data_5HS6
# 
_entry.id   5HS6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HS6         
WWPDB D_1000217381 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5EN4 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HS6 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bertoletti, N.'           1 
'Marchais-Oberwinkler, S.' 2 
'Heine, A.'                3 
'Klebe, G.'                4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            59 
_citation.language                  ? 
_citation.page_first                6961 
_citation.page_last                 6967 
_citation.title                     
;New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.6b00293 
_citation.pdbx_database_id_PubMed   27362750 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bertoletti, N.'           1 
primary 'Braun, F.'                2 
primary 'Lepage, M.'               3 
primary 'Moller, G.'               4 
primary 'Adamski, J.'              5 
primary 'Heine, A.'                6 
primary 'Klebe, G.'                7 
primary 'Marchais-Oberwinkler, S.' 8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HS6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     91.111 
_cell.length_a_esd                 ? 
_cell.length_b                     91.111 
_cell.length_b_esd                 ? 
_cell.length_c                     132.021 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HS6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '17-beta-hydroxysteroid dehydrogenase 14'               28682.740 1   1.1.1.- ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                       663.425   1   ?       ? ? ? 
3 non-polymer syn '(9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one' 270.366   1   ?       ? ? ? 
4 non-polymer syn 'SODIUM ION'                                            22.990    1   ?       ? ? ? 
5 water       nat water                                                   18.015    136 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;17-beta-HSD 14,17-beta-hydroxysteroid dehydrogenase DHRS10,Dehydrogenase/reductase SDR family member 10,Retinal short-chain dehydrogenase/reductase retSDR3,Short chain dehydrogenase/reductase family 47C member 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR
RFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATK
GAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFC
TGIELLVTGGAELGYGCKASRSTPVDAPDIPSGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR
RFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATK
GAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFC
TGIELLVTGGAELGYGCKASRSTPVDAPDIPSGS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ALA n 
1 5   THR n 
1 6   GLY n 
1 7   THR n 
1 8   ARG n 
1 9   TYR n 
1 10  ALA n 
1 11  GLY n 
1 12  LYS n 
1 13  VAL n 
1 14  VAL n 
1 15  VAL n 
1 16  VAL n 
1 17  THR n 
1 18  GLY n 
1 19  GLY n 
1 20  GLY n 
1 21  ARG n 
1 22  GLY n 
1 23  ILE n 
1 24  GLY n 
1 25  ALA n 
1 26  GLY n 
1 27  ILE n 
1 28  VAL n 
1 29  ARG n 
1 30  ALA n 
1 31  PHE n 
1 32  VAL n 
1 33  ASN n 
1 34  SER n 
1 35  GLY n 
1 36  ALA n 
1 37  ARG n 
1 38  VAL n 
1 39  VAL n 
1 40  ILE n 
1 41  CYS n 
1 42  ASP n 
1 43  LYS n 
1 44  ASP n 
1 45  GLU n 
1 46  SER n 
1 47  GLY n 
1 48  GLY n 
1 49  ARG n 
1 50  ALA n 
1 51  LEU n 
1 52  GLU n 
1 53  GLN n 
1 54  GLU n 
1 55  LEU n 
1 56  PRO n 
1 57  GLY n 
1 58  ALA n 
1 59  VAL n 
1 60  PHE n 
1 61  ILE n 
1 62  LEU n 
1 63  CYS n 
1 64  ASP n 
1 65  VAL n 
1 66  THR n 
1 67  GLN n 
1 68  GLU n 
1 69  ASP n 
1 70  ASP n 
1 71  VAL n 
1 72  LYS n 
1 73  THR n 
1 74  LEU n 
1 75  VAL n 
1 76  SER n 
1 77  GLU n 
1 78  THR n 
1 79  ILE n 
1 80  ARG n 
1 81  ARG n 
1 82  PHE n 
1 83  GLY n 
1 84  ARG n 
1 85  LEU n 
1 86  ASP n 
1 87  CYS n 
1 88  VAL n 
1 89  VAL n 
1 90  ASN n 
1 91  ASN n 
1 92  ALA n 
1 93  GLY n 
1 94  HIS n 
1 95  HIS n 
1 96  PRO n 
1 97  PRO n 
1 98  PRO n 
1 99  GLN n 
1 100 ARG n 
1 101 PRO n 
1 102 GLU n 
1 103 GLU n 
1 104 THR n 
1 105 SER n 
1 106 ALA n 
1 107 GLN n 
1 108 GLY n 
1 109 PHE n 
1 110 ARG n 
1 111 GLN n 
1 112 LEU n 
1 113 LEU n 
1 114 GLU n 
1 115 LEU n 
1 116 ASN n 
1 117 LEU n 
1 118 LEU n 
1 119 GLY n 
1 120 THR n 
1 121 TYR n 
1 122 THR n 
1 123 LEU n 
1 124 THR n 
1 125 LYS n 
1 126 LEU n 
1 127 ALA n 
1 128 LEU n 
1 129 PRO n 
1 130 TYR n 
1 131 LEU n 
1 132 ARG n 
1 133 LYS n 
1 134 SER n 
1 135 GLN n 
1 136 GLY n 
1 137 ASN n 
1 138 VAL n 
1 139 ILE n 
1 140 ASN n 
1 141 ILE n 
1 142 SER n 
1 143 SER n 
1 144 LEU n 
1 145 VAL n 
1 146 GLY n 
1 147 ALA n 
1 148 ILE n 
1 149 GLY n 
1 150 GLN n 
1 151 ALA n 
1 152 GLN n 
1 153 ALA n 
1 154 VAL n 
1 155 PRO n 
1 156 TYR n 
1 157 VAL n 
1 158 ALA n 
1 159 THR n 
1 160 LYS n 
1 161 GLY n 
1 162 ALA n 
1 163 VAL n 
1 164 THR n 
1 165 ALA n 
1 166 MET n 
1 167 THR n 
1 168 LYS n 
1 169 ALA n 
1 170 LEU n 
1 171 ALA n 
1 172 LEU n 
1 173 ASP n 
1 174 GLU n 
1 175 SER n 
1 176 PRO n 
1 177 TYR n 
1 178 GLY n 
1 179 VAL n 
1 180 ARG n 
1 181 VAL n 
1 182 ASN n 
1 183 CYS n 
1 184 ILE n 
1 185 SER n 
1 186 PRO n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 TRP n 
1 191 THR n 
1 192 PRO n 
1 193 LEU n 
1 194 TRP n 
1 195 GLU n 
1 196 GLU n 
1 197 LEU n 
1 198 ALA n 
1 199 ALA n 
1 200 LEU n 
1 201 MET n 
1 202 PRO n 
1 203 ASP n 
1 204 PRO n 
1 205 ARG n 
1 206 ALA n 
1 207 THR n 
1 208 ILE n 
1 209 ARG n 
1 210 GLU n 
1 211 GLY n 
1 212 MET n 
1 213 LEU n 
1 214 ALA n 
1 215 GLN n 
1 216 PRO n 
1 217 LEU n 
1 218 GLY n 
1 219 ARG n 
1 220 MET n 
1 221 GLY n 
1 222 GLN n 
1 223 PRO n 
1 224 ALA n 
1 225 GLU n 
1 226 VAL n 
1 227 GLY n 
1 228 ALA n 
1 229 ALA n 
1 230 ALA n 
1 231 VAL n 
1 232 PHE n 
1 233 LEU n 
1 234 ALA n 
1 235 SER n 
1 236 GLU n 
1 237 ALA n 
1 238 ASN n 
1 239 PHE n 
1 240 CYS n 
1 241 THR n 
1 242 GLY n 
1 243 ILE n 
1 244 GLU n 
1 245 LEU n 
1 246 LEU n 
1 247 VAL n 
1 248 THR n 
1 249 GLY n 
1 250 GLY n 
1 251 ALA n 
1 252 GLU n 
1 253 LEU n 
1 254 GLY n 
1 255 TYR n 
1 256 GLY n 
1 257 CYS n 
1 258 LYS n 
1 259 ALA n 
1 260 SER n 
1 261 ARG n 
1 262 SER n 
1 263 THR n 
1 264 PRO n 
1 265 VAL n 
1 266 ASP n 
1 267 ALA n 
1 268 PRO n 
1 269 ASP n 
1 270 ILE n 
1 271 PRO n 
1 272 SER n 
1 273 GLY n 
1 274 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   274 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              pLysS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DHB14_HUMAN 
_struct_ref.pdbx_db_accession          Q9BPX1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRF
GRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGA
VTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG
IELLVTGGAELGYGCKASRSTPVDAPDIPS
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5HS6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 272 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9BPX1 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  270 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       270 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HS6 GLY A 1   ? UNP Q9BPX1 ? ? 'expression tag' -1  1 
1 5HS6 HIS A 2   ? UNP Q9BPX1 ? ? 'expression tag' 0   2 
1 5HS6 GLY A 273 ? UNP Q9BPX1 ? ? 'expression tag' 271 3 
1 5HS6 SER A 274 ? UNP Q9BPX1 ? ? 'expression tag' 272 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                 ?       'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                ?       'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                              ?       'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                         ?       'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                ?       'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                               ?       'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                         ?       'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                 ?       'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                               ?       'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                   ?       'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                              ?       'C6 H13 N O2'       131.173 
J3Z non-polymer         . '(9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one' Estrone 'C18 H22 O2'        270.366 
LEU 'L-peptide linking' y LEUCINE                                                 ?       'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                  ?       'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                              ?       'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                                            ?       'Na 1'              22.990  
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE                       ?       'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                                           ?       'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                 ?       'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                  ?       'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                               ?       'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                              ?       'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                ?       'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                  ?       'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HS6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'CHES 0.1M, tri-sodium citrate 1M' 
_exptl_crystal_grow.pdbx_pH_range   7.0-8.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5HS6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.02 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18613 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.52 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.083 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.86 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.02 
_reflns_shell.d_res_low                   2.14 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.30 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.57 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HS6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.02 
_refine.ls_d_res_low                             46.106 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18611 
_refine.ls_number_reflns_R_free                  931 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.69 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1614 
_refine.ls_R_factor_R_free                       0.1877 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1599 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5EN4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.97 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.16 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1849 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             136 
_refine_hist.number_atoms_total               2049 
_refine_hist.d_res_high                       2.02 
_refine_hist.d_res_low                        46.106 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 1969 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.868  ? 2692 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.119 ? 1189 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.054  ? 315  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 375  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0184 2.1248  . . 129 2450 99.00  . . . 0.2401 . 0.1908 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1248 2.2579  . . 130 2478 100.00 . . . 0.2080 . 0.1750 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2579 2.4323  . . 132 2499 100.00 . . . 0.2036 . 0.1671 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4323 2.6770  . . 132 2505 100.00 . . . 0.1981 . 0.1661 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6770 3.0643  . . 132 2512 100.00 . . . 0.1946 . 0.1691 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0643 3.8604  . . 134 2556 100.00 . . . 0.1808 . 0.1512 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8604 46.1178 . . 142 2680 100.00 . . . 0.1680 . 0.1489 . . . . . . . . . . 
# 
_struct.entry_id                     5HS6 
_struct.title                        'Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with Estrone' 
_struct.pdbx_descriptor              '17-beta-hydroxysteroid dehydrogenase 14 (E.C.1.1.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HS6 
_struct_keywords.text            '17bHSD14, Estrone complex, oxidoreductase' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 21  ? SER A 34  ? ARG A 19  SER A 32  1 ? 14 
HELX_P HELX_P2  AA2 ASP A 44  ? LEU A 55  ? ASP A 42  LEU A 53  1 ? 12 
HELX_P HELX_P3  AA3 GLN A 67  ? GLY A 83  ? GLN A 65  GLY A 81  1 ? 17 
HELX_P HELX_P4  AA4 ARG A 100 ? THR A 104 ? ARG A 98  THR A 102 5 ? 5  
HELX_P HELX_P5  AA5 SER A 105 ? LEU A 117 ? SER A 103 LEU A 115 1 ? 13 
HELX_P HELX_P6  AA6 LEU A 117 ? GLN A 135 ? LEU A 115 GLN A 133 1 ? 19 
HELX_P HELX_P7  AA7 SER A 143 ? GLY A 149 ? SER A 141 GLY A 147 1 ? 7  
HELX_P HELX_P8  AA8 ALA A 153 ? SER A 175 ? ALA A 151 SER A 173 1 ? 23 
HELX_P HELX_P9  AA9 PRO A 176 ? GLY A 178 ? PRO A 174 GLY A 176 5 ? 3  
HELX_P HELX_P10 AB1 THR A 191 ? LEU A 200 ? THR A 189 LEU A 198 1 ? 10 
HELX_P HELX_P11 AB2 ASP A 203 ? ALA A 214 ? ASP A 201 ALA A 212 1 ? 12 
HELX_P HELX_P12 AB3 GLN A 222 ? GLU A 236 ? GLN A 220 GLU A 234 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 257 SG ? ? ? 1_555 A CYS 257 SG ? ? A CYS 255 A CYS 255 6_555 ? ? ? ? ? ? ? 2.037 ? 
metalc1 metalc ? ? A GLU 52  O  ? ? ? 1_555 D NA  .   NA ? ? A GLU 50  A NA  303 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc2 metalc ? ? A LEU 55  O  ? ? ? 1_555 D NA  .   NA ? ? A LEU 53  A NA  303 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc3 metalc ? ? A ALA 58  O  ? ? ? 1_555 D NA  .   NA ? ? A ALA 56  A NA  303 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc4 metalc ? ? D NA  .   NA ? ? ? 1_555 E HOH .   O  ? ? A NA  303 A HOH 480 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc5 metalc ? ? D NA  .   NA ? ? ? 1_555 E HOH .   O  ? ? A NA  303 A HOH 518 1_555 ? ? ? ? ? ? ? 2.444 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA1 2 3 ? parallel 
AA1 3 4 ? parallel 
AA1 4 5 ? parallel 
AA1 5 6 ? parallel 
AA1 6 7 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 58  ? LEU A 62  ? ALA A 56  LEU A 60  
AA1 2 ARG A 37  ? ASP A 42  ? ARG A 35  ASP A 40  
AA1 3 VAL A 13  ? THR A 17  ? VAL A 11  THR A 15  
AA1 4 CYS A 87  ? ASN A 90  ? CYS A 85  ASN A 88  
AA1 5 ASN A 137 ? ILE A 141 ? ASN A 135 ILE A 139 
AA1 6 ARG A 180 ? PRO A 186 ? ARG A 178 PRO A 184 
AA1 7 GLU A 244 ? VAL A 247 ? GLU A 242 VAL A 245 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 59  ? O VAL A 57  N ILE A 40  ? N ILE A 38  
AA1 2 3 O VAL A 39  ? O VAL A 37  N VAL A 14  ? N VAL A 12  
AA1 3 4 N VAL A 15  ? N VAL A 13  O VAL A 89  ? O VAL A 87  
AA1 4 5 N VAL A 88  ? N VAL A 86  O ILE A 139 ? O ILE A 137 
AA1 5 6 N VAL A 138 ? N VAL A 136 O ASN A 182 ? O ASN A 180 
AA1 6 7 N CYS A 183 ? N CYS A 181 O LEU A 245 ? O LEU A 243 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NAD 301 ? 29 'binding site for residue NAD A 301' 
AC2 Software A J3Z 302 ? 7  'binding site for residue J3Z A 302' 
AC3 Software A NA  303 ? 5  'binding site for residue NA A 303'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 29 GLY A 18  ? GLY A 16  . ? 1_555 ? 
2  AC1 29 ARG A 21  ? ARG A 19  . ? 1_555 ? 
3  AC1 29 GLY A 22  ? GLY A 20  . ? 1_555 ? 
4  AC1 29 ILE A 23  ? ILE A 21  . ? 1_555 ? 
5  AC1 29 ASP A 42  ? ASP A 40  . ? 1_555 ? 
6  AC1 29 LYS A 43  ? LYS A 41  . ? 1_555 ? 
7  AC1 29 CYS A 63  ? CYS A 61  . ? 1_555 ? 
8  AC1 29 ASP A 64  ? ASP A 62  . ? 1_555 ? 
9  AC1 29 VAL A 65  ? VAL A 63  . ? 1_555 ? 
10 AC1 29 ASN A 91  ? ASN A 89  . ? 1_555 ? 
11 AC1 29 GLY A 93  ? GLY A 91  . ? 1_555 ? 
12 AC1 29 LEU A 115 ? LEU A 113 . ? 1_555 ? 
13 AC1 29 ILE A 141 ? ILE A 139 . ? 1_555 ? 
14 AC1 29 SER A 142 ? SER A 140 . ? 1_555 ? 
15 AC1 29 SER A 143 ? SER A 141 . ? 1_555 ? 
16 AC1 29 TYR A 156 ? TYR A 154 . ? 1_555 ? 
17 AC1 29 LYS A 160 ? LYS A 158 . ? 1_555 ? 
18 AC1 29 PRO A 186 ? PRO A 184 . ? 1_555 ? 
19 AC1 29 GLY A 187 ? GLY A 185 . ? 1_555 ? 
20 AC1 29 ASN A 188 ? ASN A 186 . ? 1_555 ? 
21 AC1 29 ILE A 189 ? ILE A 187 . ? 1_555 ? 
22 AC1 29 THR A 191 ? THR A 189 . ? 1_555 ? 
23 AC1 29 PRO A 192 ? PRO A 190 . ? 1_555 ? 
24 AC1 29 LEU A 193 ? LEU A 191 . ? 1_555 ? 
25 AC1 29 TRP A 194 ? TRP A 192 . ? 1_555 ? 
26 AC1 29 J3Z C .   ? J3Z A 302 . ? 1_555 ? 
27 AC1 29 HOH E .   ? HOH A 403 . ? 1_555 ? 
28 AC1 29 HOH E .   ? HOH A 450 . ? 1_555 ? 
29 AC1 29 HOH E .   ? HOH A 453 . ? 1_555 ? 
30 AC2 7  HIS A 95  ? HIS A 93  . ? 1_555 ? 
31 AC2 7  GLN A 150 ? GLN A 148 . ? 1_555 ? 
32 AC2 7  TYR A 156 ? TYR A 154 . ? 1_555 ? 
33 AC2 7  LEU A 197 ? LEU A 195 . ? 1_555 ? 
34 AC2 7  MET A 201 ? MET A 199 . ? 1_555 ? 
35 AC2 7  THR A 207 ? THR A 205 . ? 1_555 ? 
36 AC2 7  NAD B .   ? NAD A 301 . ? 1_555 ? 
37 AC3 5  GLU A 52  ? GLU A 50  . ? 1_555 ? 
38 AC3 5  LEU A 55  ? LEU A 53  . ? 1_555 ? 
39 AC3 5  ALA A 58  ? ALA A 56  . ? 1_555 ? 
40 AC3 5  HOH E .   ? HOH A 480 . ? 1_555 ? 
41 AC3 5  HOH E .   ? HOH A 518 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5HS6 
_atom_sites.fract_transf_matrix[1][1]   0.010976 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010976 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007575 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 6   ? 44.771 36.289  -6.664  1.00 46.47 ? 4   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 6   ? 45.247 35.088  -5.995  1.00 30.66 ? 4   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 6   ? 46.753 35.026  -6.022  1.00 29.07 ? 4   GLY A C   1 
ATOM   4    O  O   . GLY A 1 6   ? 47.384 35.493  -6.979  1.00 40.15 ? 4   GLY A O   1 
ATOM   5    N  N   . THR A 1 7   ? 47.337 34.438  -4.980  1.00 46.05 ? 5   THR A N   1 
ATOM   6    C  CA  . THR A 1 7   ? 48.774 34.483  -4.762  1.00 43.27 ? 5   THR A CA  1 
ATOM   7    C  C   . THR A 1 7   ? 49.449 33.109  -4.673  1.00 37.34 ? 5   THR A C   1 
ATOM   8    O  O   . THR A 1 7   ? 50.652 33.013  -4.959  1.00 33.78 ? 5   THR A O   1 
ATOM   9    C  CB  . THR A 1 7   ? 49.059 35.298  -3.484  1.00 49.64 ? 5   THR A CB  1 
ATOM   10   O  OG1 . THR A 1 7   ? 49.466 36.623  -3.843  1.00 56.32 ? 5   THR A OG1 1 
ATOM   11   C  CG2 . THR A 1 7   ? 50.104 34.659  -2.582  1.00 53.78 ? 5   THR A CG2 1 
ATOM   12   N  N   A ARG A 1 8   ? 48.662 32.106  -4.408  0.48 32.11 ? 6   ARG A N   1 
ATOM   13   N  N   B ARG A 1 8   ? 48.720 32.044  -4.332  0.52 32.04 ? 6   ARG A N   1 
ATOM   14   C  CA  A ARG A 1 8   ? 49.160 30.826  -4.045  0.48 32.48 ? 6   ARG A CA  1 
ATOM   15   C  CA  B ARG A 1 8   ? 49.381 30.789  -3.974  0.52 32.48 ? 6   ARG A CA  1 
ATOM   16   C  C   A ARG A 1 8   ? 49.985 30.150  -5.157  0.48 29.94 ? 6   ARG A C   1 
ATOM   17   C  C   B ARG A 1 8   ? 50.030 30.076  -5.160  0.52 29.78 ? 6   ARG A C   1 
ATOM   18   O  O   A ARG A 1 8   ? 50.918 29.484  -4.903  0.48 28.69 ? 6   ARG A O   1 
ATOM   19   O  O   B ARG A 1 8   ? 50.899 29.226  -4.945  0.52 28.64 ? 6   ARG A O   1 
ATOM   20   C  CB  A ARG A 1 8   ? 47.967 29.972  -3.685  0.48 33.44 ? 6   ARG A CB  1 
ATOM   21   C  CB  B ARG A 1 8   ? 48.389 29.852  -3.288  0.52 34.77 ? 6   ARG A CB  1 
ATOM   22   C  CG  A ARG A 1 8   ? 48.348 28.670  -3.120  0.48 37.37 ? 6   ARG A CG  1 
ATOM   23   C  CG  B ARG A 1 8   ? 47.142 29.604  -4.085  0.52 32.47 ? 6   ARG A CG  1 
ATOM   24   C  CD  A ARG A 1 8   ? 47.150 27.780  -2.888  0.48 37.80 ? 6   ARG A CD  1 
ATOM   25   C  CD  B ARG A 1 8   ? 46.104 28.880  -3.263  0.52 36.39 ? 6   ARG A CD  1 
ATOM   26   N  NE  A ARG A 1 8   ? 46.171 28.403  -2.045  0.48 38.02 ? 6   ARG A NE  1 
ATOM   27   N  NE  B ARG A 1 8   ? 46.567 27.576  -2.805  0.52 35.56 ? 6   ARG A NE  1 
ATOM   28   C  CZ  A ARG A 1 8   ? 45.093 27.784  -1.620  0.48 38.80 ? 6   ARG A CZ  1 
ATOM   29   C  CZ  B ARG A 1 8   ? 45.764 26.674  -2.252  0.52 35.81 ? 6   ARG A CZ  1 
ATOM   30   N  NH1 A ARG A 1 8   ? 44.912 26.544  -1.943  0.48 34.51 ? 6   ARG A NH1 1 
ATOM   31   N  NH1 B ARG A 1 8   ? 46.237 25.493  -1.855  0.52 30.01 ? 6   ARG A NH1 1 
ATOM   32   N  NH2 A ARG A 1 8   ? 44.226 28.423  -0.863  0.48 39.19 ? 6   ARG A NH2 1 
ATOM   33   N  NH2 B ARG A 1 8   ? 44.477 26.961  -2.111  0.52 28.81 ? 6   ARG A NH2 1 
ATOM   34   N  N   . TYR A 1 9   ? 49.640 30.380  -6.396  1.00 28.23 ? 7   TYR A N   1 
ATOM   35   C  CA  . TYR A 1 9   ? 50.307 29.804  -7.561  1.00 26.99 ? 7   TYR A CA  1 
ATOM   36   C  C   . TYR A 1 9   ? 50.568 30.881  -8.594  1.00 25.91 ? 7   TYR A C   1 
ATOM   37   O  O   . TYR A 1 9   ? 50.488 30.646  -9.804  1.00 25.01 ? 7   TYR A O   1 
ATOM   38   C  CB  . TYR A 1 9   ? 49.494 28.641  -8.147  1.00 24.26 ? 7   TYR A CB  1 
ATOM   39   C  CG  . TYR A 1 9   ? 50.342 27.493  -8.681  1.00 21.87 ? 7   TYR A CG  1 
ATOM   40   C  CD1 . TYR A 1 9   ? 51.408 26.982  -7.941  1.00 20.44 ? 7   TYR A CD1 1 
ATOM   41   C  CD2 . TYR A 1 9   ? 50.073 26.922  -9.927  1.00 21.10 ? 7   TYR A CD2 1 
ATOM   42   C  CE1 . TYR A 1 9   ? 52.193 25.937  -8.428  1.00 23.88 ? 7   TYR A CE1 1 
ATOM   43   C  CE2 . TYR A 1 9   ? 50.860 25.874  -10.428 1.00 21.30 ? 7   TYR A CE2 1 
ATOM   44   C  CZ  . TYR A 1 9   ? 51.902 25.387  -9.681  1.00 21.62 ? 7   TYR A CZ  1 
ATOM   45   O  OH  . TYR A 1 9   ? 52.658 24.348  -10.182 1.00 24.59 ? 7   TYR A OH  1 
ATOM   46   N  N   . ALA A 1 10  ? 50.890 32.083  -8.122  1.00 23.80 ? 8   ALA A N   1 
ATOM   47   C  CA  . ALA A 1 10  ? 51.118 33.218  -9.005  1.00 25.96 ? 8   ALA A CA  1 
ATOM   48   C  C   . ALA A 1 10  ? 52.380 33.013  -9.834  1.00 27.38 ? 8   ALA A C   1 
ATOM   49   O  O   . ALA A 1 10  ? 53.364 32.422  -9.376  1.00 26.86 ? 8   ALA A O   1 
ATOM   50   C  CB  . ALA A 1 10  ? 51.226 34.509  -8.195  1.00 29.97 ? 8   ALA A CB  1 
ATOM   51   N  N   . GLY A 1 11  ? 52.339 33.498  -11.073 1.00 29.25 ? 9   GLY A N   1 
ATOM   52   C  CA  . GLY A 1 11  ? 53.465 33.382  -11.979 1.00 30.43 ? 9   GLY A CA  1 
ATOM   53   C  C   . GLY A 1 11  ? 53.643 32.009  -12.595 1.00 24.86 ? 9   GLY A C   1 
ATOM   54   O  O   . GLY A 1 11  ? 54.626 31.795  -13.317 1.00 29.20 ? 9   GLY A O   1 
ATOM   55   N  N   . LYS A 1 12  ? 52.729 31.080  -12.342 1.00 20.76 ? 10  LYS A N   1 
ATOM   56   C  CA  . LYS A 1 12  ? 52.824 29.716  -12.842 1.00 20.91 ? 10  LYS A CA  1 
ATOM   57   C  C   . LYS A 1 12  ? 51.897 29.531  -14.036 1.00 25.39 ? 10  LYS A C   1 
ATOM   58   O  O   . LYS A 1 12  ? 50.881 30.225  -14.173 1.00 25.17 ? 10  LYS A O   1 
ATOM   59   C  CB  . LYS A 1 12  ? 52.462 28.706  -11.751 1.00 19.17 ? 10  LYS A CB  1 
ATOM   60   C  CG  . LYS A 1 12  ? 53.282 28.840  -10.481 1.00 23.24 ? 10  LYS A CG  1 
ATOM   61   C  CD  . LYS A 1 12  ? 54.729 28.459  -10.702 1.00 26.72 ? 10  LYS A CD  1 
ATOM   62   C  CE  . LYS A 1 12  ? 55.503 28.463  -9.385  1.00 30.18 ? 10  LYS A CE  1 
ATOM   63   N  NZ  . LYS A 1 12  ? 56.890 27.963  -9.565  1.00 33.65 ? 10  LYS A NZ  1 
ATOM   64   N  N   . VAL A 1 13  ? 52.249 28.585  -14.902 1.00 18.54 ? 11  VAL A N   1 
ATOM   65   C  CA  . VAL A 1 13  ? 51.475 28.295  -16.108 1.00 22.39 ? 11  VAL A CA  1 
ATOM   66   C  C   . VAL A 1 13  ? 50.993 26.853  -16.039 1.00 23.85 ? 11  VAL A C   1 
ATOM   67   O  O   . VAL A 1 13  ? 51.803 25.932  -15.866 1.00 18.63 ? 11  VAL A O   1 
ATOM   68   C  CB  . VAL A 1 13  ? 52.300 28.550  -17.380 1.00 24.18 ? 11  VAL A CB  1 
ATOM   69   C  CG1 . VAL A 1 13  ? 51.567 28.043  -18.640 1.00 24.48 ? 11  VAL A CG1 1 
ATOM   70   C  CG2 . VAL A 1 13  ? 52.620 30.032  -17.498 1.00 26.90 ? 11  VAL A CG2 1 
ATOM   71   N  N   . VAL A 1 14  ? 49.676 26.665  -16.183 1.00 21.88 ? 12  VAL A N   1 
ATOM   72   C  CA  . VAL A 1 14  ? 48.999 25.388  -15.975 1.00 23.78 ? 12  VAL A CA  1 
ATOM   73   C  C   . VAL A 1 14  ? 48.238 25.003  -17.239 1.00 25.05 ? 12  VAL A C   1 
ATOM   74   O  O   . VAL A 1 14  ? 47.535 25.831  -17.827 1.00 23.49 ? 12  VAL A O   1 
ATOM   75   C  CB  . VAL A 1 14  ? 48.016 25.459  -14.781 1.00 21.51 ? 12  VAL A CB  1 
ATOM   76   C  CG1 . VAL A 1 14  ? 47.302 24.098  -14.569 1.00 19.01 ? 12  VAL A CG1 1 
ATOM   77   C  CG2 . VAL A 1 14  ? 48.739 25.930  -13.508 1.00 19.36 ? 12  VAL A CG2 1 
ATOM   78   N  N   . VAL A 1 15  ? 48.355 23.743  -17.643 1.00 23.77 ? 13  VAL A N   1 
ATOM   79   C  CA  . VAL A 1 15  ? 47.535 23.173  -18.708 1.00 23.68 ? 13  VAL A CA  1 
ATOM   80   C  C   . VAL A 1 15  ? 46.551 22.190  -18.078 1.00 24.58 ? 13  VAL A C   1 
ATOM   81   O  O   . VAL A 1 15  ? 46.959 21.288  -17.333 1.00 22.73 ? 13  VAL A O   1 
ATOM   82   C  CB  . VAL A 1 15  ? 48.399 22.474  -19.773 1.00 24.63 ? 13  VAL A CB  1 
ATOM   83   C  CG1 . VAL A 1 15  ? 47.521 21.727  -20.770 1.00 21.95 ? 13  VAL A CG1 1 
ATOM   84   C  CG2 . VAL A 1 15  ? 49.327 23.474  -20.492 1.00 20.18 ? 13  VAL A CG2 1 
ATOM   85   N  N   . VAL A 1 16  ? 45.265 22.359  -18.377 1.00 19.71 ? 14  VAL A N   1 
ATOM   86   C  CA  . VAL A 1 16  ? 44.196 21.469  -17.913 1.00 21.84 ? 14  VAL A CA  1 
ATOM   87   C  C   . VAL A 1 16  ? 43.511 20.896  -19.145 1.00 23.63 ? 14  VAL A C   1 
ATOM   88   O  O   . VAL A 1 16  ? 42.916 21.650  -19.927 1.00 22.95 ? 14  VAL A O   1 
ATOM   89   C  CB  . VAL A 1 16  ? 43.166 22.201  -17.032 1.00 17.65 ? 14  VAL A CB  1 
ATOM   90   C  CG1 . VAL A 1 16  ? 42.077 21.238  -16.550 1.00 20.75 ? 14  VAL A CG1 1 
ATOM   91   C  CG2 . VAL A 1 16  ? 43.827 22.906  -15.832 1.00 19.28 ? 14  VAL A CG2 1 
ATOM   92   N  N   . THR A 1 17  ? 43.593 19.577  -19.327 1.00 25.43 ? 15  THR A N   1 
ATOM   93   C  CA  . THR A 1 17  ? 42.907 18.934  -20.441 1.00 25.60 ? 15  THR A CA  1 
ATOM   94   C  C   . THR A 1 17  ? 41.471 18.606  -20.050 1.00 25.50 ? 15  THR A C   1 
ATOM   95   O  O   . THR A 1 17  ? 41.157 18.412  -18.875 1.00 20.21 ? 15  THR A O   1 
ATOM   96   C  CB  . THR A 1 17  ? 43.628 17.668  -20.901 1.00 26.96 ? 15  THR A CB  1 
ATOM   97   O  OG1 . THR A 1 17  ? 43.494 16.627  -19.921 1.00 26.02 ? 15  THR A OG1 1 
ATOM   98   C  CG2 . THR A 1 17  ? 45.098 17.963  -21.130 1.00 23.98 ? 15  THR A CG2 1 
ATOM   99   N  N   . GLY A 1 18  ? 40.596 18.556  -21.052 1.00 25.42 ? 16  GLY A N   1 
ATOM   100  C  CA  . GLY A 1 18  ? 39.172 18.489  -20.767 1.00 24.81 ? 16  GLY A CA  1 
ATOM   101  C  C   . GLY A 1 18  ? 38.684 19.627  -19.891 1.00 24.61 ? 16  GLY A C   1 
ATOM   102  O  O   . GLY A 1 18  ? 37.756 19.442  -19.096 1.00 25.63 ? 16  GLY A O   1 
ATOM   103  N  N   . GLY A 1 19  ? 39.285 20.808  -20.010 1.00 25.63 ? 17  GLY A N   1 
ATOM   104  C  CA  . GLY A 1 19  ? 38.915 21.867  -19.088 1.00 19.81 ? 17  GLY A CA  1 
ATOM   105  C  C   . GLY A 1 19  ? 37.692 22.657  -19.467 1.00 24.42 ? 17  GLY A C   1 
ATOM   106  O  O   . GLY A 1 19  ? 37.382 23.665  -18.823 1.00 21.84 ? 17  GLY A O   1 
ATOM   107  N  N   . GLY A 1 20  ? 36.984 22.247  -20.521 1.00 23.43 ? 18  GLY A N   1 
ATOM   108  C  CA  . GLY A 1 20  ? 35.861 23.043  -20.969 1.00 20.48 ? 18  GLY A CA  1 
ATOM   109  C  C   . GLY A 1 20  ? 34.619 22.941  -20.106 1.00 27.19 ? 18  GLY A C   1 
ATOM   110  O  O   . GLY A 1 20  ? 33.788 23.854  -20.140 1.00 27.98 ? 18  GLY A O   1 
ATOM   111  N  N   . ARG A 1 21  ? 34.453 21.851  -19.356 1.00 26.40 ? 19  ARG A N   1 
ATOM   112  C  CA  . ARG A 1 21  ? 33.256 21.694  -18.535 1.00 23.13 ? 19  ARG A CA  1 
ATOM   113  C  C   . ARG A 1 21  ? 33.565 20.741  -17.389 1.00 25.56 ? 19  ARG A C   1 
ATOM   114  O  O   . ARG A 1 21  ? 34.645 20.152  -17.319 1.00 24.14 ? 19  ARG A O   1 
ATOM   115  C  CB  . ARG A 1 21  ? 32.071 21.187  -19.368 1.00 23.78 ? 19  ARG A CB  1 
ATOM   116  C  CG  . ARG A 1 21  ? 32.210 19.708  -19.771 1.00 22.01 ? 19  ARG A CG  1 
ATOM   117  C  CD  . ARG A 1 21  ? 30.983 19.175  -20.539 1.00 25.24 ? 19  ARG A CD  1 
ATOM   118  N  NE  . ARG A 1 21  ? 30.836 17.721  -20.395 1.00 33.16 ? 19  ARG A NE  1 
ATOM   119  C  CZ  . ARG A 1 21  ? 29.916 16.995  -21.027 1.00 37.79 ? 19  ARG A CZ  1 
ATOM   120  N  NH1 . ARG A 1 21  ? 29.840 15.680  -20.837 1.00 38.88 ? 19  ARG A NH1 1 
ATOM   121  N  NH2 . ARG A 1 21  ? 29.071 17.579  -21.857 1.00 33.68 ? 19  ARG A NH2 1 
ATOM   122  N  N   . GLY A 1 22  ? 32.593 20.602  -16.484 1.00 25.70 ? 20  GLY A N   1 
ATOM   123  C  CA  . GLY A 1 22  ? 32.674 19.567  -15.468 1.00 22.20 ? 20  GLY A CA  1 
ATOM   124  C  C   . GLY A 1 22  ? 33.860 19.757  -14.549 1.00 24.06 ? 20  GLY A C   1 
ATOM   125  O  O   . GLY A 1 22  ? 34.238 20.882  -14.211 1.00 22.74 ? 20  GLY A O   1 
ATOM   126  N  N   . ILE A 1 23  ? 34.466 18.637  -14.142 1.00 24.92 ? 21  ILE A N   1 
ATOM   127  C  CA  . ILE A 1 23  ? 35.616 18.684  -13.235 1.00 23.32 ? 21  ILE A CA  1 
ATOM   128  C  C   . ILE A 1 23  ? 36.720 19.563  -13.811 1.00 22.64 ? 21  ILE A C   1 
ATOM   129  O  O   . ILE A 1 23  ? 37.295 20.404  -13.109 1.00 24.44 ? 21  ILE A O   1 
ATOM   130  C  CB  . ILE A 1 23  ? 36.125 17.259  -12.930 1.00 18.62 ? 21  ILE A CB  1 
ATOM   131  C  CG1 . ILE A 1 23  ? 35.125 16.522  -12.044 1.00 21.38 ? 21  ILE A CG1 1 
ATOM   132  C  CG2 . ILE A 1 23  ? 37.499 17.313  -12.247 1.00 18.27 ? 21  ILE A CG2 1 
ATOM   133  C  CD1 . ILE A 1 23  ? 35.443 15.032  -11.831 1.00 25.72 ? 21  ILE A CD1 1 
ATOM   134  N  N   . GLY A 1 24  ? 37.031 19.381  -15.099 1.00 23.20 ? 22  GLY A N   1 
ATOM   135  C  CA  . GLY A 1 24  ? 38.107 20.147  -15.710 1.00 22.52 ? 22  GLY A CA  1 
ATOM   136  C  C   . GLY A 1 24  ? 37.894 21.644  -15.594 1.00 25.29 ? 22  GLY A C   1 
ATOM   137  O  O   . GLY A 1 24  ? 38.818 22.388  -15.261 1.00 19.96 ? 22  GLY A O   1 
ATOM   138  N  N   . ALA A 1 25  ? 36.665 22.106  -15.844 1.00 17.78 ? 23  ALA A N   1 
ATOM   139  C  CA  . ALA A 1 25  ? 36.399 23.537  -15.687 1.00 21.16 ? 23  ALA A CA  1 
ATOM   140  C  C   . ALA A 1 25  ? 36.526 23.985  -14.230 1.00 22.66 ? 23  ALA A C   1 
ATOM   141  O  O   . ALA A 1 25  ? 36.928 25.128  -13.970 1.00 24.32 ? 23  ALA A O   1 
ATOM   142  C  CB  . ALA A 1 25  ? 35.013 23.873  -16.234 1.00 17.01 ? 23  ALA A CB  1 
ATOM   143  N  N   . GLY A 1 26  ? 36.181 23.117  -13.273 1.00 19.05 ? 24  GLY A N   1 
ATOM   144  C  CA  . GLY A 1 26  ? 36.384 23.463  -11.871 1.00 23.25 ? 24  GLY A CA  1 
ATOM   145  C  C   . GLY A 1 26  ? 37.857 23.614  -11.529 1.00 27.17 ? 24  GLY A C   1 
ATOM   146  O  O   . GLY A 1 26  ? 38.247 24.506  -10.762 1.00 23.45 ? 24  GLY A O   1 
ATOM   147  N  N   . ILE A 1 27  ? 38.694 22.753  -12.107 1.00 18.87 ? 25  ILE A N   1 
ATOM   148  C  CA  . ILE A 1 27  ? 40.140 22.869  -11.922 1.00 19.24 ? 25  ILE A CA  1 
ATOM   149  C  C   . ILE A 1 27  ? 40.669 24.142  -12.575 1.00 20.60 ? 25  ILE A C   1 
ATOM   150  O  O   . ILE A 1 27  ? 41.505 24.848  -11.995 1.00 21.96 ? 25  ILE A O   1 
ATOM   151  C  CB  . ILE A 1 27  ? 40.841 21.604  -12.462 1.00 19.33 ? 25  ILE A CB  1 
ATOM   152  C  CG1 . ILE A 1 27  ? 40.321 20.369  -11.710 1.00 18.59 ? 25  ILE A CG1 1 
ATOM   153  C  CG2 . ILE A 1 27  ? 42.391 21.726  -12.330 1.00 19.01 ? 25  ILE A CG2 1 
ATOM   154  C  CD1 . ILE A 1 27  ? 40.796 19.017  -12.279 1.00 19.70 ? 25  ILE A CD1 1 
ATOM   155  N  N   . VAL A 1 28  ? 40.192 24.468  -13.785 1.00 21.27 ? 26  VAL A N   1 
ATOM   156  C  CA  . VAL A 1 28  ? 40.610 25.715  -14.422 1.00 22.28 ? 26  VAL A CA  1 
ATOM   157  C  C   . VAL A 1 28  ? 40.316 26.901  -13.515 1.00 17.98 ? 26  VAL A C   1 
ATOM   158  O  O   . VAL A 1 28  ? 41.182 27.758  -13.278 1.00 23.91 ? 26  VAL A O   1 
ATOM   159  C  CB  . VAL A 1 28  ? 39.931 25.898  -15.791 1.00 17.72 ? 26  VAL A CB  1 
ATOM   160  C  CG1 . VAL A 1 28  ? 40.102 27.356  -16.250 1.00 18.86 ? 26  VAL A CG1 1 
ATOM   161  C  CG2 . VAL A 1 28  ? 40.506 24.916  -16.836 1.00 19.95 ? 26  VAL A CG2 1 
ATOM   162  N  N   . ARG A 1 29  ? 39.078 26.991  -13.020 1.00 17.38 ? 27  ARG A N   1 
ATOM   163  C  CA  . ARG A 1 29  ? 38.707 28.138  -12.204 1.00 22.22 ? 27  ARG A CA  1 
ATOM   164  C  C   . ARG A 1 29  ? 39.560 28.211  -10.949 1.00 23.12 ? 27  ARG A C   1 
ATOM   165  O  O   . ARG A 1 29  ? 39.941 29.302  -10.509 1.00 20.65 ? 27  ARG A O   1 
ATOM   166  C  CB  . ARG A 1 29  ? 37.222 28.073  -11.837 1.00 23.61 ? 27  ARG A CB  1 
ATOM   167  C  CG  . ARG A 1 29  ? 36.278 28.132  -13.031 1.00 23.20 ? 27  ARG A CG  1 
ATOM   168  C  CD  . ARG A 1 29  ? 34.826 28.101  -12.563 1.00 25.03 ? 27  ARG A CD  1 
ATOM   169  N  NE  . ARG A 1 29  ? 33.895 28.086  -13.688 1.00 28.89 ? 27  ARG A NE  1 
ATOM   170  C  CZ  . ARG A 1 29  ? 33.449 29.183  -14.292 1.00 29.58 ? 27  ARG A CZ  1 
ATOM   171  N  NH1 . ARG A 1 29  ? 32.596 29.092  -15.300 1.00 29.40 ? 27  ARG A NH1 1 
ATOM   172  N  NH2 . ARG A 1 29  ? 33.861 30.376  -13.881 1.00 28.13 ? 27  ARG A NH2 1 
ATOM   173  N  N   . ALA A 1 30  ? 39.840 27.056  -10.337 1.00 19.38 ? 28  ALA A N   1 
ATOM   174  C  CA  . ALA A 1 30  ? 40.624 27.042  -9.107  1.00 20.89 ? 28  ALA A CA  1 
ATOM   175  C  C   . ALA A 1 30  ? 42.030 27.586  -9.345  1.00 16.30 ? 28  ALA A C   1 
ATOM   176  O  O   . ALA A 1 30  ? 42.545 28.375  -8.543  1.00 21.97 ? 28  ALA A O   1 
ATOM   177  C  CB  . ALA A 1 30  ? 40.677 25.612  -8.546  1.00 22.33 ? 28  ALA A CB  1 
ATOM   178  N  N   . PHE A 1 31  ? 42.662 27.181  -10.449 1.00 19.67 ? 29  PHE A N   1 
ATOM   179  C  CA  . PHE A 1 31  ? 44.013 27.647  -10.744 1.00 21.42 ? 29  PHE A CA  1 
ATOM   180  C  C   . PHE A 1 31  ? 44.033 29.124  -11.123 1.00 25.08 ? 29  PHE A C   1 
ATOM   181  O  O   . PHE A 1 31  ? 44.961 29.845  -10.740 1.00 26.51 ? 29  PHE A O   1 
ATOM   182  C  CB  . PHE A 1 31  ? 44.650 26.784  -11.841 1.00 16.80 ? 29  PHE A CB  1 
ATOM   183  C  CG  . PHE A 1 31  ? 45.353 25.571  -11.298 1.00 21.21 ? 29  PHE A CG  1 
ATOM   184  C  CD1 . PHE A 1 31  ? 46.562 25.701  -10.608 1.00 18.02 ? 29  PHE A CD1 1 
ATOM   185  C  CD2 . PHE A 1 31  ? 44.806 24.308  -11.449 1.00 21.66 ? 29  PHE A CD2 1 
ATOM   186  C  CE1 . PHE A 1 31  ? 47.213 24.587  -10.085 1.00 20.44 ? 29  PHE A CE1 1 
ATOM   187  C  CE2 . PHE A 1 31  ? 45.446 23.199  -10.928 1.00 23.34 ? 29  PHE A CE2 1 
ATOM   188  C  CZ  . PHE A 1 31  ? 46.669 23.346  -10.243 1.00 21.83 ? 29  PHE A CZ  1 
ATOM   189  N  N   . VAL A 1 32  ? 43.029 29.600  -11.870 1.00 22.36 ? 30  VAL A N   1 
ATOM   190  C  CA  . VAL A 1 32  ? 42.931 31.040  -12.131 1.00 22.76 ? 30  VAL A CA  1 
ATOM   191  C  C   . VAL A 1 32  ? 42.780 31.795  -10.815 1.00 23.70 ? 30  VAL A C   1 
ATOM   192  O  O   . VAL A 1 32  ? 43.440 32.819  -10.577 1.00 22.77 ? 30  VAL A O   1 
ATOM   193  C  CB  . VAL A 1 32  ? 41.765 31.347  -13.097 1.00 22.73 ? 30  VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 32  ? 41.509 32.865  -13.184 1.00 23.57 ? 30  VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 32  ? 42.058 30.758  -14.488 1.00 23.34 ? 30  VAL A CG2 1 
ATOM   196  N  N   . ASN A 1 33  ? 41.905 31.290  -9.933  1.00 21.40 ? 31  ASN A N   1 
ATOM   197  C  CA  . ASN A 1 33  ? 41.691 31.928  -8.637  1.00 28.72 ? 31  ASN A CA  1 
ATOM   198  C  C   . ASN A 1 33  ? 42.968 31.970  -7.807  1.00 29.18 ? 31  ASN A C   1 
ATOM   199  O  O   . ASN A 1 33  ? 43.104 32.836  -6.938  1.00 30.89 ? 31  ASN A O   1 
ATOM   200  C  CB  . ASN A 1 33  ? 40.595 31.201  -7.851  1.00 34.78 ? 31  ASN A CB  1 
ATOM   201  C  CG  . ASN A 1 33  ? 39.193 31.559  -8.318  1.00 47.30 ? 31  ASN A CG  1 
ATOM   202  O  OD1 . ASN A 1 33  ? 38.984 32.567  -9.000  1.00 50.72 ? 31  ASN A OD1 1 
ATOM   203  N  ND2 . ASN A 1 33  ? 38.218 30.735  -7.938  1.00 50.37 ? 31  ASN A ND2 1 
ATOM   204  N  N   A SER A 1 34  ? 43.909 31.062  -8.057  0.45 23.61 ? 32  SER A N   1 
ATOM   205  N  N   B SER A 1 34  ? 43.903 31.052  -8.056  0.55 23.25 ? 32  SER A N   1 
ATOM   206  C  CA  A SER A 1 34  ? 45.159 31.024  -7.316  0.45 25.57 ? 32  SER A CA  1 
ATOM   207  C  CA  B SER A 1 34  ? 45.163 30.999  -7.330  0.55 25.58 ? 32  SER A CA  1 
ATOM   208  C  C   A SER A 1 34  ? 46.263 31.842  -7.974  0.45 26.73 ? 32  SER A C   1 
ATOM   209  C  C   B SER A 1 34  ? 46.232 31.906  -7.926  0.55 27.10 ? 32  SER A C   1 
ATOM   210  O  O   A SER A 1 34  ? 47.398 31.838  -7.482  0.45 27.36 ? 32  SER A O   1 
ATOM   211  O  O   B SER A 1 34  ? 47.316 32.029  -7.341  0.55 27.49 ? 32  SER A O   1 
ATOM   212  C  CB  A SER A 1 34  ? 45.614 29.573  -7.140  0.45 24.07 ? 32  SER A CB  1 
ATOM   213  C  CB  B SER A 1 34  ? 45.687 29.555  -7.281  0.55 23.87 ? 32  SER A CB  1 
ATOM   214  O  OG  A SER A 1 34  ? 44.528 28.783  -6.695  0.45 23.59 ? 32  SER A OG  1 
ATOM   215  O  OG  B SER A 1 34  ? 46.154 29.137  -8.552  0.55 19.98 ? 32  SER A OG  1 
ATOM   216  N  N   . GLY A 1 35  ? 45.960 32.542  -9.065  1.00 27.43 ? 33  GLY A N   1 
ATOM   217  C  CA  . GLY A 1 35  ? 46.908 33.450  -9.691  1.00 29.58 ? 33  GLY A CA  1 
ATOM   218  C  C   . GLY A 1 35  ? 47.678 32.868  -10.861 1.00 24.40 ? 33  GLY A C   1 
ATOM   219  O  O   . GLY A 1 35  ? 48.519 33.563  -11.433 1.00 26.77 ? 33  GLY A O   1 
ATOM   220  N  N   . ALA A 1 36  ? 47.417 31.622  -11.233 1.00 24.97 ? 34  ALA A N   1 
ATOM   221  C  CA  . ALA A 1 36  ? 48.091 31.018  -12.371 1.00 27.00 ? 34  ALA A CA  1 
ATOM   222  C  C   . ALA A 1 36  ? 47.485 31.511  -13.683 1.00 28.67 ? 34  ALA A C   1 
ATOM   223  O  O   . ALA A 1 36  ? 46.333 31.954  -13.740 1.00 26.66 ? 34  ALA A O   1 
ATOM   224  C  CB  . ALA A 1 36  ? 47.998 29.491  -12.290 1.00 21.15 ? 34  ALA A CB  1 
ATOM   225  N  N   . ARG A 1 37  ? 48.285 31.444  -14.748 1.00 23.85 ? 35  ARG A N   1 
ATOM   226  C  CA  . ARG A 1 37  ? 47.748 31.464  -16.100 1.00 20.65 ? 35  ARG A CA  1 
ATOM   227  C  C   . ARG A 1 37  ? 47.418 30.033  -16.507 1.00 23.60 ? 35  ARG A C   1 
ATOM   228  O  O   . ARG A 1 37  ? 48.161 29.094  -16.191 1.00 25.57 ? 35  ARG A O   1 
ATOM   229  C  CB  . ARG A 1 37  ? 48.733 32.112  -17.076 1.00 23.62 ? 35  ARG A CB  1 
ATOM   230  C  CG  . ARG A 1 37  ? 48.657 33.648  -17.065 1.00 31.01 ? 35  ARG A CG  1 
ATOM   231  C  CD  . ARG A 1 37  ? 49.859 34.288  -17.763 1.00 40.58 ? 35  ARG A CD  1 
ATOM   232  N  NE  . ARG A 1 37  ? 51.112 33.910  -17.115 1.00 43.29 ? 35  ARG A NE  1 
ATOM   233  C  CZ  . ARG A 1 37  ? 52.321 34.270  -17.548 1.00 49.54 ? 35  ARG A CZ  1 
ATOM   234  N  NH1 . ARG A 1 37  ? 52.438 35.026  -18.635 1.00 42.70 ? 35  ARG A NH1 1 
ATOM   235  N  NH2 . ARG A 1 37  ? 53.411 33.876  -16.888 1.00 44.20 ? 35  ARG A NH2 1 
ATOM   236  N  N   . VAL A 1 38  ? 46.274 29.851  -17.163 1.00 20.30 ? 36  VAL A N   1 
ATOM   237  C  CA  . VAL A 1 38  ? 45.768 28.505  -17.429 1.00 22.80 ? 36  VAL A CA  1 
ATOM   238  C  C   . VAL A 1 38  ? 45.479 28.369  -18.912 1.00 21.25 ? 36  VAL A C   1 
ATOM   239  O  O   . VAL A 1 38  ? 44.841 29.242  -19.511 1.00 23.76 ? 36  VAL A O   1 
ATOM   240  C  CB  . VAL A 1 38  ? 44.497 28.187  -16.618 1.00 23.12 ? 36  VAL A CB  1 
ATOM   241  C  CG1 . VAL A 1 38  ? 43.987 26.774  -16.962 1.00 18.15 ? 36  VAL A CG1 1 
ATOM   242  C  CG2 . VAL A 1 38  ? 44.770 28.337  -15.124 1.00 20.10 ? 36  VAL A CG2 1 
ATOM   243  N  N   . VAL A 1 39  ? 45.958 27.285  -19.502 1.00 16.90 ? 37  VAL A N   1 
ATOM   244  C  CA  . VAL A 1 39  ? 45.619 26.917  -20.868 1.00 21.97 ? 37  VAL A CA  1 
ATOM   245  C  C   . VAL A 1 39  ? 44.520 25.876  -20.769 1.00 25.39 ? 37  VAL A C   1 
ATOM   246  O  O   . VAL A 1 39  ? 44.737 24.797  -20.203 1.00 24.58 ? 37  VAL A O   1 
ATOM   247  C  CB  . VAL A 1 39  ? 46.840 26.376  -21.628 1.00 25.97 ? 37  VAL A CB  1 
ATOM   248  C  CG1 . VAL A 1 39  ? 46.435 25.806  -22.991 1.00 24.08 ? 37  VAL A CG1 1 
ATOM   249  C  CG2 . VAL A 1 39  ? 47.906 27.478  -21.765 1.00 23.12 ? 37  VAL A CG2 1 
ATOM   250  N  N   . ILE A 1 40  ? 43.330 26.208  -21.265 1.00 24.61 ? 38  ILE A N   1 
ATOM   251  C  CA  . ILE A 1 40  ? 42.228 25.254  -21.307 1.00 24.54 ? 38  ILE A CA  1 
ATOM   252  C  C   . ILE A 1 40  ? 42.373 24.436  -22.579 1.00 20.27 ? 38  ILE A C   1 
ATOM   253  O  O   . ILE A 1 40  ? 42.305 24.981  -23.690 1.00 23.28 ? 38  ILE A O   1 
ATOM   254  C  CB  . ILE A 1 40  ? 40.860 25.948  -21.271 1.00 25.44 ? 38  ILE A CB  1 
ATOM   255  C  CG1 . ILE A 1 40  ? 40.765 26.937  -20.109 1.00 20.98 ? 38  ILE A CG1 1 
ATOM   256  C  CG2 . ILE A 1 40  ? 39.740 24.885  -21.179 1.00 23.27 ? 38  ILE A CG2 1 
ATOM   257  C  CD1 . ILE A 1 40  ? 39.752 28.062  -20.373 1.00 24.17 ? 38  ILE A CD1 1 
ATOM   258  N  N   . CYS A 1 41  ? 42.564 23.129  -22.422 1.00 20.56 ? 39  CYS A N   1 
ATOM   259  C  CA  . CYS A 1 41  ? 42.622 22.213  -23.551 1.00 21.01 ? 39  CYS A CA  1 
ATOM   260  C  C   . CYS A 1 41  ? 41.330 21.413  -23.578 1.00 23.67 ? 39  CYS A C   1 
ATOM   261  O  O   . CYS A 1 41  ? 40.888 20.917  -22.537 1.00 23.33 ? 39  CYS A O   1 
ATOM   262  C  CB  . CYS A 1 41  ? 43.838 21.294  -23.445 1.00 26.84 ? 39  CYS A CB  1 
ATOM   263  S  SG  . CYS A 1 41  ? 43.567 19.665  -24.179 1.00 32.83 ? 39  CYS A SG  1 
ATOM   264  N  N   . ASP A 1 42  ? 40.710 21.316  -24.751 1.00 23.87 ? 40  ASP A N   1 
ATOM   265  C  CA  . ASP A 1 42  ? 39.495 20.525  -24.894 1.00 22.97 ? 40  ASP A CA  1 
ATOM   266  C  C   . ASP A 1 42  ? 39.297 20.193  -26.360 1.00 26.34 ? 40  ASP A C   1 
ATOM   267  O  O   . ASP A 1 42  ? 39.748 20.933  -27.239 1.00 26.56 ? 40  ASP A O   1 
ATOM   268  C  CB  . ASP A 1 42  ? 38.254 21.255  -24.357 1.00 25.11 ? 40  ASP A CB  1 
ATOM   269  C  CG  . ASP A 1 42  ? 37.194 20.293  -23.844 1.00 30.90 ? 40  ASP A CG  1 
ATOM   270  O  OD1 . ASP A 1 42  ? 36.542 19.604  -24.671 1.00 29.17 ? 40  ASP A OD1 1 
ATOM   271  O  OD2 . ASP A 1 42  ? 37.013 20.225  -22.607 1.00 27.74 ? 40  ASP A OD2 1 
ATOM   272  N  N   . LYS A 1 43  ? 38.614 19.067  -26.613 1.00 27.14 ? 41  LYS A N   1 
ATOM   273  C  CA  . LYS A 1 43  ? 38.302 18.675  -27.981 1.00 31.49 ? 41  LYS A CA  1 
ATOM   274  C  C   . LYS A 1 43  ? 37.068 19.382  -28.509 1.00 34.82 ? 41  LYS A C   1 
ATOM   275  O  O   . LYS A 1 43  ? 36.877 19.441  -29.726 1.00 36.21 ? 41  LYS A O   1 
ATOM   276  C  CB  . LYS A 1 43  ? 38.088 17.155  -28.082 1.00 32.73 ? 41  LYS A CB  1 
ATOM   277  C  CG  . LYS A 1 43  ? 36.803 16.649  -27.430 1.00 40.29 ? 41  LYS A CG  1 
ATOM   278  C  CD  . LYS A 1 43  ? 36.598 15.150  -27.661 1.00 46.97 ? 41  LYS A CD  1 
ATOM   279  C  CE  . LYS A 1 43  ? 35.266 14.674  -27.076 1.00 53.88 ? 41  LYS A CE  1 
ATOM   280  N  N   . ASP A 1 44  ? 36.224 19.903  -27.626 1.00 31.11 ? 42  ASP A N   1 
ATOM   281  C  CA  . ASP A 1 44  ? 35.013 20.613  -28.012 1.00 37.71 ? 42  ASP A CA  1 
ATOM   282  C  C   . ASP A 1 44  ? 35.184 22.095  -27.703 1.00 42.10 ? 42  ASP A C   1 
ATOM   283  O  O   . ASP A 1 44  ? 35.762 22.464  -26.673 1.00 33.24 ? 42  ASP A O   1 
ATOM   284  C  CB  . ASP A 1 44  ? 33.790 20.060  -27.281 1.00 33.54 ? 42  ASP A CB  1 
ATOM   285  C  CG  . ASP A 1 44  ? 33.350 18.697  -27.812 1.00 40.25 ? 42  ASP A CG  1 
ATOM   286  N  N   . GLU A 1 45  ? 34.670 22.939  -28.596 1.00 41.57 ? 43  GLU A N   1 
ATOM   287  C  CA  . GLU A 1 45  ? 34.919 24.373  -28.506 1.00 42.64 ? 43  GLU A CA  1 
ATOM   288  C  C   . GLU A 1 45  ? 33.970 25.075  -27.536 1.00 39.40 ? 43  GLU A C   1 
ATOM   289  O  O   . GLU A 1 45  ? 34.365 26.055  -26.891 1.00 38.67 ? 43  GLU A O   1 
ATOM   290  C  CB  . GLU A 1 45  ? 34.799 24.992  -29.902 1.00 51.99 ? 43  GLU A CB  1 
ATOM   291  C  CG  . GLU A 1 45  ? 35.284 26.425  -30.011 1.00 59.39 ? 43  GLU A CG  1 
ATOM   292  C  CD  . GLU A 1 45  ? 36.340 26.602  -31.089 1.00 68.96 ? 43  GLU A CD  1 
ATOM   293  O  OE1 . GLU A 1 45  ? 37.272 27.413  -30.877 1.00 71.03 ? 43  GLU A OE1 1 
ATOM   294  O  OE2 . GLU A 1 45  ? 36.242 25.926  -32.141 1.00 71.63 ? 43  GLU A OE2 1 
ATOM   295  N  N   . SER A 1 46  ? 32.740 24.572  -27.410 1.00 38.42 ? 44  SER A N   1 
ATOM   296  C  CA  . SER A 1 46  ? 31.643 25.317  -26.794 1.00 40.37 ? 44  SER A CA  1 
ATOM   297  C  C   . SER A 1 46  ? 32.006 25.843  -25.407 1.00 42.54 ? 44  SER A C   1 
ATOM   298  O  O   . SER A 1 46  ? 32.022 27.060  -25.172 1.00 36.91 ? 44  SER A O   1 
ATOM   299  C  CB  . SER A 1 46  ? 30.399 24.423  -26.729 1.00 39.67 ? 44  SER A CB  1 
ATOM   300  N  N   . GLY A 1 47  ? 32.298 24.931  -24.474 1.00 36.86 ? 45  GLY A N   1 
ATOM   301  C  CA  . GLY A 1 47  ? 32.553 25.333  -23.102 1.00 29.72 ? 45  GLY A CA  1 
ATOM   302  C  C   . GLY A 1 47  ? 33.873 26.055  -22.930 1.00 31.23 ? 45  GLY A C   1 
ATOM   303  O  O   . GLY A 1 47  ? 33.951 27.068  -22.222 1.00 24.12 ? 45  GLY A O   1 
ATOM   304  N  N   . GLY A 1 48  ? 34.929 25.552  -23.574 1.00 24.07 ? 46  GLY A N   1 
ATOM   305  C  CA  . GLY A 1 48  ? 36.253 26.115  -23.356 1.00 25.25 ? 46  GLY A CA  1 
ATOM   306  C  C   . GLY A 1 48  ? 36.398 27.522  -23.902 1.00 22.77 ? 46  GLY A C   1 
ATOM   307  O  O   . GLY A 1 48  ? 37.055 28.366  -23.289 1.00 26.23 ? 46  GLY A O   1 
ATOM   308  N  N   . ARG A 1 49  ? 35.800 27.787  -25.066 1.00 22.90 ? 47  ARG A N   1 
ATOM   309  C  CA  . ARG A 1 49  ? 35.817 29.131  -25.638 1.00 28.37 ? 47  ARG A CA  1 
ATOM   310  C  C   . ARG A 1 49  ? 35.145 30.134  -24.706 1.00 31.48 ? 47  ARG A C   1 
ATOM   311  O  O   . ARG A 1 49  ? 35.648 31.244  -24.499 1.00 28.66 ? 47  ARG A O   1 
ATOM   312  C  CB  . ARG A 1 49  ? 35.114 29.128  -26.993 1.00 37.23 ? 47  ARG A CB  1 
ATOM   313  C  CG  . ARG A 1 49  ? 35.821 29.900  -28.085 1.00 51.65 ? 47  ARG A CG  1 
ATOM   314  C  CD  . ARG A 1 49  ? 37.186 29.309  -28.389 1.00 52.62 ? 47  ARG A CD  1 
ATOM   315  N  N   . ALA A 1 50  ? 33.992 29.762  -24.153 1.00 27.65 ? 48  ALA A N   1 
ATOM   316  C  CA  . ALA A 1 50  ? 33.278 30.649  -23.245 1.00 23.44 ? 48  ALA A CA  1 
ATOM   317  C  C   . ALA A 1 50  ? 34.086 30.896  -21.981 1.00 25.15 ? 48  ALA A C   1 
ATOM   318  O  O   . ALA A 1 50  ? 34.089 32.016  -21.454 1.00 25.40 ? 48  ALA A O   1 
ATOM   319  C  CB  . ALA A 1 50  ? 31.911 30.055  -22.912 1.00 25.30 ? 48  ALA A CB  1 
ATOM   320  N  N   . LEU A 1 51  ? 34.785 29.860  -21.494 1.00 23.96 ? 49  LEU A N   1 
ATOM   321  C  CA  . LEU A 1 51  ? 35.599 29.980  -20.292 1.00 21.71 ? 49  LEU A CA  1 
ATOM   322  C  C   . LEU A 1 51  ? 36.762 30.938  -20.507 1.00 23.77 ? 49  LEU A C   1 
ATOM   323  O  O   . LEU A 1 51  ? 37.119 31.697  -19.599 1.00 25.22 ? 49  LEU A O   1 
ATOM   324  C  CB  . LEU A 1 51  ? 36.134 28.605  -19.873 1.00 29.89 ? 49  LEU A CB  1 
ATOM   325  C  CG  . LEU A 1 51  ? 35.643 27.911  -18.597 1.00 37.44 ? 49  LEU A CG  1 
ATOM   326  C  CD1 . LEU A 1 51  ? 36.618 26.803  -18.141 1.00 33.93 ? 49  LEU A CD1 1 
ATOM   327  C  CD2 . LEU A 1 51  ? 35.363 28.891  -17.463 1.00 32.06 ? 49  LEU A CD2 1 
ATOM   328  N  N   . GLU A 1 52  ? 37.394 30.885  -21.683 1.00 21.90 ? 50  GLU A N   1 
ATOM   329  C  CA  . GLU A 1 52  ? 38.438 31.854  -21.997 1.00 26.15 ? 50  GLU A CA  1 
ATOM   330  C  C   . GLU A 1 52  ? 37.894 33.274  -21.963 1.00 27.11 ? 50  GLU A C   1 
ATOM   331  O  O   . GLU A 1 52  ? 38.561 34.190  -21.465 1.00 26.46 ? 50  GLU A O   1 
ATOM   332  C  CB  . GLU A 1 52  ? 39.061 31.574  -23.373 1.00 28.42 ? 50  GLU A CB  1 
ATOM   333  C  CG  . GLU A 1 52  ? 39.830 32.781  -23.858 1.00 27.91 ? 50  GLU A CG  1 
ATOM   334  C  CD  . GLU A 1 52  ? 40.579 32.622  -25.171 1.00 34.16 ? 50  GLU A CD  1 
ATOM   335  O  OE1 . GLU A 1 52  ? 41.090 33.653  -25.656 1.00 48.77 ? 50  GLU A OE1 1 
