data_5I1U
# 
_entry.id   5I1U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I1U         
WWPDB D_1000218107 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I1U 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, M.'           1 
'Christianson, D.W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            55 
_citation.language                  ? 
_citation.page_first                2112 
_citation.page_last                 2121 
_citation.title                     'Mechanism of Germacradien-4-ol Synthase-Controlled Water Capture.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.6b00115 
_citation.pdbx_database_id_PubMed   26998816 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Grundy, D.J.'       1 ? 
primary 'Chen, M.'           2 ? 
primary 'Gonzalez, V.'       3 ? 
primary 'Leoni, S.'          4 ? 
primary 'Miller, D.J.'       5 ? 
primary 'Christianson, D.W.' 6 ? 
primary 'Allemann, R.K.'     7 ? 
# 
_cell.entry_id           5I1U 
_cell.length_a           51.369 
_cell.length_b           74.127 
_cell.length_c           82.489 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.72 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I1U 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Germacradien-4-ol synthase' 38181.812 2   ? E248A ? ? 
2 non-polymer syn 'SULFATE ION'                96.063    2   ? ?     ? ? 
3 water       nat water                        18.015    658 ? ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSMSDDTSLELPFTHRRNPHQTEAADRHLEWLQRHRELAAVVSGSTYTGWDITELASLVYPES
SAEDLALAADLMGFYFLFDDQFDSPLGRRPEQVALICERLSAIAHGTLTAVTSPSERAFADLWRRITLGMTDRWRARAAC
NWEYYFACHPAEAAGRTIGQPPDREGYLTLRRGTAAMESIFDMIERLGHFEVPQHVMHHPLFRQLRQLAADIPSFTNDVR
SFAQESERGDVANLVMIVRRDRCCSTAEACAVVWDEAQRMADRFCDLRDQLPDACRSMSLDPAQRLAAERYADGMALWLA
GYLHWESHTRRYHHG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSMSDDTSLELPFTHRRNPHQTEAADRHLEWLQRHRELAAVVSGSTYTGWDITELASLVYPES
SAEDLALAADLMGFYFLFDDQFDSPLGRRPEQVALICERLSAIAHGTLTAVTSPSERAFADLWRRITLGMTDRWRARAAC
NWEYYFACHPAEAAGRTIGQPPDREGYLTLRRGTAAMESIFDMIERLGHFEVPQHVMHHPLFRQLRQLAADIPSFTNDVR
SFAQESERGDVANLVMIVRRDRCCSTAEACAVVWDEAQRMADRFCDLRDQLPDACRSMSLDPAQRLAAERYADGMALWLA
GYLHWESHTRRYHHG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  MET n 
1 21  SER n 
1 22  ASP n 
1 23  ASP n 
1 24  THR n 
1 25  SER n 
1 26  LEU n 
1 27  GLU n 
1 28  LEU n 
1 29  PRO n 
1 30  PHE n 
1 31  THR n 
1 32  HIS n 
1 33  ARG n 
1 34  ARG n 
1 35  ASN n 
1 36  PRO n 
1 37  HIS n 
1 38  GLN n 
1 39  THR n 
1 40  GLU n 
1 41  ALA n 
1 42  ALA n 
1 43  ASP n 
1 44  ARG n 
1 45  HIS n 
1 46  LEU n 
1 47  GLU n 
1 48  TRP n 
1 49  LEU n 
1 50  GLN n 
1 51  ARG n 
1 52  HIS n 
1 53  ARG n 
1 54  GLU n 
1 55  LEU n 
1 56  ALA n 
1 57  ALA n 
1 58  VAL n 
1 59  VAL n 
1 60  SER n 
1 61  GLY n 
1 62  SER n 
1 63  THR n 
1 64  TYR n 
1 65  THR n 
1 66  GLY n 
1 67  TRP n 
1 68  ASP n 
1 69  ILE n 
1 70  THR n 
1 71  GLU n 
1 72  LEU n 
1 73  ALA n 
1 74  SER n 
1 75  LEU n 
1 76  VAL n 
1 77  TYR n 
1 78  PRO n 
1 79  GLU n 
1 80  SER n 
1 81  SER n 
1 82  ALA n 
1 83  GLU n 
1 84  ASP n 
1 85  LEU n 
1 86  ALA n 
1 87  LEU n 
1 88  ALA n 
1 89  ALA n 
1 90  ASP n 
1 91  LEU n 
1 92  MET n 
1 93  GLY n 
1 94  PHE n 
1 95  TYR n 
1 96  PHE n 
1 97  LEU n 
1 98  PHE n 
1 99  ASP n 
1 100 ASP n 
1 101 GLN n 
1 102 PHE n 
1 103 ASP n 
1 104 SER n 
1 105 PRO n 
1 106 LEU n 
1 107 GLY n 
1 108 ARG n 
1 109 ARG n 
1 110 PRO n 
1 111 GLU n 
1 112 GLN n 
1 113 VAL n 
1 114 ALA n 
1 115 LEU n 
1 116 ILE n 
1 117 CYS n 
1 118 GLU n 
1 119 ARG n 
1 120 LEU n 
1 121 SER n 
1 122 ALA n 
1 123 ILE n 
1 124 ALA n 
1 125 HIS n 
1 126 GLY n 
1 127 THR n 
1 128 LEU n 
1 129 THR n 
1 130 ALA n 
1 131 VAL n 
1 132 THR n 
1 133 SER n 
1 134 PRO n 
1 135 SER n 
1 136 GLU n 
1 137 ARG n 
1 138 ALA n 
1 139 PHE n 
1 140 ALA n 
1 141 ASP n 
1 142 LEU n 
1 143 TRP n 
1 144 ARG n 
1 145 ARG n 
1 146 ILE n 
1 147 THR n 
1 148 LEU n 
1 149 GLY n 
1 150 MET n 
1 151 THR n 
1 152 ASP n 
1 153 ARG n 
1 154 TRP n 
1 155 ARG n 
1 156 ALA n 
1 157 ARG n 
1 158 ALA n 
1 159 ALA n 
1 160 CYS n 
1 161 ASN n 
1 162 TRP n 
1 163 GLU n 
1 164 TYR n 
1 165 TYR n 
1 166 PHE n 
1 167 ALA n 
1 168 CYS n 
1 169 HIS n 
1 170 PRO n 
1 171 ALA n 
1 172 GLU n 
1 173 ALA n 
1 174 ALA n 
1 175 GLY n 
1 176 ARG n 
1 177 THR n 
1 178 ILE n 
1 179 GLY n 
1 180 GLN n 
1 181 PRO n 
1 182 PRO n 
1 183 ASP n 
1 184 ARG n 
1 185 GLU n 
1 186 GLY n 
1 187 TYR n 
1 188 LEU n 
1 189 THR n 
1 190 LEU n 
1 191 ARG n 
1 192 ARG n 
1 193 GLY n 
1 194 THR n 
1 195 ALA n 
1 196 ALA n 
1 197 MET n 
1 198 GLU n 
1 199 SER n 
1 200 ILE n 
1 201 PHE n 
1 202 ASP n 
1 203 MET n 
1 204 ILE n 
1 205 GLU n 
1 206 ARG n 
1 207 LEU n 
1 208 GLY n 
1 209 HIS n 
1 210 PHE n 
1 211 GLU n 
1 212 VAL n 
1 213 PRO n 
1 214 GLN n 
1 215 HIS n 
1 216 VAL n 
1 217 MET n 
1 218 HIS n 
1 219 HIS n 
1 220 PRO n 
1 221 LEU n 
1 222 PHE n 
1 223 ARG n 
1 224 GLN n 
1 225 LEU n 
1 226 ARG n 
1 227 GLN n 
1 228 LEU n 
1 229 ALA n 
1 230 ALA n 
1 231 ASP n 
1 232 ILE n 
1 233 PRO n 
1 234 SER n 
1 235 PHE n 
1 236 THR n 
1 237 ASN n 
1 238 ASP n 
1 239 VAL n 
1 240 ARG n 
1 241 SER n 
1 242 PHE n 
1 243 ALA n 
1 244 GLN n 
1 245 GLU n 
1 246 SER n 
1 247 GLU n 
1 248 ARG n 
1 249 GLY n 
1 250 ASP n 
1 251 VAL n 
1 252 ALA n 
1 253 ASN n 
1 254 LEU n 
1 255 VAL n 
1 256 MET n 
1 257 ILE n 
1 258 VAL n 
1 259 ARG n 
1 260 ARG n 
1 261 ASP n 
1 262 ARG n 
1 263 CYS n 
1 264 CYS n 
1 265 SER n 
1 266 THR n 
1 267 ALA n 
1 268 GLU n 
1 269 ALA n 
1 270 CYS n 
1 271 ALA n 
1 272 VAL n 
1 273 VAL n 
1 274 TRP n 
1 275 ASP n 
1 276 GLU n 
1 277 ALA n 
1 278 GLN n 
1 279 ARG n 
1 280 MET n 
1 281 ALA n 
1 282 ASP n 
1 283 ARG n 
1 284 PHE n 
1 285 CYS n 
1 286 ASP n 
1 287 LEU n 
1 288 ARG n 
1 289 ASP n 
1 290 GLN n 
1 291 LEU n 
1 292 PRO n 
1 293 ASP n 
1 294 ALA n 
1 295 CYS n 
1 296 ARG n 
1 297 SER n 
1 298 MET n 
1 299 SER n 
1 300 LEU n 
1 301 ASP n 
1 302 PRO n 
1 303 ALA n 
1 304 GLN n 
1 305 ARG n 
1 306 LEU n 
1 307 ALA n 
1 308 ALA n 
1 309 GLU n 
1 310 ARG n 
1 311 TYR n 
1 312 ALA n 
1 313 ASP n 
1 314 GLY n 
1 315 MET n 
1 316 ALA n 
1 317 LEU n 
1 318 TRP n 
1 319 LEU n 
1 320 ALA n 
1 321 GLY n 
1 322 TYR n 
1 323 LEU n 
1 324 HIS n 
1 325 TRP n 
1 326 GLU n 
1 327 SER n 
1 328 HIS n 
1 329 THR n 
1 330 ARG n 
1 331 ARG n 
1 332 TYR n 
1 333 HIS n 
1 334 HIS n 
1 335 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   335 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SC1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces citricolor' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     212427 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G5EKM9_9ACTN 
_struct_ref.pdbx_db_accession          G5EKM9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSDDTSLELPFTHRRNPHQTEAADRHLEWLQRHRELAAVVSGSTYTGWDITELASLVYPESSAEDLALAADLMGFYFLFD
DQFDSPLGRRPEQVALICERLSAIAHGTLTAVTSPSERAFADLWRRITLGMTDRWRARAACNWEYYFACHPAEAAGRTIG
QPPDREGYLTLRRGTAAMESIFDMIERLGHFEVPQHVMHHPLFRQLRQLAADIPSFTNDVRSFAQESERGDVANLVMIVR
RDRCCSTEEACAVVWDEAQRMADRFCDLRDQLPDACRSMSLDPAQRLAAERYADGMALWLAGYLHWESHTRRYHHG
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5I1U A 20 ? 335 ? G5EKM9 1 ? 316 ? 1 316 
2 1 5I1U B 20 ? 335 ? G5EKM9 1 ? 316 ? 1 316 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I1U MET A 1   ? UNP G5EKM9 ?   ?   'initiating methionine' -18 1  
1 5I1U GLY A 2   ? UNP G5EKM9 ?   ?   'expression tag'        -17 2  
1 5I1U SER A 3   ? UNP G5EKM9 ?   ?   'expression tag'        -16 3  
1 5I1U SER A 4   ? UNP G5EKM9 ?   ?   'expression tag'        -15 4  
1 5I1U HIS A 5   ? UNP G5EKM9 ?   ?   'expression tag'        -14 5  
1 5I1U HIS A 6   ? UNP G5EKM9 ?   ?   'expression tag'        -13 6  
1 5I1U HIS A 7   ? UNP G5EKM9 ?   ?   'expression tag'        -12 7  
1 5I1U HIS A 8   ? UNP G5EKM9 ?   ?   'expression tag'        -11 8  
1 5I1U HIS A 9   ? UNP G5EKM9 ?   ?   'expression tag'        -10 9  
1 5I1U HIS A 10  ? UNP G5EKM9 ?   ?   'expression tag'        -9  10 
1 5I1U SER A 11  ? UNP G5EKM9 ?   ?   'expression tag'        -8  11 
1 5I1U SER A 12  ? UNP G5EKM9 ?   ?   'expression tag'        -7  12 
1 5I1U GLY A 13  ? UNP G5EKM9 ?   ?   'expression tag'        -6  13 
1 5I1U LEU A 14  ? UNP G5EKM9 ?   ?   'expression tag'        -5  14 
1 5I1U VAL A 15  ? UNP G5EKM9 ?   ?   'expression tag'        -4  15 
1 5I1U PRO A 16  ? UNP G5EKM9 ?   ?   'expression tag'        -3  16 
1 5I1U ARG A 17  ? UNP G5EKM9 ?   ?   'expression tag'        -2  17 
1 5I1U GLY A 18  ? UNP G5EKM9 ?   ?   'expression tag'        -1  18 
1 5I1U SER A 19  ? UNP G5EKM9 ?   ?   'expression tag'        0   19 
1 5I1U ALA A 267 ? UNP G5EKM9 GLU 248 'engineered mutation'   248 20 
2 5I1U MET B 1   ? UNP G5EKM9 ?   ?   'initiating methionine' -18 21 
2 5I1U GLY B 2   ? UNP G5EKM9 ?   ?   'expression tag'        -17 22 
2 5I1U SER B 3   ? UNP G5EKM9 ?   ?   'expression tag'        -16 23 
2 5I1U SER B 4   ? UNP G5EKM9 ?   ?   'expression tag'        -15 24 
2 5I1U HIS B 5   ? UNP G5EKM9 ?   ?   'expression tag'        -14 25 
2 5I1U HIS B 6   ? UNP G5EKM9 ?   ?   'expression tag'        -13 26 
2 5I1U HIS B 7   ? UNP G5EKM9 ?   ?   'expression tag'        -12 27 
2 5I1U HIS B 8   ? UNP G5EKM9 ?   ?   'expression tag'        -11 28 
2 5I1U HIS B 9   ? UNP G5EKM9 ?   ?   'expression tag'        -10 29 
2 5I1U HIS B 10  ? UNP G5EKM9 ?   ?   'expression tag'        -9  30 
2 5I1U SER B 11  ? UNP G5EKM9 ?   ?   'expression tag'        -8  31 
2 5I1U SER B 12  ? UNP G5EKM9 ?   ?   'expression tag'        -7  32 
2 5I1U GLY B 13  ? UNP G5EKM9 ?   ?   'expression tag'        -6  33 
2 5I1U LEU B 14  ? UNP G5EKM9 ?   ?   'expression tag'        -5  34 
2 5I1U VAL B 15  ? UNP G5EKM9 ?   ?   'expression tag'        -4  35 
2 5I1U PRO B 16  ? UNP G5EKM9 ?   ?   'expression tag'        -3  36 
2 5I1U ARG B 17  ? UNP G5EKM9 ?   ?   'expression tag'        -2  37 
2 5I1U GLY B 18  ? UNP G5EKM9 ?   ?   'expression tag'        -1  38 
2 5I1U SER B 19  ? UNP G5EKM9 ?   ?   'expression tag'        0   39 
2 5I1U ALA B 267 ? UNP G5EKM9 GLU 248 'engineered mutation'   248 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I1U 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.06 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.17 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris, 2.0 M ammonium sulfate, pH 8.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CMOS 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RDI CMOS_8M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-12-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000064 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 4.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000064 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   4.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5I1U 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.5 
_reflns.d_resolution_low                 55.125 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       98277 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I1U 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     98141 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             55.125 
_refine.ls_d_res_high                            1.500 
_refine.ls_percent_reflns_obs                    99.24 
_refine.ls_R_factor_obs                          0.1577 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1569 
_refine.ls_R_factor_R_free                       0.2004 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.03 
_refine.ls_number_reflns_R_free                  1994 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pentalenene synthase' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.16 
_refine.pdbx_overall_phase_error                 20.66 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4767 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             658 
_refine_hist.number_atoms_total               5435 
_refine_hist.d_res_high                       1.500 
_refine_hist.d_res_low                        55.125 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014  ? ? 5143 'X-RAY DIFFRACTION' ? 
f_angle_d          1.347  ? ? 7034 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.415 ? ? 1950 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.071  ? ? 757  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 924  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.5000 1.5375  6789 0.2692 99.00  0.3054 . . 152 . . . . 
'X-RAY DIFFRACTION' . 1.5375 1.5791  6864 0.2372 100.00 0.3097 . . 142 . . . . 
'X-RAY DIFFRACTION' . 1.5791 1.6256  6878 0.2055 100.00 0.2523 . . 140 . . . . 
'X-RAY DIFFRACTION' . 1.6256 1.6780  6905 0.1823 100.00 0.2391 . . 136 . . . . 
'X-RAY DIFFRACTION' . 1.6780 1.7380  6880 0.1701 100.00 0.2308 . . 146 . . . . 
'X-RAY DIFFRACTION' . 1.7380 1.8076  6900 0.1576 100.00 0.2101 . . 149 . . . . 
'X-RAY DIFFRACTION' . 1.8076 1.8899  6887 0.1502 100.00 0.2050 . . 135 . . . . 
'X-RAY DIFFRACTION' . 1.8899 1.9895  6837 0.1494 99.00  0.2183 . . 137 . . . . 
'X-RAY DIFFRACTION' . 1.9895 2.1142  6809 0.1346 99.00  0.1732 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.1142 2.2774  6793 0.1326 99.00  0.2129 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.2774 2.5066  6901 0.1336 99.00  0.1753 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.5066 2.8693  6885 0.1454 99.00  0.1802 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.8693 3.6149  6886 0.1512 99.00  0.1867 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.6149 55.1618 6933 0.1616 98.00  0.1863 . . 138 . . . . 
# 
_struct.entry_id                     5I1U 
_struct.title                        'Crystal structure of germacradien-4-ol synthase from Streptomyces citricolor' 
_struct.pdbx_descriptor              'Germacradien-4-ol synthase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I1U 
_struct_keywords.text            'Lyase, sesquiterpene cyclase' 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 37  ? HIS A 52  ? HIS A 18  HIS A 33  1 ? 16 
HELX_P HELX_P2  AA2 HIS A 52  ? ALA A 57  ? HIS A 33  ALA A 38  1 ? 6  
HELX_P HELX_P3  AA3 SER A 60  ? ASP A 68  ? SER A 41  ASP A 49  1 ? 9  
HELX_P HELX_P4  AA4 ASP A 68  ? TYR A 77  ? ASP A 49  TYR A 58  1 ? 10 
HELX_P HELX_P5  AA5 SER A 81  ? GLN A 101 ? SER A 62  GLN A 82  1 ? 21 
HELX_P HELX_P6  AA6 PHE A 102 ? ASP A 103 ? PHE A 83  ASP A 84  5 ? 2  
HELX_P HELX_P7  AA7 SER A 104 ? ARG A 108 ? SER A 85  ARG A 89  5 ? 5  
HELX_P HELX_P8  AA8 ARG A 109 ? HIS A 125 ? ARG A 90  HIS A 106 1 ? 17 
HELX_P HELX_P9  AA9 SER A 133 ? LEU A 148 ? SER A 114 LEU A 129 1 ? 16 
HELX_P HELX_P10 AB1 THR A 151 ? CYS A 168 ? THR A 132 CYS A 149 1 ? 18 
HELX_P HELX_P11 AB2 CYS A 168 ? GLY A 175 ? CYS A 149 GLY A 156 1 ? 8  
HELX_P HELX_P12 AB3 ASP A 183 ? ALA A 195 ? ASP A 164 ALA A 176 1 ? 13 
HELX_P HELX_P13 AB4 ALA A 196 ? HIS A 209 ? ALA A 177 HIS A 190 1 ? 14 
HELX_P HELX_P14 AB5 PRO A 213 ? HIS A 218 ? PRO A 194 HIS A 199 1 ? 6  
HELX_P HELX_P15 AB6 HIS A 219 ? PHE A 242 ? HIS A 200 PHE A 223 1 ? 24 
HELX_P HELX_P16 AB7 ASN A 253 ? CYS A 263 ? ASN A 234 CYS A 244 1 ? 11 
HELX_P HELX_P17 AB8 SER A 265 ? GLN A 290 ? SER A 246 GLN A 271 1 ? 26 
HELX_P HELX_P18 AB9 GLN A 290 ? MET A 298 ? GLN A 271 MET A 279 1 ? 9  
HELX_P HELX_P19 AC1 ASP A 301 ? THR A 329 ? ASP A 282 THR A 310 1 ? 29 
HELX_P HELX_P20 AC2 HIS B 37  ? HIS B 52  ? HIS B 18  HIS B 33  1 ? 16 
HELX_P HELX_P21 AC3 HIS B 52  ? ALA B 57  ? HIS B 33  ALA B 38  1 ? 6  
HELX_P HELX_P22 AC4 SER B 60  ? GLY B 66  ? SER B 41  GLY B 47  1 ? 7  
HELX_P HELX_P23 AC5 ASP B 68  ? TYR B 77  ? ASP B 49  TYR B 58  1 ? 10 
HELX_P HELX_P24 AC6 SER B 81  ? GLN B 101 ? SER B 62  GLN B 82  1 ? 21 
HELX_P HELX_P25 AC7 ARG B 109 ? HIS B 125 ? ARG B 90  HIS B 106 1 ? 17 
HELX_P HELX_P26 AC8 SER B 133 ? LEU B 148 ? SER B 114 LEU B 129 1 ? 16 
HELX_P HELX_P27 AC9 THR B 151 ? CYS B 168 ? THR B 132 CYS B 149 1 ? 18 
HELX_P HELX_P28 AD1 CYS B 168 ? ARG B 176 ? CYS B 149 ARG B 157 1 ? 9  
HELX_P HELX_P29 AD2 ASP B 183 ? ALA B 195 ? ASP B 164 ALA B 176 1 ? 13 
HELX_P HELX_P30 AD3 ALA B 196 ? HIS B 209 ? ALA B 177 HIS B 190 1 ? 14 
HELX_P HELX_P31 AD4 PRO B 213 ? HIS B 218 ? PRO B 194 HIS B 199 1 ? 6  
HELX_P HELX_P32 AD5 HIS B 219 ? SER B 241 ? HIS B 200 SER B 222 1 ? 23 
HELX_P HELX_P33 AD6 ASN B 253 ? CYS B 263 ? ASN B 234 CYS B 244 1 ? 11 
HELX_P HELX_P34 AD7 SER B 265 ? GLN B 290 ? SER B 246 GLN B 271 1 ? 26 
HELX_P HELX_P35 AD8 GLN B 290 ? MET B 298 ? GLN B 271 MET B 279 1 ? 9  
HELX_P HELX_P36 AD9 ASP B 301 ? HIS B 328 ? ASP B 282 HIS B 309 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 401 ? 3 'binding site for residue SO4 A 401' 
AC2 Software B SO4 401 ? 2 'binding site for residue SO4 B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 HIS A 32  ? HIS A 13  . ? 1_555 ? 
2 AC1 3 ARG A 34  ? ARG A 15  . ? 1_555 ? 
3 AC1 3 HIS A 324 ? HIS A 305 . ? 1_555 ? 
4 AC2 2 ARG A 192 ? ARG A 173 . ? 1_555 ? 
5 AC2 2 ARG B 192 ? ARG B 173 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5I1U 
_atom_sites.fract_transf_matrix[1][1]   0.019467 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000585 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013490 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012128 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 20  ? 51.924 2.126   30.151 1.00 41.26  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 20  ? 52.787 1.988   31.324 1.00 41.73  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 20  ? 53.828 3.110   31.392 1.00 41.69  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 20  ? 54.407 3.496   30.370 1.00 41.15  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 20  ? 53.486 0.620   31.316 1.00 42.03  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 20  ? 54.306 0.325   32.575 1.00 42.75  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 20  ? 53.348 -0.425  33.920 1.00 41.61  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 20  ? 53.055 -2.074  33.262 1.00 41.49  ? 1   MET A CE  1 
ATOM   9    N N   . SER A 1 21  ? 54.055 3.634   32.596 1.00 41.44  ? 2   SER A N   1 
ATOM   10   C CA  . SER A 1 21  ? 55.027 4.704   32.817 1.00 41.48  ? 2   SER A CA  1 
ATOM   11   C C   . SER A 1 21  ? 56.454 4.269   32.450 1.00 42.29  ? 2   SER A C   1 
ATOM   12   O O   . SER A 1 21  ? 56.841 3.121   32.665 1.00 41.09  ? 2   SER A O   1 
ATOM   13   C CB  . SER A 1 21  ? 54.986 5.161   34.276 1.00 40.54  ? 2   SER A CB  1 
ATOM   14   O OG  . SER A 1 21  ? 55.708 6.362   34.450 1.00 40.65  ? 2   SER A OG  1 
ATOM   15   N N   . ASP A 1 22  ? 57.244 5.188   31.902 1.00 44.49  ? 3   ASP A N   1 
ATOM   16   C CA  . ASP A 1 22  ? 58.645 4.885   31.603 1.00 46.46  ? 3   ASP A CA  1 
ATOM   17   C C   . ASP A 1 22  ? 59.446 4.957   32.903 1.00 46.73  ? 3   ASP A C   1 
ATOM   18   O O   . ASP A 1 22  ? 60.635 4.630   32.962 1.00 46.69  ? 3   ASP A O   1 
ATOM   19   C CB  . ASP A 1 22  ? 59.170 5.842   30.529 1.00 49.42  ? 3   ASP A CB  1 
ATOM   20   C CG  . ASP A 1 22  ? 58.388 5.721   29.227 1.00 52.42  ? 3   ASP A CG  1 
ATOM   21   O OD1 . ASP A 1 22  ? 57.890 4.603   28.934 1.00 53.82  ? 3   ASP A OD1 1 
ATOM   22   O OD2 . ASP A 1 22  ? 58.255 6.734   28.507 1.00 53.82  ? 3   ASP A OD2 1 
ATOM   23   N N   . ASP A 1 23  ? 58.738 5.369   33.947 1.00 47.09  ? 4   ASP A N   1 
ATOM   24   C CA  . ASP A 1 23  ? 59.210 5.396   35.320 1.00 47.89  ? 4   ASP A CA  1 
ATOM   25   C C   . ASP A 1 23  ? 59.289 3.994   35.936 1.00 45.92  ? 4   ASP A C   1 
ATOM   26   O O   . ASP A 1 23  ? 60.126 3.724   36.810 1.00 46.04  ? 4   ASP A O   1 
ATOM   27   C CB  . ASP A 1 23  ? 58.261 6.268   36.143 1.00 50.33  ? 4   ASP A CB  1 
ATOM   28   C CG  . ASP A 1 23  ? 58.919 6.873   37.350 1.00 52.52  ? 4   ASP A CG  1 
ATOM   29   O OD1 . ASP A 1 23  ? 59.764 6.208   37.986 1.00 52.69  ? 4   ASP A OD1 1 
ATOM   30   O OD2 . ASP A 1 23  ? 58.581 8.034   37.663 1.00 54.68  ? 4   ASP A OD2 1 
ATOM   31   N N   . THR A 1 24  ? 58.404 3.102   35.509 1.00 43.22  ? 5   THR A N   1 
ATOM   32   C CA  . THR A 1 24  ? 58.346 1.807   36.173 1.00 41.12  ? 5   THR A CA  1 
ATOM   33   C C   . THR A 1 24  ? 59.348 0.857   35.538 1.00 37.36  ? 5   THR A C   1 
ATOM   34   O O   . THR A 1 24  ? 59.633 0.930   34.335 1.00 35.13  ? 5   THR A O   1 
ATOM   35   C CB  . THR A 1 24  ? 56.930 1.171   36.155 1.00 43.37  ? 5   THR A CB  1 
ATOM   36   O OG1 . THR A 1 24  ? 56.822 0.173   35.135 1.00 45.26  ? 5   THR A OG1 1 
ATOM   37   C CG2 . THR A 1 24  ? 55.856 2.202   36.009 1.00 43.64  ? 5   THR A CG2 1 
ATOM   38   N N   . SER A 1 25  ? 59.895 -0.014  36.378 1.00 34.73  ? 6   SER A N   1 
ATOM   39   C CA  . SER A 1 25  ? 60.910 -0.950  35.956 1.00 33.72  ? 6   SER A CA  1 
ATOM   40   C C   . SER A 1 25  ? 60.547 -2.334  36.470 1.00 28.46  ? 6   SER A C   1 
ATOM   41   O O   . SER A 1 25  ? 59.805 -2.435  37.438 1.00 29.81  ? 6   SER A O   1 
ATOM   42   C CB  . SER A 1 25  ? 62.284 -0.532  36.497 1.00 38.11  ? 6   SER A CB  1 
ATOM   43   O OG  . SER A 1 25  ? 62.446 0.870   36.510 1.00 41.71  ? 6   SER A OG  1 
ATOM   44   N N   . LEU A 1 26  ? 61.065 -3.386  35.844 1.00 23.78  ? 7   LEU A N   1 
ATOM   45   C CA  . LEU A 1 26  ? 61.007 -4.719  36.442 1.00 22.40  ? 7   LEU A CA  1 
ATOM   46   C C   . LEU A 1 26  ? 61.926 -4.751  37.639 1.00 23.28  ? 7   LEU A C   1 
ATOM   47   O O   . LEU A 1 26  ? 63.007 -4.128  37.601 1.00 24.96  ? 7   LEU A O   1 
ATOM   48   C CB  . LEU A 1 26  ? 61.452 -5.808  35.485 1.00 22.59  ? 7   LEU A CB  1 
ATOM   49   C CG  . LEU A 1 26  ? 60.517 -6.421  34.482 1.00 23.00  ? 7   LEU A CG  1 
ATOM   50   C CD1 . LEU A 1 26  ? 61.175 -7.696  33.868 1.00 22.89  ? 7   LEU A CD1 1 
ATOM   51   C CD2 . LEU A 1 26  ? 59.129 -6.650  35.042 1.00 21.03  ? 7   LEU A CD2 1 
ATOM   52   N N   . GLU A 1 27  ? 61.532 -5.489  38.674 1.00 21.77  ? 8   GLU A N   1 
ATOM   53   C CA  . GLU A 1 27  ? 62.334 -5.597  39.897 1.00 22.53  ? 8   GLU A CA  1 
ATOM   54   C C   . GLU A 1 27  ? 63.429 -6.639  39.721 1.00 18.84  ? 8   GLU A C   1 
ATOM   55   O O   . GLU A 1 27  ? 63.126 -7.793  39.396 1.00 18.94  ? 8   GLU A O   1 
ATOM   56   C CB  . GLU A 1 27  ? 61.461 -5.990  41.100 1.00 25.61  ? 8   GLU A CB  1 
ATOM   57   C CG  . GLU A 1 27  ? 60.153 -5.241  41.247 1.00 31.64  ? 8   GLU A CG  1 
ATOM   58   C CD  . GLU A 1 27  ? 60.320 -3.837  41.738 1.00 36.36  ? 8   GLU A CD  1 
ATOM   59   O OE1 . GLU A 1 27  ? 59.401 -3.016  41.501 1.00 37.71  ? 8   GLU A OE1 1 
ATOM   60   O OE2 . GLU A 1 27  ? 61.355 -3.555  42.376 1.00 39.68  ? 8   GLU A OE2 1 
ATOM   61   N N   . LEU A 1 28  ? 64.694 -6.228  39.898 1.00 18.19  ? 9   LEU A N   1 
ATOM   62   C CA  . LEU A 1 28  ? 65.839 -7.129  39.941 1.00 17.96  ? 9   LEU A CA  1 
ATOM   63   C C   . LEU A 1 28  ? 66.705 -6.790  41.158 1.00 17.82  ? 9   LEU A C   1 
ATOM   64   O O   . LEU A 1 28  ? 66.726 -5.633  41.590 1.00 19.51  ? 9   LEU A O   1 
ATOM   65   C CB  . LEU A 1 28  ? 66.684 -7.034  38.675 1.00 16.83  ? 9   LEU A CB  1 
ATOM   66   C CG  . LEU A 1 28  ? 66.144 -7.463  37.312 1.00 17.77  ? 9   LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 28  ? 67.143 -7.063  36.245 1.00 19.12  ? 9   LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 28  ? 65.923 -8.974  37.274 1.00 19.13  ? 9   LEU A CD2 1 
ATOM   69   N N   . PRO A 1 29  ? 67.441 -7.782  41.696 1.00 17.55  ? 10  PRO A N   1 
ATOM   70   C CA  . PRO A 1 29  ? 68.292 -7.563  42.875 1.00 17.59  ? 10  PRO A CA  1 
ATOM   71   C C   . PRO A 1 29  ? 69.679 -6.999  42.552 1.00 16.76  ? 10  PRO A C   1 
ATOM   72   O O   . PRO A 1 29  ? 70.504 -6.875  43.457 1.00 20.32  ? 10  PRO A O   1 
ATOM   73   C CB  . PRO A 1 29  ? 68.430 -8.967  43.484 1.00 18.34  ? 10  PRO A CB  1 
ATOM   74   C CG  . PRO A 1 29  ? 68.412 -9.856  42.271 1.00 18.59  ? 10  PRO A CG  1 
ATOM   75   C CD  . PRO A 1 29  ? 67.360 -9.220  41.344 1.00 17.78  ? 10  PRO A CD  1 
ATOM   76   N N   . PHE A 1 30  ? 69.936 -6.653  41.300 1.00 13.99  ? 11  PHE A N   1 
ATOM   77   C CA  . PHE A 1 30  ? 71.205 -6.070  40.905 1.00 14.60  ? 11  PHE A CA  1 
ATOM   78   C C   . PHE A 1 30  ? 70.841 -5.002  39.895 1.00 14.56  ? 11  PHE A C   1 
ATOM   79   O O   . PHE A 1 30  ? 69.704 -4.998  39.362 1.00 16.32  ? 11  PHE A O   1 
ATOM   80   C CB  . PHE A 1 30  ? 72.146 -7.125  40.300 1.00 15.43  ? 11  PHE A CB  1 
ATOM   81   C CG  . PHE A 1 30  ? 71.497 -7.956  39.212 1.00 15.78  ? 11  PHE A CG  1 
ATOM   82   C CD1 . PHE A 1 30  ? 71.505 -7.559  37.870 1.00 17.70  ? 11  PHE A CD1 1 
ATOM   83   C CD2 . PHE A 1 30  ? 70.881 -9.161  39.544 1.00 16.62  ? 11  PHE A CD2 1 
ATOM   84   C CE1 . PHE A 1 30  ? 70.881 -8.373  36.889 1.00 17.99  ? 11  PHE A CE1 1 
ATOM   85   C CE2 . PHE A 1 30  ? 70.263 -9.972  38.577 1.00 18.12  ? 11  PHE A CE2 1 
ATOM   86   C CZ  . PHE A 1 30  ? 70.274 -9.587  37.255 1.00 16.94  ? 11  PHE A CZ  1 
ATOM   87   N N   . THR A 1 31  ? 71.793 -4.112  39.640 1.00 14.39  ? 12  THR A N   1 
ATOM   88   C CA  A THR A 1 31  ? 71.532 -3.037  38.681 0.50 15.42  ? 12  THR A CA  1 
ATOM   89   C CA  B THR A 1 31  ? 71.654 -2.973  38.731 0.50 17.27  ? 12  THR A CA  1 
ATOM   90   C C   . THR A 1 31  ? 72.314 -3.230  37.373 1.00 16.64  ? 12  THR A C   1 
ATOM   91   O O   . THR A 1 31  ? 73.139 -4.158  37.243 1.00 18.61  ? 12  THR A O   1 
ATOM   92   C CB  A THR A 1 31  ? 71.878 -1.675  39.302 0.50 16.32  ? 12  THR A CB  1 
ATOM   93   C CB  B THR A 1 31  ? 72.264 -1.726  39.433 0.50 20.99  ? 12  THR A CB  1 
ATOM   94   O OG1 A THR A 1 31  ? 71.135 -0.622  38.668 0.50 18.73  ? 12  THR A OG1 1 
ATOM   95   O OG1 B THR A 1 31  ? 71.376 -1.349  40.479 0.50 22.02  ? 12  THR A OG1 1 
ATOM   96   C CG2 A THR A 1 31  ? 73.363 -1.445  39.219 0.50 13.97  ? 12  THR A CG2 1 
ATOM   97   C CG2 B THR A 1 31  ? 72.449 -0.556  38.527 0.50 22.56  ? 12  THR A CG2 1 
ATOM   98   N N   . HIS A 1 32  ? 71.982 -2.414  36.370 1.00 15.36  ? 13  HIS A N   1 
ATOM   99   C CA  . HIS A 1 32  ? 72.721 -2.421  35.114 1.00 16.60  ? 13  HIS A CA  1 
ATOM   100  C C   . HIS A 1 32  ? 74.138 -1.845  35.276 1.00 18.10  ? 13  HIS A C   1 
ATOM   101  O O   . HIS A 1 32  ? 74.449 -1.134  36.253 1.00 19.44  ? 13  HIS A O   1 
ATOM   102  C CB  . HIS A 1 32  ? 71.973 -1.593  34.039 1.00 18.36  ? 13  HIS A CB  1 
ATOM   103  C CG  . HIS A 1 32  ? 71.957 -0.130  34.330 1.00 22.48  ? 13  HIS A CG  1 
ATOM   104  N ND1 . HIS A 1 32  ? 71.021 0.452   35.156 1.00 23.85  ? 13  HIS A ND1 1 
ATOM   105  C CD2 . HIS A 1 32  ? 72.778 0.871   33.925 1.00 22.61  ? 13  HIS A CD2 1 
ATOM   106  C CE1 . HIS A 1 32  ? 71.255 1.754   35.232 1.00 24.20  ? 13  HIS A CE1 1 
ATOM   107  N NE2 . HIS A 1 32  ? 72.320 2.030   34.498 1.00 24.39  ? 13  HIS A NE2 1 
ATOM   108  N N   . ARG A 1 33  ? 74.975 -2.110  34.278 1.00 18.52  ? 14  ARG A N   1 
ATOM   109  C CA  . ARG A 1 33  ? 76.279 -1.484  34.161 1.00 17.48  ? 14  ARG A CA  1 
ATOM   110  C C   . ARG A 1 33  ? 76.407 -0.860  32.780 1.00 17.50  ? 14  ARG A C   1 
ATOM   111  O O   . ARG A 1 33  ? 75.639 -1.202  31.846 1.00 17.83  ? 14  ARG A O   1 
ATOM   112  C CB  . ARG A 1 33  ? 77.375 -2.495  34.382 1.00 17.51  ? 14  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 33  ? 77.268 -3.144  35.736 1.00 18.77  ? 14  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 33  ? 78.376 -4.116  35.983 1.00 19.84  ? 14  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 33  ? 78.194 -4.749  37.293 1.00 21.34  ? 14  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 33  ? 79.133 -5.461  37.900 1.00 23.12  ? 14  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 33  ? 80.327 -5.603  37.320 1.00 25.77  ? 14  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 33  ? 78.901 -5.995  39.087 1.00 23.16  ? 14  ARG A NH2 1 
ATOM   119  N N   . ARG A 1 34  ? 77.376 0.046   32.644 1.00 19.70  ? 15  ARG A N   1 
ATOM   120  C CA  . ARG A 1 34  ? 77.574 0.773   31.409 1.00 20.16  ? 15  ARG A CA  1 
ATOM   121  C C   . ARG A 1 34  ? 79.029 0.658   30.945 1.00 20.10  ? 15  ARG A C   1 
ATOM   122  O O   . ARG A 1 34  ? 79.971 0.777   31.738 1.00 20.60  ? 15  ARG A O   1 
ATOM   123  C CB  . ARG A 1 34  ? 77.158 2.243   31.595 1.00 23.31  ? 15  ARG A CB  1 
ATOM   124  C CG  . ARG A 1 34  ? 77.476 3.125   30.433 1.00 24.93  ? 15  ARG A CG  1 
ATOM   125  C CD  . ARG A 1 34  ? 77.183 4.587   30.799 1.00 25.87  ? 15  ARG A CD  1 
ATOM   126  N NE  . ARG A 1 34  ? 75.768 4.777   31.125 1.00 27.07  ? 15  ARG A NE  1 
ATOM   127  C CZ  . ARG A 1 34  ? 74.808 4.889   30.217 1.00 27.77  ? 15  ARG A CZ  1 
ATOM   128  N NH1 . ARG A 1 34  ? 75.126 4.847   28.935 1.00 29.37  ? 15  ARG A NH1 1 
ATOM   129  N NH2 . ARG A 1 34  ? 73.546 5.075   30.582 1.00 28.79  ? 15  ARG A NH2 1 
ATOM   130  N N   . ASN A 1 35  ? 79.215 0.342   29.663 1.00 18.80  ? 16  ASN A N   1 
ATOM   131  C CA  . ASN A 1 35  ? 80.552 0.223   29.127 1.00 18.78  ? 16  ASN A CA  1 
ATOM   132  C C   . ASN A 1 35  ? 81.324 1.549   29.128 1.00 19.16  ? 16  ASN A C   1 
ATOM   133  O O   . ASN A 1 35  ? 80.855 2.551   28.591 1.00 21.23  ? 16  ASN A O   1 
ATOM   134  C CB  . ASN A 1 35  ? 80.469 -0.329  27.694 1.00 18.21  ? 16  ASN A CB  1 
ATOM   135  C CG  . ASN A 1 35  ? 81.744 -0.983  27.257 1.00 18.24  ? 16  ASN A CG  1 
ATOM   136  O OD1 . ASN A 1 35  ? 82.805 -0.367  27.326 1.00 19.26  ? 16  ASN A OD1 1 
ATOM   137  N ND2 . ASN A 1 35  ? 81.661 -2.234  26.802 1.00 17.90  ? 16  ASN A ND2 1 
ATOM   138  N N   . PRO A 1 36  ? 82.530 1.552   29.712 1.00 20.67  ? 17  PRO A N   1 
ATOM   139  C CA  . PRO A 1 36  ? 83.356 2.761   29.673 1.00 21.36  ? 17  PRO A CA  1 
ATOM   140  C C   . PRO A 1 36  ? 83.892 3.130   28.285 1.00 21.18  ? 17  PRO A C   1 
ATOM   141  O O   . PRO A 1 36  ? 84.480 4.200   28.162 1.00 23.19  ? 17  PRO A O   1 
ATOM   142  C CB  . PRO A 1 36  ? 84.521 2.423   30.612 1.00 22.53  ? 17  PRO A CB  1 
ATOM   143  C CG  . PRO A 1 36  ? 84.575 0.933   30.654 1.00 24.36  ? 17  PRO A CG  1 
ATOM   144  C CD  . PRO A 1 36  ? 83.147 0.467   30.504 1.00 22.84  ? 17  PRO A CD  1 
ATOM   145  N N   . HIS A 1 37  ? 83.688 2.293   27.278 1.00 20.41  ? 18  HIS A N   1 
ATOM   146  C CA  . HIS A 1 37  ? 84.200 2.574   25.941 1.00 19.91  ? 18  HIS A CA  1 
ATOM   147  C C   . HIS A 1 37  ? 83.114 3.117   25.027 1.00 20.14  ? 18  HIS A C   1 
ATOM   148  O O   . HIS A 1 37  ? 83.300 3.153   23.798 1.00 19.80  ? 18  HIS A O   1 
ATOM   149  C CB  . HIS A 1 37  ? 84.798 1.296   25.291 1.00 21.37  ? 18  HIS A CB  1 
ATOM   150  C CG  . HIS A 1 37  ? 85.912 0.669   26.077 1.00 22.32  ? 18  HIS A CG  1 
ATOM   151  N ND1 . HIS A 1 37  ? 87.157 1.255   26.223 1.00 24.75  ? 18  HIS A ND1 1 
ATOM   152  C CD2 . HIS A 1 37  ? 85.971 -0.513  26.747 1.00 23.76  ? 18  HIS A CD2 1 
ATOM   153  C CE1 . HIS A 1 37  ? 87.920 0.474   26.972 1.00 24.58  ? 18  HIS A CE1 1 
ATOM   154  N NE2 . HIS A 1 37  ? 87.228 -0.606  27.297 1.00 24.47  ? 18  HIS A NE2 1 
ATOM   155  N N   . GLN A 1 38  ? 81.989 3.529   25.608 1.00 19.87  ? 19  GLN A N   1 
ATOM   156  C CA  . GLN A 1 38  ? 80.826 3.933   24.819 1.00 19.82  ? 19  GLN A CA  1 
ATOM   157  C C   . GLN A 1 38  ? 81.120 5.053   23.791 1.00 19.52  ? 19  GLN A C   1 
ATOM   158  O O   . GLN A 1 38  ? 80.667 4.974   22.643 1.00 21.65  ? 19  GLN A O   1 
ATOM   159  C CB  . GLN A 1 38  ? 79.708 4.373   25.764 1.00 21.89  ? 19  GLN A CB  1 
ATOM   160  C CG  . GLN A 1 38  ? 78.487 4.855   25.031 1.00 23.53  ? 19  GLN A CG  1 
ATOM   161  C CD  . GLN A 1 38  ? 77.289 5.020   25.936 1.00 26.69  ? 19  GLN A CD  1 
ATOM   162  O OE1 . GLN A 1 38  ? 77.295 4.590   27.096 1.00 29.20  ? 19  GLN A OE1 1 
ATOM   163  N NE2 . GLN A 1 38  ? 76.240 5.615   25.404 1.00 27.35  ? 19  GLN A NE2 1 
ATOM   164  N N   . THR A 1 39  ? 81.868 6.077   24.182 1.00 20.57  ? 20  THR A N   1 
ATOM   165  C CA  . THR A 1 39  ? 82.171 7.155   23.227 1.00 21.69  ? 20  THR A CA  1 
ATOM   166  C C   . THR A 1 39  ? 83.014 6.696   22.046 1.00 23.14  ? 20  THR A C   1 
ATOM   167  O O   . THR A 1 39  ? 82.690 6.990   20.886 1.00 24.20  ? 20  THR A O   1 
ATOM   168  C CB  . THR A 1 39  ? 82.901 8.323   23.926 1.00 25.53  ? 20  THR A CB  1 
ATOM   169  O OG1 . THR A 1 39  ? 82.029 8.855   24.924 1.00 30.25  ? 20  THR A OG1 1 
ATOM   170  C CG2 . THR A 1 39  ? 83.276 9.444   22.897 1.00 27.44  ? 20  THR A CG2 1 
ATOM   171  N N   . GLU A 1 40  ? 84.089 5.979   22.333 1.00 23.31  ? 21  GLU A N   1 
ATOM   172  C CA  . GLU A 1 40  ? 84.960 5.460   21.282 1.00 22.60  ? 21  GLU A CA  1 
ATOM   173  C C   . GLU A 1 40  ? 84.168 4.513   20.360 1.00 21.49  ? 21  GLU A C   1 
ATOM   174  O O   . GLU A 1 40  ? 84.323 4.555   19.136 1.00 21.86  ? 21  GLU A O   1 
ATOM   175  C CB  . GLU A 1 40  ? 86.187 4.765   21.898 1.00 24.51  ? 21  GLU A CB  1 
ATOM   176  C CG  . GLU A 1 40  ? 87.110 4.099   20.891 1.00 28.48  ? 21  GLU A CG  1 
ATOM   177  C CD  . GLU A 1 40  ? 88.356 3.498   21.531 1.00 32.23  ? 21  GLU A CD  1 
ATOM   178  O OE1 . GLU A 1 40  ? 89.198 2.975   20.768 1.00 35.58  ? 21  GLU A OE1 1 
ATOM   179  O OE2 . GLU A 1 40  ? 88.487 3.529   22.786 1.00 32.64  ? 21  GLU A OE2 1 
ATOM   180  N N   . ALA A 1 41  ? 83.314 3.669   20.935 1.00 21.66  ? 22  ALA A N   1 
ATOM   181  C CA  . ALA A 1 41  ? 82.578 2.712   20.076 1.00 20.71  ? 22  ALA A CA  1 
ATOM   182  C C   . ALA A 1 41  ? 81.553 3.436   19.212 1.00 21.98  ? 22  ALA A C   1 
ATOM   183  O O   . ALA A 1 41  ? 81.348 3.066   18.047 1.00 22.01  ? 22  ALA A O   1 
ATOM   184  C CB  . ALA A 1 41  ? 81.894 1.639   20.898 1.00 19.04  ? 22  ALA A CB  1 
ATOM   185  N N   . ALA A 1 42  ? 80.943 4.494   19.768 1.00 20.49  ? 23  ALA A N   1 
ATOM   186  C CA  . ALA A 1 42  ? 79.990 5.317   19.002 1.00 22.15  ? 23  ALA A CA  1 
ATOM   187  C C   . ALA A 1 42  ? 80.661 5.953   17.783 1.00 21.50  ? 23  ALA A C   1 
ATOM   188  O O   . ALA A 1 42  ? 80.076 6.002   16.691 1.00 22.01  ? 23  ALA A O   1 
ATOM   189  C CB  . ALA A 1 42  ? 79.365 6.397   19.900 1.00 23.49  ? 23  ALA A CB  1 
ATOM   190  N N   . ASP A 1 43  ? 81.913 6.365   17.941 1.00 21.61  ? 24  ASP A N   1 
ATOM   191  C CA  . ASP A 1 43  ? 82.670 6.932   16.811 1.00 23.01  ? 24  ASP A CA  1 
ATOM   192  C C   . ASP A 1 43  ? 82.913 5.877   15.732 1.00 20.06  ? 24  ASP A C   1 
ATOM   193  O O   . ASP A 1 43  ? 82.767 6.158   14.531 1.00 20.91  ? 24  ASP A O   1 
ATOM   194  C CB  . ASP A 1 43  ? 84.002 7.504   17.283 1.00 24.40  ? 24  ASP A CB  1 
ATOM   195  C CG  . ASP A 1 43  ? 83.839 8.818   18.075 1.00 28.04  ? 24  ASP A CG  1 
ATOM   196  O OD1 . ASP A 1 43  ? 82.772 9.463   17.993 1.00 29.13  ? 24  ASP A OD1 1 
ATOM   197  O OD2 . ASP A 1 43  ? 84.783 9.194   18.796 1.00 31.29  ? 24  ASP A OD2 1 
ATOM   198  N N   . ARG A 1 44  ? 83.252 4.657   16.164 1.00 20.36  ? 25  ARG A N   1 
ATOM   199  C CA  . ARG A 1 44  ? 83.455 3.531   15.252 1.00 19.76  ? 25  ARG A CA  1 
ATOM   200  C C   . ARG A 1 44  ? 82.151 3.126   14.560 1.00 19.39  ? 25  ARG A C   1 
ATOM   201  O O   . ARG A 1 44  ? 82.136 2.738   13.394 1.00 19.20  ? 25  ARG A O   1 
ATOM   202  C CB  . ARG A 1 44  ? 84.037 2.329   16.008 1.00 23.67  ? 25  ARG A CB  1 
ATOM   203  C CG  . ARG A 1 44  ? 85.394 2.599   16.617 1.00 29.62  ? 25  ARG A CG  1 
ATOM   204  C CD  . ARG A 1 44  ? 86.514 2.191   15.691 1.00 37.36  ? 25  ARG A CD  1 
ATOM   205  N NE  . ARG A 1 44  ? 86.403 0.777   15.329 1.00 43.03  ? 25  ARG A NE  1 
ATOM   206  C CZ  . ARG A 1 44  ? 87.002 -0.237  15.960 1.00 45.88  ? 25  ARG A CZ  1 
ATOM   207  N NH1 . ARG A 1 44  ? 87.792 -0.024  17.007 1.00 46.32  ? 25  ARG A NH1 1 
ATOM   208  N NH2 . ARG A 1 44  ? 86.816 -1.476  15.524 1.00 46.11  ? 25  ARG A NH2 1 
ATOM   209  N N   . HIS A 1 45  ? 81.060 3.192   15.290 1.00 18.24  ? 26  HIS A N   1 
ATOM   210  C CA  . HIS A 1 45  ? 79.761 2.839   14.743 1.00 17.37  ? 26  HIS A CA  1 
ATOM   211  C C   . HIS A 1 45  ? 79.345 3.840   13.659 1.00 18.55  ? 26  HIS A C   1 
ATOM   212  O O   . HIS A 1 45  ? 78.792 3.448   12.620 1.00 19.01  ? 26  HIS A O   1 
ATOM   213  C CB  . HIS A 1 45  ? 78.710 2.769   15.861 1.00 16.45  ? 26  HIS A CB  1 
ATOM   214  C CG  . HIS A 1 45  ? 77.332 2.426   15.357 1.00 16.33  ? 26  HIS A CG  1 
ATOM   215  N ND1 . HIS A 1 45  ? 77.075 1.272   14.652 1.00 16.19  ? 26  HIS A ND1 1 
ATOM   216  C CD2 . HIS A 1 45  ? 76.145 3.075   15.478 1.00 17.82  ? 26  HIS A CD2 1 
ATOM   217  C CE1 . HIS A 1 45  ? 75.785 1.226   14.342 1.00 16.50  ? 26  HIS A CE1 1 
ATOM   218  N NE2 . HIS A 1 45  ? 75.202 2.309   14.825 1.00 17.17  ? 26  HIS A NE2 1 
ATOM   219  N N   . LEU A 1 46  ? 79.595 5.128   13.885 1.00 19.39  ? 27  LEU A N   1 
ATOM   220  C CA  . LEU A 1 46  ? 79.325 6.113   12.865 1.00 21.07  ? 27  LEU A CA  1 
ATOM   221  C C   . LEU A 1 46  ? 80.127 5.811   11.603 1.00 21.81  ? 27  LEU A C   1 
ATOM   222  O O   . LEU A 1 46  ? 79.607 5.957   10.489 1.00 22.28  ? 27  LEU A O   1 
ATOM   223  C CB  . LEU A 1 46  ? 79.655 7.523   13.385 1.00 24.71  ? 27  LEU A CB  1 
ATOM   224  C CG  . LEU A 1 46  ? 78.648 8.592   12.952 1.00 31.37  ? 27  LEU A CG  1 
ATOM   225  C CD1 . LEU A 1 46  ? 79.262 9.999   13.132 1.00 30.97  ? 27  LEU A CD1 1 
ATOM   226  C CD2 . LEU A 1 46  ? 78.090 8.393   11.540 1.00 32.03  ? 27  LEU A CD2 1 
ATOM   227  N N   . GLU A 1 47  ? 81.376 5.377   11.750 1.00 21.52  ? 28  GLU A N   1 
ATOM   228  C CA  . GLU A 1 47  ? 82.165 5.027   10.558 1.00 22.52  ? 28  GLU A CA  1 
ATOM   229  C C   . GLU A 1 47  ? 81.568 3.824   9.801  1.00 22.58  ? 28  GLU A C   1 
ATOM   230  O O   . GLU A 1 47  ? 81.548 3.799   8.556  1.00 24.81  ? 28  GLU A O   1 
ATOM   231  C CB  . GLU A 1 47  ? 83.616 4.724   10.941 1.00 25.25  ? 28  GLU A CB  1 
ATOM   232  C CG  . GLU A 1 47  ? 84.424 5.957   11.396 1.00 26.42  ? 28  GLU A CG  1 
ATOM   233  C CD  . GLU A 1 47  ? 85.727 5.574   12.081 1.00 29.41  ? 28  GLU A CD  1 
ATOM   234  O OE1 . GLU A 1 47  ? 85.989 4.366   12.292 1.00 31.52  ? 28  GLU A OE1 1 
ATOM   235  O OE2 . GLU A 1 47  ? 86.493 6.496   12.421 1.00 32.70  ? 28  GLU A OE2 1 
ATOM   236  N N   . TRP A 1 48  ? 81.111 2.811   10.542 1.00 19.68  ? 29  TRP A N   1 
ATOM   237  C CA  . TRP A 1 48  ? 80.436 1.677   9.917  1.00 18.33  ? 29  TRP A CA  1 
ATOM   238  C C   . TRP A 1 48  ? 79.184 2.116   9.159  1.00 20.10  ? 29  TRP A C   1 
ATOM   239  O O   . TRP A 1 48  ? 78.932 1.649   8.041  1.00 21.24  ? 29  TRP A O   1 
ATOM   240  C CB  . TRP A 1 48  ? 80.088 0.616   10.997 1.00 19.03  ? 29  TRP A CB  1 
ATOM   241  C CG  . TRP A 1 48  ? 79.482 -0.667  10.453 1.00 20.40  ? 29  TRP A CG  1 
ATOM   242  C CD1 . TRP A 1 48  ? 80.161 -1.759  9.960  1.00 21.55  ? 29  TRP A CD1 1 
ATOM   243  C CD2 . TRP A 1 48  ? 78.090 -0.987  10.354 1.00 19.83  ? 29  TRP A CD2 1 
ATOM   244  N NE1 . TRP A 1 48  ? 79.268 -2.742  9.583  1.00 21.79  ? 29  TRP A NE1 1 
ATOM   245  C CE2 . TRP A 1 48  ? 77.994 -2.305  9.823  1.00 20.29  ? 29  TRP A CE2 1 
ATOM   246  C CE3 . TRP A 1 48  ? 76.919 -0.313  10.680 1.00 21.59  ? 29  TRP A CE3 1 
ATOM   247  C CZ2 . TRP A 1 48  ? 76.769 -2.925  9.579  1.00 21.22  ? 29  TRP A CZ2 1 
ATOM   248  C CZ3 . TRP A 1 48  ? 75.691 -0.953  10.465 1.00 21.79  ? 29  TRP A CZ3 1 
ATOM   249  C CH2 . TRP A 1 48  ? 75.631 -2.244  9.919  1.00 22.11  ? 29  TRP A CH2 1 
ATOM   250  N N   . LEU A 1 49  ? 78.405 3.034   9.730  1.00 21.07  ? 30  LEU A N   1 
ATOM   251  C CA  . LEU A 1 49  ? 77.187 3.507   9.083  1.00 21.68  ? 30  LEU A CA  1 
ATOM   252  C C   . LEU A 1 49  ? 77.515 4.203   7.764  1.00 23.31  ? 30  LEU A C   1 
ATOM   253  O O   . LEU A 1 49  ? 76.750 4.112   6.815  1.00 24.06  ? 30  LEU A O   1 
ATOM   254  C CB  . LEU A 1 49  ? 76.407 4.463   10.013 1.00 21.13  ? 30  LEU A CB  1 
ATOM   255  C CG  . LEU A 1 49  ? 75.675 3.818   11.204 1.00 22.05  ? 30  LEU A CG  1 
ATOM   256  C CD1 . LEU A 1 49  ? 75.188 4.875   12.170 1.00 21.82  ? 30  LEU A CD1 1 
ATOM   257  C CD2 . LEU A 1 49  ? 74.493 2.986   10.751 1.00 22.53  ? 30  LEU A CD2 1 
ATOM   258  N N   . GLN A 1 50  ? 78.661 4.871   7.729  1.00 22.77  ? 31  GLN A N   1 
ATOM   259  C CA  . GLN A 1 50  ? 79.151 5.514   6.512  1.00 26.63  ? 31  GLN A CA  1 
ATOM   260  C C   . GLN A 1 50  ? 79.574 4.471   5.473  1.00 27.08  ? 31  GLN A C   1 
ATOM   261  O O   . GLN A 1 50  ? 79.333 4.639   4.268  1.00 29.86  ? 31  GLN A O   1 
ATOM   262  C CB  . GLN A 1 50  ? 80.296 6.469   6.865  1.00 31.01  ? 31  GLN A CB  1 
ATOM   263  C CG  . GLN A 1 50  ? 79.757 7.685   7.619  1.00 35.40  ? 31  GLN A CG  1 
ATOM   264  C CD  . GLN A 1 50  ? 80.790 8.490   8.400  1.00 39.61  ? 31  GLN A CD  1 
ATOM   265  O OE1 . GLN A 1 50  ? 81.972 8.121   8.512  1.00 41.63  ? 31  GLN A OE1 1 
ATOM   266  N NE2 . GLN A 1 50  ? 80.334 9.613   8.955  1.00 41.05  ? 31  GLN A NE2 1 
ATOM   267  N N   . ARG A 1 51  ? 80.197 3.391   5.921  1.00 25.24  ? 32  ARG A N   1 
ATOM   268  C CA  A ARG A 1 51  ? 80.572 2.349   4.977  0.50 24.45  ? 32  ARG A CA  1 
ATOM   269  C CA  B ARG A 1 51  ? 80.574 2.289   5.034  0.50 23.43  ? 32  ARG A CA  1 
ATOM   270  C C   . ARG A 1 51  ? 79.360 1.563   4.475  1.00 23.48  ? 32  ARG A C   1 
ATOM   271  O O   . ARG A 1 51  ? 79.455 0.881   3.443  1.00 24.43  ? 32  ARG A O   1 
ATOM   272  C CB  A ARG A 1 51  ? 81.612 1.412   5.592  0.50 26.58  ? 32  ARG A CB  1 
ATOM   273  C CB  B ARG A 1 51  ? 81.461 1.266   5.752  0.50 23.69  ? 32  ARG A CB  1 
ATOM   274  C CG  A ARG A 1 51  ? 83.011 2.015   5.550  0.50 28.29  ? 32  ARG A CG  1 
ATOM   275  C CG  B ARG A 1 51  ? 82.811 1.790   6.201  0.50 23.35  ? 32  ARG A CG  1 
ATOM   276  C CD  A ARG A 1 51  ? 84.060 1.132   6.194  0.50 29.90  ? 32  ARG A CD  1 
ATOM   277  C CD  B ARG A 1 51  ? 83.784 0.652   6.484  0.50 22.03  ? 32  ARG A CD  1 
ATOM   278  N NE  A ARG A 1 51  ? 83.806 0.921   7.613  0.50 32.27  ? 32  ARG A NE  1 
ATOM   279  N NE  B ARG A 1 51  ? 83.466 -0.078  7.712  0.50 20.22  ? 32  ARG A NE  1 
ATOM   280  C CZ  A ARG A 1 51  ? 83.884 -0.261  8.209  0.50 32.28  ? 32  ARG A CZ  1 
ATOM   281  C CZ  B ARG A 1 51  ? 83.769 0.359   8.932  0.50 19.76  ? 32  ARG A CZ  1 
ATOM   282  N NH1 A ARG A 1 51  ? 84.209 -1.337  7.500  0.50 32.79  ? 32  ARG A NH1 1 
ATOM   283  N NH1 B ARG A 1 51  ? 84.401 1.519   9.082  0.50 20.31  ? 32  ARG A NH1 1 
ATOM   284  N NH2 A ARG A 1 51  ? 83.634 -0.367  9.509  0.50 32.67  ? 32  ARG A NH2 1 
ATOM   285  N NH2 B ARG A 1 51  ? 83.451 -0.365  10.000 0.50 20.35  ? 32  ARG A NH2 1 
ATOM   286  N N   . HIS A 1 52  ? 78.235 1.674   5.176  1.00 21.09  ? 33  HIS A N   1 
ATOM   287  C CA  . HIS A 1 52  ? 77.011 0.982   4.776  1.00 19.79  ? 33  HIS A CA  1 
ATOM   288  C C   . HIS A 1 52  ? 75.859 1.967   4.585  1.00 21.77  ? 33  HIS A C   1 
ATOM   289  O O   . HIS A 1 52  ? 74.720 1.730   4.987  1.00 22.44  ? 33  HIS A O   1 
ATOM   290  C CB  . HIS A 1 52  ? 76.690 -0.128  5.798  1.00 18.86  ? 33  HIS A CB  1 
ATOM   291  C CG  . HIS A 1 52  ? 77.782 -1.148  5.861  1.00 18.29  ? 33  HIS A CG  1 
ATOM   292  N ND1 . HIS A 1 52  ? 77.852 -2.214  4.981  1.00 17.30  ? 33  HIS A ND1 1 
ATOM   293  C CD2 . HIS A 1 52  ? 78.902 -1.208  6.622  1.00 19.47  ? 33  HIS A CD2 1 
ATOM   294  C CE1 . HIS A 1 52  ? 78.958 -2.900  5.220  1.00 19.13  ? 33  HIS A CE1 1 
ATOM   295  N NE2 . HIS A 1 52  ? 79.608 -2.318  6.217  1.00 19.59  ? 33  HIS A NE2 1 
ATOM   296  N N   . ARG A 1 53  ? 76.198 3.077   3.933  1.00 23.92  ? 34  ARG A N   1 
ATOM   297  C CA  . ARG A 1 53  ? 75.303 4.200   3.738  1.00 25.98  ? 34  ARG A CA  1 
ATOM   298  C C   . ARG A 1 53  ? 73.997 3.804   3.084  1.00 22.07  ? 34  ARG A C   1 
ATOM   299  O O   . ARG A 1 53  ? 72.937 4.268   3.504  1.00 22.79  ? 34  ARG A O   1 
ATOM   300  C CB  . ARG A 1 53  ? 76.024 5.257   2.893  1.00 32.46  ? 34  ARG A CB  1 
ATOM   301  C CG  . ARG A 1 53  ? 75.291 6.532   2.731  1.00 38.68  ? 34  ARG A CG  1 
ATOM   302  C CD  . ARG A 1 53  ? 76.194 7.590   2.087  1.00 44.66  ? 34  ARG A CD  1 
ATOM   303  N NE  . ARG A 1 53  ? 77.529 7.628   2.699  1.00 49.20  ? 34  ARG A NE  1 
ATOM   304  C CZ  . ARG A 1 53  ? 77.825 8.283   3.822  1.00 52.04  ? 34  ARG A CZ  1 
ATOM   305  N NH1 . ARG A 1 53  ? 79.067 8.260   4.296  1.00 52.78  ? 34  ARG A NH1 1 
ATOM   306  N NH2 . ARG A 1 53  ? 76.882 8.953   4.478  1.00 53.20  ? 34  ARG A NH2 1 
ATOM   307  N N   . GLU A 1 54  ? 74.057 2.910   2.073  1.00 21.91  ? 35  GLU A N   1 
ATOM   308  C CA  . GLU A 1 54  ? 72.834 2.507   1.410  1.00 22.36  ? 35  GLU A CA  1 
ATOM   309  C C   . GLU A 1 54  ? 71.851 1.775   2.330  1.00 24.83  ? 35  GLU A C   1 
ATOM   310  O O   . GLU A 1 54  ? 70.637 1.925   2.186  1.00 26.82  ? 35  GLU A O   1 
ATOM   311  C CB  . GLU A 1 54  ? 73.166 1.640   0.201  1.00 22.52  ? 35  GLU A CB  1 
ATOM   312  C CG  . GLU A 1 54  ? 72.459 2.030   -1.040 1.00 22.00  ? 35  GLU A CG  1 
ATOM   313  C CD  . GLU A 1 54  ? 72.758 1.115   -2.195 1.00 21.27  ? 35  GLU A CD  1 
ATOM   314  O OE1 . GLU A 1 54  ? 71.781 0.679   -2.848 1.00 20.47  ? 35  GLU A OE1 1 
ATOM   315  O OE2 . GLU A 1 54  ? 73.961 0.838   -2.449 1.00 21.78  ? 35  GLU A OE2 1 
ATOM   316  N N   . LEU A 1 55  ? 72.382 0.961   3.239  1.00 24.17  ? 36  LEU A N   1 
ATOM   317  C CA  . LEU A 1 55  ? 71.584 0.254   4.247  1.00 25.19  ? 36  LEU A CA  1 
ATOM   318  C C   . LEU A 1 55  ? 70.972 1.236   5.262  1.00 24.45  ? 36  LEU A C   1 
ATOM   319  O O   . LEU A 1 55  ? 69.795 1.155   5.619  1.00 25.55  ? 36  LEU A O   1 
ATOM   320  C CB  . LEU A 1 55  ? 72.473 -0.774  4.994  1.00 26.04  ? 36  LEU A CB  1 
ATOM   321  C CG  . LEU A 1 55  ? 71.859 -1.802  5.953  1.00 28.19  ? 36  LEU A CG  1 
ATOM   322  C CD1 . LEU A 1 55  ? 71.343 -3.005  5.198  1.00 30.52  ? 36  LEU A CD1 1 
ATOM   323  C CD2 . LEU A 1 55  ? 72.890 -2.239  6.992  1.00 28.92  ? 36  LEU A CD2 1 
ATOM   324  N N   . ALA A 1 56  ? 71.803 2.149   5.744  1.00 22.92  ? 37  ALA A N   1 
ATOM   325  C CA  . ALA A 1 56  ? 71.373 3.112   6.767  1.00 24.11  ? 37  ALA A CA  1 
ATOM   326  C C   . ALA A 1 56  ? 70.348 4.129   6.265  1.00 23.77  ? 37  ALA A C   1 
ATOM   327  O O   . ALA A 1 56  ? 69.516 4.625   7.036  1.00 23.90  ? 37  ALA A O   1 
ATOM   328  C CB  . ALA A 1 56  ? 72.587 3.839   7.320  1.00 23.30  ? 37  ALA A CB  1 
ATOM   329  N N   . ALA A 1 57  ? 70.401 4.435   4.965  1.00 25.14  ? 38  ALA A N   1 
ATOM   330  C CA  . ALA A 1 57  ? 69.546 5.470   4.356  1.00 27.06  ? 38  ALA A CA  1 
ATOM   331  C C   . ALA A 1 57  ? 68.064 5.076   4.248  1.00 28.88  ? 38  ALA A C   1 
ATOM   332  O O   . ALA A 1 57  ? 67.241 5.878   3.783  1.00 31.77  ? 38  ALA A O   1 
ATOM   333  C CB  . ALA A 1 57  ? 70.088 5.846   2.961  1.00 27.00  ? 38  ALA A CB  1 
ATOM   334  N N   . VAL A 1 58  ? 67.710 3.857   4.652  1.00 29.85  ? 39  VAL A N   1 
ATOM   335  C CA  . VAL A 1 58  ? 66.313 3.437   4.609  1.00 29.48  ? 39  VAL A CA  1 
ATOM   336  C C   . VAL A 1 58  ? 65.439 4.147   5.655  1.00 29.13  ? 39  VAL A C   1 
ATOM   337  O O   . VAL A 1 58  ? 64.203 4.081   5.592  1.00 30.62  ? 39  VAL A O   1 
ATOM   338  C CB  . VAL A 1 58  ? 66.187 1.881   4.775  1.00 30.57  ? 39  VAL A CB  1 
ATOM   339  C CG1 . VAL A 1 58  ? 66.592 1.439   6.184  1.00 29.77  ? 39  VAL A CG1 1 
ATOM   340  C CG2 . VAL A 1 58  ? 64.780 1.397   4.422  1.00 33.44  ? 39  VAL A CG2 1 
ATOM   341  N N   . VAL A 1 59  ? 66.078 4.829   6.610  1.00 26.62  ? 40  VAL A N   1 
ATOM   342  C CA  . VAL A 1 59  ? 65.368 5.652   7.596  1.00 25.91  ? 40  VAL A CA  1 
ATOM   343  C C   . VAL A 1 59  ? 66.107 6.978   7.749  1.00 24.85  ? 40  VAL A C   1 
ATOM   344  O O   . VAL A 1 59  ? 67.264 7.116   7.353  1.00 25.55  ? 40  VAL A O   1 
ATOM   345  C CB  . VAL A 1 59  ? 65.240 4.983   8.990  1.00 26.05  ? 40  VAL A CB  1 
ATOM   346  C CG1 . VAL A 1 59  ? 64.478 3.641   8.907  1.00 26.08  ? 40  VAL A CG1 1 
ATOM   347  C CG2 . VAL A 1 59  ? 66.615 4.800   9.650  1.00 26.46  ? 40  VAL A CG2 1 
ATOM   348  N N   . SER A 1 60  ? 65.428 7.956   8.328  1.00 24.80  ? 41  SER A N   1 
ATOM   349  C CA  . SER A 1 60  ? 66.038 9.259   8.499  1.00 24.65  ? 41  SER A CA  1 
ATOM   350  C C   . SER A 1 60  ? 67.111 9.219   9.570  1.00 24.20  ? 41  SER A C   1 
ATOM   351  O O   . SER A 1 60  ? 67.135 8.300   10.391 1.00 23.32  ? 41  SER A O   1 
ATOM   352  C CB  . SER A 1 60  ? 64.970 10.290  8.861  1.00 25.48  ? 41  SER A CB  1 
ATOM   353  O OG  . SER A 1 60  ? 64.425 10.013  10.143 1.00 26.63  ? 41  SER A OG  1 
ATOM   354  N N   . GLY A 1 61  ? 68.009 10.198  9.550  1.00 23.22  ? 42  GLY A N   1 
ATOM   355  C CA  . GLY A 1 61  ? 68.928 10.379  10.657 1.00 24.67  ? 42  GLY A CA  1 
ATOM   356  C C   . GLY A 1 61  ? 68.225 10.572  11.995 1.00 25.41  ? 42  GLY A C   1 
ATOM   357  O O   . GLY A 1 61  ? 68.706 10.058  13.021 1.00 25.81  ? 42  GLY A O   1 
ATOM   358  N N   . SER A 1 62  ? 67.099 11.299  12.010 1.00 26.61  ? 43  SER A N   1 
ATOM   359  C CA  A SER A 1 62  ? 66.332 11.479  13.246 0.50 26.56  ? 43  SER A CA  1 
ATOM   360  C CA  B SER A 1 62  ? 66.314 11.474  13.244 0.50 26.90  ? 43  SER A CA  1 
ATOM   361  C C   . SER A 1 62  ? 65.753 10.160  13.801 1.00 26.05  ? 43  SER A C   1 
ATOM   362  O O   . SER A 1 62  ? 65.819 9.910   15.002 1.00 26.02  ? 43  SER A O   1 
ATOM   363  C CB  A SER A 1 62  ? 65.209 12.497  13.021 0.50 27.14  ? 43  SER A CB  1 
ATOM   364  C CB  B SER A 1 62  ? 65.154 12.449  13.020 0.50 28.55  ? 43  SER A CB  1 
ATOM   365  O OG  A SER A 1 62  ? 65.732 13.708  12.485 0.50 26.96  ? 43  SER A OG  1 
ATOM   366  O OG  B SER A 1 62  ? 64.322 12.522  14.167 0.50 29.24  ? 43  SER A OG  1 
ATOM   367  N N   . THR A 1 63  ? 65.175 9.332   12.928 1.00 24.99  ? 44  THR A N   1 
ATOM   368  C CA  . THR A 1 63  ? 64.656 8.034   13.361 1.00 25.16  ? 44  THR A CA  1 
ATOM   369  C C   . THR A 1 63  ? 65.799 7.198   13.923 1.00 24.35  ? 44  THR A C   1 
ATOM   370  O O   . THR A 1 63  ? 65.693 6.638   15.034 1.00 24.43  ? 44  THR A O   1 
ATOM   371  C CB  . THR A 1 63  ? 63.970 7.266   12.219 1.00 26.36  ? 44  THR A CB  1 
ATOM   372  O OG1 . THR A 1 63  ? 62.801 7.971   11.792 1.00 29.60  ? 44  THR A OG1 1 
ATOM   373  C CG2 . THR A 1 63  ? 63.584 5.840   12.683 1.00 25.85  ? 44  THR A CG2 1 
ATOM   374  N N   . TYR A 1 64  ? 66.900 7.124   13.178 1.00 23.01  ? 45  TYR A N   1 
ATOM   375  C CA  . TYR A 1 64  ? 68.035 6.308   13.631 1.00 22.59  ? 45  TYR A CA  1 
ATOM   376  C C   . TYR A 1 64  ? 68.593 6.780   14.988 1.00 22.57  ? 45  TYR A C   1 
ATOM   377  O O   . TYR A 1 64  ? 68.820 5.962   15.890 1.00 21.51  ? 45  TYR A O   1 
ATOM   378  C CB  . TYR A 1 64  ? 69.173 6.300   12.586 1.00 22.62  ? 45  TYR A CB  1 
ATOM   379  C CG  . TYR A 1 64  ? 70.141 5.179   12.887 1.00 19.11  ? 45  TYR A CG  1 
ATOM   380  C CD1 . TYR A 1 64  ? 71.203 5.362   13.771 1.00 18.77  ? 45  TYR A CD1 1 
ATOM   381  C CD2 . TYR A 1 64  ? 69.953 3.901   12.341 1.00 20.15  ? 45  TYR A CD2 1 
ATOM   382  C CE1 . TYR A 1 64  ? 72.066 4.320   14.088 1.00 18.00  ? 45  TYR A CE1 1 
ATOM   383  C CE2 . TYR A 1 64  ? 70.819 2.852   12.650 1.00 19.26  ? 45  TYR A CE2 1 
ATOM   384  C CZ  . TYR A 1 64  ? 71.873 3.063   13.511 1.00 18.80  ? 45  TYR A CZ  1 
ATOM   385  O OH  . TYR A 1 64  ? 72.705 1.995   13.811 1.00 19.52  ? 45  TYR A OH  1 
ATOM   386  N N   . THR A 1 65  ? 68.818 8.093   15.134 1.00 22.75  ? 46  THR A N   1 
ATOM   387  C CA  A THR A 1 65  ? 69.313 8.595   16.414 0.50 24.45  ? 46  THR A CA  1 
ATOM   388  C CA  B THR A 1 65  ? 69.295 8.646   16.399 0.50 21.90  ? 46  THR A CA  1 
ATOM   389  C C   . THR A 1 65  ? 68.328 8.312   17.533 1.00 24.07  ? 46  THR A C   1 
ATOM   390  O O   . THR A 1 65  ? 68.749 8.026   18.665 1.00 23.85  ? 46  THR A O   1 
ATOM   391  C CB  A THR A 1 65  ? 69.588 10.096  16.387 0.50 26.37  ? 46  THR A CB  1 
ATOM   392  C CB  B THR A 1 65  ? 69.494 10.181  16.278 0.50 20.49  ? 46  THR A CB  1 
ATOM   393  O OG1 A THR A 1 65  ? 68.382 10.773  16.042 0.50 27.81  ? 46  THR A OG1 1 
ATOM   394  O OG1 B THR A 1 65  ? 70.354 10.437  15.169 0.50 21.83  ? 46  THR A OG1 1 
ATOM   395  C CG2 A THR A 1 65  ? 70.675 10.414  15.388 0.50 27.40  ? 46  THR A CG2 1 
ATOM   396  C CG2 B THR A 1 65  ? 70.130 10.767  17.536 0.50 18.68  ? 46  THR A CG2 1 
ATOM   397  N N   . GLY A 1 66  ? 67.031 8.361   17.220 1.00 23.90  ? 47  GLY A N   1 
ATOM   398  C CA  . GLY A 1 66  ? 65.986 8.092   18.193 1.00 25.94  ? 47  GLY A CA  1 
ATOM   399  C C   . GLY A 1 66  ? 66.100 6.710   18.818 1.00 26.70  ? 47  GLY A C   1 
ATOM   400  O O   . GLY A 1 66  ? 65.722 6.487   19.970 1.00 27.98  ? 47  GLY A O   1 
ATOM   401  N N   . TRP A 1 67  ? 66.640 5.776   18.055 1.00 26.55  ? 48  TRP A N   1 
ATOM   402  C CA  . TRP A 1 67  ? 66.812 4.405   18.550 1.00 25.45  ? 48  TRP A CA  1 
ATOM   403  C C   . TRP A 1 67  ? 67.850 4.275   19.672 1.00 26.23  ? 48  TRP A C   1 
ATOM   404  O O   . TRP A 1 67  ? 67.817 3.320   20.484 1.00 28.26  ? 48  TRP A O   1 
ATOM   405  C CB  . TRP A 1 67  ? 67.224 3.490   17.394 1.00 25.29  ? 48  TRP A CB  1 
ATOM   406  C CG  . TRP A 1 67  ? 66.126 3.277   16.398 1.00 25.93  ? 48  TRP A CG  1 
ATOM   407  C CD1 . TRP A 1 67  ? 64.796 3.437   16.618 1.00 28.69  ? 48  TRP A CD1 1 
ATOM   408  C CD2 . TRP A 1 67  ? 66.258 2.816   15.046 1.00 26.65  ? 48  TRP A CD2 1 
ATOM   409  N NE1 . TRP A 1 67  ? 64.084 3.111   15.488 1.00 28.36  ? 48  TRP A NE1 1 
ATOM   410  C CE2 . TRP A 1 67  ? 64.961 2.750   14.502 1.00 27.19  ? 48  TRP A CE2 1 
ATOM   411  C CE3 . TRP A 1 67  ? 67.353 2.489   14.227 1.00 27.35  ? 48  TRP A CE3 1 
ATOM   412  C CZ2 . TRP A 1 67  ? 64.715 2.329   13.192 1.00 27.70  ? 48  TRP A CZ2 1 
ATOM   413  C CZ3 . TRP A 1 67  ? 67.110 2.072   12.906 1.00 27.53  ? 48  TRP A CZ3 1 
ATOM   414  C CH2 . TRP A 1 67  ? 65.797 1.997   12.410 1.00 28.46  ? 48  TRP A CH2 1 
ATOM   415  N N   . ASP A 1 68  ? 68.805 5.196   19.676 1.00 25.08  ? 49  ASP A N   1 
ATOM   416  C CA  . ASP A 1 68  ? 69.918 5.203   20.634 1.00 24.80  ? 49  ASP A CA  1 
ATOM   417  C C   . ASP A 1 68  ? 70.628 3.862   20.686 1.00 21.51  ? 49  ASP A C   1 
ATOM   418  O O   . ASP A 1 68  ? 70.784 3.212   21.745 1.00 21.57  ? 49  ASP A O   1 
ATOM   419  C CB  . ASP A 1 68  ? 69.463 5.595   22.045 1.00 28.37  ? 49  ASP A CB  1 
ATOM   420  C CG  . ASP A 1 68  ? 70.521 6.440   22.755 1.00 33.55  ? 49  ASP A CG  1 
ATOM   421  O OD1 . ASP A 1 68  ? 70.266 6.933   23.873 1.00 36.81  ? 49  ASP A OD1 1 
ATOM   422  O OD2 . ASP A 1 68  ? 71.641 6.585   22.187 1.00 34.61  ? 49  ASP A OD2 1 
ATOM   423  N N   . ILE A 1 69  ? 71.111 3.490   19.527 1.00 18.43  ? 50  ILE A N   1 
ATOM   424  C CA  . ILE A 1 69  ? 71.747 2.197   19.331 1.00 17.44  ? 50  ILE A CA  1 
ATOM   425  C C   . ILE A 1 69  ? 73.041 1.997   20.123 1.00 17.39  ? 50  ILE A C   1 
ATOM   426  O O   . ILE A 1 69  ? 73.278 0.910   20.681 1.00 17.68  ? 50  ILE A O   1 
ATOM   427  C CB  . ILE A 1 69  ? 72.062 2.002   17.795 1.00 18.39  ? 50  ILE A CB  1 
ATOM   428  C CG1 . ILE A 1 69  ? 70.775 1.928   16.948 1.00 20.05  ? 50  ILE A CG1 1 
ATOM   429  C CG2 . ILE A 1 69  ? 73.026 0.818   17.574 1.00 16.82  ? 50  ILE A CG2 1 
ATOM   430  C CD1 . ILE A 1 69  ? 69.971 0.718   17.169 1.00 22.09  ? 50  ILE A CD1 1 
ATOM   431  N N   . THR A 1 70  ? 73.902 3.017   20.216 1.00 18.08  ? 51  THR A N   1 
ATOM   432  C CA  A THR A 1 70  ? 75.167 2.839   20.907 0.50 18.41  ? 51  THR A CA  1 
ATOM   433  C CA  B THR A 1 70  ? 75.155 2.765   20.900 0.50 18.92  ? 51  THR A CA  1 
ATOM   434  C C   . THR A 1 70  ? 74.944 2.783   22.417 1.00 19.19  ? 51  THR A C   1 
ATOM   435  O O   . THR A 1 70  ? 75.674 2.102   23.148 1.00 19.53  ? 51  THR A O   1 
ATOM   436  C CB  A THR A 1 70  ? 76.182 3.969   20.552 0.50 18.44  ? 51  THR A CB  1 
ATOM   437  C CB  B THR A 1 70  ? 76.262 3.764   20.475 0.50 20.67  ? 51  THR A CB  1 
ATOM   438  O OG1 A THR A 1 70  ? 75.559 5.255   20.666 0.50 18.45  ? 51  THR A OG1 1 
ATOM   439  O OG1 B THR A 1 70  ? 76.434 3.707   19.051 0.50 22.00  ? 51  THR A OG1 1 
ATOM   440  C CG2 A THR A 1 70  ? 76.726 3.777   19.132 0.50 18.82  ? 51  THR A CG2 1 
ATOM   441  C CG2 B THR A 1 70  ? 77.588 3.383   21.131 0.50 20.56  ? 51  THR A CG2 1 
ATOM   442  N N   . GLU A 1 71  ? 73.934 3.515   22.893 1.00 18.72  ? 52  GLU A N   1 
ATOM   443  C CA  . GLU A 1 71  ? 73.528 3.406   24.304 1.00 18.05  ? 52  GLU A CA  1 
ATOM   444  C C   . GLU A 1 71  ? 73.065 1.973   24.648 1.00 16.78  ? 52  GLU A C   1 
ATOM   445  O O   . GLU A 1 71  ? 73.495 1.377   25.652 1.00 16.42  ? 52  GLU A O   1 
ATOM   446  C CB  . GLU A 1 71  ? 72.407 4.396   24.602 1.00 20.34  ? 52  GLU A CB  1 
ATOM   447  C CG  . GLU A 1 71  ? 71.782 4.314   26.003 1.00 22.91  ? 52  GLU A CG  1 
ATOM   448  C CD  . GLU A 1 71  ? 72.499 5.168   27.026 1.00 27.62  ? 52  GLU A CD  1 
ATOM   449  O OE1 . GLU A 1 71  ? 71.961 5.302   28.134 1.00 28.94  ? 52  GLU A OE1 1 
ATOM   450  O OE2 . GLU A 1 71  ? 73.591 5.712   26.705 1.00 30.65  ? 52  GLU A OE2 1 
ATOM   451  N N   . LEU A 1 72  ? 72.175 1.432   23.818 1.00 16.52  ? 53  LEU A N   1 
ATOM   452  C CA  . LEU A 1 72  ? 71.760 0.042   23.954 1.00 16.13  ? 53  LEU A CA  1 
ATOM   453  C C   . LEU A 1 72  ? 72.953 -0.930  24.039 1.00 16.00  ? 53  LEU A C   1 
ATOM   454  O O   . LEU A 1 72  ? 73.033 -1.703  24.981 1.00 15.22  ? 53  LEU A O   1 
ATOM   455  C CB  . LEU A 1 72  ? 70.867 -0.346  22.783 1.00 14.67  ? 53  LEU A CB  1 
ATOM   456  C CG  . LEU A 1 72  ? 70.485 -1.833  22.729 1.00 16.26  ? 53  LEU A CG  1 
ATOM   457  C CD1 . LEU A 1 72  ? 69.650 -2.202  23.951 1.00 16.79  ? 53  LEU A CD1 1 
ATOM   458  C CD2 . LEU A 1 72  ? 69.673 -2.110  21.432 1.00 17.87  ? 53  LEU A CD2 1 
ATOM   459  N N   . ALA A 1 73  ? 73.895 -0.843  23.096 1.00 15.70  ? 54  ALA A N   1 
ATOM   460  C CA  . ALA A 1 73  ? 75.033 -1.751  23.033 1.00 15.05  ? 54  ALA A CA  1 
ATOM   461  C C   . ALA A 1 73  ? 75.882 -1.625  24.314 1.00 14.37  ? 54  ALA A C   1 
ATOM   462  O O   . ALA A 1 73  ? 76.332 -2.622  24.891 1.00 14.01  ? 54  ALA A O   1 
ATOM   463  C CB  . ALA A 1 73  ? 75.899 -1.462  21.807 1.00 15.49  ? 54  ALA A CB  1 
ATOM   464  N N   . SER A 1 74  ? 76.093 -0.390  24.751 1.00 14.02  ? 55  SER A N   1 
ATOM   465  C CA  A SER A 1 74  ? 76.928 -0.141  25.926 0.50 14.68  ? 55  SER A CA  1 
ATOM   466  C CA  B SER A 1 74  ? 76.928 -0.133  25.924 0.50 14.89  ? 55  SER A CA  1 
ATOM   467  C C   . SER A 1 74  ? 76.339 -0.719  27.212 1.00 15.50  ? 55  SER A C   1 
ATOM   468  O O   . SER A 1 74  ? 77.075 -1.155  28.117 1.00 17.54  ? 55  SER A O   1 
ATOM   469  C CB  A SER A 1 74  ? 77.128 1.349   26.131 0.50 16.37  ? 55  SER A CB  1 
ATOM   470  C CB  B SER A 1 74  ? 77.119 1.367   26.107 0.50 16.49  ? 55  SER A CB  1 
ATOM   471  O OG  A SER A 1 74  ? 77.800 1.573   27.355 0.50 17.20  ? 55  SER A OG  1 
ATOM   472  O OG  B SER A 1 74  ? 77.725 1.943   24.962 0.50 16.66  ? 55  SER A OG  1 
ATOM   473  N N   . LEU A 1 75  ? 75.018 -0.699  27.307 1.00 15.66  ? 56  LEU A N   1 
ATOM   474  C CA  . LEU A 1 75  ? 74.340 -1.209  28.497 1.00 14.44  ? 56  LEU A CA  1 
ATOM   475  C C   . LEU A 1 75  ? 74.227 -2.722  28.501 1.00 15.20  ? 56  LEU A C   1 
ATOM   476  O O   . LEU A 1 75  ? 74.215 -3.367  29.560 1.00 16.20  ? 56  LEU A O   1 
ATOM   477  C CB  . LEU A 1 75  ? 72.940 -0.588  28.595 1.00 14.77  ? 56  LEU A CB  1 
ATOM   478  C CG  . LEU A 1 75  ? 72.948 0.922   28.966 1.00 15.11  ? 56  LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 75  ? 71.577 1.553   28.742 1.00 17.01  ? 56  LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 75  ? 73.386 1.142   30.402 1.00 18.84  ? 56  LEU A CD2 1 
ATOM   481  N N   . VAL A 1 76  ? 74.118 -3.317  27.325 1.00 13.93  ? 57  VAL A N   1 
ATOM   482  C CA  A VAL A 1 76  ? 73.834 -4.719  27.217 0.50 15.08  ? 57  VAL A CA  1 
ATOM   483  C CA  B VAL A 1 76  ? 73.847 -4.765  27.326 0.50 11.77  ? 57  VAL A CA  1 
ATOM   484  C C   . VAL A 1 76  ? 75.111 -5.610  27.184 1.00 13.51  ? 57  VAL A C   1 
ATOM   485  O O   . VAL A 1 76  ? 75.087 -6.787  27.552 1.00 14.21  ? 57  VAL A O   1 
ATOM   486  C CB  A VAL A 1 76  ? 72.907 -4.826  25.980 0.50 17.96  ? 57  VAL A CB  1 
ATOM   487  C CB  B VAL A 1 76  ? 72.790 -5.173  26.236 0.50 8.73   ? 57  VAL A CB  1 
ATOM   488  C CG1 A VAL A 1 76  ? 73.555 -5.431  24.755 0.50 17.78  ? 57  VAL A CG1 1 
ATOM   489  C CG1 B VAL A 1 76  ? 71.483 -4.456  26.542 0.50 7.66   ? 57  VAL A CG1 1 
ATOM   490  C CG2 A VAL A 1 76  ? 71.548 -5.314  26.354 0.50 18.52  ? 57  VAL A CG2 1 
ATOM   491  C CG2 B VAL A 1 76  ? 73.273 -4.826  24.766 0.50 7.23   ? 57  VAL A CG2 1 
ATOM   492  N N   . TYR A 1 77  ? 76.221 -5.051  26.709 1.00 15.00  ? 58  TYR A N   1 
ATOM   493  C CA  . TYR A 1 77  ? 77.530 -5.712  26.752 1.00 14.79  ? 58  TYR A CA  1 
ATOM   494  C C   . TYR A 1 77  ? 78.544 -4.768  27.434 1.00 15.75  ? 58  TYR A C   1 
ATOM   495  O O   . TYR A 1 77  ? 79.465 -4.260  26.783 1.00 14.84  ? 58  TYR A O   1 
ATOM   496  C CB  . TYR A 1 77  ? 78.044 -6.082  25.337 1.00 14.81  ? 58  TYR A CB  1 
ATOM   497  C CG  . TYR A 1 77  ? 77.115 -6.971  24.544 1.00 14.00  ? 58  TYR A CG  1 
ATOM   498  C CD1 . TYR A 1 77  ? 76.937 -8.338  24.876 1.00 14.22  ? 58  TYR A CD1 1 
ATOM   499  C CD2 . TYR A 1 77  ? 76.450 -6.479  23.429 1.00 14.79  ? 58  TYR A CD2 1 
ATOM   500  C CE1 . TYR A 1 77  ? 76.082 -9.157  24.111 1.00 11.37  ? 58  TYR A CE1 1 
ATOM   501  C CE2 . TYR A 1 77  ? 75.600 -7.289  22.673 1.00 13.22  ? 58  TYR A CE2 1 
ATOM   502  C CZ  . TYR A 1 77  ? 75.415 -8.611  23.018 1.00 12.43  ? 58  TYR A CZ  1 
ATOM   503  O OH  . TYR A 1 77  ? 74.559 -9.363  22.259 1.00 13.76  ? 58  TYR A OH  1 
ATOM   504  N N   . PRO A 1 78  ? 78.399 -4.563  28.757 1.00 15.99  ? 59  PRO A N   1 
ATOM   505  C CA  . PRO A 1 78  ? 79.141 -3.463  29.419 1.00 16.80  ? 59  PRO A CA  1 
ATOM   506  C C   . PRO A 1 78  ? 80.586 -3.806  29.728 1.00 17.70  ? 59  PRO A C   1 
ATOM   507  O O   . PRO A 1 78  ? 81.323 -2.905  30.170 1.00 20.01  ? 59  PRO A O   1 
ATOM   508  C CB  . PRO A 1 78  ? 78.350 -3.248  30.721 1.00 17.74  ? 59  PRO A CB  1 
ATOM   509  C CG  . PRO A 1 78  ? 77.785 -4.669  31.050 1.00 17.38  ? 59  PRO A CG  1 
ATOM   510  C CD  . PRO A 1 78  ? 77.351 -5.147  29.639 1.00 15.66  ? 59  PRO A CD  1 
ATOM   511  N N   . GLU A 1 79  ? 80.985 -5.075  29.526 1.00 17.54  ? 60  GLU A N   1 
ATOM   512  C CA  . GLU A 1 79  ? 82.369 -5.484  29.800 1.00 20.07  ? 60  GLU A CA  1 
ATOM   513  C C   . GLU A 1 79  ? 83.220 -5.735  28.535 1.00 19.32  ? 60  GLU A C   1 
ATOM   514  O O   . GLU A 1 79  ? 84.391 -6.147  28.621 1.00 21.66  ? 60  GLU A O   1 
ATOM   515  C CB  . GLU A 1 79  ? 82.348 -6.723  30.712 1.00 22.10  ? 60  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 79  ? 81.483 -6.451  31.960 1.00 27.42  ? 60  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 79  ? 81.682 -7.457  33.075 1.00 32.94  ? 60  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 79  ? 81.132 -8.569  32.988 1.00 34.58  ? 60  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 79  ? 82.354 -7.115  34.070 1.00 35.70  ? 60  GLU A OE2 1 
ATOM   520  N N   . SER A 1 80  ? 82.654 -5.462  27.363 1.00 16.28  ? 61  SER A N   1 
ATOM   521  C CA  . SER A 1 80  ? 83.399 -5.665  26.107 1.00 18.21  ? 61  SER A CA  1 
ATOM   522  C C   . SER A 1 80  ? 84.457 -4.574  25.847 1.00 18.32  ? 61  SER A C   1 
ATOM   523  O O   . SER A 1 80  ? 84.334 -3.430  26.342 1.00 19.32  ? 61  SER A O   1 
ATOM   524  C CB  . SER A 1 80  ? 82.390 -5.768  24.939 1.00 18.65  ? 61  SER A CB  1 
ATOM   525  O OG  . SER A 1 80  ? 81.619 -4.565  24.799 1.00 19.27  ? 61  SER A OG  1 
ATOM   526  N N   . SER A 1 81  ? 85.513 -4.927  25.108 1.00 18.17  ? 62  SER A N   1 
ATOM   527  C CA  . SER A 1 81  ? 86.505 -3.954  24.642 1.00 18.03  ? 62  SER A CA  1 
ATOM   528  C C   . SER A 1 81  ? 85.873 -2.902  23.720 1.00 17.02  ? 62  SER A C   1 
ATOM   529  O O   . SER A 1 81  ? 84.723 -3.071  23.273 1.00 17.55  ? 62  SER A O   1 
ATOM   530  C CB  . SER A 1 81  ? 87.631 -4.665  23.879 1.00 18.09  ? 62  SER A CB  1 
ATOM   531  O OG  . SER A 1 81  ? 87.114 -5.231  22.684 1.00 18.36  ? 62  SER A OG  1 
ATOM   532  N N   . ALA A 1 82  ? 86.604 -1.815  23.442 1.00 18.88  ? 63  ALA A N   1 
ATOM   533  C CA  . ALA A 1 82  ? 86.079 -0.813  22.510 1.00 19.66  ? 63  ALA A CA  1 
ATOM   534  C C   . ALA A 1 82  ? 85.747 -1.419  21.145 1.00 19.57  ? 63  ALA A C   1 
ATOM   535  O O   . ALA A 1 82  ? 84.691 -1.138  20.573 1.00 18.43  ? 63  ALA A O   1 
ATOM   536  C CB  . ALA A 1 82  ? 87.074 0.318   22.330 1.00 19.35  ? 63  ALA A CB  1 
ATOM   537  N N   . GLU A 1 83  ? 86.658 -2.238  20.616 1.00 20.27  ? 64  GLU A N   1 
ATOM   538  C CA  . GLU A 1 83  ? 86.471 -2.861  19.306 1.00 19.89  ? 64  GLU A CA  1 
ATOM   539  C C   . GLU A 1 83  ? 85.257 -3.814  19.313 1.00 17.88  ? 64  GLU A C   1 
ATOM   540  O O   . GLU A 1 83  ? 84.436 -3.827  18.358 1.00 17.63  ? 64  GLU A O   1 
ATOM   541  C CB  . GLU A 1 83  ? 87.756 -3.600  18.884 1.00 23.67  ? 64  GLU A CB  1 
ATOM   542  C CG  . GLU A 1 83  ? 87.619 -4.356  17.550 1.00 27.89  ? 64  GLU A CG  1 
ATOM   543  C CD  . GLU A 1 83  ? 88.839 -5.223  17.208 1.00 33.60  ? 64  GLU A CD  1 
ATOM   544  O OE1 . GLU A 1 83  ? 89.957 -4.664  17.125 1.00 35.64  ? 64  GLU A OE1 1 
ATOM   545  O OE2 . GLU A 1 83  ? 88.679 -6.459  17.023 1.00 34.66  ? 64  GLU A OE2 1 
ATOM   546  N N   . ASP A 1 84  ? 85.119 -4.594  20.391 1.00 16.24  ? 65  ASP A N   1 
ATOM   547  C CA  . ASP A 1 84  ? 83.972 -5.512  20.472 1.00 16.01  ? 65  ASP A CA  1 
ATOM   548  C C   . ASP A 1 84  ? 82.631 -4.779  20.718 1.00 14.09  ? 65  ASP A C   1 
ATOM   549  O O   . ASP A 1 84  ? 81.562 -5.203  20.213 1.00 13.48  ? 65  ASP A O   1 
ATOM   550  C CB  . ASP A 1 84  ? 84.237 -6.553  21.548 1.00 16.58  ? 65  ASP A CB  1 
ATOM   551  C CG  . ASP A 1 84  ? 85.222 -7.622  21.088 1.00 18.88  ? 65  ASP A CG  1 
ATOM   552  O OD1 . ASP A 1 84  ? 85.418 -7.813  19.873 1.00 18.25  ? 65  ASP A OD1 1 
ATOM   553  O OD2 . ASP A 1 84  ? 85.802 -8.282  21.946 1.00 20.53  ? 65  ASP A OD2 1 
ATOM   554  N N   . LEU A 1 85  ? 82.671 -3.669  21.460 1.00 15.33  ? 66  LEU A N   1 
ATOM   555  C CA  . LEU A 1 85  ? 81.470 -2.879  21.680 1.00 13.95  ? 66  LEU A CA  1 
ATOM   556  C C   . LEU A 1 85  ? 81.023 -2.268  20.343 1.00 14.15  ? 66  LEU A C   1 
ATOM   557  O O   . LEU A 1 85  ? 79.832 -2.164  20.083 1.00 14.89  ? 66  LEU A O   1 
ATOM   558  C CB  . LEU A 1 85  ? 81.728 -1.770  22.715 1.00 14.62  ? 66  LEU A CB  1 
ATOM   559  C CG  . LEU A 1 85  ? 80.529 -0.853  23.029 1.00 15.03  ? 66  LEU A CG  1 
ATOM   560  C CD1 . LEU A 1 85  ? 79.291 -1.610  23.541 1.00 17.36  ? 66  LEU A CD1 1 
