978   -40.544 125.864 1.00 143.71 ? 179  VAL C C     1 
ATOM   9362  O  O     . VAL C 1  179 ? 4.041   -39.892 125.387 1.00 146.00 ? 179  VAL C O     1 
ATOM   9363  C  CB    . VAL C 1  179 ? 5.421   -39.341 128.034 1.00 146.89 ? 179  VAL C CB    1 
ATOM   9364  C  CG1   . VAL C 1  179 ? 4.483   -40.381 128.630 1.00 141.42 ? 179  VAL C CG1   1 
ATOM   9365  C  CG2   . VAL C 1  179 ? 6.522   -38.977 129.018 1.00 147.62 ? 179  VAL C CG2   1 
ATOM   9366  N  N     . ILE C 1  180 ? 5.123   -41.851 125.662 1.00 141.52 ? 180  ILE C N     1 
ATOM   9367  C  CA    . ILE C 1  180 ? 4.161   -42.593 124.859 1.00 139.92 ? 180  ILE C CA    1 
ATOM   9368  C  C     . ILE C 1  180 ? 3.576   -43.718 125.690 1.00 141.55 ? 180  ILE C C     1 
ATOM   9369  O  O     . ILE C 1  180 ? 4.303   -44.600 126.164 1.00 145.29 ? 180  ILE C O     1 
ATOM   9370  C  CB    . ILE C 1  180 ? 4.790   -43.163 123.578 1.00 139.97 ? 180  ILE C CB    1 
ATOM   9371  C  CG1   . ILE C 1  180 ? 5.549   -42.081 122.816 1.00 138.72 ? 180  ILE C CG1   1 
ATOM   9372  C  CG2   . ILE C 1  180 ? 3.718   -43.791 122.696 1.00 136.79 ? 180  ILE C CG2   1 
ATOM   9373  C  CD1   . ILE C 1  180 ? 6.038   -42.525 121.458 1.00 150.04 ? 180  ILE C CD1   1 
ATOM   9374  N  N     . TYR C 1  181 ? 2.261   -43.681 125.854 1.00 134.64 ? 181  TYR C N     1 
ATOM   9375  C  CA    . TYR C 1  181 ? 1.498   -44.711 126.539 1.00 133.20 ? 181  TYR C CA    1 
ATOM   9376  C  C     . TYR C 1  181 ? 0.892   -45.551 125.423 1.00 131.49 ? 181  TYR C C     1 
ATOM   9377  O  O     . TYR C 1  181 ? -0.030  -45.098 124.738 1.00 135.00 ? 181  TYR C O     1 
ATOM   9378  C  CB    . TYR C 1  181 ? 0.430   -44.094 127.439 1.00 139.62 ? 181  TYR C CB    1 
ATOM   9379  C  CG    . TYR C 1  181 ? 0.887   -43.864 128.864 1.00 134.50 ? 181  TYR C CG    1 
ATOM   9380  C  CD1   . TYR C 1  181 ? 1.846   -42.899 129.152 1.00 132.74 ? 181  TYR C CD1   1 
ATOM   9381  C  CD2   . TYR C 1  181 ? 0.361   -44.599 129.918 1.00 122.19 ? 181  TYR C CD2   1 
ATOM   9382  C  CE1   . TYR C 1  181 ? 2.264   -42.666 130.448 1.00 128.79 ? 181  TYR C CE1   1 
ATOM   9383  C  CE2   . TYR C 1  181 ? 0.781   -44.379 131.219 1.00 118.15 ? 181  TYR C CE2   1 
ATOM   9384  C  CZ    . TYR C 1  181 ? 1.730   -43.410 131.478 1.00 123.07 ? 181  TYR C CZ    1 
ATOM   9385  O  OH    . TYR C 1  181 ? 2.159   -43.190 132.767 1.00 116.27 ? 181  TYR C OH    1 
ATOM   9386  N  N     . GLN C 1  182 ? 1.405   -46.757 125.218 1.00 130.27 ? 182  GLN C N     1 
ATOM   9387  C  CA    . GLN C 1  182 ? 0.819   -47.656 124.234 1.00 129.88 ? 182  GLN C CA    1 
ATOM   9388  C  C     . GLN C 1  182 ? -0.068  -48.693 124.917 1.00 128.79 ? 182  GLN C C     1 
ATOM   9389  O  O     . GLN C 1  182 ? 0.363   -49.387 125.845 1.00 132.52 ? 182  GLN C O     1 
ATOM   9390  C  CB    . GLN C 1  182 ? 1.946   -48.294 123.415 1.00 131.40 ? 182  GLN C CB    1 
ATOM   9391  C  CG    . GLN C 1  182 ? 2.687   -49.426 124.100 1.00 127.95 ? 182  GLN C CG    1 
ATOM   9392  C  CD    . GLN C 1  182 ? 3.449   -50.310 123.144 1.00 126.73 ? 182  GLN C CD    1 
ATOM   9393  O  OE1   . GLN C 1  182 ? 4.681   -50.320 123.144 1.00 130.05 ? 182  GLN C OE1   1 
ATOM   9394  N  NE2   . GLN C 1  182 ? 2.726   -51.067 122.328 1.00 122.66 ? 182  GLN C NE2   1 
ATOM   9395  N  N     . TYR C 1  183 ? -1.334  -48.735 124.501 1.00 124.36 ? 183  TYR C N     1 
ATOM   9396  C  CA    . TYR C 1  183 ? -2.291  -49.772 124.881 1.00 128.29 ? 183  TYR C CA    1 
ATOM   9397  C  C     . TYR C 1  183 ? -2.804  -50.439 123.605 1.00 134.82 ? 183  TYR C C     1 
ATOM   9398  O  O     . TYR C 1  183 ? -3.657  -49.870 122.915 1.00 138.71 ? 183  TYR C O     1 
ATOM   9399  C  CB    . TYR C 1  183 ? -3.421  -49.188 125.722 1.00 120.04 ? 183  TYR C CB    1 
ATOM   9400  C  CG    . TYR C 1  183 ? -4.434  -50.211 126.170 1.00 118.11 ? 183  TYR C CG    1 
ATOM   9401  C  CD1   . TYR C 1  183 ? -4.187  -51.007 127.280 1.00 116.90 ? 183  TYR C CD1   1 
ATOM   9402  C  CD2   . TYR C 1  183 ? -5.636  -50.377 125.499 1.00 123.76 ? 183  TYR C CD2   1 
ATOM   9403  C  CE1   . TYR C 1  183 ? -5.105  -51.943 127.706 1.00 113.29 ? 183  TYR C CE1   1 
ATOM   9404  C  CE2   . TYR C 1  183 ? -6.562  -51.315 125.918 1.00 123.60 ? 183  TYR C CE2   1 
ATOM   9405  C  CZ    . TYR C 1  183 ? -6.290  -52.093 127.023 1.00 114.33 ? 183  TYR C CZ    1 
ATOM   9406  O  OH    . TYR C 1  183 ? -7.203  -53.030 127.444 1.00 116.79 ? 183  TYR C OH    1 
ATOM   9407  N  N     . MET C 1  184 ? -2.285  -51.625 123.278 1.00 134.43 ? 184  MET C N     1 
ATOM   9408  C  CA    . MET C 1  184 ? -2.562  -52.290 122.004 1.00 130.91 ? 184  MET C CA    1 
ATOM   9409  C  C     . MET C 1  184 ? -2.156  -51.402 120.830 1.00 134.10 ? 184  MET C C     1 
ATOM   9410  O  O     . MET C 1  184 ? -0.961  -51.243 120.560 1.00 135.43 ? 184  MET C O     1 
ATOM   9411  C  CB    . MET C 1  184 ? -4.051  -52.663 121.912 1.00 130.55 ? 184  MET C CB    1 
ATOM   9412  C  CG    . MET C 1  184 ? -4.455  -53.519 120.712 1.00 129.43 ? 184  MET C CG    1 
ATOM   9413  S  SD    . MET C 1  184 ? -3.879  -55.220 120.767 1.00 147.30 ? 184  MET C SD    1 
ATOM   9414  C  CE    . MET C 1  184 ? -4.968  -55.895 122.020 1.00 141.74 ? 184  MET C CE    1 
ATOM   9415  N  N     . ASP C 1  185 ? -3.131  -50.807 120.134 1.00 146.37 ? 185  ASP C N     1 
ATOM   9416  C  CA    . ASP C 1  185 ? -2.850  -49.933 118.999 1.00 146.38 ? 185  ASP C CA    1 
ATOM   9417  C  C     . ASP C 1  185 ? -3.034  -48.465 119.340 1.00 147.73 ? 185  ASP C C     1 