ATOM   336  O  OE2 . GLU A 1 52  ? 40.677 31.513  -25.706 1.00 27.35 ? 50  GLU A OE2 1 
ATOM   337  N  N   . GLN A 1 53  ? 36.692 33.491  -22.512 1.00 23.61 ? 51  GLN A N   1 
ATOM   338  C  CA  . GLN A 1 53  ? 36.151 34.843  -22.488 1.00 24.06 ? 51  GLN A CA  1 
ATOM   339  C  C   . GLN A 1 53  ? 35.843 35.278  -21.065 1.00 24.83 ? 51  GLN A C   1 
ATOM   340  O  O   . GLN A 1 53  ? 36.012 36.449  -20.713 1.00 29.32 ? 51  GLN A O   1 
ATOM   341  C  CB  . GLN A 1 53  ? 34.902 34.928  -23.366 1.00 27.91 ? 51  GLN A CB  1 
ATOM   342  C  CG  . GLN A 1 53  ? 35.177 34.663  -24.842 1.00 25.76 ? 51  GLN A CG  1 
ATOM   343  C  CD  . GLN A 1 53  ? 36.263 35.573  -25.404 1.00 31.26 ? 51  GLN A CD  1 
ATOM   344  O  OE1 . GLN A 1 53  ? 37.340 35.118  -25.753 1.00 40.50 ? 51  GLN A OE1 1 
ATOM   345  N  NE2 . GLN A 1 53  ? 35.973 36.856  -25.488 1.00 36.92 ? 51  GLN A NE2 1 
ATOM   346  N  N   . GLU A 1 54  ? 35.426 34.342  -20.231 1.00 23.17 ? 52  GLU A N   1 
ATOM   347  C  CA  . GLU A 1 54  ? 34.979 34.666  -18.886 1.00 26.88 ? 52  GLU A CA  1 
ATOM   348  C  C   . GLU A 1 54  ? 36.142 34.981  -17.948 1.00 25.01 ? 52  GLU A C   1 
ATOM   349  O  O   . GLU A 1 54  ? 36.056 35.917  -17.142 1.00 24.92 ? 52  GLU A O   1 
ATOM   350  C  CB  . GLU A 1 54  ? 34.157 33.499  -18.338 1.00 27.80 ? 52  GLU A CB  1 
ATOM   351  C  CG  . GLU A 1 54  ? 33.824 33.685  -16.899 1.00 31.97 ? 52  GLU A CG  1 
ATOM   352  C  CD  . GLU A 1 54  ? 33.169 32.487  -16.260 1.00 23.96 ? 52  GLU A CD  1 
ATOM   353  O  OE1 . GLU A 1 54  ? 32.819 31.494  -16.949 1.00 25.80 ? 52  GLU A OE1 1 
ATOM   354  O  OE2 . GLU A 1 54  ? 32.981 32.569  -15.037 1.00 27.08 ? 52  GLU A OE2 1 
ATOM   355  N  N   . LEU A 1 55  ? 37.233 34.213  -18.033 1.00 22.90 ? 53  LEU A N   1 
ATOM   356  C  CA  . LEU A 1 55  ? 38.296 34.266  -17.038 1.00 24.27 ? 53  LEU A CA  1 
ATOM   357  C  C   . LEU A 1 55  ? 39.511 35.008  -17.576 1.00 24.33 ? 53  LEU A C   1 
ATOM   358  O  O   . LEU A 1 55  ? 40.190 34.491  -18.480 1.00 22.19 ? 53  LEU A O   1 
ATOM   359  C  CB  . LEU A 1 55  ? 38.698 32.850  -16.616 1.00 22.39 ? 53  LEU A CB  1 
ATOM   360  C  CG  . LEU A 1 55  ? 37.550 31.952  -16.145 1.00 28.51 ? 53  LEU A CG  1 
ATOM   361  C  CD1 . LEU A 1 55  ? 38.056 30.548  -15.814 1.00 29.98 ? 53  LEU A CD1 1 
ATOM   362  C  CD2 . LEU A 1 55  ? 36.882 32.584  -14.931 1.00 27.63 ? 53  LEU A CD2 1 
ATOM   363  N  N   . PRO A 1 56  ? 39.855 36.178  -17.045 1.00 29.78 ? 54  PRO A N   1 
ATOM   364  C  CA  . PRO A 1 56  ? 41.162 36.756  -17.373 1.00 30.58 ? 54  PRO A CA  1 
ATOM   365  C  C   . PRO A 1 56  ? 42.254 35.809  -16.898 1.00 35.24 ? 54  PRO A C   1 
ATOM   366  O  O   . PRO A 1 56  ? 42.229 35.323  -15.765 1.00 46.47 ? 54  PRO A O   1 
ATOM   367  C  CB  . PRO A 1 56  ? 41.174 38.082  -16.602 1.00 36.15 ? 54  PRO A CB  1 
ATOM   368  C  CG  . PRO A 1 56  ? 39.718 38.394  -16.351 1.00 36.79 ? 54  PRO A CG  1 
ATOM   369  C  CD  . PRO A 1 56  ? 39.041 37.069  -16.194 1.00 33.37 ? 54  PRO A CD  1 
ATOM   370  N  N   . GLY A 1 57  ? 43.194 35.517  -17.774 1.00 30.33 ? 55  GLY A N   1 
ATOM   371  C  CA  . GLY A 1 57  ? 44.261 34.609  -17.418 1.00 30.25 ? 55  GLY A CA  1 
ATOM   372  C  C   . GLY A 1 57  ? 44.041 33.162  -17.800 1.00 27.64 ? 55  GLY A C   1 
ATOM   373  O  O   . GLY A 1 57  ? 44.931 32.343  -17.557 1.00 30.73 ? 55  GLY A O   1 
ATOM   374  N  N   . ALA A 1 58  ? 42.886 32.817  -18.375 1.00 25.40 ? 56  ALA A N   1 
ATOM   375  C  CA  . ALA A 1 58  ? 42.672 31.530  -19.023 1.00 25.30 ? 56  ALA A CA  1 
ATOM   376  C  C   . ALA A 1 58  ? 42.529 31.745  -20.522 1.00 25.60 ? 56  ALA A C   1 
ATOM   377  O  O   . ALA A 1 58  ? 41.886 32.702  -20.958 1.00 25.14 ? 56  ALA A O   1 
ATOM   378  C  CB  . ALA A 1 58  ? 41.419 30.816  -18.499 1.00 22.26 ? 56  ALA A CB  1 
ATOM   379  N  N   . VAL A 1 59  ? 43.155 30.875  -21.307 1.00 23.53 ? 57  VAL A N   1 
ATOM   380  C  CA  . VAL A 1 59  ? 42.976 30.872  -22.751 1.00 30.59 ? 57  VAL A CA  1 
ATOM   381  C  C   . VAL A 1 59  ? 42.636 29.455  -23.172 1.00 30.38 ? 57  VAL A C   1 
ATOM   382  O  O   . VAL A 1 59  ? 42.975 28.485  -22.486 1.00 26.23 ? 57  VAL A O   1 
ATOM   383  C  CB  . VAL A 1 59  ? 44.212 31.381  -23.516 1.00 22.39 ? 57  VAL A CB  1 
ATOM   384  C  CG1 . VAL A 1 59  ? 44.602 32.814  -23.030 1.00 25.12 ? 57  VAL A CG1 1 
ATOM   385  C  CG2 . VAL A 1 59  ? 45.360 30.394  -23.405 1.00 26.22 ? 57  VAL A CG2 1 
ATOM   386  N  N   . PHE A 1 60  ? 41.956 29.336  -24.305 1.00 30.71 ? 58  PHE A N   1 
ATOM   387  C  CA  . PHE A 1 60  ? 41.479 28.051  -24.797 1.00 28.33 ? 58  PHE A CA  1 
ATOM   388  C  C   . PHE A 1 60  ? 42.292 27.627  -26.011 1.00 22.85 ? 58  PHE A C   1 
ATOM   389  O  O   . PHE A 1 60  ? 42.449 28.403  -26.956 1.00 22.39 ? 58  PHE A O   1 
ATOM   390  C  CB  . PHE A 1 60  ? 39.995 28.114  -25.176 1.00 30.02 ? 58  PHE A CB  1 
ATOM   391  C  CG  . PHE A 1 60  ? 39.495 26.852  -25.830 1.00 25.04 ? 58  PHE A CG  1 
ATOM   392  C  CD1 . PHE A 1 60  ? 39.325 25.700  -25.085 1.00 23.78 ? 58  PHE A CD1 1 
ATOM   393  C  CD2 . PHE A 1 60  ? 39.235 26.813  -27.192 1.00 30.96 ? 58  PHE A CD2 1 
ATOM   394  C  CE1 . PHE A 1 60  ? 38.875 24.519  -25.688 1.00 24.00 ? 58  PHE A CE1 1 
ATOM   395  C  CE2 . PHE A 1 60  ? 38.781 25.649  -27.804 1.00 30.90 ? 58  PHE A CE2 1 
ATOM   396  C  CZ  . PHE A 1 60  ? 38.604 24.495  -27.052 1.00 24.94 ? 58  PHE A CZ  1 
ATOM   397  N  N   . ILE A 1 61  ? 42.778 26.389  -26.004 1.00 24.95 ? 59  ILE A N   1 
ATOM   398  C  CA  . ILE A 1 61  ? 43.435 25.817  -27.174 1.00 28.03 ? 59  ILE A CA  1 
ATOM   399  C  C   . ILE A 1 61  ? 42.719 24.522  -27.533 1.00 28.47 ? 59  ILE A C   1 
ATOM   400  O  O   . ILE A 1 61  ? 42.665 23.588  -26.723 1.00 25.02 ? 59  ILE A O   1 
ATOM   401  C  CB  . ILE A 1 61  ? 44.937 25.587  -26.946 1.00 27.99 ? 59  ILE A CB  1 
ATOM   402  C  CG1 . ILE A 1 61  ? 45.648 26.939  -26.812 1.00 28.97 ? 59  ILE A CG1 1 
ATOM   403  C  CG2 . ILE A 1 61  ? 45.546 24.798  -28.127 1.00 29.04 ? 59  ILE A CG2 1 
ATOM   404  C  CD1 . ILE A 1 61  ? 47.144 26.856  -26.530 1.00 29.21 ? 59  ILE A CD1 1 
ATOM   405  N  N   . LEU A 1 62  ? 42.155 24.478  -28.738 1.00 26.85 ? 60  LEU A N   1 
ATOM   406  C  CA  . LEU A 1 62  ? 41.498 23.266  -29.196 1.00 29.79 ? 60  LEU A CA  1 
ATOM   407  C  C   . LEU A 1 62  ? 42.536 22.163  -29.332 1.00 33.17 ? 60  LEU A C   1 
ATOM   408  O  O   . LEU A 1 62  ? 43.578 22.351  -29.968 1.00 30.22 ? 60  LEU A O   1 
ATOM   409  C  CB  . LEU A 1 62  ? 40.796 23.518  -30.529 1.00 34.33 ? 60  LEU A CB  1 
ATOM   410  C  CG  . LEU A 1 62  ? 39.891 22.395  -31.034 1.00 33.46 ? 60  LEU A CG  1 
ATOM   411  C  CD1 . LEU A 1 62  ? 38.576 22.374  -30.265 1.00 30.44 ? 60  LEU A CD1 1 
ATOM   412  C  CD2 . LEU A 1 62  ? 39.665 22.577  -32.520 1.00 37.51 ? 60  LEU A CD2 1 
ATOM   413  N  N   . CYS A 1 63  ? 42.277 21.026  -28.694 1.00 28.39 ? 61  CYS A N   1 
ATOM   414  C  CA  . CYS A 1 63  ? 43.249 19.937  -28.704 1.00 24.60 ? 61  CYS A CA  1 
ATOM   415  C  C   . CYS A 1 63  ? 42.542 18.660  -28.305 1.00 27.92 ? 61  CYS A C   1 
ATOM   416  O  O   . CYS A 1 63  ? 41.958 18.594  -27.220 1.00 31.82 ? 61  CYS A O   1 
ATOM   417  C  CB  . CYS A 1 63  ? 44.410 20.213  -27.755 1.00 28.35 ? 61  CYS A CB  1 
ATOM   418  S  SG  . CYS A 1 63  ? 45.519 18.793  -27.557 1.00 33.30 ? 61  CYS A SG  1 
ATOM   419  N  N   . ASP A 1 64  ? 42.586 17.667  -29.184 1.00 22.00 ? 62  ASP A N   1 
ATOM   420  C  CA  . ASP A 1 64  ? 42.153 16.310  -28.871 1.00 22.04 ? 62  ASP A CA  1 
ATOM   421  C  C   . ASP A 1 64  ? 43.379 15.557  -28.372 1.00 31.77 ? 62  ASP A C   1 
ATOM   422  O  O   . ASP A 1 64  ? 44.310 15.322  -29.149 1.00 25.73 ? 62  ASP A O   1 
ATOM   423  C  CB  . ASP A 1 64  ? 41.564 15.654  -30.118 1.00 25.30 ? 62  ASP A CB  1 
ATOM   424  C  CG  . ASP A 1 64  ? 41.034 14.254  -29.854 1.00 34.75 ? 62  ASP A CG  1 
ATOM   425  O  OD1 . ASP A 1 64  ? 41.478 13.597  -28.884 1.00 30.90 ? 62  ASP A OD1 1 
ATOM   426  O  OD2 . ASP A 1 64  ? 40.164 13.813  -30.623 1.00 33.81 ? 62  ASP A OD2 1 
ATOM   427  N  N   . VAL A 1 65  ? 43.381 15.167  -27.087 1.00 24.97 ? 63  VAL A N   1 
ATOM   428  C  CA  . VAL A 1 65  ? 44.569 14.542  -26.503 1.00 26.65 ? 63  VAL A CA  1 
ATOM   429  C  C   . VAL A 1 65  ? 44.886 13.181  -27.107 1.00 25.15 ? 63  VAL A C   1 
ATOM   430  O  O   . VAL A 1 65  ? 46.001 12.685  -26.921 1.00 31.28 ? 63  VAL A O   1 
ATOM   431  C  CB  . VAL A 1 65  ? 44.475 14.391  -24.964 1.00 30.13 ? 63  VAL A CB  1 
ATOM   432  C  CG1 . VAL A 1 65  ? 44.298 15.751  -24.300 1.00 27.78 ? 63  VAL A CG1 1 
ATOM   433  C  CG2 . VAL A 1 65  ? 43.378 13.393  -24.553 1.00 30.65 ? 63  VAL A CG2 1 
ATOM   434  N  N   . THR A 1 66  ? 43.950 12.550  -27.821 1.00 25.95 ? 64  THR A N   1 
ATOM   435  C  CA  . THR A 1 66  ? 44.268 11.302  -28.507 1.00 27.19 ? 64  THR A CA  1 
ATOM   436  C  C   . THR A 1 66  ? 45.009 11.527  -29.819 1.00 36.23 ? 64  THR A C   1 
ATOM   437  O  O   . THR A 1 66  ? 45.401 10.548  -30.468 1.00 31.64 ? 64  THR A O   1 
ATOM   438  C  CB  . THR A 1 66  ? 43.002 10.486  -28.796 1.00 29.98 ? 64  THR A CB  1 
ATOM   439  O  OG1 . THR A 1 66  ? 42.231 11.130  -29.817 1.00 32.49 ? 64  THR A OG1 1 
ATOM   440  C  CG2 . THR A 1 66  ? 42.162 10.306  -27.544 1.00 26.62 ? 64  THR A CG2 1 
ATOM   441  N  N   . GLN A 1 67  ? 45.202 12.779  -30.230 1.00 32.62 ? 65  GLN A N   1 
ATOM   442  C  CA  . GLN A 1 67  ? 45.888 13.102  -31.476 1.00 37.38 ? 65  GLN A CA  1 
ATOM   443  C  C   . GLN A 1 67  ? 47.240 13.696  -31.108 1.00 34.51 ? 65  GLN A C   1 
ATOM   444  O  O   . GLN A 1 67  ? 47.309 14.793  -30.543 1.00 29.31 ? 65  GLN A O   1 
ATOM   445  C  CB  . GLN A 1 67  ? 45.051 14.062  -32.317 1.00 40.58 ? 65  GLN A CB  1 
ATOM   446  C  CG  . GLN A 1 67  ? 43.631 13.562  -32.541 1.00 37.55 ? 65  GLN A CG  1 
ATOM   447  C  CD  . GLN A 1 67  ? 43.595 12.304  -33.374 1.00 44.00 ? 65  GLN A CD  1 
ATOM   448  O  OE1 . GLN A 1 67  ? 44.058 12.287  -34.514 1.00 51.00 ? 65  GLN A OE1 1 
ATOM   449  N  NE2 . GLN A 1 67  ? 43.054 11.228  -32.804 1.00 47.42 ? 65  GLN A NE2 1 
ATOM   450  N  N   . GLU A 1 68  ? 48.310 12.964  -31.423 1.00 33.42 ? 66  GLU A N   1 
ATOM   451  C  CA  . GLU A 1 68  ? 49.637 13.340  -30.943 1.00 34.53 ? 66  GLU A CA  1 
ATOM   452  C  C   . GLU A 1 68  ? 50.053 14.708  -31.469 1.00 34.04 ? 66  GLU A C   1 
ATOM   453  O  O   . GLU A 1 68  ? 50.722 15.471  -30.766 1.00 33.42 ? 66  GLU A O   1 
ATOM   454  C  CB  . GLU A 1 68  ? 50.658 12.270  -31.347 1.00 41.43 ? 66  GLU A CB  1 
ATOM   455  C  CG  . GLU A 1 68  ? 52.062 12.487  -30.783 1.00 48.58 ? 66  GLU A CG  1 
ATOM   456  N  N   . ASP A 1 69  ? 49.664 15.038  -32.701 1.00 33.49 ? 67  ASP A N   1 
ATOM   457  C  CA  . ASP A 1 69  ? 50.028 16.336  -33.266 1.00 35.45 ? 67  ASP A CA  1 
ATOM   458  C  C   . ASP A 1 69  ? 49.251 17.473  -32.609 1.00 34.81 ? 67  ASP A C   1 
ATOM   459  O  O   . ASP A 1 69  ? 49.777 18.581  -32.455 1.00 35.96 ? 67  ASP A O   1 
ATOM   460  C  CB  . ASP A 1 69  ? 49.809 16.325  -34.783 1.00 38.69 ? 67  ASP A CB  1 
ATOM   461  C  CG  . ASP A 1 69  ? 50.839 15.473  -35.504 1.00 52.36 ? 67  ASP A CG  1 
ATOM   462  O  OD1 . ASP A 1 69  ? 51.940 15.278  -34.937 1.00 56.99 ? 67  ASP A OD1 1 
ATOM   463  O  OD2 . ASP A 1 69  ? 50.565 15.009  -36.635 1.00 58.81 ? 67  ASP A OD2 1 
ATOM   464  N  N   . ASP A 1 70  ? 47.989 17.232  -32.243 1.00 33.88 ? 68  ASP A N   1 
ATOM   465  C  CA  . ASP A 1 70  ? 47.281 18.180  -31.385 1.00 32.92 ? 68  ASP A CA  1 
ATOM   466  C  C   . ASP A 1 70  ? 48.078 18.460  -30.116 1.00 32.77 ? 68  ASP A C   1 
ATOM   467  O  O   . ASP A 1 70  ? 48.259 19.618  -29.721 1.00 30.75 ? 68  ASP A O   1 
ATOM   468  C  CB  . ASP A 1 70  ? 45.894 17.645  -31.010 1.00 37.56 ? 68  ASP A CB  1 
ATOM   469  C  CG  . ASP A 1 70  ? 44.856 17.851  -32.090 1.00 38.68 ? 68  ASP A CG  1 
ATOM   470  O  OD1 . ASP A 1 70  ? 45.213 17.954  -33.283 1.00 39.53 ? 68  ASP A OD1 1 
ATOM   471  O  OD2 . ASP A 1 70  ? 43.661 17.891  -31.732 1.00 35.93 ? 68  ASP A OD2 1 
ATOM   472  N  N   . VAL A 1 71  ? 48.569 17.402  -29.464 1.00 32.51 ? 69  VAL A N   1 
ATOM   473  C  CA  . VAL A 1 71  ? 49.207 17.573  -28.162 1.00 27.33 ? 69  VAL A CA  1 
ATOM   474  C  C   . VAL A 1 71  ? 50.544 18.281  -28.309 1.00 26.20 ? 69  VAL A C   1 
ATOM   475  O  O   . VAL A 1 71  ? 50.896 19.139  -27.493 1.00 25.98 ? 69  VAL A O   1 
ATOM   476  C  CB  . VAL A 1 71  ? 49.376 16.222  -27.446 1.00 34.64 ? 69  VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 71  ? 49.928 16.460  -26.048 1.00 28.92 ? 69  VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 71  ? 48.053 15.473  -27.379 1.00 32.01 ? 69  VAL A CG2 1 
ATOM   479  N  N   . LYS A 1 72  ? 51.316 17.926  -29.340 1.00 28.21 ? 70  LYS A N   1 
ATOM   480  C  CA  . LYS A 1 72  ? 52.572 18.627  -29.591 1.00 32.90 ? 70  LYS A CA  1 
ATOM   481  C  C   . LYS A 1 72  ? 52.332 20.122  -29.781 1.00 29.86 ? 70  LYS A C   1 
ATOM   482  O  O   . LYS A 1 72  ? 53.059 20.960  -29.231 1.00 27.19 ? 70  LYS A O   1 
ATOM   483  C  CB  . LYS A 1 72  ? 53.257 18.025  -30.823 1.00 37.10 ? 70  LYS A CB  1 
ATOM   484  C  CG  . LYS A 1 72  ? 54.681 18.491  -31.021 1.00 40.51 ? 70  LYS A CG  1 
ATOM   485  N  N   . THR A 1 73  ? 51.317 20.472  -30.572 1.00 29.45 ? 71  THR A N   1 
ATOM   486  C  CA  . THR A 1 73  ? 50.994 21.878  -30.784 1.00 28.40 ? 71  THR A CA  1 
ATOM   487  C  C   . THR A 1 73  ? 50.533 22.529  -29.489 1.00 27.33 ? 71  THR A C   1 
ATOM   488  O  O   . THR A 1 73  ? 50.899 23.674  -29.196 1.00 27.32 ? 71  THR A O   1 
ATOM   489  C  CB  . THR A 1 73  ? 49.935 21.996  -31.875 1.00 31.23 ? 71  THR A CB  1 
ATOM   490  O  OG1 . THR A 1 73  ? 50.535 21.645  -33.126 1.00 33.19 ? 71  THR A OG1 1 
ATOM   491  C  CG2 . THR A 1 73  ? 49.376 23.412  -31.960 1.00 34.88 ? 71  THR A CG2 1 
ATOM   492  N  N   . LEU A 1 74  ? 49.765 21.798  -28.676 1.00 25.76 ? 72  LEU A N   1 
ATOM   493  C  CA  . LEU A 1 74  ? 49.341 22.332  -27.385 1.00 24.05 ? 72  LEU A CA  1 
ATOM   494  C  C   . LEU A 1 74  ? 50.542 22.742  -26.537 1.00 26.93 ? 72  LEU A C   1 
ATOM   495  O  O   . LEU A 1 74  ? 50.573 23.841  -25.974 1.00 25.65 ? 72  LEU A O   1 
ATOM   496  C  CB  . LEU A 1 74  ? 48.490 21.294  -26.650 1.00 23.32 ? 72  LEU A CB  1 
ATOM   497  C  CG  . LEU A 1 74  ? 48.121 21.604  -25.197 1.00 23.89 ? 72  LEU A CG  1 
ATOM   498  C  CD1 . LEU A 1 74  ? 47.187 22.785  -25.135 1.00 21.34 ? 72  LEU A CD1 1 
ATOM   499  C  CD2 . LEU A 1 74  ? 47.465 20.387  -24.522 1.00 23.71 ? 72  LEU A CD2 1 
ATOM   500  N  N   . VAL A 1 75  ? 51.547 21.871  -26.434 1.00 25.94 ? 73  VAL A N   1 
ATOM   501  C  CA  . VAL A 1 75  ? 52.717 22.192  -25.615 1.00 22.90 ? 73  VAL A CA  1 
ATOM   502  C  C   . VAL A 1 75  ? 53.518 23.337  -26.240 1.00 28.39 ? 73  VAL A C   1 
ATOM   503  O  O   . VAL A 1 75  ? 53.928 24.278  -25.546 1.00 26.46 ? 73  VAL A O   1 
ATOM   504  C  CB  . VAL A 1 75  ? 53.592 20.942  -25.396 1.00 24.53 ? 73  VAL A CB  1 
ATOM   505  C  CG1 . VAL A 1 75  ? 54.935 21.328  -24.773 1.00 23.20 ? 73  VAL A CG1 1 
ATOM   506  C  CG2 . VAL A 1 75  ? 52.872 19.936  -24.486 1.00 24.47 ? 73  VAL A CG2 1 
ATOM   507  N  N   . SER A 1 76  ? 53.768 23.276  -27.551 1.00 27.56 ? 74  SER A N   1 
ATOM   508  C  CA  . SER A 1 76  ? 54.599 24.311  -28.165 1.00 30.26 ? 74  SER A CA  1 
ATOM   509  C  C   . SER A 1 76  ? 53.908 25.673  -28.137 1.00 29.59 ? 74  SER A C   1 
ATOM   510  O  O   . SER A 1 76  ? 54.558 26.703  -27.922 1.00 25.57 ? 74  SER A O   1 
ATOM   511  C  CB  . SER A 1 76  ? 54.967 23.914  -29.599 1.00 33.11 ? 74  SER A CB  1 
ATOM   512  O  OG  . SER A 1 76  ? 53.825 23.863  -30.427 1.00 37.06 ? 74  SER A OG  1 
ATOM   513  N  N   . GLU A 1 77  ? 52.593 25.697  -28.361 1.00 19.52 ? 75  GLU A N   1 
ATOM   514  C  CA  . GLU A 1 77  ? 51.829 26.938  -28.234 1.00 26.26 ? 75  GLU A CA  1 
ATOM   515  C  C   . GLU A 1 77  ? 51.845 27.475  -26.803 1.00 23.83 ? 75  GLU A C   1 
ATOM   516  O  O   . GLU A 1 77  ? 51.926 28.688  -26.596 1.00 24.51 ? 75  GLU A O   1 
ATOM   517  C  CB  . GLU A 1 77  ? 50.384 26.715  -28.703 1.00 21.35 ? 75  GLU A CB  1 
ATOM   518  C  CG  . GLU A 1 77  ? 50.236 26.759  -30.213 1.00 27.28 ? 75  GLU A CG  1 
ATOM   519  C  CD  . GLU A 1 77  ? 50.679 28.102  -30.788 1.00 35.07 ? 75  GLU A CD  1 
ATOM   520  O  OE1 . GLU A 1 77  ? 51.805 28.200  -31.331 1.00 35.15 ? 75  GLU A OE1 1 
ATOM   521  O  OE2 . GLU A 1 77  ? 49.901 29.069  -30.678 1.00 37.39 ? 75  GLU A OE2 1 
ATOM   522  N  N   . THR A 1 78  ? 51.738 26.595  -25.805 1.00 25.06 ? 76  THR A N   1 
ATOM   523  C  CA  . THR A 1 78  ? 51.789 27.039  -24.413 1.00 25.37 ? 76  THR A CA  1 
ATOM   524  C  C   . THR A 1 78  ? 53.117 27.725  -24.105 1.00 29.13 ? 76  THR A C   1 
ATOM   525  O  O   . THR A 1 78  ? 53.148 28.816  -23.513 1.00 22.32 ? 76  THR A O   1 
ATOM   526  C  CB  . THR A 1 78  ? 51.564 25.846  -23.478 1.00 25.71 ? 76  THR A CB  1 
ATOM   527  O  OG1 . THR A 1 78  ? 50.215 25.375  -23.616 1.00 23.73 ? 76  THR A OG1 1 
ATOM   528  C  CG2 . THR A 1 78  ? 51.802 26.240  -22.023 1.00 23.56 ? 76  THR A CG2 1 
ATOM   529  N  N   . ILE A 1 79  ? 54.227 27.094  -24.509 1.00 24.08 ? 77  ILE A N   1 
ATOM   530  C  CA  . ILE A 1 79  ? 55.554 27.674  -24.303 1.00 24.05 ? 77  ILE A CA  1 
ATOM   531  C  C   . ILE A 1 79  ? 55.716 28.954  -25.107 1.00 25.55 ? 77  ILE A C   1 
ATOM   532  O  O   . ILE A 1 79  ? 56.262 29.946  -24.608 1.00 23.56 ? 77  ILE A O   1 
ATOM   533  C  CB  . ILE A 1 79  ? 56.646 26.647  -24.663 1.00 20.11 ? 77  ILE A CB  1 
ATOM   534  C  CG1 . ILE A 1 79  ? 56.561 25.444  -23.728 1.00 26.12 ? 77  ILE A CG1 1 
ATOM   535  C  CG2 . ILE A 1 79  ? 58.039 27.276  -24.547 1.00 21.35 ? 77  ILE A CG2 1 
ATOM   536  C  CD1 . ILE A 1 79  ? 56.711 25.838  -22.271 1.00 23.31 ? 77  ILE A CD1 1 
ATOM   537  N  N   . ARG A 1 80  ? 55.256 28.958  -26.369 1.00 24.64 ? 78  ARG A N   1 
ATOM   538  C  CA  . ARG A 1 80  ? 55.424 30.153  -27.191 1.00 25.60 ? 78  ARG A CA  1 
ATOM   539  C  C   . ARG A 1 80  ? 54.709 31.346  -26.563 1.00 30.68 ? 78  ARG A C   1 
ATOM   540  O  O   . ARG A 1 80  ? 55.252 32.456  -26.529 1.00 21.60 ? 78  ARG A O   1 
ATOM   541  C  CB  . ARG A 1 80  ? 54.906 29.913  -28.614 1.00 23.84 ? 78  ARG A CB  1 
ATOM   542  C  CG  . ARG A 1 80  ? 55.156 31.088  -29.553 1.00 28.09 ? 78  ARG A CG  1 
ATOM   543  C  CD  . ARG A 1 80  ? 54.493 30.892  -30.920 1.00 36.06 ? 78  ARG A CD  1 
ATOM   544  N  NE  . ARG A 1 80  ? 53.033 30.842  -30.839 1.00 35.99 ? 78  ARG A NE  1 
ATOM   545  C  CZ  . ARG A 1 80  ? 52.248 31.917  -30.781 1.00 39.90 ? 78  ARG A CZ  1 
ATOM   546  N  NH1 . ARG A 1 80  ? 50.928 31.780  -30.711 1.00 37.08 ? 78  ARG A NH1 1 
ATOM   547  N  NH2 . ARG A 1 80  ? 52.783 33.131  -30.785 1.00 40.37 ? 78  ARG A NH2 1 
ATOM   548  N  N   . ARG A 1 81  ? 53.503 31.124  -26.029 1.00 25.23 ? 79  ARG A N   1 
ATOM   549  C  CA  . ARG A 1 81  ? 52.666 32.211  -25.538 1.00 29.42 ? 79  ARG A CA  1 
ATOM   550  C  C   . ARG A 1 81  ? 52.991 32.636  -24.107 1.00 22.71 ? 79  ARG A C   1 
ATOM   551  O  O   . ARG A 1 81  ? 52.815 33.812  -23.772 1.00 24.26 ? 79  ARG A O   1 
ATOM   552  C  CB  . ARG A 1 81  ? 51.183 31.805  -25.643 1.00 23.51 ? 79  ARG A CB  1 
ATOM   553  C  CG  . ARG A 1 81  ? 50.754 31.597  -27.085 1.00 27.18 ? 79  ARG A CG  1 
ATOM   554  C  CD  . ARG A 1 81  ? 49.346 31.056  -27.216 1.00 29.49 ? 79  ARG A CD  1 
ATOM   555  N  NE  . ARG A 1 81  ? 48.363 32.053  -26.812 1.00 34.62 ? 79  ARG A NE  1 
ATOM   556  C  CZ  . ARG A 1 81  ? 47.052 31.881  -26.911 1.00 29.16 ? 79  ARG A CZ  1 
ATOM   557  N  NH1 . ARG A 1 81  ? 46.236 32.824  -26.497 1.00 29.39 ? 79  ARG A NH1 1 
ATOM   558  N  NH2 . ARG A 1 81  ? 46.569 30.757  -27.422 1.00 26.07 ? 79  ARG A NH2 1 
ATOM   559  N  N   . PHE A 1 82  ? 53.462 31.726  -23.249 1.00 22.17 ? 80  PHE A N   1 
ATOM   560  C  CA  . PHE A 1 82  ? 53.622 32.051  -21.835 1.00 21.60 ? 80  PHE A CA  1 
ATOM   561  C  C   . PHE A 1 82  ? 55.015 31.802  -21.269 1.00 24.11 ? 80  PHE A C   1 
ATOM   562  O  O   . PHE A 1 82  ? 55.257 32.178  -20.118 1.00 22.39 ? 80  PHE A O   1 
ATOM   563  C  CB  . PHE A 1 82  ? 52.586 31.279  -20.999 1.00 23.06 ? 80  PHE A CB  1 
ATOM   564  C  CG  . PHE A 1 82  ? 51.172 31.540  -21.442 1.00 29.45 ? 80  PHE A CG  1 
ATOM   565  C  CD1 . PHE A 1 82  ? 50.607 32.799  -21.273 1.00 31.48 ? 80  PHE A CD1 1 
ATOM   566  C  CD2 . PHE A 1 82  ? 50.433 30.556  -22.079 1.00 28.82 ? 80  PHE A CD2 1 
ATOM   567  C  CE1 . PHE A 1 82  ? 49.316 33.066  -21.705 1.00 36.29 ? 80  PHE A CE1 1 
ATOM   568  C  CE2 . PHE A 1 82  ? 49.135 30.817  -22.510 1.00 35.19 ? 80  PHE A CE2 1 
ATOM   569  C  CZ  . PHE A 1 82  ? 48.581 32.074  -22.327 1.00 32.64 ? 80  PHE A CZ  1 
ATOM   570  N  N   . GLY A 1 83  ? 55.922 31.165  -22.015 1.00 24.73 ? 81  GLY A N   1 
ATOM   571  C  CA  . GLY A 1 83  ? 57.330 31.160  -21.661 1.00 26.51 ? 81  GLY A CA  1 
ATOM   572  C  C   . GLY A 1 83  ? 57.766 30.109  -20.661 1.00 25.27 ? 81  GLY A C   1 
ATOM   573  O  O   . GLY A 1 83  ? 58.961 30.039  -20.346 1.00 22.52 ? 81  GLY A O   1 
ATOM   574  N  N   . ARG A 1 84  ? 56.851 29.286  -20.164 1.00 21.18 ? 82  ARG A N   1 
ATOM   575  C  CA  . ARG A 1 84  ? 57.173 28.264  -19.181 1.00 17.23 ? 82  ARG A CA  1 
ATOM   576  C  C   . ARG A 1 84  ? 55.961 27.353  -19.055 1.00 20.40 ? 82  ARG A C   1 
ATOM   577  O  O   . ARG A 1 84  ? 54.865 27.674  -19.530 1.00 19.79 ? 82  ARG A O   1 
ATOM   578  C  CB  . ARG A 1 84  ? 57.530 28.869  -17.821 1.00 18.13 ? 82  ARG A CB  1 
ATOM   579  C  CG  . ARG A 1 84  ? 56.383 29.615  -17.170 1.00 19.04 ? 82  ARG A CG  1 
ATOM   580  C  CD  . ARG A 1 84  ? 56.849 30.317  -15.887 1.00 25.16 ? 82  ARG A CD  1 
ATOM   581  N  NE  . ARG A 1 84  ? 57.108 29.371  -14.799 1.00 23.56 ? 82  ARG A NE  1 
ATOM   582  C  CZ  . ARG A 1 84  ? 58.087 29.508  -13.910 1.00 30.74 ? 82  ARG A CZ  1 
ATOM   583  N  NH1 . ARG A 1 84  ? 58.244 28.604  -12.950 1.00 26.78 ? 82  ARG A NH1 1 
ATOM   584  N  NH2 . ARG A 1 84  ? 58.919 30.549  -13.983 1.00 29.44 ? 82  ARG A NH2 1 
ATOM   585  N  N   . LEU A 1 85  ? 56.163 26.220  -18.389 1.00 18.29 ? 83  LEU A N   1 
ATOM   586  C  CA  . LEU A 1 85  ? 55.051 25.318  -18.079 1.00 22.62 ? 83  LEU A CA  1 
ATOM   587  C  C   . LEU A 1 85  ? 55.322 24.697  -16.722 1.00 22.29 ? 83  LEU A C   1 
ATOM   588  O  O   . LEU A 1 85  ? 56.361 24.058  -16.534 1.00 23.17 ? 83  LEU A O   1 
ATOM   589  C  CB  . LEU A 1 85  ? 54.886 24.232  -19.151 1.00 21.79 ? 83  LEU A CB  1 
ATOM   590  C  CG  . LEU A 1 85  ? 53.920 23.098  -18.784 1.00 23.55 ? 83  LEU A CG  1 
ATOM   591  C  CD1 . LEU A 1 85  ? 52.499 23.636  -18.547 1.00 19.76 ? 83  LEU A CD1 1 
ATOM   592  C  CD2 . LEU A 1 85  ? 53.934 22.045  -19.883 1.00 26.23 ? 83  LEU A CD2 1 
ATOM   593  N  N   . ASP A 1 86  ? 54.415 24.917  -15.772 1.00 18.54 ? 84  ASP A N   1 
ATOM   594  C  CA  . ASP A 1 86  ? 54.633 24.489  -14.397 1.00 22.17 ? 84  ASP A CA  1 
ATOM   595  C  C   . ASP A 1 86  ? 53.786 23.308  -13.970 1.00 24.48 ? 84  ASP A C   1 
ATOM   596  O  O   . ASP A 1 86  ? 54.174 22.586  -13.048 1.00 18.73 ? 84  ASP A O   1 
ATOM   597  C  CB  . ASP A 1 86  ? 54.362 25.642  -13.437 1.00 22.24 ? 84  ASP A CB  1 
ATOM   598  C  CG  . ASP A 1 86  ? 55.302 26.789  -13.654 1.00 25.50 ? 84  ASP A CG  1 
ATOM   599  O  OD1 . ASP A 1 86  ? 56.441 26.714  -13.140 1.00 25.86 ? 84  ASP A OD1 1 
ATOM   600  O  OD2 . ASP A 1 86  ? 54.915 27.743  -14.359 1.00 25.06 ? 84  ASP A OD2 1 
ATOM   601  N  N   . CYS A 1 87  ? 52.630 23.105  -14.586 1.00 21.18 ? 85  CYS A N   1 
ATOM   602  C  CA  . CYS A 1 87  ? 51.755 22.051  -14.097 1.00 22.67 ? 85  CYS A CA  1 
ATOM   603  C  C   . CYS A 1 87  ? 50.891 21.577  -15.243 1.00 22.11 ? 85  CYS A C   1 
ATOM   604  O  O   . CYS A 1 87  ? 50.325 22.397  -15.971 1.00 20.18 ? 85  CYS A O   1 
ATOM   605  C  CB  . CYS A 1 87  ? 50.879 22.540  -12.933 1.00 19.07 ? 85  CYS A CB  1 
ATOM   606  S  SG  . CYS A 1 87  ? 49.681 21.299  -12.304 1.00 22.52 ? 85  CYS A SG  1 
ATOM   607  N  N   . VAL A 1 88  ? 50.778 20.262  -15.379 1.00 19.36 ? 86  VAL A N   1 
ATOM   608  C  CA  . VAL A 1 88  ? 49.870 19.638  -16.329 1.00 20.58 ? 86  VAL A CA  1 
ATOM   609  C  C   . VAL A 1 88  ? 48.839 18.842  -15.544 1.00 20.21 ? 86  VAL A C   1 
ATOM   610  O  O   . VAL A 1 88  ? 49.200 17.991  -14.720 1.00 20.07 ? 86  VAL A O   1 
ATOM   611  C  CB  . VAL A 1 88  ? 50.633 18.737  -17.314 1.00 25.30 ? 86  VAL A CB  1 
ATOM   612  C  CG1 . VAL A 1 88  ? 49.656 17.887  -18.100 1.00 28.11 ? 86  VAL A CG1 1 
ATOM   613  C  CG2 . VAL A 1 88  ? 51.494 19.605  -18.235 1.00 18.11 ? 86  VAL A CG2 1 
ATOM   614  N  N   . VAL A 1 89  ? 47.560 19.116  -15.795 1.00 20.79 ? 87  VAL A N   1 
ATOM   615  C  CA  . VAL A 1 89  ? 46.457 18.395  -15.169 1.00 19.92 ? 87  VAL A CA  1 
ATOM   616  C  C   . VAL A 1 89  ? 45.796 17.561  -16.261 1.00 21.05 ? 87  VAL A C   1 
ATOM   617  O  O   . VAL A 1 89  ? 45.126 18.108  -17.147 1.00 23.98 ? 87  VAL A O   1 
ATOM   618  C  CB  . VAL A 1 89  ? 45.445 19.346  -14.505 1.00 19.82 ? 87  VAL A CB  1 
ATOM   619  C  CG1 . VAL A 1 89  ? 44.310 18.557  -13.881 1.00 22.08 ? 87  VAL A CG1 1 
ATOM   620  C  CG2 . VAL A 1 89  ? 46.127 20.275  -13.474 1.00 17.73 ? 87  VAL A CG2 1 
ATOM   621  N  N   . ASN A 1 90  ? 45.971 16.240  -16.194 1.00 19.77 ? 88  ASN A N   1 
ATOM   622  C  CA  . ASN A 1 90  ? 45.396 15.314  -17.172 1.00 17.35 ? 88  ASN A CA  1 
ATOM   623  C  C   . ASN A 1 90  ? 44.016 14.887  -16.682 1.00 21.15 ? 88  ASN A C   1 
ATOM   624  O  O   . ASN A 1 90  ? 43.850 13.889  -15.963 1.00 22.64 ? 88  ASN A O   1 
ATOM   625  C  CB  . ASN A 1 90  ? 46.317 14.123  -17.395 1.00 17.65 ? 88  ASN A CB  1 
ATOM   626  C  CG  . ASN A 1 90  ? 47.598 14.513  -18.131 1.00 23.33 ? 88  ASN A CG  1 
ATOM   627  O  OD1 . ASN A 1 90  ? 47.554 14.943  -19.285 1.00 28.04 ? 88  ASN A OD1 1 
ATOM   628  N  ND2 . ASN A 1 90  ? 48.740 14.356  -17.466 1.00 18.43 ? 88  ASN A ND2 1 
ATOM   629  N  N   . ASN A 1 91  ? 43.014 15.654  -17.094 1.00 16.68 ? 89  ASN A N   1 
ATOM   630  C  CA  . ASN A 1 91  ? 41.627 15.459  -16.699 1.00 19.39 ? 89  ASN A CA  1 
ATOM   631  C  C   . ASN A 1 91  ? 40.778 14.853  -17.801 1.00 24.55 ? 89  ASN A C   1 
ATOM   632  O  O   . ASN A 1 91  ? 39.803 14.153  -17.501 1.00 24.70 ? 89  ASN A O   1 
ATOM   633  C  CB  . ASN A 1 91  ? 41.031 16.805  -16.258 1.00 21.87 ? 89  ASN A CB  1 
ATOM   634  C  CG  . ASN A 1 91  ? 39.528 16.765  -16.064 1.00 25.34 ? 89  ASN A CG  1 
ATOM   635  O  OD1 . ASN A 1 91  ? 39.044 16.258  -15.057 1.00 24.93 ? 89  ASN A OD1 1 
ATOM   636  N  ND2 . ASN A 1 91  ? 38.782 17.339  -17.011 1.00 25.55 ? 89  ASN A ND2 1 
ATOM   637  N  N   . ALA A 1 92  ? 41.140 15.091  -19.063 1.00 26.44 ? 90  ALA A N   1 
ATOM   638  C  CA  . ALA A 1 92  ? 40.378 14.573  -20.195 1.00 28.00 ? 90  ALA A CA  1 
ATOM   639  C  C   . ALA A 1 92  ? 40.151 13.078  -20.046 1.00 28.84 ? 90  ALA A C   1 
ATOM   640  O  O   . ALA A 1 92  ? 41.082 12.318  -19.781 1.00 23.99 ? 90  ALA A O   1 
ATOM   641  C  CB  . ALA A 1 92  ? 41.117 14.859  -21.512 1.00 26.10 ? 90  ALA A CB  1 
ATOM   642  N  N   . GLY A 1 93  ? 38.908 12.664  -20.217 1.00 28.59 ? 91  GLY A N   1 
ATOM   643  C  CA  . GLY A 1 93  ? 38.547 11.276  -20.016 1.00 25.17 ? 91  GLY A CA  1 
ATOM   644  C  C   . GLY A 1 93  ? 37.061 11.120  -20.238 1.00 31.88 ? 91  GLY A C   1 
ATOM   645  O  O   . GLY A 1 93  ? 36.311 12.102  -20.319 1.00 33.40 ? 91  GLY A O   1 
ATOM   646  N  N   . HIS A 1 94  ? 36.640 9.861   -20.325 1.00 29.10 ? 92  HIS A N   1 
ATOM   647  C  CA  . HIS A 1 94  ? 35.254 9.541   -20.614 1.00 27.68 ? 92  HIS A CA  1 
ATOM   648  C  C   . HIS A 1 94  ? 34.834 8.310   -19.833 1.00 33.84 ? 92  HIS A C   1 
ATOM   649  O  O   . HIS A 1 94  ? 35.625 7.374   -19.664 1.00 28.15 ? 92  HIS A O   1 
ATOM   650  C  CB  . HIS A 1 94  ? 35.057 9.300   -22.107 1.00 29.79 ? 92  HIS A CB  1 
ATOM   651  C  CG  . HIS A 1 94  ? 33.645 9.002   -22.481 1.00 37.70 ? 92  HIS A CG  1 
ATOM   652  N  ND1 . HIS A 1 94  ? 32.603 9.854   -22.184 1.00 40.62 ? 92  HIS A ND1 1 
ATOM   653  C  CD2 . HIS A 1 94  ? 33.098 7.943   -23.119 1.00 38.48 ? 92  HIS A CD2 1 
ATOM   654  C  CE1 . HIS A 1 94  ? 31.474 9.330   -22.624 1.00 41.02 ? 92  HIS A CE1 1 
ATOM   655  N  NE2 . HIS A 1 94  ? 31.747 8.172   -23.196 1.00 40.95 ? 92  HIS A NE2 1 
ATOM   656  N  N   . HIS A 1 95  ? 33.582 8.322   -19.353 1.00 32.69 ? 93  HIS A N   1 
ATOM   657  C  CA  . HIS A 1 95  ? 32.968 7.142   -18.748 1.00 33.28 ? 93  HIS A CA  1 
ATOM   658  C  C   . HIS A 1 95  ? 31.842 6.679   -19.654 1.00 36.33 ? 93  HIS A C   1 
ATOM   659  O  O   . HIS A 1 95  ? 30.803 7.351   -19.732 1.00 34.72 ? 93  HIS A O   1 
ATOM   660  C  CB  . HIS A 1 95  ? 32.435 7.427   -17.340 1.00 30.45 ? 93  HIS A CB  1 
ATOM   661  C  CG  . HIS A 1 95  ? 31.969 6.201   -16.608 1.00 38.12 ? 93  HIS A CG  1 
ATOM   662  N  ND1 . HIS A 1 95  ? 30.838 5.497   -16.969 1.00 45.49 ? 93  HIS A ND1 1 
ATOM   663  C  CD2 . HIS A 1 95  ? 32.480 5.556   -15.530 1.00 36.75 ? 93  HIS A CD2 1 
ATOM   664  C  CE1 . HIS A 1 95  ? 30.675 4.472   -16.149 1.00 44.34 ? 93  HIS A CE1 1 
ATOM   665  N  NE2 . HIS A 1 95  ? 31.657 4.485   -15.267 1.00 39.73 ? 93  HIS A NE2 1 
ATOM   666  N  N   . PRO A 1 96  ? 31.999 5.563   -20.355 1.00 29.26 ? 94  PRO A N   1 
ATOM   667  C  CA  . PRO A 1 96  ? 30.947 5.090   -21.245 1.00 31.40 ? 94  PRO A CA  1 
ATOM   668  C  C   . PRO A 1 96  ? 29.701 4.733   -20.455 1.00 31.43 ? 94  PRO A C   1 
ATOM   669  O  O   . PRO A 1 96  ? 29.780 4.486   -19.243 1.00 30.85 ? 94  PRO A O   1 
ATOM   670  C  CB  . PRO A 1 96  ? 31.568 3.836   -21.895 1.00 36.21 ? 94  PRO A CB  1 
ATOM   671  C  CG  . PRO A 1 96  ? 33.039 3.895   -21.570 1.00 33.05 ? 94  PRO A CG  1 
ATOM   672  C  CD  . PRO A 1 96  ? 33.133 4.625   -20.274 1.00 29.49 ? 94  PRO A CD  1 
ATOM   673  N  N   . PRO A 1 97  ? 28.540 4.686   -21.098 1.00 32.08 ? 95  PRO A N   1 
ATOM   674  C  CA  . PRO A 1 97  ? 27.342 4.153   -20.435 1.00 37.00 ? 95  PRO A CA  1 
ATOM   675  C  C   . PRO A 1 97  ? 27.603 2.757   -19.900 1.00 41.98 ? 95  PRO A C   1 
ATOM   676  O  O   . PRO A 1 97  ? 28.482 2.044   -20.413 1.00 36.13 ? 95  PRO A O   1 
ATOM   677  C  CB  . PRO A 1 97  ? 26.292 4.133   -21.557 1.00 37.75 ? 95  PRO A CB  1 
ATOM   678  C  CG  . PRO A 1 97  ? 26.772 5.135   -22.544 1.00 35.90 ? 95  PRO A CG  1 
ATOM   679  C  CD  . PRO A 1 97  ? 28.270 5.106   -22.483 1.00 36.09 ? 95  PRO A CD  1 
ATOM   680  N  N   . PRO A 1 98  ? 26.868 2.339   -18.866 1.00 44.39 ? 96  PRO A N   1 
ATOM   681  C  CA  . PRO A 1 98  ? 27.110 1.019   -18.265 1.00 37.41 ? 96  PRO A CA  1 
ATOM   682  C  C   . PRO A 1 98  ? 27.013 -0.097  -19.294 1.00 35.04 ? 96  PRO A C   1 
ATOM   683  O  O   . PRO A 1 98  ? 26.117 -0.111  -20.139 1.00 32.43 ? 96  PRO A O   1 
ATOM   684  C  CB  . PRO A 1 98  ? 25.998 0.900   -17.213 1.00 41.24 ? 96  PRO A CB  1 
ATOM   685  C  CG  . PRO A 1 98  ? 25.614 2.321   -16.901 1.00 43.94 ? 96  PRO A CG  1 
ATOM   686  C  CD  . PRO A 1 98  ? 25.790 3.079   -18.183 1.00 43.47 ? 96  PRO A CD  1 
ATOM   687  N  N   . GLN A 1 99  ? 27.930 -1.058  -19.189 1.00 35.73 ? 97  GLN A N   1 
ATOM   688  C  CA  . GLN A 1 99  ? 27.991 -2.198  -20.096 1.00 39.90 ? 97  GLN A CA  1 
ATOM   689  C  C   . GLN A 1 99  ? 28.321 -3.450  -19.309 1.00 33.33 ? 97  GLN A C   1 
ATOM   690  O  O   . GLN A 1 99  ? 29.329 -3.473  -18.601 1.00 34.40 ? 97  GLN A O   1 
ATOM   691  C  CB  . GLN A 1 99  ? 29.072 -2.006  -21.158 1.00 47.08 ? 97  GLN A CB  1 
ATOM   692  C  CG  . GLN A 1 99  ? 28.672 -1.215  -22.368 1.00 57.86 ? 97  GLN A CG  1 
ATOM   693  C  CD  . GLN A 1 99  ? 29.821 -1.109  -23.352 1.00 61.99 ? 97  GLN A CD  1 
ATOM   694  O  OE1 . GLN A 1 99  ? 30.914 -0.659  -22.995 1.00 61.80 ? 97  GLN A OE1 1 
ATOM   695  N  NE2 . GLN A 1 99  ? 29.589 -1.548  -24.590 1.00 61.83 ? 97  GLN A NE2 1 
ATOM   696  N  N   . ARG A 1 100 ? 27.504 -4.491  -19.453 1.00 34.25 ? 98  ARG A N   1 
ATOM   697  C  CA  . ARG A 1 100 ? 27.902 -5.797  -18.952 1.00 39.05 ? 98  ARG A CA  1 
ATOM   698  C  C   . ARG A 1 100 ? 29.166 -6.268  -19.682 1.00 42.48 ? 98  ARG A C   1 
ATOM   699  O  O   . ARG A 1 100 ? 29.412 -5.873  -20.831 1.00 40.14 ? 98  ARG A O   1 
ATOM   700  C  CB  . ARG A 1 100 ? 26.764 -6.800  -19.122 1.00 42.89 ? 98  ARG A CB  1 
ATOM   701  C  CG  . ARG A 1 100 ? 25.616 -6.545  -18.144 1.00 47.26 ? 98  ARG A CG  1 
ATOM   702  C  CD  . ARG A 1 100 ? 24.422 -7.436  -18.387 1.00 53.81 ? 98  ARG A CD  1 
ATOM   703  N  NE  . ARG A 1 100 ? 23.508 -7.410  -17.246 1.00 59.94 ? 98  ARG A NE  1 
ATOM   704  N  N   . PRO A 1 101 ? 29.998 -7.097  -19.032 1.00 39.57 ? 99  PRO A N   1 
ATOM   705  C  CA  . PRO A 1 101 ? 31.270 -7.497  -19.665 1.00 37.81 ? 99  PRO A CA  1 
ATOM   706  C  C   . PRO A 1 101 ? 31.108 -8.088  -21.058 1.00 33.96 ? 99  PRO A C   1 
ATOM   707  O  O   . PRO A 1 101 ? 31.906 -7.774  -21.953 1.00 30.71 ? 99  PRO A O   1 
ATOM   708  C  CB  . PRO A 1 101 ? 31.844 -8.538  -18.687 1.00 36.83 ? 99  PRO A CB  1 
ATOM   709  C  CG  . PRO A 1 101 ? 31.157 -8.301  -17.404 1.00 37.46 ? 99  PRO A CG  1 
ATOM   710  C  CD  . PRO A 1 101 ? 29.795 -7.757  -17.728 1.00 40.44 ? 99  PRO A CD  1 
ATOM   711  N  N   . GLU A 1 102 ? 30.091 -8.934  -21.266 1.00 32.69 ? 100 GLU A N   1 
ATOM   712  C  CA  . GLU A 1 102 ? 29.883 -9.543  -22.578 1.00 34.18 ? 100 GLU A CA  1 
ATOM   713  C  C   . GLU A 1 102 ? 29.413 -8.525  -23.615 1.00 34.86 ? 100 GLU A C   1 
ATOM   714  O  O   . GLU A 1 102 ? 29.490 -8.800  -24.816 1.00 39.16 ? 100 GLU A O   1 
ATOM   715  C  CB  . GLU A 1 102 ? 28.885 -10.713 -22.479 1.00 38.35 ? 100 GLU A CB  1 
ATOM   716  C  CG  . GLU A 1 102 ? 27.462 -10.331 -22.065 1.00 36.08 ? 100 GLU A CG  1 
ATOM   717  C  CD  . GLU A 1 102 ? 27.288 -10.194 -20.553 1.00 38.26 ? 100 GLU A CD  1 
ATOM   718  O  OE1 . GLU A 1 102 ? 26.134 -10.210 -20.082 1.00 42.58 ? 100 GLU A OE1 1 
ATOM   719  O  OE2 . GLU A 1 102 ? 28.299 -10.069 -19.829 1.00 36.58 ? 100 GLU A OE2 1 
ATOM   720  N  N   . GLU A 1 103 ? 28.963 -7.350  -23.183 1.00 38.21 ? 101 GLU A N   1 
ATOM   721  C  CA  . GLU A 1 103 ? 28.597 -6.276  -24.098 1.00 43.70 ? 101 GLU A CA  1 
ATOM   722  C  C   . GLU A 1 103 ? 29.780 -5.391  -24.480 1.00 40.17 ? 101 GLU A C   1 
ATOM   723  O  O   . GLU A 1 103 ? 29.663 -4.588  -25.412 1.00 37.34 ? 101 GLU A O   1 
ATOM   724  C  CB  . GLU A 1 103 ? 27.485 -5.423  -23.477 1.00 50.86 ? 101 GLU A CB  1 
ATOM   725  C  CG  . GLU A 1 103 ? 26.193 -6.200  -23.217 1.00 58.36 ? 101 GLU A CG  1 
ATOM   726  C  CD  . GLU A 1 103 ? 25.291 -5.527  -22.187 1.00 64.56 ? 101 GLU A CD  1 
ATOM   727  O  OE1 . GLU A 1 103 ? 24.317 -6.179  -21.745 1.00 68.87 ? 101 GLU A OE1 1 
ATOM   728  O  OE2 . GLU A 1 103 ? 25.557 -4.358  -21.815 1.00 58.59 ? 101 GLU A OE2 1 
ATOM   729  N  N   . THR A 1 104 ? 30.910 -5.519  -23.797 1.00 37.07 ? 102 THR A N   1 
ATOM   730  C  CA  . THR A 1 104 ? 32.090 -4.761  -24.168 1.00 35.76 ? 102 THR A CA  1 
ATOM   731  C  C   . THR A 1 104 ? 32.768 -5.407  -25.371 1.00 35.07 ? 102 THR A C   1 
ATOM   732  O  O   . THR A 1 104 ? 32.519 -6.564  -25.719 1.00 36.01 ? 102 THR A O   1 
ATOM   733  C  CB  . THR A 1 104 ? 33.081 -4.674  -23.002 1.00 34.06 ? 102 THR A CB  1 
ATOM   734  O  OG1 . THR A 1 104 ? 33.672 -5.962  -22.767 1.00 35.59 ? 102 THR A OG1 1 
ATOM   735  C  CG2 . THR A 1 104 ? 32.378 -4.204  -21.733 1.00 35.78 ? 102 THR A CG2 1 
ATOM   736  N  N   . SER A 1 105 ? 33.641 -4.640  -26.008 1.00 32.29 ? 103 SER A N   1 
ATOM   737  C  CA  . SER A 1 105 ? 34.461 -5.150  -27.094 1.00 34.44 ? 103 SER A CA  1 
ATOM   738  C  C   . SER A 1 105 ? 35.913 -4.779  -26.838 1.00 36.13 ? 103 SER A C   1 
ATOM   739  O  O   . SER A 1 105 ? 36.216 -3.792  -26.155 1.00 33.66 ? 103 SER A O   1 
ATOM   740  C  CB  . SER A 1 105 ? 34.024 -4.591  -28.466 1.00 37.25 ? 103 SER A CB  1 
ATOM   741  O  OG  . SER A 1 105 ? 34.460 -3.250  -28.629 1.00 33.31 ? 103 SER A OG  1 
ATOM   742  N  N   . ALA A 1 106 ? 36.806 -5.585  -27.406 1.00 32.71 ? 104 ALA A N   1 
ATOM   743  C  CA  . ALA A 1 106 ? 38.221 -5.255  -27.373 1.00 32.65 ? 104 ALA A CA  1 
ATOM   744  C  C   . ALA A 1 106 ? 38.478 -3.901  -28.027 1.00 30.71 ? 104 ALA A C   1 
ATOM   745  O  O   . ALA A 1 106 ? 39.289 -3.109  -27.533 1.00 27.68 ? 104 ALA A O   1 
ATOM   746  C  CB  . ALA A 1 106 ? 39.020 -6.366  -28.060 1.00 32.44 ? 104 ALA A CB  1 
ATOM   747  N  N   . GLN A 1 107 ? 37.778 -3.600  -29.125 1.00 29.68 ? 105 GLN A N   1 
ATOM   748  C  CA  . GLN A 1 107 ? 38.061 -2.351  -29.828 1.00 35.50 ? 105 GLN A CA  1 
ATOM   749  C  C   . GLN A 1 107 ? 37.515 -1.149  -29.069 1.00 28.39 ? 105 GLN A C   1 
ATOM   750  O  O   . GLN A 1 107 ? 38.144 -0.086  -29.054 1.00 29.48 ? 105 GLN A O   1 
ATOM   751  C  CB  . GLN A 1 107 ? 37.510 -2.389  -31.254 1.00 43.18 ? 105 GLN A CB  1 
ATOM   752  C  CG  . GLN A 1 107 ? 38.132 -1.331  -32.184 1.00 52.99 ? 105 GLN A CG  1 
ATOM   753  C  CD  . GLN A 1 107 ? 39.618 -1.574  -32.538 1.00 54.84 ? 105 GLN A CD  1 
ATOM   754  O  OE1 . GLN A 1 107 ? 40.163 -2.665  -32.345 1.00 49.05 ? 105 GLN A OE1 1 
ATOM   755  N  NE2 . GLN A 1 107 ? 40.263 -0.542  -33.073 1.00 57.82 ? 105 GLN A NE2 1 
ATOM   756  N  N   . GLY A 1 108 ? 36.354 -1.291  -28.426 1.00 29.19 ? 106 GLY A N   1 
ATOM   757  C  CA  . GLY A 1 108 ? 35.898 -0.237  -27.529 1.00 30.24 ? 106 GLY A CA  1 
ATOM   758  C  C   . GLY A 1 108 ? 36.836 -0.045  -26.352 1.00 27.31 ? 106 GLY A C   1 
ATOM   759  O  O   . GLY A 1 108 ? 37.114 1.083   -25.937 1.00 27.96 ? 106 GLY A O   1 
ATOM   760  N  N   . PHE A 1 109 ? 37.345 -1.150  -25.806 1.00 28.03 ? 107 PHE A N   1 
ATOM   761  C  CA  . PHE A 1 109 ? 38.346 -1.093  -24.746 1.00 25.59 ? 107 PHE A CA  1 
ATOM   762  C  C   . PHE A 1 109 ? 39.578 -0.311  -25.210 1.00 22.11 ? 107 PHE A C   1 
ATOM   763  O  O   . PHE A 1 109 ? 40.056 0.589   -24.511 1.00 27.19 ? 107 PHE A O   1 
ATOM   764  C  CB  . PHE A 1 109 ? 38.708 -2.535  -24.343 1.00 27.98 ? 107 PHE A CB  1 
ATOM   765  C  CG  . PHE A 1 109 ? 39.309 -2.699  -22.957 1.00 23.90 ? 107 PHE A CG  1 
ATOM   766  C  CD1 . PHE A 1 109 ? 39.981 -1.672  -22.312 1.00 21.21 ? 107 PHE A CD1 1 
ATOM   767  C  CD2 . PHE A 1 109 ? 39.211 -3.930  -22.316 1.00 22.29 ? 107 PHE A CD2 1 
ATOM   768  C  CE1 . PHE A 1 109 ? 40.526 -1.864  -21.039 1.00 19.31 ? 107 PHE A CE1 1 
ATOM   769  C  CE2 . PHE A 1 109 ? 39.755 -4.128  -21.045 1.00 20.89 ? 107 PHE A CE2 1 
ATOM   770  C  CZ  . PHE A 1 109 ? 40.416 -3.095  -20.414 1.00 21.42 ? 107 PHE A CZ  1 
ATOM   771  N  N   . ARG A 1 110 ? 40.106 -0.646  -26.394 1.00 24.17 ? 108 ARG A N   1 
ATOM   772  C  CA  . ARG A 1 110 ? 41.271 0.066   -26.917 1.00 23.66 ? 108 ARG A CA  1 
ATOM   773  C  C   . ARG A 1 110 ? 40.996 1.556   -27.066 1.00 27.35 ? 108 ARG A C   1 
ATOM   774  O  O   . ARG A 1 110 ? 41.853 2.386   -26.734 1.00 26.40 ? 108 ARG A O   1 
ATOM   775  C  CB  . ARG A 1 110 ? 41.691 -0.512  -28.266 1.00 26.14 ? 108 ARG A CB  1 
ATOM   776  C  CG  . ARG A 1 110 ? 42.264 -1.912  -28.191 1.00 24.77 ? 108 ARG A CG  1 
ATOM   777  C  CD  . ARG A 1 110 ? 42.722 -2.418  -29.560 1.00 30.35 ? 108 ARG A CD  1 
ATOM   778  N  NE  . ARG A 1 110 ? 43.100 -3.822  -29.439 1.00 30.28 ? 108 ARG A NE  1 
ATOM   779  C  CZ  . ARG A 1 110 ? 42.355 -4.843  -29.848 1.00 38.73 ? 108 ARG A CZ  1 
ATOM   780  N  NH1 . ARG A 1 110 ? 41.193 -4.628  -30.456 1.00 38.55 ? 108 ARG A NH1 1 
ATOM   781  N  NH2 . ARG A 1 110 ? 42.786 -6.082  -29.662 1.00 38.24 ? 108 ARG A NH2 1 
ATOM   782  N  N   . GLN A 1 111 ? 39.811 1.914   -27.575 1.00 24.91 ? 109 GLN A N   1 
ATOM   783  C  CA  . GLN A 1 111 ? 39.479 3.324   -27.763 1.00 25.35 ? 109 GLN A CA  1 
ATOM   784  C  C   . GLN A 1 111 ? 39.421 4.058   -26.434 1.00 22.67 ? 109 GLN A C   1 
ATOM   785  O  O   . GLN A 1 111 ? 39.916 5.186   -26.315 1.00 23.07 ? 109 GLN A O   1 
ATOM   786  C  CB  . GLN A 1 111 ? 38.153 3.458   -28.516 1.00 32.09 ? 109 GLN A CB  1 
ATOM   787  C  CG  . GLN A 1 111 ? 38.211 2.943   -29.950 1.00 42.67 ? 109 GLN A CG  1 
ATOM   788  C  CD  . GLN A 1 111 ? 36.836 2.649   -30.551 1.00 51.85 ? 109 GLN A CD  1 
ATOM   789  O  OE1 . GLN A 1 111 ? 36.727 2.326   -31.734 1.00 49.52 ? 109 GLN A OE1 1 
ATOM   790  N  NE2 . GLN A 1 111 ? 35.788 2.747   -29.735 1.00 55.78 ? 109 GLN A NE2 1 
ATOM   791  N  N   . LEU A 1 112 ? 38.852 3.425   -25.407 1.00 23.54 ? 110 LEU A N   1 
ATOM   792  C  CA  . LEU A 1 112 ? 38.818 4.072   -24.101 1.00 23.43 ? 110 LEU A CA  1 
ATOM   793  C  C   . LEU A 1 112 ? 40.219 4.206   -23.526 1.00 29.32 ? 110 LEU A C   1 
ATOM   794  O  O   . LEU A 1 112 ? 40.530 5.203   -22.856 1.00 24.62 ? 110 LEU A O   1 
ATOM   795  C  CB  . LEU A 1 112 ? 37.917 3.290   -23.151 1.00 23.01 ? 110 LEU A CB  1 
ATOM   796  C  CG  . LEU A 1 112 ? 37.497 4.055   -21.901 1.00 29.03 ? 110 LEU A CG  1 
ATOM   797  C  CD1 . LEU A 1 112 ? 36.747 5.363   -22.265 1.00 27.72 ? 110 LEU A CD1 1 
ATOM   798  C  CD2 . LEU A 1 112 ? 36.642 3.140   -21.036 1.00 29.30 ? 110 LEU A CD2 1 
ATOM   799  N  N   . LEU A 1 113 ? 41.078 3.214   -23.784 1.00 25.49 ? 111 LEU A N   1 
ATOM   800  C  CA  . LEU A 1 113 ? 42.475 3.329   -23.385 1.00 21.93 ? 111 LEU A CA  1 
ATOM   801  C  C   . LEU A 1 113 ? 43.151 4.502   -24.087 1.00 21.82 ? 111 LEU A C   1 
ATOM   802  O  O   . LEU A 1 113 ? 43.963 5.209   -23.476 1.00 23.50 ? 111 LEU A O   1 
ATOM   803  C  CB  . LEU A 1 113 ? 43.211 2.011   -23.674 1.00 25.03 ? 111 LEU A CB  1 
ATOM   804  C  CG  . LEU A 1 113 ? 42.889 0.889   -22.675 1.00 26.19 ? 111 LEU A CG  1 
ATOM   805  C  CD1 . LEU A 1 113 ? 43.156 -0.512  -23.254 1.00 19.73 ? 111 LEU A CD1 1 
ATOM   806  C  CD2 . LEU A 1 113 ? 43.665 1.108   -21.372 1.00 22.91 ? 111 LEU A CD2 1 
ATOM   807  N  N   . GLU A 1 114 ? 42.835 4.729   -25.370 1.00 23.44 ? 112 GLU A N   1 
ATOM   808  C  CA  . GLU A 1 114 ? 43.404 5.880   -26.077 1.00 26.72 ? 112 GLU A CA  1 
ATOM   809  C  C   . GLU A 1 114 ? 43.108 7.188   -25.347 1.00 23.79 ? 112 GLU A C   1 
ATOM   810  O  O   . GLU A 1 114 ? 43.998 8.029   -25.175 1.00 24.98 ? 112 GLU A O   1 
ATOM   811  C  CB  . GLU A 1 114 ? 42.876 5.958   -27.515 1.00 30.74 ? 112 GLU A CB  1 
ATOM   812  C  CG  . GLU A 1 114 ? 43.525 5.005   -28.510 1.00 35.16 ? 112 GLU A CG  1 
ATOM   813  C  CD  . GLU A 1 114 ? 45.044 5.135   -28.568 1.00 34.12 ? 112 GLU A CD  1 
ATOM   814  O  OE1 . GLU A 1 114 ? 45.710 4.096   -28.422 1.00 37.56 ? 112 GLU A OE1 1 
ATOM   815  O  OE2 . GLU A 1 114 ? 45.572 6.256   -28.759 1.00 30.51 ? 112 GLU A OE2 1 
ATOM   816  N  N   . LEU A 1 115 ? 41.863 7.387   -24.907 1.00 23.58 ? 113 LEU A N   1 
ATOM   817  C  CA  . LEU A 1 115 ? 41.533 8.663   -24.269 1.00 31.36 ? 113 LEU A CA  1 
ATOM   818  C  C   . LEU A 1 115 ? 42.007 8.716   -22.823 1.00 30.76 ? 113 LEU A C   1 
ATOM   819  O  O   . LEU A 1 115 ? 42.787 9.601   -22.443 1.00 35.16 ? 113 LEU A O   1 
ATOM   820  C  CB  . LEU A 1 115 ? 40.029 8.929   -24.328 1.00 33.63 ? 113 LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 115 ? 39.583 10.162  -23.520 1.00 32.19 ? 113 LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 115 ? 40.261 11.486  -23.968 1.00 28.15 ? 113 LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 115 ? 38.076 10.290  -23.612 1.00 34.17 ? 113 LEU A CD2 1 
ATOM   824  N  N   . ASN A 1 116 ? 41.541 7.770   -22.000 1.00 23.86 ? 114 ASN A N   1 
ATOM   825  C  CA  . ASN A 1 116 ? 41.770 7.860   -20.562 1.00 20.77 ? 114 ASN A CA  1 
ATOM   826  C  C   . ASN A 1 116 ? 43.228 7.623   -20.183 1.00 23.93 ? 114 ASN A C   1 
ATOM   827  O  O   . ASN A 1 116 ? 43.681 8.132   -19.153 1.00 24.20 ? 114 ASN A O   1 
ATOM   828  C  CB  . ASN A 1 116 ? 40.881 6.860   -19.817 1.00 19.66 ? 114 ASN A CB  1 
ATOM   829  C  CG  . ASN A 1 116 ? 39.414 7.238   -19.866 1.00 24.76 ? 114 ASN A CG  1 
ATOM   830  O  OD1 . ASN A 1 116 ? 39.038 8.202   -20.525 1.00 25.57 ? 114 ASN A OD1 1 
ATOM   831  N  ND2 . ASN A 1 116 ? 38.577 6.477   -19.165 1.00 25.14 ? 114 ASN A ND2 1 
ATOM   832  N  N   . LEU A 1 117 ? 43.974 6.836   -20.960 1.00 22.65 ? 115 LEU A N   1 
ATOM   833  C  CA  . LEU A 1 117 ? 45.316 6.432   -20.546 1.00 23.56 ? 115 LEU A CA  1 
ATOM   834  C  C   . LEU A 1 117 ? 46.405 7.012   -21.440 1.00 24.14 ? 115 LEU A C   1 
ATOM   835  O  O   . LEU A 1 117 ? 47.304 7.698   -20.951 1.00 21.16 ? 115 LEU A O   1 
ATOM   836  C  CB  . LEU A 1 117 ? 45.424 4.890   -20.500 1.00 21.45 ? 115 LEU A CB  1 
ATOM   837  C  CG  . LEU A 1 117 ? 46.798 4.374   -20.063 1.00 21.55 ? 115 LEU A CG  1 
ATOM   838  C  CD1 . LEU A 1 117 ? 47.180 4.890   -18.663 1.00 20.31 ? 115 LEU A CD1 1 
ATOM   839  C  CD2 . LEU A 1 117 ? 46.842 2.844   -20.109 1.00 18.86 ? 115 LEU A CD2 1 
ATOM   840  N  N   . LEU A 1 118 ? 46.359 6.739   -22.747 1.00 21.59 ? 116 LEU A N   1 
ATOM   841  C  CA  . LEU A 1 118 ? 47.446 7.160   -23.623 1.00 24.09 ? 116 LEU A CA  1 
ATOM   842  C  C   . LEU A 1 118 ? 47.437 8.660   -23.881 1.00 26.77 ? 116 LEU A C   1 
ATOM   843  O  O   . LEU A 1 118 ? 48.495 9.240   -24.155 1.00 26.91 ? 116 LEU A O   1 
ATOM   844  C  CB  . LEU A 1 118 ? 47.367 6.380   -24.929 1.00 27.09 ? 116 LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 118 ? 47.642 4.906   -24.611 1.00 34.58 ? 116 LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 118 ? 47.218 4.034   -25.763 1.00 32.58 ? 116 LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 118 ? 49.118 4.716   -24.278 1.00 33.33 ? 116 LEU A CD2 1 
ATOM   848  N  N   . GLY A 1 119 ? 46.269 9.304   -23.812 1.00 26.69 ? 117 GLY A N   1 
ATOM   849  C  CA  . GLY A 1 119 ? 46.244 10.759  -23.899 1.00 27.46 ? 117 GLY A CA  1 
ATOM   850  C  C   . GLY A 1 119 ? 46.997 11.404  -22.750 1.00 26.34 ? 117 GLY A C   1 
ATOM   851  O  O   . GLY A 1 119 ? 47.820 12.303  -22.946 1.00 27.57 ? 117 GLY A O   1 
ATOM   852  N  N   . THR A 1 120 ? 46.745 10.919  -21.535 1.00 20.26 ? 118 THR A N   1 
ATOM   853  C  CA  . THR A 1 120 ? 47.493 11.349  -20.354 1.00 24.03 ? 118 THR A CA  1 
ATOM   854  C  C   . THR A 1 120 ? 48.988 11.072  -20.502 1.00 25.60 ? 118 THR A C   1 
ATOM   855  O  O   . THR A 1 120 ? 49.825 11.923  -20.177 1.00 23.03 ? 118 THR A O   1 
ATOM   856  C  CB  . THR A 1 120 ? 46.928 10.636  -19.124 1.00 22.21 ? 118 THR A CB  1 
ATOM   857  O  OG1 . THR A 1 120 ? 45.605 11.135  -18.858 1.00 23.74 ? 118 THR A OG1 1 
ATOM   858  C  CG2 . THR A 1 120 ? 47.823 10.847  -17.897 1.00 24.52 ? 118 THR A CG2 1 
ATOM   859  N  N   . TYR A 1 121 ? 49.339 9.876   -20.977 1.00 21.22 ? 119 TYR A N   1 
ATOM   860  C  CA  . TYR A 1 121 ? 50.742 9.529   -21.195 1.00 22.09 ? 119 TYR A CA  1 
ATOM   861  C  C   . TYR A 1 121 ? 51.405 10.481  -22.194 1.00 25.99 ? 119 TYR A C   1 
ATOM   862  O  O   . TYR A 1 121 ? 52.535 10.940  -21.980 1.00 24.37 ? 119 TYR A O   1 
ATOM   863  C  CB  . TYR A 1 121 ? 50.825 8.074   -21.685 1.00 22.83 ? 119 TYR A CB  1 
ATOM   864  C  CG  . TYR A 1 121 ? 52.122 7.725   -22.371 1.00 25.19 ? 119 TYR A CG  1 
ATOM   865  C  CD1 . TYR A 1 121 ? 53.220 7.297   -21.638 1.00 22.66 ? 119 TYR A CD1 1 
ATOM   866  C  CD2 . TYR A 1 121 ? 52.247 7.823   -23.754 1.00 26.96 ? 119 TYR A CD2 1 
ATOM   867  C  CE1 . TYR A 1 121 ? 54.415 6.988   -22.266 1.00 22.02 ? 119 TYR A CE1 1 
ATOM   868  C  CE2 . TYR A 1 121 ? 53.431 7.515   -24.386 1.00 27.82 ? 119 TYR A CE2 1 
ATOM   869  C  CZ  . TYR A 1 121 ? 54.511 7.105   -23.639 1.00 25.83 ? 119 TYR A CZ  1 