ATOM   561  C CD2 . LEU A 1 85  ? 80.897 0.292   23.992 1.00 15.76  ? 66  LEU A CD2 1 
ATOM   562  N N   . ALA A 1 86  ? 81.976 -1.788  19.546 1.00 13.54  ? 67  ALA A N   1 
ATOM   563  C CA  . ALA A 1 86  ? 81.617 -1.274  18.220 1.00 13.61  ? 67  ALA A CA  1 
ATOM   564  C C   . ALA A 1 86  ? 80.914 -2.353  17.377 1.00 13.76  ? 67  ALA A C   1 
ATOM   565  O O   . ALA A 1 86  ? 79.919 -2.079  16.674 1.00 14.36  ? 67  ALA A O   1 
ATOM   566  C CB  . ALA A 1 86  ? 82.874 -0.759  17.489 1.00 15.39  ? 67  ALA A CB  1 
ATOM   567  N N   . LEU A 1 87  ? 81.396 -3.595  17.473 1.00 13.25  ? 68  LEU A N   1 
ATOM   568  C CA  . LEU A 1 87  ? 80.755 -4.700  16.753 1.00 12.67  ? 68  LEU A CA  1 
ATOM   569  C C   . LEU A 1 87  ? 79.325 -4.916  17.259 1.00 12.56  ? 68  LEU A C   1 
ATOM   570  O O   . LEU A 1 87  ? 78.400 -5.112  16.434 1.00 12.04  ? 68  LEU A O   1 
ATOM   571  C CB  . LEU A 1 87  ? 81.577 -6.000  16.892 1.00 14.27  ? 68  LEU A CB  1 
ATOM   572  C CG  . LEU A 1 87  ? 80.965 -7.284  16.305 1.00 13.87  ? 68  LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 87  ? 80.633 -7.059  14.806 1.00 15.75  ? 68  LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 87  ? 81.947 -8.444  16.428 1.00 15.98  ? 68  LEU A CD2 1 
ATOM   575  N N   . ALA A 1 88  ? 79.124 -4.849  18.590 1.00 12.96  ? 69  ALA A N   1 
ATOM   576  C CA  . ALA A 1 88  ? 77.784 -4.926  19.143 1.00 13.42  ? 69  ALA A CA  1 
ATOM   577  C C   . ALA A 1 88  ? 76.877 -3.805  18.611 1.00 13.31  ? 69  ALA A C   1 
ATOM   578  O O   . ALA A 1 88  ? 75.699 -4.037  18.292 1.00 13.88  ? 69  ALA A O   1 
ATOM   579  C CB  . ALA A 1 88  ? 77.806 -4.886  20.711 1.00 14.32  ? 69  ALA A CB  1 
ATOM   580  N N   . ALA A 1 89  ? 77.421 -2.592  18.515 1.00 13.11  ? 70  ALA A N   1 
ATOM   581  C CA  . ALA A 1 89  ? 76.641 -1.478  18.016 1.00 14.01  ? 70  ALA A CA  1 
ATOM   582  C C   . ALA A 1 89  ? 76.249 -1.678  16.546 1.00 14.18  ? 70  ALA A C   1 
ATOM   583  O O   . ALA A 1 89  ? 75.094 -1.478  16.155 1.00 14.23  ? 70  ALA A O   1 
ATOM   584  C CB  . ALA A 1 89  ? 77.446 -0.176  18.173 1.00 16.32  ? 70  ALA A CB  1 
ATOM   585  N N   . ASP A 1 90  ? 77.241 -2.054  15.746 1.00 14.43  ? 71  ASP A N   1 
ATOM   586  C CA  . ASP A 1 90  ? 77.000 -2.330  14.322 1.00 13.74  ? 71  ASP A CA  1 
ATOM   587  C C   . ASP A 1 90  ? 75.929 -3.400  14.173 1.00 13.96  ? 71  ASP A C   1 
ATOM   588  O O   . ASP A 1 90  ? 75.018 -3.293  13.320 1.00 14.80  ? 71  ASP A O   1 
ATOM   589  C CB  . ASP A 1 90  ? 78.307 -2.767  13.630 1.00 14.17  ? 71  ASP A CB  1 
ATOM   590  C CG  . ASP A 1 90  ? 79.382 -1.683  13.628 1.00 14.73  ? 71  ASP A CG  1 
ATOM   591  O OD1 . ASP A 1 90  ? 79.060 -0.494  13.898 1.00 14.91  ? 71  ASP A OD1 1 
ATOM   592  O OD2 . ASP A 1 90  ? 80.564 -2.040  13.351 1.00 14.47  ? 71  ASP A OD2 1 
ATOM   593  N N   . LEU A 1 91  ? 76.032 -4.449  15.000 1.00 13.61  ? 72  LEU A N   1 
ATOM   594  C CA  . LEU A 1 91  ? 75.064 -5.547  14.956 1.00 13.23  ? 72  LEU A CA  1 
ATOM   595  C C   . LEU A 1 91  ? 73.651 -5.065  15.302 1.00 14.23  ? 72  LEU A C   1 
ATOM   596  O O   . LEU A 1 91  ? 72.694 -5.394  14.592 1.00 14.15  ? 72  LEU A O   1 
ATOM   597  C CB  . LEU A 1 91  ? 75.483 -6.684  15.906 1.00 13.04  ? 72  LEU A CB  1 
ATOM   598  C CG  . LEU A 1 91  ? 74.511 -7.859  16.018 1.00 15.20  ? 72  LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 91  ? 74.303 -8.507  14.618 1.00 16.97  ? 72  LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 91  ? 74.986 -8.896  17.078 1.00 15.51  ? 72  LEU A CD2 1 
ATOM   601  N N   . MET A 1 92  ? 73.496 -4.285  16.388 1.00 13.67  ? 73  MET A N   1 
ATOM   602  C CA  A MET A 1 92  ? 72.161 -3.825  16.765 0.50 14.67  ? 73  MET A CA  1 
ATOM   603  C CA  B MET A 1 92  ? 72.165 -3.818  16.763 0.50 13.95  ? 73  MET A CA  1 
ATOM   604  C C   . MET A 1 92  ? 71.610 -2.898  15.685 1.00 14.76  ? 73  MET A C   1 
ATOM   605  O O   . MET A 1 92  ? 70.413 -2.954  15.352 1.00 15.62  ? 73  MET A O   1 
ATOM   606  C CB  A MET A 1 92  ? 72.182 -3.117  18.126 0.50 16.91  ? 73  MET A CB  1 
ATOM   607  C CB  B MET A 1 92  ? 72.204 -3.103  18.114 0.50 14.62  ? 73  MET A CB  1 
ATOM   608  C CG  A MET A 1 92  ? 72.643 -4.009  19.274 0.50 18.88  ? 73  MET A CG  1 
ATOM   609  C CG  B MET A 1 92  ? 72.513 -4.039  19.261 0.50 15.13  ? 73  MET A CG  1 
ATOM   610  S SD  A MET A 1 92  ? 71.810 -5.599  19.322 0.50 20.44  ? 73  MET A SD  1 
ATOM   611  S SD  B MET A 1 92  ? 71.173 -5.201  19.521 0.50 14.61  ? 73  MET A SD  1 
ATOM   612  C CE  A MET A 1 92  ? 70.107 -5.147  19.513 0.50 21.04  ? 73  MET A CE  1 
ATOM   613  C CE  B MET A 1 92  ? 71.786 -6.024  20.995 0.50 15.70  ? 73  MET A CE  1 
ATOM   614  N N   . GLY A 1 93  ? 72.470 -2.053  15.129 1.00 15.71  ? 74  GLY A N   1 
ATOM   615  C CA  . GLY A 1 93  ? 72.016 -1.188  14.047 1.00 14.80  ? 74  GLY A CA  1 
ATOM   616  C C   . GLY A 1 93  ? 71.510 -2.014  12.864 1.00 15.17  ? 74  GLY A C   1 
ATOM   617  O O   . GLY A 1 93  ? 70.456 -1.679  12.262 1.00 17.10  ? 74  GLY A O   1 
ATOM   618  N N   . PHE A 1 94  ? 72.211 -3.104  12.533 1.00 14.38  ? 75  PHE A N   1 
ATOM   619  C CA  . PHE A 1 94  ? 71.742 -4.000  11.478 1.00 15.12  ? 75  PHE A CA  1 
ATOM   620  C C   . PHE A 1 94  ? 70.366 -4.560  11.785 1.00 14.72  ? 75  PHE A C   1 
ATOM   621  O O   . PHE A 1 94  ? 69.497 -4.563  10.915 1.00 15.74  ? 75  PHE A O   1 
ATOM   622  C CB  . PHE A 1 94  ? 72.734 -5.143  11.256 1.00 15.22  ? 75  PHE A CB  1 
ATOM   623  C CG  . PHE A 1 94  ? 72.267 -6.159  10.242 1.00 14.91  ? 75  PHE A CG  1 
ATOM   624  C CD1 . PHE A 1 94  ? 71.574 -7.291  10.637 1.00 15.77  ? 75  PHE A CD1 1 
ATOM   625  C CD2 . PHE A 1 94  ? 72.489 -5.944  8.891  1.00 15.05  ? 75  PHE A CD2 1 
ATOM   626  C CE1 . PHE A 1 94  ? 71.117 -8.237  9.681  1.00 15.71  ? 75  PHE A CE1 1 
ATOM   627  C CE2 . PHE A 1 94  ? 72.007 -6.841  7.943  1.00 15.47  ? 75  PHE A CE2 1 
ATOM   628  C CZ  . PHE A 1 94  ? 71.357 -8.009  8.336  1.00 15.45  ? 75  PHE A CZ  1 
ATOM   629  N N   . TYR A 1 95  ? 70.160 -5.070  13.003 1.00 15.79  ? 76  TYR A N   1 
ATOM   630  C CA  . TYR A 1 95  ? 68.849 -5.594  13.374 1.00 17.06  ? 76  TYR A CA  1 
ATOM   631  C C   . TYR A 1 95  ? 67.711 -4.559  13.221 1.00 18.65  ? 76  TYR A C   1 
ATOM   632  O O   . TYR A 1 95  ? 66.613 -4.868  12.701 1.00 20.02  ? 76  TYR A O   1 
ATOM   633  C CB  . TYR A 1 95  ? 68.871 -6.079  14.832 1.00 15.58  ? 76  TYR A CB  1 
ATOM   634  C CG  . TYR A 1 95  ? 69.533 -7.402  15.097 1.00 15.09  ? 76  TYR A CG  1 
ATOM   635  C CD1 . TYR A 1 95  ? 69.287 -8.516  14.282 1.00 13.70  ? 76  TYR A CD1 1 
ATOM   636  C CD2 . TYR A 1 95  ? 70.380 -7.577  16.202 1.00 16.54  ? 76  TYR A CD2 1 
ATOM   637  C CE1 . TYR A 1 95  ? 69.867 -9.779  14.575 1.00 13.33  ? 76  TYR A CE1 1 
ATOM   638  C CE2 . TYR A 1 95  ? 70.981 -8.824  16.488 1.00 14.92  ? 76  TYR A CE2 1 
ATOM   639  C CZ  . TYR A 1 95  ? 70.710 -9.908  15.679 1.00 12.59  ? 76  TYR A CZ  1 
ATOM   640  O OH  . TYR A 1 95  ? 71.291 -11.115 15.964 1.00 13.41  ? 76  TYR A OH  1 
ATOM   641  N N   . PHE A 1 96  ? 67.961 -3.337  13.680 1.00 18.44  ? 77  PHE A N   1 
ATOM   642  C CA  . PHE A 1 96  ? 66.919 -2.319  13.629 1.00 20.29  ? 77  PHE A CA  1 
ATOM   643  C C   . PHE A 1 96  ? 66.646 -1.922  12.164 1.00 21.21  ? 77  PHE A C   1 
ATOM   644  O O   . PHE A 1 96  ? 65.488 -1.724  11.785 1.00 23.62  ? 77  PHE A O   1 
ATOM   645  C CB  . PHE A 1 96  ? 67.300 -1.074  14.463 1.00 20.67  ? 77  PHE A CB  1 
ATOM   646  C CG  . PHE A 1 96  ? 67.039 -1.208  15.975 1.00 22.22  ? 77  PHE A CG  1 
ATOM   647  C CD1 . PHE A 1 96  ? 67.744 -2.125  16.766 1.00 23.19  ? 77  PHE A CD1 1 
ATOM   648  C CD2 . PHE A 1 96  ? 66.120 -0.380  16.608 1.00 25.53  ? 77  PHE A CD2 1 
ATOM   649  C CE1 . PHE A 1 96  ? 67.521 -2.225  18.147 1.00 23.65  ? 77  PHE A CE1 1 
ATOM   650  C CE2 . PHE A 1 96  ? 65.900 -0.482  17.992 1.00 26.13  ? 77  PHE A CE2 1 
ATOM   651  C CZ  . PHE A 1 96  ? 66.609 -1.399  18.754 1.00 25.59  ? 77  PHE A CZ  1 
ATOM   652  N N   . LEU A 1 97  ? 67.696 -1.830  11.343 1.00 19.05  ? 78  LEU A N   1 
ATOM   653  C CA  . LEU A 1 97  ? 67.568 -1.438  9.921  1.00 20.43  ? 78  LEU A CA  1 
ATOM   654  C C   . LEU A 1 97  ? 67.013 -2.531  9.020  1.00 22.08  ? 78  LEU A C   1 
ATOM   655  O O   . LEU A 1 97  ? 66.372 -2.266  7.980  1.00 23.42  ? 78  LEU A O   1 
ATOM   656  C CB  . LEU A 1 97  ? 68.927 -1.050  9.366  1.00 19.89  ? 78  LEU A CB  1 
ATOM   657  C CG  . LEU A 1 97  ? 69.488 0.287   9.883  1.00 20.52  ? 78  LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 97  ? 70.990 0.370   9.583  1.00 19.76  ? 78  LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 97  ? 68.711 1.506   9.280  1.00 20.56  ? 78  LEU A CD2 1 
ATOM   660  N N   . PHE A 1 98  ? 67.335 -3.768  9.379  1.00 24.25  ? 79  PHE A N   1 
ATOM   661  C CA  . PHE A 1 98  ? 66.949 -4.890  8.545  1.00 24.16  ? 79  PHE A CA  1 
ATOM   662  C C   . PHE A 1 98  ? 65.464 -4.989  8.569  1.00 27.03  ? 79  PHE A C   1 
ATOM   663  O O   . PHE A 1 98  ? 64.818 -5.017  7.500  1.00 27.56  ? 79  PHE A O   1 
ATOM   664  C CB  . PHE A 1 98  ? 67.589 -6.193  9.037  1.00 24.95  ? 79  PHE A CB  1 
ATOM   665  C CG  . PHE A 1 98  ? 67.237 -7.388  8.189  1.00 22.89  ? 79  PHE A CG  1 
ATOM   666  C CD1 . PHE A 1 98  ? 66.452 -8.403  8.693  1.00 22.87  ? 79  PHE A CD1 1 
ATOM   667  C CD2 . PHE A 1 98  ? 67.628 -7.458  6.844  1.00 24.96  ? 79  PHE A CD2 1 
ATOM   668  C CE1 . PHE A 1 98  ? 66.134 -9.530  7.906  1.00 22.72  ? 79  PHE A CE1 1 
ATOM   669  C CE2 . PHE A 1 98  ? 67.279 -8.569  6.056  1.00 25.75  ? 79  PHE A CE2 1 
ATOM   670  C CZ  . PHE A 1 98  ? 66.533 -9.596  6.605  1.00 24.57  ? 79  PHE A CZ  1 
ATOM   671  N N   . ASP A 1 99  ? 64.947 -5.022  9.797  1.00 32.49  ? 80  ASP A N   1 
ATOM   672  C CA  . ASP A 1 99  ? 63.539 -5.201  10.082 1.00 35.73  ? 80  ASP A CA  1 
ATOM   673  C C   . ASP A 1 99  ? 62.717 -4.024  9.598  1.00 34.73  ? 80  ASP A C   1 
ATOM   674  O O   . ASP A 1 99  ? 61.591 -4.187  9.140  1.00 31.07  ? 80  ASP A O   1 
ATOM   675  C CB  . ASP A 1 99  ? 63.298 -5.392  11.579 1.00 40.45  ? 80  ASP A CB  1 
ATOM   676  C CG  . ASP A 1 99  ? 61.843 -5.804  11.885 1.00 46.23  ? 80  ASP A CG  1 
ATOM   677  O OD1 . ASP A 1 99  ? 61.208 -6.432  10.996 1.00 47.92  ? 80  ASP A OD1 1 
ATOM   678  O OD2 . ASP A 1 99  ? 61.336 -5.503  12.998 1.00 48.15  ? 80  ASP A OD2 1 
ATOM   679  N N   . ASP A 1 100 ? 63.272 -2.827  9.726  1.00 36.69  ? 81  ASP A N   1 
ATOM   680  C CA  . ASP A 1 100 ? 62.528 -1.661  9.278  1.00 38.17  ? 81  ASP A CA  1 
ATOM   681  C C   . ASP A 1 100 ? 62.299 -1.747  7.780  1.00 36.20  ? 81  ASP A C   1 
ATOM   682  O O   . ASP A 1 100 ? 61.305 -1.246  7.259  1.00 36.70  ? 81  ASP A O   1 
ATOM   683  C CB  . ASP A 1 100 ? 63.250 -0.366  9.634  1.00 40.28  ? 81  ASP A CB  1 
ATOM   684  C CG  . ASP A 1 100 ? 62.415 0.859   9.310  1.00 42.06  ? 81  ASP A CG  1 
ATOM   685  O OD1 . ASP A 1 100 ? 61.729 1.372   10.225 1.00 43.91  ? 81  ASP A OD1 1 
ATOM   686  O OD2 . ASP A 1 100 ? 62.422 1.274   8.138  1.00 41.32  ? 81  ASP A OD2 1 
ATOM   687  N N   . GLN A 1 101 ? 63.198 -2.409  7.078  1.00 36.11  ? 82  GLN A N   1 
ATOM   688  C CA  . GLN A 1 101 ? 63.023 -2.577  5.641  1.00 36.74  ? 82  GLN A CA  1 
ATOM   689  C C   . GLN A 1 101 ? 61.721 -3.377  5.321  1.00 34.99  ? 82  GLN A C   1 
ATOM   690  O O   . GLN A 1 101 ? 61.202 -3.307  4.199  1.00 36.42  ? 82  GLN A O   1 
ATOM   691  C CB  . GLN A 1 101 ? 64.289 -3.231  5.053  1.00 38.90  ? 82  GLN A CB  1 
ATOM   692  C CG  . GLN A 1 101 ? 64.184 -3.803  3.651  1.00 41.29  ? 82  GLN A CG  1 
ATOM   693  C CD  . GLN A 1 101 ? 65.103 -5.022  3.464  1.00 41.86  ? 82  GLN A CD  1 
ATOM   694  O OE1 . GLN A 1 101 ? 65.857 -5.393  4.378  1.00 42.69  ? 82  GLN A OE1 1 
ATOM   695  N NE2 . GLN A 1 101 ? 65.045 -5.646  2.277  1.00 39.92  ? 82  GLN A NE2 1 
ATOM   696  N N   . PHE A 1 102 ? 61.157 -4.089  6.304  1.00 30.84  ? 83  PHE A N   1 
ATOM   697  C CA  . PHE A 1 102 ? 59.921 -4.858  6.058  1.00 29.41  ? 83  PHE A CA  1 
ATOM   698  C C   . PHE A 1 102 ? 58.657 -4.197  6.609  1.00 31.61  ? 83  PHE A C   1 
ATOM   699  O O   . PHE A 1 102 ? 57.564 -4.781  6.567  1.00 32.18  ? 83  PHE A O   1 
ATOM   700  C CB  . PHE A 1 102 ? 60.041 -6.278  6.647  1.00 27.96  ? 83  PHE A CB  1 
ATOM   701  C CG  . PHE A 1 102 ? 61.151 -7.081  6.029  1.00 27.01  ? 83  PHE A CG  1 
ATOM   702  C CD1 . PHE A 1 102 ? 62.276 -7.418  6.754  1.00 26.04  ? 83  PHE A CD1 1 
ATOM   703  C CD2 . PHE A 1 102 ? 61.081 -7.462  4.699  1.00 28.49  ? 83  PHE A CD2 1 
ATOM   704  C CE1 . PHE A 1 102 ? 63.315 -8.125  6.170  1.00 27.02  ? 83  PHE A CE1 1 
ATOM   705  C CE2 . PHE A 1 102 ? 62.124 -8.182  4.107  1.00 29.11  ? 83  PHE A CE2 1 
ATOM   706  C CZ  . PHE A 1 102 ? 63.240 -8.516  4.852  1.00 27.02  ? 83  PHE A CZ  1 
ATOM   707  N N   . ASP A 1 103 ? 58.805 -2.983  7.131  1.00 33.22  ? 84  ASP A N   1 
ATOM   708  C CA  . ASP A 1 103 ? 57.663 -2.156  7.496  1.00 37.70  ? 84  ASP A CA  1 
ATOM   709  C C   . ASP A 1 103 ? 57.269 -1.379  6.237  1.00 38.70  ? 84  ASP A C   1 
ATOM   710  O O   . ASP A 1 103 ? 57.453 -0.164  6.161  1.00 39.10  ? 84  ASP A O   1 
ATOM   711  C CB  . ASP A 1 103 ? 58.018 -1.219  8.668  1.00 41.88  ? 84  ASP A CB  1 
ATOM   712  C CG  . ASP A 1 103 ? 56.825 -0.393  9.159  1.00 46.25  ? 84  ASP A CG  1 
ATOM   713  O OD1 . ASP A 1 103 ? 55.667 -0.751  8.847  1.00 48.53  ? 84  ASP A OD1 1 
ATOM   714  O OD2 . ASP A 1 103 ? 57.048 0.617   9.865  1.00 48.23  ? 84  ASP A OD2 1 
ATOM   715  N N   . SER A 1 104 ? 56.733 -2.105  5.254  1.00 38.21  ? 85  SER A N   1 
ATOM   716  C CA  . SER A 1 104 ? 56.649 -1.640  3.866  1.00 37.74  ? 85  SER A CA  1 
ATOM   717  C C   . SER A 1 104 ? 55.753 -2.581  3.048  1.00 36.83  ? 85  SER A C   1 
ATOM   718  O O   . SER A 1 104 ? 55.396 -3.673  3.527  1.00 35.02  ? 85  SER A O   1 
ATOM   719  C CB  . SER A 1 104 ? 58.049 -1.588  3.244  1.00 37.61  ? 85  SER A CB  1 
ATOM   720  O OG  . SER A 1 104 ? 58.551 -2.918  3.102  1.00 37.82  ? 85  SER A OG  1 
ATOM   721  N N   . PRO A 1 105 ? 55.392 -2.183  1.812  1.00 37.74  ? 86  PRO A N   1 
ATOM   722  C CA  . PRO A 1 105 ? 54.648 -3.150  0.988  1.00 37.88  ? 86  PRO A CA  1 
ATOM   723  C C   . PRO A 1 105 ? 55.436 -4.432  0.732  1.00 36.58  ? 86  PRO A C   1 
ATOM   724  O O   . PRO A 1 105 ? 54.813 -5.490  0.624  1.00 36.05  ? 86  PRO A O   1 
ATOM   725  C CB  . PRO A 1 105 ? 54.395 -2.390  -0.326 1.00 38.98  ? 86  PRO A CB  1 
ATOM   726  C CG  . PRO A 1 105 ? 55.294 -1.213  -0.292 1.00 39.59  ? 86  PRO A CG  1 
ATOM   727  C CD  . PRO A 1 105 ? 55.468 -0.863  1.157  1.00 38.77  ? 86  PRO A CD  1 
ATOM   728  N N   . LEU A 1 106 ? 56.761 -4.349  0.648  1.00 35.70  ? 87  LEU A N   1 
ATOM   729  C CA  . LEU A 1 106 ? 57.568 -5.570  0.508  1.00 35.60  ? 87  LEU A CA  1 
ATOM   730  C C   . LEU A 1 106 ? 57.312 -6.511  1.683  1.00 34.35  ? 87  LEU A C   1 
ATOM   731  O O   . LEU A 1 106 ? 57.284 -7.723  1.516  1.00 34.19  ? 87  LEU A O   1 
ATOM   732  C CB  . LEU A 1 106 ? 59.069 -5.250  0.398  1.00 37.18  ? 87  LEU A CB  1 
ATOM   733  C CG  . LEU A 1 106 ? 60.058 -6.433  0.290  1.00 38.69  ? 87  LEU A CG  1 
ATOM   734  C CD1 . LEU A 1 106 ? 59.715 -7.383  -0.843 1.00 39.00  ? 87  LEU A CD1 1 
ATOM   735  C CD2 . LEU A 1 106 ? 61.499 -5.961  0.127  1.00 39.39  ? 87  LEU A CD2 1 
ATOM   736  N N   . GLY A 1 107 ? 57.105 -5.948  2.867  1.00 33.47  ? 88  GLY A N   1 
ATOM   737  C CA  . GLY A 1 107 ? 56.892 -6.743  4.064  1.00 33.14  ? 88  GLY A CA  1 
ATOM   738  C C   . GLY A 1 107 ? 55.571 -7.482  4.047  1.00 34.29  ? 88  GLY A C   1 
ATOM   739  O O   . GLY A 1 107 ? 55.258 -8.242  4.971  1.00 32.81  ? 88  GLY A O   1 
ATOM   740  N N   . ARG A 1 108 ? 54.787 -7.256  2.996  1.00 35.86  ? 89  ARG A N   1 
ATOM   741  C CA  . ARG A 1 108 ? 53.508 -7.940  2.835  1.00 38.92  ? 89  ARG A CA  1 
ATOM   742  C C   . ARG A 1 108 ? 53.556 -8.931  1.674  1.00 37.70  ? 89  ARG A C   1 
ATOM   743  O O   . ARG A 1 108 ? 52.508 -9.421  1.233  1.00 38.45  ? 89  ARG A O   1 
ATOM   744  C CB  . ARG A 1 108 ? 52.371 -6.928  2.614  1.00 42.88  ? 89  ARG A CB  1 
ATOM   745  C CG  . ARG A 1 108 ? 52.211 -5.905  3.740  1.00 47.29  ? 89  ARG A CG  1 
ATOM   746  C CD  . ARG A 1 108 ? 51.151 -4.844  3.400  1.00 51.17  ? 89  ARG A CD  1 
ATOM   747  N NE  . ARG A 1 108 ? 51.224 -3.708  4.319  1.00 54.54  ? 89  ARG A NE  1 
ATOM   748  C CZ  . ARG A 1 108 ? 51.718 -2.511  4.003  1.00 56.83  ? 89  ARG A CZ  1 
ATOM   749  N NH1 . ARG A 1 108 ? 52.172 -2.278  2.775  1.00 57.62  ? 89  ARG A NH1 1 
ATOM   750  N NH2 . ARG A 1 108 ? 51.752 -1.542  4.915  1.00 57.32  ? 89  ARG A NH2 1 
ATOM   751  N N   . ARG A 1 109 ? 54.763 -9.212  1.179  1.00 35.53  ? 90  ARG A N   1 
ATOM   752  C CA  . ARG A 1 109 ? 54.958 -10.183 0.098  1.00 33.85  ? 90  ARG A CA  1 
ATOM   753  C C   . ARG A 1 109 ? 55.881 -11.329 0.551  1.00 29.93  ? 90  ARG A C   1 
ATOM   754  O O   . ARG A 1 109 ? 57.094 -11.272 0.332  1.00 28.72  ? 90  ARG A O   1 
ATOM   755  C CB  . ARG A 1 109 ? 55.549 -9.512  -1.133 1.00 38.65  ? 90  ARG A CB  1 
ATOM   756  C CG  . ARG A 1 109 ? 54.648 -8.422  -1.720 1.00 43.63  ? 90  ARG A CG  1 
ATOM   757  C CD  . ARG A 1 109 ? 55.238 -7.803  -2.982 1.00 48.70  ? 90  ARG A CD  1 
ATOM   758  N NE  . ARG A 1 109 ? 55.156 -8.690  -4.145 1.00 52.99  ? 90  ARG A NE  1 
ATOM   759  C CZ  . ARG A 1 109 ? 55.430 -8.312  -5.393 1.00 55.87  ? 90  ARG A CZ  1 
ATOM   760  N NH1 . ARG A 1 109 ? 55.796 -7.059  -5.643 1.00 56.82  ? 90  ARG A NH1 1 
ATOM   761  N NH2 . ARG A 1 109 ? 55.339 -9.181  -6.395 1.00 56.47  ? 90  ARG A NH2 1 
ATOM   762  N N   . PRO A 1 110 ? 55.301 -12.369 1.173  1.00 29.60  ? 91  PRO A N   1 
ATOM   763  C CA  . PRO A 1 110 ? 56.124 -13.397 1.828  1.00 28.05  ? 91  PRO A CA  1 
ATOM   764  C C   . PRO A 1 110 ? 57.097 -14.124 0.885  1.00 26.60  ? 91  PRO A C   1 
ATOM   765  O O   . PRO A 1 110 ? 58.190 -14.476 1.319  1.00 25.11  ? 91  PRO A O   1 
ATOM   766  C CB  . PRO A 1 110 ? 55.098 -14.396 2.390  1.00 27.21  ? 91  PRO A CB  1 
ATOM   767  C CG  . PRO A 1 110 ? 53.765 -13.713 2.371  1.00 29.29  ? 91  PRO A CG  1 
ATOM   768  C CD  . PRO A 1 110 ? 53.865 -12.476 1.502  1.00 29.68  ? 91  PRO A CD  1 
ATOM   769  N N   . GLU A 1 111 ? 56.728 -14.332 -0.389 1.00 27.41  ? 92  GLU A N   1 
ATOM   770  C CA  . GLU A 1 111 ? 57.638 -15.037 -1.295 1.00 29.91  ? 92  GLU A CA  1 
ATOM   771  C C   . GLU A 1 111 ? 58.871 -14.203 -1.573 1.00 28.51  ? 92  GLU A C   1 
ATOM   772  O O   . GLU A 1 111 ? 59.976 -14.737 -1.643 1.00 28.42  ? 92  GLU A O   1 
ATOM   773  C CB  . GLU A 1 111 ? 56.983 -15.389 -2.638 1.00 33.96  ? 92  GLU A CB  1 
ATOM   774  C CG  . GLU A 1 111 ? 55.487 -15.127 -2.771 1.00 39.68  ? 92  GLU A CG  1 
ATOM   775  C CD  . GLU A 1 111 ? 55.075 -13.676 -2.793 1.00 44.11  ? 92  GLU A CD  1 
ATOM   776  O OE1 . GLU A 1 111 ? 55.247 -13.011 -3.845 1.00 46.97  ? 92  GLU A OE1 1 
ATOM   777  O OE2 . GLU A 1 111 ? 54.530 -13.219 -1.766 1.00 44.37  ? 92  GLU A OE2 1 
ATOM   778  N N   . GLN A 1 112 ? 58.682 -12.894 -1.774 1.00 27.09  ? 93  GLN A N   1 
ATOM   779  C CA  . GLN A 1 112 ? 59.826 -12.009 -1.950 1.00 25.85  ? 93  GLN A CA  1 
ATOM   780  C C   . GLN A 1 112 ? 60.713 -11.993 -0.707 1.00 22.71  ? 93  GLN A C   1 
ATOM   781  O O   . GLN A 1 112 ? 61.951 -12.025 -0.805 1.00 22.56  ? 93  GLN A O   1 
ATOM   782  C CB  . GLN A 1 112 ? 59.358 -10.580 -2.285 1.00 29.72  ? 93  GLN A CB  1 
ATOM   783  C CG  . GLN A 1 112 ? 58.516 -10.534 -3.527 1.00 35.42  ? 93  GLN A CG  1 
ATOM   784  C CD  . GLN A 1 112 ? 59.225 -11.173 -4.690 1.00 40.61  ? 93  GLN A CD  1 
ATOM   785  O OE1 . GLN A 1 112 ? 60.453 -11.061 -4.830 1.00 44.44  ? 93  GLN A OE1 1 
ATOM   786  N NE2 . GLN A 1 112 ? 58.464 -11.861 -5.534 1.00 42.74  ? 93  GLN A NE2 1 
ATOM   787  N N   . VAL A 1 113 ? 60.077 -11.955 0.463  1.00 19.93  ? 94  VAL A N   1 
ATOM   788  C CA  . VAL A 1 113 ? 60.797 -11.971 1.717  1.00 19.39  ? 94  VAL A CA  1 
ATOM   789  C C   . VAL A 1 113 ? 61.582 -13.288 1.819  1.00 18.25  ? 94  VAL A C   1 
ATOM   790  O O   . VAL A 1 113 ? 62.756 -13.300 2.263  1.00 17.39  ? 94  VAL A O   1 
ATOM   791  C CB  . VAL A 1 113 ? 59.831 -11.768 2.913  1.00 18.86  ? 94  VAL A CB  1 
ATOM   792  C CG1 . VAL A 1 113 ? 60.571 -11.920 4.235  1.00 19.33  ? 94  VAL A CG1 1 
ATOM   793  C CG2 . VAL A 1 113 ? 59.178 -10.357 2.810  1.00 20.05  ? 94  VAL A CG2 1 
ATOM   794  N N   . ALA A 1 114 ? 60.980 -14.389 1.357  1.00 18.44  ? 95  ALA A N   1 
ATOM   795  C CA  . ALA A 1 114 ? 61.652 -15.699 1.465  1.00 18.67  ? 95  ALA A CA  1 
ATOM   796  C C   . ALA A 1 114 ? 62.913 -15.751 0.610  1.00 18.17  ? 95  ALA A C   1 
ATOM   797  O O   . ALA A 1 114 ? 63.940 -16.255 1.069  1.00 16.13  ? 95  ALA A O   1 
ATOM   798  C CB  . ALA A 1 114 ? 60.697 -16.848 1.103  1.00 17.34  ? 95  ALA A CB  1 
ATOM   799  N N   . LEU A 1 115 ? 62.864 -15.214 -0.615 1.00 19.41  ? 96  LEU A N   1 
ATOM   800  C CA  A LEU A 1 115 ? 64.073 -15.152 -1.426 0.50 20.77  ? 96  LEU A CA  1 
ATOM   801  C CA  B LEU A 1 115 ? 64.065 -15.170 -1.424 0.50 20.70  ? 96  LEU A CA  1 
ATOM   802  C C   . LEU A 1 115 ? 65.188 -14.362 -0.752 1.00 19.95  ? 96  LEU A C   1 
ATOM   803  O O   . LEU A 1 115 ? 66.346 -14.794 -0.714 1.00 20.63  ? 96  LEU A O   1 
ATOM   804  C CB  A LEU A 1 115 ? 63.788 -14.508 -2.788 0.50 25.23  ? 96  LEU A CB  1 
ATOM   805  C CB  B LEU A 1 115 ? 63.729 -14.582 -2.803 0.50 24.97  ? 96  LEU A CB  1 
ATOM   806  C CG  A LEU A 1 115 ? 64.965 -14.634 -3.756 0.50 29.13  ? 96  LEU A CG  1 
ATOM   807  C CG  B LEU A 1 115 ? 62.637 -15.346 -3.570 0.50 28.52  ? 96  LEU A CG  1 
ATOM   808  C CD1 A LEU A 1 115 ? 64.920 -15.998 -4.407 0.50 33.51  ? 96  LEU A CD1 1 
ATOM   809  C CD1 B LEU A 1 115 ? 62.168 -14.556 -4.772 0.50 32.11  ? 96  LEU A CD1 1 
ATOM   810  C CD2 A LEU A 1 115 ? 64.933 -13.556 -4.841 0.50 30.26  ? 96  LEU A CD2 1 
ATOM   811  C CD2 B LEU A 1 115 ? 63.146 -16.706 -3.998 0.50 29.39  ? 96  LEU A CD2 1 
ATOM   812  N N   . ILE A 1 116 ? 64.842 -13.184 -0.223 1.00 17.54  ? 97  ILE A N   1 
ATOM   813  C CA  . ILE A 1 116 ? 65.830 -12.331 0.430  1.00 18.03  ? 97  ILE A CA  1 
ATOM   814  C C   . ILE A 1 116 ? 66.480 -13.057 1.637  1.00 16.82  ? 97  ILE A C   1 
ATOM   815  O O   . ILE A 1 116 ? 67.731 -13.060 1.825  1.00 16.30  ? 97  ILE A O   1 
ATOM   816  C CB  . ILE A 1 116 ? 65.166 -11.017 0.888  1.00 17.67  ? 97  ILE A CB  1 
ATOM   817  C CG1 . ILE A 1 116 ? 64.915 -10.113 -0.330 1.00 20.83  ? 97  ILE A CG1 1 
ATOM   818  C CG2 . ILE A 1 116 ? 66.018 -10.276 1.935  1.00 18.79  ? 97  ILE A CG2 1 
ATOM   819  C CD1 . ILE A 1 116 ? 63.880 -9.051  -0.113 1.00 21.49  ? 97  ILE A CD1 1 
ATOM   820  N N   . CYS A 1 117 ? 65.637 -13.701 2.434  1.00 16.69  ? 98  CYS A N   1 
ATOM   821  C CA  . CYS A 1 117 ? 66.107 -14.292 3.684  1.00 15.37  ? 98  CYS A CA  1 
ATOM   822  C C   . CYS A 1 117 ? 66.873 -15.604 3.446  1.00 15.54  ? 98  CYS A C   1 
ATOM   823  O O   . CYS A 1 117 ? 67.759 -15.975 4.253  1.00 14.81  ? 98  CYS A O   1 
ATOM   824  C CB  . CYS A 1 117 ? 64.930 -14.549 4.633  1.00 15.95  ? 98  CYS A CB  1 
ATOM   825  S SG  . CYS A 1 117 ? 64.272 -12.989 5.281  1.00 17.09  ? 98  CYS A SG  1 
ATOM   826  N N   . GLU A 1 118 ? 66.529 -16.320 2.368  1.00 15.60  ? 99  GLU A N   1 
ATOM   827  C CA  . GLU A 1 118 ? 67.298 -17.514 2.008  1.00 14.44  ? 99  GLU A CA  1 
ATOM   828  C C   . GLU A 1 118 ? 68.742 -17.123 1.631  1.00 15.65  ? 99  GLU A C   1 
ATOM   829  O O   . GLU A 1 118 ? 69.707 -17.772 2.043  1.00 15.20  ? 99  GLU A O   1 
ATOM   830  C CB  . GLU A 1 118 ? 66.595 -18.307 0.879  1.00 15.48  ? 99  GLU A CB  1 
ATOM   831  C CG  . GLU A 1 118 ? 67.447 -19.389 0.265  1.00 15.81  ? 99  GLU A CG  1 
ATOM   832  C CD  . GLU A 1 118 ? 67.782 -20.538 1.234  1.00 17.61  ? 99  GLU A CD  1 
ATOM   833  O OE1 . GLU A 1 118 ? 68.659 -21.363 0.859  1.00 20.90  ? 99  GLU A OE1 1 
ATOM   834  O OE2 . GLU A 1 118 ? 67.153 -20.651 2.331  1.00 17.32  ? 99  GLU A OE2 1 
ATOM   835  N N   . ARG A 1 119 ? 68.909 -16.051 0.860  1.00 16.34  ? 100 ARG A N   1 
ATOM   836  C CA  . ARG A 1 119 ? 70.258 -15.594 0.494  1.00 16.45  ? 100 ARG A CA  1 
ATOM   837  C C   . ARG A 1 119 ? 71.101 -15.197 1.714  1.00 15.89  ? 100 ARG A C   1 
ATOM   838  O O   . ARG A 1 119 ? 72.310 -15.447 1.752  1.00 16.02  ? 100 ARG A O   1 
ATOM   839  C CB  . ARG A 1 119 ? 70.148 -14.439 -0.523 1.00 16.03  ? 100 ARG A CB  1 
ATOM   840  C CG  . ARG A 1 119 ? 69.721 -14.990 -1.931 1.00 15.24  ? 100 ARG A CG  1 
ATOM   841  C CD  . ARG A 1 119 ? 69.553 -13.841 -2.951 1.00 16.57  ? 100 ARG A CD  1 
ATOM   842  N NE  . ARG A 1 119 ? 70.821 -13.143 -3.117 1.00 17.20  ? 100 ARG A NE  1 
ATOM   843  C CZ  . ARG A 1 119 ? 71.792 -13.545 -3.936 1.00 19.02  ? 100 ARG A CZ  1 
ATOM   844  N NH1 . ARG A 1 119 ? 71.625 -14.648 -4.721 1.00 20.64  ? 100 ARG A NH1 1 
ATOM   845  N NH2 . ARG A 1 119 ? 72.940 -12.880 -3.946 1.00 20.67  ? 100 ARG A NH2 1 
ATOM   846  N N   . LEU A 1 120 ? 70.458 -14.564 2.689  1.00 14.96  ? 101 LEU A N   1 
ATOM   847  C CA  . LEU A 1 120 ? 71.155 -14.121 3.902  1.00 14.01  ? 101 LEU A CA  1 
ATOM   848  C C   . LEU A 1 120 ? 71.613 -15.357 4.712  1.00 14.78  ? 101 LEU A C   1 
ATOM   849  O O   . LEU A 1 120 ? 72.749 -15.409 5.197  1.00 15.17  ? 101 LEU A O   1 
ATOM   850  C CB  . LEU A 1 120 ? 70.253 -13.198 4.737  1.00 14.86  ? 101 LEU A CB  1 
ATOM   851  C CG  . LEU A 1 120 ? 70.209 -11.782 4.138  1.00 15.91  ? 101 LEU A CG  1 
ATOM   852  C CD1 . LEU A 1 120 ? 68.971 -11.100 4.576  1.00 17.72  ? 101 LEU A CD1 1 
ATOM   853  C CD2 . LEU A 1 120 ? 71.463 -11.014 4.524  1.00 15.45  ? 101 LEU A CD2 1 
ATOM   854  N N   . SER A 1 121 ? 70.740 -16.352 4.838  1.00 14.74  ? 102 SER A N   1 
ATOM   855  C CA  . SER A 1 121 ? 71.165 -17.577 5.520  1.00 14.93  ? 102 SER A CA  1 
ATOM   856  C C   . SER A 1 121 ? 72.322 -18.239 4.798  1.00 15.78  ? 102 SER A C   1 
ATOM   857  O O   . SER A 1 121 ? 73.188 -18.844 5.443  1.00 16.62  ? 102 SER A O   1 
ATOM   858  C CB  . SER A 1 121 ? 69.994 -18.577 5.664  1.00 13.50  ? 102 SER A CB  1 
ATOM   859  O OG  . SER A 1 121 ? 69.038 -18.076 6.593  1.00 15.11  ? 102 SER A OG  1 
ATOM   860  N N   . ALA A 1 122 ? 72.324 -18.173 3.468  1.00 15.79  ? 103 ALA A N   1 
ATOM   861  C CA  . ALA A 1 122 ? 73.407 -18.781 2.696  1.00 17.03  ? 103 ALA A CA  1 
ATOM   862  C C   . ALA A 1 122 ? 74.745 -18.118 3.044  1.00 17.58  ? 103 ALA A C   1 
ATOM   863  O O   . ALA A 1 122 ? 75.784 -18.780 3.064  1.00 18.56  ? 103 ALA A O   1 
ATOM   864  C CB  . ALA A 1 122 ? 73.098 -18.694 1.169  1.00 17.01  ? 103 ALA A CB  1 
ATOM   865  N N   . ILE A 1 123 ? 74.728 -16.813 3.348  1.00 16.31  ? 104 ILE A N   1 
ATOM   866  C CA  . ILE A 1 123 ? 75.949 -16.152 3.779  1.00 15.16  ? 104 ILE A CA  1 
ATOM   867  C C   . ILE A 1 123 ? 76.465 -16.761 5.109  1.00 15.33  ? 104 ILE A C   1 
ATOM   868  O O   . ILE A 1 123 ? 77.669 -17.010 5.268  1.00 15.88  ? 104 ILE A O   1 
ATOM   869  C CB  . ILE A 1 123 ? 75.721 -14.635 3.943  1.00 16.32  ? 104 ILE A CB  1 
ATOM   870  C CG1 . ILE A 1 123 ? 75.479 -14.000 2.565  1.00 19.15  ? 104 ILE A CG1 1 
ATOM   871  C CG2 . ILE A 1 123 ? 76.924 -13.925 4.690  1.00 17.28  ? 104 ILE A CG2 1 
ATOM   872  C CD1 . ILE A 1 123 ? 75.119 -12.513 2.683  1.00 22.15  ? 104 ILE A CD1 1 
ATOM   873  N N   . ALA A 1 124 ? 75.557 -16.969 6.060  1.00 15.46  ? 105 ALA A N   1 
ATOM   874  C CA  . ALA A 1 124 ? 75.934 -17.530 7.370  1.00 15.62  ? 105 ALA A CA  1 
ATOM   875  C C   . ALA A 1 124 ? 76.581 -18.910 7.220  1.00 15.55  ? 105 ALA A C   1 
ATOM   876  O O   . ALA A 1 124 ? 77.437 -19.314 8.032  1.00 16.77  ? 105 ALA A O   1 
ATOM   877  C CB  . ALA A 1 124 ? 74.714 -17.645 8.294  1.00 14.96  ? 105 ALA A CB  1 
ATOM   878  N N   . HIS A 1 125 ? 76.121 -19.649 6.226  1.00 15.49  ? 106 HIS A N   1 
ATOM   879  C CA  . HIS A 1 125 ? 76.590 -21.013 6.005  1.00 15.22  ? 106 HIS A CA  1 
ATOM   880  C C   . HIS A 1 125 ? 77.680 -21.113 4.925  1.00 17.26  ? 106 HIS A C   1 
ATOM   881  O O   . HIS A 1 125 ? 78.106 -22.217 4.544  1.00 20.05  ? 106 HIS A O   1 
ATOM   882  C CB  . HIS A 1 125 ? 75.400 -21.906 5.664  1.00 15.89  ? 106 HIS A CB  1 
ATOM   883  C CG  . HIS A 1 125 ? 74.558 -22.228 6.862  1.00 13.88  ? 106 HIS A CG  1 
ATOM   884  N ND1 . HIS A 1 125 ? 74.957 -23.129 7.834  1.00 12.96  ? 106 HIS A ND1 1 
ATOM   885  C CD2 . HIS A 1 125 ? 73.332 -21.777 7.233  1.00 15.52  ? 106 HIS A CD2 1 
ATOM   886  C CE1 . HIS A 1 125 ? 74.015 -23.203 8.759  1.00 13.36  ? 106 HIS A CE1 1 
ATOM   887  N NE2 . HIS A 1 125 ? 73.019 -22.394 8.420  1.00 14.81  ? 106 HIS A NE2 1 
ATOM   888  N N   . GLY A 1 126 ? 78.123 -19.961 4.419  1.00 18.34  ? 107 GLY A N   1 
ATOM   889  C CA  . GLY A 1 126 ? 79.208 -19.909 3.447  1.00 20.21  ? 107 GLY A CA  1 
ATOM   890  C C   . GLY A 1 126 ? 78.917 -20.363 2.027  1.00 22.43  ? 107 GLY A C   1 
ATOM   891  O O   . GLY A 1 126 ? 79.849 -20.728 1.289  1.00 25.39  ? 107 GLY A O   1 
ATOM   892  N N   . THR A 1 127 ? 77.653 -20.352 1.617  1.00 23.09  ? 108 THR A N   1 
ATOM   893  C CA  . THR A 1 127 ? 77.287 -20.839 0.277  1.00 25.01  ? 108 THR A CA  1 
ATOM   894  C C   . THR A 1 127 ? 76.762 -19.763 -0.691 1.00 26.68  ? 108 THR A C   1 
ATOM   895  O O   . THR A 1 127 ? 76.290 -20.084 -1.772 1.00 28.87  ? 108 THR A O   1 
ATOM   896  C CB  . THR A 1 127 ? 76.219 -21.960 0.353  1.00 24.41  ? 108 THR A CB  1 
ATOM   897  O OG1 . THR A 1 127 ? 75.022 -21.453 0.961  1.00 27.69  ? 108 THR A OG1 1 
ATOM   898  C CG2 . THR A 1 127 ? 76.738 -23.080 1.190  1.00 24.78  ? 108 THR A CG2 1 
ATOM   899  N N   . LEU A 1 128 ? 76.830 -18.496 -0.323 1.00 24.19  ? 109 LEU A N   1 
ATOM   900  C CA  . LEU A 1 128 ? 76.293 -17.485 -1.218 1.00 24.68  ? 109 LEU A CA  1 
ATOM   901  C C   . LEU A 1 128 ? 77.310 -17.172 -2.325 1.00 26.71  ? 109 LEU A C   1 
ATOM   902  O O   . LEU A 1 128 ? 78.493 -16.894 -2.047 1.00 27.34  ? 109 LEU A O   1 
ATOM   903  C CB  . LEU A 1 128 ? 75.923 -16.243 -0.412 1.00 25.61  ? 109 LEU A CB  1 
ATOM   904  C CG  . LEU A 1 128 ? 74.797 -15.282 -0.835 1.00 28.42  ? 109 LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 128 ? 75.325 -14.003 -1.369 1.00 28.52  ? 109 LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 128 ? 73.704 -15.863 -1.693 1.00 26.23  ? 109 LEU A CD2 1 
ATOM   907  N N   . THR A 1 129 ? 76.852 -17.226 -3.575 1.00 28.22  ? 110 THR A N   1 
ATOM   908  C CA  A THR A 1 129 ? 77.828 -17.064 -4.653 0.50 27.75  ? 110 THR A CA  1 
ATOM   909  C CA  B THR A 1 129 ? 77.625 -16.993 -4.771 0.50 29.38  ? 110 THR A CA  1 
ATOM   910  C C   . THR A 1 129 ? 78.330 -15.629 -4.776 1.00 27.45  ? 110 THR A C   1 
ATOM   911  O O   . THR A 1 129 ? 79.552 -15.470 -4.872 1.00 28.33  ? 110 THR A O   1 
ATOM   912  C CB  A THR A 1 129 ? 77.327 -17.520 -6.032 0.50 26.62  ? 110 THR A CB  1 
ATOM   913  C CB  B THR A 1 129 ? 76.656 -17.098 -5.960 0.50 31.24  ? 110 THR A CB  1 
ATOM   914  O OG1 A THR A 1 129 ? 77.094 -18.933 -5.999 0.50 25.99  ? 110 THR A OG1 1 
ATOM   915  O OG1 B THR A 1 129 ? 75.615 -16.117 -5.815 0.50 31.91  ? 110 THR A OG1 1 
ATOM   916  C CG2 A THR A 1 129 ? 78.417 -17.248 -7.106 0.50 25.44  ? 110 THR A CG2 1 
ATOM   917  C CG2 B THR A 1 129 ? 75.995 -18.469 -5.950 0.50 32.04  ? 110 THR A CG2 1 
ATOM   918  N N   . ALA A 1 130 ? 77.487 -14.610 -4.731 1.00 24.39  ? 111 ALA A N   1 
ATOM   919  C CA  . ALA A 1 130 ? 77.968 -13.212 -4.734 1.00 21.59  ? 111 ALA A CA  1 
ATOM   920  C C   . ALA A 1 130 ? 77.007 -12.368 -3.943 1.00 18.11  ? 111 ALA A C   1 
ATOM   921  O O   . ALA A 1 130 ? 75.795 -12.604 -4.013 1.00 20.73  ? 111 ALA A O   1 
ATOM   922  C CB  . ALA A 1 130 ? 78.095 -12.653 -6.157 1.00 23.04  ? 111 ALA A CB  1 
ATOM   923  N N   . VAL A 1 131 ? 77.541 -11.375 -3.219 1.00 15.53  ? 112 VAL A N   1 
ATOM   924  C CA  A VAL A 1 131 ? 76.657 -10.437 -2.506 0.50 16.36  ? 112 VAL A CA  1 
ATOM   925  C CA  B VAL A 1 131 ? 76.764 -10.383 -2.494 0.50 15.43  ? 112 VAL A CA  1 
ATOM   926  C C   . VAL A 1 131 ? 76.118 -9.370  -3.447 1.00 16.38  ? 112 VAL A C   1 
ATOM   927  O O   . VAL A 1 131 ? 76.826 -8.751  -4.228 1.00 17.91  ? 112 VAL A O   1 
ATOM   928  C CB  A VAL A 1 131 ? 77.331 -9.742  -1.299 0.50 17.26  ? 112 VAL A CB  1 
ATOM   929  C CB  B VAL A 1 131 ? 77.692 -9.678  -1.497 0.50 14.58  ? 112 VAL A CB  1 
ATOM   930  C CG1 A VAL A 1 131 ? 77.363 -10.683 -0.075 0.50 16.78  ? 112 VAL A CG1 1 
ATOM   931  C CG1 B VAL A 1 131 ? 77.024 -8.512  -0.885 0.50 12.28  ? 112 VAL A CG1 1 
ATOM   932  C CG2 A VAL A 1 131 ? 78.705 -9.250  -1.667 0.50 18.00  ? 112 VAL A CG2 1 
ATOM   933  C CG2 B VAL A 1 131 ? 78.188 -10.671 -0.441 0.50 14.96  ? 112 VAL A CG2 1 
ATOM   934  N N   . THR A 1 132 ? 74.799 -9.187  -3.400 1.00 15.89  ? 113 THR A N   1 
ATOM   935  C CA  . THR A 1 132 ? 74.154 -8.301  -4.395 1.00 15.91  ? 113 THR A CA  1 
ATOM   936  C C   . THR A 1 132 ? 73.110 -7.353  -3.773 1.00 16.12  ? 113 THR A C   1 
ATOM   937  O O   . THR A 1 132 ? 72.244 -6.830  -4.484 1.00 17.46  ? 113 THR A O   1 
ATOM   938  C CB  . THR A 1 132 ? 73.476 -9.119  -5.518 1.00 16.91  ? 113 THR A CB  1 
ATOM   939  O OG1 . THR A 1 132 ? 72.398 -9.892  -4.961 1.00 19.39  ? 113 THR A OG1 1 
ATOM   940  C CG2 . THR A 1 132 ? 74.506 -10.070 -6.211 1.00 15.56  ? 113 THR A CG2 1 
ATOM   941  N N   . SER A 1 133 ? 73.178 -7.085  -2.465 1.00 17.00  ? 114 SER A N   1 
ATOM   942  C CA  . SER A 1 133 ? 72.303 -6.048  -1.894 1.00 16.16  ? 114 SER A CA  1 
ATOM   943  C C   . SER A 1 133 ? 73.017 -5.391  -0.712 1.00 16.69  ? 114 SER A C   1 
ATOM   944  O O   . SER A 1 133 ? 73.999 -5.946  -0.194 1.00 16.04  ? 114 SER A O   1 
ATOM   945  C CB  . SER A 1 133 ? 70.973 -6.628  -1.407 1.00 17.09  ? 114 SER A CB  1 
ATOM   946  O OG  . SER A 1 133 ? 71.186 -7.394  -0.216 1.00 17.62  ? 114 SER A OG  1 
ATOM   947  N N   . PRO A 1 134 ? 72.534 -4.209  -0.283 1.00 16.72  ? 115 PRO A N   1 
ATOM   948  C CA  . PRO A 1 134 ? 73.118 -3.592  0.917  1.00 15.34  ? 115 PRO A CA  1 
ATOM   949  C C   . PRO A 1 134 ? 72.965 -4.474  2.159  1.00 14.76  ? 115 PRO A C   1 
ATOM   950  O O   . PRO A 1 134 ? 73.908 -4.511  2.968  1.00 16.18  ? 115 PRO A O   1 
ATOM   951  C CB  . PRO A 1 134 ? 72.317 -2.294  1.058  1.00 17.21  ? 115 PRO A CB  1 
ATOM   952  C CG  . PRO A 1 134 ? 71.935 -1.938  -0.388 1.00 17.50  ? 115 PRO A CG  1 
ATOM   953  C CD  . PRO A 1 134 ? 71.557 -3.313  -0.951 1.00 17.75  ? 115 PRO A CD  1 
ATOM   954  N N   . SER A 1 135 ? 71.837 -5.163  2.309  1.00 14.64  ? 116 SER A N   1 
ATOM   955  C CA  . SER A 1 135 ? 71.686 -6.053  3.488  1.00 16.99  ? 116 SER A CA  1 
ATOM   956  C C   . SER A 1 135 ? 72.697 -7.194  3.449  1.00 16.28  ? 116 SER A C   1 
ATOM   957  O O   . SER A 1 135 ? 73.300 -7.570  4.499  1.00 16.28  ? 116 SER A O   1 
ATOM   958  C CB  . SER A 1 135 ? 70.260 -6.649  3.577  1.00 18.21  ? 116 SER A CB  1 
ATOM   959  O OG  . SER A 1 135 ? 69.293 -5.611  3.751  1.00 21.96  ? 116 SER A OG  1 
ATOM   960  N N   . GLU A 1 136 ? 72.854 -7.798  2.262  1.00 15.45  ? 117 GLU A N   1 
ATOM   961  C CA  . GLU A 1 136 ? 73.820 -8.893  2.120  1.00 15.11  ? 117 GLU A CA  1 
ATOM   962  C C   . GLU A 1 136 ? 75.249 -8.427  2.423  1.00 15.20  ? 117 GLU A C   1 
ATOM   963  O O   . GLU A 1 136 ? 76.012 -9.108  3.129  1.00 15.67  ? 117 GLU A O   1 
ATOM   964  C CB  . GLU A 1 136 ? 73.727 -9.507  0.724  1.00 16.02  ? 117 GLU A CB  1 
ATOM   965  C CG  . GLU A 1 136 ? 72.491 -10.389 0.536  1.00 17.37  ? 117 GLU A CG  1 
ATOM   966  C CD  . GLU A 1 136 ? 72.279 -10.845 -0.910 1.00 17.47  ? 117 GLU A CD  1 
ATOM   967  O OE1 . GLU A 1 136 ? 73.248 -10.848 -1.696 1.00 17.83  ? 117 GLU A OE1 1 
ATOM   968  O OE2 . GLU A 1 136 ? 71.141 -11.227 -1.254 1.00 20.05  ? 117 GLU A OE2 1 
ATOM   969  N N   . ARG A 1 137 ? 75.598 -7.241  1.945  1.00 14.07  ? 118 ARG A N   1 
ATOM   970  C CA  . ARG A 1 137 ? 76.933 -6.733  2.165  1.00 15.03  ? 118 ARG A CA  1 
ATOM   971  C C   . ARG A 1 137 ? 77.177 -6.441  3.635  1.00 16.36  ? 118 ARG A C   1 
ATOM   972  O O   . ARG A 1 137 ? 78.251 -6.766  4.177  1.00 16.73  ? 118 ARG A O   1 
ATOM   973  C CB  . ARG A 1 137 ? 77.160 -5.431  1.359  1.00 16.64  ? 118 ARG A CB  1 
ATOM   974  C CG  . ARG A 1 137 ? 78.520 -4.756  1.636  1.00 18.08  ? 118 ARG A CG  1 
ATOM   975  C CD  . ARG A 1 137 ? 78.879 -3.646  0.627  1.00 21.75  ? 118 ARG A CD  1 
ATOM   976  N NE  . ARG A 1 137 ? 80.075 -2.955  1.111  1.00 24.00  ? 118 ARG A NE  1 
ATOM   977  C CZ  . ARG A 1 137 ? 79.974 -1.817  1.761  1.00 23.91  ? 118 ARG A CZ  1 
ATOM   978  N NH1 . ARG A 1 137 ? 78.751 -1.327  1.903  1.00 23.83  ? 118 ARG A NH1 1 
ATOM   979  N NH2 . ARG A 1 137 ? 81.045 -1.167  2.233  1.00 24.65  ? 118 ARG A NH2 1 
ATOM   980  N N   . ALA A 1 138 ? 76.188 -5.824  4.280  1.00 15.30  ? 119 ALA A N   1 
ATOM   981  C CA  . ALA A 1 138 ? 76.354 -5.502  5.707  1.00 15.52  ? 119 ALA A CA  1 
ATOM   982  C C   . ALA A 1 138 ? 76.449 -6.782  6.535  1.00 14.65  ? 119 ALA A C   1 
ATOM   983  O O   . ALA A 1 138 ? 77.285 -6.894  7.440  1.00 15.45  ? 119 ALA A O   1 
ATOM   984  C CB  . ALA A 1 138 ? 75.206 -4.610  6.212  1.00 16.06  ? 119 ALA A CB  1 
ATOM   985  N N   . PHE A 1 139 ? 75.589 -7.741  6.233  1.00 14.13  ? 120 PHE A N   1 
ATOM   986  C CA  . PHE A 1 139 ? 75.603 -8.973  7.020  1.00 14.73  ? 120 PHE A CA  1 
ATOM   987  C C   . PHE A 1 139 ? 76.907 -9.787  6.786  1.00 14.80  ? 120 PHE A C   1 
ATOM   988  O O   . PHE A 1 139 ? 77.476 -10.340 7.737  1.00 15.30  ? 120 PHE A O   1 
ATOM   989  C CB  . PHE A 1 139 ? 74.364 -9.840  6.738  1.00 14.69  ? 120 PHE A CB  1 
ATOM   990  C CG  . PHE A 1 139 ? 74.403 -11.133 7.502  1.00 13.11  ? 120 PHE A CG  1 
ATOM   991  C CD1 . PHE A 1 139 ? 74.426 -11.087 8.885  1.00 13.90  ? 120 PHE A CD1 1 
ATOM   992  C CD2 . PHE A 1 139 ? 74.538 -12.361 6.862  1.00 13.40  ? 120 PHE A CD2 1 
ATOM   993  C CE1 . PHE A 1 139 ? 74.535 -12.260 9.637  1.00 12.97  ? 120 PHE A CE1 1 
ATOM   994  C CE2 . PHE A 1 139 ? 74.612 -13.559 7.616  1.00 14.46  ? 120 PHE A CE2 1 
ATOM   995  C CZ  . PHE A 1 139 ? 74.649 -13.512 8.989  1.00 13.97  ? 120 PHE A CZ  1 
ATOM   996  N N   . ALA A 1 140 ? 77.412 -9.835  5.550  1.00 15.37  ? 121 ALA A N   1 
ATOM   997  C CA  . ALA A 1 140 ? 78.668 -10.533 5.290  1.00 14.74  ? 121 ALA A CA  1 
ATOM   998  C C   . ALA A 1 140 ? 79.808 -9.882  6.097  1.00 15.24  ? 121 ALA A C   1 
ATOM   999  O O   . ALA A 1 140 ? 80.662 -10.591 6.598  1.00 16.72  ? 121 ALA A O   1 
ATOM   1000 C CB  . ALA A 1 140 ? 78.978 -10.548 3.786  1.00 15.65  ? 121 ALA A CB  1 
ATOM   1001 N N   . ASP A 1 141 ? 79.799 -8.543  6.248  1.00 15.47  ? 122 ASP A N   1 
ATOM   1002 C CA  . ASP A 1 141 ? 80.845 -7.846  7.035  1.00 17.88  ? 122 ASP A CA  1 
ATOM   1003 C C   . ASP A 1 141 ? 80.718 -8.223  8.501  1.00 17.01  ? 122 ASP A C   1 
ATOM   1004 O O   . ASP A 1 141 ? 81.704 -8.559  9.180  1.00 17.05  ? 122 ASP A O   1 
ATOM   1005 C CB  . ASP A 1 141 ? 80.753 -6.302  6.870  1.00 17.64  ? 122 ASP A CB  1 
ATOM   1006 C CG  . ASP A 1 141 ? 81.683 -5.504  7.884  1.00 22.95  ? 122 ASP A CG  1 
ATOM   1007 O OD1 . ASP A 1 141 ? 82.912 -5.354  7.591  1.00 26.43  ? 122 ASP A OD1 1 
ATOM   1008 O OD2 . ASP A 1 141 ? 81.206 -5.014  8.955  1.00 22.54  ? 122 ASP A OD2 1 
ATOM   1009 N N   . LEU A 1 142 ? 79.497 -8.185  8.996  1.00 15.65  ? 123 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 142 ? 79.269 -8.527  10.398 1.00 13.25  ? 123 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 142 ? 79.652 -9.994  10.695 1.00 14.18  ? 123 LEU A C   1 
ATOM   1012 O O   . LEU A 1 142 ? 80.295 -10.285 11.719 1.00 14.50  ? 123 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 142 ? 77.819 -8.297  10.765 1.00 13.73  ? 123 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 142 ? 77.356 -6.848  10.897 1.00 15.00  ? 123 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 142 ? 75.824 -6.771  10.995 1.00 16.66  ? 123 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 142 ? 78.076 -6.150  12.106 1.00 15.94  ? 123 LEU A CD2 1 
ATOM   1017 N N   . TRP A 1 143 ? 79.252 -10.892 9.802  1.00 13.57  ? 124 TRP A N   1 
ATOM   1018 C CA  . TRP A 1 143 ? 79.450 -12.320 10.027 1.00 13.16  ? 124 TRP A CA  1 
ATOM   1019 C C   . TRP A 1 143 ? 80.947 -12.631 10.031 1.00 14.74  ? 124 TRP A C   1 
ATOM   1020 O O   . TRP A 1 143 ? 81.404 -13.481 10.804 1.00 15.45  ? 124 TRP A O   1 
ATOM   1021 C CB  . TRP A 1 143 ? 78.666 -13.118 8.958  1.00 13.38  ? 124 TRP A CB  1 
ATOM   1022 C CG  . TRP A 1 143 ? 78.796 -14.625 9.077  1.00 14.15  ? 124 TRP A CG  1 
ATOM   1023 C CD1 . TRP A 1 143 ? 79.308 -15.469 8.137  1.00 14.74  ? 124 TRP A CD1 1 
ATOM   1024 C CD2 . TRP A 1 143 ? 78.438 -15.437 10.200 1.00 14.70  ? 124 TRP A CD2 1 
ATOM   1025 N NE1 . TRP A 1 143 ? 79.287 -16.772 8.588  1.00 14.86  ? 124 TRP A NE1 1 
ATOM   1026 C CE2 . TRP A 1 143 ? 78.763 -16.776 9.867  1.00 14.92  ? 124 TRP A CE2 1 
ATOM   1027 C CE3 . TRP A 1 143 ? 77.860 -15.161 11.449 1.00 15.06  ? 124 TRP A CE3 1 
ATOM   1028 C CZ2 . TRP A 1 143 ? 78.514 -17.839 10.736 1.00 16.72  ? 124 TRP A CZ2 1 
ATOM   1029 C CZ3 . TRP A 1 143 ? 77.637 -16.211 12.343 1.00 14.38  ? 124 TRP A CZ3 1 
ATOM   1030 C CH2 . TRP A 1 143 ? 77.962 -17.539 11.979 1.00 15.90  ? 124 TRP A CH2 1 
ATOM   1031 N N   . ARG A 1 144 ? 81.717 -11.972 9.165  1.00 15.51  ? 125 ARG A N   1 
ATOM   1032 C CA  . ARG A 1 144 ? 83.167 -12.153 9.136  1.00 15.37  ? 125 ARG A CA  1 
ATOM   1033 C C   . ARG A 1 144 ? 83.735 -11.774 10.488 1.00 15.77  ? 125 ARG A C   1 
ATOM   1034 O O   . ARG A 1 144 ? 84.593 -12.476 11.026 1.00 17.67  ? 125 ARG A O   1 
ATOM   1035 C CB  . ARG A 1 144 ? 83.815 -11.294 8.034  1.00 18.68  ? 125 ARG A CB  1 
ATOM   1036 C CG  . ARG A 1 144 ? 85.318 -11.331 8.038  1.00 21.82  ? 125 ARG A CG  1 
ATOM   1037 C CD  . ARG A 1 144 ? 85.927 -10.274 7.055  1.00 28.70  ? 125 ARG A CD  1 
ATOM   1038 N NE  . ARG A 1 144 ? 85.898 -8.884  7.557  1.00 34.28  ? 125 ARG A NE  1 
ATOM   1039 C CZ  . ARG A 1 144 ? 86.637 -8.441  8.584  1.00 36.97  ? 125 ARG A CZ  1 
ATOM   1040 N NH1 . ARG A 1 144 ? 87.455 -9.271  9.228  1.00 39.80  ? 125 ARG A NH1 1 
ATOM   1041 N NH2 . ARG A 1 144 ? 86.550 -7.179  8.988  1.00 36.48  ? 125 ARG A NH2 1 
ATOM   1042 N N   . ARG A 1 145 ? 83.263 -10.655 11.027 1.00 13.80  ? 126 ARG A N   1 
ATOM   1043 C CA  . ARG A 1 145 ? 83.782 -10.174 12.311 1.00 14.25  ? 126 ARG A CA  1 
ATOM   1044 C C   . ARG A 1 145 ? 83.315 -11.048 13.488 1.00 14.85  ? 126 ARG A C   1 
ATOM   1045 O O   . ARG A 1 145 ? 84.085 -11.315 14.432 1.00 14.90  ? 126 ARG A O   1 
ATOM   1046 C CB  . ARG A 1 145 ? 83.386 -8.700  12.522 1.00 13.62  ? 126 ARG A CB  1 
ATOM   1047 C CG  . ARG A 1 145 ? 84.079 -7.756  11.531 1.00 14.66  ? 126 ARG A CG  1 
ATOM   1048 C CD  . ARG A 1 145 ? 83.284 -6.464  11.313 1.00 14.57  ? 126 ARG A CD  1 
ATOM   1049 N NE  . ARG A 1 145 ? 83.319 -5.656  12.518 1.00 15.08  ? 126 ARG A NE  1 
ATOM   1050 C CZ  . ARG A 1 145 ? 82.509 -4.619  12.747 1.00 15.70  ? 126 ARG A CZ  1 
ATOM   1051 N NH1 . ARG A 1 145 ? 81.549 -4.302  11.869 1.00 16.84  ? 126 ARG A NH1 1 
ATOM   1052 N NH2 . ARG A 1 145 ? 82.636 -3.928  13.877 1.00 15.25  ? 126 ARG A NH2 1 
ATOM   1053 N N   . ILE A 1 146 ? 82.068 -11.508 13.414 1.00 13.12  ? 127 ILE A N   1 
ATOM   1054 C CA  . ILE A 1 146 ? 81.489 -12.329 14.484 1.00 13.21  ? 127 ILE A CA  1 
ATOM   1055 C C   . ILE A 1 146 ? 82.229 -13.639 14.632 1.00 13.57  ? 127 ILE A C   1 
ATOM   1056 O O   . ILE A 1 146 ? 82.442 -14.104 15.767 1.00 14.28  ? 127 ILE A O   1 
ATOM   1057 C CB  . ILE A 1 146 ? 79.954 -12.577 14.221 1.00 12.73  ? 127 ILE A CB  1 
ATOM   1058 C CG1 . ILE A 1 146 ? 79.148 -11.291 14.519 1.00 12.30  ? 127 ILE A CG1 1 
ATOM   1059 C CG2 . ILE A 1 146 ? 79.377 -13.749 15.023 1.00 12.67  ? 127 ILE A CG2 1 
ATOM   1060 C CD1 . ILE A 1 146 ? 77.754 -11.301 13.912 1.00 13.32  ? 127 ILE A CD1 1 
ATOM   1061 N N   . THR A 1 147 ? 82.618 -14.261 13.507 1.00 14.66  ? 128 THR A N   1 
ATOM   1062 C CA  . THR A 1 147 ? 83.237 -15.577 13.598 1.00 14.59  ? 128 THR A CA  1 
ATOM   1063 C C   . THR A 1 147 ? 84.738 -15.542 13.899 1.00 15.14  ? 128 THR A C   1 
ATOM   1064 O O   . THR A 1 147 ? 85.314 -16.586 14.227 1.00 17.42  ? 128 THR A O   1 
ATOM   1065 C CB  . THR A 1 147 ? 82.981 -16.376 12.311 1.00 16.37  ? 128 THR A CB  1 
ATOM   1066 O OG1 . THR A 1 147 ? 83.469 -15.642 11.172 1.00 18.57  ? 128 THR A OG1 1 
ATOM   1067 C CG2 . THR A 1 147 ? 81.476 -16.655 12.144 1.00 17.53  ? 128 THR A CG2 1 
ATOM   1068 N N   . LEU A 1 148 ? 85.354 -14.361 13.848 1.00 15.26  ? 129 LEU A N   1 
ATOM   1069 C CA  . LEU A 1 148 ? 86.779 -14.246 14.187 1.00 17.15  ? 129 LEU A CA  1 
ATOM   1070 C C   . LEU A 1 148 ? 87.108 -14.839 15.549 1.00 19.11  ? 129 LEU A C   1 
ATOM   1071 O O   . LEU A 1 148 ? 86.477 -14.469 16.575 1.00 19.75  ? 129 LEU A O   1 
ATOM   1072 C CB  . LEU A 1 148 ? 87.217 -12.765 14.186 1.00 20.49  ? 129 LEU A CB  1 
ATOM   1073 C CG  . LEU A 1 148 ? 87.348 -12.072 12.851 1.00 26.93  ? 129 LEU A CG  1 
ATOM   1074 C CD1 . LEU A 1 148 ? 87.503 -10.579 13.068 1.00 27.48  ? 129 LEU A CD1 1 
ATOM   1075 C CD2 . LEU A 1 148 ? 88.573 -12.615 12.180 1.00 29.97  ? 129 LEU A CD2 1 
ATOM   1076 N N   . GLY A 1 149 ? 88.102 -15.729 15.569 1.00 16.49  ? 130 GLY A N   1 
ATOM   1077 C CA  . GLY A 1 149 ? 88.578 -16.289 16.830 1.00 17.12  ? 130 GLY A CA  1 
ATOM   1078 C C   . GLY A 1 149 ? 87.671 -17.338 17.481 1.00 16.13  ? 130 GLY A C   1 
ATOM   1079 O O   . GLY A 1 149 ? 87.982 -17.827 18.582 1.00 18.64  ? 130 GLY A O   1 
ATOM   1080 N N   . MET A 1 150 ? 86.558 -17.704 16.832 1.00 14.32  ? 131 MET A N   1 
ATOM   1081 C CA  . MET A 1 150 ? 85.628 -18.676 17.412 1.00 14.95  ? 131 MET A CA  1 
ATOM   1082 C C   . MET A 1 150 ? 85.825 -20.011 16.721 1.00 14.34  ? 131 MET A C   1 
ATOM   1083 O O   . MET A 1 150 ? 86.207 -20.054 15.528 1.00 15.01  ? 131 MET A O   1 
ATOM   1084 C CB  . MET A 1 150 ? 84.158 -18.235 17.267 1.00 13.79  ? 131 MET A CB  1 
ATOM   1085 C CG  . MET A 1 150 ? 83.883 -16.838 17.793 1.00 13.11  ? 131 MET A CG  1 
ATOM   1086 S SD  . MET A 1 150 ? 84.392 -16.607 19.537 1.00 14.45  ? 131 MET A SD  1 
ATOM   1087 C CE  . MET A 1 150 ? 83.087 -17.471 20.397 1.00 14.47  ? 131 MET A CE  1 
ATOM   1088 N N   . THR A 1 151 ? 85.629 -21.100 17.463 1.00 14.03  ? 132 THR A N   1 
ATOM   1089 C CA  . THR A 1 151 ? 85.746 -22.452 16.845 1.00 14.11  ? 132 THR A CA  1 
ATOM   1090 C C   . THR A 1 151 ? 84.701 -22.704 15.777 1.00 15.14  ? 132 THR A C   1 
ATOM   1091 O O   . THR A 1 151 ? 83.625 -22.100 15.812 1.00 13.95  ? 132 THR A O   1 
ATOM   1092 C CB  . THR A 1 151 ? 85.614 -23.605 17.877 1.00 14.36  ? 132 THR A CB  1 
ATOM   1093 O OG1 . THR A 1 151 ? 84.296 -23.628 18.433 1.00 13.18  ? 132 THR A OG1 1 
ATOM   1094 C CG2 . THR A 1 151 ? 86.677 -23.440 18.983 1.00 14.77  ? 132 THR A CG2 1 
ATOM   1095 N N   . ASP A 1 152 ? 85.011 -23.603 14.829 1.00 15.40  ? 133 ASP A N   1 
ATOM   1096 C CA  . ASP A 1 152 ? 84.011 -23.999 13.829 1.00 15.59  ? 133 ASP A CA  1 
ATOM   1097 C C   . ASP A 1 152 ? 82.771 -24.624 14.498 1.00 15.20  ? 133 ASP A C   1 
ATOM   1098 O O   . ASP A 1 152 ? 81.639 -24.534 14.003 1.00 15.83  ? 133 ASP A O   1 
ATOM   1099 C CB  . ASP A 1 152 ? 84.604 -24.982 12.821 1.00 19.39  ? 133 ASP A CB  1 
ATOM   1100 C CG  . ASP A 1 152 ? 85.589 -24.338 11.863 1.00 22.55  ? 133 ASP A CG  1 
ATOM   1101 O OD1 . ASP A 1 152 ? 85.687 -23.089 11.797 1.00 24.95  ? 133 ASP A OD1 1 
ATOM   1102 O OD2 . ASP A 1 152 ? 86.235 -25.105 11.107 1.00 25.04  ? 133 ASP A OD2 1 
ATOM   1103 N N   . ARG A 1 153 ? 82.987 -25.279 15.618 1.00 14.60  ? 134 ARG A N   1 
ATOM   1104 C CA  . ARG A 1 153 ? 81.889 -25.848 16.412 1.00 15.39  ? 134 ARG A CA  1 
ATOM   1105 C C   . ARG A 1 153 ? 80.910 -24.779 16.985 1.00 14.38  ? 134 ARG A C   1 
ATOM   1106 O O   . ARG A 1 153 ? 79.676 -24.922 16.907 1.00 12.40  ? 134 ARG A O   1 
ATOM   1107 C CB  . ARG A 1 153 ? 82.502 -26.691 17.530 1.00 15.31  ? 134 ARG A CB  1 
ATOM   1108 C CG  . ARG A 1 153 ? 81.556 -27.281 18.489 1.00 16.10  ? 134 ARG A CG  1 
ATOM   1109 C CD  . ARG A 1 153 ? 82.319 -28.350 19.247 1.00 17.44  ? 134 ARG A CD  1 
ATOM   1110 N NE  . ARG A 1 153 ? 81.590 -28.779 20.425 1.00 17.44  ? 134 ARG A NE  1 
ATOM   1111 C CZ  . ARG A 1 153 ? 82.091 -29.533 21.411 1.00 17.34  ? 134 ARG A CZ  1 
ATOM   1112 N NH1 . ARG A 1 153 ? 83.337 -30.039 21.353 1.00 18.95  ? 134 ARG A NH1 1 
ATOM   1113 N NH2 . ARG A 1 153 ? 81.320 -29.815 22.440 1.00 16.93  ? 134 ARG A NH2 1 
ATOM   1114 N N   . TRP A 1 154 ? 81.456 -23.707 17.559 1.00 13.10  ? 135 TRP A N   1 
ATOM   1115 C CA  . TRP A 1 154 ? 80.628 -22.567 17.942 1.00 12.49  ? 135 TRP A CA  1 
ATOM   1116 C C   . TRP A 1 154 ? 79.913 -21.955 16.705 1.00 11.77  ? 135 TRP A C   1 
ATOM   1117 O O   . TRP A 1 154 ? 78.720 -21.645 16.743 1.00 10.92  ? 135 TRP A O   1 
ATOM   1118 C CB  . TRP A 1 154 ? 81.477 -21.514 18.649 1.00 12.74  ? 135 TRP A CB  1 
ATOM   1119 C CG  . TRP A 1 154 ? 80.707 -20.307 19.105 1.00 12.31  ? 135 TRP A CG  1 
ATOM   1120 C CD1 . TRP A 1 154 ? 80.127 -20.115 20.338 1.00 12.57  ? 135 TRP A CD1 1 
ATOM   1121 C CD2 . TRP A 1 154 ? 80.485 -19.091 18.372 1.00 11.08  ? 135 TRP A CD2 1 
ATOM   1122 N NE1 . TRP A 1 154 ? 79.549 -18.857 20.411 1.00 11.43  ? 135 TRP A NE1 1 
ATOM   1123 C CE2 . TRP A 1 154 ? 79.714 -18.229 19.202 1.00 11.78  ? 135 TRP A CE2 1 
ATOM   1124 C CE3 . TRP A 1 154 ? 80.794 -18.674 17.064 1.00 12.72  ? 135 TRP A CE3 1 
ATOM   1125 C CZ2 . TRP A 1 154 ? 79.325 -16.933 18.790 1.00 12.33  ? 135 TRP A CZ2 1 
ATOM   1126 C CZ3 . TRP A 1 154 ? 80.406 -17.380 16.656 1.00 13.94  ? 135 TRP A CZ3 1 
ATOM   1127 C CH2 . TRP A 1 154 ? 79.672 -16.539 17.513 1.00 12.13  ? 135 TRP A CH2 1 
ATOM   1128 N N   . ARG A 1 155 ? 80.665 -21.784 15.632 1.00 12.53  ? 136 ARG A N   1 
ATOM   1129 C CA  . ARG A 1 155 ? 80.139 -21.213 14.399 1.00 13.97  ? 136 ARG A CA  1 
ATOM   1130 C C   . ARG A 1 155 ? 78.948 -22.004 13.884 1.00 12.76  ? 136 ARG A C   1 
ATOM   1131 O O   . ARG A 1 155 ? 78.017 -21.406 13.320 1.00 13.40  ? 136 ARG A O   1 
ATOM   1132 C CB  . ARG A 1 155 ? 81.223 -21.131 13.332 1.00 15.80  ? 136 ARG A CB  1 
ATOM   1133 C CG  . ARG A 1 155 ? 80.757 -20.338 12.067 1.00 19.76  ? 136 ARG A CG  1 
ATOM   1134 C CD  . ARG A 1 155 ? 81.885 -20.307 11.031 1.00 23.80  ? 136 ARG A CD  1 
ATOM   1135 N NE  . ARG A 1 155 ? 82.172 -21.658 10.575 1.00 28.20  ? 136 ARG A NE  1 
ATOM   1136 C CZ  . ARG A 1 155 ? 83.141 -21.980 9.722  1.00 30.69  ? 136 ARG A CZ  1 
ATOM   1137 N NH1 . ARG A 1 155 ? 83.939 -21.045 9.217  1.00 31.08  ? 136 ARG A NH1 1 
ATOM   1138 N NH2 . ARG A 1 155 ? 83.306 -23.251 9.375  1.00 32.75  ? 136 ARG A NH2 1 
ATOM   1139 N N   . ALA A 1 156 ? 78.966 -23.341 14.045 1.00 11.74  ? 137 ALA A N   1 
ATOM   1140 C CA  . ALA A 1 156 ? 77.832 -24.114 13.584 1.00 11.44  ? 137 ALA A CA  1 
ATOM   1141 C C   . ALA A 1 156 ? 76.544 -23.700 14.286 1.00 11.95  ? 137 ALA A C   1 
ATOM   1142 O O   . ALA A 1 156 ? 75.503 -23.484 13.620 1.00 11.17  ? 137 ALA A O   1 
ATOM   1143 C CB  . ALA A 1 156 ? 78.097 -25.612 13.781 1.00 13.60  ? 137 ALA A CB  1 
ATOM   1144 N N   . ARG A 1 157 ? 76.588 -23.523 15.612 1.00 10.41  ? 138 ARG A N   1 
ATOM   1145 C CA  . ARG A 1 157 ? 75.357 -23.109 16.317 1.00 8.80   ? 138 ARG A CA  1 
ATOM   1146 C C   . ARG A 1 157 ? 75.043 -21.646 15.967 1.00 10.02  ? 138 ARG A C   1 
ATOM   1147 O O   . ARG A 1 157 ? 73.887 -21.313 15.775 1.00 10.73  ? 138 ARG A O   1 
ATOM   1148 C CB  . ARG A 1 157 ? 75.455 -23.240 17.848 1.00 10.85  ? 138 ARG A CB  1 
ATOM   1149 C CG  . ARG A 1 157 ? 74.081 -23.011 18.521 1.00 11.87  ? 138 ARG A CG  1 
ATOM   1150 C CD  . ARG A 1 157 ? 74.125 -22.948 20.036 1.00 12.29  ? 138 ARG A CD  1 
ATOM   1151 N NE  . ARG A 1 157 ? 74.764 -21.716 20.523 1.00 11.77  ? 138 ARG A NE  1 
ATOM   1152 C CZ  . ARG A 1 157 ? 75.936 -21.658 21.170 1.00 13.33  ? 138 ARG A CZ  1 
ATOM   1153 N NH1 . ARG A 1 157 ? 76.389 -20.458 21.552 1.00 13.77  ? 138 ARG A NH1 1 
ATOM   1154 N NH2 . ARG A 1 157 ? 76.639 -22.768 21.466 1.00 15.63  ? 138 ARG A NH2 1 
ATOM   1155 N N   . ALA A 1 158 ? 76.057 -20.786 15.944 1.00 10.73  ? 139 ALA A N   1 
ATOM   1156 C CA  . ALA A 1 158 ? 75.811 -19.370 15.633 1.00 10.73  ? 139 ALA A CA  1 
ATOM   1157 C C   . ALA A 1 158 ? 75.143 -19.237 14.238 1.00 11.54  ? 139 ALA A C   1 
ATOM   1158 O O   . ALA A 1 158 ? 74.223 -18.424 14.058 1.00 11.90  ? 139 ALA A O   1 
ATOM   1159 C CB  . ALA A 1 158 ? 77.149 -18.553 15.711 1.00 12.76  ? 139 ALA A CB  1 
ATOM   1160 N N   . ALA A 1 159 ? 75.605 -20.028 13.267 1.00 10.69  ? 140 ALA A N   1 
ATOM   1161 C CA  . ALA A 1 159 ? 75.056 -19.963 11.904 1.00 9.64   ? 140 ALA A CA  1 
ATOM   1162 C C   . ALA A 1 159 ? 73.605 -20.455 11.931 1.00 10.13  ? 140 ALA A C   1 
ATOM   1163 O O   . ALA A 1 159 ? 72.716 -19.857 11.301 1.00 12.21  ? 140 ALA A O   1 
ATOM   1164 C CB  . ALA A 1 159 ? 75.926 -20.817 10.908 1.00 12.24  ? 140 ALA A CB  1 
ATOM   1165 N N   . CYS A 1 160 ? 73.350 -21.555 12.665 1.00 9.76   ? 141 CYS A N   1 
ATOM   1166 C CA  . CYS A 1 160 ? 71.948 -22.010 12.762 1.00 10.43  ? 141 CYS A CA  1 
ATOM   1167 C C   . CYS A 1 160 ? 71.020 -21.004 13.433 1.00 11.17  ? 141 CYS A C   1 
ATOM   1168 O O   . CYS A 1 160 ? 69.857 -20.895 13.058 1.00 11.82  ? 141 CYS A O   1 
ATOM   1169 C CB  . CYS A 1 160 ? 71.857 -23.346 13.509 1.00 11.82  ? 141 CYS A CB  1 
ATOM   1170 S SG  . CYS A 1 160 ? 72.615 -24.730 12.567 1.00 14.40  ? 141 CYS A SG  1 
ATOM   1171 N N   . ASN A 1 161 ? 71.527 -20.263 14.423 1.00 11.06  ? 142 ASN A N   1 
ATOM   1172 C CA  . ASN A 1 161 ? 70.691 -19.247 15.038 1.00 10.23  ? 142 ASN A CA  1 
ATOM   1173 C C   . ASN A 1 161 ? 70.437 -18.046 14.122 1.00 11.46  ? 142 ASN A C   1 
ATOM   1174 O O   . ASN A 1 161 ? 69.357 -17.460 14.188 1.00 12.21  ? 142 ASN A O   1 
ATOM   1175 C CB  . ASN A 1 161 ? 71.296 -18.785 16.381 1.00 10.79  ? 142 ASN A CB  1 
ATOM   1176 C CG  . ASN A 1 161 ? 71.062 -19.827 17.488 1.00 11.08  ? 142 ASN A CG  1 
ATOM   1177 O OD1 . ASN A 1 161 ? 70.084 -20.582 17.433 1.00 13.63  ? 142 ASN A OD1 1 
ATOM   1178 N ND2 . ASN A 1 161 ? 71.943 -19.866 18.490 1.00 10.56  ? 142 ASN A ND2 1 
ATOM   1179 N N   . TRP A 1 162 ? 71.401 -17.707 13.280 1.00 10.53  ? 143 TRP A N   1 
ATOM   1180 C CA  . TRP A 1 162 ? 71.165 -16.663 12.258 1.00 10.94  ? 143 TRP A CA  1 
ATOM   1181 C C   . TRP A 1 162 ? 70.110 -17.138 11.248 1.00 11.78  ? 143 TRP A C   1 
ATOM   1182 O O   . TRP A 1 162 ? 69.202 -16.389 10.848 1.00 12.56  ? 143 TRP A O   1 
ATOM   1183 C CB  . TRP A 1 162 ? 72.481 -16.291 11.538 1.00 11.96  ? 143 TRP A CB  1 
ATOM   1184 C CG  . TRP A 1 162 ? 73.185 -15.166 12.242 1.00 12.06  ? 143 TRP A CG  1 
ATOM   1185 C CD1 . TRP A 1 162 ? 74.293 -15.263 13.064 1.00 12.92  ? 143 TRP A CD1 1 
ATOM   1186 C CD2 . TRP A 1 162 ? 72.812 -13.780 12.243 1.00 12.93  ? 143 TRP A CD2 1 
ATOM   1187 N NE1 . TRP A 1 162 ? 74.609 -14.013 13.573 1.00 13.83  ? 143 TRP A NE1 1 
ATOM   1188 C CE2 . TRP A 1 162 ? 73.727 -13.097 13.081 1.00 13.41  ? 143 TRP A CE2 1 
ATOM   1189 C CE3 . TRP A 1 162 ? 71.783 -13.058 11.641 1.00 13.01  ? 143 TRP A CE3 1 
ATOM   1190 C CZ2 . TRP A 1 162 ? 73.662 -11.725 13.301 1.00 14.81  ? 143 TRP A CZ2 1 
ATOM   1191 C CZ3 . TRP A 1 162 ? 71.724 -11.702 11.836 1.00 14.42  ? 143 TRP A CZ3 1 
ATOM   1192 C CH2 . TRP A 1 162 ? 72.660 -11.049 12.674 1.00 14.84  ? 143 TRP A CH2 1 
ATOM   1193 N N   . GLU A 1 163 ? 70.245 -18.385 10.813 1.00 11.13  ? 144 GLU A N   1 
ATOM   1194 C CA  . GLU A 1 163 ? 69.267 -18.978 9.880  1.00 12.76  ? 144 GLU A CA  1 
ATOM   1195 C C   . GLU A 1 163 ? 67.852 -18.948 10.479 1.00 12.30  ? 144 GLU A C   1 
ATOM   1196 O O   . GLU A 1 163 ? 66.883 -18.647 9.799  1.00 12.02  ? 144 GLU A O   1 
ATOM   1197 C CB  . GLU A 1 163 ? 69.689 -20.420 9.533  1.00 12.44  ? 144 GLU A CB  1 
ATOM   1198 C CG  . GLU A 1 163 ? 68.663 -21.189 8.698  1.00 14.41  ? 144 GLU A CG  1 
ATOM   1199 C CD  . GLU A 1 163 ? 69.262 -22.465 8.118  1.00 17.34  ? 144 GLU A CD  1 
ATOM   1200 O OE1 . GLU A 1 163 ? 68.608 -23.104 7.269  1.00 16.32  ? 144 GLU A OE1 1 
ATOM   1201 O OE2 . GLU A 1 163 ? 70.314 -22.893 8.636  1.00 20.75  ? 144 GLU A OE2 1 
ATOM   1202 N N   . TYR A 1 164 ? 67.732 -19.345 11.766 1.00 10.65  ? 145 TYR A N   1 
ATOM   1203 C CA  . TYR A 1 164 ? 66.458 -19.257 12.507 1.00 11.00  ? 145 TYR A CA  1 
ATOM   1204 C C   . TYR A 1 164 ? 65.838 -17.838 12.412 1.00 12.11  ? 145 TYR A C   1 
ATOM   1205 O O   . TYR A 1 164 ? 64.689 -17.660 12.005 1.00 12.06  ? 145 TYR A O   1 
ATOM   1206 C CB  . TYR A 1 164 ? 66.728 -19.628 13.960 1.00 10.89  ? 145 TYR A CB  1 
ATOM   1207 C CG  . TYR A 1 164 ? 65.647 -19.500 15.002 1.00 11.67  ? 145 TYR A CG  1 
ATOM   1208 C CD1 . TYR A 1 164 ? 64.289 -19.620 14.718 1.00 13.44  ? 145 TYR A CD1 1 
ATOM   1209 C CD2 . TYR A 1 164 ? 66.013 -19.312 16.333 1.00 13.78  ? 145 TYR A CD2 1 
ATOM   1210 C CE1 . TYR A 1 164 ? 63.333 -19.554 15.754 1.00 14.37  ? 145 TYR A CE1 1 
ATOM   1211 C CE2 . TYR A 1 164 ? 65.084 -19.224 17.323 1.00 13.70  ? 145 TYR A CE2 1 
ATOM   1212 C CZ  . TYR A 1 164 ? 63.750 -19.347 17.055 1.00 13.95  ? 145 TYR A CZ  1 
ATOM   1213 O OH  . TYR A 1 164 ? 62.858 -19.268 18.124 1.00 14.29  ? 145 TYR A OH  1 
ATOM   1214 N N   . TYR A 1 165 ? 66.636 -16.827 12.757 1.00 12.45  ? 146 TYR A N   1 
ATOM   1215 C CA  . TYR A 1 165 ? 66.213 -15.423 12.634 1.00 12.10  ? 146 TYR A CA  1 
ATOM   1216 C C   . TYR A 1 165 ? 65.734 -15.089 11.215 1.00 12.64  ? 146 TYR A C   1 
ATOM   1217 O O   . TYR A 1 165 ? 64.614 -14.587 11.031 1.00 14.16  ? 146 TYR A O   1 
ATOM   1218 C CB  . TYR A 1 165 ? 67.356 -14.489 13.040 1.00 12.29  ? 146 TYR A CB  1 
ATOM   1219 C CG  . TYR A 1 165 ? 67.133 -13.024 12.732 1.00 13.20  ? 146 TYR A CG  1 
ATOM   1220 C CD1 . TYR A 1 165 ? 66.240 -12.274 13.477 1.00 13.18  ? 146 TYR A CD1 1 
ATOM   1221 C CD2 . TYR A 1 165 ? 67.860 -12.391 11.739 1.00 12.39  ? 146 TYR A CD2 1 
ATOM   1222 C CE1 . TYR A 1 165 ? 66.065 -10.921 13.209 1.00 12.32  ? 146 TYR A CE1 1 
ATOM   1223 C CE2 . TYR A 1 165 ? 67.680 -11.068 11.465 1.00 13.62  ? 146 TYR A CE2 1 
ATOM   1224 C CZ  . TYR A 1 165 ? 66.804 -10.335 12.197 1.00 12.52  ? 146 TYR A CZ  1 
ATOM   1225 O OH  . TYR A 1 165 ? 66.677 -8.985  11.896 1.00 14.37  ? 146 TYR A OH  1 
ATOM   1226 N N   . PHE A 1 166 ? 66.587 -15.332 10.225 1.00 11.73  ? 147 PHE A N   1 
ATOM   1227 C CA  . PHE A 1 166 ? 66.197 -14.929 8.856  1.00 12.41  ? 147 PHE A CA  1 
ATOM   1228 C C   . PHE A 1 166 ? 64.925 -15.676 8.437  1.00 12.37  ? 147 PHE A C   1 
ATOM   1229 O O   . PHE A 1 166 ? 63.992 -15.115 7.829  1.00 13.71  ? 147 PHE A O   1 
ATOM   1230 C CB  . PHE A 1 166 ? 67.336 -15.209 7.864  1.00 12.72  ? 147 PHE A CB  1 
ATOM   1231 C CG  . PHE A 1 166 ? 68.546 -14.307 8.013  1.00 15.60  ? 147 PHE A CG  1 
ATOM   1232 C CD1 . PHE A 1 166 ? 68.401 -12.926 8.068  1.00 16.18  ? 147 PHE A CD1 1 
ATOM   1233 C CD2 . PHE A 1 166 ? 69.828 -14.846 8.093  1.00 15.71  ? 147 PHE A CD2 1 
ATOM   1234 C CE1 . PHE A 1 166 ? 69.545 -12.060 8.190  1.00 17.06  ? 147 PHE A CE1 1 
ATOM   1235 C CE2 . PHE A 1 166 ? 70.961 -14.032 8.207  1.00 17.07  ? 147 PHE A CE2 1 
ATOM   1236 C CZ  . PHE A 1 166 ? 70.835 -12.628 8.261  1.00 17.20  ? 147 PHE A CZ  1 
ATOM   1237 N N   . ALA A 1 167 ? 64.902 -16.968 8.748  1.00 11.60  ? 148 ALA A N   1 
ATOM   1238 C CA  . ALA A 1 167 ? 63.841 -17.846 8.251  1.00 11.70  ? 148 ALA A CA  1 
ATOM   1239 C C   . ALA A 1 167 ? 62.443 -17.570 8.811  1.00 13.63  ? 148 ALA A C   1 
ATOM   1240 O O   . ALA A 1 167 ? 61.457 -18.039 8.238  1.00 14.53  ? 148 ALA A O   1 
ATOM   1241 C CB  . ALA A 1 167 ? 64.219 -19.324 8.549  1.00 12.79  ? 148 ALA A CB  1 
ATOM   1242 N N   . CYS A 1 168 ? 62.345 -16.861 9.940  1.00 14.03  ? 149 CYS A N   1 
ATOM   1243 C CA  . CYS A 1 168 ? 61.051 -16.506 10.516 1.00 15.84  ? 149 CYS A CA  1 
ATOM   1244 C C   . CYS A 1 168 ? 60.387 -15.356 9.795  1.00 15.23  ? 149 CYS A C   1 
ATOM   1245 O O   . CYS A 1 168 ? 59.207 -15.097 10.000 1.00 15.08  ? 149 CYS A O   1 
ATOM   1246 C CB  . CYS A 1 168 ? 61.194 -16.099 12.015 1.00 16.05  ? 149 CYS A CB  1 
ATOM   1247 S SG  . CYS A 1 168 ? 61.553 -17.538 13.089 1.00 17.34  ? 149 CYS A SG  1 
ATOM   1248 N N   . HIS A 1 169 ? 61.144 -14.649 8.968  1.00 14.91  ? 150 HIS A N   1 
ATOM   1249 C CA  . HIS A 1 169 ? 60.587 -13.404 8.401  1.00 15.43  ? 150 HIS A CA  1 
ATOM   1250 C C   . HIS A 1 169 ? 59.473 -13.620 7.369  1.00 16.04  ? 150 HIS A C   1 
ATOM   1251 O O   . HIS A 1 169 ? 58.550 -12.825 7.350  1.00 17.37  ? 150 HIS A O   1 
ATOM   1252 C CB  . HIS A 1 169 ? 61.720 -12.519 7.838  1.00 17.25  ? 150 HIS A CB  1 
ATOM   1253 C CG  . HIS A 1 169 ? 62.488 -11.794 8.918  1.00 16.08  ? 150 HIS A CG  1 
ATOM   1254 N ND1 . HIS A 1 169 ? 63.404 -12.421 9.742  1.00 17.55  ? 150 HIS A ND1 1 
ATOM   1255 C CD2 . HIS A 1 169 ? 62.392 -10.517 9.373  1.00 17.05  ? 150 HIS A CD2 1 
ATOM   1256 C CE1 . HIS A 1 169 ? 63.871 -11.554 10.627 1.00 17.82  ? 150 HIS A CE1 1 
ATOM   1257 N NE2 . HIS A 1 169 ? 63.298 -10.386 10.407 1.00 18.33  ? 150 HIS A NE2 1 
ATOM   1258 N N   . PRO A 1 170 ? 59.517 -14.692 6.544  1.00 16.19  ? 151 PRO A N   1 
ATOM   1259 C CA  . PRO A 1 170 ? 58.349 -14.892 5.654  1.00 16.40  ? 151 PRO A CA  1 
ATOM   1260 C C   . PRO A 1 170 ? 57.058 -15.130 6.433  1.00 17.25  ? 151 PRO A C   1 
ATOM   1261 O O   . PRO A 1 170 ? 56.000 -14.626 6.020  1.00 17.75  ? 151 PRO A O   1 
ATOM   1262 C CB  . PRO A 1 170 ? 58.749 -16.123 4.809  1.00 14.84  ? 151 PRO A CB  1 
ATOM   1263 C CG  . PRO A 1 170 ? 60.273 -15.964 4.706  1.00 14.43  ? 151 PRO A CG  1 
ATOM   1264 C CD  . PRO A 1 170 ? 60.658 -15.524 6.134  1.00 15.22  ? 151 PRO A CD  1 
ATOM   1265 N N   . ALA A 1 171 ? 57.118 -15.904 7.529  1.00 17.36  ? 152 ALA A N   1 
ATOM   1266 C CA  . ALA A 1 171 ? 55.917 -16.088 8.342  1.00 17.91  ? 152 ALA A CA  1 
ATOM   1267 C C   . ALA A 1 171 ? 55.396 -14.749 8.886  1.00 17.88  ? 152 ALA A C   1 
ATOM   1268 O O   . ALA A 1 171 ? 54.181 -14.511 8.915  1.00 19.43  ? 152 ALA A O   1 
ATOM   1269 C CB  . ALA A 1 171 ? 56.194 -17.036 9.478  1.00 18.22  ? 152 ALA A CB  1 
ATOM   1270 N N   . GLU A 1 172 ? 56.308 -13.891 9.340  1.00 17.55  ? 153 GLU A N   1 
ATOM   1271 C CA  A GLU A 1 172 ? 55.946 -12.573 9.859  0.50 20.36  ? 153 GLU A CA  1 
ATOM   1272 C CA  B GLU A 1 172 ? 55.934 -12.584 9.868  0.50 18.55  ? 153 GLU A CA  1 
ATOM   1273 C C   . GLU A 1 172 ? 55.225 -11.753 8.794  1.00 21.03  ? 153 GLU A C   1 
ATOM   1274 O O   . GLU A 1 172 ? 54.204 -11.121 9.056  1.00 21.99  ? 153 GLU A O   1 
ATOM   1275 C CB  A GLU A 1 172 ? 57.199 -11.835 10.335 0.50 23.17  ? 153 GLU A CB  1 
ATOM   1276 C CB  B GLU A 1 172 ? 57.183 -11.871 10.382 0.50 17.92  ? 153 GLU A CB  1 
ATOM   1277 C CG  A GLU A 1 172 ? 56.961 -10.378 10.752 0.50 26.52  ? 153 GLU A CG  1 
ATOM   1278 C CG  B GLU A 1 172 ? 56.930 -10.585 11.168 0.50 18.38  ? 153 GLU A CG  1 
ATOM   1279 C CD  A GLU A 1 172 ? 56.509 -10.248 12.190 0.50 29.97  ? 153 GLU A CD  1 
ATOM   1280 C CD  B GLU A 1 172 ? 58.238 -9.921  11.586 0.50 18.79  ? 153 GLU A CD  1 
ATOM   1281 O OE1 A GLU A 1 172 ? 57.170 -9.505  12.953 0.50 30.94  ? 153 GLU A OE1 1 
ATOM   1282 O OE1 B GLU A 1 172 ? 59.220 -9.991  10.822 0.50 21.14  ? 153 GLU A OE1 1 
ATOM   1283 O OE2 A GLU A 1 172 ? 55.487 -10.872 12.553 0.50 31.88  ? 153 GLU A OE2 1 
ATOM   1284 O OE2 B GLU A 1 172 ? 58.296 -9.318  12.665 0.50 19.88  ? 153 GLU A OE2 1 
ATOM   1285 N N   . ALA A 1 173 ? 55.762 -11.782 7.579  1.00 21.36  ? 154 ALA A N   1 
ATOM   1286 C CA  . ALA A 1 173 ? 55.134 -11.089 6.447  1.00 22.50  ? 154 ALA A CA  1 
ATOM   1287 C C   . ALA A 1 173 ? 53.744 -11.632 6.149  1.00 23.81  ? 154 ALA A C   1 
ATOM   1288 O O   . ALA A 1 173 ? 52.814 -10.860 5.886  1.00 24.71  ? 154 ALA A O   1 
ATOM   1289 C CB  . ALA A 1 173 ? 56.004 -11.200 5.209  1.00 21.42  ? 154 ALA A CB  1 
ATOM   1290 N N   . ALA A 1 174 ? 53.600 -12.957 6.132  1.00 25.40  ? 155 ALA A N   1 
ATOM   1291 C CA  . ALA A 1 174 ? 52.276 -13.564 5.919  1.00 27.76  ? 155 ALA A CA  1 
ATOM   1292 C C   . ALA A 1 174 ? 51.278 -13.102 6.979  1.00 30.75  ? 155 ALA A C   1 
ATOM   1293 O O   . ALA A 1 174 ? 50.105 -12.876 6.673  1.00 32.56  ? 155 ALA A O   1 
ATOM   1294 C CB  . ALA A 1 174 ? 52.367 -15.105 5.921  1.00 28.32  ? 155 ALA A CB  1 
ATOM   1295 N N   . GLY A 1 175 ? 51.743 -12.958 8.217  1.00 33.14  ? 156 GLY A N   1 
ATOM   1296 C CA  . GLY A 1 175 ? 50.907 -12.479 9.303  1.00 36.66  ? 156 GLY A CA  1 
ATOM   1297 C C   . GLY A 1 175 ? 50.484 -11.026 9.143  1.00 40.00  ? 156 GLY A C   1 
ATOM   1298 O O   . GLY A 1 175 ? 49.608 -10.567 9.868  1.00 40.27  ? 156 GLY A O   1 
ATOM   1299 N N   . ARG A 1 176 ? 51.151 -10.333 8.216  1.00 42.62  ? 157 ARG A N   1 
ATOM   1300 C CA  . ARG A 1 176 ? 50.866 -8.968  7.741  1.00 46.06  ? 157 ARG A CA  1 
ATOM   1301 C C   . ARG A 1 176 ? 51.710 -7.926  8.475  1.00 47.07  ? 157 ARG A C   1 
ATOM   1302 O O   . ARG A 1 176 ? 52.861 -7.656  8.094  1.00 47.99  ? 157 ARG A O   1 
ATOM   1303 C CB  . ARG A 1 176 ? 49.371 -8.621  7.845  1.00 47.79  ? 157 ARG A CB  1 
ATOM   1304 C CG  . ARG A 1 176 ? 48.964 -7.482  6.942  1.00 49.79  ? 157 ARG A CG  1 
ATOM   1305 C CD  . ARG A 1 176 ? 48.090 -7.935  5.769  1.00 51.48  ? 157 ARG A CD  1 
ATOM   1306 N NE  . ARG A 1 176 ? 48.587 -9.127  5.079  1.00 52.19  ? 157 ARG A NE  1 
ATOM   1307 C CZ  . ARG A 1 176 ? 48.123 -10.352 5.290  1.00 53.12  ? 157 ARG A CZ  1 
ATOM   1308 N NH1 . ARG A 1 176 ? 47.159 -10.546 6.183  1.00 54.17  ? 157 ARG A NH1 1 
ATOM   1309 N NH2 . ARG A 1 176 ? 48.620 -11.381 4.617  1.00 53.63  ? 157 ARG A NH2 1 
ATOM   1310 N N   . PRO A 1 181 ? 44.968 -11.058 14.242 1.00 49.26  ? 162 PRO A N   1 
ATOM   1311 C CA  . PRO A 1 181 ? 45.093 -11.439 15.657 1.00 48.64  ? 162 PRO A CA  1 
ATOM   1312 C C   . PRO A 1 181 ? 45.425 -12.919 15.832 1.00 47.89  ? 162 PRO A C   1 
ATOM   1313 O O   . PRO A 1 181 ? 44.574 -13.781 15.571 1.00 49.71  ? 162 PRO A O   1 
ATOM   1314 C CB  . PRO A 1 181 ? 43.715 -11.109 16.231 1.00 48.75  ? 162 PRO A CB  1 
ATOM   1315 C CG  . PRO A 1 181 ? 42.783 -11.154 15.038 1.00 49.21  ? 162 PRO A CG  1 
ATOM   1316 C CD  . PRO A 1 181 ? 43.595 -10.648 13.890 1.00 49.56  ? 162 PRO A CD  1 
ATOM   1317 N N   . PRO A 1 182 ? 46.662 -13.218 16.269 1.00 44.98  ? 163 PRO A N   1 
ATOM   1318 C CA  . PRO A 1 182 ? 47.140 -14.600 16.379 1.00 42.44  ? 163 PRO A CA  1 