ATOM   9418  O  O     . ASP C 1  185 ? -2.635  -47.604 118.550 1.00 149.98 ? 185  ASP C O     1 
ATOM   9419  C  CB    . ASP C 1  185 ? -3.728  -50.256 117.784 1.00 149.94 ? 185  ASP C CB    1 
ATOM   9420  C  CG    . ASP C 1  185 ? -5.194  -49.993 118.029 1.00 145.97 ? 185  ASP C CG    1 
ATOM   9421  O  OD1   . ASP C 1  185 ? -5.598  -49.817 119.196 1.00 147.92 ? 185  ASP C OD1   1 
ATOM   9422  O  OD2   . ASP C 1  185 ? -5.937  -49.906 117.029 1.00 150.57 ? 185  ASP C OD2   1 
ATOM   9423  N  N     . ASP C 1  186 ? -3.631  -48.166 120.488 1.00 146.66 ? 186  ASP C N     1 
ATOM   9424  C  CA    . ASP C 1  186 ? -3.896  -46.789 120.864 1.00 146.51 ? 186  ASP C CA    1 
ATOM   9425  C  C     . ASP C 1  186 ? -2.659  -46.204 121.514 1.00 147.88 ? 186  ASP C C     1 
ATOM   9426  O  O     . ASP C 1  186 ? -2.118  -46.762 122.474 1.00 145.14 ? 186  ASP C O     1 
ATOM   9427  C  CB    . ASP C 1  186 ? -5.084  -46.705 121.821 1.00 143.12 ? 186  ASP C CB    1 
ATOM   9428  C  CG    . ASP C 1  186 ? -6.397  -47.012 121.143 1.00 147.23 ? 186  ASP C CG    1 
ATOM   9429  O  OD1   . ASP C 1  186 ? -6.447  -47.985 120.364 1.00 149.43 ? 186  ASP C OD1   1 
ATOM   9430  O  OD2   . ASP C 1  186 ? -7.379  -46.281 121.387 1.00 149.33 ? 186  ASP C OD2   1 
ATOM   9431  N  N     . LEU C 1  187 ? -2.212  -45.079 120.975 1.00 143.32 ? 187  LEU C N     1 
ATOM   9432  C  CA    . LEU C 1  187 ? -1.023  -44.396 121.446 1.00 144.82 ? 187  LEU C CA    1 
ATOM   9433  C  C     . LEU C 1  187 ? -1.442  -43.059 122.030 1.00 145.24 ? 187  LEU C C     1 
ATOM   9434  O  O     . LEU C 1  187 ? -2.228  -42.326 121.421 1.00 151.32 ? 187  LEU C O     1 
ATOM   9435  C  CB    . LEU C 1  187 ? -0.032  -44.182 120.300 1.00 143.84 ? 187  LEU C CB    1 
ATOM   9436  C  CG    . LEU C 1  187 ? 0.598   -45.416 119.651 1.00 145.05 ? 187  LEU C CG    1 
ATOM   9437  C  CD1   . LEU C 1  187 ? 1.952   -45.072 119.052 1.00 154.04 ? 187  LEU C CD1   1 
ATOM   9438  C  CD2   . LEU C 1  187 ? 0.718   -46.560 120.637 1.00 144.81 ? 187  LEU C CD2   1 
ATOM   9439  N  N     . TYR C 1  188 ? -0.918  -42.751 123.207 1.00 142.50 ? 188  TYR C N     1 
ATOM   9440  C  CA    . TYR C 1  188 ? -0.975  -41.415 123.772 1.00 142.92 ? 188  TYR C CA    1 
ATOM   9441  C  C     . TYR C 1  188 ? 0.441   -40.865 123.732 1.00 138.63 ? 188  TYR C C     1 
ATOM   9442  O  O     . TYR C 1  188 ? 1.390   -41.575 124.073 1.00 136.66 ? 188  TYR C O     1 
ATOM   9443  C  CB    . TYR C 1  188 ? -1.535  -41.475 125.200 1.00 140.82 ? 188  TYR C CB    1 
ATOM   9444  C  CG    . TYR C 1  188 ? -1.200  -40.317 126.111 1.00 134.82 ? 188  TYR C CG    1 
ATOM   9445  C  CD1   . TYR C 1  188 ? -0.011  -40.289 126.832 1.00 138.65 ? 188  TYR C CD1   1 
ATOM   9446  C  CD2   . TYR C 1  188 ? -2.095  -39.271 126.287 1.00 132.47 ? 188  TYR C CD2   1 
ATOM   9447  C  CE1   . TYR C 1  188 ? 0.290   -39.237 127.673 1.00 135.16 ? 188  TYR C CE1   1 
ATOM   9448  C  CE2   . TYR C 1  188 ? -1.805  -38.217 127.129 1.00 132.63 ? 188  TYR C CE2   1 
ATOM   9449  C  CZ    . TYR C 1  188 ? -0.612  -38.204 127.820 1.00 133.91 ? 188  TYR C CZ    1 
ATOM   9450  O  OH    . TYR C 1  188 ? -0.319  -37.154 128.660 1.00 134.21 ? 188  TYR C OH    1 
ATOM   9451  N  N     . VAL C 1  189 ? 0.587   -39.616 123.299 1.00 138.91 ? 189  VAL C N     1 
ATOM   9452  C  CA    . VAL C 1  189 ? 1.902   -39.013 123.112 1.00 141.29 ? 189  VAL C CA    1 
ATOM   9453  C  C     . VAL C 1  189 ? 1.896   -37.621 123.724 1.00 143.38 ? 189  VAL C C     1 
ATOM   9454  O  O     . VAL C 1  189 ? 1.125   -36.754 123.296 1.00 146.18 ? 189  VAL C O     1 
ATOM   9455  C  CB    . VAL C 1  189 ? 2.294   -38.941 121.625 1.00 147.62 ? 189  VAL C CB    1 
ATOM   9456  C  CG1   . VAL C 1  189 ? 3.735   -38.505 121.484 1.00 144.13 ? 189  VAL C CG1   1 
ATOM   9457  C  CG2   . VAL C 1  189 ? 2.072   -40.285 120.935 1.00 145.09 ? 189  VAL C CG2   1 
ATOM   9458  N  N     . GLY C 1  190 ? 2.755   -37.407 124.706 1.00 144.53 ? 190  GLY C N     1 
ATOM   9459  C  CA    . GLY C 1  190 ? 2.760   -36.162 125.458 1.00 149.21 ? 190  GLY C CA    1 
ATOM   9460  C  C     . GLY C 1  190 ? 4.151   -35.579 125.561 1.00 151.66 ? 190  GLY C C     1 
ATOM   9461  O  O     . GLY C 1  190 ? 5.136   -36.309 125.671 1.00 150.00 ? 190  GLY C O     1 
ATOM   9462  N  N     . SER C 1  191 ? 4.223   -34.250 125.521 1.00 156.65 ? 191  SER C N     1 
ATOM   9463  C  CA    . SER C 1  191 ? 5.495   -33.550 125.624 1.00 159.30 ? 191  SER C CA    1 
ATOM   9464  C  C     . SER C 1  191 ? 5.271   -32.201 126.290 1.00 162.03 ? 191  SER C C     1 
ATOM   9465  O  O     . SER C 1  191 ? 4.151   -31.684 126.326 1.00 162.97 ? 191  SER C O     1 
ATOM   9466  C  CB    . SER C 1  191 ? 6.145   -33.362 124.249 1.00 167.43 ? 191  SER C CB    1 
ATOM   9467  O  OG    . SER C 1  191 ? 5.428   -32.415 123.476 1.00 166.91 ? 191  SER C OG    1 
ATOM   9468  N  N     . ASP C 1  192 ? 6.353   -31.628 126.815 1.00 162.30 ? 192  ASP C N     1 
ATOM   9469  C  CA    . ASP C 1  192 ? 6.355   -30.230 127.243 1.00 163.87 ? 192  ASP C CA    1 
ATOM   9470  C  C     . ASP C 1  192 ? 7.068   -29.348 126.228 1.00 172.63 ? 192  ASP C C     1 
ATOM   9471  O  O     . ASP C 1  192 ? 7.752   -28.383 126.582 1.00 157.72 ? 192  ASP C O     1 
ATOM   9472  C  CB    . ASP C 1  192 ? 6.997   -30.095 128.619 1.00 151.71 ? 192  ASP C CB    1 
ATOM   9473  C  CG    . ASP C 1  192 ? 6.065   -30.508 129.739 1.00 152.86 ? 192  ASP C CG    1 
ATOM   9474  O  OD1   . ASP C 1  192 ? 4.833   -30.475 129.531 1.00 152.03 ? 192  ASP C OD1   1 