ATOM   870  O  OH  . TYR A 1 121 ? 55.692 6.800   -24.277 1.00 33.47 ? 119 TYR A OH  1 
ATOM   871  N  N   . THR A 1 122 ? 50.710 10.796  -23.288 1.00 22.11 ? 120 THR A N   1 
ATOM   872  C  CA  . THR A 1 122 ? 51.332 11.553  -24.374 1.00 25.21 ? 120 THR A CA  1 
ATOM   873  C  C   . THR A 1 122 ? 51.600 13.003  -23.975 1.00 27.69 ? 120 THR A C   1 
ATOM   874  O  O   . THR A 1 122 ? 52.707 13.512  -24.184 1.00 24.28 ? 120 THR A O   1 
ATOM   875  C  CB  . THR A 1 122 ? 50.456 11.472  -25.625 1.00 28.77 ? 120 THR A CB  1 
ATOM   876  O  OG1 . THR A 1 122 ? 50.498 10.127  -26.121 1.00 35.96 ? 120 THR A OG1 1 
ATOM   877  C  CG2 . THR A 1 122 ? 50.947 12.435  -26.724 1.00 28.85 ? 120 THR A CG2 1 
ATOM   878  N  N   . LEU A 1 123 ? 50.603 13.691  -23.405 1.00 26.91 ? 121 LEU A N   1 
ATOM   879  C  CA  . LEU A 1 123 ? 50.845 15.060  -22.950 1.00 24.82 ? 121 LEU A CA  1 
ATOM   880  C  C   . LEU A 1 123 ? 51.912 15.100  -21.868 1.00 25.63 ? 121 LEU A C   1 
ATOM   881  O  O   . LEU A 1 123 ? 52.799 15.958  -21.894 1.00 25.78 ? 121 LEU A O   1 
ATOM   882  C  CB  . LEU A 1 123 ? 49.562 15.694  -22.427 1.00 23.38 ? 121 LEU A CB  1 
ATOM   883  C  CG  . LEU A 1 123 ? 49.751 17.056  -21.763 1.00 26.04 ? 121 LEU A CG  1 
ATOM   884  C  CD1 . LEU A 1 123 ? 50.455 18.033  -22.696 1.00 26.08 ? 121 LEU A CD1 1 
ATOM   885  C  CD2 . LEU A 1 123 ? 48.385 17.595  -21.380 1.00 23.18 ? 121 LEU A CD2 1 
ATOM   886  N  N   . THR A 1 124 ? 51.836 14.190  -20.898 1.00 24.41 ? 122 THR A N   1 
ATOM   887  C  CA  . THR A 1 124 ? 52.866 14.141  -19.869 1.00 21.01 ? 122 THR A CA  1 
ATOM   888  C  C   . THR A 1 124 ? 54.260 14.046  -20.486 1.00 24.80 ? 122 THR A C   1 
ATOM   889  O  O   . THR A 1 124 ? 55.160 14.813  -20.128 1.00 21.92 ? 122 THR A O   1 
ATOM   890  C  CB  . THR A 1 124 ? 52.619 12.966  -18.930 1.00 20.89 ? 122 THR A CB  1 
ATOM   891  O  OG1 . THR A 1 124 ? 51.356 13.127  -18.284 1.00 20.41 ? 122 THR A OG1 1 
ATOM   892  C  CG2 . THR A 1 124 ? 53.703 12.934  -17.886 1.00 23.95 ? 122 THR A CG2 1 
ATOM   893  N  N   . LYS A 1 125 ? 54.446 13.112  -21.428 1.00 26.11 ? 123 LYS A N   1 
ATOM   894  C  CA  . LYS A 1 125 ? 55.740 12.925  -22.087 1.00 29.35 ? 123 LYS A CA  1 
ATOM   895  C  C   . LYS A 1 125 ? 56.212 14.204  -22.778 1.00 26.02 ? 123 LYS A C   1 
ATOM   896  O  O   . LYS A 1 125 ? 57.371 14.617  -22.640 1.00 25.94 ? 123 LYS A O   1 
ATOM   897  C  CB  . LYS A 1 125 ? 55.631 11.776  -23.101 1.00 30.96 ? 123 LYS A CB  1 
ATOM   898  C  CG  . LYS A 1 125 ? 56.894 11.476  -23.925 1.00 34.82 ? 123 LYS A CG  1 
ATOM   899  C  CD  . LYS A 1 125 ? 56.770 10.100  -24.625 1.00 36.15 ? 123 LYS A CD  1 
ATOM   900  C  CE  . LYS A 1 125 ? 57.924 9.804   -25.572 1.00 41.98 ? 123 LYS A CE  1 
ATOM   901  N  N   . LEU A 1 126 ? 55.327 14.850  -23.533 1.00 25.20 ? 124 LEU A N   1 
ATOM   902  C  CA  . LEU A 1 126 ? 55.744 16.053  -24.245 1.00 26.70 ? 124 LEU A CA  1 
ATOM   903  C  C   . LEU A 1 126 ? 56.008 17.212  -23.293 1.00 30.20 ? 124 LEU A C   1 
ATOM   904  O  O   . LEU A 1 126 ? 56.821 18.096  -23.604 1.00 25.70 ? 124 LEU A O   1 
ATOM   905  C  CB  . LEU A 1 126 ? 54.690 16.422  -25.287 1.00 29.38 ? 124 LEU A CB  1 
ATOM   906  C  CG  . LEU A 1 126 ? 54.666 15.451  -26.475 1.00 36.20 ? 124 LEU A CG  1 
ATOM   907  C  CD1 . LEU A 1 126 ? 53.452 15.704  -27.360 1.00 39.27 ? 124 LEU A CD1 1 
ATOM   908  C  CD2 . LEU A 1 126 ? 55.947 15.594  -27.278 1.00 36.82 ? 124 LEU A CD2 1 
ATOM   909  N  N   . ALA A 1 127 ? 55.361 17.216  -22.124 1.00 19.89 ? 125 ALA A N   1 
ATOM   910  C  CA  . ALA A 1 127 ? 55.506 18.326  -21.185 1.00 22.40 ? 125 ALA A CA  1 
ATOM   911  C  C   . ALA A 1 127 ? 56.690 18.175  -20.238 1.00 24.51 ? 125 ALA A C   1 
ATOM   912  O  O   . ALA A 1 127 ? 57.199 19.186  -19.741 1.00 21.88 ? 125 ALA A O   1 
ATOM   913  C  CB  . ALA A 1 127 ? 54.230 18.482  -20.358 1.00 19.48 ? 125 ALA A CB  1 
ATOM   914  N  N   . LEU A 1 128 ? 57.147 16.945  -19.982 1.00 21.92 ? 126 LEU A N   1 
ATOM   915  C  CA  . LEU A 1 128 ? 58.161 16.736  -18.952 1.00 23.61 ? 126 LEU A CA  1 
ATOM   916  C  C   . LEU A 1 128 ? 59.460 17.506  -19.168 1.00 27.05 ? 126 LEU A C   1 
ATOM   917  O  O   . LEU A 1 128 ? 60.022 17.973  -18.164 1.00 27.23 ? 126 LEU A O   1 
ATOM   918  C  CB  . LEU A 1 128 ? 58.459 15.237  -18.795 1.00 23.41 ? 126 LEU A CB  1 
ATOM   919  C  CG  . LEU A 1 128 ? 57.450 14.518  -17.891 1.00 26.66 ? 126 LEU A CG  1 
ATOM   920  C  CD1 . LEU A 1 128 ? 57.616 13.000  -17.994 1.00 29.24 ? 126 LEU A CD1 1 
ATOM   921  C  CD2 . LEU A 1 128 ? 57.570 14.996  -16.434 1.00 24.36 ? 126 LEU A CD2 1 
ATOM   922  N  N   . PRO A 1 129 ? 60.006 17.659  -20.395 1.00 28.80 ? 127 PRO A N   1 
ATOM   923  C  CA  . PRO A 1 129 ? 61.205 18.507  -20.536 1.00 24.70 ? 127 PRO A CA  1 
ATOM   924  C  C   . PRO A 1 129 ? 61.002 19.904  -19.982 1.00 26.64 ? 127 PRO A C   1 
ATOM   925  O  O   . PRO A 1 129 ? 61.908 20.452  -19.341 1.00 25.68 ? 127 PRO A O   1 
ATOM   926  C  CB  . PRO A 1 129 ? 61.450 18.527  -22.054 1.00 26.61 ? 127 PRO A CB  1 
ATOM   927  C  CG  . PRO A 1 129 ? 60.920 17.225  -22.514 1.00 27.90 ? 127 PRO A CG  1 
ATOM   928  C  CD  . PRO A 1 129 ? 59.674 16.996  -21.675 1.00 27.07 ? 127 PRO A CD  1 
ATOM   929  N  N   . TYR A 1 130 ? 59.816 20.487  -20.185 1.00 22.24 ? 128 TYR A N   1 
ATOM   930  C  CA  . TYR A 1 130 ? 59.547 21.818  -19.649 1.00 22.28 ? 128 TYR A CA  1 
ATOM   931  C  C   . TYR A 1 130 ? 59.263 21.767  -18.150 1.00 25.02 ? 128 TYR A C   1 
ATOM   932  O  O   . TYR A 1 130 ? 59.666 22.673  -17.408 1.00 23.91 ? 128 TYR A O   1 
ATOM   933  C  CB  . TYR A 1 130 ? 58.392 22.474  -20.424 1.00 21.58 ? 128 TYR A CB  1 
ATOM   934  C  CG  . TYR A 1 130 ? 58.684 22.499  -21.920 1.00 23.21 ? 128 TYR A CG  1 
ATOM   935  C  CD1 . TYR A 1 130 ? 59.545 23.442  -22.470 1.00 25.20 ? 128 TYR A CD1 1 
ATOM   936  C  CD2 . TYR A 1 130 ? 58.132 21.545  -22.768 1.00 31.21 ? 128 TYR A CD2 1 
ATOM   937  C  CE1 . TYR A 1 130 ? 59.832 23.442  -23.844 1.00 29.48 ? 128 TYR A CE1 1 
ATOM   938  C  CE2 . TYR A 1 130 ? 58.416 21.535  -24.127 1.00 31.96 ? 128 TYR A CE2 1 
ATOM   939  C  CZ  . TYR A 1 130 ? 59.250 22.482  -24.658 1.00 30.29 ? 128 TYR A CZ  1 
ATOM   940  O  OH  . TYR A 1 130 ? 59.505 22.451  -26.004 1.00 41.81 ? 128 TYR A OH  1 
ATOM   941  N  N   . LEU A 1 131 ? 58.593 20.709  -17.683 1.00 22.75 ? 129 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 131 ? 58.345 20.577  -16.255 1.00 19.63 ? 129 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 131 ? 59.654 20.388  -15.492 1.00 23.67 ? 129 LEU A C   1 
ATOM   944  O  O   . LEU A 1 131 ? 59.800 20.865  -14.361 1.00 24.08 ? 129 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 131 ? 57.389 19.413  -15.993 1.00 20.34 ? 129 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 131 ? 55.970 19.595  -16.550 1.00 22.15 ? 129 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 131 ? 55.163 18.306  -16.421 1.00 19.91 ? 129 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 131 ? 55.246 20.789  -15.886 1.00 18.65 ? 129 LEU A CD2 1 
ATOM   949  N  N   . ARG A 1 132 ? 60.618 19.686  -16.091 1.00 25.54 ? 130 ARG A N   1 
ATOM   950  C  CA  . ARG A 1 132 ? 61.914 19.548  -15.437 1.00 23.66 ? 130 ARG A CA  1 
ATOM   951  C  C   . ARG A 1 132 ? 62.599 20.899  -15.291 1.00 24.10 ? 130 ARG A C   1 
ATOM   952  O  O   . ARG A 1 132 ? 63.192 21.184  -14.243 1.00 28.50 ? 130 ARG A O   1 
ATOM   953  C  CB  . ARG A 1 132 ? 62.794 18.575  -16.213 1.00 26.12 ? 130 ARG A CB  1 
ATOM   954  C  CG  . ARG A 1 132 ? 62.317 17.140  -16.137 1.00 27.64 ? 130 ARG A CG  1 
ATOM   955  C  CD  . ARG A 1 132 ? 63.269 16.245  -16.873 1.00 32.98 ? 130 ARG A CD  1 
ATOM   956  N  NE  . ARG A 1 132 ? 62.869 14.843  -16.817 1.00 39.33 ? 130 ARG A NE  1 
ATOM   957  C  CZ  . ARG A 1 132 ? 63.687 13.848  -17.150 1.00 45.21 ? 130 ARG A CZ  1 
ATOM   958  N  NH1 . ARG A 1 132 ? 64.925 14.133  -17.543 1.00 42.44 ? 130 ARG A NH1 1 
ATOM   959  N  NH2 . ARG A 1 132 ? 63.286 12.583  -17.077 1.00 44.67 ? 130 ARG A NH2 1 
ATOM   960  N  N   . LYS A 1 133 ? 62.512 21.754  -16.321 1.00 22.37 ? 131 LYS A N   1 
ATOM   961  C  CA  . LYS A 1 133 ? 63.128 23.082  -16.239 1.00 24.21 ? 131 LYS A CA  1 
ATOM   962  C  C   . LYS A 1 133 ? 62.483 23.932  -15.156 1.00 27.89 ? 131 LYS A C   1 
ATOM   963  O  O   . LYS A 1 133 ? 63.147 24.774  -14.554 1.00 25.63 ? 131 LYS A O   1 
ATOM   964  C  CB  . LYS A 1 133 ? 63.035 23.817  -17.580 1.00 28.29 ? 131 LYS A CB  1 
ATOM   965  C  CG  . LYS A 1 133 ? 63.788 23.150  -18.739 1.00 34.99 ? 131 LYS A CG  1 
ATOM   966  N  N   . SER A 1 134 ? 61.197 23.730  -14.887 1.00 22.92 ? 132 SER A N   1 
ATOM   967  C  CA  . SER A 1 134 ? 60.498 24.574  -13.929 1.00 24.37 ? 132 SER A CA  1 
ATOM   968  C  C   . SER A 1 134 ? 60.340 23.913  -12.567 1.00 26.95 ? 132 SER A C   1 
ATOM   969  O  O   . SER A 1 134 ? 59.771 24.532  -11.658 1.00 26.94 ? 132 SER A O   1 
ATOM   970  C  CB  . SER A 1 134 ? 59.118 24.962  -14.479 1.00 21.56 ? 132 SER A CB  1 
ATOM   971  O  OG  . SER A 1 134 ? 58.282 23.807  -14.573 1.00 22.35 ? 132 SER A OG  1 
ATOM   972  N  N   . GLN A 1 135 ? 60.841 22.688  -12.400 1.00 20.65 ? 133 GLN A N   1 
ATOM   973  C  CA  . GLN A 1 135 ? 60.516 21.860  -11.238 1.00 20.16 ? 133 GLN A CA  1 
ATOM   974  C  C   . GLN A 1 135 ? 59.003 21.842  -11.035 1.00 25.79 ? 133 GLN A C   1 
ATOM   975  O  O   . GLN A 1 135 ? 58.478 22.038  -9.933  1.00 22.24 ? 133 GLN A O   1 
ATOM   976  C  CB  . GLN A 1 135 ? 61.255 22.343  -9.986  1.00 28.02 ? 133 GLN A CB  1 
ATOM   977  C  CG  . GLN A 1 135 ? 62.795 22.260  -10.110 1.00 38.97 ? 133 GLN A CG  1 
ATOM   978  C  CD  . GLN A 1 135 ? 63.384 21.019  -9.451  1.00 40.81 ? 133 GLN A CD  1 
ATOM   979  N  N   . GLY A 1 136 ? 58.298 21.632  -12.140 1.00 24.85 ? 134 GLY A N   1 
ATOM   980  C  CA  . GLY A 1 136 ? 56.853 21.596  -12.134 1.00 23.30 ? 134 GLY A CA  1 
ATOM   981  C  C   . GLY A 1 136 ? 56.335 20.253  -11.666 1.00 24.84 ? 134 GLY A C   1 
ATOM   982  O  O   . GLY A 1 136 ? 57.059 19.445  -11.076 1.00 22.59 ? 134 GLY A O   1 
ATOM   983  N  N   . ASN A 1 137 ? 55.060 20.005  -11.948 1.00 20.76 ? 135 ASN A N   1 
ATOM   984  C  CA  . ASN A 1 137 ? 54.432 18.791  -11.434 1.00 17.94 ? 135 ASN A CA  1 
ATOM   985  C  C   . ASN A 1 137 ? 53.280 18.367  -12.341 1.00 17.20 ? 135 ASN A C   1 
ATOM   986  O  O   . ASN A 1 137 ? 52.725 19.171  -13.101 1.00 19.24 ? 135 ASN A O   1 
ATOM   987  C  CB  . ASN A 1 137 ? 53.955 18.984  -9.980  1.00 16.85 ? 135 ASN A CB  1 
ATOM   988  C  CG  . ASN A 1 137 ? 52.780 19.941  -9.856  1.00 22.61 ? 135 ASN A CG  1 
ATOM   989  O  OD1 . ASN A 1 137 ? 51.645 19.512  -9.695  1.00 22.62 ? 135 ASN A OD1 1 
ATOM   990  N  ND2 . ASN A 1 137 ? 53.055 21.244  -9.892  1.00 25.50 ? 135 ASN A ND2 1 
ATOM   991  N  N   . VAL A 1 138 ? 52.924 17.088  -12.225 1.00 21.42 ? 136 VAL A N   1 
ATOM   992  C  CA  . VAL A 1 138 ? 51.882 16.434  -13.009 1.00 24.37 ? 136 VAL A CA  1 
ATOM   993  C  C   . VAL A 1 138 ? 50.773 15.997  -12.066 1.00 22.72 ? 136 VAL A C   1 
ATOM   994  O  O   . VAL A 1 138 ? 51.045 15.436  -11.000 1.00 20.84 ? 136 VAL A O   1 
ATOM   995  C  CB  . VAL A 1 138 ? 52.436 15.209  -13.771 1.00 25.48 ? 136 VAL A CB  1 
ATOM   996  C  CG1 . VAL A 1 138 ? 51.311 14.443  -14.464 1.00 21.18 ? 136 VAL A CG1 1 
ATOM   997  C  CG2 . VAL A 1 138 ? 53.500 15.633  -14.772 1.00 23.43 ? 136 VAL A CG2 1 
ATOM   998  N  N   . ILE A 1 139 ? 49.526 16.258  -12.450 1.00 20.58 ? 137 ILE A N   1 
ATOM   999  C  CA  . ILE A 1 139 ? 48.367 15.834  -11.675 1.00 19.40 ? 137 ILE A CA  1 
ATOM   1000 C  C   . ILE A 1 139 ? 47.449 15.068  -12.615 1.00 25.21 ? 137 ILE A C   1 
ATOM   1001 O  O   . ILE A 1 139 ? 46.919 15.644  -13.572 1.00 18.32 ? 137 ILE A O   1 
ATOM   1002 C  CB  . ILE A 1 139 ? 47.613 17.019  -11.045 1.00 21.20 ? 137 ILE A CB  1 
ATOM   1003 C  CG1 . ILE A 1 139 ? 48.508 17.781  -10.057 1.00 17.71 ? 137 ILE A CG1 1 
ATOM   1004 C  CG2 . ILE A 1 139 ? 46.317 16.526  -10.343 1.00 15.96 ? 137 ILE A CG2 1 
ATOM   1005 C  CD1 . ILE A 1 139 ? 47.940 19.137  -9.639  1.00 16.65 ? 137 ILE A CD1 1 
ATOM   1006 N  N   . ASN A 1 140 ? 47.261 13.781  -12.349 1.00 20.22 ? 138 ASN A N   1 
ATOM   1007 C  CA  . ASN A 1 140 ? 46.372 12.954  -13.151 1.00 19.33 ? 138 ASN A CA  1 
ATOM   1008 C  C   . ASN A 1 140 ? 45.032 12.826  -12.435 1.00 18.38 ? 138 ASN A C   1 
ATOM   1009 O  O   . ASN A 1 140 ? 44.985 12.611  -11.220 1.00 21.82 ? 138 ASN A O   1 
ATOM   1010 C  CB  . ASN A 1 140 ? 47.015 11.584  -13.409 1.00 17.68 ? 138 ASN A CB  1 
ATOM   1011 C  CG  . ASN A 1 140 ? 48.298 11.692  -14.259 1.00 22.05 ? 138 ASN A CG  1 
ATOM   1012 O  OD1 . ASN A 1 140 ? 48.427 12.597  -15.092 1.00 22.11 ? 138 ASN A OD1 1 
ATOM   1013 N  ND2 . ASN A 1 140 ? 49.258 10.784  -14.030 1.00 22.21 ? 138 ASN A ND2 1 
ATOM   1014 N  N   . ILE A 1 141 ? 43.941 13.004  -13.169 1.00 20.26 ? 139 ILE A N   1 
ATOM   1015 C  CA  . ILE A 1 141 ? 42.612 12.784  -12.598 1.00 19.48 ? 139 ILE A CA  1 
ATOM   1016 C  C   . ILE A 1 141 ? 42.219 11.343  -12.913 1.00 22.11 ? 139 ILE A C   1 
ATOM   1017 O  O   . ILE A 1 141 ? 41.907 10.999  -14.056 1.00 23.65 ? 139 ILE A O   1 
ATOM   1018 C  CB  . ILE A 1 141 ? 41.572 13.776  -13.125 1.00 19.29 ? 139 ILE A CB  1 
ATOM   1019 C  CG1 . ILE A 1 141 ? 42.038 15.230  -12.936 1.00 21.23 ? 139 ILE A CG1 1 
ATOM   1020 C  CG2 . ILE A 1 141 ? 40.194 13.539  -12.423 1.00 22.57 ? 139 ILE A CG2 1 
ATOM   1021 C  CD1 . ILE A 1 141 ? 42.392 15.619  -11.469 1.00 18.51 ? 139 ILE A CD1 1 
ATOM   1022 N  N   . SER A 1 142 ? 42.236 10.493  -11.900 1.00 19.47 ? 140 SER A N   1 
ATOM   1023 C  CA  . SER A 1 142 ? 41.920 9.084   -12.063 1.00 20.69 ? 140 SER A CA  1 
ATOM   1024 C  C   . SER A 1 142 ? 40.466 8.863   -11.628 1.00 18.41 ? 140 SER A C   1 
ATOM   1025 O  O   . SER A 1 142 ? 39.604 9.616   -12.083 1.00 22.01 ? 140 SER A O   1 
ATOM   1026 C  CB  . SER A 1 142 ? 42.948 8.238   -11.323 1.00 17.59 ? 140 SER A CB  1 
ATOM   1027 O  OG  . SER A 1 142 ? 42.638 6.867   -11.496 1.00 20.56 ? 140 SER A OG  1 
ATOM   1028 N  N   . SER A 1 143 ? 40.165 7.886   -10.780 1.00 20.23 ? 141 SER A N   1 
ATOM   1029 C  CA  . SER A 1 143 ? 38.808 7.634   -10.339 1.00 20.56 ? 141 SER A CA  1 
ATOM   1030 C  C   . SER A 1 143 ? 38.866 6.687   -9.154  1.00 22.09 ? 141 SER A C   1 
ATOM   1031 O  O   . SER A 1 143 ? 39.700 5.782   -9.126  1.00 19.78 ? 141 SER A O   1 
ATOM   1032 C  CB  . SER A 1 143 ? 37.967 7.025   -11.466 1.00 23.89 ? 141 SER A CB  1 
ATOM   1033 O  OG  . SER A 1 143 ? 36.604 7.032   -11.114 1.00 31.25 ? 141 SER A OG  1 
ATOM   1034 N  N   . LEU A 1 144 ? 37.984 6.903   -8.177  1.00 19.85 ? 142 LEU A N   1 
ATOM   1035 C  CA  . LEU A 1 144 ? 37.898 5.952   -7.068  1.00 20.43 ? 142 LEU A CA  1 
ATOM   1036 C  C   . LEU A 1 144 ? 37.647 4.532   -7.564  1.00 22.86 ? 142 LEU A C   1 
ATOM   1037 O  O   . LEU A 1 144 ? 38.166 3.574   -6.981  1.00 20.09 ? 142 LEU A O   1 
ATOM   1038 C  CB  . LEU A 1 144 ? 36.803 6.374   -6.092  1.00 21.54 ? 142 LEU A CB  1 
ATOM   1039 C  CG  . LEU A 1 144 ? 36.390 5.359   -5.007  1.00 24.68 ? 142 LEU A CG  1 
ATOM   1040 C  CD1 . LEU A 1 144 ? 37.546 5.027   -4.080  1.00 24.74 ? 142 LEU A CD1 1 
ATOM   1041 C  CD2 . LEU A 1 144 ? 35.206 5.867   -4.209  1.00 20.32 ? 142 LEU A CD2 1 
ATOM   1042 N  N   . VAL A 1 145 ? 36.897 4.369   -8.659  1.00 22.51 ? 143 VAL A N   1 
ATOM   1043 C  CA  . VAL A 1 145 ? 36.576 3.016   -9.104  1.00 22.19 ? 143 VAL A CA  1 
ATOM   1044 C  C   . VAL A 1 145 ? 37.790 2.284   -9.655  1.00 20.54 ? 143 VAL A C   1 
ATOM   1045 O  O   . VAL A 1 145 ? 37.761 1.056   -9.745  1.00 18.34 ? 143 VAL A O   1 
ATOM   1046 C  CB  . VAL A 1 145 ? 35.412 3.023   -10.125 1.00 25.02 ? 143 VAL A CB  1 
ATOM   1047 C  CG1 . VAL A 1 145 ? 34.231 3.711   -9.530  1.00 27.16 ? 143 VAL A CG1 1 
ATOM   1048 C  CG2 . VAL A 1 145 ? 35.799 3.680   -11.433 1.00 27.09 ? 143 VAL A CG2 1 
ATOM   1049 N  N   . GLY A 1 146 ? 38.871 2.987   -10.013 1.00 20.76 ? 144 GLY A N   1 
ATOM   1050 C  CA  . GLY A 1 146 ? 40.112 2.287   -10.297 1.00 22.74 ? 144 GLY A CA  1 
ATOM   1051 C  C   . GLY A 1 146 ? 40.623 1.504   -9.101  1.00 24.62 ? 144 GLY A C   1 
ATOM   1052 O  O   . GLY A 1 146 ? 41.228 0.437   -9.259  1.00 25.14 ? 144 GLY A O   1 
ATOM   1053 N  N   . ALA A 1 147 ? 40.386 2.016   -7.891  1.00 18.33 ? 145 ALA A N   1 
ATOM   1054 C  CA  . ALA A 1 147 ? 40.878 1.372   -6.681  1.00 22.60 ? 145 ALA A CA  1 
ATOM   1055 C  C   . ALA A 1 147 ? 39.920 0.309   -6.154  1.00 27.73 ? 145 ALA A C   1 
ATOM   1056 O  O   . ALA A 1 147 ? 40.367 -0.733  -5.660  1.00 22.12 ? 145 ALA A O   1 
ATOM   1057 C  CB  . ALA A 1 147 ? 41.143 2.416   -5.592  1.00 19.61 ? 145 ALA A CB  1 
ATOM   1058 N  N   . ILE A 1 148 ? 38.608 0.539   -6.236  1.00 22.08 ? 146 ILE A N   1 
ATOM   1059 C  CA  . ILE A 1 148 ? 37.651 -0.364  -5.595  1.00 21.53 ? 146 ILE A CA  1 
ATOM   1060 C  C   . ILE A 1 148 ? 36.792 -1.124  -6.591  1.00 18.03 ? 146 ILE A C   1 
ATOM   1061 O  O   . ILE A 1 148 ? 35.991 -1.980  -6.173  1.00 22.95 ? 146 ILE A O   1 
ATOM   1062 C  CB  . ILE A 1 148 ? 36.759 0.387   -4.586  1.00 24.40 ? 146 ILE A CB  1 
ATOM   1063 C  CG1 . ILE A 1 148 ? 35.900 1.453   -5.276  1.00 22.88 ? 146 ILE A CG1 1 
ATOM   1064 C  CG2 . ILE A 1 148 ? 37.605 0.981   -3.419  1.00 23.09 ? 146 ILE A CG2 1 
ATOM   1065 C  CD1 . ILE A 1 148 ? 34.786 1.985   -4.383  1.00 23.41 ? 146 ILE A CD1 1 
ATOM   1066 N  N   . GLY A 1 149 ? 36.923 -0.859  -7.889  1.00 26.41 ? 147 GLY A N   1 
ATOM   1067 C  CA  . GLY A 1 149 ? 36.068 -1.491  -8.875  1.00 23.85 ? 147 GLY A CA  1 
ATOM   1068 C  C   . GLY A 1 149 ? 34.690 -0.849  -8.933  1.00 25.56 ? 147 GLY A C   1 
ATOM   1069 O  O   . GLY A 1 149 ? 34.313 -0.024  -8.102  1.00 22.25 ? 147 GLY A O   1 
ATOM   1070 N  N   . GLN A 1 150 ? 33.923 -1.259  -9.944  1.00 25.78 ? 148 GLN A N   1 
ATOM   1071 C  CA  . GLN A 1 150 ? 32.552 -0.821  -10.176 1.00 25.85 ? 148 GLN A CA  1 
ATOM   1072 C  C   . GLN A 1 150 ? 31.902 -1.836  -11.104 1.00 24.10 ? 148 GLN A C   1 
ATOM   1073 O  O   . GLN A 1 150 ? 32.583 -2.464  -11.919 1.00 24.66 ? 148 GLN A O   1 
ATOM   1074 C  CB  . GLN A 1 150 ? 32.509 0.580   -10.804 1.00 29.33 ? 148 GLN A CB  1 
ATOM   1075 C  CG  . GLN A 1 150 ? 31.123 1.114   -11.110 1.00 39.73 ? 148 GLN A CG  1 
ATOM   1076 C  CD  . GLN A 1 150 ? 31.135 2.072   -12.288 1.00 50.83 ? 148 GLN A CD  1 
ATOM   1077 O  OE1 . GLN A 1 150 ? 32.178 2.623   -12.648 1.00 49.45 ? 148 GLN A OE1 1 
ATOM   1078 N  NE2 . GLN A 1 150 ? 29.975 2.267   -12.904 1.00 59.48 ? 148 GLN A NE2 1 
ATOM   1079 N  N   . ALA A 1 151 ? 30.588 -1.997  -10.983 1.00 28.78 ? 149 ALA A N   1 
ATOM   1080 C  CA  . ALA A 1 151 ? 29.897 -2.927  -11.868 1.00 28.62 ? 149 ALA A CA  1 
ATOM   1081 C  C   . ALA A 1 151 ? 29.640 -2.273  -13.221 1.00 26.45 ? 149 ALA A C   1 
ATOM   1082 O  O   . ALA A 1 151 ? 29.547 -1.047  -13.336 1.00 23.91 ? 149 ALA A O   1 
ATOM   1083 C  CB  . ALA A 1 151 ? 28.581 -3.409  -11.253 1.00 29.38 ? 149 ALA A CB  1 
ATOM   1084 N  N   . GLN A 1 152 ? 29.563 -3.115  -14.251 1.00 24.85 ? 150 GLN A N   1 
ATOM   1085 C  CA  . GLN A 1 152 ? 29.248 -2.706  -15.619 1.00 23.92 ? 150 GLN A CA  1 
ATOM   1086 C  C   . GLN A 1 152 ? 30.147 -1.577  -16.118 1.00 23.17 ? 150 GLN A C   1 
ATOM   1087 O  O   . GLN A 1 152 ? 29.689 -0.643  -16.775 1.00 27.06 ? 150 GLN A O   1 
ATOM   1088 C  CB  . GLN A 1 152 ? 27.766 -2.325  -15.737 1.00 26.70 ? 150 GLN A CB  1 
ATOM   1089 C  CG  . GLN A 1 152 ? 26.862 -3.504  -15.370 1.00 29.03 ? 150 GLN A CG  1 
ATOM   1090 C  CD  . GLN A 1 152 ? 25.405 -3.277  -15.665 1.00 41.80 ? 150 GLN A CD  1 
ATOM   1091 O  OE1 . GLN A 1 152 ? 25.010 -2.233  -16.174 1.00 45.52 ? 150 GLN A OE1 1 
ATOM   1092 N  NE2 . GLN A 1 152 ? 24.589 -4.268  -15.348 1.00 44.39 ? 150 GLN A NE2 1 
ATOM   1093 N  N   . ALA A 1 153 ? 31.452 -1.702  -15.866 1.00 22.03 ? 151 ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 153 ? 32.420 -0.702  -16.310 1.00 21.87 ? 151 ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 153 ? 33.831 -1.279  -16.392 1.00 21.95 ? 151 ALA A C   1 
ATOM   1096 O  O   . ALA A 1 153 ? 34.800 -0.614  -16.010 1.00 23.57 ? 151 ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 153 ? 32.416 0.508   -15.371 1.00 21.63 ? 151 ALA A CB  1 
ATOM   1098 N  N   . VAL A 1 154 ? 33.954 -2.510  -16.882 1.00 21.46 ? 152 VAL A N   1 
ATOM   1099 C  CA  . VAL A 1 154 ? 35.266 -3.164  -16.929 1.00 21.67 ? 152 VAL A CA  1 
ATOM   1100 C  C   . VAL A 1 154 ? 36.301 -2.316  -17.665 1.00 24.07 ? 152 VAL A C   1 
ATOM   1101 O  O   . VAL A 1 154 ? 37.383 -2.083  -17.104 1.00 22.94 ? 152 VAL A O   1 
ATOM   1102 C  CB  . VAL A 1 154 ? 35.129 -4.585  -17.500 1.00 23.78 ? 152 VAL A CB  1 
ATOM   1103 C  CG1 . VAL A 1 154 ? 36.407 -5.007  -18.251 1.00 23.05 ? 152 VAL A CG1 1 
ATOM   1104 C  CG2 . VAL A 1 154 ? 34.796 -5.565  -16.370 1.00 20.66 ? 152 VAL A CG2 1 
ATOM   1105 N  N   . PRO A 1 155 ? 36.040 -1.804  -18.882 1.00 20.36 ? 153 PRO A N   1 
ATOM   1106 C  CA  . PRO A 1 155 ? 37.072 -0.984  -19.540 1.00 23.68 ? 153 PRO A CA  1 
ATOM   1107 C  C   . PRO A 1 155 ? 37.397 0.293   -18.787 1.00 23.46 ? 153 PRO A C   1 
ATOM   1108 O  O   . PRO A 1 155 ? 38.575 0.640   -18.644 1.00 19.74 ? 153 PRO A O   1 
ATOM   1109 C  CB  . PRO A 1 155 ? 36.461 -0.701  -20.921 1.00 21.64 ? 153 PRO A CB  1 
ATOM   1110 C  CG  . PRO A 1 155 ? 35.552 -1.855  -21.154 1.00 25.77 ? 153 PRO A CG  1 
ATOM   1111 C  CD  . PRO A 1 155 ? 34.921 -2.084  -19.805 1.00 23.24 ? 153 PRO A CD  1 
ATOM   1112 N  N   . TYR A 1 156 ? 36.381 1.013   -18.313 1.00 24.09 ? 154 TYR A N   1 
ATOM   1113 C  CA  . TYR A 1 156 ? 36.638 2.258   -17.598 1.00 22.63 ? 154 TYR A CA  1 
ATOM   1114 C  C   . TYR A 1 156 ? 37.483 2.014   -16.355 1.00 23.74 ? 154 TYR A C   1 
ATOM   1115 O  O   . TYR A 1 156 ? 38.497 2.687   -16.144 1.00 23.84 ? 154 TYR A O   1 
ATOM   1116 C  CB  . TYR A 1 156 ? 35.319 2.935   -17.232 1.00 19.48 ? 154 TYR A CB  1 
ATOM   1117 C  CG  . TYR A 1 156 ? 35.501 4.233   -16.463 1.00 26.06 ? 154 TYR A CG  1 
ATOM   1118 C  CD1 . TYR A 1 156 ? 35.733 5.432   -17.131 1.00 29.77 ? 154 TYR A CD1 1 
ATOM   1119 C  CD2 . TYR A 1 156 ? 35.445 4.256   -15.070 1.00 24.25 ? 154 TYR A CD2 1 
ATOM   1120 C  CE1 . TYR A 1 156 ? 35.893 6.630   -16.429 1.00 32.59 ? 154 TYR A CE1 1 
ATOM   1121 C  CE2 . TYR A 1 156 ? 35.610 5.441   -14.365 1.00 26.89 ? 154 TYR A CE2 1 
ATOM   1122 C  CZ  . TYR A 1 156 ? 35.832 6.624   -15.050 1.00 29.52 ? 154 TYR A CZ  1 
ATOM   1123 O  OH  . TYR A 1 156 ? 35.988 7.795   -14.342 1.00 27.71 ? 154 TYR A OH  1 
ATOM   1124 N  N   . VAL A 1 157 ? 37.069 1.059   -15.516 1.00 24.35 ? 155 VAL A N   1 
ATOM   1125 C  CA  . VAL A 1 157 ? 37.808 0.737   -14.295 1.00 17.40 ? 155 VAL A CA  1 
ATOM   1126 C  C   . VAL A 1 157 ? 39.260 0.393   -14.624 1.00 18.85 ? 155 VAL A C   1 
ATOM   1127 O  O   . VAL A 1 157 ? 40.198 0.832   -13.941 1.00 18.91 ? 155 VAL A O   1 
ATOM   1128 C  CB  . VAL A 1 157 ? 37.115 -0.422  -13.551 1.00 17.73 ? 155 VAL A CB  1 
ATOM   1129 C  CG1 . VAL A 1 157 ? 38.051 -1.000  -12.461 1.00 20.12 ? 155 VAL A CG1 1 
ATOM   1130 C  CG2 . VAL A 1 157 ? 35.760 0.028   -12.951 1.00 20.38 ? 155 VAL A CG2 1 
ATOM   1131 N  N   . ALA A 1 158 ? 39.468 -0.394  -15.681 1.00 23.31 ? 156 ALA A N   1 
ATOM   1132 C  CA  . ALA A 1 158 ? 40.827 -0.796  -16.044 1.00 24.74 ? 156 ALA A CA  1 
ATOM   1133 C  C   . ALA A 1 158 ? 41.680 0.411   -16.451 1.00 22.73 ? 156 ALA A C   1 
ATOM   1134 O  O   . ALA A 1 158 ? 42.855 0.497   -16.072 1.00 24.75 ? 156 ALA A O   1 
ATOM   1135 C  CB  . ALA A 1 158 ? 40.781 -1.836  -17.164 1.00 20.50 ? 156 ALA A CB  1 
ATOM   1136 N  N   . THR A 1 159 ? 41.113 1.356   -17.219 1.00 18.04 ? 157 THR A N   1 
ATOM   1137 C  CA  . THR A 1 159 ? 41.887 2.546   -17.609 1.00 18.71 ? 157 THR A CA  1 
ATOM   1138 C  C   . THR A 1 159 ? 42.263 3.383   -16.393 1.00 20.99 ? 157 THR A C   1 
ATOM   1139 O  O   . THR A 1 159 ? 43.352 3.973   -16.339 1.00 21.89 ? 157 THR A O   1 
ATOM   1140 C  CB  . THR A 1 159 ? 41.131 3.434   -18.617 1.00 19.86 ? 157 THR A CB  1 
ATOM   1141 O  OG1 . THR A 1 159 ? 40.017 4.092   -17.985 1.00 22.16 ? 157 THR A OG1 1 
ATOM   1142 C  CG2 . THR A 1 159 ? 40.651 2.656   -19.849 1.00 21.86 ? 157 THR A CG2 1 
ATOM   1143 N  N   . LYS A 1 160 ? 41.388 3.441   -15.399 1.00 19.57 ? 158 LYS A N   1 
ATOM   1144 C  CA  . LYS A 1 160 ? 41.722 4.246   -14.232 1.00 18.22 ? 158 LYS A CA  1 
ATOM   1145 C  C   . LYS A 1 160 ? 42.706 3.527   -13.316 1.00 19.03 ? 158 LYS A C   1 
ATOM   1146 O  O   . LYS A 1 160 ? 43.604 4.164   -12.748 1.00 20.78 ? 158 LYS A O   1 
ATOM   1147 C  CB  . LYS A 1 160 ? 40.444 4.639   -13.498 1.00 20.00 ? 158 LYS A CB  1 
ATOM   1148 C  CG  . LYS A 1 160 ? 39.544 5.485   -14.369 1.00 17.70 ? 158 LYS A CG  1 
ATOM   1149 C  CD  . LYS A 1 160 ? 40.237 6.803   -14.716 1.00 19.45 ? 158 LYS A CD  1 
ATOM   1150 C  CE  . LYS A 1 160 ? 39.209 7.829   -15.229 1.00 21.24 ? 158 LYS A CE  1 
ATOM   1151 N  NZ  . LYS A 1 160 ? 39.843 9.162   -15.486 1.00 22.67 ? 158 LYS A NZ  1 
ATOM   1152 N  N   . GLY A 1 161 ? 42.574 2.207   -13.158 1.00 18.93 ? 159 GLY A N   1 
ATOM   1153 C  CA  . GLY A 1 161 ? 43.629 1.463   -12.481 1.00 15.80 ? 159 GLY A CA  1 
ATOM   1154 C  C   . GLY A 1 161 ? 44.990 1.725   -13.103 1.00 21.52 ? 159 GLY A C   1 
ATOM   1155 O  O   . GLY A 1 161 ? 45.988 1.899   -12.395 1.00 17.51 ? 159 GLY A O   1 
ATOM   1156 N  N   . ALA A 1 162 ? 45.034 1.819   -14.437 1.00 19.09 ? 160 ALA A N   1 
ATOM   1157 C  CA  . ALA A 1 162 ? 46.295 2.086   -15.132 1.00 23.03 ? 160 ALA A CA  1 
ATOM   1158 C  C   . ALA A 1 162 ? 46.813 3.494   -14.851 1.00 23.08 ? 160 ALA A C   1 
ATOM   1159 O  O   . ALA A 1 162 ? 48.022 3.694   -14.674 1.00 20.88 ? 160 ALA A O   1 
ATOM   1160 C  CB  . ALA A 1 162 ? 46.111 1.898   -16.633 1.00 16.82 ? 160 ALA A CB  1 
ATOM   1161 N  N   . VAL A 1 163 ? 45.921 4.488   -14.847 1.00 22.27 ? 161 VAL A N   1 
ATOM   1162 C  CA  . VAL A 1 163 ? 46.342 5.864   -14.582 1.00 21.36 ? 161 VAL A CA  1 
ATOM   1163 C  C   . VAL A 1 163 ? 46.936 5.991   -13.183 1.00 20.35 ? 161 VAL A C   1 
ATOM   1164 O  O   . VAL A 1 163 ? 47.979 6.631   -12.985 1.00 22.59 ? 161 VAL A O   1 
ATOM   1165 C  CB  . VAL A 1 163 ? 45.157 6.825   -14.779 1.00 17.68 ? 161 VAL A CB  1 
ATOM   1166 C  CG1 . VAL A 1 163 ? 45.503 8.229   -14.244 1.00 18.45 ? 161 VAL A CG1 1 
ATOM   1167 C  CG2 . VAL A 1 163 ? 44.791 6.886   -16.254 1.00 18.35 ? 161 VAL A CG2 1 
ATOM   1168 N  N   . THR A 1 164 ? 46.279 5.397   -12.188 1.00 17.83 ? 162 THR A N   1 
ATOM   1169 C  CA  . THR A 1 164 ? 46.772 5.500   -10.819 1.00 17.01 ? 162 THR A CA  1 
ATOM   1170 C  C   . THR A 1 164 ? 48.127 4.814   -10.676 1.00 18.42 ? 162 THR A C   1 
ATOM   1171 O  O   . THR A 1 164 ? 49.058 5.372   -10.076 1.00 19.07 ? 162 THR A O   1 
ATOM   1172 C  CB  . THR A 1 164 ? 45.734 4.909   -9.868  1.00 24.25 ? 162 THR A CB  1 
ATOM   1173 O  OG1 . THR A 1 164 ? 44.559 5.731   -9.913  1.00 20.93 ? 162 THR A OG1 1 
ATOM   1174 C  CG2 . THR A 1 164 ? 46.257 4.823   -8.424  1.00 21.62 ? 162 THR A CG2 1 
ATOM   1175 N  N   . ALA A 1 165 ? 48.266 3.617   -11.256 1.00 17.91 ? 163 ALA A N   1 
ATOM   1176 C  CA  . ALA A 1 165 ? 49.547 2.918   -11.237 1.00 19.70 ? 163 ALA A CA  1 
ATOM   1177 C  C   . ALA A 1 165 ? 50.619 3.701   -11.997 1.00 20.42 ? 163 ALA A C   1 
ATOM   1178 O  O   . ALA A 1 165 ? 51.729 3.894   -11.494 1.00 22.99 ? 163 ALA A O   1 
ATOM   1179 C  CB  . ALA A 1 165 ? 49.379 1.512   -11.823 1.00 21.49 ? 163 ALA A CB  1 
ATOM   1180 N  N   . MET A 1 166 ? 50.291 4.174   -13.209 1.00 19.83 ? 164 MET A N   1 
ATOM   1181 C  CA  . MET A 1 166 ? 51.235 4.970   -14.004 1.00 23.06 ? 164 MET A CA  1 
ATOM   1182 C  C   . MET A 1 166 ? 51.750 6.182   -13.235 1.00 18.37 ? 164 MET A C   1 
ATOM   1183 O  O   . MET A 1 166 ? 52.928 6.553   -13.360 1.00 21.44 ? 164 MET A O   1 
ATOM   1184 C  CB  . MET A 1 166 ? 50.575 5.434   -15.308 1.00 18.90 ? 164 MET A CB  1 
ATOM   1185 C  CG  . MET A 1 166 ? 51.543 6.176   -16.246 1.00 19.22 ? 164 MET A CG  1 
ATOM   1186 S  SD  . MET A 1 166 ? 50.873 6.393   -17.912 1.00 24.04 ? 164 MET A SD  1 
ATOM   1187 C  CE  . MET A 1 166 ? 49.623 7.651   -17.597 1.00 18.49 ? 164 MET A CE  1 
ATOM   1188 N  N   . THR A 1 167 ? 50.864 6.832   -12.471 1.00 18.40 ? 165 THR A N   1 
ATOM   1189 C  CA  . THR A 1 167 ? 51.232 7.975   -11.637 1.00 20.73 ? 165 THR A CA  1 
ATOM   1190 C  C   . THR A 1 167 ? 52.372 7.632   -10.681 1.00 20.89 ? 165 THR A C   1 
ATOM   1191 O  O   . THR A 1 167 ? 53.297 8.433   -10.498 1.00 17.58 ? 165 THR A O   1 
ATOM   1192 C  CB  . THR A 1 167 ? 49.994 8.449   -10.869 1.00 23.71 ? 165 THR A CB  1 
ATOM   1193 O  OG1 . THR A 1 167 ? 48.983 8.811   -11.814 1.00 21.44 ? 165 THR A OG1 1 
ATOM   1194 C  CG2 . THR A 1 167 ? 50.311 9.661   -9.984  1.00 22.60 ? 165 THR A CG2 1 
ATOM   1195 N  N   . LYS A 1 168 ? 52.334 6.438   -10.073 1.00 18.02 ? 166 LYS A N   1 
ATOM   1196 C  CA  . LYS A 1 168 ? 53.395 6.053   -9.147  1.00 24.28 ? 166 LYS A CA  1 
ATOM   1197 C  C   . LYS A 1 168 ? 54.689 5.714   -9.879  1.00 24.82 ? 166 LYS A C   1 
ATOM   1198 O  O   . LYS A 1 168 ? 55.779 6.056   -9.408  1.00 24.51 ? 166 LYS A O   1 
ATOM   1199 C  CB  . LYS A 1 168 ? 52.942 4.870   -8.295  1.00 21.09 ? 166 LYS A CB  1 
ATOM   1200 C  CG  . LYS A 1 168 ? 51.610 5.131   -7.610  1.00 22.83 ? 166 LYS A CG  1 
ATOM   1201 C  CD  . LYS A 1 168 ? 51.201 3.955   -6.734  1.00 23.18 ? 166 LYS A CD  1 
ATOM   1202 C  CE  . LYS A 1 168 ? 49.854 4.252   -6.081  1.00 24.21 ? 166 LYS A CE  1 
ATOM   1203 N  NZ  . LYS A 1 168 ? 49.415 3.150   -5.187  1.00 24.74 ? 166 LYS A NZ  1 
ATOM   1204 N  N   . ALA A 1 169 ? 54.593 5.022   -11.013 1.00 20.98 ? 167 ALA A N   1 
ATOM   1205 C  CA  . ALA A 1 169 ? 55.786 4.714   -11.797 1.00 18.92 ? 167 ALA A CA  1 
ATOM   1206 C  C   . ALA A 1 169 ? 56.477 5.988   -12.259 1.00 23.29 ? 167 ALA A C   1 
ATOM   1207 O  O   . ALA A 1 169 ? 57.702 6.121   -12.147 1.00 24.40 ? 167 ALA A O   1 
ATOM   1208 C  CB  . ALA A 1 169 ? 55.400 3.847   -12.997 1.00 19.88 ? 167 ALA A CB  1 
ATOM   1209 N  N   . LEU A 1 170 ? 55.699 6.949   -12.749 1.00 19.08 ? 168 LEU A N   1 
ATOM   1210 C  CA  . LEU A 1 170 ? 56.273 8.195   -13.233 1.00 21.19 ? 168 LEU A CA  1 
ATOM   1211 C  C   . LEU A 1 170 ? 56.839 9.020   -12.082 1.00 21.90 ? 168 LEU A C   1 
ATOM   1212 O  O   . LEU A 1 170 ? 57.878 9.667   -12.235 1.00 21.84 ? 168 LEU A O   1 
ATOM   1213 C  CB  . LEU A 1 170 ? 55.220 8.999   -14.002 1.00 22.01 ? 168 LEU A CB  1 
ATOM   1214 C  CG  . LEU A 1 170 ? 55.901 10.140  -14.787 1.00 28.63 ? 168 LEU A CG  1 
ATOM   1215 C  CD1 . LEU A 1 170 ? 56.864 9.611   -15.857 1.00 27.92 ? 168 LEU A CD1 1 
ATOM   1216 C  CD2 . LEU A 1 170 ? 54.877 11.047  -15.406 1.00 26.26 ? 168 LEU A CD2 1 
ATOM   1217 N  N   . ALA A 1 171 ? 56.161 9.024   -10.929 1.00 18.04 ? 169 ALA A N   1 
ATOM   1218 C  CA  . ALA A 1 171 ? 56.712 9.701   -9.757  1.00 19.47 ? 169 ALA A CA  1 
ATOM   1219 C  C   . ALA A 1 171 ? 58.105 9.184   -9.434  1.00 23.73 ? 169 ALA A C   1 
ATOM   1220 O  O   . ALA A 1 171 ? 59.009 9.969   -9.112  1.00 22.78 ? 169 ALA A O   1 
ATOM   1221 C  CB  . ALA A 1 171 ? 55.796 9.516   -8.552  1.00 16.21 ? 169 ALA A CB  1 
ATOM   1222 N  N   . LEU A 1 172 ? 58.295 7.863   -9.520  1.00 22.14 ? 170 LEU A N   1 
ATOM   1223 C  CA  . LEU A 1 172 ? 59.611 7.283   -9.288  1.00 23.41 ? 170 LEU A CA  1 
ATOM   1224 C  C   . LEU A 1 172 ? 60.620 7.759   -10.328 1.00 23.39 ? 170 LEU A C   1 
ATOM   1225 O  O   . LEU A 1 172 ? 61.741 8.129   -9.977  1.00 24.01 ? 170 LEU A O   1 
ATOM   1226 C  CB  . LEU A 1 172 ? 59.514 5.752   -9.269  1.00 26.78 ? 170 LEU A CB  1 
ATOM   1227 C  CG  . LEU A 1 172 ? 58.963 5.177   -7.943  1.00 27.21 ? 170 LEU A CG  1 
ATOM   1228 C  CD1 . LEU A 1 172 ? 58.539 3.717   -8.060  1.00 25.80 ? 170 LEU A CD1 1 
ATOM   1229 C  CD2 . LEU A 1 172 ? 59.975 5.327   -6.802  1.00 27.05 ? 170 LEU A CD2 1 
ATOM   1230 N  N   . ASP A 1 173 ? 60.239 7.779   -11.607 1.00 20.74 ? 171 ASP A N   1 
ATOM   1231 C  CA  . ASP A 1 173 ? 61.193 8.159   -12.651 1.00 24.63 ? 171 ASP A CA  1 
ATOM   1232 C  C   . ASP A 1 173 ? 61.576 9.627   -12.558 1.00 24.66 ? 171 ASP A C   1 
ATOM   1233 O  O   . ASP A 1 173 ? 62.723 9.993   -12.842 1.00 22.93 ? 171 ASP A O   1 
ATOM   1234 C  CB  . ASP A 1 173 ? 60.613 7.887   -14.042 1.00 26.40 ? 171 ASP A CB  1 
ATOM   1235 C  CG  . ASP A 1 173 ? 60.548 6.415   -14.373 1.00 31.92 ? 171 ASP A CG  1 
ATOM   1236 O  OD1 . ASP A 1 173 ? 61.429 5.649   -13.928 1.00 28.64 ? 171 ASP A OD1 1 
ATOM   1237 O  OD2 . ASP A 1 173 ? 59.597 6.020   -15.076 1.00 34.01 ? 171 ASP A OD2 1 
ATOM   1238 N  N   . GLU A 1 174 ? 60.626 10.485  -12.189 1.00 23.24 ? 172 GLU A N   1 
ATOM   1239 C  CA  . GLU A 1 174 ? 60.839 11.924  -12.237 1.00 25.34 ? 172 GLU A CA  1 
ATOM   1240 C  C   . GLU A 1 174 ? 61.312 12.509  -10.909 1.00 26.18 ? 172 GLU A C   1 
ATOM   1241 O  O   . GLU A 1 174 ? 61.776 13.658  -10.884 1.00 24.42 ? 172 GLU A O   1 
ATOM   1242 C  CB  . GLU A 1 174 ? 59.547 12.610  -12.720 1.00 22.94 ? 172 GLU A CB  1 
ATOM   1243 C  CG  . GLU A 1 174 ? 59.215 12.265  -14.186 1.00 23.57 ? 172 GLU A CG  1 
ATOM   1244 C  CD  . GLU A 1 174 ? 60.359 12.645  -15.133 1.00 31.85 ? 172 GLU A CD  1 
ATOM   1245 O  OE1 . GLU A 1 174 ? 60.792 11.806  -15.952 1.00 32.97 ? 172 GLU A OE1 1 
ATOM   1246 O  OE2 . GLU A 1 174 ? 60.843 13.792  -15.047 1.00 30.85 ? 172 GLU A OE2 1 
ATOM   1247 N  N   . SER A 1 175 ? 61.247 11.746  -9.816  1.00 19.10 ? 173 SER A N   1 
ATOM   1248 C  CA  . SER A 1 175 ? 61.739 12.256  -8.533  1.00 23.76 ? 173 SER A CA  1 
ATOM   1249 C  C   . SER A 1 175 ? 63.176 12.777  -8.566  1.00 27.83 ? 173 SER A C   1 
ATOM   1250 O  O   . SER A 1 175 ? 63.421 13.836  -7.960  1.00 28.74 ? 173 SER A O   1 
ATOM   1251 C  CB  . SER A 1 175 ? 61.577 11.190  -7.435  1.00 26.03 ? 173 SER A CB  1 
ATOM   1252 O  OG  . SER A 1 175 ? 62.359 10.027  -7.681  1.00 33.68 ? 173 SER A OG  1 
ATOM   1253 N  N   . PRO A 1 176 ? 64.147 12.149  -9.252  1.00 28.92 ? 174 PRO A N   1 
ATOM   1254 C  CA  . PRO A 1 176 ? 65.499 12.735  -9.278  1.00 30.40 ? 174 PRO A CA  1 
ATOM   1255 C  C   . PRO A 1 176 ? 65.552 14.112  -9.902  1.00 34.00 ? 174 PRO A C   1 
ATOM   1256 O  O   . PRO A 1 176 ? 66.526 14.836  -9.662  1.00 33.24 ? 174 PRO A O   1 
ATOM   1257 C  CB  . PRO A 1 176 ? 66.317 11.729  -10.106 1.00 32.63 ? 174 PRO A CB  1 
ATOM   1258 C  CG  . PRO A 1 176 ? 65.575 10.465  -10.029 1.00 32.94 ? 174 PRO A CG  1 
ATOM   1259 C  CD  . PRO A 1 176 ? 64.116 10.870  -9.986  1.00 29.85 ? 174 PRO A CD  1 
ATOM   1260 N  N   . TYR A 1 177 ? 64.553 14.499  -10.699 1.00 33.19 ? 175 TYR A N   1 
ATOM   1261 C  CA  . TYR A 1 177 ? 64.531 15.806  -11.345 1.00 33.78 ? 175 TYR A CA  1 
ATOM   1262 C  C   . TYR A 1 177 ? 63.669 16.808  -10.599 1.00 36.00 ? 175 TYR A C   1 
ATOM   1263 O  O   . TYR A 1 177 ? 63.492 17.929  -11.080 1.00 37.21 ? 175 TYR A O   1 
ATOM   1264 C  CB  . TYR A 1 177 ? 64.042 15.682  -12.796 1.00 39.16 ? 175 TYR A CB  1 
ATOM   1265 C  CG  . TYR A 1 177 ? 64.875 14.710  -13.585 1.00 44.49 ? 175 TYR A CG  1 
ATOM   1266 C  CD1 . TYR A 1 177 ? 64.562 13.361  -13.608 1.00 47.06 ? 175 TYR A CD1 1 
ATOM   1267 C  CD2 . TYR A 1 177 ? 66.006 15.130  -14.265 1.00 51.82 ? 175 TYR A CD2 1 
ATOM   1268 C  CE1 . TYR A 1 177 ? 65.341 12.459  -14.304 1.00 53.69 ? 175 TYR A CE1 1 
ATOM   1269 C  CE2 . TYR A 1 177 ? 66.794 14.239  -14.964 1.00 56.03 ? 175 TYR A CE2 1 
ATOM   1270 C  CZ  . TYR A 1 177 ? 66.455 12.903  -14.984 1.00 58.44 ? 175 TYR A CZ  1 
ATOM   1271 O  OH  . TYR A 1 177 ? 67.233 12.006  -15.683 1.00 62.58 ? 175 TYR A OH  1 
ATOM   1272 N  N   . GLY A 1 178 ? 63.136 16.438  -9.436  1.00 30.79 ? 176 GLY A N   1 
ATOM   1273 C  CA  . GLY A 1 178 ? 62.295 17.349  -8.693  1.00 37.26 ? 176 GLY A CA  1 
ATOM   1274 C  C   . GLY A 1 178 ? 60.892 17.496  -9.230  1.00 33.94 ? 176 GLY A C   1 
ATOM   1275 O  O   . GLY A 1 178 ? 60.150 18.367  -8.761  1.00 31.97 ? 176 GLY A O   1 
ATOM   1276 N  N   . VAL A 1 179 ? 60.493 16.682  -10.197 1.00 24.48 ? 177 VAL A N   1 
ATOM   1277 C  CA  . VAL A 1 179 ? 59.145 16.764  -10.746 1.00 21.43 ? 177 VAL A CA  1 
ATOM   1278 C  C   . VAL A 1 179 ? 58.257 15.783  -9.997  1.00 22.82 ? 177 VAL A C   1 
ATOM   1279 O  O   . VAL A 1 179 ? 58.487 14.574  -10.044 1.00 24.31 ? 177 VAL A O   1 
ATOM   1280 C  CB  . VAL A 1 179 ? 59.144 16.488  -12.254 1.00 19.67 ? 177 VAL A CB  1 
ATOM   1281 C  CG1 . VAL A 1 179 ? 57.719 16.402  -12.762 1.00 17.82 ? 177 VAL A CG1 1 
ATOM   1282 C  CG2 . VAL A 1 179 ? 59.906 17.622  -12.991 1.00 23.49 ? 177 VAL A CG2 1 
ATOM   1283 N  N   . ARG A 1 180 ? 57.273 16.312  -9.271  1.00 21.13 ? 178 ARG A N   1 
ATOM   1284 C  CA  . ARG A 1 180 ? 56.284 15.499  -8.583  1.00 20.50 ? 178 ARG A CA  1 
ATOM   1285 C  C   . ARG A 1 180 ? 55.178 15.075  -9.541  1.00 22.96 ? 178 ARG A C   1 
ATOM   1286 O  O   . ARG A 1 180 ? 54.803 15.814  -10.459 1.00 21.58 ? 178 ARG A O   1 
ATOM   1287 C  CB  . ARG A 1 180 ? 55.691 16.271  -7.396  1.00 19.23 ? 178 ARG A CB  1 
ATOM   1288 C  CG  . ARG A 1 180 ? 56.762 16.696  -6.346  1.00 21.20 ? 178 ARG A CG  1 
ATOM   1289 C  CD  . ARG A 1 180 ? 56.211 17.650  -5.287  1.00 22.03 ? 178 ARG A CD  1 
ATOM   1290 N  NE  . ARG A 1 180 ? 55.672 18.860  -5.901  1.00 24.74 ? 178 ARG A NE  1 
ATOM   1291 C  CZ  . ARG A 1 180 ? 54.378 19.147  -5.973  1.00 26.91 ? 178 ARG A CZ  1 
ATOM   1292 N  NH1 . ARG A 1 180 ? 53.478 18.323  -5.434  1.00 27.83 ? 178 ARG A NH1 1 
ATOM   1293 N  NH2 . ARG A 1 180 ? 53.983 20.256  -6.581  1.00 24.70 ? 178 ARG A NH2 1 
ATOM   1294 N  N   . VAL A 1 181 ? 54.655 13.867  -9.317  1.00 22.07 ? 179 VAL A N   1 
ATOM   1295 C  CA  . VAL A 1 181 ? 53.600 13.279  -10.136 1.00 18.76 ? 179 VAL A CA  1 
ATOM   1296 C  C   . VAL A 1 181 ? 52.572 12.682  -9.182  1.00 19.68 ? 179 VAL A C   1 
ATOM   1297 O  O   . VAL A 1 181 ? 52.882 11.739  -8.448  1.00 21.31 ? 179 VAL A O   1 
ATOM   1298 C  CB  . VAL A 1 181 ? 54.136 12.199  -11.097 1.00 18.65 ? 179 VAL A CB  1 
ATOM   1299 C  CG1 . VAL A 1 181 ? 53.006 11.705  -12.012 1.00 18.61 ? 179 VAL A CG1 1 
ATOM   1300 C  CG2 . VAL A 1 181 ? 55.302 12.733  -11.912 1.00 21.29 ? 179 VAL A CG2 1 
ATOM   1301 N  N   . ASN A 1 182 ? 51.362 13.239  -9.169  1.00 18.22 ? 180 ASN A N   1 
ATOM   1302 C  CA  . ASN A 1 182 ? 50.339 12.799  -8.238  1.00 19.32 ? 180 ASN A CA  1 
ATOM   1303 C  C   . ASN A 1 182 ? 49.036 12.600  -8.991  1.00 21.35 ? 180 ASN A C   1 
ATOM   1304 O  O   . ASN A 1 182 ? 48.885 13.049  -10.131 1.00 25.16 ? 180 ASN A O   1 
ATOM   1305 C  CB  . ASN A 1 182 ? 50.133 13.803  -7.108  1.00 21.45 ? 180 ASN A CB  1 
ATOM   1306 C  CG  . ASN A 1 182 ? 51.353 13.944  -6.226  1.00 24.31 ? 180 ASN A CG  1 
ATOM   1307 O  OD1 . ASN A 1 182 ? 51.686 13.038  -5.472  1.00 20.39 ? 180 ASN A OD1 1 
ATOM   1308 N  ND2 . ASN A 1 182 ? 52.015 15.095  -6.302  1.00 23.34 ? 180 ASN A ND2 1 
ATOM   1309 N  N   . CYS A 1 183 ? 48.092 11.901  -8.356  1.00 18.65 ? 181 CYS A N   1 
ATOM   1310 C  CA  . CYS A 1 183 ? 46.764 11.790  -8.938  1.00 18.56 ? 181 CYS A CA  1 
ATOM   1311 C  C   . CYS A 1 183 ? 45.684 12.097  -7.905  1.00 23.94 ? 181 CYS A C   1 
ATOM   1312 O  O   . CYS A 1 183 ? 45.893 12.013  -6.691  1.00 22.03 ? 181 CYS A O   1 
ATOM   1313 C  CB  . CYS A 1 183 ? 46.517 10.411  -9.582  1.00 23.53 ? 181 CYS A CB  1 
ATOM   1314 S  SG  . CYS A 1 183 ? 46.477 8.989   -8.468  1.00 23.25 ? 181 CYS A SG  1 
ATOM   1315 N  N   . ILE A 1 184 ? 44.533 12.511  -8.423  1.00 18.03 ? 182 ILE A N   1 
ATOM   1316 C  CA  . ILE A 1 184 ? 43.309 12.682  -7.654  1.00 16.73 ? 182 ILE A CA  1 
ATOM   1317 C  C   . ILE A 1 184 ? 42.334 11.600  -8.107  1.00 20.35 ? 182 ILE A C   1 
ATOM   1318 O  O   . ILE A 1 184 ? 42.174 11.368  -9.313  1.00 19.15 ? 182 ILE A O   1 
ATOM   1319 C  CB  . ILE A 1 184 ? 42.712 14.085  -7.872  1.00 19.24 ? 182 ILE A CB  1 
ATOM   1320 C  CG1 . ILE A 1 184 ? 43.725 15.175  -7.483  1.00 23.08 ? 182 ILE A CG1 1 
ATOM   1321 C  CG2 . ILE A 1 184 ? 41.418 14.244  -7.110  1.00 18.50 ? 182 ILE A CG2 1 
ATOM   1322 C  CD1 . ILE A 1 184 ? 43.299 16.605  -7.880  1.00 20.22 ? 182 ILE A CD1 1 
ATOM   1323 N  N   . SER A 1 185 ? 41.688 10.934  -7.150  1.00 18.47 ? 183 SER A N   1 
ATOM   1324 C  CA  . SER A 1 185 ? 40.677 9.929   -7.462  1.00 20.89 ? 183 SER A CA  1 
ATOM   1325 C  C   . SER A 1 185 ? 39.336 10.451  -6.979  1.00 23.09 ? 183 SER A C   1 
ATOM   1326 O  O   . SER A 1 185 ? 38.988 10.297  -5.797  1.00 25.76 ? 183 SER A O   1 
ATOM   1327 C  CB  . SER A 1 185 ? 41.006 8.584   -6.810  1.00 24.46 ? 183 SER A CB  1 
ATOM   1328 O  OG  . SER A 1 185 ? 42.016 7.908   -7.541  1.00 23.05 ? 183 SER A OG  1 
ATOM   1329 N  N   . PRO A 1 186 ? 38.550 11.090  -7.841  1.00 20.39 ? 184 PRO A N   1 
ATOM   1330 C  CA  . PRO A 1 186 ? 37.224 11.538  -7.420  1.00 18.38 ? 184 PRO A CA  1 
ATOM   1331 C  C   . PRO A 1 186 ? 36.277 10.358  -7.329  1.00 21.57 ? 184 PRO A C   1 
ATOM   1332 O  O   . PRO A 1 186 ? 36.457 9.339   -7.997  1.00 18.54 ? 184 PRO A O   1 
ATOM   1333 C  CB  . PRO A 1 186 ? 36.801 12.501  -8.537  1.00 19.80 ? 184 PRO A CB  1 
ATOM   1334 C  CG  . PRO A 1 186 ? 38.068 12.759  -9.349  1.00 21.87 ? 184 PRO A CG  1 
ATOM   1335 C  CD  . PRO A 1 186 ? 38.865 11.512  -9.217  1.00 19.79 ? 184 PRO A CD  1 
ATOM   1336 N  N   . GLY A 1 187 ? 35.268 10.499  -6.476  1.00 26.84 ? 185 GLY A N   1 
ATOM   1337 C  CA  . GLY A 1 187 ? 34.124 9.598   -6.513  1.00 22.54 ? 185 GLY A CA  1 
ATOM   1338 C  C   . GLY A 1 187 ? 33.026 10.230  -7.344  1.00 27.06 ? 185 GLY A C   1 
ATOM   1339 O  O   . GLY A 1 187 ? 33.290 10.727  -8.440  1.00 33.94 ? 185 GLY A O   1 
ATOM   1340 N  N   . ASN A 1 188 ? 31.808 10.273  -6.822  1.00 21.86 ? 186 ASN A N   1 
ATOM   1341 C  CA  . ASN A 1 188 ? 30.687 10.897  -7.527  1.00 23.84 ? 186 ASN A CA  1 
ATOM   1342 C  C   . ASN A 1 188 ? 30.790 12.412  -7.423  1.00 27.50 ? 186 ASN A C   1 
ATOM   1343 O  O   . ASN A 1 188 ? 30.589 12.983  -6.346  1.00 24.90 ? 186 ASN A O   1 
ATOM   1344 C  CB  . ASN A 1 188 ? 29.362 10.410  -6.954  1.00 21.53 ? 186 ASN A CB  1 
ATOM   1345 C  CG  . ASN A 1 188 ? 29.131 8.955   -7.241  1.00 29.68 ? 186 ASN A CG  1 
ATOM   1346 O  OD1 . ASN A 1 188 ? 29.363 8.490   -8.367  1.00 25.69 ? 186 ASN A OD1 1 
ATOM   1347 N  ND2 . ASN A 1 188 ? 28.723 8.209   -6.223  1.00 29.73 ? 186 ASN A ND2 1 
ATOM   1348 N  N   . ILE A 1 189 ? 31.106 13.062  -8.542  1.00 20.79 ? 187 ILE A N   1 
ATOM   1349 C  CA  . ILE A 1 189 ? 31.113 14.515  -8.648  1.00 18.82 ? 187 ILE A CA  1 
ATOM   1350 C  C   . ILE A 1 189 ? 29.997 14.900  -9.610  1.00 20.25 ? 187 ILE A C   1 
ATOM   1351 O  O   . ILE A 1 189 ? 29.886 14.316  -10.693 1.00 25.01 ? 187 ILE A O   1 
ATOM   1352 C  CB  . ILE A 1 189 ? 32.476 15.034  -9.147  1.00 21.28 ? 187 ILE A CB  1 
ATOM   1353 C  CG1 . ILE A 1 189 ? 33.622 14.401  -8.351  1.00 22.83 ? 187 ILE A CG1 1 
ATOM   1354 C  CG2 . ILE A 1 189 ? 32.515 16.580  -9.100  1.00 25.38 ? 187 ILE A CG2 1 
ATOM   1355 C  CD1 . ILE A 1 189 ? 33.539 14.630  -6.847  1.00 23.21 ? 187 ILE A CD1 1 
ATOM   1356 N  N   . TRP A 1 190 ? 29.163 15.860  -9.215  1.00 22.61 ? 188 TRP A N   1 
ATOM   1357 C  CA  . TRP A 1 190 ? 28.030 16.272  -10.038 1.00 24.88 ? 188 TRP A CA  1 
ATOM   1358 C  C   . TRP A 1 190 ? 28.544 17.121  -11.199 1.00 27.64 ? 188 TRP A C   1 
ATOM   1359 O  O   . TRP A 1 190 ? 29.011 18.250  -10.999 1.00 27.82 ? 188 TRP A O   1 
ATOM   1360 C  CB  . TRP A 1 190 ? 27.006 17.018  -9.186  1.00 26.81 ? 188 TRP A CB  1 
ATOM   1361 C  CG  . TRP A 1 190 ? 25.776 17.445  -9.926  1.00 28.27 ? 188 TRP A CG  1 
ATOM   1362 C  CD1 . TRP A 1 190 ? 25.324 18.724  -10.087 1.00 37.37 ? 188 TRP A CD1 1 
ATOM   1363 C  CD2 . TRP A 1 190 ? 24.834 16.599  -10.607 1.00 34.28 ? 188 TRP A CD2 1 
ATOM   1364 N  NE1 . TRP A 1 190 ? 24.157 18.728  -10.816 1.00 38.13 ? 188 TRP A NE1 1 
ATOM   1365 C  CE2 . TRP A 1 190 ? 23.834 17.438  -11.148 1.00 38.17 ? 188 TRP A CE2 1 
ATOM   1366 C  CE3 . TRP A 1 190 ? 24.733 15.211  -10.805 1.00 27.66 ? 188 TRP A CE3 1 
ATOM   1367 C  CZ2 . TRP A 1 190 ? 22.752 16.941  -11.880 1.00 37.76 ? 188 TRP A CZ2 1 
ATOM   1368 C  CZ3 . TRP A 1 190 ? 23.659 14.719  -11.529 1.00 28.33 ? 188 TRP A CZ3 1 
ATOM   1369 C  CH2 . TRP A 1 190 ? 22.681 15.582  -12.056 1.00 37.02 ? 188 TRP A CH2 1 
ATOM   1370 N  N   . THR A 1 191 ? 28.483 16.558  -12.423 1.00 28.18 ? 189 THR A N   1 
ATOM   1371 C  CA  . THR A 1 191 ? 29.030 17.142  -13.653 1.00 28.49 ? 189 THR A CA  1 
ATOM   1372 C  C   . THR A 1 191 ? 28.067 16.888  -14.802 1.00 31.45 ? 189 THR A C   1 
ATOM   1373 O  O   . THR A 1 191 ? 27.093 16.137  -14.633 1.00 33.17 ? 189 THR A O   1 
ATOM   1374 C  CB  . THR A 1 191 ? 30.391 16.535  -14.020 1.00 28.38 ? 189 THR A CB  1 
ATOM   1375 O  OG1 . THR A 1 191 ? 30.219 15.144  -14.337 1.00 29.23 ? 189 THR A OG1 1 
ATOM   1376 C  CG2 . THR A 1 191 ? 31.407 16.706  -12.904 1.00 24.48 ? 189 THR A CG2 1 
ATOM   1377 N  N   . PRO A 1 192 ? 28.293 17.482  -15.978 1.00 32.02 ? 190 PRO A N   1 
ATOM   1378 C  CA  . PRO A 1 192 ? 27.435 17.141  -17.120 1.00 31.62 ? 190 PRO A CA  1 
ATOM   1379 C  C   . PRO A 1 192 ? 27.540 15.682  -17.523 1.00 33.37 ? 190 PRO A C   1 
ATOM   1380 O  O   . PRO A 1 192 ? 26.556 15.117  -18.009 1.00 34.52 ? 190 PRO A O   1 
ATOM   1381 C  CB  . PRO A 1 192 ? 27.937 18.080  -18.228 1.00 37.74 ? 190 PRO A CB  1 
ATOM   1382 C  CG  . PRO A 1 192 ? 28.540 19.236  -17.492 1.00 37.70 ? 190 PRO A CG  1 
ATOM   1383 C  CD  . PRO A 1 192 ? 29.187 18.617  -16.293 1.00 33.60 ? 190 PRO A CD  1 
ATOM   1384 N  N   . LEU A 1 193 ? 28.703 15.048  -17.335 1.00 29.31 ? 191 LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 193 ? 28.804 13.628  -17.645 1.00 34.33 ? 191 LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 193 ? 27.905 12.815  -16.720 1.00 33.17 ? 191 LEU A C   1 
ATOM   1387 O  O   . LEU A 1 193 ? 27.161 11.944  -17.177 1.00 32.78 ? 191 LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 193 ? 30.255 13.160  -17.555 1.00 38.57 ? 191 LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 193 ? 30.547 11.659  -17.756 1.00 37.71 ? 191 LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 193 ? 30.121 11.153  -19.140 1.00 33.43 ? 191 LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 193 ? 32.033 11.373  -17.521 1.00 35.78 ? 191 LEU A CD2 1 
ATOM   1392 N  N   . TRP A 1 194 ? 27.949 13.096  -15.413 1.00 29.61 ? 192 TRP A N   1 
ATOM   1393 C  CA  . TRP A 1 194 ? 27.068 12.393  -14.480 1.00 29.43 ? 192 TRP A CA  1 
ATOM   1394 C  C   . TRP A 1 194 ? 25.610 12.562  -14.887 1.00 30.67 ? 192 TRP A C   1 
ATOM   1395 O  O   . TRP A 1 194 ? 24.847 11.588  -14.942 1.00 28.29 ? 192 TRP A O   1 
ATOM   1396 C  CB  . TRP A 1 194 ? 27.286 12.893  -13.046 1.00 26.91 ? 192 TRP A CB  1 
ATOM   1397 C  CG  . TRP A 1 194 ? 27.344 11.797  -12.022 1.00 27.58 ? 192 TRP A CG  1 
ATOM   1398 C  CD1 . TRP A 1 194 ? 28.452 11.356  -11.355 1.00 28.91 ? 192 TRP A CD1 1 
ATOM   1399 C  CD2 . TRP A 1 194 ? 26.251 10.995  -11.560 1.00 29.46 ? 192 TRP A CD2 1 
ATOM   1400 N  NE1 . TRP A 1 194 ? 28.117 10.327  -10.501 1.00 23.97 ? 192 TRP A NE1 1 
ATOM   1401 C  CE2 . TRP A 1 194 ? 26.771 10.088  -10.606 1.00 28.59 ? 192 TRP A CE2 1 
ATOM   1402 C  CE3 . TRP A 1 194 ? 24.876 10.960  -11.850 1.00 26.22 ? 192 TRP A CE3 1 