ATOM   1319 C C   . PRO A 1 182 ? 46.839 -15.195 17.747 1.00 38.86  ? 163 PRO A C   1 
ATOM   1320 O O   . PRO A 1 182 ? 46.498 -14.443 18.658 1.00 40.76  ? 163 PRO A O   1 
ATOM   1321 C CB  . PRO A 1 182 ? 48.647 -14.456 16.154 1.00 43.19  ? 163 PRO A CB  1 
ATOM   1322 C CG  . PRO A 1 182 ? 48.959 -13.075 16.715 1.00 43.97  ? 163 PRO A CG  1 
ATOM   1323 C CD  . PRO A 1 182 ? 47.724 -12.233 16.553 1.00 44.35  ? 163 PRO A CD  1 
ATOM   1324 N N   . ASP A 1 183 ? 46.945 -16.509 17.903 1.00 34.53  ? 164 ASP A N   1 
ATOM   1325 C CA  . ASP A 1 183 ? 46.882 -17.087 19.246 1.00 34.26  ? 164 ASP A CA  1 
ATOM   1326 C C   . ASP A 1 183 ? 48.195 -16.843 19.976 1.00 31.43  ? 164 ASP A C   1 
ATOM   1327 O O   . ASP A 1 183 ? 49.230 -16.578 19.347 1.00 29.53  ? 164 ASP A O   1 
ATOM   1328 C CB  . ASP A 1 183 ? 46.598 -18.578 19.201 1.00 36.96  ? 164 ASP A CB  1 
ATOM   1329 C CG  . ASP A 1 183 ? 47.661 -19.332 18.453 1.00 39.91  ? 164 ASP A CG  1 
ATOM   1330 O OD1 . ASP A 1 183 ? 47.579 -19.384 17.215 1.00 43.30  ? 164 ASP A OD1 1 
ATOM   1331 O OD2 . ASP A 1 183 ? 48.589 -19.846 19.086 1.00 40.89  ? 164 ASP A OD2 1 
ATOM   1332 N N   . ARG A 1 184 ? 48.145 -16.955 21.299 1.00 30.53  ? 165 ARG A N   1 
ATOM   1333 C CA  A ARG A 1 184 ? 49.296 -16.682 22.152 0.50 30.61  ? 165 ARG A CA  1 
ATOM   1334 C CA  B ARG A 1 184 ? 49.302 -16.670 22.147 0.50 30.54  ? 165 ARG A CA  1 
ATOM   1335 C C   . ARG A 1 184 ? 50.527 -17.505 21.780 1.00 29.41  ? 165 ARG A C   1 
ATOM   1336 O O   . ARG A 1 184 ? 51.615 -16.971 21.582 1.00 27.40  ? 165 ARG A O   1 
ATOM   1337 C CB  A ARG A 1 184 ? 48.932 -16.943 23.612 0.50 32.32  ? 165 ARG A CB  1 
ATOM   1338 C CB  B ARG A 1 184 ? 48.957 -16.896 23.624 0.50 32.13  ? 165 ARG A CB  1 
ATOM   1339 C CG  A ARG A 1 184 ? 50.063 -16.687 24.573 0.50 33.64  ? 165 ARG A CG  1 
ATOM   1340 C CG  B ARG A 1 184 ? 50.115 -16.602 24.565 0.50 33.28  ? 165 ARG A CG  1 
ATOM   1341 C CD  A ARG A 1 184 ? 49.656 -17.033 25.994 0.50 34.73  ? 165 ARG A CD  1 
ATOM   1342 C CD  B ARG A 1 184 ? 49.802 -16.980 26.016 0.50 34.26  ? 165 ARG A CD  1 
ATOM   1343 N NE  A ARG A 1 184 ? 50.766 -16.844 26.915 0.50 35.06  ? 165 ARG A NE  1 
ATOM   1344 N NE  B ARG A 1 184 ? 51.009 -17.414 26.715 0.50 34.63  ? 165 ARG A NE  1 
ATOM   1345 C CZ  A ARG A 1 184 ? 50.863 -15.846 27.785 0.50 34.29  ? 165 ARG A CZ  1 
ATOM   1346 C CZ  B ARG A 1 184 ? 51.617 -16.727 27.682 0.50 33.72  ? 165 ARG A CZ  1 
ATOM   1347 N NH1 A ARG A 1 184 ? 49.904 -14.931 27.866 0.50 33.80  ? 165 ARG A NH1 1 
ATOM   1348 N NH1 B ARG A 1 184 ? 51.123 -15.568 28.092 0.50 33.28  ? 165 ARG A NH1 1 
ATOM   1349 N NH2 A ARG A 1 184 ? 51.919 -15.771 28.579 0.50 34.08  ? 165 ARG A NH2 1 
ATOM   1350 N NH2 B ARG A 1 184 ? 52.717 -17.209 28.244 0.50 33.04  ? 165 ARG A NH2 1 
ATOM   1351 N N   . GLU A 1 185 ? 50.343 -18.815 21.690 1.00 28.65  ? 166 GLU A N   1 
ATOM   1352 C CA  . GLU A 1 185 ? 51.451 -19.715 21.448 1.00 28.70  ? 166 GLU A CA  1 
ATOM   1353 C C   . GLU A 1 185 ? 52.096 -19.485 20.076 1.00 25.20  ? 166 GLU A C   1 
ATOM   1354 O O   . GLU A 1 185 ? 53.328 -19.444 19.975 1.00 24.95  ? 166 GLU A O   1 
ATOM   1355 C CB  . GLU A 1 185 ? 50.963 -21.161 21.595 1.00 34.42  ? 166 GLU A CB  1 
ATOM   1356 C CG  . GLU A 1 185 ? 50.426 -21.504 22.993 1.00 40.82  ? 166 GLU A CG  1 
ATOM   1357 C CD  . GLU A 1 185 ? 49.040 -20.895 23.306 1.00 47.15  ? 166 GLU A CD  1 
ATOM   1358 O OE1 . GLU A 1 185 ? 48.263 -20.575 22.366 1.00 47.55  ? 166 GLU A OE1 1 
ATOM   1359 O OE2 . GLU A 1 185 ? 48.735 -20.728 24.514 1.00 51.42  ? 166 GLU A OE2 1 
ATOM   1360 N N   . GLY A 1 186 ? 51.281 -19.332 19.027 1.00 22.48  ? 167 GLY A N   1 
ATOM   1361 C CA  . GLY A 1 186 ? 51.824 -18.972 17.719 1.00 21.05  ? 167 GLY A CA  1 
ATOM   1362 C C   . GLY A 1 186 ? 52.574 -17.650 17.699 1.00 20.33  ? 167 GLY A C   1 
ATOM   1363 O O   . GLY A 1 186 ? 53.660 -17.520 17.091 1.00 18.80  ? 167 GLY A O   1 
ATOM   1364 N N   . TYR A 1 187 ? 52.002 -16.649 18.352 1.00 20.20  ? 168 TYR A N   1 
ATOM   1365 C CA  . TYR A 1 187 ? 52.629 -15.338 18.415 1.00 20.56  ? 168 TYR A CA  1 
ATOM   1366 C C   . TYR A 1 187 ? 53.994 -15.399 19.122 1.00 20.55  ? 168 TYR A C   1 
ATOM   1367 O O   . TYR A 1 187 ? 54.997 -14.869 18.615 1.00 18.66  ? 168 TYR A O   1 
ATOM   1368 C CB  . TYR A 1 187 ? 51.699 -14.322 19.128 1.00 21.86  ? 168 TYR A CB  1 
ATOM   1369 C CG  . TYR A 1 187 ? 52.369 -12.976 19.339 1.00 22.60  ? 168 TYR A CG  1 
ATOM   1370 C CD1 . TYR A 1 187 ? 52.557 -12.106 18.278 1.00 22.90  ? 168 TYR A CD1 1 
ATOM   1371 C CD2 . TYR A 1 187 ? 52.864 -12.615 20.586 1.00 22.40  ? 168 TYR A CD2 1 
ATOM   1372 C CE1 . TYR A 1 187 ? 53.185 -10.897 18.439 1.00 23.60  ? 168 TYR A CE1 1 
ATOM   1373 C CE2 . TYR A 1 187 ? 53.510 -11.404 20.774 1.00 22.97  ? 168 TYR A CE2 1 
ATOM   1374 C CZ  . TYR A 1 187 ? 53.671 -10.548 19.695 1.00 22.93  ? 168 TYR A CZ  1 
ATOM   1375 O OH  . TYR A 1 187 ? 54.302 -9.339  19.874 1.00 25.06  ? 168 TYR A OH  1 
ATOM   1376 N N   . LEU A 1 188 ? 54.029 -16.045 20.290 1.00 20.75  ? 169 LEU A N   1 
ATOM   1377 C CA  . LEU A 1 188 ? 55.274 -16.146 21.046 1.00 21.19  ? 169 LEU A CA  1 
ATOM   1378 C C   . LEU A 1 188 ? 56.307 -17.029 20.333 1.00 18.99  ? 169 LEU A C   1 
ATOM   1379 O O   . LEU A 1 188 ? 57.495 -16.771 20.435 1.00 19.66  ? 169 LEU A O   1 
ATOM   1380 C CB  . LEU A 1 188 ? 54.994 -16.659 22.452 1.00 23.92  ? 169 LEU A CB  1 
ATOM   1381 C CG  . LEU A 1 188 ? 54.201 -15.619 23.264 1.00 27.31  ? 169 LEU A CG  1 
ATOM   1382 C CD1 . LEU A 1 188 ? 53.739 -16.178 24.607 1.00 28.92  ? 169 LEU A CD1 1 
ATOM   1383 C CD2 . LEU A 1 188 ? 55.070 -14.359 23.456 1.00 28.61  ? 169 LEU A CD2 1 
ATOM   1384 N N   . THR A 1 189 ? 55.853 -18.050 19.603 1.00 18.32  ? 170 THR A N   1 
ATOM   1385 C CA  . THR A 1 189 ? 56.770 -18.894 18.836 1.00 17.39  ? 170 THR A CA  1 
ATOM   1386 C C   . THR A 1 189 ? 57.433 -18.060 17.728 1.00 17.61  ? 170 THR A C   1 
ATOM   1387 O O   . THR A 1 189 ? 58.636 -18.137 17.501 1.00 19.46  ? 170 THR A O   1 
ATOM   1388 C CB  . THR A 1 189 ? 56.026 -20.118 18.248 1.00 15.99  ? 170 THR A CB  1 
ATOM   1389 O OG1 . THR A 1 189 ? 55.510 -20.893 19.333 1.00 18.65  ? 170 THR A OG1 1 
ATOM   1390 C CG2 . THR A 1 189 ? 56.970 -21.017 17.414 1.00 16.62  ? 170 THR A CG2 1 
ATOM   1391 N N   . LEU A 1 190 ? 56.651 -17.251 17.027 1.00 15.92  ? 171 LEU A N   1 
ATOM   1392 C CA  . LEU A 1 190 ? 57.220 -16.363 16.015 1.00 16.39  ? 171 LEU A CA  1 
ATOM   1393 C C   . LEU A 1 190 ? 58.152 -15.306 16.643 1.00 17.42  ? 171 LEU A C   1 
ATOM   1394 O O   . LEU A 1 190 ? 59.258 -15.037 16.158 1.00 15.47  ? 171 LEU A O   1 
ATOM   1395 C CB  . LEU A 1 190 ? 56.085 -15.679 15.251 1.00 17.77  ? 171 LEU A CB  1 
ATOM   1396 C CG  . LEU A 1 190 ? 56.527 -14.698 14.156 1.00 19.04  ? 171 LEU A CG  1 
ATOM   1397 C CD1 . LEU A 1 190 ? 57.418 -15.318 13.101 1.00 19.28  ? 171 LEU A CD1 1 
ATOM   1398 C CD2 . LEU A 1 190 ? 55.306 -14.072 13.488 1.00 21.12  ? 171 LEU A CD2 1 
ATOM   1399 N N   . ARG A 1 191 ? 57.673 -14.690 17.720 1.00 18.12  ? 172 ARG A N   1 
ATOM   1400 C CA  . ARG A 1 191 ? 58.426 -13.609 18.357 1.00 18.55  ? 172 ARG A CA  1 
ATOM   1401 C C   . ARG A 1 191 ? 59.826 -14.081 18.818 1.00 18.37  ? 172 ARG A C   1 
ATOM   1402 O O   . ARG A 1 191 ? 60.808 -13.339 18.754 1.00 17.41  ? 172 ARG A O   1 
ATOM   1403 C CB  . ARG A 1 191 ? 57.615 -13.071 19.549 1.00 22.08  ? 172 ARG A CB  1 
ATOM   1404 C CG  . ARG A 1 191 ? 58.190 -11.928 20.308 1.00 28.51  ? 172 ARG A CG  1 
ATOM   1405 C CD  . ARG A 1 191 ? 57.809 -10.643 19.623 1.00 33.86  ? 172 ARG A CD  1 
ATOM   1406 N NE  . ARG A 1 191 ? 58.761 -10.380 18.560 1.00 37.18  ? 172 ARG A NE  1 
ATOM   1407 C CZ  . ARG A 1 191 ? 59.789 -9.544  18.674 1.00 35.78  ? 172 ARG A CZ  1 
ATOM   1408 N NH1 . ARG A 1 191 ? 59.975 -8.882  19.818 1.00 37.32  ? 172 ARG A NH1 1 
ATOM   1409 N NH2 . ARG A 1 191 ? 60.617 -9.378  17.642 1.00 32.34  ? 172 ARG A NH2 1 
ATOM   1410 N N   . ARG A 1 192 ? 59.917 -15.310 19.315 1.00 16.59  ? 173 ARG A N   1 
ATOM   1411 C CA  . ARG A 1 192 ? 61.215 -15.801 19.771 1.00 15.65  ? 173 ARG A CA  1 
ATOM   1412 C C   . ARG A 1 192 ? 62.240 -15.813 18.649 1.00 15.48  ? 173 ARG A C   1 
ATOM   1413 O O   . ARG A 1 192 ? 63.439 -15.619 18.869 1.00 15.55  ? 173 ARG A O   1 
ATOM   1414 C CB  . ARG A 1 192 ? 61.082 -17.199 20.356 1.00 15.01  ? 173 ARG A CB  1 
ATOM   1415 C CG  . ARG A 1 192 ? 60.502 -17.230 21.797 1.00 16.61  ? 173 ARG A CG  1 
ATOM   1416 C CD  . ARG A 1 192 ? 60.371 -18.685 22.257 1.00 17.28  ? 173 ARG A CD  1 
ATOM   1417 N NE  . ARG A 1 192 ? 60.132 -18.763 23.694 1.00 16.96  ? 173 ARG A NE  1 
ATOM   1418 C CZ  . ARG A 1 192 ? 59.899 -19.898 24.347 1.00 18.05  ? 173 ARG A CZ  1 
ATOM   1419 N NH1 . ARG A 1 192 ? 59.808 -21.041 23.664 1.00 22.42  ? 173 ARG A NH1 1 
ATOM   1420 N NH2 . ARG A 1 192 ? 59.725 -19.883 25.677 1.00 19.70  ? 173 ARG A NH2 1 
ATOM   1421 N N   . GLY A 1 193 ? 61.758 -16.037 17.437 1.00 14.26  ? 174 GLY A N   1 
ATOM   1422 C CA  . GLY A 1 193 ? 62.636 -16.056 16.281 1.00 13.62  ? 174 GLY A CA  1 
ATOM   1423 C C   . GLY A 1 193 ? 62.990 -14.651 15.819 1.00 13.84  ? 174 GLY A C   1 
ATOM   1424 O O   . GLY A 1 193 ? 64.155 -14.357 15.578 1.00 14.15  ? 174 GLY A O   1 
ATOM   1425 N N   . THR A 1 194 ? 61.987 -13.787 15.666 1.00 14.12  ? 175 THR A N   1 
ATOM   1426 C CA  . THR A 1 194 ? 62.257 -12.477 15.105 1.00 14.05  ? 175 THR A CA  1 
ATOM   1427 C C   . THR A 1 194 ? 62.990 -11.560 16.096 1.00 16.06  ? 175 THR A C   1 
ATOM   1428 O O   . THR A 1 194 ? 63.629 -10.596 15.689 1.00 16.96  ? 175 THR A O   1 
ATOM   1429 C CB  . THR A 1 194 ? 60.961 -11.801 14.646 1.00 16.02  ? 175 THR A CB  1 
ATOM   1430 O OG1 . THR A 1 194 ? 60.086 -11.621 15.774 1.00 17.38  ? 175 THR A OG1 1 
ATOM   1431 C CG2 . THR A 1 194 ? 60.300 -12.678 13.524 1.00 17.33  ? 175 THR A CG2 1 
ATOM   1432 N N   . ALA A 1 195 ? 62.944 -11.908 17.385 1.00 14.33  ? 176 ALA A N   1 
ATOM   1433 C CA  . ALA A 1 195 ? 63.637 -11.127 18.412 1.00 15.26  ? 176 ALA A CA  1 
ATOM   1434 C C   . ALA A 1 195 ? 65.184 -11.329 18.357 1.00 13.87  ? 176 ALA A C   1 
ATOM   1435 O O   . ALA A 1 195 ? 65.942 -10.513 18.904 1.00 15.24  ? 176 ALA A O   1 
ATOM   1436 C CB  . ALA A 1 195 ? 63.103 -11.500 19.805 1.00 14.98  ? 176 ALA A CB  1 
ATOM   1437 N N   . ALA A 1 196 ? 65.645 -12.420 17.723 1.00 12.77  ? 177 ALA A N   1 
ATOM   1438 C CA  . ALA A 1 196 ? 67.105 -12.689 17.554 1.00 12.18  ? 177 ALA A CA  1 
ATOM   1439 C C   . ALA A 1 196 ? 67.855 -12.855 18.873 1.00 11.67  ? 177 ALA A C   1 
ATOM   1440 O O   . ALA A 1 196 ? 69.104 -12.761 18.914 1.00 11.41  ? 177 ALA A O   1 
ATOM   1441 C CB  . ALA A 1 196 ? 67.786 -11.582 16.702 1.00 15.06  ? 177 ALA A CB  1 
ATOM   1442 N N   . MET A 1 197 ? 67.123 -13.167 19.939 1.00 11.71  ? 178 MET A N   1 
ATOM   1443 C CA  . MET A 1 197 ? 67.797 -13.305 21.238 1.00 11.50  ? 178 MET A CA  1 
ATOM   1444 C C   . MET A 1 197 ? 68.804 -14.466 21.285 1.00 11.05  ? 178 MET A C   1 
ATOM   1445 O O   . MET A 1 197 ? 69.767 -14.418 22.030 1.00 13.13  ? 178 MET A O   1 
ATOM   1446 C CB  . MET A 1 197 ? 66.772 -13.451 22.354 1.00 13.25  ? 178 MET A CB  1 
ATOM   1447 C CG  . MET A 1 197 ? 66.003 -12.103 22.611 1.00 14.24  ? 178 MET A CG  1 
ATOM   1448 S SD  . MET A 1 197 ? 67.085 -10.687 23.022 1.00 15.27  ? 178 MET A SD  1 
ATOM   1449 C CE  . MET A 1 197 ? 67.991 -11.347 24.442 1.00 16.68  ? 178 MET A CE  1 
ATOM   1450 N N   . GLU A 1 198 ? 68.574 -15.522 20.522 1.00 9.59   ? 179 GLU A N   1 
ATOM   1451 C CA  . GLU A 1 198 ? 69.549 -16.614 20.521 1.00 10.27  ? 179 GLU A CA  1 
ATOM   1452 C C   . GLU A 1 198 ? 70.887 -16.157 19.976 1.00 10.50  ? 179 GLU A C   1 
ATOM   1453 O O   . GLU A 1 198 ? 71.927 -16.462 20.566 1.00 11.20  ? 179 GLU A O   1 
ATOM   1454 C CB  . GLU A 1 198 ? 69.017 -17.833 19.722 1.00 9.26   ? 179 GLU A CB  1 
ATOM   1455 C CG  . GLU A 1 198 ? 67.814 -18.485 20.380 1.00 11.73  ? 179 GLU A CG  1 
ATOM   1456 C CD  . GLU A 1 198 ? 68.124 -18.982 21.794 1.00 14.80  ? 179 GLU A CD  1 
ATOM   1457 O OE1 . GLU A 1 198 ? 67.214 -18.905 22.664 1.00 16.97  ? 179 GLU A OE1 1 
ATOM   1458 O OE2 . GLU A 1 198 ? 69.270 -19.462 22.027 1.00 14.92  ? 179 GLU A OE2 1 
ATOM   1459 N N   . SER A 1 199 ? 70.902 -15.383 18.876 1.00 10.66  ? 180 SER A N   1 
ATOM   1460 C CA  . SER A 1 199 ? 72.164 -14.828 18.369 1.00 11.23  ? 180 SER A CA  1 
ATOM   1461 C C   . SER A 1 199 ? 72.756 -13.783 19.322 1.00 11.48  ? 180 SER A C   1 
ATOM   1462 O O   . SER A 1 199 ? 73.991 -13.714 19.521 1.00 11.60  ? 180 SER A O   1 
ATOM   1463 C CB  . SER A 1 199 ? 71.963 -14.185 16.988 1.00 12.37  ? 180 SER A CB  1 
ATOM   1464 O OG  . SER A 1 199 ? 71.660 -15.163 16.006 1.00 11.83  ? 180 SER A OG  1 
ATOM   1465 N N   . ILE A 1 200 ? 71.873 -12.991 19.927 1.00 12.14  ? 181 ILE A N   1 
ATOM   1466 C CA  . ILE A 1 200 ? 72.294 -11.922 20.858 1.00 12.30  ? 181 ILE A CA  1 
ATOM   1467 C C   . ILE A 1 200 ? 72.985 -12.553 22.080 1.00 11.16  ? 181 ILE A C   1 
ATOM   1468 O O   . ILE A 1 200 ? 74.024 -12.077 22.527 1.00 11.49  ? 181 ILE A O   1 
ATOM   1469 C CB  . ILE A 1 200 ? 71.070 -11.046 21.207 1.00 13.87  ? 181 ILE A CB  1 
ATOM   1470 C CG1 . ILE A 1 200 ? 70.819 -10.069 20.013 1.00 14.75  ? 181 ILE A CG1 1 
ATOM   1471 C CG2 . ILE A 1 200 ? 71.285 -10.258 22.530 1.00 15.86  ? 181 ILE A CG2 1 
ATOM   1472 C CD1 . ILE A 1 200 ? 69.492 -9.419  20.045 1.00 16.75  ? 181 ILE A CD1 1 
ATOM   1473 N N   . PHE A 1 201 ? 72.539 -13.740 22.484 1.00 12.73  ? 182 PHE A N   1 
ATOM   1474 C CA  . PHE A 1 201 ? 73.262 -14.436 23.552 1.00 12.91  ? 182 PHE A CA  1 
ATOM   1475 C C   . PHE A 1 201 ? 74.471 -15.264 23.069 1.00 12.38  ? 182 PHE A C   1 
ATOM   1476 O O   . PHE A 1 201 ? 75.442 -15.419 23.816 1.00 11.47  ? 182 PHE A O   1 
ATOM   1477 C CB  . PHE A 1 201 ? 72.295 -15.324 24.370 1.00 11.52  ? 182 PHE A CB  1 
ATOM   1478 C CG  . PHE A 1 201 ? 71.349 -14.517 25.248 1.00 11.35  ? 182 PHE A CG  1 
ATOM   1479 C CD1 . PHE A 1 201 ? 71.660 -13.182 25.619 1.00 12.00  ? 182 PHE A CD1 1 
ATOM   1480 C CD2 . PHE A 1 201 ? 70.139 -15.068 25.662 1.00 12.03  ? 182 PHE A CD2 1 
ATOM   1481 C CE1 . PHE A 1 201 ? 70.798 -12.459 26.440 1.00 11.56  ? 182 PHE A CE1 1 
ATOM   1482 C CE2 . PHE A 1 201 ? 69.265 -14.371 26.480 1.00 13.72  ? 182 PHE A CE2 1 
ATOM   1483 C CZ  . PHE A 1 201 ? 69.586 -13.039 26.875 1.00 13.61  ? 182 PHE A CZ  1 
ATOM   1484 N N   . ASP A 1 202 ? 74.463 -15.738 21.832 1.00 11.80  ? 183 ASP A N   1 
ATOM   1485 C CA  . ASP A 1 202 ? 75.688 -16.265 21.248 1.00 11.07  ? 183 ASP A CA  1 
ATOM   1486 C C   . ASP A 1 202 ? 76.788 -15.237 21.374 1.00 11.14  ? 183 ASP A C   1 
ATOM   1487 O O   . ASP A 1 202 ? 77.963 -15.597 21.581 1.00 11.18  ? 183 ASP A O   1 
ATOM   1488 C CB  . ASP A 1 202 ? 75.515 -16.634 19.760 1.00 10.65  ? 183 ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 202 ? 74.617 -17.865 19.525 1.00 11.07  ? 183 ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 202 ? 74.474 -18.721 20.448 1.00 10.48  ? 183 ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 202 ? 74.103 -17.999 18.358 1.00 11.52  ? 183 ASP A OD2 1 
ATOM   1492 N N   . MET A 1 203 ? 76.442 -13.946 21.197 1.00 11.20  ? 184 MET A N   1 
ATOM   1493 C CA  A MET A 1 203 ? 77.464 -12.889 21.222 0.50 12.58  ? 184 MET A CA  1 
ATOM   1494 C CA  B MET A 1 203 ? 77.497 -12.924 21.191 0.50 10.62  ? 184 MET A CA  1 
ATOM   1495 C C   . MET A 1 203 ? 78.125 -12.723 22.584 1.00 12.10  ? 184 MET A C   1 
ATOM   1496 O O   . MET A 1 203 ? 79.185 -12.134 22.672 1.00 12.35  ? 184 MET A O   1 
ATOM   1497 C CB  A MET A 1 203 ? 76.886 -11.540 20.781 0.50 14.67  ? 184 MET A CB  1 
ATOM   1498 C CB  B MET A 1 203 ? 76.976 -11.587 20.649 0.50 9.06   ? 184 MET A CB  1 
ATOM   1499 C CG  A MET A 1 203 ? 76.299 -11.549 19.363 0.50 17.58  ? 184 MET A CG  1 
ATOM   1500 C CG  B MET A 1 203 ? 76.530 -11.694 19.169 0.50 10.02  ? 184 MET A CG  1 
ATOM   1501 S SD  A MET A 1 203 ? 77.576 -11.683 18.092 0.50 19.28  ? 184 MET A SD  1 
ATOM   1502 S SD  B MET A 1 203 ? 77.928 -12.093 18.124 0.50 9.86   ? 184 MET A SD  1 
ATOM   1503 C CE  A MET A 1 203 ? 77.943 -13.424 18.040 0.50 22.06  ? 184 MET A CE  1 
ATOM   1504 C CE  B MET A 1 203 ? 78.897 -10.585 18.327 0.50 8.55   ? 184 MET A CE  1 
ATOM   1505 N N   . ILE A 1 204 ? 77.508 -13.232 23.657 1.00 11.62  ? 185 ILE A N   1 
ATOM   1506 C CA  . ILE A 1 204 ? 78.196 -13.150 24.958 1.00 11.88  ? 185 ILE A CA  1 
ATOM   1507 C C   . ILE A 1 204 ? 79.543 -13.845 24.900 1.00 11.66  ? 185 ILE A C   1 
ATOM   1508 O O   . ILE A 1 204 ? 80.546 -13.361 25.472 1.00 13.49  ? 185 ILE A O   1 
ATOM   1509 C CB  . ILE A 1 204 ? 77.337 -13.759 26.088 1.00 11.80  ? 185 ILE A CB  1 
ATOM   1510 C CG1 . ILE A 1 204 ? 76.068 -12.911 26.258 1.00 12.69  ? 185 ILE A CG1 1 
ATOM   1511 C CG2 . ILE A 1 204 ? 78.130 -13.928 27.435 1.00 13.45  ? 185 ILE A CG2 1 
ATOM   1512 C CD1 . ILE A 1 204 ? 74.975 -13.500 27.180 1.00 13.36  ? 185 ILE A CD1 1 
ATOM   1513 N N   . GLU A 1 205 ? 79.556 -15.029 24.286 1.00 11.19  ? 186 GLU A N   1 
ATOM   1514 C CA  . GLU A 1 205 ? 80.826 -15.746 24.080 1.00 11.67  ? 186 GLU A CA  1 
ATOM   1515 C C   . GLU A 1 205 ? 81.804 -15.006 23.158 1.00 11.68  ? 186 GLU A C   1 
ATOM   1516 O O   . GLU A 1 205 ? 82.983 -14.855 23.474 1.00 12.60  ? 186 GLU A O   1 
ATOM   1517 C CB  . GLU A 1 205 ? 80.529 -17.145 23.491 1.00 12.02  ? 186 GLU A CB  1 
ATOM   1518 C CG  . GLU A 1 205 ? 79.873 -18.045 24.538 1.00 11.89  ? 186 GLU A CG  1 
ATOM   1519 C CD  . GLU A 1 205 ? 79.379 -19.349 23.902 1.00 12.77  ? 186 GLU A CD  1 
ATOM   1520 O OE1 . GLU A 1 205 ? 79.973 -20.427 24.166 1.00 13.07  ? 186 GLU A OE1 1 
ATOM   1521 O OE2 . GLU A 1 205 ? 78.404 -19.257 23.136 1.00 13.15  ? 186 GLU A OE2 1 
ATOM   1522 N N   . ARG A 1 206 ? 81.337 -14.578 21.969 1.00 12.67  ? 187 ARG A N   1 
ATOM   1523 C CA  . ARG A 1 206 ? 82.238 -13.873 21.034 1.00 12.81  ? 187 ARG A CA  1 
ATOM   1524 C C   . ARG A 1 206 ? 82.798 -12.586 21.637 1.00 12.11  ? 187 ARG A C   1 
ATOM   1525 O O   . ARG A 1 206 ? 83.984 -12.300 21.497 1.00 13.95  ? 187 ARG A O   1 
ATOM   1526 C CB  . ARG A 1 206 ? 81.491 -13.555 19.717 1.00 12.59  ? 187 ARG A CB  1 
ATOM   1527 C CG  . ARG A 1 206 ? 82.185 -12.601 18.774 1.00 12.89  ? 187 ARG A CG  1 
ATOM   1528 C CD  . ARG A 1 206 ? 83.572 -13.051 18.345 1.00 12.37  ? 187 ARG A CD  1 
ATOM   1529 N NE  . ARG A 1 206 ? 84.172 -12.084 17.411 1.00 13.25  ? 187 ARG A NE  1 
ATOM   1530 C CZ  . ARG A 1 206 ? 84.776 -10.945 17.763 1.00 13.55  ? 187 ARG A CZ  1 
ATOM   1531 N NH1 . ARG A 1 206 ? 84.910 -10.624 19.044 1.00 14.40  ? 187 ARG A NH1 1 
ATOM   1532 N NH2 . ARG A 1 206 ? 85.264 -10.124 16.827 1.00 13.48  ? 187 ARG A NH2 1 
ATOM   1533 N N   . LEU A 1 207 ? 81.952 -11.815 22.309 1.00 12.93  ? 188 LEU A N   1 
ATOM   1534 C CA  . LEU A 1 207 ? 82.401 -10.509 22.828 1.00 12.78  ? 188 LEU A CA  1 
ATOM   1535 C C   . LEU A 1 207 ? 83.164 -10.653 24.143 1.00 14.04  ? 188 LEU A C   1 
ATOM   1536 O O   . LEU A 1 207 ? 83.810 -9.706  24.595 1.00 16.98  ? 188 LEU A O   1 
ATOM   1537 C CB  . LEU A 1 207 ? 81.217 -9.550  22.986 1.00 13.76  ? 188 LEU A CB  1 
ATOM   1538 C CG  . LEU A 1 207 ? 80.466 -9.270  21.657 1.00 12.76  ? 188 LEU A CG  1 
ATOM   1539 C CD1 . LEU A 1 207 ? 79.253 -8.369  21.918 1.00 15.92  ? 188 LEU A CD1 1 
ATOM   1540 C CD2 . LEU A 1 207 ? 81.339 -8.689  20.486 1.00 14.29  ? 188 LEU A CD2 1 
ATOM   1541 N N   . GLY A 1 208 ? 83.077 -11.838 24.750 1.00 13.70  ? 189 GLY A N   1 
ATOM   1542 C CA  . GLY A 1 208 ? 83.861 -12.161 25.930 1.00 15.44  ? 189 GLY A CA  1 
ATOM   1543 C C   . GLY A 1 208 ? 85.089 -13.008 25.631 1.00 16.11  ? 189 GLY A C   1 
ATOM   1544 O O   . GLY A 1 208 ? 85.885 -13.321 26.527 1.00 17.22  ? 189 GLY A O   1 
ATOM   1545 N N   . HIS A 1 209 ? 85.255 -13.392 24.368 1.00 15.16  ? 190 HIS A N   1 
ATOM   1546 C CA  . HIS A 1 209 ? 86.354 -14.293 23.976 1.00 14.12  ? 190 HIS A CA  1 
ATOM   1547 C C   . HIS A 1 209 ? 86.471 -15.585 24.773 1.00 15.12  ? 190 HIS A C   1 
ATOM   1548 O O   . HIS A 1 209 ? 87.576 -15.938 25.245 1.00 18.00  ? 190 HIS A O   1 
ATOM   1549 C CB  . HIS A 1 209 ? 87.678 -13.552 24.066 1.00 18.41  ? 190 HIS A CB  1 
ATOM   1550 C CG  . HIS A 1 209 ? 87.717 -12.394 23.148 1.00 21.26  ? 190 HIS A CG  1 
ATOM   1551 N ND1 . HIS A 1 209 ? 88.332 -12.440 21.916 1.00 25.57  ? 190 HIS A ND1 1 
ATOM   1552 C CD2 . HIS A 1 209 ? 87.088 -11.202 23.214 1.00 23.04  ? 190 HIS A CD2 1 
ATOM   1553 C CE1 . HIS A 1 209 ? 88.145 -11.285 21.298 1.00 26.56  ? 190 HIS A CE1 1 
ATOM   1554 N NE2 . HIS A 1 209 ? 87.401 -10.513 22.072 1.00 23.87  ? 190 HIS A NE2 1 
ATOM   1555 N N   . PHE A 1 210 ? 85.353 -16.283 24.908 1.00 14.86  ? 191 PHE A N   1 
ATOM   1556 C CA  . PHE A 1 210 ? 85.391 -17.589 25.566 1.00 14.46  ? 191 PHE A CA  1 
ATOM   1557 C C   . PHE A 1 210 ? 84.273 -18.438 25.035 1.00 13.78  ? 191 PHE A C   1 
ATOM   1558 O O   . PHE A 1 210 ? 83.367 -17.899 24.452 1.00 13.90  ? 191 PHE A O   1 
ATOM   1559 C CB  . PHE A 1 210 ? 85.292 -17.438 27.104 1.00 15.29  ? 191 PHE A CB  1 
ATOM   1560 C CG  . PHE A 1 210 ? 83.911 -17.047 27.623 1.00 14.00  ? 191 PHE A CG  1 
ATOM   1561 C CD1 . PHE A 1 210 ? 83.086 -17.993 28.195 1.00 14.84  ? 191 PHE A CD1 1 
ATOM   1562 C CD2 . PHE A 1 210 ? 83.432 -15.727 27.521 1.00 16.51  ? 191 PHE A CD2 1 
ATOM   1563 C CE1 . PHE A 1 210 ? 81.822 -17.643 28.709 1.00 15.22  ? 191 PHE A CE1 1 
ATOM   1564 C CE2 . PHE A 1 210 ? 82.161 -15.369 28.023 1.00 17.15  ? 191 PHE A CE2 1 
ATOM   1565 C CZ  . PHE A 1 210 ? 81.347 -16.334 28.591 1.00 16.28  ? 191 PHE A CZ  1 
ATOM   1566 N N   . GLU A 1 211 ? 84.333 -19.757 25.258 1.00 14.50  ? 192 GLU A N   1 
ATOM   1567 C CA  . GLU A 1 211 ? 83.260 -20.648 24.836 1.00 13.41  ? 192 GLU A CA  1 
ATOM   1568 C C   . GLU A 1 211 ? 82.849 -21.477 26.048 1.00 14.71  ? 192 GLU A C   1 
ATOM   1569 O O   . GLU A 1 211 ? 83.689 -21.941 26.836 1.00 17.38  ? 192 GLU A O   1 
ATOM   1570 C CB  . GLU A 1 211 ? 83.693 -21.512 23.643 1.00 14.53  ? 192 GLU A CB  1 
ATOM   1571 C CG  . GLU A 1 211 ? 83.864 -20.655 22.390 1.00 13.75  ? 192 GLU A CG  1 
ATOM   1572 C CD  . GLU A 1 211 ? 84.249 -21.416 21.126 1.00 13.86  ? 192 GLU A CD  1 
ATOM   1573 O OE1 . GLU A 1 211 ? 84.024 -22.652 21.019 1.00 15.91  ? 192 GLU A OE1 1 
ATOM   1574 O OE2 . GLU A 1 211 ? 84.795 -20.749 20.219 1.00 14.72  ? 192 GLU A OE2 1 
ATOM   1575 N N   . VAL A 1 212 ? 81.556 -21.594 26.235 1.00 11.17  ? 193 VAL A N   1 
ATOM   1576 C CA  A VAL A 1 212 ? 81.074 -22.269 27.425 0.50 13.64  ? 193 VAL A CA  1 
ATOM   1577 C CA  B VAL A 1 212 ? 80.951 -22.277 27.382 0.50 11.14  ? 193 VAL A CA  1 
ATOM   1578 C C   . VAL A 1 212 ? 81.157 -23.792 27.270 1.00 12.00  ? 193 VAL A C   1 
ATOM   1579 O O   . VAL A 1 212 ? 80.890 -24.359 26.199 1.00 11.87  ? 193 VAL A O   1 
ATOM   1580 C CB  A VAL A 1 212 ? 79.659 -21.857 27.728 0.50 16.02  ? 193 VAL A CB  1 
ATOM   1581 C CB  B VAL A 1 212 ? 79.420 -21.972 27.468 0.50 8.97   ? 193 VAL A CB  1 
ATOM   1582 C CG1 A VAL A 1 212 ? 79.600 -20.366 28.042 0.50 15.05  ? 193 VAL A CG1 1 
ATOM   1583 C CG1 B VAL A 1 212 ? 78.809 -22.651 28.693 0.50 5.60   ? 193 VAL A CG1 1 
ATOM   1584 C CG2 A VAL A 1 212 ? 78.868 -22.140 26.568 0.50 17.74  ? 193 VAL A CG2 1 
ATOM   1585 C CG2 B VAL A 1 212 ? 79.153 -20.471 27.504 0.50 10.24  ? 193 VAL A CG2 1 
ATOM   1586 N N   . PRO A 1 213 ? 81.585 -24.471 28.354 1.00 13.15  ? 194 PRO A N   1 
ATOM   1587 C CA  . PRO A 1 213 ? 81.657 -25.948 28.276 1.00 12.50  ? 194 PRO A CA  1 
ATOM   1588 C C   . PRO A 1 213 ? 80.288 -26.534 27.906 1.00 12.26  ? 194 PRO A C   1 
ATOM   1589 O O   . PRO A 1 213 ? 79.291 -26.037 28.441 1.00 11.64  ? 194 PRO A O   1 
ATOM   1590 C CB  . PRO A 1 213 ? 82.061 -26.360 29.709 1.00 15.04  ? 194 PRO A CB  1 
ATOM   1591 C CG  . PRO A 1 213 ? 82.850 -25.116 30.241 1.00 15.12  ? 194 PRO A CG  1 
ATOM   1592 C CD  . PRO A 1 213 ? 82.085 -23.934 29.635 1.00 15.29  ? 194 PRO A CD  1 
ATOM   1593 N N   . GLN A 1 214 ? 80.200 -27.572 27.051 1.00 11.53  ? 195 GLN A N   1 
ATOM   1594 C CA  . GLN A 1 214 ? 78.890 -27.971 26.553 1.00 11.32  ? 195 GLN A CA  1 
ATOM   1595 C C   . GLN A 1 214 ? 77.955 -28.433 27.663 1.00 11.95  ? 195 GLN A C   1 
ATOM   1596 O O   . GLN A 1 214 ? 76.726 -28.226 27.562 1.00 10.97  ? 195 GLN A O   1 
ATOM   1597 C CB  . GLN A 1 214 ? 79.020 -29.085 25.491 1.00 12.50  ? 195 GLN A CB  1 
ATOM   1598 C CG  . GLN A 1 214 ? 79.546 -30.449 26.072 1.00 13.33  ? 195 GLN A CG  1 
ATOM   1599 C CD  . GLN A 1 214 ? 79.409 -31.573 25.050 1.00 11.87  ? 195 GLN A CD  1 
ATOM   1600 O OE1 . GLN A 1 214 ? 79.133 -31.314 23.878 1.00 12.17  ? 195 GLN A OE1 1 
ATOM   1601 N NE2 . GLN A 1 214 ? 79.539 -32.815 25.498 1.00 12.74  ? 195 GLN A NE2 1 
ATOM   1602 N N   . HIS A 1 215 ? 78.513 -29.080 28.709 1.00 10.58  ? 196 HIS A N   1 
ATOM   1603 C CA  . HIS A 1 215 ? 77.636 -29.608 29.740 1.00 11.33  ? 196 HIS A CA  1 
ATOM   1604 C C   . HIS A 1 215 ? 77.219 -28.551 30.788 1.00 11.23  ? 196 HIS A C   1 
ATOM   1605 O O   . HIS A 1 215 ? 76.362 -28.841 31.624 1.00 9.91   ? 196 HIS A O   1 
ATOM   1606 C CB  . HIS A 1 215 ? 78.277 -30.836 30.427 1.00 10.95  ? 196 HIS A CB  1 
ATOM   1607 C CG  . HIS A 1 215 ? 79.555 -30.571 31.123 1.00 16.21  ? 196 HIS A CG  1 
ATOM   1608 N ND1 . HIS A 1 215 ? 80.711 -30.209 30.456 1.00 18.83  ? 196 HIS A ND1 1 
ATOM   1609 C CD2 . HIS A 1 215 ? 79.907 -30.755 32.422 1.00 15.15  ? 196 HIS A CD2 1 
ATOM   1610 C CE1 . HIS A 1 215 ? 81.698 -30.121 31.334 1.00 19.42  ? 196 HIS A CE1 1 
ATOM   1611 N NE2 . HIS A 1 215 ? 81.241 -30.457 32.522 1.00 18.21  ? 196 HIS A NE2 1 
ATOM   1612 N N   . VAL A 1 216 ? 77.752 -27.321 30.666 1.00 11.31  ? 197 VAL A N   1 
ATOM   1613 C CA  . VAL A 1 216 ? 77.192 -26.142 31.322 1.00 11.13  ? 197 VAL A CA  1 
ATOM   1614 C C   . VAL A 1 216 ? 76.095 -25.510 30.426 1.00 12.34  ? 197 VAL A C   1 
ATOM   1615 O O   . VAL A 1 216 ? 74.963 -25.280 30.871 1.00 12.27  ? 197 VAL A O   1 
ATOM   1616 C CB  . VAL A 1 216 ? 78.310 -25.122 31.623 1.00 11.97  ? 197 VAL A CB  1 
ATOM   1617 C CG1 . VAL A 1 216 ? 77.715 -23.773 32.119 1.00 13.10  ? 197 VAL A CG1 1 
ATOM   1618 C CG2 . VAL A 1 216 ? 79.246 -25.710 32.699 1.00 13.80  ? 197 VAL A CG2 1 
ATOM   1619 N N   . MET A 1 217 ? 76.445 -25.244 29.167 1.00 10.20  ? 198 MET A N   1 
ATOM   1620 C CA  . MET A 1 217 ? 75.489 -24.696 28.201 1.00 11.78  ? 198 MET A CA  1 
ATOM   1621 C C   . MET A 1 217 ? 74.146 -25.452 28.234 1.00 12.39  ? 198 MET A C   1 
ATOM   1622 O O   . MET A 1 217 ? 73.053 -24.845 28.226 1.00 12.68  ? 198 MET A O   1 
ATOM   1623 C CB  . MET A 1 217 ? 76.067 -24.770 26.787 1.00 11.25  ? 198 MET A CB  1 
ATOM   1624 C CG  . MET A 1 217 ? 75.064 -24.331 25.729 1.00 14.89  ? 198 MET A CG  1 
ATOM   1625 S SD  . MET A 1 217 ? 74.617 -22.567 25.753 1.00 15.62  ? 198 MET A SD  1 
ATOM   1626 C CE  . MET A 1 217 ? 76.094 -21.730 25.219 1.00 15.22  ? 198 MET A CE  1 
ATOM   1627 N N   . HIS A 1 218 ? 74.228 -26.791 28.273 1.00 11.34  ? 199 HIS A N   1 
ATOM   1628 C CA  . HIS A 1 218 ? 72.998 -27.582 28.165 1.00 11.69  ? 199 HIS A CA  1 
ATOM   1629 C C   . HIS A 1 218 ? 72.479 -28.148 29.485 1.00 11.86  ? 199 HIS A C   1 
ATOM   1630 O O   . HIS A 1 218 ? 71.498 -28.912 29.489 1.00 12.41  ? 199 HIS A O   1 
ATOM   1631 C CB  . HIS A 1 218 ? 73.211 -28.702 27.167 1.00 10.85  ? 199 HIS A CB  1 
ATOM   1632 C CG  . HIS A 1 218 ? 73.387 -28.189 25.769 1.00 11.70  ? 199 HIS A CG  1 
ATOM   1633 N ND1 . HIS A 1 218 ? 72.365 -27.585 25.069 1.00 13.11  ? 199 HIS A ND1 1 
ATOM   1634 C CD2 . HIS A 1 218 ? 74.483 -28.118 24.979 1.00 13.86  ? 199 HIS A CD2 1 
ATOM   1635 C CE1 . HIS A 1 218 ? 72.805 -27.225 23.878 1.00 14.77  ? 199 HIS A CE1 1 
ATOM   1636 N NE2 . HIS A 1 218 ? 74.086 -27.532 23.794 1.00 14.75  ? 199 HIS A NE2 1 
ATOM   1637 N N   . HIS A 1 219 ? 73.102 -27.749 30.604 1.00 10.95  ? 200 HIS A N   1 
ATOM   1638 C CA  . HIS A 1 219 ? 72.555 -28.072 31.923 1.00 10.96  ? 200 HIS A CA  1 
ATOM   1639 C C   . HIS A 1 219 ? 71.184 -27.396 32.028 1.00 11.80  ? 200 HIS A C   1 
ATOM   1640 O O   . HIS A 1 219 ? 71.022 -26.250 31.583 1.00 10.61  ? 200 HIS A O   1 
ATOM   1641 C CB  . HIS A 1 219 ? 73.505 -27.620 33.027 1.00 12.47  ? 200 HIS A CB  1 
ATOM   1642 C CG  . HIS A 1 219 ? 73.064 -27.988 34.412 1.00 12.31  ? 200 HIS A CG  1 
ATOM   1643 N ND1 . HIS A 1 219 ? 72.003 -27.374 35.056 1.00 12.86  ? 200 HIS A ND1 1 
ATOM   1644 C CD2 . HIS A 1 219 ? 73.523 -28.934 35.280 1.00 13.26  ? 200 HIS A CD2 1 
ATOM   1645 C CE1 . HIS A 1 219 ? 71.862 -27.893 36.265 1.00 13.31  ? 200 HIS A CE1 1 
ATOM   1646 N NE2 . HIS A 1 219 ? 72.771 -28.849 36.427 1.00 14.83  ? 200 HIS A NE2 1 
ATOM   1647 N N   . PRO A 1 220 ? 70.171 -28.069 32.607 1.00 11.17  ? 201 PRO A N   1 
ATOM   1648 C CA  . PRO A 1 220 ? 68.817 -27.498 32.575 1.00 11.21  ? 201 PRO A CA  1 
ATOM   1649 C C   . PRO A 1 220 ? 68.726 -26.148 33.314 1.00 11.69  ? 201 PRO A C   1 
ATOM   1650 O O   . PRO A 1 220 ? 67.847 -25.341 32.968 1.00 11.64  ? 201 PRO A O   1 
ATOM   1651 C CB  . PRO A 1 220 ? 67.951 -28.578 33.245 1.00 12.74  ? 201 PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 220 ? 68.931 -29.398 34.081 1.00 12.17  ? 201 PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 220 ? 70.199 -29.396 33.240 1.00 11.93  ? 201 PRO A CD  1 
ATOM   1654 N N   . LEU A 1 221 ? 69.576 -25.909 34.313 1.00 11.36  ? 202 LEU A N   1 
ATOM   1655 C CA  . LEU A 1 221 ? 69.522 -24.615 35.009 1.00 10.42  ? 202 LEU A CA  1 
ATOM   1656 C C   . LEU A 1 221 ? 69.897 -23.523 33.997 1.00 11.64  ? 202 LEU A C   1 
ATOM   1657 O O   . LEU A 1 221 ? 69.249 -22.467 33.937 1.00 12.31  ? 202 LEU A O   1 
ATOM   1658 C CB  . LEU A 1 221 ? 70.460 -24.613 36.258 1.00 12.52  ? 202 LEU A CB  1 
ATOM   1659 C CG  . LEU A 1 221 ? 70.424 -23.306 37.082 1.00 13.64  ? 202 LEU A CG  1 
ATOM   1660 C CD1 . LEU A 1 221 ? 70.783 -23.590 38.541 1.00 17.74  ? 202 LEU A CD1 1 
ATOM   1661 C CD2 . LEU A 1 221 ? 71.477 -22.274 36.516 1.00 16.47  ? 202 LEU A CD2 1 
ATOM   1662 N N   . PHE A 1 222 ? 70.935 -23.774 33.200 1.00 10.91  ? 203 PHE A N   1 
ATOM   1663 C CA  . PHE A 1 222 ? 71.429 -22.759 32.286 1.00 9.64   ? 203 PHE A CA  1 
ATOM   1664 C C   . PHE A 1 222 ? 70.508 -22.615 31.073 1.00 11.57  ? 203 PHE A C   1 
ATOM   1665 O O   . PHE A 1 222 ? 70.340 -21.482 30.520 1.00 13.16  ? 203 PHE A O   1 
ATOM   1666 C CB  . PHE A 1 222 ? 72.859 -23.082 31.838 1.00 9.74   ? 203 PHE A CB  1 
ATOM   1667 C CG  . PHE A 1 222 ? 73.894 -22.878 32.952 1.00 10.16  ? 203 PHE A CG  1 
ATOM   1668 C CD1 . PHE A 1 222 ? 74.638 -21.688 33.017 1.00 10.93  ? 203 PHE A CD1 1 
ATOM   1669 C CD2 . PHE A 1 222 ? 74.070 -23.848 33.958 1.00 11.68  ? 203 PHE A CD2 1 
ATOM   1670 C CE1 . PHE A 1 222 ? 75.561 -21.449 34.068 1.00 10.92  ? 203 PHE A CE1 1 
ATOM   1671 C CE2 . PHE A 1 222 ? 75.001 -23.629 34.978 1.00 10.79  ? 203 PHE A CE2 1 
ATOM   1672 C CZ  . PHE A 1 222 ? 75.754 -22.441 35.033 1.00 11.17  ? 203 PHE A CZ  1 
ATOM   1673 N N   . ARG A 1 223 ? 69.935 -23.733 30.600 1.00 9.98   ? 204 ARG A N   1 
ATOM   1674 C CA  . ARG A 1 223 ? 69.014 -23.609 29.471 1.00 10.09  ? 204 ARG A CA  1 
ATOM   1675 C C   . ARG A 1 223 ? 67.786 -22.757 29.883 1.00 11.26  ? 204 ARG A C   1 
ATOM   1676 O O   . ARG A 1 223 ? 67.283 -21.926 29.075 1.00 11.68  ? 204 ARG A O   1 
ATOM   1677 C CB  . ARG A 1 223 ? 68.580 -24.997 28.946 1.00 11.43  ? 204 ARG A CB  1 
ATOM   1678 C CG  . ARG A 1 223 ? 69.713 -25.693 28.250 1.00 11.86  ? 204 ARG A CG  1 
ATOM   1679 C CD  . ARG A 1 223 ? 69.302 -26.999 27.533 1.00 14.13  ? 204 ARG A CD  1 
ATOM   1680 N NE  . ARG A 1 223 ? 68.240 -26.744 26.559 1.00 13.85  ? 204 ARG A NE  1 
ATOM   1681 C CZ  . ARG A 1 223 ? 68.461 -26.430 25.286 1.00 16.35  ? 204 ARG A CZ  1 
ATOM   1682 N NH1 . ARG A 1 223 ? 67.435 -26.151 24.493 1.00 17.53  ? 204 ARG A NH1 1 
ATOM   1683 N NH2 . ARG A 1 223 ? 69.697 -26.413 24.803 1.00 17.97  ? 204 ARG A NH2 1 
ATOM   1684 N N   . GLN A 1 224 ? 67.332 -22.927 31.127 1.00 11.14  ? 205 GLN A N   1 
ATOM   1685 C CA  . GLN A 1 224 ? 66.269 -22.103 31.645 1.00 11.46  ? 205 GLN A CA  1 
ATOM   1686 C C   . GLN A 1 224 ? 66.682 -20.634 31.796 1.00 10.90  ? 205 GLN A C   1 
ATOM   1687 O O   . GLN A 1 224 ? 65.877 -19.767 31.423 1.00 12.12  ? 205 GLN A O   1 
ATOM   1688 C CB  . GLN A 1 224 ? 65.767 -22.624 33.000 1.00 11.60  ? 205 GLN A CB  1 
ATOM   1689 C CG  . GLN A 1 224 ? 64.966 -23.896 32.846 1.00 11.88  ? 205 GLN A CG  1 
ATOM   1690 C CD  . GLN A 1 224 ? 64.520 -24.405 34.176 1.00 13.64  ? 205 GLN A CD  1 
ATOM   1691 O OE1 . GLN A 1 224 ? 63.412 -24.087 34.655 1.00 16.25  ? 205 GLN A OE1 1 
ATOM   1692 N NE2 . GLN A 1 224 ? 65.403 -25.176 34.818 1.00 15.43  ? 205 GLN A NE2 1 
ATOM   1693 N N   . LEU A 1 225 ? 67.885 -20.337 32.329 1.00 9.81   ? 206 LEU A N   1 
ATOM   1694 C CA  . LEU A 1 225 ? 68.329 -18.917 32.407 1.00 9.66   ? 206 LEU A CA  1 
ATOM   1695 C C   . LEU A 1 225 ? 68.233 -18.292 31.035 1.00 10.07  ? 206 LEU A C   1 
ATOM   1696 O O   . LEU A 1 225 ? 67.785 -17.141 30.917 1.00 11.86  ? 206 LEU A O   1 
ATOM   1697 C CB  . LEU A 1 225 ? 69.767 -18.771 32.914 1.00 11.56  ? 206 LEU A CB  1 
ATOM   1698 C CG  . LEU A 1 225 ? 70.056 -19.086 34.410 1.00 11.46  ? 206 LEU A CG  1 
ATOM   1699 C CD1 . LEU A 1 225 ? 71.561 -18.993 34.629 1.00 13.03  ? 206 LEU A CD1 1 
ATOM   1700 C CD2 . LEU A 1 225 ? 69.318 -18.158 35.377 1.00 12.25  ? 206 LEU A CD2 1 
ATOM   1701 N N   . ARG A 1 226 ? 68.724 -19.013 30.017 1.00 11.32  ? 207 ARG A N   1 
ATOM   1702 C CA  . ARG A 1 226 ? 68.791 -18.430 28.678 1.00 10.57  ? 207 ARG A CA  1 
ATOM   1703 C C   . ARG A 1 226 ? 67.391 -18.165 28.132 1.00 10.57  ? 207 ARG A C   1 
ATOM   1704 O O   . ARG A 1 226 ? 67.137 -17.068 27.547 1.00 11.63  ? 207 ARG A O   1 
ATOM   1705 C CB  . ARG A 1 226 ? 69.563 -19.370 27.732 1.00 10.28  ? 207 ARG A CB  1 
ATOM   1706 C CG  . ARG A 1 226 ? 69.929 -18.743 26.377 1.00 10.62  ? 207 ARG A CG  1 
ATOM   1707 C CD  . ARG A 1 226 ? 70.640 -19.752 25.544 1.00 13.32  ? 207 ARG A CD  1 
ATOM   1708 N NE  . ARG A 1 226 ? 71.009 -19.245 24.219 1.00 11.99  ? 207 ARG A NE  1 
ATOM   1709 C CZ  . ARG A 1 226 ? 72.256 -19.042 23.799 1.00 11.09  ? 207 ARG A CZ  1 
ATOM   1710 N NH1 . ARG A 1 226 ? 73.270 -19.150 24.658 1.00 10.10  ? 207 ARG A NH1 1 
ATOM   1711 N NH2 . ARG A 1 226 ? 72.474 -18.606 22.547 1.00 12.36  ? 207 ARG A NH2 1 
ATOM   1712 N N   . GLN A 1 227 ? 66.471 -19.129 28.305 1.00 11.55  ? 208 GLN A N   1 
ATOM   1713 C CA  . GLN A 1 227 ? 65.103 -18.950 27.762 1.00 12.43  ? 208 GLN A CA  1 
ATOM   1714 C C   . GLN A 1 227 ? 64.330 -17.828 28.454 1.00 12.20  ? 208 GLN A C   1 
ATOM   1715 O O   . GLN A 1 227 ? 63.661 -17.009 27.783 1.00 12.46  ? 208 GLN A O   1 
ATOM   1716 C CB  . GLN A 1 227 ? 64.303 -20.251 27.835 1.00 13.68  ? 208 GLN A CB  1 
ATOM   1717 C CG  . GLN A 1 227 ? 63.060 -20.120 26.938 1.00 15.59  ? 208 GLN A CG  1 
ATOM   1718 C CD  . GLN A 1 227 ? 63.444 -19.876 25.418 1.00 16.27  ? 208 GLN A CD  1 
ATOM   1719 O OE1 . GLN A 1 227 ? 63.906 -20.805 24.718 1.00 19.30  ? 208 GLN A OE1 1 
ATOM   1720 N NE2 . GLN A 1 227 ? 63.229 -18.615 24.912 1.00 15.37  ? 208 GLN A NE2 1 
ATOM   1721 N N   . LEU A 1 228 ? 64.467 -17.759 29.783 1.00 12.08  ? 209 LEU A N   1 
ATOM   1722 C CA  . LEU A 1 228 ? 63.816 -16.696 30.558 1.00 11.28  ? 209 LEU A CA  1 
ATOM   1723 C C   . LEU A 1 228 ? 64.365 -15.312 30.151 1.00 11.35  ? 209 LEU A C   1 
ATOM   1724 O O   . LEU A 1 228 ? 63.591 -14.380 29.928 1.00 13.98  ? 209 LEU A O   1 
ATOM   1725 C CB  . LEU A 1 228 ? 64.033 -16.913 32.051 1.00 11.80  ? 209 LEU A CB  1 
ATOM   1726 C CG  . LEU A 1 228 ? 63.307 -18.131 32.632 1.00 9.57   ? 209 LEU A CG  1 
ATOM   1727 C CD1 . LEU A 1 228 ? 63.942 -18.499 34.008 1.00 12.12  ? 209 LEU A CD1 1 
ATOM   1728 C CD2 . LEU A 1 228 ? 61.832 -17.890 32.850 1.00 11.64  ? 209 LEU A CD2 1 
ATOM   1729 N N   . ALA A 1 229 ? 65.687 -15.180 30.061 1.00 11.03  ? 210 ALA A N   1 
ATOM   1730 C CA  . ALA A 1 229 ? 66.276 -13.862 29.726 1.00 11.17  ? 210 ALA A CA  1 
ATOM   1731 C C   . ALA A 1 229 ? 65.967 -13.506 28.280 1.00 10.91  ? 210 ALA A C   1 
ATOM   1732 O O   . ALA A 1 229 ? 65.855 -12.329 27.931 1.00 12.30  ? 210 ALA A O   1 
ATOM   1733 C CB  . ALA A 1 229 ? 67.771 -13.854 29.955 1.00 12.30  ? 210 ALA A CB  1 
ATOM   1734 N N   . ALA A 1 230 ? 65.785 -14.520 27.438 1.00 12.47  ? 211 ALA A N   1 
ATOM   1735 C CA  . ALA A 1 230 ? 65.385 -14.236 26.051 1.00 12.62  ? 211 ALA A CA  1 
ATOM   1736 C C   . ALA A 1 230 ? 63.927 -13.756 25.972 1.00 13.83  ? 211 ALA A C   1 
ATOM   1737 O O   . ALA A 1 230 ? 63.570 -12.892 25.139 1.00 14.32  ? 211 ALA A O   1 
ATOM   1738 C CB  . ALA A 1 230 ? 65.577 -15.508 25.185 1.00 13.98  ? 211 ALA A CB  1 
ATOM   1739 N N   . ASP A 1 231 ? 63.055 -14.340 26.800 1.00 12.36  ? 212 ASP A N   1 
ATOM   1740 C CA  . ASP A 1 231 ? 61.606 -14.055 26.716 1.00 13.29  ? 212 ASP A CA  1 
ATOM   1741 C C   . ASP A 1 231 ? 61.216 -12.733 27.366 1.00 13.86  ? 212 ASP A C   1 
ATOM   1742 O O   . ASP A 1 231 ? 60.347 -12.003 26.856 1.00 15.02  ? 212 ASP A O   1 
ATOM   1743 C CB  . ASP A 1 231 ? 60.761 -15.169 27.359 1.00 13.56  ? 212 ASP A CB  1 
ATOM   1744 C CG  . ASP A 1 231 ? 60.659 -16.435 26.509 1.00 17.03  ? 212 ASP A CG  1 
ATOM   1745 O OD1 . ASP A 1 231 ? 60.156 -17.458 27.048 1.00 18.38  ? 212 ASP A OD1 1 
ATOM   1746 O OD2 . ASP A 1 231 ? 61.048 -16.416 25.320 1.00 17.75  ? 212 ASP A OD2 1 
ATOM   1747 N N   . ILE A 1 232 ? 61.853 -12.406 28.485 1.00 13.26  ? 213 ILE A N   1 
ATOM   1748 C CA  . ILE A 1 232 ? 61.442 -11.214 29.247 1.00 13.54  ? 213 ILE A CA  1 
ATOM   1749 C C   . ILE A 1 232 ? 61.368 -9.937  28.381 1.00 15.49  ? 213 ILE A C   1 
ATOM   1750 O O   . ILE A 1 232 ? 60.354 -9.259  28.425 1.00 16.64  ? 213 ILE A O   1 
ATOM   1751 C CB  . ILE A 1 232 ? 62.364 -11.020 30.480 1.00 12.94  ? 213 ILE A CB  1 
ATOM   1752 C CG1 . ILE A 1 232 ? 62.024 -12.086 31.549 1.00 13.41  ? 213 ILE A CG1 1 
ATOM   1753 C CG2 . ILE A 1 232 ? 62.209 -9.590  31.055 1.00 14.54  ? 213 ILE A CG2 1 
ATOM   1754 C CD1 . ILE A 1 232 ? 63.159 -12.373 32.568 1.00 15.91  ? 213 ILE A CD1 1 
ATOM   1755 N N   . PRO A 1 233 ? 62.402 -9.631  27.571 1.00 14.21  ? 214 PRO A N   1 
ATOM   1756 C CA  . PRO A 1 233 ? 62.348 -8.377  26.787 1.00 15.86  ? 214 PRO A CA  1 
ATOM   1757 C C   . PRO A 1 233 ? 61.218 -8.365  25.784 1.00 16.53  ? 214 PRO A C   1 
ATOM   1758 O O   . PRO A 1 233 ? 60.743 -7.278  25.409 1.00 16.53  ? 214 PRO A O   1 
ATOM   1759 C CB  . PRO A 1 233 ? 63.690 -8.353  26.049 1.00 16.41  ? 214 PRO A CB  1 
ATOM   1760 C CG  . PRO A 1 233 ? 64.568 -9.127  26.851 1.00 17.38  ? 214 PRO A CG  1 
ATOM   1761 C CD  . PRO A 1 233 ? 63.715 -10.286 27.403 1.00 15.28  ? 214 PRO A CD  1 
ATOM   1762 N N   . SER A 1 234 ? 60.807 -9.523  25.273 1.00 18.18  ? 215 SER A N   1 
ATOM   1763 C CA  A SER A 1 234 ? 59.691 -9.534  24.328 0.50 19.51  ? 215 SER A CA  1 
ATOM   1764 C CA  B SER A 1 234 ? 59.704 -9.493  24.315 0.50 17.28  ? 215 SER A CA  1 
ATOM   1765 C C   . SER A 1 234 ? 58.407 -9.106  25.039 1.00 17.03  ? 215 SER A C   1 
ATOM   1766 O O   . SER A 1 234 ? 57.548 -8.416  24.470 1.00 18.21  ? 215 SER A O   1 
ATOM   1767 C CB  A SER A 1 234 ? 59.508 -10.924 23.692 0.50 22.92  ? 215 SER A CB  1 
ATOM   1768 C CB  B SER A 1 234 ? 59.557 -10.840 23.569 0.50 17.04  ? 215 SER A CB  1 
ATOM   1769 O OG  A SER A 1 234 ? 59.290 -11.901 24.696 0.50 25.65  ? 215 SER A OG  1 
ATOM   1770 O OG  B SER A 1 234 ? 60.634 -11.012 22.658 0.50 16.22  ? 215 SER A OG  1 
ATOM   1771 N N   . PHE A 1 235 ? 58.278 -9.509  26.304 1.00 15.44  ? 216 PHE A N   1 
ATOM   1772 C CA  . PHE A 1 235 ? 57.085 -9.177  27.082 1.00 14.44  ? 216 PHE A CA  1 
ATOM   1773 C C   . PHE A 1 235 ? 57.071 -7.699  27.434 1.00 15.06  ? 216 PHE A C   1 
ATOM   1774 O O   . PHE A 1 235 ? 56.071 -6.998  27.250 1.00 17.67  ? 216 PHE A O   1 
ATOM   1775 C CB  . PHE A 1 235 ? 57.023 -10.019 28.367 1.00 14.84  ? 216 PHE A CB  1 
ATOM   1776 C CG  . PHE A 1 235 ? 56.480 -11.419 28.169 1.00 15.78  ? 216 PHE A CG  1 
ATOM   1777 C CD1 . PHE A 1 235 ? 55.363 -11.869 28.907 1.00 15.74  ? 216 PHE A CD1 1 
ATOM   1778 C CD2 . PHE A 1 235 ? 57.075 -12.296 27.267 1.00 15.34  ? 216 PHE A CD2 1 
ATOM   1779 C CE1 . PHE A 1 235 ? 54.842 -13.161 28.723 1.00 17.52  ? 216 PHE A CE1 1 
ATOM   1780 C CE2 . PHE A 1 235 ? 56.560 -13.589 27.084 1.00 15.62  ? 216 PHE A CE2 1 
ATOM   1781 C CZ  . PHE A 1 235 ? 55.421 -14.015 27.813 1.00 16.27  ? 216 PHE A CZ  1 
ATOM   1782 N N   . THR A 1 236 ? 58.175 -7.233  27.992 1.00 15.64  ? 217 THR A N   1 
ATOM   1783 C CA  . THR A 1 236 ? 58.215 -5.826  28.375 1.00 16.80  ? 217 THR A CA  1 
ATOM   1784 C C   . THR A 1 236 ? 58.099 -4.949  27.131 1.00 18.09  ? 217 THR A C   1 
ATOM   1785 O O   . THR A 1 236 ? 57.437 -3.923  27.169 1.00 17.97  ? 217 THR A O   1 
ATOM   1786 C CB  . THR A 1 236 ? 59.508 -5.457  29.159 1.00 15.77  ? 217 THR A CB  1 
ATOM   1787 O OG1 . THR A 1 236 ? 60.643 -5.736  28.346 1.00 15.49  ? 217 THR A OG1 1 
ATOM   1788 C CG2 . THR A 1 236 ? 59.590 -6.249  30.496 1.00 16.64  ? 217 THR A CG2 1 
ATOM   1789 N N   . ASN A 1 237 ? 58.726 -5.333  26.018 1.00 18.05  ? 218 ASN A N   1 
ATOM   1790 C CA  . ASN A 1 237 ? 58.616 -4.505  24.791 1.00 19.67  ? 218 ASN A CA  1 
ATOM   1791 C C   . ASN A 1 237 ? 57.173 -4.361  24.329 1.00 21.13  ? 218 ASN A C   1 
ATOM   1792 O O   . ASN A 1 237 ? 56.753 -3.265  23.913 1.00 22.15  ? 218 ASN A O   1 
ATOM   1793 C CB  . ASN A 1 237 ? 59.467 -5.096  23.674 1.00 22.23  ? 218 ASN A CB  1 
ATOM   1794 C CG  . ASN A 1 237 ? 59.263 -4.407  22.359 1.00 27.25  ? 218 ASN A CG  1 
ATOM   1795 O OD1 . ASN A 1 237 ? 58.682 -4.980  21.441 1.00 32.11  ? 218 ASN A OD1 1 
ATOM   1796 N ND2 . ASN A 1 237 ? 59.743 -3.187  22.252 1.00 27.27  ? 218 ASN A ND2 1 
ATOM   1797 N N   . ASP A 1 238 ? 56.393 -5.445  24.441 1.00 20.46  ? 219 ASP A N   1 
ATOM   1798 C CA  . ASP A 1 238 ? 55.004 -5.383  23.976 1.00 20.98  ? 219 ASP A CA  1 
ATOM   1799 C C   . ASP A 1 238 ? 54.174 -4.450  24.866 1.00 21.96  ? 219 ASP A C   1 
ATOM   1800 O O   . ASP A 1 238 ? 53.284 -3.766  24.377 1.00 24.33  ? 219 ASP A O   1 
ATOM   1801 C CB  . ASP A 1 238 ? 54.372 -6.778  23.930 1.00 21.64  ? 219 ASP A CB  1 
ATOM   1802 C CG  . ASP A 1 238 ? 54.551 -7.452  22.587 1.00 21.61  ? 219 ASP A CG  1 
ATOM   1803 O OD1 . ASP A 1 238 ? 55.278 -6.889  21.739 1.00 23.63  ? 219 ASP A OD1 1 
ATOM   1804 O OD2 . ASP A 1 238 ? 53.971 -8.539  22.380 1.00 21.89  ? 219 ASP A OD2 1 
ATOM   1805 N N   . VAL A 1 239 ? 54.434 -4.429  26.162 1.00 21.74  ? 220 VAL A N   1 
ATOM   1806 C CA  . VAL A 1 239 ? 53.754 -3.466  27.018 1.00 23.02  ? 220 VAL A CA  1 
ATOM   1807 C C   . VAL A 1 239 ? 54.164 -2.040  26.643 1.00 24.21  ? 220 VAL A C   1 
ATOM   1808 O O   . VAL A 1 239 ? 53.301 -1.163  26.491 1.00 26.79  ? 220 VAL A O   1 
ATOM   1809 C CB  . VAL A 1 239 ? 54.042 -3.743  28.504 1.00 22.88  ? 220 VAL A CB  1 
ATOM   1810 C CG1 . VAL A 1 239 ? 53.488 -2.596  29.393 1.00 25.00  ? 220 VAL A CG1 1 
ATOM   1811 C CG2 . VAL A 1 239 ? 53.449 -5.102  28.888 1.00 21.75  ? 220 VAL A CG2 1 
ATOM   1812 N N   . ARG A 1 240 ? 55.468 -1.798  26.469 1.00 24.49  ? 221 ARG A N   1 
ATOM   1813 C CA  . ARG A 1 240 ? 55.938 -0.439  26.153 1.00 26.81  ? 221 ARG A CA  1 
ATOM   1814 C C   . ARG A 1 240 ? 55.344 0.061   24.845 1.00 29.21  ? 221 ARG A C   1 
ATOM   1815 O O   . ARG A 1 240 ? 55.031 1.256   24.700 1.00 31.29  ? 221 ARG A O   1 
ATOM   1816 C CB  . ARG A 1 240 ? 57.470 -0.377  26.051 1.00 27.15  ? 221 ARG A CB  1 
ATOM   1817 C CG  . ARG A 1 240 ? 58.272 -0.813  27.293 1.00 29.29  ? 221 ARG A CG  1 
ATOM   1818 C CD  . ARG A 1 240 ? 58.368 0.257   28.308 1.00 28.14  ? 221 ARG A CD  1 
ATOM   1819 N NE  . ARG A 1 240 ? 59.242 -0.042  29.450 1.00 25.39  ? 221 ARG A NE  1 
ATOM   1820 C CZ  . ARG A 1 240 ? 59.094 0.560   30.636 1.00 27.30  ? 221 ARG A CZ  1 
ATOM   1821 N NH1 . ARG A 1 240 ? 58.130 1.460   30.787 1.00 29.11  ? 221 ARG A NH1 1 
ATOM   1822 N NH2 . ARG A 1 240 ? 59.893 0.293   31.658 1.00 25.18  ? 221 ARG A NH2 1 
ATOM   1823 N N   . SER A 1 241 ? 55.194 -0.836  23.876 1.00 31.64  ? 222 SER A N   1 
ATOM   1824 C CA  . SER A 1 241 ? 54.872 -0.450  22.501 1.00 34.18  ? 222 SER A CA  1 
ATOM   1825 C C   . SER A 1 241 ? 53.395 -0.520  22.188 1.00 35.04  ? 222 SER A C   1 
ATOM   1826 O O   . SER A 1 241 ? 52.980 -0.130  21.099 1.00 35.05  ? 222 SER A O   1 
ATOM   1827 C CB  . SER A 1 241 ? 55.617 -1.340  21.528 1.00 36.50  ? 222 SER A CB  1 
ATOM   1828 O OG  . SER A 1 241 ? 55.024 -2.623  21.506 1.00 38.36  ? 222 SER A OG  1 
ATOM   1829 N N   . PHE A 1 242 ? 52.604 -0.999  23.137 1.00 35.77  ? 223 PHE A N   1 
ATOM   1830 C CA  . PHE A 1 242 ? 51.203 -1.271  22.882 1.00 39.96  ? 223 PHE A CA  1 
ATOM   1831 C C   . PHE A 1 242 ? 50.469 -0.035  22.336 1.00 42.24  ? 223 PHE A C   1 
ATOM   1832 O O   . PHE A 1 242 ? 49.742 -0.129  21.340 1.00 40.72  ? 223 PHE A O   1 
ATOM   1833 C CB  . PHE A 1 242 ? 50.527 -1.784  24.162 1.00 42.14  ? 223 PHE A CB  1 
ATOM   1834 C CG  . PHE A 1 242 ? 49.046 -1.640  24.141 1.00 45.26  ? 223 PHE A CG  1 
ATOM   1835 C CD1 . PHE A 1 242 ? 48.435 -0.596  24.821 1.00 46.41  ? 223 PHE A CD1 1 
ATOM   1836 C CD2 . PHE A 1 242 ? 48.263 -2.507  23.398 1.00 46.09  ? 223 PHE A CD2 1 
ATOM   1837 C CE1 . PHE A 1 242 ? 47.064 -0.435  24.785 1.00 47.37  ? 223 PHE A CE1 1 
ATOM   1838 C CE2 . PHE A 1 242 ? 46.881 -2.350  23.357 1.00 46.90  ? 223 PHE A CE2 1 
ATOM   1839 C CZ  . PHE A 1 242 ? 46.284 -1.316  24.059 1.00 46.80  ? 223 PHE A CZ  1 
ATOM   1840 N N   . ALA A 1 243 ? 50.697 1.114   22.973 1.00 45.40  ? 224 ALA A N   1 
ATOM   1841 C CA  . ALA A 1 243 ? 50.043 2.378   22.598 1.00 48.01  ? 224 ALA A CA  1 
ATOM   1842 C C   . ALA A 1 243 ? 50.245 2.715   21.128 1.00 51.23  ? 224 ALA A C   1 
ATOM   1843 O O   . ALA A 1 243 ? 49.281 2.981   20.402 1.00 51.11  ? 224 ALA A O   1 
ATOM   1844 C CB  . ALA A 1 243 ? 50.558 3.523   23.471 1.00 48.27  ? 224 ALA A CB  1 
ATOM   1845 N N   . GLN A 1 244 ? 51.502 2.699   20.697 1.00 54.80  ? 225 GLN A N   1 
ATOM   1846 C CA  . GLN A 1 244 ? 51.852 2.964   19.311 1.00 58.90  ? 225 GLN A CA  1 
ATOM   1847 C C   . GLN A 1 244 ? 51.204 1.967   18.363 1.00 58.33  ? 225 GLN A C   1 
ATOM   1848 O O   . GLN A 1 244 ? 50.576 2.355   17.378 1.00 57.92  ? 225 GLN A O   1 
ATOM   1849 C CB  . GLN A 1 244 ? 53.370 2.939   19.136 1.00 63.46  ? 225 GLN A CB  1 
ATOM   1850 C CG  . GLN A 1 244 ? 54.072 4.056   19.891 1.00 67.81  ? 225 GLN A CG  1 
ATOM   1851 C CD  . GLN A 1 244 ? 55.590 3.943   19.858 1.00 71.12  ? 225 GLN A CD  1 
ATOM   1852 O OE1 . GLN A 1 244 ? 56.145 2.864   19.617 1.00 72.28  ? 225 GLN A OE1 1 
ATOM   1853 N NE2 . GLN A 1 244 ? 56.270 5.063   20.110 1.00 72.14  ? 225 GLN A NE2 1 
ATOM   1854 N N   . GLU A 1 245 ? 51.358 0.680   18.661 1.00 57.66  ? 226 GLU A N   1 
ATOM   1855 C CA  . GLU A 1 245 ? 50.836 -0.368  17.790 1.00 57.15  ? 226 GLU A CA  1 
ATOM   1856 C C   . GLU A 1 245 ? 49.307 -0.392  17.808 1.00 55.99  ? 226 GLU A C   1 
ATOM   1857 O O   . GLU A 1 245 ? 48.666 -0.509  16.764 1.00 55.00  ? 226 GLU A O   1 
ATOM   1858 C CB  . GLU A 1 245 ? 51.401 -1.733  18.201 1.00 57.70  ? 226 GLU A CB  1 
ATOM   1859 C CG  . GLU A 1 245 ? 52.913 -1.837  18.050 1.00 58.38  ? 226 GLU A CG  1 
ATOM   1860 C CD  . GLU A 1 245 ? 53.476 -3.161  18.537 1.00 58.79  ? 226 GLU A CD  1 
ATOM   1861 O OE1 . GLU A 1 245 ? 52.762 -3.894  19.250 1.00 57.59  ? 226 GLU A OE1 1 
ATOM   1862 O OE2 . GLU A 1 245 ? 54.643 -3.463  18.203 1.00 59.54  ? 226 GLU A OE2 1 
ATOM   1863 N N   . ALA A 1 252 ? 49.131 -7.907  16.658 1.00 34.78  ? 233 ALA A N   1 
ATOM   1864 C CA  . ALA A 1 252 ? 50.376 -8.642  16.810 1.00 32.86  ? 233 ALA A CA  1 
ATOM   1865 C C   . ALA A 1 252 ? 51.126 -8.121  18.034 1.00 30.77  ? 233 ALA A C   1 
ATOM   1866 O O   . ALA A 1 252 ? 52.237 -7.613  17.927 1.00 30.46  ? 233 ALA A O   1 
ATOM   1867 C CB  . ALA A 1 252 ? 51.235 -8.514  15.552 1.00 34.86  ? 233 ALA A CB  1 
ATOM   1868 N N   . ASN A 1 253 ? 50.498 -8.243  19.202 1.00 28.32  ? 234 ASN A N   1 
ATOM   1869 C CA  . ASN A 1 253 ? 51.059 -7.728  20.451 1.00 25.84  ? 234 ASN A CA  1 
ATOM   1870 C C   . ASN A 1 253 ? 50.406 -8.532  21.591 1.00 23.10  ? 234 ASN A C   1 
ATOM   1871 O O   . ASN A 1 253 ? 49.187 -8.702  21.590 1.00 22.41  ? 234 ASN A O   1 
ATOM   1872 C CB  . ASN A 1 253 ? 50.799 -6.224  20.545 1.00 24.91  ? 234 ASN A CB  1 
ATOM   1873 C CG  . ASN A 1 253 ? 51.313 -5.608  21.829 1.00 26.18  ? 234 ASN A CG  1 
ATOM   1874 O OD1 . ASN A 1 253 ? 50.870 -5.977  22.921 1.00 27.99  ? 234 ASN A OD1 1 
ATOM   1875 N ND2 . ASN A 1 253 ? 52.238 -4.648  21.708 1.00 24.74  ? 234 ASN A ND2 1 
ATOM   1876 N N   . LEU A 1 254 ? 51.192 -9.033  22.547 1.00 22.64  ? 235 LEU A N   1 
ATOM   1877 C CA  . LEU A 1 254 ? 50.655 -9.922  23.588 1.00 22.47  ? 235 LEU A CA  1 
ATOM   1878 C C   . LEU A 1 254 ? 49.617 -9.229  24.472 1.00 21.97  ? 235 LEU A C   1 
ATOM   1879 O O   . LEU A 1 254 ? 48.724 -9.894  24.998 1.00 22.63  ? 235 LEU A O   1 
ATOM   1880 C CB  . LEU A 1 254 ? 51.804 -10.509 24.438 1.00 22.92  ? 235 LEU A CB  1 
ATOM   1881 C CG  . LEU A 1 254 ? 51.430 -11.581 25.461 1.00 24.14  ? 235 LEU A CG  1 
ATOM   1882 C CD1 . LEU A 1 254 ? 50.801 -12.788 24.731 1.00 25.57  ? 235 LEU A CD1 1 
ATOM   1883 C CD2 . LEU A 1 254 ? 52.661 -12.020 26.235 1.00 25.51  ? 235 LEU A CD2 1 
ATOM   1884 N N   . VAL A 1 255 ? 49.729 -7.910  24.663 1.00 21.39  ? 236 VAL A N   1 
ATOM   1885 C CA  . VAL A 1 255 ? 48.740 -7.177  25.461 1.00 22.51  ? 236 VAL A CA  1 
ATOM   1886 C C   . VAL A 1 255 ? 47.388 -7.256  24.742 1.00 24.82  ? 236 VAL A C   1 
ATOM   1887 O O   . VAL A 1 255 ? 46.374 -7.529  25.359 1.00 23.65  ? 236 VAL A O   1 
ATOM   1888 C CB  . VAL A 1 255 ? 49.182 -5.701  25.708 1.00 21.70  ? 236 VAL A CB  1 
ATOM   1889 C CG1 . VAL A 1 255 ? 48.067 -4.886  26.395 1.00 21.53  ? 236 VAL A CG1 1 
ATOM   1890 C CG2 . VAL A 1 255 ? 50.448 -5.675  26.583 1.00 21.04  ? 236 VAL A CG2 1 
ATOM   1891 N N   . MET A 1 256 ? 47.387 -7.070  23.422 1.00 28.15  ? 237 MET A N   1 
ATOM   1892 C CA  . MET A 1 256 ? 46.150 -7.168  22.663 1.00 31.84  ? 237 MET A CA  1 
ATOM   1893 C C   . MET A 1 256 ? 45.538 -8.570  22.728 1.00 27.49  ? 237 MET A C   1 
ATOM   1894 O O   . MET A 1 256 ? 44.301 -8.718  22.839 1.00 26.62  ? 237 MET A O   1 
ATOM   1895 C CB  . MET A 1 256 ? 46.397 -6.766  21.209 1.00 44.21  ? 237 MET A CB  1 
ATOM   1896 C CG  . MET A 1 256 ? 46.548 -5.273  21.023 1.00 54.88  ? 237 MET A CG  1 
ATOM   1897 S SD  . MET A 1 256 ? 45.007 -4.421  21.443 1.00 65.41  ? 237 MET A SD  1 
ATOM   1898 C CE  . MET A 1 256 ? 43.981 -4.832  20.027 1.00 71.33  ? 237 MET A CE  1 
ATOM   1899 N N   . ILE A 1 257 ? 46.402 -9.584  22.680 1.00 24.51  ? 238 ILE A N   1 
ATOM   1900 C CA  . ILE A 1 257 ? 45.971 -10.982 22.704 1.00 24.52  ? 238 ILE A CA  1 
ATOM   1901 C C   . ILE A 1 257 ? 45.321 -11.304 24.046 1.00 24.60  ? 238 ILE A C   1 
ATOM   1902 O O   . ILE A 1 257 ? 44.242 -11.887 24.100 1.00 26.35  ? 238 ILE A O   1 
ATOM   1903 C CB  . ILE A 1 257 ? 47.160 -11.925 22.417 1.00 26.86  ? 238 ILE A CB  1 
ATOM   1904 C CG1 . ILE A 1 257 ? 47.664 -11.671 20.983 1.00 28.40  ? 238 ILE A CG1 1 
ATOM   1905 C CG2 . ILE A 1 257 ? 46.797 -13.413 22.672 1.00 27.10  ? 238 ILE A CG2 1 
ATOM   1906 C CD1 . ILE A 1 257 ? 48.994 -12.309 20.639 1.00 28.01  ? 238 ILE A CD1 1 
ATOM   1907 N N   . VAL A 1 258 ? 45.975 -10.897 25.131 1.00 23.73  ? 239 VAL A N   1 
ATOM   1908 C CA  . VAL A 1 258 ? 45.424 -11.101 26.466 1.00 23.61  ? 239 VAL A CA  1 
ATOM   1909 C C   . VAL A 1 258 ? 44.097 -10.355 26.666 1.00 24.68  ? 239 VAL A C   1 
ATOM   1910 O O   . VAL A 1 258 ? 43.130 -10.930 27.187 1.00 24.61  ? 239 VAL A O   1 
ATOM   1911 C CB  . VAL A 1 258 ? 46.424 -10.649 27.534 1.00 23.25  ? 239 VAL A CB  1 
ATOM   1912 C CG1 . VAL A 1 258 ? 45.759 -10.642 28.913 1.00 23.06  ? 239 VAL A CG1 1 
ATOM   1913 C CG2 . VAL A 1 258 ? 47.629 -11.582 27.558 1.00 24.23  ? 239 VAL A CG2 1 
ATOM   1914 N N   . ARG A 1 259 ? 44.059 -9.080  26.281 1.00 23.75  ? 240 ARG A N   1 
ATOM   1915 C CA  . ARG A 1 259 ? 42.846 -8.264  26.443 1.00 28.52  ? 240 ARG A CA  1 
ATOM   1916 C C   . ARG A 1 259 ? 41.663 -8.923  25.739 1.00 30.39  ? 240 ARG A C   1 
ATOM   1917 O O   . ARG A 1 259 ? 40.543 -8.967  26.272 1.00 30.96  ? 240 ARG A O   1 
ATOM   1918 C CB  . ARG A 1 259 ? 43.044 -6.857  25.888 1.00 31.93  ? 240 ARG A CB  1 
ATOM   1919 C CG  . ARG A 1 259 ? 42.056 -5.843  26.468 1.00 36.13  ? 240 ARG A CG  1 
ATOM   1920 C CD  . ARG A 1 259 ? 41.355 -5.058  25.407 1.00 40.51  ? 240 ARG A CD  1 
ATOM   1921 N NE  . ARG A 1 259 ? 42.258 -4.244  24.611 1.00 42.87  ? 240 ARG A NE  1 
ATOM   1922 C CZ  . ARG A 1 259 ? 41.842 -3.337  23.738 1.00 46.90  ? 240 ARG A CZ  1 
ATOM   1923 N NH1 . ARG A 1 259 ? 40.540 -3.154  23.553 1.00 49.37  ? 240 ARG A NH1 1 
ATOM   1924 N NH2 . ARG A 1 259 ? 42.716 -2.624  23.042 1.00 47.50  ? 240 ARG A NH2 1 
ATOM   1925 N N   . ARG A 1 260 ? 41.926 -9.453  24.548 1.00 31.23  ? 241 ARG A N   1 
ATOM   1926 C CA  . ARG A 1 260 ? 40.896 -10.136 23.773 1.00 33.82  ? 241 ARG A CA  1 
ATOM   1927 C C   . ARG A 1 260 ? 40.484 -11.448 24.444 1.00 33.80  ? 241 ARG A C   1 
ATOM   1928 O O   . ARG A 1 260 ? 39.294 -11.673 24.721 1.00 33.69  ? 241 ARG A O   1 
ATOM   1929 C CB  . ARG A 1 260 ? 41.393 -10.398 22.351 1.00 36.15  ? 241 ARG A CB  1 
ATOM   1930 C CG  . ARG A 1 260 ? 40.457 -11.251 21.501 1.00 39.25  ? 241 ARG A CG  1 
ATOM   1931 C CD  . ARG A 1 260 ? 41.153 -12.529 21.082 1.00 42.96  ? 241 ARG A CD  1 
ATOM   1932 N NE  . ARG A 1 260 ? 42.254 -12.242 20.158 1.00 45.40  ? 241 ARG A NE  1 
ATOM   1933 C CZ  . ARG A 1 260 ? 43.339 -12.999 20.003 1.00 46.23  ? 241 ARG A CZ  1 
ATOM   1934 N NH1 . ARG A 1 260 ? 43.501 -14.106 20.713 1.00 45.37  ? 241 ARG A NH1 1 
ATOM   1935 N NH2 . ARG A 1 260 ? 44.277 -12.633 19.135 1.00 47.89  ? 241 ARG A NH2 1 
ATOM   1936 N N   . ASP A 1 261 ? 41.471 -12.301 24.710 1.00 33.14  ? 242 ASP A N   1 
ATOM   1937 C CA  . ASP A 1 261 ? 41.233 -13.625 25.272 1.00 34.12  ? 242 ASP A CA  1 
ATOM   1938 C C   . ASP A 1 261 ? 40.519 -13.583 26.619 1.00 33.63  ? 242 ASP A C   1 
ATOM   1939 O O   . ASP A 1 261 ? 39.697 -14.454 26.892 1.00 33.65  ? 242 ASP A O   1 
ATOM   1940 C CB  . ASP A 1 261 ? 42.542 -14.400 25.437 1.00 37.09  ? 242 ASP A CB  1 
ATOM   1941 C CG  . ASP A 1 261 ? 43.157 -14.854 24.103 1.00 40.29  ? 242 ASP A CG  1 
ATOM   1942 O OD1 . ASP A 1 261 ? 42.567 -14.668 23.011 1.00 41.30  ? 242 ASP A OD1 1 
ATOM   1943 O OD2 . ASP A 1 261 ? 44.265 -15.412 24.167 1.00 42.56  ? 242 ASP A OD2 1 
ATOM   1944 N N   . ARG A 1 262 ? 40.840 -12.594 27.454 1.00 32.67  ? 243 ARG A N   1 
ATOM   1945 C CA  . ARG A 1 262 ? 40.305 -12.533 28.805 1.00 32.43  ? 243 ARG A CA  1 
ATOM   1946 C C   . ARG A 1 262 ? 39.084 -11.641 28.898 1.00 31.88  ? 243 ARG A C   1 
ATOM   1947 O O   . ARG A 1 262 ? 38.385 -11.631 29.924 1.00 31.15  ? 243 ARG A O   1 
ATOM   1948 C CB  . ARG A 1 262 ? 41.362 -12.024 29.786 1.00 33.94  ? 243 ARG A CB  1 
ATOM   1949 C CG  . ARG A 1 262 ? 42.610 -12.881 29.870 1.00 36.82  ? 243 ARG A CG  1 
ATOM   1950 C CD  . ARG A 1 262 ? 43.403 -12.503 31.107 1.00 38.89  ? 243 ARG A CD  1 
ATOM   1951 N NE  . ARG A 1 262 ? 44.515 -13.416 31.360 1.00 42.30  ? 243 ARG A NE  1 
ATOM   1952 C CZ  . ARG A 1 262 ? 45.078 -13.577 32.555 1.00 44.28  ? 243 ARG A CZ  1 
ATOM   1953 N NH1 . ARG A 1 262 ? 44.621 -12.898 33.599 1.00 43.59  ? 243 ARG A NH1 1 
ATOM   1954 N NH2 . ARG A 1 262 ? 46.091 -14.421 32.710 1.00 46.99  ? 243 ARG A NH2 1 
ATOM   1955 N N   . CYS A 1 263 ? 38.839 -10.894 27.829 1.00 31.29  ? 244 CYS A N   1 
ATOM   1956 C CA  . CYS A 1 263 ? 37.766 -9.904  27.780 1.00 30.85  ? 244 CYS A CA  1 
ATOM   1957 C C   . CYS A 1 263 ? 37.914 -8.928  28.945 1.00 30.33  ? 244 CYS A C   1 
ATOM   1958 O O   . CYS A 1 263 ? 36.974 -8.648  29.675 1.00 30.35  ? 244 CYS A O   1 
ATOM   1959 C CB  . CYS A 1 263 ? 36.397 -10.608 27.780 1.00 32.09  ? 244 CYS A CB  1 
ATOM   1960 S SG  . CYS A 1 263 ? 35.067 -9.598  27.225 1.00 34.81  ? 244 CYS A SG  1 
ATOM   1961 N N   . CYS A 1 264 ? 39.126 -8.426  29.143 1.00 30.04  ? 245 CYS A N   1 
ATOM   1962 C CA  . CYS A 1 264 ? 39.414 -7.586  30.307 1.00 29.46  ? 245 CYS A CA  1 
ATOM   1963 C C   . CYS A 1 264 ? 39.763 -6.168  29.857 1.00 30.61  ? 245 CYS A C   1 
ATOM   1964 O O   . CYS A 1 264 ? 39.808 -5.892  28.659 1.00 32.10  ? 245 CYS A O   1 
ATOM   1965 C CB  . CYS A 1 264 ? 40.554 -8.188  31.144 1.00 28.97  ? 245 CYS A CB  1 
ATOM   1966 S SG  . CYS A 1 264 ? 42.181 -8.233  30.308 1.00 26.43  ? 245 CYS A SG  1 
ATOM   1967 N N   . SER A 1 265 ? 39.999 -5.265  30.805 1.00 30.80  ? 246 SER A N   1 
ATOM   1968 C CA  . SER A 1 265 ? 40.390 -3.903  30.437 1.00 32.77  ? 246 SER A CA  1 
ATOM   1969 C C   . SER A 1 265 ? 41.802 -3.887  29.848 1.00 33.52  ? 246 SER A C   1 
ATOM   1970 O O   . SER A 1 265 ? 42.569 -4.840  30.024 1.00 31.94  ? 246 SER A O   1 
ATOM   1971 C CB  . SER A 1 265 ? 40.314 -2.970  31.649 1.00 34.11  ? 246 SER A CB  1 
ATOM   1972 O OG  . SER A 1 265 ? 41.293 -3.295  32.629 1.00 34.57  ? 246 SER A OG  1 
ATOM   1973 N N   . THR A 1 266 ? 42.143 -2.794  29.176 1.00 35.18  ? 247 THR A N   1 
ATOM   1974 C CA  . THR A 1 266 ? 43.473 -2.612  28.605 1.00 36.04  ? 247 THR A CA  1 
ATOM   1975 C C   . THR A 1 266 ? 44.553 -2.559  29.692 1.00 36.12  ? 247 THR A C   1 
ATOM   1976 O O   . THR A 1 266 ? 45.616 -3.168  29.574 1.00 35.02  ? 247 THR A O   1 
ATOM   1977 C CB  . THR A 1 266 ? 43.541 -1.318  27.769 1.00 37.89  ? 247 THR A CB  1 
ATOM   1978 O OG1 . THR A 1 266 ? 42.693 -1.439  26.625 1.00 39.78  ? 247 THR A OG1 1 
ATOM   1979 C CG2 . THR A 1 266 ? 44.945 -1.062  27.294 1.00 38.56  ? 247 THR A CG2 1 
ATOM   1980 N N   . ALA A 1 267 ? 44.269 -1.830  30.757 1.00 36.42  ? 248 ALA A N   1 
ATOM   1981 C CA  . ALA A 1 267 ? 45.231 -1.670  31.830 1.00 38.99  ? 248 ALA A CA  1 
ATOM   1982 C C   . ALA A 1 267 ? 45.423 -3.006  32.555 1.00 34.90  ? 248 ALA A C   1 
ATOM   1983 O O   . ALA A 1 267 ? 46.536 -3.350  32.963 1.00 31.33  ? 248 ALA A O   1 
ATOM   1984 C CB  . ALA A 1 267 ? 44.784 -0.587  32.800 1.00 20.00  ? 248 ALA A CB  1 
ATOM   1985 N N   . GLU A 1 268 ? 44.344 -3.772  32.671 1.00 33.78  ? 249 GLU A N   1 
ATOM   1986 C CA  . GLU A 1 268 ? 44.424 -5.119  33.216 1.00 32.51  ? 249 GLU A CA  1 
ATOM   1987 C C   . GLU A 1 268 ? 45.305 -5.999  32.338 1.00 25.65  ? 249 GLU A C   1 
ATOM   1988 O O   . GLU A 1 268 ? 46.154 -6.734  32.846 1.00 22.36  ? 249 GLU A O   1 
ATOM   1989 C CB  . GLU A 1 268 ? 43.038 -5.744  33.349 1.00 38.77  ? 249 GLU A CB  1 
ATOM   1990 C CG  . GLU A 1 268 ? 43.024 -7.065  34.099 1.00 45.93  ? 249 GLU A CG  1 
ATOM   1991 C CD  . GLU A 1 268 ? 41.633 -7.439  34.583 1.00 53.15  ? 249 GLU A CD  1 
ATOM   1992 O OE1 . GLU A 1 268 ? 40.681 -6.670  34.313 1.00 56.30  ? 249 GLU A OE1 1 
ATOM   1993 O OE2 . GLU A 1 268 ? 41.488 -8.492  35.239 1.00 55.73  ? 249 GLU A OE2 1 
ATOM   1994 N N   . ALA A 1 269 ? 45.113 -5.926  31.023 1.00 24.76  ? 250 ALA A N   1 
ATOM   1995 C CA  . ALA A 1 269 ? 45.935 -6.726  30.117 1.00 22.77  ? 250 ALA A CA  1 
ATOM   1996 C C   . ALA A 1 269 ? 47.412 -6.339  30.204 1.00 21.48  ? 250 ALA A C   1 
ATOM   1997 O O   . ALA A 1 269 ? 48.267 -7.225  30.185 1.00 19.86  ? 250 ALA A O   1 
ATOM   1998 C CB  . ALA A 1 269 ? 45.438 -6.607  28.681 1.00 21.99  ? 250 ALA A CB  1 
ATOM   1999 N N   . CYS A 1 270 ? 47.721 -5.031  30.255 1.00 20.05  ? 251 CYS A N   1 
ATOM   2000 C CA  . CYS A 1 270 ? 49.109 -4.602  30.464 1.00 21.60  ? 251 CYS A CA  1 
ATOM   2001 C C   . CYS A 1 270 ? 49.687 -5.186  31.743 1.00 21.17  ? 251 CYS A C   1 
ATOM   2002 O O   . CYS A 1 270 ? 50.836 -5.665  31.747 1.00 21.65  ? 251 CYS A O   1 
ATOM   2003 C CB  . CYS A 1 270 ? 49.227 -3.067  30.511 1.00 26.75  ? 251 CYS A CB  1 
ATOM   2004 S SG  . CYS A 1 270 ? 49.003 -2.305  28.909 1.00 31.54  ? 251 CYS A SG  1 
ATOM   2005 N N   . ALA A 1 271 ? 48.922 -5.129  32.835 1.00 19.76  ? 252 ALA A N   1 
ATOM   2006 C CA  . ALA A 1 271 ? 49.427 -5.719  34.083 1.00 20.72  ? 252 ALA A CA  1 
ATOM   2007 C C   . ALA A 1 271 ? 49.663 -7.231  34.005 1.00 20.83  ? 252 ALA A C   1 
ATOM   2008 O O   . ALA A 1 271 ? 50.633 -7.737  34.585 1.00 20.97  ? 252 ALA A O   1 
ATOM   2009 C CB  . ALA A 1 271 ? 48.471 -5.417  35.254 1.00 21.10  ? 252 ALA A CB  1 
ATOM   2010 N N   . VAL A 1 272 ? 48.786 -7.959  33.310 1.00 20.38  ? 253 VAL A N   1 
ATOM   2011 C CA  . VAL A 1 272 ? 48.954 -9.402  33.179 1.00 20.98  ? 253 VAL A CA  1 
ATOM   2012 C C   . VAL A 1 272 ? 50.293 -9.716  32.508 1.00 19.20  ? 253 VAL A C   1 
ATOM   2013 O O   . VAL A 1 272 ? 51.061 -10.581 32.958 1.00 18.98  ? 253 VAL A O   1 
ATOM   2014 C CB  . VAL A 1 272 ? 47.785 -10.023 32.366 1.00 20.77  ? 253 VAL A CB  1 
ATOM   2015 C CG1 . VAL A 1 272 ? 48.088 -11.466 31.993 1.00 19.94  ? 253 VAL A CG1 1 
ATOM   2016 C CG2 . VAL A 1 272 ? 46.485 -9.935  33.177 1.00 21.43  ? 253 VAL A CG2 1 
ATOM   2017 N N   . VAL A 1 273 ? 50.555 -9.029  31.399 1.00 16.58  ? 254 VAL A N   1 
ATOM   2018 C CA  . VAL A 1 273 ? 51.801 -9.220  30.656 1.00 15.89  ? 254 VAL A CA  1 
ATOM   2019 C C   . VAL A 1 273 ? 53.039 -8.773  31.450 1.00 15.80  ? 254 VAL A C   1 
ATOM   2020 O O   . VAL A 1 273 ? 54.029 -9.504  31.523 1.00 16.62  ? 254 VAL A O   1 
ATOM   2021 C CB  . VAL A 1 273 ? 51.730 -8.500  29.297 1.00 16.80  ? 254 VAL A CB  1 
ATOM   2022 C CG1 . VAL A 1 273 ? 53.073 -8.590  28.536 1.00 17.83  ? 254 VAL A CG1 1 
ATOM   2023 C CG2 . VAL A 1 273 ? 50.583 -9.081  28.445 1.00 17.01  ? 254 VAL A CG2 1 
ATOM   2024 N N   . TRP A 1 274 ? 53.003 -7.575  32.030 1.00 17.11  ? 255 TRP A N   1 
ATOM   2025 C CA  . TRP A 1 274 ? 54.108 -7.126  32.847 1.00 17.93  ? 255 TRP A CA  1 
ATOM   2026 C C   . TRP A 1 274 ? 54.365 -8.076  34.018 1.00 18.26  ? 255 TRP A C   1 
ATOM   2027 O O   . TRP A 1 274 ? 55.527 -8.361  34.344 1.00 17.97  ? 255 TRP A O   1 
ATOM   2028 C CB  . TRP A 1 274 ? 53.827 -5.702  33.365 1.00 18.73  ? 255 TRP A CB  1 
ATOM   2029 C CG  . TRP A 1 274 ? 55.054 -5.029  33.868 1.00 19.82  ? 255 TRP A CG  1 
ATOM   2030 C CD1 . TRP A 1 274 ? 55.478 -4.956  35.159 1.00 21.88  ? 255 TRP A CD1 1 
ATOM   2031 C CD2 . TRP A 1 274 ? 56.041 -4.350  33.080 1.00 20.74  ? 255 TRP A CD2 1 
ATOM   2032 N NE1 . TRP A 1 274 ? 56.662 -4.242  35.233 1.00 22.89  ? 255 TRP A NE1 1 
ATOM   2033 C CE2 . TRP A 1 274 ? 57.026 -3.859  33.974 1.00 23.17  ? 255 TRP A CE2 1 
ATOM   2034 C CE3 . TRP A 1 274 ? 56.177 -4.094  31.706 1.00 22.44  ? 255 TRP A CE3 1 
ATOM   2035 C CZ2 . TRP A 1 274 ? 58.146 -3.148  33.539 1.00 23.89  ? 255 TRP A CZ2 1 
ATOM   2036 C CZ3 . TRP A 1 274 ? 57.289 -3.382  31.277 1.00 22.95  ? 255 TRP A CZ3 1 
ATOM   2037 C CH2 . TRP A 1 274 ? 58.264 -2.923  32.194 1.00 23.80  ? 255 TRP A CH2 1 
ATOM   2038 N N   . ASP A 1 275 ? 53.303 -8.591  34.639 1.00 19.28  ? 256 ASP A N   1 
ATOM   2039 C CA  . ASP A 1 275 ? 53.480 -9.393  35.846 1.00 19.34  ? 256 ASP A CA  1 
ATOM   2040 C C   . ASP A 1 275 ? 54.058 -10.758 35.476 1.00 17.59  ? 256 ASP A C   1 
ATOM   2041 O O   . ASP A 1 275 ? 54.777 -11.371 36.287 1.00 17.30  ? 256 ASP A O   1 
ATOM   2042 C CB  . ASP A 1 275 ? 52.150 -9.534  36.606 1.00 20.86  ? 256 ASP A CB  1 
ATOM   2043 C CG  . ASP A 1 275 ? 51.740 -8.223  37.262 1.00 23.01  ? 256 ASP A CG  1 
ATOM   2044 O OD1 . ASP A 1 275 ? 50.596 -8.080  37.744 1.00 24.17  ? 256 ASP A OD1 1 
ATOM   2045 O OD2 . ASP A 1 275 ? 52.586 -7.289  37.260 1.00 24.42  ? 256 ASP A OD2 1 
ATOM   2046 N N   . GLU A 1 276 ? 53.775 -11.243 34.267 1.00 16.32  ? 257 GLU A N   1 
ATOM   2047 C CA  A GLU A 1 276 ? 54.373 -12.498 33.824 0.50 16.33  ? 257 GLU A CA  1 
ATOM   2048 C CA  B GLU A 1 276 ? 54.378 -12.496 33.825 0.50 15.82  ? 257 GLU A CA  1 
ATOM   2049 C C   . GLU A 1 276 ? 55.868 -12.285 33.557 1.00 16.93  ? 257 GLU A C   1 
ATOM   2050 O O   . GLU A 1 276 ? 56.700 -13.140 33.856 1.00 16.37  ? 257 GLU A O   1 
ATOM   2051 C CB  A GLU A 1 276 ? 53.642 -13.031 32.583 0.50 17.55  ? 257 GLU A CB  1 
ATOM   2052 C CB  B GLU A 1 276 ? 53.676 -13.053 32.577 0.50 16.06  ? 257 GLU A CB  1 
ATOM   2053 C CG  A GLU A 1 276 ? 54.268 -14.283 31.964 0.50 21.06  ? 257 GLU A CG  1 
ATOM   2054 C CG  B GLU A 1 276 ? 54.059 -14.523 32.373 0.50 18.29  ? 257 GLU A CG  1 
ATOM   2055 C CD  A GLU A 1 276 ? 54.404 -15.465 32.909 0.50 23.56  ? 257 GLU A CD  1 
ATOM   2056 C CD  B GLU A 1 276 ? 53.350 -15.216 31.227 0.50 20.35  ? 257 GLU A CD  1 
ATOM   2057 O OE1 A GLU A 1 276 ? 53.631 -15.588 33.884 0.50 23.43  ? 257 GLU A OE1 1 
ATOM   2058 O OE1 B GLU A 1 276 ? 53.843 -16.298 30.837 0.50 21.80  ? 257 GLU A OE1 1 
ATOM   2059 O OE2 A GLU A 1 276 ? 55.287 -16.306 32.638 0.50 26.69  ? 257 GLU A OE2 1 
ATOM   2060 O OE2 B GLU A 1 276 ? 52.316 -14.704 30.728 0.50 20.47  ? 257 GLU A OE2 1 
ATOM   2061 N N   . ALA A 1 277 ? 56.215 -11.120 33.027 1.00 14.46  ? 258 ALA A N   1 
ATOM   2062 C CA  . ALA A 1 277 ? 57.617 -10.772 32.865 1.00 14.07  ? 258 ALA A CA  1 
ATOM   2063 C C   . ALA A 1 277 ? 58.300 -10.740 34.220 1.00 14.92  ? 258 ALA A C   1 
ATOM   2064 O O   . ALA A 1 277 ? 59.433 -11.189 34.342 1.00 13.94  ? 258 ALA A O   1 
ATOM   2065 C CB  . ALA A 1 277 ? 57.771 -9.412  32.130 1.00 15.07  ? 258 ALA A CB  1 
ATOM   2066 N N   . GLN A 1 278 ? 57.618 -10.199 35.229 1.00 15.73  ? 259 GLN A N   1 
ATOM   2067 C CA  . GLN A 1 278 ? 58.193 -10.121 36.590 1.00 13.74  ? 259 GLN A CA  1 
ATOM   2068 C C   . GLN A 1 278 ? 58.392 -11.517 37.189 1.00 13.25  ? 259 GLN A C   1 
ATOM   2069 O O   . GLN A 1 278 ? 59.401 -11.784 37.861 1.00 16.11  ? 259 GLN A O   1 
ATOM   2070 C CB  . GLN A 1 278 ? 57.298 -9.285  37.515 1.00 14.15  ? 259 GLN A CB  1 
ATOM   2071 C CG  . GLN A 1 278 ? 57.931 -9.075  38.907 1.00 16.14  ? 259 GLN A CG  1 
ATOM   2072 C CD  . GLN A 1 278 ? 59.230 -8.264  38.850 1.00 16.36  ? 259 GLN A CD  1 
ATOM   2073 O OE1 . GLN A 1 278 ? 59.214 -7.071  38.528 1.00 17.67  ? 259 GLN A OE1 1 
ATOM   2074 N NE2 . GLN A 1 278 ? 60.346 -8.897  39.192 1.00 16.25  ? 259 GLN A NE2 1 
ATOM   2075 N N   . ARG A 1 279 ? 57.415 -12.395 36.982 1.00 13.51  ? 260 ARG A N   1 
ATOM   2076 C CA  . ARG A 1 279 ? 57.538 -13.798 37.443 1.00 13.50  ? 260 ARG A CA  1 
ATOM   2077 C C   . ARG A 1 279 ? 58.736 -14.484 36.794 1.00 13.74  ? 260 ARG A C   1 
ATOM   2078 O O   . ARG A 1 279 ? 59.489 -15.224 37.468 1.00 13.82  ? 260 ARG A O   1 