ATOM   9475  O  OD2   . ASP C 1  192 ? 6.563   -30.869 130.826 1.00 149.27 ? 192  ASP C OD2   1 
ATOM   9476  N  N     . LEU C 1  193 ? 6.908   -29.677 124.952 1.00 189.56 ? 193  LEU C N     1 
ATOM   9477  C  CA    . LEU C 1  193 ? 7.425   -28.891 123.844 1.00 194.81 ? 193  LEU C CA    1 
ATOM   9478  C  C     . LEU C 1  193 ? 6.380   -27.906 123.337 1.00 199.49 ? 193  LEU C C     1 
ATOM   9479  O  O     . LEU C 1  193 ? 5.172   -28.127 123.463 1.00 198.45 ? 193  LEU C O     1 
ATOM   9480  C  CB    . LEU C 1  193 ? 7.897   -29.795 122.703 1.00 193.54 ? 193  LEU C CB    1 
ATOM   9481  C  CG    . LEU C 1  193 ? 9.169   -30.588 123.007 1.00 185.63 ? 193  LEU C CG    1 
ATOM   9482  C  CD1   . LEU C 1  193 ? 9.629   -31.363 121.785 1.00 186.64 ? 193  LEU C CD1   1 
ATOM   9483  C  CD2   . LEU C 1  193 ? 10.269  -29.658 123.499 1.00 181.35 ? 193  LEU C CD2   1 
ATOM   9484  N  N     . GLU C 1  194 ? 6.866   -26.801 122.778 1.00 191.22 ? 194  GLU C N     1 
ATOM   9485  C  CA    . GLU C 1  194 ? 6.002   -25.865 122.074 1.00 191.10 ? 194  GLU C CA    1 
ATOM   9486  C  C     . GLU C 1  194 ? 5.272   -26.596 120.953 1.00 197.82 ? 194  GLU C C     1 
ATOM   9487  O  O     . GLU C 1  194 ? 5.880   -27.362 120.199 1.00 199.49 ? 194  GLU C O     1 
ATOM   9488  C  CB    . GLU C 1  194 ? 6.821   -24.694 121.528 1.00 186.96 ? 194  GLU C CB    1 
ATOM   9489  C  CG    . GLU C 1  194 ? 6.009   -23.650 120.777 1.00 193.09 ? 194  GLU C CG    1 
ATOM   9490  C  CD    . GLU C 1  194 ? 6.012   -23.869 119.279 1.00 199.11 ? 194  GLU C CD    1 
ATOM   9491  O  OE1   . GLU C 1  194 ? 6.842   -24.668 118.797 1.00 198.07 ? 194  GLU C OE1   1 
ATOM   9492  O  OE2   . GLU C 1  194 ? 5.184   -23.244 118.583 1.00 199.35 ? 194  GLU C OE2   1 
ATOM   9493  N  N     . ILE C 1  195 ? 3.961   -26.362 120.858 1.00 196.70 ? 195  ILE C N     1 
ATOM   9494  C  CA    . ILE C 1  195 ? 3.036   -27.108 120.005 1.00 193.36 ? 195  ILE C CA    1 
ATOM   9495  C  C     . ILE C 1  195 ? 3.540   -27.228 118.570 1.00 200.08 ? 195  ILE C C     1 
ATOM   9496  O  O     . ILE C 1  195 ? 3.130   -28.136 117.839 1.00 195.59 ? 195  ILE C O     1 
ATOM   9497  C  CB    . ILE C 1  195 ? 1.635   -26.463 120.036 1.00 185.14 ? 195  ILE C CB    1 
ATOM   9498  C  CG1   . ILE C 1  195 ? 0.574   -27.417 119.476 1.00 184.26 ? 195  ILE C CG1   1 
ATOM   9499  C  CG2   . ILE C 1  195 ? 1.627   -25.153 119.262 1.00 189.79 ? 195  ILE C CG2   1 
ATOM   9500  C  CD1   . ILE C 1  195 ? 0.354   -28.655 120.315 1.00 180.28 ? 195  ILE C CD1   1 
ATOM   9501  N  N     . GLY C 1  196 ? 4.439   -26.337 118.153 1.00 223.69 ? 196  GLY C N     1 
ATOM   9502  C  CA    . GLY C 1  196 ? 5.043   -26.493 116.845 1.00 227.20 ? 196  GLY C CA    1 
ATOM   9503  C  C     . GLY C 1  196 ? 5.942   -27.711 116.763 1.00 225.97 ? 196  GLY C C     1 
ATOM   9504  O  O     . GLY C 1  196 ? 5.656   -28.628 115.987 1.00 224.60 ? 196  GLY C O     1 
ATOM   9505  N  N     . GLN C 1  197 ? 7.033   -27.745 117.539 1.00 200.99 ? 197  GLN C N     1 
ATOM   9506  C  CA    . GLN C 1  197 ? 7.885   -28.934 117.558 1.00 194.19 ? 197  GLN C CA    1 
ATOM   9507  C  C     . GLN C 1  197 ? 7.115   -30.184 117.968 1.00 192.92 ? 197  GLN C C     1 
ATOM   9508  O  O     . GLN C 1  197 ? 7.527   -31.294 117.613 1.00 188.25 ? 197  GLN C O     1 
ATOM   9509  C  CB    . GLN C 1  197 ? 9.160   -28.737 118.387 1.00 188.49 ? 197  GLN C CB    1 
ATOM   9510  C  CG    . GLN C 1  197 ? 9.571   -27.294 118.601 1.00 185.95 ? 197  GLN C CG    1 
ATOM   9511  C  CD    . GLN C 1  197 ? 10.581  -27.147 119.716 1.00 184.64 ? 197  GLN C CD    1 
ATOM   9512  O  OE1   . GLN C 1  197 ? 10.245  -27.135 120.903 1.00 186.24 ? 197  GLN C OE1   1 
ATOM   9513  N  NE2   . GLN C 1  197 ? 11.839  -27.022 119.333 1.00 186.34 ? 197  GLN C NE2   1 
ATOM   9514  N  N     . HIS C 1  198 ? 6.018   -30.037 118.716 1.00 196.01 ? 198  HIS C N     1 
ATOM   9515  C  CA    . HIS C 1  198 ? 5.219   -31.205 119.068 1.00 191.33 ? 198  HIS C CA    1 
ATOM   9516  C  C     . HIS C 1  198 ? 4.531   -31.770 117.833 1.00 194.51 ? 198  HIS C C     1 
ATOM   9517  O  O     . HIS C 1  198 ? 4.605   -32.977 117.578 1.00 189.25 ? 198  HIS C O     1 
ATOM   9518  C  CB    . HIS C 1  198 ? 4.181   -30.839 120.137 1.00 186.37 ? 198  HIS C CB    1 
ATOM   9519  C  CG    . HIS C 1  198 ? 3.229   -31.951 120.474 1.00 172.11 ? 198  HIS C CG    1 
ATOM   9520  N  ND1   . HIS C 1  198 ? 3.471   -32.867 121.476 1.00 163.92 ? 198  HIS C ND1   1 
ATOM   9521  C  CD2   . HIS C 1  198 ? 2.029   -32.287 119.942 1.00 170.61 ? 198  HIS C CD2   1 
ATOM   9522  C  CE1   . HIS C 1  198 ? 2.463   -33.720 121.544 1.00 155.41 ? 198  HIS C CE1   1 
ATOM   9523  N  NE2   . HIS C 1  198 ? 1.576   -33.390 120.623 1.00 157.35 ? 198  HIS C NE2   1 
ATOM   9524  N  N     . ARG C 1  199 ? 3.849   -30.921 117.056 1.00 204.52 ? 199  ARG C N     1 
ATOM   9525  C  CA    . ARG C 1  199 ? 3.158   -31.424 115.873 1.00 206.51 ? 199  ARG C CA    1 
ATOM   9526  C  C     . ARG C 1  199 ? 4.146   -32.120 114.938 1.00 208.54 ? 199  ARG C C     1 
ATOM   9527  O  O     . ARG C 1  199 ? 3.814   -33.118 114.288 1.00 208.74 ? 199  ARG C O     1 
ATOM   9528  C  CB    . ARG C 1  199 ? 2.491   -30.272 115.119 1.00 211.27 ? 199  ARG C CB    1 
ATOM   9529  C  CG    . ARG C 1  199 ? 1.303   -29.600 115.796 1.00 204.64 ? 199  ARG C CG    1 
ATOM   9530  C  CD    . ARG C 1  199 ? -0.015  -30.320 115.712 1.00 202.59 ? 199  ARG C CD    1 