ATOM   1403 C  CZ2 . TRP A 1 194 ? 25.966 9.150   -9.946  1.00 27.00 ? 192 TRP A CZ2 1 
ATOM   1404 C  CZ3 . TRP A 1 194 ? 24.078 10.028  -11.194 1.00 26.04 ? 192 TRP A CZ3 1 
ATOM   1405 C  CH2 . TRP A 1 194 ? 24.626 9.135   -10.249 1.00 25.70 ? 192 TRP A CH2 1 
ATOM   1406 N  N   . GLU A 1 195 ? 25.216 13.796  -15.217 1.00 28.87 ? 193 GLU A N   1 
ATOM   1407 C  CA  . GLU A 1 195 ? 23.821 14.063  -15.547 1.00 30.66 ? 193 GLU A CA  1 
ATOM   1408 C  C   . GLU A 1 195 ? 23.404 13.355  -16.834 1.00 31.80 ? 193 GLU A C   1 
ATOM   1409 O  O   . GLU A 1 195 ? 22.305 12.790  -16.911 1.00 31.51 ? 193 GLU A O   1 
ATOM   1410 C  CB  . GLU A 1 195 ? 23.587 15.572  -15.658 1.00 40.31 ? 193 GLU A CB  1 
ATOM   1411 C  CG  . GLU A 1 195 ? 22.106 15.939  -15.642 1.00 47.28 ? 193 GLU A CG  1 
ATOM   1412 C  CD  . GLU A 1 195 ? 21.869 17.439  -15.619 1.00 58.58 ? 193 GLU A CD  1 
ATOM   1413 O  OE1 . GLU A 1 195 ? 22.723 18.189  -16.139 1.00 61.79 ? 193 GLU A OE1 1 
ATOM   1414 O  OE2 . GLU A 1 195 ? 20.830 17.867  -15.071 1.00 61.93 ? 193 GLU A OE2 1 
ATOM   1415 N  N   . GLU A 1 196 ? 24.264 13.375  -17.857 1.00 32.80 ? 194 GLU A N   1 
ATOM   1416 C  CA  . GLU A 1 196 ? 23.959 12.645  -19.088 1.00 41.01 ? 194 GLU A CA  1 
ATOM   1417 C  C   . GLU A 1 196 ? 23.789 11.152  -18.818 1.00 40.10 ? 194 GLU A C   1 
ATOM   1418 O  O   . GLU A 1 196 ? 22.839 10.524  -19.307 1.00 35.54 ? 194 GLU A O   1 
ATOM   1419 C  CB  . GLU A 1 196 ? 25.061 12.873  -20.124 1.00 47.61 ? 194 GLU A CB  1 
ATOM   1420 C  CG  . GLU A 1 196 ? 25.124 14.277  -20.692 1.00 48.63 ? 194 GLU A CG  1 
ATOM   1421 C  CD  . GLU A 1 196 ? 26.445 14.552  -21.397 1.00 56.40 ? 194 GLU A CD  1 
ATOM   1422 O  OE1 . GLU A 1 196 ? 27.278 13.625  -21.508 1.00 58.33 ? 194 GLU A OE1 1 
ATOM   1423 O  OE2 . GLU A 1 196 ? 26.657 15.701  -21.836 1.00 59.69 ? 194 GLU A OE2 1 
ATOM   1424 N  N   . LEU A 1 197 ? 24.712 10.563  -18.047 1.00 34.54 ? 195 LEU A N   1 
ATOM   1425 C  CA  . LEU A 1 197 ? 24.638 9.130   -17.776 1.00 35.92 ? 195 LEU A CA  1 
ATOM   1426 C  C   . LEU A 1 197 ? 23.358 8.778   -17.029 1.00 39.30 ? 195 LEU A C   1 
ATOM   1427 O  O   . LEU A 1 197 ? 22.674 7.805   -17.377 1.00 33.49 ? 195 LEU A O   1 
ATOM   1428 C  CB  . LEU A 1 197 ? 25.870 8.676   -16.992 1.00 35.46 ? 195 LEU A CB  1 
ATOM   1429 C  CG  . LEU A 1 197 ? 27.179 8.577   -17.798 1.00 40.36 ? 195 LEU A CG  1 
ATOM   1430 C  CD1 . LEU A 1 197 ? 28.392 8.418   -16.878 1.00 36.05 ? 195 LEU A CD1 1 
ATOM   1431 C  CD2 . LEU A 1 197 ? 27.125 7.436   -18.808 1.00 40.38 ? 195 LEU A CD2 1 
ATOM   1432 N  N   . ALA A 1 198 ? 23.002 9.570   -16.015 1.00 33.45 ? 196 ALA A N   1 
ATOM   1433 C  CA  . ALA A 1 198 ? 21.750 9.328   -15.304 1.00 35.44 ? 196 ALA A CA  1 
ATOM   1434 C  C   . ALA A 1 198 ? 20.548 9.426   -16.241 1.00 36.18 ? 196 ALA A C   1 
ATOM   1435 O  O   . ALA A 1 198 ? 19.578 8.675   -16.093 1.00 34.42 ? 196 ALA A O   1 
ATOM   1436 C  CB  . ALA A 1 198 ? 21.608 10.304  -14.136 1.00 28.38 ? 196 ALA A CB  1 
ATOM   1437 N  N   . ALA A 1 199 ? 20.598 10.334  -17.221 1.00 35.68 ? 197 ALA A N   1 
ATOM   1438 C  CA  . ALA A 1 199 ? 19.453 10.523  -18.111 1.00 37.49 ? 197 ALA A CA  1 
ATOM   1439 C  C   . ALA A 1 199 ? 19.149 9.272   -18.929 1.00 40.52 ? 197 ALA A C   1 
ATOM   1440 O  O   . ALA A 1 199 ? 17.994 9.047   -19.305 1.00 41.42 ? 197 ALA A O   1 
ATOM   1441 C  CB  . ALA A 1 199 ? 19.695 11.709  -19.046 1.00 37.52 ? 197 ALA A CB  1 
ATOM   1442 N  N   . LEU A 1 200 ? 20.162 8.449   -19.215 1.00 42.76 ? 198 LEU A N   1 
ATOM   1443 C  CA  . LEU A 1 200 ? 19.935 7.202   -19.942 1.00 48.74 ? 198 LEU A CA  1 
ATOM   1444 C  C   . LEU A 1 200 ? 19.190 6.165   -19.109 1.00 51.63 ? 198 LEU A C   1 
ATOM   1445 O  O   . LEU A 1 200 ? 18.684 5.189   -19.670 1.00 55.60 ? 198 LEU A O   1 
ATOM   1446 C  CB  . LEU A 1 200 ? 21.266 6.600   -20.405 1.00 50.05 ? 198 LEU A CB  1 
ATOM   1447 C  CG  . LEU A 1 200 ? 22.276 7.486   -21.139 1.00 50.83 ? 198 LEU A CG  1 
ATOM   1448 N  N   . MET A 1 201 ? 19.129 6.340   -17.794 1.00 49.55 ? 199 MET A N   1 
ATOM   1449 C  CA  . MET A 1 201 ? 18.576 5.328   -16.909 1.00 47.24 ? 199 MET A CA  1 
ATOM   1450 C  C   . MET A 1 201 ? 17.055 5.371   -16.917 1.00 51.66 ? 199 MET A C   1 
ATOM   1451 O  O   . MET A 1 201 ? 16.454 6.406   -17.217 1.00 50.81 ? 199 MET A O   1 
ATOM   1452 C  CB  . MET A 1 201 ? 19.092 5.539   -15.489 1.00 47.22 ? 199 MET A CB  1 
ATOM   1453 C  CG  . MET A 1 201 ? 20.596 5.496   -15.375 1.00 49.75 ? 199 MET A CG  1 
ATOM   1454 S  SD  . MET A 1 201 ? 21.279 3.903   -15.854 1.00 55.94 ? 199 MET A SD  1 
ATOM   1455 C  CE  . MET A 1 201 ? 22.944 4.092   -15.229 1.00 52.76 ? 199 MET A CE  1 
ATOM   1456 N  N   . PRO A 1 202 ? 16.403 4.251   -16.583 1.00 55.02 ? 200 PRO A N   1 
ATOM   1457 C  CA  . PRO A 1 202 ? 14.931 4.245   -16.582 1.00 60.17 ? 200 PRO A CA  1 
ATOM   1458 C  C   . PRO A 1 202 ? 14.330 5.295   -15.666 1.00 57.44 ? 200 PRO A C   1 
ATOM   1459 O  O   . PRO A 1 202 ? 13.322 5.918   -16.021 1.00 57.75 ? 200 PRO A O   1 
ATOM   1460 C  CB  . PRO A 1 202 ? 14.590 2.821   -16.118 1.00 64.28 ? 200 PRO A CB  1 
ATOM   1461 C  CG  . PRO A 1 202 ? 15.818 2.012   -16.411 1.00 62.87 ? 200 PRO A CG  1 
ATOM   1462 C  CD  . PRO A 1 202 ? 16.964 2.943   -16.200 1.00 55.48 ? 200 PRO A CD  1 
ATOM   1463 N  N   . ASP A 1 203 ? 14.929 5.510   -14.492 1.00 53.87 ? 201 ASP A N   1 
ATOM   1464 C  CA  . ASP A 1 203 ? 14.495 6.541   -13.553 1.00 50.20 ? 201 ASP A CA  1 
ATOM   1465 C  C   . ASP A 1 203 ? 15.701 7.409   -13.235 1.00 46.57 ? 201 ASP A C   1 
ATOM   1466 O  O   . ASP A 1 203 ? 16.426 7.147   -12.264 1.00 43.31 ? 201 ASP A O   1 
ATOM   1467 C  CB  . ASP A 1 203 ? 13.908 5.934   -12.281 1.00 55.66 ? 201 ASP A CB  1 
ATOM   1468 C  CG  . ASP A 1 203 ? 13.209 6.965   -11.414 1.00 62.35 ? 201 ASP A CG  1 
ATOM   1469 O  OD1 . ASP A 1 203 ? 13.408 8.177   -11.651 1.00 61.30 ? 201 ASP A OD1 1 
ATOM   1470 O  OD2 . ASP A 1 203 ? 12.454 6.565   -10.498 1.00 64.97 ? 201 ASP A OD2 1 
ATOM   1471 N  N   . PRO A 1 204 ? 15.947 8.452   -14.033 1.00 44.46 ? 202 PRO A N   1 
ATOM   1472 C  CA  . PRO A 1 204 ? 17.114 9.318   -13.780 1.00 43.34 ? 202 PRO A CA  1 
ATOM   1473 C  C   . PRO A 1 204 ? 17.173 9.880   -12.369 1.00 44.87 ? 202 PRO A C   1 
ATOM   1474 O  O   . PRO A 1 204 ? 18.249 9.896   -11.758 1.00 40.05 ? 202 PRO A O   1 
ATOM   1475 C  CB  . PRO A 1 204 ? 16.940 10.429  -14.822 1.00 43.43 ? 202 PRO A CB  1 
ATOM   1476 C  CG  . PRO A 1 204 ? 16.182 9.778   -15.933 1.00 45.79 ? 202 PRO A CG  1 
ATOM   1477 C  CD  . PRO A 1 204 ? 15.247 8.802   -15.281 1.00 46.62 ? 202 PRO A CD  1 
ATOM   1478 N  N   . ARG A 1 205 ? 16.042 10.339  -11.829 1.00 42.27 ? 203 ARG A N   1 
ATOM   1479 C  CA  . ARG A 1 205 ? 16.052 10.917  -10.487 1.00 42.42 ? 203 ARG A CA  1 
ATOM   1480 C  C   . ARG A 1 205 ? 16.447 9.879   -9.444  1.00 45.01 ? 203 ARG A C   1 
ATOM   1481 O  O   . ARG A 1 205 ? 17.229 10.172  -8.531  1.00 51.25 ? 203 ARG A O   1 
ATOM   1482 C  CB  . ARG A 1 205 ? 14.680 11.525  -10.164 1.00 48.46 ? 203 ARG A CB  1 
ATOM   1483 N  N   . ALA A 1 206 ? 15.923 8.656   -9.568  1.00 42.60 ? 204 ALA A N   1 
ATOM   1484 C  CA  . ALA A 1 206 ? 16.332 7.583   -8.668  1.00 42.99 ? 204 ALA A CA  1 
ATOM   1485 C  C   . ALA A 1 206 ? 17.829 7.324   -8.765  1.00 45.36 ? 204 ALA A C   1 
ATOM   1486 O  O   . ALA A 1 206 ? 18.503 7.128   -7.747  1.00 44.35 ? 204 ALA A O   1 
ATOM   1487 C  CB  . ALA A 1 206 ? 15.553 6.307   -8.979  1.00 43.45 ? 204 ALA A CB  1 
ATOM   1488 N  N   . THR A 1 207 ? 18.366 7.309   -9.987  1.00 44.23 ? 205 THR A N   1 
ATOM   1489 C  CA  . THR A 1 207 ? 19.796 7.087   -10.161 1.00 35.43 ? 205 THR A CA  1 
ATOM   1490 C  C   . THR A 1 207 ? 20.600 8.204   -9.511  1.00 37.61 ? 205 THR A C   1 
ATOM   1491 O  O   . THR A 1 207 ? 21.617 7.943   -8.856  1.00 36.49 ? 205 THR A O   1 
ATOM   1492 C  CB  . THR A 1 207 ? 20.121 6.960   -11.649 1.00 34.67 ? 205 THR A CB  1 
ATOM   1493 O  OG1 . THR A 1 207 ? 19.349 5.886   -12.209 1.00 41.12 ? 205 THR A OG1 1 
ATOM   1494 C  CG2 . THR A 1 207 ? 21.584 6.677   -11.869 1.00 33.05 ? 205 THR A CG2 1 
ATOM   1495 N  N   . ILE A 1 208 ? 20.147 9.454   -9.659  1.00 35.23 ? 206 ILE A N   1 
ATOM   1496 C  CA  . ILE A 1 208 ? 20.841 10.571  -9.025  1.00 39.85 ? 206 ILE A CA  1 
ATOM   1497 C  C   . ILE A 1 208 ? 20.735 10.468  -7.509  1.00 42.18 ? 206 ILE A C   1 
ATOM   1498 O  O   . ILE A 1 208 ? 21.707 10.722  -6.784  1.00 38.33 ? 206 ILE A O   1 
ATOM   1499 C  CB  . ILE A 1 208 ? 20.286 11.909  -9.545  1.00 37.85 ? 206 ILE A CB  1 
ATOM   1500 C  CG1 . ILE A 1 208 ? 20.496 12.031  -11.056 1.00 37.76 ? 206 ILE A CG1 1 
ATOM   1501 C  CG2 . ILE A 1 208 ? 20.951 13.078  -8.817  1.00 34.54 ? 206 ILE A CG2 1 
ATOM   1502 C  CD1 . ILE A 1 208 ? 19.684 13.157  -11.703 1.00 38.06 ? 206 ILE A CD1 1 
ATOM   1503 N  N   . ARG A 1 209 ? 19.556 10.093  -7.006  1.00 44.69 ? 207 ARG A N   1 
ATOM   1504 C  CA  . ARG A 1 209 ? 19.377 9.914   -5.569  1.00 41.20 ? 207 ARG A CA  1 
ATOM   1505 C  C   . ARG A 1 209 ? 20.312 8.838   -5.035  1.00 40.99 ? 207 ARG A C   1 
ATOM   1506 O  O   . ARG A 1 209 ? 20.955 9.020   -3.996  1.00 41.40 ? 207 ARG A O   1 
ATOM   1507 C  CB  . ARG A 1 209 ? 17.913 9.571   -5.264  1.00 41.12 ? 207 ARG A CB  1 
ATOM   1508 N  N   . GLU A 1 210 ? 20.416 7.711   -5.747  1.00 41.39 ? 208 GLU A N   1 
ATOM   1509 C  CA  . GLU A 1 210 ? 21.348 6.666   -5.330  1.00 43.59 ? 208 GLU A CA  1 
ATOM   1510 C  C   . GLU A 1 210 ? 22.788 7.167   -5.343  1.00 40.69 ? 208 GLU A C   1 
ATOM   1511 O  O   . GLU A 1 210 ? 23.571 6.843   -4.441  1.00 37.53 ? 208 GLU A O   1 
ATOM   1512 C  CB  . GLU A 1 210 ? 21.198 5.433   -6.226  1.00 46.32 ? 208 GLU A CB  1 
ATOM   1513 C  CG  . GLU A 1 210 ? 19.874 4.691   -6.047  1.00 46.38 ? 208 GLU A CG  1 
ATOM   1514 N  N   . GLY A 1 211 ? 23.154 7.966   -6.349  1.00 39.07 ? 209 GLY A N   1 
ATOM   1515 C  CA  . GLY A 1 211 ? 24.510 8.500   -6.411  1.00 30.88 ? 209 GLY A CA  1 
ATOM   1516 C  C   . GLY A 1 211 ? 24.857 9.393   -5.230  1.00 35.03 ? 209 GLY A C   1 
ATOM   1517 O  O   . GLY A 1 211 ? 25.992 9.377   -4.739  1.00 32.92 ? 209 GLY A O   1 
ATOM   1518 N  N   . MET A 1 212 ? 23.890 10.194  -4.767  1.00 37.16 ? 210 MET A N   1 
ATOM   1519 C  CA  . MET A 1 212 ? 24.127 11.049  -3.606  1.00 38.25 ? 210 MET A CA  1 
ATOM   1520 C  C   . MET A 1 212 ? 24.327 10.230  -2.341  1.00 41.25 ? 210 MET A C   1 
ATOM   1521 O  O   . MET A 1 212 ? 25.189 10.553  -1.517  1.00 44.68 ? 210 MET A O   1 
ATOM   1522 C  CB  . MET A 1 212 ? 22.965 12.014  -3.398  1.00 33.31 ? 210 MET A CB  1 
ATOM   1523 C  CG  . MET A 1 212 ? 22.766 13.025  -4.492  1.00 37.71 ? 210 MET A CG  1 
ATOM   1524 S  SD  . MET A 1 212 ? 21.202 13.877  -4.246  1.00 45.29 ? 210 MET A SD  1 
ATOM   1525 C  CE  . MET A 1 212 ? 21.537 14.794  -2.745  1.00 45.99 ? 210 MET A CE  1 
ATOM   1526 N  N   . LEU A 1 213 ? 23.521 9.187   -2.153  1.00 39.00 ? 211 LEU A N   1 
ATOM   1527 C  CA  . LEU A 1 213 ? 23.571 8.397   -0.932  1.00 38.88 ? 211 LEU A CA  1 
ATOM   1528 C  C   . LEU A 1 213 ? 24.694 7.370   -0.930  1.00 40.97 ? 211 LEU A C   1 
ATOM   1529 O  O   . LEU A 1 213 ? 24.890 6.704   0.091   1.00 37.94 ? 211 LEU A O   1 
ATOM   1530 C  CB  . LEU A 1 213 ? 22.231 7.695   -0.707  1.00 44.27 ? 211 LEU A CB  1 
ATOM   1531 C  CG  . LEU A 1 213 ? 21.058 8.655   -0.485  1.00 47.39 ? 211 LEU A CG  1 
ATOM   1532 C  CD1 . LEU A 1 213 ? 19.805 7.900   -0.071  1.00 52.81 ? 211 LEU A CD1 1 
ATOM   1533 C  CD2 . LEU A 1 213 ? 21.421 9.718   0.548   1.00 44.90 ? 211 LEU A CD2 1 
ATOM   1534 N  N   . ALA A 1 214 ? 25.424 7.223   -2.041  1.00 31.51 ? 212 ALA A N   1 
ATOM   1535 C  CA  . ALA A 1 214 ? 26.588 6.355   -2.070  1.00 29.38 ? 212 ALA A CA  1 
ATOM   1536 C  C   . ALA A 1 214 ? 27.723 6.885   -1.215  1.00 32.42 ? 212 ALA A C   1 
ATOM   1537 O  O   . ALA A 1 214 ? 28.679 6.143   -0.963  1.00 33.33 ? 212 ALA A O   1 
ATOM   1538 C  CB  . ALA A 1 214 ? 27.081 6.168   -3.505  1.00 25.55 ? 212 ALA A CB  1 
ATOM   1539 N  N   . GLN A 1 215 ? 27.659 8.140   -0.773  1.00 26.03 ? 213 GLN A N   1 
ATOM   1540 C  CA  . GLN A 1 215 ? 28.732 8.517   0.126   1.00 27.57 ? 213 GLN A CA  1 
ATOM   1541 C  C   . GLN A 1 215 ? 28.175 8.956   1.479   1.00 23.83 ? 213 GLN A C   1 
ATOM   1542 O  O   . GLN A 1 215 ? 27.048 9.463   1.576   1.00 28.86 ? 213 GLN A O   1 
ATOM   1543 C  CB  . GLN A 1 215 ? 29.655 9.605   -0.462  1.00 37.16 ? 213 GLN A CB  1 
ATOM   1544 C  CG  . GLN A 1 215 ? 29.037 10.650  -1.334  1.00 36.64 ? 213 GLN A CG  1 
ATOM   1545 C  CD  . GLN A 1 215 ? 28.641 10.165  -2.737  1.00 30.18 ? 213 GLN A CD  1 
ATOM   1546 O  OE1 . GLN A 1 215 ? 29.335 9.365   -3.374  1.00 30.02 ? 213 GLN A OE1 1 
ATOM   1547 N  NE2 . GLN A 1 215 ? 27.499 10.645  -3.203  1.00 26.31 ? 213 GLN A NE2 1 
ATOM   1548 N  N   . PRO A 1 216 ? 28.928 8.708   2.547   1.00 26.61 ? 214 PRO A N   1 
ATOM   1549 C  CA  . PRO A 1 216 ? 28.441 9.045   3.896   1.00 33.76 ? 214 PRO A CA  1 
ATOM   1550 C  C   . PRO A 1 216 ? 28.114 10.516  4.086   1.00 31.21 ? 214 PRO A C   1 
ATOM   1551 O  O   . PRO A 1 216 ? 27.311 10.845  4.964   1.00 32.84 ? 214 PRO A O   1 
ATOM   1552 C  CB  . PRO A 1 216 ? 29.599 8.614   4.804   1.00 27.67 ? 214 PRO A CB  1 
ATOM   1553 C  CG  . PRO A 1 216 ? 30.394 7.634   4.002   1.00 34.14 ? 214 PRO A CG  1 
ATOM   1554 C  CD  . PRO A 1 216 ? 30.190 7.955   2.565   1.00 24.03 ? 214 PRO A CD  1 
ATOM   1555 N  N   . LEU A 1 217 ? 28.724 11.414  3.309   1.00 29.98 ? 215 LEU A N   1 
ATOM   1556 C  CA  . LEU A 1 217 ? 28.372 12.829  3.389   1.00 30.89 ? 215 LEU A CA  1 
ATOM   1557 C  C   . LEU A 1 217 ? 27.012 13.134  2.784   1.00 34.32 ? 215 LEU A C   1 
ATOM   1558 O  O   . LEU A 1 217 ? 26.501 14.240  2.990   1.00 33.55 ? 215 LEU A O   1 
ATOM   1559 C  CB  . LEU A 1 217 ? 29.433 13.681  2.699   1.00 29.68 ? 215 LEU A CB  1 
ATOM   1560 C  CG  . LEU A 1 217 ? 30.787 13.700  3.387   1.00 26.41 ? 215 LEU A CG  1 
ATOM   1561 C  CD1 . LEU A 1 217 ? 31.720 14.651  2.658   1.00 25.77 ? 215 LEU A CD1 1 
ATOM   1562 C  CD2 . LEU A 1 217 ? 30.592 14.115  4.830   1.00 31.16 ? 215 LEU A CD2 1 
ATOM   1563 N  N   . GLY A 1 218 ? 26.417 12.194  2.048   1.00 35.36 ? 216 GLY A N   1 
ATOM   1564 C  CA  . GLY A 1 218 ? 25.042 12.346  1.610   1.00 36.87 ? 216 GLY A CA  1 
ATOM   1565 C  C   . GLY A 1 218 ? 24.848 13.239  0.406   1.00 34.58 ? 216 GLY A C   1 
ATOM   1566 O  O   . GLY A 1 218 ? 23.707 13.583  0.086   1.00 33.76 ? 216 GLY A O   1 
ATOM   1567 N  N   . ARG A 1 219 ? 25.925 13.632  -0.264  1.00 27.41 ? 217 ARG A N   1 
ATOM   1568 C  CA  . ARG A 1 219 ? 25.832 14.446  -1.465  1.00 28.33 ? 217 ARG A CA  1 
ATOM   1569 C  C   . ARG A 1 219 ? 26.950 14.013  -2.396  1.00 26.04 ? 217 ARG A C   1 
ATOM   1570 O  O   . ARG A 1 219 ? 27.881 13.310  -1.990  1.00 28.31 ? 217 ARG A O   1 
ATOM   1571 C  CB  . ARG A 1 219 ? 25.935 15.949  -1.144  1.00 29.64 ? 217 ARG A CB  1 
ATOM   1572 C  CG  . ARG A 1 219 ? 27.295 16.339  -0.556  1.00 31.52 ? 217 ARG A CG  1 
ATOM   1573 C  CD  . ARG A 1 219 ? 27.479 17.852  -0.482  1.00 36.28 ? 217 ARG A CD  1 
ATOM   1574 N  NE  . ARG A 1 219 ? 28.751 18.200  0.150   1.00 32.83 ? 217 ARG A NE  1 
ATOM   1575 C  CZ  . ARG A 1 219 ? 29.894 18.421  -0.494  1.00 31.77 ? 217 ARG A CZ  1 
ATOM   1576 N  NH1 . ARG A 1 219 ? 29.960 18.343  -1.816  1.00 26.46 ? 217 ARG A NH1 1 
ATOM   1577 N  NH2 . ARG A 1 219 ? 30.979 18.730  0.201   1.00 30.77 ? 217 ARG A NH2 1 
ATOM   1578 N  N   . MET A 1 220 ? 26.838 14.403  -3.664  1.00 30.47 ? 218 MET A N   1 
ATOM   1579 C  CA  . MET A 1 220 ? 27.985 14.261  -4.549  1.00 27.25 ? 218 MET A CA  1 
ATOM   1580 C  C   . MET A 1 220 ? 28.921 15.452  -4.364  1.00 24.60 ? 218 MET A C   1 
ATOM   1581 O  O   . MET A 1 220 ? 28.559 16.472  -3.768  1.00 26.66 ? 218 MET A O   1 
ATOM   1582 C  CB  . MET A 1 220 ? 27.562 14.178  -6.016  1.00 27.38 ? 218 MET A CB  1 
ATOM   1583 C  CG  . MET A 1 220 ? 26.474 13.174  -6.332  1.00 32.18 ? 218 MET A CG  1 
ATOM   1584 S  SD  . MET A 1 220 ? 26.293 12.998  -8.119  1.00 32.81 ? 218 MET A SD  1 
ATOM   1585 C  CE  . MET A 1 220 ? 24.797 11.996  -8.204  1.00 25.45 ? 218 MET A CE  1 
ATOM   1586 N  N   . GLY A 1 221 ? 30.146 15.321  -4.906  1.00 19.55 ? 219 GLY A N   1 
ATOM   1587 C  CA  . GLY A 1 221 ? 31.114 16.390  -4.805  1.00 21.86 ? 219 GLY A CA  1 
ATOM   1588 C  C   . GLY A 1 221 ? 30.925 17.428  -5.885  1.00 23.96 ? 219 GLY A C   1 
ATOM   1589 O  O   . GLY A 1 221 ? 30.151 17.247  -6.820  1.00 27.06 ? 219 GLY A O   1 
ATOM   1590 N  N   . GLN A 1 222 ? 31.632 18.557  -5.727  1.00 24.69 ? 220 GLN A N   1 
ATOM   1591 C  CA  . GLN A 1 222 ? 31.578 19.617  -6.721  1.00 29.55 ? 220 GLN A CA  1 
ATOM   1592 C  C   . GLN A 1 222 ? 32.883 19.677  -7.507  1.00 24.35 ? 220 GLN A C   1 
ATOM   1593 O  O   . GLN A 1 222 ? 33.942 19.328  -6.982  1.00 23.77 ? 220 GLN A O   1 
ATOM   1594 C  CB  . GLN A 1 222 ? 31.327 20.982  -6.067  1.00 33.52 ? 220 GLN A CB  1 
ATOM   1595 C  CG  . GLN A 1 222 ? 30.118 20.996  -5.146  1.00 37.19 ? 220 GLN A CG  1 
ATOM   1596 C  CD  . GLN A 1 222 ? 30.105 22.203  -4.247  1.00 54.99 ? 220 GLN A CD  1 
ATOM   1597 O  OE1 . GLN A 1 222 ? 30.741 23.214  -4.544  1.00 64.06 ? 220 GLN A OE1 1 
ATOM   1598 N  NE2 . GLN A 1 222 ? 29.383 22.109  -3.135  1.00 61.05 ? 220 GLN A NE2 1 
ATOM   1599 N  N   . PRO A 1 223 ? 32.833 20.107  -8.771  1.00 20.89 ? 221 PRO A N   1 
ATOM   1600 C  CA  . PRO A 1 223 ? 34.085 20.359  -9.510  1.00 21.90 ? 221 PRO A CA  1 
ATOM   1601 C  C   . PRO A 1 223 ? 35.049 21.286  -8.769  1.00 24.50 ? 221 PRO A C   1 
ATOM   1602 O  O   . PRO A 1 223 ? 36.266 21.062  -8.801  1.00 21.96 ? 221 PRO A O   1 
ATOM   1603 C  CB  . PRO A 1 223 ? 33.579 20.974  -10.820 1.00 22.18 ? 221 PRO A CB  1 
ATOM   1604 C  CG  . PRO A 1 223 ? 32.203 20.329  -11.008 1.00 23.73 ? 221 PRO A CG  1 
ATOM   1605 C  CD  . PRO A 1 223 ? 31.634 20.184  -9.627  1.00 25.50 ? 221 PRO A CD  1 
ATOM   1606 N  N   . ALA A 1 224 ? 34.525 22.313  -8.082  1.00 24.78 ? 222 ALA A N   1 
ATOM   1607 C  CA  . ALA A 1 224 ? 35.370 23.221  -7.302  1.00 25.48 ? 222 ALA A CA  1 
ATOM   1608 C  C   . ALA A 1 224 ? 36.150 22.488  -6.215  1.00 24.88 ? 222 ALA A C   1 
ATOM   1609 O  O   . ALA A 1 224 ? 37.252 22.910  -5.851  1.00 23.44 ? 222 ALA A O   1 
ATOM   1610 C  CB  . ALA A 1 224 ? 34.509 24.329  -6.676  1.00 25.58 ? 222 ALA A CB  1 
ATOM   1611 N  N   . GLU A 1 225 ? 35.598 21.397  -5.675  1.00 22.69 ? 223 GLU A N   1 
ATOM   1612 C  CA  . GLU A 1 225 ? 36.303 20.678  -4.623  1.00 21.81 ? 223 GLU A CA  1 
ATOM   1613 C  C   . GLU A 1 225 ? 37.441 19.832  -5.196  1.00 23.75 ? 223 GLU A C   1 
ATOM   1614 O  O   . GLU A 1 225 ? 38.518 19.744  -4.589  1.00 22.83 ? 223 GLU A O   1 
ATOM   1615 C  CB  . GLU A 1 225 ? 35.301 19.843  -3.810  1.00 22.57 ? 223 GLU A CB  1 
ATOM   1616 C  CG  . GLU A 1 225 ? 34.328 20.726  -3.007  1.00 25.85 ? 223 GLU A CG  1 
ATOM   1617 C  CD  . GLU A 1 225 ? 33.146 19.960  -2.425  1.00 28.04 ? 223 GLU A CD  1 
ATOM   1618 O  OE1 . GLU A 1 225 ? 32.564 19.112  -3.129  1.00 24.82 ? 223 GLU A OE1 1 
ATOM   1619 O  OE2 . GLU A 1 225 ? 32.807 20.205  -1.255  1.00 24.64 ? 223 GLU A OE2 1 
ATOM   1620 N  N   . VAL A 1 226 ? 37.246 19.233  -6.373  1.00 20.58 ? 224 VAL A N   1 
ATOM   1621 C  CA  . VAL A 1 226 ? 38.378 18.627  -7.079  1.00 19.93 ? 224 VAL A CA  1 
ATOM   1622 C  C   . VAL A 1 226 ? 39.406 19.698  -7.459  1.00 19.99 ? 224 VAL A C   1 
ATOM   1623 O  O   . VAL A 1 226 ? 40.623 19.461  -7.409  1.00 21.88 ? 224 VAL A O   1 
ATOM   1624 C  CB  . VAL A 1 226 ? 37.889 17.848  -8.318  1.00 23.22 ? 224 VAL A CB  1 
ATOM   1625 C  CG1 . VAL A 1 226 ? 39.069 17.227  -9.056  1.00 19.85 ? 224 VAL A CG1 1 
ATOM   1626 C  CG2 . VAL A 1 226 ? 36.867 16.773  -7.924  1.00 22.60 ? 224 VAL A CG2 1 
ATOM   1627 N  N   . GLY A 1 227 ? 38.933 20.889  -7.842  1.00 17.43 ? 225 GLY A N   1 
ATOM   1628 C  CA  . GLY A 1 227 ? 39.851 21.964  -8.196  1.00 20.62 ? 225 GLY A CA  1 
ATOM   1629 C  C   . GLY A 1 227 ? 40.720 22.399  -7.029  1.00 24.23 ? 225 GLY A C   1 
ATOM   1630 O  O   . GLY A 1 227 ? 41.923 22.613  -7.188  1.00 21.72 ? 225 GLY A O   1 
ATOM   1631 N  N   . ALA A 1 228 ? 40.126 22.525  -5.837  1.00 21.76 ? 226 ALA A N   1 
ATOM   1632 C  CA  . ALA A 1 228 ? 40.914 22.885  -4.659  1.00 23.42 ? 226 ALA A CA  1 
ATOM   1633 C  C   . ALA A 1 228 ? 41.975 21.829  -4.363  1.00 25.10 ? 226 ALA A C   1 
ATOM   1634 O  O   . ALA A 1 228 ? 43.110 22.156  -4.006  1.00 19.70 ? 226 ALA A O   1 
ATOM   1635 C  CB  . ALA A 1 228 ? 40.002 23.079  -3.445  1.00 22.14 ? 226 ALA A CB  1 
ATOM   1636 N  N   . ALA A 1 229 ? 41.629 20.555  -4.524  1.00 23.46 ? 227 ALA A N   1 
ATOM   1637 C  CA  . ALA A 1 229 ? 42.607 19.504  -4.294  1.00 18.99 ? 227 ALA A CA  1 
ATOM   1638 C  C   . ALA A 1 229 ? 43.755 19.590  -5.293  1.00 18.76 ? 227 ALA A C   1 
ATOM   1639 O  O   . ALA A 1 229 ? 44.917 19.364  -4.927  1.00 20.75 ? 227 ALA A O   1 
ATOM   1640 C  CB  . ALA A 1 229 ? 41.924 18.124  -4.357  1.00 19.81 ? 227 ALA A CB  1 
ATOM   1641 N  N   . ALA A 1 230 ? 43.455 19.916  -6.559  1.00 19.22 ? 228 ALA A N   1 
ATOM   1642 C  CA  . ALA A 1 230 ? 44.513 20.049  -7.561  1.00 17.73 ? 228 ALA A CA  1 
ATOM   1643 C  C   . ALA A 1 230 ? 45.452 21.204  -7.236  1.00 20.65 ? 228 ALA A C   1 
ATOM   1644 O  O   . ALA A 1 230 ? 46.672 21.063  -7.342  1.00 20.66 ? 228 ALA A O   1 
ATOM   1645 C  CB  . ALA A 1 230 ? 43.905 20.244  -8.962  1.00 17.51 ? 228 ALA A CB  1 
ATOM   1646 N  N   . VAL A 1 231 ? 44.903 22.354  -6.844  1.00 20.45 ? 229 VAL A N   1 
ATOM   1647 C  CA  . VAL A 1 231 ? 45.746 23.496  -6.502  1.00 20.77 ? 229 VAL A CA  1 
ATOM   1648 C  C   . VAL A 1 231 ? 46.630 23.167  -5.305  1.00 19.26 ? 229 VAL A C   1 
ATOM   1649 O  O   . VAL A 1 231 ? 47.810 23.533  -5.270  1.00 20.07 ? 229 VAL A O   1 
ATOM   1650 C  CB  . VAL A 1 231 ? 44.879 24.739  -6.244  1.00 22.53 ? 229 VAL A CB  1 
ATOM   1651 C  CG1 . VAL A 1 231 ? 45.741 25.913  -5.669  1.00 23.62 ? 229 VAL A CG1 1 
ATOM   1652 C  CG2 . VAL A 1 231 ? 44.191 25.175  -7.538  1.00 20.33 ? 229 VAL A CG2 1 
ATOM   1653 N  N   . PHE A 1 232 ? 46.086 22.454  -4.315  1.00 19.45 ? 230 PHE A N   1 
ATOM   1654 C  CA  . PHE A 1 232 ? 46.915 21.999  -3.198  1.00 22.28 ? 230 PHE A CA  1 
ATOM   1655 C  C   . PHE A 1 232 ? 48.092 21.156  -3.681  1.00 23.00 ? 230 PHE A C   1 
ATOM   1656 O  O   . PHE A 1 232 ? 49.240 21.380  -3.278  1.00 21.48 ? 230 PHE A O   1 
ATOM   1657 C  CB  . PHE A 1 232 ? 46.081 21.190  -2.202  1.00 22.51 ? 230 PHE A CB  1 
ATOM   1658 C  CG  . PHE A 1 232 ? 46.921 20.391  -1.244  1.00 20.47 ? 230 PHE A CG  1 
ATOM   1659 C  CD1 . PHE A 1 232 ? 47.668 21.034  -0.261  1.00 21.10 ? 230 PHE A CD1 1 
ATOM   1660 C  CD2 . PHE A 1 232 ? 46.997 19.006  -1.350  1.00 24.77 ? 230 PHE A CD2 1 
ATOM   1661 C  CE1 . PHE A 1 232 ? 48.461 20.307  0.621   1.00 26.29 ? 230 PHE A CE1 1 
ATOM   1662 C  CE2 . PHE A 1 232 ? 47.782 18.272  -0.471  1.00 25.36 ? 230 PHE A CE2 1 
ATOM   1663 C  CZ  . PHE A 1 232 ? 48.512 18.926  0.514   1.00 21.33 ? 230 PHE A CZ  1 
ATOM   1664 N  N   . LEU A 1 233 ? 47.825 20.160  -4.526  1.00 20.97 ? 231 LEU A N   1 
ATOM   1665 C  CA  . LEU A 1 233 ? 48.905 19.298  -5.005  1.00 21.89 ? 231 LEU A CA  1 
ATOM   1666 C  C   . LEU A 1 233 ? 49.955 20.098  -5.777  1.00 22.42 ? 231 LEU A C   1 
ATOM   1667 O  O   . LEU A 1 233 ? 51.164 19.872  -5.626  1.00 23.81 ? 231 LEU A O   1 
ATOM   1668 C  CB  . LEU A 1 233 ? 48.333 18.185  -5.884  1.00 19.25 ? 231 LEU A CB  1 
ATOM   1669 C  CG  . LEU A 1 233 ? 47.528 17.097  -5.174  1.00 21.70 ? 231 LEU A CG  1 
ATOM   1670 C  CD1 . LEU A 1 233 ? 46.917 16.180  -6.210  1.00 19.97 ? 231 LEU A CD1 1 
ATOM   1671 C  CD2 . LEU A 1 233 ? 48.451 16.299  -4.235  1.00 22.21 ? 231 LEU A CD2 1 
ATOM   1672 N  N   . ALA A 1 234 ? 49.514 21.026  -6.622  1.00 18.10 ? 232 ALA A N   1 
ATOM   1673 C  CA  . ALA A 1 234 ? 50.469 21.812  -7.408  1.00 18.59 ? 232 ALA A CA  1 
ATOM   1674 C  C   . ALA A 1 234 ? 51.288 22.744  -6.523  1.00 22.26 ? 232 ALA A C   1 
ATOM   1675 O  O   . ALA A 1 234 ? 52.522 22.817  -6.648  1.00 24.22 ? 232 ALA A O   1 
ATOM   1676 C  CB  . ALA A 1 234 ? 49.733 22.611  -8.489  1.00 20.09 ? 232 ALA A CB  1 
ATOM   1677 N  N   . SER A 1 235 ? 50.623 23.472  -5.621  1.00 19.97 ? 233 SER A N   1 
ATOM   1678 C  CA  . SER A 1 235 ? 51.246 24.637  -4.994  1.00 21.08 ? 233 SER A CA  1 
ATOM   1679 C  C   . SER A 1 235 ? 51.799 24.365  -3.602  1.00 21.20 ? 233 SER A C   1 
ATOM   1680 O  O   . SER A 1 235 ? 52.723 25.058  -3.178  1.00 22.50 ? 233 SER A O   1 
ATOM   1681 C  CB  . SER A 1 235 ? 50.242 25.803  -4.910  1.00 28.97 ? 233 SER A CB  1 
ATOM   1682 O  OG  . SER A 1 235 ? 49.198 25.552  -3.976  1.00 21.40 ? 233 SER A OG  1 
ATOM   1683 N  N   . GLU A 1 236 ? 51.292 23.357  -2.891  1.00 20.11 ? 234 GLU A N   1 
ATOM   1684 C  CA  . GLU A 1 236 ? 51.622 23.224  -1.481  1.00 26.40 ? 234 GLU A CA  1 
ATOM   1685 C  C   . GLU A 1 236 ? 52.039 21.822  -1.055  1.00 25.41 ? 234 GLU A C   1 
ATOM   1686 O  O   . GLU A 1 236 ? 52.565 21.677  0.048   1.00 30.83 ? 234 GLU A O   1 
ATOM   1687 C  CB  . GLU A 1 236 ? 50.434 23.686  -0.622  1.00 25.34 ? 234 GLU A CB  1 
ATOM   1688 C  CG  . GLU A 1 236 ? 50.230 25.206  -0.648  1.00 35.91 ? 234 GLU A CG  1 
ATOM   1689 C  CD  . GLU A 1 236 ? 48.934 25.649  0.026   1.00 42.01 ? 234 GLU A CD  1 
ATOM   1690 O  OE1 . GLU A 1 236 ? 47.971 24.855  0.072   1.00 39.91 ? 234 GLU A OE1 1 
ATOM   1691 O  OE2 . GLU A 1 236 ? 48.883 26.805  0.496   1.00 58.17 ? 234 GLU A OE2 1 
ATOM   1692 N  N   . ALA A 1 237 ? 51.845 20.803  -1.883  1.00 21.99 ? 235 ALA A N   1 
ATOM   1693 C  CA  . ALA A 1 237 ? 52.181 19.419  -1.533  1.00 24.62 ? 235 ALA A CA  1 
ATOM   1694 C  C   . ALA A 1 237 ? 53.606 19.053  -1.956  1.00 23.30 ? 235 ALA A C   1 
ATOM   1695 O  O   . ALA A 1 237 ? 53.853 18.049  -2.629  1.00 22.38 ? 235 ALA A O   1 
ATOM   1696 C  CB  . ALA A 1 237 ? 51.164 18.478  -2.163  1.00 20.58 ? 235 ALA A CB  1 
ATOM   1697 N  N   . ASN A 1 238 ? 54.575 19.864  -1.534  1.00 22.06 ? 236 ASN A N   1 
ATOM   1698 C  CA  . ASN A 1 238 ? 55.914 19.757  -2.092  1.00 23.23 ? 236 ASN A CA  1 
ATOM   1699 C  C   . ASN A 1 238 ? 56.652 18.490  -1.665  1.00 20.77 ? 236 ASN A C   1 
ATOM   1700 O  O   . ASN A 1 238 ? 57.672 18.156  -2.276  1.00 25.87 ? 236 ASN A O   1 
ATOM   1701 C  CB  . ASN A 1 238 ? 56.727 20.995  -1.714  1.00 30.42 ? 236 ASN A CB  1 
ATOM   1702 C  CG  . ASN A 1 238 ? 56.175 22.259  -2.342  1.00 42.66 ? 236 ASN A CG  1 
ATOM   1703 O  OD1 . ASN A 1 238 ? 55.555 22.212  -3.402  1.00 44.62 ? 236 ASN A OD1 1 
ATOM   1704 N  ND2 . ASN A 1 238 ? 56.400 23.396  -1.693  1.00 44.78 ? 236 ASN A ND2 1 
ATOM   1705 N  N   . PHE A 1 239 ? 56.174 17.786  -0.642  1.00 22.59 ? 237 PHE A N   1 
ATOM   1706 C  CA  . PHE A 1 239 ? 56.731 16.502  -0.238  1.00 24.52 ? 237 PHE A CA  1 
ATOM   1707 C  C   . PHE A 1 239 ? 55.807 15.343  -0.617  1.00 26.84 ? 237 PHE A C   1 
ATOM   1708 O  O   . PHE A 1 239 ? 55.998 14.223  -0.133  1.00 24.18 ? 237 PHE A O   1 
ATOM   1709 C  CB  . PHE A 1 239 ? 57.003 16.524  1.273   1.00 21.38 ? 237 PHE A CB  1 
ATOM   1710 C  CG  . PHE A 1 239 ? 57.915 15.426  1.779   1.00 22.12 ? 237 PHE A CG  1 
ATOM   1711 C  CD1 . PHE A 1 239 ? 59.182 15.235  1.248   1.00 22.97 ? 237 PHE A CD1 1 
ATOM   1712 C  CD2 . PHE A 1 239 ? 57.507 14.620  2.843   1.00 24.15 ? 237 PHE A CD2 1 
ATOM   1713 C  CE1 . PHE A 1 239 ? 60.028 14.236  1.748   1.00 24.02 ? 237 PHE A CE1 1 
ATOM   1714 C  CE2 . PHE A 1 239 ? 58.328 13.622  3.353   1.00 23.39 ? 237 PHE A CE2 1 
ATOM   1715 C  CZ  . PHE A 1 239 ? 59.604 13.430  2.805   1.00 25.88 ? 237 PHE A CZ  1 
ATOM   1716 N  N   . CYS A 1 240 ? 54.800 15.591  -1.455  1.00 20.86 ? 238 CYS A N   1 
ATOM   1717 C  CA  . CYS A 1 240 ? 53.887 14.558  -1.935  1.00 21.27 ? 238 CYS A CA  1 
ATOM   1718 C  C   . CYS A 1 240 ? 54.242 14.209  -3.370  1.00 24.12 ? 238 CYS A C   1 
ATOM   1719 O  O   . CYS A 1 240 ? 54.243 15.085  -4.245  1.00 24.35 ? 238 CYS A O   1 
ATOM   1720 C  CB  . CYS A 1 240 ? 52.428 15.016  -1.884  1.00 18.32 ? 238 CYS A CB  1 
ATOM   1721 S  SG  . CYS A 1 240 ? 51.777 15.338  -0.256  1.00 23.29 ? 238 CYS A SG  1 
ATOM   1722 N  N   . THR A 1 241 ? 54.533 12.936  -3.615  1.00 19.43 ? 239 THR A N   1 
ATOM   1723 C  CA  . THR A 1 241 ? 54.686 12.472  -4.986  1.00 19.69 ? 239 THR A CA  1 
ATOM   1724 C  C   . THR A 1 241 ? 54.236 11.018  -5.040  1.00 24.45 ? 239 THR A C   1 
ATOM   1725 O  O   . THR A 1 241 ? 54.439 10.257  -4.087  1.00 20.74 ? 239 THR A O   1 
ATOM   1726 C  CB  . THR A 1 241 ? 56.130 12.632  -5.498  1.00 19.54 ? 239 THR A CB  1 
ATOM   1727 O  OG1 . THR A 1 241 ? 56.141 12.507  -6.927  1.00 21.05 ? 239 THR A OG1 1 
ATOM   1728 C  CG2 . THR A 1 241 ? 57.048 11.581  -4.909  1.00 21.30 ? 239 THR A CG2 1 
ATOM   1729 N  N   . GLY A 1 242 ? 53.594 10.652  -6.144  1.00 19.11 ? 240 GLY A N   1 
ATOM   1730 C  CA  . GLY A 1 242 ? 53.057 9.314   -6.254  1.00 22.51 ? 240 GLY A CA  1 
ATOM   1731 C  C   . GLY A 1 242 ? 51.875 9.029   -5.353  1.00 21.79 ? 240 GLY A C   1 
ATOM   1732 O  O   . GLY A 1 242 ? 51.575 7.858   -5.115  1.00 23.26 ? 240 GLY A O   1 
ATOM   1733 N  N   . ILE A 1 243 ? 51.182 10.056  -4.841  1.00 23.41 ? 241 ILE A N   1 
ATOM   1734 C  CA  . ILE A 1 243 ? 50.048 9.803   -3.954  1.00 24.73 ? 241 ILE A CA  1 
ATOM   1735 C  C   . ILE A 1 243 ? 48.758 9.789   -4.767  1.00 24.11 ? 241 ILE A C   1 
ATOM   1736 O  O   . ILE A 1 243 ? 48.674 10.326  -5.877  1.00 20.04 ? 241 ILE A O   1 
ATOM   1737 C  CB  . ILE A 1 243 ? 49.932 10.808  -2.789  1.00 23.24 ? 241 ILE A CB  1 
ATOM   1738 C  CG1 . ILE A 1 243 ? 49.364 12.157  -3.271  1.00 25.21 ? 241 ILE A CG1 1 
ATOM   1739 C  CG2 . ILE A 1 243 ? 51.267 10.969  -2.032  1.00 20.59 ? 241 ILE A CG2 1 
ATOM   1740 C  CD1 . ILE A 1 243 ? 48.787 12.982  -2.158  1.00 22.36 ? 241 ILE A CD1 1 
ATOM   1741 N  N   . GLU A 1 244 ? 47.746 9.141   -4.204  1.00 19.64 ? 242 GLU A N   1 
ATOM   1742 C  CA  . GLU A 1 244 ? 46.398 9.112   -4.755  1.00 23.35 ? 242 GLU A CA  1 
ATOM   1743 C  C   . GLU A 1 244 ? 45.507 9.838   -3.751  1.00 26.06 ? 242 GLU A C   1 
ATOM   1744 O  O   . GLU A 1 244 ? 45.230 9.312   -2.671  1.00 26.44 ? 242 GLU A O   1 
ATOM   1745 C  CB  . GLU A 1 244 ? 45.937 7.672   -5.003  1.00 23.21 ? 242 GLU A CB  1 
ATOM   1746 C  CG  . GLU A 1 244 ? 44.442 7.557   -5.357  1.00 22.09 ? 242 GLU A CG  1 
ATOM   1747 C  CD  . GLU A 1 244 ? 43.970 6.126   -5.542  1.00 26.33 ? 242 GLU A CD  1 
ATOM   1748 O  OE1 . GLU A 1 244 ? 44.683 5.188   -5.115  1.00 21.76 ? 242 GLU A OE1 1 
ATOM   1749 O  OE2 . GLU A 1 244 ? 42.881 5.930   -6.130  1.00 27.56 ? 242 GLU A OE2 1 
ATOM   1750 N  N   . LEU A 1 245 ? 45.094 11.057  -4.091  1.00 20.81 ? 243 LEU A N   1 
ATOM   1751 C  CA  . LEU A 1 245 ? 44.288 11.894  -3.204  1.00 21.55 ? 243 LEU A CA  1 
ATOM   1752 C  C   . LEU A 1 245 ? 42.807 11.602  -3.454  1.00 22.45 ? 243 LEU A C   1 
ATOM   1753 O  O   . LEU A 1 245 ? 42.276 11.928  -4.523  1.00 23.95 ? 243 LEU A O   1 
ATOM   1754 C  CB  . LEU A 1 245 ? 44.625 13.370  -3.444  1.00 15.71 ? 243 LEU A CB  1 
ATOM   1755 C  CG  . LEU A 1 245 ? 43.906 14.464  -2.643  1.00 27.84 ? 243 LEU A CG  1 
ATOM   1756 C  CD1 . LEU A 1 245 ? 43.812 14.078  -1.177  1.00 28.58 ? 243 LEU A CD1 1 
ATOM   1757 C  CD2 . LEU A 1 245 ? 44.646 15.800  -2.802  1.00 26.59 ? 243 LEU A CD2 1 
ATOM   1758 N  N   . LEU A 1 246 ? 42.136 10.982  -2.476  1.00 18.44 ? 244 LEU A N   1 
ATOM   1759 C  CA  . LEU A 1 246 ? 40.735 10.612  -2.639  1.00 21.67 ? 244 LEU A CA  1 
ATOM   1760 C  C   . LEU A 1 246 ? 39.831 11.817  -2.393  1.00 19.58 ? 244 LEU A C   1 
ATOM   1761 O  O   . LEU A 1 246 ? 39.928 12.484  -1.359  1.00 23.14 ? 244 LEU A O   1 
ATOM   1762 C  CB  . LEU A 1 246 ? 40.358 9.467   -1.690  1.00 26.38 ? 244 LEU A CB  1 
ATOM   1763 C  CG  . LEU A 1 246 ? 40.984 8.082   -1.923  1.00 28.79 ? 244 LEU A CG  1 
ATOM   1764 C  CD1 . LEU A 1 246 ? 40.482 7.071   -0.886  1.00 32.85 ? 244 LEU A CD1 1 
ATOM   1765 C  CD2 . LEU A 1 246 ? 40.701 7.576   -3.326  1.00 25.15 ? 244 LEU A CD2 1 
ATOM   1766 N  N   . VAL A 1 247 ? 38.956 12.098  -3.352  1.00 20.90 ? 245 VAL A N   1 
ATOM   1767 C  CA  . VAL A 1 247 ? 37.990 13.185  -3.214  1.00 22.35 ? 245 VAL A CA  1 
ATOM   1768 C  C   . VAL A 1 247 ? 36.632 12.543  -3.459  1.00 21.99 ? 245 VAL A C   1 
ATOM   1769 O  O   . VAL A 1 247 ? 36.085 12.616  -4.563  1.00 20.99 ? 245 VAL A O   1 
ATOM   1770 C  CB  . VAL A 1 247 ? 38.291 14.340  -4.190  1.00 20.97 ? 245 VAL A CB  1 
ATOM   1771 C  CG1 . VAL A 1 247 ? 37.256 15.465  -4.057  1.00 17.46 ? 245 VAL A CG1 1 
ATOM   1772 C  CG2 . VAL A 1 247 ? 39.707 14.892  -3.939  1.00 21.18 ? 245 VAL A CG2 1 
ATOM   1773 N  N   . THR A 1 248 ? 36.113 11.847  -2.441  1.00 21.48 ? 246 THR A N   1 
ATOM   1774 C  CA  . THR A 1 248 ? 35.032 10.890  -2.643  1.00 21.21 ? 246 THR A CA  1 
ATOM   1775 C  C   . THR A 1 248 ? 33.884 11.021  -1.651  1.00 20.05 ? 246 THR A C   1 
ATOM   1776 O  O   . THR A 1 248 ? 32.902 10.276  -1.772  1.00 18.31 ? 246 THR A O   1 
ATOM   1777 C  CB  . THR A 1 248 ? 35.567 9.452   -2.543  1.00 21.12 ? 246 THR A CB  1 
ATOM   1778 O  OG1 . THR A 1 248 ? 36.060 9.259   -1.215  1.00 24.98 ? 246 THR A OG1 1 
ATOM   1779 C  CG2 . THR A 1 248 ? 36.708 9.194   -3.552  1.00 19.86 ? 246 THR A CG2 1 
ATOM   1780 N  N   . GLY A 1 249 ? 33.982 11.909  -0.663  1.00 19.44 ? 247 GLY A N   1 
ATOM   1781 C  CA  . GLY A 1 249 ? 32.956 11.974  0.359   1.00 22.89 ? 247 GLY A CA  1 
ATOM   1782 C  C   . GLY A 1 249 ? 32.853 10.740  1.232   1.00 24.92 ? 247 GLY A C   1 
ATOM   1783 O  O   . GLY A 1 249 ? 31.826 10.542  1.888   1.00 23.21 ? 247 GLY A O   1 
ATOM   1784 N  N   . GLY A 1 250 ? 33.900 9.912   1.272   1.00 21.58 ? 248 GLY A N   1 
ATOM   1785 C  CA  . GLY A 1 250 ? 33.896 8.689   2.060   1.00 19.12 ? 248 GLY A CA  1 
ATOM   1786 C  C   . GLY A 1 250 ? 33.211 7.498   1.430   1.00 22.02 ? 248 GLY A C   1 
ATOM   1787 O  O   . GLY A 1 250 ? 32.864 6.543   2.148   1.00 20.39 ? 248 GLY A O   1 
ATOM   1788 N  N   . ALA A 1 251 ? 33.003 7.509   0.108   1.00 18.87 ? 249 ALA A N   1 
ATOM   1789 C  CA  . ALA A 1 251 ? 32.291 6.398   -0.530  1.00 22.91 ? 249 ALA A CA  1 
ATOM   1790 C  C   . ALA A 1 251 ? 32.984 5.060   -0.293  1.00 24.53 ? 249 ALA A C   1 
ATOM   1791 O  O   . ALA A 1 251 ? 32.322 4.009   -0.283  1.00 24.78 ? 249 ALA A O   1 
ATOM   1792 C  CB  . ALA A 1 251 ? 32.145 6.654   -2.033  1.00 20.49 ? 249 ALA A CB  1 
ATOM   1793 N  N   . GLU A 1 252 ? 34.310 5.067   -0.107  1.00 21.31 ? 250 GLU A N   1 
ATOM   1794 C  CA  . GLU A 1 252 ? 35.036 3.809   0.025   1.00 24.31 ? 250 GLU A CA  1 
ATOM   1795 C  C   . GLU A 1 252 ? 34.983 3.241   1.439   1.00 26.21 ? 250 GLU A C   1 
ATOM   1796 O  O   . GLU A 1 252 ? 35.464 2.125   1.656   1.00 29.26 ? 250 GLU A O   1 
ATOM   1797 C  CB  . GLU A 1 252 ? 36.501 3.990   -0.421  1.00 23.92 ? 250 GLU A CB  1 
ATOM   1798 C  CG  . GLU A 1 252 ? 37.400 4.845   0.505   1.00 20.46 ? 250 GLU A CG  1 
ATOM   1799 C  CD  . GLU A 1 252 ? 37.114 6.351   0.455   1.00 26.55 ? 250 GLU A CD  1 
ATOM   1800 O  OE1 . GLU A 1 252 ? 36.238 6.803   -0.319  1.00 24.37 ? 250 GLU A OE1 1 
ATOM   1801 O  OE2 . GLU A 1 252 ? 37.775 7.096   1.209   1.00 25.77 ? 250 GLU A OE2 1 
ATOM   1802 N  N   . LEU A 1 253 ? 34.411 3.971   2.394   1.00 24.46 ? 251 LEU A N   1 
ATOM   1803 C  CA  . LEU A 1 253 ? 34.415 3.576   3.796   1.00 23.14 ? 251 LEU A CA  1 
ATOM   1804 C  C   . LEU A 1 253 ? 33.220 2.698   4.121   1.00 26.02 ? 251 LEU A C   1 
ATOM   1805 O  O   . LEU A 1 253 ? 32.105 2.944   3.648   1.00 28.65 ? 251 LEU A O   1 
ATOM   1806 C  CB  . LEU A 1 253 ? 34.377 4.803   4.704   1.00 21.56 ? 251 LEU A CB  1 
ATOM   1807 C  CG  . LEU A 1 253 ? 35.437 5.882   4.475   1.00 24.02 ? 251 LEU A CG  1 
ATOM   1808 C  CD1 . LEU A 1 253 ? 35.170 7.079   5.384   1.00 29.57 ? 251 LEU A CD1 1 
ATOM   1809 C  CD2 . LEU A 1 253 ? 36.801 5.299   4.703   1.00 23.73 ? 251 LEU A CD2 1 
ATOM   1810 N  N   . GLY A 1 254 ? 33.456 1.688   4.950   1.00 25.86 ? 252 GLY A N   1 
ATOM   1811 C  CA  . GLY A 1 254 ? 32.374 0.925   5.539   1.00 26.50 ? 252 GLY A CA  1 
ATOM   1812 C  C   . GLY A 1 254 ? 31.654 0.014   4.562   1.00 31.44 ? 252 GLY A C   1 
ATOM   1813 O  O   . GLY A 1 254 ? 31.918 -0.017  3.364   1.00 34.69 ? 252 GLY A O   1 
ATOM   1814 N  N   . TYR A 1 255 ? 30.727 -0.758  5.128   1.00 31.12 ? 253 TYR A N   1 
ATOM   1815 C  CA  . TYR A 1 255 ? 29.837 -1.645  4.395   1.00 38.17 ? 253 TYR A CA  1 
ATOM   1816 C  C   . TYR A 1 255 ? 28.694 -0.869  3.750   1.00 47.41 ? 253 TYR A C   1 
ATOM   1817 O  O   . TYR A 1 255 ? 28.251 0.172   4.250   1.00 40.28 ? 253 TYR A O   1 
ATOM   1818 C  CB  . TYR A 1 255 ? 29.224 -2.700  5.319   1.00 36.97 ? 253 TYR A CB  1 
ATOM   1819 C  CG  . TYR A 1 255 ? 30.170 -3.743  5.873   1.00 44.50 ? 253 TYR A CG  1 
ATOM   1820 C  CD1 . TYR A 1 255 ? 30.622 -4.792  5.083   1.00 49.04 ? 253 TYR A CD1 1 
ATOM   1821 C  CD2 . TYR A 1 255 ? 30.562 -3.711  7.205   1.00 47.02 ? 253 TYR A CD2 1 
ATOM   1822 C  CE1 . TYR A 1 255 ? 31.470 -5.764  5.592   1.00 50.87 ? 253 TYR A CE1 1 
ATOM   1823 C  CE2 . TYR A 1 255 ? 31.404 -4.680  7.729   1.00 52.08 ? 253 TYR A CE2 1 
ATOM   1824 C  CZ  . TYR A 1 255 ? 31.861 -5.704  6.916   1.00 53.94 ? 253 TYR A CZ  1 
ATOM   1825 O  OH  . TYR A 1 255 ? 32.702 -6.671  7.433   1.00 55.42 ? 253 TYR A OH  1 
ATOM   1826 N  N   . GLY A 1 256 ? 28.199 -1.410  2.641   1.00 54.64 ? 254 GLY A N   1 
ATOM   1827 C  CA  . GLY A 1 256 ? 27.012 -0.896  1.992   1.00 57.61 ? 254 GLY A CA  1 
ATOM   1828 C  C   . GLY A 1 256 ? 26.233 -2.036  1.377   1.00 68.73 ? 254 GLY A C   1 
ATOM   1829 O  O   . GLY A 1 256 ? 26.539 -3.202  1.635   1.00 71.08 ? 254 GLY A O   1 
ATOM   1830 N  N   . CYS A 1 257 ? 25.227 -1.723  0.568   1.00 49.55 ? 255 CYS A N   1 
ATOM   1831 C  CA  . CYS A 1 257 ? 24.460 -2.733  -0.155  1.00 53.02 ? 255 CYS A CA  1 
ATOM   1832 C  C   . CYS A 1 257 ? 25.143 -2.989  -1.495  1.00 49.69 ? 255 CYS A C   1 
ATOM   1833 O  O   . CYS A 1 257 ? 25.136 -2.121  -2.376  1.00 49.03 ? 255 CYS A O   1 
ATOM   1834 C  CB  . CYS A 1 257 ? 23.020 -2.271  -0.353  1.00 68.12 ? 255 CYS A CB  1 
ATOM   1835 S  SG  . CYS A 1 257 ? 22.590 -0.807  0.621   1.00 80.91 ? 255 CYS A SG  1 
ATOM   1836 N  N   . LYS A 1 258 ? 25.740 -4.177  -1.644  1.00 48.76 ? 256 LYS A N   1 
ATOM   1837 C  CA  . LYS A 1 258 ? 26.506 -4.535  -2.831  1.00 53.06 ? 256 LYS A CA  1 
ATOM   1838 C  C   . LYS A 1 258 ? 25.911 -5.686  -3.630  1.00 56.61 ? 256 LYS A C   1 
ATOM   1839 O  O   . LYS A 1 258 ? 26.449 -6.015  -4.695  1.00 55.19 ? 256 LYS A O   1 
ATOM   1840 C  CB  . LYS A 1 258 ? 27.950 -4.921  -2.451  1.00 48.19 ? 256 LYS A CB  1 
ATOM   1841 C  CG  . LYS A 1 258 ? 28.718 -3.888  -1.627  1.00 47.92 ? 256 LYS A CG  1 
ATOM   1842 C  CD  . LYS A 1 258 ? 29.038 -2.649  -2.434  1.00 44.47 ? 256 LYS A CD  1 
ATOM   1843 C  CE  . LYS A 1 258 ? 29.789 -1.615  -1.592  1.00 39.77 ? 256 LYS A CE  1 
ATOM   1844 N  NZ  . LYS A 1 258 ? 31.219 -1.984  -1.349  1.00 33.57 ? 256 LYS A NZ  1 
ATOM   1845 N  N   . ALA A 1 259 ? 24.842 -6.316  -3.151  1.00 60.50 ? 257 ALA A N   1 
ATOM   1846 C  CA  . ALA A 1 259 ? 24.245 -7.454  -3.849  1.00 61.99 ? 257 ALA A CA  1 
ATOM   1847 C  C   . ALA A 1 259 ? 22.931 -7.069  -4.521  1.00 64.92 ? 257 ALA A C   1 
ATOM   1848 O  O   . ALA A 1 259 ? 21.904 -6.922  -3.857  1.00 66.06 ? 257 ALA A O   1 
ATOM   1849 C  CB  . ALA A 1 259 ? 24.027 -8.617  -2.883  1.00 58.11 ? 257 ALA A CB  1 
ATOM   1850 N  N   . PRO A 1 271 ? 22.143 -18.266 5.776   1.00 47.87 ? 269 PRO A N   1 
ATOM   1851 C  CA  . PRO A 1 271 ? 22.750 -16.931 5.670   1.00 46.59 ? 269 PRO A CA  1 
ATOM   1852 C  C   . PRO A 1 271 ? 24.175 -16.995 5.125   1.00 40.00 ? 269 PRO A C   1 
ATOM   1853 O  O   . PRO A 1 271 ? 24.608 -16.082 4.424   1.00 40.45 ? 269 PRO A O   1 
ATOM   1854 C  CB  . PRO A 1 271 ? 22.741 -16.407 7.119   1.00 45.29 ? 269 PRO A CB  1 
ATOM   1855 C  CG  . PRO A 1 271 ? 22.191 -17.555 7.979   1.00 45.61 ? 269 PRO A CG  1 
ATOM   1856 C  CD  . PRO A 1 271 ? 22.254 -18.802 7.142   1.00 45.48 ? 269 PRO A CD  1 
ATOM   1857 N  N   . SER A 1 272 ? 24.886 -18.073 5.453   1.00 40.80 ? 270 SER A N   1 
ATOM   1858 C  CA  . SER A 1 272 ? 26.220 -18.347 4.936   1.00 43.39 ? 270 SER A CA  1 
ATOM   1859 C  C   . SER A 1 272 ? 26.195 -19.308 3.749   1.00 48.62 ? 270 SER A C   1 
ATOM   1860 O  O   . SER A 1 272 ? 27.227 -19.911 3.424   1.00 44.36 ? 270 SER A O   1 
ATOM   1861 C  CB  . SER A 1 272 ? 27.115 -18.904 6.048   1.00 45.74 ? 270 SER A CB  1 
ATOM   1862 O  OG  . SER A 1 272 ? 26.624 -20.146 6.558   1.00 46.18 ? 270 SER A OG  1 
ATOM   1863 N  N   . GLY A 1 273 ? 25.039 -19.468 3.104   1.00 53.27 ? 271 GLY A N   1 
ATOM   1864 C  CA  . GLY A 1 273 ? 24.906 -20.334 1.946   1.00 53.80 ? 271 GLY A CA  1 
ATOM   1865 C  C   . GLY A 1 273 ? 24.136 -19.666 0.820   1.00 55.99 ? 271 GLY A C   1 
ATOM   1866 O  O   . GLY A 1 273 ? 24.570 -19.659 -0.335  1.00 57.59 ? 271 GLY A O   1 
HETATM 1867 P  PA  . NAD B 2 .   ? 32.720 15.661  -18.516 1.00 31.63 ? 301 NAD A PA  1 
HETATM 1868 O  O1A . NAD B 2 .   ? 32.154 14.861  -19.630 1.00 30.50 ? 301 NAD A O1A 1 
HETATM 1869 O  O2A . NAD B 2 .   ? 31.621 16.527  -17.825 1.00 26.94 ? 301 NAD A O2A 1 
HETATM 1870 O  O5B . NAD B 2 .   ? 33.926 16.603  -18.998 1.00 26.72 ? 301 NAD A O5B 1 
HETATM 1871 C  C5B . NAD B 2 .   ? 35.079 16.040  -19.657 1.00 35.36 ? 301 NAD A C5B 1 
HETATM 1872 C  C4B . NAD B 2 .   ? 35.669 17.085  -20.570 1.00 34.57 ? 301 NAD A C4B 1 
HETATM 1873 O  O4B . NAD B 2 .   ? 36.792 16.520  -21.287 1.00 30.64 ? 301 NAD A O4B 1 
HETATM 1874 C  C3B . NAD B 2 .   ? 34.700 17.624  -21.635 1.00 34.82 ? 301 NAD A C3B 1 
HETATM 1875 O  O3B . NAD B 2 .   ? 34.832 19.038  -21.779 1.00 31.14 ? 301 NAD A O3B 1 
HETATM 1876 C  C2B . NAD B 2 .   ? 35.124 16.857  -22.893 1.00 34.61 ? 301 NAD A C2B 1 
HETATM 1877 O  O2B . NAD B 2 .   ? 34.872 17.535  -24.117 1.00 30.69 ? 301 NAD A O2B 1 
HETATM 1878 C  C1B . NAD B 2 .   ? 36.630 16.770  -22.668 1.00 33.80 ? 301 NAD A C1B 1 
HETATM 1879 N  N9A . NAD B 2 .   ? 37.287 15.720  -23.441 1.00 39.84 ? 301 NAD A N9A 1 
HETATM 1880 C  C8A . NAD B 2 .   ? 36.801 14.469  -23.720 1.00 37.42 ? 301 NAD A C8A 1 
HETATM 1881 N  N7A . NAD B 2 .   ? 37.527 13.792  -24.579 1.00 33.98 ? 301 NAD A N7A 1 
HETATM 1882 C  C5A . NAD B 2 .   ? 38.569 14.656  -24.882 1.00 36.52 ? 301 NAD A C5A 1 
HETATM 1883 C  C6A . NAD B 2 .   ? 39.662 14.554  -25.765 1.00 38.34 ? 301 NAD A C6A 1 
HETATM 1884 N  N6A . NAD B 2 .   ? 39.894 13.491  -26.546 1.00 33.34 ? 301 NAD A N6A 1 
HETATM 1885 N  N1A . NAD B 2 .   ? 40.509 15.607  -25.841 1.00 37.01 ? 301 NAD A N1A 1 
HETATM 1886 C  C2A . NAD B 2 .   ? 40.269 16.683  -25.084 1.00 33.23 ? 301 NAD A C2A 1 
HETATM 1887 N  N3A . NAD B 2 .   ? 39.272 16.893  -24.217 1.00 29.96 ? 301 NAD A N3A 1 
HETATM 1888 C  C4A . NAD B 2 .   ? 38.445 15.842  -24.171 1.00 37.56 ? 301 NAD A C4A 1 
HETATM 1889 O  O3  . NAD B 2 .   ? 33.296 14.687  -17.396 1.00 32.99 ? 301 NAD A O3  1 
HETATM 1890 P  PN  . NAD B 2 .   ? 33.742 14.913  -15.878 1.00 29.94 ? 301 NAD A PN  1 
HETATM 1891 O  O1N . NAD B 2 .   ? 32.720 14.311  -14.990 1.00 28.10 ? 301 NAD A O1N 1 
HETATM 1892 O  O2N . NAD B 2 .   ? 34.109 16.331  -15.689 1.00 23.35 ? 301 NAD A O2N 1 
HETATM 1893 O  O5D . NAD B 2 .   ? 35.068 14.008  -15.857 1.00 25.61 ? 301 NAD A O5D 1 
HETATM 1894 C  C5D . NAD B 2 .   ? 36.402 14.558  -15.864 1.00 25.15 ? 301 NAD A C5D 1 
HETATM 1895 C  C4D . NAD B 2 .   ? 37.391 13.504  -15.418 1.00 27.92 ? 301 NAD A C4D 1 
HETATM 1896 O  O4D . NAD B 2 .   ? 37.057 13.051  -14.084 1.00 33.48 ? 301 NAD A O4D 1 
HETATM 1897 C  C3D . NAD B 2 .   ? 37.456 12.240  -16.292 1.00 30.54 ? 301 NAD A C3D 1 
HETATM 1898 O  O3D . NAD B 2 .   ? 38.804 11.786  -16.432 1.00 28.90 ? 301 NAD A O3D 1 
HETATM 1899 C  C2D . NAD B 2 .   ? 36.603 11.246  -15.499 1.00 32.80 ? 301 NAD A C2D 1 
HETATM 1900 O  O2D . NAD B 2 .   ? 36.931 9.884   -15.748 1.00 28.55 ? 301 NAD A O2D 1 
HETATM 1901 C  C1D . NAD B 2 .   ? 36.988 11.651  -14.081 1.00 34.14 ? 301 NAD A C1D 1 
HETATM 1902 N  N1N . NAD B 2 .   ? 36.003 11.205  -12.972 1.00 34.34 ? 301 NAD A N1N 1 
HETATM 1903 C  C2N . NAD B 2 .   ? 34.761 11.724  -12.920 1.00 29.20 ? 301 NAD A C2N 1 
HETATM 1904 C  C3N . NAD B 2 .   ? 33.885 11.326  -11.927 1.00 30.06 ? 301 NAD A C3N 1 
HETATM 1905 C  C7N . NAD B 2 .   ? 32.504 11.913  -11.724 1.00 31.05 ? 301 NAD A C7N 1 
HETATM 1906 O  O7N . NAD B 2 .   ? 31.793 11.493  -10.782 1.00 25.97 ? 301 NAD A O7N 1 
HETATM 1907 N  N7N . NAD B 2 .   ? 32.098 12.884  -12.553 1.00 30.85 ? 301 NAD A N7N 1 
HETATM 1908 C  C4N . NAD B 2 .   ? 34.310 10.365  -11.013 1.00 32.21 ? 301 NAD A C4N 1 
HETATM 1909 C  C5N . NAD B 2 .   ? 35.592 9.856   -11.088 1.00 32.81 ? 301 NAD A C5N 1 
HETATM 1910 C  C6N . NAD B 2 .   ? 36.433 10.291  -12.080 1.00 26.04 ? 301 NAD A C6N 1 
HETATM 1911 C  C2  . J3Z C 3 .   ? 28.955 7.236   -12.534 0.88 49.03 ? 302 J3Z A C2  1 
HETATM 1912 C  C4  . J3Z C 3 .   ? 26.489 6.895   -13.115 0.88 45.34 ? 302 J3Z A C4  1 
HETATM 1913 C  C5  . J3Z C 3 .   ? 26.639 5.393   -12.839 0.88 48.46 ? 302 J3Z A C5  1 
HETATM 1914 O  O1  . J3Z C 3 .   ? 24.304 4.943   -12.327 0.88 41.94 ? 302 J3Z A O1  1 
HETATM 1915 O  O3  . J3Z C 3 .   ? 33.904 9.214   -14.480 0.88 35.53 ? 302 J3Z A O3  1 
HETATM 1916 C  C7  . J3Z C 3 .   ? 25.474 4.676   -12.182 0.88 47.73 ? 302 J3Z A C7  1 
HETATM 1917 C  C8  . J3Z C 3 .   ? 26.024 3.562   -11.317 0.88 49.07 ? 302 J3Z A C8  1 
HETATM 1918 C  C9  . J3Z C 3 .   ? 27.544 3.766   -11.292 0.88 50.61 ? 302 J3Z A C9  1 
HETATM 1919 C  C10 . J3Z C 3 .   ? 27.714 5.221   -11.762 0.88 48.04 ? 302 J3Z A C10 1 
HETATM 1920 C  C12 . J3Z C 3 .   ? 29.080 5.735   -12.216 0.88 50.02 ? 302 J3Z A C12 1 
HETATM 1921 C  C3  . J3Z C 3 .   ? 27.826 7.512   -13.539 0.88 44.84 ? 302 J3Z A C3  1 
HETATM 1922 C  C14 . J3Z C 3 .   ? 30.182 5.540   -11.176 0.88 46.44 ? 302 J3Z A C14 1 
HETATM 1923 C  C15 . J3Z C 3 .   ? 31.530 5.930   -11.763 0.88 46.77 ? 302 J3Z A C15 1 
HETATM 1924 C  C16 . J3Z C 3 .   ? 31.499 7.172   -12.623 0.88 45.00 ? 302 J3Z A C16 1 
HETATM 1925 C  C21 . J3Z C 3 .   ? 30.298 7.817   -12.951 0.88 47.00 ? 302 J3Z A C21 1 
HETATM 1926 C  C17 . J3Z C 3 .   ? 32.703 7.669   -13.115 0.88 40.56 ? 302 J3Z A C17 1 
HETATM 1927 C  C18 . J3Z C 3 .   ? 32.725 8.787   -13.934 0.88 38.83 ? 302 J3Z A C18 1 
HETATM 1928 C  C19 . J3Z C 3 .   ? 31.543 9.443   -14.237 0.88 38.13 ? 302 J3Z A C19 1 
HETATM 1929 C  C20 . J3Z C 3 .   ? 30.347 8.961   -13.742 0.88 39.65 ? 302 J3Z A C20 1 
HETATM 1930 NA NA  . NA  D 4 .   ? 40.691 34.774  -20.691 1.00 30.30 ? 303 NA  A NA  1 
HETATM 1931 O  O   . HOH E 5 .   ? 34.974 22.971  -24.408 1.00 36.45 ? 401 HOH A O   1 
HETATM 1932 O  O   . HOH E 5 .   ? 32.726 0.316   -21.616 1.00 43.80 ? 402 HOH A O   1 
HETATM 1933 O  O   . HOH E 5 .   ? 35.879 17.565  -16.951 1.00 22.72 ? 403 HOH A O   1 
HETATM 1934 O  O   . HOH E 5 .   ? 36.946 9.494   1.419   1.00 22.38 ? 404 HOH A O   1 
HETATM 1935 O  O   . HOH E 5 .   ? 39.738 6.563   2.765   1.00 19.54 ? 405 HOH A O   1 
HETATM 1936 O  O   . HOH E 5 .   ? 28.352 -20.370 8.437   1.00 42.87 ? 406 HOH A O   1 
HETATM 1937 O  O   . HOH E 5 .   ? 33.720 34.740  -13.856 1.00 29.92 ? 407 HOH A O   1 
HETATM 1938 O  O   . HOH E 5 .   ? 57.066 26.765  -28.529 1.00 29.24 ? 408 HOH A O   1 