ATOM   2079 C CB  . ARG A 1 279 ? 56.207 -14.513 37.147 1.00 19.03  ? 260 ARG A CB  1 
ATOM   2080 C CG  . ARG A 1 279 ? 56.003 -15.920 37.561 1.00 26.08  ? 260 ARG A CG  1 
ATOM   2081 C CD  . ARG A 1 279 ? 54.506 -16.219 37.240 1.00 33.88  ? 260 ARG A CD  1 
ATOM   2082 N NE  . ARG A 1 279 ? 53.647 -15.234 37.925 1.00 37.91  ? 260 ARG A NE  1 
ATOM   2083 C CZ  . ARG A 1 279 ? 52.730 -14.426 37.357 1.00 40.71  ? 260 ARG A CZ  1 
ATOM   2084 N NH1 . ARG A 1 279 ? 52.468 -14.453 36.042 1.00 39.95  ? 260 ARG A NH1 1 
ATOM   2085 N NH2 . ARG A 1 279 ? 52.057 -13.572 38.131 1.00 41.27  ? 260 ARG A NH2 1 
ATOM   2086 N N   . MET A 1 280 ? 58.903 -14.262 35.497 1.00 13.16  ? 261 MET A N   1 
ATOM   2087 C CA  . MET A 1 280 ? 60.089 -14.789 34.795 1.00 11.11  ? 261 MET A CA  1 
ATOM   2088 C C   . MET A 1 280 ? 61.402 -14.230 35.347 1.00 12.11  ? 261 MET A C   1 
ATOM   2089 O O   . MET A 1 280 ? 62.365 -14.970 35.538 1.00 13.23  ? 261 MET A O   1 
ATOM   2090 C CB  . MET A 1 280 ? 59.993 -14.522 33.291 1.00 11.91  ? 261 MET A CB  1 
ATOM   2091 C CG  . MET A 1 280 ? 58.964 -15.422 32.653 1.00 13.34  ? 261 MET A CG  1 
ATOM   2092 S SD  . MET A 1 280 ? 59.025 -15.397 30.815 1.00 18.82  ? 261 MET A SD  1 
ATOM   2093 C CE  . MET A 1 280 ? 58.233 -13.851 30.625 1.00 20.63  ? 261 MET A CE  1 
ATOM   2094 N N   . ALA A 1 281 ? 61.431 -12.926 35.610 1.00 12.06  ? 262 ALA A N   1 
ATOM   2095 C CA  . ALA A 1 281 ? 62.620 -12.315 36.190 1.00 12.32  ? 262 ALA A CA  1 
ATOM   2096 C C   . ALA A 1 281 ? 62.938 -12.954 37.567 1.00 13.38  ? 262 ALA A C   1 
ATOM   2097 O O   . ALA A 1 281 ? 64.097 -13.228 37.896 1.00 12.06  ? 262 ALA A O   1 
ATOM   2098 C CB  . ALA A 1 281 ? 62.417 -10.791 36.356 1.00 12.37  ? 262 ALA A CB  1 
ATOM   2099 N N   . ASP A 1 282 ? 61.903 -13.148 38.367 1.00 13.71  ? 263 ASP A N   1 
ATOM   2100 C CA  . ASP A 1 282 ? 62.089 -13.726 39.718 1.00 13.76  ? 263 ASP A CA  1 
ATOM   2101 C C   . ASP A 1 282 ? 62.669 -15.141 39.613 1.00 14.50  ? 263 ASP A C   1 
ATOM   2102 O O   . ASP A 1 282 ? 63.578 -15.532 40.369 1.00 15.10  ? 263 ASP A O   1 
ATOM   2103 C CB  . ASP A 1 282 ? 60.749 -13.770 40.483 1.00 15.07  ? 263 ASP A CB  1 
ATOM   2104 C CG  . ASP A 1 282 ? 60.233 -12.377 40.903 1.00 17.50  ? 263 ASP A CG  1 
ATOM   2105 O OD1 . ASP A 1 282 ? 60.966 -11.373 40.800 1.00 17.58  ? 263 ASP A OD1 1 
ATOM   2106 O OD2 . ASP A 1 282 ? 59.071 -12.305 41.338 1.00 20.13  ? 263 ASP A OD2 1 
ATOM   2107 N N   . ARG A 1 283 ? 62.154 -15.896 38.653 1.00 12.59  ? 264 ARG A N   1 
ATOM   2108 C CA  . ARG A 1 283 ? 62.596 -17.285 38.444 1.00 12.60  ? 264 ARG A CA  1 
ATOM   2109 C C   . ARG A 1 283 ? 64.051 -17.292 37.946 1.00 11.60  ? 264 ARG A C   1 
ATOM   2110 O O   . ARG A 1 283 ? 64.862 -18.073 38.407 1.00 13.71  ? 264 ARG A O   1 
ATOM   2111 C CB  . ARG A 1 283 ? 61.670 -17.970 37.458 1.00 14.78  ? 264 ARG A CB  1 
ATOM   2112 C CG  . ARG A 1 283 ? 62.181 -19.309 36.986 1.00 17.92  ? 264 ARG A CG  1 
ATOM   2113 C CD  . ARG A 1 283 ? 62.045 -20.359 38.014 1.00 22.58  ? 264 ARG A CD  1 
ATOM   2114 N NE  . ARG A 1 283 ? 62.206 -21.665 37.358 1.00 27.50  ? 264 ARG A NE  1 
ATOM   2115 C CZ  . ARG A 1 283 ? 62.438 -22.778 38.032 1.00 29.53  ? 264 ARG A CZ  1 
ATOM   2116 N NH1 . ARG A 1 283 ? 62.517 -22.719 39.369 1.00 32.37  ? 264 ARG A NH1 1 
ATOM   2117 N NH2 . ARG A 1 283 ? 62.572 -23.927 37.387 1.00 25.83  ? 264 ARG A NH2 1 
ATOM   2118 N N   . PHE A 1 284 ? 64.374 -16.350 37.050 1.00 11.26  ? 265 PHE A N   1 
ATOM   2119 C CA  . PHE A 1 284 ? 65.750 -16.182 36.589 1.00 10.26  ? 265 PHE A CA  1 
ATOM   2120 C C   . PHE A 1 284 ? 66.688 -15.994 37.770 1.00 13.29  ? 265 PHE A C   1 
ATOM   2121 O O   . PHE A 1 284 ? 67.727 -16.651 37.856 1.00 13.45  ? 265 PHE A O   1 
ATOM   2122 C CB  . PHE A 1 284 ? 65.817 -14.986 35.583 1.00 10.35  ? 265 PHE A CB  1 
ATOM   2123 C CG  . PHE A 1 284 ? 67.178 -14.700 35.063 1.00 10.02  ? 265 PHE A CG  1 
ATOM   2124 C CD1 . PHE A 1 284 ? 67.630 -15.276 33.847 1.00 8.77   ? 265 PHE A CD1 1 
ATOM   2125 C CD2 . PHE A 1 284 ? 68.023 -13.854 35.762 1.00 12.86  ? 265 PHE A CD2 1 
ATOM   2126 C CE1 . PHE A 1 284 ? 68.912 -15.003 33.353 1.00 9.94   ? 265 PHE A CE1 1 
ATOM   2127 C CE2 . PHE A 1 284 ? 69.290 -13.580 35.281 1.00 14.80  ? 265 PHE A CE2 1 
ATOM   2128 C CZ  . PHE A 1 284 ? 69.734 -14.125 34.059 1.00 12.94  ? 265 PHE A CZ  1 
ATOM   2129 N N   . CYS A 1 285 ? 66.312 -15.103 38.681 1.00 13.85  ? 266 CYS A N   1 
ATOM   2130 C CA  . CYS A 1 285 ? 67.186 -14.789 39.804 1.00 13.13  ? 266 CYS A CA  1 
ATOM   2131 C C   . CYS A 1 285 ? 67.254 -15.959 40.786 1.00 13.57  ? 266 CYS A C   1 
ATOM   2132 O O   . CYS A 1 285 ? 68.321 -16.220 41.357 1.00 14.18  ? 266 CYS A O   1 
ATOM   2133 C CB  . CYS A 1 285 ? 66.711 -13.524 40.521 1.00 13.99  ? 266 CYS A CB  1 
ATOM   2134 S SG  . CYS A 1 285 ? 66.885 -12.030 39.487 1.00 15.82  ? 266 CYS A SG  1 
ATOM   2135 N N   . ASP A 1 286 ? 66.141 -16.675 40.981 1.00 14.58  ? 267 ASP A N   1 
ATOM   2136 C CA  . ASP A 1 286 ? 66.167 -17.867 41.841 1.00 15.14  ? 267 ASP A CA  1 
ATOM   2137 C C   . ASP A 1 286 ? 67.130 -18.906 41.273 1.00 14.85  ? 267 ASP A C   1 
ATOM   2138 O O   . ASP A 1 286 ? 67.879 -19.546 42.016 1.00 16.07  ? 267 ASP A O   1 
ATOM   2139 C CB  . ASP A 1 286 ? 64.785 -18.509 41.969 1.00 17.69  ? 267 ASP A CB  1 
ATOM   2140 C CG  . ASP A 1 286 ? 63.825 -17.705 42.793 1.00 22.16  ? 267 ASP A CG  1 
ATOM   2141 O OD1 . ASP A 1 286 ? 64.256 -16.845 43.570 1.00 23.68  ? 267 ASP A OD1 1 
ATOM   2142 O OD2 . ASP A 1 286 ? 62.616 -17.981 42.698 1.00 25.30  ? 267 ASP A OD2 1 
ATOM   2143 N N   . LEU A 1 287 ? 67.104 -19.085 39.943 1.00 12.60  ? 268 LEU A N   1 
ATOM   2144 C CA  . LEU A 1 287 ? 67.986 -20.064 39.322 1.00 12.17  ? 268 LEU A CA  1 
ATOM   2145 C C   . LEU A 1 287 ? 69.444 -19.601 39.426 1.00 14.51  ? 268 LEU A C   1 
ATOM   2146 O O   . LEU A 1 287 ? 70.351 -20.382 39.638 1.00 15.11  ? 268 LEU A O   1 
ATOM   2147 C CB  . LEU A 1 287 ? 67.593 -20.274 37.842 1.00 13.64  ? 268 LEU A CB  1 
ATOM   2148 C CG  . LEU A 1 287 ? 66.296 -21.062 37.671 1.00 15.50  ? 268 LEU A CG  1 
ATOM   2149 C CD1 . LEU A 1 287 ? 65.844 -20.989 36.192 1.00 16.70  ? 268 LEU A CD1 1 
ATOM   2150 C CD2 . LEU A 1 287 ? 66.500 -22.554 38.081 1.00 17.89  ? 268 LEU A CD2 1 
ATOM   2151 N N   . ARG A 1 288 ? 69.695 -18.304 39.271 1.00 14.22  ? 269 ARG A N   1 
ATOM   2152 C CA  A ARG A 1 288 ? 71.055 -17.794 39.438 0.50 16.34  ? 269 ARG A CA  1 
ATOM   2153 C CA  B ARG A 1 288 ? 71.072 -17.802 39.441 0.50 14.86  ? 269 ARG A CA  1 
ATOM   2154 C C   . ARG A 1 288 ? 71.591 -18.097 40.850 1.00 16.00  ? 269 ARG A C   1 
ATOM   2155 O O   . ARG A 1 288 ? 72.761 -18.433 41.013 1.00 16.73  ? 269 ARG A O   1 
ATOM   2156 C CB  A ARG A 1 288 ? 71.068 -16.290 39.115 0.50 19.27  ? 269 ARG A CB  1 
ATOM   2157 C CB  B ARG A 1 288 ? 71.155 -16.290 39.141 0.50 15.25  ? 269 ARG A CB  1 
ATOM   2158 C CG  A ARG A 1 288 ? 71.659 -15.382 40.168 0.50 22.46  ? 269 ARG A CG  1 
ATOM   2159 C CG  B ARG A 1 288 ? 72.584 -15.689 39.230 0.50 15.34  ? 269 ARG A CG  1 
ATOM   2160 C CD  A ARG A 1 288 ? 71.877 -13.993 39.579 0.50 23.08  ? 269 ARG A CD  1 
ATOM   2161 C CD  B ARG A 1 288 ? 73.562 -16.391 38.307 0.50 16.24  ? 269 ARG A CD  1 
ATOM   2162 N NE  A ARG A 1 288 ? 72.535 -14.094 38.302 0.50 21.10  ? 269 ARG A NE  1 
ATOM   2163 N NE  B ARG A 1 288 ? 74.927 -15.850 38.373 0.50 16.32  ? 269 ARG A NE  1 
ATOM   2164 C CZ  A ARG A 1 288 ? 73.839 -14.022 38.097 0.50 19.13  ? 269 ARG A CZ  1 
ATOM   2165 C CZ  B ARG A 1 288 ? 75.844 -16.214 39.266 0.50 15.50  ? 269 ARG A CZ  1 
ATOM   2166 N NH1 A ARG A 1 288 ? 74.691 -13.772 39.091 0.50 17.65  ? 269 ARG A NH1 1 
ATOM   2167 N NH1 B ARG A 1 288 ? 75.548 -17.090 40.226 0.50 15.95  ? 269 ARG A NH1 1 
ATOM   2168 N NH2 A ARG A 1 288 ? 74.293 -14.198 36.871 0.50 18.84  ? 269 ARG A NH2 1 
ATOM   2169 N NH2 B ARG A 1 288 ? 77.075 -15.705 39.195 0.50 15.70  ? 269 ARG A NH2 1 
ATOM   2170 N N   . ASP A 1 289 ? 70.723 -17.994 41.860 1.00 15.49  ? 270 ASP A N   1 
ATOM   2171 C CA  . ASP A 1 289 ? 71.093 -18.347 43.257 1.00 16.05  ? 270 ASP A CA  1 
ATOM   2172 C C   . ASP A 1 289 ? 71.497 -19.809 43.426 1.00 16.98  ? 270 ASP A C   1 
ATOM   2173 O O   . ASP A 1 289 ? 72.274 -20.145 44.326 1.00 17.07  ? 270 ASP A O   1 
ATOM   2174 C CB  . ASP A 1 289 ? 69.915 -18.088 44.214 1.00 17.60  ? 270 ASP A CB  1 
ATOM   2175 C CG  . ASP A 1 289 ? 69.642 -16.598 44.472 1.00 21.65  ? 270 ASP A CG  1 
ATOM   2176 O OD1 . ASP A 1 289 ? 70.502 -15.734 44.165 1.00 23.71  ? 270 ASP A OD1 1 
ATOM   2177 O OD2 . ASP A 1 289 ? 68.550 -16.291 45.027 1.00 23.16  ? 270 ASP A OD2 1 
ATOM   2178 N N   . GLN A 1 290 ? 70.948 -20.662 42.558 1.00 15.70  ? 271 GLN A N   1 
ATOM   2179 C CA  . GLN A 1 290 ? 71.173 -22.117 42.562 1.00 16.92  ? 271 GLN A CA  1 
ATOM   2180 C C   . GLN A 1 290 ? 72.387 -22.539 41.704 1.00 16.25  ? 271 GLN A C   1 
ATOM   2181 O O   . GLN A 1 290 ? 72.747 -23.722 41.672 1.00 16.66  ? 271 GLN A O   1 
ATOM   2182 C CB  . GLN A 1 290 ? 69.909 -22.838 42.078 1.00 18.39  ? 271 GLN A CB  1 
ATOM   2183 C CG  . GLN A 1 290 ? 68.648 -22.578 42.948 1.00 20.81  ? 271 GLN A CG  1 
ATOM   2184 C CD  . GLN A 1 290 ? 67.362 -23.065 42.311 1.00 25.10  ? 271 GLN A CD  1 
ATOM   2185 O OE1 . GLN A 1 290 ? 67.378 -23.917 41.424 1.00 27.27  ? 271 GLN A OE1 1 
ATOM   2186 N NE2 . GLN A 1 290 ? 66.228 -22.507 42.758 1.00 27.02  ? 271 GLN A NE2 1 
ATOM   2187 N N   . LEU A 1 291 ? 73.019 -21.584 41.020 1.00 15.18  ? 272 LEU A N   1 
ATOM   2188 C CA  . LEU A 1 291 ? 74.129 -21.884 40.119 1.00 14.78  ? 272 LEU A CA  1 
ATOM   2189 C C   . LEU A 1 291 ? 75.342 -22.524 40.838 1.00 15.22  ? 272 LEU A C   1 
ATOM   2190 O O   . LEU A 1 291 ? 75.862 -23.540 40.364 1.00 15.67  ? 272 LEU A O   1 
ATOM   2191 C CB  . LEU A 1 291 ? 74.532 -20.623 39.336 1.00 15.04  ? 272 LEU A CB  1 
ATOM   2192 C CG  . LEU A 1 291 ? 75.740 -20.742 38.393 1.00 15.36  ? 272 LEU A CG  1 
ATOM   2193 C CD1 . LEU A 1 291 ? 75.625 -19.708 37.225 1.00 18.41  ? 272 LEU A CD1 1 
ATOM   2194 C CD2 . LEU A 1 291 ? 77.110 -20.524 39.093 1.00 16.74  ? 272 LEU A CD2 1 
ATOM   2195 N N   . PRO A 1 292 ? 75.763 -21.991 42.009 1.00 14.76  ? 273 PRO A N   1 
ATOM   2196 C CA  . PRO A 1 292 ? 76.919 -22.677 42.596 1.00 16.18  ? 273 PRO A CA  1 
ATOM   2197 C C   . PRO A 1 292 ? 76.650 -24.146 42.918 1.00 16.93  ? 273 PRO A C   1 
ATOM   2198 O O   . PRO A 1 292 ? 77.503 -24.980 42.615 1.00 18.06  ? 273 PRO A O   1 
ATOM   2199 C CB  . PRO A 1 292 ? 77.180 -21.874 43.891 1.00 17.21  ? 273 PRO A CB  1 
ATOM   2200 C CG  . PRO A 1 292 ? 76.683 -20.474 43.507 1.00 17.43  ? 273 PRO A CG  1 
ATOM   2201 C CD  . PRO A 1 292 ? 75.416 -20.755 42.744 1.00 15.76  ? 273 PRO A CD  1 
ATOM   2202 N N   . ASP A 1 293 ? 75.478 -24.471 43.457 1.00 16.26  ? 274 ASP A N   1 
ATOM   2203 C CA  . ASP A 1 293 ? 75.178 -25.890 43.776 1.00 18.07  ? 274 ASP A CA  1 
ATOM   2204 C C   . ASP A 1 293 ? 75.162 -26.715 42.478 1.00 16.53  ? 274 ASP A C   1 
ATOM   2205 O O   . ASP A 1 293 ? 75.616 -27.878 42.453 1.00 17.48  ? 274 ASP A O   1 
ATOM   2206 C CB  . ASP A 1 293 ? 73.819 -26.036 44.513 1.00 21.28  ? 274 ASP A CB  1 
ATOM   2207 C CG  . ASP A 1 293 ? 73.875 -25.659 46.012 1.00 26.45  ? 274 ASP A CG  1 
ATOM   2208 O OD1 . ASP A 1 293 ? 74.959 -25.382 46.583 1.00 26.91  ? 274 ASP A OD1 1 
ATOM   2209 O OD2 . ASP A 1 293 ? 72.783 -25.635 46.636 1.00 30.80  ? 274 ASP A OD2 1 
ATOM   2210 N N   . ALA A 1 294 ? 74.645 -26.113 41.388 1.00 15.89  ? 275 ALA A N   1 
ATOM   2211 C CA  . ALA A 1 294 ? 74.564 -26.855 40.116 1.00 16.41  ? 275 ALA A CA  1 
ATOM   2212 C C   . ALA A 1 294 ? 75.971 -27.172 39.608 1.00 16.02  ? 275 ALA A C   1 
ATOM   2213 O O   . ALA A 1 294 ? 76.245 -28.297 39.134 1.00 17.80  ? 275 ALA A O   1 
ATOM   2214 C CB  . ALA A 1 294 ? 73.776 -26.052 39.071 1.00 17.70  ? 275 ALA A CB  1 
ATOM   2215 N N   . CYS A 1 295 ? 76.863 -26.176 39.679 1.00 16.78  ? 276 CYS A N   1 
ATOM   2216 C CA  . CYS A 1 295 ? 78.239 -26.358 39.234 1.00 15.40  ? 276 CYS A CA  1 
ATOM   2217 C C   . CYS A 1 295 ? 78.970 -27.381 40.089 1.00 16.70  ? 276 CYS A C   1 
ATOM   2218 O O   . CYS A 1 295 ? 79.615 -28.301 39.539 1.00 17.90  ? 276 CYS A O   1 
ATOM   2219 C CB  . CYS A 1 295 ? 78.974 -25.015 39.221 1.00 16.05  ? 276 CYS A CB  1 
ATOM   2220 S SG  . CYS A 1 295 ? 78.303 -23.889 37.936 1.00 17.42  ? 276 CYS A SG  1 
ATOM   2221 N N   . ARG A 1 296 ? 78.878 -27.250 41.414 1.00 17.07  ? 277 ARG A N   1 
ATOM   2222 C CA  . ARG A 1 296 ? 79.499 -28.241 42.278 1.00 17.69  ? 277 ARG A CA  1 
ATOM   2223 C C   . ARG A 1 296 ? 78.981 -29.665 42.000 1.00 16.70  ? 277 ARG A C   1 
ATOM   2224 O O   . ARG A 1 296 ? 79.740 -30.630 42.122 1.00 18.52  ? 277 ARG A O   1 
ATOM   2225 C CB  . ARG A 1 296 ? 79.273 -27.884 43.765 1.00 19.74  ? 277 ARG A CB  1 
ATOM   2226 C CG  . ARG A 1 296 ? 80.073 -26.714 44.223 1.00 23.74  ? 277 ARG A CG  1 
ATOM   2227 C CD  . ARG A 1 296 ? 79.941 -26.559 45.755 1.00 28.83  ? 277 ARG A CD  1 
ATOM   2228 N NE  . ARG A 1 296 ? 78.634 -26.002 46.127 1.00 33.43  ? 277 ARG A NE  1 
ATOM   2229 C CZ  . ARG A 1 296 ? 78.373 -24.695 46.206 1.00 36.91  ? 277 ARG A CZ  1 
ATOM   2230 N NH1 . ARG A 1 296 ? 77.159 -24.278 46.554 1.00 38.03  ? 277 ARG A NH1 1 
ATOM   2231 N NH2 . ARG A 1 296 ? 79.331 -23.793 45.950 1.00 38.56  ? 277 ARG A NH2 1 
ATOM   2232 N N   . SER A 1 297 ? 77.691 -29.805 41.676 1.00 17.17  ? 278 SER A N   1 
ATOM   2233 C CA  . SER A 1 297 ? 77.126 -31.144 41.466 1.00 17.61  ? 278 SER A CA  1 
ATOM   2234 C C   . SER A 1 297 ? 77.777 -31.857 40.279 1.00 17.98  ? 278 SER A C   1 
ATOM   2235 O O   . SER A 1 297 ? 77.767 -33.085 40.219 1.00 19.41  ? 278 SER A O   1 
ATOM   2236 C CB  . SER A 1 297 ? 75.616 -31.069 41.250 1.00 19.22  ? 278 SER A CB  1 
ATOM   2237 O OG  . SER A 1 297 ? 75.299 -30.698 39.910 1.00 20.87  ? 278 SER A OG  1 
ATOM   2238 N N   . MET A 1 298 ? 78.347 -31.088 39.344 1.00 18.63  ? 279 MET A N   1 
ATOM   2239 C CA  . MET A 1 298 ? 79.043 -31.670 38.189 1.00 18.22  ? 279 MET A CA  1 
ATOM   2240 C C   . MET A 1 298 ? 80.560 -31.712 38.350 1.00 18.24  ? 279 MET A C   1 
ATOM   2241 O O   . MET A 1 298 ? 81.276 -32.093 37.419 1.00 17.87  ? 279 MET A O   1 
ATOM   2242 C CB  . MET A 1 298 ? 78.675 -30.913 36.882 1.00 18.48  ? 279 MET A CB  1 
ATOM   2243 C CG  . MET A 1 298 ? 77.211 -31.108 36.458 1.00 18.33  ? 279 MET A CG  1 
ATOM   2244 S SD  . MET A 1 298 ? 76.883 -30.460 34.827 1.00 18.08  ? 279 MET A SD  1 
ATOM   2245 C CE  . MET A 1 298 ? 77.127 -28.719 35.187 1.00 15.99  ? 279 MET A CE  1 
ATOM   2246 N N   . SER A 1 299 ? 81.052 -31.261 39.512 1.00 18.32  ? 280 SER A N   1 
ATOM   2247 C CA  . SER A 1 299 ? 82.477 -31.175 39.785 1.00 18.05  ? 280 SER A CA  1 
ATOM   2248 C C   . SER A 1 299 ? 83.216 -30.431 38.683 1.00 18.93  ? 280 SER A C   1 
ATOM   2249 O O   . SER A 1 299 ? 84.250 -30.894 38.232 1.00 20.58  ? 280 SER A O   1 
ATOM   2250 C CB  . SER A 1 299 ? 83.090 -32.588 39.984 1.00 19.77  ? 280 SER A CB  1 
ATOM   2251 O OG  . SER A 1 299 ? 82.604 -33.201 41.174 1.00 22.41  ? 280 SER A OG  1 
ATOM   2252 N N   . LEU A 1 300 ? 82.696 -29.266 38.264 1.00 17.68  ? 281 LEU A N   1 
ATOM   2253 C CA  . LEU A 1 300 ? 83.428 -28.418 37.328 1.00 17.40  ? 281 LEU A CA  1 
ATOM   2254 C C   . LEU A 1 300 ? 84.816 -28.059 37.867 1.00 19.54  ? 281 LEU A C   1 
ATOM   2255 O O   . LEU A 1 300 ? 84.971 -27.815 39.068 1.00 21.39  ? 281 LEU A O   1 
ATOM   2256 C CB  . LEU A 1 300 ? 82.671 -27.133 37.063 1.00 16.88  ? 281 LEU A CB  1 
ATOM   2257 C CG  . LEU A 1 300 ? 81.259 -27.214 36.477 1.00 15.97  ? 281 LEU A CG  1 
ATOM   2258 C CD1 . LEU A 1 300 ? 80.853 -25.779 36.123 1.00 18.17  ? 281 LEU A CD1 1 
ATOM   2259 C CD2 . LEU A 1 300 ? 81.261 -28.159 35.242 1.00 16.10  ? 281 LEU A CD2 1 
ATOM   2260 N N   . ASP A 1 301 ? 85.809 -27.950 36.988 1.00 19.73  ? 282 ASP A N   1 
ATOM   2261 C CA  . ASP A 1 301 ? 87.099 -27.407 37.430 1.00 21.25  ? 282 ASP A CA  1 
ATOM   2262 C C   . ASP A 1 301 ? 87.005 -25.856 37.486 1.00 20.48  ? 282 ASP A C   1 
ATOM   2263 O O   . ASP A 1 301 ? 86.004 -25.282 37.072 1.00 19.00  ? 282 ASP A O   1 
ATOM   2264 C CB  . ASP A 1 301 ? 88.251 -27.916 36.537 1.00 22.73  ? 282 ASP A CB  1 
ATOM   2265 C CG  . ASP A 1 301 ? 88.228 -27.381 35.101 1.00 23.39  ? 282 ASP A CG  1 
ATOM   2266 O OD1 . ASP A 1 301 ? 87.800 -26.239 34.824 1.00 23.68  ? 282 ASP A OD1 1 
ATOM   2267 O OD2 . ASP A 1 301 ? 88.719 -28.123 34.222 1.00 26.67  ? 282 ASP A OD2 1 
ATOM   2268 N N   . PRO A 1 302 ? 88.034 -25.172 38.036 1.00 20.96  ? 283 PRO A N   1 
ATOM   2269 C CA  . PRO A 1 302 ? 87.931 -23.711 38.207 1.00 22.01  ? 283 PRO A CA  1 
ATOM   2270 C C   . PRO A 1 302 ? 87.716 -22.939 36.895 1.00 21.96  ? 283 PRO A C   1 
ATOM   2271 O O   . PRO A 1 302 ? 86.907 -22.002 36.904 1.00 21.62  ? 283 PRO A O   1 
ATOM   2272 C CB  . PRO A 1 302 ? 89.261 -23.354 38.874 1.00 22.90  ? 283 PRO A CB  1 
ATOM   2273 C CG  . PRO A 1 302 ? 89.599 -24.607 39.655 1.00 23.01  ? 283 PRO A CG  1 
ATOM   2274 C CD  . PRO A 1 302 ? 89.192 -25.734 38.753 1.00 21.75  ? 283 PRO A CD  1 
ATOM   2275 N N   . ALA A 1 303 ? 88.338 -23.355 35.786 1.00 21.06  ? 284 ALA A N   1 
ATOM   2276 C CA  . ALA A 1 303 ? 88.157 -22.630 34.515 1.00 18.77  ? 284 ALA A CA  1 
ATOM   2277 C C   . ALA A 1 303 ? 86.740 -22.792 33.994 1.00 18.07  ? 284 ALA A C   1 
ATOM   2278 O O   . ALA A 1 303 ? 86.190 -21.870 33.414 1.00 16.29  ? 284 ALA A O   1 
ATOM   2279 C CB  . ALA A 1 303 ? 89.165 -23.094 33.453 1.00 17.37  ? 284 ALA A CB  1 
ATOM   2280 N N   . GLN A 1 304 ? 86.181 -23.997 34.176 1.00 17.57  ? 285 GLN A N   1 
ATOM   2281 C CA  . GLN A 1 304 ? 84.830 -24.305 33.738 1.00 15.67  ? 285 GLN A CA  1 
ATOM   2282 C C   . GLN A 1 304 ? 83.838 -23.540 34.585 1.00 14.72  ? 285 GLN A C   1 
ATOM   2283 O O   . GLN A 1 304 ? 82.835 -23.018 34.088 1.00 14.37  ? 285 GLN A O   1 
ATOM   2284 C CB  . GLN A 1 304 ? 84.550 -25.807 33.843 1.00 15.19  ? 285 GLN A CB  1 
ATOM   2285 C CG  . GLN A 1 304 ? 85.325 -26.627 32.840 1.00 15.79  ? 285 GLN A CG  1 
ATOM   2286 C CD  . GLN A 1 304 ? 85.174 -28.135 33.081 1.00 17.13  ? 285 GLN A CD  1 
ATOM   2287 O OE1 . GLN A 1 304 ? 85.074 -28.575 34.241 1.00 19.40  ? 285 GLN A OE1 1 
ATOM   2288 N NE2 . GLN A 1 304 ? 85.114 -28.931 31.990 1.00 18.24  ? 285 GLN A NE2 1 
ATOM   2289 N N   . ARG A 1 305 ? 84.105 -23.510 35.894 1.00 17.04  ? 286 ARG A N   1 
ATOM   2290 C CA  . ARG A 1 305 ? 83.265 -22.725 36.799 1.00 18.11  ? 286 ARG A CA  1 
ATOM   2291 C C   . ARG A 1 305 ? 83.268 -21.232 36.450 1.00 16.51  ? 286 ARG A C   1 
ATOM   2292 O O   . ARG A 1 305 ? 82.218 -20.577 36.462 1.00 15.76  ? 286 ARG A O   1 
ATOM   2293 C CB  . ARG A 1 305 ? 83.743 -22.917 38.256 1.00 17.10  ? 286 ARG A CB  1 
ATOM   2294 C CG  . ARG A 1 305 ? 82.997 -22.077 39.309 1.00 18.48  ? 286 ARG A CG  1 
ATOM   2295 C CD  . ARG A 1 305 ? 81.470 -22.274 39.372 1.00 18.01  ? 286 ARG A CD  1 
ATOM   2296 N NE  . ARG A 1 305 ? 80.946 -21.468 40.478 1.00 20.35  ? 286 ARG A NE  1 
ATOM   2297 C CZ  . ARG A 1 305 ? 80.718 -21.885 41.729 1.00 22.21  ? 286 ARG A CZ  1 
ATOM   2298 N NH1 . ARG A 1 305 ? 80.264 -21.015 42.613 1.00 23.72  ? 286 ARG A NH1 1 
ATOM   2299 N NH2 . ARG A 1 305 ? 80.873 -23.156 42.097 1.00 23.23  ? 286 ARG A NH2 1 
ATOM   2300 N N   . LEU A 1 306 ? 84.431 -20.692 36.145 1.00 15.54  ? 287 LEU A N   1 
ATOM   2301 C CA  . LEU A 1 306 ? 84.525 -19.277 35.760 1.00 15.33  ? 287 LEU A CA  1 
ATOM   2302 C C   . LEU A 1 306 ? 83.750 -19.009 34.456 1.00 15.14  ? 287 LEU A C   1 
ATOM   2303 O O   . LEU A 1 306 ? 83.036 -17.982 34.340 1.00 14.47  ? 287 LEU A O   1 
ATOM   2304 C CB  . LEU A 1 306 ? 86.008 -18.881 35.603 1.00 18.79  ? 287 LEU A CB  1 
ATOM   2305 C CG  . LEU A 1 306 ? 86.396 -17.432 35.330 1.00 23.18  ? 287 LEU A CG  1 
ATOM   2306 C CD1 . LEU A 1 306 ? 86.345 -17.172 33.918 1.00 30.22  ? 287 LEU A CD1 1 
ATOM   2307 C CD2 . LEU A 1 306 ? 85.455 -16.508 36.063 1.00 21.39  ? 287 LEU A CD2 1 
ATOM   2308 N N   . ALA A 1 307 ? 83.865 -19.924 33.483 1.00 14.27  ? 288 ALA A N   1 
ATOM   2309 C CA  . ALA A 1 307 ? 83.091 -19.752 32.251 1.00 13.01  ? 288 ALA A CA  1 
ATOM   2310 C C   . ALA A 1 307 ? 81.599 -19.760 32.521 1.00 12.74  ? 288 ALA A C   1 
ATOM   2311 O O   . ALA A 1 307 ? 80.821 -18.997 31.909 1.00 13.95  ? 288 ALA A O   1 
ATOM   2312 C CB  . ALA A 1 307 ? 83.434 -20.861 31.230 1.00 14.69  ? 288 ALA A CB  1 
ATOM   2313 N N   . ALA A 1 308 ? 81.164 -20.682 33.375 1.00 11.70  ? 289 ALA A N   1 
ATOM   2314 C CA  . ALA A 1 308 ? 79.755 -20.779 33.738 1.00 12.14  ? 289 ALA A CA  1 
ATOM   2315 C C   . ALA A 1 308 ? 79.274 -19.460 34.343 1.00 12.57  ? 289 ALA A C   1 
ATOM   2316 O O   . ALA A 1 308 ? 78.190 -18.997 34.022 1.00 12.13  ? 289 ALA A O   1 
ATOM   2317 C CB  . ALA A 1 308 ? 79.547 -21.946 34.724 1.00 12.91  ? 289 ALA A CB  1 
ATOM   2318 N N   . GLU A 1 309 ? 80.074 -18.869 35.226 1.00 12.98  ? 290 GLU A N   1 
ATOM   2319 C CA  . GLU A 1 309 ? 79.700 -17.602 35.847 1.00 14.31  ? 290 GLU A CA  1 
ATOM   2320 C C   . GLU A 1 309 ? 79.694 -16.447 34.833 1.00 13.73  ? 290 GLU A C   1 
ATOM   2321 O O   . GLU A 1 309 ? 78.784 -15.627 34.824 1.00 13.26  ? 290 GLU A O   1 
ATOM   2322 C CB  . GLU A 1 309 ? 80.672 -17.290 37.002 1.00 15.56  ? 290 GLU A CB  1 
ATOM   2323 C CG  . GLU A 1 309 ? 80.491 -18.255 38.156 1.00 19.38  ? 290 GLU A CG  1 
ATOM   2324 C CD  . GLU A 1 309 ? 81.585 -18.146 39.210 1.00 25.50  ? 290 GLU A CD  1 
ATOM   2325 O OE1 . GLU A 1 309 ? 81.402 -18.709 40.303 1.00 27.01  ? 290 GLU A OE1 1 
ATOM   2326 O OE2 . GLU A 1 309 ? 82.647 -17.511 38.941 1.00 29.33  ? 290 GLU A OE2 1 
ATOM   2327 N N   . ARG A 1 310 ? 80.697 -16.403 33.959 1.00 13.20  ? 291 ARG A N   1 
ATOM   2328 C CA  . ARG A 1 310 ? 80.737 -15.339 32.931 1.00 11.90  ? 291 ARG A CA  1 
ATOM   2329 C C   . ARG A 1 310 ? 79.516 -15.411 31.998 1.00 11.86  ? 291 ARG A C   1 
ATOM   2330 O O   . ARG A 1 310 ? 78.932 -14.379 31.600 1.00 12.53  ? 291 ARG A O   1 
ATOM   2331 C CB  . ARG A 1 310 ? 82.037 -15.424 32.117 1.00 13.30  ? 291 ARG A CB  1 
ATOM   2332 C CG  . ARG A 1 310 ? 83.338 -15.110 32.924 1.00 14.21  ? 291 ARG A CG  1 
ATOM   2333 C CD  . ARG A 1 310 ? 84.551 -15.110 32.018 1.00 16.14  ? 291 ARG A CD  1 
ATOM   2334 N NE  . ARG A 1 310 ? 84.517 -14.013 31.063 1.00 17.23  ? 291 ARG A NE  1 
ATOM   2335 C CZ  . ARG A 1 310 ? 85.342 -13.907 30.030 1.00 19.39  ? 291 ARG A CZ  1 
ATOM   2336 N NH1 . ARG A 1 310 ? 86.254 -14.874 29.792 1.00 18.88  ? 291 ARG A NH1 1 
ATOM   2337 N NH2 . ARG A 1 310 ? 85.234 -12.838 29.221 1.00 19.62  ? 291 ARG A NH2 1 
ATOM   2338 N N   . TYR A 1 311 ? 79.111 -16.621 31.663 1.00 11.70  ? 292 TYR A N   1 
ATOM   2339 C CA  . TYR A 1 311 ? 77.919 -16.811 30.837 1.00 10.01  ? 292 TYR A CA  1 
ATOM   2340 C C   . TYR A 1 311 ? 76.640 -16.377 31.537 1.00 11.28  ? 292 TYR A C   1 
ATOM   2341 O O   . TYR A 1 311 ? 75.874 -15.603 30.989 1.00 12.05  ? 292 TYR A O   1 
ATOM   2342 C CB  . TYR A 1 311 ? 77.856 -18.307 30.449 1.00 10.68  ? 292 TYR A CB  1 
ATOM   2343 C CG  . TYR A 1 311 ? 76.645 -18.752 29.649 1.00 10.92  ? 292 TYR A CG  1 
ATOM   2344 C CD1 . TYR A 1 311 ? 76.194 -18.016 28.547 1.00 10.86  ? 292 TYR A CD1 1 
ATOM   2345 C CD2 . TYR A 1 311 ? 76.014 -20.006 29.940 1.00 10.24  ? 292 TYR A CD2 1 
ATOM   2346 C CE1 . TYR A 1 311 ? 75.102 -18.443 27.822 1.00 12.09  ? 292 TYR A CE1 1 
ATOM   2347 C CE2 . TYR A 1 311 ? 74.921 -20.461 29.191 1.00 10.34  ? 292 TYR A CE2 1 
ATOM   2348 C CZ  . TYR A 1 311 ? 74.471 -19.671 28.124 1.00 11.43  ? 292 TYR A CZ  1 
ATOM   2349 O OH  . TYR A 1 311 ? 73.390 -20.104 27.381 1.00 14.08  ? 292 TYR A OH  1 
ATOM   2350 N N   . ALA A 1 312 ? 76.402 -16.880 32.753 1.00 11.34  ? 293 ALA A N   1 
ATOM   2351 C CA  . ALA A 1 312 ? 75.228 -16.507 33.517 1.00 13.34  ? 293 ALA A CA  1 
ATOM   2352 C C   . ALA A 1 312 ? 75.181 -14.995 33.827 1.00 14.05  ? 293 ALA A C   1 
ATOM   2353 O O   . ALA A 1 312 ? 74.133 -14.356 33.684 1.00 14.64  ? 293 ALA A O   1 
ATOM   2354 C CB  . ALA A 1 312 ? 75.173 -17.319 34.810 1.00 15.08  ? 293 ALA A CB  1 
ATOM   2355 N N   . ASP A 1 313 ? 76.322 -14.457 34.249 1.00 13.27  ? 294 ASP A N   1 
ATOM   2356 C CA  . ASP A 1 313 ? 76.422 -13.022 34.535 1.00 13.22  ? 294 ASP A CA  1 
ATOM   2357 C C   . ASP A 1 313 ? 76.220 -12.178 33.277 1.00 13.73  ? 294 ASP A C   1 
ATOM   2358 O O   . ASP A 1 313 ? 75.648 -11.089 33.363 1.00 12.84  ? 294 ASP A O   1 
ATOM   2359 C CB  . ASP A 1 313 ? 77.775 -12.699 35.159 1.00 14.93  ? 294 ASP A CB  1 
ATOM   2360 C CG  . ASP A 1 313 ? 77.907 -13.228 36.583 1.00 17.63  ? 294 ASP A CG  1 
ATOM   2361 O OD1 . ASP A 1 313 ? 76.909 -13.744 37.145 1.00 17.57  ? 294 ASP A OD1 1 
ATOM   2362 O OD2 . ASP A 1 313 ? 79.040 -13.138 37.138 1.00 21.79  ? 294 ASP A OD2 1 
ATOM   2363 N N   . GLY A 1 314 ? 76.694 -12.683 32.132 1.00 12.30  ? 295 GLY A N   1 
ATOM   2364 C CA  . GLY A 1 314 ? 76.508 -11.977 30.866 1.00 12.93  ? 295 GLY A CA  1 
ATOM   2365 C C   . GLY A 1 314 ? 75.029 -11.868 30.520 1.00 12.43  ? 295 GLY A C   1 
ATOM   2366 O O   . GLY A 1 314 ? 74.563 -10.823 30.074 1.00 12.02  ? 295 GLY A O   1 
ATOM   2367 N N   . MET A 1 315 ? 74.282 -12.952 30.693 1.00 12.89  ? 296 MET A N   1 
ATOM   2368 C CA  . MET A 1 315 ? 72.847 -12.907 30.425 1.00 12.10  ? 296 MET A CA  1 
ATOM   2369 C C   . MET A 1 315 ? 72.148 -11.943 31.427 1.00 12.08  ? 296 MET A C   1 
ATOM   2370 O O   . MET A 1 315 ? 71.276 -11.186 31.031 1.00 11.60  ? 296 MET A O   1 
ATOM   2371 C CB  . MET A 1 315 ? 72.242 -14.314 30.498 1.00 12.23  ? 296 MET A CB  1 
ATOM   2372 C CG  . MET A 1 315 ? 72.647 -15.165 29.294 1.00 12.30  ? 296 MET A CG  1 
ATOM   2373 S SD  . MET A 1 315 ? 71.864 -16.781 29.231 1.00 14.04  ? 296 MET A SD  1 
ATOM   2374 C CE  . MET A 1 315 ? 72.727 -17.671 30.581 1.00 13.18  ? 296 MET A CE  1 
ATOM   2375 N N   . ALA A 1 316 ? 72.536 -12.010 32.713 1.00 10.93  ? 297 ALA A N   1 
ATOM   2376 C CA  . ALA A 1 316 ? 71.973 -11.129 33.755 1.00 11.63  ? 297 ALA A CA  1 
ATOM   2377 C C   . ALA A 1 316 ? 72.231 -9.652  33.429 1.00 10.69  ? 297 ALA A C   1 
ATOM   2378 O O   . ALA A 1 316 ? 71.311 -8.839  33.520 1.00 12.76  ? 297 ALA A O   1 
ATOM   2379 C CB  . ALA A 1 316 ? 72.542 -11.448 35.163 1.00 12.59  ? 297 ALA A CB  1 
ATOM   2380 N N   . LEU A 1 317 ? 73.481 -9.301  33.105 1.00 11.62  ? 298 LEU A N   1 
ATOM   2381 C CA  . LEU A 1 317 ? 73.815 -7.894  32.782 1.00 11.26  ? 298 LEU A CA  1 
ATOM   2382 C C   . LEU A 1 317 ? 73.152 -7.432  31.475 1.00 11.80  ? 298 LEU A C   1 
ATOM   2383 O O   . LEU A 1 317 ? 72.748 -6.263  31.354 1.00 11.47  ? 298 LEU A O   1 
ATOM   2384 C CB  . LEU A 1 317 ? 75.339 -7.714  32.716 1.00 11.44  ? 298 LEU A CB  1 
ATOM   2385 C CG  . LEU A 1 317 ? 76.021 -7.722  34.100 1.00 12.51  ? 298 LEU A CG  1 
ATOM   2386 C CD1 . LEU A 1 317 ? 77.528 -7.726  33.948 1.00 14.86  ? 298 LEU A CD1 1 
ATOM   2387 C CD2 . LEU A 1 317 ? 75.569 -6.499  34.980 1.00 15.55  ? 298 LEU A CD2 1 
ATOM   2388 N N   . TRP A 1 318 ? 72.993 -8.352  30.516 1.00 13.19  ? 299 TRP A N   1 
ATOM   2389 C CA  . TRP A 1 318 ? 72.250 -8.056  29.269 1.00 10.70  ? 299 TRP A CA  1 
ATOM   2390 C C   . TRP A 1 318 ? 70.832 -7.608  29.637 1.00 11.17  ? 299 TRP A C   1 
ATOM   2391 O O   . TRP A 1 318 ? 70.320 -6.551  29.198 1.00 13.18  ? 299 TRP A O   1 
ATOM   2392 C CB  . TRP A 1 318 ? 72.224 -9.300  28.317 1.00 12.80  ? 299 TRP A CB  1 
ATOM   2393 C CG  . TRP A 1 318 ? 71.944 -8.850  26.894 1.00 14.24  ? 299 TRP A CG  1 
ATOM   2394 C CD1 . TRP A 1 318 ? 72.862 -8.686  25.879 1.00 15.02  ? 299 TRP A CD1 1 
ATOM   2395 C CD2 . TRP A 1 318 ? 70.670 -8.474  26.358 1.00 14.90  ? 299 TRP A CD2 1 
ATOM   2396 N NE1 . TRP A 1 318 ? 72.223 -8.217  24.744 1.00 15.57  ? 299 TRP A NE1 1 
ATOM   2397 C CE2 . TRP A 1 318 ? 70.881 -8.088  25.002 1.00 14.94  ? 299 TRP A CE2 1 
ATOM   2398 C CE3 . TRP A 1 318 ? 69.362 -8.457  26.871 1.00 16.83  ? 299 TRP A CE3 1 
ATOM   2399 C CZ2 . TRP A 1 318 ? 69.850 -7.620  24.177 1.00 16.63  ? 299 TRP A CZ2 1 
ATOM   2400 C CZ3 . TRP A 1 318 ? 68.330 -8.023  26.019 1.00 17.88  ? 299 TRP A CZ3 1 
ATOM   2401 C CH2 . TRP A 1 318 ? 68.598 -7.601  24.699 1.00 17.94  ? 299 TRP A CH2 1 
ATOM   2402 N N   . LEU A 1 319 ? 70.171 -8.419  30.440 1.00 12.79  ? 300 LEU A N   1 
ATOM   2403 C CA  A LEU A 1 319 ? 68.794 -8.146  30.851 0.50 14.07  ? 300 LEU A CA  1 
ATOM   2404 C CA  B LEU A 1 319 ? 68.802 -8.138  30.803 0.50 12.31  ? 300 LEU A CA  1 
ATOM   2405 C C   . LEU A 1 319 ? 68.659 -6.813  31.571 1.00 14.25  ? 300 LEU A C   1 
ATOM   2406 O O   . LEU A 1 319 ? 67.811 -6.008  31.233 1.00 14.25  ? 300 LEU A O   1 
ATOM   2407 C CB  A LEU A 1 319 ? 68.273 -9.241  31.784 0.50 15.51  ? 300 LEU A CB  1 
ATOM   2408 C CB  B LEU A 1 319 ? 68.267 -9.300  31.622 0.50 10.93  ? 300 LEU A CB  1 
ATOM   2409 C CG  A LEU A 1 319 ? 67.519 -10.476 31.300 0.50 16.33  ? 300 LEU A CG  1 
ATOM   2410 C CG  B LEU A 1 319 ? 66.853 -9.209  32.161 0.50 8.54   ? 300 LEU A CG  1 
ATOM   2411 C CD1 A LEU A 1 319 ? 67.095 -11.325 32.510 0.50 15.11  ? 300 LEU A CD1 1 
ATOM   2412 C CD1 B LEU A 1 319 ? 65.865 -9.182  30.993 0.50 8.07   ? 300 LEU A CD1 1 
ATOM   2413 C CD2 A LEU A 1 319 ? 66.299 -10.110 30.448 0.50 15.21  ? 300 LEU A CD2 1 
ATOM   2414 C CD2 B LEU A 1 319 ? 66.604 -10.379 33.083 0.50 10.28  ? 300 LEU A CD2 1 
ATOM   2415 N N   . ALA A 1 320 ? 69.491 -6.606  32.597 1.00 14.64  ? 301 ALA A N   1 
ATOM   2416 C CA  . ALA A 1 320 ? 69.403 -5.383  33.376 1.00 14.53  ? 301 ALA A CA  1 
ATOM   2417 C C   . ALA A 1 320 ? 69.634 -4.168  32.498 1.00 14.60  ? 301 ALA A C   1 
ATOM   2418 O O   . ALA A 1 320 ? 68.925 -3.163  32.629 1.00 16.24  ? 301 ALA A O   1 
ATOM   2419 C CB  . ALA A 1 320 ? 70.430 -5.393  34.559 1.00 15.63  ? 301 ALA A CB  1 
ATOM   2420 N N   . GLY A 1 321 ? 70.657 -4.243  31.634 1.00 14.96  ? 302 GLY A N   1 
ATOM   2421 C CA  . GLY A 1 321 ? 70.970 -3.124  30.727 1.00 12.86  ? 302 GLY A CA  1 
ATOM   2422 C C   . GLY A 1 321 ? 69.848 -2.856  29.740 1.00 12.84  ? 302 GLY A C   1 
ATOM   2423 O O   . GLY A 1 321 ? 69.510 -1.688  29.446 1.00 13.00  ? 302 GLY A O   1 
ATOM   2424 N N   . TYR A 1 322 ? 69.346 -3.917  29.133 1.00 14.47  ? 303 TYR A N   1 
ATOM   2425 C CA  . TYR A 1 322 ? 68.228 -3.806  28.199 1.00 14.18  ? 303 TYR A CA  1 
ATOM   2426 C C   . TYR A 1 322 ? 67.040 -3.098  28.842 1.00 17.48  ? 303 TYR A C   1 
ATOM   2427 O O   . TYR A 1 322 ? 66.480 -2.156  28.262 1.00 16.59  ? 303 TYR A O   1 
ATOM   2428 C CB  . TYR A 1 322 ? 67.766 -5.201  27.692 1.00 14.65  ? 303 TYR A CB  1 
ATOM   2429 C CG  . TYR A 1 322 ? 66.481 -5.001  26.933 1.00 15.62  ? 303 TYR A CG  1 
ATOM   2430 C CD1 . TYR A 1 322 ? 65.241 -5.159  27.549 1.00 15.99  ? 303 TYR A CD1 1 
ATOM   2431 C CD2 . TYR A 1 322 ? 66.494 -4.547  25.609 1.00 16.68  ? 303 TYR A CD2 1 
ATOM   2432 C CE1 . TYR A 1 322 ? 64.063 -4.882  26.882 1.00 16.02  ? 303 TYR A CE1 1 
ATOM   2433 C CE2 . TYR A 1 322 ? 65.306 -4.274  24.938 1.00 16.84  ? 303 TYR A CE2 1 
ATOM   2434 C CZ  . TYR A 1 322 ? 64.099 -4.423  25.600 1.00 16.28  ? 303 TYR A CZ  1 
ATOM   2435 O OH  . TYR A 1 322 ? 62.906 -4.154  24.963 1.00 19.06  ? 303 TYR A OH  1 
ATOM   2436 N N   . LEU A 1 323 ? 66.689 -3.521  30.056 1.00 16.64  ? 304 LEU A N   1 
ATOM   2437 C CA  . LEU A 1 323 ? 65.542 -2.918  30.739 1.00 15.97  ? 304 LEU A CA  1 
ATOM   2438 C C   . LEU A 1 323 ? 65.779 -1.416  31.026 1.00 15.91  ? 304 LEU A C   1 
ATOM   2439 O O   . LEU A 1 323 ? 64.844 -0.608  30.929 1.00 19.08  ? 304 LEU A O   1 
ATOM   2440 C CB  . LEU A 1 323 ? 65.222 -3.682  32.035 1.00 15.22  ? 304 LEU A CB  1 
ATOM   2441 C CG  . LEU A 1 323 ? 64.752 -5.125  31.775 1.00 14.98  ? 304 LEU A CG  1 
ATOM   2442 C CD1 . LEU A 1 323 ? 64.772 -5.929  33.047 1.00 15.70  ? 304 LEU A CD1 1 
ATOM   2443 C CD2 . LEU A 1 323 ? 63.343 -5.092  31.166 1.00 15.06  ? 304 LEU A CD2 1 
ATOM   2444 N N   . HIS A 1 324 ? 67.014 -1.035  31.354 1.00 16.49  ? 305 HIS A N   1 
ATOM   2445 C CA  . HIS A 1 324 ? 67.308 0.379   31.582 1.00 18.45  ? 305 HIS A CA  1 
ATOM   2446 C C   . HIS A 1 324 ? 67.162 1.151   30.270 1.00 20.03  ? 305 HIS A C   1 
ATOM   2447 O O   . HIS A 1 324 ? 66.554 2.209   30.245 1.00 21.83  ? 305 HIS A O   1 
ATOM   2448 C CB  . HIS A 1 324 ? 68.722 0.572   32.142 1.00 18.11  ? 305 HIS A CB  1 
ATOM   2449 C CG  . HIS A 1 324 ? 69.026 1.980   32.505 1.00 20.84  ? 305 HIS A CG  1 
ATOM   2450 N ND1 . HIS A 1 324 ? 68.501 2.583   33.626 1.00 21.60  ? 305 HIS A ND1 1 
ATOM   2451 C CD2 . HIS A 1 324 ? 69.848 2.892   31.932 1.00 21.47  ? 305 HIS A CD2 1 
ATOM   2452 C CE1 . HIS A 1 324 ? 68.956 3.823   33.707 1.00 22.14  ? 305 HIS A CE1 1 
ATOM   2453 N NE2 . HIS A 1 324 ? 69.783 4.031   32.696 1.00 22.42  ? 305 HIS A NE2 1 
ATOM   2454 N N   . TRP A 1 325 ? 67.724 0.612   29.179 1.00 19.20  ? 306 TRP A N   1 
ATOM   2455 C CA  . TRP A 1 325 ? 67.609 1.267   27.867 1.00 19.28  ? 306 TRP A CA  1 
ATOM   2456 C C   . TRP A 1 325 ? 66.148 1.428   27.470 1.00 19.56  ? 306 TRP A C   1 
ATOM   2457 O O   . TRP A 1 325 ? 65.721 2.490   26.997 1.00 22.61  ? 306 TRP A O   1 
ATOM   2458 C CB  . TRP A 1 325 ? 68.355 0.466   26.795 1.00 17.20  ? 306 TRP A CB  1 
ATOM   2459 C CG  . TRP A 1 325 ? 68.117 0.919   25.390 1.00 17.44  ? 306 TRP A CG  1 
ATOM   2460 C CD1 . TRP A 1 325 ? 68.800 1.892   24.727 1.00 17.66  ? 306 TRP A CD1 1 
ATOM   2461 C CD2 . TRP A 1 325 ? 67.142 0.406   24.469 1.00 17.84  ? 306 TRP A CD2 1 
ATOM   2462 N NE1 . TRP A 1 325 ? 68.324 2.019   23.431 1.00 18.15  ? 306 TRP A NE1 1 
ATOM   2463 C CE2 . TRP A 1 325 ? 67.294 1.129   23.252 1.00 18.45  ? 306 TRP A CE2 1 
ATOM   2464 C CE3 . TRP A 1 325 ? 66.161 -0.586  24.548 1.00 17.89  ? 306 TRP A CE3 1 
ATOM   2465 C CZ2 . TRP A 1 325 ? 66.496 0.881   22.125 1.00 19.20  ? 306 TRP A CZ2 1 
ATOM   2466 C CZ3 . TRP A 1 325 ? 65.366 -0.844  23.426 1.00 18.57  ? 306 TRP A CZ3 1 
ATOM   2467 C CH2 . TRP A 1 325 ? 65.529 -0.099  22.236 1.00 19.35  ? 306 TRP A CH2 1 
ATOM   2468 N N   . GLU A 1 326 ? 65.369 0.375   27.679 1.00 19.30  ? 307 GLU A N   1 
ATOM   2469 C CA  . GLU A 1 326 ? 63.981 0.355   27.253 1.00 20.64  ? 307 GLU A CA  1 
ATOM   2470 C C   . GLU A 1 326 ? 63.139 1.418   27.946 1.00 24.37  ? 307 GLU A C   1 
ATOM   2471 O O   . GLU A 1 326 ? 62.226 1.998   27.336 1.00 25.74  ? 307 GLU A O   1 
ATOM   2472 C CB  . GLU A 1 326 ? 63.401 -1.037  27.501 1.00 18.46  ? 307 GLU A CB  1 
ATOM   2473 C CG  . GLU A 1 326 ? 61.997 -1.219  26.982 1.00 18.89  ? 307 GLU A CG  1 
ATOM   2474 C CD  . GLU A 1 326 ? 61.330 -2.438  27.639 1.00 20.52  ? 307 GLU A CD  1 
ATOM   2475 O OE1 . GLU A 1 326 ? 61.151 -3.456  26.946 1.00 19.71  ? 307 GLU A OE1 1 
ATOM   2476 O OE2 . GLU A 1 326 ? 60.971 -2.357  28.843 1.00 21.15  ? 307 GLU A OE2 1 
ATOM   2477 N N   . SER A 1 327 ? 63.445 1.709   29.205 1.00 25.17  ? 308 SER A N   1 
ATOM   2478 C CA  . SER A 1 327 ? 62.628 2.664   29.928 1.00 30.37  ? 308 SER A CA  1 
ATOM   2479 C C   . SER A 1 327 ? 63.029 4.112   29.634 1.00 35.52  ? 308 SER A C   1 
ATOM   2480 O O   . SER A 1 327 ? 62.322 5.038   30.033 1.00 35.95  ? 308 SER A O   1 
ATOM   2481 C CB  . SER A 1 327 ? 62.702 2.377   31.415 1.00 32.09  ? 308 SER A CB  1 
ATOM   2482 O OG  . SER A 1 327 ? 64.033 2.467   31.850 1.00 36.14  ? 308 SER A OG  1 
ATOM   2483 N N   . HIS A 1 328 ? 64.146 4.301   28.934 1.00 40.01  ? 309 HIS A N   1 
ATOM   2484 C CA  . HIS A 1 328 ? 64.656 5.639   28.608 1.00 45.98  ? 309 HIS A CA  1 
ATOM   2485 C C   . HIS A 1 328 ? 64.738 5.883   27.100 1.00 51.50  ? 309 HIS A C   1 
ATOM   2486 O O   . HIS A 1 328 ? 64.932 7.017   26.666 1.00 51.83  ? 309 HIS A O   1 
ATOM   2487 C CB  . HIS A 1 328 ? 66.042 5.855   29.223 1.00 46.45  ? 309 HIS A CB  1 
ATOM   2488 C CG  . HIS A 1 328 ? 66.055 5.837   30.719 1.00 46.85  ? 309 HIS A CG  1 
ATOM   2489 N ND1 . HIS A 1 328 ? 65.983 4.673   31.450 1.00 47.39  ? 309 HIS A ND1 1 
ATOM   2490 C CD2 . HIS A 1 328 ? 66.144 6.842   31.622 1.00 48.13  ? 309 HIS A CD2 1 
ATOM   2491 C CE1 . HIS A 1 328 ? 66.017 4.958   32.739 1.00 47.98  ? 309 HIS A CE1 1 
ATOM   2492 N NE2 . HIS A 1 328 ? 66.121 6.268   32.871 1.00 48.63  ? 309 HIS A NE2 1 
ATOM   2493 N N   . THR A 1 329 ? 64.609 4.813   26.320 1.00 56.17  ? 310 THR A N   1 
ATOM   2494 C CA  . THR A 1 329 ? 64.540 4.854   24.853 1.00 60.34  ? 310 THR A CA  1 
ATOM   2495 C C   . THR A 1 329 ? 65.847 5.237   24.192 1.00 61.20  ? 310 THR A C   1 
ATOM   2496 O O   . THR A 1 329 ? 66.208 4.651   23.173 1.00 61.35  ? 310 THR A O   1 
ATOM   2497 C CB  . THR A 1 329 ? 63.437 5.832   24.409 1.00 20.00  ? 310 THR A CB  1 
ATOM   2498 O OG1 . THR A 1 329 ? 63.731 7.144   24.900 1.00 20.00  ? 310 THR A OG1 1 
ATOM   2499 C CG2 . THR A 1 329 ? 62.117 5.491   25.085 1.00 20.00  ? 310 THR A CG2 1 
ATOM   2500 N N   . SER B 1 25  ? 45.339 -45.920 25.637 1.00 45.48  ? 6   SER B N   1 
ATOM   2501 C CA  . SER B 1 25  ? 46.030 -45.548 24.404 1.00 44.73  ? 6   SER B CA  1 
ATOM   2502 C C   . SER B 1 25  ? 45.882 -44.057 24.099 1.00 40.86  ? 6   SER B C   1 
ATOM   2503 O O   . SER B 1 25  ? 44.838 -43.467 24.351 1.00 42.77  ? 6   SER B O   1 
ATOM   2504 C CB  . SER B 1 25  ? 45.510 -46.368 23.225 1.00 47.14  ? 6   SER B CB  1 
ATOM   2505 O OG  . SER B 1 25  ? 44.113 -46.193 23.062 1.00 48.52  ? 6   SER B OG  1 
ATOM   2506 N N   . LEU B 1 26  ? 46.937 -43.452 23.562 1.00 34.78  ? 7   LEU B N   1 
ATOM   2507 C CA  . LEU B 1 26  ? 46.909 -42.046 23.187 1.00 31.22  ? 7   LEU B CA  1 
ATOM   2508 C C   . LEU B 1 26  ? 46.169 -41.928 21.861 1.00 28.46  ? 7   LEU B C   1 
ATOM   2509 O O   . LEU B 1 26  ? 46.516 -42.620 20.898 1.00 28.55  ? 7   LEU B O   1 
ATOM   2510 C CB  . LEU B 1 26  ? 48.334 -41.508 23.081 1.00 32.27  ? 7   LEU B CB  1 
ATOM   2511 C CG  . LEU B 1 26  ? 48.580 -40.049 23.438 1.00 34.72  ? 7   LEU B CG  1 
ATOM   2512 C CD1 . LEU B 1 26  ? 48.072 -39.202 22.317 1.00 36.65  ? 7   LEU B CD1 1 
ATOM   2513 C CD2 . LEU B 1 26  ? 47.897 -39.711 24.771 1.00 34.59  ? 7   LEU B CD2 1 
ATOM   2514 N N   . GLU B 1 27  ? 45.158 -41.069 21.797 1.00 25.14  ? 8   GLU B N   1 
ATOM   2515 C CA  . GLU B 1 27  ? 44.299 -41.042 20.605 1.00 26.33  ? 8   GLU B CA  1 
ATOM   2516 C C   . GLU B 1 27  ? 44.733 -40.115 19.486 1.00 26.01  ? 8   GLU B C   1 
ATOM   2517 O O   . GLU B 1 27  ? 44.996 -38.915 19.709 1.00 25.74  ? 8   GLU B O   1 
ATOM   2518 C CB  . GLU B 1 27  ? 42.876 -40.696 21.021 1.00 29.21  ? 8   GLU B CB  1 
ATOM   2519 C CG  . GLU B 1 27  ? 42.313 -41.741 21.962 1.00 33.02  ? 8   GLU B CG  1 
ATOM   2520 C CD  . GLU B 1 27  ? 40.906 -41.405 22.367 1.00 36.69  ? 8   GLU B CD  1 
ATOM   2521 O OE1 . GLU B 1 27  ? 40.412 -40.341 21.922 1.00 38.11  ? 8   GLU B OE1 1 
ATOM   2522 O OE2 . GLU B 1 27  ? 40.298 -42.197 23.107 1.00 38.61  ? 8   GLU B OE2 1 
ATOM   2523 N N   . LEU B 1 28  ? 44.799 -40.680 18.276 1.00 24.66  ? 9   LEU B N   1 
ATOM   2524 C CA  . LEU B 1 28  ? 45.094 -39.923 17.049 1.00 26.03  ? 9   LEU B CA  1 
ATOM   2525 C C   . LEU B 1 28  ? 44.058 -40.222 15.967 1.00 24.55  ? 9   LEU B C   1 
ATOM   2526 O O   . LEU B 1 28  ? 43.501 -41.330 15.925 1.00 23.83  ? 9   LEU B O   1 
ATOM   2527 C CB  . LEU B 1 28  ? 46.509 -40.246 16.531 1.00 25.96  ? 9   LEU B CB  1 
ATOM   2528 C CG  . LEU B 1 28  ? 47.663 -39.805 17.446 1.00 24.82  ? 9   LEU B CG  1 
ATOM   2529 C CD1 . LEU B 1 28  ? 48.975 -40.378 16.954 1.00 24.05  ? 9   LEU B CD1 1 
ATOM   2530 C CD2 . LEU B 1 28  ? 47.715 -38.295 17.485 1.00 24.37  ? 9   LEU B CD2 1 
ATOM   2531 N N   . PRO B 1 29  ? 43.818 -39.255 15.055 1.00 25.64  ? 10  PRO B N   1 
ATOM   2532 C CA  . PRO B 1 29  ? 42.809 -39.483 14.003 1.00 27.08  ? 10  PRO B CA  1 
ATOM   2533 C C   . PRO B 1 29  ? 43.321 -40.275 12.799 1.00 28.59  ? 10  PRO B C   1 
ATOM   2534 O O   . PRO B 1 29  ? 42.600 -40.445 11.801 1.00 30.73  ? 10  PRO B O   1 
ATOM   2535 C CB  . PRO B 1 29  ? 42.427 -38.067 13.571 1.00 28.33  ? 10  PRO B CB  1 
ATOM   2536 C CG  . PRO B 1 29  ? 43.682 -37.234 13.828 1.00 27.35  ? 10  PRO B CG  1 
ATOM   2537 C CD  . PRO B 1 29  ? 44.374 -37.886 15.027 1.00 26.53  ? 10  PRO B CD  1 
ATOM   2538 N N   . PHE B 1 30  ? 44.564 -40.731 12.867 1.00 27.87  ? 11  PHE B N   1 
ATOM   2539 C CA  . PHE B 1 30  ? 45.151 -41.531 11.801 1.00 28.59  ? 11  PHE B CA  1 
ATOM   2540 C C   . PHE B 1 30  ? 45.848 -42.694 12.479 1.00 29.50  ? 11  PHE B C   1 
ATOM   2541 O O   . PHE B 1 30  ? 46.158 -42.618 13.678 1.00 28.46  ? 11  PHE B O   1 
ATOM   2542 C CB  . PHE B 1 30  ? 46.132 -40.702 10.965 1.00 28.72  ? 11  PHE B CB  1 
ATOM   2543 C CG  . PHE B 1 30  ? 47.078 -39.894 11.791 1.00 28.56  ? 11  PHE B CG  1 
ATOM   2544 C CD1 . PHE B 1 30  ? 48.269 -40.430 12.229 1.00 27.92  ? 11  PHE B CD1 1 
ATOM   2545 C CD2 . PHE B 1 30  ? 46.766 -38.594 12.150 1.00 28.86  ? 11  PHE B CD2 1 
ATOM   2546 C CE1 . PHE B 1 30  ? 49.146 -39.653 13.016 1.00 26.40  ? 11  PHE B CE1 1 
ATOM   2547 C CE2 . PHE B 1 30  ? 47.624 -37.830 12.928 1.00 27.77  ? 11  PHE B CE2 1 
ATOM   2548 C CZ  . PHE B 1 30  ? 48.808 -38.360 13.359 1.00 26.78  ? 11  PHE B CZ  1 
ATOM   2549 N N   . THR B 1 31  ? 46.091 -43.768 11.736 1.00 30.57  ? 12  THR B N   1 
ATOM   2550 C CA  . THR B 1 31  ? 46.765 -44.909 12.324 1.00 31.85  ? 12  THR B CA  1 
ATOM   2551 C C   . THR B 1 31  ? 48.245 -44.952 11.946 1.00 29.93  ? 12  THR B C   1 
ATOM   2552 O O   . THR B 1 31  ? 48.694 -44.270 11.027 1.00 29.51  ? 12  THR B O   1 
ATOM   2553 C CB  . THR B 1 31  ? 46.114 -46.219 11.900 1.00 35.18  ? 12  THR B CB  1 
ATOM   2554 O OG1 . THR B 1 31  ? 46.006 -46.243 10.476 1.00 37.65  ? 12  THR B OG1 1 
ATOM   2555 C CG2 . THR B 1 31  ? 44.723 -46.338 12.499 1.00 35.70  ? 12  THR B CG2 1 
ATOM   2556 N N   . HIS B 1 32  ? 48.991 -45.770 12.669 1.00 28.40  ? 13  HIS B N   1 
ATOM   2557 C CA  . HIS B 1 32  ? 50.388 -46.008 12.344 1.00 27.55  ? 13  HIS B CA  1 
ATOM   2558 C C   . HIS B 1 32  ? 50.532 -46.769 11.030 1.00 26.40  ? 13  HIS B C   1 
ATOM   2559 O O   . HIS B 1 32  ? 49.613 -47.468 10.590 1.00 29.67  ? 13  HIS B O   1 
ATOM   2560 C CB  . HIS B 1 32  ? 51.052 -46.804 13.452 1.00 28.24  ? 13  HIS B CB  1 
ATOM   2561 C CG  . HIS B 1 32  ? 50.564 -48.216 13.541 1.00 30.37  ? 13  HIS B CG  1 
ATOM   2562 N ND1 . HIS B 1 32  ? 49.373 -48.560 14.146 1.00 31.11  ? 13  HIS B ND1 1 
ATOM   2563 C CD2 . HIS B 1 32  ? 51.098 -49.372 13.082 1.00 31.23  ? 13  HIS B CD2 1 
ATOM   2564 C CE1 . HIS B 1 32  ? 49.197 -49.867 14.061 1.00 30.76  ? 13  HIS B CE1 1 
ATOM   2565 N NE2 . HIS B 1 32  ? 50.232 -50.384 13.425 1.00 31.71  ? 13  HIS B NE2 1 
ATOM   2566 N N   . ARG B 1 33  ? 51.717 -46.679 10.438 1.00 25.14  ? 14  ARG B N   1 
ATOM   2567 C CA  . ARG B 1 33  ? 52.081 -47.556 9.341  1.00 24.93  ? 14  ARG B CA  1 
ATOM   2568 C C   . ARG B 1 33  ? 53.342 -48.355 9.695  1.00 22.81  ? 14  ARG B C   1 
ATOM   2569 O O   . ARG B 1 33  ? 54.076 -48.004 10.616 1.00 21.56  ? 14  ARG B O   1 
ATOM   2570 C CB  . ARG B 1 33  ? 52.288 -46.743 8.061  1.00 27.50  ? 14  ARG B CB  1 
ATOM   2571 C CG  . ARG B 1 33  ? 51.062 -45.921 7.641  1.00 31.79  ? 14  ARG B CG  1 
ATOM   2572 C CD  . ARG B 1 33  ? 51.350 -45.194 6.336  1.00 35.85  ? 14  ARG B CD  1 
ATOM   2573 N NE  . ARG B 1 33  ? 50.317 -44.242 5.941  1.00 41.46  ? 14  ARG B NE  1 
ATOM   2574 C CZ  . ARG B 1 33  ? 50.508 -43.294 5.022  1.00 46.26  ? 14  ARG B CZ  1 
ATOM   2575 N NH1 . ARG B 1 33  ? 51.692 -43.177 4.437  1.00 46.86  ? 14  ARG B NH1 1 
ATOM   2576 N NH2 . ARG B 1 33  ? 49.530 -42.453 4.692  1.00 49.42  ? 14  ARG B NH2 1 
ATOM   2577 N N   . ARG B 1 34  ? 53.571 -49.431 8.955  1.00 23.27  ? 15  ARG B N   1 
ATOM   2578 C CA  . ARG B 1 34  ? 54.696 -50.335 9.189  1.00 23.94  ? 15  ARG B CA  1 
ATOM   2579 C C   . ARG B 1 34  ? 55.537 -50.490 7.924  1.00 23.19  ? 15  ARG B C   1 
ATOM   2580 O O   . ARG B 1 34  ? 55.007 -50.752 6.836  1.00 23.01  ? 15  ARG B O   1 
ATOM   2581 C CB  . ARG B 1 34  ? 54.175 -51.715 9.649  1.00 26.04  ? 15  ARG B CB  1 
ATOM   2582 C CG  . ARG B 1 34  ? 55.258 -52.750 9.899  1.00 26.77  ? 15  ARG B CG  1 
ATOM   2583 C CD  . ARG B 1 34  ? 54.657 -54.109 10.337 1.00 28.68  ? 15  ARG B CD  1 
ATOM   2584 N NE  . ARG B 1 34  ? 53.900 -54.008 11.590 1.00 30.10  ? 15  ARG B NE  1 
ATOM   2585 C CZ  . ARG B 1 34  ? 54.463 -54.037 12.797 1.00 31.50  ? 15  ARG B CZ  1 
ATOM   2586 N NH1 . ARG B 1 34  ? 55.779 -54.173 12.909 1.00 33.34  ? 15  ARG B NH1 1 
ATOM   2587 N NH2 . ARG B 1 34  ? 53.719 -53.942 13.884 1.00 31.13  ? 15  ARG B NH2 1 
ATOM   2588 N N   . ASN B 1 35  ? 56.845 -50.370 8.065  1.00 21.63  ? 16  ASN B N   1 
ATOM   2589 C CA  . ASN B 1 35  ? 57.747 -50.526 6.933  1.00 20.96  ? 16  ASN B CA  1 
ATOM   2590 C C   . ASN B 1 35  ? 57.767 -51.955 6.391  1.00 22.05  ? 16  ASN B C   1 
ATOM   2591 O O   . ASN B 1 35  ? 58.026 -52.890 7.154  1.00 23.84  ? 16  ASN B O   1 
ATOM   2592 C CB  . ASN B 1 35  ? 59.159 -50.126 7.365  1.00 20.31  ? 16  ASN B CB  1 
ATOM   2593 C CG  . ASN B 1 35  ? 60.044 -49.779 6.190  1.00 20.49  ? 16  ASN B CG  1 
ATOM   2594 O OD1 . ASN B 1 35  ? 60.210 -50.570 5.276  1.00 19.85  ? 16  ASN B OD1 1 
ATOM   2595 N ND2 . ASN B 1 35  ? 60.611 -48.571 6.207  1.00 20.19  ? 16  ASN B ND2 1 
ATOM   2596 N N   . PRO B 1 36  ? 57.545 -52.119 5.073  1.00 22.21  ? 17  PRO B N   1 
ATOM   2597 C CA  . PRO B 1 36  ? 57.564 -53.455 4.463  1.00 23.44  ? 17  PRO B CA  1 
ATOM   2598 C C   . PRO B 1 36  ? 58.946 -54.101 4.420  1.00 22.51  ? 17  PRO B C   1 
ATOM   2599 O O   . PRO B 1 36  ? 59.063 -55.290 4.078  1.00 24.51  ? 17  PRO B O   1 
ATOM   2600 C CB  . PRO B 1 36  ? 57.050 -53.201 3.033  1.00 23.92  ? 17  PRO B CB  1 
ATOM   2601 C CG  . PRO B 1 36  ? 57.420 -51.763 2.747  1.00 24.02  ? 17  PRO B CG  1 
ATOM   2602 C CD  . PRO B 1 36  ? 57.276 -51.047 4.088  1.00 23.73  ? 17  PRO B CD  1 
ATOM   2603 N N   . HIS B 1 37  ? 59.977 -53.344 4.773  1.00 21.03  ? 18  HIS B N   1 
ATOM   2604 C CA  . HIS B 1 37  ? 61.352 -53.816 4.688  1.00 20.17  ? 18  HIS B CA  1 
ATOM   2605 C C   . HIS B 1 37  ? 61.888 -54.262 6.047  1.00 19.83  ? 18  HIS B C   1 
ATOM   2606 O O   . HIS B 1 37  ? 63.096 -54.468 6.210  1.00 18.71  ? 18  HIS B O   1 
ATOM   2607 C CB  . HIS B 1 37  ? 62.255 -52.711 4.108  1.00 20.91  ? 18  HIS B CB  1 
ATOM   2608 C CG  . HIS B 1 37  ? 61.840 -52.265 2.743  1.00 23.59  ? 18  HIS B CG  1 
ATOM   2609 N ND1 . HIS B 1 37  ? 61.781 -53.128 1.672  1.00 25.55  ? 18  HIS B ND1 1 
ATOM   2610 C CD2 . HIS B 1 37  ? 61.456 -51.050 2.278  1.00 24.64  ? 18  HIS B CD2 1 
ATOM   2611 C CE1 . HIS B 1 37  ? 61.378 -52.463 0.601  1.00 25.89  ? 18  HIS B CE1 1 
ATOM   2612 N NE2 . HIS B 1 37  ? 61.154 -51.203 0.944  1.00 25.00  ? 18  HIS B NE2 1 
ATOM   2613 N N   . GLN B 1 38  ? 60.997 -54.381 7.027  1.00 19.83  ? 19  GLN B N   1 
ATOM   2614 C CA  . GLN B 1 38  ? 61.387 -54.775 8.388  1.00 22.73  ? 19  GLN B CA  1 
ATOM   2615 C C   . GLN B 1 38  ? 62.353 -55.979 8.504  1.00 21.41  ? 19  GLN B C   1 
ATOM   2616 O O   . GLN B 1 38  ? 63.397 -55.867 9.163  1.00 21.85  ? 19  GLN B O   1 
ATOM   2617 C CB  . GLN B 1 38  ? 60.133 -55.045 9.230  1.00 24.89  ? 19  GLN B CB  1 
ATOM   2618 C CG  . GLN B 1 38  ? 60.458 -55.464 10.658 1.00 28.16  ? 19  GLN B CG  1 
ATOM   2619 C CD  . GLN B 1 38  ? 59.286 -55.282 11.636 1.00 31.82  ? 19  GLN B CD  1 
ATOM   2620 O OE1 . GLN B 1 38  ? 58.246 -54.714 11.295 1.00 35.12  ? 19  GLN B OE1 1 
ATOM   2621 N NE2 . GLN B 1 38  ? 59.475 -55.733 12.860 1.00 31.79  ? 19  GLN B NE2 1 
ATOM   2622 N N   . THR B 1 39  ? 62.062 -57.099 7.842  1.00 23.35  ? 20  THR B N   1 
ATOM   2623 C CA  A THR B 1 39  ? 62.903 -58.299 7.934  0.50 23.42  ? 20  THR B CA  1 
ATOM   2624 C CA  B THR B 1 39  ? 62.909 -58.271 7.999  0.50 24.24  ? 20  THR B CA  1 
ATOM   2625 C C   . THR B 1 39  ? 64.309 -58.053 7.403  1.00 23.68  ? 20  THR B C   1 
ATOM   2626 O O   . THR B 1 39  ? 65.301 -58.358 8.062  1.00 25.13  ? 20  THR B O   1 
ATOM   2627 C CB  A THR B 1 39  ? 62.277 -59.470 7.163  0.50 22.38  ? 20  THR B CB  1 
ATOM   2628 C CB  B THR B 1 39  ? 62.223 -59.493 7.399  0.50 25.48  ? 20  THR B CB  1 
ATOM   2629 O OG1 A THR B 1 39  ? 61.017 -59.789 7.755  0.50 22.86  ? 20  THR B OG1 1 
ATOM   2630 O OG1 B THR B 1 39  ? 61.617 -59.131 6.155  0.50 27.27  ? 20  THR B OG1 1 
ATOM   2631 C CG2 A THR B 1 39  ? 63.195 -60.697 7.179  0.50 21.26  ? 20  THR B CG2 1 
ATOM   2632 C CG2 B THR B 1 39  ? 61.133 -59.930 8.337  0.50 25.21  ? 20  THR B CG2 1 
ATOM   2633 N N   . GLU B 1 40  ? 64.401 -57.501 6.198  1.00 21.81  ? 21  GLU B N   1 
ATOM   2634 C CA  . GLU B 1 40  ? 65.710 -57.185 5.610  1.00 21.77  ? 21  GLU B CA  1 
ATOM   2635 C C   . GLU B 1 40  ? 66.491 -56.218 6.518  1.00 20.45  ? 21  GLU B C   1 
ATOM   2636 O O   . GLU B 1 40  ? 67.675 -56.433 6.782  1.00 21.89  ? 21  GLU B O   1 
ATOM   2637 C CB  . GLU B 1 40  ? 65.568 -56.578 4.184  1.00 23.86  ? 21  GLU B CB  1 
ATOM   2638 C CG  . GLU B 1 40  ? 66.927 -56.171 3.552  1.00 27.99  ? 21  GLU B CG  1 
ATOM   2639 C CD  . GLU B 1 40  ? 66.833 -55.542 2.167  1.00 31.17  ? 21  GLU B CD  1 
ATOM   2640 O OE1 . GLU B 1 40  ? 65.730 -55.545 1.566  1.00 30.74  ? 21  GLU B OE1 1 
ATOM   2641 O OE2 . GLU B 1 40  ? 67.896 -55.033 1.697  1.00 33.31  ? 21  GLU B OE2 1 
ATOM   2642 N N   . ALA B 1 41  ? 65.851 -55.137 6.972  1.00 18.42  ? 22  ALA B N   1 
ATOM   2643 C CA  . ALA B 1 41  ? 66.533 -54.193 7.863  1.00 16.59  ? 22  ALA B CA  1 
ATOM   2644 C C   . ALA B 1 41  ? 67.005 -54.845 9.163  1.00 18.83  ? 22  ALA B C   1 
ATOM   2645 O O   . ALA B 1 41  ? 68.098 -54.539 9.665  1.00 19.85  ? 22  ALA B O   1 
ATOM   2646 C CB  . ALA B 1 41  ? 65.636 -53.022 8.182  1.00 16.09  ? 22  ALA B CB  1 
ATOM   2647 N N   . ALA B 1 42  ? 66.203 -55.771 9.678  1.00 18.92  ? 23  ALA B N   1 
ATOM   2648 C CA  . ALA B 1 42  ? 66.548 -56.426 10.928 1.00 19.86  ? 23  ALA B CA  1 
ATOM   2649 C C   . ALA B 1 42  ? 67.795 -57.289 10.742 1.00 19.53  ? 23  ALA B C   1 
ATOM   2650 O O   . ALA B 1 42  ? 68.680 -57.313 11.605 1.00 20.22  ? 23  ALA B O   1 
ATOM   2651 C CB  . ALA B 1 42  ? 65.388 -57.252 11.436 1.00 21.01  ? 23  ALA B CB  1 
ATOM   2652 N N   . ASP B 1 43  ? 67.907 -57.937 9.585  1.00 19.79  ? 24  ASP B N   1 
ATOM   2653 C CA  . ASP B 1 43  ? 69.115 -58.701 9.312  1.00 20.96  ? 24  ASP B CA  1 
ATOM   2654 C C   . ASP B 1 43  ? 70.338 -57.793 9.179  1.00 20.34  ? 24  ASP B C   1 
ATOM   2655 O O   . ASP B 1 43  ? 71.424 -58.157 9.672  1.00 21.52  ? 24  ASP B O   1 
ATOM   2656 C CB  . ASP B 1 43  ? 68.952 -59.538 8.058  1.00 20.62  ? 24  ASP B CB  1 
ATOM   2657 C CG  . ASP B 1 43  ? 68.150 -60.820 8.311  1.00 25.40  ? 24  ASP B CG  1 
ATOM   2658 O OD1 . ASP B 1 43  ? 67.547 -60.976 9.393  1.00 27.85  ? 24  ASP B OD1 1 
ATOM   2659 O OD2 . ASP B 1 43  ? 68.128 -61.660 7.404  1.00 30.54  ? 24  ASP B OD2 1 
ATOM   2660 N N   . ARG B 1 44  ? 70.182 -56.640 8.507  1.00 19.33  ? 25  ARG B N   1 
ATOM   2661 C CA  . ARG B 1 44  ? 71.285 -55.698 8.393  1.00 19.01  ? 25  ARG B CA  1 
ATOM   2662 C C   . ARG B 1 44  ? 71.667 -55.139 9.788  1.00 18.39  ? 25  ARG B C   1 
ATOM   2663 O O   . ARG B 1 44  ? 72.850 -54.897 10.067 1.00 18.45  ? 25  ARG B O   1 
ATOM   2664 C CB  . ARG B 1 44  ? 70.914 -54.551 7.433  1.00 19.83  ? 25  ARG B CB  1 
ATOM   2665 C CG  . ARG B 1 44  ? 70.683 -55.008 5.970  1.00 23.38  ? 25  ARG B CG  1 
ATOM   2666 C CD  . ARG B 1 44  ? 70.100 -53.800 5.240  1.00 29.42  ? 25  ARG B CD  1 
ATOM   2667 N NE  . ARG B 1 44  ? 70.033 -53.882 3.779  1.00 35.32  ? 25  ARG B NE  1 
ATOM   2668 C CZ  . ARG B 1 44  ? 70.762 -53.117 2.970  1.00 38.61  ? 25  ARG B CZ  1 
ATOM   2669 N NH1 . ARG B 1 44  ? 71.627 -52.248 3.486  1.00 38.63  ? 25  ARG B NH1 1 
ATOM   2670 N NH2 . ARG B 1 44  ? 70.645 -53.234 1.649  1.00 41.16  ? 25  ARG B NH2 1 
ATOM   2671 N N   . HIS B 1 45  ? 70.667 -54.948 10.654 1.00 18.06  ? 26  HIS B N   1 
ATOM   2672 C CA  . HIS B 1 45  ? 70.911 -54.440 11.992 1.00 19.04  ? 26  HIS B CA  1 
ATOM   2673 C C   . HIS B 1 45  ? 71.693 -55.476 12.824 1.00 18.95  ? 26  HIS B C   1 
ATOM   2674 O O   . HIS B 1 45  ? 72.581 -55.097 13.613 1.00 18.96  ? 26  HIS B O   1 
ATOM   2675 C CB  . HIS B 1 45  ? 69.589 -54.058 12.689 1.00 17.73  ? 26  HIS B CB  1 
ATOM   2676 C CG  . HIS B 1 45  ? 69.784 -53.587 14.106 1.00 18.21  ? 26  HIS B CG  1 
ATOM   2677 N ND1 . HIS B 1 45  ? 70.554 -52.487 14.440 1.00 18.47  ? 26  HIS B ND1 1 
ATOM   2678 C CD2 . HIS B 1 45  ? 69.335 -54.102 15.276 1.00 19.63  ? 26  HIS B CD2 1 
ATOM   2679 C CE1 . HIS B 1 45  ? 70.551 -52.337 15.757 1.00 18.25  ? 26  HIS B CE1 1 
ATOM   2680 N NE2 . HIS B 1 45  ? 69.826 -53.308 16.289 1.00 19.02  ? 26  HIS B NE2 1 
ATOM   2681 N N   . LEU B 1 46  ? 71.405 -56.779 12.620 1.00 18.85  ? 27  LEU B N   1 
ATOM   2682 C CA  . LEU B 1 46  ? 72.111 -57.834 13.355 1.00 20.26  ? 27  LEU B CA  1 
ATOM   2683 C C   . LEU B 1 46  ? 73.581 -57.822 12.921 1.00 21.06  ? 27  LEU B C   1 
ATOM   2684 O O   . LEU B 1 46  ? 74.487 -58.025 13.732 1.00 21.70  ? 27  LEU B O   1 
ATOM   2685 C CB  . LEU B 1 46  ? 71.468 -59.206 13.093 1.00 21.50  ? 27  LEU B CB  1 
ATOM   2686 C CG  . LEU B 1 46  ? 70.150 -59.426 13.858 1.00 24.03  ? 27  LEU B CG  1 
ATOM   2687 C CD1 . LEU B 1 46  ? 69.440 -60.748 13.502 1.00 25.69  ? 27  LEU B CD1 1 
ATOM   2688 C CD2 . LEU B 1 46  ? 70.421 -59.438 15.337 1.00 25.49  ? 27  LEU B CD2 1 
ATOM   2689 N N   . GLU B 1 47  ? 73.828 -57.567 11.637 1.00 20.08  ? 28  GLU B N   1 
ATOM   2690 C CA  . GLU B 1 47  ? 75.212 -57.453 11.165 1.00 21.86  ? 28  GLU B CA  1 
ATOM   2691 C C   . GLU B 1 47  ? 75.945 -56.287 11.802 1.00 19.87  ? 28  GLU B C   1 
ATOM   2692 O O   . GLU B 1 47  ? 77.116 -56.414 12.163 1.00 22.20  ? 28  GLU B O   1 
ATOM   2693 C CB  . GLU B 1 47  ? 75.250 -57.332 9.636  1.00 24.79  ? 28  GLU B CB  1 
ATOM   2694 C CG  . GLU B 1 47  ? 74.768 -58.636 8.987  1.00 28.66  ? 28  GLU B CG  1 
ATOM   2695 C CD  . GLU B 1 47  ? 74.670 -58.583 7.481  1.00 33.64  ? 28  GLU B CD  1 
ATOM   2696 O OE1 . GLU B 1 47  ? 75.140 -57.601 6.869  1.00 37.02  ? 28  GLU B OE1 1 
ATOM   2697 O OE2 . GLU B 1 47  ? 74.133 -59.546 6.893  1.00 35.68  ? 28  GLU B OE2 1 
ATOM   2698 N N   . TRP B 1 48  ? 75.279 -55.143 11.923 1.00 18.44  ? 29  TRP B N   1 
ATOM   2699 C CA  . TRP B 1 48  ? 75.863 -54.021 12.651 1.00 18.79  ? 29  TRP B CA  1 
ATOM   2700 C C   . TRP B 1 48  ? 76.206 -54.387 14.116 1.00 19.80  ? 29  TRP B C   1 
ATOM   2701 O O   . TRP B 1 48  ? 77.284 -54.039 14.606 1.00 21.00  ? 29  TRP B O   1 
ATOM   2702 C CB  . TRP B 1 48  ? 74.909 -52.827 12.563 1.00 19.30  ? 29  TRP B CB  1 
ATOM   2703 C CG  . TRP B 1 48  ? 75.454 -51.502 13.113 1.00 19.44  ? 29  TRP B CG  1 
ATOM   2704 C CD1 . TRP B 1 48  ? 76.170 -50.536 12.427 1.00 20.34  ? 29  TRP B CD1 1 
ATOM   2705 C CD2 . TRP B 1 48  ? 75.264 -50.993 14.436 1.00 19.38  ? 29  TRP B CD2 1 
ATOM   2706 N NE1 . TRP B 1 48  ? 76.456 -49.477 13.280 1.00 18.62  ? 29  TRP B NE1 1 
ATOM   2707 C CE2 . TRP B 1 48  ? 75.897 -49.739 14.508 1.00 19.40  ? 29  TRP B CE2 1 
ATOM   2708 C CE3 . TRP B 1 48  ? 74.594 -51.473 15.569 1.00 20.13  ? 29  TRP B CE3 1 
ATOM   2709 C CZ2 . TRP B 1 48  ? 75.904 -48.976 15.701 1.00 21.51  ? 29  TRP B CZ2 1 
ATOM   2710 C CZ3 . TRP B 1 48  ? 74.611 -50.736 16.729 1.00 21.73  ? 29  TRP B CZ3 1 
ATOM   2711 C CH2 . TRP B 1 48  ? 75.246 -49.489 16.787 1.00 21.65  ? 29  TRP B CH2 1 
ATOM   2712 N N   . LEU B 1 49  ? 75.314 -55.097 14.806 1.00 19.71  ? 30  LEU B N   1 
ATOM   2713 C CA  . LEU B 1 49  ? 75.569 -55.460 16.195 1.00 20.90  ? 30  LEU B CA  1 
ATOM   2714 C C   . LEU B 1 49  ? 76.761 -56.390 16.285 1.00 24.46  ? 30  LEU B C   1 
ATOM   2715 O O   . LEU B 1 49  ? 77.537 -56.348 17.277 1.00 25.93  ? 30  LEU B O   1 
ATOM   2716 C CB  . LEU B 1 49  ? 74.335 -56.120 16.816 1.00 21.05  ? 30  LEU B CB  1 
ATOM   2717 C CG  . LEU B 1 49  ? 73.136 -55.210 17.079 1.00 21.19  ? 30  LEU B CG  1 
ATOM   2718 C CD1 . LEU B 1 49  ? 71.890 -56.032 17.331 1.00 21.85  ? 30  LEU B CD1 1 
ATOM   2719 C CD2 . LEU B 1 49  ? 73.450 -54.265 18.265 1.00 21.47  ? 30  LEU B CD2 1 
ATOM   2720 N N   . GLN B 1 50  ? 76.892 -57.268 15.284 1.00 25.77  ? 31  GLN B N   1 
ATOM   2721 C CA  . GLN B 1 50  ? 78.047 -58.161 15.208 1.00 29.17  ? 31  GLN B CA  1 
ATOM   2722 C C   . GLN B 1 50  ? 79.347 -57.357 15.079 1.00 30.64  ? 31  GLN B C   1 
ATOM   2723 O O   . GLN B 1 50  ? 80.339 -57.635 15.767 1.00 31.95  ? 31  GLN B O   1 
ATOM   2724 C CB  . GLN B 1 50  ? 77.865 -59.168 14.043 1.00 32.85  ? 31  GLN B CB  1 
ATOM   2725 C CG  . GLN B 1 50  ? 76.784 -60.225 14.349 1.00 37.31  ? 31  GLN B CG  1 
ATOM   2726 C CD  . GLN B 1 50  ? 76.353 -61.074 13.139 1.00 42.37  ? 31  GLN B CD  1 
ATOM   2727 O OE1 . GLN B 1 50  ? 77.044 -61.139 12.112 1.00 44.74  ? 31  GLN B OE1 1 
ATOM   2728 N NE2 . GLN B 1 50  ? 75.194 -61.717 13.261 1.00 44.09  ? 31  GLN B NE2 1 
ATOM   2729 N N   . ARG B 1 51  ? 79.318 -56.314 14.261 1.00 29.98  ? 32  ARG B N   1 
ATOM   2730 C CA  . ARG B 1 51  ? 80.479 -55.456 14.050 1.00 31.76  ? 32  ARG B CA  1 
ATOM   2731 C C   . ARG B 1 51  ? 80.829 -54.628 15.294 1.00 29.16  ? 32  ARG B C   1 
ATOM   2732 O O   . ARG B 1 51  ? 81.990 -54.294 15.513 1.00 32.52  ? 32  ARG B O   1 
ATOM   2733 C CB  . ARG B 1 51  ? 80.221 -54.514 12.871 1.00 36.94  ? 32  ARG B CB  1 
ATOM   2734 C CG  . ARG B 1 51  ? 81.475 -53.984 12.215 1.00 41.98  ? 32  ARG B CG  1 
ATOM   2735 C CD  . ARG B 1 51  ? 81.169 -53.427 10.805 1.00 45.59  ? 32  ARG B CD  1 
ATOM   2736 N NE  . ARG B 1 51  ? 80.183 -54.239 10.078 1.00 48.73  ? 32  ARG B NE  1 
ATOM   2737 C CZ  . ARG B 1 51  ? 78.938 -53.838 9.804  1.00 49.36  ? 32  ARG B CZ  1 
ATOM   2738 N NH1 . ARG B 1 51  ? 78.541 -52.639 10.186 1.00 48.78  ? 32  ARG B NH1 1 
ATOM   2739 N NH2 . ARG B 1 51  ? 78.090 -54.636 9.157  1.00 49.32  ? 32  ARG B NH2 1 
ATOM   2740 N N   . HIS B 1 52  ? 79.824 -54.315 16.101 1.00 24.85  ? 33  HIS B N   1 
ATOM   2741 C CA  . HIS B 1 52  ? 80.024 -53.494 17.293 1.00 23.42  ? 33  HIS B CA  1 
ATOM   2742 C C   . HIS B 1 52  ? 79.708 -54.333 18.499 1.00 25.06  ? 33  HIS B C   1 
ATOM   2743 O O   . HIS B 1 52  ? 78.960 -53.942 19.383 1.00 25.02  ? 33  HIS B O   1 
ATOM   2744 C CB  . HIS B 1 52  ? 79.173 -52.224 17.219 1.00 22.39  ? 33  HIS B CB  1 
ATOM   2745 C CG  . HIS B 1 52  ? 79.518 -51.392 16.037 1.00 21.62  ? 33  HIS B CG  1 
ATOM   2746 N ND1 . HIS B 1 52  ? 80.597 -50.536 16.032 1.00 20.53  ? 33  HIS B ND1 1 
ATOM   2747 C CD2 . HIS B 1 52  ? 78.996 -51.355 14.785 1.00 20.96  ? 33  HIS B CD2 1 
ATOM   2748 C CE1 . HIS B 1 52  ? 80.725 -50.011 14.827 1.00 20.97  ? 33  HIS B CE1 1 
ATOM   2749 N NE2 . HIS B 1 52  ? 79.750 -50.465 14.062 1.00 20.13  ? 33  HIS B NE2 1 
ATOM   2750 N N   . ARG B 1 53  ? 80.312 -55.512 18.504 1.00 28.34  ? 34  ARG B N   1 
ATOM   2751 C CA  . ARG B 1 53  ? 80.098 -56.500 19.554 1.00 32.16  ? 34  ARG B CA  1 
ATOM   2752 C C   . ARG B 1 53  ? 80.347 -55.990 20.983 1.00 31.87  ? 34  ARG B C   1 
ATOM   2753 O O   . ARG B 1 53  ? 79.572 -56.305 21.903 1.00 31.62  ? 34  ARG B O   1 
ATOM   2754 C CB  . ARG B 1 53  ? 80.977 -57.722 19.262 1.00 36.89  ? 34  ARG B CB  1 
ATOM   2755 C CG  . ARG B 1 53  ? 81.364 -58.495 20.488 1.00 43.59  ? 34  ARG B CG  1 
ATOM   2756 C CD  . ARG B 1 53  ? 82.048 -59.807 20.142 1.00 48.38  ? 34  ARG B CD  1 
ATOM   2757 N NE  . ARG B 1 53  ? 81.095 -60.839 19.746 1.00 53.83  ? 34  ARG B NE  1 
ATOM   2758 C CZ  . ARG B 1 53  ? 81.324 -62.143 19.882 1.00 56.51  ? 34  ARG B CZ  1 
ATOM   2759 N NH1 . ARG B 1 53  ? 80.415 -63.032 19.492 1.00 58.03  ? 34  ARG B NH1 1 
ATOM   2760 N NH2 . ARG B 1 53  ? 82.470 -62.554 20.405 1.00 56.82  ? 34  ARG B NH2 1 
ATOM   2761 N N   . GLU B 1 54  ? 81.410 -55.214 21.179 1.00 31.09  ? 35  GLU B N   1 
ATOM   2762 C CA  . GLU B 1 54  ? 81.776 -54.801 22.538 1.00 32.26  ? 35  GLU B CA  1 
ATOM   2763 C C   . GLU B 1 54  ? 80.704 -53.861 23.104 1.00 30.94  ? 35  GLU B C   1 
ATOM   2764 O O   . GLU B 1 54  ? 80.337 -53.936 24.281 1.00 31.51  ? 35  GLU B O   1 
ATOM   2765 C CB  . GLU B 1 54  ? 83.154 -54.134 22.559 1.00 36.22  ? 35  GLU B CB  1 
ATOM   2766 C CG  . GLU B 1 54  ? 83.752 -54.065 23.950 1.00 40.46  ? 35  GLU B CG  1 
ATOM   2767 C CD  . GLU B 1 54  ? 85.202 -53.576 23.986 1.00 42.98  ? 35  GLU B CD  1 
ATOM   2768 O OE1 . GLU B 1 54  ? 85.699 -53.313 25.118 1.00 44.53  ? 35  GLU B OE1 1 
ATOM   2769 O OE2 . GLU B 1 54  ? 85.837 -53.461 22.909 1.00 43.18  ? 35  GLU B OE2 1 
ATOM   2770 N N   . LEU B 1 55  ? 80.194 -52.981 22.252 1.00 28.68  ? 36  LEU B N   1 
ATOM   2771 C CA  . LEU B 1 55  ? 79.090 -52.141 22.659 1.00 26.77  ? 36  LEU B CA  1 
ATOM   2772 C C   . LEU B 1 55  ? 77.824 -52.976 22.907 1.00 30.47  ? 36  LEU B C   1 
ATOM   2773 O O   . LEU B 1 55  ? 77.106 -52.766 23.889 1.00 32.19  ? 36  LEU B O   1 
ATOM   2774 C CB  . LEU B 1 55  ? 78.833 -51.062 21.601 1.00 25.17  ? 36  LEU B CB  1 
ATOM   2775 C CG  . LEU B 1 55  ? 77.650 -50.164 21.884 1.00 24.77  ? 36  LEU B CG  1 
ATOM   2776 C CD1 . LEU B 1 55  ? 77.907 -49.294 23.143 1.00 25.67  ? 36  LEU B CD1 1 
ATOM   2777 C CD2 . LEU B 1 55  ? 77.359 -49.261 20.661 1.00 25.97  ? 36  LEU B CD2 1 
ATOM   2778 N N   . ALA B 1 56  ? 77.555 -53.918 22.003 1.00 31.89  ? 37  ALA B N   1 
ATOM   2779 C CA  . ALA B 1 56  ? 76.334 -54.712 22.048 1.00 32.99  ? 37  ALA B CA  1 
ATOM   2780 C C   . ALA B 1 56  ? 76.340 -55.665 23.231 1.00 35.28  ? 37  ALA B C   1 
ATOM   2781 O O   . ALA B 1 56  ? 75.289 -55.966 23.789 1.00 36.81  ? 37  ALA B O   1 
ATOM   2782 C CB  . ALA B 1 56  ? 76.153 -55.492 20.740 1.00 33.29  ? 37  ALA B CB  1 
ATOM   2783 N N   . ALA B 1 57  ? 77.535 -56.103 23.618 1.00 36.87  ? 38  ALA B N   1 
ATOM   2784 C CA  . ALA B 1 57  ? 77.709 -57.130 24.659 1.00 39.12  ? 38  ALA B CA  1 
ATOM   2785 C C   . ALA B 1 57  ? 77.496 -56.576 26.055 1.00 42.93  ? 38  ALA B C   1 
ATOM   2786 O O   . ALA B 1 57  ? 77.594 -57.305 27.057 1.00 43.49  ? 38  ALA B O   1 
ATOM   2787 C CB  . ALA B 1 57  ? 79.100 -57.762 24.556 1.00 37.63  ? 38  ALA B CB  1 
ATOM   2788 N N   . VAL B 1 58  ? 77.200 -55.283 26.125 1.00 45.55  ? 39  VAL B N   1 
ATOM   2789 C CA  . VAL B 1 58  ? 77.103 -54.591 27.398 1.00 48.16  ? 39  VAL B CA  1 
ATOM   2790 C C   . VAL B 1 58  ? 75.827 -55.017 28.119 1.00 49.38  ? 39  VAL B C   1 
ATOM   2791 O O   . VAL B 1 58  ? 75.731 -54.948 29.351 1.00 50.00  ? 39  VAL B O   1 
ATOM   2792 C CB  . VAL B 1 58  ? 77.144 -53.049 27.199 1.00 49.73  ? 39  VAL B CB  1 
ATOM   2793 C CG1 . VAL B 1 58  ? 75.767 -52.502 26.813 1.00 49.56  ? 39  VAL B CG1 1 
ATOM   2794 C CG2 . VAL B 1 58  ? 77.663 -52.378 28.447 1.00 50.91  ? 39  VAL B CG2 1 
ATOM   2795 N N   . VAL B 1 59  ? 74.855 -55.488 27.349 1.00 50.08  ? 40  VAL B N   1 
ATOM   2796 C CA  . VAL B 1 59  ? 73.607 -55.974 27.915 1.00 50.81  ? 40  VAL B CA  1 
ATOM   2797 C C   . VAL B 1 59  ? 73.353 -57.411 27.445 1.00 51.21  ? 40  VAL B C   1 
ATOM   2798 O O   . VAL B 1 59  ? 73.951 -57.860 26.461 1.00 50.28  ? 40  VAL B O   1 
ATOM   2799 C CB  . VAL B 1 59  ? 72.426 -55.059 27.526 1.00 50.82  ? 40  VAL B CB  1 
ATOM   2800 C CG1 . VAL B 1 59  ? 71.965 -55.350 26.107 1.00 50.74  ? 40  VAL B CG1 1 
ATOM   2801 C CG2 . VAL B 1 59  ? 71.288 -55.220 28.507 1.00 51.13  ? 40  VAL B CG2 1 
ATOM   2802 N N   . SER B 1 60  ? 72.482 -58.125 28.157 1.00 52.62  ? 41  SER B N   1 
ATOM   2803 C CA  . SER B 1 60  ? 72.101 -59.492 27.796 1.00 54.26  ? 41  SER B CA  1 
ATOM   2804 C C   . SER B 1 60  ? 71.368 -59.553 26.451 1.00 55.19  ? 41  SER B C   1 
ATOM   2805 O O   . SER B 1 60  ? 70.825 -58.543 25.986 1.00 55.81  ? 41  SER B O   1 
ATOM   2806 C CB  . SER B 1 60  ? 71.220 -60.098 28.891 1.00 54.70  ? 41  SER B CB  1 
ATOM   2807 O OG  . SER B 1 60  ? 70.854 -61.420 28.551 1.00 55.49  ? 41  SER B OG  1 
ATOM   2808 N N   . GLY B 1 61  ? 71.349 -60.733 25.831 1.00 55.03  ? 42  GLY B N   1 
ATOM   2809 C CA  . GLY B 1 61  ? 70.633 -60.920 24.578 1.00 55.17  ? 42  GLY B CA  1 
ATOM   2810 C C   . GLY B 1 61  ? 69.115 -60.850 24.689 1.00 55.67  ? 42  GLY B C   1 
ATOM   2811 O O   . GLY B 1 61  ? 68.432 -60.385 23.767 1.00 55.04  ? 42  GLY B O   1 
ATOM   2812 N N   . SER B 1 62  ? 68.580 -61.325 25.812 1.00 56.20  ? 43  SER B N   1 
ATOM   2813 C CA  . SER B 1 62  ? 67.141 -61.266 26.058 1.00 56.70  ? 43  SER B CA  1 
ATOM   2814 C C   . SER B 1 62  ? 66.673 -59.835 26.329 1.00 56.40  ? 43  SER B C   1 
ATOM   2815 O O   . SER B 1 62  ? 65.576 -59.440 25.911 1.00 56.43  ? 43  SER B O   1 
ATOM   2816 C CB  . SER B 1 62  ? 66.759 -62.171 27.236 1.00 57.46  ? 43  SER B CB  1 
ATOM   2817 O OG  . SER B 1 62  ? 66.925 -63.540 26.899 1.00 58.35  ? 43  SER B OG  1 
ATOM   2818 N N   . THR B 1 63  ? 67.502 -59.070 27.041 1.00 55.20  ? 44  THR B N   1 
ATOM   2819 C CA  . THR B 1 63  ? 67.195 -57.675 27.337 1.00 54.70  ? 44  THR B CA  1 
ATOM   2820 C C   . THR B 1 63  ? 67.110 -56.844 26.060 1.00 52.72  ? 44  THR B C   1 
ATOM   2821 O O   . THR B 1 63  ? 66.158 -56.079 25.867 1.00 51.69  ? 44  THR B O   1 
ATOM   2822 C CB  . THR B 1 63  ? 68.246 -57.046 28.258 1.00 55.64  ? 44  THR B CB  1 
ATOM   2823 O OG1 . THR B 1 63  ? 68.399 -57.854 29.434 1.00 56.11  ? 44  THR B OG1 1 
ATOM   2824 C CG2 . THR B 1 63  ? 67.823 -55.629 28.648 1.00 55.95  ? 44  THR B CG2 1 
ATOM   2825 N N   . TYR B 1 64  ? 68.110 -57.008 25.193 1.00 51.44  ? 45  TYR B N   1 
ATOM   2826 C CA  . TYR B 1 64  ? 68.159 -56.265 23.934 1.00 49.89  ? 45  TYR B CA  1 
ATOM   2827 C C   . TYR B 1 64  ? 66.989 -56.617 23.023 1.00 51.26  ? 45  TYR B C   1 
ATOM   2828 O O   . TYR B 1 64  ? 66.296 -55.737 22.532 1.00 51.30  ? 45  TYR B O   1 
ATOM   2829 C CB  . TYR B 1 64  ? 69.478 -56.513 23.192 1.00 47.24  ? 45  TYR B CB  1 
ATOM   2830 C CG  . TYR B 1 64  ? 69.637 -55.579 22.007 1.00 44.74  ? 45  TYR B CG  1 
ATOM   2831 C CD1 . TYR B 1 64  ? 69.208 -55.957 20.744 1.00 42.96  ? 45  TYR B CD1 1 
ATOM   2832 C CD2 . TYR B 1 64  ? 70.171 -54.308 22.172 1.00 43.55  ? 45  TYR B CD2 1 
ATOM   2833 C CE1 . TYR B 1 64  ? 69.319 -55.109 19.670 1.00 42.46  ? 45  TYR B CE1 1 
ATOM   2834 C CE2 . TYR B 1 64  ? 70.290 -53.451 21.106 1.00 42.40  ? 45  TYR B CE2 1 
ATOM   2835 C CZ  . TYR B 1 64  ? 69.857 -53.854 19.858 1.00 41.38  ? 45  TYR B CZ  1 
ATOM   2836 O OH  . TYR B 1 64  ? 69.980 -53.009 18.795 1.00 38.54  ? 45  TYR B OH  1 
ATOM   2837 N N   . THR B 1 65  ? 66.766 -57.904 22.790 1.00 52.73  ? 46  THR B N   1 
ATOM   2838 C CA  . THR B 1 65  ? 65.660 -58.310 21.928 1.00 54.31  ? 46  THR B CA  1 