ATOM   9531  N  NE    . ARG C 1  199 ? -0.652  -30.225 117.024 1.00 204.73 ? 199  ARG C NE    1 
ATOM   9532  C  CZ    . ARG C 1  199 ? -1.331  -31.196 117.620 1.00 198.98 ? 199  ARG C CZ    1 
ATOM   9533  N  NH1   . ARG C 1  199 ? -1.484  -32.367 117.022 1.00 197.82 ? 199  ARG C NH1   1 
ATOM   9534  N  NH2   . ARG C 1  199 ? -1.865  -30.987 118.817 1.00 190.52 ? 199  ARG C NH2   1 
ATOM   9535  N  N     . THR C 1  200 ? 5.374   -31.592 114.871 1.00 196.24 ? 200  THR C N     1 
ATOM   9536  C  CA    . THR C 1  200 ? 6.456   -32.161 114.067 1.00 190.15 ? 200  THR C CA    1 
ATOM   9537  C  C     . THR C 1  200 ? 6.813   -33.575 114.514 1.00 185.47 ? 200  THR C C     1 
ATOM   9538  O  O     . THR C 1  200 ? 6.740   -34.530 113.732 1.00 187.08 ? 200  THR C O     1 
ATOM   9539  C  CB    . THR C 1  200 ? 7.687   -31.254 114.131 1.00 189.67 ? 200  THR C CB    1 
ATOM   9540  O  OG1   . THR C 1  200 ? 7.373   -29.979 113.558 1.00 191.21 ? 200  THR C OG1   1 
ATOM   9541  C  CG2   . THR C 1  200 ? 8.848   -31.876 113.367 1.00 182.70 ? 200  THR C CG2   1 
ATOM   9542  N  N     . LYS C 1  201 ? 7.244   -33.705 115.771 1.00 185.66 ? 201  LYS C N     1 
ATOM   9543  C  CA    . LYS C 1  201 ? 7.604   -34.993 116.359 1.00 179.57 ? 201  LYS C CA    1 
ATOM   9544  C  C     . LYS C 1  201 ? 6.539   -36.049 116.083 1.00 184.21 ? 201  LYS C C     1 
ATOM   9545  O  O     . LYS C 1  201 ? 6.859   -37.190 115.732 1.00 187.02 ? 201  LYS C O     1 
ATOM   9546  C  CB    . LYS C 1  201 ? 7.844   -34.822 117.859 1.00 167.40 ? 201  LYS C CB    1 
ATOM   9547  C  CG    . LYS C 1  201 ? 9.152   -34.102 118.180 1.00 165.93 ? 201  LYS C CG    1 
ATOM   9548  C  CD    . LYS C 1  201 ? 10.345  -34.745 117.488 1.00 164.12 ? 201  LYS C CD    1 
ATOM   9549  C  CE    . LYS C 1  201 ? 11.638  -34.007 117.815 1.00 159.53 ? 201  LYS C CE    1 
ATOM   9550  N  NZ    . LYS C 1  201 ? 11.941  -33.996 119.271 1.00 154.53 ? 201  LYS C NZ    1 
ATOM   9551  N  N     . ILE C 1  202 ? 5.266   -35.691 116.268 1.00 175.28 ? 202  ILE C N     1 
ATOM   9552  C  CA    . ILE C 1  202 ? 4.170   -36.598 115.925 1.00 183.13 ? 202  ILE C CA    1 
ATOM   9553  C  C     . ILE C 1  202 ? 4.318   -37.092 114.490 1.00 195.50 ? 202  ILE C C     1 
ATOM   9554  O  O     . ILE C 1  202 ? 4.237   -38.296 114.220 1.00 201.89 ? 202  ILE C O     1 
ATOM   9555  C  CB    . ILE C 1  202 ? 2.809   -35.910 116.142 1.00 179.17 ? 202  ILE C CB    1 
ATOM   9556  C  CG1   . ILE C 1  202 ? 2.683   -35.406 117.579 1.00 174.51 ? 202  ILE C CG1   1 
ATOM   9557  C  CG2   . ILE C 1  202 ? 1.671   -36.857 115.799 1.00 176.60 ? 202  ILE C CG2   1 
ATOM   9558  C  CD1   . ILE C 1  202 ? 2.688   -36.509 118.609 1.00 164.15 ? 202  ILE C CD1   1 
ATOM   9559  N  N     . GLU C 1  203 ? 4.516   -36.171 113.544 1.00 196.69 ? 203  GLU C N     1 
ATOM   9560  C  CA    . GLU C 1  203 ? 4.659   -36.576 112.147 1.00 199.97 ? 203  GLU C CA    1 
ATOM   9561  C  C     . GLU C 1  203 ? 5.848   -37.511 111.953 1.00 198.10 ? 203  GLU C C     1 
ATOM   9562  O  O     . GLU C 1  203 ? 5.783   -38.438 111.139 1.00 199.81 ? 203  GLU C O     1 
ATOM   9563  C  CB    . GLU C 1  203 ? 4.786   -35.348 111.246 1.00 204.32 ? 203  GLU C CB    1 
ATOM   9564  C  CG    . GLU C 1  203 ? 3.513   -34.528 111.149 1.00 207.80 ? 203  GLU C CG    1 
ATOM   9565  C  CD    . GLU C 1  203 ? 2.319   -35.373 110.741 1.00 206.25 ? 203  GLU C CD    1 
ATOM   9566  O  OE1   . GLU C 1  203 ? 2.386   -36.022 109.675 1.00 208.88 ? 203  GLU C OE1   1 
ATOM   9567  O  OE2   . GLU C 1  203 ? 1.316   -35.392 111.485 1.00 197.50 ? 203  GLU C OE2   1 
ATOM   9568  N  N     . GLU C 1  204 ? 6.936   -37.301 112.700 1.00 191.26 ? 204  GLU C N     1 
ATOM   9569  C  CA    . GLU C 1  204 ? 8.045   -38.252 112.658 1.00 192.26 ? 204  GLU C CA    1 
ATOM   9570  C  C     . GLU C 1  204 ? 7.598   -39.633 113.123 1.00 202.98 ? 204  GLU C C     1 
ATOM   9571  O  O     . GLU C 1  204 ? 8.059   -40.654 112.598 1.00 202.52 ? 204  GLU C O     1 
ATOM   9572  C  CB    . GLU C 1  204 ? 9.205   -37.756 113.521 1.00 186.29 ? 204  GLU C CB    1 
ATOM   9573  C  CG    . GLU C 1  204 ? 9.623   -36.322 113.261 1.00 185.57 ? 204  GLU C CG    1 
ATOM   9574  C  CD    . GLU C 1  204 ? 10.841  -35.924 114.071 1.00 184.45 ? 204  GLU C CD    1 
ATOM   9575  O  OE1   . GLU C 1  204 ? 11.376  -34.820 113.840 1.00 188.40 ? 204  GLU C OE1   1 
ATOM   9576  O  OE2   . GLU C 1  204 ? 11.260  -36.715 114.943 1.00 181.69 ? 204  GLU C OE2   1 
ATOM   9577  N  N     . LEU C 1  205 ? 6.704   -39.682 114.114 1.00 217.47 ? 205  LEU C N     1 
ATOM   9578  C  CA    . LEU C 1  205 ? 6.225   -40.958 114.639 1.00 216.22 ? 205  LEU C CA    1 
ATOM   9579  C  C     . LEU C 1  205 ? 5.405   -41.707 113.595 1.00 219.38 ? 205  LEU C C     1 
ATOM   9580  O  O     . LEU C 1  205 ? 5.584   -42.915 113.401 1.00 219.01 ? 205  LEU C O     1 
ATOM   9581  C  CB    . LEU C 1  205 ? 5.399   -40.730 115.905 1.00 211.11 ? 205  LEU C CB    1 
ATOM   9582  C  CG    . LEU C 1  205 ? 4.738   -41.969 116.517 1.00 205.44 ? 205  LEU C CG    1 
ATOM   9583  C  CD1   . LEU C 1  205 ? 5.780   -42.993 116.943 1.00 203.08 ? 205  LEU C CD1   1 
ATOM   9584  C  CD2   . LEU C 1  205 ? 3.838   -41.585 117.683 1.00 199.04 ? 205  LEU C CD2   1 
ATOM   9585  N  N     . ARG C 1  206 ? 4.497   -41.003 112.913 1.00 210.84 ? 206  ARG C N     1 
ATOM   9586  C  CA    . ARG C 1  206 ? 3.643   -41.659 111.927 1.00 201.40 ? 206  ARG C CA    1 
ATOM   9587  C  C     . ARG C 1  206 ? 4.469   -42.192 110.766 1.00 210.38 ? 206  ARG C C     1 