HETATM 1939 O  O   . HOH E 5 .   ? 43.545 11.960  -20.489 1.00 36.41 ? 409 HOH A O   1 
HETATM 1940 O  O   . HOH E 5 .   ? 59.538 19.200  -3.739  1.00 39.13 ? 410 HOH A O   1 
HETATM 1941 O  O   . HOH E 5 .   ? 57.025 25.229  -11.092 1.00 19.33 ? 411 HOH A O   1 
HETATM 1942 O  O   . HOH E 5 .   ? 60.201 19.974  -26.374 1.00 46.52 ? 412 HOH A O   1 
HETATM 1943 O  O   . HOH E 5 .   ? 45.147 34.100  -12.871 1.00 38.64 ? 413 HOH A O   1 
HETATM 1944 O  O   . HOH E 5 .   ? 42.457 4.724   -8.752  1.00 25.11 ? 414 HOH A O   1 
HETATM 1945 O  O   . HOH E 5 .   ? 37.990 25.408  -5.893  1.00 31.08 ? 415 HOH A O   1 
HETATM 1946 O  O   . HOH E 5 .   ? 38.789 11.792  -29.717 1.00 44.94 ? 416 HOH A O   1 
HETATM 1947 O  O   . HOH E 5 .   ? 55.072 24.331  -9.169  1.00 29.47 ? 417 HOH A O   1 
HETATM 1948 O  O   . HOH E 5 .   ? 53.643 26.358  -31.627 1.00 34.71 ? 418 HOH A O   1 
HETATM 1949 O  O   . HOH E 5 .   ? 57.638 19.259  -8.519  1.00 27.55 ? 419 HOH A O   1 
HETATM 1950 O  O   . HOH E 5 .   ? 59.688 13.439  -22.246 1.00 28.47 ? 420 HOH A O   1 
HETATM 1951 O  O   . HOH E 5 .   ? 58.850 23.442  -7.740  1.00 43.59 ? 421 HOH A O   1 
HETATM 1952 O  O   . HOH E 5 .   ? 51.413 32.771  -14.623 1.00 41.07 ? 422 HOH A O   1 
HETATM 1953 O  O   . HOH E 5 .   ? 58.415 12.568  -8.269  1.00 21.89 ? 423 HOH A O   1 
HETATM 1954 O  O   . HOH E 5 .   ? 32.600 -3.699  -14.255 1.00 22.67 ? 424 HOH A O   1 
HETATM 1955 O  O   . HOH E 5 .   ? 64.483 19.827  -19.282 1.00 30.65 ? 425 HOH A O   1 
HETATM 1956 O  O   . HOH E 5 .   ? 60.677 31.906  -19.551 1.00 26.55 ? 426 HOH A O   1 
HETATM 1957 O  O   . HOH E 5 .   ? 45.047 7.894   -30.796 1.00 42.59 ? 427 HOH A O   1 
HETATM 1958 O  O   . HOH E 5 .   ? 44.577 11.073  -16.394 1.00 20.72 ? 428 HOH A O   1 
HETATM 1959 O  O   . HOH E 5 .   ? 58.480 17.946  -25.694 1.00 32.06 ? 429 HOH A O   1 
HETATM 1960 O  O   . HOH E 5 .   ? 41.978 28.451  -5.930  1.00 37.09 ? 430 HOH A O   1 
HETATM 1961 O  O   . HOH E 5 .   ? 31.910 9.267   -4.092  1.00 23.68 ? 431 HOH A O   1 
HETATM 1962 O  O   . HOH E 5 .   ? 52.740 9.747   -27.535 1.00 40.95 ? 432 HOH A O   1 
HETATM 1963 O  O   . HOH E 5 .   ? 45.017 14.555  -20.677 1.00 29.44 ? 433 HOH A O   1 
HETATM 1964 O  O   . HOH E 5 .   ? 38.998 19.557  -1.955  1.00 23.38 ? 434 HOH A O   1 
HETATM 1965 O  O   . HOH E 5 .   ? 54.839 23.736  -5.646  1.00 36.34 ? 435 HOH A O   1 
HETATM 1966 O  O   . HOH E 5 .   ? 44.569 1.986   -27.198 1.00 32.13 ? 436 HOH A O   1 
HETATM 1967 O  O   . HOH E 5 .   ? 32.313 25.549  -18.654 1.00 27.90 ? 437 HOH A O   1 
HETATM 1968 O  O   . HOH E 5 .   ? 35.397 0.000   -0.000  0.50 37.46 ? 438 HOH A O   1 
HETATM 1969 O  O   . HOH E 5 .   ? 60.600 28.186  -21.421 1.00 32.07 ? 439 HOH A O   1 
HETATM 1970 O  O   . HOH E 5 .   ? 31.256 28.888  -27.011 1.00 39.04 ? 440 HOH A O   1 
HETATM 1971 O  O   . HOH E 5 .   ? 47.512 29.168  -29.412 1.00 35.07 ? 441 HOH A O   1 
HETATM 1972 O  O   . HOH E 5 .   ? 36.639 25.856  -9.034  1.00 28.33 ? 442 HOH A O   1 
HETATM 1973 O  O   . HOH E 5 .   ? 62.798 9.971   -15.828 1.00 42.54 ? 443 HOH A O   1 
HETATM 1974 O  O   . HOH E 5 .   ? 27.843 11.039  -22.170 1.00 46.18 ? 444 HOH A O   1 
HETATM 1975 O  O   . HOH E 5 .   ? 44.548 2.500   -5.574  1.00 25.37 ? 445 HOH A O   1 
HETATM 1976 O  O   . HOH E 5 .   ? 42.824 -1.598  -8.345  1.00 21.42 ? 446 HOH A O   1 
HETATM 1977 O  O   . HOH E 5 .   ? 57.361 22.585  -27.710 1.00 43.16 ? 447 HOH A O   1 
HETATM 1978 O  O   . HOH E 5 .   ? 47.183 1.621   -5.648  1.00 25.67 ? 448 HOH A O   1 
HETATM 1979 O  O   . HOH E 5 .   ? 52.373 36.097  -22.314 1.00 40.37 ? 449 HOH A O   1 
HETATM 1980 O  O   . HOH E 5 .   ? 33.257 20.832  -23.152 1.00 37.14 ? 450 HOH A O   1 
HETATM 1981 O  O   . HOH E 5 .   ? 37.530 11.813  -0.069  1.00 19.95 ? 451 HOH A O   1 
HETATM 1982 O  O   . HOH E 5 .   ? 61.137 12.125  -18.761 1.00 33.16 ? 452 HOH A O   1 
HETATM 1983 O  O   . HOH E 5 .   ? 33.568 12.762  -20.762 1.00 31.79 ? 453 HOH A O   1 
HETATM 1984 O  O   . HOH E 5 .   ? 44.619 6.889   -1.453  1.00 38.87 ? 454 HOH A O   1 
HETATM 1985 O  O   . HOH E 5 .   ? 41.999 9.478   -17.218 1.00 29.27 ? 455 HOH A O   1 
HETATM 1986 O  O   . HOH E 5 .   ? 29.818 3.601   -1.437  1.00 30.42 ? 456 HOH A O   1 
HETATM 1987 O  O   . HOH E 5 .   ? 44.501 24.399  -31.620 1.00 47.46 ? 457 HOH A O   1 
HETATM 1988 O  O   . HOH E 5 .   ? 47.816 10.608  -27.333 1.00 38.56 ? 458 HOH A O   1 
HETATM 1989 O  O   . HOH E 5 .   ? 45.877 8.552   -27.189 1.00 30.54 ? 459 HOH A O   1 
HETATM 1990 O  O   . HOH E 5 .   ? 51.017 3.740   -2.968  1.00 32.35 ? 460 HOH A O   1 
HETATM 1991 O  O   . HOH E 5 .   ? 26.100 -10.064 -17.282 1.00 37.40 ? 461 HOH A O   1 
HETATM 1992 O  O   . HOH E 5 .   ? 45.991 1.285   -9.653  1.00 22.85 ? 462 HOH A O   1 
HETATM 1993 O  O   . HOH E 5 .   ? 59.345 4.628   -17.509 1.00 25.82 ? 463 HOH A O   1 
HETATM 1994 O  O   . HOH E 5 .   ? 33.826 21.814  -31.038 1.00 41.34 ? 464 HOH A O   1 
HETATM 1995 O  O   . HOH E 5 .   ? 47.115 4.366   -3.933  1.00 21.41 ? 465 HOH A O   1 
HETATM 1996 O  O   . HOH E 5 .   ? 28.657 1.886   -15.375 1.00 46.79 ? 466 HOH A O   1 
HETATM 1997 O  O   . HOH E 5 .   ? 57.775 33.175  -27.587 1.00 35.52 ? 467 HOH A O   1 
HETATM 1998 O  O   . HOH E 5 .   ? 57.889 20.618  -5.817  1.00 46.75 ? 468 HOH A O   1 
HETATM 1999 O  O   . HOH E 5 .   ? 58.214 31.816  -25.452 1.00 34.52 ? 469 HOH A O   1 
HETATM 2000 O  O   . HOH E 5 .   ? 46.252 21.607  -30.539 1.00 37.96 ? 470 HOH A O   1 
HETATM 2001 O  O   . HOH E 5 .   ? 50.450 36.403  -20.120 1.00 42.94 ? 471 HOH A O   1 
HETATM 2002 O  O   . HOH E 5 .   ? 38.357 31.605  -11.604 1.00 31.22 ? 472 HOH A O   1 
HETATM 2003 O  O   . HOH E 5 .   ? 43.800 10.205  -0.297  1.00 24.39 ? 473 HOH A O   1 
HETATM 2004 O  O   . HOH E 5 .   ? 47.858 7.887   -1.645  1.00 40.71 ? 474 HOH A O   1 
HETATM 2005 O  O   . HOH E 5 .   ? 51.403 16.949  -8.464  1.00 24.51 ? 475 HOH A O   1 
HETATM 2006 O  O   . HOH E 5 .   ? 42.662 26.572  -30.615 1.00 41.88 ? 476 HOH A O   1 
HETATM 2007 O  O   . HOH E 5 .   ? 54.459 10.078  -20.042 1.00 34.54 ? 477 HOH A O   1 
HETATM 2008 O  O   . HOH E 5 .   ? 32.185 26.339  -15.988 1.00 30.46 ? 478 HOH A O   1 
HETATM 2009 O  O   . HOH E 5 .   ? 54.716 22.163  -32.558 1.00 46.12 ? 479 HOH A O   1 
HETATM 2010 O  O   . HOH E 5 .   ? 39.261 36.707  -20.247 1.00 40.38 ? 480 HOH A O   1 
HETATM 2011 O  O   . HOH E 5 .   ? 32.288 22.913  -13.581 1.00 28.70 ? 481 HOH A O   1 
HETATM 2012 O  O   . HOH E 5 .   ? 23.692 4.406   -2.878  1.00 47.12 ? 482 HOH A O   1 
HETATM 2013 O  O   . HOH E 5 .   ? 31.914 23.443  -8.650  1.00 24.92 ? 483 HOH A O   1 
HETATM 2014 O  O   . HOH E 5 .   ? 60.366 27.551  -11.275 1.00 47.27 ? 484 HOH A O   1 
HETATM 2015 O  O   . HOH E 5 .   ? 35.744 -8.106  -28.380 1.00 46.50 ? 485 HOH A O   1 
HETATM 2016 O  O   . HOH E 5 .   ? 32.017 27.828  -20.179 1.00 24.53 ? 486 HOH A O   1 
HETATM 2017 O  O   . HOH E 5 .   ? 53.757 17.659  0.989   1.00 23.10 ? 487 HOH A O   1 
HETATM 2018 O  O   . HOH E 5 .   ? 59.087 25.440  -18.165 1.00 22.78 ? 488 HOH A O   1 
HETATM 2019 O  O   . HOH E 5 .   ? 48.867 34.795  -25.902 1.00 42.79 ? 489 HOH A O   1 
HETATM 2020 O  O   . HOH E 5 .   ? 47.662 10.375  -32.656 1.00 43.54 ? 490 HOH A O   1 
HETATM 2021 O  O   . HOH E 5 .   ? 51.174 10.962  -16.301 1.00 26.46 ? 491 HOH A O   1 
HETATM 2022 O  O   . HOH E 5 .   ? 55.807 21.739  -8.726  1.00 26.02 ? 492 HOH A O   1 
HETATM 2023 O  O   . HOH E 5 .   ? 37.008 32.473  -27.020 1.00 46.96 ? 493 HOH A O   1 
HETATM 2024 O  O   . HOH E 5 .   ? 33.728 -1.871  -24.923 1.00 34.92 ? 494 HOH A O   1 
HETATM 2025 O  O   . HOH E 5 .   ? 33.512 0.992   -19.291 1.00 22.42 ? 495 HOH A O   1 
HETATM 2026 O  O   . HOH E 5 .   ? 35.633 31.279  -11.572 1.00 23.93 ? 496 HOH A O   1 
HETATM 2027 O  O   . HOH E 5 .   ? 32.815 25.341  -12.880 1.00 31.01 ? 497 HOH A O   1 
HETATM 2028 O  O   . HOH E 5 .   ? 36.925 -6.069  -30.746 1.00 42.52 ? 498 HOH A O   1 
HETATM 2029 O  O   . HOH E 5 .   ? 29.253 27.211  -23.817 1.00 36.37 ? 499 HOH A O   1 
HETATM 2030 O  O   . HOH E 5 .   ? 25.974 8.681   6.714   1.00 50.73 ? 500 HOH A O   1 
HETATM 2031 O  O   . HOH E 5 .   ? 61.230 30.538  -11.925 1.00 43.03 ? 501 HOH A O   1 
HETATM 2032 O  O   . HOH E 5 .   ? 34.136 -9.594  -20.801 1.00 35.20 ? 502 HOH A O   1 
HETATM 2033 O  O   . HOH E 5 .   ? 31.033 1.853   -18.176 1.00 42.08 ? 503 HOH A O   1 
HETATM 2034 O  O   . HOH E 5 .   ? 63.142 26.029  -11.659 1.00 39.86 ? 504 HOH A O   1 
HETATM 2035 O  O   . HOH E 5 .   ? 32.187 -11.250 -20.815 1.00 32.93 ? 505 HOH A O   1 
HETATM 2036 O  O   . HOH E 5 .   ? 56.095 20.341  -28.577 1.00 34.59 ? 506 HOH A O   1 
HETATM 2037 O  O   . HOH E 5 .   ? 44.010 4.576   -2.031  1.00 40.09 ? 507 HOH A O   1 
HETATM 2038 O  O   . HOH E 5 .   ? 35.143 30.140  -8.987  1.00 48.51 ? 508 HOH A O   1 
HETATM 2039 O  O   . HOH E 5 .   ? 45.247 32.588  -3.210  1.00 50.44 ? 509 HOH A O   1 
HETATM 2040 O  O   . HOH E 5 .   ? 43.791 2.304   -8.228  1.00 22.55 ? 510 HOH A O   1 
HETATM 2041 O  O   . HOH E 5 .   ? 29.114 -0.346  -8.444  1.00 39.93 ? 511 HOH A O   1 
HETATM 2042 O  O   . HOH E 5 .   ? 41.450 0.086   -2.574  1.00 39.91 ? 512 HOH A O   1 
HETATM 2043 O  O   . HOH E 5 .   ? 34.528 0.393   -23.631 1.00 42.41 ? 513 HOH A O   1 
HETATM 2044 O  O   . HOH E 5 .   ? 25.167 -2.232  4.769   1.00 51.03 ? 514 HOH A O   1 
HETATM 2045 O  O   . HOH E 5 .   ? 55.825 25.727  -6.944  1.00 45.63 ? 515 HOH A O   1 
HETATM 2046 O  O   . HOH E 5 .   ? 48.811 34.530  -29.647 1.00 58.91 ? 516 HOH A O   1 
HETATM 2047 O  O   . HOH E 5 .   ? 41.606 2.437   -30.790 1.00 47.35 ? 517 HOH A O   1 
HETATM 2048 O  O   . HOH E 5 .   ? 41.671 36.086  -22.505 1.00 44.68 ? 518 HOH A O   1 
HETATM 2049 O  O   . HOH E 5 .   ? 43.839 28.808  -30.469 1.00 50.79 ? 519 HOH A O   1 
HETATM 2050 O  O   . HOH E 5 .   ? 33.822 13.132  -23.869 1.00 50.42 ? 520 HOH A O   1 
HETATM 2051 O  O   . HOH E 5 .   ? 61.480 14.123  -20.335 1.00 33.97 ? 521 HOH A O   1 
HETATM 2052 O  O   . HOH E 5 .   ? 58.707 29.057  -28.195 1.00 29.56 ? 522 HOH A O   1 
HETATM 2053 O  O   . HOH E 5 .   ? 59.966 29.839  -26.011 1.00 33.98 ? 523 HOH A O   1 
HETATM 2054 O  O   . HOH E 5 .   ? 43.823 0.545   -3.951  1.00 30.15 ? 524 HOH A O   1 
HETATM 2055 O  O   . HOH E 5 .   ? 33.509 25.537  -10.385 1.00 37.41 ? 525 HOH A O   1 
HETATM 2056 O  O   . HOH E 5 .   ? 34.828 33.919  -11.550 1.00 43.00 ? 526 HOH A O   1 
HETATM 2057 O  O   . HOH E 5 .   ? 52.765 9.218   -17.834 1.00 37.60 ? 527 HOH A O   1 
HETATM 2058 O  O   . HOH E 5 .   ? 41.195 26.582  -4.710  1.00 42.96 ? 528 HOH A O   1 
HETATM 2059 O  O   . HOH E 5 .   ? 61.883 26.095  -25.546 1.00 48.80 ? 529 HOH A O   1 
HETATM 2060 O  O   . HOH E 5 .   ? 60.930 26.047  -20.077 1.00 31.89 ? 530 HOH A O   1 
HETATM 2061 O  O   . HOH E 5 .   ? 29.408 27.514  -21.280 1.00 29.68 ? 531 HOH A O   1 
HETATM 2062 O  O   . HOH E 5 .   ? 28.228 29.931  -24.340 1.00 36.68 ? 532 HOH A O   1 
HETATM 2063 O  O   . HOH E 5 .   ? 34.551 27.676  -8.793  1.00 43.05 ? 533 HOH A O   1 
HETATM 2064 O  O   . HOH E 5 .   ? 32.931 27.350  -6.342  1.00 47.16 ? 534 HOH A O   1 
HETATM 2065 O  O   . HOH E 5 .   ? 40.290 2.083   -1.328  1.00 49.09 ? 535 HOH A O   1 
HETATM 2066 O  O   . HOH E 5 .   ? 45.556 -0.000  -1.843  0.50 40.63 ? 536 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
5    N N   . THR A 7   ? 0.6330 0.5553 0.5613 -0.0251 0.0017  -0.1640 5   THR A N   
6    C CA  . THR A 7   ? 0.6058 0.5161 0.5224 -0.0436 -0.0124 -0.1447 5   THR A CA  
7    C C   . THR A 7   ? 0.5303 0.4650 0.4235 -0.0580 -0.0145 -0.1048 5   THR A C   
8    O O   . THR A 7   ? 0.4858 0.4087 0.3890 -0.0661 -0.0267 -0.0818 5   THR A O   
9    C CB  . THR A 7   ? 0.6870 0.6092 0.5899 -0.0582 -0.0175 -0.1866 5   THR A CB  
10   O OG1 . THR A 7   ? 0.7761 0.6500 0.7140 -0.0518 -0.0326 -0.2036 5   THR A OG1 
11   C CG2 . THR A 7   ? 0.7429 0.6921 0.6085 -0.0865 -0.0274 -0.1688 5   THR A CG2 
12   N N   A ARG A 8   ? 0.4602 0.4281 0.3316 -0.0612 -0.0053 -0.0963 6   ARG A N   
13   N N   B ARG A 8   ? 0.4594 0.4275 0.3304 -0.0616 -0.0055 -0.0959 6   ARG A N   
14   C CA  A ARG A 8   ? 0.4646 0.4516 0.3179 -0.0775 -0.0163 -0.0609 6   ARG A CA  
15   C CA  B ARG A 8   ? 0.4648 0.4513 0.3181 -0.0784 -0.0175 -0.0606 6   ARG A CA  
16   C C   A ARG A 8   ? 0.4287 0.3937 0.3150 -0.0663 -0.0234 -0.0290 6   ARG A C   
17   C C   B ARG A 8   ? 0.4266 0.3931 0.3119 -0.0662 -0.0232 -0.0276 6   ARG A C   
18   O O   A ARG A 8   ? 0.4084 0.3792 0.3027 -0.0763 -0.0407 -0.0074 6   ARG A O   
19   O O   B ARG A 8   ? 0.4075 0.3817 0.2990 -0.0758 -0.0399 -0.0034 6   ARG A O   
20   C CB  A ARG A 8   ? 0.4743 0.4949 0.3015 -0.0859 -0.0074 -0.0545 6   ARG A CB  
21   C CB  B ARG A 8   ? 0.4921 0.5162 0.3127 -0.0917 -0.0105 -0.0559 6   ARG A CB  
22   C CG  A ARG A 8   ? 0.5271 0.5728 0.3201 -0.1165 -0.0264 -0.0264 6   ARG A CG  
23   C CG  B ARG A 8   ? 0.4575 0.4826 0.2936 -0.0725 0.0076  -0.0597 6   ARG A CG  
24   C CD  A ARG A 8   ? 0.5307 0.6083 0.2971 -0.1312 -0.0186 -0.0147 6   ARG A CD  
25   C CD  B ARG A 8   ? 0.5024 0.5740 0.3061 -0.0922 0.0174  -0.0612 6   ARG A CD  
26   N NE  A ARG A 8   ? 0.5270 0.6437 0.2738 -0.1371 0.0076  -0.0565 6   ARG A NE  
27   N NE  B ARG A 8   ? 0.4969 0.5772 0.2769 -0.1172 -0.0027 -0.0180 6   ARG A NE  
28   C CZ  A ARG A 8   ? 0.5255 0.6752 0.2735 -0.1444 0.0213  -0.0535 6   ARG A CZ  
29   C CZ  B ARG A 8   ? 0.4970 0.6096 0.2540 -0.1392 -0.0009 -0.0022 6   ARG A CZ  
30   N NH1 A ARG A 8   ? 0.4723 0.6174 0.2215 -0.1530 0.0092  -0.0122 6   ARG A NH1 
31   N NH1 B ARG A 8   ? 0.4259 0.5324 0.1819 -0.1582 -0.0270 0.0403  6   ARG A NH1 
32   N NH2 A ARG A 8   ? 0.5154 0.7023 0.2712 -0.1435 0.0440  -0.0935 6   ARG A NH2 
33   N NH2 B ARG A 8   ? 0.3953 0.5399 0.1593 -0.1353 0.0242  -0.0298 6   ARG A NH2 
34   N N   . TYR A 9   ? 0.4066 0.3510 0.3151 -0.0469 -0.0119 -0.0281 7   TYR A N   
35   C CA  . TYR A 9   ? 0.3850 0.3202 0.3205 -0.0396 -0.0128 -0.0058 7   TYR A CA  
36   C C   . TYR A 9   ? 0.3745 0.2838 0.3262 -0.0349 -0.0079 -0.0095 7   TYR A C   
37   O O   . TYR A 9   ? 0.3614 0.2648 0.3239 -0.0285 -0.0005 0.0018  7   TYR A O   
38   C CB  . TYR A 9   ? 0.3476 0.2898 0.2846 -0.0295 -0.0065 0.0070  7   TYR A CB  
39   C CG  . TYR A 9   ? 0.3057 0.2547 0.2705 -0.0276 -0.0144 0.0246  7   TYR A CG  
40   C CD1 . TYR A 9   ? 0.2787 0.2390 0.2587 -0.0376 -0.0341 0.0344  7   TYR A CD1 
41   C CD2 . TYR A 9   ? 0.2915 0.2375 0.2727 -0.0154 -0.0048 0.0274  7   TYR A CD2 
42   C CE1 . TYR A 9   ? 0.3054 0.2731 0.3287 -0.0310 -0.0448 0.0431  7   TYR A CE1 
43   C CE2 . TYR A 9   ? 0.2785 0.2351 0.2956 -0.0109 -0.0109 0.0318  7   TYR A CE2 
44   C CZ  . TYR A 9   ? 0.2701 0.2372 0.3141 -0.0164 -0.0310 0.0379  7   TYR A CZ  
45   O OH  . TYR A 9   ? 0.2866 0.2652 0.3826 -0.0073 -0.0401 0.0353  7   TYR A OH  
46   N N   . ALA A 10  ? 0.3532 0.2467 0.3046 -0.0423 -0.0145 -0.0247 8   ALA A N   
47   C CA  . ALA A 10  ? 0.3864 0.2476 0.3525 -0.0442 -0.0174 -0.0229 8   ALA A CA  
48   C C   . ALA A 10  ? 0.3955 0.2663 0.3785 -0.0577 -0.0162 -0.0019 8   ALA A C   
49   O O   . ALA A 10  ? 0.3761 0.2735 0.3708 -0.0653 -0.0194 0.0013  8   ALA A O   
50   C CB  . ALA A 10  ? 0.4437 0.2824 0.4125 -0.0503 -0.0297 -0.0470 8   ALA A CB  
51   N N   . GLY A 11  ? 0.4238 0.2776 0.4102 -0.0630 -0.0129 0.0121  9   GLY A N   
52   C CA  . GLY A 11  ? 0.4273 0.3020 0.4271 -0.0817 -0.0057 0.0277  9   GLY A CA  
53   C C   . GLY A 11  ? 0.3403 0.2553 0.3491 -0.0745 0.0104  0.0297  9   GLY A C   
54   O O   . GLY A 11  ? 0.3782 0.3255 0.4059 -0.0891 0.0211  0.0328  9   GLY A O   
55   N N   . LYS A 12  ? 0.2905 0.2076 0.2908 -0.0542 0.0126  0.0247  10  LYS A N   
56   C CA  . LYS A 12  ? 0.2772 0.2247 0.2928 -0.0449 0.0223  0.0227  10  LYS A CA  
57   C C   . LYS A 12  ? 0.3426 0.2837 0.3383 -0.0411 0.0330  0.0271  10  LYS A C   
58   O O   . LYS A 12  ? 0.3581 0.2685 0.3299 -0.0383 0.0278  0.0334  10  LYS A O   
59   C CB  . LYS A 12  ? 0.2521 0.2039 0.2723 -0.0310 0.0114  0.0196  10  LYS A CB  
60   C CG  . LYS A 12  ? 0.2979 0.2560 0.3289 -0.0385 -0.0052 0.0190  10  LYS A CG  
61   C CD  . LYS A 12  ? 0.3162 0.3048 0.3944 -0.0440 -0.0084 0.0168  10  LYS A CD  
62   C CE  . LYS A 12  ? 0.3538 0.3486 0.4444 -0.0519 -0.0325 0.0198  10  LYS A CE  
63   N NZ  . LYS A 12  ? 0.3654 0.3952 0.5180 -0.0533 -0.0402 0.0157  10  LYS A NZ  
64   N N   . VAL A 13  ? 0.2405 0.2127 0.2513 -0.0405 0.0458  0.0202  11  VAL A N   
65   C CA  . VAL A 13  ? 0.2963 0.2696 0.2849 -0.0410 0.0557  0.0216  11  VAL A CA  
66   C C   . VAL A 13  ? 0.3058 0.2894 0.3110 -0.0213 0.0557  0.0091  11  VAL A C   
67   O O   . VAL A 13  ? 0.2174 0.2272 0.2633 -0.0148 0.0565  -0.0062 11  VAL A O   
68   C CB  . VAL A 13  ? 0.3091 0.3158 0.2937 -0.0661 0.0732  0.0195  11  VAL A CB  
69   C CG1 . VAL A 13  ? 0.3187 0.3357 0.2759 -0.0700 0.0832  0.0167  11  VAL A CG1 
70   C CG2 . VAL A 13  ? 0.3574 0.3438 0.3209 -0.0918 0.0667  0.0410  11  VAL A CG2 
71   N N   . VAL A 14  ? 0.2958 0.2581 0.2773 -0.0121 0.0511  0.0153  12  VAL A N   
72   C CA  . VAL A 14  ? 0.3156 0.2786 0.3094 0.0033  0.0459  0.0090  12  VAL A CA  
73   C C   . VAL A 14  ? 0.3366 0.3031 0.3123 0.0023  0.0530  0.0045  12  VAL A C   
74   O O   . VAL A 14  ? 0.3323 0.2846 0.2756 -0.0052 0.0522  0.0167  12  VAL A O   
75   C CB  . VAL A 14  ? 0.2973 0.2397 0.2802 0.0109  0.0333  0.0196  12  VAL A CB  
76   C CG1 . VAL A 14  ? 0.2615 0.2051 0.2558 0.0192  0.0254  0.0195  12  VAL A CG1 
77   C CG2 . VAL A 14  ? 0.2680 0.2097 0.2578 0.0066  0.0253  0.0225  12  VAL A CG2 
78   N N   . VAL A 15  ? 0.3068 0.2894 0.3068 0.0096  0.0551  -0.0137 13  VAL A N   
79   C CA  . VAL A 15  ? 0.3101 0.2957 0.2938 0.0092  0.0585  -0.0223 13  VAL A CA  
80   C C   . VAL A 15  ? 0.3232 0.2899 0.3207 0.0228  0.0426  -0.0182 13  VAL A C   
81   O O   . VAL A 15  ? 0.2879 0.2525 0.3235 0.0314  0.0314  -0.0227 13  VAL A O   
82   C CB  . VAL A 15  ? 0.3029 0.3264 0.3065 0.0041  0.0744  -0.0552 13  VAL A CB  
83   C CG1 . VAL A 15  ? 0.2735 0.2998 0.2608 0.0035  0.0751  -0.0695 13  VAL A CG1 
84   C CG2 . VAL A 15  ? 0.2435 0.2970 0.2262 -0.0194 0.0938  -0.0568 13  VAL A CG2 
85   N N   . VAL A 16  ? 0.2749 0.2288 0.2452 0.0220  0.0379  -0.0070 14  VAL A N   
86   C CA  . VAL A 16  ? 0.3022 0.2450 0.2827 0.0286  0.0248  -0.0018 14  VAL A CA  
87   C C   . VAL A 16  ? 0.3271 0.2738 0.2970 0.0262  0.0245  -0.0138 14  VAL A C   
88   O O   . VAL A 16  ? 0.3291 0.2764 0.2666 0.0192  0.0263  -0.0067 14  VAL A O   
89   C CB  . VAL A 16  ? 0.2566 0.1912 0.2227 0.0291  0.0198  0.0175  14  VAL A CB  
90   C CG1 . VAL A 16  ? 0.2922 0.2268 0.2693 0.0288  0.0093  0.0236  14  VAL A CG1 
91   C CG2 . VAL A 16  ? 0.2768 0.2106 0.2451 0.0281  0.0211  0.0242  14  VAL A CG2 
92   N N   . THR A 17  ? 0.3400 0.2866 0.3395 0.0306  0.0176  -0.0316 15  THR A N   
93   C CA  . THR A 17  ? 0.3440 0.2942 0.3347 0.0271  0.0153  -0.0479 15  THR A CA  
94   C C   . THR A 17  ? 0.3482 0.2841 0.3367 0.0264  -0.0005 -0.0287 15  THR A C   
95   O O   . THR A 17  ? 0.2788 0.2056 0.2835 0.0275  -0.0095 -0.0098 15  THR A O   
96   C CB  . THR A 17  ? 0.3452 0.3017 0.3774 0.0332  0.0134  -0.0848 15  THR A CB  
97   O OG1 . THR A 17  ? 0.3264 0.2580 0.4043 0.0414  -0.0096 -0.0770 15  THR A OG1 
98   C CG2 . THR A 17  ? 0.2932 0.2759 0.3421 0.0346  0.0312  -0.1082 15  THR A CG2 
99   N N   . GLY A 18  ? 0.3531 0.2931 0.3197 0.0202  -0.0038 -0.0334 16  GLY A N   
100  C CA  . GLY A 18  ? 0.3467 0.2825 0.3134 0.0180  -0.0171 -0.0150 16  GLY A CA  
101  C C   . GLY A 18  ? 0.3448 0.2843 0.3059 0.0211  -0.0146 0.0087  16  GLY A C   
102  O O   . GLY A 18  ? 0.3502 0.2960 0.3277 0.0200  -0.0205 0.0202  16  GLY A O   
103  N N   . GLY A 19  ? 0.3643 0.3034 0.3061 0.0228  -0.0059 0.0130  17  GLY A N   
104  C CA  . GLY A 19  ? 0.2886 0.2286 0.2354 0.0286  -0.0049 0.0266  17  GLY A CA  
105  C C   . GLY A 19  ? 0.3457 0.2887 0.2937 0.0319  -0.0165 0.0346  17  GLY A C   
106  O O   . GLY A 19  ? 0.3080 0.2525 0.2693 0.0399  -0.0172 0.0378  17  GLY A O   
107  N N   . GLY A 20  ? 0.3353 0.2799 0.2751 0.0266  -0.0289 0.0349  18  GLY A N   
108  C CA  . GLY A 20  ? 0.2946 0.2409 0.2425 0.0303  -0.0474 0.0449  18  GLY A CA  
109  C C   . GLY A 20  ? 0.3573 0.3270 0.3488 0.0393  -0.0503 0.0417  18  GLY A C   
110  O O   . GLY A 20  ? 0.3567 0.3319 0.3745 0.0494  -0.0642 0.0441  18  GLY A O   
111  N N   . ARG A 21  ? 0.3373 0.3236 0.3421 0.0336  -0.0399 0.0361  19  ARG A N   
112  C CA  . ARG A 21  ? 0.2714 0.2929 0.3145 0.0337  -0.0386 0.0328  19  ARG A CA  
113  C C   . ARG A 21  ? 0.2979 0.3317 0.3415 0.0199  -0.0246 0.0346  19  ARG A C   
114  O O   . ARG A 21  ? 0.2950 0.3045 0.3179 0.0148  -0.0221 0.0384  19  ARG A O   
115  C CB  . ARG A 21  ? 0.2698 0.3042 0.3298 0.0292  -0.0570 0.0345  19  ARG A CB  
116  C CG  . ARG A 21  ? 0.2557 0.2793 0.3012 0.0129  -0.0613 0.0359  19  ARG A CG  
117  C CD  . ARG A 21  ? 0.2856 0.3240 0.3493 0.0054  -0.0812 0.0361  19  ARG A CD  
118  N NE  . ARG A 21  ? 0.3846 0.4207 0.4544 -0.0124 -0.0847 0.0360  19  ARG A NE  
119  C CZ  . ARG A 21  ? 0.4360 0.4799 0.5199 -0.0238 -0.1029 0.0347  19  ARG A CZ  
120  N NH1 . ARG A 21  ? 0.4496 0.4841 0.5436 -0.0415 -0.1098 0.0355  19  ARG A NH1 
121  N NH2 . ARG A 21  ? 0.3768 0.4347 0.4682 -0.0189 -0.1194 0.0344  19  ARG A NH2 
122  N N   . GLY A 22  ? 0.2765 0.3526 0.3474 0.0115  -0.0177 0.0322  20  GLY A N   
123  C CA  . GLY A 22  ? 0.2287 0.3194 0.2954 -0.0124 -0.0114 0.0430  20  GLY A CA  
124  C C   . GLY A 22  ? 0.2646 0.3425 0.3071 -0.0156 -0.0014 0.0472  20  GLY A C   
125  O O   . GLY A 22  ? 0.2479 0.3297 0.2864 -0.0023 0.0096  0.0351  20  GLY A O   
126  N N   . ILE A 23  ? 0.2857 0.3446 0.3167 -0.0340 -0.0104 0.0650  21  ILE A N   
127  C CA  . ILE A 23  ? 0.2761 0.3226 0.2875 -0.0400 -0.0082 0.0735  21  ILE A CA  
128  C C   . ILE A 23  ? 0.2803 0.2978 0.2820 -0.0154 -0.0039 0.0604  21  ILE A C   
129  O O   . ILE A 23  ? 0.3050 0.3288 0.2948 -0.0125 0.0063  0.0557  21  ILE A O   
130  C CB  . ILE A 23  ? 0.2251 0.2441 0.2382 -0.0604 -0.0306 0.0974  21  ILE A CB  
131  C CG1 . ILE A 23  ? 0.2486 0.3011 0.2625 -0.0966 -0.0352 0.1192  21  ILE A CG1 
132  C CG2 . ILE A 23  ? 0.2320 0.2295 0.2329 -0.0608 -0.0365 0.1060  21  ILE A CG2 
133  C CD1 . ILE A 23  ? 0.3126 0.3286 0.3360 -0.1207 -0.0681 0.1494  21  ILE A CD1 
134  N N   . GLY A 24  ? 0.2960 0.2854 0.3003 -0.0017 -0.0112 0.0534  22  GLY A N   
135  C CA  . GLY A 24  ? 0.2982 0.2673 0.2903 0.0135  -0.0060 0.0436  22  GLY A CA  
136  C C   . GLY A 24  ? 0.3320 0.3109 0.3181 0.0237  0.0040  0.0370  22  GLY A C   
137  O O   . GLY A 24  ? 0.2705 0.2406 0.2473 0.0277  0.0100  0.0345  22  GLY A O   
138  N N   . ALA A 25  ? 0.2265 0.2230 0.2260 0.0285  0.0023  0.0326  23  ALA A N   
139  C CA  . ALA A 25  ? 0.2643 0.2658 0.2738 0.0415  0.0051  0.0226  23  ALA A CA  
140  C C   . ALA A 25  ? 0.2738 0.2994 0.2879 0.0380  0.0193  0.0118  23  ALA A C   
141  O O   . ALA A 25  ? 0.2968 0.3136 0.3137 0.0479  0.0217  0.0007  23  ALA A O   
142  C CB  . ALA A 25  ? 0.1966 0.2148 0.2350 0.0499  -0.0052 0.0173  23  ALA A CB  
143  N N   . GLY A 26  ? 0.2183 0.2749 0.2307 0.0199  0.0268  0.0153  24  GLY A N   
144  C CA  . GLY A 26  ? 0.2647 0.3505 0.2684 0.0082  0.0406  0.0057  24  GLY A CA  
145  C C   . GLY A 26  ? 0.3329 0.3887 0.3109 0.0060  0.0381  0.0137  24  GLY A C   
146  O O   . GLY A 26  ? 0.2849 0.3492 0.2569 0.0068  0.0461  -0.0015 24  GLY A O   
147  N N   . ILE A 27  ? 0.2414 0.2646 0.2108 0.0038  0.0260  0.0328  25  ILE A N   
148  C CA  . ILE A 27  ? 0.2581 0.2571 0.2158 0.0040  0.0218  0.0381  25  ILE A CA  
149  C C   . ILE A 27  ? 0.2816 0.2609 0.2402 0.0208  0.0258  0.0257  25  ILE A C   
150  O O   . ILE A 27  ? 0.3028 0.2774 0.2542 0.0196  0.0280  0.0209  25  ILE A O   
151  C CB  . ILE A 27  ? 0.2645 0.2400 0.2299 0.0013  0.0072  0.0527  25  ILE A CB  
152  C CG1 . ILE A 27  ? 0.2512 0.2372 0.2182 -0.0202 -0.0052 0.0718  25  ILE A CG1 
153  C CG2 . ILE A 27  ? 0.2655 0.2237 0.2331 0.0041  0.0023  0.0535  25  ILE A CG2 
154  C CD1 . ILE A 27  ? 0.2672 0.2242 0.2571 -0.0203 -0.0266 0.0820  25  ILE A CD1 
155  N N   . VAL A 28  ? 0.2920 0.2586 0.2575 0.0324  0.0231  0.0235  26  VAL A N   
156  C CA  . VAL A 28  ? 0.3127 0.2574 0.2765 0.0411  0.0208  0.0198  26  VAL A CA  
157  C C   . VAL A 28  ? 0.2522 0.2031 0.2279 0.0470  0.0232  0.0035  26  VAL A C   
158  O O   . VAL A 28  ? 0.3343 0.2683 0.3060 0.0467  0.0221  0.0001  26  VAL A O   
159  C CB  . VAL A 28  ? 0.2586 0.1910 0.2236 0.0465  0.0108  0.0256  26  VAL A CB  
160  C CG1 . VAL A 28  ? 0.2809 0.1882 0.2475 0.0510  0.0004  0.0280  26  VAL A CG1 
161  C CG2 . VAL A 28  ? 0.2943 0.2212 0.2427 0.0386  0.0109  0.0327  26  VAL A CG2 
162  N N   . ARG A 29  ? 0.2283 0.2073 0.2246 0.0522  0.0267  -0.0116 27  ARG A N   
163  C CA  . ARG A 29  ? 0.2780 0.2696 0.2967 0.0609  0.0303  -0.0396 27  ARG A CA  
164  C C   . ARG A 29  ? 0.2923 0.2968 0.2895 0.0475  0.0411  -0.0489 27  ARG A C   
165  O O   . ARG A 29  ? 0.2617 0.2556 0.2674 0.0530  0.0397  -0.0687 27  ARG A O   
166  C CB  . ARG A 29  ? 0.2693 0.3060 0.3217 0.0670  0.0371  -0.0619 27  ARG A CB  
167  C CG  . ARG A 29  ? 0.2579 0.2839 0.3398 0.0814  0.0206  -0.0545 27  ARG A CG  
168  C CD  . ARG A 29  ? 0.2473 0.3286 0.3751 0.0877  0.0285  -0.0819 27  ARG A CD  
169  N NE  . ARG A 29  ? 0.2880 0.3616 0.4480 0.1005  0.0079  -0.0728 27  ARG A NE  
170  C CZ  . ARG A 29  ? 0.2893 0.3396 0.4949 0.1229  -0.0167 -0.0814 27  ARG A CZ  
171  N NH1 . ARG A 29  ? 0.2812 0.3256 0.5103 0.1293  -0.0397 -0.0676 27  ARG A NH1 
172  N NH2 . ARG A 29  ? 0.2756 0.3027 0.4903 0.1289  -0.0212 -0.0960 27  ARG A NH2 
173  N N   . ALA A 30  ? 0.2466 0.2721 0.2177 0.0278  0.0472  -0.0339 28  ALA A N   
174  C CA  . ALA A 30  ? 0.2693 0.3093 0.2151 0.0098  0.0515  -0.0370 28  ALA A CA  
175  C C   . ALA A 30  ? 0.2264 0.2279 0.1653 0.0130  0.0421  -0.0296 28  ALA A C   
176  O O   . ALA A 30  ? 0.2995 0.3035 0.2316 0.0083  0.0433  -0.0465 28  ALA A O   
177  C CB  . ALA A 30  ? 0.2887 0.3487 0.2109 -0.0150 0.0488  -0.0112 28  ALA A CB  
178  N N   . PHE A 31  ? 0.2779 0.2494 0.2199 0.0185  0.0339  -0.0082 29  PHE A N   
179  C CA  . PHE A 31  ? 0.3092 0.2554 0.2494 0.0174  0.0280  -0.0019 29  PHE A CA  
180  C C   . PHE A 31  ? 0.3599 0.2817 0.3112 0.0264  0.0248  -0.0147 29  PHE A C   
181  O O   . PHE A 31  ? 0.3826 0.2923 0.3322 0.0205  0.0210  -0.0190 29  PHE A O   
182  C CB  . PHE A 31  ? 0.2531 0.1876 0.1976 0.0181  0.0248  0.0162  29  PHE A CB  
183  C CG  . PHE A 31  ? 0.3046 0.2495 0.2518 0.0090  0.0179  0.0275  29  PHE A CG  
184  C CD1 . PHE A 31  ? 0.2630 0.2088 0.2129 0.0009  0.0107  0.0299  29  PHE A CD1 
185  C CD2 . PHE A 31  ? 0.3066 0.2570 0.2594 0.0078  0.0129  0.0371  29  PHE A CD2 
186  C CE1 . PHE A 31  ? 0.2878 0.2391 0.2497 -0.0066 -0.0046 0.0434  29  PHE A CE1 
187  C CE2 . PHE A 31  ? 0.3238 0.2750 0.2882 -0.0005 -0.0025 0.0505  29  PHE A CE2 
188  C CZ  . PHE A 31  ? 0.3024 0.2536 0.2734 -0.0068 -0.0130 0.0544  29  PHE A CZ  
189  N N   . VAL A 32  ? 0.3237 0.2349 0.2908 0.0392  0.0210  -0.0187 30  VAL A N   
190  C CA  . VAL A 32  ? 0.3323 0.2132 0.3192 0.0476  0.0085  -0.0289 30  VAL A CA  
191  C C   . VAL A 32  ? 0.3355 0.2293 0.3356 0.0507  0.0120  -0.0636 30  VAL A C   
192  O O   . VAL A 32  ? 0.3298 0.1978 0.3376 0.0489  0.0025  -0.0730 30  VAL A O   
193  C CB  . VAL A 32  ? 0.3288 0.1965 0.3382 0.0614  -0.0042 -0.0254 30  VAL A CB  
194  C CG1 . VAL A 32  ? 0.3398 0.1716 0.3842 0.0726  -0.0261 -0.0380 30  VAL A CG1 
195  C CG2 . VAL A 32  ? 0.3486 0.2030 0.3353 0.0521  -0.0090 0.0068  30  VAL A CG2 
196  N N   . ASN A 33  ? 0.2911 0.2294 0.2928 0.0517  0.0263  -0.0852 31  ASN A N   
197  C CA  . ASN A 33  ? 0.3721 0.3381 0.3811 0.0502  0.0350  -0.1266 31  ASN A CA  
198  C C   . ASN A 33  ? 0.3894 0.3537 0.3658 0.0307  0.0352  -0.1240 31  ASN A C   
199  O O   . ASN A 33  ? 0.4071 0.3778 0.3889 0.0289  0.0360  -0.1591 31  ASN A O   
200  C CB  . ASN A 33  ? 0.4288 0.4578 0.4348 0.0438  0.0549  -0.1461 31  ASN A CB  
201  C CG  . ASN A 33  ? 0.5655 0.6094 0.6224 0.0660  0.0552  -0.1691 31  ASN A CG  
202  O OD1 . ASN A 33  ? 0.6091 0.6140 0.7042 0.0847  0.0353  -0.1709 31  ASN A OD1 
203  N ND2 . ASN A 33  ? 0.5869 0.6851 0.6420 0.0560  0.0707  -0.1717 31  ASN A ND2 
204  N N   A SER A 34  ? 0.3302 0.2874 0.2793 0.0169  0.0320  -0.0872 32  SER A N   
205  N N   B SER A 34  ? 0.3256 0.2831 0.2746 0.0169  0.0321  -0.0871 32  SER A N   
206  C CA  A SER A 34  ? 0.3626 0.3200 0.2889 -0.0012 0.0268  -0.0810 32  SER A CA  
207  C CA  B SER A 34  ? 0.3628 0.3202 0.2889 -0.0012 0.0268  -0.0802 32  SER A CA  
208  C C   A SER A 34  ? 0.3869 0.3023 0.3265 0.0004  0.0141  -0.0713 32  SER A C   
209  C C   B SER A 34  ? 0.3914 0.3069 0.3314 0.0006  0.0141  -0.0735 32  SER A C   
210  O O   A SER A 34  ? 0.3984 0.3140 0.3272 -0.0141 0.0075  -0.0648 32  SER A O   
211  O O   B SER A 34  ? 0.4000 0.3155 0.3291 -0.0138 0.0076  -0.0712 32  SER A O   
212  C CB  A SER A 34  ? 0.3451 0.3203 0.2492 -0.0163 0.0246  -0.0489 32  SER A CB  
213  C CB  B SER A 34  ? 0.3431 0.3145 0.2493 -0.0151 0.0238  -0.0462 32  SER A CB  
214  O OG  A SER A 34  ? 0.3314 0.3418 0.2232 -0.0229 0.0338  -0.0499 32  SER A OG  
215  O OG  B SER A 34  ? 0.2969 0.2435 0.2187 -0.0060 0.0194  -0.0221 32  SER A OG  
216  N N   . GLY A 35  ? 0.3992 0.2809 0.3619 0.0136  0.0077  -0.0672 33  GLY A N   
217  C CA  . GLY A 35  ? 0.4360 0.2791 0.4089 0.0075  -0.0058 -0.0555 33  GLY A CA  
218  C C   . GLY A 35  ? 0.3742 0.2126 0.3401 -0.0016 -0.0046 -0.0206 33  GLY A C   
219  O O   . GLY A 35  ? 0.4102 0.2262 0.3808 -0.0141 -0.0129 -0.0075 33  GLY A O   
220  N N   . ALA A 36  ? 0.3766 0.2387 0.3333 0.0016  0.0057  -0.0084 34  ALA A N   
221  C CA  . ALA A 36  ? 0.4016 0.2682 0.3563 -0.0058 0.0102  0.0131  34  ALA A CA  
222  C C   . ALA A 36  ? 0.4314 0.2756 0.3823 -0.0055 0.0054  0.0262  34  ALA A C   
223  O O   . ALA A 36  ? 0.4094 0.2372 0.3663 0.0069  -0.0030 0.0210  34  ALA A O   
224  C CB  . ALA A 36  ? 0.3183 0.2133 0.2718 -0.0012 0.0181  0.0163  34  ALA A CB  
225  N N   . ARG A 37  ? 0.3714 0.2203 0.3144 -0.0221 0.0095  0.0427  35  ARG A N   
226  C CA  . ARG A 37  ? 0.3388 0.1803 0.2654 -0.0287 0.0069  0.0592  35  ARG A CA  
227  C C   . ARG A 37  ? 0.3676 0.2395 0.2894 -0.0205 0.0209  0.0530  35  ARG A C   
228  O O   . ARG A 37  ? 0.3792 0.2792 0.3130 -0.0190 0.0330  0.0423  35  ARG A O   
229  C CB  . ARG A 37  ? 0.3815 0.2221 0.2937 -0.0593 0.0065  0.0788  35  ARG A CB  
230  C CG  . ARG A 37  ? 0.4902 0.2829 0.4051 -0.0710 -0.0192 0.0952  35  ARG A CG  
231  C CD  . ARG A 37  ? 0.6095 0.4159 0.5163 -0.1042 -0.0173 0.1119  35  ARG A CD  
232  N NE  . ARG A 37  ? 0.6308 0.4647 0.5495 -0.1147 0.0001  0.1007  35  ARG A NE  
233  C CZ  . ARG A 37  ? 0.7005 0.5608 0.6208 -0.1439 0.0079  0.1087  35  ARG A CZ  
234  N NH1 . ARG A 37  ? 0.6193 0.4807 0.5224 -0.1647 -0.0002 0.1278  35  ARG A NH1 
235  N NH2 . ARG A 37  ? 0.6137 0.5072 0.5585 -0.1480 0.0218  0.0934  35  ARG A NH2 
236  N N   . VAL A 38  ? 0.3319 0.1958 0.2435 -0.0138 0.0145  0.0586  36  VAL A N   
237  C CA  . VAL A 38  ? 0.3562 0.2428 0.2672 -0.0046 0.0236  0.0500  36  VAL A CA  
238  C C   . VAL A 38  ? 0.3439 0.2345 0.2290 -0.0184 0.0224  0.0602  36  VAL A C   
239  O O   . VAL A 38  ? 0.3886 0.2553 0.2591 -0.0253 0.0048  0.0785  36  VAL A O   
240  C CB  . VAL A 38  ? 0.3568 0.2404 0.2814 0.0150  0.0177  0.0425  36  VAL A CB  
241  C CG1 . VAL A 38  ? 0.2873 0.1898 0.2125 0.0196  0.0230  0.0376  36  VAL A CG1 
242  C CG2 . VAL A 38  ? 0.3123 0.2002 0.2512 0.0208  0.0200  0.0312  36  VAL A CG2 
243  N N   . VAL A 39  ? 0.2796 0.2007 0.1616 -0.0234 0.0378  0.0469  37  VAL A N   
244  C CA  . VAL A 39  ? 0.3490 0.2837 0.2020 -0.0379 0.0396  0.0480  37  VAL A CA  
245  C C   . VAL A 39  ? 0.3889 0.3229 0.2529 -0.0194 0.0345  0.0379  37  VAL A C   
246  O O   . VAL A 39  ? 0.3654 0.3116 0.2571 -0.0061 0.0418  0.0193  37  VAL A O   
247  C CB  . VAL A 39  ? 0.3869 0.3646 0.2354 -0.0564 0.0627  0.0284  37  VAL A CB  
248  C CG1 . VAL A 39  ? 0.3664 0.3672 0.1814 -0.0726 0.0677  0.0194  37  VAL A CG1 
249  C CG2 . VAL A 39  ? 0.3524 0.3368 0.1893 -0.0819 0.0681  0.0423  37  VAL A CG2 
250  N N   . ILE A 40  ? 0.3897 0.3073 0.2378 -0.0195 0.0170  0.0527  38  ILE A N   
251  C CA  . ILE A 40  ? 0.3844 0.3054 0.2426 -0.0070 0.0109  0.0446  38  ILE A CA  
252  C C   . ILE A 40  ? 0.3316 0.2745 0.1640 -0.0226 0.0173  0.0313  38  ILE A C   
253  O O   . ILE A 40  ? 0.3822 0.3280 0.1742 -0.0451 0.0106  0.0442  38  ILE A O   
254  C CB  . ILE A 40  ? 0.4004 0.3017 0.2644 0.0012  -0.0123 0.0615  38  ILE A CB  
255  C CG1 . ILE A 40  ? 0.3402 0.2250 0.2320 0.0153  -0.0171 0.0650  38  ILE A CG1 
256  C CG2 . ILE A 40  ? 0.3634 0.2759 0.2450 0.0121  -0.0165 0.0519  38  ILE A CG2 
257  C CD1 . ILE A 40  ? 0.3840 0.2456 0.2887 0.0209  -0.0449 0.0800  38  ILE A CD1 
258  N N   . CYS A 41  ? 0.3225 0.2806 0.1781 -0.0134 0.0272  0.0052  39  CYS A N   
259  C CA  . CYS A 41  ? 0.3257 0.3063 0.1664 -0.0245 0.0334  -0.0195 39  CYS A CA  
260  C C   . CYS A 41  ? 0.3596 0.3291 0.2106 -0.0154 0.0169  -0.0206 39  CYS A C   
261  O O   . CYS A 41  ? 0.3476 0.3038 0.2349 0.0013  0.0103  -0.0173 39  CYS A O   
262  C CB  . CYS A 41  ? 0.3802 0.3849 0.2545 -0.0193 0.0523  -0.0558 39  CYS A CB  
263  S SG  . CYS A 41  ? 0.4446 0.4637 0.3393 -0.0151 0.0517  -0.0991 39  CYS A SG  
264  N N   . ASP A 42  ? 0.3567 0.2875 0.2626 -0.0335 -0.0509 0.0105  40  ASP A N   
265  C CA  . ASP A 42  ? 0.3381 0.2782 0.2563 -0.0508 -0.0449 -0.0003 40  ASP A CA  
266  C C   . ASP A 42  ? 0.3711 0.3336 0.2961 -0.0522 -0.0547 -0.0187 40  ASP A C   
267  O O   . ASP A 42  ? 0.3765 0.3477 0.2851 -0.0343 -0.0635 -0.0148 40  ASP A O   
268  C CB  . ASP A 42  ? 0.3490 0.3196 0.2855 -0.0545 -0.0432 -0.0022 40  ASP A CB  
269  C CG  . ASP A 42  ? 0.4156 0.3816 0.3767 -0.0773 -0.0215 -0.0158 40  ASP A CG  
270  O OD1 . ASP A 42  ? 0.3743 0.3647 0.3692 -0.0929 -0.0205 -0.0450 40  ASP A OD1 
271  O OD2 . ASP A 42  ? 0.3896 0.3260 0.3383 -0.0779 -0.0013 -0.0015 40  ASP A OD2 
272  N N   . LYS A 43  ? 0.3717 0.3392 0.3203 -0.0712 -0.0477 -0.0419 41  LYS A N   
273  C CA  . LYS A 43  ? 0.4117 0.4128 0.3719 -0.0684 -0.0624 -0.0717 41  LYS A CA  
274  C C   . LYS A 43  ? 0.4253 0.4915 0.4060 -0.0558 -0.0813 -0.0975 41  LYS A C   
275  O O   . LYS A 43  ? 0.4346 0.5362 0.4048 -0.0330 -0.1029 -0.1207 41  LYS A O   
276  C CB  . LYS A 43  ? 0.4222 0.4076 0.4137 -0.0949 -0.0457 -0.0987 41  LYS A CB  
277  C CG  . LYS A 43  ? 0.4941 0.4940 0.5428 -0.1237 -0.0221 -0.1260 41  LYS A CG  
278  C CD  . LYS A 43  ? 0.5725 0.5495 0.6626 -0.1532 0.0059  -0.1596 41  LYS A CD  
279  C CE  . LYS A 43  ? 0.6314 0.6228 0.7931 -0.1831 0.0419  -0.1919 41  LYS A CE  
280  N N   . ASP A 44  ? 0.3644 0.4487 0.3692 -0.0633 -0.0752 -0.0965 42  ASP A N   
281  C CA  . ASP A 44  ? 0.4175 0.5696 0.4455 -0.0465 -0.0951 -0.1245 42  ASP A CA  
282  C C   . ASP A 44  ? 0.4896 0.6336 0.4763 -0.0189 -0.1006 -0.0887 42  ASP A C   
283  O O   . ASP A 44  ? 0.3954 0.4974 0.3700 -0.0290 -0.0835 -0.0555 42  ASP A O   
284  C CB  . ASP A 44  ? 0.3294 0.5137 0.4311 -0.0790 -0.0778 -0.1597 42  ASP A CB  
285  C CG  . ASP A 44  ? 0.3876 0.5921 0.5495 -0.1046 -0.0676 -0.2111 42  ASP A CG  
286  N N   . GLU A 45  ? 0.4780 0.6610 0.4403 0.0217  -0.1235 -0.0993 43  GLU A N   
287  C CA  . GLU A 45  ? 0.5154 0.6751 0.4297 0.0531  -0.1201 -0.0636 43  GLU A CA  
288  C C   . GLU A 45  ? 0.4550 0.6428 0.3993 0.0485  -0.1193 -0.0650 43  GLU A C   
289  O O   . GLU A 45  ? 0.4639 0.6174 0.3880 0.0532  -0.1050 -0.0322 43  GLU A O   
290  C CB  . GLU A 45  ? 0.6513 0.8090 0.5153 0.1040  -0.1261 -0.0627 43  GLU A CB  
291  C CG  . GLU A 45  ? 0.7801 0.8868 0.5896 0.1355  -0.1048 -0.0230 43  GLU A CG  
292  C CD  . GLU A 45  ? 0.9390 0.9900 0.6914 0.1611  -0.0847 -0.0025 43  GLU A CD  
293  O OE1 . GLU A 45  ? 0.9937 0.9851 0.7199 0.1631  -0.0528 0.0302  43  GLU A OE1 
294  O OE2 . GLU A 45  ? 0.9718 1.0382 0.7114 0.1788  -0.0964 -0.0226 43  GLU A OE2 
295  N N   . SER A 46  ? 0.4029 0.6521 0.4049 0.0366  -0.1294 -0.1073 44  SER A N   
296  C CA  . SER A 46  ? 0.4066 0.6907 0.4367 0.0424  -0.1295 -0.1158 44  SER A CA  
297  C C   . SER A 46  ? 0.4468 0.6944 0.4752 0.0208  -0.1088 -0.0806 44  SER A C   
298  O O   . SER A 46  ? 0.3894 0.6255 0.3876 0.0452  -0.1091 -0.0566 44  SER A O   
299  C CB  . SER A 46  ? 0.3518 0.6933 0.4622 0.0193  -0.1270 -0.1700 44  SER A CB  
300  N N   . GLY A 47  ? 0.3769 0.5926 0.4312 -0.0205 -0.0838 -0.0753 45  GLY A N   
301  C CA  . GLY A 47  ? 0.3021 0.4797 0.3476 -0.0326 -0.0626 -0.0457 45  GLY A CA  
302  C C   . GLY A 47  ? 0.3540 0.4819 0.3505 -0.0174 -0.0627 -0.0096 45  GLY A C   
303  O O   . GLY A 47  ? 0.2699 0.3896 0.2569 -0.0074 -0.0592 0.0063  45  GLY A O   
304  N N   . GLY A 48  ? 0.2806 0.3788 0.2552 -0.0167 -0.0645 -0.0030 46  GLY A N   
305  C CA  . GLY A 48  ? 0.3175 0.3751 0.2670 -0.0081 -0.0591 0.0187  46  GLY A CA  
306  C C   . GLY A 48  ? 0.2928 0.3468 0.2255 0.0174  -0.0573 0.0293  46  GLY A C   
307  O O   . GLY A 48  ? 0.3426 0.3756 0.2787 0.0199  -0.0459 0.0384  46  GLY A O   
308  N N   . ARG A 49  ? 0.2954 0.3668 0.2077 0.0414  -0.0657 0.0247  47  ARG A N   
309  C CA  . ARG A 49  ? 0.3833 0.4341 0.2607 0.0764  -0.0546 0.0405  47  ARG A CA  
310  C C   . ARG A 49  ? 0.4136 0.4764 0.3061 0.0801  -0.0511 0.0447  47  ARG A C   
311  O O   . ARG A 49  ? 0.3931 0.4188 0.2773 0.0900  -0.0281 0.0601  47  ARG A O   
312  C CB  . ARG A 49  ? 0.5026 0.5738 0.3382 0.1172  -0.0701 0.0319  47  ARG A CB  
313  C CG  . ARG A 49  ? 0.7233 0.7349 0.5040 0.1510  -0.0425 0.0524  47  ARG A CG  
314  C CD  . ARG A 49  ? 0.7529 0.7222 0.5241 0.1353  -0.0257 0.0630  47  ARG A CD  
315  N N   . ALA A 50  ? 0.3385 0.4521 0.2598 0.0707  -0.0685 0.0272  48  ALA A N   
316  C CA  . ALA A 50  ? 0.2749 0.4041 0.2116 0.0743  -0.0656 0.0292  48  ALA A CA  
317  C C   . ALA A 50  ? 0.3009 0.4006 0.2541 0.0516  -0.0500 0.0395  48  ALA A C   
318  O O   . ALA A 50  ? 0.3072 0.3957 0.2620 0.0614  -0.0395 0.0465  48  ALA A O   
319  C CB  . ALA A 50  ? 0.2646 0.4562 0.2403 0.0640  -0.0808 0.0017  48  ALA A CB  
320  N N   . LEU A 51  ? 0.2867 0.3742 0.2494 0.0274  -0.0495 0.0364  49  LEU A N   
321  C CA  . LEU A 51  ? 0.2622 0.3303 0.2324 0.0190  -0.0429 0.0376  49  LEU A CA  
322  C C   . LEU A 51  ? 0.2949 0.3364 0.2717 0.0273  -0.0310 0.0371  49  LEU A C   
323  O O   . LEU A 51  ? 0.3070 0.3480 0.3031 0.0295  -0.0261 0.0280  49  LEU A O   
324  C CB  . LEU A 51  ? 0.3728 0.4270 0.3359 0.0053  -0.0450 0.0348  49  LEU A CB  
325  C CG  . LEU A 51  ? 0.4732 0.5225 0.4268 0.0002  -0.0382 0.0359  49  LEU A CG  
326  C CD1 . LEU A 51  ? 0.4495 0.4638 0.3757 0.0039  -0.0363 0.0377  49  LEU A CD1 
327  C CD2 . LEU A 51  ? 0.4021 0.4602 0.3560 0.0124  -0.0367 0.0357  49  LEU A CD2 
328  N N   . GLU A 52  ? 0.2824 0.3011 0.2488 0.0315  -0.0218 0.0415  50  GLU A N   
329  C CA  . GLU A 52  ? 0.3424 0.3270 0.3244 0.0358  0.0054  0.0382  50  GLU A CA  
330  C C   . GLU A 52  ? 0.3597 0.3298 0.3405 0.0517  0.0262  0.0459  50  GLU A C   
331  O O   . GLU A 52  ? 0.3447 0.2979 0.3629 0.0469  0.0496  0.0318  50  GLU A O   
332  C CB  . GLU A 52  ? 0.3896 0.3413 0.3490 0.0419  0.0219  0.0469  50  GLU A CB  
333  C CG  . GLU A 52  ? 0.3962 0.2975 0.3666 0.0495  0.0688  0.0486  50  GLU A CG  
334  C CD  . GLU A 52  ? 0.4999 0.3541 0.4440 0.0581  0.0991  0.0588  50  GLU A CD  
335  O OE1 . GLU A 52  ? 0.7038 0.5003 0.6490 0.0670  0.1524  0.0648  50  GLU A OE1 
336  O OE2 . GLU A 52  ? 0.4164 0.2836 0.3392 0.0563  0.0776  0.0603  50  GLU A OE2 
337  N N   . GLN A 53  ? 0.3254 0.3037 0.2678 0.0739  0.0190  0.0623  51  GLN A N   
338  C CA  . GLN A 53  ? 0.3415 0.2997 0.2729 0.0969  0.0397  0.0720  51  GLN A CA  
339  C C   . GLN A 53  ? 0.3283 0.3154 0.2996 0.0827  0.0311  0.0579  51  GLN A C   
340  O O   . GLN A 53  ? 0.3878 0.3498 0.3764 0.0882  0.0571  0.0550  51  GLN A O   
341  C CB  . GLN A 53  ? 0.4031 0.3757 0.2815 0.1350  0.0251  0.0854  51  GLN A CB  
342  C CG  . GLN A 53  ? 0.4059 0.3452 0.2275 0.1644  0.0342  0.0985  51  GLN A CG  
343  C CD  . GLN A 53  ? 0.5118 0.3636 0.3122 0.1758  0.0916  0.1168  51  GLN A CD  
344  O OE1 . GLN A 53  ? 0.6337 0.4587 0.4466 0.1567  0.1098  0.1142  51  GLN A OE1 
345  N NE2 . GLN A 53  ? 0.6040 0.4161 0.3827 0.2005  0.1251  0.1267  51  GLN A NE2 
346  N N   . GLU A 54  ? 0.2882 0.3203 0.2719 0.0662  0.0013  0.0482  52  GLU A N   
347  C CA  . GLU A 54  ? 0.3196 0.3772 0.3246 0.0608  -0.0065 0.0379  52  GLU A CA  
348  C C   . GLU A 54  ? 0.2866 0.3373 0.3263 0.0515  -0.0008 0.0149  52  GLU A C   
349  O O   . GLU A 54  ? 0.2762 0.3325 0.3382 0.0561  0.0055  0.0017  52  GLU A O   
350  C CB  . GLU A 54  ? 0.3217 0.4145 0.3202 0.0500  -0.0271 0.0370  52  GLU A CB  
351  C CG  . GLU A 54  ? 0.3666 0.4745 0.3736 0.0484  -0.0290 0.0293  52  GLU A CG  
352  C CD  . GLU A 54  ? 0.2648 0.3853 0.2603 0.0376  -0.0316 0.0310  52  GLU A CD  
353  O OE1 . GLU A 54  ? 0.2868 0.4121 0.2814 0.0257  -0.0321 0.0329  52  GLU A OE1 
354  O OE2 . GLU A 54  ? 0.3068 0.4282 0.2941 0.0426  -0.0277 0.0282  52  GLU A OE2 
355  N N   . LEU A 55  ? 0.2584 0.3042 0.3076 0.0420  -0.0058 0.0027  53  LEU A N   
356  C CA  . LEU A 55  ? 0.2593 0.3192 0.3435 0.0416  -0.0133 -0.0320 53  LEU A CA  
357  C C   . LEU A 55  ? 0.2483 0.2894 0.3867 0.0337  0.0139  -0.0582 53  LEU A C   
358  O O   . LEU A 55  ? 0.2273 0.2495 0.3662 0.0263  0.0235  -0.0548 53  LEU A O   
359  C CB  . LEU A 55  ? 0.2408 0.3115 0.2986 0.0446  -0.0380 -0.0347 53  LEU A CB  
360  C CG  . LEU A 55  ? 0.3337 0.4071 0.3423 0.0473  -0.0479 -0.0094 53  LEU A CG  
361  C CD1 . LEU A 55  ? 0.3678 0.4296 0.3420 0.0540  -0.0590 -0.0082 53  LEU A CD1 
362  C CD2 . LEU A 55  ? 0.3190 0.4084 0.3225 0.0601  -0.0502 -0.0149 53  LEU A CD2 
363  N N   . PRO A 56  ? 0.2983 0.3429 0.4903 0.0329  0.0320  -0.0898 54  PRO A N   
364  C CA  . PRO A 56  ? 0.2871 0.3201 0.5545 0.0195  0.0642  -0.1312 54  PRO A CA  
365  C C   . PRO A 56  ? 0.3224 0.3987 0.6179 0.0217  0.0322  -0.1717 54  PRO A C   
366  O O   . PRO A 56  ? 0.4546 0.5755 0.7356 0.0413  -0.0099 -0.1916 54  PRO A O   
367  C CB  . PRO A 56  ? 0.3353 0.3767 0.6614 0.0176  0.0829  -0.1670 54  PRO A CB  
368  C CG  . PRO A 56  ? 0.3660 0.3997 0.6321 0.0320  0.0742  -0.1256 54  PRO A CG  
369  C CD  . PRO A 56  ? 0.3385 0.3956 0.5337 0.0416  0.0308  -0.0930 54  PRO A CD  
370  N N   . GLY A 57  ? 0.2559 0.3150 0.5813 0.0086  0.0536  -0.1820 55  GLY A N   
371  C CA  . GLY A 57  ? 0.2341 0.3365 0.5789 0.0119  0.0202  -0.2152 55  GLY A CA  
372  C C   . GLY A 57  ? 0.2278 0.3202 0.5020 0.0243  -0.0056 -0.1819 55  GLY A C   
373  O O   . GLY A 57  ? 0.2538 0.3743 0.5396 0.0358  -0.0304 -0.2113 55  GLY A O   
374  N N   . ALA A 58  ? 0.2357 0.2933 0.4358 0.0217  -0.0028 -0.1219 56  ALA A N   
375  C CA  . ALA A 58  ? 0.2593 0.3008 0.4013 0.0218  -0.0165 -0.0881 56  ALA A CA  
376  C C   . ALA A 58  ? 0.2819 0.2803 0.4104 0.0097  0.0174  -0.0590 56  ALA A C   
377  O O   . ALA A 58  ? 0.2875 0.2606 0.4073 0.0108  0.0435  -0.0401 56  ALA A O   
378  C CB  . ALA A 58  ? 0.2421 0.2856 0.3179 0.0304  -0.0395 -0.0544 56  ALA A CB  
379  N N   . VAL A 59  ? 0.2629 0.2494 0.3818 0.0054  0.0179  -0.0559 57  VAL A N   
380  C CA  . VAL A 59  ? 0.3773 0.3222 0.4627 0.0040  0.0449  -0.0264 57  VAL A CA  
381  C C   . VAL A 59  ? 0.3890 0.3394 0.4260 0.0053  0.0167  -0.0083 57  VAL A C   
382  O O   . VAL A 59  ? 0.3288 0.3001 0.3678 0.0044  -0.0100 -0.0210 57  VAL A O   
383  C CB  . VAL A 59  ? 0.2689 0.1821 0.3999 -0.0047 0.0907  -0.0457 57  VAL A CB  
384  C CG1 . VAL A 59  ? 0.2834 0.1882 0.4830 -0.0123 0.1297  -0.0748 57  VAL A CG1 
385  C CG2 . VAL A 59  ? 0.2977 0.2360 0.4627 -0.0117 0.0737  -0.0764 57  VAL A CG2 
386  N N   . PHE A 60  ? 0.4157 0.3452 0.4058 0.0131  0.0241  0.0183  58  PHE A N   
387  C CA  . PHE A 60  ? 0.3941 0.3337 0.3485 0.0125  -0.0002 0.0275  58  PHE A CA  
388  C C   . PHE A 60  ? 0.3385 0.2510 0.2788 0.0153  0.0156  0.0290  58  PHE A C   
389  O O   . PHE A 60  ? 0.3514 0.2288 0.2706 0.0300  0.0474  0.0407  58  PHE A O   
390  C CB  . PHE A 60  ? 0.4217 0.3775 0.3412 0.0246  -0.0129 0.0417  58  PHE A CB  
391  C CG  . PHE A 60  ? 0.3597 0.3320 0.2597 0.0220  -0.0330 0.0378  58  PHE A CG  
392  C CD1 . PHE A 60  ? 0.3337 0.3203 0.2494 0.0020  -0.0475 0.0285  58  PHE A CD1 
393  C CD2 . PHE A 60  ? 0.4488 0.4162 0.3114 0.0439  -0.0327 0.0407  58  PHE A CD2 
394  C CE1 . PHE A 60  ? 0.3343 0.3321 0.2454 -0.0056 -0.0578 0.0179  58  PHE A CE1 
395  C CE2 . PHE A 60  ? 0.4419 0.4337 0.2984 0.0413  -0.0532 0.0254  58  PHE A CE2 
396  C CZ  . PHE A 60  ? 0.3502 0.3580 0.2396 0.0116  -0.0639 0.0118  58  PHE A CZ  
397  N N   . ILE A 61  ? 0.3617 0.2818 0.3044 0.0056  -0.0015 0.0197  59  ILE A N   
398  C CA  . ILE A 61  ? 0.4138 0.3121 0.3391 0.0085  0.0094  0.0204  59  ILE A CA  
399  C C   . ILE A 61  ? 0.4236 0.3371 0.3209 0.0062  -0.0175 0.0214  59  ILE A C   
400  O O   . ILE A 61  ? 0.3723 0.2969 0.2813 -0.0063 -0.0348 0.0140  59  ILE A O   
401  C CB  . ILE A 61  ? 0.4006 0.2931 0.3697 -0.0011 0.0206  -0.0016 59  ILE A CB  
402  C CG1 . ILE A 61  ? 0.4020 0.2807 0.4180 -0.0033 0.0587  -0.0148 59  ILE A CG1 
403  C CG2 . ILE A 61  ? 0.4278 0.2993 0.3762 0.0010  0.0298  -0.0005 59  ILE A CG2 
404  C CD1 . ILE A 61  ? 0.3781 0.2682 0.4636 -0.0135 0.0711  -0.0539 59  ILE A CD1 
405  N N   . LEU A 62  ? 0.4172 0.3278 0.2754 0.0229  -0.0174 0.0273  60  LEU A N   
406  C CA  . LEU A 62  ? 0.4503 0.3835 0.2979 0.0193  -0.0411 0.0146  60  LEU A CA  
407  C C   . LEU A 62  ? 0.4960 0.4114 0.3527 0.0055  -0.0396 0.0067  60  LEU A C   
408  O O   . LEU A 62  ? 0.4701 0.3594 0.3186 0.0128  -0.0212 0.0099  60  LEU A O   
409  C CB  . LEU A 62  ? 0.5201 0.4630 0.3213 0.0521  -0.0468 0.0123  60  LEU A CB  
410  C CG  . LEU A 62  ? 0.4927 0.4788 0.2997 0.0505  -0.0756 -0.0176 60  LEU A CG  
411  C CD1 . LEU A 62  ? 0.4261 0.4594 0.2712 0.0381  -0.0923 -0.0351 60  LEU A CD1 
412  C CD2 . LEU A 62  ? 0.5617 0.5532 0.3104 0.0961  -0.0833 -0.0252 60  LEU A CD2 
413  N N   . CYS A 63  ? 0.4275 0.3501 0.3012 -0.0133 -0.0522 -0.0035 61  CYS A N   
414  C CA  . CYS A 63  ? 0.3861 0.2859 0.2627 -0.0210 -0.0505 -0.0096 61  CYS A CA  
415  C C   . CYS A 63  ? 0.4268 0.3239 0.3102 -0.0375 -0.0547 -0.0198 61  CYS A C   
416  O O   . CYS A 63  ? 0.4744 0.3685 0.3660 -0.0454 -0.0507 -0.0152 61  CYS A O   
417  C CB  . CYS A 63  ? 0.4327 0.3188 0.3257 -0.0180 -0.0453 -0.0073 61  CYS A CB  
418  S SG  . CYS A 63  ? 0.5047 0.3659 0.3945 -0.0159 -0.0489 -0.0173 61  CYS A SG  
419  N N   . ASP A 64  ? 0.3541 0.2468 0.2348 -0.0425 -0.0562 -0.0352 62  ASP A N   
420  C CA  . ASP A 64  ? 0.3563 0.2305 0.2507 -0.0617 -0.0473 -0.0488 62  ASP A CA  
421  C C   . ASP A 64  ? 0.5019 0.3278 0.3773 -0.0553 -0.0385 -0.0373 62  ASP A C   
422  O O   . ASP A 64  ? 0.4302 0.2504 0.2970 -0.0471 -0.0430 -0.0415 62  ASP A O   
423  C CB  . ASP A 64  ? 0.3837 0.2846 0.2929 -0.0680 -0.0549 -0.0815 62  ASP A CB  
424  C CG  . ASP A 64  ? 0.4999 0.3796 0.4407 -0.0948 -0.0353 -0.1048 62  ASP A CG  
425  O OD1 . ASP A 64  ? 0.4748 0.2966 0.4028 -0.1006 -0.0114 -0.0858 62  ASP A OD1 