ATOM   2839 C C   . THR B 1 65  ? 64.298 -58.018 22.586 1.00 55.47  ? 46  THR B C   1 
ATOM   2840 O O   . THR B 1 65  ? 63.278 -57.933 21.901 1.00 56.54  ? 46  THR B O   1 
ATOM   2841 C CB  . THR B 1 65  ? 65.772 -59.796 21.554 1.00 54.75  ? 46  THR B CB  1 
ATOM   2842 O OG1 . THR B 1 65  ? 65.894 -60.576 22.745 1.00 55.23  ? 46  THR B OG1 1 
ATOM   2843 C CG2 . THR B 1 65  ? 67.012 -60.022 20.685 1.00 54.83  ? 46  THR B CG2 1 
ATOM   2844 N N   . GLY B 1 66  ? 64.286 -57.829 23.905 1.00 55.47  ? 47  GLY B N   1 
ATOM   2845 C CA  . GLY B 1 66  ? 63.075 -57.423 24.601 1.00 55.91  ? 47  GLY B CA  1 
ATOM   2846 C C   . GLY B 1 66  ? 62.706 -55.970 24.332 1.00 56.20  ? 47  GLY B C   1 
ATOM   2847 O O   . GLY B 1 66  ? 61.622 -55.500 24.703 1.00 57.48  ? 47  GLY B O   1 
ATOM   2848 N N   . TRP B 1 67  ? 63.617 -55.248 23.690 1.00 54.66  ? 48  TRP B N   1 
ATOM   2849 C CA  . TRP B 1 67  ? 63.367 -53.864 23.303 1.00 52.81  ? 48  TRP B CA  1 
ATOM   2850 C C   . TRP B 1 67  ? 62.666 -53.738 21.932 1.00 49.44  ? 48  TRP B C   1 
ATOM   2851 O O   . TRP B 1 67  ? 62.236 -52.640 21.587 1.00 50.45  ? 48  TRP B O   1 
ATOM   2852 C CB  . TRP B 1 67  ? 64.694 -53.080 23.265 1.00 54.13  ? 48  TRP B CB  1 
ATOM   2853 C CG  . TRP B 1 67  ? 65.342 -52.808 24.606 1.00 55.14  ? 48  TRP B CG  1 
ATOM   2854 C CD1 . TRP B 1 67  ? 64.718 -52.748 25.823 1.00 56.20  ? 48  TRP B CD1 1 
ATOM   2855 C CD2 . TRP B 1 67  ? 66.741 -52.551 24.863 1.00 55.47  ? 48  TRP B CD2 1 
ATOM   2856 N NE1 . TRP B 1 67  ? 65.637 -52.470 26.817 1.00 56.87  ? 48  TRP B NE1 1 
ATOM   2857 C CE2 . TRP B 1 67  ? 66.883 -52.346 26.255 1.00 55.83  ? 48  TRP B CE2 1 
ATOM   2858 C CE3 . TRP B 1 67  ? 67.884 -52.477 24.055 1.00 54.96  ? 48  TRP B CE3 1 
ATOM   2859 C CZ2 . TRP B 1 67  ? 68.122 -52.072 26.854 1.00 54.42  ? 48  TRP B CZ2 1 
ATOM   2860 C CZ3 . TRP B 1 67  ? 69.117 -52.208 24.660 1.00 54.15  ? 48  TRP B CZ3 1 
ATOM   2861 C CH2 . TRP B 1 67  ? 69.219 -52.006 26.045 1.00 53.38  ? 48  TRP B CH2 1 
ATOM   2862 N N   . ASP B 1 68  ? 62.466 -54.858 21.215 1.00 44.76  ? 49  ASP B N   1 
ATOM   2863 C CA  . ASP B 1 68  ? 62.831 -54.924 19.787 1.00 39.69  ? 49  ASP B CA  1 
ATOM   2864 C C   . ASP B 1 68  ? 62.898 -53.614 19.036 1.00 32.56  ? 49  ASP B C   1 
ATOM   2865 O O   . ASP B 1 68  ? 61.914 -52.927 18.727 1.00 30.59  ? 49  ASP B O   1 
ATOM   2866 C CB  . ASP B 1 68  ? 61.995 -55.828 18.919 1.00 41.26  ? 49  ASP B CB  1 
ATOM   2867 C CG  . ASP B 1 68  ? 62.720 -56.110 17.590 1.00 42.66  ? 49  ASP B CG  1 
ATOM   2868 O OD1 . ASP B 1 68  ? 63.883 -56.568 17.655 1.00 44.22  ? 49  ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 1 68  ? 62.200 -55.817 16.498 1.00 42.29  ? 49  ASP B OD2 1 
ATOM   2870 N N   . ILE B 1 69  ? 64.131 -53.392 18.660 1.00 27.61  ? 50  ILE B N   1 
ATOM   2871 C CA  . ILE B 1 69  ? 64.618 -52.152 18.142 1.00 24.10  ? 50  ILE B CA  1 
ATOM   2872 C C   . ILE B 1 69  ? 64.169 -51.989 16.704 1.00 22.24  ? 50  ILE B C   1 
ATOM   2873 O O   . ILE B 1 69  ? 63.766 -50.903 16.290 1.00 21.21  ? 50  ILE B O   1 
ATOM   2874 C CB  . ILE B 1 69  ? 66.159 -52.142 18.272 1.00 23.98  ? 50  ILE B CB  1 
ATOM   2875 C CG1 . ILE B 1 69  ? 66.571 -52.097 19.753 1.00 26.70  ? 50  ILE B CG1 1 
ATOM   2876 C CG2 . ILE B 1 69  ? 66.803 -51.022 17.462 1.00 23.48  ? 50  ILE B CG2 1 
ATOM   2877 C CD1 . ILE B 1 69  ? 66.183 -50.850 20.442 1.00 27.24  ? 50  ILE B CD1 1 
ATOM   2878 N N   . THR B 1 70  ? 64.244 -53.044 15.910 1.00 25.11  ? 51  THR B N   1 
ATOM   2879 C CA  A THR B 1 70  ? 63.879 -52.925 14.509 0.50 27.14  ? 51  THR B CA  1 
ATOM   2880 C CA  B THR B 1 70  ? 63.889 -52.893 14.506 0.50 26.97  ? 51  THR B CA  1 
ATOM   2881 C C   . THR B 1 70  ? 62.374 -52.746 14.354 1.00 25.49  ? 51  THR B C   1 
ATOM   2882 O O   . THR B 1 70  ? 61.907 -52.073 13.416 1.00 22.81  ? 51  THR B O   1 
ATOM   2883 C CB  A THR B 1 70  ? 64.360 -54.141 13.710 0.50 31.62  ? 51  THR B CB  1 
ATOM   2884 C CB  B THR B 1 70  ? 64.418 -54.067 13.646 0.50 31.62  ? 51  THR B CB  1 
ATOM   2885 O OG1 A THR B 1 70  ? 63.897 -55.342 14.343 0.50 35.48  ? 51  THR B OG1 1 
ATOM   2886 O OG1 B THR B 1 70  ? 65.831 -54.190 13.834 0.50 35.06  ? 51  THR B OG1 1 
ATOM   2887 C CG2 A THR B 1 70  ? 65.870 -54.151 13.680 0.50 32.97  ? 51  THR B CG2 1 
ATOM   2888 C CG2 B THR B 1 70  ? 64.146 -53.819 12.167 0.50 33.49  ? 51  THR B CG2 1 
ATOM   2889 N N   . GLU B 1 71  ? 61.607 -53.329 15.289 1.00 24.38  ? 52  GLU B N   1 
ATOM   2890 C CA  . GLU B 1 71  ? 60.147 -53.132 15.289 1.00 23.74  ? 52  GLU B CA  1 
ATOM   2891 C C   . GLU B 1 71  ? 59.852 -51.638 15.467 1.00 21.41  ? 52  GLU B C   1 
ATOM   2892 O O   . GLU B 1 71  ? 59.036 -51.026 14.725 1.00 20.82  ? 52  GLU B O   1 
ATOM   2893 C CB  . GLU B 1 71  ? 59.475 -53.965 16.397 1.00 26.32  ? 52  GLU B CB  1 
ATOM   2894 C CG  . GLU B 1 71  ? 58.006 -53.627 16.713 1.00 30.94  ? 52  GLU B CG  1 
ATOM   2895 C CD  . GLU B 1 71  ? 57.009 -54.400 15.868 1.00 35.65  ? 52  GLU B CD  1 
ATOM   2896 O OE1 . GLU B 1 71  ? 55.795 -54.332 16.168 1.00 36.81  ? 52  GLU B OE1 1 
ATOM   2897 O OE2 . GLU B 1 71  ? 57.436 -55.067 14.898 1.00 38.20  ? 52  GLU B OE2 1 
ATOM   2898 N N   . LEU B 1 72  ? 60.545 -51.036 16.422 1.00 18.09  ? 53  LEU B N   1 
ATOM   2899 C CA  . LEU B 1 72  ? 60.357 -49.601 16.646 1.00 18.33  ? 53  LEU B CA  1 
ATOM   2900 C C   . LEU B 1 72  ? 60.688 -48.815 15.376 1.00 18.82  ? 53  LEU B C   1 
ATOM   2901 O O   . LEU B 1 72  ? 59.914 -47.921 14.939 1.00 18.41  ? 53  LEU B O   1 
ATOM   2902 C CB  . LEU B 1 72  ? 61.240 -49.141 17.804 1.00 19.05  ? 53  LEU B CB  1 
ATOM   2903 C CG  . LEU B 1 72  ? 61.363 -47.642 18.143 1.00 21.38  ? 53  LEU B CG  1 
ATOM   2904 C CD1 . LEU B 1 72  ? 59.969 -47.073 18.523 1.00 21.99  ? 53  LEU B CD1 1 
ATOM   2905 C CD2 . LEU B 1 72  ? 62.418 -47.396 19.236 1.00 21.79  ? 53  LEU B CD2 1 
ATOM   2906 N N   . ALA B 1 73  ? 61.846 -49.128 14.790 1.00 17.68  ? 54  ALA B N   1 
ATOM   2907 C CA  . ALA B 1 73  ? 62.312 -48.357 13.634 1.00 16.66  ? 54  ALA B CA  1 
ATOM   2908 C C   . ALA B 1 73  ? 61.307 -48.469 12.493 1.00 17.12  ? 54  ALA B C   1 
ATOM   2909 O O   . ALA B 1 73  ? 61.000 -47.472 11.817 1.00 17.65  ? 54  ALA B O   1 
ATOM   2910 C CB  . ALA B 1 73  ? 63.658 -48.816 13.195 1.00 17.36  ? 54  ALA B CB  1 
ATOM   2911 N N   . SER B 1 74  ? 60.809 -49.687 12.273 1.00 17.28  ? 55  SER B N   1 
ATOM   2912 C CA  . SER B 1 74  ? 59.858 -49.949 11.196 1.00 18.61  ? 55  SER B CA  1 
ATOM   2913 C C   . SER B 1 74  ? 58.567 -49.180 11.333 1.00 19.48  ? 55  SER B C   1 
ATOM   2914 O O   . SER B 1 74  ? 57.944 -48.845 10.328 1.00 21.47  ? 55  SER B O   1 
ATOM   2915 C CB  . SER B 1 74  ? 59.509 -51.448 11.135 1.00 21.02  ? 55  SER B CB  1 
ATOM   2916 O OG  . SER B 1 74  ? 60.677 -52.140 10.823 1.00 26.25  ? 55  SER B OG  1 
ATOM   2917 N N   . LEU B 1 75  ? 58.144 -48.935 12.577 1.00 18.98  ? 56  LEU B N   1 
ATOM   2918 C CA  . LEU B 1 75  ? 56.905 -48.219 12.874 1.00 18.42  ? 56  LEU B CA  1 
ATOM   2919 C C   . LEU B 1 75  ? 57.068 -46.692 12.820 1.00 18.28  ? 56  LEU B C   1 
ATOM   2920 O O   . LEU B 1 75  ? 56.129 -45.981 12.457 1.00 18.48  ? 56  LEU B O   1 
ATOM   2921 C CB  . LEU B 1 75  ? 56.383 -48.602 14.255 1.00 19.65  ? 56  LEU B CB  1 
ATOM   2922 C CG  . LEU B 1 75  ? 55.771 -50.006 14.335 1.00 21.35  ? 56  LEU B CG  1 
ATOM   2923 C CD1 . LEU B 1 75  ? 55.580 -50.423 15.799 1.00 21.65  ? 56  LEU B CD1 1 
ATOM   2924 C CD2 . LEU B 1 75  ? 54.439 -49.972 13.567 1.00 22.98  ? 56  LEU B CD2 1 
ATOM   2925 N N   . VAL B 1 76  ? 58.250 -46.173 13.147 1.00 16.89  ? 57  VAL B N   1 
ATOM   2926 C CA  . VAL B 1 76  ? 58.387 -44.695 13.241 1.00 15.91  ? 57  VAL B CA  1 
ATOM   2927 C C   . VAL B 1 76  ? 58.963 -44.082 11.930 1.00 16.41  ? 57  VAL B C   1 
ATOM   2928 O O   . VAL B 1 76  ? 58.788 -42.875 11.688 1.00 15.37  ? 57  VAL B O   1 
ATOM   2929 C CB  . VAL B 1 76  ? 59.246 -44.248 14.463 1.00 14.30  ? 57  VAL B CB  1 
ATOM   2930 C CG1 . VAL B 1 76  ? 58.582 -44.654 15.753 1.00 17.16  ? 57  VAL B CG1 1 
ATOM   2931 C CG2 . VAL B 1 76  ? 60.691 -44.787 14.402 1.00 14.71  ? 57  VAL B CG2 1 
ATOM   2932 N N   . TYR B 1 77  ? 59.623 -44.895 11.089 1.00 16.35  ? 58  TYR B N   1 
ATOM   2933 C CA  . TYR B 1 77  ? 60.035 -44.460 9.743  1.00 16.43  ? 58  TYR B CA  1 
ATOM   2934 C C   . TYR B 1 77  ? 59.534 -45.455 8.683  1.00 17.60  ? 58  TYR B C   1 
ATOM   2935 O O   . TYR B 1 77  ? 60.336 -46.130 8.015  1.00 17.96  ? 58  TYR B O   1 
ATOM   2936 C CB  . TYR B 1 77  ? 61.565 -44.301 9.607  1.00 15.93  ? 58  TYR B CB  1 
ATOM   2937 C CG  . TYR B 1 77  ? 62.190 -43.393 10.632 1.00 14.35  ? 58  TYR B CG  1 
ATOM   2938 C CD1 . TYR B 1 77  ? 62.065 -42.015 10.525 1.00 14.85  ? 58  TYR B CD1 1 
ATOM   2939 C CD2 . TYR B 1 77  ? 62.937 -43.914 11.694 1.00 16.13  ? 58  TYR B CD2 1 
ATOM   2940 C CE1 . TYR B 1 77  ? 62.681 -41.173 11.456 1.00 14.06  ? 58  TYR B CE1 1 
ATOM   2941 C CE2 . TYR B 1 77  ? 63.517 -43.101 12.641 1.00 14.11  ? 58  TYR B CE2 1 
ATOM   2942 C CZ  . TYR B 1 77  ? 63.398 -41.725 12.520 1.00 13.27  ? 58  TYR B CZ  1 
ATOM   2943 O OH  . TYR B 1 77  ? 64.030 -40.934 13.485 1.00 15.38  ? 58  TYR B OH  1 
ATOM   2944 N N   . PRO B 1 78  ? 58.208 -45.540 8.534  1.00 18.54  ? 59  PRO B N   1 
ATOM   2945 C CA  . PRO B 1 78  ? 57.616 -46.650 7.764  1.00 19.70  ? 59  PRO B CA  1 
ATOM   2946 C C   . PRO B 1 78  ? 57.749 -46.467 6.240  1.00 19.05  ? 59  PRO B C   1 
ATOM   2947 O O   . PRO B 1 78  ? 57.422 -47.417 5.505  1.00 19.56  ? 59  PRO B O   1 
ATOM   2948 C CB  . PRO B 1 78  ? 56.146 -46.630 8.194  1.00 20.49  ? 59  PRO B CB  1 
ATOM   2949 C CG  . PRO B 1 78  ? 55.870 -45.133 8.587  1.00 19.67  ? 59  PRO B CG  1 
ATOM   2950 C CD  . PRO B 1 78  ? 57.200 -44.662 9.184  1.00 19.14  ? 59  PRO B CD  1 
ATOM   2951 N N   . GLU B 1 79  ? 58.192 -45.289 5.780  1.00 21.47  ? 60  GLU B N   1 
ATOM   2952 C CA  . GLU B 1 79  ? 58.332 -45.039 4.336  1.00 22.41  ? 60  GLU B CA  1 
ATOM   2953 C C   . GLU B 1 79  ? 59.791 -45.090 3.833  1.00 20.64  ? 60  GLU B C   1 
ATOM   2954 O O   . GLU B 1 79  ? 60.065 -44.838 2.637  1.00 22.76  ? 60  GLU B O   1 
ATOM   2955 C CB  . GLU B 1 79  ? 57.695 -43.688 3.984  1.00 27.85  ? 60  GLU B CB  1 
ATOM   2956 C CG  . GLU B 1 79  ? 56.241 -43.591 4.408  1.00 34.31  ? 60  GLU B CG  1 
ATOM   2957 C CD  . GLU B 1 79  ? 55.291 -44.230 3.408  1.00 40.93  ? 60  GLU B CD  1 
ATOM   2958 O OE1 . GLU B 1 79  ? 55.770 -44.802 2.410  1.00 43.22  ? 60  GLU B OE1 1 
ATOM   2959 O OE2 . GLU B 1 79  ? 54.058 -44.142 3.612  1.00 44.70  ? 60  GLU B OE2 1 
ATOM   2960 N N   . SER B 1 80  ? 60.732 -45.424 4.717  1.00 18.54  ? 61  SER B N   1 
ATOM   2961 C CA  . SER B 1 80  ? 62.145 -45.502 4.308  1.00 16.73  ? 61  SER B CA  1 
ATOM   2962 C C   . SER B 1 80  ? 62.481 -46.773 3.511  1.00 18.13  ? 61  SER B C   1 
ATOM   2963 O O   . SER B 1 80  ? 61.856 -47.827 3.677  1.00 19.49  ? 61  SER B O   1 
ATOM   2964 C CB  . SER B 1 80  ? 63.074 -45.410 5.525  1.00 17.70  ? 61  SER B CB  1 
ATOM   2965 O OG  . SER B 1 80  ? 62.803 -46.460 6.457  1.00 20.64  ? 61  SER B OG  1 
ATOM   2966 N N   . SER B 1 81  ? 63.510 -46.668 2.682  1.00 17.75  ? 62  SER B N   1 
ATOM   2967 C CA  . SER B 1 81  ? 64.043 -47.837 1.992  1.00 16.77  ? 62  SER B CA  1 
ATOM   2968 C C   . SER B 1 81  ? 64.631 -48.814 2.984  1.00 17.33  ? 62  SER B C   1 
ATOM   2969 O O   . SER B 1 81  ? 64.826 -48.485 4.163  1.00 18.57  ? 62  SER B O   1 
ATOM   2970 C CB  . SER B 1 81  ? 65.142 -47.455 1.024  1.00 18.62  ? 62  SER B CB  1 
ATOM   2971 O OG  . SER B 1 81  ? 66.238 -46.887 1.763  1.00 19.05  ? 62  SER B OG  1 
ATOM   2972 N N   . ALA B 1 82  ? 64.936 -50.016 2.506  1.00 19.92  ? 63  ALA B N   1 
ATOM   2973 C CA  . ALA B 1 82  ? 65.547 -51.017 3.398  1.00 18.52  ? 63  ALA B CA  1 
ATOM   2974 C C   . ALA B 1 82  ? 66.847 -50.526 4.010  1.00 17.81  ? 63  ALA B C   1 
ATOM   2975 O O   . ALA B 1 82  ? 67.119 -50.750 5.194  1.00 17.77  ? 63  ALA B O   1 
ATOM   2976 C CB  . ALA B 1 82  ? 65.796 -52.350 2.632  1.00 18.80  ? 63  ALA B CB  1 
ATOM   2977 N N   . GLU B 1 83  ? 67.671 -49.895 3.181  1.00 18.50  ? 64  GLU B N   1 
ATOM   2978 C CA  . GLU B 1 83  ? 68.987 -49.442 3.595  1.00 19.79  ? 64  GLU B CA  1 
ATOM   2979 C C   . GLU B 1 83  ? 68.840 -48.350 4.677  1.00 17.62  ? 64  GLU B C   1 
ATOM   2980 O O   . GLU B 1 83  ? 69.580 -48.314 5.676  1.00 17.00  ? 64  GLU B O   1 
ATOM   2981 C CB  . GLU B 1 83  ? 69.721 -48.913 2.370  1.00 24.32  ? 64  GLU B CB  1 
ATOM   2982 C CG  . GLU B 1 83  ? 71.121 -48.469 2.605  1.00 30.86  ? 64  GLU B CG  1 
ATOM   2983 C CD  . GLU B 1 83  ? 71.613 -47.481 1.544  1.00 34.58  ? 64  GLU B CD  1 
ATOM   2984 O OE1 . GLU B 1 83  ? 71.300 -47.685 0.340  1.00 36.54  ? 64  GLU B OE1 1 
ATOM   2985 O OE2 . GLU B 1 83  ? 72.288 -46.487 1.923  1.00 35.64  ? 64  GLU B OE2 1 
ATOM   2986 N N   . ASP B 1 84  ? 67.880 -47.459 4.473  1.00 16.70  ? 65  ASP B N   1 
ATOM   2987 C CA  . ASP B 1 84  ? 67.666 -46.356 5.402  1.00 15.65  ? 65  ASP B CA  1 
ATOM   2988 C C   . ASP B 1 84  ? 66.973 -46.830 6.672  1.00 15.83  ? 65  ASP B C   1 
ATOM   2989 O O   . ASP B 1 84  ? 67.270 -46.326 7.759  1.00 14.77  ? 65  ASP B O   1 
ATOM   2990 C CB  . ASP B 1 84  ? 66.862 -45.239 4.703  1.00 15.73  ? 65  ASP B CB  1 
ATOM   2991 C CG  . ASP B 1 84  ? 67.700 -44.456 3.729  1.00 18.58  ? 65  ASP B CG  1 
ATOM   2992 O OD1 . ASP B 1 84  ? 68.920 -44.278 3.945  1.00 19.23  ? 65  ASP B OD1 1 
ATOM   2993 O OD2 . ASP B 1 84  ? 67.131 -44.000 2.715  1.00 21.98  ? 65  ASP B OD2 1 
ATOM   2994 N N   . LEU B 1 85  ? 66.083 -47.820 6.558  1.00 14.63  ? 66  LEU B N   1 
ATOM   2995 C CA  . LEU B 1 85  ? 65.485 -48.416 7.755  1.00 15.12  ? 66  LEU B CA  1 
ATOM   2996 C C   . LEU B 1 85  ? 66.550 -49.098 8.623  1.00 15.97  ? 66  LEU B C   1 
ATOM   2997 O O   . LEU B 1 85  ? 66.483 -48.993 9.844  1.00 15.62  ? 66  LEU B O   1 
ATOM   2998 C CB  . LEU B 1 85  ? 64.392 -49.423 7.368  1.00 16.00  ? 66  LEU B CB  1 
ATOM   2999 C CG  . LEU B 1 85  ? 63.621 -50.111 8.519  1.00 15.18  ? 66  LEU B CG  1 
ATOM   3000 C CD1 . LEU B 1 85  ? 62.917 -49.090 9.432  1.00 17.55  ? 66  LEU B CD1 1 
ATOM   3001 C CD2 . LEU B 1 85  ? 62.609 -51.127 7.961  1.00 15.19  ? 66  LEU B CD2 1 
ATOM   3002 N N   . ALA B 1 86  ? 67.548 -49.735 8.001  1.00 13.90  ? 67  ALA B N   1 
ATOM   3003 C CA  . ALA B 1 86  ? 68.669 -50.330 8.740  1.00 14.12  ? 67  ALA B CA  1 
ATOM   3004 C C   . ALA B 1 86  ? 69.448 -49.252 9.507  1.00 13.14  ? 67  ALA B C   1 
ATOM   3005 O O   . ALA B 1 86  ? 69.832 -49.460 10.663 1.00 14.81  ? 67  ALA B O   1 
ATOM   3006 C CB  . ALA B 1 86  ? 69.597 -51.081 7.798  1.00 16.66  ? 67  ALA B CB  1 
ATOM   3007 N N   . LEU B 1 87  ? 69.664 -48.087 8.869  1.00 12.79  ? 68  LEU B N   1 
ATOM   3008 C CA  . LEU B 1 87  ? 70.329 -46.975 9.546  1.00 13.46  ? 68  LEU B CA  1 
ATOM   3009 C C   . LEU B 1 87  ? 69.484 -46.529 10.757 1.00 13.78  ? 68  LEU B C   1 
ATOM   3010 O O   . LEU B 1 87  ? 70.026 -46.284 11.844 1.00 13.39  ? 68  LEU B O   1 
ATOM   3011 C CB  . LEU B 1 87  ? 70.537 -45.819 8.582  1.00 14.49  ? 68  LEU B CB  1 
ATOM   3012 C CG  . LEU B 1 87  ? 71.084 -44.536 9.217  1.00 12.89  ? 68  LEU B CG  1 
ATOM   3013 C CD1 . LEU B 1 87  ? 72.408 -44.794 9.963  1.00 13.49  ? 68  LEU B CD1 1 
ATOM   3014 C CD2 . LEU B 1 87  ? 71.303 -43.514 8.091  1.00 15.66  ? 68  LEU B CD2 1 
ATOM   3015 N N   . ALA B 1 88  ? 68.160 -46.438 10.590 1.00 14.03  ? 69  ALA B N   1 
ATOM   3016 C CA  . ALA B 1 88  ? 67.295 -46.081 11.731 1.00 14.38  ? 69  ALA B CA  1 
ATOM   3017 C C   . ALA B 1 88  ? 67.339 -47.113 12.860 1.00 13.77  ? 69  ALA B C   1 
ATOM   3018 O O   . ALA B 1 88  ? 67.385 -46.730 14.054 1.00 14.97  ? 69  ALA B O   1 
ATOM   3019 C CB  . ALA B 1 88  ? 65.836 -45.886 11.265 1.00 14.64  ? 69  ALA B CB  1 
ATOM   3020 N N   . ALA B 1 89  ? 67.398 -48.403 12.510 1.00 13.87  ? 70  ALA B N   1 
ATOM   3021 C CA  . ALA B 1 89  ? 67.531 -49.420 13.557 1.00 14.40  ? 70  ALA B CA  1 
ATOM   3022 C C   . ALA B 1 89  ? 68.873 -49.333 14.273 1.00 14.10  ? 70  ALA B C   1 
ATOM   3023 O O   . ALA B 1 89  ? 68.943 -49.497 15.491 1.00 15.61  ? 70  ALA B O   1 
ATOM   3024 C CB  . ALA B 1 89  ? 67.344 -50.813 12.953 1.00 14.71  ? 70  ALA B CB  1 
ATOM   3025 N N   . ASP B 1 90  ? 69.951 -49.144 13.504 1.00 13.55  ? 71  ASP B N   1 
ATOM   3026 C CA  . ASP B 1 90  ? 71.281 -49.036 14.084 1.00 12.73  ? 71  ASP B CA  1 
ATOM   3027 C C   . ASP B 1 90  ? 71.337 -47.839 15.022 1.00 13.62  ? 71  ASP B C   1 
ATOM   3028 O O   . ASP B 1 90  ? 71.921 -47.923 16.113 1.00 14.87  ? 71  ASP B O   1 
ATOM   3029 C CB  . ASP B 1 90  ? 72.368 -48.918 12.982 1.00 12.91  ? 71  ASP B CB  1 
ATOM   3030 C CG  . ASP B 1 90  ? 72.495 -50.205 12.101 1.00 14.99  ? 71  ASP B CG  1 
ATOM   3031 O OD1 . ASP B 1 90  ? 72.068 -51.339 12.514 1.00 15.63  ? 71  ASP B OD1 1 
ATOM   3032 O OD2 . ASP B 1 90  ? 73.072 -50.081 10.965 1.00 14.64  ? 71  ASP B OD2 1 
ATOM   3033 N N   . LEU B 1 91  ? 70.726 -46.728 14.598 1.00 13.75  ? 72  LEU B N   1 
ATOM   3034 C CA  . LEU B 1 91  ? 70.675 -45.502 15.425 1.00 13.42  ? 72  LEU B CA  1 
ATOM   3035 C C   . LEU B 1 91  ? 69.893 -45.742 16.711 1.00 15.10  ? 72  LEU B C   1 
ATOM   3036 O O   . LEU B 1 91  ? 70.387 -45.456 17.818 1.00 15.02  ? 72  LEU B O   1 
ATOM   3037 C CB  . LEU B 1 91  ? 70.030 -44.355 14.635 1.00 13.55  ? 72  LEU B CB  1 
ATOM   3038 C CG  . LEU B 1 91  ? 69.788 -43.080 15.439 1.00 14.52  ? 72  LEU B CG  1 
ATOM   3039 C CD1 . LEU B 1 91  ? 71.098 -42.559 16.053 1.00 17.19  ? 72  LEU B CD1 1 
ATOM   3040 C CD2 . LEU B 1 91  ? 69.092 -42.038 14.553 1.00 14.54  ? 72  LEU B CD2 1 
ATOM   3041 N N   . MET B 1 92  ? 68.691 -46.312 16.601 1.00 16.03  ? 73  MET B N   1 
ATOM   3042 C CA  . MET B 1 92  ? 67.901 -46.576 17.825 1.00 18.44  ? 73  MET B CA  1 
ATOM   3043 C C   . MET B 1 92  ? 68.595 -47.556 18.780 1.00 17.78  ? 73  MET B C   1 
ATOM   3044 O O   . MET B 1 92  ? 68.546 -47.386 20.018 1.00 18.73  ? 73  MET B O   1 
ATOM   3045 C CB  . MET B 1 92  ? 66.513 -47.128 17.478 1.00 19.97  ? 73  MET B CB  1 
ATOM   3046 C CG  . MET B 1 92  ? 65.576 -46.177 16.762 1.00 23.94  ? 73  MET B CG  1 
ATOM   3047 S SD  . MET B 1 92  ? 65.375 -44.588 17.600 1.00 27.75  ? 73  MET B SD  1 
ATOM   3048 C CE  . MET B 1 92  ? 64.052 -43.920 16.607 1.00 29.66  ? 73  MET B CE  1 
ATOM   3049 N N   . GLY B 1 93  ? 69.230 -48.586 18.210 1.00 16.69  ? 74  GLY B N   1 
ATOM   3050 C CA  . GLY B 1 93  ? 70.037 -49.521 18.991 1.00 16.60  ? 74  GLY B CA  1 
ATOM   3051 C C   . GLY B 1 93  ? 71.157 -48.782 19.712 1.00 17.19  ? 74  GLY B C   1 
ATOM   3052 O O   . GLY B 1 93  ? 71.427 -49.051 20.907 1.00 19.46  ? 74  GLY B O   1 
ATOM   3053 N N   . PHE B 1 94  ? 71.829 -47.868 19.006 1.00 16.99  ? 75  PHE B N   1 
ATOM   3054 C CA  . PHE B 1 94  ? 72.894 -47.077 19.640 1.00 16.26  ? 75  PHE B CA  1 
ATOM   3055 C C   . PHE B 1 94  ? 72.377 -46.284 20.852 1.00 17.63  ? 75  PHE B C   1 
ATOM   3056 O O   . PHE B 1 94  ? 72.998 -46.319 21.943 1.00 17.99  ? 75  PHE B O   1 
ATOM   3057 C CB  . PHE B 1 94  ? 73.527 -46.110 18.621 1.00 16.56  ? 75  PHE B CB  1 
ATOM   3058 C CG  . PHE B 1 94  ? 74.501 -45.158 19.243 1.00 16.29  ? 75  PHE B CG  1 
ATOM   3059 C CD1 . PHE B 1 94  ? 74.092 -43.879 19.636 1.00 16.69  ? 75  PHE B CD1 1 
ATOM   3060 C CD2 . PHE B 1 94  ? 75.809 -45.573 19.517 1.00 16.55  ? 75  PHE B CD2 1 
ATOM   3061 C CE1 . PHE B 1 94  ? 74.993 -43.005 20.251 1.00 16.93  ? 75  PHE B CE1 1 
ATOM   3062 C CE2 . PHE B 1 94  ? 76.729 -44.700 20.126 1.00 17.73  ? 75  PHE B CE2 1 
ATOM   3063 C CZ  . PHE B 1 94  ? 76.317 -43.402 20.487 1.00 16.57  ? 75  PHE B CZ  1 
ATOM   3064 N N   . TYR B 1 95  ? 71.225 -45.644 20.698 1.00 16.29  ? 76  TYR B N   1 
ATOM   3065 C CA  . TYR B 1 95  ? 70.727 -44.840 21.824 1.00 18.01  ? 76  TYR B CA  1 
ATOM   3066 C C   . TYR B 1 95  ? 70.576 -45.728 23.066 1.00 19.84  ? 76  TYR B C   1 
ATOM   3067 O O   . TYR B 1 95  ? 70.993 -45.338 24.162 1.00 20.46  ? 76  TYR B O   1 
ATOM   3068 C CB  . TYR B 1 95  ? 69.392 -44.201 21.500 1.00 16.99  ? 76  TYR B CB  1 
ATOM   3069 C CG  . TYR B 1 95  ? 69.459 -42.963 20.602 1.00 15.83  ? 76  TYR B CG  1 
ATOM   3070 C CD1 . TYR B 1 95  ? 70.274 -41.873 20.927 1.00 16.60  ? 76  TYR B CD1 1 
ATOM   3071 C CD2 . TYR B 1 95  ? 68.657 -42.870 19.470 1.00 17.09  ? 76  TYR B CD2 1 
ATOM   3072 C CE1 . TYR B 1 95  ? 70.301 -40.712 20.144 1.00 14.96  ? 76  TYR B CE1 1 
ATOM   3073 C CE2 . TYR B 1 95  ? 68.676 -41.723 18.667 1.00 15.55  ? 76  TYR B CE2 1 
ATOM   3074 C CZ  . TYR B 1 95  ? 69.503 -40.662 19.006 1.00 15.59  ? 76  TYR B CZ  1 
ATOM   3075 O OH  . TYR B 1 95  ? 69.498 -39.552 18.199 1.00 14.88  ? 76  TYR B OH  1 
ATOM   3076 N N   . PHE B 1 96  ? 69.991 -46.911 22.899 1.00 19.37  ? 77  PHE B N   1 
ATOM   3077 C CA  . PHE B 1 96  ? 69.756 -47.786 24.058 1.00 22.61  ? 77  PHE B CA  1 
ATOM   3078 C C   . PHE B 1 96  ? 71.067 -48.313 24.634 1.00 21.95  ? 77  PHE B C   1 
ATOM   3079 O O   . PHE B 1 96  ? 71.261 -48.314 25.867 1.00 23.27  ? 77  PHE B O   1 
ATOM   3080 C CB  . PHE B 1 96  ? 68.826 -48.932 23.651 1.00 26.47  ? 77  PHE B CB  1 
ATOM   3081 C CG  . PHE B 1 96  ? 67.380 -48.523 23.534 1.00 33.18  ? 77  PHE B CG  1 
ATOM   3082 C CD1 . PHE B 1 96  ? 66.888 -47.989 22.355 1.00 36.37  ? 77  PHE B CD1 1 
ATOM   3083 C CD2 . PHE B 1 96  ? 66.514 -48.647 24.609 1.00 38.81  ? 77  PHE B CD2 1 
ATOM   3084 C CE1 . PHE B 1 96  ? 65.563 -47.590 22.231 1.00 37.66  ? 77  PHE B CE1 1 
ATOM   3085 C CE2 . PHE B 1 96  ? 65.176 -48.246 24.494 1.00 39.85  ? 77  PHE B CE2 1 
ATOM   3086 C CZ  . PHE B 1 96  ? 64.710 -47.714 23.296 1.00 39.89  ? 77  PHE B CZ  1 
ATOM   3087 N N   . LEU B 1 97  ? 71.987 -48.727 23.763 1.00 20.38  ? 78  LEU B N   1 
ATOM   3088 C CA  . LEU B 1 97  ? 73.254 -49.299 24.248 1.00 21.22  ? 78  LEU B CA  1 
ATOM   3089 C C   . LEU B 1 97  ? 74.176 -48.227 24.887 1.00 20.81  ? 78  LEU B C   1 
ATOM   3090 O O   . LEU B 1 97  ? 74.820 -48.475 25.921 1.00 22.39  ? 78  LEU B O   1 
ATOM   3091 C CB  . LEU B 1 97  ? 73.963 -50.034 23.101 1.00 21.68  ? 78  LEU B CB  1 
ATOM   3092 C CG  . LEU B 1 97  ? 73.281 -51.301 22.558 1.00 21.73  ? 78  LEU B CG  1 
ATOM   3093 C CD1 . LEU B 1 97  ? 73.903 -51.605 21.196 1.00 22.52  ? 78  LEU B CD1 1 
ATOM   3094 C CD2 . LEU B 1 97  ? 73.448 -52.486 23.523 1.00 22.73  ? 78  LEU B CD2 1 
ATOM   3095 N N   . PHE B 1 98  ? 74.231 -47.044 24.281 1.00 21.45  ? 79  PHE B N   1 
ATOM   3096 C CA  . PHE B 1 98  ? 75.066 -45.967 24.756 1.00 19.05  ? 79  PHE B CA  1 
ATOM   3097 C C   . PHE B 1 98  ? 74.630 -45.574 26.147 1.00 20.35  ? 79  PHE B C   1 
ATOM   3098 O O   . PHE B 1 98  ? 75.448 -45.444 27.060 1.00 22.03  ? 79  PHE B O   1 
ATOM   3099 C CB  . PHE B 1 98  ? 74.975 -44.749 23.797 1.00 18.23  ? 79  PHE B CB  1 
ATOM   3100 C CG  . PHE B 1 98  ? 75.677 -43.528 24.335 1.00 18.62  ? 79  PHE B CG  1 
ATOM   3101 C CD1 . PHE B 1 98  ? 74.961 -42.406 24.730 1.00 19.82  ? 79  PHE B CD1 1 
ATOM   3102 C CD2 . PHE B 1 98  ? 77.052 -43.520 24.474 1.00 20.43  ? 79  PHE B CD2 1 
ATOM   3103 C CE1 . PHE B 1 98  ? 75.613 -41.281 25.219 1.00 19.84  ? 79  PHE B CE1 1 
ATOM   3104 C CE2 . PHE B 1 98  ? 77.713 -42.429 25.009 1.00 20.93  ? 79  PHE B CE2 1 
ATOM   3105 C CZ  . PHE B 1 98  ? 76.983 -41.298 25.378 1.00 19.62  ? 79  PHE B CZ  1 
ATOM   3106 N N   . ASP B 1 99  ? 73.321 -45.415 26.310 1.00 21.90  ? 80  ASP B N   1 
ATOM   3107 C CA  . ASP B 1 99  ? 72.763 -44.925 27.564 1.00 21.75  ? 80  ASP B CA  1 
ATOM   3108 C C   . ASP B 1 99  ? 72.858 -45.963 28.665 1.00 22.10  ? 80  ASP B C   1 
ATOM   3109 O O   . ASP B 1 99  ? 72.900 -45.615 29.851 1.00 23.42  ? 80  ASP B O   1 
ATOM   3110 C CB  . ASP B 1 99  ? 71.324 -44.456 27.346 1.00 21.69  ? 80  ASP B CB  1 
ATOM   3111 C CG  . ASP B 1 99  ? 71.286 -43.032 26.813 1.00 22.52  ? 80  ASP B CG  1 
ATOM   3112 O OD1 . ASP B 1 99  ? 72.231 -42.308 27.160 1.00 22.16  ? 80  ASP B OD1 1 
ATOM   3113 O OD2 . ASP B 1 99  ? 70.369 -42.626 26.048 1.00 23.63  ? 80  ASP B OD2 1 
ATOM   3114 N N   . ASP B 1 100 ? 72.946 -47.225 28.290 1.00 22.65  ? 81  ASP B N   1 
ATOM   3115 C CA  . ASP B 1 100 ? 73.078 -48.279 29.288 1.00 24.04  ? 81  ASP B CA  1 
ATOM   3116 C C   . ASP B 1 100 ? 74.325 -48.126 30.157 1.00 24.76  ? 81  ASP B C   1 
ATOM   3117 O O   . ASP B 1 100 ? 74.314 -48.509 31.335 1.00 24.50  ? 81  ASP B O   1 
ATOM   3118 C CB  . ASP B 1 100 ? 73.090 -49.649 28.604 1.00 25.30  ? 81  ASP B CB  1 
ATOM   3119 C CG  . ASP B 1 100 ? 73.186 -50.772 29.591 1.00 29.49  ? 81  ASP B CG  1 
ATOM   3120 O OD1 . ASP B 1 100 ? 72.150 -51.066 30.228 1.00 29.37  ? 81  ASP B OD1 1 
ATOM   3121 O OD2 . ASP B 1 100 ? 74.305 -51.330 29.749 1.00 31.59  ? 81  ASP B OD2 1 
ATOM   3122 N N   . GLN B 1 101 ? 75.392 -47.546 29.608 1.00 25.18  ? 82  GLN B N   1 
ATOM   3123 C CA  . GLN B 1 101 ? 76.625 -47.476 30.384 1.00 24.85  ? 82  GLN B CA  1 
ATOM   3124 C C   . GLN B 1 101 ? 76.487 -46.522 31.580 1.00 24.19  ? 82  GLN B C   1 
ATOM   3125 O O   . GLN B 1 101 ? 77.253 -46.636 32.572 1.00 26.59  ? 82  GLN B O   1 
ATOM   3126 C CB  . GLN B 1 101 ? 77.809 -47.060 29.505 1.00 25.40  ? 82  GLN B CB  1 
ATOM   3127 C CG  . GLN B 1 101 ? 77.869 -45.548 29.145 1.00 25.78  ? 82  GLN B CG  1 
ATOM   3128 C CD  . GLN B 1 101 ? 78.828 -45.294 28.005 1.00 25.70  ? 82  GLN B CD  1 
ATOM   3129 O OE1 . GLN B 1 101 ? 78.406 -45.231 26.835 1.00 26.37  ? 82  GLN B OE1 1 
ATOM   3130 N NE2 . GLN B 1 101 ? 80.129 -45.211 28.314 1.00 24.47  ? 82  GLN B NE2 1 
ATOM   3131 N N   . PHE B 1 102 ? 75.521 -45.601 31.516 1.00 23.12  ? 83  PHE B N   1 
ATOM   3132 C CA  . PHE B 1 102 ? 75.321 -44.653 32.624 1.00 22.07  ? 83  PHE B CA  1 
ATOM   3133 C C   . PHE B 1 102 ? 74.314 -45.160 33.651 1.00 24.68  ? 83  PHE B C   1 
ATOM   3134 O O   . PHE B 1 102 ? 74.146 -44.589 34.745 1.00 25.27  ? 83  PHE B O   1 
ATOM   3135 C CB  . PHE B 1 102 ? 74.903 -43.278 32.074 1.00 21.77  ? 83  PHE B CB  1 
ATOM   3136 C CG  . PHE B 1 102 ? 75.841 -42.778 31.053 1.00 20.47  ? 83  PHE B CG  1 
ATOM   3137 C CD1 . PHE B 1 102 ? 75.450 -42.667 29.720 1.00 20.49  ? 83  PHE B CD1 1 
ATOM   3138 C CD2 . PHE B 1 102 ? 77.163 -42.516 31.395 1.00 19.28  ? 83  PHE B CD2 1 
ATOM   3139 C CE1 . PHE B 1 102 ? 76.357 -42.240 28.775 1.00 20.85  ? 83  PHE B CE1 1 
ATOM   3140 C CE2 . PHE B 1 102 ? 78.063 -42.053 30.449 1.00 22.53  ? 83  PHE B CE2 1 
ATOM   3141 C CZ  . PHE B 1 102 ? 77.653 -41.914 29.140 1.00 22.33  ? 83  PHE B CZ  1 
ATOM   3142 N N   . ASP B 1 103 ? 73.667 -46.256 33.295 1.00 27.39  ? 84  ASP B N   1 
ATOM   3143 C CA  . ASP B 1 103 ? 72.699 -46.919 34.140 1.00 31.18  ? 84  ASP B CA  1 
ATOM   3144 C C   . ASP B 1 103 ? 73.344 -47.842 35.173 1.00 29.87  ? 84  ASP B C   1 
ATOM   3145 O O   . ASP B 1 103 ? 72.886 -48.968 35.364 1.00 32.44  ? 84  ASP B O   1 
ATOM   3146 C CB  . ASP B 1 103 ? 71.756 -47.742 33.273 1.00 37.03  ? 84  ASP B CB  1 
ATOM   3147 C CG  . ASP B 1 103 ? 70.378 -47.174 33.225 1.00 42.07  ? 84  ASP B CG  1 
ATOM   3148 O OD1 . ASP B 1 103 ? 70.060 -46.489 32.229 1.00 45.25  ? 84  ASP B OD1 1 
ATOM   3149 O OD2 . ASP B 1 103 ? 69.619 -47.408 34.190 1.00 43.75  ? 84  ASP B OD2 1 
ATOM   3150 N N   . SER B 1 104 ? 74.429 -47.400 35.793 1.00 26.49  ? 85  SER B N   1 
ATOM   3151 C CA  . SER B 1 104 ? 75.046 -48.145 36.894 1.00 25.34  ? 85  SER B CA  1 
ATOM   3152 C C   . SER B 1 104 ? 74.188 -48.055 38.153 1.00 24.28  ? 85  SER B C   1 
ATOM   3153 O O   . SER B 1 104 ? 73.337 -47.156 38.272 1.00 23.59  ? 85  SER B O   1 
ATOM   3154 C CB  . SER B 1 104 ? 76.448 -47.600 37.176 1.00 24.38  ? 85  SER B CB  1 
ATOM   3155 O OG  . SER B 1 104 ? 76.367 -46.240 37.576 1.00 25.20  ? 85  SER B OG  1 
ATOM   3156 N N   . PRO B 1 105 ? 74.422 -48.965 39.117 1.00 25.59  ? 86  PRO B N   1 
ATOM   3157 C CA  . PRO B 1 105 ? 73.611 -48.945 40.341 1.00 23.74  ? 86  PRO B CA  1 
ATOM   3158 C C   . PRO B 1 105 ? 73.597 -47.601 41.086 1.00 22.41  ? 86  PRO B C   1 
ATOM   3159 O O   . PRO B 1 105 ? 72.536 -47.156 41.530 1.00 23.19  ? 86  PRO B O   1 
ATOM   3160 C CB  . PRO B 1 105 ? 74.261 -50.039 41.205 1.00 26.02  ? 86  PRO B CB  1 
ATOM   3161 C CG  . PRO B 1 105 ? 74.786 -51.004 40.208 1.00 26.82  ? 86  PRO B CG  1 
ATOM   3162 C CD  . PRO B 1 105 ? 75.268 -50.177 39.041 1.00 26.84  ? 86  PRO B CD  1 
ATOM   3163 N N   . LEU B 1 106 ? 74.748 -46.958 41.208 1.00 21.01  ? 87  LEU B N   1 
ATOM   3164 C CA  . LEU B 1 106 ? 74.820 -45.689 41.935 1.00 18.41  ? 87  LEU B CA  1 
ATOM   3165 C C   . LEU B 1 106 ? 75.048 -44.466 41.028 1.00 19.28  ? 87  LEU B C   1 
ATOM   3166 O O   . LEU B 1 106 ? 75.141 -43.343 41.532 1.00 21.34  ? 87  LEU B O   1 
ATOM   3167 C CB  . LEU B 1 106 ? 75.923 -45.763 42.962 1.00 19.00  ? 87  LEU B CB  1 
ATOM   3168 C CG  . LEU B 1 106 ? 75.686 -46.826 44.030 1.00 20.10  ? 87  LEU B CG  1 
ATOM   3169 C CD1 . LEU B 1 106 ? 76.854 -46.826 45.002 1.00 21.17  ? 87  LEU B CD1 1 
ATOM   3170 C CD2 . LEU B 1 106 ? 74.427 -46.512 44.781 1.00 20.23  ? 87  LEU B CD2 1 
ATOM   3171 N N   . GLY B 1 107 ? 75.123 -44.646 39.708 1.00 18.72  ? 88  GLY B N   1 
ATOM   3172 C CA  . GLY B 1 107 ? 75.391 -43.506 38.829 1.00 18.71  ? 88  GLY B CA  1 
ATOM   3173 C C   . GLY B 1 107 ? 76.880 -43.262 38.636 1.00 18.55  ? 88  GLY B C   1 
ATOM   3174 O O   . GLY B 1 107 ? 77.693 -43.581 39.506 1.00 22.70  ? 88  GLY B O   1 
ATOM   3175 N N   . ARG B 1 108 ? 77.246 -42.724 37.480 1.00 16.47  ? 89  ARG B N   1 
ATOM   3176 C CA  A ARG B 1 108 ? 78.645 -42.448 37.185 0.50 15.96  ? 89  ARG B CA  1 
ATOM   3177 C CA  B ARG B 1 108 ? 78.633 -42.422 37.146 0.50 14.05  ? 89  ARG B CA  1 
ATOM   3178 C C   . ARG B 1 108 ? 78.997 -41.028 37.641 1.00 14.76  ? 89  ARG B C   1 
ATOM   3179 O O   . ARG B 1 108 ? 78.130 -40.158 37.726 1.00 15.96  ? 89  ARG B O   1 
ATOM   3180 C CB  A ARG B 1 108 ? 78.938 -42.637 35.681 0.50 18.97  ? 89  ARG B CB  1 
ATOM   3181 C CB  B ARG B 1 108 ? 78.856 -42.517 35.623 0.50 13.95  ? 89  ARG B CB  1 
ATOM   3182 C CG  A ARG B 1 108 ? 78.811 -44.102 35.180 0.50 23.81  ? 89  ARG B CG  1 
ATOM   3183 C CG  B ARG B 1 108 ? 78.520 -43.874 35.033 0.50 16.64  ? 89  ARG B CG  1 
ATOM   3184 C CD  A ARG B 1 108 ? 80.173 -44.821 35.193 0.50 28.50  ? 89  ARG B CD  1 
ATOM   3185 C CD  B ARG B 1 108 ? 79.626 -44.838 35.402 0.50 19.47  ? 89  ARG B CD  1 
ATOM   3186 N NE  A ARG B 1 108 ? 80.123 -46.187 34.657 0.50 32.22  ? 89  ARG B NE  1 
ATOM   3187 N NE  B ARG B 1 108 ? 80.937 -44.507 34.831 0.50 22.46  ? 89  ARG B NE  1 
ATOM   3188 C CZ  A ARG B 1 108 ? 81.109 -47.084 34.759 0.50 34.00  ? 89  ARG B CZ  1 
ATOM   3189 C CZ  B ARG B 1 108 ? 81.280 -44.729 33.562 0.50 23.12  ? 89  ARG B CZ  1 
ATOM   3190 N NH1 A ARG B 1 108 ? 80.954 -48.296 34.242 0.50 35.25  ? 89  ARG B NH1 1 
ATOM   3191 N NH1 B ARG B 1 108 ? 82.494 -44.416 33.124 0.50 22.65  ? 89  ARG B NH1 1 
ATOM   3192 N NH2 A ARG B 1 108 ? 82.246 -46.785 35.382 0.50 33.47  ? 89  ARG B NH2 1 
ATOM   3193 N NH2 B ARG B 1 108 ? 80.398 -45.246 32.720 0.50 24.82  ? 89  ARG B NH2 1 
ATOM   3194 N N   . ARG B 1 109 ? 80.266 -40.797 37.948 1.00 14.17  ? 90  ARG B N   1 
ATOM   3195 C CA  . ARG B 1 109 ? 80.710 -39.440 38.377 1.00 13.95  ? 90  ARG B CA  1 
ATOM   3196 C C   . ARG B 1 109 ? 80.393 -38.465 37.221 1.00 14.31  ? 90  ARG B C   1 
ATOM   3197 O O   . ARG B 1 109 ? 80.786 -38.724 36.058 1.00 13.63  ? 90  ARG B O   1 
ATOM   3198 C CB  . ARG B 1 109 ? 82.208 -39.412 38.709 1.00 17.26  ? 90  ARG B CB  1 
ATOM   3199 C CG  . ARG B 1 109 ? 82.605 -40.220 40.003 1.00 21.38  ? 90  ARG B CG  1 
ATOM   3200 C CD  . ARG B 1 109 ? 83.963 -39.820 40.594 1.00 26.94  ? 90  ARG B CD  1 
ATOM   3201 N NE  . ARG B 1 109 ? 84.927 -39.527 39.551 1.00 38.05  ? 90  ARG B NE  1 
ATOM   3202 C CZ  . ARG B 1 109 ? 86.175 -39.083 39.736 1.00 44.80  ? 90  ARG B CZ  1 
ATOM   3203 N NH1 . ARG B 1 109 ? 86.670 -38.888 40.963 1.00 47.56  ? 90  ARG B NH1 1 
ATOM   3204 N NH2 . ARG B 1 109 ? 86.937 -38.825 38.670 1.00 46.07  ? 90  ARG B NH2 1 
ATOM   3205 N N   . PRO B 1 110 ? 79.696 -37.362 37.518 1.00 14.47  ? 91  PRO B N   1 
ATOM   3206 C CA  . PRO B 1 110 ? 79.313 -36.459 36.399 1.00 14.30  ? 91  PRO B CA  1 
ATOM   3207 C C   . PRO B 1 110 ? 80.503 -35.947 35.579 1.00 13.70  ? 91  PRO B C   1 
ATOM   3208 O O   . PRO B 1 110 ? 80.372 -35.769 34.345 1.00 13.07  ? 91  PRO B O   1 
ATOM   3209 C CB  . PRO B 1 110 ? 78.581 -35.316 37.119 1.00 15.19  ? 91  PRO B CB  1 
ATOM   3210 C CG  . PRO B 1 110 ? 77.919 -36.058 38.315 1.00 16.06  ? 91  PRO B CG  1 
ATOM   3211 C CD  . PRO B 1 110 ? 79.057 -36.970 38.795 1.00 16.02  ? 91  PRO B CD  1 
ATOM   3212 N N   . GLU B 1 111 ? 81.654 -35.749 36.209 1.00 13.96  ? 92  GLU B N   1 
ATOM   3213 C CA  . GLU B 1 111 ? 82.754 -35.184 35.465 1.00 16.27  ? 92  GLU B CA  1 
ATOM   3214 C C   . GLU B 1 111 ? 83.367 -36.254 34.529 1.00 16.61  ? 92  GLU B C   1 
ATOM   3215 O O   . GLU B 1 111 ? 83.918 -35.914 33.473 1.00 14.99  ? 92  GLU B O   1 
ATOM   3216 C CB  . GLU B 1 111 ? 83.789 -34.534 36.409 1.00 20.15  ? 92  GLU B CB  1 
ATOM   3217 C CG  . GLU B 1 111 ? 84.637 -35.463 37.193 1.00 23.02  ? 92  GLU B CG  1 
ATOM   3218 C CD  . GLU B 1 111 ? 83.973 -35.994 38.467 1.00 24.76  ? 92  GLU B CD  1 
ATOM   3219 O OE1 . GLU B 1 111 ? 84.750 -36.512 39.306 1.00 26.71  ? 92  GLU B OE1 1 
ATOM   3220 O OE2 . GLU B 1 111 ? 82.716 -35.870 38.649 1.00 23.75  ? 92  GLU B OE2 1 
ATOM   3221 N N   . GLN B 1 112 ? 83.228 -37.540 34.895 1.00 15.58  ? 93  GLN B N   1 
ATOM   3222 C CA  . GLN B 1 112 ? 83.643 -38.608 34.001 1.00 16.68  ? 93  GLN B CA  1 
ATOM   3223 C C   . GLN B 1 112 ? 82.671 -38.719 32.825 1.00 15.25  ? 93  GLN B C   1 
ATOM   3224 O O   . GLN B 1 112 ? 83.084 -38.902 31.669 1.00 16.20  ? 93  GLN B O   1 
ATOM   3225 C CB  . GLN B 1 112 ? 83.768 -39.932 34.776 1.00 18.13  ? 93  GLN B CB  1 
ATOM   3226 C CG  . GLN B 1 112 ? 84.830 -39.816 35.845 1.00 24.06  ? 93  GLN B CG  1 
ATOM   3227 C CD  . GLN B 1 112 ? 85.077 -41.109 36.640 1.00 30.05  ? 93  GLN B CD  1 
ATOM   3228 O OE1 . GLN B 1 112 ? 84.267 -42.049 36.625 1.00 33.47  ? 93  GLN B OE1 1 
ATOM   3229 N NE2 . GLN B 1 112 ? 86.207 -41.149 37.366 1.00 33.35  ? 93  GLN B NE2 1 
ATOM   3230 N N   . VAL B 1 113 ? 81.379 -38.609 33.108 1.00 12.64  ? 94  VAL B N   1 
ATOM   3231 C CA  . VAL B 1 113 ? 80.383 -38.582 32.020 1.00 12.61  ? 94  VAL B CA  1 
ATOM   3232 C C   . VAL B 1 113 ? 80.682 -37.396 31.075 1.00 12.99  ? 94  VAL B C   1 
ATOM   3233 O O   . VAL B 1 113 ? 80.540 -37.497 29.853 1.00 12.76  ? 94  VAL B O   1 
ATOM   3234 C CB  . VAL B 1 113 ? 78.945 -38.469 32.603 1.00 13.26  ? 94  VAL B CB  1 
ATOM   3235 C CG1 . VAL B 1 113 ? 77.871 -38.371 31.510 1.00 12.38  ? 94  VAL B CG1 1 
ATOM   3236 C CG2 . VAL B 1 113 ? 78.655 -39.695 33.519 1.00 13.34  ? 94  VAL B CG2 1 
ATOM   3237 N N   . ALA B 1 114 ? 81.087 -36.266 31.656 1.00 11.85  ? 95  ALA B N   1 
ATOM   3238 C CA  . ALA B 1 114 ? 81.363 -35.071 30.853 1.00 11.12  ? 95  ALA B CA  1 
ATOM   3239 C C   . ALA B 1 114 ? 82.507 -35.302 29.871 1.00 12.19  ? 95  ALA B C   1 
ATOM   3240 O O   . ALA B 1 114 ? 82.425 -34.875 28.691 1.00 14.63  ? 95  ALA B O   1 
ATOM   3241 C CB  . ALA B 1 114 ? 81.678 -33.844 31.775 1.00 12.30  ? 95  ALA B CB  1 
ATOM   3242 N N   . LEU B 1 115 ? 83.566 -35.974 30.327 1.00 14.14  ? 96  LEU B N   1 
ATOM   3243 C CA  . LEU B 1 115 ? 84.692 -36.318 29.457 1.00 15.89  ? 96  LEU B CA  1 
ATOM   3244 C C   . LEU B 1 115 ? 84.247 -37.216 28.266 1.00 16.27  ? 96  LEU B C   1 
ATOM   3245 O O   . LEU B 1 115 ? 84.590 -36.993 27.104 1.00 17.07  ? 96  LEU B O   1 
ATOM   3246 C CB  . LEU B 1 115 ? 85.771 -37.063 30.282 1.00 17.50  ? 96  LEU B CB  1 
ATOM   3247 C CG  . LEU B 1 115 ? 87.171 -37.114 29.699 1.00 26.04  ? 96  LEU B CG  1 
ATOM   3248 C CD1 . LEU B 1 115 ? 87.561 -35.701 29.348 1.00 31.66  ? 96  LEU B CD1 1 
ATOM   3249 C CD2 . LEU B 1 115 ? 88.139 -37.672 30.710 1.00 29.28  ? 96  LEU B CD2 1 
ATOM   3250 N N   . ILE B 1 116 ? 83.512 -38.259 28.600 1.00 16.85  ? 97  ILE B N   1 
ATOM   3251 C CA  . ILE B 1 116 ? 82.976 -39.208 27.609 1.00 16.41  ? 97  ILE B CA  1 
ATOM   3252 C C   . ILE B 1 116 ? 82.149 -38.455 26.564 1.00 15.26  ? 97  ILE B C   1 
ATOM   3253 O O   . ILE B 1 116 ? 82.274 -38.670 25.331 1.00 16.94  ? 97  ILE B O   1 
ATOM   3254 C CB  . ILE B 1 116 ? 82.098 -40.306 28.307 1.00 16.69  ? 97  ILE B CB  1 
ATOM   3255 C CG1 . ILE B 1 116 ? 82.988 -41.313 29.064 1.00 18.69  ? 97  ILE B CG1 1 
ATOM   3256 C CG2 . ILE B 1 116 ? 81.240 -41.117 27.297 1.00 18.14  ? 97  ILE B CG2 1 
ATOM   3257 C CD1 . ILE B 1 116 ? 82.214 -42.174 30.064 1.00 18.73  ? 97  ILE B CD1 1 
ATOM   3258 N N   . CYS B 1 117 ? 81.272 -37.597 27.058 1.00 14.44  ? 98  CYS B N   1 
ATOM   3259 C CA  . CYS B 1 117 ? 80.314 -36.959 26.156 1.00 13.54  ? 98  CYS B CA  1 
ATOM   3260 C C   . CYS B 1 117 ? 80.932 -35.838 25.342 1.00 13.31  ? 98  CYS B C   1 
ATOM   3261 O O   . CYS B 1 117 ? 80.469 -35.561 24.220 1.00 12.97  ? 98  CYS B O   1 
ATOM   3262 C CB  . CYS B 1 117 ? 79.123 -36.458 26.971 1.00 14.47  ? 98  CYS B CB  1 
ATOM   3263 S SG  . CYS B 1 117 ? 78.056 -37.806 27.570 1.00 14.98  ? 98  CYS B SG  1 
ATOM   3264 N N   . GLU B 1 118 ? 81.963 -35.184 25.881 1.00 13.21  ? 99  GLU B N   1 
ATOM   3265 C CA  . GLU B 1 118 ? 82.675 -34.159 25.113 1.00 11.69  ? 99  GLU B CA  1 
ATOM   3266 C C   . GLU B 1 118 ? 83.393 -34.777 23.887 1.00 12.94  ? 99  GLU B C   1 
ATOM   3267 O O   . GLU B 1 118 ? 83.335 -34.246 22.756 1.00 14.09  ? 99  GLU B O   1 
ATOM   3268 C CB  . GLU B 1 118 ? 83.672 -33.425 26.029 1.00 12.63  ? 99  GLU B CB  1 
ATOM   3269 C CG  . GLU B 1 118 ? 84.662 -32.551 25.268 1.00 14.95  ? 99  GLU B CG  1 
ATOM   3270 C CD  . GLU B 1 118 ? 84.022 -31.341 24.555 1.00 17.14  ? 99  GLU B CD  1 
ATOM   3271 O OE1 . GLU B 1 118 ? 84.747 -30.699 23.769 1.00 19.34  ? 99  GLU B OE1 1 
ATOM   3272 O OE2 . GLU B 1 118 ? 82.822 -31.019 24.768 1.00 16.07  ? 99  GLU B OE2 1 
ATOM   3273 N N   . ARG B 1 119 ? 83.957 -35.970 24.089 1.00 13.58  ? 100 ARG B N   1 
ATOM   3274 C CA  . ARG B 1 119 ? 84.625 -36.677 22.989 1.00 15.29  ? 100 ARG B CA  1 
ATOM   3275 C C   . ARG B 1 119 ? 83.610 -37.083 21.905 1.00 16.40  ? 100 ARG B C   1 
ATOM   3276 O O   . ARG B 1 119 ? 83.910 -37.039 20.722 1.00 15.90  ? 100 ARG B O   1 
ATOM   3277 C CB  . ARG B 1 119 ? 85.386 -37.897 23.555 1.00 16.94  ? 100 ARG B CB  1 
ATOM   3278 C CG  . ARG B 1 119 ? 86.634 -37.501 24.367 1.00 18.83  ? 100 ARG B CG  1 
ATOM   3279 C CD  . ARG B 1 119 ? 87.320 -38.717 24.987 1.00 21.14  ? 100 ARG B CD  1 
ATOM   3280 N NE  . ARG B 1 119 ? 87.566 -39.757 23.985 1.00 23.02  ? 100 ARG B NE  1 
ATOM   3281 C CZ  . ARG B 1 119 ? 88.670 -39.827 23.243 1.00 25.92  ? 100 ARG B CZ  1 
ATOM   3282 N NH1 . ARG B 1 119 ? 89.622 -38.904 23.397 1.00 29.31  ? 100 ARG B NH1 1 
ATOM   3283 N NH2 . ARG B 1 119 ? 88.825 -40.787 22.332 1.00 25.40  ? 100 ARG B NH2 1 
ATOM   3284 N N   . LEU B 1 120 ? 82.408 -37.475 22.296 1.00 14.95  ? 101 LEU B N   1 
ATOM   3285 C CA  A LEU B 1 120 ? 81.397 -37.861 21.309 0.50 14.32  ? 101 LEU B CA  1 
ATOM   3286 C CA  B LEU B 1 120 ? 81.383 -37.851 21.312 0.50 15.48  ? 101 LEU B CA  1 
ATOM   3287 C C   . LEU B 1 120 ? 80.911 -36.619 20.536 1.00 14.12  ? 101 LEU B C   1 
ATOM   3288 O O   . LEU B 1 120 ? 80.756 -36.657 19.318 1.00 14.51  ? 101 LEU B O   1 
ATOM   3289 C CB  A LEU B 1 120 ? 80.241 -38.586 21.990 0.50 12.63  ? 101 LEU B CB  1 
ATOM   3290 C CB  B LEU B 1 120 ? 80.194 -38.518 21.984 0.50 16.08  ? 101 LEU B CB  1 
ATOM   3291 C CG  A LEU B 1 120 ? 80.708 -40.011 22.322 0.50 12.02  ? 101 LEU B CG  1 
ATOM   3292 C CG  B LEU B 1 120 ? 80.290 -40.024 22.218 0.50 17.51  ? 101 LEU B CG  1 
ATOM   3293 C CD1 A LEU B 1 120 ? 80.115 -40.552 23.599 0.50 12.05  ? 101 LEU B CD1 1 
ATOM   3294 C CD1 B LEU B 1 120 ? 81.620 -40.398 22.785 0.50 18.71  ? 101 LEU B CD1 1 
ATOM   3295 C CD2 A LEU B 1 120 ? 80.414 -40.914 21.106 0.50 11.34  ? 101 LEU B CD2 1 
ATOM   3296 C CD2 B LEU B 1 120 ? 79.267 -40.359 23.186 0.50 17.76  ? 101 LEU B CD2 1 
ATOM   3297 N N   . SER B 1 121 ? 80.707 -35.506 21.217 1.00 13.02  ? 102 SER B N   1 
ATOM   3298 C CA  . SER B 1 121 ? 80.318 -34.278 20.472 1.00 13.33  ? 102 SER B CA  1 
ATOM   3299 C C   . SER B 1 121 ? 81.405 -33.889 19.474 1.00 15.13  ? 102 SER B C   1 
ATOM   3300 O O   . SER B 1 121 ? 81.111 -33.378 18.369 1.00 14.74  ? 102 SER B O   1 
ATOM   3301 C CB  . SER B 1 121 ? 80.069 -33.135 21.445 1.00 13.02  ? 102 SER B CB  1 
ATOM   3302 O OG  . SER B 1 121 ? 78.864 -33.356 22.160 1.00 12.64  ? 102 SER B OG  1 
ATOM   3303 N N   . ALA B 1 122 ? 82.660 -34.103 19.868 1.00 14.86  ? 103 ALA B N   1 
ATOM   3304 C CA  . ALA B 1 122 ? 83.796 -33.781 19.002 1.00 15.21  ? 103 ALA B CA  1 
ATOM   3305 C C   . ALA B 1 122 ? 83.747 -34.576 17.686 1.00 16.19  ? 103 ALA B C   1 
ATOM   3306 O O   . ALA B 1 122 ? 84.128 -34.057 16.635 1.00 16.40  ? 103 ALA B O   1 
ATOM   3307 C CB  . ALA B 1 122 ? 85.119 -34.043 19.743 1.00 16.83  ? 103 ALA B CB  1 
ATOM   3308 N N   . ILE B 1 123 ? 83.263 -35.812 17.738 1.00 15.72  ? 104 ILE B N   1 
ATOM   3309 C CA  . ILE B 1 123 ? 83.088 -36.625 16.521 1.00 16.88  ? 104 ILE B CA  1 
ATOM   3310 C C   . ILE B 1 123 ? 82.057 -35.970 15.581 1.00 17.18  ? 104 ILE B C   1 
ATOM   3311 O O   . ILE B 1 123 ? 82.267 -35.891 14.355 1.00 18.36  ? 104 ILE B O   1 
ATOM   3312 C CB  . ILE B 1 123 ? 82.649 -38.066 16.883 1.00 17.94  ? 104 ILE B CB  1 
ATOM   3313 C CG1 . ILE B 1 123 ? 83.780 -38.783 17.616 1.00 20.94  ? 104 ILE B CG1 1 
ATOM   3314 C CG2 . ILE B 1 123 ? 82.274 -38.865 15.629 1.00 18.75  ? 104 ILE B CG2 1 
ATOM   3315 C CD1 . ILE B 1 123 ? 83.364 -40.103 18.186 1.00 22.64  ? 104 ILE B CD1 1 
ATOM   3316 N N   . ALA B 1 124 ? 80.936 -35.524 16.161 1.00 16.22  ? 105 ALA B N   1 
ATOM   3317 C CA  . ALA B 1 124 ? 79.860 -34.895 15.392 1.00 15.57  ? 105 ALA B CA  1 
ATOM   3318 C C   . ALA B 1 124 ? 80.363 -33.615 14.694 1.00 14.47  ? 105 ALA B C   1 
ATOM   3319 O O   . ALA B 1 124 ? 79.896 -33.290 13.602 1.00 16.54  ? 105 ALA B O   1 
ATOM   3320 C CB  . ALA B 1 124 ? 78.646 -34.571 16.286 1.00 15.76  ? 105 ALA B CB  1 
ATOM   3321 N N   . HIS B 1 125 ? 81.310 -32.918 15.321 1.00 14.82  ? 106 HIS B N   1 
ATOM   3322 C CA  . HIS B 1 125 ? 81.855 -31.670 14.778 1.00 14.59  ? 106 HIS B CA  1 
ATOM   3323 C C   . HIS B 1 125 ? 83.168 -31.899 14.045 1.00 17.72  ? 106 HIS B C   1 
ATOM   3324 O O   . HIS B 1 125 ? 83.821 -30.951 13.622 1.00 20.11  ? 106 HIS B O   1 
ATOM   3325 C CB  . HIS B 1 125 ? 82.011 -30.656 15.912 1.00 13.92  ? 106 HIS B CB  1 
ATOM   3326 C CG  . HIS B 1 125 ? 80.697 -30.091 16.348 1.00 14.74  ? 106 HIS B CG  1 
ATOM   3327 N ND1 . HIS B 1 125 ? 80.005 -29.159 15.589 1.00 15.40  ? 106 HIS B ND1 1 
ATOM   3328 C CD2 . HIS B 1 125 ? 79.963 -30.291 17.471 1.00 16.35  ? 106 HIS B CD2 1 
ATOM   3329 C CE1 . HIS B 1 125 ? 78.874 -28.857 16.205 1.00 15.91  ? 106 HIS B CE1 1 
ATOM   3330 N NE2 . HIS B 1 125 ? 78.825 -29.534 17.350 1.00 15.40  ? 106 HIS B NE2 1 
ATOM   3331 N N   . GLY B 1 126 ? 83.559 -33.169 13.888 1.00 18.94  ? 107 GLY B N   1 
ATOM   3332 C CA  . GLY B 1 126 ? 84.758 -33.469 13.105 1.00 20.63  ? 107 GLY B CA  1 
ATOM   3333 C C   . GLY B 1 126 ? 86.102 -33.174 13.774 1.00 23.86  ? 107 GLY B C   1 
ATOM   3334 O O   . GLY B 1 126 ? 87.136 -33.070 13.082 1.00 25.94  ? 107 GLY B O   1 
ATOM   3335 N N   . THR B 1 127 ? 86.111 -33.060 15.107 1.00 25.77  ? 108 THR B N   1 
ATOM   3336 C CA  . THR B 1 127 ? 87.326 -32.646 15.842 1.00 26.66  ? 108 THR B CA  1 
ATOM   3337 C C   . THR B 1 127 ? 87.920 -33.744 16.745 1.00 29.14  ? 108 THR B C   1 
ATOM   3338 O O   . THR B 1 127 ? 88.888 -33.481 17.477 1.00 31.52  ? 108 THR B O   1 
ATOM   3339 C CB  . THR B 1 127 ? 87.062 -31.400 16.736 1.00 24.37  ? 108 THR B CB  1 
ATOM   3340 O OG1 . THR B 1 127 ? 85.899 -31.617 17.540 1.00 25.46  ? 108 THR B OG1 1 
ATOM   3341 C CG2 . THR B 1 127 ? 86.809 -30.162 15.893 1.00 23.08  ? 108 THR B CG2 1 
ATOM   3342 N N   . LEU B 1 128 ? 87.369 -34.955 16.746 1.00 29.66  ? 109 LEU B N   1 
ATOM   3343 C CA  . LEU B 1 128 ? 87.954 -35.949 17.640 1.00 33.39  ? 109 LEU B CA  1 
ATOM   3344 C C   . LEU B 1 128 ? 89.158 -36.572 16.974 1.00 38.54  ? 109 LEU B C   1 
ATOM   3345 O O   . LEU B 1 128 ? 89.105 -37.017 15.817 1.00 39.92  ? 109 LEU B O   1 
ATOM   3346 C CB  . LEU B 1 128 ? 86.963 -37.038 18.053 1.00 31.77  ? 109 LEU B CB  1 
ATOM   3347 C CG  . LEU B 1 128 ? 87.501 -37.987 19.136 1.00 30.23  ? 109 LEU B CG  1 
ATOM   3348 C CD1 . LEU B 1 128 ? 87.472 -37.335 20.525 1.00 29.14  ? 109 LEU B CD1 1 
ATOM   3349 C CD2 . LEU B 1 128 ? 86.709 -39.278 19.145 1.00 30.73  ? 109 LEU B CD2 1 
ATOM   3350 N N   . THR B 1 129 ? 90.240 -36.595 17.743 1.00 42.23  ? 110 THR B N   1 
ATOM   3351 C CA  . THR B 1 129 ? 91.529 -37.080 17.288 1.00 43.45  ? 110 THR B CA  1 
ATOM   3352 C C   . THR B 1 129 ? 91.401 -38.510 16.856 1.00 43.02  ? 110 THR B C   1 
ATOM   3353 O O   . THR B 1 129 ? 91.529 -38.833 15.675 1.00 45.28  ? 110 THR B O   1 
ATOM   3354 C CB  . THR B 1 129 ? 92.573 -36.980 18.397 1.00 45.23  ? 110 THR B CB  1 
ATOM   3355 O OG1 . THR B 1 129 ? 92.810 -35.602 18.704 1.00 46.22  ? 110 THR B OG1 1 
ATOM   3356 C CG2 . THR B 1 129 ? 93.854 -37.631 17.956 1.00 45.42  ? 110 THR B CG2 1 
ATOM   3357 N N   . ALA B 1 130 ? 91.103 -39.372 17.816 1.00 39.50  ? 111 ALA B N   1 
ATOM   3358 C CA  . ALA B 1 130 ? 91.027 -40.790 17.523 1.00 37.43  ? 111 ALA B CA  1 
ATOM   3359 C C   . ALA B 1 130 ? 89.809 -41.416 18.158 1.00 35.41  ? 111 ALA B C   1 
ATOM   3360 O O   . ALA B 1 130 ? 89.538 -41.261 19.344 1.00 34.81  ? 111 ALA B O   1 
ATOM   3361 C CB  . ALA B 1 130 ? 92.274 -41.502 17.998 1.00 37.82  ? 111 ALA B CB  1 
ATOM   3362 N N   . VAL B 1 131 ? 89.096 -42.165 17.349 1.00 34.34  ? 112 VAL B N   1 
ATOM   3363 C CA  . VAL B 1 131 ? 87.962 -42.912 17.810 1.00 32.16  ? 112 VAL B CA  1 
ATOM   3364 C C   . VAL B 1 131 ? 88.448 -44.159 18.575 1.00 30.15  ? 112 VAL B C   1 
ATOM   3365 O O   . VAL B 1 131 ? 89.076 -45.052 17.968 1.00 31.28  ? 112 VAL B O   1 
ATOM   3366 C CB  . VAL B 1 131 ? 87.099 -43.262 16.587 1.00 34.30  ? 112 VAL B CB  1 
ATOM   3367 C CG1 . VAL B 1 131 ? 85.884 -43.902 17.002 1.00 34.24  ? 112 VAL B CG1 1 
ATOM   3368 C CG2 . VAL B 1 131 ? 86.770 -41.981 15.813 1.00 34.81  ? 112 VAL B CG2 1 
ATOM   3369 N N   . THR B 1 132 ? 88.195 -44.244 19.886 1.00 27.44  ? 113 THR B N   1 
ATOM   3370 C CA  . THR B 1 132 ? 88.792 -45.338 20.673 1.00 29.54  ? 113 THR B CA  1 
ATOM   3371 C C   . THR B 1 132 ? 87.813 -46.328 21.344 1.00 28.09  ? 113 THR B C   1 
ATOM   3372 O O   . THR B 1 132 ? 87.964 -47.550 21.212 1.00 31.91  ? 113 THR B O   1 
ATOM   3373 C CB  . THR B 1 132 ? 89.741 -44.745 21.751 1.00 32.87  ? 113 THR B CB  1 
ATOM   3374 O OG1 . THR B 1 132 ? 90.805 -44.041 21.094 1.00 34.57  ? 113 THR B OG1 1 
ATOM   3375 C CG2 . THR B 1 132 ? 90.352 -45.841 22.598 1.00 34.81  ? 113 THR B CG2 1 
ATOM   3376 N N   . SER B 1 133 ? 86.810 -45.826 22.042 1.00 22.95  ? 114 SER B N   1 
ATOM   3377 C CA  . SER B 1 133 ? 85.880 -46.642 22.814 1.00 21.33  ? 114 SER B CA  1 
ATOM   3378 C C   . SER B 1 133 ? 84.838 -47.295 21.929 1.00 20.09  ? 114 SER B C   1 
ATOM   3379 O O   . SER B 1 133 ? 84.646 -46.885 20.771 1.00 19.77  ? 114 SER B O   1 
ATOM   3380 C CB  . SER B 1 133 ? 85.161 -45.784 23.866 1.00 21.30  ? 114 SER B CB  1 
ATOM   3381 O OG  . SER B 1 133 ? 84.267 -44.887 23.238 1.00 20.61  ? 114 SER B OG  1 
ATOM   3382 N N   . PRO B 1 134 ? 84.138 -48.298 22.469 1.00 18.57  ? 115 PRO B N   1 
ATOM   3383 C CA  . PRO B 1 134 ? 83.047 -48.921 21.691 1.00 18.42  ? 115 PRO B CA  1 
ATOM   3384 C C   . PRO B 1 134 ? 81.974 -47.901 21.283 1.00 18.47  ? 115 PRO B C   1 
ATOM   3385 O O   . PRO B 1 134 ? 81.524 -47.919 20.130 1.00 18.88  ? 115 PRO B O   1 
ATOM   3386 C CB  . PRO B 1 134 ? 82.501 -49.974 22.662 1.00 19.32  ? 115 PRO B CB  1 
ATOM   3387 C CG  . PRO B 1 134 ? 83.762 -50.431 23.402 1.00 20.96  ? 115 PRO B CG  1 
ATOM   3388 C CD  . PRO B 1 134 ? 84.513 -49.112 23.649 1.00 19.88  ? 115 PRO B CD  1 
ATOM   3389 N N   . SER B 1 135 ? 81.588 -47.008 22.194 1.00 17.13  ? 116 SER B N   1 
ATOM   3390 C CA  . SER B 1 135 ? 80.585 -45.994 21.832 1.00 16.31  ? 116 SER B CA  1 
ATOM   3391 C C   . SER B 1 135 ? 81.091 -45.076 20.729 1.00 16.27  ? 116 SER B C   1 
ATOM   3392 O O   . SER B 1 135 ? 80.326 -44.684 19.832 1.00 17.09  ? 116 SER B O   1 
ATOM   3393 C CB  . SER B 1 135 ? 80.205 -45.139 23.054 1.00 17.31  ? 116 SER B CB  1 
ATOM   3394 O OG  . SER B 1 135 ? 79.587 -45.931 24.063 1.00 17.10  ? 116 SER B OG  1 
ATOM   3395 N N   . GLU B 1 136 ? 82.368 -44.710 20.808 1.00 15.69  ? 117 GLU B N   1 
ATOM   3396 C CA  . GLU B 1 136 ? 82.954 -43.822 19.797 1.00 14.92  ? 117 GLU B CA  1 
ATOM   3397 C C   . GLU B 1 136 ? 83.006 -44.467 18.413 1.00 15.54  ? 117 GLU B C   1 
ATOM   3398 O O   . GLU B 1 136 ? 82.679 -43.821 17.413 1.00 17.36  ? 117 GLU B O   1 
ATOM   3399 C CB  . GLU B 1 136 ? 84.346 -43.374 20.227 1.00 15.92  ? 117 GLU B CB  1 
ATOM   3400 C CG  . GLU B 1 136 ? 84.270 -42.345 21.384 1.00 16.72  ? 117 GLU B CG  1 
ATOM   3401 C CD  . GLU B 1 136 ? 85.607 -42.108 22.069 1.00 19.08  ? 117 GLU B CD  1 
ATOM   3402 O OE1 . GLU B 1 136 ? 86.637 -42.635 21.585 1.00 19.88  ? 117 GLU B OE1 1 
ATOM   3403 O OE2 . GLU B 1 136 ? 85.625 -41.379 23.106 1.00 21.12  ? 117 GLU B OE2 1 
ATOM   3404 N N   . ARG B 1 137 ? 83.418 -45.722 18.358 1.00 16.64  ? 118 ARG B N   1 
ATOM   3405 C CA  A ARG B 1 137 ? 83.481 -46.448 17.097 0.50 18.93  ? 118 ARG B CA  1 
ATOM   3406 C CA  B ARG B 1 137 ? 83.483 -46.431 17.093 0.50 17.53  ? 118 ARG B CA  1 
ATOM   3407 C C   . ARG B 1 137 ? 82.093 -46.561 16.482 1.00 17.14  ? 118 ARG B C   1 
ATOM   3408 O O   . ARG B 1 137 ? 81.933 -46.398 15.256 1.00 19.57  ? 118 ARG B O   1 
ATOM   3409 C CB  A ARG B 1 137 ? 84.109 -47.835 17.311 0.50 23.63  ? 118 ARG B CB  1 
ATOM   3410 C CB  B ARG B 1 137 ? 84.143 -47.801 17.292 0.50 19.70  ? 118 ARG B CB  1 
ATOM   3411 C CG  A ARG B 1 137 ? 84.004 -48.784 16.110 0.50 28.04  ? 118 ARG B CG  1 
ATOM   3412 C CG  B ARG B 1 137 ? 85.638 -47.725 17.552 0.50 21.52  ? 118 ARG B CG  1 
ATOM   3413 C CD  A ARG B 1 137 ? 84.461 -50.191 16.471 0.50 32.41  ? 118 ARG B CD  1 
ATOM   3414 C CD  B ARG B 1 137 ? 86.276 -49.136 17.775 0.50 25.34  ? 118 ARG B CD  1 
ATOM   3415 N NE  A ARG B 1 137 ? 84.341 -51.096 15.334 0.50 35.95  ? 118 ARG B NE  1 
ATOM   3416 N NE  B ARG B 1 137 ? 86.606 -49.304 19.188 0.50 29.71  ? 118 ARG B NE  1 
ATOM   3417 C CZ  A ARG B 1 137 ? 85.255 -51.210 14.377 0.50 38.40  ? 118 ARG B CZ  1 
ATOM   3418 C CZ  B ARG B 1 137 ? 86.306 -50.371 19.919 0.50 30.28  ? 118 ARG B CZ  1 
ATOM   3419 N NH1 A ARG B 1 137 ? 86.364 -50.483 14.425 0.50 39.06  ? 118 ARG B NH1 1 
ATOM   3420 N NH1 B ARG B 1 137 ? 85.682 -51.415 19.377 0.50 30.45  ? 118 ARG B NH1 1 
ATOM   3421 N NH2 A ARG B 1 137 ? 85.064 -52.059 13.374 0.50 39.52  ? 118 ARG B NH2 1 
ATOM   3422 N NH2 B ARG B 1 137 ? 86.645 -50.393 21.201 0.50 30.80  ? 118 ARG B NH2 1 
ATOM   3423 N N   . ALA B 1 138 ? 81.084 -46.816 17.317 1.00 14.02  ? 119 ALA B N   1 
ATOM   3424 C CA  . ALA B 1 138 ? 79.721 -46.986 16.820 1.00 13.82  ? 119 ALA B CA  1 
ATOM   3425 C C   . ALA B 1 138 ? 79.186 -45.636 16.345 1.00 14.95  ? 119 ALA B C   1 
ATOM   3426 O O   . ALA B 1 138 ? 78.636 -45.517 15.238 1.00 15.05  ? 119 ALA B O   1 
ATOM   3427 C CB  . ALA B 1 138 ? 78.827 -47.573 17.883 1.00 15.03  ? 119 ALA B CB  1 
ATOM   3428 N N   . PHE B 1 139 ? 79.374 -44.599 17.145 1.00 14.94  ? 120 PHE B N   1 
ATOM   3429 C CA  . PHE B 1 139 ? 78.883 -43.293 16.733 1.00 12.94  ? 120 PHE B CA  1 
ATOM   3430 C C   . PHE B 1 139 ? 79.580 -42.743 15.493 1.00 14.37  ? 120 PHE B C   1 
ATOM   3431 O O   . PHE B 1 139 ? 78.916 -42.141 14.647 1.00 14.42  ? 120 PHE B O   1 
ATOM   3432 C CB  . PHE B 1 139 ? 79.019 -42.269 17.870 1.00 15.44  ? 120 PHE B CB  1 
ATOM   3433 C CG  . PHE B 1 139 ? 78.439 -40.935 17.494 1.00 14.31  ? 120 PHE B CG  1 
ATOM   3434 C CD1 . PHE B 1 139 ? 77.070 -40.840 17.164 1.00 14.14  ? 120 PHE B CD1 1 
ATOM   3435 C CD2 . PHE B 1 139 ? 79.236 -39.787 17.395 1.00 14.26  ? 120 PHE B CD2 1 
ATOM   3436 C CE1 . PHE B 1 139 ? 76.519 -39.612 16.751 1.00 13.47  ? 120 PHE B CE1 1 
ATOM   3437 C CE2 . PHE B 1 139 ? 78.693 -38.581 16.943 1.00 13.73  ? 120 PHE B CE2 1 
ATOM   3438 C CZ  . PHE B 1 139 ? 77.345 -38.487 16.645 1.00 14.38  ? 120 PHE B CZ  1 
ATOM   3439 N N   . ALA B 1 140 ? 80.892 -42.956 15.359 1.00 14.09  ? 121 ALA B N   1 
ATOM   3440 C CA  . ALA B 1 140 ? 81.565 -42.489 14.143 1.00 14.52  ? 121 ALA B CA  1 
ATOM   3441 C C   . ALA B 1 140 ? 80.994 -43.142 12.879 1.00 14.41  ? 121 ALA B C   1 
ATOM   3442 O O   . ALA B 1 140 ? 80.835 -42.472 11.845 1.00 14.91  ? 121 ALA B O   1 
ATOM   3443 C CB  . ALA B 1 140 ? 83.041 -42.717 14.218 1.00 15.51  ? 121 ALA B CB  1 
ATOM   3444 N N   . ASP B 1 141 ? 80.690 -44.440 12.954 1.00 16.02  ? 122 ASP B N   1 
ATOM   3445 C CA  . ASP B 1 141 ? 80.003 -45.105 11.865 1.00 15.63  ? 122 ASP B CA  1 
ATOM   3446 C C   . ASP B 1 141 ? 78.658 -44.466 11.545 1.00 14.97  ? 122 ASP B C   1 
ATOM   3447 O O   . ASP B 1 141 ? 78.347 -44.169 10.381 1.00 14.77  ? 122 ASP B O   1 
ATOM   3448 C CB  . ASP B 1 141 ? 79.783 -46.597 12.223 1.00 17.03  ? 122 ASP B CB  1 
ATOM   3449 C CG  . ASP B 1 141 ? 78.868 -47.344 11.175 1.00 19.61  ? 122 ASP B CG  1 
ATOM   3450 O OD1 . ASP B 1 141 ? 79.359 -47.694 10.062 1.00 22.71  ? 122 ASP B OD1 1 
ATOM   3451 O OD2 . ASP B 1 141 ? 77.665 -47.561 11.453 1.00 18.32  ? 122 ASP B OD2 1 
ATOM   3452 N N   . LEU B 1 142 ? 77.856 -44.262 12.590 1.00 14.58  ? 123 LEU B N   1 
ATOM   3453 C CA  . LEU B 1 142 ? 76.497 -43.771 12.411 1.00 13.19  ? 123 LEU B CA  1 
ATOM   3454 C C   . LEU B 1 142 ? 76.552 -42.362 11.862 1.00 11.98  ? 123 LEU B C   1 
ATOM   3455 O O   . LEU B 1 142 ? 75.807 -42.045 10.918 1.00 13.87  ? 123 LEU B O   1 
ATOM   3456 C CB  . LEU B 1 142 ? 75.734 -43.785 13.747 1.00 13.61  ? 123 LEU B CB  1 
ATOM   3457 C CG  . LEU B 1 142 ? 75.299 -45.173 14.240 1.00 14.56  ? 123 LEU B CG  1 
ATOM   3458 C CD1 . LEU B 1 142 ? 74.791 -45.020 15.673 1.00 16.39  ? 123 LEU B CD1 1 
ATOM   3459 C CD2 . LEU B 1 142 ? 74.226 -45.751 13.385 1.00 16.62  ? 123 LEU B CD2 1 
ATOM   3460 N N   . TRP B 1 143 ? 77.388 -41.505 12.472 1.00 12.67  ? 124 TRP B N   1 
ATOM   3461 C CA  . TRP B 1 143 ? 77.504 -40.099 12.005 1.00 12.28  ? 124 TRP B CA  1 
ATOM   3462 C C   . TRP B 1 143 ? 77.963 -39.991 10.512 1.00 12.68  ? 124 TRP B C   1 
ATOM   3463 O O   . TRP B 1 143 ? 77.411 -39.169 9.739  1.00 13.11  ? 124 TRP B O   1 
ATOM   3464 C CB  . TRP B 1 143 ? 78.438 -39.330 12.942 1.00 11.11  ? 124 TRP B CB  1 
ATOM   3465 C CG  . TRP B 1 143 ? 78.552 -37.863 12.562 1.00 11.63  ? 124 TRP B CG  1 
ATOM   3466 C CD1 . TRP B 1 143 ? 79.695 -37.198 12.240 1.00 12.95  ? 124 TRP B CD1 1 
ATOM   3467 C CD2 . TRP B 1 143 ? 77.485 -36.891 12.503 1.00 11.82  ? 124 TRP B CD2 1 
ATOM   3468 N NE1 . TRP B 1 143 ? 79.401 -35.873 11.936 1.00 13.74  ? 124 TRP B NE1 1 
ATOM   3469 C CE2 . TRP B 1 143 ? 78.052 -35.676 12.078 1.00 12.07  ? 124 TRP B CE2 1 
ATOM   3470 C CE3 . TRP B 1 143 ? 76.091 -36.960 12.687 1.00 12.83  ? 124 TRP B CE3 1 
ATOM   3471 C CZ2 . TRP B 1 143 ? 77.291 -34.500 11.940 1.00 11.30  ? 124 TRP B CZ2 1 
ATOM   3472 C CZ3 . TRP B 1 143 ? 75.334 -35.792 12.522 1.00 14.19  ? 124 TRP B CZ3 1 
ATOM   3473 C CH2 . TRP B 1 143 ? 75.943 -34.589 12.126 1.00 11.82  ? 124 TRP B CH2 1 
ATOM   3474 N N   . ARG B 1 144 ? 78.902 -40.840 10.085 1.00 11.05  ? 125 ARG B N   1 
ATOM   3475 C CA  . ARG B 1 144 ? 79.310 -40.833 8.675  1.00 13.03  ? 125 ARG B CA  1 
ATOM   3476 C C   . ARG B 1 144 ? 78.118 -41.185 7.788  1.00 13.48  ? 125 ARG B C   1 
ATOM   3477 O O   . ARG B 1 144 ? 77.858 -40.520 6.744  1.00 14.07  ? 125 ARG B O   1 
ATOM   3478 C CB  . ARG B 1 144 ? 80.475 -41.809 8.440  1.00 15.11  ? 125 ARG B CB  1 
ATOM   3479 C CG  . ARG B 1 144 ? 80.806 -42.127 6.967  1.00 16.13  ? 125 ARG B CG  1 
ATOM   3480 C CD  . ARG B 1 144 ? 81.408 -40.923 6.192  1.00 16.94  ? 125 ARG B CD  1 
ATOM   3481 N NE  . ARG B 1 144 ? 80.454 -39.852 5.866  1.00 16.45  ? 125 ARG B NE  1 
ATOM   3482 C CZ  . ARG B 1 144 ? 80.677 -38.841 5.012  1.00 16.53  ? 125 ARG B CZ  1 
ATOM   3483 N NH1 . ARG B 1 144 ? 81.846 -38.727 4.331  1.00 17.02  ? 125 ARG B NH1 1 
ATOM   3484 N NH2 . ARG B 1 144 ? 79.715 -37.925 4.839  1.00 15.05  ? 125 ARG B NH2 1 
ATOM   3485 N N   . ARG B 1 145 ? 77.389 -42.221 8.183  1.00 12.76  ? 126 ARG B N   1 
ATOM   3486 C CA  . ARG B 1 145 ? 76.216 -42.628 7.389  1.00 12.26  ? 126 ARG B CA  1 
ATOM   3487 C C   . ARG B 1 145 ? 75.098 -41.541 7.392  1.00 13.50  ? 126 ARG B C   1 
ATOM   3488 O O   . ARG B 1 145 ? 74.488 -41.240 6.349  1.00 15.45  ? 126 ARG B O   1 
ATOM   3489 C CB  . ARG B 1 145 ? 75.708 -43.988 7.921  1.00 12.97  ? 126 ARG B CB  1 
ATOM   3490 C CG  . ARG B 1 145 ? 76.713 -45.109 7.636  1.00 14.61  ? 126 ARG B CG  1 
ATOM   3491 C CD  . ARG B 1 145 ? 76.460 -46.332 8.502  1.00 15.14  ? 126 ARG B CD  1 
ATOM   3492 N NE  . ARG B 1 145 ? 75.145 -46.920 8.242  1.00 15.84  ? 126 ARG B NE  1 
ATOM   3493 C CZ  . ARG B 1 145 ? 74.550 -47.837 9.020  1.00 14.51  ? 126 ARG B CZ  1 
ATOM   3494 N NH1 . ARG B 1 145 ? 75.116 -48.239 10.157 1.00 15.92  ? 126 ARG B NH1 1 
ATOM   3495 N NH2 . ARG B 1 145 ? 73.354 -48.338 8.690  1.00 14.81  ? 126 ARG B NH2 1 
ATOM   3496 N N   . ILE B 1 146 ? 74.876 -40.911 8.539  1.00 13.17  ? 127 ILE B N   1 
ATOM   3497 C CA  . ILE B 1 146 ? 73.853 -39.878 8.640  1.00 11.48  ? 127 ILE B CA  1 
ATOM   3498 C C   . ILE B 1 146 ? 74.173 -38.653 7.782  1.00 11.63  ? 127 ILE B C   1 
ATOM   3499 O O   . ILE B 1 146 ? 73.281 -38.115 7.138  1.00 12.42  ? 127 ILE B O   1 
ATOM   3500 C CB  . ILE B 1 146 ? 73.697 -39.447 10.129 1.00 10.64  ? 127 ILE B CB  1 
ATOM   3501 C CG1 . ILE B 1 146 ? 72.953 -40.535 10.944 1.00 12.23  ? 127 ILE B CG1 1 
ATOM   3502 C CG2 . ILE B 1 146 ? 72.998 -38.086 10.266 1.00 12.99  ? 127 ILE B CG2 1 
ATOM   3503 C CD1 . ILE B 1 146 ? 73.052 -40.359 12.458 1.00 13.41  ? 127 ILE B CD1 1 
ATOM   3504 N N   . THR B 1 147 ? 75.445 -38.264 7.710  1.00 12.86  ? 128 THR B N   1 
ATOM   3505 C CA  . THR B 1 147 ? 75.795 -37.046 6.961  1.00 13.57  ? 128 THR B CA  1 
ATOM   3506 C C   . THR B 1 147 ? 75.878 -37.241 5.436  1.00 13.53  ? 128 THR B C   1 
ATOM   3507 O O   . THR B 1 147 ? 75.740 -36.272 4.683  1.00 15.23  ? 128 THR B O   1 
ATOM   3508 C CB  . THR B 1 147 ? 77.144 -36.454 7.423  1.00 14.39  ? 128 THR B CB  1 
ATOM   3509 O OG1 . THR B 1 147 ? 78.179 -37.438 7.301  1.00 15.40  ? 128 THR B OG1 1 
ATOM   3510 C CG2 . THR B 1 147 ? 77.078 -35.922 8.861  1.00 15.28  ? 128 THR B CG2 1 
ATOM   3511 N N   . LEU B 1 148 ? 76.046 -38.483 4.972  1.00 13.76  ? 129 LEU B N   1 
ATOM   3512 C CA  . LEU B 1 148 ? 76.137 -38.710 3.535  1.00 13.81  ? 129 LEU B CA  1 
ATOM   3513 C C   . LEU B 1 148 ? 74.890 -38.184 2.818  1.00 14.23  ? 129 LEU B C   1 
ATOM   3514 O O   . LEU B 1 148 ? 73.759 -38.501 3.225  1.00 15.03  ? 129 LEU B O   1 
ATOM   3515 C CB  . LEU B 1 148 ? 76.333 -40.214 3.267  1.00 13.68  ? 129 LEU B CB  1 
ATOM   3516 C CG  . LEU B 1 148 ? 77.791 -40.684 3.349  1.00 15.41  ? 129 LEU B CG  1 
ATOM   3517 C CD1 . LEU B 1 148 ? 77.876 -42.201 3.299  1.00 17.59  ? 129 LEU B CD1 1 
ATOM   3518 C CD2 . LEU B 1 148 ? 78.678 -40.095 2.214  1.00 16.37  ? 129 LEU B CD2 1 
ATOM   3519 N N   . GLY B 1 149 ? 75.091 -37.428 1.729  1.00 13.82  ? 130 GLY B N   1 
ATOM   3520 C CA  . GLY B 1 149 ? 73.985 -36.902 0.951  1.00 14.79  ? 130 GLY B CA  1 
ATOM   3521 C C   . GLY B 1 149 ? 73.329 -35.630 1.473  1.00 15.79  ? 130 GLY B C   1 
ATOM   3522 O O   . GLY B 1 149 ? 72.503 -35.034 0.782  1.00 19.22  ? 130 GLY B O   1 
ATOM   3523 N N   A MET B 1 150 ? 73.679 -35.194 2.679  0.50 13.55  ? 131 MET B N   1 
ATOM   3524 N N   B MET B 1 150 ? 73.715 -35.194 2.670  0.50 12.80  ? 131 MET B N   1 
ATOM   3525 C CA  A MET B 1 150 ? 73.054 -33.976 3.217  0.50 14.74  ? 131 MET B CA  1 
ATOM   3526 C CA  B MET B 1 150 ? 73.124 -33.986 3.268  0.50 13.44  ? 131 MET B CA  1 
ATOM   3527 C C   A MET B 1 150 ? 73.982 -32.776 3.122  0.50 15.17  ? 131 MET B C   1 
ATOM   3528 C C   B MET B 1 150 ? 74.009 -32.766 3.091  0.50 14.74  ? 131 MET B C   1 
ATOM   3529 O O   A MET B 1 150 ? 75.206 -32.923 3.166  0.50 15.54  ? 131 MET B O   1 
ATOM   3530 O O   B MET B 1 150 ? 75.236 -32.888 3.045  0.50 15.25  ? 131 MET B O   1 
ATOM   3531 C CB  A MET B 1 150 ? 72.611 -34.180 4.687  0.50 15.73  ? 131 MET B CB  1 
ATOM   3532 C CB  B MET B 1 150 ? 72.838 -34.212 4.774  0.50 13.04  ? 131 MET B CB  1 
ATOM   3533 C CG  A MET B 1 150 ? 71.790 -35.475 4.944  0.50 16.38  ? 131 MET B CG  1 
ATOM   3534 C CG  B MET B 1 150 ? 72.071 -35.536 5.067  0.50 12.00  ? 131 MET B CG  1 
ATOM   3535 S SD  A MET B 1 150 ? 70.241 -35.572 3.999  0.50 17.25  ? 131 MET B SD  1 
ATOM   3536 S SD  B MET B 1 150 ? 70.536 -35.678 4.100  0.50 11.86  ? 131 MET B SD  1 
ATOM   3537 C CE  A MET B 1 150 ? 70.600 -36.971 2.956  0.50 20.09  ? 131 MET B CE  1 
ATOM   3538 C CE  B MET B 1 150 ? 69.499 -34.434 4.933  0.50 8.07   ? 131 MET B CE  1 
ATOM   3539 N N   . THR B 1 151 ? 73.401 -31.578 3.008  1.00 14.79  ? 132 THR B N   1 
ATOM   3540 C CA  . THR B 1 151 ? 74.189 -30.347 2.862  1.00 15.28  ? 132 THR B CA  1 
ATOM   3541 C C   . THR B 1 151 ? 74.973 -30.072 4.147  1.00 15.34  ? 132 THR B C   1 
ATOM   3542 O O   . THR B 1 151 ? 74.567 -30.518 5.229  1.00 13.93  ? 132 THR B O   1 
ATOM   3543 C CB  . THR B 1 151 ? 73.336 -29.088 2.557  1.00 15.79  ? 132 THR B CB  1 
ATOM   3544 O OG1 . THR B 1 151 ? 72.445 -28.814 3.644  1.00 14.95  ? 132 THR B OG1 1 
ATOM   3545 C CG2 . THR B 1 151 ? 72.516 -29.235 1.256  1.00 16.31  ? 132 THR B CG2 1 
ATOM   3546 N N   . ASP B 1 152 ? 76.085 -29.348 4.018  1.00 15.02  ? 133 ASP B N   1 
ATOM   3547 C CA  . ASP B 1 152 ? 76.832 -28.931 5.206  1.00 16.63  ? 133 ASP B CA  1 
ATOM   3548 C C   . ASP B 1 152 ? 75.933 -28.072 6.114  1.00 15.03  ? 133 ASP B C   1 
ATOM   3549 O O   . ASP B 1 152 ? 76.069 -28.074 7.360  1.00 15.42  ? 133 ASP B O   1 
ATOM   3550 C CB  . ASP B 1 152 ? 78.096 -28.158 4.833  1.00 19.89  ? 133 ASP B CB  1 
ATOM   3551 C CG  . ASP B 1 152 ? 79.238 -29.063 4.389  1.00 22.66  ? 133 ASP B CG  1 
ATOM   3552 O OD1 . ASP B 1 152 ? 79.204 -30.306 4.637  1.00 23.13  ? 133 ASP B OD1 1 
ATOM   3553 O OD2 . ASP B 1 152 ? 80.170 -28.522 3.774  1.00 25.80  ? 133 ASP B OD2 1 
ATOM   3554 N N   . ARG B 1 153 ? 75.028 -27.320 5.502  1.00 15.79  ? 134 ARG B N   1 
ATOM   3555 C CA  . ARG B 1 153 ? 74.078 -26.492 6.259  1.00 15.53  ? 134 ARG B CA  1 
ATOM   3556 C C   . ARG B 1 153 ? 73.112 -27.299 7.167  1.00 13.73  ? 134 ARG B C   1 
ATOM   3557 O O   . ARG B 1 153 ? 72.920 -26.991 8.354  1.00 13.97  ? 134 ARG B O   1 
ATOM   3558 C CB  . ARG B 1 153 ? 73.332 -25.654 5.246  1.00 15.89  ? 134 ARG B CB  1 
ATOM   3559 C CG  . ARG B 1 153 ? 72.253 -24.826 5.754  1.00 15.28  ? 134 ARG B CG  1 
ATOM   3560 C CD  . ARG B 1 153 ? 71.902 -23.767 4.715  1.00 16.87  ? 134 ARG B CD  1 
ATOM   3561 N NE  . ARG B 1 153 ? 70.613 -23.134 5.017  1.00 16.92  ? 134 ARG B NE  1 
ATOM   3562 C CZ  . ARG B 1 153 ? 69.944 -22.379 4.151  1.00 17.37  ? 134 ARG B CZ  1 
ATOM   3563 N NH1 . ARG B 1 153 ? 68.759 -21.902 4.480  1.00 17.18  ? 134 ARG B NH1 1 
ATOM   3564 N NH2 . ARG B 1 153 ? 70.461 -22.129 2.940  1.00 17.44  ? 134 ARG B NH2 1 
ATOM   3565 N N   . TRP B 1 154 ? 72.584 -28.397 6.624  1.00 13.21  ? 135 TRP B N   1 
ATOM   3566 C CA  . TRP B 1 154 ? 71.826 -29.365 7.396  1.00 12.27  ? 135 TRP B CA  1 
ATOM   3567 C C   . TRP B 1 154 ? 72.735 -29.974 8.461  1.00 11.93  ? 135 TRP B C   1 
ATOM   3568 O O   . TRP B 1 154 ? 72.306 -30.152 9.637  1.00 12.74  ? 135 TRP B O   1 
ATOM   3569 C CB  . TRP B 1 154 ? 71.272 -30.484 6.475  1.00 12.70  ? 135 TRP B CB  1 
ATOM   3570 C CG  . TRP B 1 154 ? 70.415 -31.506 7.208  1.00 11.85  ? 135 TRP B CG  1 
ATOM   3571 C CD1 . TRP B 1 154 ? 69.068 -31.432 7.462  1.00 12.54  ? 135 TRP B CD1 1 
ATOM   3572 C CD2 . TRP B 1 154 ? 70.867 -32.733 7.825  1.00 12.09  ? 135 TRP B CD2 1 
ATOM   3573 N NE1 . TRP B 1 154 ? 68.656 -32.535 8.164  1.00 12.07  ? 135 TRP B NE1 1 
ATOM   3574 C CE2 . TRP B 1 154 ? 69.729 -33.345 8.424  1.00 12.35  ? 135 TRP B CE2 1 
ATOM   3575 C CE3 . TRP B 1 154 ? 72.117 -33.350 7.943  1.00 11.73  ? 135 TRP B CE3 1 
ATOM   3576 C CZ2 . TRP B 1 154 ? 69.808 -34.565 9.116  1.00 12.78  ? 135 TRP B CZ2 1 
ATOM   3577 C CZ3 . TRP B 1 154 ? 72.192 -34.559 8.645  1.00 12.59  ? 135 TRP B CZ3 1 
ATOM   3578 C CH2 . TRP B 1 154 ? 71.045 -35.160 9.176  1.00 11.65  ? 135 TRP B CH2 1 
ATOM   3579 N N   . ARG B 1 155 ? 73.959 -30.327 8.079  1.00 10.76  ? 136 ARG B N   1 
ATOM   3580 C CA  A ARG B 1 155 ? 74.845 -30.993 9.045  0.50 13.09  ? 136 ARG B CA  1 
ATOM   3581 C CA  B ARG B 1 155 ? 74.862 -30.973 9.048  0.50 11.86  ? 136 ARG B CA  1 
ATOM   3582 C C   . ARG B 1 155 ? 75.146 -30.104 10.251 1.00 12.18  ? 136 ARG B C   1 
ATOM   3583 O O   . ARG B 1 155 ? 75.336 -30.616 11.338 1.00 12.32  ? 136 ARG B O   1 
ATOM   3584 C CB  A ARG B 1 155 ? 76.137 -31.449 8.366  0.50 15.56  ? 136 ARG B CB  1 
ATOM   3585 C CB  B ARG B 1 155 ? 76.174 -31.355 8.394  0.50 11.71  ? 136 ARG B CB  1 
ATOM   3586 C CG  A ARG B 1 155 ? 75.914 -32.670 7.433  0.50 18.62  ? 136 ARG B CG  1 
ATOM   3587 C CG  B ARG B 1 155 ? 75.984 -32.339 7.254  0.50 12.56  ? 136 ARG B CG  1 
ATOM   3588 C CD  A ARG B 1 155 ? 77.045 -32.864 6.407  0.50 22.04  ? 136 ARG B CD  1 
ATOM   3589 C CD  B ARG B 1 155 ? 77.332 -32.746 6.670  0.50 13.75  ? 136 ARG B CD  1 
ATOM   3590 N NE  A ARG B 1 155 ? 78.360 -33.077 7.008  0.50 22.55  ? 136 ARG B NE  1 
ATOM   3591 N NE  B ARG B 1 155 ? 77.177 -33.513 5.432  0.50 11.90  ? 136 ARG B NE  1 
ATOM   3592 C CZ  A ARG B 1 155 ? 79.408 -33.526 6.318  0.50 25.70  ? 136 ARG B CZ  1 
ATOM   3593 C CZ  B ARG B 1 155 ? 78.191 -34.126 4.839  0.50 12.88  ? 136 ARG B CZ  1 
ATOM   3594 N NH1 A ARG B 1 155 ? 79.271 -33.802 5.028  0.50 26.99  ? 136 ARG B NH1 1 
ATOM   3595 N NH1 B ARG B 1 155 ? 79.400 -34.049 5.379  0.50 16.36  ? 136 ARG B NH1 1 
ATOM   3596 N NH2 A ARG B 1 155 ? 80.585 -33.709 6.908  0.50 27.19  ? 136 ARG B NH2 1 
ATOM   3597 N NH2 B ARG B 1 155 ? 78.005 -34.837 3.729  0.50 14.29  ? 136 ARG B NH2 1 
ATOM   3598 N N   . ALA B 1 156 ? 75.177 -28.789 10.058 1.00 12.39  ? 137 ALA B N   1 
ATOM   3599 C CA  . ALA B 1 156 ? 75.441 -27.898 11.194 1.00 11.72  ? 137 ALA B CA  1 