ATOM   9588  O  O     . ARG C 1  206 ? 4.153   -43.246 110.201 1.00 207.16 ? 206  ARG C O     1 
ATOM   9589  C  CB    . ARG C 1  206 ? 2.577   -40.684 111.427 1.00 195.55 ? 206  ARG C CB    1 
ATOM   9590  C  CG    . ARG C 1  206 ? 1.972   -39.819 112.520 1.00 193.55 ? 206  ARG C CG    1 
ATOM   9591  C  CD    . ARG C 1  206 ? 0.990   -38.802 111.958 1.00 192.29 ? 206  ARG C CD    1 
ATOM   9592  N  NE    . ARG C 1  206 ? -0.355  -39.347 111.802 1.00 189.49 ? 206  ARG C NE    1 
ATOM   9593  C  CZ    . ARG C 1  206 ? -1.175  -39.031 110.806 1.00 189.86 ? 206  ARG C CZ    1 
ATOM   9594  N  NH1   . ARG C 1  206 ? -0.777  -38.194 109.858 1.00 191.69 ? 206  ARG C NH1   1 
ATOM   9595  N  NH2   . ARG C 1  206 ? -2.385  -39.569 110.745 1.00 186.76 ? 206  ARG C NH2   1 
ATOM   9596  N  N     . GLN C 1  207 ? 5.530   -41.474 110.392 1.00 217.76 ? 207  GLN C N     1 
ATOM   9597  C  CA    . GLN C 1  207 ? 6.375   -41.919 109.290 1.00 222.19 ? 207  GLN C CA    1 
ATOM   9598  C  C     . GLN C 1  207 ? 7.077   -43.215 109.673 1.00 218.61 ? 207  GLN C C     1 
ATOM   9599  O  O     . GLN C 1  207 ? 6.989   -44.223 108.961 1.00 217.86 ? 207  GLN C O     1 
ATOM   9600  C  CB    . GLN C 1  207 ? 7.394   -40.836 108.929 1.00 226.57 ? 207  GLN C CB    1 
ATOM   9601  C  CG    . GLN C 1  207 ? 6.780   -39.504 108.513 1.00 228.05 ? 207  GLN C CG    1 
ATOM   9602  C  CD    . GLN C 1  207 ? 5.763   -39.615 107.398 1.00 228.73 ? 207  GLN C CD    1 
ATOM   9603  O  OE1   . GLN C 1  207 ? 5.900   -40.428 106.485 1.00 227.68 ? 207  GLN C OE1   1 
ATOM   9604  N  NE2   . GLN C 1  207 ? 4.721   -38.793 107.474 1.00 229.71 ? 207  GLN C NE2   1 
ATOM   9605  N  N     . HIS C 1  208 ? 7.824   -43.179 110.782 1.00 218.56 ? 208  HIS C N     1 
ATOM   9606  C  CA    . HIS C 1  208 ? 8.410   -44.370 111.391 1.00 216.13 ? 208  HIS C CA    1 
ATOM   9607  C  C     . HIS C 1  208 ? 7.398   -45.517 111.407 1.00 212.26 ? 208  HIS C C     1 
ATOM   9608  O  O     . HIS C 1  208 ? 7.732   -46.661 111.083 1.00 209.37 ? 208  HIS C O     1 
ATOM   9609  C  CB    . HIS C 1  208 ? 8.910   -44.024 112.798 1.00 211.63 ? 208  HIS C CB    1 
ATOM   9610  C  CG    . HIS C 1  208 ? 9.423   -45.196 113.576 1.00 210.90 ? 208  HIS C CG    1 
ATOM   9611  N  ND1   . HIS C 1  208 ? 10.745  -45.583 113.545 1.00 208.48 ? 208  HIS C ND1   1 
ATOM   9612  C  CD2   . HIS C 1  208 ? 8.803   -46.046 114.429 1.00 207.42 ? 208  HIS C CD2   1 
ATOM   9613  C  CE1   . HIS C 1  208 ? 10.915  -46.631 114.331 1.00 205.35 ? 208  HIS C CE1   1 
ATOM   9614  N  NE2   . HIS C 1  208 ? 9.752   -46.932 114.880 1.00 202.60 ? 208  HIS C NE2   1 
ATOM   9615  N  N     . LEU C 1  209 ? 6.156   -45.225 111.812 1.00 213.34 ? 209  LEU C N     1 
ATOM   9616  C  CA    . LEU C 1  209 ? 5.126   -46.261 111.875 1.00 197.29 ? 209  LEU C CA    1 
ATOM   9617  C  C     . LEU C 1  209 ? 4.739   -46.721 110.474 1.00 198.27 ? 209  LEU C C     1 
ATOM   9618  O  O     . LEU C 1  209 ? 4.505   -47.913 110.246 1.00 188.05 ? 209  LEU C O     1 
ATOM   9619  C  CB    . LEU C 1  209 ? 3.900   -45.754 112.633 1.00 183.17 ? 209  LEU C CB    1 
ATOM   9620  C  CG    . LEU C 1  209 ? 4.006   -45.711 114.158 1.00 183.04 ? 209  LEU C CG    1 
ATOM   9621  C  CD1   . LEU C 1  209 ? 2.672   -45.320 114.774 1.00 175.45 ? 209  LEU C CD1   1 
ATOM   9622  C  CD2   . LEU C 1  209 ? 4.478   -47.053 114.701 1.00 171.76 ? 209  LEU C CD2   1 
ATOM   9623  N  N     . LEU C 1  210 ? 4.682   -45.787 109.521 1.00 200.36 ? 210  LEU C N     1 
ATOM   9624  C  CA    . LEU C 1  210 ? 4.300   -46.125 108.154 1.00 203.87 ? 210  LEU C CA    1 
ATOM   9625  C  C     . LEU C 1  210 ? 5.397   -46.953 107.509 1.00 206.10 ? 210  LEU C C     1 
ATOM   9626  O  O     . LEU C 1  210 ? 5.124   -47.829 106.681 1.00 207.26 ? 210  LEU C O     1 
ATOM   9627  C  CB    . LEU C 1  210 ? 4.040   -44.857 107.343 1.00 208.29 ? 210  LEU C CB    1 
ATOM   9628  C  CG    . LEU C 1  210 ? 3.181   -45.000 106.087 1.00 210.77 ? 210  LEU C CG    1 
ATOM   9629  C  CD1   . LEU C 1  210 ? 1.881   -45.721 106.400 1.00 202.45 ? 210  LEU C CD1   1 
ATOM   9630  C  CD2   . LEU C 1  210 ? 2.912   -43.636 105.471 1.00 213.46 ? 210  LEU C CD2   1 
ATOM   9631  N  N     . ARG C 1  211 ? 6.640   -46.660 107.881 1.00 225.73 ? 211  ARG C N     1 
ATOM   9632  C  CA    . ARG C 1  211 ? 7.783   -47.481 107.521 1.00 224.18 ? 211  ARG C CA    1 
ATOM   9633  C  C     . ARG C 1  211 ? 7.638   -48.969 107.839 1.00 222.36 ? 211  ARG C C     1 
ATOM   9634  O  O     . ARG C 1  211 ? 8.207   -49.808 107.127 1.00 223.39 ? 211  ARG C O     1 
ATOM   9635  C  CB    . ARG C 1  211 ? 8.987   -46.912 108.268 1.00 222.09 ? 211  ARG C CB    1 
ATOM   9636  C  CG    . ARG C 1  211 ? 9.881   -48.000 108.685 1.00 221.40 ? 211  ARG C CG    1 
ATOM   9637  C  CD    . ARG C 1  211 ? 11.195  -47.653 109.242 1.00 220.03 ? 211  ARG C CD    1 
ATOM   9638  N  NE    . ARG C 1  211 ? 11.687  -48.902 109.795 1.00 215.05 ? 211  ARG C NE    1 
ATOM   9639  C  CZ    . ARG C 1  211 ? 12.133  -49.903 109.053 1.00 216.31 ? 211  ARG C CZ    1 
ATOM   9640  N  NH1   . ARG C 1  211 ? 12.163  -49.775 107.735 1.00 218.21 ? 211  ARG C NH1   1 
ATOM   9641  N  NH2   . ARG C 1  211 ? 12.594  -51.004 109.623 1.00 215.60 ? 211  ARG C NH2   1 
ATOM   9642  N  N     . TRP C 1  212 ? 6.833   -49.335 108.832 1.00 203.32 ? 212  TRP C N     1 
ATOM   9643  C  CA    . TRP C 1  212 ? 6.604   -50.744 109.126 1.00 190.14 ? 212  TRP C CA    1 
ATOM   9644  C  C     . TRP C 1  212 ? 5.217   -51.201 108.699 1.00 185.94 ? 212  TRP C C     1 