426  O OD2 . ASP A 64  ? 0.4624 0.3818 0.4403 -0.1059 -0.0409 -0.1463 62  ASP A OD2 
427  N N   . VAL A 65  ? 0.4324 0.2219 0.2946 -0.0523 -0.0250 -0.0238 63  VAL A N   
428  C CA  . VAL A 65  ? 0.4781 0.2248 0.3097 -0.0298 -0.0225 -0.0145 63  VAL A CA  
429  C C   . VAL A 65  ? 0.4745 0.1832 0.2979 -0.0350 -0.0100 -0.0237 63  VAL A C   
430  O O   . VAL A 65  ? 0.5696 0.2507 0.3681 -0.0111 -0.0133 -0.0205 63  VAL A O   
431  C CB  . VAL A 65  ? 0.5474 0.2542 0.3430 -0.0089 -0.0100 0.0037  63  VAL A CB  
432  C CG1 . VAL A 65  ? 0.5012 0.2480 0.3062 -0.0004 -0.0250 0.0085  63  VAL A CG1 
433  C CG2 . VAL A 65  ? 0.5748 0.2291 0.3608 -0.0268 0.0291  0.0092  63  VAL A CG2 
434  N N   . THR A 66  ? 0.4475 0.2660 0.2727 -0.0417 -0.0062 -0.0793 64  THR A N   
435  C CA  . THR A 66  ? 0.4788 0.2703 0.2840 -0.0548 0.0106  -0.1037 64  THR A CA  
436  C C   . THR A 66  ? 0.6057 0.3947 0.3760 -0.0729 0.0235  -0.1206 64  THR A C   
437  O O   . THR A 66  ? 0.5612 0.3264 0.3145 -0.0855 0.0439  -0.1469 64  THR A O   
438  C CB  . THR A 66  ? 0.5224 0.3051 0.3115 -0.0761 0.0007  -0.1053 64  THR A CB  
439  O OG1 . THR A 66  ? 0.5585 0.3596 0.3164 -0.1028 -0.0161 -0.0963 64  THR A OG1 
440  C CG2 . THR A 66  ? 0.4670 0.2564 0.2880 -0.0625 -0.0121 -0.0882 64  THR A CG2 
441  N N   . GLN A 67  ? 0.5560 0.3678 0.3155 -0.0767 0.0138  -0.1075 65  GLN A N   
442  C CA  . GLN A 67  ? 0.6281 0.4421 0.3502 -0.0984 0.0243  -0.1206 65  GLN A CA  
443  C C   . GLN A 67  ? 0.5827 0.4031 0.3254 -0.0764 0.0385  -0.1226 65  GLN A C   
444  O O   . GLN A 67  ? 0.5047 0.3434 0.2655 -0.0620 0.0250  -0.1010 65  GLN A O   
445  C CB  . GLN A 67  ? 0.6709 0.5073 0.3638 -0.1248 -0.0013 -0.0994 65  GLN A CB  
446  C CG  . GLN A 67  ? 0.6359 0.4736 0.3173 -0.1454 -0.0203 -0.0906 65  GLN A CG  
447  C CD  . GLN A 67  ? 0.7329 0.5532 0.3859 -0.1695 -0.0029 -0.1158 65  GLN A CD  
448  O OE1 . GLN A 67  ? 0.8269 0.6542 0.4565 -0.1899 0.0086  -0.1234 65  GLN A OE1 
449  N NE2 . GLN A 67  ? 0.7781 0.5795 0.4442 -0.1640 0.0009  -0.1249 65  GLN A NE2 
450  N N   . GLU A 68  ? 0.5721 0.3794 0.3184 -0.0736 0.0665  -0.1477 66  GLU A N   
451  C CA  . GLU A 68  ? 0.5736 0.3890 0.3494 -0.0506 0.0808  -0.1489 66  GLU A CA  
452  C C   . GLU A 68  ? 0.5681 0.4049 0.3203 -0.0607 0.0740  -0.1386 66  GLU A C   
453  O O   . GLU A 68  ? 0.5471 0.3978 0.3248 -0.0409 0.0714  -0.1252 66  GLU A O   
454  C CB  . GLU A 68  ? 0.6540 0.4650 0.4553 -0.0449 0.1065  -0.1681 66  GLU A CB  
455  C CG  . GLU A 68  ? 0.7273 0.5499 0.5687 -0.0206 0.1195  -0.1666 66  GLU A CG  
456  N N   . ASP A 69  ? 0.5717 0.4175 0.2834 -0.0918 0.0672  -0.1379 67  ASP A N   
457  C CA  . ASP A 69  ? 0.5970 0.4631 0.2869 -0.1046 0.0579  -0.1240 67  ASP A CA  
458  C C   . ASP A 69  ? 0.5813 0.4584 0.2828 -0.0955 0.0278  -0.0915 67  ASP A C   
459  O O   . ASP A 69  ? 0.5890 0.4793 0.2980 -0.0889 0.0220  -0.0768 67  ASP A O   
460  C CB  . ASP A 69  ? 0.6463 0.5229 0.3010 -0.1410 0.0564  -0.1251 67  ASP A CB  
461  C CG  . ASP A 69  ? 0.8187 0.6927 0.4779 -0.1467 0.0876  -0.1519 67  ASP A CG  
462  O OD1 . ASP A 69  ? 0.8669 0.7397 0.5589 -0.1220 0.1067  -0.1631 67  ASP A OD1 
463  O OD2 . ASP A 69  ? 0.9092 0.7836 0.5416 -0.1772 0.0932  -0.1607 67  ASP A OD2 
464  N N   . ASP A 70  ? 0.5674 0.4414 0.2785 -0.0945 0.0090  -0.0786 68  ASP A N   
465  C CA  . ASP A 70  ? 0.5408 0.4257 0.2844 -0.0774 -0.0135 -0.0503 68  ASP A CA  
466  C C   . ASP A 70  ? 0.5265 0.4110 0.3077 -0.0456 -0.0031 -0.0506 68  ASP A C   
467  O O   . ASP A 70  ? 0.4926 0.3869 0.2887 -0.0368 -0.0112 -0.0346 68  ASP A O   
468  C CB  . ASP A 70  ? 0.5959 0.4784 0.3529 -0.0775 -0.0285 -0.0418 68  ASP A CB  
469  C CG  . ASP A 70  ? 0.6153 0.5085 0.3457 -0.1090 -0.0506 -0.0264 68  ASP A CG  
470  O OD1 . ASP A 70  ? 0.6391 0.5359 0.3271 -0.1381 -0.0499 -0.0305 68  ASP A OD1 
471  O OD2 . ASP A 70  ? 0.5704 0.4713 0.3234 -0.1070 -0.0691 -0.0091 68  ASP A OD2 
472  N N   . VAL A 71  ? 0.5216 0.3944 0.3191 -0.0306 0.0142  -0.0676 69  VAL A N   
473  C CA  . VAL A 71  ? 0.4432 0.3192 0.2761 -0.0049 0.0196  -0.0633 69  VAL A CA  
474  C C   . VAL A 71  ? 0.4256 0.3118 0.2579 -0.0015 0.0303  -0.0651 69  VAL A C   
475  O O   . VAL A 71  ? 0.4137 0.3095 0.2638 0.0101  0.0259  -0.0530 69  VAL A O   
476  C CB  . VAL A 71  ? 0.5330 0.3956 0.3877 0.0080  0.0313  -0.0747 69  VAL A CB  
477  C CG1 . VAL A 71  ? 0.4466 0.3174 0.3348 0.0286  0.0312  -0.0640 69  VAL A CG1 
478  C CG2 . VAL A 71  ? 0.5043 0.3562 0.3558 0.0012  0.0213  -0.0739 69  VAL A CG2 
479  N N   . LYS A 72  ? 0.4587 0.3436 0.2698 -0.0141 0.0464  -0.0821 70  LYS A N   
480  C CA  . LYS A 72  ? 0.5141 0.4124 0.3234 -0.0142 0.0571  -0.0839 70  LYS A CA  
481  C C   . LYS A 72  ? 0.4766 0.3860 0.2719 -0.0230 0.0389  -0.0632 70  LYS A C   
482  O O   . LYS A 72  ? 0.4349 0.3543 0.2440 -0.0139 0.0390  -0.0545 70  LYS A O   
483  C CB  . LYS A 72  ? 0.5763 0.4725 0.3608 -0.0321 0.0795  -0.1084 70  LYS A CB  
484  C CG  . LYS A 72  ? 0.6121 0.5244 0.4027 -0.0303 0.0964  -0.1144 70  LYS A CG  
485  N N   . THR A 73  ? 0.4804 0.3881 0.2504 -0.0425 0.0222  -0.0533 71  THR A N   
486  C CA  . THR A 73  ? 0.4660 0.3817 0.2315 -0.0504 0.0026  -0.0295 71  THR A CA  
487  C C   . THR A 73  ? 0.4403 0.3544 0.2439 -0.0281 -0.0072 -0.0149 71  THR A C   
488  O O   . THR A 73  ? 0.4358 0.3535 0.2487 -0.0247 -0.0115 -0.0029 71  THR A O   
489  C CB  . THR A 73  ? 0.5106 0.4276 0.2486 -0.0768 -0.0163 -0.0172 71  THR A CB  
490  O OG1 . THR A 73  ? 0.5487 0.4697 0.2427 -0.1048 -0.0051 -0.0317 71  THR A OG1 
491  C CG2 . THR A 73  ? 0.5509 0.4741 0.3002 -0.0808 -0.0407 0.0138  71  THR A CG2 
492  N N   . LEU A 74  ? 0.4155 0.3232 0.2401 -0.0151 -0.0084 -0.0178 72  LEU A N   
493  C CA  . LEU A 74  ? 0.3828 0.2901 0.2408 0.0024  -0.0128 -0.0088 72  LEU A CA  
494  C C   . LEU A 74  ? 0.4144 0.3261 0.2828 0.0134  -0.0008 -0.0128 72  LEU A C   
495  O O   . LEU A 74  ? 0.3936 0.3062 0.2748 0.0168  -0.0041 -0.0038 72  LEU A O   
496  C CB  . LEU A 74  ? 0.3699 0.2722 0.2439 0.0111  -0.0127 -0.0141 72  LEU A CB  
497  C CG  . LEU A 74  ? 0.3667 0.2703 0.2709 0.0255  -0.0120 -0.0104 72  LEU A CG  
498  C CD1 . LEU A 74  ? 0.3273 0.2329 0.2507 0.0251  -0.0230 0.0037  72  LEU A CD1 
499  C CD2 . LEU A 74  ? 0.3622 0.2622 0.2764 0.0303  -0.0103 -0.0165 72  LEU A CD2 
500  N N   . VAL A 75  ? 0.4016 0.3161 0.2679 0.0178  0.0137  -0.0258 73  VAL A N   
501  C CA  . VAL A 75  ? 0.3555 0.2797 0.2350 0.0260  0.0225  -0.0258 73  VAL A CA  
502  C C   . VAL A 75  ? 0.4275 0.3590 0.2921 0.0162  0.0232  -0.0211 73  VAL A C   
503  O O   . VAL A 75  ? 0.3991 0.3348 0.2715 0.0179  0.0220  -0.0140 73  VAL A O   
504  C CB  . VAL A 75  ? 0.3703 0.2987 0.2629 0.0343  0.0364  -0.0366 73  VAL A CB  
505  C CG1 . VAL A 75  ? 0.3430 0.2882 0.2504 0.0390  0.0433  -0.0327 73  VAL A CG1 
506  C CG2 . VAL A 75  ? 0.3659 0.2866 0.2772 0.0437  0.0333  -0.0362 73  VAL A CG2 
507  N N   . SER A 76  ? 0.4247 0.3578 0.2646 0.0024  0.0260  -0.0258 74  SER A N   
508  C CA  . SER A 76  ? 0.4615 0.4032 0.2850 -0.0098 0.0269  -0.0205 74  SER A CA  
509  C C   . SER A 76  ? 0.4557 0.3898 0.2789 -0.0154 0.0096  -0.0015 74  SER A C   
510  O O   . SER A 76  ? 0.4034 0.3404 0.2276 -0.0183 0.0095  0.0056  74  SER A O   
511  C CB  . SER A 76  ? 0.5063 0.4528 0.2989 -0.0288 0.0351  -0.0308 74  SER A CB  
512  O OG  . SER A 76  ? 0.5663 0.5043 0.3375 -0.0440 0.0212  -0.0249 74  SER A OG  
513  N N   . GLU A 77  ? 0.3303 0.2548 0.1568 -0.0173 -0.0049 0.0076  75  GLU A N   
514  C CA  . GLU A 77  ? 0.4132 0.3294 0.2553 -0.0183 -0.0203 0.0269  75  GLU A CA  
515  C C   . GLU A 77  ? 0.3747 0.2847 0.2461 -0.0026 -0.0142 0.0248  75  GLU A C   
516  O O   . GLU A 77  ? 0.3823 0.2848 0.2643 -0.0044 -0.0173 0.0342  75  GLU A O   
517  C CB  . GLU A 77  ? 0.3498 0.2620 0.1995 -0.0221 -0.0368 0.0384  75  GLU A CB  
518  C CG  . GLU A 77  ? 0.4336 0.3517 0.2515 -0.0472 -0.0499 0.0499  75  GLU A CG  
519  C CD  . GLU A 77  ? 0.5343 0.4523 0.3458 -0.0605 -0.0600 0.0694  75  GLU A CD  
520  O OE1 . GLU A 77  ? 0.5432 0.4682 0.3242 -0.0737 -0.0508 0.0627  75  GLU A OE1 
521  O OE2 . GLU A 77  ? 0.5562 0.4669 0.3975 -0.0577 -0.0763 0.0920  75  GLU A OE2 
522  N N   . THR A 78  ? 0.3855 0.2975 0.2692 0.0098  -0.0054 0.0126  76  THR A N   
523  C CA  . THR A 78  ? 0.3837 0.2928 0.2874 0.0179  0.0018  0.0087  76  THR A CA  
524  C C   . THR A 78  ? 0.4325 0.3474 0.3268 0.0124  0.0095  0.0073  76  THR A C   
525  O O   . THR A 78  ? 0.3463 0.2526 0.2491 0.0096  0.0116  0.0094  76  THR A O   
526  C CB  . THR A 78  ? 0.3836 0.2977 0.2957 0.0266  0.0078  -0.0011 76  THR A CB  
527  O OG1 . THR A 78  ? 0.3565 0.2649 0.2801 0.0302  0.0006  0.0006  76  THR A OG1 
528  C CG2 . THR A 78  ? 0.3521 0.2680 0.2753 0.0275  0.0160  -0.0056 76  THR A CG2 
529  N N   . ILE A 79  ? 0.3687 0.2982 0.2482 0.0100  0.0155  0.0028  77  ILE A N   
530  C CA  . ILE A 79  ? 0.3668 0.3077 0.2395 0.0034  0.0221  0.0033  77  ILE A CA  
531  C C   . ILE A 79  ? 0.3927 0.3257 0.2524 -0.0090 0.0166  0.0127  77  ILE A C   
532  O O   . ILE A 79  ? 0.3682 0.2988 0.2281 -0.0154 0.0188  0.0155  77  ILE A O   
533  C CB  . ILE A 79  ? 0.3111 0.2720 0.1810 0.0053  0.0314  -0.0032 77  ILE A CB  
534  C CG1 . ILE A 79  ? 0.3785 0.3454 0.2684 0.0174  0.0348  -0.0077 77  ILE A CG1 
535  C CG2 . ILE A 79  ? 0.3220 0.3003 0.1888 -0.0028 0.0374  -0.0005 77  ILE A CG2 
536  C CD1 . ILE A 79  ? 0.3379 0.3096 0.2381 0.0161  0.0335  -0.0032 77  ILE A CD1 
537  N N   . ARG A 80  ? 0.3869 0.3158 0.2333 -0.0160 0.0082  0.0191  78  ARG A N   
538  C CA  . ARG A 80  ? 0.4055 0.3281 0.2393 -0.0309 -0.0002 0.0330  78  ARG A CA  
539  C C   . ARG A 80  ? 0.4691 0.3701 0.3263 -0.0279 -0.0069 0.0429  78  ARG A C   
540  O O   . ARG A 80  ? 0.3574 0.2507 0.2126 -0.0369 -0.0070 0.0495  78  ARG A O   
541  C CB  . ARG A 80  ? 0.3894 0.3133 0.2032 -0.0439 -0.0114 0.0418  78  ARG A CB  
542  C CG  . ARG A 80  ? 0.4498 0.3704 0.2473 -0.0641 -0.0229 0.0606  78  ARG A CG  
543  C CD  . ARG A 80  ? 0.5571 0.4808 0.3321 -0.0829 -0.0383 0.0740  78  ARG A CD  
544  N NE  . ARG A 80  ? 0.5516 0.4642 0.3516 -0.0753 -0.0546 0.0869  78  ARG A NE  
545  C CZ  . ARG A 80  ? 0.5962 0.4941 0.4259 -0.0738 -0.0716 0.1107  78  ARG A CZ  
546  N NH1 . ARG A 80  ? 0.5522 0.4451 0.4117 -0.0658 -0.0849 0.1223  78  ARG A NH1 
547  N NH2 . ARG A 80  ? 0.6039 0.4918 0.4383 -0.0803 -0.0746 0.1234  78  ARG A NH2 
548  N N   . ARG A 81  ? 0.3953 0.2855 0.2778 -0.0158 -0.0100 0.0421  79  ARG A N   
549  C CA  . ARG A 81  ? 0.4450 0.3136 0.3592 -0.0116 -0.0131 0.0494  79  ARG A CA  
550  C C   . ARG A 81  ? 0.3588 0.2199 0.2842 -0.0081 0.0034  0.0339  79  ARG A C   
551  O O   . ARG A 81  ? 0.3790 0.2195 0.3233 -0.0107 0.0066  0.0361  79  ARG A O   
552  C CB  . ARG A 81  ? 0.3623 0.2269 0.3040 -0.0016 -0.0221 0.0554  79  ARG A CB  
553  C CG  . ARG A 81  ? 0.4106 0.2819 0.3403 -0.0116 -0.0417 0.0748  79  ARG A CG  
554  C CD  . ARG A 81  ? 0.4309 0.3043 0.3854 -0.0046 -0.0524 0.0820  79  ARG A CD  
555  N NE  . ARG A 81  ? 0.4835 0.3420 0.4902 0.0047  -0.0568 0.0943  79  ARG A NE  
556  C CZ  . ARG A 81  ? 0.4011 0.2626 0.4441 0.0115  -0.0675 0.1058  79  ARG A CZ  
557  N NH1 . ARG A 81  ? 0.3895 0.2379 0.4894 0.0219  -0.0674 0.1153  79  ARG A NH1 
558  N NH2 . ARG A 81  ? 0.3626 0.2402 0.3879 0.0070  -0.0767 0.1069  79  ARG A NH2 
559  N N   . PHE A 82  ? 0.3504 0.2267 0.2653 -0.0050 0.0138  0.0189  80  PHE A N   
560  C CA  . PHE A 82  ? 0.3424 0.2145 0.2636 -0.0076 0.0278  0.0052  80  PHE A CA  
561  C C   . PHE A 82  ? 0.3755 0.2671 0.2734 -0.0176 0.0342  0.0000  80  PHE A C   
562  O O   . PHE A 82  ? 0.3548 0.2449 0.2510 -0.0268 0.0442  -0.0096 80  PHE A O   
563  C CB  . PHE A 82  ? 0.3548 0.2280 0.2932 0.0018  0.0327  -0.0045 80  PHE A CB  
564  C CG  . PHE A 82  ? 0.4303 0.2889 0.4000 0.0117  0.0269  0.0015  80  PHE A CG  
565  C CD1 . PHE A 82  ? 0.4537 0.2895 0.4530 0.0117  0.0322  0.0021  80  PHE A CD1 
566  C CD2 . PHE A 82  ? 0.4179 0.2856 0.3915 0.0200  0.0160  0.0081  80  PHE A CD2 
567  C CE1 . PHE A 82  ? 0.5044 0.3304 0.5441 0.0221  0.0254  0.0119  80  PHE A CE1 
568  C CE2 . PHE A 82  ? 0.4905 0.3499 0.4968 0.0272  0.0079  0.0177  80  PHE A CE2 
569  C CZ  . PHE A 82  ? 0.4524 0.2928 0.4951 0.0293  0.0118  0.0214  80  PHE A CZ  
570  N N   . GLY A 83  ? 0.3819 0.2937 0.2640 -0.0181 0.0298  0.0056  81  GLY A N   
571  C CA  . GLY A 83  ? 0.4018 0.3348 0.2706 -0.0283 0.0344  0.0055  81  GLY A CA  
572  C C   . GLY A 83  ? 0.3770 0.3328 0.2502 -0.0262 0.0376  0.0021  81  GLY A C   
573  O O   . GLY A 83  ? 0.3359 0.3147 0.2049 -0.0347 0.0392  0.0061  81  GLY A O   
574  N N   . ARG A 84  ? 0.3227 0.2750 0.2069 -0.0166 0.0370  -0.0020 82  ARG A N   
575  C CA  . ARG A 84  ? 0.2640 0.2365 0.1543 -0.0166 0.0371  -0.0009 82  ARG A CA  
576  C C   . ARG A 84  ? 0.3035 0.2667 0.2048 -0.0045 0.0351  -0.0046 82  ARG A C   
577  O O   . ARG A 84  ? 0.3012 0.2444 0.2063 0.0015  0.0345  -0.0088 82  ARG A O   
578  C CB  . ARG A 84  ? 0.2763 0.2548 0.1576 -0.0360 0.0410  -0.0027 82  ARG A CB  
579  C CG  . ARG A 84  ? 0.2968 0.2502 0.1762 -0.0422 0.0489  -0.0157 82  ARG A CG  
580  C CD  . ARG A 84  ? 0.3785 0.3365 0.2410 -0.0684 0.0566  -0.0220 82  ARG A CD  
581  N NE  . ARG A 84  ? 0.3513 0.3349 0.2090 -0.0795 0.0523  -0.0161 82  ARG A NE  
582  C CZ  . ARG A 84  ? 0.4399 0.4465 0.2815 -0.1042 0.0499  -0.0095 82  ARG A CZ  
583  N NH1 . ARG A 84  ? 0.3823 0.4135 0.2218 -0.1159 0.0423  0.0011  82  ARG A NH1 
584  N NH2 . ARG A 84  ? 0.4283 0.4345 0.2557 -0.1197 0.0533  -0.0108 82  ARG A NH2 
585  N N   . LEU A 85  ? 0.2686 0.2480 0.1782 -0.0023 0.0326  -0.0003 83  LEU A N   
586  C CA  . LEU A 85  ? 0.3230 0.2949 0.2415 0.0055  0.0305  -0.0030 83  LEU A CA  
587  C C   . LEU A 85  ? 0.3123 0.3014 0.2332 -0.0051 0.0280  0.0036  83  LEU A C   
588  O O   . LEU A 85  ? 0.3133 0.3235 0.2437 -0.0056 0.0229  0.0160  83  LEU A O   
589  C CB  . LEU A 85  ? 0.3105 0.2795 0.2381 0.0213  0.0275  -0.0023 83  LEU A CB  
590  C CG  . LEU A 85  ? 0.3313 0.2949 0.2686 0.0276  0.0243  -0.0031 83  LEU A CG  
591  C CD1 . LEU A 85  ? 0.2890 0.2372 0.2245 0.0255  0.0250  -0.0101 83  LEU A CD1 
592  C CD2 . LEU A 85  ? 0.3648 0.3234 0.3085 0.0396  0.0240  -0.0052 83  LEU A CD2 
593  N N   . ASP A 86  ? 0.2691 0.2516 0.1837 -0.0156 0.0316  -0.0032 84  ASP A N   
594  C CA  . ASP A 86  ? 0.3112 0.3117 0.2196 -0.0342 0.0288  0.0038  84  ASP A CA  
595  C C   . ASP A 86  ? 0.3374 0.3383 0.2546 -0.0306 0.0239  0.0075  84  ASP A C   
596  O O   . ASP A 86  ? 0.2582 0.2779 0.1754 -0.0435 0.0157  0.0218  84  ASP A O   
597  C CB  . ASP A 86  ? 0.3203 0.3163 0.2085 -0.0581 0.0402  -0.0094 84  ASP A CB  
598  C CG  . ASP A 86  ? 0.3654 0.3613 0.2422 -0.0672 0.0442  -0.0115 84  ASP A CG  
599  O OD1 . ASP A 86  ? 0.3647 0.3847 0.2332 -0.0830 0.0373  0.0014  84  ASP A OD1 
600  O OD2 . ASP A 86  ? 0.3666 0.3398 0.2458 -0.0594 0.0524  -0.0231 84  ASP A OD2 
601  N N   . CYS A 87  ? 0.2992 0.2814 0.2242 -0.0163 0.0270  -0.0023 85  CYS A N   
602  C CA  . CYS A 87  ? 0.3160 0.2984 0.2470 -0.0165 0.0232  0.0003  85  CYS A CA  
603  C C   . CYS A 87  ? 0.3104 0.2757 0.2540 0.0038  0.0218  -0.0048 85  CYS A C   
604  O O   . CYS A 87  ? 0.2897 0.2421 0.2351 0.0106  0.0268  -0.0146 85  CYS A O   
605  C CB  . CYS A 87  ? 0.2739 0.2576 0.1930 -0.0370 0.0331  -0.0109 85  CYS A CB  
606  S SG  . CYS A 87  ? 0.3151 0.3012 0.2393 -0.0412 0.0295  -0.0083 85  CYS A SG  
607  N N   . VAL A 88  ? 0.2723 0.2373 0.2258 0.0110  0.0141  0.0033  86  VAL A N   
608  C CA  . VAL A 88  ? 0.2905 0.2401 0.2512 0.0241  0.0123  -0.0019 86  VAL A CA  
609  C C   . VAL A 88  ? 0.2848 0.2346 0.2485 0.0169  0.0097  -0.0004 86  VAL A C   
610  O O   . VAL A 88  ? 0.2794 0.2377 0.2456 0.0093  0.0038  0.0116  86  VAL A O   
611  C CB  . VAL A 88  ? 0.3494 0.2935 0.3184 0.0370  0.0092  0.0019  86  VAL A CB  
612  C CG1 . VAL A 88  ? 0.3896 0.3176 0.3609 0.0436  0.0072  -0.0040 86  VAL A CG1 
613  C CG2 . VAL A 88  ? 0.2600 0.2050 0.2232 0.0417  0.0137  -0.0021 86  VAL A CG2 
614  N N   . VAL A 89  ? 0.2934 0.2363 0.2601 0.0182  0.0129  -0.0099 87  VAL A N   
615  C CA  . VAL A 89  ? 0.2805 0.2252 0.2512 0.0109  0.0118  -0.0100 87  VAL A CA  
616  C C   . VAL A 89  ? 0.2971 0.2286 0.2742 0.0216  0.0050  -0.0103 87  VAL A C   
617  O O   . VAL A 89  ? 0.3341 0.2608 0.3161 0.0276  0.0052  -0.0160 87  VAL A O   
618  C CB  . VAL A 89  ? 0.2756 0.2267 0.2509 0.0014  0.0234  -0.0217 87  VAL A CB  
619  C CG1 . VAL A 89  ? 0.3007 0.2575 0.2809 -0.0078 0.0235  -0.0223 87  VAL A CG1 
620  C CG2 . VAL A 89  ? 0.2499 0.2108 0.2129 -0.0140 0.0337  -0.0265 87  VAL A CG2 
621  N N   . ASN A 90  ? 0.2824 0.2080 0.2608 0.0217  -0.0016 -0.0028 88  ASN A N   
622  C CA  . ASN A 90  ? 0.2563 0.1662 0.2365 0.0274  -0.0063 -0.0054 88  ASN A CA  
623  C C   . ASN A 90  ? 0.3022 0.2154 0.2860 0.0180  -0.0088 -0.0057 88  ASN A C   
624  O O   . ASN A 90  ? 0.3210 0.2329 0.3063 0.0102  -0.0129 0.0017  88  ASN A O   
625  C CB  . ASN A 90  ? 0.2626 0.1598 0.2483 0.0329  -0.0088 0.0002  88  ASN A CB  
626  C CG  . ASN A 90  ? 0.3347 0.2305 0.3212 0.0431  -0.0036 -0.0025 88  ASN A CG  
627  O OD1 . ASN A 90  ? 0.3998 0.2892 0.3765 0.0469  -0.0001 -0.0128 88  ASN A OD1 
628  N ND2 . ASN A 90  ? 0.2656 0.1703 0.2644 0.0448  -0.0041 0.0086  88  ASN A ND2 
629  N N   . ASN A 91  ? 0.2419 0.1609 0.2311 0.0182  -0.0071 -0.0121 89  ASN A N   
630  C CA  . ASN A 91  ? 0.2696 0.1976 0.2693 0.0100  -0.0074 -0.0133 89  ASN A CA  
631  C C   . ASN A 91  ? 0.3372 0.2574 0.3382 0.0103  -0.0164 -0.0130 89  ASN A C   
632  O O   . ASN A 91  ? 0.3361 0.2603 0.3422 0.0015  -0.0196 -0.0114 89  ASN A O   
633  C CB  . ASN A 91  ? 0.2901 0.2340 0.3067 0.0092  0.0028  -0.0197 89  ASN A CB  
634  C CG  . ASN A 91  ? 0.3224 0.2796 0.3609 0.0037  0.0046  -0.0219 89  ASN A CG  
635  O OD1 . ASN A 91  ? 0.3140 0.2809 0.3524 -0.0088 0.0096  -0.0235 89  ASN A OD1 
636  N ND2 . ASN A 91  ? 0.3167 0.2776 0.3765 0.0110  -0.0001 -0.0200 89  ASN A ND2 
637  N N   . ALA A 92  ? 0.3669 0.2777 0.3600 0.0164  -0.0207 -0.0144 90  ALA A N   
638  C CA  . ALA A 92  ? 0.3905 0.2955 0.3777 0.0106  -0.0302 -0.0140 90  ALA A CA  
639  C C   . ALA A 92  ? 0.4091 0.2997 0.3870 0.0025  -0.0326 -0.0155 90  ALA A C   
640  O O   . ALA A 92  ? 0.3555 0.2298 0.3263 0.0057  -0.0284 -0.0173 90  ALA A O   
641  C CB  . ALA A 92  ? 0.3760 0.2707 0.3452 0.0125  -0.0324 -0.0168 90  ALA A CB  
642  N N   . GLY A 93  ? 0.4022 0.2992 0.3849 -0.0080 -0.0399 -0.0131 91  GLY A N   
643  C CA  . GLY A 93  ? 0.3663 0.2487 0.3411 -0.0183 -0.0426 -0.0139 91  GLY A CA  
644  C C   . GLY A 93  ? 0.4435 0.3412 0.4266 -0.0314 -0.0516 -0.0097 91  GLY A C   
645  O O   . GLY A 93  ? 0.4474 0.3705 0.4513 -0.0301 -0.0547 -0.0043 91  GLY A O   
646  N N   . HIS A 94  ? 0.4173 0.2994 0.3889 -0.0443 -0.0557 -0.0112 92  HIS A N   
647  C CA  . HIS A 94  ? 0.3929 0.2892 0.3696 -0.0604 -0.0657 -0.0066 92  HIS A CA  
648  C C   . HIS A 94  ? 0.4754 0.3608 0.4495 -0.0722 -0.0659 -0.0053 92  HIS A C   
649  O O   . HIS A 94  ? 0.4182 0.2726 0.3790 -0.0715 -0.0619 -0.0093 92  HIS A O   
650  C CB  . HIS A 94  ? 0.4305 0.3168 0.3846 -0.0732 -0.0747 -0.0101 92  HIS A CB  
651  C CG  . HIS A 94  ? 0.5227 0.4277 0.4819 -0.0931 -0.0881 -0.0023 92  HIS A CG  
652  N ND1 . HIS A 94  ? 0.5346 0.4791 0.5299 -0.0919 -0.0949 0.0112  92  HIS A ND1 
653  C CD2 . HIS A 94  ? 0.5451 0.4358 0.4811 -0.1159 -0.0953 -0.0059 92  HIS A CD2 
654  C CE1 . HIS A 94  ? 0.5348 0.4926 0.5311 -0.1126 -0.1079 0.0183  92  HIS A CE1 
655  N NE2 . HIS A 94  ? 0.5580 0.4832 0.5147 -0.1290 -0.1090 0.0079  92  HIS A NE2 
656  N N   . HIS A 95  ? 0.4461 0.3582 0.4380 -0.0832 -0.0704 0.0016  93  HIS A N   
657  C CA  . HIS A 95  ? 0.4574 0.3623 0.4448 -0.0999 -0.0732 0.0046  93  HIS A CA  
658  C C   . HIS A 95  ? 0.4956 0.4066 0.4782 -0.1190 -0.0852 0.0062  93  HIS A C   
659  O O   . HIS A 95  ? 0.4544 0.4028 0.4619 -0.1229 -0.0906 0.0136  93  HIS A O   
660  C CB  . HIS A 95  ? 0.4048 0.3384 0.4137 -0.1028 -0.0668 0.0104  93  HIS A CB  
661  C CG  . HIS A 95  ? 0.5076 0.4324 0.5083 -0.1218 -0.0699 0.0158  93  HIS A CG  
662  N ND1 . HIS A 95  ? 0.5993 0.5295 0.5995 -0.1409 -0.0787 0.0185  93  HIS A ND1 
663  C CD2 . HIS A 95  ? 0.4969 0.4092 0.4900 -0.1273 -0.0674 0.0220  93  HIS A CD2 
664  C CE1 . HIS A 95  ? 0.5915 0.5101 0.5832 -0.1564 -0.0801 0.0245  93  HIS A CE1 
665  N NE2 . HIS A 95  ? 0.5380 0.4458 0.5259 -0.1487 -0.0741 0.0281  93  HIS A NE2 
666  N N   . PRO A 96  ? 0.3278 0.3631 0.4207 0.0148  -0.1037 0.0272  94  PRO A N   
667  C CA  . PRO A 96  ? 0.3510 0.3908 0.4511 0.0093  -0.1209 0.0307  94  PRO A CA  
668  C C   . PRO A 96  ? 0.3324 0.3919 0.4697 0.0076  -0.1203 0.0297  94  PRO A C   
669  O O   . PRO A 96  ? 0.3194 0.3850 0.4678 0.0083  -0.1052 0.0248  94  PRO A O   
670  C CB  . PRO A 96  ? 0.4283 0.4530 0.4946 0.0014  -0.1233 0.0267  94  PRO A CB  
671  C CG  . PRO A 96  ? 0.4007 0.4126 0.4424 0.0046  -0.1088 0.0226  94  PRO A CG  
672  C CD  . PRO A 96  ? 0.3448 0.3672 0.4084 0.0112  -0.0956 0.0217  94  PRO A CD  
673  N N   . PRO A 97  ? 0.3307 0.4003 0.4878 0.0046  -0.1364 0.0344  95  PRO A N   
674  C CA  . PRO A 97  ? 0.3746 0.4638 0.5676 0.0010  -0.1359 0.0329  95  PRO A CA  
675  C C   . PRO A 97  ? 0.4438 0.5285 0.6227 -0.0072 -0.1272 0.0259  95  PRO A C   
676  O O   . PRO A 97  ? 0.3878 0.4547 0.5305 -0.0113 -0.1282 0.0233  95  PRO A O   
677  C CB  . PRO A 97  ? 0.3772 0.4734 0.5837 -0.0031 -0.1590 0.0396  95  PRO A CB  
678  C CG  . PRO A 97  ? 0.3643 0.4479 0.5519 0.0021  -0.1696 0.0461  95  PRO A CG  
679  C CD  . PRO A 97  ? 0.3870 0.4502 0.5341 0.0035  -0.1566 0.0417  95  PRO A CD  
680  N N   . PRO A 98  ? 0.4602 0.5596 0.6668 -0.0098 -0.1179 0.0227  96  PRO A N   
681  C CA  . PRO A 98  ? 0.3784 0.4719 0.5713 -0.0178 -0.1092 0.0166  96  PRO A CA  
682  C C   . PRO A 98  ? 0.3586 0.4422 0.5306 -0.0273 -0.1235 0.0164  96  PRO A C   
683  O O   . PRO A 98  ? 0.3185 0.4099 0.5037 -0.0314 -0.1403 0.0204  96  PRO A O   
684  C CB  . PRO A 98  ? 0.4072 0.5206 0.6390 -0.0203 -0.1004 0.0148  96  PRO A CB  
685  C CG  . PRO A 98  ? 0.4274 0.5537 0.6884 -0.0104 -0.0965 0.0179  96  PRO A CG  
686  C CD  . PRO A 98  ? 0.4261 0.5472 0.6783 -0.0055 -0.1137 0.0243  96  PRO A CD  
687  N N   . GLN A 99  ? 0.3838 0.4498 0.5239 -0.0311 -0.1170 0.0115  97  GLN A N   
688  C CA  . GLN A 99  ? 0.4496 0.5018 0.5649 -0.0402 -0.1275 0.0097  97  GLN A CA  
689  C C   . GLN A 99  ? 0.3730 0.4165 0.4771 -0.0458 -0.1163 0.0039  97  GLN A C   
690  O O   . GLN A 99  ? 0.3942 0.4286 0.4841 -0.0409 -0.1028 0.0012  97  GLN A O   
691  C CB  . GLN A 99  ? 0.5597 0.5916 0.6376 -0.0376 -0.1323 0.0100  97  GLN A CB  
692  C CG  . GLN A 99  ? 0.6965 0.7290 0.7730 -0.0371 -0.1494 0.0160  97  GLN A CG  
693  C CD  . GLN A 99  ? 0.7701 0.7799 0.8053 -0.0360 -0.1508 0.0153  97  GLN A CD  
694  O OE1 . GLN A 99  ? 0.7741 0.7769 0.7970 -0.0287 -0.1380 0.0137  97  GLN A OE1 
695  N NE2 . GLN A 99  ? 0.7795 0.7770 0.7927 -0.0440 -0.1660 0.0162  97  GLN A NE2 
696  N N   . ARG A 100 ? 0.3821 0.4273 0.4919 -0.0564 -0.1229 0.0023  98  ARG A N   
697  C CA  . ARG A 100 ? 0.4536 0.4846 0.5457 -0.0627 -0.1148 -0.0028 98  ARG A CA  
698  C C   . ARG A 100 ? 0.5190 0.5246 0.5703 -0.0610 -0.1149 -0.0059 98  ARG A C   
699  O O   . ARG A 100 ? 0.4971 0.4956 0.5323 -0.0598 -0.1249 -0.0044 98  ARG A O   
700  C CB  . ARG A 100 ? 0.4964 0.5325 0.6009 -0.0754 -0.1233 -0.0038 98  ARG A CB  
701  C CG  . ARG A 100 ? 0.5296 0.5901 0.6758 -0.0778 -0.1179 -0.0023 98  ARG A CG  
702  C CD  . ARG A 100 ? 0.6043 0.6730 0.7673 -0.0911 -0.1274 -0.0027 98  ARG A CD  
703  N NE  . ARG A 100 ? 0.6630 0.7518 0.8624 -0.0943 -0.1166 -0.0029 98  ARG A NE  
704  N N   . PRO A 101 ? 0.4927 0.4838 0.5269 -0.0608 -0.1033 -0.0099 99  PRO A N   
705  C CA  . PRO A 101 ? 0.4895 0.4577 0.4893 -0.0576 -0.1012 -0.0132 99  PRO A CA  
706  C C   . PRO A 101 ? 0.4530 0.4068 0.4307 -0.0649 -0.1137 -0.0153 99  PRO A C   
707  O O   . PRO A 101 ? 0.4238 0.3649 0.3781 -0.0613 -0.1151 -0.0162 99  PRO A O   
708  C CB  . PRO A 101 ? 0.4837 0.4402 0.4755 -0.0585 -0.0896 -0.0166 99  PRO A CB  
709  C CG  . PRO A 101 ? 0.4771 0.4504 0.4957 -0.0594 -0.0829 -0.0144 99  PRO A CG  
710  C CD  . PRO A 101 ? 0.4994 0.4929 0.5444 -0.0640 -0.0922 -0.0115 99  PRO A CD  
711  N N   . GLU A 102 ? 0.4348 0.3893 0.4181 -0.0762 -0.1224 -0.0163 100 GLU A N   
712  C CA  . GLU A 102 ? 0.4667 0.4055 0.4264 -0.0850 -0.1352 -0.0187 100 GLU A CA  
713  C C   . GLU A 102 ? 0.4721 0.4189 0.4336 -0.0851 -0.1499 -0.0139 100 GLU A C   
714  O O   . GLU A 102 ? 0.5411 0.4715 0.4755 -0.0912 -0.1601 -0.0155 100 GLU A O   
715  C CB  . GLU A 102 ? 0.5177 0.4554 0.4841 -0.0983 -0.1413 -0.0209 100 GLU A CB  
716  C CG  . GLU A 102 ? 0.4667 0.4319 0.4724 -0.1035 -0.1492 -0.0161 100 GLU A CG  
717  C CD  . GLU A 102 ? 0.4797 0.4608 0.5133 -0.0994 -0.1347 -0.0150 100 GLU A CD  
718  O OE1 . GLU A 102 ? 0.5174 0.5181 0.5825 -0.1056 -0.1374 -0.0130 100 GLU A OE1 
719  O OE2 . GLU A 102 ? 0.4640 0.4379 0.4881 -0.0906 -0.1206 -0.0163 100 GLU A OE2 
720  N N   . GLU A 103 ? 0.4970 0.4667 0.4881 -0.0785 -0.1510 -0.0080 101 GLU A N   
721  C CA  . GLU A 103 ? 0.5633 0.5398 0.5572 -0.0767 -0.1649 -0.0021 101 GLU A CA  
722  C C   . GLU A 103 ? 0.5295 0.4953 0.5016 -0.0669 -0.1586 -0.0013 101 GLU A C   
723  O O   . GLU A 103 ? 0.4966 0.4611 0.4610 -0.0663 -0.1702 0.0033  101 GLU A O   
724  C CB  . GLU A 103 ? 0.6290 0.6349 0.6683 -0.0739 -0.1691 0.0039  101 GLU A CB  
725  C CG  . GLU A 103 ? 0.7109 0.7304 0.7762 -0.0847 -0.1767 0.0038  101 GLU A CG  
726  C CD  . GLU A 103 ? 0.7636 0.8122 0.8771 -0.0805 -0.1718 0.0073  101 GLU A CD  
727  O OE1 . GLU A 103 ? 0.8058 0.8671 0.9438 -0.0889 -0.1732 0.0064  101 GLU A OE1 
728  O OE2 . GLU A 103 ? 0.6805 0.7384 0.8073 -0.0693 -0.1656 0.0105  101 GLU A OE2 
729  N N   . THR A 104 ? 0.4961 0.4541 0.4582 -0.0597 -0.1414 -0.0052 102 THR A N   
730  C CA  . THR A 104 ? 0.4896 0.4375 0.4316 -0.0515 -0.1346 -0.0050 102 THR A CA  
731  C C   . THR A 104 ? 0.5031 0.4249 0.4045 -0.0568 -0.1369 -0.0096 102 THR A C   
732  O O   . THR A 104 ? 0.5239 0.4331 0.4112 -0.0657 -0.1404 -0.0143 102 THR A O   
733  C CB  . THR A 104 ? 0.4655 0.4153 0.4132 -0.0426 -0.1163 -0.0074 102 THR A CB  
734  O OG1 . THR A 104 ? 0.4955 0.4297 0.4270 -0.0455 -0.1084 -0.0137 102 THR A OG1 
735  C CG2 . THR A 104 ? 0.4679 0.4400 0.4517 -0.0393 -0.1122 -0.0043 102 THR A CG2 
736  N N   . SER A 105 ? 0.4776 0.3901 0.3593 -0.0519 -0.1337 -0.0087 103 SER A N   
737  C CA  . SER A 105 ? 0.5268 0.4133 0.3686 -0.0559 -0.1315 -0.0140 103 SER A CA  
738  C C   . SER A 105 ? 0.5533 0.4336 0.3859 -0.0464 -0.1141 -0.0167 103 SER A C   
739  O O   . SER A 105 ? 0.5109 0.4056 0.3625 -0.0378 -0.1085 -0.0126 103 SER A O   
740  C CB  . SER A 105 ? 0.5727 0.4498 0.3927 -0.0626 -0.1472 -0.0099 103 SER A CB  
741  O OG  . SER A 105 ? 0.5209 0.4027 0.3419 -0.0553 -0.1458 -0.0043 103 SER A OG  
742  N N   . ALA A 106 ? 0.5269 0.3851 0.3307 -0.0485 -0.1054 -0.0239 104 ALA A N   
743  C CA  . ALA A 106 ? 0.5316 0.3830 0.3258 -0.0405 -0.0895 -0.0268 104 ALA A CA  
744  C C   . ALA A 106 ? 0.5095 0.3622 0.2952 -0.0383 -0.0918 -0.0216 104 ALA A C   
745  O O   . ALA A 106 ? 0.4650 0.3257 0.2609 -0.0299 -0.0818 -0.0199 104 ALA A O   
746  C CB  . ALA A 106 ? 0.5473 0.3735 0.3119 -0.0439 -0.0802 -0.0360 104 ALA A CB  
747  N N   . GLN A 107 ? 0.5056 0.3499 0.2722 -0.0463 -0.1061 -0.0184 105 GLN A N   
748  C CA  . GLN A 107 ? 0.5846 0.4259 0.3385 -0.0450 -0.1086 -0.0130 105 GLN A CA  
749  C C   . GLN A 107 ? 0.4756 0.3405 0.2627 -0.0380 -0.1145 -0.0042 105 GLN A C   
750  O O   . GLN A 107 ? 0.4885 0.3556 0.2760 -0.0322 -0.1086 -0.0007 105 GLN A O   
751  C CB  . GLN A 107 ? 0.6994 0.5218 0.4193 -0.0565 -0.1232 -0.0115 105 GLN A CB  
752  C CG  . GLN A 107 ? 0.8368 0.6462 0.5302 -0.0569 -0.1218 -0.0078 105 GLN A CG  
753  C CD  . GLN A 107 ? 0.8746 0.6664 0.5427 -0.0553 -0.1003 -0.0160 105 GLN A CD  
754  O OE1 . GLN A 107 ? 0.8053 0.5894 0.4690 -0.0551 -0.0882 -0.0250 105 GLN A OE1 
755  N NE2 . GLN A 107 ? 0.9197 0.7048 0.5723 -0.0541 -0.0955 -0.0125 105 GLN A NE2 
756  N N   . GLY A 108 ? 0.4703 0.3526 0.2861 -0.0387 -0.1250 -0.0008 106 GLY A N   
757  C CA  . GLY A 108 ? 0.4646 0.3693 0.3152 -0.0310 -0.1266 0.0058  106 GLY A CA  
758  C C   . GLY A 108 ? 0.4193 0.3326 0.2856 -0.0218 -0.1087 0.0030  106 GLY A C   
759  O O   . GLY A 108 ? 0.4204 0.3425 0.2994 -0.0149 -0.1047 0.0071  106 GLY A O   
760  N N   . PHE A 109 ? 0.4302 0.3397 0.2949 -0.0219 -0.0985 -0.0038 107 PHE A N   
761  C CA  . PHE A 109 ? 0.3937 0.3087 0.2697 -0.0142 -0.0829 -0.0064 107 PHE A CA  
762  C C   . PHE A 109 ? 0.3576 0.2645 0.2177 -0.0099 -0.0738 -0.0066 107 PHE A C   
763  O O   . PHE A 109 ? 0.4139 0.3308 0.2884 -0.0033 -0.0673 -0.0040 107 PHE A O   
764  C CB  . PHE A 109 ? 0.4281 0.3353 0.2997 -0.0160 -0.0759 -0.0132 107 PHE A CB  
765  C CG  . PHE A 109 ? 0.3670 0.2834 0.2576 -0.0095 -0.0647 -0.0144 107 PHE A CG  
766  C CD1 . PHE A 109 ? 0.3260 0.2519 0.2280 -0.0024 -0.0575 -0.0117 107 PHE A CD1 
767  C CD2 . PHE A 109 ? 0.3463 0.2597 0.2410 -0.0115 -0.0620 -0.0181 107 PHE A CD2 
768  C CE1 . PHE A 109 ? 0.2947 0.2274 0.2114 0.0022  -0.0489 -0.0125 107 PHE A CE1 
769  C CE2 . PHE A 109 ? 0.3217 0.2413 0.2309 -0.0065 -0.0534 -0.0184 107 PHE A CE2 
770  C CZ  . PHE A 109 ? 0.3217 0.2509 0.2413 0.0002  -0.0472 -0.0156 107 PHE A CZ  
771  N N   . ARG A 110 ? 0.4004 0.2882 0.2298 -0.0144 -0.0725 -0.0099 108 ARG A N   
772  C CA  . ARG A 110 ? 0.4020 0.2814 0.2154 -0.0117 -0.0626 -0.0104 108 ARG A CA  
773  C C   . ARG A 110 ? 0.4447 0.3310 0.2634 -0.0095 -0.0686 -0.0025 108 ARG A C   
774  O O   . ARG A 110 ? 0.4297 0.3199 0.2536 -0.0042 -0.0591 -0.0013 108 ARG A O   
775  C CB  . ARG A 110 ? 0.4536 0.3094 0.2303 -0.0186 -0.0605 -0.0154 108 ARG A CB  
776  C CG  . ARG A 110 ? 0.4421 0.2875 0.2115 -0.0194 -0.0506 -0.0244 108 ARG A CG  
777  C CD  . ARG A 110 ? 0.5342 0.3539 0.2651 -0.0265 -0.0461 -0.0305 108 ARG A CD  
778  N NE  . ARG A 110 ? 0.5382 0.3474 0.2650 -0.0269 -0.0377 -0.0392 108 ARG A NE  
779  C CZ  . ARG A 110 ? 0.6539 0.4508 0.3668 -0.0346 -0.0455 -0.0428 108 ARG A CZ  
780  N NH1 . ARG A 110 ? 0.6563 0.4507 0.3579 -0.0431 -0.0628 -0.0384 108 ARG A NH1 
781  N NH2 . ARG A 110 ? 0.6520 0.4384 0.3627 -0.0338 -0.0364 -0.0508 108 ARG A NH2 
782  N N   . GLN A 111 ? 0.4135 0.3009 0.2319 -0.0137 -0.0848 0.0033  109 GLN A N   
783  C CA  . GLN A 111 ? 0.4156 0.3078 0.2399 -0.0112 -0.0920 0.0115  109 GLN A CA  
784  C C   . GLN A 111 ? 0.3635 0.2756 0.2221 -0.0027 -0.0868 0.0140  109 GLN A C   
785  O O   . GLN A 111 ? 0.3672 0.2807 0.2285 0.0017  -0.0823 0.0175  109 GLN A O   
786  C CB  . GLN A 111 ? 0.5022 0.3930 0.3238 -0.0169 -0.1123 0.0177  109 GLN A CB  
787  C CG  . GLN A 111 ? 0.6575 0.5250 0.4387 -0.0269 -0.1191 0.0162  109 GLN A CG  
788  C CD  . GLN A 111 ? 0.7740 0.6413 0.5547 -0.0343 -0.1408 0.0208  109 GLN A CD  
789  O OE1 . GLN A 111 ? 0.7625 0.6100 0.5091 -0.0437 -0.1496 0.0207  109 GLN A OE1 
790  N NE2 . GLN A 111 ? 0.8041 0.6930 0.6223 -0.0309 -0.1493 0.0245  109 GLN A NE2 
791  N N   . LEU A 112 ? 0.3618 0.2877 0.2449 -0.0011 -0.0865 0.0119  110 LEU A N   
792  C CA  . LEU A 112 ? 0.3454 0.2876 0.2574 0.0058  -0.0801 0.0133  110 LEU A CA  
793  C C   . LEU A 112 ? 0.4217 0.3622 0.3301 0.0100  -0.0646 0.0096  110 LEU A C   
794  O O   . LEU A 112 ? 0.3555 0.3031 0.2767 0.0150  -0.0593 0.0119  110 LEU A O   
795  C CB  . LEU A 112 ? 0.3279 0.2831 0.2633 0.0051  -0.0820 0.0115  110 LEU A CB  
796  C CG  . LEU A 112 ? 0.3887 0.3603 0.3540 0.0106  -0.0778 0.0137  110 LEU A CG  
797  C CD1 . LEU A 112 ? 0.3662 0.3431 0.3438 0.0136  -0.0866 0.0207  110 LEU A CD1 
798  C CD2 . LEU A 112 ? 0.3822 0.3643 0.3667 0.0081  -0.0780 0.0112  110 LEU A CD2 
799  N N   . LEU A 113 ? 0.3820 0.3126 0.2741 0.0080  -0.0573 0.0037  111 LEU A N   
800  C CA  . LEU A 113 ? 0.3380 0.2672 0.2279 0.0118  -0.0436 0.0005  111 LEU A CA  
801  C C   . LEU A 113 ? 0.3429 0.2659 0.2203 0.0125  -0.0405 0.0035  111 LEU A C   
802  O O   . LEU A 113 ? 0.3594 0.2879 0.2456 0.0165  -0.0322 0.0040  111 LEU A O   
803  C CB  . LEU A 113 ? 0.3852 0.3041 0.2616 0.0100  -0.0369 -0.0063 111 LEU A CB  
804  C CG  . LEU A 113 ? 0.3931 0.3178 0.2841 0.0106  -0.0366 -0.0092 111 LEU A CG  
805  C CD1 . LEU A 113 ? 0.3213 0.2320 0.1962 0.0072  -0.0343 -0.0153 111 LEU A CD1 
806  C CD2 . LEU A 113 ? 0.3421 0.2771 0.2513 0.0161  -0.0281 -0.0092 111 LEU A CD2 
807  N N   . GLU A 114 ? 0.3750 0.2854 0.2302 0.0078  -0.0475 0.0058  112 GLU A N   
808  C CA  . GLU A 114 ? 0.4241 0.3264 0.2648 0.0074  -0.0450 0.0096  112 GLU A CA  
809  C C   . GLU A 114 ? 0.3764 0.2898 0.2377 0.0123  -0.0472 0.0155  112 GLU A C   
810  O O   . GLU A 114 ? 0.3917 0.3046 0.2528 0.0144  -0.0385 0.0163  112 GLU A O   
811  C CB  . GLU A 114 ? 0.4900 0.3758 0.3024 0.0005  -0.0554 0.0126  112 GLU A CB  
812  C CG  . GLU A 114 ? 0.5620 0.4300 0.3440 -0.0056 -0.0491 0.0062  112 GLU A CG  
813  C CD  . GLU A 114 ? 0.5529 0.4162 0.3273 -0.0041 -0.0308 0.0015  112 GLU A CD  
814  O OE1 . GLU A 114 ? 0.5971 0.4587 0.3712 -0.0035 -0.0205 -0.0061 112 GLU A OE1 
815  O OE2 . GLU A 114 ? 0.5090 0.3705 0.2795 -0.0035 -0.0265 0.0053  112 GLU A OE2 
816  N N   . LEU A 115 ? 0.3641 0.2873 0.2443 0.0140  -0.0580 0.0195  113 LEU A N   
817  C CA  . LEU A 115 ? 0.4535 0.3851 0.3529 0.0190  -0.0591 0.0246  113 LEU A CA  
818  C C   . LEU A 115 ? 0.4348 0.3787 0.3553 0.0235  -0.0483 0.0210  113 LEU A C   
819  O O   . LEU A 115 ? 0.4899 0.4337 0.4123 0.0258  -0.0405 0.0216  113 LEU A O   
820  C CB  . LEU A 115 ? 0.4748 0.4129 0.3902 0.0198  -0.0736 0.0300  113 LEU A CB  
821  C CG  . LEU A 115 ? 0.4451 0.3927 0.3853 0.0261  -0.0732 0.0342  113 LEU A CG  
822  C CD1 . LEU A 115 ? 0.4015 0.3384 0.3298 0.0276  -0.0706 0.0388  113 LEU A CD1 
823  C CD2 . LEU A 115 ? 0.4608 0.4166 0.4211 0.0273  -0.0871 0.0391  113 LEU A CD2 
824  N N   . ASN A 116 ? 0.3394 0.2927 0.2744 0.0237  -0.0480 0.0175  114 ASN A N   
825  C CA  . ASN A 116 ? 0.2905 0.2544 0.2445 0.0270  -0.0399 0.0150  114 ASN A CA  
826  C C   . ASN A 116 ? 0.3337 0.2952 0.2805 0.0273  -0.0288 0.0111  114 ASN A C   
827  O O   . ASN A 116 ? 0.3316 0.2987 0.2891 0.0295  -0.0225 0.0105  114 ASN A O   
828  C CB  . ASN A 116 ? 0.2687 0.2413 0.2372 0.0259  -0.0423 0.0127  114 ASN A CB  
829  C CG  . ASN A 116 ? 0.3252 0.3051 0.3105 0.0263  -0.0516 0.0165  114 ASN A CG  
830  O OD1 . ASN A 116 ? 0.3361 0.3137 0.3216 0.0280  -0.0579 0.0214  114 ASN A OD1 
831  N ND2 . ASN A 116 ? 0.3219 0.3107 0.3226 0.0248  -0.0526 0.0145  114 ASN A ND2 
832  N N   . LEU A 117 ? 0.3259 0.2791 0.2558 0.0250  -0.0262 0.0081  115 LEU A N   
833  C CA  . LEU A 117 ? 0.3376 0.2909 0.2665 0.0260  -0.0161 0.0041  115 LEU A CA  
834  C C   . LEU A 117 ? 0.3526 0.2979 0.2667 0.0250  -0.0097 0.0041  115 LEU A C   
835  O O   . LEU A 117 ? 0.3115 0.2606 0.2318 0.0264  -0.0030 0.0043  115 LEU A O   
836  C CB  . LEU A 117 ? 0.3126 0.2636 0.2388 0.0250  -0.0153 -0.0006 115 LEU A CB  
837  C CG  . LEU A 117 ? 0.3126 0.2644 0.2417 0.0270  -0.0060 -0.0043 115 LEU A CG  
838  C CD1 . LEU A 117 ? 0.2878 0.2500 0.2340 0.0293  -0.0034 -0.0028 115 LEU A CD1 
839  C CD2 . LEU A 117 ? 0.2812 0.2280 0.2073 0.0266  -0.0056 -0.0086 115 LEU A CD2 
840  N N   . LEU A 118 ? 0.3311 0.2645 0.2246 0.0217  -0.0114 0.0036  116 LEU A N   
841  C CA  . LEU A 118 ? 0.3711 0.2955 0.2486 0.0197  -0.0029 0.0027  116 LEU A CA  
842  C C   . LEU A 118 ? 0.4071 0.3290 0.2811 0.0191  -0.0041 0.0084  116 LEU A C   
843  O O   . LEU A 118 ? 0.4118 0.3305 0.2801 0.0179  0.0050  0.0080  116 LEU A O   
844  C CB  . LEU A 118 ? 0.4224 0.3319 0.2749 0.0151  -0.0035 -0.0001 116 LEU A CB  
845  C CG  . LEU A 118 ? 0.5154 0.4260 0.3725 0.0163  0.0006  -0.0067 116 LEU A CG  
846  C CD1 . LEU A 118 ? 0.5033 0.3984 0.3362 0.0111  -0.0024 -0.0098 116 LEU A CD1 
847  C CD2 . LEU A 118 ? 0.4955 0.4098 0.3611 0.0191  0.0145  -0.0109 116 LEU A CD2 
848  N N   . GLY A 119 ? 0.4042 0.3272 0.2827 0.0199  -0.0149 0.0138  117 GLY A N   
849  C CA  . GLY A 119 ? 0.4149 0.3351 0.2932 0.0204  -0.0160 0.0194  117 GLY A CA  
850  C C   . GLY A 119 ? 0.3918 0.3214 0.2875 0.0232  -0.0077 0.0184  117 GLY A C   
851  O O   . GLY A 119 ? 0.4107 0.3358 0.3009 0.0217  -0.0014 0.0198  117 GLY A O   
852  N N   . THR A 120 ? 0.3044 0.2460 0.2196 0.0262  -0.0076 0.0157  118 THR A N   
853  C CA  . THR A 120 ? 0.3446 0.2944 0.2742 0.0276  -0.0006 0.0141  118 THR A CA  
854  C C   . THR A 120 ? 0.3657 0.3156 0.2913 0.0258  0.0090  0.0107  118 THR A C   
855  O O   . THR A 120 ? 0.3315 0.2828 0.2607 0.0247  0.0147  0.0113  118 THR A O   
856  C CB  . THR A 120 ? 0.3128 0.2726 0.2587 0.0297  -0.0027 0.0117  118 THR A CB  
857  O OG1 . THR A 120 ? 0.3286 0.2902 0.2832 0.0316  -0.0093 0.0146  118 THR A OG1 
858  C CG2 . THR A 120 ? 0.3362 0.3027 0.2929 0.0298  0.0036  0.0096  118 THR A CG2 
859  N N   . TYR A 121 ? 0.3126 0.2612 0.2324 0.0253  0.0113  0.0069  119 TYR A N   
860  C CA  . TYR A 121 ? 0.3235 0.2730 0.2429 0.0243  0.0214  0.0032  119 TYR A CA  
861  C C   . TYR A 121 ? 0.3804 0.3214 0.2857 0.0206  0.0277  0.0049  119 TYR A C   
862  O O   . TYR A 121 ? 0.3561 0.3015 0.2684 0.0194  0.0360  0.0040  119 TYR A O   
863  C CB  . TYR A 121 ? 0.3358 0.2821 0.2496 0.0248  0.0229  -0.0014 119 TYR A CB  
864  C CG  . TYR A 121 ? 0.3680 0.3114 0.2775 0.0237  0.0346  -0.0055 119 TYR A CG  
865  C CD1 . TYR A 121 ? 0.3263 0.2800 0.2547 0.0263  0.0409  -0.0084 119 TYR A CD1 
866  C CD2 . TYR A 121 ? 0.4026 0.3325 0.2893 0.0198  0.0394  -0.0066 119 TYR A CD2 
867  C CE1 . TYR A 121 ? 0.3182 0.2710 0.2474 0.0259  0.0527  -0.0124 119 TYR A CE1 
868  C CE2 . TYR A 121 ? 0.4156 0.3425 0.2990 0.0184  0.0526  -0.0112 119 TYR A CE2 
869  C CZ  . TYR A 121 ? 0.3785 0.3179 0.2852 0.0219  0.0597  -0.0143 119 TYR A CZ  
870  O OH  . TYR A 121 ? 0.4753 0.4133 0.3830 0.0211  0.0738  -0.0191 119 TYR A OH  
871  N N   . THR A 122 ? 0.3422 0.2705 0.2273 0.0181  0.0234  0.0078  120 THR A N   
872  C CA  . THR A 122 ? 0.3917 0.3083 0.2579 0.0133  0.0299  0.0095  120 THR A CA  
873  C C   . THR A 122 ? 0.4210 0.3383 0.2927 0.0124  0.0311  0.0139  120 THR A C   
874  O O   . THR A 122 ? 0.3785 0.2951 0.2488 0.0090  0.0412  0.0131  120 THR A O   
875  C CB  . THR A 122 ? 0.4508 0.3514 0.2909 0.0100  0.0228  0.0122  120 THR A CB  
876  O OG1 . THR A 122 ? 0.5461 0.4431 0.3773 0.0091  0.0250  0.0066  120 THR A OG1 
877  C CG2 . THR A 122 ? 0.4648 0.3500 0.2813 0.0040  0.0279  0.0156  120 THR A CG2 
878  N N   . LEU A 123 ? 0.4084 0.3269 0.2873 0.0151  0.0215  0.0184  121 LEU A N   
879  C CA  . LEU A 123 ? 0.3803 0.2979 0.2647 0.0144  0.0231  0.0220  121 LEU A CA  
880  C C   . LEU A 123 ? 0.3803 0.3104 0.2831 0.0143  0.0309  0.0182  121 LEU A C   
881  O O   . LEU A 123 ? 0.3830 0.3112 0.2853 0.0106  0.0377  0.0190  121 LEU A O   
882  C CB  . LEU A 123 ? 0.3595 0.2767 0.2521 0.0184  0.0129  0.0263  121 LEU A CB  
883  C CG  . LEU A 123 ? 0.3912 0.3067 0.2915 0.0184  0.0151  0.0289  121 LEU A CG  
884  C CD1 . LEU A 123 ? 0.4021 0.3040 0.2849 0.0132  0.0199  0.0326  121 LEU A CD1 
885  C CD2 . LEU A 123 ? 0.3526 0.2666 0.2617 0.0232  0.0058  0.0327  121 LEU A CD2 
886  N N   . THR A 124 ? 0.3555 0.2977 0.2742 0.0176  0.0292  0.0146  122 THR A N   
887  C CA  . THR A 124 ? 0.3031 0.2567 0.2384 0.0169  0.0343  0.0116  122 THR A CA  
888  C C   . THR A 124 ? 0.3510 0.3061 0.2853 0.0133  0.0446  0.0094  122 THR A C   
889  O O   . THR A 124 ? 0.3107 0.2695 0.2524 0.0100  0.0496  0.0097  122 THR A O   
890  C CB  . THR A 124 ? 0.2939 0.2575 0.2422 0.0205  0.0304  0.0086  122 THR A CB  
891  O OG1 . THR A 124 ? 0.2872 0.2503 0.2382 0.0229  0.0229  0.0102  122 THR A OG1 
892  C CG2 . THR A 124 ? 0.3238 0.2981 0.2880 0.0192  0.0336  0.0066  122 THR A CG2 
893  N N   . LYS A 125 ? 0.3716 0.3235 0.2970 0.0136  0.0486  0.0067  123 LYS A N   
894  C CA  . LYS A 125 ? 0.4121 0.3653 0.3378 0.0105  0.0606  0.0036  123 LYS A CA  
895  C C   . LYS A 125 ? 0.3769 0.3212 0.2905 0.0044  0.0670  0.0066  123 LYS A C   
896  O O   . LYS A 125 ? 0.3700 0.3211 0.2945 0.0009  0.0757  0.0053  123 LYS A O   
897  C CB  . LYS A 125 ? 0.4392 0.3853 0.3517 0.0113  0.0643  -0.0002 123 LYS A CB  
898  C CG  . LYS A 125 ? 0.4888 0.4343 0.4001 0.0083  0.0794  -0.0047 123 LYS A CG  
899  C CD  . LYS A 125 ? 0.5106 0.4500 0.4129 0.0104  0.0830  -0.0101 123 LYS A CD  
900  C CE  . LYS A 125 ? 0.5870 0.5228 0.4854 0.0073  0.1002  -0.0155 123 LYS A CE  
901  N N   . LEU A 126 ? 0.3790 0.3079 0.2706 0.0026  0.0623  0.0110  124 LEU A N   
902  C CA  . LEU A 126 ? 0.4067 0.3242 0.2837 -0.0037 0.0680  0.0146  124 LEU A CA  
903  C C   . LEU A 126 ? 0.4449 0.3671 0.3355 -0.0050 0.0667  0.0173  124 LEU A C   
904  O O   . LEU A 126 ? 0.3905 0.3084 0.2774 -0.0111 0.0746  0.0186  124 LEU A O   
905  C CB  . LEU A 126 ? 0.4563 0.3545 0.3056 -0.0051 0.0609  0.0198  124 LEU A CB  
906  C CG  . LEU A 126 ? 0.5529 0.4415 0.3811 -0.0073 0.0647  0.0169  124 LEU A CG  
907  C CD1 . LEU A 126 ? 0.6064 0.4770 0.4085 -0.0085 0.0531  0.0227  124 LEU A CD1 
908  C CD2 . LEU A 126 ? 0.5658 0.4493 0.3841 -0.0142 0.0812  0.0139  124 LEU A CD2 
909  N N   . ALA A 127 ? 0.3068 0.2367 0.2122 -0.0002 0.0578  0.0176  125 ALA A N   
910  C CA  . ALA A 127 ? 0.3348 0.2662 0.2500 -0.0019 0.0564  0.0195  125 ALA A CA  
911  C C   . ALA A 127 ? 0.3493 0.2963 0.2855 -0.0043 0.0613  0.0157  125 ALA A C   
912  O O   . ALA A 127 ? 0.3147 0.2611 0.2556 -0.0089 0.0632  0.0168  125 ALA A O   
913  C CB  . ALA A 127 ? 0.2966 0.2272 0.2164 0.0035  0.0460  0.0211  125 ALA A CB  
914  N N   . LEU A 128 ? 0.3080 0.2679 0.2571 -0.0016 0.0625  0.0116  126 LEU A N   
915  C CA  . LEU A 128 ? 0.3167 0.2922 0.2883 -0.0030 0.0635  0.0091  126 LEU A CA  
916  C C   . LEU A 128 ? 0.3567 0.3359 0.3352 -0.0103 0.0724  0.0090  126 LEU A C   
917  O O   . LEU A 128 ? 0.3515 0.3388 0.3443 -0.0136 0.0699  0.0090  126 LEU A O   
918  C CB  . LEU A 128 ? 0.3060 0.2931 0.2905 0.0018  0.0633  0.0055  126 LEU A CB  
919  C CG  . LEU A 128 ? 0.3458 0.3347 0.3326 0.0072  0.0528  0.0054  126 LEU A CG  
920  C CD1 . LEU A 128 ? 0.3736 0.3692 0.3683 0.0121  0.0530  0.0023  126 LEU A CD1 
921  C CD2 . LEU A 128 ? 0.3109 0.3057 0.3089 0.0052  0.0466  0.0062  126 LEU A CD2 
922  N N   . PRO A 129 ? 0.3838 0.3575 0.3530 -0.0139 0.0830  0.0088  127 PRO A N   
923  C CA  . PRO A 129 ? 0.3280 0.3054 0.3050 -0.0221 0.0921  0.0089  127 PRO A CA  
924  C C   . PRO A 129 ? 0.3572 0.3262 0.3287 -0.0271 0.0880  0.0125  127 PRO A C   
925  O O   . PRO A 129 ? 0.3370 0.3148 0.3239 -0.0330 0.0896  0.0120  127 PRO A O   
926  C CB  . PRO A 129 ? 0.3620 0.3284 0.3207 -0.0255 0.1041  0.0087  127 PRO A CB  
927  C CG  . PRO A 129 ? 0.3804 0.3462 0.3335 -0.0187 0.1031  0.0059  127 PRO A CG  
928  C CD  . PRO A 129 ? 0.3708 0.3352 0.3224 -0.0121 0.0882  0.0078  127 PRO A CD  
929  N N   . TYR A 130 ? 0.3138 0.2660 0.2651 -0.0249 0.0821  0.0161  128 TYR A N   
930  C CA  . TYR A 130 ? 0.3195 0.2613 0.2657 -0.0287 0.0787  0.0191  128 TYR A CA  
931  C C   . TYR A 130 ? 0.3470 0.2967 0.3069 -0.0264 0.0701  0.0173  128 TYR A C   
932  O O   . TYR A 130 ? 0.3320 0.2802 0.2963 -0.0321 0.0696  0.0173  128 TYR A O   
933  C CB  . TYR A 130 ? 0.3257 0.2463 0.2479 -0.0264 0.0755  0.0239  128 TYR A CB  
934  C CG  . TYR A 130 ? 0.3561 0.2661 0.2598 -0.0302 0.0835  0.0261  128 TYR A CG  
935  C CD1 . TYR A 130 ? 0.3864 0.2883 0.2826 -0.0394 0.0927  0.0280  128 TYR A CD1 
936  C CD2 . TYR A 130 ? 0.4622 0.3694 0.3542 -0.0258 0.0823  0.0258  128 TYR A CD2 
937  C CE1 . TYR A 130 ? 0.4512 0.3416 0.3272 -0.0441 0.1013  0.0297  128 TYR A CE1 
938  C CE2 . TYR A 130 ? 0.4826 0.3779 0.3538 -0.0305 0.0902  0.0272  128 TYR A CE2 
939  C CZ  . TYR A 130 ? 0.4672 0.3538 0.3297 -0.0395 0.0999  0.0292  128 TYR A CZ  
940  O OH  . TYR A 130 ? 0.6258 0.4985 0.4643 -0.0451 0.1086  0.0305  128 TYR A OH  
941  N N   . LEU A 131 ? 0.3142 0.2709 0.2793 -0.0191 0.0636  0.0155  129 LEU A N   
942  C CA  . LEU A 131 ? 0.2692 0.2321 0.2446 -0.0179 0.0562  0.0137  129 LEU A CA  
943  C C   . LEU A 131 ? 0.3090 0.2872 0.3030 -0.0235 0.0566  0.0115  129 LEU A C   
944  O O   . LEU A 131 ? 0.3126 0.2914 0.3108 -0.0275 0.0520  0.0108  129 LEU A O   
945  C CB  . LEU A 131 ? 0.2766 0.2435 0.2529 -0.0099 0.0501  0.0125  129 LEU A CB  
946  C CG  . LEU A 131 ? 0.3085 0.2625 0.2704 -0.0044 0.0471  0.0149  129 LEU A CG  
947  C CD1 . LEU A 131 ? 0.2773 0.2371 0.2419 0.0023  0.0419  0.0134  129 LEU A CD1 
948  C CD2 . LEU A 131 ? 0.2697 0.2120 0.2269 -0.0051 0.0448  0.0162  129 LEU A CD2 
949  N N   . ARG A 132 ? 0.3248 0.3150 0.3305 -0.0239 0.0620  0.0104  130 ARG A N   
950  C CA  . ARG A 132 ? 0.2882 0.2946 0.3160 -0.0291 0.0617  0.0090  130 ARG A CA  
951  C C   . ARG A 132 ? 0.2952 0.2976 0.3229 -0.0392 0.0649  0.0101  130 ARG A C   
952  O O   . ARG A 132 ? 0.3446 0.3542 0.3840 -0.0448 0.0593  0.0096  130 ARG A O   
953  C CB  . ARG A 132 ? 0.3097 0.3296 0.3529 -0.0268 0.0689  0.0073  130 ARG A CB  
954  C CG  . ARG A 132 ? 0.3259 0.3511 0.3732 -0.0177 0.0647  0.0057  130 ARG A CG  
955  C CD  . ARG A 132 ? 0.3840 0.4212 0.4480 -0.0155 0.0733  0.0033  130 ARG A CD  
956  N NE  . ARG A 132 ? 0.4619 0.5025 0.5298 -0.0069 0.0697  0.0016  130 ARG A NE  
957  C CZ  . ARG A 132 ? 0.5261 0.5784 0.6134 -0.0033 0.0751  -0.0011 130 ARG A CZ  
958  N NH1 . ARG A 132 ? 0.4811 0.5443 0.5871 -0.0075 0.0847  -0.0023 130 ARG A NH1 
959  N NH2 . ARG A 132 ? 0.5182 0.5712 0.6079 0.0045  0.0716  -0.0026 130 ARG A NH2 
960  N N   . LYS A 133 ? 0.2826 0.2720 0.2955 -0.0423 0.0733  0.0118  131 LYS A N   
961  C CA  . LYS A 133 ? 0.3086 0.2916 0.3195 -0.0526 0.0769  0.0130  131 LYS A CA  
962  C C   . LYS A 133 ? 0.3622 0.3334 0.3640 -0.0547 0.0691  0.0132  131 LYS A C   
963  O O   . LYS A 133 ? 0.3323 0.3029 0.3385 -0.0638 0.0685  0.0129  131 LYS A O   
964  C CB  . LYS A 133 ? 0.3716 0.3391 0.3642 -0.0554 0.0869  0.0156  131 LYS A CB  
965  C CG  . LYS A 133 ? 0.4518 0.4277 0.4498 -0.0559 0.0980  0.0145  131 LYS A CG  
966  N N   . SER A 134 ? 0.3066 0.2680 0.2961 -0.0469 0.0637  0.0135  132 SER A N   
967  C CA  . SER A 134 ? 0.3328 0.2806 0.3126 -0.0484 0.0589  0.0129  132 SER A CA  
968  C C   . SER A 134 ? 0.3601 0.3163 0.3474 -0.0473 0.0505  0.0101  132 SER A C   
969  O O   . SER A 134 ? 0.3668 0.3115 0.3453 -0.0491 0.0475  0.0085  132 SER A O   
970  C CB  . SER A 134 ? 0.3089 0.2388 0.2715 -0.0411 0.0592  0.0151  132 SER A CB  
971  O OG  . SER A 134 ? 0.3163 0.2526 0.2804 -0.0316 0.0552  0.0147  132 SER A OG  
972  N N   . GLN A 135 ? 0.2694 0.2436 0.2716 -0.0446 0.0470  0.0093  133 GLN A N   
973  C CA  . GLN A 135 ? 0.2600 0.2401 0.2660 -0.0422 0.0384  0.0076  133 GLN A CA  
974  C C   . GLN A 135 ? 0.3407 0.3076 0.3318 -0.0353 0.0374  0.0070  133 GLN A C   
975  O O   . GLN A 135 ? 0.3003 0.2602 0.2846 -0.0370 0.0335  0.0051  133 GLN A O   
976  C CB  . GLN A 135 ? 0.3577 0.3395 0.3675 -0.0521 0.0323  0.0064  133 GLN A CB  
977  C CG  . GLN A 135 ? 0.4838 0.4825 0.5142 -0.0591 0.0317  0.0073  133 GLN A CG  
978  C CD  . GLN A 135 ? 0.4953 0.5119 0.5436 -0.0573 0.0227  0.0078  133 GLN A CD  
979  N N   . GLY A 136 ? 0.3317 0.2947 0.3176 -0.0280 0.0413  0.0086  134 GLY A N   