ATOM   3600 C C   . ALA B 1 156 ? 74.358 -28.069 12.258 1.00 11.34  ? 137 ALA B C   1 
ATOM   3601 O O   . ALA B 1 156 ? 74.672 -28.166 13.459 1.00 11.83  ? 137 ALA B O   1 
ATOM   3602 C CB  . ALA B 1 156 ? 75.495 -26.447 10.728 1.00 12.15  ? 137 ALA B CB  1 
ATOM   3603 N N   . ARG B 1 157 ? 73.086 -28.080 11.860 1.00 10.51  ? 138 ARG B N   1 
ATOM   3604 C CA  . ARG B 1 157 ? 72.008 -28.242 12.850 1.00 10.07  ? 138 ARG B CA  1 
ATOM   3605 C C   . ARG B 1 157 ? 72.060 -29.642 13.423 1.00 9.26   ? 138 ARG B C   1 
ATOM   3606 O O   . ARG B 1 157 ? 71.940 -29.836 14.643 1.00 10.27  ? 138 ARG B O   1 
ATOM   3607 C CB  . ARG B 1 157 ? 70.616 -27.970 12.260 1.00 11.33  ? 138 ARG B CB  1 
ATOM   3608 C CG  . ARG B 1 157 ? 69.558 -27.849 13.389 1.00 12.78  ? 138 ARG B CG  1 
ATOM   3609 C CD  . ARG B 1 157 ? 68.149 -27.753 12.924 1.00 13.16  ? 138 ARG B CD  1 
ATOM   3610 N NE  . ARG B 1 157 ? 67.693 -29.015 12.336 1.00 12.94  ? 138 ARG B NE  1 
ATOM   3611 C CZ  . ARG B 1 157 ? 67.332 -29.169 11.053 1.00 13.31  ? 138 ARG B CZ  1 
ATOM   3612 N NH1 . ARG B 1 157 ? 67.352 -28.138 10.209 1.00 15.19  ? 138 ARG B NH1 1 
ATOM   3613 N NH2 . ARG B 1 157 ? 66.910 -30.377 10.632 1.00 12.72  ? 138 ARG B NH2 1 
ATOM   3614 N N   . ALA B 1 158 ? 72.225 -30.644 12.542 1.00 9.26   ? 139 ALA B N   1 
ATOM   3615 C CA  . ALA B 1 158 ? 72.238 -32.035 13.035 1.00 9.47   ? 139 ALA B CA  1 
ATOM   3616 C C   . ALA B 1 158 ? 73.366 -32.243 14.056 1.00 10.69  ? 139 ALA B C   1 
ATOM   3617 O O   . ALA B 1 158 ? 73.150 -32.924 15.077 1.00 10.57  ? 139 ALA B O   1 
ATOM   3618 C CB  . ALA B 1 158 ? 72.371 -33.025 11.849 1.00 9.77   ? 139 ALA B CB  1 
ATOM   3619 N N   . ALA B 1 159 ? 74.547 -31.675 13.804 1.00 10.68  ? 140 ALA B N   1 
ATOM   3620 C CA  . ALA B 1 159 ? 75.670 -31.784 14.744 1.00 11.28  ? 140 ALA B CA  1 
ATOM   3621 C C   . ALA B 1 159 ? 75.353 -31.110 16.070 1.00 11.19  ? 140 ALA B C   1 
ATOM   3622 O O   . ALA B 1 159 ? 75.648 -31.666 17.151 1.00 12.41  ? 140 ALA B O   1 
ATOM   3623 C CB  . ALA B 1 159 ? 76.954 -31.182 14.136 1.00 10.92  ? 140 ALA B CB  1 
ATOM   3624 N N   . CYS B 1 160 ? 74.768 -29.908 15.999 1.00 11.24  ? 141 CYS B N   1 
ATOM   3625 C CA  . CYS B 1 160 ? 74.379 -29.225 17.207 1.00 11.49  ? 141 CYS B CA  1 
ATOM   3626 C C   . CYS B 1 160 ? 73.357 -29.962 18.022 1.00 12.14  ? 141 CYS B C   1 
ATOM   3627 O O   . CYS B 1 160 ? 73.371 -29.868 19.262 1.00 11.37  ? 141 CYS B O   1 
ATOM   3628 C CB  . CYS B 1 160 ? 73.860 -27.840 16.859 1.00 12.56  ? 141 CYS B CB  1 
ATOM   3629 S SG  . CYS B 1 160 ? 75.177 -26.652 16.350 1.00 14.78  ? 141 CYS B SG  1 
ATOM   3630 N N   . ASN B 1 161 ? 72.478 -30.731 17.361 1.00 10.14  ? 142 ASN B N   1 
ATOM   3631 C CA  . ASN B 1 161 ? 71.481 -31.482 18.089 1.00 9.96   ? 142 ASN B CA  1 
ATOM   3632 C C   . ASN B 1 161 ? 72.074 -32.746 18.718 1.00 10.28  ? 142 ASN B C   1 
ATOM   3633 O O   . ASN B 1 161 ? 71.635 -33.141 19.793 1.00 11.76  ? 142 ASN B O   1 
ATOM   3634 C CB  . ASN B 1 161 ? 70.311 -31.846 17.158 1.00 9.98   ? 142 ASN B CB  1 
ATOM   3635 C CG  . ASN B 1 161 ? 69.345 -30.703 16.983 1.00 10.54  ? 142 ASN B CG  1 
ATOM   3636 O OD1 . ASN B 1 161 ? 69.237 -29.824 17.852 1.00 13.45  ? 142 ASN B OD1 1 
ATOM   3637 N ND2 . ASN B 1 161 ? 68.635 -30.685 15.844 1.00 12.04  ? 142 ASN B ND2 1 
ATOM   3638 N N   . TRP B 1 162 ? 73.072 -33.350 18.074 1.00 10.64  ? 143 TRP B N   1 
ATOM   3639 C CA  . TRP B 1 162 ? 73.821 -34.452 18.726 1.00 11.58  ? 143 TRP B CA  1 
ATOM   3640 C C   . TRP B 1 162 ? 74.564 -33.913 19.952 1.00 12.24  ? 143 TRP B C   1 
ATOM   3641 O O   . TRP B 1 162 ? 74.602 -34.569 21.018 1.00 11.92  ? 143 TRP B O   1 
ATOM   3642 C CB  . TRP B 1 162 ? 74.815 -35.110 17.771 1.00 12.15  ? 143 TRP B CB  1 
ATOM   3643 C CG  . TRP B 1 162 ? 74.156 -36.194 16.979 1.00 11.48  ? 143 TRP B CG  1 
ATOM   3644 C CD1 . TRP B 1 162 ? 73.728 -36.126 15.673 1.00 13.26  ? 143 TRP B CD1 1 
ATOM   3645 C CD2 . TRP B 1 162 ? 73.823 -37.488 17.464 1.00 11.72  ? 143 TRP B CD2 1 
ATOM   3646 N NE1 . TRP B 1 162 ? 73.167 -37.344 15.314 1.00 13.36  ? 143 TRP B NE1 1 
ATOM   3647 C CE2 . TRP B 1 162 ? 73.218 -38.193 16.403 1.00 12.20  ? 143 TRP B CE2 1 
ATOM   3648 C CE3 . TRP B 1 162 ? 73.996 -38.115 18.699 1.00 13.43  ? 143 TRP B CE3 1 
ATOM   3649 C CZ2 . TRP B 1 162 ? 72.760 -39.491 16.552 1.00 13.30  ? 143 TRP B CZ2 1 
ATOM   3650 C CZ3 . TRP B 1 162 ? 73.561 -39.420 18.860 1.00 13.88  ? 143 TRP B CZ3 1 
ATOM   3651 C CH2 . TRP B 1 162 ? 72.942 -40.100 17.787 1.00 14.34  ? 143 TRP B CH2 1 
ATOM   3652 N N   . GLU B 1 163 ? 75.161 -32.724 19.791 1.00 10.74  ? 144 GLU B N   1 
ATOM   3653 C CA  . GLU B 1 163 ? 75.923 -32.081 20.862 1.00 11.15  ? 144 GLU B CA  1 
ATOM   3654 C C   . GLU B 1 163 ? 75.008 -31.812 22.084 1.00 11.56  ? 144 GLU B C   1 
ATOM   3655 O O   . GLU B 1 163 ? 75.391 -32.098 23.240 1.00 12.32  ? 144 GLU B O   1 
ATOM   3656 C CB  . GLU B 1 163 ? 76.592 -30.793 20.345 1.00 10.88  ? 144 GLU B CB  1 
ATOM   3657 C CG  . GLU B 1 163 ? 77.222 -29.963 21.486 1.00 11.87  ? 144 GLU B CG  1 
ATOM   3658 C CD  . GLU B 1 163 ? 78.070 -28.845 20.947 1.00 16.46  ? 144 GLU B CD  1 
ATOM   3659 O OE1 . GLU B 1 163 ? 78.858 -28.261 21.716 1.00 16.24  ? 144 GLU B OE1 1 
ATOM   3660 O OE2 . GLU B 1 163 ? 77.886 -28.509 19.757 1.00 21.12  ? 144 GLU B OE2 1 
ATOM   3661 N N   . TYR B 1 164 ? 73.794 -31.328 21.829 1.00 9.30   ? 145 TYR B N   1 
ATOM   3662 C CA  . TYR B 1 164 ? 72.731 -31.126 22.852 1.00 9.36   ? 145 TYR B CA  1 
ATOM   3663 C C   . TYR B 1 164 ? 72.441 -32.441 23.620 1.00 11.17  ? 145 TYR B C   1 
ATOM   3664 O O   . TYR B 1 164 ? 72.481 -32.491 24.857 1.00 11.70  ? 145 TYR B O   1 
ATOM   3665 C CB  . TYR B 1 164 ? 71.478 -30.636 22.117 1.00 10.82  ? 145 TYR B CB  1 
ATOM   3666 C CG  . TYR B 1 164 ? 70.171 -30.478 22.832 1.00 11.86  ? 145 TYR B CG  1 
ATOM   3667 C CD1 . TYR B 1 164 ? 70.102 -30.092 24.168 1.00 11.19  ? 145 TYR B CD1 1 
ATOM   3668 C CD2 . TYR B 1 164 ? 68.985 -30.606 22.126 1.00 13.72  ? 145 TYR B CD2 1 
ATOM   3669 C CE1 . TYR B 1 164 ? 68.887 -29.881 24.788 1.00 10.51  ? 145 TYR B CE1 1 
ATOM   3670 C CE2 . TYR B 1 164 ? 67.759 -30.413 22.711 1.00 13.81  ? 145 TYR B CE2 1 
ATOM   3671 C CZ  . TYR B 1 164 ? 67.702 -30.044 24.046 1.00 10.67  ? 145 TYR B CZ  1 
ATOM   3672 O OH  . TYR B 1 164 ? 66.479 -29.832 24.602 1.00 13.55  ? 145 TYR B OH  1 
ATOM   3673 N N   . TYR B 1 165 ? 72.168 -33.508 22.864 1.00 9.88   ? 146 TYR B N   1 
ATOM   3674 C CA  . TYR B 1 165 ? 71.950 -34.839 23.471 1.00 10.75  ? 146 TYR B CA  1 
ATOM   3675 C C   . TYR B 1 165 ? 73.106 -35.281 24.386 1.00 10.41  ? 146 TYR B C   1 
ATOM   3676 O O   . TYR B 1 165 ? 72.901 -35.624 25.563 1.00 12.46  ? 146 TYR B O   1 
ATOM   3677 C CB  . TYR B 1 165 ? 71.767 -35.869 22.353 1.00 10.58  ? 146 TYR B CB  1 
ATOM   3678 C CG  . TYR B 1 165 ? 71.758 -37.313 22.831 1.00 10.97  ? 146 TYR B CG  1 
ATOM   3679 C CD1 . TYR B 1 165 ? 70.690 -37.842 23.542 1.00 12.23  ? 146 TYR B CD1 1 
ATOM   3680 C CD2 . TYR B 1 165 ? 72.818 -38.139 22.535 1.00 12.50  ? 146 TYR B CD2 1 
ATOM   3681 C CE1 . TYR B 1 165 ? 70.702 -39.206 23.960 1.00 12.79  ? 146 TYR B CE1 1 
ATOM   3682 C CE2 . TYR B 1 165 ? 72.829 -39.483 22.906 1.00 12.10  ? 146 TYR B CE2 1 
ATOM   3683 C CZ  . TYR B 1 165 ? 71.783 -40.003 23.615 1.00 12.59  ? 146 TYR B CZ  1 
ATOM   3684 O OH  . TYR B 1 165 ? 71.846 -41.355 23.969 1.00 13.33  ? 146 TYR B OH  1 
ATOM   3685 N N   . PHE B 1 166 ? 74.324 -35.280 23.841 1.00 10.57  ? 147 PHE B N   1 
ATOM   3686 C CA  . PHE B 1 166 ? 75.486 -35.746 24.618 1.00 10.58  ? 147 PHE B CA  1 
ATOM   3687 C C   . PHE B 1 166 ? 75.707 -34.845 25.832 1.00 10.52  ? 147 PHE B C   1 
ATOM   3688 O O   . PHE B 1 166 ? 75.951 -35.331 26.963 1.00 11.67  ? 147 PHE B O   1 
ATOM   3689 C CB  . PHE B 1 166 ? 76.767 -35.744 23.778 1.00 10.22  ? 147 PHE B CB  1 
ATOM   3690 C CG  . PHE B 1 166 ? 76.784 -36.799 22.676 1.00 11.02  ? 147 PHE B CG  1 
ATOM   3691 C CD1 . PHE B 1 166 ? 76.511 -38.156 22.972 1.00 12.67  ? 147 PHE B CD1 1 
ATOM   3692 C CD2 . PHE B 1 166 ? 77.108 -36.455 21.344 1.00 12.27  ? 147 PHE B CD2 1 
ATOM   3693 C CE1 . PHE B 1 166 ? 76.517 -39.124 21.960 1.00 13.54  ? 147 PHE B CE1 1 
ATOM   3694 C CE2 . PHE B 1 166 ? 77.108 -37.453 20.317 1.00 13.80  ? 147 PHE B CE2 1 
ATOM   3695 C CZ  . PHE B 1 166 ? 76.835 -38.797 20.653 1.00 13.89  ? 147 PHE B CZ  1 
ATOM   3696 N N   . ALA B 1 167 ? 75.569 -33.530 25.602 1.00 9.51   ? 148 ALA B N   1 
ATOM   3697 C CA  . ALA B 1 167 ? 75.897 -32.560 26.641 1.00 10.72  ? 148 ALA B CA  1 
ATOM   3698 C C   . ALA B 1 167 ? 74.958 -32.565 27.859 1.00 11.38  ? 148 ALA B C   1 
ATOM   3699 O O   . ALA B 1 167 ? 75.322 -32.030 28.914 1.00 10.59  ? 148 ALA B O   1 
ATOM   3700 C CB  . ALA B 1 167 ? 75.953 -31.175 26.030 1.00 11.23  ? 148 ALA B CB  1 
ATOM   3701 N N   . CYS B 1 168 ? 73.750 -33.100 27.720 1.00 10.64  ? 149 CYS B N   1 
ATOM   3702 C CA  . CYS B 1 168 ? 72.800 -33.211 28.823 1.00 11.34  ? 149 CYS B CA  1 
ATOM   3703 C C   . CYS B 1 168 ? 73.124 -34.339 29.800 1.00 11.93  ? 149 CYS B C   1 
ATOM   3704 O O   . CYS B 1 168 ? 72.574 -34.380 30.909 1.00 12.41  ? 149 CYS B O   1 
ATOM   3705 C CB  . CYS B 1 168 ? 71.370 -33.434 28.294 1.00 13.33  ? 149 CYS B CB  1 
ATOM   3706 S SG  . CYS B 1 168 ? 70.629 -31.940 27.584 1.00 13.93  ? 149 CYS B SG  1 
ATOM   3707 N N   . HIS B 1 169 ? 74.009 -35.251 29.406 1.00 11.37  ? 150 HIS B N   1 
ATOM   3708 C CA  . HIS B 1 169 ? 74.216 -36.441 30.263 1.00 11.57  ? 150 HIS B CA  1 
ATOM   3709 C C   . HIS B 1 169 ? 74.909 -36.171 31.603 1.00 12.54  ? 150 HIS B C   1 
ATOM   3710 O O   . HIS B 1 169 ? 74.517 -36.780 32.578 1.00 12.76  ? 150 HIS B O   1 
ATOM   3711 C CB  . HIS B 1 169 ? 74.978 -37.495 29.453 1.00 12.74  ? 150 HIS B CB  1 
ATOM   3712 C CG  . HIS B 1 169 ? 74.117 -38.207 28.453 1.00 12.38  ? 150 HIS B CG  1 
ATOM   3713 N ND1 . HIS B 1 169 ? 73.698 -37.637 27.263 1.00 14.11  ? 150 HIS B ND1 1 
ATOM   3714 C CD2 . HIS B 1 169 ? 73.627 -39.475 28.453 1.00 15.74  ? 150 HIS B CD2 1 
ATOM   3715 C CE1 . HIS B 1 169 ? 72.965 -38.516 26.592 1.00 16.40  ? 150 HIS B CE1 1 
ATOM   3716 N NE2 . HIS B 1 169 ? 72.934 -39.650 27.278 1.00 17.96  ? 150 HIS B NE2 1 
ATOM   3717 N N   . PRO B 1 170 ? 75.919 -35.269 31.658 1.00 12.22  ? 151 PRO B N   1 
ATOM   3718 C CA  . PRO B 1 170 ? 76.457 -34.970 33.008 1.00 11.24  ? 151 PRO B CA  1 
ATOM   3719 C C   . PRO B 1 170 ? 75.396 -34.465 33.989 1.00 10.69  ? 151 PRO B C   1 
ATOM   3720 O O   . PRO B 1 170 ? 75.384 -34.896 35.168 1.00 10.95  ? 151 PRO B O   1 
ATOM   3721 C CB  . PRO B 1 170 ? 77.544 -33.912 32.714 1.00 12.15  ? 151 PRO B CB  1 
ATOM   3722 C CG  . PRO B 1 170 ? 78.055 -34.321 31.350 1.00 10.36  ? 151 PRO B CG  1 
ATOM   3723 C CD  . PRO B 1 170 ? 76.737 -34.627 30.605 1.00 13.05  ? 151 PRO B CD  1 
ATOM   3724 N N   . ALA B 1 171 ? 74.501 -33.565 33.552 1.00 11.33  ? 152 ALA B N   1 
ATOM   3725 C CA  . ALA B 1 171 ? 73.402 -33.121 34.418 1.00 12.22  ? 152 ALA B CA  1 
ATOM   3726 C C   . ALA B 1 171 ? 72.499 -34.283 34.857 1.00 12.00  ? 152 ALA B C   1 
ATOM   3727 O O   . ALA B 1 171 ? 72.067 -34.342 36.018 1.00 11.99  ? 152 ALA B O   1 
ATOM   3728 C CB  . ALA B 1 171 ? 72.557 -32.057 33.715 1.00 12.45  ? 152 ALA B CB  1 
ATOM   3729 N N   . GLU B 1 172 ? 72.197 -35.187 33.936 1.00 13.35  ? 153 GLU B N   1 
ATOM   3730 C CA  . GLU B 1 172 ? 71.403 -36.360 34.263 1.00 13.83  ? 153 GLU B CA  1 
ATOM   3731 C C   . GLU B 1 172 ? 72.116 -37.191 35.327 1.00 14.73  ? 153 GLU B C   1 
ATOM   3732 O O   . GLU B 1 172 ? 71.496 -37.650 36.306 1.00 16.03  ? 153 GLU B O   1 
ATOM   3733 C CB  . GLU B 1 172 ? 71.136 -37.189 32.999 1.00 14.72  ? 153 GLU B CB  1 
ATOM   3734 C CG  . GLU B 1 172 ? 70.246 -38.415 33.226 1.00 18.16  ? 153 GLU B CG  1 
ATOM   3735 C CD  . GLU B 1 172 ? 70.093 -39.222 31.948 1.00 24.24  ? 153 GLU B CD  1 
ATOM   3736 O OE1 . GLU B 1 172 ? 68.956 -39.539 31.604 1.00 27.16  ? 153 GLU B OE1 1 
ATOM   3737 O OE2 . GLU B 1 172 ? 71.108 -39.526 31.269 1.00 27.91  ? 153 GLU B OE2 1 
ATOM   3738 N N   . ALA B 1 173 ? 73.420 -37.382 35.164 1.00 14.72  ? 154 ALA B N   1 
ATOM   3739 C CA  . ALA B 1 173 ? 74.166 -38.187 36.163 1.00 14.14  ? 154 ALA B CA  1 
ATOM   3740 C C   . ALA B 1 173 ? 74.184 -37.518 37.536 1.00 14.15  ? 154 ALA B C   1 
ATOM   3741 O O   . ALA B 1 173 ? 74.062 -38.197 38.580 1.00 15.52  ? 154 ALA B O   1 
ATOM   3742 C CB  . ALA B 1 173 ? 75.599 -38.435 35.692 1.00 14.36  ? 154 ALA B CB  1 
ATOM   3743 N N   . ALA B 1 174 ? 74.321 -36.201 37.543 1.00 13.39  ? 155 ALA B N   1 
ATOM   3744 C CA  . ALA B 1 174 ? 74.271 -35.471 38.821 1.00 14.28  ? 155 ALA B CA  1 
ATOM   3745 C C   . ALA B 1 174 ? 72.908 -35.640 39.494 1.00 16.03  ? 155 ALA B C   1 
ATOM   3746 O O   . ALA B 1 174 ? 72.805 -35.751 40.741 1.00 18.53  ? 155 ALA B O   1 
ATOM   3747 C CB  . ALA B 1 174 ? 74.555 -33.998 38.584 1.00 16.83  ? 155 ALA B CB  1 
ATOM   3748 N N   . GLY B 1 175 ? 71.854 -35.672 38.682 1.00 16.03  ? 156 GLY B N   1 
ATOM   3749 C CA  . GLY B 1 175 ? 70.507 -35.803 39.212 1.00 18.03  ? 156 GLY B CA  1 
ATOM   3750 C C   . GLY B 1 175 ? 70.272 -37.109 39.952 1.00 20.72  ? 156 GLY B C   1 
ATOM   3751 O O   . GLY B 1 175 ? 69.420 -37.190 40.857 1.00 23.75  ? 156 GLY B O   1 
ATOM   3752 N N   . ARG B 1 176 ? 71.035 -38.138 39.619 1.00 23.08  ? 157 ARG B N   1 
ATOM   3753 C CA  A ARG B 1 176 ? 70.880 -39.449 40.251 0.50 26.52  ? 157 ARG B CA  1 
ATOM   3754 C CA  B ARG B 1 176 ? 70.826 -39.424 40.272 0.50 24.11  ? 157 ARG B CA  1 
ATOM   3755 C C   . ARG B 1 176 ? 71.261 -39.413 41.723 1.00 26.65  ? 157 ARG B C   1 
ATOM   3756 O O   . ARG B 1 176 ? 70.906 -40.320 42.496 1.00 27.66  ? 157 ARG B O   1 
ATOM   3757 C CB  A ARG B 1 176 ? 71.735 -40.506 39.532 0.50 29.57  ? 157 ARG B CB  1 
ATOM   3758 C CB  B ARG B 1 176 ? 71.554 -40.525 39.514 0.50 22.56  ? 157 ARG B CB  1 
ATOM   3759 C CG  A ARG B 1 176 ? 71.356 -41.943 39.871 0.50 32.52  ? 157 ARG B CG  1 
ATOM   3760 C CG  B ARG B 1 176 ? 70.870 -40.798 38.207 0.50 21.29  ? 157 ARG B CG  1 
ATOM   3761 C CD  A ARG B 1 176 ? 69.930 -42.248 39.415 0.50 34.69  ? 157 ARG B CD  1 
ATOM   3762 C CD  B ARG B 1 176 ? 71.248 -42.114 37.658 0.50 19.03  ? 157 ARG B CD  1 
ATOM   3763 N NE  A ARG B 1 176 ? 69.375 -43.393 40.130 0.50 36.02  ? 157 ARG B NE  1 
ATOM   3764 N NE  B ARG B 1 176 ? 71.176 -43.186 38.648 0.50 17.70  ? 157 ARG B NE  1 
ATOM   3765 C CZ  A ARG B 1 176 ? 68.914 -43.343 41.378 0.50 36.85  ? 157 ARG B CZ  1 
ATOM   3766 C CZ  B ARG B 1 176 ? 71.716 -44.386 38.455 0.50 16.04  ? 157 ARG B CZ  1 
ATOM   3767 N NH1 A ARG B 1 176 ? 68.946 -42.207 42.053 0.50 37.35  ? 157 ARG B NH1 1 
ATOM   3768 N NH1 B ARG B 1 176 ? 72.350 -44.630 37.326 0.50 15.89  ? 157 ARG B NH1 1 
ATOM   3769 N NH2 A ARG B 1 176 ? 68.434 -44.436 41.956 0.50 37.50  ? 157 ARG B NH2 1 
ATOM   3770 N NH2 B ARG B 1 176 ? 71.645 -45.326 39.394 0.50 14.59  ? 157 ARG B NH2 1 
ATOM   3771 N N   . THR B 1 177 ? 72.010 -38.387 42.111 1.00 27.59  ? 158 THR B N   1 
ATOM   3772 C CA  . THR B 1 177 ? 72.515 -38.337 43.482 1.00 31.52  ? 158 THR B CA  1 
ATOM   3773 C C   . THR B 1 177 ? 71.541 -37.604 44.411 1.00 36.72  ? 158 THR B C   1 
ATOM   3774 O O   . THR B 1 177 ? 71.801 -37.487 45.620 1.00 37.30  ? 158 THR B O   1 
ATOM   3775 C CB  . THR B 1 177 ? 73.894 -37.653 43.550 1.00 32.25  ? 158 THR B CB  1 
ATOM   3776 O OG1 . THR B 1 177 ? 73.771 -36.280 43.167 1.00 32.45  ? 158 THR B OG1 1 
ATOM   3777 C CG2 . THR B 1 177 ? 74.872 -38.337 42.635 1.00 33.70  ? 158 THR B CG2 1 
ATOM   3778 N N   . ILE B 1 178 ? 70.408 -37.174 43.848 1.00 40.24  ? 159 ILE B N   1 
ATOM   3779 C CA  . ILE B 1 178 ? 69.471 -36.244 44.491 1.00 43.64  ? 159 ILE B CA  1 
ATOM   3780 C C   . ILE B 1 178 ? 70.140 -34.876 44.664 1.00 45.32  ? 159 ILE B C   1 
ATOM   3781 O O   . ILE B 1 178 ? 70.280 -34.106 43.695 1.00 45.50  ? 159 ILE B O   1 
ATOM   3782 C CB  . ILE B 1 178 ? 68.959 -36.777 45.854 1.00 45.75  ? 159 ILE B CB  1 
ATOM   3783 C CG1 . ILE B 1 178 ? 67.930 -37.890 45.626 1.00 46.05  ? 159 ILE B CG1 1 
ATOM   3784 C CG2 . ILE B 1 178 ? 68.396 -35.643 46.715 1.00 46.17  ? 159 ILE B CG2 1 
ATOM   3785 C CD1 . ILE B 1 178 ? 67.565 -38.658 46.872 1.00 47.07  ? 159 ILE B CD1 1 
ATOM   3786 N N   . PRO B 1 181 ? 62.551 -35.946 44.227 1.00 46.78  ? 162 PRO B N   1 
ATOM   3787 C CA  . PRO B 1 181 ? 62.064 -35.609 42.881 1.00 44.22  ? 162 PRO B CA  1 
ATOM   3788 C C   . PRO B 1 181 ? 62.475 -34.203 42.499 1.00 39.25  ? 162 PRO B C   1 
ATOM   3789 O O   . PRO B 1 181 ? 62.298 -33.280 43.290 1.00 38.72  ? 162 PRO B O   1 
ATOM   3790 C CB  . PRO B 1 181 ? 60.534 -35.731 42.996 1.00 46.28  ? 162 PRO B CB  1 
ATOM   3791 C CG  . PRO B 1 181 ? 60.239 -35.945 44.462 1.00 47.60  ? 162 PRO B CG  1 
ATOM   3792 C CD  . PRO B 1 181 ? 61.488 -36.501 45.080 1.00 48.23  ? 162 PRO B CD  1 
ATOM   3793 N N   . PRO B 1 182 ? 63.030 -34.038 41.293 1.00 34.61  ? 163 PRO B N   1 
ATOM   3794 C CA  . PRO B 1 182 ? 63.456 -32.719 40.825 1.00 32.93  ? 163 PRO B CA  1 
ATOM   3795 C C   . PRO B 1 182 ? 62.288 -31.744 40.607 1.00 32.16  ? 163 PRO B C   1 
ATOM   3796 O O   . PRO B 1 182 ? 61.096 -32.079 40.655 1.00 32.25  ? 163 PRO B O   1 
ATOM   3797 C CB  . PRO B 1 182 ? 64.150 -33.036 39.490 1.00 32.44  ? 163 PRO B CB  1 
ATOM   3798 C CG  . PRO B 1 182 ? 63.478 -34.259 39.008 1.00 33.35  ? 163 PRO B CG  1 
ATOM   3799 C CD  . PRO B 1 182 ? 63.157 -35.069 40.250 1.00 33.20  ? 163 PRO B CD  1 
ATOM   3800 N N   . ASP B 1 183 ? 62.670 -30.506 40.380 1.00 31.21  ? 164 ASP B N   1 
ATOM   3801 C CA  . ASP B 1 183 ? 61.784 -29.461 39.929 1.00 31.03  ? 164 ASP B CA  1 
ATOM   3802 C C   . ASP B 1 183 ? 61.130 -29.787 38.547 1.00 29.82  ? 164 ASP B C   1 
ATOM   3803 O O   . ASP B 1 183 ? 61.798 -30.348 37.681 1.00 28.98  ? 164 ASP B O   1 
ATOM   3804 C CB  . ASP B 1 183 ? 62.644 -28.189 39.908 1.00 35.07  ? 164 ASP B CB  1 
ATOM   3805 C CG  . ASP B 1 183 ? 62.011 -27.071 39.184 1.00 36.36  ? 164 ASP B CG  1 
ATOM   3806 O OD1 . ASP B 1 183 ? 61.295 -26.279 39.815 1.00 37.87  ? 164 ASP B OD1 1 
ATOM   3807 O OD2 . ASP B 1 183 ? 62.240 -26.978 37.986 1.00 36.38  ? 164 ASP B OD2 1 
ATOM   3808 N N   . ARG B 1 184 ? 59.848 -29.461 38.333 1.00 28.68  ? 165 ARG B N   1 
ATOM   3809 C CA  . ARG B 1 184 ? 59.167 -29.848 37.076 1.00 27.72  ? 165 ARG B CA  1 
ATOM   3810 C C   . ARG B 1 184 ? 59.786 -29.225 35.821 1.00 25.26  ? 165 ARG B C   1 
ATOM   3811 O O   . ARG B 1 184 ? 60.061 -29.916 34.838 1.00 24.58  ? 165 ARG B O   1 
ATOM   3812 C CB  . ARG B 1 184 ? 57.678 -29.492 37.101 1.00 30.68  ? 165 ARG B CB  1 
ATOM   3813 C CG  . ARG B 1 184 ? 57.046 -29.576 35.724 1.00 33.13  ? 165 ARG B CG  1 
ATOM   3814 C CD  . ARG B 1 184 ? 55.544 -29.272 35.712 1.00 36.52  ? 165 ARG B CD  1 
ATOM   3815 N NE  . ARG B 1 184 ? 55.023 -29.330 34.348 1.00 39.17  ? 165 ARG B NE  1 
ATOM   3816 C CZ  . ARG B 1 184 ? 53.990 -30.081 33.950 1.00 40.81  ? 165 ARG B CZ  1 
ATOM   3817 N NH1 . ARG B 1 184 ? 53.319 -30.812 34.823 1.00 41.28  ? 165 ARG B NH1 1 
ATOM   3818 N NH2 . ARG B 1 184 ? 53.598 -30.063 32.682 1.00 40.71  ? 165 ARG B NH2 1 
ATOM   3819 N N   . GLU B 1 185 ? 59.997 -27.913 35.854 1.00 22.75  ? 166 GLU B N   1 
ATOM   3820 C CA  . GLU B 1 185 ? 60.526 -27.206 34.693 1.00 21.98  ? 166 GLU B CA  1 
ATOM   3821 C C   . GLU B 1 185 ? 61.933 -27.686 34.402 1.00 18.77  ? 166 GLU B C   1 
ATOM   3822 O O   . GLU B 1 185 ? 62.322 -27.874 33.264 1.00 18.66  ? 166 GLU B O   1 
ATOM   3823 C CB  . GLU B 1 185 ? 60.514 -25.682 34.931 1.00 27.74  ? 166 GLU B CB  1 
ATOM   3824 C CG  . GLU B 1 185 ? 59.120 -25.090 35.154 1.00 35.25  ? 166 GLU B CG  1 
ATOM   3825 C CD  . GLU B 1 185 ? 58.457 -25.498 36.494 1.00 42.56  ? 166 GLU B CD  1 
ATOM   3826 O OE1 . GLU B 1 185 ? 57.200 -25.522 36.519 1.00 47.34  ? 166 GLU B OE1 1 
ATOM   3827 O OE2 . GLU B 1 185 ? 59.163 -25.778 37.511 1.00 42.82  ? 166 GLU B OE2 1 
ATOM   3828 N N   . GLY B 1 186 ? 62.701 -27.953 35.440 1.00 17.64  ? 167 GLY B N   1 
ATOM   3829 C CA  . GLY B 1 186 ? 64.063 -28.388 35.215 1.00 16.72  ? 167 GLY B CA  1 
ATOM   3830 C C   . GLY B 1 186 ? 64.090 -29.813 34.689 1.00 15.48  ? 167 GLY B C   1 
ATOM   3831 O O   . GLY B 1 186 ? 64.935 -30.144 33.840 1.00 14.71  ? 167 GLY B O   1 
ATOM   3832 N N   . TYR B 1 187 ? 63.192 -30.650 35.224 1.00 15.61  ? 168 TYR B N   1 
ATOM   3833 C CA  . TYR B 1 187 ? 63.074 -32.020 34.721 1.00 16.64  ? 168 TYR B CA  1 
ATOM   3834 C C   . TYR B 1 187 ? 62.711 -32.024 33.219 1.00 17.40  ? 168 TYR B C   1 
ATOM   3835 O O   . TYR B 1 187 ? 63.341 -32.733 32.409 1.00 16.66  ? 168 TYR B O   1 
ATOM   3836 C CB  . TYR B 1 187 ? 62.038 -32.808 35.505 1.00 17.61  ? 168 TYR B CB  1 
ATOM   3837 C CG  . TYR B 1 187 ? 61.828 -34.163 34.905 1.00 18.27  ? 168 TYR B CG  1 
ATOM   3838 C CD1 . TYR B 1 187 ? 60.714 -34.440 34.135 1.00 19.56  ? 168 TYR B CD1 1 
ATOM   3839 C CD2 . TYR B 1 187 ? 62.769 -35.171 35.084 1.00 20.97  ? 168 TYR B CD2 1 
ATOM   3840 C CE1 . TYR B 1 187 ? 60.546 -35.678 33.551 1.00 20.95  ? 168 TYR B CE1 1 
ATOM   3841 C CE2 . TYR B 1 187 ? 62.586 -36.426 34.541 1.00 21.92  ? 168 TYR B CE2 1 
ATOM   3842 C CZ  . TYR B 1 187 ? 61.479 -36.669 33.757 1.00 22.33  ? 168 TYR B CZ  1 
ATOM   3843 O OH  . TYR B 1 187 ? 61.299 -37.923 33.189 1.00 23.79  ? 168 TYR B OH  1 
ATOM   3844 N N   . LEU B 1 188 ? 61.700 -31.246 32.822 1.00 17.48  ? 169 LEU B N   1 
ATOM   3845 C CA  . LEU B 1 188 ? 61.297 -31.300 31.403 1.00 17.62  ? 169 LEU B CA  1 
ATOM   3846 C C   . LEU B 1 188 ? 62.376 -30.681 30.502 1.00 15.12  ? 169 LEU B C   1 
ATOM   3847 O O   . LEU B 1 188 ? 62.570 -31.138 29.374 1.00 15.90  ? 169 LEU B O   1 
ATOM   3848 C CB  . LEU B 1 188 ? 59.943 -30.615 31.184 1.00 21.84  ? 169 LEU B CB  1 
ATOM   3849 C CG  . LEU B 1 188 ? 58.792 -31.358 31.877 1.00 25.47  ? 169 LEU B CG  1 
ATOM   3850 C CD1 . LEU B 1 188 ? 57.512 -30.536 31.891 1.00 28.99  ? 169 LEU B CD1 1 
ATOM   3851 C CD2 . LEU B 1 188 ? 58.543 -32.735 31.255 1.00 25.98  ? 169 LEU B CD2 1 
ATOM   3852 N N   . THR B 1 189 ? 63.078 -29.652 30.991 1.00 13.81  ? 170 THR B N   1 
ATOM   3853 C CA  . THR B 1 189 ? 64.212 -29.110 30.243 1.00 12.97  ? 170 THR B CA  1 
ATOM   3854 C C   . THR B 1 189 ? 65.296 -30.157 30.003 1.00 13.25  ? 170 THR B C   1 
ATOM   3855 O O   . THR B 1 189 ? 65.845 -30.260 28.892 1.00 13.34  ? 170 THR B O   1 
ATOM   3856 C CB  . THR B 1 189 ? 64.809 -27.858 30.978 1.00 12.99  ? 170 THR B CB  1 
ATOM   3857 O OG1 . THR B 1 189 ? 63.778 -26.865 31.048 1.00 15.04  ? 170 THR B OG1 1 
ATOM   3858 C CG2 . THR B 1 189 ? 65.965 -27.260 30.207 1.00 13.01  ? 170 THR B CG2 1 
ATOM   3859 N N   . LEU B 1 190 ? 65.604 -30.942 31.032 1.00 13.10  ? 171 LEU B N   1 
ATOM   3860 C CA  . LEU B 1 190 ? 66.587 -32.015 30.883 1.00 12.69  ? 171 LEU B CA  1 
ATOM   3861 C C   . LEU B 1 190 ? 66.106 -33.120 29.945 1.00 12.22  ? 171 LEU B C   1 
ATOM   3862 O O   . LEU B 1 190 ? 66.864 -33.586 29.033 1.00 13.39  ? 171 LEU B O   1 
ATOM   3863 C CB  . LEU B 1 190 ? 66.929 -32.607 32.271 1.00 13.91  ? 171 LEU B CB  1 
ATOM   3864 C CG  . LEU B 1 190 ? 67.914 -33.768 32.274 1.00 15.80  ? 171 LEU B CG  1 
ATOM   3865 C CD1 . LEU B 1 190 ? 69.314 -33.377 31.700 1.00 15.49  ? 171 LEU B CD1 1 
ATOM   3866 C CD2 . LEU B 1 190 ? 68.007 -34.336 33.697 1.00 19.92  ? 171 LEU B CD2 1 
ATOM   3867 N N   . ARG B 1 191 ? 64.856 -33.542 30.136 1.00 12.60  ? 172 ARG B N   1 
ATOM   3868 C CA  . ARG B 1 191 ? 64.315 -34.700 29.385 1.00 14.60  ? 172 ARG B CA  1 
ATOM   3869 C C   . ARG B 1 191 ? 64.251 -34.374 27.879 1.00 13.72  ? 172 ARG B C   1 
ATOM   3870 O O   . ARG B 1 191 ? 64.397 -35.265 27.038 1.00 14.54  ? 172 ARG B O   1 
ATOM   3871 C CB  . ARG B 1 191 ? 62.927 -35.069 29.899 1.00 16.90  ? 172 ARG B CB  1 
ATOM   3872 C CG  . ARG B 1 191 ? 62.336 -36.377 29.313 1.00 21.67  ? 172 ARG B CG  1 
ATOM   3873 C CD  . ARG B 1 191 ? 63.295 -37.568 29.548 1.00 25.86  ? 172 ARG B CD  1 
ATOM   3874 N NE  . ARG B 1 191 ? 62.884 -38.800 28.869 1.00 30.33  ? 172 ARG B NE  1 
ATOM   3875 C CZ  . ARG B 1 191 ? 63.701 -39.609 28.194 1.00 30.99  ? 172 ARG B CZ  1 
ATOM   3876 N NH1 . ARG B 1 191 ? 65.007 -39.339 28.093 1.00 25.85  ? 172 ARG B NH1 1 
ATOM   3877 N NH2 . ARG B 1 191 ? 63.211 -40.713 27.630 1.00 34.28  ? 172 ARG B NH2 1 
ATOM   3878 N N   . ARG B 1 192 ? 63.978 -33.124 27.532 1.00 13.73  ? 173 ARG B N   1 
ATOM   3879 C CA  . ARG B 1 192 ? 63.947 -32.783 26.093 1.00 12.50  ? 173 ARG B CA  1 
ATOM   3880 C C   . ARG B 1 192 ? 65.287 -33.080 25.421 1.00 11.89  ? 173 ARG B C   1 
ATOM   3881 O O   . ARG B 1 192 ? 65.329 -33.443 24.216 1.00 15.73  ? 173 ARG B O   1 
ATOM   3882 C CB  . ARG B 1 192 ? 63.585 -31.299 25.886 1.00 12.94  ? 173 ARG B CB  1 
ATOM   3883 C CG  . ARG B 1 192 ? 62.071 -31.048 25.918 1.00 13.69  ? 173 ARG B CG  1 
ATOM   3884 C CD  . ARG B 1 192 ? 61.798 -29.549 25.835 1.00 13.34  ? 173 ARG B CD  1 
ATOM   3885 N NE  . ARG B 1 192 ? 60.405 -29.278 25.655 1.00 16.07  ? 173 ARG B NE  1 
ATOM   3886 C CZ  . ARG B 1 192 ? 59.899 -28.052 25.586 1.00 18.28  ? 173 ARG B CZ  1 
ATOM   3887 N NH1 . ARG B 1 192 ? 60.690 -26.983 25.714 1.00 21.87  ? 173 ARG B NH1 1 
ATOM   3888 N NH2 . ARG B 1 192 ? 58.606 -27.892 25.397 1.00 17.32  ? 173 ARG B NH2 1 
ATOM   3889 N N   . GLY B 1 193 ? 66.385 -32.928 26.180 1.00 10.74  ? 174 GLY B N   1 
ATOM   3890 C CA  . GLY B 1 193 ? 67.718 -33.203 25.676 1.00 11.18  ? 174 GLY B CA  1 
ATOM   3891 C C   . GLY B 1 193 ? 68.011 -34.704 25.671 1.00 11.89  ? 174 GLY B C   1 
ATOM   3892 O O   . GLY B 1 193 ? 68.467 -35.257 24.667 1.00 13.52  ? 174 GLY B O   1 
ATOM   3893 N N   . THR B 1 194 ? 67.777 -35.361 26.804 1.00 11.78  ? 175 THR B N   1 
ATOM   3894 C CA  . THR B 1 194 ? 68.136 -36.773 26.854 1.00 11.94  ? 175 THR B CA  1 
ATOM   3895 C C   . THR B 1 194 ? 67.261 -37.679 25.984 1.00 13.65  ? 175 THR B C   1 
ATOM   3896 O O   . THR B 1 194 ? 67.686 -38.795 25.668 1.00 15.13  ? 175 THR B O   1 
ATOM   3897 C CB  . THR B 1 194 ? 68.111 -37.332 28.312 1.00 12.50  ? 175 THR B CB  1 
ATOM   3898 O OG1 . THR B 1 194 ? 66.785 -37.246 28.845 1.00 13.94  ? 175 THR B OG1 1 
ATOM   3899 C CG2 . THR B 1 194 ? 69.072 -36.525 29.195 1.00 14.92  ? 175 THR B CG2 1 
ATOM   3900 N N   . ALA B 1 195 ? 66.068 -37.213 25.605 1.00 12.86  ? 176 ALA B N   1 
ATOM   3901 C CA  . ALA B 1 195 ? 65.176 -38.017 24.756 1.00 12.60  ? 176 ALA B CA  1 
ATOM   3902 C C   . ALA B 1 195 ? 65.616 -38.062 23.306 1.00 14.03  ? 176 ALA B C   1 
ATOM   3903 O O   . ALA B 1 195 ? 65.125 -38.919 22.548 1.00 14.93  ? 176 ALA B O   1 
ATOM   3904 C CB  . ALA B 1 195 ? 63.718 -37.484 24.852 1.00 14.25  ? 176 ALA B CB  1 
ATOM   3905 N N   . ALA B 1 196 ? 66.501 -37.132 22.910 1.00 13.46  ? 177 ALA B N   1 
ATOM   3906 C CA  . ALA B 1 196 ? 67.096 -37.080 21.548 1.00 12.72  ? 177 ALA B CA  1 
ATOM   3907 C C   . ALA B 1 196 ? 66.068 -36.865 20.449 1.00 11.34  ? 177 ALA B C   1 
ATOM   3908 O O   . ALA B 1 196 ? 66.362 -37.147 19.293 1.00 12.11  ? 177 ALA B O   1 
ATOM   3909 C CB  . ALA B 1 196 ? 67.916 -38.372 21.251 1.00 14.36  ? 177 ALA B CB  1 
ATOM   3910 N N   . MET B 1 197 ? 64.888 -36.339 20.792 1.00 11.53  ? 178 MET B N   1 
ATOM   3911 C CA  . MET B 1 197 ? 63.855 -36.173 19.762 1.00 11.34  ? 178 MET B CA  1 
ATOM   3912 C C   . MET B 1 197 ? 64.290 -35.184 18.670 1.00 12.71  ? 178 MET B C   1 
ATOM   3913 O O   . MET B 1 197 ? 63.835 -35.297 17.531 1.00 12.00  ? 178 MET B O   1 
ATOM   3914 C CB  . MET B 1 197 ? 62.523 -35.744 20.372 1.00 13.88  ? 178 MET B CB  1 
ATOM   3915 C CG  . MET B 1 197 ? 61.844 -36.853 21.198 1.00 14.20  ? 178 MET B CG  1 
ATOM   3916 S SD  . MET B 1 197 ? 61.589 -38.403 20.230 1.00 16.34  ? 178 MET B SD  1 
ATOM   3917 C CE  . MET B 1 197 ? 60.440 -37.855 18.948 1.00 15.23  ? 178 MET B CE  1 
ATOM   3918 N N   . GLU B 1 198 ? 65.144 -34.216 18.983 1.00 11.12  ? 179 GLU B N   1 
ATOM   3919 C CA  . GLU B 1 198 ? 65.564 -33.271 17.923 1.00 11.70  ? 179 GLU B CA  1 
ATOM   3920 C C   . GLU B 1 198 ? 66.360 -33.998 16.860 1.00 11.15  ? 179 GLU B C   1 
ATOM   3921 O O   . GLU B 1 198 ? 66.086 -33.785 15.668 1.00 11.34  ? 179 GLU B O   1 
ATOM   3922 C CB  . GLU B 1 198 ? 66.374 -32.087 18.515 1.00 12.93  ? 179 GLU B CB  1 
ATOM   3923 C CG  . GLU B 1 198 ? 65.498 -31.142 19.382 1.00 14.19  ? 179 GLU B CG  1 
ATOM   3924 C CD  . GLU B 1 198 ? 64.330 -30.531 18.605 1.00 15.34  ? 179 GLU B CD  1 
ATOM   3925 O OE1 . GLU B 1 198 ? 63.248 -30.388 19.203 1.00 17.17  ? 179 GLU B OE1 1 
ATOM   3926 O OE2 . GLU B 1 198 ? 64.488 -30.232 17.389 1.00 15.43  ? 179 GLU B OE2 1 
ATOM   3927 N N   . SER B 1 199 ? 67.271 -34.911 17.263 1.00 11.81  ? 180 SER B N   1 
ATOM   3928 C CA  . SER B 1 199 ? 68.011 -35.691 16.244 1.00 11.50  ? 180 SER B CA  1 
ATOM   3929 C C   . SER B 1 199 ? 67.086 -36.685 15.565 1.00 11.35  ? 180 SER B C   1 
ATOM   3930 O O   . SER B 1 199 ? 67.190 -36.934 14.361 1.00 11.45  ? 180 SER B O   1 
ATOM   3931 C CB  . SER B 1 199 ? 69.207 -36.447 16.857 1.00 12.33  ? 180 SER B CB  1 
ATOM   3932 O OG  . SER B 1 199 ? 70.200 -35.536 17.325 1.00 12.60  ? 180 SER B OG  1 
ATOM   3933 N N   . ILE B 1 200 ? 66.162 -37.254 16.324 1.00 12.29  ? 181 ILE B N   1 
ATOM   3934 C CA  . ILE B 1 200 ? 65.248 -38.237 15.735 1.00 12.80  ? 181 ILE B CA  1 
ATOM   3935 C C   . ILE B 1 200 ? 64.380 -37.560 14.636 1.00 12.71  ? 181 ILE B C   1 
ATOM   3936 O O   . ILE B 1 200 ? 64.102 -38.164 13.605 1.00 12.41  ? 181 ILE B O   1 
ATOM   3937 C CB  . ILE B 1 200 ? 64.423 -38.852 16.862 1.00 13.72  ? 181 ILE B CB  1 
ATOM   3938 C CG1 . ILE B 1 200 ? 65.289 -39.946 17.537 1.00 16.95  ? 181 ILE B CG1 1 
ATOM   3939 C CG2 . ILE B 1 200 ? 63.067 -39.383 16.352 1.00 14.59  ? 181 ILE B CG2 1 
ATOM   3940 C CD1 . ILE B 1 200 ? 64.849 -40.369 18.977 1.00 17.63  ? 181 ILE B CD1 1 
ATOM   3941 N N   . PHE B 1 201 ? 64.000 -36.298 14.836 1.00 12.03  ? 182 PHE B N   1 
ATOM   3942 C CA  . PHE B 1 201 ? 63.261 -35.612 13.772 1.00 11.72  ? 182 PHE B CA  1 
ATOM   3943 C C   . PHE B 1 201 ? 64.173 -35.065 12.676 1.00 11.15  ? 182 PHE B C   1 
ATOM   3944 O O   . PHE B 1 201 ? 63.715 -34.924 11.533 1.00 11.39  ? 182 PHE B O   1 
ATOM   3945 C CB  . PHE B 1 201 ? 62.381 -34.500 14.346 1.00 11.27  ? 182 PHE B CB  1 
ATOM   3946 C CG  . PHE B 1 201 ? 61.169 -35.019 15.087 1.00 13.67  ? 182 PHE B CG  1 
ATOM   3947 C CD1 . PHE B 1 201 ? 60.668 -36.322 14.872 1.00 15.75  ? 182 PHE B CD1 1 
ATOM   3948 C CD2 . PHE B 1 201 ? 60.558 -34.239 16.043 1.00 15.15  ? 182 PHE B CD2 1 
ATOM   3949 C CE1 . PHE B 1 201 ? 59.554 -36.781 15.569 1.00 17.02  ? 182 PHE B CE1 1 
ATOM   3950 C CE2 . PHE B 1 201 ? 59.443 -34.684 16.748 1.00 15.97  ? 182 PHE B CE2 1 
ATOM   3951 C CZ  . PHE B 1 201 ? 58.952 -35.979 16.531 1.00 15.67  ? 182 PHE B CZ  1 
ATOM   3952 N N   . ASP B 1 202 ? 65.439 -34.755 12.988 1.00 11.29  ? 183 ASP B N   1 
ATOM   3953 C CA  . ASP B 1 202 ? 66.424 -34.467 11.919 1.00 11.32  ? 183 ASP B CA  1 
ATOM   3954 C C   . ASP B 1 202 ? 66.454 -35.631 10.914 1.00 11.94  ? 183 ASP B C   1 
ATOM   3955 O O   . ASP B 1 202 ? 66.588 -35.435 9.673  1.00 13.37  ? 183 ASP B O   1 
ATOM   3956 C CB  . ASP B 1 202 ? 67.828 -34.251 12.479 1.00 12.30  ? 183 ASP B CB  1 
ATOM   3957 C CG  . ASP B 1 202 ? 67.992 -32.924 13.215 1.00 11.31  ? 183 ASP B CG  1 
ATOM   3958 O OD1 . ASP B 1 202 ? 67.233 -31.954 12.970 1.00 12.24  ? 183 ASP B OD1 1 
ATOM   3959 O OD2 . ASP B 1 202 ? 68.979 -32.824 14.005 1.00 11.54  ? 183 ASP B OD2 1 
ATOM   3960 N N   . MET B 1 203 ? 66.313 -36.848 11.437 1.00 11.69  ? 184 MET B N   1 
ATOM   3961 C CA  A MET B 1 203 ? 66.381 -38.032 10.574 0.50 13.23  ? 184 MET B CA  1 
ATOM   3962 C CA  B MET B 1 203 ? 66.408 -38.026 10.565 0.50 12.02  ? 184 MET B CA  1 
ATOM   3963 C C   . MET B 1 203 ? 65.227 -38.149 9.592  1.00 13.59  ? 184 MET B C   1 
ATOM   3964 O O   . MET B 1 203 ? 65.345 -38.865 8.610  1.00 13.39  ? 184 MET B O   1 
ATOM   3965 C CB  A MET B 1 203 ? 66.477 -39.302 11.426 0.50 14.59  ? 184 MET B CB  1 
ATOM   3966 C CB  B MET B 1 203 ? 66.538 -39.309 11.398 0.50 11.16  ? 184 MET B CB  1 
ATOM   3967 C CG  A MET B 1 203 ? 67.722 -39.336 12.296 0.50 16.40  ? 184 MET B CG  1 
ATOM   3968 C CG  B MET B 1 203 ? 67.834 -39.381 12.184 0.50 10.65  ? 184 MET B CG  1 
ATOM   3969 S SD  A MET B 1 203 ? 69.283 -39.499 11.408 0.50 19.77  ? 184 MET B SD  1 
ATOM   3970 S SD  B MET B 1 203 ? 69.315 -39.251 11.171 0.50 11.40  ? 184 MET B SD  1 
ATOM   3971 C CE  A MET B 1 203 ? 69.598 -37.861 10.779 0.50 21.60  ? 184 MET B CE  1 
ATOM   3972 C CE  B MET B 1 203 ? 69.241 -40.860 10.340 0.50 8.06   ? 184 MET B CE  1 
ATOM   3973 N N   . ILE B 1 204 ? 64.104 -37.467 9.842  1.00 13.39  ? 185 ILE B N   1 
ATOM   3974 C CA  . ILE B 1 204 ? 63.028 -37.487 8.826  1.00 13.95  ? 185 ILE B CA  1 
ATOM   3975 C C   . ILE B 1 204 ? 63.584 -36.988 7.475  1.00 13.14  ? 185 ILE B C   1 
ATOM   3976 O O   . ILE B 1 204 ? 63.349 -37.596 6.423  1.00 14.96  ? 185 ILE B O   1 
ATOM   3977 C CB  . ILE B 1 204 ? 61.832 -36.618 9.259  1.00 14.00  ? 185 ILE B CB  1 
ATOM   3978 C CG1 . ILE B 1 204 ? 61.210 -37.187 10.557 1.00 15.03  ? 185 ILE B CG1 1 
ATOM   3979 C CG2 . ILE B 1 204 ? 60.798 -36.399 8.113  1.00 14.56  ? 185 ILE B CG2 1 
ATOM   3980 C CD1 . ILE B 1 204 ? 60.065 -36.315 11.161 1.00 13.62  ? 185 ILE B CD1 1 
ATOM   3981 N N   . GLU B 1 205 ? 64.380 -35.917 7.511  1.00 12.06  ? 186 GLU B N   1 
ATOM   3982 C CA  . GLU B 1 205 ? 65.034 -35.413 6.291  1.00 12.52  ? 186 GLU B CA  1 
ATOM   3983 C C   . GLU B 1 205 ? 66.084 -36.395 5.694  1.00 13.24  ? 186 GLU B C   1 
ATOM   3984 O O   . GLU B 1 205 ? 66.061 -36.678 4.471  1.00 13.31  ? 186 GLU B O   1 
ATOM   3985 C CB  . GLU B 1 205 ? 65.698 -34.061 6.596  1.00 12.38  ? 186 GLU B CB  1 
ATOM   3986 C CG  . GLU B 1 205 ? 64.684 -32.967 6.773  1.00 12.43  ? 186 GLU B CG  1 
ATOM   3987 C CD  . GLU B 1 205 ? 65.331 -31.672 7.304  1.00 12.91  ? 186 GLU B CD  1 
ATOM   3988 O OE1 . GLU B 1 205 ? 65.398 -30.636 6.567  1.00 14.83  ? 186 GLU B OE1 1 
ATOM   3989 O OE2 . GLU B 1 205 ? 65.807 -31.718 8.463  1.00 13.24  ? 186 GLU B OE2 1 
ATOM   3990 N N   . ARG B 1 206 ? 66.991 -36.906 6.523  1.00 13.69  ? 187 ARG B N   1 
ATOM   3991 C CA  . ARG B 1 206 ? 68.033 -37.784 6.022  1.00 13.51  ? 187 ARG B CA  1 
ATOM   3992 C C   . ARG B 1 206 ? 67.442 -39.111 5.453  1.00 13.37  ? 187 ARG B C   1 
ATOM   3993 O O   . ARG B 1 206 ? 67.859 -39.589 4.376  1.00 14.04  ? 187 ARG B O   1 
ATOM   3994 C CB  . ARG B 1 206 ? 69.069 -38.099 7.132  1.00 12.81  ? 187 ARG B CB  1 
ATOM   3995 C CG  . ARG B 1 206 ? 69.973 -39.316 6.842  1.00 13.10  ? 187 ARG B CG  1 
ATOM   3996 C CD  . ARG B 1 206 ? 70.868 -39.122 5.589  1.00 13.90  ? 187 ARG B CD  1 
ATOM   3997 N NE  . ARG B 1 206 ? 71.772 -40.252 5.382  1.00 13.74  ? 187 ARG B NE  1 
ATOM   3998 C CZ  . ARG B 1 206 ? 71.400 -41.446 4.874  1.00 14.32  ? 187 ARG B CZ  1 
ATOM   3999 N NH1 . ARG B 1 206 ? 70.132 -41.663 4.473  1.00 14.12  ? 187 ARG B NH1 1 
ATOM   4000 N NH2 . ARG B 1 206 ? 72.300 -42.435 4.769  1.00 14.82  ? 187 ARG B NH2 1 
ATOM   4001 N N   . LEU B 1 207 ? 66.487 -39.704 6.166  1.00 13.07  ? 188 LEU B N   1 
ATOM   4002 C CA  . LEU B 1 207 ? 65.917 -40.993 5.708  1.00 13.93  ? 188 LEU B CA  1 
ATOM   4003 C C   . LEU B 1 207 ? 64.923 -40.808 4.534  1.00 16.36  ? 188 LEU B C   1 
ATOM   4004 O O   . LEU B 1 207 ? 64.694 -41.756 3.768  1.00 19.11  ? 188 LEU B O   1 
ATOM   4005 C CB  . LEU B 1 207 ? 65.263 -41.757 6.873  1.00 13.99  ? 188 LEU B CB  1 
ATOM   4006 C CG  . LEU B 1 207 ? 66.213 -41.984 8.069  1.00 13.08  ? 188 LEU B CG  1 
ATOM   4007 C CD1 . LEU B 1 207 ? 65.462 -42.695 9.187  1.00 13.22  ? 188 LEU B CD1 1 
ATOM   4008 C CD2 . LEU B 1 207 ? 67.455 -42.798 7.645  1.00 14.61  ? 188 LEU B CD2 1 
ATOM   4009 N N   . GLY B 1 208 ? 64.393 -39.593 4.377  1.00 15.48  ? 189 GLY B N   1 
ATOM   4010 C CA  . GLY B 1 208 ? 63.537 -39.224 3.266  1.00 16.44  ? 189 GLY B CA  1 
ATOM   4011 C C   . GLY B 1 208 ? 64.256 -38.603 2.078  1.00 18.29  ? 189 GLY B C   1 
ATOM   4012 O O   . GLY B 1 208 ? 63.637 -38.345 1.048  1.00 21.20  ? 189 GLY B O   1 
ATOM   4013 N N   . HIS B 1 209 ? 65.550 -38.340 2.223  1.00 16.04  ? 190 HIS B N   1 
ATOM   4014 C CA  . HIS B 1 209 ? 66.363 -37.707 1.172  1.00 17.93  ? 190 HIS B CA  1 
ATOM   4015 C C   . HIS B 1 209 ? 65.791 -36.382 0.684  1.00 17.29  ? 190 HIS B C   1 
ATOM   4016 O O   . HIS B 1 209 ? 65.651 -36.119 -0.531 1.00 18.97  ? 190 HIS B O   1 
ATOM   4017 C CB  . HIS B 1 209 ? 66.567 -38.708 0.016  1.00 18.01  ? 190 HIS B CB  1 
ATOM   4018 C CG  . HIS B 1 209 ? 67.266 -39.946 0.472  1.00 21.23  ? 190 HIS B CG  1 
ATOM   4019 N ND1 . HIS B 1 209 ? 68.645 -40.023 0.541  1.00 24.86  ? 190 HIS B ND1 1 
ATOM   4020 C CD2 . HIS B 1 209 ? 66.792 -41.092 1.017  1.00 20.45  ? 190 HIS B CD2 1 
ATOM   4021 C CE1 . HIS B 1 209 ? 68.982 -41.209 1.023  1.00 23.83  ? 190 HIS B CE1 1 
ATOM   4022 N NE2 . HIS B 1 209 ? 67.878 -41.873 1.321  1.00 21.10  ? 190 HIS B NE2 1 
ATOM   4023 N N   . PHE B 1 210 ? 65.474 -35.517 1.638  1.00 17.45  ? 191 PHE B N   1 
ATOM   4024 C CA  . PHE B 1 210 ? 65.034 -34.159 1.295  1.00 16.24  ? 191 PHE B CA  1 
ATOM   4025 C C   . PHE B 1 210 ? 65.385 -33.218 2.428  1.00 15.68  ? 191 PHE B C   1 
ATOM   4026 O O   . PHE B 1 210 ? 65.654 -33.686 3.535  1.00 16.37  ? 191 PHE B O   1 
ATOM   4027 C CB  . PHE B 1 210 ? 63.525 -34.119 0.985  1.00 17.63  ? 191 PHE B CB  1 
ATOM   4028 C CG  . PHE B 1 210 ? 62.631 -34.241 2.192  1.00 18.29  ? 191 PHE B CG  1 
ATOM   4029 C CD1 . PHE B 1 210 ? 61.931 -33.137 2.674  1.00 17.84  ? 191 PHE B CD1 1 
ATOM   4030 C CD2 . PHE B 1 210 ? 62.508 -35.455 2.875  1.00 19.02  ? 191 PHE B CD2 1 
ATOM   4031 C CE1 . PHE B 1 210 ? 61.089 -33.255 3.799  1.00 17.94  ? 191 PHE B CE1 1 
ATOM   4032 C CE2 . PHE B 1 210 ? 61.682 -35.566 3.989  1.00 18.76  ? 191 PHE B CE2 1 
ATOM   4033 C CZ  . PHE B 1 210 ? 60.975 -34.450 4.456  1.00 18.17  ? 191 PHE B CZ  1 
ATOM   4034 N N   . GLU B 1 211 ? 65.441 -31.906 2.141  1.00 16.16  ? 192 GLU B N   1 
ATOM   4035 C CA  . GLU B 1 211 ? 65.699 -30.924 3.196  1.00 15.44  ? 192 GLU B CA  1 
ATOM   4036 C C   . GLU B 1 211 ? 64.557 -29.910 3.142  1.00 14.78  ? 192 GLU B C   1 
ATOM   4037 O O   . GLU B 1 211 ? 64.148 -29.464 2.068  1.00 17.25  ? 192 GLU B O   1 
ATOM   4038 C CB  . GLU B 1 211 ? 67.083 -30.268 3.063  1.00 14.26  ? 192 GLU B CB  1 
ATOM   4039 C CG  . GLU B 1 211 ? 68.226 -31.270 3.305  1.00 15.12  ? 192 GLU B CG  1 
ATOM   4040 C CD  . GLU B 1 211 ? 69.641 -30.707 3.209  1.00 14.61  ? 192 GLU B CD  1 
ATOM   4041 O OE1 . GLU B 1 211 ? 69.854 -29.447 3.333  1.00 17.22  ? 192 GLU B OE1 1 
ATOM   4042 O OE2 . GLU B 1 211 ? 70.550 -31.563 2.962  1.00 15.43  ? 192 GLU B OE2 1 
ATOM   4043 N N   . VAL B 1 212 ? 64.008 -29.551 4.301  1.00 13.28  ? 193 VAL B N   1 
ATOM   4044 C CA  A VAL B 1 212 ? 62.842 -28.696 4.211  0.50 15.47  ? 193 VAL B CA  1 
ATOM   4045 C CA  B VAL B 1 212 ? 62.854 -28.656 4.420  0.50 12.23  ? 193 VAL B CA  1 
ATOM   4046 C C   . VAL B 1 212 ? 63.255 -27.229 4.118  1.00 14.53  ? 193 VAL B C   1 
ATOM   4047 O O   . VAL B 1 212 ? 64.282 -26.793 4.657  1.00 15.51  ? 193 VAL B O   1 
ATOM   4048 C CB  A VAL B 1 212 ? 61.805 -28.986 5.365  0.50 19.67  ? 193 VAL B CB  1 
ATOM   4049 C CB  B VAL B 1 212 ? 62.279 -28.781 5.854  0.50 9.84   ? 193 VAL B CB  1 
ATOM   4050 C CG1 A VAL B 1 212 ? 62.325 -29.976 6.431  0.50 20.61  ? 193 VAL B CG1 1 
ATOM   4051 C CG1 B VAL B 1 212 ? 61.099 -27.901 6.079  0.50 11.76  ? 193 VAL B CG1 1 
ATOM   4052 C CG2 A VAL B 1 212 ? 61.134 -27.729 5.907  0.50 20.53  ? 193 VAL B CG2 1 
ATOM   4053 C CG2 B VAL B 1 212 ? 61.828 -30.247 6.092  0.50 8.92   ? 193 VAL B CG2 1 
ATOM   4054 N N   . PRO B 1 213 ? 62.470 -26.483 3.303  1.00 14.95  ? 194 PRO B N   1 
ATOM   4055 C CA  . PRO B 1 213 ? 62.771 -25.054 3.099  1.00 14.41  ? 194 PRO B CA  1 
ATOM   4056 C C   . PRO B 1 213 ? 62.876 -24.324 4.441  1.00 14.64  ? 194 PRO B C   1 
ATOM   4057 O O   . PRO B 1 213 ? 62.047 -24.562 5.310  1.00 14.54  ? 194 PRO B O   1 
ATOM   4058 C CB  . PRO B 1 213 ? 61.553 -24.535 2.309  1.00 16.30  ? 194 PRO B CB  1 
ATOM   4059 C CG  . PRO B 1 213 ? 61.054 -25.785 1.565  1.00 17.09  ? 194 PRO B CG  1 
ATOM   4060 C CD  . PRO B 1 213 ? 61.292 -26.923 2.517  1.00 15.78  ? 194 PRO B CD  1 
ATOM   4061 N N   . GLN B 1 214 ? 63.832 -23.417 4.590  1.00 13.92  ? 195 GLN B N   1 
ATOM   4062 C CA  . GLN B 1 214 ? 64.001 -22.819 5.939  1.00 13.05  ? 195 GLN B CA  1 
ATOM   4063 C C   . GLN B 1 214 ? 62.743 -22.106 6.463  1.00 14.66  ? 195 GLN B C   1 
ATOM   4064 O O   . GLN B 1 214 ? 62.460 -22.137 7.666  1.00 13.95  ? 195 GLN B O   1 
ATOM   4065 C CB  . GLN B 1 214 ? 65.200 -21.869 5.941  1.00 13.61  ? 195 GLN B CB  1 
ATOM   4066 C CG  . GLN B 1 214 ? 64.990 -20.556 5.145  1.00 13.90  ? 195 GLN B CG  1 
ATOM   4067 C CD  . GLN B 1 214 ? 66.091 -19.562 5.445  1.00 13.97  ? 195 GLN B CD  1 
ATOM   4068 O OE1 . GLN B 1 214 ? 67.091 -19.920 6.075  1.00 15.51  ? 195 GLN B OE1 1 
ATOM   4069 N NE2 . GLN B 1 214 ? 65.888 -18.298 5.082  1.00 13.77  ? 195 GLN B NE2 1 
ATOM   4070 N N   . HIS B 1 215 ? 61.964 -21.458 5.586  1.00 13.91  ? 196 HIS B N   1 
ATOM   4071 C CA  . HIS B 1 215 ? 60.826 -20.698 6.097  1.00 14.43  ? 196 HIS B CA  1 
ATOM   4072 C C   . HIS B 1 215 ? 59.570 -21.537 6.307  1.00 15.59  ? 196 HIS B C   1 
ATOM   4073 O O   . HIS B 1 215 ? 58.541 -21.017 6.782  1.00 15.53  ? 196 HIS B O   1 
ATOM   4074 C CB  . HIS B 1 215 ? 60.554 -19.484 5.164  1.00 15.37  ? 196 HIS B CB  1 
ATOM   4075 C CG  . HIS B 1 215 ? 60.310 -19.852 3.732  1.00 17.72  ? 196 HIS B CG  1 
ATOM   4076 N ND1 . HIS B 1 215 ? 61.269 -20.447 2.939  1.00 20.16  ? 196 HIS B ND1 1 
ATOM   4077 C CD2 . HIS B 1 215 ? 59.224 -19.661 2.940  1.00 18.48  ? 196 HIS B CD2 1 
ATOM   4078 C CE1 . HIS B 1 215 ? 60.776 -20.619 1.724  1.00 20.13  ? 196 HIS B CE1 1 
ATOM   4079 N NE2 . HIS B 1 215 ? 59.541 -20.152 1.700  1.00 20.69  ? 196 HIS B NE2 1 
ATOM   4080 N N   . VAL B 1 216 ? 59.667 -22.839 5.991  1.00 15.12  ? 197 VAL B N   1 
ATOM   4081 C CA  . VAL B 1 216 ? 58.736 -23.836 6.464  1.00 15.15  ? 197 VAL B CA  1 
ATOM   4082 C C   . VAL B 1 216 ? 59.203 -24.367 7.842  1.00 14.33  ? 197 VAL B C   1 
ATOM   4083 O O   . VAL B 1 216 ? 58.422 -24.375 8.821  1.00 14.06  ? 197 VAL B O   1 
ATOM   4084 C CB  . VAL B 1 216 ? 58.612 -25.010 5.450  1.00 15.02  ? 197 VAL B CB  1 
ATOM   4085 C CG1 . VAL B 1 216 ? 57.809 -26.151 6.057  1.00 14.99  ? 197 VAL B CG1 1 
ATOM   4086 C CG2 . VAL B 1 216 ? 57.944 -24.495 4.167  1.00 16.25  ? 197 VAL B CG2 1 
ATOM   4087 N N   . MET B 1 217 ? 60.460 -24.812 7.904  1.00 13.75  ? 198 MET B N   1 
ATOM   4088 C CA  A MET B 1 217 ? 61.010 -25.370 9.144  0.50 15.05  ? 198 MET B CA  1 
ATOM   4089 C CA  B MET B 1 217 ? 61.061 -25.297 9.141  0.50 13.54  ? 198 MET B CA  1 
ATOM   4090 C C   . MET B 1 217 ? 60.780 -24.379 10.315 1.00 14.00  ? 198 MET B C   1 
ATOM   4091 O O   . MET B 1 217 ? 60.383 -24.811 11.430 1.00 13.91  ? 198 MET B O   1 
ATOM   4092 C CB  A MET B 1 217 ? 62.517 -25.736 8.987  0.50 16.20  ? 198 MET B CB  1 
ATOM   4093 C CB  B MET B 1 217 ? 62.575 -25.443 8.987  0.50 14.75  ? 198 MET B CB  1 
ATOM   4094 C CG  A MET B 1 217 ? 62.856 -27.273 8.598  0.50 18.88  ? 198 MET B CG  1 
ATOM   4095 C CG  B MET B 1 217 ? 63.315 -25.696 10.299 0.50 14.79  ? 198 MET B CG  1 
ATOM   4096 S SD  A MET B 1 217 ? 63.515 -28.519 9.748  0.50 19.85  ? 198 MET B SD  1 
ATOM   4097 S SD  B MET B 1 217 ? 63.437 -27.392 10.825 0.50 22.61  ? 198 MET B SD  1 
ATOM   4098 C CE  A MET B 1 217 ? 62.744 -27.615 11.059 0.50 6.32   ? 198 MET B CE  1 
ATOM   4099 C CE  B MET B 1 217 ? 61.907 -27.726 11.115 0.50 26.73  ? 198 MET B CE  1 
ATOM   4100 N N   . HIS B 1 218 ? 60.999 -23.083 10.074 1.00 12.04  ? 199 HIS B N   1 
ATOM   4101 C CA  . HIS B 1 218 ? 60.889 -22.120 11.171 1.00 12.30  ? 199 HIS B CA  1 
ATOM   4102 C C   . HIS B 1 218 ? 59.581 -21.306 11.222 1.00 13.54  ? 199 HIS B C   1 
ATOM   4103 O O   . HIS B 1 218 ? 59.434 -20.394 12.062 1.00 15.69  ? 199 HIS B O   1 
ATOM   4104 C CB  . HIS B 1 218 ? 62.078 -21.166 11.117 1.00 12.69  ? 199 HIS B CB  1 
ATOM   4105 C CG  . HIS B 1 218 ? 63.370 -21.855 11.389 1.00 12.84  ? 199 HIS B CG  1 
ATOM   4106 N ND1 . HIS B 1 218 ? 63.700 -22.333 12.640 1.00 14.95  ? 199 HIS B ND1 1 
ATOM   4107 C CD2 . HIS B 1 218 ? 64.407 -22.164 10.578 1.00 13.97  ? 199 HIS B CD2 1 
ATOM   4108 C CE1 . HIS B 1 218 ? 64.893 -22.889 12.590 1.00 15.51  ? 199 HIS B CE1 1 
ATOM   4109 N NE2 . HIS B 1 218 ? 65.343 -22.808 11.345 1.00 15.88  ? 199 HIS B NE2 1 
ATOM   4110 N N   . HIS B 1 219 ? 58.631 -21.641 10.353 1.00 15.34  ? 200 HIS B N   1 
ATOM   4111 C CA  . HIS B 1 219 ? 57.280 -21.099 10.506 1.00 15.40  ? 200 HIS B CA  1 
ATOM   4112 C C   . HIS B 1 219 ? 56.694 -21.541 11.861 1.00 14.89  ? 200 HIS B C   1 
ATOM   4113 O O   . HIS B 1 219 ? 56.883 -22.713 12.251 1.00 13.58  ? 200 HIS B O   1 
ATOM   4114 C CB  . HIS B 1 219 ? 56.406 -21.564 9.331  1.00 16.03  ? 200 HIS B CB  1 
ATOM   4115 C CG  . HIS B 1 219 ? 55.031 -20.972 9.312  1.00 16.25  ? 200 HIS B CG  1 
ATOM   4116 N ND1 . HIS B 1 219 ? 54.036 -21.362 10.185 1.00 15.91  ? 200 HIS B ND1 1 
ATOM   4117 C CD2 . HIS B 1 219 ? 54.483 -20.027 8.508  1.00 16.82  ? 200 HIS B CD2 1 
ATOM   4118 C CE1 . HIS B 1 219 ? 52.934 -20.678 9.916  1.00 17.19  ? 200 HIS B CE1 1 
ATOM   4119 N NE2 . HIS B 1 219 ? 53.181 -19.855 8.909  1.00 17.81  ? 200 HIS B NE2 1 
ATOM   4120 N N   . PRO B 1 220 ? 55.997 -20.636 12.588 1.00 14.12  ? 201 PRO B N   1 
ATOM   4121 C CA  . PRO B 1 220 ? 55.563 -20.982 13.956 1.00 14.21  ? 201 PRO B CA  1 
ATOM   4122 C C   . PRO B 1 220 ? 54.609 -22.164 14.006 1.00 13.54  ? 201 PRO B C   1 
ATOM   4123 O O   . PRO B 1 220 ? 54.581 -22.859 15.019 1.00 14.64  ? 201 PRO B O   1 
ATOM   4124 C CB  . PRO B 1 220 ? 54.889 -19.688 14.466 1.00 16.07  ? 201 PRO B CB  1 
ATOM   4125 C CG  . PRO B 1 220 ? 54.503 -18.966 13.221 1.00 17.66  ? 201 PRO B CG  1 
ATOM   4126 C CD  . PRO B 1 220 ? 55.621 -19.237 12.258 1.00 15.23  ? 201 PRO B CD  1 
ATOM   4127 N N   . LEU B 1 221 ? 53.859 -22.446 12.947 1.00 14.72  ? 202 LEU B N   1 
ATOM   4128 C CA  A LEU B 1 221 ? 53.036 -23.651 12.907 0.50 16.20  ? 202 LEU B CA  1 
ATOM   4129 C CA  B LEU B 1 221 ? 53.031 -23.649 12.978 0.50 14.37  ? 202 LEU B CA  1 
ATOM   4130 C C   . LEU B 1 221 ? 53.905 -24.904 13.009 1.00 14.88  ? 202 LEU B C   1 
ATOM   4131 O O   . LEU B 1 221 ? 53.604 -25.853 13.790 1.00 15.67  ? 202 LEU B O   1 
ATOM   4132 C CB  A LEU B 1 221 ? 52.226 -23.677 11.603 0.50 18.49  ? 202 LEU B CB  1 
ATOM   4133 C CB  B LEU B 1 221 ? 52.079 -23.697 11.772 0.50 13.52  ? 202 LEU B CB  1 
ATOM   4134 C CG  A LEU B 1 221 ? 51.132 -24.707 11.310 0.50 21.63  ? 202 LEU B CG  1 
ATOM   4135 C CG  B LEU B 1 221 ? 51.098 -24.870 11.664 0.50 14.35  ? 202 LEU B CG  1 
ATOM   4136 C CD1 A LEU B 1 221 ? 51.656 -26.123 11.036 0.50 22.86  ? 202 LEU B CD1 1 
ATOM   4137 C CD1 B LEU B 1 221 ? 49.808 -24.384 10.981 0.50 12.66  ? 202 LEU B CD1 1 
ATOM   4138 C CD2 A LEU B 1 221 ? 50.172 -24.710 12.441 0.50 22.05  ? 202 LEU B CD2 1 
ATOM   4139 C CD2 B LEU B 1 221 ? 51.681 -26.020 10.836 0.50 16.24  ? 202 LEU B CD2 1 
ATOM   4140 N N   . PHE B 1 222 ? 54.976 -24.914 12.207 1.00 13.94  ? 203 PHE B N   1 
ATOM   4141 C CA  . PHE B 1 222 ? 55.827 -26.100 12.074 1.00 13.60  ? 203 PHE B CA  1 
ATOM   4142 C C   . PHE B 1 222 ? 56.715 -26.238 13.298 1.00 13.51  ? 203 PHE B C   1 
ATOM   4143 O O   . PHE B 1 222 ? 56.967 -27.371 13.753 1.00 15.33  ? 203 PHE B O   1 
ATOM   4144 C CB  . PHE B 1 222 ? 56.664 -26.056 10.765 1.00 12.84  ? 203 PHE B CB  1 
ATOM   4145 C CG  . PHE B 1 222 ? 55.839 -26.333 9.537  1.00 12.37  ? 203 PHE B CG  1 
ATOM   4146 C CD1 . PHE B 1 222 ? 55.785 -27.620 8.993  1.00 14.01  ? 203 PHE B CD1 1 
ATOM   4147 C CD2 . PHE B 1 222 ? 55.096 -25.313 8.945  1.00 15.04  ? 203 PHE B CD2 1 
ATOM   4148 C CE1 . PHE B 1 222 ? 55.032 -27.845 7.828  1.00 14.53  ? 203 PHE B CE1 1 
ATOM   4149 C CE2 . PHE B 1 222 ? 54.306 -25.536 7.826  1.00 15.00  ? 203 PHE B CE2 1 
ATOM   4150 C CZ  . PHE B 1 222 ? 54.258 -26.805 7.262  1.00 15.35  ? 203 PHE B CZ  1 
ATOM   4151 N N   . ARG B 1 223 ? 57.145 -25.127 13.886 1.00 13.25  ? 204 ARG B N   1 
ATOM   4152 C CA  A ARG B 1 223 ? 57.956 -25.211 15.089 0.50 14.63  ? 204 ARG B CA  1 
ATOM   4153 C CA  B ARG B 1 223 ? 57.963 -25.238 15.076 0.50 13.11  ? 204 ARG B CA  1 
ATOM   4154 C C   . ARG B 1 223 ? 57.135 -25.801 16.229 1.00 14.58  ? 204 ARG B C   1 
ATOM   4155 O O   . ARG B 1 223 ? 57.661 -26.578 17.047 1.00 14.75  ? 204 ARG B O   1 
ATOM   4156 C CB  A ARG B 1 223 ? 58.516 -23.835 15.492 0.50 15.54  ? 204 ARG B CB  1 
ATOM   4157 C CB  B ARG B 1 223 ? 58.585 -23.884 15.454 0.50 10.88  ? 204 ARG B CB  1 
ATOM   4158 C CG  A ARG B 1 223 ? 59.521 -23.237 14.498 0.50 18.29  ? 204 ARG B CG  1 
ATOM   4159 C CG  B ARG B 1 223 ? 59.668 -23.411 14.475 0.50 11.18  ? 204 ARG B CG  1 
ATOM   4160 C CD  A ARG B 1 223 ? 60.333 -22.079 15.120 0.50 21.53  ? 204 ARG B CD  1 
ATOM   4161 C CD  B ARG B 1 223 ? 60.366 -22.116 14.945 0.50 11.97  ? 204 ARG B CD  1 
ATOM   4162 N NE  A ARG B 1 223 ? 61.456 -22.566 15.933 0.50 24.16  ? 204 ARG B NE  1 
ATOM   4163 N NE  B ARG B 1 223 ? 60.974 -22.312 16.274 0.50 10.94  ? 204 ARG B NE  1 
ATOM   4164 C CZ  A ARG B 1 223 ? 61.402 -22.773 17.242 0.50 25.66  ? 204 ARG B CZ  1 
ATOM   4165 C CZ  B ARG B 1 223 ? 62.202 -22.806 16.474 0.50 11.15  ? 204 ARG B CZ  1 
ATOM   4166 N NH1 A ARG B 1 223 ? 60.277 -22.502 17.910 0.50 26.46  ? 204 ARG B NH1 1 
ATOM   4167 N NH1 B ARG B 1 223 ? 62.997 -23.090 15.452 0.50 10.87  ? 204 ARG B NH1 1 
ATOM   4168 N NH2 A ARG B 1 223 ? 62.464 -23.237 17.899 0.50 24.88  ? 204 ARG B NH2 1 
ATOM   4169 N NH2 B ARG B 1 223 ? 62.658 -22.988 17.721 0.50 13.02  ? 204 ARG B NH2 1 
ATOM   4170 N N   . GLN B 1 224 ? 55.848 -25.430 16.307 1.00 14.99  ? 205 GLN B N   1 
ATOM   4171 C CA  . GLN B 1 224 ? 54.959 -26.013 17.326 1.00 15.15  ? 205 GLN B CA  1 
ATOM   4172 C C   . GLN B 1 224 ? 54.679 -27.482 17.030 1.00 16.97  ? 205 GLN B C   1 
ATOM   4173 O O   . GLN B 1 224 ? 54.708 -28.274 17.961 1.00 17.76  ? 205 GLN B O   1 
ATOM   4174 C CB  . GLN B 1 224 ? 53.643 -25.249 17.427 1.00 16.83  ? 205 GLN B CB  1 
ATOM   4175 C CG  . GLN B 1 224 ? 53.801 -23.827 18.019 1.00 17.92  ? 205 GLN B CG  1 
ATOM   4176 C CD  . GLN B 1 224 ? 52.484 -23.099 18.015 1.00 19.58  ? 205 GLN B CD  1 
ATOM   4177 O OE1 . GLN B 1 224 ? 51.687 -23.254 18.953 1.00 20.65  ? 205 GLN B OE1 1 
ATOM   4178 N NE2 . GLN B 1 224 ? 52.196 -22.360 16.911 1.00 20.04  ? 205 GLN B NE2 1 
ATOM   4179 N N   . LEU B 1 225 ? 54.400 -27.843 15.761 1.00 15.40  ? 206 LEU B N   1 
ATOM   4180 C CA  . LEU B 1 225 ? 54.238 -29.272 15.428 1.00 14.30  ? 206 LEU B CA  1 
ATOM   4181 C C   . LEU B 1 225 ? 55.435 -30.082 15.977 1.00 15.29  ? 206 LEU B C   1 
ATOM   4182 O O   . LEU B 1 225 ? 55.266 -31.138 16.615 1.00 14.07  ? 206 LEU B O   1 
ATOM   4183 C CB  . LEU B 1 225 ? 54.125 -29.511 13.919 1.00 15.20  ? 206 LEU B CB  1 
ATOM   4184 C CG  . LEU B 1 225 ? 52.874 -29.111 13.157 1.00 15.74  ? 206 LEU B CG  1 
ATOM   4185 C CD1 . LEU B 1 225 ? 53.071 -29.483 11.673 1.00 17.77  ? 206 LEU B CD1 1 
ATOM   4186 C CD2 . LEU B 1 225 ? 51.688 -29.827 13.746 1.00 15.22  ? 206 LEU B CD2 1 
ATOM   4187 N N   . ARG B 1 226 ? 56.637 -29.608 15.696 1.00 14.00  ? 207 ARG B N   1 
ATOM   4188 C CA  A ARG B 1 226 ? 57.841 -30.342 16.092 0.50 15.35  ? 207 ARG B CA  1 
ATOM   4189 C CA  B ARG B 1 226 ? 57.848 -30.333 16.093 0.50 13.82  ? 207 ARG B CA  1 
ATOM   4190 C C   . ARG B 1 226 ? 57.982 -30.460 17.611 1.00 14.12  ? 207 ARG B C   1 
ATOM   4191 O O   . ARG B 1 226 ? 58.286 -31.549 18.148 1.00 14.04  ? 207 ARG B O   1 
ATOM   4192 C CB  A ARG B 1 226 ? 59.099 -29.663 15.504 0.50 17.80  ? 207 ARG B CB  1 
ATOM   4193 C CB  B ARG B 1 226 ? 59.106 -29.637 15.522 0.50 12.80  ? 207 ARG B CB  1 
ATOM   4194 C CG  A ARG B 1 226 ? 60.358 -30.542 15.571 0.50 20.45  ? 207 ARG B CG  1 
ATOM   4195 C CG  B ARG B 1 226 ? 60.385 -30.497 15.619 0.50 11.44  ? 207 ARG B CG  1 
ATOM   4196 C CD  A ARG B 1 226 ? 61.607 -29.788 15.138 0.50 24.63  ? 207 ARG B CD  1 
ATOM   4197 C CD  B ARG B 1 226 ? 61.578 -29.738 15.095 0.50 11.29  ? 207 ARG B CD  1 
ATOM   4198 N NE  A ARG B 1 226 ? 62.048 -30.084 13.771 0.50 28.81  ? 207 ARG B NE  1 
ATOM   4199 N NE  B ARG B 1 226 ? 62.864 -30.421 15.187 0.50 14.13  ? 207 ARG B NE  1 
ATOM   4200 C CZ  A ARG B 1 226 ? 63.174 -30.741 13.502 0.50 27.83  ? 207 ARG B CZ  1 
ATOM   4201 C CZ  B ARG B 1 226 ? 63.503 -30.937 14.151 0.50 9.12   ? 207 ARG B CZ  1 
ATOM   4202 N NH1 A ARG B 1 226 ? 63.936 -31.151 14.501 0.50 27.00  ? 207 ARG B NH1 1 
ATOM   4203 N NH1 B ARG B 1 226 ? 62.951 -30.869 12.928 0.50 6.80   ? 207 ARG B NH1 1 
ATOM   4204 N NH2 A ARG B 1 226 ? 63.538 -30.983 12.262 0.50 27.20  ? 207 ARG B NH2 1 
ATOM   4205 N NH2 B ARG B 1 226 ? 64.686 -31.499 14.308 0.50 6.71   ? 207 ARG B NH2 1 
ATOM   4206 N N   . GLN B 1 227 ? 57.748 -29.357 18.327 1.00 14.90  ? 208 GLN B N   1 
ATOM   4207 C CA  . GLN B 1 227 ? 57.900 -29.382 19.795 1.00 13.36  ? 208 GLN B CA  1 
ATOM   4208 C C   . GLN B 1 227 ? 56.845 -30.286 20.459 1.00 11.76  ? 208 GLN B C   1 
ATOM   4209 O O   . GLN B 1 227 ? 57.150 -31.051 21.389 1.00 13.28  ? 208 GLN B O   1 
ATOM   4210 C CB  . GLN B 1 227 ? 57.810 -27.978 20.406 1.00 14.51  ? 208 GLN B CB  1 
ATOM   4211 C CG  . GLN B 1 227 ? 58.296 -28.039 21.861 1.00 16.86  ? 208 GLN B CG  1 
ATOM   4212 C CD  . GLN B 1 227 ? 59.780 -28.526 21.946 1.00 19.06  ? 208 GLN B CD  1 
ATOM   4213 O OE1 . GLN B 1 227 ? 60.690 -27.802 21.527 1.00 21.60  ? 208 GLN B OE1 1 
ATOM   4214 N NE2 . GLN B 1 227 ? 60.009 -29.785 22.445 1.00 17.36  ? 208 GLN B NE2 1 
ATOM   4215 N N   . LEU B 1 228 ? 55.620 -30.231 19.956 1.00 13.63  ? 209 LEU B N   1 
ATOM   4216 C CA  . LEU B 1 228 ? 54.542 -31.052 20.468 1.00 14.50  ? 209 LEU B CA  1 
ATOM   4217 C C   . LEU B 1 228 ? 54.841 -32.530 20.219 1.00 13.75  ? 209 LEU B C   1 
ATOM   4218 O O   . LEU B 1 228 ? 54.680 -33.362 21.133 1.00 14.26  ? 209 LEU B O   1 
ATOM   4219 C CB  . LEU B 1 228 ? 53.211 -30.664 19.800 1.00 16.04  ? 209 LEU B CB  1 
ATOM   4220 C CG  . LEU B 1 228 ? 52.621 -29.328 20.242 1.00 15.35  ? 209 LEU B CG  1 
ATOM   4221 C CD1 . LEU B 1 228 ? 51.601 -28.873 19.213 1.00 16.61  ? 209 LEU B CD1 1 
ATOM   4222 C CD2 . LEU B 1 228 ? 51.982 -29.377 21.679 1.00 17.40  ? 209 LEU B CD2 1 
ATOM   4223 N N   . ALA B 1 229 ? 55.251 -32.856 18.990 1.00 13.29  ? 210 ALA B N   1 
ATOM   4224 C CA  . ALA B 1 229 ? 55.545 -34.251 18.699 1.00 13.99  ? 210 ALA B CA  1 
ATOM   4225 C C   . ALA B 1 229 ? 56.779 -34.759 19.464 1.00 13.96  ? 210 ALA B C   1 
ATOM   4226 O O   . ALA B 1 229 ? 56.888 -35.953 19.740 1.00 15.84  ? 210 ALA B O   1 
ATOM   4227 C CB  . ALA B 1 229 ? 55.728 -34.469 17.151 1.00 14.27  ? 210 ALA B CB  1 
ATOM   4228 N N   . ALA B 1 230 ? 57.717 -33.871 19.793 1.00 13.32  ? 211 ALA B N   1 
ATOM   4229 C CA  . ALA B 1 230 ? 58.883 -34.245 20.587 1.00 13.66  ? 211 ALA B CA  1 
ATOM   4230 C C   . ALA B 1 230 ? 58.459 -34.486 22.046 1.00 13.86  ? 211 ALA B C   1 
ATOM   4231 O O   . ALA B 1 230 ? 58.998 -35.394 22.715 1.00 14.69  ? 211 ALA B O   1 
ATOM   4232 C CB  . ALA B 1 230 ? 59.979 -33.146 20.500 1.00 13.94  ? 211 ALA B CB  1 
ATOM   4233 N N   . ASP B 1 231 ? 57.518 -33.688 22.552 1.00 13.79  ? 212 ASP B N   1 
ATOM   4234 C CA  . ASP B 1 231 ? 57.203 -33.795 23.997 1.00 14.72  ? 212 ASP B CA  1 
ATOM   4235 C C   . ASP B 1 231 ? 56.283 -34.962 24.336 1.00 16.82  ? 212 ASP B C   1 
ATOM   4236 O O   . ASP B 1 231 ? 56.384 -35.542 25.405 1.00 18.06  ? 212 ASP B O   1 
ATOM   4237 C CB  . ASP B 1 231 ? 56.539 -32.504 24.529 1.00 14.33  ? 212 ASP B CB  1 
ATOM   4238 C CG  . ASP B 1 231 ? 57.524 -31.329 24.660 1.00 16.04  ? 212 ASP B CG  1 
ATOM   4239 O OD1 . ASP B 1 231 ? 57.046 -30.171 24.775 1.00 18.01  ? 212 ASP B OD1 1 
ATOM   4240 O OD2 . ASP B 1 231 ? 58.754 -31.549 24.593 1.00 17.11  ? 212 ASP B OD2 1 
ATOM   4241 N N   . ILE B 1 232 ? 55.337 -35.253 23.455 1.00 14.86  ? 213 ILE B N   1 
ATOM   4242 C CA  . ILE B 1 232 ? 54.311 -36.277 23.734 1.00 15.58  ? 213 ILE B CA  1 
ATOM   4243 C C   . ILE B 1 232 ? 54.924 -37.617 24.165 1.00 17.42  ? 213 ILE B C   1 
ATOM   4244 O O   . ILE B 1 232 ? 54.513 -38.137 25.216 1.00 17.83  ? 213 ILE B O   1 
ATOM   4245 C CB  . ILE B 1 232 ? 53.364 -36.466 22.508 1.00 17.24  ? 213 ILE B CB  1 
ATOM   4246 C CG1 . ILE B 1 232 ? 52.426 -35.250 22.361 1.00 16.25  ? 213 ILE B CG1 1 
ATOM   4247 C CG2 . ILE B 1 232 ? 52.607 -37.773 22.629 1.00 18.69  ? 213 ILE B CG2 1 
ATOM   4248 C CD1 . ILE B 1 232 ? 51.854 -35.070 20.941 1.00 16.20  ? 213 ILE B CD1 1 
ATOM   4249 N N   . PRO B 1 233 ? 55.946 -38.140 23.429 1.00 17.83  ? 214 PRO B N   1 
ATOM   4250 C CA  . PRO B 1 233 ? 56.474 -39.454 23.835 1.00 18.11  ? 214 PRO B CA  1 
ATOM   4251 C C   . PRO B 1 233 ? 57.172 -39.420 25.185 1.00 19.16  ? 214 PRO B C   1 
ATOM   4252 O O   . PRO B 1 233 ? 57.154 -40.427 25.882 1.00 19.02  ? 214 PRO B O   1 
ATOM   4253 C CB  . PRO B 1 233 ? 57.467 -39.832 22.703 1.00 18.68  ? 214 PRO B CB  1 
ATOM   4254 C CG  . PRO B 1 233 ? 57.517 -38.700 21.786 1.00 20.67  ? 214 PRO B CG  1 
ATOM   4255 C CD  . PRO B 1 233 ? 56.404 -37.767 22.089 1.00 17.93  ? 214 PRO B CD  1 
ATOM   4256 N N   . SER B 1 234 ? 57.767 -38.303 25.585 1.00 19.54  ? 215 SER B N   1 
ATOM   4257 C CA  A SER B 1 234 ? 58.370 -38.225 26.919 0.50 18.90  ? 215 SER B CA  1 
ATOM   4258 C CA  B SER B 1 234 ? 58.381 -38.276 26.909 0.50 19.87  ? 215 SER B CA  1 
ATOM   4259 C C   . SER B 1 234 ? 57.305 -38.340 27.995 1.00 18.79  ? 215 SER B C   1 
ATOM   4260 O O   . SER B 1 234 ? 57.524 -38.959 29.036 1.00 21.01  ? 215 SER B O   1 
ATOM   4261 C CB  A SER B 1 234 ? 59.148 -36.923 27.112 0.50 18.67  ? 215 SER B CB  1 
ATOM   4262 C CB  B SER B 1 234 ? 59.263 -37.039 27.092 0.50 21.28  ? 215 SER B CB  1 
ATOM   4263 O OG  A SER B 1 234 ? 60.374 -36.972 26.425 0.50 18.55  ? 215 SER B OG  1 
ATOM   4264 O OG  B SER B 1 234 ? 58.509 -35.858 26.943 0.50 23.04  ? 215 SER B OG  1 
ATOM   4265 N N   . PHE B 1 235 ? 56.152 -37.717 27.758 1.00 17.26  ? 216 PHE B N   1 
ATOM   4266 C CA  . PHE B 1 235 ? 55.058 -37.755 28.725 1.00 17.62  ? 216 PHE B CA  1 
ATOM   4267 C C   . PHE B 1 235 ? 54.468 -39.169 28.811 1.00 19.50  ? 216 PHE B C   1 
ATOM   4268 O O   . PHE B 1 235 ? 54.300 -39.692 29.890 1.00 19.78  ? 216 PHE B O   1 
ATOM   4269 C CB  . PHE B 1 235 ? 53.948 -36.758 28.351 1.00 17.81  ? 216 PHE B CB  1 
ATOM   4270 C CG  . PHE B 1 235 ? 54.211 -35.319 28.789 1.00 16.97  ? 216 PHE B CG  1 
ATOM   4271 C CD1 . PHE B 1 235 ? 53.273 -34.616 29.568 1.00 18.43  ? 216 PHE B CD1 1 
ATOM   4272 C CD2 . PHE B 1 235 ? 55.407 -34.676 28.443 1.00 15.31  ? 216 PHE B CD2 1 
ATOM   4273 C CE1 . PHE B 1 235 ? 53.533 -33.266 29.967 1.00 19.94  ? 216 PHE B CE1 1 
ATOM   4274 C CE2 . PHE B 1 235 ? 55.660 -33.365 28.839 1.00 18.51  ? 216 PHE B CE2 1 
ATOM   4275 C CZ  . PHE B 1 235 ? 54.719 -32.662 29.595 1.00 19.37  ? 216 PHE B CZ  1 
ATOM   4276 N N   . THR B 1 236 ? 54.129 -39.792 27.684 1.00 18.55  ? 217 THR B N   1 
ATOM   4277 C CA  . THR B 1 236 ? 53.542 -41.134 27.742 1.00 19.39  ? 217 THR B CA  1 
ATOM   4278 C C   . THR B 1 236 ? 54.527 -42.147 28.315 1.00 21.43  ? 217 THR B C   1 
ATOM   4279 O O   . THR B 1 236 ? 54.123 -43.064 29.037 1.00 24.45  ? 217 THR B O   1 
ATOM   4280 C CB  . THR B 1 236 ? 53.042 -41.604 26.364 1.00 18.93  ? 217 THR B CB  1 
ATOM   4281 O OG1 . THR B 1 236 ? 54.128 -41.591 25.428 1.00 19.29  ? 217 THR B OG1 1 
ATOM   4282 C CG2 . THR B 1 236 ? 51.956 -40.628 25.855 1.00 20.04  ? 217 THR B CG2 1 
ATOM   4283 N N   . ASN B 1 237 ? 55.813 -41.995 28.013 1.00 21.48  ? 218 ASN B N   1 
ATOM   4284 C CA  . ASN B 1 237 ? 56.819 -42.937 28.526 1.00 24.51  ? 218 ASN B CA  1 
ATOM   4285 C C   . ASN B 1 237 ? 56.978 -42.851 30.046 1.00 24.18  ? 218 ASN B C   1 
ATOM   4286 O O   . ASN B 1 237 ? 57.205 -43.859 30.726 1.00 25.14  ? 218 ASN B O   1 
ATOM   4287 C CB  . ASN B 1 237 ? 58.182 -42.696 27.853 1.00 26.83  ? 218 ASN B CB  1 
ATOM   4288 C CG  . ASN B 1 237 ? 59.286 -43.554 28.461 1.00 30.50  ? 218 ASN B CG  1 
ATOM   4289 O OD1 . ASN B 1 237 ? 60.133 -43.063 29.203 1.00 34.01  ? 218 ASN B OD1 1 
ATOM   4290 N ND2 . ASN B 1 237 ? 59.253 -44.840 28.181 1.00 30.92  ? 218 ASN B ND2 1 
ATOM   4291 N N   . ASP B 1 238 ? 56.836 -41.648 30.588 1.00 21.76  ? 219 ASP B N   1 
ATOM   4292 C CA  . ASP B 1 238 ? 56.928 -41.485 32.033 1.00 21.83  ? 219 ASP B CA  1 
ATOM   4293 C C   . ASP B 1 238 ? 55.709 -42.114 32.726 1.00 24.24  ? 219 ASP B C   1 
ATOM   4294 O O   . ASP B 1 238 ? 55.855 -42.712 33.789 1.00 26.29  ? 219 ASP B O   1 
ATOM   4295 C CB  . ASP B 1 238 ? 57.080 -39.988 32.402 1.00 19.84  ? 219 ASP B CB  1 
ATOM   4296 C CG  . ASP B 1 238 ? 58.527 -39.553 32.523 1.00 21.43  ? 219 ASP B CG  1 
ATOM   4297 O OD1 . ASP B 1 238 ? 59.424 -40.287 32.074 1.00 22.52  ? 219 ASP B OD1 1 
ATOM   4298 O OD2 . ASP B 1 238 ? 58.787 -38.447 33.070 1.00 21.94  ? 219 ASP B OD2 1 
ATOM   4299 N N   . VAL B 1 239 ? 54.512 -42.014 32.151 1.00 24.53  ? 220 VAL B N   1 
ATOM   4300 C CA  . VAL B 1 239 ? 53.341 -42.640 32.772 1.00 27.29  ? 220 VAL B CA  1 
ATOM   4301 C C   . VAL B 1 239 ? 53.491 -44.153 32.699 1.00 29.81  ? 220 VAL B C   1 
ATOM   4302 O O   . VAL B 1 239 ? 53.202 -44.883 33.673 1.00 31.47  ? 220 VAL B O   1 
ATOM   4303 C CB  . VAL B 1 239 ? 52.010 -42.234 32.083 1.00 28.08  ? 220 VAL B CB  1 
ATOM   4304 C CG1 . VAL B 1 239 ? 50.843 -43.128 32.582 1.00 28.45  ? 220 VAL B CG1 1 
ATOM   4305 C CG2 . VAL B 1 239 ? 51.717 -40.768 32.314 1.00 29.44  ? 220 VAL B CG2 1 
ATOM   4306 N N   . ARG B 1 240 ? 53.986 -44.644 31.568 1.00 31.08  ? 221 ARG B N   1 
ATOM   4307 C CA  . ARG B 1 240 ? 54.138 -46.096 31.455 1.00 33.35  ? 221 ARG B CA  1 
ATOM   4308 C C   . ARG B 1 240 ? 55.216 -46.661 32.375 1.00 36.77  ? 221 ARG B C   1 
ATOM   4309 O O   . ARG B 1 240 ? 55.058 -47.767 32.916 1.00 37.77  ? 221 ARG B O   1 
ATOM   4310 C CB  . ARG B 1 240 ? 54.415 -46.499 30.019 1.00 34.15  ? 221 ARG B CB  1 
ATOM   4311 C CG  . ARG B 1 240 ? 53.244 -46.182 29.110 1.00 35.64  ? 221 ARG B CG  1 
ATOM   4312 C CD  . ARG B 1 240 ? 53.081 -47.218 28.036 1.00 36.24  ? 221 ARG B CD  1 
ATOM   4313 N NE  . ARG B 1 240 ? 52.058 -46.858 27.064 1.00 37.34  ? 221 ARG B NE  1 
ATOM   4314 C CZ  . ARG B 1 240 ? 50.808 -47.310 27.084 1.00 38.42  ? 221 ARG B CZ  1 
ATOM   4315 N NH1 . ARG B 1 240 ? 50.404 -48.117 28.057 1.00 38.66  ? 221 ARG B NH1 1 
ATOM   4316 N NH2 . ARG B 1 240 ? 49.957 -46.952 26.131 1.00 38.68  ? 221 ARG B NH2 1 
ATOM   4317 N N   . SER B 1 241 ? 56.302 -45.931 32.591 1.00 40.32  ? 222 SER B N   1 
ATOM   4318 C CA  . SER B 1 241 ? 57.293 -46.428 33.538 1.00 43.39  ? 222 SER B CA  1 
ATOM   4319 C C   . SER B 1 241 ? 57.007 -45.919 34.959 1.00 47.19  ? 222 SER B C   1 
ATOM   4320 O O   . SER B 1 241 ? 57.624 -44.976 35.416 1.00 50.22  ? 222 SER B O   1 
ATOM   4321 C CB  . SER B 1 241 ? 58.704 -46.049 33.075 1.00 44.82  ? 222 SER B CB  1 
ATOM   4322 O OG  . SER B 1 241 ? 58.919 -44.651 33.101 1.00 45.75  ? 222 SER B OG  1 
ATOM   4323 N N   . PHE B 1 242 ? 56.066 -46.559 35.651 1.00 49.40  ? 223 PHE B N   1 
ATOM   4324 C CA  . PHE B 1 242 ? 55.651 -46.145 37.001 1.00 50.11  ? 223 PHE B CA  1 
ATOM   4325 C C   . PHE B 1 242 ? 55.270 -44.662 37.024 1.00 49.96  ? 223 PHE B C   1 
ATOM   4326 O O   . PHE B 1 242 ? 54.956 -44.106 38.085 1.00 50.57  ? 223 PHE B O   1 
ATOM   4327 C CB  . PHE B 1 242 ? 56.754 -46.408 38.033 1.00 50.93  ? 223 PHE B CB  1 
ATOM   4328 C CG  . PHE B 1 242 ? 57.161 -47.864 38.158 1.00 52.16  ? 223 PHE B CG  1 
ATOM   4329 C CD1 . PHE B 1 242 ? 57.904 -48.483 37.162 1.00 52.42  ? 223 PHE B CD1 1 
ATOM   4330 C CD2 . PHE B 1 242 ? 56.826 -48.597 39.292 1.00 52.15  ? 223 PHE B CD2 1 
ATOM   4331 C CE1 . PHE B 1 242 ? 58.285 -49.804 37.277 1.00 52.38  ? 223 PHE B CE1 1 
ATOM   4332 C CE2 . PHE B 1 242 ? 57.206 -49.919 39.420 1.00 52.48  ? 223 PHE B CE2 1 
ATOM   4333 C CZ  . PHE B 1 242 ? 57.939 -50.528 38.410 1.00 52.64  ? 223 PHE B CZ  1 
ATOM   4334 N N   . VAL B 1 251 ? 63.243 -41.304 40.974 1.00 53.44  ? 232 VAL B N   1 
ATOM   4335 C CA  . VAL B 1 251 ? 62.186 -40.326 41.207 1.00 53.33  ? 232 VAL B CA  1 
ATOM   4336 C C   . VAL B 1 251 ? 62.181 -39.239 40.130 1.00 47.27  ? 232 VAL B C   1 
ATOM   4337 O O   . VAL B 1 251 ? 61.387 -38.294 40.185 1.00 44.53  ? 232 VAL B O   1 
ATOM   4338 C CB  . VAL B 1 251 ? 62.320 -39.650 42.591 1.00 57.39  ? 232 VAL B CB  1 
ATOM   4339 C CG1 . VAL B 1 251 ? 60.951 -39.238 43.090 1.00 60.11  ? 232 VAL B CG1 1 
ATOM   4340 C CG2 . VAL B 1 251 ? 62.958 -40.589 43.588 1.00 58.08  ? 232 VAL B CG2 1 
ATOM   4341 N N   . ALA B 1 252 ? 63.085 -39.376 39.162 1.00 43.27  ? 233 ALA B N   1 
ATOM   4342 C CA  . ALA B 1 252 ? 63.134 -38.470 38.024 1.00 38.40  ? 233 ALA B CA  1 
ATOM   4343 C C   . ALA B 1 252 ? 62.097 -38.914 36.985 1.00 33.72  ? 233 ALA B C   1 
ATOM   4344 O O   . ALA B 1 252 ? 62.422 -39.531 35.963 1.00 33.22  ? 233 ALA B O   1 
ATOM   4345 C CB  . ALA B 1 252 ? 64.527 -38.429 37.428 1.00 39.48  ? 233 ALA B CB  1 
ATOM   4346 N N   . ASN B 1 253 ? 60.841 -38.595 37.285 1.00 28.53  ? 234 ASN B N   1 
ATOM   4347 C CA  . ASN B 1 253 ? 59.694 -39.021 36.489 1.00 27.14  ? 234 ASN B CA  1 
ATOM   4348 C C   . ASN B 1 253 ? 58.585 -38.008 36.711 1.00 25.77  ? 234 ASN B C   1 
ATOM   4349 O O   . ASN B 1 253 ? 58.340 -37.609 37.858 1.00 24.72  ? 234 ASN B O   1 
ATOM   4350 C CB  . ASN B 1 253 ? 59.250 -40.441 36.894 1.00 28.37  ? 234 ASN B CB  1 
ATOM   4351 C CG  . ASN B 1 253 ? 58.025 -40.925 36.126 1.00 27.81  ? 234 ASN B CG  1 
ATOM   4352 O OD1 . ASN B 1 253 ? 56.938 -40.340 36.224 1.00 30.66  ? 234 ASN B OD1 1 
ATOM   4353 N ND2 . ASN B 1 253 ? 58.191 -42.004 35.367 1.00 25.86  ? 234 ASN B ND2 1 
ATOM   4354 N N   . LEU B 1 254 ? 57.931 -37.570 35.633 1.00 22.46  ? 235 LEU B N   1 
ATOM   4355 C CA  . LEU B 1 254 ? 56.981 -36.460 35.719 1.00 22.80  ? 235 LEU B CA  1 
ATOM   4356 C C   . LEU B 1 254 ? 55.756 -36.793 36.594 1.00 23.40  ? 235 LEU B C   1 
ATOM   4357 O O   . LEU B 1 254 ? 55.175 -35.905 37.222 1.00 24.77  ? 235 LEU B O   1 
ATOM   4358 C CB  . LEU B 1 254 ? 56.555 -36.016 34.302 1.00 22.28  ? 235 LEU B CB  1 
ATOM   4359 C CG  . LEU B 1 254 ? 55.621 -34.812 34.250 1.00 22.11  ? 235 LEU B CG  1 