ATOM   9645  O  O     . TRP C 1  212 ? 4.751   -52.255 109.145 1.00 174.98 ? 212  TRP C O     1 
ATOM   9646  C  CB    . TRP C 1  212 ? 6.799   -51.032 110.614 1.00 181.03 ? 212  TRP C CB    1 
ATOM   9647  C  CG    . TRP C 1  212 ? 8.167   -50.752 111.156 1.00 184.89 ? 212  TRP C CG    1 
ATOM   9648  C  CD1   . TRP C 1  212 ? 8.658   -49.544 111.557 1.00 188.86 ? 212  TRP C CD1   1 
ATOM   9649  C  CD2   . TRP C 1  212 ? 9.211   -51.706 111.386 1.00 180.52 ? 212  TRP C CD2   1 
ATOM   9650  N  NE1   . TRP C 1  212 ? 9.946   -49.685 112.015 1.00 187.62 ? 212  TRP C NE1   1 
ATOM   9651  C  CE2   . TRP C 1  212 ? 10.310  -51.003 111.919 1.00 181.20 ? 212  TRP C CE2   1 
ATOM   9652  C  CE3   . TRP C 1  212 ? 9.326   -53.086 111.187 1.00 171.10 ? 212  TRP C CE3   1 
ATOM   9653  C  CZ2   . TRP C 1  212 ? 11.503  -51.633 112.265 1.00 175.35 ? 212  TRP C CZ2   1 
ATOM   9654  C  CZ3   . TRP C 1  212 ? 10.516  -53.709 111.522 1.00 172.10 ? 212  TRP C CZ3   1 
ATOM   9655  C  CH2   . TRP C 1  212 ? 11.590  -52.982 112.051 1.00 172.28 ? 212  TRP C CH2   1 
ATOM   9656  N  N     . GLY C 1  213 ? 4.550   -50.438 107.842 1.00 188.31 ? 213  GLY C N     1 
ATOM   9657  C  CA    . GLY C 1  213 ? 3.275   -50.874 107.328 1.00 188.35 ? 213  GLY C CA    1 
ATOM   9658  C  C     . GLY C 1  213 ? 2.137   -50.537 108.258 1.00 183.42 ? 213  GLY C C     1 
ATOM   9659  O  O     . GLY C 1  213 ? 1.032   -51.065 108.089 1.00 178.81 ? 213  GLY C O     1 
ATOM   9660  N  N     . LEU C 1  214 ? 2.383   -49.665 109.233 1.00 180.67 ? 214  LEU C N     1 
ATOM   9661  C  CA    . LEU C 1  214 ? 1.403   -49.273 110.237 1.00 174.96 ? 214  LEU C CA    1 
ATOM   9662  C  C     . LEU C 1  214 ? 0.901   -47.878 109.892 1.00 174.00 ? 214  LEU C C     1 
ATOM   9663  O  O     . LEU C 1  214 ? 1.627   -46.890 110.044 1.00 174.02 ? 214  LEU C O     1 
ATOM   9664  C  CB    . LEU C 1  214 ? 2.019   -49.296 111.635 1.00 172.37 ? 214  LEU C CB    1 
ATOM   9665  C  CG    . LEU C 1  214 ? 2.400   -50.639 112.260 1.00 164.95 ? 214  LEU C CG    1 
ATOM   9666  C  CD1   . LEU C 1  214 ? 2.884   -50.435 113.685 1.00 151.18 ? 214  LEU C CD1   1 
ATOM   9667  C  CD2   . LEU C 1  214 ? 1.219   -51.590 112.238 1.00 157.46 ? 214  LEU C CD2   1 
ATOM   9668  N  N     . THR C 1  215 ? -0.341  -47.803 109.435 1.00 172.63 ? 215  THR C N     1 
ATOM   9669  C  CA    . THR C 1  215 ? -0.964  -46.544 109.075 1.00 176.67 ? 215  THR C CA    1 
ATOM   9670  C  C     . THR C 1  215 ? -1.523  -45.865 110.319 1.00 173.51 ? 215  THR C C     1 
ATOM   9671  O  O     . THR C 1  215 ? -1.817  -46.506 111.331 1.00 175.13 ? 215  THR C O     1 
ATOM   9672  C  CB    . THR C 1  215 ? -2.081  -46.761 108.055 1.00 176.83 ? 215  THR C CB    1 
ATOM   9673  O  OG1   . THR C 1  215 ? -3.130  -47.531 108.653 1.00 172.49 ? 215  THR C OG1   1 
ATOM   9674  C  CG2   . THR C 1  215 ? -1.551  -47.501 106.837 1.00 180.27 ? 215  THR C CG2   1 
ATOM   9675  N  N     . THR C 1  216 ? -1.665  -44.544 110.235 1.00 170.85 ? 216  THR C N     1 
ATOM   9676  C  CA    . THR C 1  216 ? -2.331  -43.757 111.275 1.00 173.87 ? 216  THR C CA    1 
ATOM   9677  C  C     . THR C 1  216 ? -3.368  -42.872 110.592 1.00 173.72 ? 216  THR C C     1 
ATOM   9678  O  O     . THR C 1  216 ? -3.092  -41.709 110.267 1.00 170.15 ? 216  THR C O     1 
ATOM   9679  C  CB    . THR C 1  216 ? -1.318  -42.919 112.062 1.00 171.99 ? 216  THR C CB    1 
ATOM   9680  O  OG1   . THR C 1  216 ? -0.390  -42.308 111.157 1.00 165.43 ? 216  THR C OG1   1 
ATOM   9681  C  CG2   . THR C 1  216 ? -0.542  -43.794 113.041 1.00 179.02 ? 216  THR C CG2   1 
ATOM   9682  N  N     . PRO C 1  217 ? -4.572  -43.411 110.343 1.00 173.32 ? 217  PRO C N     1 
ATOM   9683  C  CA    . PRO C 1  217 ? -5.614  -42.657 109.624 1.00 175.26 ? 217  PRO C CA    1 
ATOM   9684  C  C     . PRO C 1  217 ? -5.951  -41.327 110.307 1.00 176.57 ? 217  PRO C C     1 
ATOM   9685  O  O     . PRO C 1  217 ? -5.879  -41.193 111.520 1.00 179.34 ? 217  PRO C O     1 
ATOM   9686  C  CB    . PRO C 1  217 ? -6.812  -43.615 109.616 1.00 167.89 ? 217  PRO C CB    1 
ATOM   9687  C  CG    . PRO C 1  217 ? -6.448  -44.730 110.568 1.00 172.33 ? 217  PRO C CG    1 
ATOM   9688  C  CD    . PRO C 1  217 ? -4.966  -44.799 110.607 1.00 173.72 ? 217  PRO C CD    1 
ATOM   9689  N  N     . ASP C 1  218 ? -6.320  -40.331 109.480 1.00 180.11 ? 218  ASP C N     1 
ATOM   9690  C  CA    . ASP C 1  218 ? -6.622  -38.997 109.987 1.00 181.12 ? 218  ASP C CA    1 
ATOM   9691  C  C     . ASP C 1  218 ? -7.896  -38.892 110.835 1.00 188.19 ? 218  ASP C C     1 
ATOM   9692  O  O     . ASP C 1  218 ? -7.968  -38.054 111.749 1.00 188.46 ? 218  ASP C O     1 
ATOM   9693  C  CB    . ASP C 1  218 ? -6.719  -38.015 108.819 1.00 178.65 ? 218  ASP C CB    1 
ATOM   9694  C  CG    . ASP C 1  218 ? -5.396  -37.360 108.506 1.00 182.35 ? 218  ASP C CG    1 
ATOM   9695  O  OD1   . ASP C 1  218 ? -4.528  -37.331 109.394 1.00 182.58 ? 218  ASP C OD1   1 
ATOM   9696  O  OD2   . ASP C 1  218 ? -5.224  -36.877 107.361 1.00 180.35 ? 218  ASP C OD2   1 
ATOM   9697  N  N     . LYS C 1  219 ? -8.919  -39.748 110.571 1.00 199.86 ? 219  LYS C N     1 
ATOM   9698  C  CA    . LYS C 1  219 ? -10.175 -39.645 111.311 1.00 194.39 ? 219  LYS C CA    1 
ATOM   9699  C  C     . LYS C 1  219 ? -10.025 -39.908 112.794 1.00 191.38 ? 219  LYS C C     1 
ATOM   9700  O  O     . LYS C 1  219 ? -10.841 -39.399 113.580 1.00 186.61 ? 219  LYS C O     1 