980  C CA  . GLY A 136 ? 0.3188 0.2717 0.2948 -0.0210 0.0402  0.0087  134 GLY A CA  
981  C C   . GLY A 136 ? 0.3337 0.2956 0.3146 -0.0154 0.0351  0.0074  134 GLY A C   
982  O O   . GLY A 136 ? 0.2982 0.2717 0.2884 -0.0173 0.0313  0.0065  134 GLY A O   
983  N N   . ASN A 137 ? 0.2857 0.2421 0.2612 -0.0084 0.0346  0.0078  135 ASN A N   
984  C CA  . ASN A 137 ? 0.2466 0.2095 0.2254 -0.0040 0.0303  0.0065  135 ASN A CA  
985  C C   . ASN A 137 ? 0.2391 0.1994 0.2150 0.0036  0.0301  0.0079  135 ASN A C   
986  O O   . ASN A 137 ? 0.2699 0.2211 0.2401 0.0056  0.0320  0.0101  135 ASN A O   
987  C CB  . ASN A 137 ? 0.2356 0.1936 0.2111 -0.0069 0.0284  0.0038  135 ASN A CB  
988  C CG  . ASN A 137 ? 0.3150 0.2598 0.2841 -0.0046 0.0320  0.0030  135 ASN A CG  
989  O OD1 . ASN A 137 ? 0.3153 0.2592 0.2851 0.0004  0.0318  0.0022  135 ASN A OD1 
990  N ND2 . ASN A 137 ? 0.3567 0.2910 0.3210 -0.0084 0.0357  0.0030  135 ASN A ND2 
991  N N   . VAL A 138 ? 0.2888 0.2566 0.2685 0.0072  0.0267  0.0071  136 VAL A N   
992  C CA  . VAL A 138 ? 0.3269 0.2942 0.3049 0.0133  0.0249  0.0081  136 VAL A CA  
993  C C   . VAL A 138 ? 0.3052 0.2726 0.2855 0.0153  0.0224  0.0064  136 VAL A C   
994  O O   . VAL A 138 ? 0.2794 0.2506 0.2618 0.0126  0.0210  0.0045  136 VAL A O   
995  C CB  . VAL A 138 ? 0.3378 0.3127 0.3179 0.0151  0.0241  0.0080  136 VAL A CB  
996  C CG1 . VAL A 138 ? 0.2848 0.2583 0.2615 0.0200  0.0210  0.0085  136 VAL A CG1 
997  C CG2 . VAL A 138 ? 0.3126 0.2871 0.2904 0.0128  0.0289  0.0090  136 VAL A CG2 
998  N N   . ILE A 139 ? 0.2796 0.2425 0.2599 0.0194  0.0218  0.0075  137 ILE A N   
999  C CA  . ILE A 139 ? 0.2627 0.2268 0.2477 0.0214  0.0210  0.0057  137 ILE A CA  
1000 C C   . ILE A 139 ? 0.3342 0.3016 0.3219 0.0261  0.0168  0.0074  137 ILE A C   
1001 O O   . ILE A 139 ? 0.2486 0.2118 0.2357 0.0291  0.0150  0.0104  137 ILE A O   
1002 C CB  . ILE A 139 ? 0.2875 0.2437 0.2745 0.0216  0.0251  0.0046  137 ILE A CB  
1003 C CG1 . ILE A 139 ? 0.2470 0.1977 0.2283 0.0154  0.0290  0.0022  137 ILE A CG1 
1004 C CG2 . ILE A 139 ? 0.2179 0.1764 0.2121 0.0238  0.0260  0.0024  137 ILE A CG2 
1005 C CD1 . ILE A 139 ? 0.2374 0.1766 0.2185 0.0156  0.0344  0.0008  137 ILE A CD1 
1006 N N   . ASN A 140 ? 0.2684 0.2419 0.2581 0.0261  0.0143  0.0060  138 ASN A N   
1007 C CA  . ASN A 140 ? 0.2556 0.2318 0.2472 0.0293  0.0098  0.0071  138 ASN A CA  
1008 C C   . ASN A 140 ? 0.2396 0.2181 0.2406 0.0304  0.0099  0.0059  138 ASN A C   
1009 O O   . ASN A 140 ? 0.2825 0.2617 0.2850 0.0277  0.0134  0.0032  138 ASN A O   
1010 C CB  . ASN A 140 ? 0.2346 0.2146 0.2227 0.0285  0.0077  0.0060  138 ASN A CB  
1011 C CG  . ASN A 140 ? 0.2926 0.2711 0.2741 0.0278  0.0094  0.0067  138 ASN A CG  
1012 O OD1 . ASN A 140 ? 0.2965 0.2703 0.2731 0.0281  0.0105  0.0088  138 ASN A OD1 
1013 N ND2 . ASN A 140 ? 0.2931 0.2754 0.2756 0.0269  0.0101  0.0050  138 ASN A ND2 
1014 N N   . ILE A 141 ? 0.2611 0.2403 0.2685 0.0338  0.0062  0.0081  139 ILE A N   
1015 C CA  . ILE A 141 ? 0.2453 0.2292 0.2658 0.0349  0.0065  0.0069  139 ILE A CA  
1016 C C   . ILE A 141 ? 0.2766 0.2659 0.2974 0.0338  0.0015  0.0065  139 ILE A C   
1017 O O   . ILE A 141 ? 0.2966 0.2863 0.3157 0.0351  -0.0053 0.0090  139 ILE A O   
1018 C CB  . ILE A 141 ? 0.2391 0.2223 0.2715 0.0395  0.0044  0.0098  139 ILE A CB  
1019 C CG1 . ILE A 141 ? 0.2672 0.2420 0.2974 0.0407  0.0093  0.0104  139 ILE A CG1 
1020 C CG2 . ILE A 141 ? 0.2720 0.2624 0.3231 0.0406  0.0067  0.0078  139 ILE A CG2 
1021 C CD1 . ILE A 141 ? 0.2341 0.2058 0.2632 0.0374  0.0190  0.0055  139 ILE A CD1 
1022 N N   . SER A 142 ? 0.2426 0.2341 0.2633 0.0305  0.0047  0.0035  140 SER A N   
1023 C CA  . SER A 142 ? 0.2572 0.2519 0.2772 0.0287  0.0007  0.0029  140 SER A CA  
1024 C C   . SER A 142 ? 0.2214 0.2220 0.2561 0.0280  0.0015  0.0020  140 SER A C   
1025 O O   . SER A 142 ? 0.2617 0.2657 0.3087 0.0312  -0.0002 0.0037  140 SER A O   
1026 C CB  . SER A 142 ? 0.2220 0.2140 0.2321 0.0254  0.0026  0.0012  140 SER A CB  
1027 O OG  . SER A 142 ? 0.2599 0.2528 0.2687 0.0238  -0.0011 0.0006  140 SER A OG  
1028 N N   . SER A 143 ? 0.2439 0.2458 0.2789 0.0239  0.0040  -0.0002 141 SER A N   
1029 C CA  . SER A 143 ? 0.2409 0.2492 0.2912 0.0223  0.0064  -0.0014 141 SER A CA  
1030 C C   . SER A 143 ? 0.2634 0.2689 0.3071 0.0163  0.0115  -0.0040 141 SER A C   
1031 O O   . SER A 143 ? 0.2404 0.2407 0.2705 0.0142  0.0083  -0.0036 141 SER A O   
1032 C CB  . SER A 143 ? 0.2783 0.2925 0.3371 0.0231  -0.0026 0.0006  141 SER A CB  
1033 O OG  . SER A 143 ? 0.3616 0.3847 0.4409 0.0221  -0.0003 -0.0002 141 SER A OG  
1034 N N   . LEU A 144 ? 0.2311 0.2388 0.2843 0.0134  0.0198  -0.0064 142 LEU A N   
1035 C CA  . LEU A 144 ? 0.2427 0.2461 0.2876 0.0064  0.0248  -0.0084 142 LEU A CA  
1036 C C   . LEU A 144 ? 0.2733 0.2781 0.3170 0.0038  0.0179  -0.0071 142 LEU A C   
1037 O O   . LEU A 144 ? 0.2457 0.2427 0.2751 -0.0008 0.0175  -0.0070 142 LEU A O   
1038 C CB  . LEU A 144 ? 0.2518 0.2580 0.3087 0.0031  0.0363  -0.0118 142 LEU A CB  
1039 C CG  . LEU A 144 ? 0.2954 0.2972 0.3452 -0.0056 0.0427  -0.0137 142 LEU A CG  
1040 C CD1 . LEU A 144 ? 0.3097 0.2975 0.3330 -0.0105 0.0431  -0.0133 142 LEU A CD1 
1041 C CD2 . LEU A 144 ? 0.2337 0.2396 0.2987 -0.0085 0.0561  -0.0178 142 LEU A CD2 
1042 N N   . VAL A 145 ? 0.2617 0.2747 0.3189 0.0063  0.0113  -0.0059 143 VAL A N   
1043 C CA  . VAL A 145 ? 0.2583 0.2712 0.3136 0.0026  0.0052  -0.0054 143 VAL A CA  
1044 C C   . VAL A 145 ? 0.2468 0.2504 0.2833 0.0038  -0.0014 -0.0043 143 VAL A C   
1045 O O   . VAL A 145 ? 0.2225 0.2215 0.2527 0.0002  -0.0046 -0.0045 143 VAL A O   
1046 C CB  . VAL A 145 ? 0.2842 0.3079 0.3585 0.0037  -0.0014 -0.0044 143 VAL A CB  
1047 C CG1 . VAL A 145 ? 0.3000 0.3342 0.3977 0.0032  0.0059  -0.0057 143 VAL A CG1 
1048 C CG2 . VAL A 145 ? 0.3109 0.3350 0.3834 0.0098  -0.0102 -0.0018 143 VAL A CG2 
1049 N N   . GLY A 146 ? 0.2534 0.2538 0.2817 0.0087  -0.0025 -0.0033 144 GLY A N   
1050 C CA  . GLY A 146 ? 0.2862 0.2783 0.2993 0.0097  -0.0060 -0.0028 144 GLY A CA  
1051 C C   . GLY A 146 ? 0.3157 0.3004 0.3193 0.0057  -0.0032 -0.0030 144 GLY A C   
1052 O O   . GLY A 146 ? 0.3274 0.3052 0.3226 0.0053  -0.0069 -0.0026 144 GLY A O   
1053 N N   . ALA A 147 ? 0.2361 0.2204 0.2400 0.0023  0.0033  -0.0035 145 ALA A N   
1054 C CA  . ALA A 147 ? 0.2974 0.2725 0.2888 -0.0027 0.0051  -0.0028 145 ALA A CA  
1055 C C   . ALA A 147 ? 0.3636 0.3356 0.3546 -0.0093 0.0069  -0.0032 145 ALA A C   
1056 O O   . ALA A 147 ? 0.2997 0.2618 0.2791 -0.0126 0.0042  -0.0015 145 ALA A O   
1057 C CB  . ALA A 147 ? 0.2619 0.2347 0.2485 -0.0050 0.0114  -0.0034 145 ALA A CB  
1058 N N   . ILE A 148 ? 0.2848 0.2648 0.2895 -0.0116 0.0114  -0.0051 146 ILE A N   
1059 C CA  . ILE A 148 ? 0.2782 0.2561 0.2838 -0.0194 0.0152  -0.0058 146 ILE A CA  
1060 C C   . ILE A 148 ? 0.2279 0.2119 0.2452 -0.0200 0.0101  -0.0061 146 ILE A C   
1061 O O   . ILE A 148 ? 0.2903 0.2726 0.3092 -0.0271 0.0126  -0.0067 146 ILE A O   
1062 C CB  . ILE A 148 ? 0.3110 0.2924 0.3236 -0.0240 0.0271  -0.0083 146 ILE A CB  
1063 C CG1 . ILE A 148 ? 0.2789 0.2751 0.3152 -0.0189 0.0295  -0.0101 146 ILE A CG1 
1064 C CG2 . ILE A 148 ? 0.3039 0.2748 0.2988 -0.0262 0.0323  -0.0084 146 ILE A CG2 
1065 C CD1 . ILE A 148 ? 0.2796 0.2810 0.3289 -0.0233 0.0426  -0.0135 146 ILE A CD1 
1066 N N   . GLY A 149 ? 0.3300 0.3198 0.3536 -0.0138 0.0028  -0.0058 147 GLY A N   
1067 C CA  . GLY A 149 ? 0.2926 0.2877 0.3259 -0.0154 -0.0035 -0.0062 147 GLY A CA  
1068 C C   . GLY A 149 ? 0.3015 0.3112 0.3584 -0.0168 -0.0006 -0.0070 147 GLY A C   
1069 O O   . GLY A 149 ? 0.2547 0.2696 0.3209 -0.0170 0.0084  -0.0081 147 GLY A O   
1070 N N   . GLN A 150 ? 0.2986 0.3148 0.3661 -0.0181 -0.0086 -0.0067 148 GLN A N   
1071 C CA  . GLN A 150 ? 0.2853 0.3173 0.3796 -0.0195 -0.0090 -0.0068 148 GLN A CA  
1072 C C   . GLN A 150 ? 0.2615 0.2950 0.3592 -0.0246 -0.0194 -0.0064 148 GLN A C   
1073 O O   . GLN A 150 ? 0.2783 0.3012 0.3576 -0.0240 -0.0274 -0.0062 148 GLN A O   
1074 C CB  . GLN A 150 ? 0.3224 0.3631 0.4291 -0.0113 -0.0119 -0.0051 148 GLN A CB  
1075 C CG  . GLN A 150 ? 0.4377 0.4956 0.5761 -0.0111 -0.0140 -0.0043 148 GLN A CG  
1076 C CD  . GLN A 150 ? 0.5747 0.6371 0.7194 -0.0038 -0.0245 -0.0009 148 GLN A CD  
1077 O OE1 . GLN A 150 ? 0.5663 0.6196 0.6932 0.0016  -0.0260 0.0003  148 GLN A OE1 
1078 N NE2 . GLN A 150 ? 0.6711 0.7472 0.8415 -0.0040 -0.0324 0.0013  148 GLN A NE2 
1079 N N   . ALA A 151 ? 0.3084 0.3550 0.4301 -0.0300 -0.0189 -0.0068 149 ALA A N   
1080 C CA  . ALA A 151 ? 0.3043 0.3529 0.4303 -0.0361 -0.0299 -0.0065 149 ALA A CA  
1081 C C   . ALA A 151 ? 0.2716 0.3276 0.4059 -0.0314 -0.0434 -0.0038 149 ALA A C   
1082 O O   . ALA A 151 ? 0.2319 0.2968 0.3797 -0.0242 -0.0431 -0.0019 149 ALA A O   
1083 C CB  . ALA A 151 ? 0.3018 0.3625 0.4520 -0.0449 -0.0249 -0.0077 149 ALA A CB  
1084 N N   . GLN A 152 ? 0.2571 0.3067 0.3804 -0.0359 -0.0556 -0.0037 150 GLN A N   
1085 C CA  . GLN A 152 ? 0.2432 0.2966 0.3693 -0.0343 -0.0707 -0.0008 150 GLN A CA  
1086 C C   . GLN A 152 ? 0.2391 0.2878 0.3535 -0.0245 -0.0719 0.0014  150 GLN A C   
1087 O O   . GLN A 152 ? 0.2808 0.3384 0.4088 -0.0206 -0.0801 0.0051  150 GLN A O   
1088 C CB  . GLN A 152 ? 0.2589 0.3338 0.4219 -0.0371 -0.0769 0.0016  150 GLN A CB  
1089 C CG  . GLN A 152 ? 0.2829 0.3625 0.4575 -0.0484 -0.0765 -0.0006 150 GLN A CG  
1090 C CD  . GLN A 152 ? 0.4247 0.5263 0.6373 -0.0524 -0.0850 0.0018  150 GLN A CD  
1091 O OE1 . GLN A 152 ? 0.4613 0.5750 0.6934 -0.0460 -0.0925 0.0057  150 GLN A OE1 
1092 N NE2 . GLN A 152 ? 0.4516 0.5587 0.6765 -0.0632 -0.0843 -0.0001 150 GLN A NE2 
1093 N N   . ALA A 153 ? 0.2381 0.2720 0.3270 -0.0210 -0.0647 -0.0005 151 ALA A N   
1094 C CA  . ALA A 153 ? 0.2420 0.2704 0.3183 -0.0128 -0.0644 0.0011  151 ALA A CA  
1095 C C   . ALA A 153 ? 0.2587 0.2697 0.3057 -0.0114 -0.0600 -0.0015 151 ALA A C   
1096 O O   . ALA A 153 ? 0.2827 0.2903 0.3227 -0.0054 -0.0529 -0.0014 151 ALA A O   
1097 C CB  . ALA A 153 ? 0.2303 0.2682 0.3234 -0.0066 -0.0547 0.0022  151 ALA A CB  
1098 N N   . VAL A 154 ? 0.2615 0.2612 0.2927 -0.0169 -0.0641 -0.0039 152 VAL A N   
1099 C CA  . VAL A 154 ? 0.2777 0.2609 0.2848 -0.0150 -0.0591 -0.0068 152 VAL A CA  
1100 C C   . VAL A 154 ? 0.3144 0.2922 0.3079 -0.0084 -0.0587 -0.0060 152 VAL A C   
1101 O O   . VAL A 154 ? 0.3031 0.2773 0.2911 -0.0034 -0.0504 -0.0066 152 VAL A O   
1102 C CB  . VAL A 154 ? 0.3135 0.2839 0.3062 -0.0219 -0.0639 -0.0100 152 VAL A CB  
1103 C CG1 . VAL A 154 ? 0.3187 0.2713 0.2857 -0.0188 -0.0620 -0.0130 152 VAL A CG1 
1104 C CG2 . VAL A 154 ? 0.2721 0.2415 0.2712 -0.0268 -0.0586 -0.0113 152 VAL A CG2 
1105 N N   . PRO A 155 ? 0.2699 0.2465 0.2574 -0.0086 -0.0674 -0.0042 153 PRO A N   
1106 C CA  . PRO A 155 ? 0.3189 0.2890 0.2917 -0.0033 -0.0653 -0.0034 153 PRO A CA  
1107 C C   . PRO A 155 ? 0.3087 0.2883 0.2945 0.0033  -0.0589 -0.0007 153 PRO A C   
1108 O O   . PRO A 155 ? 0.2663 0.2408 0.2428 0.0076  -0.0515 -0.0015 153 PRO A O   
1109 C CB  . PRO A 155 ? 0.2973 0.2639 0.2611 -0.0067 -0.0777 -0.0011 153 PRO A CB  
1110 C CG  . PRO A 155 ? 0.3501 0.3147 0.3142 -0.0148 -0.0853 -0.0030 153 PRO A CG  
1111 C CD  . PRO A 155 ? 0.3051 0.2833 0.2944 -0.0151 -0.0803 -0.0030 153 PRO A CD  
1112 N N   . TYR A 156 ? 0.3046 0.2978 0.3129 0.0039  -0.0612 0.0024  154 TYR A N   
1113 C CA  . TYR A 156 ? 0.2800 0.2802 0.2997 0.0098  -0.0545 0.0044  154 TYR A CA  
1114 C C   . TYR A 156 ? 0.2951 0.2937 0.3131 0.0111  -0.0430 0.0016  154 TYR A C   
1115 O O   . TYR A 156 ? 0.2997 0.2951 0.3111 0.0152  -0.0374 0.0017  154 TYR A O   
1116 C CB  . TYR A 156 ? 0.2262 0.2409 0.2730 0.0103  -0.0575 0.0071  154 TYR A CB  
1117 C CG  . TYR A 156 ? 0.3039 0.3239 0.3626 0.0162  -0.0495 0.0084  154 TYR A CG  
1118 C CD1 . TYR A 156 ? 0.3521 0.3701 0.4090 0.0210  -0.0529 0.0120  154 TYR A CD1 
1119 C CD2 . TYR A 156 ? 0.2757 0.3005 0.3450 0.0160  -0.0385 0.0057  154 TYR A CD2 
1120 C CE1 . TYR A 156 ? 0.3835 0.4044 0.4506 0.0260  -0.0453 0.0128  154 TYR A CE1 
1121 C CE2 . TYR A 156 ? 0.3055 0.3329 0.3832 0.0205  -0.0307 0.0060  154 TYR A CE2 
1122 C CZ  . TYR A 156 ? 0.3396 0.3651 0.4170 0.0257  -0.0341 0.0094  154 TYR A CZ  
1123 O OH  . TYR A 156 ? 0.3138 0.3401 0.3989 0.0298  -0.0260 0.0093  154 TYR A OH  
1124 N N   . VAL A 157 ? 0.3005 0.3007 0.3241 0.0069  -0.0402 -0.0005 155 VAL A N   
1125 C CA  . VAL A 157 ? 0.2148 0.2116 0.2347 0.0071  -0.0311 -0.0023 155 VAL A CA  
1126 C C   . VAL A 157 ? 0.2429 0.2287 0.2444 0.0098  -0.0295 -0.0035 155 VAL A C   
1127 O O   . VAL A 157 ? 0.2451 0.2297 0.2439 0.0127  -0.0237 -0.0033 155 VAL A O   
1128 C CB  . VAL A 157 ? 0.2175 0.2142 0.2417 0.0008  -0.0298 -0.0039 155 VAL A CB  
1129 C CG1 . VAL A 157 ? 0.2541 0.2424 0.2679 0.0003  -0.0232 -0.0048 155 VAL A CG1 
1130 C CG2 . VAL A 157 ? 0.2394 0.2491 0.2859 -0.0019 -0.0277 -0.0033 155 VAL A CG2 
1131 N N   . ALA A 158 ? 0.3064 0.2839 0.2955 0.0086  -0.0343 -0.0049 156 ALA A N   
1132 C CA  . ALA A 158 ? 0.3328 0.3000 0.3071 0.0115  -0.0311 -0.0068 156 ALA A CA  
1133 C C   . ALA A 158 ? 0.3078 0.2765 0.2791 0.0163  -0.0282 -0.0054 156 ALA A C   
1134 O O   . ALA A 158 ? 0.3350 0.3016 0.3037 0.0194  -0.0227 -0.0060 156 ALA A O   
1135 C CB  . ALA A 158 ? 0.2874 0.2437 0.2478 0.0087  -0.0354 -0.0096 156 ALA A CB  
1136 N N   . THR A 159 ? 0.2470 0.2191 0.2194 0.0166  -0.0325 -0.0032 157 THR A N   
1137 C CA  . THR A 159 ? 0.2568 0.2288 0.2253 0.0204  -0.0296 -0.0014 157 THR A CA  
1138 C C   . THR A 159 ? 0.2798 0.2586 0.2593 0.0229  -0.0236 -0.0003 157 THR A C   
1139 O O   . THR A 159 ? 0.2929 0.2702 0.2686 0.0254  -0.0187 -0.0002 157 THR A O   
1140 C CB  . THR A 159 ? 0.2716 0.2442 0.2388 0.0200  -0.0367 0.0019  157 THR A CB  
1141 O OG1 . THR A 159 ? 0.2909 0.2740 0.2772 0.0206  -0.0394 0.0046  157 THR A OG1 
1142 C CG2 . THR A 159 ? 0.3043 0.2686 0.2576 0.0158  -0.0446 0.0011  157 THR A CG2 
1143 N N   . LYS A 160 ? 0.2549 0.2407 0.2478 0.0216  -0.0232 0.0002  158 LYS A N   
1144 C CA  . LYS A 160 ? 0.2342 0.2239 0.2340 0.0229  -0.0169 0.0006  158 LYS A CA  
1145 C C   . LYS A 160 ? 0.2474 0.2334 0.2421 0.0220  -0.0129 -0.0009 158 LYS A C   
1146 O O   . LYS A 160 ? 0.2700 0.2560 0.2636 0.0232  -0.0090 -0.0006 158 LYS A O   
1147 C CB  . LYS A 160 ? 0.2492 0.2463 0.2643 0.0216  -0.0160 0.0011  158 LYS A CB  
1148 C CG  . LYS A 160 ? 0.2156 0.2172 0.2397 0.0237  -0.0211 0.0036  158 LYS A CG  
1149 C CD  . LYS A 160 ? 0.2401 0.2388 0.2602 0.0276  -0.0193 0.0056  158 LYS A CD  
1150 C CE  . LYS A 160 ? 0.2570 0.2600 0.2901 0.0304  -0.0238 0.0089  158 LYS A CE  
1151 N NZ  . LYS A 160 ? 0.2780 0.2763 0.3069 0.0339  -0.0216 0.0112  158 LYS A NZ  
1152 N N   . GLY A 161 ? 0.2484 0.2307 0.2400 0.0196  -0.0146 -0.0023 159 GLY A N   
1153 C CA  . GLY A 161 ? 0.2122 0.1894 0.1986 0.0197  -0.0128 -0.0028 159 GLY A CA  
1154 C C   . GLY A 161 ? 0.2870 0.2620 0.2687 0.0237  -0.0113 -0.0030 159 GLY A C   
1155 O O   . GLY A 161 ? 0.2356 0.2110 0.2186 0.0247  -0.0093 -0.0022 159 GLY A O   
1156 N N   . ALA A 162 ? 0.2587 0.2315 0.2350 0.0253  -0.0123 -0.0040 160 ALA A N   
1157 C CA  . ALA A 162 ? 0.3108 0.2814 0.2827 0.0283  -0.0088 -0.0048 160 ALA A CA  
1158 C C   . ALA A 162 ? 0.3083 0.2843 0.2842 0.0294  -0.0058 -0.0028 160 ALA A C   
1159 O O   . ALA A 162 ? 0.2793 0.2566 0.2573 0.0309  -0.0023 -0.0029 160 ALA A O   
1160 C CB  . ALA A 162 ? 0.2379 0.2022 0.1989 0.0281  -0.0098 -0.0065 160 ALA A CB  
1161 N N   . VAL A 163 ? 0.2964 0.2754 0.2745 0.0285  -0.0072 -0.0011 161 VAL A N   
1162 C CA  . VAL A 163 ? 0.2830 0.2648 0.2638 0.0292  -0.0041 0.0006  161 VAL A CA  
1163 C C   . VAL A 163 ? 0.2675 0.2521 0.2536 0.0280  -0.0018 0.0007  161 VAL A C   
1164 O O   . VAL A 163 ? 0.2952 0.2810 0.2820 0.0281  0.0009  0.0011  161 VAL A O   
1165 C CB  . VAL A 163 ? 0.2346 0.2181 0.2191 0.0292  -0.0063 0.0026  161 VAL A CB  
1166 C CG1 . VAL A 163 ? 0.2429 0.2274 0.2308 0.0297  -0.0024 0.0039  161 VAL A CG1 
1167 C CG2 . VAL A 163 ? 0.2472 0.2264 0.2237 0.0298  -0.0104 0.0038  161 VAL A CG2 
1168 N N   . THR A 164 ? 0.2345 0.2195 0.2233 0.0258  -0.0030 0.0003  162 THR A N   
1169 C CA  . THR A 164 ? 0.2239 0.2089 0.2135 0.0232  -0.0017 0.0007  162 THR A CA  
1170 C C   . THR A 164 ? 0.2421 0.2264 0.2313 0.0241  -0.0032 0.0011  162 THR A C   
1171 O O   . THR A 164 ? 0.2494 0.2351 0.2399 0.0230  -0.0028 0.0021  162 THR A O   
1172 C CB  . THR A 164 ? 0.3161 0.2995 0.3058 0.0197  -0.0019 0.0003  162 THR A CB  
1173 O OG1 . THR A 164 ? 0.2713 0.2575 0.2662 0.0194  0.0007  -0.0003 162 THR A OG1 
1174 C CG2 . THR A 164 ? 0.2854 0.2655 0.2707 0.0156  -0.0014 0.0009  162 THR A CG2 
1175 N N   . ALA A 165 ? 0.2367 0.2185 0.2252 0.0262  -0.0051 0.0004  163 ALA A N   
1176 C CA  . ALA A 165 ? 0.2583 0.2398 0.2504 0.0285  -0.0060 0.0007  163 ALA A CA  
1177 C C   . ALA A 165 ? 0.2646 0.2504 0.2607 0.0309  -0.0023 0.0002  163 ALA A C   
1178 O O   . ALA A 165 ? 0.2935 0.2833 0.2967 0.0310  -0.0027 0.0014  163 ALA A O   
1179 C CB  . ALA A 165 ? 0.2835 0.2593 0.2737 0.0307  -0.0073 -0.0009 163 ALA A CB  
1180 N N   . MET A 166 ? 0.2591 0.2440 0.2505 0.0319  0.0010  -0.0013 164 MET A N   
1181 C CA  . MET A 166 ? 0.2987 0.2860 0.2913 0.0330  0.0059  -0.0017 164 MET A CA  
1182 C C   . MET A 166 ? 0.2362 0.2284 0.2335 0.0305  0.0064  0.0003  164 MET A C   
1183 O O   . MET A 166 ? 0.2714 0.2680 0.2752 0.0306  0.0094  0.0004  164 MET A O   
1184 C CB  . MET A 166 ? 0.2510 0.2337 0.2332 0.0329  0.0079  -0.0024 164 MET A CB  
1185 C CG  . MET A 166 ? 0.2560 0.2386 0.2359 0.0329  0.0142  -0.0029 164 MET A CG  
1186 S SD  . MET A 166 ? 0.3261 0.2990 0.2882 0.0319  0.0155  -0.0035 164 MET A SD  
1187 C CE  . MET A 166 ? 0.2565 0.2293 0.2169 0.0305  0.0098  0.0007  164 MET A CE  
1188 N N   . THR A 167 ? 0.2379 0.2291 0.2322 0.0279  0.0044  0.0014  165 THR A N   
1189 C CA  . THR A 167 ? 0.2662 0.2591 0.2622 0.0247  0.0051  0.0026  165 THR A CA  
1190 C C   . THR A 167 ? 0.2648 0.2614 0.2674 0.0229  0.0022  0.0036  165 THR A C   
1191 O O   . THR A 167 ? 0.2204 0.2204 0.2271 0.0206  0.0032  0.0043  165 THR A O   
1192 C CB  . THR A 167 ? 0.3065 0.2959 0.2984 0.0225  0.0046  0.0026  165 THR A CB  
1193 O OG1 . THR A 167 ? 0.2791 0.2667 0.2688 0.0248  0.0057  0.0025  165 THR A OG1 
1194 C CG2 . THR A 167 ? 0.2933 0.2815 0.2841 0.0185  0.0063  0.0028  165 THR A CG2 
1195 N N   . LYS A 168 ? 0.2284 0.2240 0.2323 0.0234  -0.0022 0.0042  166 LYS A N   
1196 C CA  . LYS A 168 ? 0.3045 0.3029 0.3151 0.0218  -0.0074 0.0063  166 LYS A CA  
1197 C C   . LYS A 168 ? 0.3044 0.3098 0.3287 0.0257  -0.0061 0.0062  166 LYS A C   
1198 O O   . LYS A 168 ? 0.2951 0.3067 0.3293 0.0239  -0.0087 0.0080  166 LYS A O   
1199 C CB  . LYS A 168 ? 0.2672 0.2602 0.2738 0.0212  -0.0130 0.0077  166 LYS A CB  
1200 C CG  . LYS A 168 ? 0.2956 0.2820 0.2899 0.0169  -0.0120 0.0071  166 LYS A CG  
1201 C CD  . LYS A 168 ? 0.3041 0.2839 0.2927 0.0149  -0.0169 0.0088  166 LYS A CD  
1202 C CE  . LYS A 168 ? 0.3227 0.2968 0.3005 0.0101  -0.0134 0.0074  166 LYS A CE  
1203 N NZ  . LYS A 168 ? 0.3348 0.3008 0.3046 0.0064  -0.0170 0.0092  166 LYS A NZ  
1204 N N   . ALA A 169 ? 0.2556 0.2601 0.2813 0.0305  -0.0018 0.0040  167 ALA A N   
1205 C CA  . ALA A 169 ? 0.2232 0.2336 0.2621 0.0343  0.0024  0.0027  167 ALA A CA  
1206 C C   . ALA A 169 ? 0.2753 0.2916 0.3180 0.0318  0.0079  0.0024  167 ALA A C   
1207 O O   . ALA A 169 ? 0.2812 0.3063 0.3397 0.0318  0.0086  0.0031  167 ALA A O   
1208 C CB  . ALA A 169 ? 0.2389 0.2436 0.2729 0.0387  0.0077  -0.0008 167 ALA A CB  
1209 N N   . LEU A 170 ? 0.2280 0.2396 0.2576 0.0294  0.0115  0.0017  168 LEU A N   
1210 C CA  . LEU A 170 ? 0.2534 0.2678 0.2838 0.0265  0.0170  0.0017  168 LEU A CA  
1211 C C   . LEU A 170 ? 0.2589 0.2780 0.2954 0.0214  0.0126  0.0040  168 LEU A C   
1212 O O   . LEU A 170 ? 0.2527 0.2783 0.2988 0.0189  0.0156  0.0043  168 LEU A O   
1213 C CB  . LEU A 170 ? 0.2720 0.2780 0.2862 0.0255  0.0201  0.0015  168 LEU A CB  
1214 C CG  . LEU A 170 ? 0.3562 0.3625 0.3692 0.0227  0.0271  0.0016  168 LEU A CG  
1215 C CD1 . LEU A 170 ? 0.3443 0.3536 0.3629 0.0244  0.0350  -0.0007 168 LEU A CD1 
1216 C CD2 . LEU A 170 ? 0.3346 0.3313 0.3320 0.0216  0.0280  0.0028  168 LEU A CD2 
1217 N N   . ALA A 171 ? 0.2135 0.2286 0.2435 0.0190  0.0060  0.0053  169 ALA A N   
1218 C CA  . ALA A 171 ? 0.2300 0.2472 0.2624 0.0131  0.0010  0.0071  169 ALA A CA  
1219 C C   . ALA A 171 ? 0.2743 0.3019 0.3252 0.0130  -0.0035 0.0089  169 ALA A C   
1220 O O   . ALA A 171 ? 0.2579 0.2912 0.3165 0.0081  -0.0048 0.0099  169 ALA A O   
1221 C CB  . ALA A 171 ? 0.1953 0.2048 0.2159 0.0102  -0.0046 0.0078  169 ALA A CB  
1222 N N   . LEU A 172 ? 0.2505 0.2806 0.3100 0.0184  -0.0063 0.0094  170 LEU A N   
1223 C CA  . LEU A 172 ? 0.2557 0.2966 0.3373 0.0200  -0.0107 0.0114  170 LEU A CA  
1224 C C   . LEU A 172 ? 0.2468 0.2977 0.3443 0.0211  -0.0018 0.0095  170 LEU A C   
1225 O O   . LEU A 172 ? 0.2452 0.3068 0.3604 0.0181  -0.0047 0.0112  170 LEU A O   
1226 C CB  . LEU A 172 ? 0.2972 0.3360 0.3844 0.0266  -0.0143 0.0120  170 LEU A CB  
1227 C CG  . LEU A 172 ? 0.3088 0.3397 0.3854 0.0239  -0.0257 0.0156  170 LEU A CG  
1228 C CD1 . LEU A 172 ? 0.2932 0.3178 0.3694 0.0300  -0.0276 0.0159  170 LEU A CD1 
1229 C CD2 . LEU A 172 ? 0.3012 0.3380 0.3887 0.0193  -0.0373 0.0205  170 LEU A CD2 
1230 N N   . ASP A 173 ? 0.2167 0.2639 0.3075 0.0244  0.0092  0.0059  171 ASP A N   
1231 C CA  . ASP A 173 ? 0.2592 0.3140 0.3626 0.0247  0.0197  0.0037  171 ASP A CA  
1232 C C   . ASP A 173 ? 0.2591 0.3166 0.3611 0.0171  0.0218  0.0046  171 ASP A C   
1233 O O   . ASP A 173 ? 0.2276 0.2959 0.3477 0.0149  0.0264  0.0043  171 ASP A O   
1234 C CB  . ASP A 173 ? 0.2889 0.3353 0.3790 0.0283  0.0305  -0.0002 171 ASP A CB  
1235 C CG  . ASP A 173 ? 0.3579 0.4021 0.4529 0.0355  0.0314  -0.0023 171 ASP A CG  
1236 O OD1 . ASP A 173 ? 0.3060 0.3590 0.4233 0.0391  0.0284  -0.0016 171 ASP A OD1 
1237 O OD2 . ASP A 173 ? 0.3941 0.4272 0.4709 0.0374  0.0345  -0.0046 171 ASP A OD2 
1238 N N   . GLU A 174 ? 0.2514 0.2988 0.3329 0.0130  0.0192  0.0054  172 GLU A N   
1239 C CA  . GLU A 174 ? 0.2802 0.3260 0.3566 0.0061  0.0225  0.0058  172 GLU A CA  
1240 C C   . GLU A 174 ? 0.2880 0.3373 0.3693 -0.0008 0.0133  0.0081  172 GLU A C   
1241 O O   . GLU A 174 ? 0.2656 0.3152 0.3469 -0.0075 0.0157  0.0083  172 GLU A O   
1242 C CB  . GLU A 174 ? 0.2626 0.2939 0.3149 0.0060  0.0260  0.0052  172 GLU A CB  
1243 C CG  . GLU A 174 ? 0.2748 0.3013 0.3194 0.0104  0.0348  0.0034  172 GLU A CG  
1244 C CD  . GLU A 174 ? 0.3747 0.4069 0.4285 0.0080  0.0449  0.0023  172 GLU A CD  
1245 O OE1 . GLU A 174 ? 0.3857 0.4212 0.4458 0.0118  0.0515  -0.0001 172 GLU A OE1 
1246 O OE2 . GLU A 174 ? 0.3617 0.3944 0.4162 0.0017  0.0472  0.0034  172 GLU A OE2 
1247 N N   . SER A 175 ? 0.1969 0.2475 0.2811 -0.0002 0.0027  0.0099  173 SER A N   
1248 C CA  . SER A 175 ? 0.2549 0.3071 0.3408 -0.0081 -0.0073 0.0123  173 SER A CA  
1249 C C   . SER A 175 ? 0.2945 0.3604 0.4024 -0.0133 -0.0080 0.0134  173 SER A C   
1250 O O   . SER A 175 ? 0.3088 0.3720 0.4111 -0.0222 -0.0111 0.0139  173 SER A O   
1251 C CB  . SER A 175 ? 0.2842 0.3352 0.3698 -0.0069 -0.0193 0.0150  173 SER A CB  
1252 O OG  . SER A 175 ? 0.3697 0.4320 0.4779 -0.0006 -0.0223 0.0166  173 SER A OG  
1253 N N   . PRO A 176 ? 0.2950 0.3754 0.4285 -0.0087 -0.0044 0.0135  174 PRO A N   
1254 C CA  . PRO A 176 ? 0.3008 0.3960 0.4581 -0.0146 -0.0042 0.0144  174 PRO A CA  
1255 C C   . PRO A 176 ? 0.3510 0.4419 0.4991 -0.0214 0.0059  0.0124  174 PRO A C   
1256 O O   . PRO A 176 ? 0.3334 0.4335 0.4960 -0.0293 0.0043  0.0134  174 PRO A O   
1257 C CB  . PRO A 176 ? 0.3147 0.4245 0.5005 -0.0065 0.0020  0.0136  174 PRO A CB  
1258 C CG  . PRO A 176 ? 0.3232 0.4263 0.5020 0.0024  -0.0013 0.0136  174 PRO A CG  
1259 C CD  . PRO A 176 ? 0.3020 0.3862 0.4458 0.0014  0.0001  0.0123  174 PRO A CD  
1260 N N   . TYR A 177 ? 0.3530 0.4299 0.4781 -0.0190 0.0156  0.0101  175 TYR A N   
1261 C CA  . TYR A 177 ? 0.3666 0.4363 0.4806 -0.0250 0.0249  0.0089  175 TYR A CA  
1262 C C   . TYR A 177 ? 0.4082 0.4618 0.4981 -0.0305 0.0205  0.0092  175 TYR A C   
1263 O O   . TYR A 177 ? 0.4306 0.4747 0.5085 -0.0348 0.0274  0.0086  175 TYR A O   
1264 C CB  . TYR A 177 ? 0.4403 0.5033 0.5440 -0.0194 0.0380  0.0069  175 TYR A CB  
1265 C CG  . TYR A 177 ? 0.4963 0.5726 0.6216 -0.0142 0.0451  0.0054  175 TYR A CG  
1266 C CD1 . TYR A 177 ? 0.5266 0.6050 0.6564 -0.0054 0.0425  0.0045  175 TYR A CD1 
1267 C CD2 . TYR A 177 ? 0.5799 0.6665 0.7225 -0.0186 0.0551  0.0044  175 TYR A CD2 
1268 C CE1 . TYR A 177 ? 0.6001 0.6893 0.7506 -0.0002 0.0500  0.0024  175 TYR A CE1 
1269 C CE2 . TYR A 177 ? 0.6218 0.7207 0.7864 -0.0137 0.0636  0.0021  175 TYR A CE2 
1270 C CZ  . TYR A 177 ? 0.6508 0.7504 0.8191 -0.0041 0.0611  0.0009  175 TYR A CZ  
1271 O OH  . TYR A 177 ? 0.6923 0.8025 0.8828 0.0013  0.0707  -0.0021 175 TYR A OH  
1272 N N   . GLY A 178 ? 0.3463 0.3953 0.4282 -0.0305 0.0098  0.0100  176 GLY A N   
1273 C CA  . GLY A 178 ? 0.4412 0.4740 0.5005 -0.0356 0.0076  0.0091  176 GLY A CA  
1274 C C   . GLY A 178 ? 0.4105 0.4289 0.4500 -0.0295 0.0139  0.0077  176 GLY A C   
1275 O O   . GLY A 178 ? 0.3958 0.4002 0.4186 -0.0328 0.0146  0.0066  176 GLY A O   
1276 N N   . VAL A 179 ? 0.2891 0.3102 0.3307 -0.0210 0.0185  0.0076  177 VAL A N   
1277 C CA  . VAL A 179 ? 0.2602 0.2690 0.2852 -0.0155 0.0226  0.0069  177 VAL A CA  
1278 C C   . VAL A 179 ? 0.2799 0.2869 0.3002 -0.0112 0.0164  0.0065  177 VAL A C   
1279 O O   . VAL A 179 ? 0.2929 0.3081 0.3226 -0.0068 0.0134  0.0069  177 VAL A O   
1280 C CB  . VAL A 179 ? 0.2372 0.2473 0.2630 -0.0104 0.0305  0.0070  177 VAL A CB  
1281 C CG1 . VAL A 179 ? 0.2227 0.2215 0.2330 -0.0047 0.0316  0.0070  177 VAL A CG1 
1282 C CG2 . VAL A 179 ? 0.2861 0.2945 0.3121 -0.0162 0.0381  0.0076  177 VAL A CG2 
1283 N N   . ARG A 180 ? 0.2669 0.2625 0.2735 -0.0127 0.0153  0.0056  178 ARG A N   
1284 C CA  . ARG A 180 ? 0.2622 0.2543 0.2625 -0.0096 0.0115  0.0049  178 ARG A CA  
1285 C C   . ARG A 180 ? 0.2953 0.2847 0.2922 -0.0019 0.0153  0.0047  178 ARG A C   
1286 O O   . ARG A 180 ? 0.2810 0.2653 0.2738 -0.0001 0.0203  0.0050  178 ARG A O   
1287 C CB  . ARG A 180 ? 0.2543 0.2348 0.2417 -0.0152 0.0109  0.0031  178 ARG A CB  
1288 C CG  . ARG A 180 ? 0.2791 0.2601 0.2662 -0.0248 0.0053  0.0032  178 ARG A CG  
1289 C CD  . ARG A 180 ? 0.3003 0.2661 0.2707 -0.0316 0.0069  0.0004  178 ARG A CD  
1290 N NE  . ARG A 180 ? 0.3394 0.2957 0.3050 -0.0303 0.0154  -0.0013 178 ARG A NE  
1291 C CZ  . ARG A 180 ? 0.3722 0.3191 0.3311 -0.0256 0.0213  -0.0032 178 ARG A CZ  
1292 N NH1 . ARG A 180 ? 0.3853 0.3314 0.3408 -0.0228 0.0207  -0.0044 178 ARG A NH1 
1293 N NH2 . ARG A 180 ? 0.3478 0.2860 0.3046 -0.0238 0.0277  -0.0038 178 ARG A NH2 
1294 N N   . VAL A 181 ? 0.2830 0.2749 0.2807 0.0019  0.0118  0.0046  179 VAL A N   
1295 C CA  . VAL A 181 ? 0.2425 0.2326 0.2376 0.0082  0.0135  0.0044  179 VAL A CA  
1296 C C   . VAL A 181 ? 0.2569 0.2435 0.2474 0.0083  0.0108  0.0035  179 VAL A C   
1297 O O   . VAL A 181 ? 0.2761 0.2654 0.2682 0.0071  0.0061  0.0039  179 VAL A O   
1298 C CB  . VAL A 181 ? 0.2364 0.2336 0.2386 0.0126  0.0136  0.0048  179 VAL A CB  
1299 C CG1 . VAL A 181 ? 0.2392 0.2325 0.2356 0.0176  0.0146  0.0044  179 VAL A CG1 
1300 C CG2 . VAL A 181 ? 0.2665 0.2679 0.2744 0.0112  0.0180  0.0051  179 VAL A CG2 
1301 N N   . ASN A 182 ? 0.2422 0.2224 0.2277 0.0096  0.0138  0.0025  180 ASN A N   
1302 C CA  . ASN A 182 ? 0.2585 0.2352 0.2404 0.0088  0.0135  0.0010  180 ASN A CA  
1303 C C   . ASN A 182 ? 0.2833 0.2600 0.2680 0.0140  0.0150  0.0010  180 ASN A C   
1304 O O   . ASN A 182 ? 0.3309 0.3077 0.3175 0.0176  0.0158  0.0023  180 ASN A O   
1305 C CB  . ASN A 182 ? 0.2905 0.2590 0.2654 0.0033  0.0169  -0.0011 180 ASN A CB  
1306 C CG  . ASN A 182 ? 0.3285 0.2961 0.2989 -0.0036 0.0133  -0.0008 180 ASN A CG  
1307 O OD1 . ASN A 182 ? 0.2793 0.2483 0.2471 -0.0064 0.0081  0.0000  180 ASN A OD1 
1308 N ND2 . ASN A 182 ? 0.3177 0.2823 0.2868 -0.0069 0.0152  -0.0011 180 ASN A ND2 
1309 N N   . CYS A 183 ? 0.2493 0.2255 0.2339 0.0137  0.0150  -0.0003 181 CYS A N   
1310 C CA  . CYS A 183 ? 0.2458 0.2232 0.2361 0.0178  0.0160  -0.0004 181 CYS A CA  
1311 C C   . CYS A 183 ? 0.3147 0.2886 0.3063 0.0157  0.0211  -0.0030 181 CYS A C   
1312 O O   . CYS A 183 ? 0.2945 0.2639 0.2787 0.0103  0.0235  -0.0049 181 CYS A O   
1313 C CB  . CYS A 183 ? 0.3065 0.2887 0.2989 0.0202  0.0114  0.0005  181 CYS A CB  
1314 S SG  . CYS A 183 ? 0.3042 0.2860 0.2931 0.0163  0.0093  -0.0003 181 CYS A SG  
1315 N N   . ILE A 184 ? 0.2362 0.2116 0.2373 0.0198  0.0230  -0.0029 182 ILE A N   
1316 C CA  . ILE A 184 ? 0.2177 0.1923 0.2256 0.0192  0.0291  -0.0057 182 ILE A CA  
1317 C C   . ILE A 184 ? 0.2579 0.2402 0.2751 0.0211  0.0257  -0.0049 182 ILE A C   
1318 O O   . ILE A 184 ? 0.2397 0.2264 0.2617 0.0251  0.0194  -0.0020 182 ILE A O   
1319 C CB  . ILE A 184 ? 0.2478 0.2189 0.2644 0.0230  0.0339  -0.0062 182 ILE A CB  
1320 C CG1 . ILE A 184 ? 0.3030 0.2650 0.3091 0.0203  0.0371  -0.0071 182 ILE A CG1 
1321 C CG2 . ILE A 184 ? 0.2345 0.2061 0.2623 0.0232  0.0419  -0.0096 182 ILE A CG2 
1322 C CD1 . ILE A 184 ? 0.2663 0.2224 0.2797 0.0247  0.0409  -0.0068 182 ILE A CD1 
1323 N N   . SER A 185 ? 0.2338 0.2163 0.2516 0.0171  0.0299  -0.0074 183 SER A N   
1324 C CA  . SER A 185 ? 0.2588 0.2484 0.2865 0.0175  0.0276  -0.0070 183 SER A CA  
1325 C C   . SER A 185 ? 0.2803 0.2731 0.3239 0.0180  0.0357  -0.0096 183 SER A C   
1326 O O   . SER A 185 ? 0.3165 0.3056 0.3568 0.0127  0.0444  -0.0132 183 SER A O   
1327 C CB  . SER A 185 ? 0.3084 0.2957 0.3251 0.0119  0.0260  -0.0073 183 SER A CB  
1328 O OG  . SER A 185 ? 0.2932 0.2803 0.3023 0.0134  0.0179  -0.0047 183 SER A OG  
1329 N N   . PRO A 186 ? 0.2382 0.2371 0.2994 0.0240  0.0336  -0.0080 184 PRO A N   
1330 C CA  . PRO A 186 ? 0.2041 0.2082 0.2862 0.0255  0.0414  -0.0105 184 PRO A CA  
1331 C C   . PRO A 186 ? 0.2380 0.2510 0.3306 0.0222  0.0407  -0.0110 184 PRO A C   
1332 O O   . PRO A 186 ? 0.2003 0.2163 0.2879 0.0210  0.0314  -0.0084 184 PRO A O   
1333 C CB  . PRO A 186 ? 0.2155 0.2234 0.3135 0.0335  0.0357  -0.0068 184 PRO A CB  
1334 C CG  . PRO A 186 ? 0.2500 0.2512 0.3298 0.0348  0.0277  -0.0033 184 PRO A CG  
1335 C CD  . PRO A 186 ? 0.2296 0.2299 0.2923 0.0296  0.0242  -0.0036 184 PRO A CD  
1336 N N   . GLY A 187 ? 0.2988 0.3151 0.4058 0.0203  0.0519  -0.0149 185 GLY A N   
1337 C CA  . GLY A 187 ? 0.2347 0.2621 0.3596 0.0178  0.0520  -0.0153 185 GLY A CA  
1338 C C   . GLY A 187 ? 0.2772 0.3172 0.4338 0.0249  0.0483  -0.0132 185 GLY A C   
1339 O O   . GLY A 187 ? 0.3634 0.4043 0.5219 0.0310  0.0372  -0.0086 185 GLY A O   
1340 N N   . ASN A 188 ? 0.2389 0.2752 0.3164 0.0261  0.0437  -0.0033 186 ASN A N   
1341 C CA  . ASN A 188 ? 0.2612 0.3077 0.3370 0.0235  0.0382  -0.0053 186 ASN A CA  
1342 C C   . ASN A 188 ? 0.3026 0.3538 0.3884 0.0295  0.0316  -0.0011 186 ASN A C   
1343 O O   . ASN A 188 ? 0.2650 0.3207 0.3604 0.0348  0.0275  -0.0054 186 ASN A O   
1344 C CB  . ASN A 188 ? 0.2262 0.2858 0.3060 0.0163  0.0353  -0.0077 186 ASN A CB  
1345 C CG  . ASN A 188 ? 0.3369 0.3814 0.4093 0.0046  0.0346  -0.0093 186 ASN A CG  
1346 O OD1 . ASN A 188 ? 0.2958 0.3245 0.3557 0.0047  0.0330  -0.0170 186 ASN A OD1 
1347 N ND2 . ASN A 188 ? 0.3339 0.3825 0.4130 -0.0056 0.0338  -0.0019 186 ASN A ND2 
1348 N N   . ILE A 189 ? 0.2189 0.2693 0.3016 0.0286  0.0283  0.0073  187 ILE A N   
1349 C CA  . ILE A 189 ? 0.1921 0.2364 0.2865 0.0310  0.0156  0.0164  187 ILE A CA  
1350 C C   . ILE A 189 ? 0.2090 0.2607 0.2998 0.0324  0.0071  0.0203  187 ILE A C   
1351 O O   . ILE A 189 ? 0.2705 0.3346 0.3453 0.0268  0.0116  0.0239  187 ILE A O   
1352 C CB  . ILE A 189 ? 0.2227 0.2654 0.3206 0.0235  0.0155  0.0340  187 ILE A CB  
1353 C CG1 . ILE A 189 ? 0.2399 0.2858 0.3417 0.0231  0.0252  0.0304  187 ILE A CG1 
1354 C CG2 . ILE A 189 ? 0.2754 0.2987 0.3903 0.0213  -0.0045 0.0467  187 ILE A CG2 
1355 C CD1 . ILE A 189 ? 0.2451 0.2799 0.3568 0.0281  0.0191  0.0183  187 ILE A CD1 
1356 N N   . TRP A 190 ? 0.2356 0.2826 0.3407 0.0427  -0.0068 0.0170  188 TRP A N   
1357 C CA  . TRP A 190 ? 0.2602 0.3183 0.3668 0.0478  -0.0178 0.0217  188 TRP A CA  
1358 C C   . TRP A 190 ? 0.2998 0.3469 0.4036 0.0412  -0.0290 0.0475  188 TRP A C   
1359 O O   . TRP A 190 ? 0.3062 0.3261 0.4249 0.0429  -0.0440 0.0590  188 TRP A O   
1360 C CB  . TRP A 190 ? 0.2769 0.3386 0.4031 0.0675  -0.0295 0.0074  188 TRP A CB  
1361 C CG  . TRP A 190 ? 0.2869 0.3665 0.4206 0.0773  -0.0424 0.0116  188 TRP A CG  
1362 C CD1 . TRP A 190 ? 0.4018 0.4651 0.5531 0.0957  -0.0646 0.0159  188 TRP A CD1 
1363 C CD2 . TRP A 190 ? 0.3533 0.4695 0.4798 0.0698  -0.0379 0.0121  188 TRP A CD2 
1364 N NE1 . TRP A 190 ? 0.3996 0.4933 0.5558 0.1026  -0.0725 0.0207  188 TRP A NE1 
1365 C CE2 . TRP A 190 ? 0.3934 0.5225 0.5342 0.0850  -0.0563 0.0182  188 TRP A CE2 
1366 C CE3 . TRP A 190 ? 0.2682 0.4034 0.3793 0.0516  -0.0241 0.0073  188 TRP A CE3 
1367 C CZ2 . TRP A 190 ? 0.3750 0.5446 0.5150 0.0807  -0.0597 0.0206  188 TRP A CZ2 
1368 C CZ3 . TRP A 190 ? 0.2665 0.4338 0.3761 0.0451  -0.0294 0.0076  188 TRP A CZ3 
1369 C CH2 . TRP A 190 ? 0.3645 0.5535 0.4885 0.0587  -0.0462 0.0146  188 TRP A CH2 
1370 N N   . THR A 191 ? 0.3059 0.3753 0.3894 0.0316  -0.0236 0.0577  189 THR A N   
1371 C CA  . THR A 191 ? 0.3105 0.3879 0.3841 0.0215  -0.0298 0.0871  189 THR A CA  
1372 C C   . THR A 191 ? 0.3443 0.4502 0.4003 0.0211  -0.0353 0.0915  189 THR A C   
1373 O O   . THR A 191 ? 0.3631 0.4810 0.4164 0.0257  -0.0331 0.0698  189 THR A O   
1374 C CB  . THR A 191 ? 0.3086 0.4028 0.3668 0.0101  -0.0119 0.0929  189 THR A CB  
1375 O OG1 . THR A 191 ? 0.3205 0.4345 0.3557 0.0122  0.0035  0.0695  189 THR A OG1 
1376 C CG2 . THR A 191 ? 0.2600 0.3336 0.3365 0.0088  -0.0075 0.0897  189 THR A CG2 
1377 N N   . PRO A 192 ? 0.3499 0.4725 0.3940 0.0129  -0.0439 0.1218  190 PRO A N   
1378 C CA  . PRO A 192 ? 0.3407 0.4984 0.3622 0.0118  -0.0495 0.1245  190 PRO A CA  
1379 C C   . PRO A 192 ? 0.3643 0.5478 0.3558 0.0081  -0.0316 0.0962  190 PRO A C   
1380 O O   . PRO A 192 ? 0.3768 0.5790 0.3557 0.0083  -0.0379 0.0819  190 PRO A O   
1381 C CB  . PRO A 192 ? 0.4155 0.5909 0.4275 0.0010  -0.0605 0.1687  190 PRO A CB  
1382 C CG  . PRO A 192 ? 0.4187 0.5507 0.4629 -0.0011 -0.0726 0.1905  190 PRO A CG  
1383 C CD  . PRO A 192 ? 0.3702 0.4821 0.4242 0.0021  -0.0545 0.1598  190 PRO A CD  
1384 N N   . LEU A 193 ? 0.3160 0.4998 0.2977 0.0057  -0.0125 0.0861  191 LEU A N   
1385 C CA  . LEU A 193 ? 0.3843 0.5800 0.3400 0.0075  0.0001  0.0535  191 LEU A CA  
1386 C C   . LEU A 193 ? 0.3743 0.5424 0.3438 0.0090  -0.0027 0.0258  191 LEU A C   
1387 O O   . LEU A 193 ? 0.3721 0.5474 0.3261 0.0054  -0.0082 0.0052  191 LEU A O   
1388 C CB  . LEU A 193 ? 0.4380 0.6408 0.3866 0.0107  0.0195  0.0482  191 LEU A CB  
1389 C CG  . LEU A 193 ? 0.4346 0.6381 0.3602 0.0197  0.0305  0.0096  191 LEU A CG  
1390 C CD1 . LEU A 193 ? 0.3817 0.6206 0.2678 0.0213  0.0260  -0.0056 191 LEU A CD1 
1391 C CD2 . LEU A 193 ? 0.4055 0.6202 0.3337 0.0287  0.0488  0.0076  191 LEU A CD2 
1392 N N   . TRP A 194 ? 0.3287 0.4693 0.3273 0.0120  -0.0007 0.0262  192 TRP A N   
1393 C CA  . TRP A 194 ? 0.3258 0.4536 0.3390 0.0105  -0.0024 0.0076  192 TRP A CA  
1394 C C   . TRP A 194 ? 0.3321 0.4826 0.3505 0.0076  -0.0178 0.0082  192 TRP A C   
1395 O O   . TRP A 194 ? 0.3008 0.4579 0.3161 -0.0022 -0.0219 -0.0076 192 TRP A O   
1396 C CB  . TRP A 194 ? 0.2909 0.4003 0.3312 0.0165  0.0012  0.0105  192 TRP A CB  
1397 C CG  . TRP A 194 ? 0.3022 0.3983 0.3473 0.0125  0.0097  -0.0048 192 TRP A CG  
1398 C CD1 . TRP A 194 ? 0.3254 0.4025 0.3705 0.0145  0.0205  -0.0077 192 TRP A CD1 
1399 C CD2 . TRP A 194 ? 0.3205 0.4253 0.3736 0.0034  0.0059  -0.0137 192 TRP A CD2 
1400 N NE1 . TRP A 194 ? 0.2642 0.3321 0.3146 0.0081  0.0225  -0.0163 192 TRP A NE1 
1401 C CE2 . TRP A 194 ? 0.3150 0.4004 0.3709 -0.0011 0.0139  -0.0186 192 TRP A CE2 
1402 C CE3 . TRP A 194 ? 0.2675 0.4002 0.3286 -0.0032 -0.0050 -0.0144 192 TRP A CE3 
1403 C CZ2 . TRP A 194 ? 0.2901 0.3801 0.3556 -0.0156 0.0108  -0.0201 192 TRP A CZ2 
1404 C CZ3 . TRP A 194 ? 0.2576 0.4012 0.3306 -0.0181 -0.0066 -0.0183 192 TRP A CZ3 
1405 C CH2 . TRP A 194 ? 0.2603 0.3812 0.3349 -0.0258 0.0010  -0.0192 192 TRP A CH2 
1406 N N   . GLU A 195 ? 0.3019 0.4642 0.3308 0.0151  -0.0297 0.0283  193 GLU A N   
1407 C CA  . GLU A 195 ? 0.3115 0.5018 0.3516 0.0171  -0.0460 0.0308  193 GLU A CA  
1408 C C   . GLU A 195 ? 0.3268 0.5432 0.3383 0.0053  -0.0534 0.0253  193 GLU A C   
1409 O O   . GLU A 195 ? 0.3135 0.5525 0.3314 -0.0025 -0.0630 0.0143  193 GLU A O   
1410 C CB  . GLU A 195 ? 0.4280 0.6169 0.4866 0.0322  -0.0612 0.0544  193 GLU A CB  
1411 C CG  . GLU A 195 ? 0.4980 0.7183 0.5802 0.0430  -0.0779 0.0542  193 GLU A CG  
1412 C CD  . GLU A 195 ? 0.6374 0.8452 0.7431 0.0649  -0.0969 0.0738  193 GLU A CD  
1413 O OE1 . GLU A 195 ? 0.6904 0.8706 0.7867 0.0628  -0.1033 0.0977  193 GLU A OE1 
1414 O OE2 . GLU A 195 ? 0.6634 0.8905 0.7991 0.0845  -0.1070 0.0661  193 GLU A OE2 
1415 N N   . GLU A 196 ? 0.3485 0.5694 0.3282 0.0029  -0.0500 0.0324  194 GLU A N   
1416 C CA  . GLU A 196 ? 0.4548 0.7038 0.3997 -0.0057 -0.0570 0.0201  194 GLU A CA  
1417 C C   . GLU A 196 ? 0.4516 0.6838 0.3883 -0.0156 -0.0541 -0.0159 194 GLU A C   
1418 O O   . GLU A 196 ? 0.3907 0.6393 0.3203 -0.0268 -0.0695 -0.0308 194 GLU A O   
1419 C CB  . GLU A 196 ? 0.5440 0.8115 0.4536 -0.0039 -0.0491 0.0318  194 GLU A CB  
1420 C CG  . GLU A 196 ? 0.5489 0.8370 0.4619 -0.0017 -0.0590 0.0752  194 GLU A CG  
1421 C CD  . GLU A 196 ? 0.6483 0.9591 0.5355 -0.0041 -0.0460 0.0948  194 GLU A CD  
1422 O OE1 . GLU A 196 ? 0.6780 0.9952 0.5429 -0.0020 -0.0280 0.0690  194 GLU A OE1 
1423 O OE2 . GLU A 196 ? 0.6839 1.0086 0.5756 -0.0078 -0.0550 0.1378  194 GLU A OE2 
1424 N N   . LEU A 197 ? 0.3919 0.5891 0.3315 -0.0130 -0.0381 -0.0287 195 LEU A N   
1425 C CA  . LEU A 197 ? 0.4206 0.5899 0.3544 -0.0221 -0.0395 -0.0593 195 LEU A CA  
1426 C C   . LEU A 197 ? 0.4529 0.6229 0.4172 -0.0382 -0.0517 -0.0592 195 LEU A C   
1427 O O   . LEU A 197 ? 0.3826 0.5491 0.3407 -0.0550 -0.0670 -0.0778 195 LEU A O   
1428 C CB  . LEU A 197 ? 0.4258 0.5588 0.3628 -0.0133 -0.0221 -0.0664 195 LEU A CB  
1429 C CG  . LEU A 197 ? 0.4955 0.6364 0.4018 0.0018  -0.0096 -0.0753 195 LEU A CG  
1430 C CD1 . LEU A 197 ? 0.4444 0.5605 0.3648 0.0126  0.0074  -0.0737 195 LEU A CD1 
1431 C CD2 . LEU A 197 ? 0.5083 0.6468 0.3790 0.0036  -0.0187 -0.1121 195 LEU A CD2 
1432 N N   . ALA A 198 ? 0.3644 0.5442 0.3624 -0.0339 -0.0468 -0.0393 196 ALA A N   
1433 C CA  . ALA A 198 ? 0.3717 0.5738 0.4011 -0.0474 -0.0555 -0.0360 196 ALA A CA  
1434 C C   . ALA A 198 ? 0.3667 0.6117 0.3964 -0.0565 -0.0758 -0.0353 196 ALA A C   
1435 O O   . ALA A 198 ? 0.3331 0.5961 0.3785 -0.0782 -0.0882 -0.0403 196 ALA A O   
1436 C CB  . ALA A 198 ? 0.2668 0.4836 0.3279 -0.0328 -0.0460 -0.0199 196 ALA A CB  
1437 N N   . ALA A 199 ? 0.3589 0.6242 0.3727 -0.0431 -0.0816 -0.0254 197 ALA A N   
1438 C CA  . ALA A 199 ? 0.3658 0.6781 0.3807 -0.0494 -0.1030 -0.0212 197 ALA A CA  
1439 C C   . ALA A 199 ? 0.4134 0.7239 0.4023 -0.0728 -0.1182 -0.0462 197 ALA A C   
1440 O O   . ALA A 199 ? 0.4078 0.7573 0.4085 -0.0882 -0.1386 -0.0472 197 ALA A O   
1441 C CB  . ALA A 199 ? 0.3656 0.6959 0.3642 -0.0316 -0.1083 -0.0004 197 ALA A CB  
1442 N N   . LEU A 200 ? 0.4675 0.7345 0.4229 -0.0743 -0.1111 -0.0690 198 LEU A N   
1443 C CA  . LEU A 200 ? 0.5567 0.8090 0.4860 -0.0930 -0.1293 -0.1012 198 LEU A CA  
1444 C C   . LEU A 200 ? 0.5896 0.8215 0.5505 -0.1213 -0.1413 -0.1084 198 LEU A C   
1445 O O   . LEU A 200 ? 0.6474 0.8684 0.5968 -0.1437 -0.1653 -0.1319 198 LEU A O   
1446 C CB  . LEU A 200 ? 0.6011 0.8121 0.4886 -0.0794 -0.1185 -0.1282 198 LEU A CB  
1447 C CG  . LEU A 200 ? 0.6135 0.8483 0.4697 -0.0546 -0.1019 -0.1178 198 LEU A CG  
1448 N N   . MET A 201 ? 0.5519 0.7798 0.5509 -0.1228 -0.1272 -0.0880 199 MET A N   
1449 C CA  . MET A 201 ? 0.5183 0.7298 0.5469 -0.1525 -0.1360 -0.0867 199 MET A CA  
1450 C C   . MET A 201 ? 0.5414 0.8172 0.6041 -0.1774 -0.1549 -0.0726 199 MET A C   
1451 O O   . MET A 201 ? 0.5069 0.8427 0.5808 -0.1629 -0.1546 -0.0585 199 MET A O   
1452 C CB  . MET A 201 ? 0.5144 0.7125 0.5674 -0.1439 -0.1126 -0.0675 199 MET A CB  
1453 C CG  . MET A 201 ? 0.5736 0.7163 0.6004 -0.1206 -0.0948 -0.0782 199 MET A CG  
1454 S SD  . MET A 201 ? 0.6874 0.7525 0.6857 -0.1312 -0.1103 -0.1121 199 MET A SD  
1455 C CE  . MET A 201 ? 0.6637 0.6895 0.6514 -0.0996 -0.0830 -0.1118 199 MET A CE  
1456 N N   . PRO A 202 ? 0.5804 0.8465 0.6637 -0.2159 -0.1738 -0.0734 200 PRO A N   
1457 C CA  . PRO A 202 ? 0.6080 0.9484 0.7297 -0.2443 -0.1926 -0.0569 200 PRO A CA  
1458 C C   . PRO A 202 ? 0.5350 0.9503 0.6972 -0.2259 -0.1714 -0.0263 200 PRO A C   
1459 O O   . PRO A 202 ? 0.5132 0.9883 0.6928 -0.2158 -0.1754 -0.0165 200 PRO A O   
1460 C CB  . PRO A 202 ? 0.6698 0.9640 0.8085 -0.2812 -0.2071 -0.0555 200 PRO A CB  
1461 C CG  . PRO A 202 ? 0.6969 0.8958 0.7961 -0.2820 -0.2151 -0.0858 200 PRO A CG  
1462 C CD  . PRO A 202 ? 0.6143 0.8024 0.6910 -0.2367 -0.1823 -0.0862 200 PRO A CD  
1463 N N   . ASP A 203 ? 0.4893 0.8945 0.6629 -0.2139 -0.1473 -0.0139 201 ASP A N   
1464 C CA  . ASP A 203 ? 0.4087 0.8834 0.6155 -0.1904 -0.1273 0.0064  201 ASP A CA  
1465 C C   . ASP A 203 ? 0.3849 0.8159 0.5685 -0.1495 -0.1040 0.0006  201 ASP A C   
1466 O O   . ASP A 203 ? 0.3551 0.7537 0.5369 -0.1480 -0.0876 0.0044  201 ASP A O   
1467 C CB  . ASP A 203 ? 0.4612 0.9571 0.6964 -0.2088 -0.1161 0.0279  201 ASP A CB  
1468 C CG  . ASP A 203 ? 0.5136 1.0821 0.7734 -0.1781 -0.0959 0.0412  201 ASP A CG  
1469 O OD1 . ASP A 203 ? 0.4958 1.0800 0.7533 -0.1394 -0.0898 0.0327  201 ASP A OD1 
1470 O OD2 . ASP A 203 ? 0.5278 1.1346 0.8064 -0.1914 -0.0879 0.0592  201 ASP A OD2 
1471 N N   . PRO A 204 ? 0.3642 0.7943 0.5307 -0.1184 -0.1043 -0.0052 202 PRO A N   
1472 C CA  . PRO A 204 ? 0.3706 0.7578 0.5183 -0.0848 -0.0861 -0.0073 202 PRO A CA  
1473 C C   . PRO A 204 ? 0.3746 0.7824 0.5478 -0.0669 -0.0675 0.0008  202 PRO A C   
1474 O O   . PRO A 204 ? 0.3339 0.6948 0.4930 -0.0580 -0.0527 -0.0021 202 PRO A O   
1475 C CB  . PRO A 204 ? 0.3689 0.7734 0.5078 -0.0608 -0.0963 -0.0042 202 PRO A CB  
1476 C CG  . PRO A 204 ? 0.3940 0.8221 0.5238 -0.0848 -0.1189 -0.0095 202 PRO A CG  
1477 C CD  . PRO A 204 ? 0.3822 0.8458 0.5434 -0.1173 -0.1252 -0.0074 202 PRO A CD  
1478 N N   . ARG A 205 ? 0.3038 0.7881 0.5141 -0.0595 -0.0685 0.0089  203 ARG A N   
1479 C CA  . ARG A 205 ? 0.2889 0.8033 0.5197 -0.0373 -0.0512 0.0105  203 ARG A CA  
1480 C C   . ARG A 205 ? 0.3260 0.8291 0.5549 -0.0633 -0.0383 0.0170  203 ARG A C   
1481 O O   . ARG A 205 ? 0.4150 0.8962 0.6360 -0.0471 -0.0231 0.0140  203 ARG A O   
1482 C CB  . ARG A 205 ? 0.3315 0.9184 0.5912 -0.0202 -0.0522 0.0140  203 ARG A CB  
1483 N N   . ALA A 206 ? 0.2888 0.8040 0.5256 -0.1054 -0.0477 0.0278  204 ALA A N   
1484 C CA  . ALA A 206 ? 0.3018 0.7949 0.5367 -0.1341 -0.0410 0.0403  204 ALA A CA  
1485 C C   . ALA A 206 ? 0.3766 0.7715 0.5753 -0.1261 -0.0358 0.0293  204 ALA A C   
1486 O O   . ALA A 206 ? 0.3706 0.7493 0.5653 -0.1240 -0.0228 0.0363  204 ALA A O   
1487 C CB  . ALA A 206 ? 0.3059 0.7963 0.5485 -0.1793 -0.0586 0.0533  204 ALA A CB  
1488 N N   . THR A 207 ? 0.3901 0.7282 0.5624 -0.1209 -0.0458 0.0128  205 THR A N   
1489 C CA  . THR A 207 ? 0.3154 0.5745 0.4562 -0.1099 -0.0397 0.0014  205 THR A CA  
1490 C C   . THR A 207 ? 0.3450 0.6017 0.4822 -0.0762 -0.0218 0.0005  205 THR A C   
1491 O O   . THR A 207 ? 0.3468 0.5657 0.4739 -0.0720 -0.0118 0.0011  205 THR A O   
1492 C CB  . THR A 207 ? 0.3279 0.5490 0.4403 -0.1077 -0.0521 -0.0169 205 THR A CB  
1493 O OG1 . THR A 207 ? 0.4093 0.6284 0.5245 -0.1405 -0.0734 -0.0211 205 THR A OG1 
1494 C CG2 . THR A 207 ? 0.3394 0.4942 0.4222 -0.0943 -0.0443 -0.0297 205 THR A CG2 
1495 N N   . ILE A 208 ? 0.2987 0.5935 0.4462 -0.0517 -0.0210 -0.0012 206 ILE A N   
1496 C CA  . ILE A 208 ? 0.3603 0.6466 0.5073 -0.0212 -0.0102 -0.0046 206 ILE A CA  
1497 C C   . ILE A 208 ? 0.3741 0.6930 0.5356 -0.0198 0.0021  -0.0003 206 ILE A C   
1498 O O   . ILE A 208 ? 0.3377 0.6290 0.4895 -0.0080 0.0112  -0.0035 206 ILE A O   
1499 C CB  . ILE A 208 ? 0.3229 0.6343 0.4810 0.0054  -0.0186 -0.0073 206 ILE A CB  
1500 C CG1 . ILE A 208 ? 0.3374 0.6215 0.4757 0.0024  -0.0307 -0.0059 206 ILE A CG1 
1501 C CG2 . ILE A 208 ? 0.2859 0.5798 0.4467 0.0354  -0.0135 -0.0135 206 ILE A CG2 
1502 C CD1 . ILE A 208 ? 0.3262 0.6413 0.4788 0.0229  -0.0452 -0.0011 206 ILE A CD1 
1503 N N   . ARG A 209 ? 0.3754 0.7624 0.5603 -0.0331 0.0020  0.0087  207 ARG A N   
1504 C CA  . ARG A 209 ? 0.3112 0.7469 0.5074 -0.0346 0.0149  0.0167  207 ARG A CA  
1505 C C   . ARG A 209 ? 0.3300 0.7177 0.5099 -0.0578 0.0192  0.0290  207 ARG A C   
1506 O O   . ARG A 209 ? 0.3373 0.7260 0.5097 -0.0468 0.0298  0.0295  207 ARG A O   
1507 C CB  . ARG A 209 ? 0.2757 0.7915 0.4952 -0.0500 0.0135  0.0297  207 ARG A CB  
1508 N N   . GLU A 210 ? 0.3522 0.6947 0.5258 -0.0880 0.0080  0.0369  208 GLU A N   
1509 C CA  . GLU A 210 ? 0.4035 0.6891 0.5637 -0.1050 0.0076  0.0473  208 GLU A CA  
1510 C C   . GLU A 210 ? 0.3931 0.6220 0.5311 -0.0778 0.0151  0.0328  208 GLU A C   
1511 O O   . GLU A 210 ? 0.3604 0.5732 0.4925 -0.0772 0.0211  0.0415  208 GLU A O   
1512 C CB  . GLU A 210 ? 0.4554 0.6918 0.6128 -0.1360 -0.0111 0.0499  208 GLU A CB  
1513 C CG  . GLU A 210 ? 0.4302 0.7178 0.6142 -0.1749 -0.0229 0.0720  208 GLU A CG  
1514 N N   . GLY A 211 ? 0.3843 0.5890 0.5114 -0.0573 0.0135  0.0146  209 GLY A N   
1515 C CA  . GLY A 211 ? 0.3002 0.4618 0.4113 -0.0359 0.0198  0.0053  209 GLY A CA  
1516 C C   . GLY A 211 ? 0.3433 0.5286 0.4591 -0.0171 0.0290  0.0046  209 GLY A C   
1517 O O   . GLY A 211 ? 0.3289 0.4860 0.4358 -0.0104 0.0336  0.0047  209 GLY A O   
1518 N N   . MET A 212 ? 0.3471 0.5875 0.4772 -0.0058 0.0301  0.0008  210 MET A N   
1519 C CA  . MET A 212 ? 0.3519 0.6176 0.4837 0.0156  0.0362  -0.0077 210 MET A CA  
1520 C C   . MET A 212 ? 0.3830 0.6730 0.5112 0.0024  0.0443  0.0061  210 MET A C   
1521 O O   . MET A 212 ? 0.4326 0.7140 0.5510 0.0139  0.0476  0.0011  210 MET A O   
1522 C CB  . MET A 212 ? 0.2640 0.5889 0.4128 0.0366  0.0345  -0.0200 210 MET A CB  
1523 C CG  . MET A 212 ? 0.3255 0.6274 0.4799 0.0547  0.0227  -0.0306 210 MET A CG  
1524 S SD  . MET A 212 ? 0.3865 0.7670 0.5675 0.0811  0.0187  -0.0433 210 MET A SD  
1525 C CE  . MET A 212 ? 0.4014 0.7783 0.5677 0.1076  0.0211  -0.0647 210 MET A CE  
1526 N N   . LEU A 213 ? 0.3405 0.6640 0.4774 -0.0243 0.0451  0.0264  211 LEU A N   
1527 C CA  . LEU A 213 ? 0.3288 0.6846 0.4639 -0.0411 0.0508  0.0486  211 LEU A CA  
1528 C C   . LEU A 213 ? 0.3820 0.6695 0.5053 -0.0565 0.0458  0.0637  211 LEU A C   
1529 O O   . LEU A 213 ? 0.3385 0.6440 0.4590 -0.0701 0.0476  0.0868  211 LEU A O   
1530 C CB  . LEU A 213 ? 0.3678 0.7922 0.5220 -0.0689 0.0510  0.0719  211 LEU A CB  
1531 C CG  . LEU A 213 ? 0.3865 0.8706 0.5434 -0.0460 0.0532  0.0552  211 LEU A CG  
1532 C CD1 . LEU A 213 ? 0.4354 0.9723 0.5988 -0.0710 0.0504  0.0795  211 LEU A CD1 
1533 C CD2 . LEU A 213 ? 0.3550 0.8567 0.4942 -0.0111 0.0594  0.0331  211 LEU A CD2 