ATOM   4360 C CD1 . LEU B 1 254 ? 56.277 -33.562 34.933 1.00 21.94  ? 235 LEU B CD1 1 
ATOM   4361 C CD2 . LEU B 1 254 ? 55.163 -34.543 32.803 1.00 22.13  ? 235 LEU B CD2 1 
ATOM   4362 N N   . VAL B 1 255 ? 55.383 -38.060 36.665 1.00 23.80  ? 236 VAL B N   1 
ATOM   4363 C CA  . VAL B 1 255 ? 54.265 -38.450 37.525 1.00 23.84  ? 236 VAL B CA  1 
ATOM   4364 C C   . VAL B 1 255 ? 54.601 -38.177 38.998 1.00 26.91  ? 236 VAL B C   1 
ATOM   4365 O O   . VAL B 1 255 ? 53.798 -37.581 39.706 1.00 25.71  ? 236 VAL B O   1 
ATOM   4366 C CB  . VAL B 1 255 ? 53.884 -39.923 37.370 1.00 23.53  ? 236 VAL B CB  1 
ATOM   4367 C CG1 . VAL B 1 255 ? 52.688 -40.214 38.294 1.00 23.49  ? 236 VAL B CG1 1 
ATOM   4368 C CG2 . VAL B 1 255 ? 53.506 -40.222 35.919 1.00 25.48  ? 236 VAL B CG2 1 
ATOM   4369 N N   . MET B 1 256 ? 55.790 -38.597 39.430 1.00 30.64  ? 237 MET B N   1 
ATOM   4370 C CA  . MET B 1 256 ? 56.270 -38.352 40.803 1.00 35.37  ? 237 MET B CA  1 
ATOM   4371 C C   . MET B 1 256 ? 56.340 -36.861 41.119 1.00 31.14  ? 237 MET B C   1 
ATOM   4372 O O   . MET B 1 256 ? 56.002 -36.421 42.212 1.00 30.92  ? 237 MET B O   1 
ATOM   4373 C CB  . MET B 1 256 ? 57.653 -38.976 41.016 1.00 46.29  ? 237 MET B CB  1 
ATOM   4374 C CG  . MET B 1 256 ? 57.715 -40.479 40.797 1.00 56.18  ? 237 MET B CG  1 
ATOM   4375 S SD  . MET B 1 256 ? 56.903 -41.416 42.120 1.00 64.83  ? 237 MET B SD  1 
ATOM   4376 C CE  . MET B 1 256 ? 58.040 -41.178 43.481 1.00 70.94  ? 237 MET B CE  1 
ATOM   4377 N N   . ILE B 1 257 ? 56.796 -36.081 40.153 1.00 26.36  ? 238 ILE B N   1 
ATOM   4378 C CA  . ILE B 1 257 ? 56.931 -34.642 40.353 1.00 25.85  ? 238 ILE B CA  1 
ATOM   4379 C C   . ILE B 1 257 ? 55.558 -33.988 40.535 1.00 26.83  ? 238 ILE B C   1 
ATOM   4380 O O   . ILE B 1 257 ? 55.344 -33.225 41.490 1.00 29.14  ? 238 ILE B O   1 
ATOM   4381 C CB  . ILE B 1 257 ? 57.687 -34.010 39.185 1.00 25.29  ? 238 ILE B CB  1 
ATOM   4382 C CG1 . ILE B 1 257 ? 59.122 -34.579 39.146 1.00 23.42  ? 238 ILE B CG1 1 
ATOM   4383 C CG2 . ILE B 1 257 ? 57.649 -32.465 39.290 1.00 27.27  ? 238 ILE B CG2 1 
ATOM   4384 C CD1 . ILE B 1 257 ? 59.942 -34.211 37.895 1.00 22.86  ? 238 ILE B CD1 1 
ATOM   4385 N N   . VAL B 1 258 ? 54.617 -34.312 39.649 1.00 24.70  ? 239 VAL B N   1 
ATOM   4386 C CA  . VAL B 1 258 ? 53.262 -33.759 39.746 1.00 26.46  ? 239 VAL B CA  1 
ATOM   4387 C C   . VAL B 1 258 ? 52.605 -34.122 41.079 1.00 28.09  ? 239 VAL B C   1 
ATOM   4388 O O   . VAL B 1 258 ? 52.021 -33.259 41.753 1.00 28.96  ? 239 VAL B O   1 
ATOM   4389 C CB  . VAL B 1 258 ? 52.370 -34.240 38.583 1.00 27.43  ? 239 VAL B CB  1 
ATOM   4390 C CG1 . VAL B 1 258 ? 50.884 -33.842 38.826 1.00 26.60  ? 239 VAL B CG1 1 
ATOM   4391 C CG2 . VAL B 1 258 ? 52.894 -33.685 37.241 1.00 28.09  ? 239 VAL B CG2 1 
ATOM   4392 N N   . ARG B 1 259 ? 52.702 -35.397 41.455 1.00 26.90  ? 240 ARG B N   1 
ATOM   4393 C CA  . ARG B 1 259 ? 52.074 -35.898 42.670 1.00 28.87  ? 240 ARG B CA  1 
ATOM   4394 C C   . ARG B 1 259 ? 52.565 -35.144 43.910 1.00 33.10  ? 240 ARG B C   1 
ATOM   4395 O O   . ARG B 1 259 ? 51.771 -34.733 44.769 1.00 33.44  ? 240 ARG B O   1 
ATOM   4396 C CB  . ARG B 1 259 ? 52.358 -37.400 42.811 1.00 26.31  ? 240 ARG B CB  1 
ATOM   4397 C CG  . ARG B 1 259 ? 51.583 -38.068 43.955 1.00 27.12  ? 240 ARG B CG  1 
ATOM   4398 C CD  . ARG B 1 259 ? 51.819 -39.568 43.948 1.00 27.67  ? 240 ARG B CD  1 
ATOM   4399 N NE  . ARG B 1 259 ? 53.153 -39.860 44.455 1.00 31.09  ? 240 ARG B NE  1 
ATOM   4400 C CZ  . ARG B 1 259 ? 53.704 -41.065 44.503 1.00 31.22  ? 240 ARG B CZ  1 
ATOM   4401 N NH1 . ARG B 1 259 ? 53.037 -42.123 44.073 1.00 29.16  ? 240 ARG B NH1 1 
ATOM   4402 N NH2 . ARG B 1 259 ? 54.935 -41.203 44.995 1.00 33.54  ? 240 ARG B NH2 1 
ATOM   4403 N N   . ARG B 1 260 ? 53.881 -34.970 43.989 1.00 35.47  ? 241 ARG B N   1 
ATOM   4404 C CA  . ARG B 1 260 ? 54.520 -34.196 45.042 1.00 40.75  ? 241 ARG B CA  1 
ATOM   4405 C C   . ARG B 1 260 ? 54.106 -32.706 45.019 1.00 39.95  ? 241 ARG B C   1 
ATOM   4406 O O   . ARG B 1 260 ? 53.792 -32.136 46.066 1.00 39.25  ? 241 ARG B O   1 
ATOM   4407 C CB  . ARG B 1 260 ? 56.048 -34.352 44.915 1.00 47.21  ? 241 ARG B CB  1 
ATOM   4408 C CG  . ARG B 1 260 ? 56.905 -33.859 46.088 1.00 52.22  ? 241 ARG B CG  1 
ATOM   4409 C CD  . ARG B 1 260 ? 57.347 -32.404 45.911 1.00 56.72  ? 241 ARG B CD  1 
ATOM   4410 N NE  . ARG B 1 260 ? 57.724 -32.096 44.532 1.00 60.01  ? 241 ARG B NE  1 
ATOM   4411 C CZ  . ARG B 1 260 ? 58.940 -32.266 44.022 1.00 62.79  ? 241 ARG B CZ  1 
ATOM   4412 N NH1 . ARG B 1 260 ? 59.918 -32.749 44.774 1.00 63.43  ? 241 ARG B NH1 1 
ATOM   4413 N NH2 . ARG B 1 260 ? 59.177 -31.958 42.754 1.00 63.12  ? 241 ARG B NH2 1 
ATOM   4414 N N   . ASP B 1 261 ? 54.093 -32.081 43.843 1.00 38.71  ? 242 ASP B N   1 
ATOM   4415 C CA  . ASP B 1 261 ? 53.762 -30.650 43.728 1.00 39.50  ? 242 ASP B CA  1 
ATOM   4416 C C   . ASP B 1 261 ? 52.295 -30.326 44.053 1.00 39.58  ? 242 ASP B C   1 
ATOM   4417 O O   . ASP B 1 261 ? 51.991 -29.273 44.614 1.00 39.27  ? 242 ASP B O   1 
ATOM   4418 C CB  . ASP B 1 261 ? 54.059 -30.133 42.315 1.00 40.34  ? 242 ASP B CB  1 
ATOM   4419 C CG  . ASP B 1 261 ? 55.548 -30.132 41.970 1.00 43.03  ? 242 ASP B CG  1 
ATOM   4420 O OD1 . ASP B 1 261 ? 56.386 -30.502 42.825 1.00 43.27  ? 242 ASP B OD1 1 
ATOM   4421 O OD2 . ASP B 1 261 ? 55.871 -29.746 40.820 1.00 43.20  ? 242 ASP B OD2 1 
ATOM   4422 N N   . ARG B 1 262 ? 51.383 -31.218 43.671 1.00 38.19  ? 243 ARG B N   1 
ATOM   4423 C CA  . ARG B 1 262 ? 49.951 -30.993 43.857 1.00 38.15  ? 243 ARG B CA  1 
ATOM   4424 C C   . ARG B 1 262 ? 49.450 -31.585 45.177 1.00 36.56  ? 243 ARG B C   1 
ATOM   4425 O O   . ARG B 1 262 ? 48.301 -31.369 45.558 1.00 36.74  ? 243 ARG B O   1 
ATOM   4426 C CB  . ARG B 1 262 ? 49.147 -31.607 42.707 1.00 41.06  ? 243 ARG B CB  1 
ATOM   4427 C CG  . ARG B 1 262 ? 49.598 -31.224 41.288 1.00 45.01  ? 243 ARG B CG  1 
ATOM   4428 C CD  . ARG B 1 262 ? 48.926 -29.968 40.808 1.00 47.80  ? 243 ARG B CD  1 
ATOM   4429 N NE  . ARG B 1 262 ? 49.041 -29.769 39.361 1.00 50.23  ? 243 ARG B NE  1 
ATOM   4430 C CZ  . ARG B 1 262 ? 48.158 -30.211 38.468 1.00 51.23  ? 243 ARG B CZ  1 
ATOM   4431 N NH1 . ARG B 1 262 ? 47.096 -30.901 38.865 1.00 51.71  ? 243 ARG B NH1 1 
ATOM   4432 N NH2 . ARG B 1 262 ? 48.338 -29.965 37.175 1.00 51.53  ? 243 ARG B NH2 1 
ATOM   4433 N N   . CYS B 1 263 ? 50.314 -32.332 45.859 1.00 35.92  ? 244 CYS B N   1 
ATOM   4434 C CA  . CYS B 1 263 ? 49.922 -33.160 47.006 1.00 34.57  ? 244 CYS B CA  1 
ATOM   4435 C C   . CYS B 1 263 ? 48.681 -33.984 46.682 1.00 30.51  ? 244 CYS B C   1 
ATOM   4436 O O   . CYS B 1 263 ? 47.715 -34.031 47.467 1.00 28.82  ? 244 CYS B O   1 
ATOM   4437 C CB  . CYS B 1 263 ? 49.671 -32.307 48.251 1.00 36.92  ? 244 CYS B CB  1 
ATOM   4438 S SG  . CYS B 1 263 ? 51.145 -31.356 48.789 1.00 41.48  ? 244 CYS B SG  1 
ATOM   4439 N N   . CYS B 1 264 ? 48.702 -34.632 45.527 1.00 28.98  ? 245 CYS B N   1 
ATOM   4440 C CA  . CYS B 1 264 ? 47.536 -35.392 45.084 1.00 27.41  ? 245 CYS B CA  1 
ATOM   4441 C C   . CYS B 1 264 ? 47.776 -36.905 45.098 1.00 26.11  ? 245 CYS B C   1 
ATOM   4442 O O   . CYS B 1 264 ? 48.828 -37.387 45.541 1.00 25.63  ? 245 CYS B O   1 
ATOM   4443 C CB  . CYS B 1 264 ? 47.095 -34.938 43.683 1.00 27.84  ? 245 CYS B CB  1 
ATOM   4444 S SG  . CYS B 1 264 ? 48.288 -35.232 42.353 1.00 27.67  ? 245 CYS B SG  1 
ATOM   4445 N N   . SER B 1 265 ? 46.793 -37.655 44.608 1.00 25.33  ? 246 SER B N   1 
ATOM   4446 C CA  . SER B 1 265 ? 46.919 -39.104 44.548 1.00 24.28  ? 246 SER B CA  1 
ATOM   4447 C C   . SER B 1 265 ? 47.735 -39.514 43.311 1.00 22.58  ? 246 SER B C   1 
ATOM   4448 O O   . SER B 1 265 ? 47.971 -38.706 42.380 1.00 19.48  ? 246 SER B O   1 
ATOM   4449 C CB  . SER B 1 265 ? 45.532 -39.751 44.511 1.00 22.65  ? 246 SER B CB  1 
ATOM   4450 O OG  . SER B 1 265 ? 44.909 -39.503 43.243 1.00 23.73  ? 246 SER B OG  1 
ATOM   4451 N N   . THR B 1 266 ? 48.187 -40.766 43.329 1.00 23.38  ? 247 THR B N   1 
ATOM   4452 C CA  . THR B 1 266 ? 48.905 -41.342 42.218 1.00 23.50  ? 247 THR B CA  1 
ATOM   4453 C C   . THR B 1 266 ? 48.002 -41.286 40.993 1.00 24.79  ? 247 THR B C   1 
ATOM   4454 O O   . THR B 1 266 ? 48.421 -40.846 39.898 1.00 27.60  ? 247 THR B O   1 
ATOM   4455 C CB  . THR B 1 266 ? 49.341 -42.813 42.509 1.00 24.08  ? 247 THR B CB  1 
ATOM   4456 O OG1 . THR B 1 266 ? 50.181 -42.860 43.682 1.00 26.60  ? 247 THR B OG1 1 
ATOM   4457 C CG2 . THR B 1 266 ? 50.123 -43.365 41.340 1.00 23.28  ? 247 THR B CG2 1 
ATOM   4458 N N   . ALA B 1 267 ? 46.748 -41.680 41.168 1.00 26.12  ? 248 ALA B N   1 
ATOM   4459 C CA  . ALA B 1 267 ? 45.844 -41.713 40.042 1.00 30.39  ? 248 ALA B CA  1 
ATOM   4460 C C   . ALA B 1 267 ? 45.619 -40.318 39.490 1.00 27.87  ? 248 ALA B C   1 
ATOM   4461 O O   . ALA B 1 267 ? 45.596 -40.168 38.280 1.00 30.23  ? 248 ALA B O   1 
ATOM   4462 C CB  . ALA B 1 267 ? 44.521 -42.350 40.439 1.00 20.00  ? 248 ALA B CB  1 
ATOM   4463 N N   . GLU B 1 268 ? 45.447 -39.313 40.352 1.00 25.80  ? 249 GLU B N   1 
ATOM   4464 C CA  . GLU B 1 268 ? 45.280 -37.933 39.858 1.00 27.67  ? 249 GLU B CA  1 
ATOM   4465 C C   . GLU B 1 268 ? 46.534 -37.430 39.118 1.00 27.10  ? 249 GLU B C   1 
ATOM   4466 O O   . GLU B 1 268 ? 46.442 -36.695 38.095 1.00 26.98  ? 249 GLU B O   1 
ATOM   4467 C CB  . GLU B 1 268 ? 44.919 -36.994 41.018 1.00 30.46  ? 249 GLU B CB  1 
ATOM   4468 C CG  . GLU B 1 268 ? 43.484 -37.190 41.475 1.00 34.23  ? 249 GLU B CG  1 
ATOM   4469 C CD  . GLU B 1 268 ? 43.194 -36.610 42.853 1.00 37.94  ? 249 GLU B CD  1 
ATOM   4470 O OE1 . GLU B 1 268 ? 44.155 -36.161 43.512 1.00 37.04  ? 249 GLU B OE1 1 
ATOM   4471 O OE2 . GLU B 1 268 ? 42.007 -36.603 43.270 1.00 37.91  ? 249 GLU B OE2 1 
ATOM   4472 N N   . ALA B 1 269 ? 47.707 -37.834 39.604 1.00 24.37  ? 250 ALA B N   1 
ATOM   4473 C CA  . ALA B 1 269 ? 48.960 -37.399 38.968 1.00 24.07  ? 250 ALA B CA  1 
ATOM   4474 C C   . ALA B 1 269 ? 49.178 -38.077 37.615 1.00 24.99  ? 250 ALA B C   1 
ATOM   4475 O O   . ALA B 1 269 ? 49.567 -37.415 36.649 1.00 25.50  ? 250 ALA B O   1 
ATOM   4476 C CB  . ALA B 1 269 ? 50.152 -37.662 39.880 1.00 23.80  ? 250 ALA B CB  1 
ATOM   4477 N N   . CYS B 1 270 ? 48.938 -39.388 37.519 1.00 25.72  ? 251 CYS B N   1 
ATOM   4478 C CA  . CYS B 1 270 ? 49.000 -40.017 36.192 1.00 27.51  ? 251 CYS B CA  1 
ATOM   4479 C C   . CYS B 1 270 ? 48.040 -39.372 35.192 1.00 28.09  ? 251 CYS B C   1 
ATOM   4480 O O   . CYS B 1 270 ? 48.361 -39.181 34.019 1.00 27.60  ? 251 CYS B O   1 
ATOM   4481 C CB  . CYS B 1 270 ? 48.671 -41.501 36.269 1.00 26.89  ? 251 CYS B CB  1 
ATOM   4482 S SG  . CYS B 1 270 ? 49.908 -42.468 37.070 1.00 30.04  ? 251 CYS B SG  1 
ATOM   4483 N N   . ALA B 1 271 ? 46.841 -39.070 35.659 1.00 28.60  ? 252 ALA B N   1 
ATOM   4484 C CA  . ALA B 1 271 ? 45.828 -38.469 34.813 1.00 30.05  ? 252 ALA B CA  1 
ATOM   4485 C C   . ALA B 1 271 ? 46.246 -37.088 34.344 1.00 29.55  ? 252 ALA B C   1 
ATOM   4486 O O   . ALA B 1 271 ? 45.951 -36.708 33.210 1.00 31.09  ? 252 ALA B O   1 
ATOM   4487 C CB  . ALA B 1 271 ? 44.495 -38.395 35.566 1.00 31.76  ? 252 ALA B CB  1 
ATOM   4488 N N   . VAL B 1 272 ? 46.898 -36.325 35.221 1.00 27.08  ? 253 VAL B N   1 
ATOM   4489 C CA  . VAL B 1 272 ? 47.356 -34.990 34.841 1.00 27.79  ? 253 VAL B CA  1 
ATOM   4490 C C   . VAL B 1 272 ? 48.344 -35.142 33.705 1.00 26.76  ? 253 VAL B C   1 
ATOM   4491 O O   . VAL B 1 272 ? 48.249 -34.418 32.732 1.00 27.34  ? 253 VAL B O   1 
ATOM   4492 C CB  . VAL B 1 272 ? 48.012 -34.210 36.029 1.00 27.23  ? 253 VAL B CB  1 
ATOM   4493 C CG1 . VAL B 1 272 ? 48.826 -33.013 35.530 1.00 27.31  ? 253 VAL B CG1 1 
ATOM   4494 C CG2 . VAL B 1 272 ? 46.938 -33.727 36.987 1.00 29.51  ? 253 VAL B CG2 1 
ATOM   4495 N N   . VAL B 1 273 ? 49.261 -36.106 33.818 1.00 25.06  ? 254 VAL B N   1 
ATOM   4496 C CA  . VAL B 1 273 ? 50.342 -36.242 32.829 1.00 24.56  ? 254 VAL B CA  1 
ATOM   4497 C C   . VAL B 1 273 ? 49.775 -36.809 31.536 1.00 23.99  ? 254 VAL B C   1 
ATOM   4498 O O   . VAL B 1 273 ? 50.039 -36.284 30.454 1.00 23.50  ? 254 VAL B O   1 
ATOM   4499 C CB  . VAL B 1 273 ? 51.504 -37.144 33.344 1.00 24.08  ? 254 VAL B CB  1 
ATOM   4500 C CG1 . VAL B 1 273 ? 52.510 -37.393 32.244 1.00 23.08  ? 254 VAL B CG1 1 
ATOM   4501 C CG2 . VAL B 1 273 ? 52.191 -36.496 34.591 1.00 23.15  ? 254 VAL B CG2 1 
ATOM   4502 N N   . TRP B 1 274 ? 48.998 -37.885 31.644 1.00 24.11  ? 255 TRP B N   1 
ATOM   4503 C CA  . TRP B 1 274 ? 48.368 -38.471 30.450 1.00 24.71  ? 255 TRP B CA  1 
ATOM   4504 C C   . TRP B 1 274 ? 47.433 -37.490 29.721 1.00 26.34  ? 255 TRP B C   1 
ATOM   4505 O O   . TRP B 1 274 ? 47.456 -37.409 28.475 1.00 24.86  ? 255 TRP B O   1 
ATOM   4506 C CB  . TRP B 1 274 ? 47.602 -39.742 30.815 1.00 26.60  ? 255 TRP B CB  1 
ATOM   4507 C CG  . TRP B 1 274 ? 47.262 -40.564 29.609 1.00 28.69  ? 255 TRP B CG  1 
ATOM   4508 C CD1 . TRP B 1 274 ? 46.070 -40.584 28.938 1.00 30.94  ? 255 TRP B CD1 1 
ATOM   4509 C CD2 . TRP B 1 274 ? 48.130 -41.466 28.917 1.00 29.02  ? 255 TRP B CD2 1 
ATOM   4510 N NE1 . TRP B 1 274 ? 46.144 -41.462 27.864 1.00 31.51  ? 255 TRP B NE1 1 
ATOM   4511 C CE2 . TRP B 1 274 ? 47.400 -42.011 27.837 1.00 31.45  ? 255 TRP B CE2 1 
ATOM   4512 C CE3 . TRP B 1 274 ? 49.454 -41.870 29.105 1.00 30.36  ? 255 TRP B CE3 1 
ATOM   4513 C CZ2 . TRP B 1 274 ? 47.958 -42.922 26.954 1.00 31.70  ? 255 TRP B CZ2 1 
ATOM   4514 C CZ3 . TRP B 1 274 ? 50.001 -42.777 28.230 1.00 31.57  ? 255 TRP B CZ3 1 
ATOM   4515 C CH2 . TRP B 1 274 ? 49.257 -43.295 27.169 1.00 32.30  ? 255 TRP B CH2 1 
ATOM   4516 N N   . ASP B 1 275 ? 46.622 -36.744 30.467 1.00 26.69  ? 256 ASP B N   1 
ATOM   4517 C CA  . ASP B 1 275 ? 45.739 -35.760 29.845 1.00 27.04  ? 256 ASP B CA  1 
ATOM   4518 C C   . ASP B 1 275 ? 46.507 -34.644 29.176 1.00 23.72  ? 256 ASP B C   1 
ATOM   4519 O O   . ASP B 1 275 ? 46.076 -34.125 28.131 1.00 23.15  ? 256 ASP B O   1 
ATOM   4520 C CB  . ASP B 1 275 ? 44.776 -35.147 30.852 1.00 30.03  ? 256 ASP B CB  1 
ATOM   4521 C CG  . ASP B 1 275 ? 43.756 -36.151 31.389 1.00 34.27  ? 256 ASP B CG  1 
ATOM   4522 O OD1 . ASP B 1 275 ? 43.098 -35.806 32.393 1.00 36.52  ? 256 ASP B OD1 1 
ATOM   4523 O OD2 . ASP B 1 275 ? 43.622 -37.273 30.852 1.00 35.15  ? 256 ASP B OD2 1 
ATOM   4524 N N   . GLU B 1 276 ? 47.634 -34.241 29.765 1.00 23.75  ? 257 GLU B N   1 
ATOM   4525 C CA  . GLU B 1 276 ? 48.462 -33.237 29.100 1.00 23.70  ? 257 GLU B CA  1 
ATOM   4526 C C   . GLU B 1 276 ? 49.010 -33.767 27.759 1.00 21.10  ? 257 GLU B C   1 
ATOM   4527 O O   . GLU B 1 276 ? 49.059 -33.053 26.744 1.00 20.63  ? 257 GLU B O   1 
ATOM   4528 C CB  . GLU B 1 276 ? 49.610 -32.774 30.004 1.00 26.55  ? 257 GLU B CB  1 
ATOM   4529 C CG  . GLU B 1 276 ? 50.373 -31.679 29.334 1.00 31.93  ? 257 GLU B CG  1 
ATOM   4530 C CD  . GLU B 1 276 ? 51.059 -30.713 30.262 1.00 37.29  ? 257 GLU B CD  1 
ATOM   4531 O OE1 . GLU B 1 276 ? 50.957 -30.848 31.523 1.00 37.86  ? 257 GLU B OE1 1 
ATOM   4532 O OE2 . GLU B 1 276 ? 51.703 -29.800 29.686 1.00 39.04  ? 257 GLU B OE2 1 
ATOM   4533 N N   . ALA B 1 277 ? 49.436 -35.015 27.752 1.00 20.15  ? 258 ALA B N   1 
ATOM   4534 C CA  . ALA B 1 277 ? 49.884 -35.633 26.510 1.00 19.41  ? 258 ALA B CA  1 
ATOM   4535 C C   . ALA B 1 277 ? 48.782 -35.626 25.472 1.00 18.87  ? 258 ALA B C   1 
ATOM   4536 O O   . ALA B 1 277 ? 49.043 -35.347 24.297 1.00 19.02  ? 258 ALA B O   1 
ATOM   4537 C CB  . ALA B 1 277 ? 50.388 -37.079 26.749 1.00 18.75  ? 258 ALA B CB  1 
ATOM   4538 N N   . GLN B 1 278 ? 47.566 -35.975 25.883 1.00 18.98  ? 259 GLN B N   1 
ATOM   4539 C CA  . GLN B 1 278 ? 46.439 -36.021 24.950 1.00 20.00  ? 259 GLN B CA  1 
ATOM   4540 C C   . GLN B 1 278 ? 46.130 -34.614 24.430 1.00 21.64  ? 259 GLN B C   1 
ATOM   4541 O O   . GLN B 1 278 ? 45.902 -34.446 23.237 1.00 21.92  ? 259 GLN B O   1 
ATOM   4542 C CB  . GLN B 1 278 ? 45.210 -36.643 25.601 1.00 21.04  ? 259 GLN B CB  1 
ATOM   4543 C CG  . GLN B 1 278 ? 44.088 -36.820 24.601 1.00 21.23  ? 259 GLN B CG  1 
ATOM   4544 C CD  . GLN B 1 278 ? 44.437 -37.807 23.479 1.00 23.32  ? 259 GLN B CD  1 
ATOM   4545 O OE1 . GLN B 1 278 ? 44.657 -39.002 23.730 1.00 24.22  ? 259 GLN B OE1 1 
ATOM   4546 N NE2 . GLN B 1 278 ? 44.449 -37.314 22.232 1.00 23.20  ? 259 GLN B NE2 1 
ATOM   4547 N N   . ARG B 1 279 ? 46.184 -33.604 25.305 1.00 21.96  ? 260 ARG B N   1 
ATOM   4548 C CA  . ARG B 1 279 ? 45.965 -32.223 24.866 1.00 22.54  ? 260 ARG B CA  1 
ATOM   4549 C C   . ARG B 1 279 ? 47.008 -31.777 23.853 1.00 19.19  ? 260 ARG B C   1 
ATOM   4550 O O   . ARG B 1 279 ? 46.666 -31.086 22.871 1.00 19.85  ? 260 ARG B O   1 
ATOM   4551 C CB  . ARG B 1 279 ? 45.934 -31.241 26.054 1.00 26.63  ? 260 ARG B CB  1 
ATOM   4552 C CG  . ARG B 1 279 ? 44.672 -31.394 26.923 1.00 31.77  ? 260 ARG B CG  1 
ATOM   4553 C CD  . ARG B 1 279 ? 44.440 -30.210 27.875 1.00 35.89  ? 260 ARG B CD  1 
ATOM   4554 N NE  . ARG B 1 279 ? 45.565 -29.990 28.791 1.00 39.57  ? 260 ARG B NE  1 
ATOM   4555 C CZ  . ARG B 1 279 ? 45.776 -30.680 29.912 1.00 41.20  ? 260 ARG B CZ  1 
ATOM   4556 N NH1 . ARG B 1 279 ? 44.944 -31.644 30.283 1.00 42.30  ? 260 ARG B NH1 1 
ATOM   4557 N NH2 . ARG B 1 279 ? 46.828 -30.406 30.662 1.00 42.58  ? 260 ARG B NH2 1 
ATOM   4558 N N   . MET B 1 280 ? 48.270 -32.139 24.065 1.00 19.03  ? 261 MET B N   1 
ATOM   4559 C CA  A MET B 1 280 ? 49.309 -31.827 23.081 0.50 17.33  ? 261 MET B CA  1 
ATOM   4560 C CA  B MET B 1 280 ? 49.327 -31.855 23.086 0.50 17.33  ? 261 MET B CA  1 
ATOM   4561 C C   . MET B 1 280 ? 49.073 -32.560 21.759 1.00 17.30  ? 261 MET B C   1 
ATOM   4562 O O   . MET B 1 280 ? 49.276 -31.963 20.684 1.00 19.07  ? 261 MET B O   1 
ATOM   4563 C CB  A MET B 1 280 ? 50.707 -32.158 23.626 0.50 17.25  ? 261 MET B CB  1 
ATOM   4564 C CB  B MET B 1 280 ? 50.709 -32.271 23.613 0.50 17.23  ? 261 MET B CB  1 
ATOM   4565 C CG  A MET B 1 280 ? 51.132 -31.237 24.774 0.50 18.47  ? 261 MET B CG  1 
ATOM   4566 C CG  B MET B 1 280 ? 51.257 -31.367 24.706 0.50 18.93  ? 261 MET B CG  1 
ATOM   4567 S SD  A MET B 1 280 ? 52.878 -31.363 25.195 0.50 19.65  ? 261 MET B SD  1 
ATOM   4568 S SD  B MET B 1 280 ? 52.976 -31.742 25.095 0.50 20.45  ? 261 MET B SD  1 
ATOM   4569 C CE  A MET B 1 280 ? 52.980 -33.040 25.842 0.50 18.73  ? 261 MET B CE  1 
ATOM   4570 C CE  B MET B 1 280 ? 52.815 -33.269 26.022 0.50 19.63  ? 261 MET B CE  1 
ATOM   4571 N N   . ALA B 1 281 ? 48.648 -33.846 21.817 1.00 18.01  ? 262 ALA B N   1 
ATOM   4572 C CA  . ALA B 1 281 ? 48.284 -34.564 20.583 1.00 18.76  ? 262 ALA B CA  1 
ATOM   4573 C C   . ALA B 1 281 ? 47.117 -33.900 19.866 1.00 20.29  ? 262 ALA B C   1 
ATOM   4574 O O   . ALA B 1 281 ? 47.159 -33.739 18.655 1.00 20.99  ? 262 ALA B O   1 
ATOM   4575 C CB  . ALA B 1 281 ? 47.952 -36.016 20.864 1.00 19.60  ? 262 ALA B CB  1 
ATOM   4576 N N   . ASP B 1 282 ? 46.117 -33.450 20.611 1.00 21.27  ? 263 ASP B N   1 
ATOM   4577 C CA  . ASP B 1 282 ? 44.973 -32.767 20.016 1.00 22.67  ? 263 ASP B CA  1 
ATOM   4578 C C   . ASP B 1 282 ? 45.413 -31.481 19.308 1.00 21.83  ? 263 ASP B C   1 
ATOM   4579 O O   . ASP B 1 282 ? 44.953 -31.167 18.191 1.00 20.87  ? 263 ASP B O   1 
ATOM   4580 C CB  . ASP B 1 282 ? 43.937 -32.384 21.075 1.00 23.96  ? 263 ASP B CB  1 
ATOM   4581 C CG  . ASP B 1 282 ? 43.211 -33.573 21.691 1.00 27.19  ? 263 ASP B CG  1 
ATOM   4582 O OD1 . ASP B 1 282 ? 43.297 -34.721 21.196 1.00 28.11  ? 263 ASP B OD1 1 
ATOM   4583 O OD2 . ASP B 1 282 ? 42.525 -33.328 22.706 1.00 29.06  ? 263 ASP B OD2 1 
ATOM   4584 N N   . ARG B 1 283 ? 46.306 -30.733 19.959 1.00 20.20  ? 264 ARG B N   1 
ATOM   4585 C CA  . ARG B 1 283 ? 46.819 -29.491 19.367 1.00 18.78  ? 264 ARG B CA  1 
ATOM   4586 C C   . ARG B 1 283 ? 47.657 -29.769 18.104 1.00 18.44  ? 264 ARG B C   1 
ATOM   4587 O O   . ARG B 1 283 ? 47.563 -29.030 17.103 1.00 19.30  ? 264 ARG B O   1 
ATOM   4588 C CB  . ARG B 1 283 ? 47.655 -28.694 20.380 1.00 19.31  ? 264 ARG B CB  1 
ATOM   4589 C CG  . ARG B 1 283 ? 48.171 -27.401 19.789 1.00 23.19  ? 264 ARG B CG  1 
ATOM   4590 C CD  . ARG B 1 283 ? 48.772 -26.449 20.822 1.00 28.07  ? 264 ARG B CD  1 
ATOM   4591 N NE  . ARG B 1 283 ? 49.203 -25.232 20.124 1.00 31.42  ? 264 ARG B NE  1 
ATOM   4592 C CZ  . ARG B 1 283 ? 48.426 -24.176 19.929 1.00 32.73  ? 264 ARG B CZ  1 
ATOM   4593 N NH1 . ARG B 1 283 ? 47.198 -24.175 20.432 1.00 33.49  ? 264 ARG B NH1 1 
ATOM   4594 N NH2 . ARG B 1 283 ? 48.879 -23.114 19.257 1.00 32.78  ? 264 ARG B NH2 1 
ATOM   4595 N N   . PHE B 1 284 ? 48.485 -30.810 18.162 1.00 17.16  ? 265 PHE B N   1 
ATOM   4596 C CA  . PHE B 1 284 ? 49.271 -31.231 17.011 1.00 16.84  ? 265 PHE B CA  1 
ATOM   4597 C C   . PHE B 1 284 ? 48.350 -31.419 15.803 1.00 18.95  ? 265 PHE B C   1 
ATOM   4598 O O   . PHE B 1 284 ? 48.649 -30.936 14.709 1.00 19.58  ? 265 PHE B O   1 
ATOM   4599 C CB  . PHE B 1 284 ? 50.029 -32.534 17.319 1.00 17.90  ? 265 PHE B CB  1 
ATOM   4600 C CG  . PHE B 1 284 ? 50.828 -33.077 16.156 1.00 18.59  ? 265 PHE B CG  1 
ATOM   4601 C CD1 . PHE B 1 284 ? 52.178 -32.741 16.001 1.00 18.12  ? 265 PHE B CD1 1 
ATOM   4602 C CD2 . PHE B 1 284 ? 50.242 -33.933 15.225 1.00 18.08  ? 265 PHE B CD2 1 
ATOM   4603 C CE1 . PHE B 1 284 ? 52.952 -33.251 14.939 1.00 17.81  ? 265 PHE B CE1 1 
ATOM   4604 C CE2 . PHE B 1 284 ? 50.997 -34.439 14.149 1.00 19.24  ? 265 PHE B CE2 1 
ATOM   4605 C CZ  . PHE B 1 284 ? 52.345 -34.079 13.990 1.00 18.76  ? 265 PHE B CZ  1 
ATOM   4606 N N   . CYS B 1 285 ? 47.240 -32.126 16.008 1.00 20.98  ? 266 CYS B N   1 
ATOM   4607 C CA  . CYS B 1 285 ? 46.333 -32.435 14.896 1.00 21.20  ? 266 CYS B CA  1 
ATOM   4608 C C   . CYS B 1 285 ? 45.576 -31.189 14.416 1.00 21.64  ? 266 CYS B C   1 
ATOM   4609 O O   . CYS B 1 285 ? 45.323 -31.040 13.218 1.00 23.84  ? 266 CYS B O   1 
ATOM   4610 C CB  . CYS B 1 285 ? 45.358 -33.556 15.290 1.00 22.91  ? 266 CYS B CB  1 
ATOM   4611 S SG  . CYS B 1 285 ? 46.159 -35.134 15.641 1.00 25.40  ? 266 CYS B SG  1 
ATOM   4612 N N   . ASP B 1 286 ? 45.216 -30.284 15.325 1.00 22.31  ? 267 ASP B N   1 
ATOM   4613 C CA  . ASP B 1 286 ? 44.597 -29.017 14.908 1.00 23.23  ? 267 ASP B CA  1 
ATOM   4614 C C   . ASP B 1 286 ? 45.542 -28.225 14.013 1.00 22.89  ? 267 ASP B C   1 
ATOM   4615 O O   . ASP B 1 286 ? 45.145 -27.681 12.974 1.00 24.59  ? 267 ASP B O   1 
ATOM   4616 C CB  . ASP B 1 286 ? 44.230 -28.140 16.103 1.00 26.56  ? 267 ASP B CB  1 
ATOM   4617 C CG  . ASP B 1 286 ? 43.116 -28.710 16.941 1.00 32.85  ? 267 ASP B CG  1 
ATOM   4618 O OD1 . ASP B 1 286 ? 42.447 -29.672 16.497 1.00 34.45  ? 267 ASP B OD1 1 
ATOM   4619 O OD2 . ASP B 1 286 ? 42.914 -28.169 18.059 1.00 35.11  ? 267 ASP B OD2 1 
ATOM   4620 N N   . LEU B 1 287 ? 46.807 -28.172 14.416 1.00 19.47  ? 268 LEU B N   1 
ATOM   4621 C CA  A LEU B 1 287 ? 47.803 -27.428 13.659 0.50 19.59  ? 268 LEU B CA  1 
ATOM   4622 C CA  B LEU B 1 287 ? 47.796 -27.422 13.651 0.50 18.80  ? 268 LEU B CA  1 
ATOM   4623 C C   . LEU B 1 287 ? 48.051 -28.072 12.295 1.00 20.32  ? 268 LEU B C   1 
ATOM   4624 O O   . LEU B 1 287 ? 48.255 -27.377 11.283 1.00 20.89  ? 268 LEU B O   1 
ATOM   4625 C CB  A LEU B 1 287 ? 49.101 -27.332 14.450 0.50 20.56  ? 268 LEU B CB  1 
ATOM   4626 C CB  B LEU B 1 287 ? 49.094 -27.304 14.432 0.50 18.31  ? 268 LEU B CB  1 
ATOM   4627 C CG  A LEU B 1 287 ? 49.200 -26.126 15.385 0.50 21.95  ? 268 LEU B CG  1 
ATOM   4628 C CG  B LEU B 1 287 ? 48.984 -26.399 15.649 0.50 18.48  ? 268 LEU B CG  1 
ATOM   4629 C CD1 A LEU B 1 287 ? 48.076 -26.074 16.389 0.50 23.11  ? 268 LEU B CD1 1 
ATOM   4630 C CD1 B LEU B 1 287 ? 50.209 -26.607 16.500 0.50 19.16  ? 268 LEU B CD1 1 
ATOM   4631 C CD2 A LEU B 1 287 ? 50.553 -26.130 16.053 0.50 21.45  ? 268 LEU B CD2 1 
ATOM   4632 C CD2 B LEU B 1 287 ? 48.869 -24.938 15.186 0.50 18.36  ? 268 LEU B CD2 1 
ATOM   4633 N N   . ARG B 1 288 ? 48.036 -29.404 12.270 1.00 19.91  ? 269 ARG B N   1 
ATOM   4634 C CA  . ARG B 1 288 ? 48.224 -30.112 11.015 1.00 22.06  ? 269 ARG B CA  1 
ATOM   4635 C C   . ARG B 1 288 ? 47.070 -29.790 10.055 1.00 23.59  ? 269 ARG B C   1 
ATOM   4636 O O   . ARG B 1 288 ? 47.273 -29.658 8.841  1.00 24.85  ? 269 ARG B O   1 
ATOM   4637 C CB  . ARG B 1 288 ? 48.332 -31.616 11.290 1.00 25.77  ? 269 ARG B CB  1 
ATOM   4638 C CG  . ARG B 1 288 ? 48.639 -32.448 10.094 1.00 30.44  ? 269 ARG B CG  1 
ATOM   4639 C CD  . ARG B 1 288 ? 48.917 -33.833 10.629 1.00 35.22  ? 269 ARG B CD  1 
ATOM   4640 N NE  . ARG B 1 288 ? 49.165 -34.803 9.578  1.00 39.27  ? 269 ARG B NE  1 
ATOM   4641 C CZ  . ARG B 1 288 ? 48.255 -35.656 9.127  1.00 42.43  ? 269 ARG B CZ  1 
ATOM   4642 N NH1 . ARG B 1 288 ? 47.013 -35.650 9.618  1.00 42.70  ? 269 ARG B NH1 1 
ATOM   4643 N NH2 . ARG B 1 288 ? 48.593 -36.513 8.177  1.00 44.22  ? 269 ARG B NH2 1 
ATOM   4644 N N   . ASP B 1 289 ? 45.872 -29.594 10.601 1.00 24.65  ? 270 ASP B N   1 
ATOM   4645 C CA  . ASP B 1 289 ? 44.705 -29.207 9.790  1.00 25.66  ? 270 ASP B CA  1 
ATOM   4646 C C   . ASP B 1 289 ? 44.884 -27.815 9.185  1.00 24.21  ? 270 ASP B C   1 
ATOM   4647 O O   . ASP B 1 289 ? 44.295 -27.500 8.146  1.00 25.39  ? 270 ASP B O   1 
ATOM   4648 C CB  . ASP B 1 289 ? 43.421 -29.199 10.626 1.00 27.77  ? 270 ASP B CB  1 
ATOM   4649 C CG  . ASP B 1 289 ? 42.918 -30.592 10.994 1.00 32.79  ? 270 ASP B CG  1 
ATOM   4650 O OD1 . ASP B 1 289 ? 43.332 -31.604 10.371 1.00 34.77  ? 270 ASP B OD1 1 
ATOM   4651 O OD2 . ASP B 1 289 ? 42.067 -30.652 11.922 1.00 34.45  ? 270 ASP B OD2 1 
ATOM   4652 N N   . GLN B 1 290 ? 45.674 -26.974 9.860  1.00 22.44  ? 271 GLN B N   1 
ATOM   4653 C CA  . GLN B 1 290 ? 45.896 -25.592 9.413  1.00 22.80  ? 271 GLN B CA  1 
ATOM   4654 C C   . GLN B 1 290 ? 47.097 -25.472 8.460  1.00 22.11  ? 271 GLN B C   1 
ATOM   4655 O O   . GLN B 1 290 ? 47.393 -24.367 7.982  1.00 23.99  ? 271 GLN B O   1 
ATOM   4656 C CB  . GLN B 1 290 ? 46.087 -24.658 10.628 1.00 24.55  ? 271 GLN B CB  1 
ATOM   4657 C CG  . GLN B 1 290 ? 44.883 -24.643 11.569 1.00 28.26  ? 271 GLN B CG  1 
ATOM   4658 C CD  . GLN B 1 290 ? 45.189 -24.068 12.956 1.00 31.40  ? 271 GLN B CD  1 
ATOM   4659 O OE1 . GLN B 1 290 ? 46.119 -23.269 13.134 1.00 33.83  ? 271 GLN B OE1 1 
ATOM   4660 N NE2 . GLN B 1 290 ? 44.400 -24.472 13.945 1.00 32.80  ? 271 GLN B NE2 1 
ATOM   4661 N N   . LEU B 1 291 ? 47.771 -26.597 8.178  1.00 19.66  ? 272 LEU B N   1 
ATOM   4662 C CA  . LEU B 1 291 ? 48.983 -26.552 7.341  1.00 20.54  ? 272 LEU B CA  1 
ATOM   4663 C C   . LEU B 1 291 ? 48.737 -26.014 5.903  1.00 21.17  ? 272 LEU B C   1 
ATOM   4664 O O   . LEU B 1 291 ? 49.547 -25.248 5.394  1.00 21.23  ? 272 LEU B O   1 
ATOM   4665 C CB  . LEU B 1 291 ? 49.668 -27.939 7.295  1.00 22.39  ? 272 LEU B CB  1 
ATOM   4666 C CG  . LEU B 1 291 ? 50.907 -28.134 6.414  1.00 21.31  ? 272 LEU B CG  1 
ATOM   4667 C CD1 . LEU B 1 291 ? 51.811 -29.245 7.035  1.00 22.37  ? 272 LEU B CD1 1 
ATOM   4668 C CD2 . LEU B 1 291 ? 50.470 -28.508 4.984  1.00 21.52  ? 272 LEU B CD2 1 
ATOM   4669 N N   . PRO B 1 292 ? 47.660 -26.451 5.233  1.00 22.64  ? 273 PRO B N   1 
ATOM   4670 C CA  . PRO B 1 292 ? 47.474 -25.910 3.873  1.00 22.08  ? 273 PRO B CA  1 
ATOM   4671 C C   . PRO B 1 292 ? 47.375 -24.378 3.866  1.00 23.30  ? 273 PRO B C   1 
ATOM   4672 O O   . PRO B 1 292 ? 48.032 -23.722 3.032  1.00 22.29  ? 273 PRO B O   1 
ATOM   4673 C CB  . PRO B 1 292 ? 46.170 -26.586 3.421  1.00 22.12  ? 273 PRO B CB  1 
ATOM   4674 C CG  . PRO B 1 292 ? 46.182 -27.911 4.165  1.00 23.12  ? 273 PRO B CG  1 
ATOM   4675 C CD  . PRO B 1 292 ? 46.694 -27.526 5.537  1.00 22.89  ? 273 PRO B CD  1 
ATOM   4676 N N   . ASP B 1 293 ? 46.613 -23.813 4.794  1.00 25.12  ? 274 ASP B N   1 
ATOM   4677 C CA  . ASP B 1 293 ? 46.443 -22.344 4.819  1.00 28.42  ? 274 ASP B CA  1 
ATOM   4678 C C   . ASP B 1 293 ? 47.774 -21.659 5.096  1.00 26.87  ? 274 ASP B C   1 
ATOM   4679 O O   . ASP B 1 293 ? 48.083 -20.592 4.555  1.00 27.69  ? 274 ASP B O   1 
ATOM   4680 C CB  . ASP B 1 293 ? 45.411 -21.926 5.874  1.00 31.94  ? 274 ASP B CB  1 
ATOM   4681 C CG  . ASP B 1 293 ? 43.973 -22.268 5.474  1.00 36.90  ? 274 ASP B CG  1 
ATOM   4682 O OD1 . ASP B 1 293 ? 43.668 -22.270 4.265  1.00 37.66  ? 274 ASP B OD1 1 
ATOM   4683 O OD2 . ASP B 1 293 ? 43.136 -22.520 6.380  1.00 39.22  ? 274 ASP B OD2 1 
ATOM   4684 N N   . ALA B 1 294 ? 48.569 -22.269 5.966  1.00 24.58  ? 275 ALA B N   1 
ATOM   4685 C CA  . ALA B 1 294 ? 49.855 -21.688 6.312  1.00 23.30  ? 275 ALA B CA  1 
ATOM   4686 C C   . ALA B 1 294 ? 50.809 -21.667 5.110  1.00 23.22  ? 275 ALA B C   1 
ATOM   4687 O O   . ALA B 1 294 ? 51.536 -20.682 4.897  1.00 25.18  ? 275 ALA B O   1 
ATOM   4688 C CB  . ALA B 1 294 ? 50.473 -22.451 7.490  1.00 22.49  ? 275 ALA B CB  1 
ATOM   4689 N N   . CYS B 1 295 ? 50.817 -22.757 4.339  1.00 21.61  ? 276 CYS B N   1 
ATOM   4690 C CA  . CYS B 1 295 ? 51.680 -22.865 3.166  1.00 21.52  ? 276 CYS B CA  1 
ATOM   4691 C C   . CYS B 1 295 ? 51.247 -21.878 2.094  1.00 22.44  ? 276 CYS B C   1 
ATOM   4692 O O   . CYS B 1 295 ? 52.079 -21.181 1.524  1.00 22.96  ? 276 CYS B O   1 
ATOM   4693 C CB  . CYS B 1 295 ? 51.675 -24.297 2.620  1.00 21.33  ? 276 CYS B CB  1 
ATOM   4694 S SG  . CYS B 1 295 ? 52.560 -25.476 3.703  1.00 22.47  ? 276 CYS B SG  1 
ATOM   4695 N N   . ARG B 1 296 ? 49.941 -21.788 1.851  1.00 23.78  ? 277 ARG B N   1 
ATOM   4696 C CA  . ARG B 1 296 ? 49.411 -20.833 0.883  1.00 26.18  ? 277 ARG B CA  1 
ATOM   4697 C C   . ARG B 1 296 ? 49.723 -19.399 1.277  1.00 26.15  ? 277 ARG B C   1 
ATOM   4698 O O   . ARG B 1 296 ? 50.004 -18.571 0.386  1.00 26.91  ? 277 ARG B O   1 
ATOM   4699 C CB  . ARG B 1 296 ? 47.908 -21.044 0.720  1.00 28.49  ? 277 ARG B CB  1 
ATOM   4700 C CG  . ARG B 1 296 ? 47.612 -22.315 -0.089 1.00 30.42  ? 277 ARG B CG  1 
ATOM   4701 C CD  . ARG B 1 296 ? 46.153 -22.451 -0.458 1.00 33.01  ? 277 ARG B CD  1 
ATOM   4702 N NE  . ARG B 1 296 ? 45.294 -22.444 0.715  1.00 35.96  ? 277 ARG B NE  1 
ATOM   4703 C CZ  . ARG B 1 296 ? 44.728 -23.532 1.228  1.00 37.87  ? 277 ARG B CZ  1 
ATOM   4704 N NH1 . ARG B 1 296 ? 43.970 -23.432 2.312  1.00 37.20  ? 277 ARG B NH1 1 
ATOM   4705 N NH2 . ARG B 1 296 ? 44.914 -24.719 0.647  1.00 39.45  ? 277 ARG B NH2 1 
ATOM   4706 N N   . SER B 1 297 ? 49.722 -19.107 2.584  1.00 25.15  ? 278 SER B N   1 
ATOM   4707 C CA  . SER B 1 297 ? 49.966 -17.730 3.052  1.00 25.47  ? 278 SER B CA  1 
ATOM   4708 C C   . SER B 1 297 ? 51.345 -17.247 2.657  1.00 25.00  ? 278 SER B C   1 
ATOM   4709 O O   . SER B 1 297 ? 51.553 -16.039 2.486  1.00 26.24  ? 278 SER B O   1 
ATOM   4710 C CB  . SER B 1 297 ? 49.805 -17.607 4.569  1.00 24.65  ? 278 SER B CB  1 
ATOM   4711 O OG  . SER B 1 297 ? 50.900 -18.191 5.256  1.00 25.57  ? 278 SER B OG  1 
ATOM   4712 N N   . MET B 1 298 ? 52.275 -18.188 2.486  1.00 25.25  ? 279 MET B N   1 
ATOM   4713 C CA  . MET B 1 298 ? 53.640 -17.874 2.103  1.00 23.15  ? 279 MET B CA  1 
ATOM   4714 C C   . MET B 1 298 ? 53.913 -18.063 0.607  1.00 23.98  ? 279 MET B C   1 
ATOM   4715 O O   . MET B 1 298 ? 55.045 -17.881 0.166  1.00 23.50  ? 279 MET B O   1 
ATOM   4716 C CB  . MET B 1 298 ? 54.618 -18.733 2.934  1.00 22.62  ? 279 MET B CB  1 
ATOM   4717 C CG  . MET B 1 298 ? 54.666 -18.354 4.446  1.00 21.27  ? 279 MET B CG  1 
ATOM   4718 S SD  . MET B 1 298 ? 56.086 -19.144 5.247  1.00 20.11  ? 279 MET B SD  1 
ATOM   4719 C CE  . MET B 1 298 ? 55.658 -20.884 5.116  1.00 21.24  ? 279 MET B CE  1 
ATOM   4720 N N   . SER B 1 299 ? 52.880 -18.446 -0.150 1.00 25.71  ? 280 SER B N   1 
ATOM   4721 C CA  . SER B 1 299 ? 52.982 -18.699 -1.606 1.00 27.11  ? 280 SER B CA  1 
ATOM   4722 C C   . SER B 1 299 ? 54.111 -19.672 -1.918 1.00 27.54  ? 280 SER B C   1 
ATOM   4723 O O   . SER B 1 299 ? 54.935 -19.422 -2.804 1.00 28.00  ? 280 SER B O   1 
ATOM   4724 C CB  . SER B 1 299 ? 53.209 -17.422 -2.405 1.00 28.77  ? 280 SER B CB  1 
ATOM   4725 O OG  . SER B 1 299 ? 52.096 -16.586 -2.326 1.00 31.69  ? 280 SER B OG  1 
ATOM   4726 N N   . LEU B 1 300 ? 54.153 -20.777 -1.185 1.00 24.29  ? 281 LEU B N   1 
ATOM   4727 C CA  . LEU B 1 300 ? 55.111 -21.840 -1.500 1.00 25.15  ? 281 LEU B CA  1 
ATOM   4728 C C   . LEU B 1 300 ? 54.863 -22.353 -2.904 1.00 26.10  ? 281 LEU B C   1 
ATOM   4729 O O   . LEU B 1 300 ? 53.712 -22.400 -3.343 1.00 26.33  ? 281 LEU B O   1 
ATOM   4730 C CB  . LEU B 1 300 ? 54.994 -23.011 -0.542 1.00 22.26  ? 281 LEU B CB  1 
ATOM   4731 C CG  . LEU B 1 300 ? 55.299 -22.769 0.929  1.00 20.27  ? 281 LEU B CG  1 
ATOM   4732 C CD1 . LEU B 1 300 ? 55.261 -24.135 1.697  1.00 21.83  ? 281 LEU B CD1 1 
ATOM   4733 C CD2 . LEU B 1 300 ? 56.676 -22.068 1.046  1.00 19.51  ? 281 LEU B CD2 1 
ATOM   4734 N N   . ASP B 1 301 ? 55.931 -22.749 -3.599 1.00 25.68  ? 282 ASP B N   1 
ATOM   4735 C CA  . ASP B 1 301 ? 55.776 -23.422 -4.886 1.00 25.60  ? 282 ASP B CA  1 
ATOM   4736 C C   . ASP B 1 301 ? 55.500 -24.920 -4.630 1.00 27.42  ? 282 ASP B C   1 
ATOM   4737 O O   . ASP B 1 301 ? 55.578 -25.369 -3.470 1.00 26.76  ? 282 ASP B O   1 
ATOM   4738 C CB  . ASP B 1 301 ? 57.008 -23.160 -5.787 1.00 26.39  ? 282 ASP B CB  1 
ATOM   4739 C CG  . ASP B 1 301 ? 58.298 -23.852 -5.323 1.00 27.82  ? 282 ASP B CG  1 
ATOM   4740 O OD1 . ASP B 1 301 ? 58.295 -24.937 -4.699 1.00 27.17  ? 282 ASP B OD1 1 
ATOM   4741 O OD2 . ASP B 1 301 ? 59.372 -23.304 -5.648 1.00 29.28  ? 282 ASP B OD2 1 
ATOM   4742 N N   . PRO B 1 302 ? 55.129 -25.690 -5.687 1.00 26.78  ? 283 PRO B N   1 
ATOM   4743 C CA  . PRO B 1 302 ? 54.734 -27.089 -5.448 1.00 26.56  ? 283 PRO B CA  1 
ATOM   4744 C C   . PRO B 1 302 ? 55.810 -27.954 -4.789 1.00 26.13  ? 283 PRO B C   1 
ATOM   4745 O O   . PRO B 1 302 ? 55.478 -28.806 -3.939 1.00 26.19  ? 283 PRO B O   1 
ATOM   4746 C CB  . PRO B 1 302 ? 54.404 -27.604 -6.858 1.00 27.89  ? 283 PRO B CB  1 
ATOM   4747 C CG  . PRO B 1 302 ? 53.894 -26.354 -7.554 1.00 28.90  ? 283 PRO B CG  1 
ATOM   4748 C CD  . PRO B 1 302 ? 54.745 -25.228 -7.044 1.00 27.81  ? 283 PRO B CD  1 
ATOM   4749 N N   . ALA B 1 303 ? 57.072 -27.745 -5.141 1.00 23.95  ? 284 ALA B N   1 
ATOM   4750 C CA  . ALA B 1 303 ? 58.144 -28.523 -4.525 1.00 24.35  ? 284 ALA B CA  1 
ATOM   4751 C C   . ALA B 1 303 ? 58.277 -28.250 -3.025 1.00 23.49  ? 284 ALA B C   1 
ATOM   4752 O O   . ALA B 1 303 ? 58.516 -29.158 -2.228 1.00 24.17  ? 284 ALA B O   1 
ATOM   4753 C CB  . ALA B 1 303 ? 59.474 -28.243 -5.235 1.00 24.79  ? 284 ALA B CB  1 
ATOM   4754 N N   . GLN B 1 304 ? 58.143 -26.983 -2.654 1.00 21.18  ? 285 GLN B N   1 
ATOM   4755 C CA  . GLN B 1 304 ? 58.251 -26.548 -1.260 1.00 20.60  ? 285 GLN B CA  1 
ATOM   4756 C C   . GLN B 1 304 ? 57.047 -27.043 -0.464 1.00 19.08  ? 285 GLN B C   1 
ATOM   4757 O O   . GLN B 1 304 ? 57.177 -27.458 0.694  1.00 18.27  ? 285 GLN B O   1 
ATOM   4758 C CB  . GLN B 1 304 ? 58.342 -25.027 -1.199 1.00 21.22  ? 285 GLN B CB  1 
ATOM   4759 C CG  . GLN B 1 304 ? 59.604 -24.477 -1.858 1.00 21.82  ? 285 GLN B CG  1 
ATOM   4760 C CD  . GLN B 1 304 ? 59.588 -22.956 -1.944 1.00 22.79  ? 285 GLN B CD  1 
ATOM   4761 O OE1 . GLN B 1 304 ? 58.536 -22.351 -2.197 1.00 24.37  ? 285 GLN B OE1 1 
ATOM   4762 N NE2 . GLN B 1 304 ? 60.740 -22.332 -1.709 1.00 23.47  ? 285 GLN B NE2 1 
ATOM   4763 N N   . ARG B 1 305 ? 55.871 -26.984 -1.082 1.00 19.15  ? 286 ARG B N   1 
ATOM   4764 C CA  . ARG B 1 305 ? 54.645 -27.477 -0.452 1.00 19.57  ? 286 ARG B CA  1 
ATOM   4765 C C   . ARG B 1 305 ? 54.735 -28.984 -0.190 1.00 20.76  ? 286 ARG B C   1 
ATOM   4766 O O   . ARG B 1 305 ? 54.360 -29.470 0.893  1.00 20.76  ? 286 ARG B O   1 
ATOM   4767 C CB  . ARG B 1 305 ? 53.430 -27.177 -1.327 1.00 20.70  ? 286 ARG B CB  1 
ATOM   4768 C CG  . ARG B 1 305 ? 52.150 -27.848 -0.914 1.00 21.42  ? 286 ARG B CG  1 
ATOM   4769 C CD  . ARG B 1 305 ? 51.670 -27.432 0.474  1.00 23.95  ? 286 ARG B CD  1 
ATOM   4770 N NE  . ARG B 1 305 ? 50.344 -27.994 0.734  1.00 26.23  ? 286 ARG B NE  1 
ATOM   4771 C CZ  . ARG B 1 305 ? 49.181 -27.400 0.461  1.00 27.50  ? 286 ARG B CZ  1 
ATOM   4772 N NH1 . ARG B 1 305 ? 49.129 -26.156 -0.036 1.00 27.81  ? 286 ARG B NH1 1 
ATOM   4773 N NH2 . ARG B 1 305 ? 48.051 -28.035 0.749  1.00 28.88  ? 286 ARG B NH2 1 
ATOM   4774 N N   . LEU B 1 306 ? 55.272 -29.718 -1.152 1.00 20.57  ? 287 LEU B N   1 
ATOM   4775 C CA  . LEU B 1 306 ? 55.464 -31.160 -0.963 1.00 20.95  ? 287 LEU B CA  1 
ATOM   4776 C C   . LEU B 1 306 ? 56.449 -31.450 0.186  1.00 20.33  ? 287 LEU B C   1 
ATOM   4777 O O   . LEU B 1 306 ? 56.184 -32.328 1.021  1.00 20.92  ? 287 LEU B O   1 
ATOM   4778 C CB  . LEU B 1 306 ? 55.968 -31.801 -2.247 1.00 21.82  ? 287 LEU B CB  1 
ATOM   4779 C CG  . LEU B 1 306 ? 56.258 -33.320 -2.160 1.00 24.30  ? 287 LEU B CG  1 
ATOM   4780 C CD1 . LEU B 1 306 ? 55.063 -34.046 -1.627 1.00 25.36  ? 287 LEU B CD1 1 
ATOM   4781 C CD2 . LEU B 1 306 ? 56.733 -33.916 -3.483 1.00 27.19  ? 287 LEU B CD2 1 
ATOM   4782 N N   . ALA B 1 307 ? 57.570 -30.730 0.222  1.00 19.61  ? 288 ALA B N   1 
ATOM   4783 C CA  . ALA B 1 307 ? 58.520 -30.905 1.322  1.00 17.34  ? 288 ALA B CA  1 
ATOM   4784 C C   . ALA B 1 307 ? 57.852 -30.603 2.678  1.00 16.13  ? 288 ALA B C   1 
ATOM   4785 O O   . ALA B 1 307 ? 58.064 -31.345 3.670  1.00 15.79  ? 288 ALA B O   1 
ATOM   4786 C CB  . ALA B 1 307 ? 59.743 -30.054 1.127  1.00 17.38  ? 288 ALA B CB  1 
ATOM   4787 N N   . ALA B 1 308 ? 57.065 -29.522 2.739  1.00 17.06  ? 289 ALA B N   1 
ATOM   4788 C CA  . ALA B 1 308 ? 56.308 -29.179 3.959  1.00 17.43  ? 289 ALA B CA  1 
ATOM   4789 C C   . ALA B 1 308 ? 55.388 -30.344 4.384  1.00 18.41  ? 289 ALA B C   1 
ATOM   4790 O O   . ALA B 1 308 ? 55.356 -30.707 5.568  1.00 17.87  ? 289 ALA B O   1 
ATOM   4791 C CB  . ALA B 1 308 ? 55.509 -27.907 3.746  1.00 15.56  ? 289 ALA B CB  1 
ATOM   4792 N N   . GLU B 1 309 ? 54.660 -30.926 3.426  1.00 17.90  ? 290 GLU B N   1 
ATOM   4793 C CA  . GLU B 1 309 ? 53.788 -32.077 3.728  1.00 18.09  ? 290 GLU B CA  1 
ATOM   4794 C C   . GLU B 1 309 ? 54.582 -33.294 4.177  1.00 18.57  ? 290 GLU B C   1 
ATOM   4795 O O   . GLU B 1 309 ? 54.162 -33.988 5.102  1.00 19.65  ? 290 GLU B O   1 
ATOM   4796 C CB  . GLU B 1 309 ? 52.933 -32.446 2.518  1.00 20.90  ? 290 GLU B CB  1 
ATOM   4797 C CG  . GLU B 1 309 ? 51.881 -31.378 2.191  1.00 23.82  ? 290 GLU B CG  1 
ATOM   4798 C CD  . GLU B 1 309 ? 51.289 -31.525 0.800  1.00 27.94  ? 290 GLU B CD  1 
ATOM   4799 O OE1 . GLU B 1 309 ? 51.796 -32.340 0.007  1.00 29.36  ? 290 GLU B OE1 1 
ATOM   4800 O OE2 . GLU B 1 309 ? 50.331 -30.778 0.483  1.00 29.99  ? 290 GLU B OE2 1 
ATOM   4801 N N   . ARG B 1 310 ? 55.714 -33.560 3.519  1.00 18.78  ? 291 ARG B N   1 
ATOM   4802 C CA  . ARG B 1 310 ? 56.523 -34.743 3.857  1.00 16.60  ? 291 ARG B CA  1 
ATOM   4803 C C   . ARG B 1 310 ? 57.066 -34.619 5.286  1.00 16.96  ? 291 ARG B C   1 
ATOM   4804 O O   . ARG B 1 310 ? 57.143 -35.602 6.040  1.00 16.89  ? 291 ARG B O   1 
ATOM   4805 C CB  . ARG B 1 310 ? 57.673 -34.919 2.865  1.00 17.57  ? 291 ARG B CB  1 
ATOM   4806 C CG  . ARG B 1 310 ? 57.174 -35.392 1.457  1.00 19.09  ? 291 ARG B CG  1 
ATOM   4807 C CD  . ARG B 1 310 ? 58.368 -35.645 0.589  1.00 20.79  ? 291 ARG B CD  1 
ATOM   4808 N NE  . ARG B 1 310 ? 59.042 -36.864 0.964  1.00 20.80  ? 291 ARG B NE  1 
ATOM   4809 C CZ  . ARG B 1 310 ? 60.240 -37.224 0.510  1.00 23.45  ? 291 ARG B CZ  1 
ATOM   4810 N NH1 . ARG B 1 310 ? 60.909 -36.427 -0.349 1.00 24.49  ? 291 ARG B NH1 1 
ATOM   4811 N NH2 . ARG B 1 310 ? 60.760 -38.392 0.909  1.00 24.82  ? 291 ARG B NH2 1 
ATOM   4812 N N   . TYR B 1 311 ? 57.415 -33.391 5.650  1.00 16.07  ? 292 TYR B N   1 
ATOM   4813 C CA  . TYR B 1 311 ? 57.955 -33.096 6.988  1.00 15.03  ? 292 TYR B CA  1 
ATOM   4814 C C   . TYR B 1 311 ? 56.865 -33.313 8.054  1.00 15.79  ? 292 TYR B C   1 
ATOM   4815 O O   . TYR B 1 311 ? 57.092 -34.023 9.067  1.00 15.77  ? 292 TYR B O   1 
ATOM   4816 C CB  . TYR B 1 311 ? 58.509 -31.660 6.991  1.00 14.20  ? 292 TYR B CB  1 
ATOM   4817 C CG  . TYR B 1 311 ? 59.029 -31.135 8.321  1.00 12.98  ? 292 TYR B CG  1 
ATOM   4818 C CD1 . TYR B 1 311 ? 59.807 -31.946 9.157  1.00 14.25  ? 292 TYR B CD1 1 
ATOM   4819 C CD2 . TYR B 1 311 ? 58.723 -29.850 8.733  1.00 14.25  ? 292 TYR B CD2 1 
ATOM   4820 C CE1 . TYR B 1 311 ? 60.280 -31.482 10.354 1.00 14.50  ? 292 TYR B CE1 1 
ATOM   4821 C CE2 . TYR B 1 311 ? 59.216 -29.359 9.907  1.00 13.41  ? 292 TYR B CE2 1 
ATOM   4822 C CZ  . TYR B 1 311 ? 59.973 -30.172 10.730 1.00 14.53  ? 292 TYR B CZ  1 
ATOM   4823 O OH  . TYR B 1 311 ? 60.463 -29.710 11.939 1.00 15.86  ? 292 TYR B OH  1 
ATOM   4824 N N   . ALA B 1 312 ? 55.706 -32.700 7.852  1.00 15.27  ? 293 ALA B N   1 
ATOM   4825 C CA  . ALA B 1 312 ? 54.602 -32.819 8.798  1.00 15.49  ? 293 ALA B CA  1 
ATOM   4826 C C   . ALA B 1 312 ? 54.104 -34.266 8.874  1.00 16.04  ? 293 ALA B C   1 
ATOM   4827 O O   . ALA B 1 312 ? 53.830 -34.749 9.982  1.00 16.64  ? 293 ALA B O   1 
ATOM   4828 C CB  . ALA B 1 312 ? 53.451 -31.894 8.424  1.00 16.77  ? 293 ALA B CB  1 
ATOM   4829 N N   . ASP B 1 313 ? 54.008 -34.947 7.721  1.00 16.50  ? 294 ASP B N   1 
ATOM   4830 C CA  . ASP B 1 313 ? 53.554 -36.353 7.717  1.00 18.40  ? 294 ASP B CA  1 
ATOM   4831 C C   . ASP B 1 313 ? 54.563 -37.250 8.408  1.00 18.58  ? 294 ASP B C   1 
ATOM   4832 O O   . ASP B 1 313 ? 54.184 -38.238 9.051  1.00 18.71  ? 294 ASP B O   1 
ATOM   4833 C CB  . ASP B 1 313 ? 53.327 -36.906 6.293  1.00 19.00  ? 294 ASP B CB  1 
ATOM   4834 C CG  . ASP B 1 313 ? 52.126 -36.291 5.578  1.00 25.17  ? 294 ASP B CG  1 
ATOM   4835 O OD1 . ASP B 1 313 ? 51.300 -35.608 6.224  1.00 26.98  ? 294 ASP B OD1 1 
ATOM   4836 O OD2 . ASP B 1 313 ? 52.014 -36.483 4.335  1.00 28.68  ? 294 ASP B OD2 1 
ATOM   4837 N N   . GLY B 1 314 ? 55.839 -36.928 8.249  1.00 17.04  ? 295 GLY B N   1 
ATOM   4838 C CA  . GLY B 1 314 ? 56.910 -37.683 8.886  1.00 17.32  ? 295 GLY B CA  1 
ATOM   4839 C C   . GLY B 1 314 ? 56.787 -37.574 10.408 1.00 15.43  ? 295 GLY B C   1 
ATOM   4840 O O   . GLY B 1 314 ? 56.903 -38.580 11.106 1.00 15.52  ? 295 GLY B O   1 
ATOM   4841 N N   . MET B 1 315 ? 56.547 -36.370 10.933 1.00 14.10  ? 296 MET B N   1 
ATOM   4842 C CA  . MET B 1 315 ? 56.350 -36.262 12.396 1.00 14.49  ? 296 MET B CA  1 
ATOM   4843 C C   . MET B 1 315 ? 55.081 -36.987 12.857 1.00 17.57  ? 296 MET B C   1 
ATOM   4844 O O   . MET B 1 315 ? 55.069 -37.650 13.914 1.00 17.54  ? 296 MET B O   1 
ATOM   4845 C CB  . MET B 1 315 ? 56.315 -34.779 12.827 1.00 15.43  ? 296 MET B CB  1 
ATOM   4846 C CG  . MET B 1 315 ? 57.651 -34.104 12.573 1.00 16.22  ? 296 MET B CG  1 
ATOM   4847 S SD  . MET B 1 315 ? 57.687 -32.406 13.216 1.00 17.42  ? 296 MET B SD  1 
ATOM   4848 C CE  . MET B 1 315 ? 56.882 -31.479 11.887 1.00 17.63  ? 296 MET B CE  1 
ATOM   4849 N N   . ALA B 1 316 ? 54.006 -36.866 12.075 1.00 17.96  ? 297 ALA B N   1 
ATOM   4850 C CA  . ALA B 1 316 ? 52.743 -37.525 12.417 1.00 18.11  ? 297 ALA B CA  1 
ATOM   4851 C C   . ALA B 1 316 ? 52.889 -39.053 12.453 1.00 17.21  ? 297 ALA B C   1 
ATOM   4852 O O   . ALA B 1 316 ? 52.423 -39.705 13.406 1.00 17.04  ? 297 ALA B O   1 
ATOM   4853 C CB  . ALA B 1 316 ? 51.651 -37.127 11.434 1.00 17.55  ? 297 ALA B CB  1 
ATOM   4854 N N   . LEU B 1 317 ? 53.509 -39.626 11.418 1.00 17.24  ? 298 LEU B N   1 
ATOM   4855 C CA  . LEU B 1 317 ? 53.728 -41.072 11.385 1.00 17.83  ? 298 LEU B CA  1 
ATOM   4856 C C   . LEU B 1 317 ? 54.707 -41.552 12.456 1.00 17.25  ? 298 LEU B C   1 
ATOM   4857 O O   . LEU B 1 317 ? 54.601 -42.709 12.932 1.00 17.16  ? 298 LEU B O   1 
ATOM   4858 C CB  . LEU B 1 317 ? 54.229 -41.481 10.002 1.00 20.62  ? 298 LEU B CB  1 
ATOM   4859 C CG  . LEU B 1 317 ? 53.177 -41.377 8.883  1.00 22.98  ? 298 LEU B CG  1 
ATOM   4860 C CD1 . LEU B 1 317 ? 53.847 -41.605 7.511  1.00 25.59  ? 298 LEU B CD1 1 
ATOM   4861 C CD2 . LEU B 1 317 ? 52.017 -42.383 9.086  1.00 26.12  ? 298 LEU B CD2 1 
ATOM   4862 N N   . TRP B 1 318 ? 55.691 -40.718 12.799 1.00 15.69  ? 299 TRP B N   1 
ATOM   4863 C CA  . TRP B 1 318 ? 56.610 -41.047 13.881 1.00 15.66  ? 299 TRP B CA  1 
ATOM   4864 C C   . TRP B 1 318 ? 55.769 -41.208 15.160 1.00 16.20  ? 299 TRP B C   1 
ATOM   4865 O O   . TRP B 1 318 ? 55.912 -42.214 15.885 1.00 17.27  ? 299 TRP B O   1 
ATOM   4866 C CB  . TRP B 1 318 ? 57.707 -39.958 14.058 1.00 16.00  ? 299 TRP B CB  1 
ATOM   4867 C CG  . TRP B 1 318 ? 58.907 -40.511 14.787 1.00 16.28  ? 299 TRP B CG  1 
ATOM   4868 C CD1 . TRP B 1 318 ? 60.083 -40.922 14.221 1.00 17.00  ? 299 TRP B CD1 1 
ATOM   4869 C CD2 . TRP B 1 318 ? 59.039 -40.750 16.189 1.00 16.95  ? 299 TRP B CD2 1 
ATOM   4870 N NE1 . TRP B 1 318 ? 60.927 -41.421 15.171 1.00 18.47  ? 299 TRP B NE1 1 
ATOM   4871 C CE2 . TRP B 1 318 ? 60.318 -41.322 16.395 1.00 18.04  ? 299 TRP B CE2 1 
ATOM   4872 C CE3 . TRP B 1 318 ? 58.199 -40.544 17.299 1.00 17.83  ? 299 TRP B CE3 1 
ATOM   4873 C CZ2 . TRP B 1 318 ? 60.766 -41.723 17.664 1.00 19.96  ? 299 TRP B CZ2 1 
ATOM   4874 C CZ3 . TRP B 1 318 ? 58.675 -40.909 18.567 1.00 19.59  ? 299 TRP B CZ3 1 
ATOM   4875 C CH2 . TRP B 1 318 ? 59.939 -41.496 18.724 1.00 19.66  ? 299 TRP B CH2 1 
ATOM   4876 N N   . LEU B 1 319 ? 54.898 -40.237 15.444 1.00 18.04  ? 300 LEU B N   1 
ATOM   4877 C CA  A LEU B 1 319 ? 54.048 -40.278 16.651 0.50 18.00  ? 300 LEU B CA  1 
ATOM   4878 C CA  B LEU B 1 319 ? 54.088 -40.273 16.662 0.50 17.92  ? 300 LEU B CA  1 
ATOM   4879 C C   . LEU B 1 319 ? 53.155 -41.498 16.721 1.00 18.70  ? 300 LEU B C   1 
ATOM   4880 O O   . LEU B 1 319 ? 53.140 -42.217 17.717 1.00 19.33  ? 300 LEU B O   1 
ATOM   4881 C CB  A LEU B 1 319 ? 53.147 -39.052 16.741 0.50 17.55  ? 300 LEU B CB  1 
ATOM   4882 C CB  B LEU B 1 319 ? 53.285 -38.976 16.778 0.50 17.34  ? 300 LEU B CB  1 
ATOM   4883 C CG  A LEU B 1 319 ? 53.785 -37.778 17.251 0.50 16.03  ? 300 LEU B CG  1 
ATOM   4884 C CG  B LEU B 1 319 ? 52.540 -38.674 18.064 0.50 16.14  ? 300 LEU B CG  1 
ATOM   4885 C CD1 A LEU B 1 319 ? 52.822 -36.648 17.092 0.50 16.44  ? 300 LEU B CD1 1 
ATOM   4886 C CD1 B LEU B 1 319 ? 53.493 -38.624 19.263 0.50 16.17  ? 300 LEU B CD1 1 
ATOM   4887 C CD2 A LEU B 1 319 ? 54.169 -37.944 18.723 0.50 15.83  ? 300 LEU B CD2 1 
ATOM   4888 C CD2 B LEU B 1 319 ? 51.777 -37.333 17.914 0.50 17.58  ? 300 LEU B CD2 1 
ATOM   4889 N N   . ALA B 1 320 ? 52.394 -41.723 15.657 1.00 17.99  ? 301 ALA B N   1 
ATOM   4890 C CA  . ALA B 1 320 ? 51.512 -42.875 15.604 1.00 20.09  ? 301 ALA B CA  1 
ATOM   4891 C C   . ALA B 1 320 ? 52.292 -44.188 15.774 1.00 20.48  ? 301 ALA B C   1 
ATOM   4892 O O   . ALA B 1 320 ? 51.862 -45.071 16.534 1.00 21.80  ? 301 ALA B O   1 
ATOM   4893 C CB  . ALA B 1 320 ? 50.706 -42.879 14.274 1.00 21.03  ? 301 ALA B CB  1 
ATOM   4894 N N   . GLY B 1 321 ? 53.438 -44.313 15.101 1.00 19.20  ? 302 GLY B N   1 
ATOM   4895 C CA  . GLY B 1 321 ? 54.219 -45.541 15.168 1.00 19.69  ? 302 GLY B CA  1 
ATOM   4896 C C   . GLY B 1 321 ? 54.835 -45.757 16.532 1.00 19.21  ? 302 GLY B C   1 
ATOM   4897 O O   . GLY B 1 321 ? 54.762 -46.856 17.069 1.00 20.63  ? 302 GLY B O   1 
ATOM   4898 N N   . TYR B 1 322 ? 55.369 -44.694 17.127 1.00 19.80  ? 303 TYR B N   1 
ATOM   4899 C CA  . TYR B 1 322 ? 55.946 -44.794 18.462 1.00 19.05  ? 303 TYR B CA  1 
ATOM   4900 C C   . TYR B 1 322 ? 54.895 -45.226 19.480 1.00 21.44  ? 303 TYR B C   1 
ATOM   4901 O O   . TYR B 1 322 ? 55.134 -46.107 20.315 1.00 23.11  ? 303 TYR B O   1 
ATOM   4902 C CB  . TYR B 1 322 ? 56.577 -43.462 18.914 1.00 18.40  ? 303 TYR B CB  1 
ATOM   4903 C CG  . TYR B 1 322 ? 56.924 -43.564 20.367 1.00 17.92  ? 303 TYR B CG  1 
ATOM   4904 C CD1 . TYR B 1 322 ? 56.037 -43.123 21.340 1.00 18.53  ? 303 TYR B CD1 1 
ATOM   4905 C CD2 . TYR B 1 322 ? 58.117 -44.166 20.775 1.00 19.15  ? 303 TYR B CD2 1 
ATOM   4906 C CE1 . TYR B 1 322 ? 56.317 -43.286 22.695 1.00 20.14  ? 303 TYR B CE1 1 
ATOM   4907 C CE2 . TYR B 1 322 ? 58.393 -44.345 22.153 1.00 20.50  ? 303 TYR B CE2 1 
ATOM   4908 C CZ  . TYR B 1 322 ? 57.496 -43.900 23.089 1.00 21.32  ? 303 TYR B CZ  1 
ATOM   4909 O OH  . TYR B 1 322 ? 57.778 -44.103 24.423 1.00 23.65  ? 303 TYR B OH  1 
ATOM   4910 N N   . LEU B 1 323 ? 53.740 -44.580 19.438 1.00 21.28  ? 304 LEU B N   1 
ATOM   4911 C CA  . LEU B 1 323 ? 52.689 -44.852 20.407 1.00 22.36  ? 304 LEU B CA  1 
ATOM   4912 C C   . LEU B 1 323 ? 52.211 -46.301 20.314 1.00 24.71  ? 304 LEU B C   1 
ATOM   4913 O O   . LEU B 1 323 ? 51.924 -46.941 21.333 1.00 24.53  ? 304 LEU B O   1 
ATOM   4914 C CB  . LEU B 1 323 ? 51.529 -43.876 20.198 1.00 22.49  ? 304 LEU B CB  1 
ATOM   4915 C CG  . LEU B 1 323 ? 51.925 -42.461 20.688 1.00 21.75  ? 304 LEU B CG  1 
ATOM   4916 C CD1 . LEU B 1 323 ? 50.934 -41.395 20.241 1.00 22.37  ? 304 LEU B CD1 1 
ATOM   4917 C CD2 . LEU B 1 323 ? 52.115 -42.365 22.218 1.00 21.88  ? 304 LEU B CD2 1 
ATOM   4918 N N   . HIS B 1 324 ? 52.136 -46.815 19.088 1.00 24.75  ? 305 HIS B N   1 
ATOM   4919 C CA  . HIS B 1 324 ? 51.758 -48.208 18.885 1.00 26.35  ? 305 HIS B CA  1 
ATOM   4920 C C   . HIS B 1 324 ? 52.811 -49.121 19.494 1.00 26.81  ? 305 HIS B C   1 
ATOM   4921 O O   . HIS B 1 324 ? 52.489 -50.054 20.225 1.00 28.56  ? 305 HIS B O   1 
ATOM   4922 C CB  . HIS B 1 324 ? 51.581 -48.527 17.380 1.00 27.51  ? 305 HIS B CB  1 
ATOM   4923 C CG  . HIS B 1 324 ? 51.136 -49.937 17.103 1.00 29.15  ? 305 HIS B CG  1 
ATOM   4924 N ND1 . HIS B 1 324 ? 49.844 -50.364 17.318 1.00 29.29  ? 305 HIS B ND1 1 
ATOM   4925 C CD2 . HIS B 1 324 ? 51.818 -51.023 16.659 1.00 29.73  ? 305 HIS B CD2 1 
ATOM   4926 C CE1 . HIS B 1 324 ? 49.741 -51.647 17.009 1.00 30.07  ? 305 HIS B CE1 1 
ATOM   4927 N NE2 . HIS B 1 324 ? 50.924 -52.072 16.603 1.00 30.62  ? 305 HIS B NE2 1 
ATOM   4928 N N   . TRP B 1 325 ? 54.073 -48.853 19.182 1.00 25.05  ? 306 TRP B N   1 
ATOM   4929 C CA  . TRP B 1 325 ? 55.185 -49.637 19.724 1.00 25.82  ? 306 TRP B CA  1 
ATOM   4930 C C   . TRP B 1 325 ? 55.175 -49.628 21.249 1.00 26.09  ? 306 TRP B C   1 
ATOM   4931 O O   . TRP B 1 325 ? 55.374 -50.663 21.891 1.00 27.35  ? 306 TRP B O   1 
ATOM   4932 C CB  . TRP B 1 325 ? 56.511 -49.092 19.192 1.00 25.19  ? 306 TRP B CB  1 
ATOM   4933 C CG  . TRP B 1 325 ? 57.711 -49.773 19.762 1.00 25.24  ? 306 TRP B CG  1 
ATOM   4934 C CD1 . TRP B 1 325 ? 58.295 -50.943 19.333 1.00 25.45  ? 306 TRP B CD1 1 
ATOM   4935 C CD2 . TRP B 1 325 ? 58.498 -49.306 20.863 1.00 25.83  ? 306 TRP B CD2 1 
ATOM   4936 N NE1 . TRP B 1 325 ? 59.401 -51.229 20.119 1.00 24.80  ? 306 TRP B NE1 1 
ATOM   4937 C CE2 . TRP B 1 325 ? 59.539 -50.240 21.067 1.00 25.69  ? 306 TRP B CE2 1 
ATOM   4938 C CE3 . TRP B 1 325 ? 58.418 -48.179 21.699 1.00 24.83  ? 306 TRP B CE3 1 
ATOM   4939 C CZ2 . TRP B 1 325 ? 60.500 -50.082 22.070 1.00 26.04  ? 306 TRP B CZ2 1 
ATOM   4940 C CZ3 . TRP B 1 325 ? 59.378 -48.019 22.716 1.00 26.56  ? 306 TRP B CZ3 1 
ATOM   4941 C CH2 . TRP B 1 325 ? 60.410 -48.963 22.877 1.00 26.63  ? 306 TRP B CH2 1 
ATOM   4942 N N   . GLU B 1 326 ? 54.898 -48.466 21.833 1.00 24.24  ? 307 GLU B N   1 
ATOM   4943 C CA  . GLU B 1 326 ? 55.001 -48.291 23.280 1.00 26.27  ? 307 GLU B CA  1 
ATOM   4944 C C   . GLU B 1 326 ? 53.912 -49.062 24.011 1.00 29.26  ? 307 GLU B C   1 
ATOM   4945 O O   . GLU B 1 326 ? 54.101 -49.538 25.146 1.00 31.02  ? 307 GLU B O   1 
ATOM   4946 C CB  . GLU B 1 326 ? 54.916 -46.791 23.616 1.00 24.00  ? 307 GLU B CB  1 
ATOM   4947 C CG  . GLU B 1 326 ? 55.061 -46.438 25.078 1.00 24.20  ? 307 GLU B CG  1 
ATOM   4948 C CD  . GLU B 1 326 ? 54.533 -45.046 25.381 1.00 24.72  ? 307 GLU B CD  1 
ATOM   4949 O OE1 . GLU B 1 326 ? 55.344 -44.142 25.599 1.00 25.00  ? 307 GLU B OE1 1 
ATOM   4950 O OE2 . GLU B 1 326 ? 53.301 -44.851 25.406 1.00 27.23  ? 307 GLU B OE2 1 
ATOM   4951 N N   . SER B 1 327 ? 52.756 -49.192 23.374 1.00 31.09  ? 308 SER B N   1 
ATOM   4952 C CA  . SER B 1 327 ? 51.647 -49.894 24.013 1.00 34.00  ? 308 SER B CA  1 
ATOM   4953 C C   . SER B 1 327 ? 51.802 -51.422 23.844 1.00 36.51  ? 308 SER B C   1 
ATOM   4954 O O   . SER B 1 327 ? 51.182 -52.207 24.575 1.00 36.53  ? 308 SER B O   1 
ATOM   4955 C CB  . SER B 1 327 ? 50.312 -49.404 23.450 1.00 35.37  ? 308 SER B CB  1 
ATOM   4956 O OG  . SER B 1 327 ? 50.185 -49.679 22.060 1.00 37.58  ? 308 SER B OG  1 
ATOM   4957 N N   . HIS B 1 328 ? 52.707 -51.801 22.940 1.00 40.77  ? 309 HIS B N   1 
ATOM   4958 C CA  . HIS B 1 328 ? 52.922 -53.171 22.460 1.00 45.11  ? 309 HIS B CA  1 
ATOM   4959 C C   . HIS B 1 328 ? 51.646 -53.694 21.800 1.00 46.38  ? 309 HIS B C   1 
ATOM   4960 O O   . HIS B 1 328 ? 51.214 -53.180 20.753 1.00 46.92  ? 309 HIS B O   1 
ATOM   4961 C CB  . HIS B 1 328 ? 53.388 -54.102 23.584 1.00 48.02  ? 309 HIS B CB  1 
ATOM   4962 C CG  . HIS B 1 328 ? 54.829 -53.926 23.970 1.00 51.01  ? 309 HIS B CG  1 
ATOM   4963 N ND1 . HIS B 1 328 ? 55.728 -53.203 23.211 1.00 51.68  ? 309 HIS B ND1 1 
ATOM   4964 C CD2 . HIS B 1 328 ? 55.526 -54.383 25.043 1.00 52.14  ? 309 HIS B CD2 1 
ATOM   4965 C CE1 . HIS B 1 328 ? 56.914 -53.224 23.796 1.00 52.51  ? 309 HIS B CE1 1 
ATOM   4966 N NE2 . HIS B 1 328 ? 56.820 -53.936 24.909 1.00 52.75  ? 309 HIS B NE2 1 
HETATM 4967 S S   . SO4 C 2 .   ? 72.909 5.855   34.351 1.00 68.65  ? 401 SO4 A S   1 
HETATM 4968 O O1  . SO4 C 2 .   ? 74.164 5.606   33.659 1.00 68.18  ? 401 SO4 A O1  1 
HETATM 4969 O O2  . SO4 C 2 .   ? 71.853 6.089   33.369 1.00 54.79  ? 401 SO4 A O2  1 
HETATM 4970 O O3  . SO4 C 2 .   ? 72.599 4.692   35.172 1.00 79.05  ? 401 SO4 A O3  1 
HETATM 4971 O O4  . SO4 C 2 .   ? 73.038 7.023   35.212 1.00 63.68  ? 401 SO4 A O4  1 
HETATM 4972 S S   . SO4 D 2 .   ? 58.637 -24.235 25.041 1.00 125.17 ? 401 SO4 B S   1 
HETATM 4973 O O1  . SO4 D 2 .   ? 59.898 -24.219 24.308 1.00 76.46  ? 401 SO4 B O1  1 
HETATM 4974 O O2  . SO4 D 2 .   ? 57.536 -24.354 24.094 1.00 62.55  ? 401 SO4 B O2  1 
HETATM 4975 O O3  . SO4 D 2 .   ? 58.592 -25.375 25.944 1.00 81.04  ? 401 SO4 B O3  1 
HETATM 4976 O O4  . SO4 D 2 .   ? 58.522 -23.019 25.837 1.00 81.07  ? 401 SO4 B O4  1 
HETATM 4977 O O   . HOH E 3 .   ? 39.074 -5.852  33.406 1.00 59.62  ? 501 HOH A O   1 
HETATM 4978 O O   . HOH E 3 .   ? 81.083 -22.471 45.867 1.00 36.33  ? 502 HOH A O   1 
HETATM 4979 O O   . HOH E 3 .   ? 82.483 -2.558  6.724  1.00 29.41  ? 503 HOH A O   1 
HETATM 4980 O O   . HOH E 3 .   ? 61.541 -5.195  3.015  1.00 71.16  ? 504 HOH A O   1 
HETATM 4981 O O   . HOH E 3 .   ? 84.124 -7.303  7.813  1.00 34.60  ? 505 HOH A O   1 
HETATM 4982 O O   . HOH E 3 .   ? 74.837 -17.084 42.430 1.00 50.78  ? 506 HOH A O   1 
HETATM 4983 O O   . HOH E 3 .   ? 88.748 -11.227 8.755  1.00 56.88  ? 507 HOH A O   1 
HETATM 4984 O O   . HOH E 3 .   ? 82.396 -3.540  1.077  1.00 48.86  ? 508 HOH A O   1 
HETATM 4985 O O   . HOH E 3 .   ? 77.204 -27.895 46.790 1.00 43.13  ? 509 HOH A O   1 
HETATM 4986 O O   . HOH E 3 .   ? 90.680 -2.300  16.956 1.00 43.43  ? 510 HOH A O   1 
HETATM 4987 O O   . HOH E 3 .   ? 91.464 3.809   20.191 1.00 56.87  ? 511 HOH A O   1 
HETATM 4988 O O   . HOH E 3 .   ? 84.867 -18.388 39.693 1.00 33.39  ? 512 HOH A O   1 
HETATM 4989 O O   . HOH E 3 .   ? 63.259 -1.330  12.876 1.00 47.71  ? 513 HOH A O   1 
HETATM 4990 O O   . HOH E 3 .   ? 56.077 -17.171 30.074 1.00 41.21  ? 514 HOH A O   1 
HETATM 4991 O O   . HOH E 3 .   ? 61.973 -22.061 34.159 1.00 35.19  ? 515 HOH A O   1 
HETATM 4992 O O   . HOH E 3 .   ? 57.164 -5.605  38.243 1.00 23.03  ? 516 HOH A O   1 
HETATM 4993 O O   . HOH E 3 .   ? 89.026 -27.474 31.789 1.00 42.77  ? 517 HOH A O   1 
HETATM 4994 O O   . HOH E 3 .   ? 87.438 3.900   25.073 1.00 31.17  ? 518 HOH A O   1 
HETATM 4995 O O   . HOH E 3 .   ? 85.625 1.910   11.729 1.00 35.01  ? 519 HOH A O   1 
HETATM 4996 O O   . HOH E 3 .   ? 50.278 -10.072 39.304 1.00 49.48  ? 520 HOH A O   1 
HETATM 4997 O O   . HOH E 3 .   ? 69.363 0.605   -2.029 1.00 36.60  ? 521 HOH A O   1 
HETATM 4998 O O   . HOH E 3 .   ? 86.103 -3.025  7.177  1.00 55.85  ? 522 HOH A O   1 
HETATM 4999 O O   . HOH E 3 .   ? 79.815 -16.362 4.031  1.00 31.51  ? 523 HOH A O   1 
HETATM 5000 O O   . HOH E 3 .   ? 69.492 -0.119  1.130  1.00 38.67  ? 524 HOH A O   1 
HETATM 5001 O O   . HOH E 3 .   ? 79.503 -10.046 31.641 1.00 39.06  ? 525 HOH A O   1 
HETATM 5002 O O   . HOH E 3 .   ? 79.344 -20.889 8.803  1.00 26.84  ? 526 HOH A O   1 
HETATM 5003 O O   . HOH E 3 .   ? 69.092 -0.779  36.384 1.00 35.79  ? 527 HOH A O   1 
HETATM 5004 O O   . HOH E 3 .   ? 82.902 -24.801 21.983 1.00 39.05  ? 528 HOH A O   1 
HETATM 5005 O O   . HOH E 3 .   ? 72.799 -22.722 1.472  1.00 25.60  ? 529 HOH A O   1 
HETATM 5006 O O   . HOH E 3 .   ? 72.093 -22.268 28.061 1.00 12.07  ? 530 HOH A O   1 
HETATM 5007 O O   . HOH E 3 .   ? 68.938 -8.360  0.765  1.00 22.81  ? 531 HOH A O   1 
HETATM 5008 O O   . HOH E 3 .   ? 80.374 -14.126 39.187 1.00 30.52  ? 532 HOH A O   1 
HETATM 5009 O O   . HOH E 3 .   ? 82.436 -0.177  13.525 1.00 20.14  ? 533 HOH A O   1 
HETATM 5010 O O   . HOH E 3 .   ? 81.311 -14.495 -6.596 1.00 19.06  ? 534 HOH A O   1 
HETATM 5011 O O   . HOH E 3 .   ? 70.147 -20.981 -1.300 1.00 42.43  ? 535 HOH A O   1 
HETATM 5012 O O   . HOH E 3 .   ? 38.158 -6.081  26.592 1.00 33.15  ? 536 HOH A O   1 
HETATM 5013 O O   . HOH E 3 .   ? 86.160 -18.233 12.329 1.00 43.37  ? 537 HOH A O   1 
HETATM 5014 O O   . HOH E 3 .   ? 87.248 -13.376 18.866 1.00 33.05  ? 538 HOH A O   1 
HETATM 5015 O O   . HOH E 3 .   ? 57.954 -3.057  39.234 1.00 26.39  ? 539 HOH A O   1 
HETATM 5016 O O   . HOH E 3 .   ? 80.395 -7.765  40.382 1.00 51.08  ? 540 HOH A O   1 
HETATM 5017 O O   . HOH E 3 .   ? 69.703 -6.103  -4.806 1.00 43.09  ? 541 HOH A O   1 
HETATM 5018 O O   . HOH E 3 .   ? 80.276 -34.460 40.875 1.00 26.16  ? 542 HOH A O   1 
HETATM 5019 O O   . HOH E 3 .   ? 49.434 -21.123 16.420 1.00 25.55  ? 543 HOH A O   1 
HETATM 5020 O O   . HOH E 3 .   ? 69.109 -4.562  1.309  1.00 19.42  ? 544 HOH A O   1 
HETATM 5021 O O   . HOH E 3 .   ? 86.129 -14.323 9.872  1.00 28.78  ? 545 HOH A O   1 
HETATM 5022 O O   . HOH E 3 .   ? 57.369 -10.853 15.244 1.00 35.88  ? 546 HOH A O   1 
HETATM 5023 O O   . HOH E 3 .   ? 67.027 -6.473  0.696  1.00 26.04  ? 547 HOH A O   1 
HETATM 5024 O O   . HOH E 3 .   ? 63.234 -23.332 25.252 1.00 36.63  ? 548 HOH A O   1 
HETATM 5025 O O   . HOH E 3 .   ? 62.383 -13.607 22.858 1.00 30.51  ? 549 HOH A O   1 
HETATM 5026 O O   . HOH E 3 .   ? 87.488 -19.976 32.051 1.00 26.29  ? 550 HOH A O   1 
HETATM 5027 O O   . HOH E 3 .   ? 83.285 -18.822 42.200 1.00 44.23  ? 551 HOH A O   1 
HETATM 5028 O O   . HOH E 3 .   ? 85.187 -19.219 10.724 1.00 35.35  ? 552 HOH A O   1 
HETATM 5029 O O   . HOH E 3 .   ? 50.343 -12.515 34.663 1.00 23.15  ? 553 HOH A O   1 
HETATM 5030 O O   . HOH E 3 .   ? 66.170 -15.071 44.165 1.00 32.82  ? 554 HOH A O   1 
HETATM 5031 O O   . HOH E 3 .   ? 66.657 -20.673 24.596 1.00 23.33  ? 555 HOH A O   1 
HETATM 5032 O O   . HOH E 3 .   ? 73.954 -18.633 45.762 1.00 35.11  ? 556 HOH A O   1 
HETATM 5033 O O   . HOH E 3 .   ? 77.300 -24.768 4.426  1.00 27.85  ? 557 HOH A O   1 
HETATM 5034 O O   . HOH E 3 .   ? 66.783 1.492   35.370 1.00 46.64  ? 558 HOH A O   1 
HETATM 5035 O O   . HOH E 3 .   ? 82.235 -30.740 28.316 1.00 32.41  ? 559 HOH A O   1 
HETATM 5036 O O   . HOH E 3 .   ? 88.981 -7.044  22.027 1.00 29.47  ? 560 HOH A O   1 
HETATM 5037 O O   . HOH E 3 .   ? 85.312 -31.093 35.140 1.00 27.32  ? 561 HOH A O   1 
HETATM 5038 O O   . HOH E 3 .   ? 74.092 -16.481 16.142 1.00 12.04  ? 562 HOH A O   1 
HETATM 5039 O O   . HOH E 3 .   ? 68.648 -26.247 41.002 1.00 30.82  ? 563 HOH A O   1 
HETATM 5040 O O   . HOH E 3 .   ? 84.771 -3.772  15.691 1.00 21.04  ? 564 HOH A O   1 
HETATM 5041 O O   . HOH E 3 .   ? 85.856 -7.769  24.586 1.00 23.16  ? 565 HOH A O   1 
HETATM 5042 O O   . HOH E 3 .   ? 52.997 -10.806 11.521 1.00 43.37  ? 566 HOH A O   1 
HETATM 5043 O O   . HOH E 3 .   ? 81.782 -31.457 43.683 1.00 40.42  ? 567 HOH A O   1 
HETATM 5044 O O   . HOH E 3 .   ? 49.632 -12.675 38.911 1.00 54.89  ? 568 HOH A O   1 
HETATM 5045 O O   . HOH E 3 .   ? 64.693 -17.986 22.331 1.00 17.44  ? 569 HOH A O   1 
HETATM 5046 O O   . HOH E 3 .   ? 66.205 -16.080 15.988 1.00 17.61  ? 570 HOH A O   1 
HETATM 5047 O O   . HOH E 3 .   ? 88.137 2.461   18.325 1.00 45.57  ? 571 HOH A O   1 
HETATM 5048 O O   . HOH E 3 .   ? 60.631 -8.165  13.425 1.00 36.03  ? 572 HOH A O   1 
HETATM 5049 O O   . HOH E 3 .   ? 42.441 -6.854  22.184 1.00 42.36  ? 573 HOH A O   1 
HETATM 5050 O O   . HOH E 3 .   ? 68.920 -11.040 0.300  1.00 18.11  ? 574 HOH A O   1 
HETATM 5051 O O   . HOH E 3 .   ? 80.677 5.220   29.076 1.00 33.90  ? 575 HOH A O   1 
HETATM 5052 O O   . HOH E 3 .   ? 64.249 -24.247 40.805 1.00 54.44  ? 576 HOH A O   1 
HETATM 5053 O O   . HOH E 3 .   ? 72.966 6.615   4.879  1.00 44.62  ? 577 HOH A O   1 
HETATM 5054 O O   . HOH E 3 .   ? 73.686 -20.871 -1.823 1.00 52.06  ? 578 HOH A O   1 
HETATM 5055 O O   . HOH E 3 .   ? 69.929 -22.869 18.900 1.00 37.62  ? 579 HOH A O   1 
HETATM 5056 O O   . HOH E 3 .   ? 63.832 -19.899 20.586 1.00 18.72  ? 580 HOH A O   1 
HETATM 5057 O O   . HOH E 3 .   ? 76.739 -34.937 41.929 1.00 32.07  ? 581 HOH A O   1 
HETATM 5058 O O   . HOH E 3 .   ? 75.802 -29.479 44.647 1.00 34.89  ? 582 HOH A O   1 
HETATM 5059 O O   . HOH E 3 .   ? 80.729 -7.031  3.065  1.00 33.35  ? 583 HOH A O   1 
HETATM 5060 O O   . HOH E 3 .   ? 71.028 -23.688 45.875 1.00 50.17  ? 584 HOH A O   1 
HETATM 5061 O O   . HOH E 3 .   ? 67.887 -3.596  37.882 1.00 30.13  ? 585 HOH A O   1 
HETATM 5062 O O   . HOH E 3 .   ? 64.197 -15.342 21.481 1.00 18.22  ? 586 HOH A O   1 
HETATM 5063 O O   . HOH E 3 .   ? 76.203 -9.097  28.497 1.00 23.71  ? 587 HOH A O   1 
HETATM 5064 O O   . HOH E 3 .   ? 57.997 -2.355  43.759 1.00 34.98  ? 588 HOH A O   1 
HETATM 5065 O O   . HOH E 3 .   ? 79.097 -22.661 22.841 1.00 13.67  ? 589 HOH A O   1 
HETATM 5066 O O   . HOH E 3 .   ? 74.200 -3.980  32.238 1.00 15.52  ? 590 HOH A O   1 
HETATM 5067 O O   . HOH E 3 .   ? 70.181 -9.582  -3.368 1.00 24.85  ? 591 HOH A O   1 
HETATM 5068 O O   . HOH E 3 .   ? 66.488 -17.968 45.726 1.00 43.80  ? 592 HOH A O   1 
HETATM 5069 O O   . HOH E 3 .   ? 62.223 -1.557  31.158 1.00 22.95  ? 593 HOH A O   1 
HETATM 5070 O O   . HOH E 3 .   ? 64.497 -2.857  35.669 1.00 54.63  ? 594 HOH A O   1 
HETATM 5071 O O   . HOH E 3 .   ? 82.875 -14.879 38.169 1.00 33.49  ? 595 HOH A O   1 
HETATM 5072 O O   . HOH E 3 .   ? 63.329 6.630   16.445 1.00 42.54  ? 596 HOH A O   1 
HETATM 5073 O O   . HOH E 3 .   ? 80.274 -11.232 -3.531 1.00 29.31  ? 597 HOH A O   1 
HETATM 5074 O O   . HOH E 3 .   ? 68.855 -29.546 29.940 1.00 14.76  ? 598 HOH A O   1 
HETATM 5075 O O   . HOH E 3 .   ? 78.670 -24.745 24.601 1.00 17.55  ? 599 HOH A O   1 
HETATM 5076 O O   . HOH E 3 .   ? 86.643 -20.464 39.184 1.00 24.24  ? 600 HOH A O   1 
HETATM 5077 O O   . HOH E 3 .   ? 70.278 -13.208 14.468 1.00 13.37  ? 601 HOH A O   1 
HETATM 5078 O O   . HOH E 3 .   ? 68.604 -24.107 0.522  1.00 39.76  ? 602 HOH A O   1 
HETATM 5079 O O   . HOH E 3 .   ? 61.277 -18.516 45.058 1.00 49.15  ? 603 HOH A O   1 
HETATM 5080 O O   . HOH E 3 .   ? 60.889 -9.422  42.766 1.00 40.57  ? 604 HOH A O   1 
HETATM 5081 O O   . HOH E 3 .   ? 62.562 7.543   9.064  1.00 32.10  ? 605 HOH A O   1 
HETATM 5082 O O   . HOH E 3 .   ? 77.434 6.826   16.530 1.00 42.68  ? 606 HOH A O   1 
HETATM 5083 O O   . HOH E 3 .   ? 75.546 -4.912  38.395 1.00 21.63  ? 607 HOH A O   1 
HETATM 5084 O O   . HOH E 3 .   ? 81.086 -24.492 11.286 1.00 25.76  ? 608 HOH A O   1 
HETATM 5085 O O   . HOH E 3 .   ? 79.304 -18.020 41.981 1.00 42.97  ? 609 HOH A O   1 
HETATM 5086 O O   . HOH E 3 .   ? 76.288 6.803   22.897 1.00 34.62  ? 610 HOH A O   1 
HETATM 5087 O O   . HOH E 3 .   ? 72.809 -30.573 38.690 1.00 18.80  ? 611 HOH A O   1 
HETATM 5088 O O   . HOH E 3 .   ? 70.943 -21.379 20.916 1.00 18.80  ? 612 HOH A O   1 
HETATM 5089 O O   . HOH E 3 .   ? 58.734 -16.743 39.668 1.00 24.46  ? 613 HOH A O   1 
HETATM 5090 O O   . HOH E 3 .   ? 65.560 -25.570 40.127 1.00 41.23  ? 614 HOH A O   1 
HETATM 5091 O O   . HOH E 3 .   ? 68.976 3.079   0.279  1.00 36.36  ? 615 HOH A O   1 
HETATM 5092 O O   . HOH E 3 .   ? 76.037 -18.191 24.134 1.00 11.76  ? 616 HOH A O   1 
HETATM 5093 O O   . HOH E 3 .   ? 54.538 -6.192  38.933 1.00 23.86  ? 617 HOH A O   1 
HETATM 5094 O O   . HOH E 3 .   ? 74.958 1.519   36.981 1.00 45.77  ? 618 HOH A O   1 
HETATM 5095 O O   . HOH E 3 .   ? 54.517 -6.397  19.000 1.00 33.80  ? 619 HOH A O   1 
HETATM 5096 O O   . HOH E 3 .   ? 69.299 4.808   28.841 1.00 39.66  ? 620 HOH A O   1 
HETATM 5097 O O   . HOH E 3 .   ? 71.352 2.161   38.872 1.00 43.46  ? 621 HOH A O   1 
HETATM 5098 O O   . HOH E 3 .   ? 57.893 -7.880  21.601 1.00 25.06  ? 622 HOH A O   1 
HETATM 5099 O O   . HOH E 3 .   ? 80.435 -10.903 26.811 1.00 26.20  ? 623 HOH A O   1 
HETATM 5100 O O   . HOH E 3 .   ? 53.305 -3.804  6.192  1.00 57.30  ? 624 HOH A O   1 
HETATM 5101 O O   . HOH E 3 .   ? 83.769 -32.791 43.692 1.00 52.98  ? 625 HOH A O   1 
HETATM 5102 O O   . HOH E 3 .   ? 58.680 -18.325 7.967  1.00 16.40  ? 626 HOH A O   1 
HETATM 5103 O O   . HOH E 3 .   ? 86.993 -19.181 20.984 1.00 26.34  ? 627 HOH A O   1 
HETATM 5104 O O   . HOH E 3 .   ? 83.465 5.258   7.115  1.00 36.67  ? 628 HOH A O   1 
HETATM 5105 O O   . HOH E 3 .   ? 66.215 -15.997 18.686 1.00 15.33  ? 629 HOH A O   1 
HETATM 5106 O O   . HOH E 3 .   ? 74.204 -4.396  41.056 1.00 18.63  ? 630 HOH A O   1 
HETATM 5107 O O   . HOH E 3 .   ? 63.590 -10.454 40.186 1.00 23.79  ? 631 HOH A O   1 
HETATM 5108 O O   . HOH E 3 .   ? 54.650 -11.025 39.081 1.00 28.93  ? 632 HOH A O   1 
HETATM 5109 O O   . HOH E 3 .   ? 82.959 8.834   13.668 1.00 30.36  ? 633 HOH A O   1 
HETATM 5110 O O   . HOH E 3 .   ? 38.114 -13.749 31.764 1.00 49.68  ? 634 HOH A O   1 
HETATM 5111 O O   . HOH E 3 .   ? 85.885 -7.337  17.134 1.00 23.08  ? 635 HOH A O   1 
HETATM 5112 O O   . HOH E 3 .   ? 76.328 0.576   -0.938 1.00 24.27  ? 636 HOH A O   1 
HETATM 5113 O O   . HOH E 3 .   ? 60.139 -16.815 42.011 1.00 37.19  ? 637 HOH A O   1 
HETATM 5114 O O   . HOH E 3 .   ? 66.421 -24.241 8.646  1.00 16.40  ? 638 HOH A O   1 
HETATM 5115 O O   . HOH E 3 .   ? 83.752 -3.320  9.462  1.00 25.63  ? 639 HOH A O   1 
HETATM 5116 O O   . HOH E 3 .   ? 62.449 -2.234  33.664 1.00 34.38  ? 640 HOH A O   1 
HETATM 5117 O O   . HOH E 3 .   ? 68.166 -25.357 5.616  1.00 38.58  ? 641 HOH A O   1 
HETATM 5118 O O   . HOH E 3 .   ? 85.429 3.737   7.653  1.00 37.23  ? 642 HOH A O   1 
HETATM 5119 O O   . HOH E 3 .   ? 82.285 -25.222 40.769 1.00 24.46  ? 643 HOH A O   1 
HETATM 5120 O O   . HOH E 3 .   ? 73.539 5.762   18.744 1.00 46.73  ? 644 HOH A O   1 