ATOM   9701  C  CB    . LYS C 1  219 ? -11.178 -40.613 110.677 1.00 191.79 ? 219  LYS C CB    1 
ATOM   9702  C  CG    . LYS C 1  219 ? -12.488 -40.858 111.433 1.00 187.58 ? 219  LYS C CG    1 
ATOM   9703  C  CD    . LYS C 1  219 ? -12.663 -42.345 111.570 1.00 182.94 ? 219  LYS C CD    1 
ATOM   9704  C  CE    . LYS C 1  219 ? -14.000 -42.758 112.146 1.00 180.83 ? 219  LYS C CE    1 
ATOM   9705  N  NZ    . LYS C 1  219 ? -14.406 -44.121 111.666 1.00 182.04 ? 219  LYS C NZ    1 
ATOM   9706  N  N     . LYS C 1  220 ? -9.004  -40.641 113.183 1.00 183.93 ? 220  LYS C N     1 
ATOM   9707  C  CA    . LYS C 1  220 ? -8.734  -40.971 114.572 1.00 175.93 ? 220  LYS C CA    1 
ATOM   9708  C  C     . LYS C 1  220 ? -7.572  -40.211 115.166 1.00 174.52 ? 220  LYS C C     1 
ATOM   9709  O  O     . LYS C 1  220 ? -7.148  -40.502 116.288 1.00 172.51 ? 220  LYS C O     1 
ATOM   9710  C  CB    . LYS C 1  220 ? -8.530  -42.470 114.667 1.00 168.62 ? 220  LYS C CB    1 
ATOM   9711  C  CG    . LYS C 1  220 ? -9.874  -43.080 114.421 1.00 166.53 ? 220  LYS C CG    1 
ATOM   9712  C  CD    . LYS C 1  220 ? -9.868  -44.530 114.138 1.00 159.04 ? 220  LYS C CD    1 
ATOM   9713  C  CE    . LYS C 1  220 ? -11.308 -44.953 113.988 1.00 157.79 ? 220  LYS C CE    1 
ATOM   9714  N  NZ    . LYS C 1  220 ? -11.479 -46.074 113.039 1.00 157.93 ? 220  LYS C NZ    1 
ATOM   9715  N  N     . HIS C 1  221 ? -7.045  -39.220 114.450 1.00 175.23 ? 221  HIS C N     1 
ATOM   9716  C  CA    . HIS C 1  221 ? -5.877  -38.472 114.891 1.00 176.65 ? 221  HIS C CA    1 
ATOM   9717  C  C     . HIS C 1  221 ? -6.444  -37.232 115.578 1.00 179.37 ? 221  HIS C C     1 
ATOM   9718  O  O     . HIS C 1  221 ? -6.784  -36.255 114.939 1.00 181.06 ? 221  HIS C O     1 
ATOM   9719  C  CB    . HIS C 1  221 ? -4.979  -38.130 113.708 1.00 180.76 ? 221  HIS C CB    1 
ATOM   9720  C  CG    . HIS C 1  221 ? -3.673  -37.518 114.095 1.00 180.57 ? 221  HIS C CG    1 
ATOM   9721  N  ND1   . HIS C 1  221 ? -3.554  -36.680 115.184 1.00 177.52 ? 221  HIS C ND1   1 
ATOM   9722  C  CD2   . HIS C 1  221 ? -2.443  -37.578 113.534 1.00 183.31 ? 221  HIS C CD2   1 
ATOM   9723  C  CE1   . HIS C 1  221 ? -2.306  -36.260 115.285 1.00 177.79 ? 221  HIS C CE1   1 
ATOM   9724  N  NE2   . HIS C 1  221 ? -1.609  -36.793 114.298 1.00 180.72 ? 221  HIS C NE2   1 
ATOM   9725  N  N     . GLN C 1  222 ? -6.555  -37.349 116.894 1.00 177.48 ? 222  GLN C N     1 
ATOM   9726  C  CA    . GLN C 1  222 ? -7.011  -36.251 117.723 1.00 174.92 ? 222  GLN C CA    1 
ATOM   9727  C  C     . GLN C 1  222 ? -5.885  -35.272 118.036 1.00 175.05 ? 222  GLN C C     1 
ATOM   9728  O  O     . GLN C 1  222 ? -4.791  -35.684 118.436 1.00 174.00 ? 222  GLN C O     1 
ATOM   9729  C  CB    . GLN C 1  222 ? -7.613  -36.778 119.022 1.00 169.73 ? 222  GLN C CB    1 
ATOM   9730  C  CG    . GLN C 1  222 ? -8.680  -37.845 118.841 1.00 163.88 ? 222  GLN C CG    1 
ATOM   9731  C  CD    . GLN C 1  222 ? -9.167  -38.399 120.165 1.00 155.42 ? 222  GLN C CD    1 
ATOM   9732  O  OE1   . GLN C 1  222 ? -9.604  -37.643 121.039 1.00 153.56 ? 222  GLN C OE1   1 
ATOM   9733  N  NE2   . GLN C 1  222 ? -9.105  -39.712 120.323 1.00 156.54 ? 222  GLN C NE2   1 
ATOM   9734  N  N     . LYS C 1  223 ? -6.157  -33.986 117.855 1.00 176.56 ? 223  LYS C N     1 
ATOM   9735  C  CA    . LYS C 1  223 ? -5.166  -32.943 118.087 1.00 179.06 ? 223  LYS C CA    1 
ATOM   9736  C  C     . LYS C 1  223 ? -5.651  -31.855 119.028 1.00 177.63 ? 223  LYS C C     1 
ATOM   9737  O  O     . LYS C 1  223 ? -4.812  -31.206 119.664 1.00 173.49 ? 223  LYS C O     1 
ATOM   9738  C  CB    . LYS C 1  223 ? -4.656  -32.296 116.787 1.00 183.88 ? 223  LYS C CB    1 
ATOM   9739  C  CG    . LYS C 1  223 ? -4.351  -33.219 115.621 1.00 181.18 ? 223  LYS C CG    1 
ATOM   9740  C  CD    . LYS C 1  223 ? -3.702  -32.393 114.508 1.00 178.55 ? 223  LYS C CD    1 
ATOM   9741  C  CE    . LYS C 1  223 ? -3.468  -33.179 113.232 1.00 176.26 ? 223  LYS C CE    1 
ATOM   9742  N  NZ    . LYS C 1  223 ? -3.246  -32.265 112.075 1.00 174.17 ? 223  LYS C NZ    1 
ATOM   9743  N  N     . GLU C 1  224 ? -6.957  -31.633 119.146 1.00 185.46 ? 224  GLU C N     1 
ATOM   9744  C  CA    . GLU C 1  224 ? -7.493  -30.615 120.032 1.00 184.85 ? 224  GLU C CA    1 
ATOM   9745  C  C     . GLU C 1  224 ? -8.268  -31.273 121.162 1.00 181.14 ? 224  GLU C C     1 
ATOM   9746  O  O     . GLU C 1  224 ? -9.096  -32.158 120.907 1.00 179.82 ? 224  GLU C O     1 
ATOM   9747  C  CB    . GLU C 1  224 ? -8.401  -29.649 119.264 1.00 185.03 ? 224  GLU C CB    1 
ATOM   9748  C  CG    . GLU C 1  224 ? -7.714  -28.975 118.086 1.00 191.03 ? 224  GLU C CG    1 
ATOM   9749  C  CD    . GLU C 1  224 ? -8.394  -27.687 117.665 1.00 197.91 ? 224  GLU C CD    1 
ATOM   9750  O  OE1   . GLU C 1  224 ? -9.639  -27.668 117.578 1.00 193.90 ? 224  GLU C OE1   1 
ATOM   9751  O  OE2   . GLU C 1  224 ? -7.680  -26.693 117.417 1.00 210.17 ? 224  GLU C OE2   1 
ATOM   9752  N  N     . PRO C 1  225 ? -8.025  -30.872 122.421 1.00 161.80 ? 225  PRO C N     1 
ATOM   9753  C  CA    . PRO C 1  225 ? -8.776  -31.277 123.617 1.00 150.82 ? 225  PRO C CA    1 
ATOM   9754  C  C     . PRO C 1  225 ? -10.265 -30.944 123.516 1.00 155.62 ? 225  PRO C C     1 
ATOM   9755  O  O     . PRO C 1  225 ? -10.623 -29.997 122.818 1.00 163.33 ? 225  PRO C O     1 
ATOM   9756  C  CB    . PRO C 1  225 ? -8.108  -30.473 124.744 1.00 144.79 ? 225  PRO C CB    1 
ATOM   9757  C  CG    . PRO C 1  225 ? -7.315  -29.405 124.061 1.00 147.40 ? 225  PRO C CG    1 