1534 N N   . ALA A 214 ? 0.2882 0.5043 0.4047 -0.0527 0.0391  0.0522  212 ALA A N   
1535 C CA  . ALA A 214 ? 0.2848 0.4392 0.3922 -0.0569 0.0345  0.0597  212 ALA A CA  
1536 C C   . ALA A 214 ? 0.3267 0.4801 0.4252 -0.0377 0.0405  0.0568  212 ALA A C   
1537 O O   . ALA A 214 ? 0.3519 0.4684 0.4462 -0.0393 0.0367  0.0675  212 ALA A O   
1538 C CB  . ALA A 214 ? 0.2583 0.3535 0.3591 -0.0514 0.0282  0.0425  212 ALA A CB  
1539 N N   . GLN A 215 ? 0.2341 0.4242 0.3309 -0.0182 0.0466  0.0408  213 GLN A N   
1540 C CA  . GLN A 215 ? 0.2566 0.4459 0.3449 -0.0052 0.0481  0.0385  213 GLN A CA  
1541 C C   . GLN A 215 ? 0.1877 0.4464 0.2714 -0.0003 0.0531  0.0388  213 GLN A C   
1542 O O   . GLN A 215 ? 0.2326 0.5419 0.3219 0.0045  0.0571  0.0297  213 GLN A O   
1543 C CB  . GLN A 215 ? 0.3892 0.5464 0.4764 0.0144  0.0457  0.0168  213 GLN A CB  
1544 C CG  . GLN A 215 ? 0.3808 0.5376 0.4738 0.0248  0.0434  -0.0010 213 GLN A CG  
1545 C CD  . GLN A 215 ? 0.3067 0.4380 0.4020 0.0152  0.0420  0.0021  213 GLN A CD  
1546 O OE1 . GLN A 215 ? 0.3182 0.4135 0.4089 0.0085  0.0417  0.0078  213 GLN A OE1 
1547 N NE2 . GLN A 215 ? 0.2475 0.4024 0.3496 0.0174  0.0398  -0.0042 213 GLN A NE2 
1548 N N   . PRO A 216 ? 0.2223 0.4930 0.2955 0.0000  0.0527  0.0493  214 PRO A N   
1549 C CA  . PRO A 216 ? 0.2909 0.6386 0.3533 0.0053  0.0579  0.0491  214 PRO A CA  
1550 C C   . PRO A 216 ? 0.2500 0.6266 0.3093 0.0341  0.0583  0.0095  214 PRO A C   
1551 O O   . PRO A 216 ? 0.2484 0.6988 0.3006 0.0433  0.0640  0.0013  214 PRO A O   
1552 C CB  . PRO A 216 ? 0.2202 0.5614 0.2697 0.0032  0.0532  0.0645  214 PRO A CB  
1553 C CG  . PRO A 216 ? 0.3232 0.5917 0.3823 -0.0087 0.0467  0.0837  214 PRO A CG  
1554 C CD  . PRO A 216 ? 0.2066 0.4291 0.2774 -0.0046 0.0469  0.0648  214 PRO A CD  
1555 N N   . LEU A 217 ? 0.2514 0.5718 0.3159 0.0490  0.0501  -0.0147 215 LEU A N   
1556 C CA  . LEU A 217 ? 0.2590 0.5900 0.3246 0.0765  0.0439  -0.0518 215 LEU A CA  
1557 C C   . LEU A 217 ? 0.2884 0.6473 0.3682 0.0845  0.0476  -0.0599 215 LEU A C   
1558 O O   . LEU A 217 ? 0.2781 0.6413 0.3554 0.1075  0.0385  -0.0878 215 LEU A O   
1559 C CB  . LEU A 217 ? 0.2656 0.5255 0.3368 0.0835  0.0301  -0.0663 215 LEU A CB  
1560 C CG  . LEU A 217 ? 0.2328 0.4759 0.2947 0.0805  0.0227  -0.0656 215 LEU A CG  
1561 C CD1 . LEU A 217 ? 0.2408 0.4240 0.3143 0.0831  0.0076  -0.0767 215 LEU A CD1 
1562 C CD2 . LEU A 217 ? 0.2804 0.5793 0.3243 0.0958  0.0200  -0.0868 215 LEU A CD2 
1563 N N   . GLY A 218 ? 0.2979 0.6577 0.3878 0.0623  0.0539  -0.0344 216 GLY A N   
1564 C CA  . GLY A 218 ? 0.3022 0.6951 0.4036 0.0644  0.0548  -0.0366 216 GLY A CA  
1565 C C   . GLY A 218 ? 0.2811 0.6363 0.3967 0.0801  0.0457  -0.0536 216 GLY A C   
1566 O O   . GLY A 218 ? 0.2600 0.6392 0.3836 0.0869  0.0428  -0.0583 216 GLY A O   
1567 N N   . ARG A 219 ? 0.2137 0.5005 0.3273 0.0820  0.0374  -0.0576 217 ARG A N   
1568 C CA  . ARG A 219 ? 0.2358 0.4812 0.3594 0.0914  0.0259  -0.0645 217 ARG A CA  
1569 C C   . ARG A 219 ? 0.2291 0.4140 0.3461 0.0726  0.0245  -0.0480 217 ARG A C   
1570 O O   . ARG A 219 ? 0.2657 0.4366 0.3732 0.0603  0.0300  -0.0382 217 ARG A O   
1571 C CB  . ARG A 219 ? 0.2559 0.4856 0.3847 0.1223  0.0108  -0.0928 217 ARG A CB  
1572 C CG  . ARG A 219 ? 0.2966 0.4858 0.4152 0.1219  0.0035  -0.1000 217 ARG A CG  
1573 C CD  . ARG A 219 ? 0.3668 0.5183 0.4935 0.1467  -0.0195 -0.1263 217 ARG A CD  
1574 N NE  . ARG A 219 ? 0.3366 0.4549 0.4558 0.1417  -0.0295 -0.1335 217 ARG A NE  
1575 C CZ  . ARG A 219 ? 0.3392 0.4046 0.4635 0.1231  -0.0388 -0.1165 217 ARG A CZ  
1576 N NH1 . ARG A 219 ? 0.2777 0.3172 0.4105 0.1092  -0.0381 -0.0916 217 ARG A NH1 
1577 N NH2 . ARG A 219 ? 0.3337 0.3809 0.4546 0.1179  -0.0493 -0.1239 217 ARG A NH2 
1578 N N   . MET A 220 ? 0.2929 0.4499 0.4148 0.0722  0.0171  -0.0439 218 MET A N   
1579 C CA  . MET A 220 ? 0.2698 0.3811 0.3846 0.0602  0.0160  -0.0317 218 MET A CA  
1580 C C   . MET A 220 ? 0.2451 0.3249 0.3646 0.0696  0.0040  -0.0370 218 MET A C   
1581 O O   . MET A 220 ? 0.2684 0.3486 0.3961 0.0877  -0.0079 -0.0538 218 MET A O   
1582 C CB  . MET A 220 ? 0.2747 0.3776 0.3882 0.0535  0.0128  -0.0222 218 MET A CB  
1583 C CG  . MET A 220 ? 0.3262 0.4579 0.4387 0.0424  0.0175  -0.0195 218 MET A CG  
1584 S SD  . MET A 220 ? 0.3418 0.4606 0.4444 0.0332  0.0115  -0.0116 218 MET A SD  
1585 C CE  . MET A 220 ? 0.2334 0.3915 0.3421 0.0189  0.0104  -0.0126 218 MET A CE  
1586 N N   . GLY A 221 ? 0.1910 0.2446 0.3071 0.0573  0.0052  -0.0234 219 GLY A N   
1587 C CA  . GLY A 221 ? 0.2265 0.2525 0.3514 0.0577  -0.0085 -0.0219 219 GLY A CA  
1588 C C   . GLY A 221 ? 0.2578 0.2609 0.3916 0.0575  -0.0238 -0.0106 219 GLY A C   
1589 O O   . GLY A 221 ? 0.2952 0.3076 0.4253 0.0576  -0.0216 -0.0030 219 GLY A O   
1590 N N   . GLN A 222 ? 0.2732 0.2448 0.4201 0.0555  -0.0430 -0.0075 220 GLN A N   
1591 C CA  . GLN A 222 ? 0.3404 0.2836 0.4987 0.0511  -0.0626 0.0117  220 GLN A CA  
1592 C C   . GLN A 222 ? 0.2738 0.2160 0.4354 0.0253  -0.0612 0.0435  220 GLN A C   
1593 O O   . GLN A 222 ? 0.2628 0.2141 0.4265 0.0153  -0.0542 0.0441  220 GLN A O   
1594 C CB  . GLN A 222 ? 0.3992 0.2999 0.5747 0.0660  -0.0929 -0.0049 220 GLN A CB  
1595 C CG  . GLN A 222 ? 0.4411 0.3573 0.6146 0.0973  -0.0929 -0.0416 220 GLN A CG  
1596 C CD  . GLN A 222 ? 0.6756 0.5519 0.8618 0.1173  -0.1219 -0.0702 220 GLN A CD  
1597 O OE1 . GLN A 222 ? 0.8035 0.6256 1.0047 0.1073  -0.1495 -0.0584 220 GLN A OE1 
1598 N NE2 . GLN A 222 ? 0.7451 0.6515 0.9229 0.1431  -0.1165 -0.1072 220 GLN A NE2 
1599 N N   . PRO A 223 ? 0.2215 0.3575 0.2147 0.0503  0.0316  0.0559  221 PRO A N   
1600 C CA  . PRO A 223 ? 0.2352 0.3685 0.2285 0.0497  0.0320  0.0548  221 PRO A CA  
1601 C C   . PRO A 223 ? 0.2789 0.3721 0.2799 0.0543  0.0394  0.0535  221 PRO A C   
1602 O O   . PRO A 223 ? 0.2533 0.3313 0.2497 0.0492  0.0365  0.0430  221 PRO A O   
1603 C CB  . PRO A 223 ? 0.2204 0.3990 0.2235 0.0562  0.0354  0.0784  221 PRO A CB  
1604 C CG  . PRO A 223 ? 0.2297 0.4431 0.2287 0.0523  0.0300  0.0817  221 PRO A CG  
1605 C CD  . PRO A 223 ? 0.2624 0.4452 0.2612 0.0529  0.0313  0.0741  221 PRO A CD  
1606 N N   . ALA A 224 ? 0.2841 0.3601 0.2973 0.0634  0.0493  0.0628  222 ALA A N   
1607 C CA  . ALA A 224 ? 0.3039 0.3399 0.3244 0.0652  0.0566  0.0575  222 ALA A CA  
1608 C C   . ALA A 224 ? 0.3104 0.3189 0.3158 0.0548  0.0496  0.0333  222 ALA A C   
1609 O O   . ALA A 224 ? 0.2995 0.2842 0.3069 0.0509  0.0508  0.0260  222 ALA A O   
1610 C CB  . ALA A 224 ? 0.3053 0.3263 0.3404 0.0767  0.0697  0.0672  222 ALA A CB  
1611 N N   . GLU A 225 ? 0.2850 0.2994 0.2775 0.0498  0.0423  0.0228  223 GLU A N   
1612 C CA  . GLU A 225 ? 0.2845 0.2784 0.2658 0.0411  0.0364  0.0045  223 GLU A CA  
1613 C C   . GLU A 225 ? 0.3097 0.3073 0.2855 0.0334  0.0285  -0.0025 223 GLU A C   
1614 O O   . GLU A 225 ? 0.3048 0.2846 0.2781 0.0282  0.0265  -0.0116 223 GLU A O   
1615 C CB  . GLU A 225 ? 0.2945 0.2944 0.2685 0.0394  0.0327  -0.0004 223 GLU A CB  
1616 C CG  . GLU A 225 ? 0.3368 0.3301 0.3153 0.0483  0.0422  0.0043  223 GLU A CG  
1617 C CD  . GLU A 225 ? 0.3607 0.3697 0.3349 0.0483  0.0394  0.0055  223 GLU A CD  
1618 O OE1 . GLU A 225 ? 0.3119 0.3452 0.2861 0.0444  0.0326  0.0110  223 GLU A OE1 
1619 O OE2 . GLU A 225 ? 0.3222 0.3207 0.2932 0.0512  0.0440  0.0003  223 GLU A OE2 
1620 N N   . VAL A 226 ? 0.2615 0.2845 0.2358 0.0327  0.0247  0.0016  224 VAL A N   
1621 C CA  . VAL A 226 ? 0.2532 0.2804 0.2238 0.0282  0.0206  -0.0045 224 VAL A CA  
1622 C C   . VAL A 226 ? 0.2530 0.2741 0.2324 0.0315  0.0257  0.0039  224 VAL A C   
1623 O O   . VAL A 226 ? 0.2802 0.2925 0.2587 0.0277  0.0237  -0.0018 224 VAL A O   
1624 C CB  . VAL A 226 ? 0.2859 0.3446 0.2516 0.0265  0.0167  -0.0046 224 VAL A CB  
1625 C CG1 . VAL A 226 ? 0.2433 0.3063 0.2046 0.0236  0.0145  -0.0128 224 VAL A CG1 
1626 C CG2 . VAL A 226 ? 0.2784 0.3416 0.2386 0.0206  0.0112  -0.0131 224 VAL A CG2 
1627 N N   . GLY A 227 ? 0.2148 0.2414 0.2059 0.0387  0.0331  0.0197  225 GLY A N   
1628 C CA  . GLY A 227 ? 0.2532 0.2726 0.2575 0.0411  0.0388  0.0302  225 GLY A CA  
1629 C C   . GLY A 227 ? 0.3099 0.2946 0.3162 0.0354  0.0398  0.0197  225 GLY A C   
1630 O O   . GLY A 227 ? 0.2782 0.2578 0.2891 0.0312  0.0389  0.0200  225 GLY A O   
1631 N N   . ALA A 228 ? 0.2867 0.2512 0.2891 0.0345  0.0413  0.0101  226 ALA A N   
1632 C CA  . ALA A 228 ? 0.3172 0.2544 0.3184 0.0270  0.0413  -0.0029 226 ALA A CA  
1633 C C   . ALA A 228 ? 0.3407 0.2813 0.3317 0.0182  0.0319  -0.0130 226 ALA A C   
1634 O O   . ALA A 228 ? 0.2746 0.2051 0.2688 0.0110  0.0306  -0.0167 226 ALA A O   
1635 C CB  . ALA A 228 ? 0.3078 0.2301 0.3033 0.0283  0.0449  -0.0127 226 ALA A CB  
1636 N N   . ALA A 229 ? 0.3184 0.2738 0.2994 0.0184  0.0258  -0.0165 227 ALA A N   
1637 C CA  . ALA A 229 ? 0.2626 0.2207 0.2382 0.0125  0.0191  -0.0235 227 ALA A CA  
1638 C C   . ALA A 229 ? 0.2546 0.2220 0.2363 0.0126  0.0191  -0.0171 227 ALA A C   
1639 O O   . ALA A 229 ? 0.2801 0.2449 0.2633 0.0074  0.0163  -0.0195 227 ALA A O   
1640 C CB  . ALA A 229 ? 0.2720 0.2405 0.2401 0.0131  0.0146  -0.0282 227 ALA A CB  
1641 N N   . ALA A 230 ? 0.2536 0.2371 0.2396 0.0187  0.0225  -0.0071 228 ALA A N   
1642 C CA  . ALA A 230 ? 0.2279 0.2257 0.2200 0.0199  0.0235  0.0009  228 ALA A CA  
1643 C C   . ALA A 230 ? 0.2650 0.2498 0.2699 0.0157  0.0263  0.0078  228 ALA A C   
1644 O O   . ALA A 230 ? 0.2624 0.2516 0.2711 0.0122  0.0244  0.0095  228 ALA A O   
1645 C CB  . ALA A 230 ? 0.2156 0.2404 0.2094 0.0272  0.0267  0.0122  228 ALA A CB  
1646 N N   . VAL A 231 ? 0.2648 0.2336 0.2785 0.0159  0.0315  0.0119  229 VAL A N   
1647 C CA  . VAL A 231 ? 0.2696 0.2217 0.2980 0.0095  0.0347  0.0159  229 VAL A CA  
1648 C C   . VAL A 231 ? 0.2568 0.1964 0.2787 -0.0021 0.0286  0.0016  229 VAL A C   
1649 O O   . VAL A 231 ? 0.2640 0.2038 0.2949 -0.0099 0.0271  0.0048  229 VAL A O   
1650 C CB  . VAL A 231 ? 0.2944 0.2268 0.3349 0.0127  0.0437  0.0200  229 VAL A CB  
1651 C CG1 . VAL A 231 ? 0.3113 0.2184 0.3677 0.0026  0.0474  0.0180  229 VAL A CG1 
1652 C CG2 . VAL A 231 ? 0.2557 0.2084 0.3082 0.0244  0.0502  0.0412  229 VAL A CG2 
1653 N N   . PHE A 232 ? 0.2659 0.1997 0.2734 -0.0039 0.0249  -0.0121 230 PHE A N   
1654 C CA  . PHE A 232 ? 0.3045 0.2363 0.3057 -0.0142 0.0184  -0.0225 230 PHE A CA  
1655 C C   . PHE A 232 ? 0.3067 0.2574 0.3098 -0.0151 0.0137  -0.0162 230 PHE A C   
1656 O O   . PHE A 232 ? 0.2846 0.2385 0.2933 -0.0243 0.0105  -0.0151 230 PHE A O   
1657 C CB  . PHE A 232 ? 0.3126 0.2432 0.2996 -0.0136 0.0155  -0.0333 230 PHE A CB  
1658 C CG  . PHE A 232 ? 0.2855 0.2254 0.2670 -0.0216 0.0084  -0.0382 230 PHE A CG  
1659 C CD1 . PHE A 232 ? 0.2944 0.2311 0.2762 -0.0340 0.0060  -0.0451 230 PHE A CD1 
1660 C CD2 . PHE A 232 ? 0.3364 0.2900 0.3148 -0.0173 0.0046  -0.0351 230 PHE A CD2 
1661 C CE1 . PHE A 232 ? 0.3557 0.3093 0.3339 -0.0415 -0.0008 -0.0460 230 PHE A CE1 
1662 C CE2 . PHE A 232 ? 0.3400 0.3054 0.3179 -0.0229 -0.0006 -0.0349 230 PHE A CE2 
1663 C CZ  . PHE A 232 ? 0.2882 0.2568 0.2656 -0.0348 -0.0038 -0.0388 230 PHE A CZ  
1664 N N   . LEU A 233 ? 0.2777 0.2424 0.2765 -0.0060 0.0135  -0.0128 231 LEU A N   
1665 C CA  . LEU A 233 ? 0.2831 0.2642 0.2844 -0.0043 0.0114  -0.0082 231 LEU A CA  
1666 C C   . LEU A 233 ? 0.2824 0.2731 0.2963 -0.0057 0.0137  0.0040  231 LEU A C   
1667 O O   . LEU A 233 ? 0.2945 0.2956 0.3145 -0.0097 0.0113  0.0087  231 LEU A O   
1668 C CB  . LEU A 233 ? 0.2485 0.2398 0.2430 0.0053  0.0128  -0.0106 231 LEU A CB  
1669 C CG  . LEU A 233 ? 0.2845 0.2692 0.2707 0.0058  0.0102  -0.0206 231 LEU A CG  
1670 C CD1 . LEU A 233 ? 0.2613 0.2547 0.2427 0.0127  0.0121  -0.0250 231 LEU A CD1 
1671 C CD2 . LEU A 233 ? 0.2895 0.2754 0.2792 0.0022  0.0069  -0.0207 231 LEU A CD2 
1672 N N   . ALA A 234 ? 0.2252 0.2164 0.2459 -0.0020 0.0186  0.0123  232 ALA A N   
1673 C CA  . ALA A 234 ? 0.2224 0.2253 0.2585 -0.0030 0.0214  0.0276  232 ALA A CA  
1674 C C   . ALA A 234 ? 0.2696 0.2586 0.3174 -0.0170 0.0193  0.0279  232 ALA A C   
1675 O O   . ALA A 234 ? 0.2868 0.2890 0.3444 -0.0223 0.0173  0.0364  232 ALA A O   
1676 C CB  . ALA A 234 ? 0.2365 0.2464 0.2805 0.0047  0.0278  0.0402  232 ALA A CB  
1677 N N   . SER A 235 ? 0.2492 0.2131 0.2964 -0.0236 0.0202  0.0180  233 SER A N   
1678 C CA  . SER A 235 ? 0.2641 0.2119 0.3251 -0.0379 0.0205  0.0166  233 SER A CA  
1679 C C   . SER A 235 ? 0.2698 0.2141 0.3218 -0.0521 0.0131  0.0013  233 SER A C   
1680 O O   . SER A 235 ? 0.2833 0.2255 0.3461 -0.0670 0.0106  0.0007  233 SER A O   
1681 C CB  . SER A 235 ? 0.3702 0.2909 0.4397 -0.0367 0.0287  0.0142  233 SER A CB  
1682 O OG  . SER A 235 ? 0.2848 0.1900 0.3381 -0.0352 0.0289  -0.0030 233 SER A OG  
1683 N N   . GLU A 236 ? 0.2607 0.2086 0.2947 -0.0488 0.0092  -0.0096 234 GLU A N   
1684 C CA  . GLU A 236 ? 0.3431 0.2914 0.3684 -0.0620 0.0030  -0.0231 234 GLU A CA  
1685 C C   . GLU A 236 ? 0.3257 0.2978 0.3420 -0.0594 -0.0034 -0.0207 234 GLU A C   
1686 O O   . GLU A 236 ? 0.3921 0.3752 0.4041 -0.0710 -0.0094 -0.0264 234 GLU A O   
1687 C CB  . GLU A 236 ? 0.3407 0.2667 0.3553 -0.0630 0.0064  -0.0400 234 GLU A CB  
1688 C CG  . GLU A 236 ? 0.4798 0.3783 0.5065 -0.0695 0.0137  -0.0458 234 GLU A CG  
1689 C CD  . GLU A 236 ? 0.5676 0.4432 0.5852 -0.0655 0.0204  -0.0612 234 GLU A CD  
1690 O OE1 . GLU A 236 ? 0.5432 0.4249 0.5483 -0.0536 0.0206  -0.0612 234 GLU A OE1 
1691 O OE2 . GLU A 236 ? 0.7781 0.6294 0.8027 -0.0745 0.0261  -0.0735 234 GLU A OE2 
1692 N N   . ALA A 237 ? 0.2796 0.2613 0.2945 -0.0451 -0.0017 -0.0123 235 ALA A N   
1693 C CA  . ALA A 237 ? 0.3082 0.3078 0.3194 -0.0406 -0.0053 -0.0090 235 ALA A CA  
1694 C C   . ALA A 237 ? 0.2799 0.3022 0.3032 -0.0408 -0.0066 0.0049  235 ALA A C   
1695 O O   . ALA A 237 ? 0.2639 0.2963 0.2900 -0.0289 -0.0037 0.0119  235 ALA A O   
1696 C CB  . ALA A 237 ? 0.2610 0.2554 0.2656 -0.0262 -0.0016 -0.0107 235 ALA A CB  
1697 N N   . ASN A 238 ? 0.2586 0.2896 0.2899 -0.0549 -0.0106 0.0083  236 ASN A N   
1698 C CA  . ASN A 238 ? 0.2609 0.3151 0.3065 -0.0553 -0.0111 0.0243  236 ASN A CA  
1699 C C   . ASN A 238 ? 0.2203 0.2998 0.2692 -0.0503 -0.0131 0.0339  236 ASN A C   
1700 O O   . ASN A 238 ? 0.2739 0.3739 0.3351 -0.0450 -0.0111 0.0487  236 ASN A O   
1701 C CB  . ASN A 238 ? 0.3475 0.4052 0.4031 -0.0745 -0.0154 0.0255  236 ASN A CB  
1702 C CG  . ASN A 238 ? 0.5094 0.5416 0.5700 -0.0770 -0.0106 0.0215  236 ASN A CG  
1703 O OD1 . ASN A 238 ? 0.5369 0.5609 0.5977 -0.0628 -0.0041 0.0259  236 ASN A OD1 
1704 N ND2 . ASN A 238 ? 0.5381 0.5591 0.6042 -0.0957 -0.0133 0.0133  236 ASN A ND2 
1705 N N   . PHE A 239 ? 0.2455 0.3264 0.2863 -0.0508 -0.0160 0.0284  237 PHE A N   
1706 C CA  . PHE A 239 ? 0.2600 0.3635 0.3080 -0.0434 -0.0160 0.0406  237 PHE A CA  
1707 C C   . PHE A 239 ? 0.2959 0.3837 0.3401 -0.0267 -0.0098 0.0368  237 PHE A C   
1708 O O   . PHE A 239 ? 0.2558 0.3554 0.3074 -0.0202 -0.0085 0.0455  237 PHE A O   
1709 C CB  . PHE A 239 ? 0.2139 0.3389 0.2596 -0.0577 -0.0242 0.0417  237 PHE A CB  
1710 C CG  . PHE A 239 ? 0.2071 0.3664 0.2668 -0.0529 -0.0249 0.0618  237 PHE A CG  
1711 C CD1 . PHE A 239 ? 0.2046 0.3873 0.2811 -0.0492 -0.0230 0.0799  237 PHE A CD1 
1712 C CD2 . PHE A 239 ? 0.2292 0.4009 0.2872 -0.0518 -0.0269 0.0654  237 PHE A CD2 
1713 C CE1 . PHE A 239 ? 0.2011 0.4177 0.2938 -0.0433 -0.0222 0.1015  237 PHE A CE1 
1714 C CE2 . PHE A 239 ? 0.2026 0.4085 0.2775 -0.0464 -0.0265 0.0880  237 PHE A CE2 
1715 C CZ  . PHE A 239 ? 0.2207 0.4488 0.3136 -0.0417 -0.0239 0.1064  237 PHE A CZ  
1716 N N   . CYS A 240 ? 0.2315 0.2945 0.2665 -0.0206 -0.0057 0.0250  238 CYS A N   
1717 C CA  . CYS A 240 ? 0.2427 0.2914 0.2742 -0.0076 -0.0004 0.0190  238 CYS A CA  
1718 C C   . CYS A 240 ? 0.2770 0.3264 0.3129 0.0045  0.0071  0.0207  238 CYS A C   
1719 O O   . CYS A 240 ? 0.2812 0.3296 0.3142 0.0040  0.0084  0.0196  238 CYS A O   
1720 C CB  . CYS A 240 ? 0.2172 0.2442 0.2345 -0.0097 -0.0012 0.0048  238 CYS A CB  
1721 S SG  . CYS A 240 ? 0.2834 0.3093 0.2922 -0.0212 -0.0076 -0.0009 238 CYS A SG  
1722 N N   . THR A 241 ? 0.2139 0.2661 0.2582 0.0159  0.0130  0.0238  239 THR A N   
1723 C CA  . THR A 241 ? 0.2172 0.2687 0.2623 0.0282  0.0215  0.0198  239 THR A CA  
1724 C C   . THR A 241 ? 0.2804 0.3188 0.3299 0.0380  0.0279  0.0125  239 THR A C   
1725 O O   . THR A 241 ? 0.2293 0.2682 0.2905 0.0387  0.0279  0.0205  239 THR A O   
1726 C CB  . THR A 241 ? 0.2036 0.2783 0.2606 0.0329  0.0253  0.0340  239 THR A CB  
1727 O OG1 . THR A 241 ? 0.2233 0.3005 0.2760 0.0434  0.0332  0.0277  239 THR A OG1 
1728 C CG2 . THR A 241 ? 0.2161 0.3028 0.2904 0.0399  0.0294  0.0468  239 THR A CG2 
1729 N N   . GLY A 242 ? 0.2189 0.2471 0.2602 0.0444  0.0334  -0.0024 240 GLY A N   
1730 C CA  . GLY A 242 ? 0.2660 0.2772 0.3119 0.0509  0.0397  -0.0134 240 GLY A CA  
1731 C C   . GLY A 242 ? 0.2631 0.2581 0.3067 0.0434  0.0340  -0.0180 240 GLY A C   
1732 O O   . GLY A 242 ? 0.2828 0.2639 0.3373 0.0471  0.0386  -0.0215 240 GLY A O   
1733 N N   . ILE A 243 ? 0.2873 0.2832 0.3189 0.0333  0.0252  -0.0175 241 ILE A N   
1734 C CA  . ILE A 243 ? 0.3086 0.2931 0.3379 0.0272  0.0204  -0.0206 241 ILE A CA  
1735 C C   . ILE A 243 ? 0.3083 0.2825 0.3252 0.0257  0.0203  -0.0364 241 ILE A C   
1736 O O   . ILE A 243 ? 0.2582 0.2382 0.2651 0.0273  0.0218  -0.0433 241 ILE A O   
1737 C CB  . ILE A 243 ? 0.2891 0.2811 0.3129 0.0177  0.0123  -0.0127 241 ILE A CB  
1738 C CG1 . ILE A 243 ? 0.3196 0.3101 0.3282 0.0129  0.0092  -0.0193 241 ILE A CG1 
1739 C CG2 . ILE A 243 ? 0.2461 0.2561 0.2802 0.0160  0.0107  0.0027  241 ILE A CG2 
1740 C CD1 . ILE A 243 ? 0.2863 0.2755 0.2878 0.0043  0.0035  -0.0189 241 ILE A CD1 
1741 N N   . GLU A 244 ? 0.2546 0.2178 0.2737 0.0223  0.0185  -0.0401 242 GLU A N   
1742 C CA  . GLU A 244 ? 0.3069 0.2645 0.3159 0.0184  0.0167  -0.0527 242 GLU A CA  
1743 C C   . GLU A 244 ? 0.3427 0.3019 0.3454 0.0120  0.0101  -0.0469 242 GLU A C   
1744 O O   . GLU A 244 ? 0.3458 0.3021 0.3567 0.0097  0.0083  -0.0404 242 GLU A O   
1745 C CB  . GLU A 244 ? 0.3064 0.2498 0.3259 0.0187  0.0210  -0.0628 242 GLU A CB  
1746 C CG  . GLU A 244 ? 0.2956 0.2367 0.3069 0.0114  0.0173  -0.0741 242 GLU A CG  
1747 C CD  . GLU A 244 ? 0.3504 0.2752 0.3747 0.0085  0.0211  -0.0854 242 GLU A CD  
1748 O OE1 . GLU A 244 ? 0.2905 0.2022 0.3340 0.0132  0.0271  -0.0810 242 GLU A OE1 
1749 O OE2 . GLU A 244 ? 0.3679 0.2938 0.3855 0.0012  0.0186  -0.0982 242 GLU A OE2 
1750 N N   . LEU A 245 ? 0.2784 0.2440 0.2685 0.0103  0.0077  -0.0478 243 LEU A N   
1751 C CA  . LEU A 245 ? 0.2897 0.2557 0.2735 0.0062  0.0038  -0.0439 243 LEU A CA  
1752 C C   . LEU A 245 ? 0.3026 0.2681 0.2824 0.0043  0.0026  -0.0493 243 LEU A C   
1753 O O   . LEU A 245 ? 0.3216 0.2936 0.2949 0.0051  0.0034  -0.0540 243 LEU A O   
1754 C CB  . LEU A 245 ? 0.2166 0.1865 0.1937 0.0062  0.0041  -0.0409 243 LEU A CB  
1755 C CG  . LEU A 245 ? 0.3733 0.3403 0.3444 0.0033  0.0029  -0.0394 243 LEU A CG  
1756 C CD1 . LEU A 245 ? 0.3824 0.3491 0.3543 -0.0006 0.0001  -0.0378 243 LEU A CD1 
1757 C CD2 . LEU A 245 ? 0.3579 0.3237 0.3289 0.0022  0.0046  -0.0363 243 LEU A CD2 
1758 N N   . LEU A 246 ? 0.2510 0.2139 0.2358 0.0013  0.0005  -0.0464 244 LEU A N   
1759 C CA  . LEU A 246 ? 0.2916 0.2566 0.2753 -0.0018 -0.0012 -0.0496 244 LEU A CA  
1760 C C   . LEU A 246 ? 0.2659 0.2384 0.2398 -0.0010 -0.0020 -0.0459 244 LEU A C   
1761 O O   . LEU A 246 ? 0.3121 0.2841 0.2833 -0.0003 -0.0019 -0.0410 244 LEU A O   
1762 C CB  . LEU A 246 ? 0.3482 0.3094 0.3448 -0.0052 -0.0025 -0.0448 244 LEU A CB  
1763 C CG  . LEU A 246 ? 0.3770 0.3270 0.3897 -0.0054 0.0003  -0.0474 244 LEU A CG  
1764 C CD1 . LEU A 246 ? 0.4235 0.3714 0.4532 -0.0086 -0.0004 -0.0377 244 LEU A CD1 
1765 C CD2 . LEU A 246 ? 0.3331 0.2784 0.3440 -0.0076 0.0022  -0.0630 244 LEU A CD2 
1766 N N   . VAL A 247 ? 0.2812 0.2625 0.2503 -0.0010 -0.0019 -0.0485 245 VAL A N   
1767 C CA  . VAL A 247 ? 0.2986 0.2883 0.2624 0.0019  -0.0007 -0.0425 245 VAL A CA  
1768 C C   . VAL A 247 ? 0.2892 0.2912 0.2551 -0.0021 -0.0034 -0.0421 245 VAL A C   
1769 O O   . VAL A 247 ? 0.2724 0.2894 0.2358 -0.0032 -0.0040 -0.0435 245 VAL A O   
1770 C CB  . VAL A 247 ? 0.2806 0.2759 0.2404 0.0069  0.0028  -0.0399 245 VAL A CB  
1771 C CG1 . VAL A 247 ? 0.2341 0.2364 0.1930 0.0119  0.0064  -0.0313 245 VAL A CG1 
1772 C CG2 . VAL A 247 ? 0.2870 0.2704 0.2473 0.0084  0.0047  -0.0400 245 VAL A CG2 
1773 N N   . THR A 248 ? 0.2815 0.2814 0.2532 -0.0054 -0.0055 -0.0392 246 THR A N   
1774 C CA  . THR A 248 ? 0.2727 0.2821 0.2510 -0.0126 -0.0091 -0.0395 246 THR A CA  
1775 C C   . THR A 248 ? 0.2535 0.2735 0.2347 -0.0121 -0.0095 -0.0288 246 THR A C   
1776 O O   . THR A 248 ? 0.2254 0.2563 0.2141 -0.0191 -0.0130 -0.0267 246 THR A O   
1777 C CB  . THR A 248 ? 0.2721 0.2682 0.2622 -0.0191 -0.0108 -0.0458 246 THR A CB  
1778 O OG1 . THR A 248 ? 0.3214 0.3098 0.3179 -0.0166 -0.0099 -0.0373 246 THR A OG1 
1779 C CG2 . THR A 248 ? 0.2601 0.2464 0.2481 -0.0184 -0.0088 -0.0576 246 THR A CG2 
1780 N N   . GLY A 249 ? 0.2481 0.2664 0.2241 -0.0049 -0.0059 -0.0230 247 GLY A N   
1781 C CA  . GLY A 249 ? 0.2871 0.3175 0.2652 -0.0032 -0.0050 -0.0135 247 GLY A CA  
1782 C C   . GLY A 249 ? 0.3081 0.3406 0.2980 -0.0094 -0.0085 -0.0081 247 GLY A C   
1783 O O   . GLY A 249 ? 0.2797 0.3277 0.2745 -0.0097 -0.0087 0.0017  247 GLY A O   
1784 N N   . GLY A 250 ? 0.2680 0.2869 0.2649 -0.0132 -0.0102 -0.0118 248 GLY A N   
1785 C CA  . GLY A 250 ? 0.2310 0.2510 0.2446 -0.0183 -0.0122 -0.0032 248 GLY A CA  
1786 C C   . GLY A 250 ? 0.2629 0.2809 0.2928 -0.0280 -0.0154 -0.0039 248 GLY A C   
1787 O O   . GLY A 250 ? 0.2350 0.2568 0.2830 -0.0326 -0.0164 0.0072  248 GLY A O   
1788 N N   . ALA A 251 ? 0.2256 0.2402 0.2511 -0.0324 -0.0168 -0.0165 249 ALA A N   
1789 C CA  . ALA A 251 ? 0.2723 0.2863 0.3120 -0.0447 -0.0202 -0.0213 249 ALA A CA  
1790 C C   . ALA A 251 ? 0.2929 0.2855 0.3538 -0.0497 -0.0187 -0.0228 249 ALA A C   
1791 O O   . ALA A 251 ? 0.2904 0.2804 0.3709 -0.0605 -0.0206 -0.0213 249 ALA A O   
1792 C CB  . ALA A 251 ? 0.2440 0.2621 0.2724 -0.0491 -0.0219 -0.0373 249 ALA A CB  
1793 N N   . GLU A 252 ? 0.2572 0.2346 0.3177 -0.0423 -0.0147 -0.0244 250 GLU A N   
1794 C CA  . GLU A 252 ? 0.2944 0.2511 0.3781 -0.0445 -0.0111 -0.0242 250 GLU A CA  
1795 C C   . GLU A 252 ? 0.3096 0.2724 0.4139 -0.0430 -0.0101 -0.0012 250 GLU A C   
1796 O O   . GLU A 252 ? 0.3447 0.2920 0.4749 -0.0443 -0.0061 0.0045  250 GLU A O   
1797 C CB  . GLU A 252 ? 0.2964 0.2388 0.3738 -0.0363 -0.0064 -0.0328 250 GLU A CB  
1798 C CG  . GLU A 252 ? 0.2523 0.2044 0.3205 -0.0261 -0.0055 -0.0202 250 GLU A CG  
1799 C CD  . GLU A 252 ? 0.3332 0.3003 0.3751 -0.0224 -0.0083 -0.0227 250 GLU A CD  
1800 O OE1 . GLU A 252 ? 0.3073 0.2803 0.3384 -0.0255 -0.0104 -0.0309 250 GLU A OE1 
1801 O OE2 . GLU A 252 ? 0.3238 0.2981 0.3575 -0.0166 -0.0078 -0.0159 250 GLU A OE2 
1802 N N   . LEU A 253 ? 0.2825 0.2692 0.3776 -0.0395 -0.0127 0.0130  251 LEU A N   
1803 C CA  . LEU A 253 ? 0.2555 0.2575 0.3663 -0.0368 -0.0118 0.0363  251 LEU A CA  
1804 C C   . LEU A 253 ? 0.2817 0.2916 0.4152 -0.0457 -0.0137 0.0489  251 LEU A C   
1805 O O   . LEU A 253 ? 0.3146 0.3324 0.4414 -0.0519 -0.0173 0.0432  251 LEU A O   
1806 C CB  . LEU A 253 ? 0.2349 0.2614 0.3229 -0.0289 -0.0126 0.0427  251 LEU A CB  
1807 C CG  . LEU A 253 ? 0.2755 0.2968 0.3403 -0.0221 -0.0115 0.0306  251 LEU A CG  
1808 C CD1 . LEU A 253 ? 0.3455 0.3885 0.3894 -0.0167 -0.0114 0.0334  251 LEU A CD1 
1809 C CD2 . LEU A 253 ? 0.2702 0.2838 0.3477 -0.0194 -0.0090 0.0359  251 LEU A CD2 
1810 N N   . GLY A 254 ? 0.2696 0.2807 0.4323 -0.0462 -0.0110 0.0689  252 GLY A N   
1811 C CA  . GLY A 254 ? 0.2648 0.2897 0.4523 -0.0537 -0.0124 0.0877  252 GLY A CA  
1812 C C   . GLY A 254 ? 0.3282 0.3312 0.5352 -0.0682 -0.0137 0.0760  252 GLY A C   
1813 O O   . GLY A 254 ? 0.3802 0.3592 0.5785 -0.0728 -0.0136 0.0507  252 GLY A O   
1814 N N   . TYR A 255 ? 0.3111 0.3258 0.5457 -0.0766 -0.0149 0.0954  253 TYR A N   
1815 C CA  . TYR A 255 ? 0.3979 0.3978 0.6545 -0.0941 -0.0173 0.0871  253 TYR A CA  
1816 C C   . TYR A 255 ? 0.5166 0.5362 0.7487 -0.1011 -0.0246 0.0748  253 TYR A C   
1817 O O   . TYR A 255 ? 0.4237 0.4738 0.6329 -0.0922 -0.0267 0.0837  253 TYR A O   
1818 C CB  . TYR A 255 ? 0.3656 0.3751 0.6640 -0.1010 -0.0161 0.1169  253 TYR A CB  
1819 C CG  . TYR A 255 ? 0.4553 0.4450 0.7905 -0.0966 -0.0078 0.1340  253 TYR A CG  
1820 C CD1 . TYR A 255 ? 0.5185 0.4642 0.8806 -0.1047 -0.0021 0.1186  253 TYR A CD1 
1821 C CD2 . TYR A 255 ? 0.4743 0.4925 0.8197 -0.0843 -0.0048 0.1670  253 TYR A CD2 
1822 C CE1 . TYR A 255 ? 0.5375 0.4680 0.9274 -0.0946 0.0070  0.1332  253 TYR A CE1 
1823 C CE2 . TYR A 255 ? 0.5304 0.5367 0.9119 -0.0786 0.0032  0.1871  253 TYR A CE2 
1824 C CZ  . TYR A 255 ? 0.5621 0.5245 0.9629 -0.0811 0.0091  0.1685  253 TYR A CZ  
1825 O OH  . TYR A 255 ? 0.5733 0.5287 1.0037 -0.0696 0.0176  0.1849  253 TYR A OH  
1826 N N   . GLY A 256 ? 0.6111 0.6149 0.8501 -0.1175 -0.0278 0.0544  254 GLY A N   
1827 C CA  . GLY A 256 ? 0.6459 0.6737 0.8694 -0.1275 -0.0352 0.0465  254 GLY A CA  
1828 C C   . GLY A 256 ? 0.7809 0.7984 1.0321 -0.1512 -0.0390 0.0379  254 GLY A C   
1829 O O   . GLY A 256 ? 0.8082 0.7987 1.0938 -0.1585 -0.0347 0.0418  254 GLY A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   HIS 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   ALA 4   2   ?   ?   ?   A . n 
A 1 5   THR 5   3   ?   ?   ?   A . n 
A 1 6   GLY 6   4   4   GLY GLY A . n 
A 1 7   THR 7   5   5   THR THR A . n 
A 1 8   ARG 8   6   6   ARG ARG A . n 
A 1 9   TYR 9   7   7   TYR TYR A . n 
A 1 10  ALA 10  8   8   ALA ALA A . n 
A 1 11  GLY 11  9   9   GLY GLY A . n 
A 1 12  LYS 12  10  10  LYS LYS A . n 
A 1 13  VAL 13  11  11  VAL VAL A . n 
A 1 14  VAL 14  12  12  VAL VAL A . n 
A 1 15  VAL 15  13  13  VAL VAL A . n 
A 1 16  VAL 16  14  14  VAL VAL A . n 
A 1 17  THR 17  15  15  THR THR A . n 
A 1 18  GLY 18  16  16  GLY GLY A . n 
A 1 19  GLY 19  17  17  GLY GLY A . n 
A 1 20  GLY 20  18  18  GLY GLY A . n 
A 1 21  ARG 21  19  19  ARG ARG A . n 
A 1 22  GLY 22  20  20  GLY GLY A . n 
A 1 23  ILE 23  21  21  ILE ILE A . n 
A 1 24  GLY 24  22  22  GLY GLY A . n 
A 1 25  ALA 25  23  23  ALA ALA A . n 
A 1 26  GLY 26  24  24  GLY GLY A . n 
A 1 27  ILE 27  25  25  ILE ILE A . n 
A 1 28  VAL 28  26  26  VAL VAL A . n 
A 1 29  ARG 29  27  27  ARG ARG A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  PHE 31  29  29  PHE PHE A . n 
A 1 32  VAL 32  30  30  VAL VAL A . n 
A 1 33  ASN 33  31  31  ASN ASN A . n 
A 1 34  SER 34  32  32  SER SER A . n 
A 1 35  GLY 35  33  33  GLY GLY A . n 
A 1 36  ALA 36  34  34  ALA ALA A . n 
A 1 37  ARG 37  35  35  ARG ARG A . n 
A 1 38  VAL 38  36  36  VAL VAL A . n 
A 1 39  VAL 39  37  37  VAL VAL A . n 
A 1 40  ILE 40  38  38  ILE ILE A . n 
A 1 41  CYS 41  39  39  CYS CYS A . n 
A 1 42  ASP 42  40  40  ASP ASP A . n 
A 1 43  LYS 43  41  41  LYS LYS A . n 
A 1 44  ASP 44  42  42  ASP ASP A . n 
A 1 45  GLU 45  43  43  GLU GLU A . n 
A 1 46  SER 46  44  44  SER SER A . n 
A 1 47  GLY 47  45  45  GLY GLY A . n 
A 1 48  GLY 48  46  46  GLY GLY A . n 
A 1 49  ARG 49  47  47  ARG ARG A . n 
A 1 50  ALA 50  48  48  ALA ALA A . n 
A 1 51  LEU 51  49  49  LEU LEU A . n 
A 1 52  GLU 52  50  50  GLU GLU A . n 
A 1 53  GLN 53  51  51  GLN GLN A . n 
A 1 54  GLU 54  52  52  GLU GLU A . n 
A 1 55  LEU 55  53  53  LEU LEU A . n 
A 1 56  PRO 56  54  54  PRO PRO A . n 
A 1 57  GLY 57  55  55  GLY GLY A . n 
A 1 58  ALA 58  56  56  ALA ALA A . n 
A 1 59  VAL 59  57  57  VAL VAL A . n 
A 1 60  PHE 60  58  58  PHE PHE A . n 
A 1 61  ILE 61  59  59  ILE ILE A . n 
A 1 62  LEU 62  60  60  LEU LEU A . n 
A 1 63  CYS 63  61  61  CYS CYS A . n 
A 1 64  ASP 64  62  62  ASP ASP A . n 
A 1 65  VAL 65  63  63  VAL VAL A . n 
A 1 66  THR 66  64  64  THR THR A . n 
A 1 67  GLN 67  65  65  GLN GLN A . n 
A 1 68  GLU 68  66  66  GLU GLU A . n 
A 1 69  ASP 69  67  67  ASP ASP A . n 
A 1 70  ASP 70  68  68  ASP ASP A . n 
A 1 71  VAL 71  69  69  VAL VAL A . n 
A 1 72  LYS 72  70  70  LYS LYS A . n 
A 1 73  THR 73  71  71  THR THR A . n 
A 1 74  LEU 74  72  72  LEU LEU A . n 
A 1 75  VAL 75  73  73  VAL VAL A . n 
A 1 76  SER 76  74  74  SER SER A . n 
A 1 77  GLU 77  75  75  GLU GLU A . n 
A 1 78  THR 78  76  76  THR THR A . n 
A 1 79  ILE 79  77  77  ILE ILE A . n 
A 1 80  ARG 80  78  78  ARG ARG A . n 
A 1 81  ARG 81  79  79  ARG ARG A . n 
A 1 82  PHE 82  80  80  PHE PHE A . n 
A 1 83  GLY 83  81  81  GLY GLY A . n 
A 1 84  ARG 84  82  82  ARG ARG A . n 
A 1 85  LEU 85  83  83  LEU LEU A . n 
A 1 86  ASP 86  84  84  ASP ASP A . n 
A 1 87  CYS 87  85  85  CYS CYS A . n 
A 1 88  VAL 88  86  86  VAL VAL A . n 
A 1 89  VAL 89  87  87  VAL VAL A . n 
A 1 90  ASN 90  88  88  ASN ASN A . n 
A 1 91  ASN 91  89  89  ASN ASN A . n 
A 1 92  ALA 92  90  90  ALA ALA A . n 
A 1 93  GLY 93  91  91  GLY GLY A . n 
A 1 94  HIS 94  92  92  HIS HIS A . n 
A 1 95  HIS 95  93  93  HIS HIS A . n 
A 1 96  PRO 96  94  94  PRO PRO A . n 
A 1 97  PRO 97  95  95  PRO PRO A . n 
A 1 98  PRO 98  96  96  PRO PRO A . n 
A 1 99  GLN 99  97  97  GLN GLN A . n 
A 1 100 ARG 100 98  98  ARG ARG A . n 
A 1 101 PRO 101 99  99  PRO PRO A . n 
A 1 102 GLU 102 100 100 GLU GLU A . n 
A 1 103 GLU 103 101 101 GLU GLU A . n 
A 1 104 THR 104 102 102 THR THR A . n 
A 1 105 SER 105 103 103 SER SER A . n 
A 1 106 ALA 106 104 104 ALA ALA A . n 
A 1 107 GLN 107 105 105 GLN GLN A . n 
A 1 108 GLY 108 106 106 GLY GLY A . n 
A 1 109 PHE 109 107 107 PHE PHE A . n 
A 1 110 ARG 110 108 108 ARG ARG A . n 
A 1 111 GLN 111 109 109 GLN GLN A . n 
A 1 112 LEU 112 110 110 LEU LEU A . n 
A 1 113 LEU 113 111 111 LEU LEU A . n 
A 1 114 GLU 114 112 112 GLU GLU A . n 
A 1 115 LEU 115 113 113 LEU LEU A . n 
A 1 116 ASN 116 114 114 ASN ASN A . n 
A 1 117 LEU 117 115 115 LEU LEU A . n 
A 1 118 LEU 118 116 116 LEU LEU A . n 
A 1 119 GLY 119 117 117 GLY GLY A . n 
A 1 120 THR 120 118 118 THR THR A . n 
A 1 121 TYR 121 119 119 TYR TYR A . n 
A 1 122 THR 122 120 120 THR THR A . n 
A 1 123 LEU 123 121 121 LEU LEU A . n 
A 1 124 THR 124 122 122 THR THR A . n 
A 1 125 LYS 125 123 123 LYS LYS A . n 
A 1 126 LEU 126 124 124 LEU LEU A . n 
A 1 127 ALA 127 125 125 ALA ALA A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 PRO 129 127 127 PRO PRO A . n 
A 1 130 TYR 130 128 128 TYR TYR A . n 
A 1 131 LEU 131 129 129 LEU LEU A . n 
A 1 132 ARG 132 130 130 ARG ARG A . n 
A 1 133 LYS 133 131 131 LYS LYS A . n 
A 1 134 SER 134 132 132 SER SER A . n 
A 1 135 GLN 135 133 133 GLN GLN A . n 
A 1 136 GLY 136 134 134 GLY GLY A . n 
A 1 137 ASN 137 135 135 ASN ASN A . n 
A 1 138 VAL 138 136 136 VAL VAL A . n 
A 1 139 ILE 139 137 137 ILE ILE A . n 
A 1 140 ASN 140 138 138 ASN ASN A . n 
A 1 141 ILE 141 139 139 ILE ILE A . n 
A 1 142 SER 142 140 140 SER SER A . n 
A 1 143 SER 143 141 141 SER SER A . n 
A 1 144 LEU 144 142 142 LEU LEU A . n 
A 1 145 VAL 145 143 143 VAL VAL A . n 
A 1 146 GLY 146 144 144 GLY GLY A . n 
A 1 147 ALA 147 145 145 ALA ALA A . n 
A 1 148 ILE 148 146 146 ILE ILE A . n 
A 1 149 GLY 149 147 147 GLY GLY A . n 
A 1 150 GLN 150 148 148 GLN GLN A . n 
A 1 151 ALA 151 149 149 ALA ALA A . n 
A 1 152 GLN 152 150 150 GLN GLN A . n 
A 1 153 ALA 153 151 151 ALA ALA A . n 
A 1 154 VAL 154 152 152 VAL VAL A . n 
A 1 155 PRO 155 153 153 PRO PRO A . n 
A 1 156 TYR 156 154 154 TYR TYR A . n 
A 1 157 VAL 157 155 155 VAL VAL A . n 
A 1 158 ALA 158 156 156 ALA ALA A . n 
A 1 159 THR 159 157 157 THR THR A . n 
A 1 160 LYS 160 158 158 LYS LYS A . n 
A 1 161 GLY 161 159 159 GLY GLY A . n 
A 1 162 ALA 162 160 160 ALA ALA A . n 
A 1 163 VAL 163 161 161 VAL VAL A . n 
A 1 164 THR 164 162 162 THR THR A . n 
A 1 165 ALA 165 163 163 ALA ALA A . n 
A 1 166 MET 166 164 164 MET MET A . n 
A 1 167 THR 167 165 165 THR THR A . n 
A 1 168 LYS 168 166 166 LYS LYS A . n 
A 1 169 ALA 169 167 167 ALA ALA A . n 
A 1 170 LEU 170 168 168 LEU LEU A . n 
A 1 171 ALA 171 169 169 ALA ALA A . n 
A 1 172 LEU 172 170 170 LEU LEU A . n 
A 1 173 ASP 173 171 171 ASP ASP A . n 
A 1 174 GLU 174 172 172 GLU GLU A . n 
A 1 175 SER 175 173 173 SER SER A . n 
A 1 176 PRO 176 174 174 PRO PRO A . n 
A 1 177 TYR 177 175 175 TYR TYR A . n 
A 1 178 GLY 178 176 176 GLY GLY A . n 
A 1 179 VAL 179 177 177 VAL VAL A . n 
A 1 180 ARG 180 178 178 ARG ARG A . n 
A 1 181 VAL 181 179 179 VAL VAL A . n 
A 1 182 ASN 182 180 180 ASN ASN A . n 
A 1 183 CYS 183 181 181 CYS CYS A . n 
A 1 184 ILE 184 182 182 ILE ILE A . n 
A 1 185 SER 185 183 183 SER SER A . n 
A 1 186 PRO 186 184 184 PRO PRO A . n 
A 1 187 GLY 187 185 185 GLY GLY A . n 
A 1 188 ASN 188 186 186 ASN ASN A . n 
A 1 189 ILE 189 187 187 ILE ILE A . n 
A 1 190 TRP 190 188 188 TRP TRP A . n 
A 1 191 THR 191 189 189 THR THR A . n 
A 1 192 PRO 192 190 190 PRO PRO A . n 
A 1 193 LEU 193 191 191 LEU LEU A . n 
A 1 194 TRP 194 192 192 TRP TRP A . n 
A 1 195 GLU 195 193 193 GLU GLU A . n 
A 1 196 GLU 196 194 194 GLU GLU A . n 
A 1 197 LEU 197 195 195 LEU LEU A . n 
A 1 198 ALA 198 196 196 ALA ALA A . n 
A 1 199 ALA 199 197 197 ALA ALA A . n 
A 1 200 LEU 200 198 198 LEU LEU A . n 
A 1 201 MET 201 199 199 MET MET A . n 
A 1 202 PRO 202 200 200 PRO PRO A . n 
A 1 203 ASP 203 201 201 ASP ASP A . n 
A 1 204 PRO 204 202 202 PRO PRO A . n 
A 1 205 ARG 205 203 203 ARG ARG A . n 
A 1 206 ALA 206 204 204 ALA ALA A . n 
A 1 207 THR 207 205 205 THR THR A . n 
A 1 208 ILE 208 206 206 ILE ILE A . n 
A 1 209 ARG 209 207 207 ARG ARG A . n 
A 1 210 GLU 210 208 208 GLU GLU A . n 
A 1 211 GLY 211 209 209 GLY GLY A . n 
A 1 212 MET 212 210 210 MET MET A . n 
A 1 213 LEU 213 211 211 LEU LEU A . n 
A 1 214 ALA 214 212 212 ALA ALA A . n 
A 1 215 GLN 215 213 213 GLN GLN A . n 
A 1 216 PRO 216 214 214 PRO PRO A . n 
A 1 217 LEU 217 215 215 LEU LEU A . n 
A 1 218 GLY 218 216 216 GLY GLY A . n 
A 1 219 ARG 219 217 217 ARG ARG A . n 
A 1 220 MET 220 218 218 MET MET A . n 
A 1 221 GLY 221 219 219 GLY GLY A . n 
A 1 222 GLN 222 220 220 GLN GLN A . n 
A 1 223 PRO 223 221 221 PRO PRO A . n 
A 1 224 ALA 224 222 222 ALA ALA A . n 
A 1 225 GLU 225 223 223 GLU GLU A . n 
A 1 226 VAL 226 224 224 VAL VAL A . n 
A 1 227 GLY 227 225 225 GLY GLY A . n 
A 1 228 ALA 228 226 226 ALA ALA A . n 
A 1 229 ALA 229 227 227 ALA ALA A . n 
A 1 230 ALA 230 228 228 ALA ALA A . n 
A 1 231 VAL 231 229 229 VAL VAL A . n 
A 1 232 PHE 232 230 230 PHE PHE A . n 
A 1 233 LEU 233 231 231 LEU LEU A . n 
A 1 234 ALA 234 232 232 ALA ALA A . n 
A 1 235 SER 235 233 233 SER SER A . n 
A 1 236 GLU 236 234 234 GLU GLU A . n 
A 1 237 ALA 237 235 235 ALA ALA A . n 
A 1 238 ASN 238 236 236 ASN ASN A . n 
A 1 239 PHE 239 237 237 PHE PHE A . n 
A 1 240 CYS 240 238 238 CYS CYS A . n 
A 1 241 THR 241 239 239 THR THR A . n 
A 1 242 GLY 242 240 240 GLY GLY A . n 
A 1 243 ILE 243 241 241 ILE ILE A . n 
A 1 244 GLU 244 242 242 GLU GLU A . n 
A 1 245 LEU 245 243 243 LEU LEU A . n 
A 1 246 LEU 246 244 244 LEU LEU A . n 
A 1 247 VAL 247 245 245 VAL VAL A . n 
A 1 248 THR 248 246 246 THR THR A . n 
A 1 249 GLY 249 247 247 GLY GLY A . n 
A 1 250 GLY 250 248 248 GLY GLY A . n 
A 1 251 ALA 251 249 249 ALA ALA A . n 
A 1 252 GLU 252 250 250 GLU GLU A . n 
A 1 253 LEU 253 251 251 LEU LEU A . n 
A 1 254 GLY 254 252 252 GLY GLY A . n 
A 1 255 TYR 255 253 253 TYR TYR A . n 
A 1 256 GLY 256 254 254 GLY GLY A . n 
A 1 257 CYS 257 255 255 CYS CYS A . n 
A 1 258 LYS 258 256 256 LYS LYS A . n 
A 1 259 ALA 259 257 257 ALA ALA A . n 
A 1 260 SER 260 258 ?   ?   ?   A . n 
A 1 261 ARG 261 259 ?   ?   ?   A . n 
A 1 262 SER 262 260 ?   ?   ?   A . n 
A 1 263 THR 263 261 ?   ?   ?   A . n 
A 1 264 PRO 264 262 ?   ?   ?   A . n 
A 1 265 VAL 265 263 ?   ?   ?   A . n 
A 1 266 ASP 266 264 ?   ?   ?   A . n 
A 1 267 ALA 267 265 ?   ?   ?   A . n 
A 1 268 PRO 268 266 ?   ?   ?   A . n 
A 1 269 ASP 269 267 ?   ?   ?   A . n 
A 1 270 ILE 270 268 ?   ?   ?   A . n 
A 1 271 PRO 271 269 269 PRO PRO A . n 
A 1 272 SER 272 270 270 SER SER A . n 
A 1 273 GLY 273 271 271 GLY GLY A . n 
A 1 274 SER 274 272 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAD 1   301 2   NAD NAD A . 
C 3 J3Z 1   302 1   J3Z XXX A . 
D 4 NA  1   303 1   NA  NA  A . 
E 5 HOH 1   401 28  HOH HOH A . 
E 5 HOH 2   402 149 HOH HOH A . 
E 5 HOH 3   403 8   HOH HOH A . 
E 5 HOH 4   404 5   HOH HOH A . 
E 5 HOH 5   405 20  HOH HOH A . 
E 5 HOH 6   406 166 HOH HOH A . 
E 5 HOH 7   407 37  HOH HOH A . 
E 5 HOH 8   408 40  HOH HOH A . 
E 5 HOH 9   409 59  HOH HOH A . 
E 5 HOH 10  410 110 HOH HOH A . 
E 5 HOH 11  411 7   HOH HOH A . 
E 5 HOH 12  412 156 HOH HOH A . 
E 5 HOH 13  413 84  HOH HOH A . 
E 5 HOH 14  414 12  HOH HOH A . 
E 5 HOH 15  415 32  HOH HOH A . 
E 5 HOH 16  416 108 HOH HOH A . 
E 5 HOH 17  417 34  HOH HOH A . 
E 5 HOH 18  418 78  HOH HOH A . 
E 5 HOH 19  419 17  HOH HOH A . 
E 5 HOH 20  420 76  HOH HOH A . 
E 5 HOH 21  421 35  HOH HOH A . 
E 5 HOH 22  422 44  HOH HOH A . 
E 5 HOH 23  423 2   HOH HOH A . 
E 5 HOH 24  424 6   HOH HOH A . 
E 5 HOH 25  425 27  HOH HOH A . 
E 5 HOH 26  426 63  HOH HOH A . 
E 5 HOH 27  427 132 HOH HOH A . 
E 5 HOH 28  428 30  HOH HOH A . 
E 5 HOH 29  429 73  HOH HOH A . 
E 5 HOH 30  430 104 HOH HOH A . 
E 5 HOH 31  431 11  HOH HOH A . 
E 5 HOH 32  432 161 HOH HOH A . 
E 5 HOH 33  433 23  HOH HOH A . 
E 5 HOH 34  434 14  HOH HOH A . 
E 5 HOH 35  435 87  HOH HOH A . 
E 5 HOH 36  436 56  HOH HOH A . 
E 5 HOH 37  437 47  HOH HOH A . 
E 5 HOH 38  438 106 HOH HOH A . 
E 5 HOH 39  439 54  HOH HOH A . 
E 5 HOH 40  440 107 HOH HOH A . 
E 5 HOH 41  441 51  HOH HOH A . 
E 5 HOH 42  442 68  HOH HOH A . 
E 5 HOH 43  443 79  HOH HOH A . 
E 5 HOH 44  444 94  HOH HOH A . 
E 5 HOH 45  445 16  HOH HOH A . 
E 5 HOH 46  446 10  HOH HOH A . 
E 5 HOH 47  447 126 HOH HOH A . 
E 5 HOH 48  448 41  HOH HOH A . 
E 5 HOH 49  449 61  HOH HOH A . 
E 5 HOH 50  450 52  HOH HOH A . 
E 5 HOH 51  451 3   HOH HOH A . 
E 5 HOH 52  452 38  HOH HOH A . 
E 5 HOH 53  453 43  HOH HOH A . 
E 5 HOH 54  454 111 HOH HOH A . 
E 5 HOH 55  455 46  HOH HOH A . 
E 5 HOH 56  456 19  HOH HOH A . 
E 5 HOH 57  457 90  HOH HOH A . 
E 5 HOH 58  458 86  HOH HOH A . 
E 5 HOH 59  459 71  HOH HOH A . 
E 5 HOH 60  460 50  HOH HOH A . 
E 5 HOH 61  461 83  HOH HOH A . 
E 5 HOH 62  462 24  HOH HOH A . 
E 5 HOH 63  463 31  HOH HOH A . 
E 5 HOH 64  464 121 HOH HOH A . 
E 5 HOH 65  465 13  HOH HOH A . 
E 5 HOH 66  466 164 HOH HOH A . 
E 5 HOH 67  467 74  HOH HOH A . 
E 5 HOH 68  468 95  HOH HOH A . 
E 5 HOH 69  469 49  HOH HOH A . 
E 5 HOH 70  470 89  HOH HOH A . 
E 5 HOH 71  471 131 HOH HOH A . 
E 5 HOH 72  472 33  HOH HOH A . 
E 5 HOH 73  473 36  HOH HOH A . 
E 5 HOH 74  474 116 HOH HOH A . 
E 5 HOH 75  475 4   HOH HOH A . 
E 5 HOH 76  476 92  HOH HOH A . 
E 5 HOH 77  477 105 HOH HOH A . 
E 5 HOH 78  478 58  HOH HOH A . 
E 5 HOH 79  479 134 HOH HOH A . 
E 5 HOH 80  480 139 HOH HOH A . 
E 5 HOH 81  481 25  HOH HOH A . 
E 5 HOH 82  482 155 HOH HOH A . 
E 5 HOH 83  483 21  HOH HOH A . 
E 5 HOH 84  484 98  HOH HOH A . 
E 5 HOH 85  485 93  HOH HOH A . 
E 5 HOH 86  486 55  HOH HOH A . 
E 5 HOH 87  487 18  HOH HOH A . 
E 5 HOH 88  488 15  HOH HOH A . 
E 5 HOH 89  489 102 HOH HOH A . 
E 5 HOH 90  490 158 HOH HOH A . 
E 5 HOH 91  491 42  HOH HOH A . 
E 5 HOH 92  492 22  HOH HOH A . 
E 5 HOH 93  493 70  HOH HOH A . 
E 5 HOH 94  494 99  HOH HOH A . 
E 5 HOH 95  495 9   HOH HOH A . 
E 5 HOH 96  496 66  HOH HOH A . 
E 5 HOH 97  497 26  HOH HOH A . 
E 5 HOH 98  498 136 HOH HOH A . 
E 5 HOH 99  499 163 HOH HOH A . 
E 5 HOH 100 500 154 HOH HOH A . 
E 5 HOH 101 501 145 HOH HOH A . 
E 5 HOH 102 502 85  HOH HOH A . 
E 5 HOH 103 503 75  HOH HOH A . 
E 5 HOH 104 504 65  HOH HOH A . 
E 5 HOH 105 505 80  HOH HOH A . 
E 5 HOH 106 506 48  HOH HOH A . 
E 5 HOH 107 507 60  HOH HOH A . 
E 5 HOH 108 508 123 HOH HOH A . 
E 5 HOH 109 509 138 HOH HOH A . 
E 5 HOH 110 510 39  HOH HOH A . 
E 5 HOH 111 511 137 HOH HOH A . 
E 5 HOH 112 512 122 HOH HOH A . 
E 5 HOH 113 513 124 HOH HOH A . 
E 5 HOH 114 514 165 HOH HOH A . 
E 5 HOH 115 515 82  HOH HOH A . 
E 5 HOH 116 516 120 HOH HOH A . 
E 5 HOH 117 517 159 HOH HOH A . 
E 5 HOH 118 518 140 HOH HOH A . 
E 5 HOH 119 519 148 HOH HOH A . 
E 5 HOH 120 520 133 HOH HOH A . 
E 5 HOH 121 521 45  HOH HOH A . 
E 5 HOH 122 522 53  HOH HOH A . 
E 5 HOH 123 523 81  HOH HOH A . 
E 5 HOH 124 524 57  HOH HOH A . 
E 5 HOH 125 525 96  HOH HOH A . 
E 5 HOH 126 526 146 HOH HOH A . 
E 5 HOH 127 527 88  HOH HOH A . 
E 5 HOH 128 528 115 HOH HOH A . 
E 5 HOH 129 529 117 HOH HOH A . 
E 5 HOH 130 530 69  HOH HOH A . 
E 5 HOH 131 531 72  HOH HOH A . 
E 5 HOH 132 532 103 HOH HOH A . 
E 5 HOH 133 533 114 HOH HOH A . 
E 5 HOH 134 534 144 HOH HOH A . 
E 5 HOH 135 535 162 HOH HOH A . 
E 5 HOH 136 536 62  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 21790 ? 
1 MORE         -206  ? 
1 'SSA (A^2)'  31000 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 91.1110000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 91.1110000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
4 'crystal symmetry operation' 6_555 x,-y,-z   1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 438 ? E HOH . 
2 1 A HOH 536 ? E HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A GLU 52 ? A GLU 50  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? A LEU 55 ? A LEU 53  ? 1_555 95.1  ? 
2  O ? A GLU 52 ? A GLU 50  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? A ALA 58 ? A ALA 56  ? 1_555 101.6 ? 
3  O ? A LEU 55 ? A LEU 53  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? A ALA 58 ? A ALA 56  ? 1_555 96.3  ? 
4  O ? A GLU 52 ? A GLU 50  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 480 ? 1_555 74.0  ? 
5  O ? A LEU 55 ? A LEU 53  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 480 ? 1_555 78.1  ? 
6  O ? A ALA 58 ? A ALA 56  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 480 ? 1_555 172.4 ? 
7  O ? A GLU 52 ? A GLU 50  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 518 ? 1_555 104.7 ? 
8  O ? A LEU 55 ? A LEU 53  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 518 ? 1_555 150.8 ? 
9  O ? A ALA 58 ? A ALA 56  ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 518 ? 1_555 100.4 ? 
10 O ? E HOH .  ? A HOH 480 ? 1_555 NA ? D NA . ? A NA 303 ? 1_555 O ? E HOH .  ? A HOH 518 ? 1_555 86.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-07-13 
2 'Structure model' 1 1 2016-08-10 
3 'Structure model' 1 2 2017-09-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 43.9421 26.5641 -13.3849 0.1933 0.1174 0.1414 0.0268 0.0254  0.0214  8.9723 5.3985 4.4380 3.8163  
3.6094  1.5979  0.0375  -0.2565 0.2422  -0.0071 -0.0973 0.0273  -0.2760 -0.1158 0.0572  
'X-RAY DIFFRACTION' 2 ? refined 38.7695 26.7648 -24.2078 0.2346 0.2328 0.1614 0.0065 -0.0447 0.0332  6.3458 8.3675 6.2619 -5.9117 
-4.7835 5.9798  0.3014  0.3030  0.0929  -0.4120 -0.1579 -0.0860 -0.0867 -0.5881 -0.1175 
'X-RAY DIFFRACTION' 3 ? refined 48.7154 20.9741 -23.6743 0.2527 0.1580 0.1729 0.0378 -0.0003 -0.0176 4.7646 3.5605 2.4601 3.5427  
-0.5163 -0.8574 -0.1525 0.3086  -0.0198 -0.3793 0.1660  0.1624  0.0814  0.0653  -0.0250 
'X-RAY DIFFRACTION' 4 ? refined 45.7747 7.4034  -16.4407 0.2115 0.1888 0.1838 0.0304 -0.0065 0.0039  0.8804 2.2788 1.1267 0.7192  
-0.0825 -0.0425 0.0192  0.1038  0.0305  -0.2210 0.0172  0.0909  0.0076  -0.0303 -0.0357 
'X-RAY DIFFRACTION' 5 ? refined 24.4023 11.5095 -9.4557  0.1898 0.3464 0.2885 0.0073 0.0036  -0.0114 7.9636 2.6481 6.6242 -0.2678 
3.1902  -0.8676 -0.0976 0.0745  0.0250  -0.2887 0.0528  0.3086  0.1487  -0.8363 0.0574  
'X-RAY DIFFRACTION' 6 ? refined 43.0719 14.1809 -2.4972  0.1968 0.1634 0.1661 0.0034 0.0023  -0.0409 4.5897 0.8771 2.3080 0.1626  
-0.9237 -1.2577 0.0686  0.0682  -0.0765 -0.0046 -0.0742 -0.0865 -0.0231 -0.0058 0.0080  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 5:39)'    
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 40:63)'   
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 64:93)'   
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain A and resid 94:185)'  
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain A and resid 186:220)' 
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '(chain A and resid 221:254)' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1-2155 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .           4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 140 ? ? -99.31  -130.49 
2 1 ALA A 151 ? ? -158.31 40.57   
3 1 ALA A 235 ? ? -91.30  53.22   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       536 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.00 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 41  ? NZ  ? A LYS 43  NZ  
2  1 Y 1 A ASP 42  ? OD1 ? A ASP 44  OD1 
3  1 Y 1 A ASP 42  ? OD2 ? A ASP 44  OD2 
4  1 Y 1 A SER 44  ? OG  ? A SER 46  OG  
5  1 Y 1 A ARG 47  ? NE  ? A ARG 49  NE  
6  1 Y 1 A ARG 47  ? CZ  ? A ARG 49  CZ  
7  1 Y 1 A ARG 47  ? NH1 ? A ARG 49  NH1 
8  1 Y 1 A ARG 47  ? NH2 ? A ARG 49  NH2 
9  1 Y 1 A GLU 66  ? CD  ? A GLU 68  CD  
10 1 Y 1 A GLU 66  ? OE1 ? A GLU 68  OE1 
11 1 Y 1 A GLU 66  ? OE2 ? A GLU 68  OE2 
12 1 Y 1 A LYS 70  ? CD  ? A LYS 72  CD  
13 1 Y 1 A LYS 70  ? CE  ? A LYS 72  CE  
14 1 Y 1 A LYS 70  ? NZ  ? A LYS 72  NZ  
15 1 Y 1 A ARG 98  ? CZ  ? A ARG 100 CZ  
16 1 Y 1 A ARG 98  ? NH1 ? A ARG 100 NH1 
17 1 Y 1 A ARG 98  ? NH2 ? A ARG 100 NH2 
18 1 Y 1 A LYS 123 ? NZ  ? A LYS 125 NZ  
19 1 Y 1 A LYS 131 ? CD  ? A LYS 133 CD  
20 1 Y 1 A LYS 131 ? CE  ? A LYS 133 CE  
21 1 Y 1 A LYS 131 ? NZ  ? A LYS 133 NZ  
22 1 Y 1 A GLN 133 ? OE1 ? A GLN 135 OE1 
23 1 Y 1 A GLN 133 ? NE2 ? A GLN 135 NE2 
24 1 Y 1 A LEU 198 ? CD1 ? A LEU 200 CD1 
25 1 Y 1 A LEU 198 ? CD2 ? A LEU 200 CD2 
26 1 Y 1 A ARG 203 ? CG  ? A ARG 205 CG  
27 1 Y 1 A ARG 203 ? CD  ? A ARG 205 CD  
28 1 Y 1 A ARG 203 ? NE  ? A ARG 205 NE  
29 1 Y 1 A ARG 203 ? CZ  ? A ARG 205 CZ  
30 1 Y 1 A ARG 203 ? NH1 ? A ARG 205 NH1 
31 1 Y 1 A ARG 203 ? NH2 ? A ARG 205 NH2 
32 1 Y 1 A ARG 207 ? CG  ? A ARG 209 CG  
33 1 Y 1 A ARG 207 ? CD  ? A ARG 209 CD  
34 1 Y 1 A ARG 207 ? NE  ? A ARG 209 NE  
35 1 Y 1 A ARG 207 ? CZ  ? A ARG 209 CZ  
36 1 Y 1 A ARG 207 ? NH1 ? A ARG 209 NH1 
37 1 Y 1 A ARG 207 ? NH2 ? A ARG 209 NH2 
38 1 Y 1 A GLU 208 ? CD  ? A GLU 210 CD  
39 1 Y 1 A GLU 208 ? OE1 ? A GLU 210 OE1 
40 1 Y 1 A GLU 208 ? OE2 ? A GLU 210 OE2 
41 1 N 1 A J3Z 302 ? C6  ? C J3Z 1   C6  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A HIS 0   ? A HIS 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A ALA 2   ? A ALA 4   
5  1 Y 1 A THR 3   ? A THR 5   
6  1 Y 1 A SER 258 ? A SER 260 
7  1 Y 1 A ARG 259 ? A ARG 261 
8  1 Y 1 A SER 260 ? A SER 262 
9  1 Y 1 A THR 261 ? A THR 263 
10 1 Y 1 A PRO 262 ? A PRO 264 
11 1 Y 1 A VAL 263 ? A VAL 265 
12 1 Y 1 A ASP 264 ? A ASP 266 
13 1 Y 1 A ALA 265 ? A ALA 267 
14 1 Y 1 A PRO 266 ? A PRO 268 
15 1 Y 1 A ASP 267 ? A ASP 269 
16 1 Y 1 A ILE 268 ? A ILE 270 
17 1 Y 1 A SER 272 ? A SER 274 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'German Research Foundation' Germany KL1204/15-1 1 
'German Research Foundation' ?       MA-5287/1-1 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 NICOTINAMIDE-ADENINE-DINUCLEOTIDE                       NAD 
3 '(9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one' J3Z 
4 'SODIUM ION'                                            NA  
5 water                                                   HOH 
#