ATOM   9758  C  CD    . PRO C 1  225 ? -6.897  -29.988 122.758 1.00 154.16 ? 225  PRO C CD    1 
ATOM   9759  N  N     . PRO C 1  226 ? -11.125 -31.720 124.201 1.00 147.97 ? 226  PRO C N     1 
ATOM   9760  C  CA    . PRO C 1  226 ? -10.753 -32.826 125.093 1.00 146.09 ? 226  PRO C CA    1 
ATOM   9761  C  C     . PRO C 1  226 ? -10.427 -34.113 124.351 1.00 142.34 ? 226  PRO C C     1 
ATOM   9762  O  O     . PRO C 1  226 ? -11.222 -34.601 123.548 1.00 136.87 ? 226  PRO C O     1 
ATOM   9763  C  CB    . PRO C 1  226 ? -12.006 -33.017 125.965 1.00 145.35 ? 226  PRO C CB    1 
ATOM   9764  C  CG    . PRO C 1  226 ? -12.977 -31.929 125.554 1.00 146.58 ? 226  PRO C CG    1 
ATOM   9765  C  CD    . PRO C 1  226 ? -12.581 -31.519 124.178 1.00 148.00 ? 226  PRO C CD    1 
ATOM   9766  N  N     . PHE C 1  227 ? -9.237  -34.639 124.621 1.00 148.39 ? 227  PHE C N     1 
ATOM   9767  C  CA    . PHE C 1  227 ? -8.797  -35.879 124.002 1.00 135.63 ? 227  PHE C CA    1 
ATOM   9768  C  C     . PHE C 1  227 ? -9.576  -37.061 124.566 1.00 141.10 ? 227  PHE C C     1 
ATOM   9769  O  O     . PHE C 1  227 ? -9.703  -37.206 125.786 1.00 150.49 ? 227  PHE C O     1 
ATOM   9770  C  CB    . PHE C 1  227 ? -7.305  -36.068 124.256 1.00 129.33 ? 227  PHE C CB    1 
ATOM   9771  C  CG    . PHE C 1  227 ? -6.458  -34.979 123.675 1.00 135.12 ? 227  PHE C CG    1 
ATOM   9772  C  CD1   . PHE C 1  227 ? -6.133  -34.968 122.331 1.00 161.78 ? 227  PHE C CD1   1 
ATOM   9773  C  CD2   . PHE C 1  227 ? -6.001  -33.949 124.481 1.00 128.26 ? 227  PHE C CD2   1 
ATOM   9774  C  CE1   . PHE C 1  227 ? -5.356  -33.952 121.804 1.00 166.56 ? 227  PHE C CE1   1 
ATOM   9775  C  CE2   . PHE C 1  227 ? -5.227  -32.934 123.962 1.00 141.05 ? 227  PHE C CE2   1 
ATOM   9776  C  CZ    . PHE C 1  227 ? -4.905  -32.933 122.623 1.00 155.67 ? 227  PHE C CZ    1 
ATOM   9777  N  N     . LEU C 1  228 ? -10.096 -37.906 123.683 1.00 140.47 ? 228  LEU C N     1 
ATOM   9778  C  CA    . LEU C 1  228 ? -10.831 -39.097 124.091 1.00 138.54 ? 228  LEU C CA    1 
ATOM   9779  C  C     . LEU C 1  228 ? -9.849  -40.260 124.160 1.00 141.01 ? 228  LEU C C     1 
ATOM   9780  O  O     . LEU C 1  228 ? -9.210  -40.597 123.157 1.00 146.34 ? 228  LEU C O     1 
ATOM   9781  C  CB    . LEU C 1  228 ? -11.989 -39.401 123.140 1.00 144.04 ? 228  LEU C CB    1 
ATOM   9782  C  CG    . LEU C 1  228 ? -13.316 -38.659 123.363 1.00 139.24 ? 228  LEU C CG    1 
ATOM   9783  C  CD1   . LEU C 1  228 ? -13.156 -37.145 123.395 1.00 136.86 ? 228  LEU C CD1   1 
ATOM   9784  C  CD2   . LEU C 1  228 ? -14.342 -39.066 122.314 1.00 138.36 ? 228  LEU C CD2   1 
ATOM   9785  N  N     . TRP C 1  229 ? -9.730  -40.874 125.335 1.00 142.04 ? 229  TRP C N     1 
ATOM   9786  C  CA    . TRP C 1  229 ? -8.633  -41.806 125.587 1.00 142.34 ? 229  TRP C CA    1 
ATOM   9787  C  C     . TRP C 1  229 ? -9.025  -42.758 126.702 1.00 136.41 ? 229  TRP C C     1 
ATOM   9788  O  O     . TRP C 1  229 ? -9.252  -42.324 127.837 1.00 134.33 ? 229  TRP C O     1 
ATOM   9789  C  CB    . TRP C 1  229 ? -7.355  -41.039 125.944 1.00 141.72 ? 229  TRP C CB    1 
ATOM   9790  C  CG    . TRP C 1  229 ? -6.146  -41.897 126.187 1.00 139.49 ? 229  TRP C CG    1 
ATOM   9791  C  CD1   . TRP C 1  229 ? -5.330  -42.450 125.245 1.00 141.40 ? 229  TRP C CD1   1 
ATOM   9792  C  CD2   . TRP C 1  229 ? -5.583  -42.245 127.459 1.00 139.40 ? 229  TRP C CD2   1 
ATOM   9793  N  NE1   . TRP C 1  229 ? -4.313  -43.149 125.851 1.00 141.63 ? 229  TRP C NE1   1 
ATOM   9794  C  CE2   . TRP C 1  229 ? -4.443  -43.035 127.210 1.00 140.17 ? 229  TRP C CE2   1 
ATOM   9795  C  CE3   . TRP C 1  229 ? -5.939  -41.975 128.784 1.00 139.42 ? 229  TRP C CE3   1 
ATOM   9796  C  CZ2   . TRP C 1  229 ? -3.658  -43.558 128.235 1.00 139.48 ? 229  TRP C CZ2   1 
ATOM   9797  C  CZ3   . TRP C 1  229 ? -5.157  -42.496 129.801 1.00 133.77 ? 229  TRP C CZ3   1 
ATOM   9798  C  CH2   . TRP C 1  229 ? -4.030  -43.278 129.521 1.00 131.19 ? 229  TRP C CH2   1 
ATOM   9799  N  N     . MET C 1  230 ? -9.111  -44.049 126.372 1.00 135.59 ? 230  MET C N     1 
ATOM   9800  C  CA    . MET C 1  230 ? -9.328  -45.113 127.348 1.00 132.69 ? 230  MET C CA    1 
ATOM   9801  C  C     . MET C 1  230 ? -10.642 -44.927 128.101 1.00 133.22 ? 230  MET C C     1 
ATOM   9802  O  O     . MET C 1  230 ? -10.779 -45.358 129.248 1.00 139.64 ? 230  MET C O     1 
ATOM   9803  C  CB    . MET C 1  230 ? -8.153  -45.199 128.328 1.00 132.43 ? 230  MET C CB    1 
ATOM   9804  C  CG    . MET C 1  230 ? -6.840  -45.612 127.678 1.00 127.77 ? 230  MET C CG    1 
ATOM   9805  S  SD    . MET C 1  230 ? -6.933  -47.197 126.830 1.00 126.33 ? 230  MET C SD    1 
ATOM   9806  C  CE    . MET C 1  230 ? -7.463  -48.260 128.167 1.00 130.32 ? 230  MET C CE    1 
ATOM   9807  N  N     . GLY C 1  231 ? -11.623 -44.292 127.463 1.00 141.32 ? 231  GLY C N     1 
ATOM   9808  C  CA    . GLY C 1  231 ? -12.917 -44.097 128.081 1.00 135.66 ? 231  GLY C CA    1 
ATOM   9809  C  C     . GLY C 1  231 ? -13.008 -42.856 128.937 1.00 142.36 ? 231  GLY C C     1 
ATOM   9810  O  O     . GLY C 1  231 ? -14.036 -42.647 129.592 1.00 147.50 ? 231  GLY C O     1 
ATOM   9811  N  N     . TYR C 1  232 ? -11.968 -42.030 128.949 1.00 130.87 ? 232  TYR C N     1 
ATOM   9812  C  CA    . TYR C 1  232 ? -11.907 -40.775 129.681 1.00 135.24 ? 232  TYR C CA    1 
ATOM   9813  C  C     . TYR C 1  232 ? -11.871 -39.590 128.722 1.00 140.63 ? 232  TYR C C     1 
ATOM   9814  O  O     . TYR C 1  232 ? -11.755 -39.739 127.503 1.00 145.22 ? 232