HETATM 5121 O O   . HOH E 3 .   ? 86.484 -26.118 40.760 1.00 33.90  ? 645 HOH A O   1 
HETATM 5122 O O   . HOH E 3 .   ? 82.587 -11.990 31.537 1.00 29.97  ? 646 HOH A O   1 
HETATM 5123 O O   . HOH E 3 .   ? 69.540 -13.070 44.024 1.00 37.25  ? 647 HOH A O   1 
HETATM 5124 O O   . HOH E 3 .   ? 67.683 -2.636  35.126 1.00 24.46  ? 648 HOH A O   1 
HETATM 5125 O O   . HOH E 3 .   ? 77.222 -24.782 7.393  1.00 30.59  ? 649 HOH A O   1 
HETATM 5126 O O   . HOH E 3 .   ? 69.018 -14.468 47.156 1.00 43.90  ? 650 HOH A O   1 
HETATM 5127 O O   . HOH E 3 .   ? 67.590 -22.482 26.305 1.00 15.97  ? 651 HOH A O   1 
HETATM 5128 O O   . HOH E 3 .   ? 61.280 3.353   15.892 1.00 66.56  ? 652 HOH A O   1 
HETATM 5129 O O   . HOH E 3 .   ? 79.269 -7.300  -4.335 1.00 23.27  ? 653 HOH A O   1 
HETATM 5130 O O   . HOH E 3 .   ? 60.589 -18.805 29.515 1.00 27.65  ? 654 HOH A O   1 
HETATM 5131 O O   . HOH E 3 .   ? 65.321 -3.398  39.094 1.00 31.69  ? 655 HOH A O   1 
HETATM 5132 O O   . HOH E 3 .   ? 35.107 -6.876  30.897 1.00 53.05  ? 656 HOH A O   1 
HETATM 5133 O O   . HOH E 3 .   ? 48.267 -9.341  36.690 1.00 39.26  ? 657 HOH A O   1 
HETATM 5134 O O   . HOH E 3 .   ? 80.972 -13.277 5.689  1.00 26.51  ? 658 HOH A O   1 
HETATM 5135 O O   . HOH E 3 .   ? 79.214 8.564   25.287 1.00 45.92  ? 659 HOH A O   1 
HETATM 5136 O O   . HOH E 3 .   ? 37.012 -14.771 27.809 1.00 25.79  ? 660 HOH A O   1 
HETATM 5137 O O   . HOH E 3 .   ? 48.555 -1.837  34.301 1.00 40.67  ? 661 HOH A O   1 
HETATM 5138 O O   . HOH E 3 .   ? 82.497 -31.578 34.887 1.00 23.51  ? 662 HOH A O   1 
HETATM 5139 O O   . HOH E 3 .   ? 88.182 -8.530  19.737 1.00 30.41  ? 663 HOH A O   1 
HETATM 5140 O O   . HOH E 3 .   ? 60.050 -14.104 23.040 1.00 42.76  ? 664 HOH A O   1 
HETATM 5141 O O   . HOH E 3 .   ? 75.877 -2.423  2.921  1.00 18.15  ? 665 HOH A O   1 
HETATM 5142 O O   . HOH E 3 .   ? 80.134 -12.006 30.542 1.00 34.06  ? 666 HOH A O   1 
HETATM 5143 O O   . HOH E 3 .   ? 69.538 -16.503 -5.383 1.00 40.32  ? 667 HOH A O   1 
HETATM 5144 O O   . HOH E 3 .   ? 80.001 -7.370  28.107 1.00 20.49  ? 668 HOH A O   1 
HETATM 5145 O O   . HOH E 3 .   ? 61.870 -20.456 41.442 1.00 29.07  ? 669 HOH A O   1 
HETATM 5146 O O   . HOH E 3 .   ? 71.170 5.517   17.490 1.00 19.49  ? 670 HOH A O   1 
HETATM 5147 O O   . HOH E 3 .   ? 81.849 -4.414  35.188 1.00 34.05  ? 671 HOH A O   1 
HETATM 5148 O O   . HOH E 3 .   ? 76.112 -14.552 15.972 1.00 17.42  ? 672 HOH A O   1 
HETATM 5149 O O   . HOH E 3 .   ? 63.523 -14.075 43.238 1.00 34.43  ? 673 HOH A O   1 
HETATM 5150 O O   . HOH E 3 .   ? 82.655 -25.785 24.413 1.00 31.06  ? 674 HOH A O   1 
HETATM 5151 O O   . HOH E 3 .   ? 71.110 -26.043 42.203 1.00 38.99  ? 675 HOH A O   1 
HETATM 5152 O O   . HOH E 3 .   ? 85.039 6.086   30.279 1.00 40.58  ? 676 HOH A O   1 
HETATM 5153 O O   . HOH E 3 .   ? 71.739 -11.774 -7.053 1.00 26.41  ? 677 HOH A O   1 
HETATM 5154 O O   . HOH E 3 .   ? 86.973 -17.542 30.693 1.00 36.22  ? 678 HOH A O   1 
HETATM 5155 O O   . HOH E 3 .   ? 68.310 -0.898  39.297 1.00 38.68  ? 679 HOH A O   1 
HETATM 5156 O O   . HOH E 3 .   ? 52.219 -4.585  36.242 1.00 24.85  ? 680 HOH A O   1 
HETATM 5157 O O   . HOH E 3 .   ? 86.788 -4.988  10.895 1.00 56.10  ? 681 HOH A O   1 
HETATM 5158 O O   . HOH E 3 .   ? 63.554 -18.036 3.344  1.00 16.63  ? 682 HOH A O   1 
HETATM 5159 O O   . HOH E 3 .   ? 81.608 -13.643 35.827 1.00 29.66  ? 683 HOH A O   1 
HETATM 5160 O O   . HOH E 3 .   ? 51.962 -16.125 9.940  1.00 43.32  ? 684 HOH A O   1 
HETATM 5161 O O   . HOH E 3 .   ? 84.695 -24.677 26.548 1.00 40.28  ? 685 HOH A O   1 
HETATM 5162 O O   . HOH E 3 .   ? 89.296 -16.833 13.131 1.00 36.66  ? 686 HOH A O   1 
HETATM 5163 O O   . HOH E 3 .   ? 82.862 6.527   26.902 1.00 26.09  ? 687 HOH A O   1 
HETATM 5164 O O   . HOH E 3 .   ? 61.877 11.444  10.433 1.00 40.63  ? 688 HOH A O   1 
HETATM 5165 O O   . HOH E 3 .   ? 87.007 -20.538 26.196 1.00 30.90  ? 689 HOH A O   1 
HETATM 5166 O O   . HOH E 3 .   ? 85.382 -31.815 31.488 1.00 32.29  ? 690 HOH A O   1 
HETATM 5167 O O   . HOH E 3 .   ? 48.514 -14.592 34.367 1.00 55.55  ? 691 HOH A O   1 
HETATM 5168 O O   . HOH E 3 .   ? 82.338 -9.058  27.057 1.00 27.79  ? 692 HOH A O   1 
HETATM 5169 O O   . HOH E 3 .   ? 59.034 -9.935  7.704  1.00 25.50  ? 693 HOH A O   1 
HETATM 5170 O O   . HOH E 3 .   ? 73.651 -22.663 45.018 1.00 18.72  ? 694 HOH A O   1 
HETATM 5171 O O   . HOH E 3 .   ? 84.404 -2.696  29.201 1.00 31.44  ? 695 HOH A O   1 
HETATM 5172 O O   . HOH E 3 .   ? 89.442 -1.553  24.216 1.00 30.59  ? 696 HOH A O   1 
HETATM 5173 O O   . HOH E 3 .   ? 69.695 -13.632 41.769 1.00 33.67  ? 697 HOH A O   1 
HETATM 5174 O O   . HOH E 3 .   ? 68.285 -23.282 12.285 1.00 17.27  ? 698 HOH A O   1 
HETATM 5175 O O   . HOH E 3 .   ? 68.792 -15.647 16.616 1.00 13.98  ? 699 HOH A O   1 
HETATM 5176 O O   . HOH E 3 .   ? 75.076 6.572   6.751  1.00 34.25  ? 700 HOH A O   1 
HETATM 5177 O O   . HOH E 3 .   ? 81.793 -2.380  33.066 1.00 30.29  ? 701 HOH A O   1 
HETATM 5178 O O   . HOH E 3 .   ? 83.622 -10.348 29.530 1.00 29.26  ? 702 HOH A O   1 
HETATM 5179 O O   . HOH E 3 .   ? 85.245 5.908   25.082 1.00 27.37  ? 703 HOH A O   1 
HETATM 5180 O O   . HOH E 3 .   ? 85.591 -27.653 29.332 1.00 25.75  ? 704 HOH A O   1 
HETATM 5181 O O   . HOH E 3 .   ? 75.699 -21.802 47.369 1.00 43.16  ? 705 HOH A O   1 
HETATM 5182 O O   . HOH E 3 .   ? 67.030 -16.981 -2.637 1.00 32.85  ? 706 HOH A O   1 
HETATM 5183 O O   . HOH E 3 .   ? 83.550 -17.726 9.023  1.00 40.94  ? 707 HOH A O   1 
HETATM 5184 O O   . HOH E 3 .   ? 84.565 -19.815 13.032 1.00 39.47  ? 708 HOH A O   1 
HETATM 5185 O O   . HOH E 3 .   ? 82.902 -27.895 41.244 1.00 24.63  ? 709 HOH A O   1 
HETATM 5186 O O   . HOH E 3 .   ? 67.743 4.659   26.506 1.00 55.94  ? 710 HOH A O   1 
HETATM 5187 O O   . HOH E 3 .   ? 76.282 -25.699 20.888 1.00 15.14  ? 711 HOH A O   1 
HETATM 5188 O O   . HOH E 3 .   ? 85.375 -6.322  14.626 1.00 26.96  ? 712 HOH A O   1 
HETATM 5189 O O   . HOH E 3 .   ? 87.848 -24.635 14.726 1.00 26.30  ? 713 HOH A O   1 
HETATM 5190 O O   . HOH E 3 .   ? 85.585 -26.787 15.993 1.00 19.92  ? 714 HOH A O   1 
HETATM 5191 O O   . HOH E 3 .   ? 74.260 7.752   23.164 1.00 50.80  ? 715 HOH A O   1 
HETATM 5192 O O   . HOH E 3 .   ? 57.491 -14.884 41.556 1.00 42.55  ? 716 HOH A O   1 
HETATM 5193 O O   . HOH E 3 .   ? 84.720 -0.562  12.748 1.00 40.62  ? 717 HOH A O   1 
HETATM 5194 O O   . HOH E 3 .   ? 87.349 -5.610  28.165 1.00 33.89  ? 718 HOH A O   1 
HETATM 5195 O O   . HOH E 3 .   ? 80.325 -19.238 -1.409 1.00 52.22  ? 719 HOH A O   1 
HETATM 5196 O O   . HOH E 3 .   ? 88.061 -3.257  28.545 1.00 47.51  ? 720 HOH A O   1 
HETATM 5197 O O   . HOH E 3 .   ? 46.775 -22.018 15.912 1.00 38.78  ? 721 HOH A O   1 
HETATM 5198 O O   . HOH E 3 .   ? 65.290 -8.086  16.193 1.00 33.82  ? 722 HOH A O   1 
HETATM 5199 O O   . HOH E 3 .   ? 70.661 -24.719 22.446 1.00 37.42  ? 723 HOH A O   1 
HETATM 5200 O O   . HOH E 3 .   ? 66.523 -20.459 45.012 1.00 35.13  ? 724 HOH A O   1 
HETATM 5201 O O   . HOH E 3 .   ? 68.003 8.803   4.333  1.00 51.64  ? 725 HOH A O   1 
HETATM 5202 O O   . HOH E 3 .   ? 89.577 -2.501  21.558 1.00 25.78  ? 726 HOH A O   1 
HETATM 5203 O O   . HOH E 3 .   ? 79.161 -17.155 1.179  1.00 39.33  ? 727 HOH A O   1 
HETATM 5204 O O   . HOH E 3 .   ? 83.874 9.803   27.223 1.00 51.16  ? 728 HOH A O   1 
HETATM 5205 O O   . HOH E 3 .   ? 79.965 -14.178 -1.739 1.00 38.62  ? 729 HOH A O   1 
HETATM 5206 O O   . HOH E 3 .   ? 63.120 -10.579 -3.305 1.00 38.69  ? 730 HOH A O   1 
HETATM 5207 O O   . HOH E 3 .   ? 79.129 3.099   1.287  1.00 34.86  ? 731 HOH A O   1 
HETATM 5208 O O   . HOH E 3 .   ? 63.105 -22.639 42.490 1.00 53.19  ? 732 HOH A O   1 
HETATM 5209 O O   . HOH E 3 .   ? 75.369 0.061   1.939  1.00 18.30  ? 733 HOH A O   1 
HETATM 5210 O O   . HOH E 3 .   ? 67.976 -1.526  5.379  1.00 47.27  ? 734 HOH A O   1 
HETATM 5211 O O   . HOH E 3 .   ? 86.864 6.251   15.544 1.00 44.42  ? 735 HOH A O   1 
HETATM 5212 O O   . HOH E 3 .   ? 57.411 -23.367 19.811 1.00 40.09  ? 736 HOH A O   1 
HETATM 5213 O O   . HOH E 3 .   ? 81.403 3.372   32.842 1.00 51.01  ? 737 HOH A O   1 
HETATM 5214 O O   . HOH E 3 .   ? 59.806 -17.659 -2.844 1.00 44.47  ? 738 HOH A O   1 
HETATM 5215 O O   . HOH E 3 .   ? 82.110 -11.423 34.006 1.00 51.12  ? 739 HOH A O   1 
HETATM 5216 O O   . HOH E 3 .   ? 90.924 -25.215 35.823 1.00 31.71  ? 740 HOH A O   1 
HETATM 5217 O O   . HOH E 3 .   ? 65.728 11.785  17.577 1.00 44.67  ? 741 HOH A O   1 
HETATM 5218 O O   . HOH E 3 .   ? 73.833 -13.831 -7.183 1.00 28.63  ? 742 HOH A O   1 
HETATM 5219 O O   . HOH E 3 .   ? 40.024 -0.549  28.178 1.00 47.64  ? 743 HOH A O   1 
HETATM 5220 O O   . HOH E 3 .   ? 69.992 -25.636 45.007 1.00 43.40  ? 744 HOH A O   1 
HETATM 5221 O O   . HOH E 3 .   ? 65.555 -24.512 26.554 1.00 26.67  ? 745 HOH A O   1 
HETATM 5222 O O   . HOH E 3 .   ? 76.868 2.259   0.580  1.00 42.15  ? 746 HOH A O   1 
HETATM 5223 O O   . HOH E 3 .   ? 89.684 -13.030 19.019 1.00 51.12  ? 747 HOH A O   1 
HETATM 5224 O O   . HOH E 3 .   ? 87.581 7.529   18.635 1.00 39.99  ? 748 HOH A O   1 
HETATM 5225 O O   . HOH E 3 .   ? 85.294 -3.256  11.532 1.00 43.70  ? 749 HOH A O   1 
HETATM 5226 O O   . HOH E 3 .   ? 51.791 -16.445 14.618 1.00 40.93  ? 750 HOH A O   1 
HETATM 5227 O O   . HOH E 3 .   ? 90.308 1.347   24.439 1.00 43.08  ? 751 HOH A O   1 
HETATM 5228 O O   . HOH E 3 .   ? 62.304 -21.860 21.681 1.00 39.50  ? 752 HOH A O   1 
HETATM 5229 O O   . HOH E 3 .   ? 81.010 -23.980 21.255 1.00 31.71  ? 753 HOH A O   1 
HETATM 5230 O O   . HOH E 3 .   ? 81.133 -9.259  36.293 1.00 50.43  ? 754 HOH A O   1 
HETATM 5231 O O   . HOH E 3 .   ? 63.183 -18.976 -0.790 1.00 37.21  ? 755 HOH A O   1 
HETATM 5232 O O   . HOH E 3 .   ? 38.713 -3.213  26.399 1.00 33.05  ? 756 HOH A O   1 
HETATM 5233 O O   . HOH E 3 .   ? 34.050 -9.473  31.220 1.00 49.64  ? 757 HOH A O   1 
HETATM 5234 O O   . HOH E 3 .   ? 73.647 -14.447 42.275 1.00 36.95  ? 758 HOH A O   1 
HETATM 5235 O O   . HOH E 3 .   ? 67.218 -27.295 36.822 1.00 38.58  ? 759 HOH A O   1 
HETATM 5236 O O   . HOH E 3 .   ? 61.073 11.336  13.997 1.00 47.91  ? 760 HOH A O   1 
HETATM 5237 O O   . HOH E 3 .   ? 40.814 1.366   27.402 1.00 50.45  ? 761 HOH A O   1 
HETATM 5238 O O   . HOH E 3 .   ? 87.481 -29.801 40.400 1.00 51.06  ? 762 HOH A O   1 
HETATM 5239 O O   . HOH E 3 .   ? 70.550 -30.523 38.552 1.00 69.14  ? 763 HOH A O   1 
HETATM 5240 O O   . HOH E 3 .   ? 87.319 -16.495 21.782 1.00 45.54  ? 764 HOH A O   1 
HETATM 5241 O O   . HOH E 3 .   ? 73.632 3.465   38.329 1.00 56.40  ? 765 HOH A O   1 
HETATM 5242 O O   . HOH E 3 .   ? 87.415 5.022   17.451 1.00 43.06  ? 766 HOH A O   1 
HETATM 5243 O O   . HOH E 3 .   ? 57.937 -6.361  -8.411 1.00 52.79  ? 767 HOH A O   1 
HETATM 5244 O O   . HOH E 3 .   ? 84.282 -2.495  32.122 1.00 41.49  ? 768 HOH A O   1 
HETATM 5245 O O   . HOH E 3 .   ? 79.021 -23.257 10.057 1.00 37.96  ? 769 HOH A O   1 
HETATM 5246 O O   . HOH E 3 .   ? 86.500 -3.540  29.875 1.00 54.55  ? 770 HOH A O   1 
HETATM 5247 O O   . HOH E 3 .   ? 68.324 1.251   37.371 1.00 70.32  ? 771 HOH A O   1 
HETATM 5248 O O   . HOH E 3 .   ? 37.430 -8.325  24.606 1.00 26.91  ? 772 HOH A O   1 
HETATM 5249 O O   . HOH E 3 .   ? 78.538 -8.154  30.529 1.00 39.16  ? 773 HOH A O   1 
HETATM 5250 O O   . HOH E 3 .   ? 64.309 -21.818 0.445  1.00 47.96  ? 774 HOH A O   1 
HETATM 5251 O O   . HOH E 3 .   ? 80.150 -17.982 44.568 1.00 55.68  ? 775 HOH A O   1 
HETATM 5252 O O   . HOH E 3 .   ? 82.883 -23.374 45.132 1.00 55.69  ? 776 HOH A O   1 
HETATM 5253 O O   . HOH E 3 .   ? 70.319 -22.944 25.819 1.00 24.93  ? 777 HOH A O   1 
HETATM 5254 O O   . HOH E 3 .   ? 81.555 -4.748  4.201  1.00 41.42  ? 778 HOH A O   1 
HETATM 5255 O O   . HOH E 3 .   ? 71.973 -28.516 42.293 1.00 44.67  ? 779 HOH A O   1 
HETATM 5256 O O   . HOH E 3 .   ? 90.305 -20.233 36.099 1.00 34.49  ? 780 HOH A O   1 
HETATM 5257 O O   . HOH E 3 .   ? 67.885 -10.008 -2.531 1.00 46.24  ? 781 HOH A O   1 
HETATM 5258 O O   . HOH E 3 .   ? 91.872 -22.170 36.095 1.00 58.18  ? 782 HOH A O   1 
HETATM 5259 O O   . HOH E 3 .   ? 72.239 -22.620 23.142 1.00 27.02  ? 783 HOH A O   1 
HETATM 5260 O O   . HOH E 3 .   ? 72.554 -12.395 41.848 1.00 53.31  ? 784 HOH A O   1 
HETATM 5261 O O   . HOH E 3 .   ? 84.744 -15.838 7.648  1.00 49.23  ? 785 HOH A O   1 
HETATM 5262 O O   . HOH E 3 .   ? 82.702 4.630   2.547  1.00 53.00  ? 786 HOH A O   1 
HETATM 5263 O O   . HOH E 3 .   ? 67.115 -22.697 22.446 1.00 44.14  ? 787 HOH A O   1 
HETATM 5264 O O   . HOH E 3 .   ? 78.424 -22.416 49.628 1.00 60.14  ? 788 HOH A O   1 
HETATM 5265 O O   . HOH E 3 .   ? 65.375 -0.971  34.899 1.00 59.62  ? 789 HOH A O   1 
HETATM 5266 O O   . HOH E 3 .   ? 73.546 8.382   14.649 1.00 47.94  ? 790 HOH A O   1 
HETATM 5267 O O   . HOH E 3 .   ? 88.980 -17.404 28.861 1.00 44.52  ? 791 HOH A O   1 
HETATM 5268 O O   . HOH E 3 .   ? 88.936 -10.491 17.949 1.00 54.70  ? 792 HOH A O   1 
HETATM 5269 O O   . HOH E 3 .   ? 88.097 5.480   27.691 1.00 56.86  ? 793 HOH A O   1 
HETATM 5270 O O   . HOH E 3 .   ? 84.914 -26.510 21.185 1.00 29.68  ? 794 HOH A O   1 
HETATM 5271 O O   . HOH E 3 .   ? 58.529 -7.889  42.458 1.00 48.06  ? 795 HOH A O   1 
HETATM 5272 O O   . HOH E 3 .   ? 87.581 4.835   8.793  1.00 56.53  ? 796 HOH A O   1 
HETATM 5273 O O   . HOH E 3 .   ? 54.453 -8.614  40.416 1.00 29.70  ? 797 HOH A O   1 
HETATM 5274 O O   . HOH E 3 .   ? 64.454 -11.479 42.583 1.00 35.36  ? 798 HOH A O   1 
HETATM 5275 O O   . HOH E 3 .   ? 91.529 -25.736 32.853 1.00 59.92  ? 799 HOH A O   1 
HETATM 5276 O O   . HOH E 3 .   ? 63.705 -9.193  43.032 1.00 53.84  ? 800 HOH A O   1 
HETATM 5277 O O   . HOH E 3 .   ? 68.945 -12.527 -6.742 1.00 46.08  ? 801 HOH A O   1 
HETATM 5278 O O   . HOH E 3 .   ? 62.190 -21.078 30.642 1.00 33.10  ? 802 HOH A O   1 
HETATM 5279 O O   . HOH E 3 .   ? 86.041 -27.252 18.796 1.00 27.39  ? 803 HOH A O   1 
HETATM 5280 O O   . HOH E 3 .   ? 83.087 -14.691 6.508  1.00 34.21  ? 804 HOH A O   1 
HETATM 5281 O O   . HOH E 3 .   ? 68.655 -18.549 48.385 1.00 51.74  ? 805 HOH A O   1 
HETATM 5282 O O   . HOH E 3 .   ? 70.824 -18.415 -1.826 1.00 51.18  ? 806 HOH A O   1 
HETATM 5283 O O   . HOH E 3 .   ? 83.966 -24.976 44.028 1.00 50.43  ? 807 HOH A O   1 
HETATM 5284 O O   . HOH E 3 .   ? 71.964 -17.180 47.710 1.00 46.28  ? 808 HOH A O   1 
HETATM 5285 O O   . HOH E 3 .   ? 87.526 -5.929  12.782 1.00 58.69  ? 809 HOH A O   1 
HETATM 5286 O O   . HOH E 3 .   ? 68.490 -1.949  2.058  1.00 50.34  ? 810 HOH A O   1 
HETATM 5287 O O   . HOH E 3 .   ? 76.385 9.244   20.068 1.00 56.32  ? 811 HOH A O   1 
HETATM 5288 O O   . HOH E 3 .   ? 89.436 -19.119 38.406 1.00 50.72  ? 812 HOH A O   1 
HETATM 5289 O O   . HOH E 3 .   ? 68.063 -24.268 14.727 1.00 25.53  ? 813 HOH A O   1 
HETATM 5290 O O   . HOH E 3 .   ? 84.869 -24.238 41.435 1.00 36.60  ? 814 HOH A O   1 
HETATM 5291 O O   . HOH E 3 .   ? 90.176 -29.488 30.535 1.00 62.25  ? 815 HOH A O   1 
HETATM 5292 O O   . HOH E 3 .   ? 71.049 -29.189 40.242 1.00 41.98  ? 816 HOH A O   1 
HETATM 5293 O O   . HOH E 3 .   ? 75.116 -16.426 44.386 1.00 38.01  ? 817 HOH A O   1 
HETATM 5294 O O   . HOH E 3 .   ? 79.313 -24.525 7.904  1.00 55.73  ? 818 HOH A O   1 
HETATM 5295 O O   . HOH E 3 .   ? 81.878 -17.621 5.282  1.00 46.08  ? 819 HOH A O   1 
HETATM 5296 O O   . HOH E 3 .   ? 69.362 -27.408 38.550 1.00 31.16  ? 820 HOH A O   1 
HETATM 5297 O O   . HOH E 3 .   ? 48.401 -11.967 36.528 1.00 35.63  ? 821 HOH A O   1 
HETATM 5298 O O   . HOH E 3 .   ? 66.502 -12.629 44.056 1.00 29.97  ? 822 HOH A O   1 
HETATM 5299 O O   . HOH E 3 .   ? 58.482 -18.963 31.463 1.00 36.39  ? 823 HOH A O   1 
HETATM 5300 O O   . HOH E 3 .   ? 83.750 -29.445 43.228 1.00 41.50  ? 824 HOH A O   1 
HETATM 5301 O O   . HOH E 3 .   ? 80.310 10.752  0.984  1.00 37.25  ? 825 HOH A O   1 
HETATM 5302 O O   . HOH E 3 .   ? 79.972 -20.888 49.108 1.00 63.55  ? 826 HOH A O   1 
HETATM 5303 O O   . HOH E 3 .   ? 70.404 5.098   -0.769 1.00 53.59  ? 827 HOH A O   1 
HETATM 5304 O O   . HOH E 3 .   ? 86.339 -21.771 41.226 1.00 40.59  ? 828 HOH A O   1 
HETATM 5305 O O   . HOH E 3 .   ? 85.123 -25.502 24.702 1.00 73.86  ? 829 HOH A O   1 
HETATM 5306 O O   . HOH E 3 .   ? 78.704 -19.094 46.269 1.00 52.02  ? 830 HOH A O   1 
HETATM 5307 O O   . HOH E 3 .   ? 78.128 8.722   22.780 1.00 48.70  ? 831 HOH A O   1 
HETATM 5308 O O   . HOH E 3 .   ? 74.185 6.412   16.230 1.00 42.91  ? 832 HOH A O   1 
HETATM 5309 O O   . HOH E 3 .   ? 59.505 -21.241 33.832 1.00 40.24  ? 833 HOH A O   1 
HETATM 5310 O O   . HOH E 3 .   ? 85.361 -17.860 6.423  1.00 61.58  ? 834 HOH A O   1 
HETATM 5311 O O   . HOH E 3 .   ? 86.968 -26.921 42.975 1.00 70.54  ? 835 HOH A O   1 
HETATM 5312 O O   . HOH E 3 .   ? 71.954 6.742   10.161 1.00 45.36  ? 836 HOH A O   1 
HETATM 5313 O O   . HOH E 3 .   ? 78.751 -9.913  28.526 1.00 30.58  ? 837 HOH A O   1 
HETATM 5314 O O   . HOH E 3 .   ? 68.114 -24.191 46.551 1.00 44.62  ? 838 HOH A O   1 
HETATM 5315 O O   . HOH E 3 .   ? 84.074 5.369   4.508  1.00 65.05  ? 839 HOH A O   1 
HETATM 5316 O O   . HOH E 3 .   ? 68.887 -18.480 -3.026 1.00 45.59  ? 840 HOH A O   1 
HETATM 5317 O O   . HOH E 3 .   ? 80.954 5.732   31.912 1.00 48.20  ? 841 HOH A O   1 
HETATM 5318 O O   . HOH E 3 .   ? 41.477 -7.721  19.337 1.00 63.08  ? 842 HOH A O   1 
HETATM 5319 O O   . HOH E 3 .   ? 90.131 -19.448 33.022 1.00 38.65  ? 843 HOH A O   1 
HETATM 5320 O O   . HOH E 3 .   ? 75.783 -19.050 47.201 1.00 49.64  ? 844 HOH A O   1 
HETATM 5321 O O   . HOH E 3 .   ? 88.974 -27.087 7.840  1.00 66.20  ? 845 HOH A O   1 
HETATM 5322 O O   . HOH E 3 .   ? 65.100 -19.174 -2.431 1.00 39.23  ? 846 HOH A O   1 
HETATM 5323 O O   . HOH E 3 .   ? 80.662 -13.964 3.014  1.00 38.20  ? 847 HOH A O   1 
HETATM 5324 O O   . HOH E 3 .   ? 71.197 -25.245 18.019 1.00 48.29  ? 848 HOH A O   1 
HETATM 5325 O O   . HOH E 3 .   ? 73.834 7.406   8.825  1.00 50.06  ? 849 HOH A O   1 
HETATM 5326 O O   . HOH E 3 .   ? 88.873 -26.450 18.924 1.00 46.41  ? 850 HOH A O   1 
HETATM 5327 O O   . HOH E 3 .   ? 88.145 -21.757 42.749 1.00 56.72  ? 851 HOH A O   1 
HETATM 5328 O O   . HOH E 3 .   ? 90.715 -20.829 28.494 1.00 54.76  ? 852 HOH A O   1 
HETATM 5329 O O   . HOH E 3 .   ? 62.296 -0.796  -3.289 1.00 60.15  ? 853 HOH A O   1 
HETATM 5330 O O   . HOH F 3 .   ? 65.644 -60.685 10.142 1.00 30.93  ? 501 HOH B O   1 
HETATM 5331 O O   . HOH F 3 .   ? 53.511 -36.575 2.817  1.00 41.82  ? 502 HOH B O   1 
HETATM 5332 O O   . HOH F 3 .   ? 59.900 -24.258 19.105 1.00 26.81  ? 503 HOH B O   1 
HETATM 5333 O O   . HOH F 3 .   ? 64.010 -32.255 10.577 1.00 14.13  ? 504 HOH B O   1 
HETATM 5334 O O   . HOH F 3 .   ? 50.622 -34.158 8.003  1.00 55.72  ? 505 HOH B O   1 
HETATM 5335 O O   . HOH F 3 .   ? 46.743 -32.835 39.986 1.00 65.60  ? 506 HOH B O   1 
HETATM 5336 O O   . HOH F 3 .   ? 60.292 -20.254 18.231 1.00 23.10  ? 507 HOH B O   1 
HETATM 5337 O O   . HOH F 3 .   ? 85.365 -44.019 36.184 1.00 36.80  ? 508 HOH B O   1 
HETATM 5338 O O   . HOH F 3 .   ? 84.193 -61.978 18.984 1.00 50.15  ? 509 HOH B O   1 
HETATM 5339 O O   . HOH F 3 .   ? 43.062 -23.125 8.617  1.00 55.15  ? 510 HOH B O   1 
HETATM 5340 O O   . HOH F 3 .   ? 54.390 -28.443 31.218 1.00 52.48  ? 511 HOH B O   1 
HETATM 5341 O O   . HOH F 3 .   ? 82.106 -43.038 36.643 1.00 36.44  ? 512 HOH B O   1 
HETATM 5342 O O   . HOH F 3 .   ? 43.630 -33.861 33.678 1.00 51.02  ? 513 HOH B O   1 
HETATM 5343 O O   . HOH F 3 .   ? 59.872 -57.487 5.922  1.00 28.83  ? 514 HOH B O   1 
HETATM 5344 O O   . HOH F 3 .   ? 66.028 -44.313 41.893 1.00 60.22  ? 515 HOH B O   1 
HETATM 5345 O O   . HOH F 3 .   ? 58.064 -28.729 40.403 1.00 55.95  ? 516 HOH B O   1 
HETATM 5346 O O   . HOH F 3 .   ? 53.438 -29.598 27.961 1.00 39.85  ? 517 HOH B O   1 
HETATM 5347 O O   . HOH F 3 .   ? 71.734 -41.723 30.354 1.00 33.73  ? 518 HOH B O   1 
HETATM 5348 O O   . HOH F 3 .   ? 40.092 -37.352 41.901 1.00 51.49  ? 519 HOH B O   1 
HETATM 5349 O O   . HOH F 3 .   ? 76.388 -51.843 9.267  1.00 29.22  ? 520 HOH B O   1 
HETATM 5350 O O   . HOH F 3 .   ? 63.539 -20.447 1.950  1.00 31.65  ? 521 HOH B O   1 
HETATM 5351 O O   . HOH F 3 .   ? 38.886 -42.459 25.151 1.00 39.84  ? 522 HOH B O   1 
HETATM 5352 O O   . HOH F 3 .   ? 51.993 -34.830 0.104  1.00 41.27  ? 523 HOH B O   1 
HETATM 5353 O O   . HOH F 3 .   ? 69.257 -52.076 -0.085 1.00 53.68  ? 524 HOH B O   1 
HETATM 5354 O O   . HOH F 3 .   ? 51.438 -45.714 23.964 1.00 35.48  ? 525 HOH B O   1 
HETATM 5355 O O   . HOH F 3 .   ? 44.765 -32.503 8.508  1.00 47.19  ? 526 HOH B O   1 
HETATM 5356 O O   . HOH F 3 .   ? 46.793 -32.022 32.593 1.00 35.87  ? 527 HOH B O   1 
HETATM 5357 O O   . HOH F 3 .   ? 64.048 -55.646 27.174 1.00 59.28  ? 528 HOH B O   1 
HETATM 5358 O O   . HOH F 3 .   ? 84.122 -36.959 13.011 1.00 35.16  ? 529 HOH B O   1 
HETATM 5359 O O   . HOH F 3 .   ? 48.609 -17.363 -1.358 1.00 39.66  ? 530 HOH B O   1 
HETATM 5360 O O   . HOH F 3 .   ? 85.554 -29.872 19.375 1.00 26.86  ? 531 HOH B O   1 
HETATM 5361 O O   . HOH F 3 .   ? 60.015 -33.890 26.275 1.00 46.79  ? 532 HOH B O   1 
HETATM 5362 O O   . HOH F 3 .   ? 64.586 -43.994 2.299  1.00 18.30  ? 533 HOH B O   1 
HETATM 5363 O O   . HOH F 3 .   ? 48.553 -31.241 -1.329 1.00 43.89  ? 534 HOH B O   1 
HETATM 5364 O O   . HOH F 3 .   ? 75.118 -42.321 35.542 1.00 21.28  ? 535 HOH B O   1 
HETATM 5365 O O   . HOH F 3 .   ? 81.499 -46.197 30.288 1.00 37.70  ? 536 HOH B O   1 
HETATM 5366 O O   . HOH F 3 .   ? 82.671 -43.563 24.819 1.00 21.99  ? 537 HOH B O   1 
HETATM 5367 O O   . HOH F 3 .   ? 42.265 -32.103 17.426 1.00 50.14  ? 538 HOH B O   1 
HETATM 5368 O O   . HOH F 3 .   ? 46.186 -43.899 15.953 1.00 45.70  ? 539 HOH B O   1 
HETATM 5369 O O   . HOH F 3 .   ? 66.769 -28.571 7.392  1.00 15.13  ? 540 HOH B O   1 
HETATM 5370 O O   . HOH F 3 .   ? 57.588 -56.890 2.611  1.00 44.74  ? 541 HOH B O   1 
HETATM 5371 O O   . HOH F 3 .   ? 69.603 -47.805 27.844 1.00 36.83  ? 542 HOH B O   1 
HETATM 5372 O O   . HOH F 3 .   ? 79.923 -50.617 11.150 1.00 28.38  ? 543 HOH B O   1 
HETATM 5373 O O   . HOH F 3 .   ? 73.421 -52.088 9.298  1.00 18.27  ? 544 HOH B O   1 
HETATM 5374 O O   . HOH F 3 .   ? 82.351 -45.121 26.894 1.00 24.25  ? 545 HOH B O   1 
HETATM 5375 O O   . HOH F 3 .   ? 64.567 -29.149 22.908 1.00 18.90  ? 546 HOH B O   1 
HETATM 5376 O O   . HOH F 3 .   ? 53.067 -29.853 -4.252 1.00 28.91  ? 547 HOH B O   1 
HETATM 5377 O O   . HOH F 3 .   ? 42.497 -32.417 29.624 1.00 45.30  ? 548 HOH B O   1 
HETATM 5378 O O   . HOH F 3 .   ? 78.174 -49.791 8.924  1.00 21.67  ? 549 HOH B O   1 
HETATM 5379 O O   . HOH F 3 .   ? 42.187 -30.844 23.615 1.00 45.39  ? 550 HOH B O   1 
HETATM 5380 O O   . HOH F 3 .   ? 65.277 -26.228 7.066  1.00 18.47  ? 551 HOH B O   1 
HETATM 5381 O O   . HOH F 3 .   ? 52.057 -31.815 -2.597 1.00 32.21  ? 552 HOH B O   1 
HETATM 5382 O O   . HOH F 3 .   ? 78.335 -25.941 19.180 1.00 19.37  ? 553 HOH B O   1 
HETATM 5383 O O   . HOH F 3 .   ? 83.813 -46.434 13.351 1.00 31.15  ? 554 HOH B O   1 
HETATM 5384 O O   . HOH F 3 .   ? 56.849 -55.211 7.796  1.00 50.27  ? 555 HOH B O   1 
HETATM 5385 O O   . HOH F 3 .   ? 83.612 -41.059 24.850 1.00 19.03  ? 556 HOH B O   1 
HETATM 5386 O O   . HOH F 3 .   ? 71.104 -32.369 37.569 1.00 28.44  ? 557 HOH B O   1 
HETATM 5387 O O   . HOH F 3 .   ? 88.606 -39.106 14.197 1.00 50.83  ? 558 HOH B O   1 
HETATM 5388 O O   . HOH F 3 .   ? 61.477 -28.384 18.904 1.00 22.45  ? 559 HOH B O   1 
HETATM 5389 O O   . HOH F 3 .   ? 61.079 -34.957 24.370 1.00 36.19  ? 560 HOH B O   1 
HETATM 5390 O O   . HOH F 3 .   ? 84.106 -28.317 14.117 1.00 27.86  ? 561 HOH B O   1 
HETATM 5391 O O   . HOH F 3 .   ? 54.379 -53.121 5.714  1.00 39.51  ? 562 HOH B O   1 
HETATM 5392 O O   . HOH F 3 .   ? 70.099 -33.337 0.983  1.00 23.56  ? 563 HOH B O   1 
HETATM 5393 O O   . HOH F 3 .   ? 61.723 -24.531 -5.154 1.00 42.51  ? 564 HOH B O   1 
HETATM 5394 O O   . HOH F 3 .   ? 81.957 -47.407 9.377  1.00 24.61  ? 565 HOH B O   1 
HETATM 5395 O O   . HOH F 3 .   ? 73.133 -35.934 47.386 1.00 29.31  ? 566 HOH B O   1 
HETATM 5396 O O   . HOH F 3 .   ? 42.200 -43.149 14.407 1.00 46.63  ? 567 HOH B O   1 
HETATM 5397 O O   . HOH F 3 .   ? 65.824 -28.435 26.898 1.00 15.28  ? 568 HOH B O   1 
HETATM 5398 O O   . HOH F 3 .   ? 44.300 -25.977 18.832 1.00 43.32  ? 569 HOH B O   1 
HETATM 5399 O O   . HOH F 3 .   ? 60.342 -26.493 17.416 1.00 18.51  ? 570 HOH B O   1 
HETATM 5400 O O   . HOH F 3 .   ? 70.859 -34.588 14.834 1.00 11.69  ? 571 HOH B O   1 
HETATM 5401 O O   . HOH F 3 .   ? 55.646 -37.908 44.448 1.00 53.77  ? 572 HOH B O   1 
HETATM 5402 O O   . HOH F 3 .   ? 51.235 -17.967 7.935  1.00 27.77  ? 573 HOH B O   1 
HETATM 5403 O O   . HOH F 3 .   ? 54.106 -53.024 17.841 1.00 51.12  ? 574 HOH B O   1 
HETATM 5404 O O   . HOH F 3 .   ? 62.223 -57.327 4.218  1.00 26.52  ? 575 HOH B O   1 
HETATM 5405 O O   . HOH F 3 .   ? 68.128 -43.978 25.320 1.00 39.28  ? 576 HOH B O   1 
HETATM 5406 O O   . HOH F 3 .   ? 62.731 -30.905 21.827 1.00 15.84  ? 577 HOH B O   1 
HETATM 5407 O O   . HOH F 3 .   ? 47.451 -21.155 12.047 1.00 55.41  ? 578 HOH B O   1 
HETATM 5408 O O   . HOH F 3 .   ? 47.804 -46.609 15.231 1.00 37.74  ? 579 HOH B O   1 
HETATM 5409 O O   . HOH F 3 .   ? 72.226 -48.946 5.911  1.00 18.33  ? 580 HOH B O   1 
HETATM 5410 O O   . HOH F 3 .   ? 59.803 -27.180 12.730 1.00 14.60  ? 581 HOH B O   1 
HETATM 5411 O O   . HOH F 3 .   ? 62.969 -33.494 22.838 1.00 17.14  ? 582 HOH B O   1 
HETATM 5412 O O   . HOH F 3 .   ? 53.676 -45.089 11.644 1.00 21.62  ? 583 HOH B O   1 
HETATM 5413 O O   . HOH F 3 .   ? 58.608 -40.598 10.184 1.00 19.80  ? 584 HOH B O   1 
HETATM 5414 O O   . HOH F 3 .   ? 43.718 -40.230 25.987 1.00 42.50  ? 585 HOH B O   1 
HETATM 5415 O O   . HOH F 3 .   ? 66.216 -28.809 15.814 1.00 16.53  ? 586 HOH B O   1 
HETATM 5416 O O   . HOH F 3 .   ? 80.664 -55.469 26.525 1.00 50.09  ? 587 HOH B O   1 
HETATM 5417 O O   . HOH F 3 .   ? 85.368 -28.056 23.413 1.00 33.62  ? 588 HOH B O   1 
HETATM 5418 O O   . HOH F 3 .   ? 78.491 -28.148 8.643  1.00 25.45  ? 589 HOH B O   1 
HETATM 5419 O O   . HOH F 3 .   ? 79.916 -31.827 11.283 1.00 30.88  ? 590 HOH B O   1 
HETATM 5420 O O   . HOH F 3 .   ? 83.964 -45.344 31.003 1.00 43.46  ? 591 HOH B O   1 
HETATM 5421 O O   . HOH F 3 .   ? 42.951 -29.022 6.302  1.00 36.44  ? 592 HOH B O   1 
HETATM 5422 O O   . HOH F 3 .   ? 70.308 -37.894 0.066  1.00 47.01  ? 593 HOH B O   1 
HETATM 5423 O O   . HOH F 3 .   ? 43.941 -35.627 37.733 1.00 42.72  ? 594 HOH B O   1 
HETATM 5424 O O   . HOH F 3 .   ? 76.167 -39.784 39.606 1.00 22.89  ? 595 HOH B O   1 
HETATM 5425 O O   . HOH F 3 .   ? 87.114 -31.807 22.928 1.00 32.86  ? 596 HOH B O   1 
HETATM 5426 O O   . HOH F 3 .   ? 49.733 -13.995 2.267  1.00 48.27  ? 597 HOH B O   1 
HETATM 5427 O O   . HOH F 3 .   ? 69.522 -40.251 27.142 1.00 27.55  ? 598 HOH B O   1 
HETATM 5428 O O   . HOH F 3 .   ? 49.216 -45.098 17.280 1.00 28.53  ? 599 HOH B O   1 
HETATM 5429 O O   . HOH F 3 .   ? 72.653 -51.259 36.866 1.00 45.78  ? 600 HOH B O   1 
HETATM 5430 O O   . HOH F 3 .   ? 82.257 -35.534 5.706  1.00 29.48  ? 601 HOH B O   1 
HETATM 5431 O O   . HOH F 3 .   ? 60.007 -31.386 -2.857 1.00 26.82  ? 602 HOH B O   1 
HETATM 5432 O O   . HOH F 3 .   ? 69.013 -26.911 4.001  1.00 36.28  ? 603 HOH B O   1 
HETATM 5433 O O   . HOH F 3 .   ? 67.794 -45.653 -0.148 1.00 32.84  ? 604 HOH B O   1 
HETATM 5434 O O   . HOH F 3 .   ? 81.169 -28.077 13.336 1.00 30.96  ? 605 HOH B O   1 
HETATM 5435 O O   . HOH F 3 .   ? 66.571 -37.725 31.552 1.00 29.41  ? 606 HOH B O   1 
HETATM 5436 O O   . HOH F 3 .   ? 80.957 -51.688 25.753 1.00 54.55  ? 607 HOH B O   1 
HETATM 5437 O O   . HOH F 3 .   ? 47.913 -44.869 20.115 1.00 57.25  ? 608 HOH B O   1 
HETATM 5438 O O   . HOH F 3 .   ? 71.401 -43.799 31.293 1.00 36.70  ? 609 HOH B O   1 
HETATM 5439 O O   . HOH F 3 .   ? 74.953 -31.414 31.581 1.00 11.80  ? 610 HOH B O   1 
HETATM 5440 O O   . HOH F 3 .   ? 68.499 -41.225 29.463 1.00 34.64  ? 611 HOH B O   1 
HETATM 5441 O O   . HOH F 3 .   ? 89.867 -36.473 24.688 1.00 40.99  ? 612 HOH B O   1 
HETATM 5442 O O   . HOH F 3 .   ? 82.608 -28.426 25.721 1.00 18.65  ? 613 HOH B O   1 
HETATM 5443 O O   . HOH F 3 .   ? 70.997 -37.388 19.230 1.00 13.97  ? 614 HOH B O   1 
HETATM 5444 O O   . HOH F 3 .   ? 61.664 -41.007 33.549 1.00 32.61  ? 615 HOH B O   1 
HETATM 5445 O O   . HOH F 3 .   ? 45.801 -30.729 44.527 1.00 52.16  ? 616 HOH B O   1 
HETATM 5446 O O   . HOH F 3 .   ? 71.498 -45.261 4.314  1.00 18.91  ? 617 HOH B O   1 
HETATM 5447 O O   . HOH F 3 .   ? 77.063 -58.614 18.835 1.00 44.14  ? 618 HOH B O   1 
HETATM 5448 O O   . HOH F 3 .   ? 65.831 -23.124 2.664  1.00 19.50  ? 619 HOH B O   1 
HETATM 5449 O O   . HOH F 3 .   ? 81.816 -47.192 25.175 1.00 20.66  ? 620 HOH B O   1 
HETATM 5450 O O   . HOH F 3 .   ? 80.482 -32.923 28.227 1.00 13.09  ? 621 HOH B O   1 
HETATM 5451 O O   . HOH F 3 .   ? 70.509 -25.673 8.873  1.00 23.53  ? 622 HOH B O   1 
HETATM 5452 O O   . HOH F 3 .   ? 68.723 -37.660 36.701 1.00 31.09  ? 623 HOH B O   1 
HETATM 5453 O O   . HOH F 3 .   ? 57.920 -19.748 -3.034 1.00 36.00  ? 624 HOH B O   1 
HETATM 5454 O O   . HOH F 3 .   ? 55.026 -28.597 23.634 1.00 27.59  ? 625 HOH B O   1 
HETATM 5455 O O   . HOH F 3 .   ? 81.703 -50.272 18.599 1.00 21.10  ? 626 HOH B O   1 
HETATM 5456 O O   . HOH F 3 .   ? 77.219 -26.689 23.367 1.00 17.03  ? 627 HOH B O   1 
HETATM 5457 O O   . HOH F 3 .   ? 58.453 -19.255 14.434 1.00 17.31  ? 628 HOH B O   1 
HETATM 5458 O O   . HOH F 3 .   ? 62.944 -55.771 1.867  1.00 28.08  ? 629 HOH B O   1 
HETATM 5459 O O   . HOH F 3 .   ? 68.970 -33.674 22.398 1.00 19.25  ? 630 HOH B O   1 
HETATM 5460 O O   . HOH F 3 .   ? 60.242 -39.989 29.398 1.00 26.70  ? 631 HOH B O   1 
HETATM 5461 O O   . HOH F 3 .   ? 65.759 -55.539 19.773 1.00 33.09  ? 632 HOH B O   1 
HETATM 5462 O O   . HOH F 3 .   ? 52.001 -25.324 20.840 1.00 31.08  ? 633 HOH B O   1 
HETATM 5463 O O   . HOH F 3 .   ? 48.998 -45.193 22.736 1.00 37.41  ? 634 HOH B O   1 
HETATM 5464 O O   . HOH F 3 .   ? 85.344 -33.489 33.236 1.00 40.13  ? 635 HOH B O   1 
HETATM 5465 O O   . HOH F 3 .   ? 51.265 -21.911 -2.014 1.00 27.74  ? 636 HOH B O   1 
HETATM 5466 O O   . HOH F 3 .   ? 71.779 -35.196 -1.947 1.00 26.18  ? 637 HOH B O   1 
HETATM 5467 O O   . HOH F 3 .   ? 82.244 -40.047 11.467 1.00 20.90  ? 638 HOH B O   1 
HETATM 5468 O O   . HOH F 3 .   ? 66.423 -33.654 21.614 1.00 15.84  ? 639 HOH B O   1 
HETATM 5469 O O   . HOH F 3 .   ? 50.033 -39.646 46.758 1.00 32.65  ? 640 HOH B O   1 
HETATM 5470 O O   . HOH F 3 .   ? 57.976 -19.179 -0.458 1.00 24.06  ? 641 HOH B O   1 
HETATM 5471 O O   . HOH F 3 .   ? 59.126 -48.181 2.981  1.00 30.88  ? 642 HOH B O   1 
HETATM 5472 O O   . HOH F 3 .   ? 73.612 -46.107 5.986  1.00 22.95  ? 643 HOH B O   1 
HETATM 5473 O O   . HOH F 3 .   ? 48.330 -31.451 6.890  1.00 40.91  ? 644 HOH B O   1 
HETATM 5474 O O   . HOH F 3 .   ? 80.745 -32.114 3.051  1.00 43.91  ? 645 HOH B O   1 
HETATM 5475 O O   . HOH F 3 .   ? 61.750 -49.246 -1.052 1.00 51.85  ? 646 HOH B O   1 
HETATM 5476 O O   . HOH F 3 .   ? 51.149 -24.441 -1.116 1.00 37.34  ? 647 HOH B O   1 
HETATM 5477 O O   . HOH F 3 .   ? 61.720 -39.948 6.329  1.00 25.53  ? 648 HOH B O   1 
HETATM 5478 O O   . HOH F 3 .   ? 40.726 -28.246 12.721 1.00 51.96  ? 649 HOH B O   1 
HETATM 5479 O O   . HOH F 3 .   ? 64.622 -50.781 -0.247 1.00 27.51  ? 650 HOH B O   1 
HETATM 5480 O O   . HOH F 3 .   ? 84.201 -40.363 4.107  1.00 31.99  ? 651 HOH B O   1 
HETATM 5481 O O   . HOH F 3 .   ? 63.339 -37.202 -1.856 1.00 24.64  ? 652 HOH B O   1 
HETATM 5482 O O   . HOH F 3 .   ? 59.552 -42.988 6.844  1.00 18.85  ? 653 HOH B O   1 
HETATM 5483 O O   . HOH F 3 .   ? 63.155 -23.751 -1.046 1.00 31.70  ? 654 HOH B O   1 
HETATM 5484 O O   . HOH F 3 .   ? 80.876 -36.616 7.918  1.00 29.24  ? 655 HOH B O   1 
HETATM 5485 O O   . HOH F 3 .   ? 71.663 -61.026 9.944  1.00 28.64  ? 656 HOH B O   1 
HETATM 5486 O O   . HOH F 3 .   ? 68.892 -28.091 0.964  1.00 52.73  ? 657 HOH B O   1 
HETATM 5487 O O   . HOH F 3 .   ? 44.447 -25.172 6.151  1.00 26.73  ? 658 HOH B O   1 
HETATM 5488 O O   . HOH F 3 .   ? 55.703 -57.272 14.156 1.00 51.37  ? 659 HOH B O   1 
HETATM 5489 O O   . HOH F 3 .   ? 65.109 -27.181 0.555  1.00 42.84  ? 660 HOH B O   1 
HETATM 5490 O O   . HOH F 3 .   ? 59.655 -54.108 21.216 1.00 48.75  ? 661 HOH B O   1 
HETATM 5491 O O   . HOH F 3 .   ? 71.240 -36.877 13.180 1.00 15.24  ? 662 HOH B O   1 
HETATM 5492 O O   . HOH F 3 .   ? 73.865 -39.670 32.200 1.00 20.02  ? 663 HOH B O   1 
HETATM 5493 O O   . HOH F 3 .   ? 74.126 -27.430 20.674 1.00 18.05  ? 664 HOH B O   1 
HETATM 5494 O O   . HOH F 3 .   ? 79.068 -46.224 38.685 1.00 25.57  ? 665 HOH B O   1 
HETATM 5495 O O   . HOH F 3 .   ? 44.601 -29.022 22.942 1.00 35.50  ? 666 HOH B O   1 
HETATM 5496 O O   . HOH F 3 .   ? 80.651 -26.109 22.553 1.00 36.80  ? 667 HOH B O   1 
HETATM 5497 O O   . HOH F 3 .   ? 57.690 -38.448 5.651  1.00 29.69  ? 668 HOH B O   1 
HETATM 5498 O O   . HOH F 3 .   ? 65.027 -53.685 -0.582 1.00 43.95  ? 669 HOH B O   1 
HETATM 5499 O O   . HOH F 3 .   ? 66.989 -41.547 24.894 1.00 46.70  ? 670 HOH B O   1 
HETATM 5500 O O   . HOH F 3 .   ? 80.853 -25.791 4.644  1.00 50.31  ? 671 HOH B O   1 
HETATM 5501 O O   . HOH F 3 .   ? 44.816 -36.077 18.932 1.00 50.80  ? 672 HOH B O   1 
HETATM 5502 O O   . HOH F 3 .   ? 60.190 -34.117 -2.034 1.00 28.52  ? 673 HOH B O   1 
HETATM 5503 O O   . HOH F 3 .   ? 65.177 -31.396 -0.751 1.00 30.34  ? 674 HOH B O   1 
HETATM 5504 O O   . HOH F 3 .   ? 61.259 -19.427 -1.892 1.00 34.07  ? 675 HOH B O   1 
HETATM 5505 O O   . HOH F 3 .   ? 53.849 -44.897 44.725 1.00 41.26  ? 676 HOH B O   1 
HETATM 5506 O O   . HOH F 3 .   ? 69.599 -44.654 35.286 1.00 57.24  ? 677 HOH B O   1 
HETATM 5507 O O   . HOH F 3 .   ? 51.300 -50.361 7.278  1.00 35.28  ? 678 HOH B O   1 
HETATM 5508 O O   . HOH F 3 .   ? 50.888 -39.937 5.533  1.00 43.46  ? 679 HOH B O   1 
HETATM 5509 O O   . HOH F 3 .   ? 65.101 -26.198 37.663 1.00 21.41  ? 680 HOH B O   1 
HETATM 5510 O O   . HOH F 3 .   ? 60.832 -43.385 35.223 1.00 42.84  ? 681 HOH B O   1 
HETATM 5511 O O   . HOH F 3 .   ? 68.347 -25.330 10.406 1.00 14.29  ? 682 HOH B O   1 
HETATM 5512 O O   . HOH F 3 .   ? 77.541 -49.247 26.888 1.00 45.22  ? 683 HOH B O   1 
HETATM 5513 O O   . HOH F 3 .   ? 40.672 -35.900 22.013 1.00 38.12  ? 684 HOH B O   1 
HETATM 5514 O O   . HOH F 3 .   ? 77.707 -32.161 1.520  1.00 38.23  ? 685 HOH B O   1 
HETATM 5515 O O   . HOH F 3 .   ? 70.223 -44.181 1.248  1.00 31.58  ? 686 HOH B O   1 
HETATM 5516 O O   . HOH F 3 .   ? 76.966 -28.591 1.250  1.00 31.38  ? 687 HOH B O   1 
HETATM 5517 O O   . HOH F 3 .   ? 59.587 -21.538 20.668 1.00 25.87  ? 688 HOH B O   1 
HETATM 5518 O O   . HOH F 3 .   ? 61.466 -42.198 2.341  1.00 27.00  ? 689 HOH B O   1 
HETATM 5519 O O   . HOH F 3 .   ? 67.584 -50.090 0.185  1.00 27.75  ? 690 HOH B O   1 
HETATM 5520 O O   . HOH F 3 .   ? 73.521 -44.992 -0.372 1.00 40.73  ? 691 HOH B O   1 
HETATM 5521 O O   . HOH F 3 .   ? 52.262 -24.241 -5.231 1.00 36.45  ? 692 HOH B O   1 
HETATM 5522 O O   . HOH F 3 .   ? 75.595 -26.228 2.752  1.00 17.81  ? 693 HOH B O   1 
HETATM 5523 O O   . HOH F 3 .   ? 77.596 -47.689 40.531 1.00 29.63  ? 694 HOH B O   1 
HETATM 5524 O O   . HOH F 3 .   ? 43.120 -38.185 28.013 1.00 51.07  ? 695 HOH B O   1 
HETATM 5525 O O   . HOH F 3 .   ? 83.483 -54.454 19.110 1.00 41.79  ? 696 HOH B O   1 
HETATM 5526 O O   . HOH F 3 .   ? 43.929 -43.578 18.196 1.00 38.83  ? 697 HOH B O   1 
HETATM 5527 O O   . HOH F 3 .   ? 67.478 -56.753 14.327 1.00 46.30  ? 698 HOH B O   1 
HETATM 5528 O O   . HOH F 3 .   ? 68.895 -34.506 19.861 1.00 15.02  ? 699 HOH B O   1 
HETATM 5529 O O   . HOH F 3 .   ? 66.868 -25.822 3.376  1.00 29.28  ? 700 HOH B O   1 
HETATM 5530 O O   . HOH F 3 .   ? 87.394 -43.289 24.701 1.00 33.08  ? 701 HOH B O   1 
HETATM 5531 O O   . HOH F 3 .   ? 86.399 -36.570 14.340 1.00 35.85  ? 702 HOH B O   1 
HETATM 5532 O O   . HOH F 3 .   ? 82.187 -34.972 11.025 1.00 54.59  ? 703 HOH B O   1 
HETATM 5533 O O   . HOH F 3 .   ? 86.923 -35.062 26.588 1.00 39.72  ? 704 HOH B O   1 
HETATM 5534 O O   . HOH F 3 .   ? 80.331 -48.162 37.374 1.00 34.06  ? 705 HOH B O   1 
HETATM 5535 O O   . HOH F 3 .   ? 71.324 -43.330 34.621 1.00 38.30  ? 706 HOH B O   1 
HETATM 5536 O O   . HOH F 3 .   ? 63.553 -26.838 26.875 1.00 25.21  ? 707 HOH B O   1 
HETATM 5537 O O   . HOH F 3 .   ? 42.014 -26.451 13.690 1.00 64.34  ? 708 HOH B O   1 
HETATM 5538 O O   . HOH F 3 .   ? 60.527 -47.215 26.626 1.00 50.14  ? 709 HOH B O   1 
HETATM 5539 O O   . HOH F 3 .   ? 58.174 -26.546 -7.829 1.00 33.86  ? 710 HOH B O   1 
HETATM 5540 O O   . HOH F 3 .   ? 51.081 -20.793 14.408 1.00 40.31  ? 711 HOH B O   1 
HETATM 5541 O O   . HOH F 3 .   ? 45.331 -33.837 11.738 1.00 43.87  ? 712 HOH B O   1 
HETATM 5542 O O   . HOH F 3 .   ? 69.606 -49.180 30.235 1.00 48.67  ? 713 HOH B O   1 
HETATM 5543 O O   . HOH F 3 .   ? 65.817 -22.841 17.931 1.00 46.33  ? 714 HOH B O   1 
HETATM 5544 O O   . HOH F 3 .   ? 60.193 -29.006 43.343 1.00 66.41  ? 715 HOH B O   1 
HETATM 5545 O O   . HOH F 3 .   ? 66.562 -31.669 36.107 1.00 38.17  ? 716 HOH B O   1 
HETATM 5546 O O   . HOH F 3 .   ? 66.126 -41.917 22.140 1.00 64.21  ? 717 HOH B O   1 
HETATM 5547 O O   . HOH F 3 .   ? 50.212 -32.649 5.745  1.00 51.88  ? 718 HOH B O   1 
HETATM 5548 O O   . HOH F 3 .   ? 65.329 -25.272 15.334 1.00 34.34  ? 719 HOH B O   1 
HETATM 5549 O O   . HOH F 3 .   ? 61.827 -42.177 5.144  1.00 24.00  ? 720 HOH B O   1 
HETATM 5550 O O   . HOH F 3 .   ? 82.211 -52.434 19.793 1.00 32.42  ? 721 HOH B O   1 
HETATM 5551 O O   . HOH F 3 .   ? 57.741 -38.808 3.166  1.00 34.62  ? 722 HOH B O   1 
HETATM 5552 O O   . HOH F 3 .   ? 67.697 -39.073 38.888 1.00 52.84  ? 723 HOH B O   1 
HETATM 5553 O O   . HOH F 3 .   ? 47.754 -30.867 2.424  1.00 57.55  ? 724 HOH B O   1 
HETATM 5554 O O   . HOH F 3 .   ? 49.390 -39.657 8.003  1.00 49.10  ? 725 HOH B O   1 
HETATM 5555 O O   . HOH F 3 .   ? 64.551 -24.368 29.002 1.00 41.38  ? 726 HOH B O   1 
HETATM 5556 O O   . HOH F 3 .   ? 62.851 -41.506 0.402  1.00 36.71  ? 727 HOH B O   1 
HETATM 5557 O O   . HOH F 3 .   ? 45.688 -24.218 17.439 1.00 61.07  ? 728 HOH B O   1 
HETATM 5558 O O   . HOH F 3 .   ? 68.243 -47.820 -1.049 1.00 58.30  ? 729 HOH B O   1 
HETATM 5559 O O   . HOH F 3 .   ? 74.002 -43.181 1.947  1.00 29.96  ? 730 HOH B O   1 
HETATM 5560 O O   . HOH F 3 .   ? 83.095 -50.122 11.426 1.00 50.69  ? 731 HOH B O   1 
HETATM 5561 O O   . HOH F 3 .   ? 90.237 -34.829 20.820 1.00 47.45  ? 732 HOH B O   1 
HETATM 5562 O O   . HOH F 3 .   ? 80.736 -61.028 15.550 1.00 47.31  ? 733 HOH B O   1 
HETATM 5563 O O   . HOH F 3 .   ? 63.563 -26.862 23.851 1.00 35.75  ? 734 HOH B O   1 
HETATM 5564 O O   . HOH F 3 .   ? 61.027 -24.796 31.193 1.00 56.42  ? 735 HOH B O   1 
HETATM 5565 O O   . HOH F 3 .   ? 55.431 -19.237 -6.213 1.00 65.67  ? 736 HOH B O   1 
HETATM 5566 O O   . HOH F 3 .   ? 42.301 -44.560 16.175 1.00 57.28  ? 737 HOH B O   1 
HETATM 5567 O O   . HOH F 3 .   ? 40.990 -29.835 20.400 1.00 54.33  ? 738 HOH B O   1 
HETATM 5568 O O   . HOH F 3 .   ? 89.424 -30.470 13.233 1.00 55.65  ? 739 HOH B O   1 
HETATM 5569 O O   . HOH F 3 .   ? 87.992 -31.335 20.303 1.00 39.05  ? 740 HOH B O   1 
HETATM 5570 O O   . HOH F 3 .   ? 58.116 -30.632 28.066 1.00 40.66  ? 741 HOH B O   1 
HETATM 5571 O O   . HOH F 3 .   ? 62.463 -39.794 -1.919 1.00 34.87  ? 742 HOH B O   1 
HETATM 5572 O O   . HOH F 3 .   ? 73.058 -40.827 34.619 1.00 19.48  ? 743 HOH B O   1 
HETATM 5573 O O   . HOH F 3 .   ? 78.837 -61.236 16.899 1.00 47.52  ? 744 HOH B O   1 
HETATM 5574 O O   . HOH F 3 .   ? 68.933 -35.520 0.631  1.00 50.57  ? 745 HOH B O   1 
HETATM 5575 O O   . HOH F 3 .   ? 85.686 -42.104 26.589 1.00 32.42  ? 746 HOH B O   1 
HETATM 5576 O O   . HOH F 3 .   ? 56.736 -48.056 1.274  1.00 46.69  ? 747 HOH B O   1 
HETATM 5577 O O   . HOH F 3 .   ? 68.819 -27.505 6.162  1.00 42.77  ? 748 HOH B O   1 
HETATM 5578 O O   . HOH F 3 .   ? 61.789 -26.449 14.850 1.00 23.19  ? 749 HOH B O   1 
HETATM 5579 O O   . HOH F 3 .   ? 61.115 -45.261 36.432 1.00 52.94  ? 750 HOH B O   1 
HETATM 5580 O O   . HOH F 3 .   ? 84.731 -32.059 29.182 1.00 34.95  ? 751 HOH B O   1 
HETATM 5581 O O   . HOH F 3 .   ? 78.843 -29.412 11.242 1.00 31.81  ? 752 HOH B O   1 
HETATM 5582 O O   . HOH F 3 .   ? 50.963 -25.726 23.368 1.00 52.37  ? 753 HOH B O   1 
HETATM 5583 O O   . HOH F 3 .   ? 84.813 -50.318 27.189 1.00 45.89  ? 754 HOH B O   1 
HETATM 5584 O O   . HOH F 3 .   ? 64.576 -27.320 13.959 1.00 23.77  ? 755 HOH B O   1 
HETATM 5585 O O   . HOH F 3 .   ? 70.475 -25.786 1.924  1.00 34.57  ? 756 HOH B O   1 
HETATM 5586 O O   . HOH F 3 .   ? 72.772 -62.791 22.976 1.00 65.55  ? 757 HOH B O   1 
HETATM 5587 O O   . HOH F 3 .   ? 82.204 -38.706 9.042  1.00 25.73  ? 758 HOH B O   1 
HETATM 5588 O O   . HOH F 3 .   ? 57.672 -61.600 7.179  1.00 61.13  ? 759 HOH B O   1 
HETATM 5589 O O   . HOH F 3 .   ? 59.866 -35.846 -4.045 1.00 40.11  ? 760 HOH B O   1 
HETATM 5590 O O   . HOH F 3 .   ? 61.828 -46.514 -0.842 1.00 51.96  ? 761 HOH B O   1 
HETATM 5591 O O   . HOH F 3 .   ? 50.851 -25.676 -3.513 1.00 32.97  ? 762 HOH B O   1 
HETATM 5592 O O   . HOH F 3 .   ? 58.708 -27.324 29.379 1.00 52.35  ? 763 HOH B O   1 
HETATM 5593 O O   . HOH F 3 .   ? 66.597 -29.971 37.437 1.00 46.34  ? 764 HOH B O   1 
HETATM 5594 O O   . HOH F 3 .   ? 84.276 -29.263 28.032 1.00 43.20  ? 765 HOH B O   1 
HETATM 5595 O O   . HOH F 3 .   ? 54.818 -26.597 21.579 1.00 35.08  ? 766 HOH B O   1 
HETATM 5596 O O   . HOH F 3 .   ? 44.551 -32.982 41.129 1.00 59.75  ? 767 HOH B O   1 
HETATM 5597 O O   . HOH F 3 .   ? 88.204 -45.412 25.771 1.00 58.38  ? 768 HOH B O   1 
HETATM 5598 O O   . HOH F 3 .   ? 81.077 -56.870 29.145 1.00 60.64  ? 769 HOH B O   1 
HETATM 5599 O O   . HOH F 3 .   ? 54.460 -21.121 -7.155 1.00 49.61  ? 770 HOH B O   1 
HETATM 5600 O O   . HOH F 3 .   ? 77.285 -65.070 17.798 1.00 52.70  ? 771 HOH B O   1 
HETATM 5601 O O   . HOH F 3 .   ? 53.701 -31.522 -6.463 1.00 42.66  ? 772 HOH B O   1 
HETATM 5602 O O   . HOH F 3 .   ? 73.178 -25.420 1.361  1.00 24.91  ? 773 HOH B O   1 
HETATM 5603 O O   . HOH F 3 .   ? 43.971 -31.739 34.326 1.00 52.50  ? 774 HOH B O   1 
HETATM 5604 O O   . HOH F 3 .   ? 71.896 -26.077 20.138 1.00 30.53  ? 775 HOH B O   1 
HETATM 5605 O O   . HOH F 3 .   ? 86.817 -40.749 28.139 1.00 41.03  ? 776 HOH B O   1 
HETATM 5606 O O   . HOH F 3 .   ? 42.197 -19.770 -0.064 1.00 46.22  ? 777 HOH B O   1 
HETATM 5607 O O   . HOH F 3 .   ? 62.665 -23.168 29.481 1.00 43.97  ? 778 HOH B O   1 
HETATM 5608 O O   . HOH F 3 .   ? 85.736 -39.026 2.651  1.00 49.90  ? 779 HOH B O   1 
HETATM 5609 O O   . HOH F 3 .   ? 66.056 -27.541 20.644 1.00 34.35  ? 780 HOH B O   1 
HETATM 5610 O O   . HOH F 3 .   ? 66.587 -44.229 -1.974 1.00 54.43  ? 781 HOH B O   1 
HETATM 5611 O O   . HOH F 3 .   ? 82.840 -44.526 8.707  1.00 36.56  ? 782 HOH B O   1 
HETATM 5612 O O   . HOH F 3 .   ? 42.069 -21.818 11.540 1.00 66.79  ? 783 HOH B O   1 
HETATM 5613 O O   . HOH F 3 .   ? 80.452 -49.468 26.324 1.00 43.61  ? 784 HOH B O   1 
HETATM 5614 O O   . HOH F 3 .   ? 49.769 -20.351 11.497 1.00 44.83  ? 785 HOH B O   1 
HETATM 5615 O O   . HOH F 3 .   ? 77.209 -51.002 36.510 1.00 48.71  ? 786 HOH B O   1 
HETATM 5616 O O   . HOH F 3 .   ? 58.892 -25.407 32.046 1.00 47.85  ? 787 HOH B O   1 
HETATM 5617 O O   . HOH F 3 .   ? 89.558 -40.814 27.793 1.00 59.68  ? 788 HOH B O   1 
HETATM 5618 O O   . HOH F 3 .   ? 42.010 -36.817 37.904 1.00 45.02  ? 789 HOH B O   1 
HETATM 5619 O O   . HOH F 3 .   ? 50.963 -28.173 -4.465 1.00 36.69  ? 790 HOH B O   1 
HETATM 5620 O O   . HOH F 3 .   ? 59.321 -40.222 7.557  1.00 23.91  ? 791 HOH B O   1 
HETATM 5621 O O   . HOH F 3 .   ? 84.547 -39.530 12.708 1.00 34.45  ? 792 HOH B O   1 
HETATM 5622 O O   . HOH F 3 .   ? 67.308 -35.135 37.325 1.00 39.02  ? 793 HOH B O   1 
HETATM 5623 O O   . HOH F 3 .   ? 59.493 -32.115 -5.683 1.00 37.35  ? 794 HOH B O   1 
HETATM 5624 O O   . HOH F 3 .   ? 67.923 -32.692 37.441 1.00 41.38  ? 795 HOH B O   1 
HETATM 5625 O O   . HOH F 3 .   ? 88.085 -34.587 22.365 1.00 54.17  ? 796 HOH B O   1 
HETATM 5626 O O   . HOH F 3 .   ? 86.024 -47.337 26.822 1.00 50.04  ? 797 HOH B O   1 
HETATM 5627 O O   . HOH F 3 .   ? 62.772 -48.002 28.476 1.00 65.14  ? 798 HOH B O   1 
HETATM 5628 O O   . HOH F 3 .   ? 88.295 -34.206 24.885 1.00 50.26  ? 799 HOH B O   1 
HETATM 5629 O O   . HOH F 3 .   ? 84.994 -44.562 27.934 1.00 36.57  ? 800 HOH B O   1 
HETATM 5630 O O   . HOH F 3 .   ? 40.794 -20.680 10.185 1.00 65.67  ? 801 HOH B O   1 
HETATM 5631 O O   . HOH F 3 .   ? 52.892 -27.701 25.059 1.00 37.27  ? 802 HOH B O   1 
HETATM 5632 O O   . HOH F 3 .   ? 73.269 -65.654 10.850 1.00 62.55  ? 803 HOH B O   1 
HETATM 5633 O O   . HOH F 3 .   ? 86.860 -32.530 27.917 1.00 38.56  ? 804 HOH B O   1 
HETATM 5634 O O   . HOH F 3 .   ? 62.159 -24.599 -9.722 1.00 67.41  ? 805 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 20  ? 0.5483 0.4944 0.5249 0.0223  0.0451  0.0166  1   MET A N   
2    C CA  . MET A 20  ? 0.5409 0.5085 0.5360 0.0159  0.0658  0.0240  1   MET A CA  
3    C C   . MET A 20  ? 0.5257 0.5136 0.5447 0.0039  0.0958  0.0165  1   MET A C   
4    O O   . MET A 20  ? 0.5237 0.5022 0.5375 0.0118  0.1172  0.0141  1   MET A O   
5    C CB  . MET A 20  ? 0.5590 0.5048 0.5333 0.0320  0.0552  0.0302  1   MET A CB  
6    C CG  . MET A 20  ? 0.5844 0.5113 0.5284 0.0414  0.0401  0.0311  1   MET A CG  
7    S SD  . MET A 20  ? 0.5863 0.5061 0.4886 0.0676  0.0159  0.0083  1   MET A SD  
8    C CE  . MET A 20  ? 0.5952 0.5012 0.4799 0.0619  0.0147  0.0087  1   MET A CE  
9    N N   . SER A 21  ? 0.4966 0.5133 0.5647 -0.0071 0.1272  0.0160  2   SER A N   
10   C CA  . SER A 21  ? 0.4907 0.5045 0.5810 -0.0211 0.1419  0.0267  2   SER A CA  
11   C C   . SER A 21  ? 0.4972 0.5096 0.6000 0.0067  0.1421  0.0597  2   SER A C   
12   O O   . SER A 21  ? 0.5014 0.4742 0.5857 0.0625  0.1623  0.0693  2   SER A O   
13   C CB  . SER A 21  ? 0.4870 0.4858 0.5675 -0.0577 0.1391  0.0157  2   SER A CB  
14   O OG  . SER A 21  ? 0.4913 0.4919 0.5613 -0.0517 0.1346  0.0029  2   SER A OG  
15   N N   . ASP A 22  ? 0.5205 0.5456 0.6243 -0.0032 0.1116  0.0671  3   ASP A N   
16   C CA  . ASP A 22  ? 0.5407 0.5874 0.6372 -0.0141 0.0797  0.0674  3   ASP A CA  
17   C C   . ASP A 22  ? 0.5424 0.5901 0.6429 0.0255  0.0682  0.0564  3   ASP A C   
18   O O   . ASP A 22  ? 0.5325 0.5967 0.6447 0.0395  0.0660  0.0554  3   ASP A O   
19   C CB  . ASP A 22  ? 0.5927 0.6284 0.6568 -0.0400 0.0543  0.0609  3   ASP A CB  
20   C CG  . ASP A 22  ? 0.6501 0.6638 0.6778 -0.0454 0.0457  0.0646  3   ASP A CG  
21   O OD1 . ASP A 22  ? 0.6676 0.6923 0.6850 -0.0506 0.0352  0.0612  3   ASP A OD1 
22   O OD2 . ASP A 22  ? 0.6760 0.6779 0.6910 -0.0448 0.0519  0.0609  3   ASP A OD2 
23   N N   . ASP A 23  ? 0.5696 0.5793 0.6404 0.0519  0.0467  0.0425  4   ASP A N   
24   C CA  . ASP A 23  ? 0.6012 0.5663 0.6522 0.0593  0.0316  0.0297  4   ASP A CA  
25   C C   . ASP A 23  ? 0.5680 0.5403 0.6366 0.0386  0.0048  0.0179  4   ASP A C   
26   O O   . ASP A 23  ? 0.5719 0.5411 0.6364 0.0201  -0.0029 0.0234  4   ASP A O   
27   C CB  . ASP A 23  ? 0.6585 0.5790 0.6748 0.0784  0.0448  0.0259  4   ASP A CB  
28   C CG  . ASP A 23  ? 0.7035 0.5938 0.6981 0.0949  0.0497  0.0274  4   ASP A CG  
29   O OD1 . ASP A 23  ? 0.7105 0.5946 0.6971 0.0968  0.0495  0.0371  4   ASP A OD1 
30   O OD2 . ASP A 23  ? 0.7384 0.6198 0.7194 0.0828  0.0554  0.0224  4   ASP A OD2 
31   N N   . THR A 24  ? 0.5276 0.5051 0.6094 0.0385  -0.0008 -0.0084 5   THR A N   
32   C CA  . THR A 24  ? 0.4911 0.4894 0.5817 0.0284  -0.0040 -0.0193 5   THR A CA  
33   C C   . THR A 24  ? 0.4419 0.4365 0.5410 0.0387  -0.0051 0.0023  5   THR A C   
34   O O   . THR A 24  ? 0.3997 0.4132 0.5220 0.0356  -0.0079 0.0194  5   THR A O   
35   C CB  . THR A 24  ? 0.5342 0.5177 0.5959 -0.0232 -0.0158 -0.0447 5   THR A CB  
36   O OG1 . THR A 24  ? 0.5515 0.5515 0.6167 -0.0110 -0.0175 -0.0650 5   THR A OG1 
37   C CG2 . THR A 24  ? 0.5451 0.5181 0.5948 -0.0465 -0.0169 -0.0500 5   THR A CG2 
38   N N   . SER A 25  ? 0.4129 0.3975 0.5093 0.0427  0.0070  0.0219  6   SER A N   
39   C CA  . SER A 25  ? 0.3940 0.3929 0.4944 0.0296  0.0243  0.0395  6   SER A CA  
40   C C   . SER A 25  ? 0.3176 0.3345 0.4294 0.0123  0.0422  0.0418  6   SER A C   
41   O O   . SER A 25  ? 0.3579 0.3081 0.4667 0.0252  0.0948  0.0455  6   SER A O   
42   C CB  . SER A 25  ? 0.4827 0.4265 0.5388 0.0133  0.0357  0.0429  6   SER A CB  
43   O OG  . SER A 25  ? 0.5487 0.4710 0.5650 0.0183  0.0475  0.0201  6   SER A OG  
44   N N   . LEU A 26  ? 0.2398 0.3143 0.3496 0.0073  0.0042  -0.0117 7   LEU A N   
45   C CA  . LEU A 26  ? 0.1988 0.3058 0.3465 0.0178  0.0013  -0.0616 7   LEU A CA  
46   C C   . LEU A 26  ? 0.2325 0.2929 0.3591 0.0280  -0.0303 -0.0309 7   LEU A C   
47   O O   . LEU A 26  ? 0.2662 0.2843 0.3979 -0.0223 -0.0395 0.0082  7   LEU A O   
48   C CB  . LEU A 26  ? 0.2034 0.3292 0.3255 0.0430  0.0440  -0.1085 7   LEU A CB  
49   C CG  . LEU A 26  ? 0.2283 0.3330 0.3126 0.0574  0.0584  -0.1145 7   LEU A CG  
50   C CD1 . LEU A 26  ? 0.2075 0.3476 0.3144 0.0368  0.0845  -0.1279 7   LEU A CD1 
51   C CD2 . LEU A 26  ? 0.2024 0.3099 0.2868 0.0672  0.0717  -0.1027 7   LEU A CD2 
52   N N   . GLU A 27  ? 0.2269 0.2648 0.3354 0.0799  -0.0345 -0.0259 8   GLU A N   
53   C CA  . GLU A 27  ? 0.2243 0.2974 0.3343 0.0739  -0.0597 -0.0456 8   GLU A CA  
54   C C   . GLU A 27  ? 0.1478 0.2777 0.2904 0.0256  -0.0366 -0.0601 8   GLU A C   
55   O O   . GLU A 27  ? 0.1399 0.2882 0.2917 -0.0246 -0.0263 -0.0325 8   GLU A O   
56   C CB  . GLU A 27  ? 0.2585 0.3486 0.3660 0.1057  -0.0763 -0.0649 8   GLU A CB  
57   C CG  . GLU A 27  ? 0.3768 0.4016 0.4240 0.0763  -0.0575 -0.1057 8   GLU A CG  
58   C CD  . GLU A 27  ? 0.4529 0.4547 0.4738 0.0635  -0.0709 -0.1191 8   GLU A CD  
59   O OE1 . GLU A 27  ? 0.4987 0.4516 0.4823 0.0662  -0.1020 -0.1153 8   GLU A OE1 
60   O OE2 . GLU A 27  ? 0.5046 0.4960 0.5071 0.0772  -0.0282 -0.1270 8   GLU A OE2 
61   N N   . LEU A 28  ? 0.1331 0.3017 0.2564 0.0492  -0.0575 -0.0480 9   LEU A N   
62   C CA  . LEU A 28  ? 0.1905 0.2747 0.2170 0.0369  -0.0173 -0.0477 9   LEU A CA  
63   C C   . LEU A 28  ? 0.2124 0.2481 0.2165 0.0311  0.0189  -0.0733 9   LEU A C   
64   O O   . LEU A 28  ? 0.2662 0.2405 0.2345 0.0056  0.0122  -0.0407 9   LEU A O   
65   C CB  . LEU A 28  ? 0.1531 0.2743 0.2122 -0.0034 -0.0162 -0.0406 9   LEU A CB  
66   C CG  . LEU A 28  ? 0.1908 0.2616 0.2228 -0.0054 -0.0391 -0.0416 9   LEU A CG  
67   C CD1 . LEU A 28  ? 0.2027 0.2665 0.2573 0.0085  -0.0438 -0.0121 9   LEU A CD1 
68   C CD2 . LEU A 28  ? 0.2202 0.2765 0.2302 -0.0361 -0.0545 -0.0643 9   LEU A CD2 
69   N N   . PRO A 29  ? 0.2423 0.2273 0.1974 0.0086  -0.0103 -0.0537 10  PRO A N   
70   C CA  . PRO A 29  ? 0.2289 0.2432 0.1963 -0.0172 -0.0492 -0.0387 10  PRO A CA  
71   C C   . PRO A 29  ? 0.2114 0.2378 0.1877 -0.0419 -0.0566 -0.0447 10  PRO A C   
72   O O   . PRO A 29  ? 0.2462 0.3175 0.2084 -0.0554 -0.0717 -0.0297 10  PRO A O   
73   C CB  . PRO A 29  ? 0.2533 0.2280 0.2157 -0.0183 -0.0092 -0.0427 10  PRO A CB  
74   C CG  . PRO A 29  ? 0.2676 0.2204 0.2183 0.0001  -0.0249 -0.0553 10  PRO A CG  
75   C CD  . PRO A 29  ? 0.2502 0.2102 0.2151 0.0241  -0.0003 -0.0343 10  PRO A CD  
76   N N   . PHE A 30  ? 0.1640 0.1802 0.1874 -0.0166 -0.0250 -0.0436 11  PHE A N   
77   C CA  . PHE A 30  ? 0.2158 0.1807 0.1580 0.0015  -0.0029 -0.0556 11  PHE A CA  
78   C C   . PHE A 30  ? 0.2058 0.1844 0.1632 -0.0132 -0.0044 -0.0338 11  PHE A C   
79   O O   . PHE A 30  ? 0.2155 0.2208 0.1837 -0.0265 -0.0107 -0.0341 11  PHE A O   
80   C CB  . PHE A 30  ? 0.2308 0.1936 0.1617 0.0289  0.0388  -0.0937 11  PHE A CB  
81   C CG  . PHE A 30  ? 0.2390 0.1928 0.1677 0.0429  0.0076  -0.0810 11  PHE A CG  
82   C CD1 . PHE A 30  ? 0.2815 0.1985 0.1924 0.0551  -0.0147 -0.0558 11  PHE A CD1 
83   C CD2 . PHE A 30  ? 0.2556 0.1881 0.1879 0.0007  0.0240  -0.0775 11  PHE A CD2 
84   C CE1 . PHE A 30  ? 0.2906 0.1847 0.2084 0.0676  -0.0308 -0.0514 11  PHE A CE1 
85   C CE2 . PHE A 30  ? 0.2731 0.2194 0.1961 0.0305  -0.0163 -0.0689 11  PHE A CE2 
86   C CZ  . PHE A 30  ? 0.2477 0.2097 0.1864 0.0653  -0.0365 -0.0607 11  PHE A CZ  
87   N N   . THR A 31  ? 0.2176 0.1853 0.1437 -0.0231 0.0208  -0.0434 12  THR A N   
88   C CA  A THR A 31  ? 0.2319 0.1858 0.1681 -0.0342 0.0070  -0.0207 12  THR A CA  
89   C CA  B THR A 31  ? 0.2586 0.2144 0.1830 -0.0223 0.0325  -0.0371 12  THR A CA  
90   C C   . THR A 31  ? 0.2597 0.2071 0.1654 -0.0456 0.0054  -0.0473 12  THR A C   
91   O O   . THR A 31  ? 0.2715 0.2486 0.1871 -0.0395 0.0361  -0.0436 12  THR A O   
92   C CB  A THR A 31  ? 0.2536 0.1621 0.2045 -0.0592 -0.0273 0.0266  12  THR A CB  
93   C CB  B THR A 31  ? 0.3203 0.2413 0.2359 -0.0239 0.0521  -0.0227 12  THR A CB  
94   O OG1 A THR A 31  ? 0.2625 0.2290 0.2202 -0.0549 -0.0164 0.0270  12  THR A OG1 
95   O OG1 B THR A 31  ? 0.3372 0.2568 0.2429 0.0033  0.0978  -0.0262 12  THR A OG1 
96   C CG2 A THR A 31  ? 0.2000 0.1385 0.1923 -0.0892 -0.0524 0.0329  12  THR A CG2 
97   C CG2 B THR A 31  ? 0.3385 0.2633 0.2554 -0.0525 0.0287  -0.0153 12  THR A CG2 
98   N N   . HIS A 32  ? 0.2584 0.1927 0.1324 -0.0526 0.0514  -0.0264 13  HIS A N   
99   C CA  . HIS A 32  ? 0.2778 0.2007 0.1523 -0.0309 0.0198  -0.0111 13  HIS A CA  
100  C C   . HIS A 32  ? 0.3110 0.2090 0.1677 -0.0485 0.0042  -0.0375 13  HIS A C   
101  O O   . HIS A 32  ? 0.3385 0.2449 0.1552 -0.0258 -0.0127 -0.0510 13  HIS A O   
102  C CB  . HIS A 32  ? 0.3164 0.1927 0.1887 -0.0018 0.0322  0.0128  13  HIS A CB  
103  C CG  . HIS A 32  ? 0.3810 0.2262 0.2471 0.0051  0.0051  0.0180  13  HIS A CG  
104  N ND1 . HIS A 32  ? 0.4129 0.2264 0.2670 0.0105  -0.0287 0.0069  13  HIS A ND1 
105  C CD2 . HIS A 32  ? 0.3947 0.2079 0.2563 -0.0073 -0.0144 0.0169  13  HIS A CD2 
106  C CE1 . HIS A 32  ? 0.4260 0.2269 0.2666 -0.0146 -0.0358 0.0309  13  HIS A CE1 
107  N NE2 . HIS A 32  ? 0.4299 0.2379 0.2589 0.0030  -0.0347 0.0239  13  HIS A NE2 
108  N N   . ARG A 33  ? 0.2935 0.2144 0.1959 -0.0886 0.0380  -0.0078 14  ARG A N   
109  C CA  . ARG A 33  ? 0.2723 0.2179 0.1741 -0.0904 0.0009  -0.0080 14  ARG A CA  
110  C C   . ARG A 33  ? 0.2873 0.2140 0.1639 -0.1089 -0.0228 -0.0032 14  ARG A C   
111  O O   . ARG A 33  ? 0.2769 0.2089 0.1919 -0.0742 -0.0408 -0.0161 14  ARG A O   
112  C CB  . ARG A 33  ? 0.2757 0.2219 0.1677 -0.0699 -0.0040 0.0197  14  ARG A CB  
113  C CG  . ARG A 33  ? 0.2876 0.2389 0.1868 -0.0530 -0.0231 0.0095  14  ARG A CG  
114  C CD  . ARG A 33  ? 0.2910 0.2511 0.2117 -0.0449 -0.0329 0.0170  14  ARG A CD  
115  N NE  . ARG A 33  ? 0.2971 0.2691 0.2446 -0.0261 0.0039  0.0353  14  ARG A NE  
116  C CZ  . ARG A 33  ? 0.3307 0.2912 0.2564 0.0049  0.0288  0.0204  14  ARG A CZ  
117  N NH1 . ARG A 33  ? 0.3440 0.3323 0.3029 0.0331  0.0084  0.0072  14  ARG A NH1 
118  N NH2 . ARG A 33  ? 0.3752 0.2662 0.2387 0.0052  0.0394  0.0253  14  ARG A NH2 
119  N N   . ARG A 34  ? 0.3298 0.2190 0.1995 -0.1016 0.0091  -0.0020 15  ARG A N   
120  C CA  . ARG A 34  ? 0.3299 0.2303 0.2057 -0.0629 0.0163  0.0035  15  ARG A CA  
121  C C   . ARG A 34  ? 0.3230 0.2508 0.1898 -0.0686 -0.0050 -0.0009 15  ARG A C   
122  O O   . ARG A 34  ? 0.2968 0.3071 0.1790 -0.0574 -0.0223 0.0064  15  ARG A O   
123  C CB  . ARG A 34  ? 0.3847 0.2477 0.2533 -0.0622 0.0314  0.0172  15  ARG A CB  
124  C CG  . ARG A 34  ? 0.3993 0.2478 0.3001 -0.0435 0.0595  0.0237  15  ARG A CG  
125  C CD  . ARG A 34  ? 0.3984 0.2488 0.3359 -0.0433 0.0692  -0.0038 15  ARG A CD  
126  N NE  . ARG A 34  ? 0.4349 0.2228 0.3710 -0.0332 0.0914  -0.0198 15  ARG A NE  
127  C CZ  . ARG A 34  ? 0.4367 0.2271 0.3912 -0.0589 0.0887  -0.0228 15  ARG A CZ  
128  N NH1 . ARG A 34  ? 0.4841 0.2312 0.4005 -0.0602 0.0682  -0.0347 15  ARG A NH1 
129  N NH2 . ARG A 34  ? 0.4503 0.2401 0.4035 -0.0432 0.0944  -0.0257 15  ARG A NH2 
130  N N   . ASN A 35  ? 0.2992 0.2420 0.1730 -0.0800 -0.0096 0.0144  16  ASN A N   
131  C CA  . ASN A 35  ? 0.2852 0.2389 0.1895 -0.1001 -0.0453 -0.0110 16  ASN A CA  
132  C C   . ASN A 35  ? 0.2851 0.2384 0.2045 -0.1125 -0.0898 -0.0079 16  ASN A C   
133  O O   . ASN A 35  ? 0.3341 0.2409 0.2317 -0.0995 -0.0467 0.0023  16  ASN A O   
134  C CB  . ASN A 35  ? 0.2574 0.2448 0.1899 -0.1055 -0.0263 -0.0006 16  ASN A CB  
135  C CG  . ASN A 35  ? 0.2611 0.2238 0.2081 -0.1245 -0.0270 0.0112  16  ASN A CG  
136  O OD1 . ASN A 35  ? 0.2755 0.2106 0.2456 -0.1277 -0.0278 -0.0389 16  ASN A OD1 
137  N ND2 . ASN A 35  ? 0.2558 0.2523 0.1719 -0.1275 -0.0587 -0.0057 16  ASN A ND2 
138  N N   . PRO A 36  ? 0.2895 0.2560 0.2398 -0.1227 -0.0640 -0.0035 17  PRO A N   
139  C CA  . PRO A 36  ? 0.3151 0.2603 0.2360 -0.1177 -0.0512 -0.0050 17  PRO A CA  
140  C C   . PRO A 36  ? 0.3266 0.2413 0.2369 -0.1163 -0.0448 0.0092  17  PRO A C   
141  O O   . PRO A 36  ? 0.3816 0.2497 0.2497 -0.1283 -0.0212 -0.0166 17  PRO A O   
142  C CB  . PRO A 36  ? 0.3221 0.2805 0.2537 -0.1219 -0.0960 -0.0165 17  PRO A CB  
143  C CG  . PRO A 36  ? 0.3248 0.3111 0.2895 -0.1197 -0.0894 0.0041  17  PRO A CG  
144  C CD  . PRO A 36  ? 0.2867 0.2975 0.2836 -0.1284 -0.0892 0.0041  17  PRO A CD  
145  N N   . HIS A 37  ? 0.2992 0.2298 0.2465 -0.1142 -0.0456 0.0051  18  HIS A N   
146  C CA  . HIS A 37  ? 0.2882 0.2161 0.2521 -0.0645 -0.0160 0.0095  18  HIS A CA  
147  C C   . HIS A 37  ? 0.2979 0.2105 0.2570 -0.0851 -0.0004 -0.0157 18  HIS A C   
148  O O   . HIS A 37  ? 0.3238 0.1984 0.2302 -0.0671 0.0004  -0.0334 18  HIS A O   
149  C CB  . HIS A 37  ? 0.3054 0.2298 0.2770 -0.0819 -0.0276 0.0081  18  HIS A CB  
150  C CG  . HIS A 37  ? 0.2851 0.2671 0.2959 -0.0988 -0.0517 0.0290  18  HIS A CG  
151  N ND1 . HIS A 37  ? 0.3173 0.2981 0.3249 -0.0746 -0.0668 0.0197  18  HIS A ND1 
152  C CD2 . HIS A 37  ? 0.3066 0.2924 0.3039 -0.0707 -0.0456 0.0467  18  HIS A CD2 
153  C CE1 . HIS A 37  ? 0.2853 0.3145 0.3342 -0.0622 -0.0476 0.0306  18  HIS A CE1 
154  N NE2 . HIS A 37  ? 0.2926 0.3095 0.3275 -0.0491 -0.0329 0.0436  18  HIS A NE2 
155  N N   . GLN A 38  ? 0.2755 0.1962 0.2832 -0.0729 -0.0091 -0.0166 19  GLN A N   
156  C CA  . GLN A 38  ? 0.2951 0.1850 0.2732 -0.0616 0.0300  -0.0012 19  GLN A CA  
157  C C   . GLN A 38  ? 0.3105 0.1822 0.2489 -0.0745 -0.0138 0.0096  19  GLN A C   
158  O O   . GLN A 38  ? 0.3406 0.2275 0.2545 -0.0825 -0.0391 -0.0012 19  GLN A O   
159  C CB  . GLN A 38  ? 0.3262 0.2090 0.2964 -0.0308 0.0621  -0.0346 19  GLN A CB  
160  C CG  . GLN A 38  ? 0.3398 0.2256 0.3284 -0.0282 0.0692  -0.0649 19  GLN A CG  
161  C CD  . GLN A 38  ? 0.3965 0.2625 0.3551 -0.0299 0.0778  -0.0416 19  GLN A CD  
162  O OE1 . GLN A 38  ? 0.4439 0.2865 0.3792 -0.0176 0.1003  -0.0326 19  GLN A OE1 
163  N NE2 . GLN A 38  ? 0.4167 0.2455 0.3769 -0.0426 0.0816  -0.0375 19  GLN A NE2 
164  N N   . THR A 39  ? 0.3389 0.1882 0.2546 -0.0946 0.0035  0.0059  20  THR A N   
165  C CA  . THR A 39  ? 0.3627 0.1955 0.2659 -0.1320 0.0412  -0.0075 20  THR A CA  
166  C C   . THR A 39  ? 0.3534 0.2476 0.2783 -0.0984 0.0140  -0.0030 20  THR A C   
167  O O   . THR A 39  ? 0.3754 0.2616 0.2826 -0.0809 0.0175  0.0097  20  THR A O   
168  C CB  . THR A 39  ? 0.4280 0.2149 0.3270 -0.1393 0.0915  -0.0305 20  THR A CB  
169  O OG1 . THR A 39  ? 0.5162 0.2483 0.3848 -0.1107 0.0533  -0.0618 20  THR A OG1 
170  C CG2 . THR A 39  ? 0.4302 0.2489 0.3635 -0.1713 0.0914  -0.0349 20  THR A CG2 
171  N N   . GLU A 40  ? 0.3267 0.2721 0.2870 -0.1134 0.0056  -0.0183 21  GLU A N   
172  C CA  . GLU A 40  ? 0.3129 0.2711 0.2746 -0.0985 -0.0077 0.0077  21  GLU A CA  
173  C C   . GLU A 40  ? 0.3278 0.2301 0.2586 -0.1202 0.0045  0.0211  21  GLU A C   
174  O O   . GLU A 40  ? 0.3481 0.2297 0.2527 -0.0910 0.0233  0.0461  21  GLU A O   
175  C CB  . GLU A 40  ? 0.3242 0.3064 0.3006 -0.0744 0.0116  0.0234  21  GLU A CB  
176  C CG  . GLU A 40  ? 0.3732 0.3498 0.3592 -0.0627 0.0008  0.0254  21  GLU A CG  
177  C CD  . GLU A 40  ? 0.4301 0.3892 0.4053 -0.0801 0.0271  0.0087  21  GLU A CD  
178  O OE1 . GLU A 40  ? 0.4839 0.4408 0.4271 -0.0476 0.0537  0.0269  21  GLU A OE1 
179  O OE2 . GLU A 40  ? 0.4451 0.3680 0.4271 -0.1204 0.0054  -0.0073 21  GLU A OE2 
180  N N   . ALA A 41  ? 0.3175 0.2394 0.2661 -0.1609 0.0192  0.0056  22  ALA A N   
181  C CA  . ALA A 41  ? 0.3321 0.2004 0.2544 -0.1345 -0.0035 -0.0099 22  ALA A CA  
182  C C   . ALA A 41  ? 0.3709 0.2062 0.2579 -0.0876 -0.0021 -0.0065 22  ALA A C   
183  O O   . ALA A 41  ? 0.3953 0.1815 0.2595 -0.0836 -0.0025 -0.0061 22  ALA A O   
184  C CB  . ALA A 41  ? 0.3569 0.1578 0.2087 -0.1022 -0.0126 -0.0288 22  ALA A CB  
185  N N   . ALA A 42  ? 0.3170 0.2229 0.2388 -0.0431 0.0372  -0.0197 23  ALA A N   
186  C CA  . ALA A 42  ? 0.3503 0.2412 0.2499 -0.0067 0.0659  -0.0213 23  ALA A CA  
187  C C   . ALA A 42  ? 0.3431 0.2152 0.2587 -0.0414 0.0271  0.0055  23  ALA A C   
188  O O   . ALA A 42  ? 0.3686 0.2174 0.2505 -0.0580 -0.0281 -0.0148 23  ALA A O   
189  C CB  . ALA A 42  ? 0.3731 0.2633 0.2560 0.0279  0.0647  -0.0661 23  ALA A CB  
190  N N   . ASP A 43  ? 0.3709 0.1814 0.2688 -0.0978 0.0385  0.0010  24  ASP A N   
191  C CA  . ASP A 43  ? 0.3885 0.2030 0.2826 -0.0989 0.0335  -0.0172 24  ASP A CA  
192  C C   . ASP A 43  ? 0.3567 0.1702 0.2354 -0.1267 0.0172  0.0012  24  ASP A C   
193  O O   . ASP A 43  ? 0.3926 0.1852 0.2168 -0.0894 0.0004  0.0324  24  ASP A O   
194  C CB  . ASP A 43  ? 0.3918 0.1966 0.3388 -0.1210 0.0161  -0.0428 24  ASP A CB  
195  C CG  . ASP A 43  ? 0.4106 0.2729 0.3819 -0.1335 -0.0068 -0.0799 24  ASP A CG  
196  O OD1 . ASP A 43  ? 0.4193 0.2851 0.4024 -0.0676 0.0128  -0.0805 24  ASP A OD1 
197  O OD2 . ASP A 43  ? 0.4460 0.3356 0.4072 -0.1900 0.0034  -0.1012 24  ASP A OD2 
198  N N   . ARG A 44  ? 0.3611 0.1735 0.2389 -0.1217 0.0091  -0.0113 25  ARG A N   
199  C CA  . ARG A 44  ? 0.3363 0.1694 0.2450 -0.0863 0.0009  -0.0027 25  ARG A CA  
200  C C   . ARG A 44  ? 0.3168 0.1904 0.2295 -0.0825 0.0240  -0.0028 25  ARG A C   
201  O O   . ARG A 44  ? 0.3014 0.2174 0.2109 -0.0935 0.0362  0.0061  25  ARG A O   
202  C CB  . ARG A 44  ? 0.3853 0.2283 0.2857 -0.1082 -0.0050 0.0036  25  ARG A CB  
203  C CG  . ARG A 44  ? 0.4278 0.3333 0.3645 -0.0885 0.0254  -0.0033 25  ARG A CG  
204  C CD  . ARG A 44  ? 0.5280 0.4209 0.4705 -0.0726 0.0194  -0.0056 25  ARG A CD  
205  N NE  . ARG A 44  ? 0.6052 0.4854 0.5445 -0.0639 0.0236  0.0127  25  ARG A NE  
206  C CZ  . ARG A 44  ? 0.6305 0.5307 0.5819 -0.0730 0.0308  0.0313  25  ARG A CZ  
207  N NH1 . ARG A 44  ? 0.6061 0.5619 0.5919 -0.0976 0.0324  0.0383  25  ARG A NH1 
208  N NH2 . ARG A 44  ? 0.6398 0.5162 0.5959 -0.0685 0.0402  0.0330  25  ARG A NH2 
209  N N   . HIS A 45  ? 0.2937 0.1814 0.2178 -0.0711 0.0458  -0.0237 26  HIS A N   
210  C CA  . HIS A 45  ? 0.2781 0.1883 0.1936 -0.0615 0.0365  0.0084  26  HIS A CA  
211  C C   . HIS A 45  ? 0.3353 0.1744 0.1951 -0.0307 0.0230  0.0080  26  HIS A C   
212  O O   . HIS A 45  ? 0.3627 0.1679 0.1917 -0.0151 0.0267  0.0182  26  HIS A O   
213  C CB  . HIS A 45  ? 0.2331 0.1925 0.1996 -0.0841 0.0246  -0.0025 26  HIS A CB  
214  C CG  . HIS A 45  ? 0.2498 0.1673 0.2032 -0.0842 -0.0078 0.0155  26  HIS A CG  
215  N ND1 . HIS A 45  ? 0.2584 0.1463 0.2106 -0.0484 0.0072  0.0014  26  HIS A ND1 
216  C CD2 . HIS A 45  ? 0.3010 0.1724 0.2035 -0.0481 0.0025  0.0128  26  HIS A CD2 
217  C CE1 . HIS A 45  ? 0.2784 0.1421 0.2066 -0.0013 -0.0007 -0.0096 26  HIS A CE1 
218  N NE2 . HIS A 45  ? 0.3045 0.1355 0.2125 -0.0282 0.0171  0.0074  26  HIS A NE2 
219  N N   . LEU A 46  ? 0.3642 0.1633 0.2091 -0.0419 0.0056  0.0226  27  LEU A N   
220  C CA  . LEU A 46  ? 0.3959 0.1463 0.2585 -0.0288 -0.0042 0.0222  27  LEU A CA  
221  C C   . LEU A 46  ? 0.4088 0.1645 0.2555 -0.0569 0.0101  0.0016  27  LEU A C   
222  O O   . LEU A 46  ? 0.4335 0.1718 0.2414 -0.0880 -0.0019 0.0192  27  LEU A O   
223  C CB  . LEU A 46  ? 0.4355 0.1671 0.3362 -0.0245 -0.0385 0.0503  27  LEU A CB  
224  C CG  . LEU A 46  ? 0.4922 0.2732 0.4263 -0.0076 -0.0535 0.0319  27  LEU A CG  
225  C CD1 . LEU A 46  ? 0.4865 0.2414 0.4488 -0.0001 -0.0579 0.0237  27  LEU A CD1 
226  C CD2 . LEU A 46  ? 0.5223 0.2568 0.4381 -0.0059 -0.0187 0.0718  27  LEU A CD2 
227  N N   . GLU A 47  ? 0.3755 0.1909 0.2512 -0.0525 0.0165  0.0093  28  GLU A N   
228  C CA  . GLU A 47  ? 0.3640 0.2153 0.2762 -0.0884 0.0504  0.0367  28  GLU A CA  
229  C C   . GLU A 47  ? 0.3862 0.2009 0.2710 -0.0620 0.0621  0.0363  28  GLU A C   
230  O O   . GLU A 47  ? 0.4485 0.2116 0.2827 -0.0780 0.0693  0.0238  28  GLU A O   
231  C CB  . GLU A 47  ? 0.3767 0.2622 0.3207 -0.1698 0.0232  0.0402  28  GLU A CB  
232  C CG  . GLU A 47  ? 0.3353 0.2967 0.3720 -0.1761 0.0245  0.0587  28  GLU A CG  
233  C CD  . GLU A 47  ? 0.3779 0.3144 0.4252 -0.1876 0.0409  0.0557  28  GLU A CD  
234  O OE1 . GLU A 47  ? 0.4190 0.3433 0.4354 -0.1244 0.0416  0.0473  28  GLU A OE1 
235  O OE2 . GLU A 47  ? 0.4320 0.3408 0.4696 -0.1900 0.0517  0.0666  28  GLU A OE2 
236  N N   . TRP A 48  ? 0.3532 0.1464 0.2481 -0.0847 0.0674  0.0160  29  TRP A N   
237  C CA  . TRP A 48  ? 0.3563 0.1264 0.2138 -0.0710 0.0148  0.0175  29  TRP A CA  
238  C C   . TRP A 48  ? 0.3962 0.1495 0.2180 -0.0609 0.0121  -0.0145 29  TRP A C   
239  O O   . TRP A 48  ? 0.4296 0.1676 0.2098 -0.0696 -0.0087 -0.0048 29  TRP A O   
240  C CB  . TRP A 48  ? 0.3642 0.1504 0.2086 -0.0943 0.0151  0.0370  29  TRP A CB  
241  C CG  . TRP A 48  ? 0.4102 0.1789 0.1858 -0.0846 -0.0072 0.0420  29  TRP A CG  
242  C CD1 . TRP A 48  ? 0.4492 0.1847 0.1848 -0.0762 -0.0423 0.0229  29  TRP A CD1 
243  C CD2 . TRP A 48  ? 0.3877 0.2053 0.1606 -0.0950 -0.0157 0.0284  29  TRP A CD2 
244  N NE1 . TRP A 48  ? 0.4381 0.2026 0.1871 -0.0680 -0.0348 0.0208  29  TRP A NE1 
245  C CE2 . TRP A 48  ? 0.4023 0.1996 0.1690 -0.0844 -0.0187 0.0282  29  TRP A CE2 
246  C CE3 . TRP A 48  ? 0.3935 0.2439 0.1829 -0.1085 0.0049  0.0331  29  TRP A CE3 
247  C CZ2 . TRP A 48  ? 0.3887 0.2523 0.1651 -0.0747 0.0016  0.0259  29  TRP A CZ2 
248  C CZ3 . TRP A 48  ? 0.3793 0.2732 0.1756 -0.1090 0.0292  0.0252  29  TRP A CZ3 
249  C CH2 . TRP A 48  ? 0.3937 0.2633 0.1829 -0.0918 0.0194  0.0433  29  TRP A CH2 
250  N N   . LEU A 49  ? 0.3904 0.1936 0.2167 -0.0393 0.0241  -0.0259 30  LEU A N   
251  C CA  . LEU A 49  ? 0.3826 0.2256 0.2154 -0.0226 0.0289  0.0076  30  LEU A CA  
252  C C   . LEU A 49  ? 0.4065 0.2442 0.2348 0.0221  0.0307  0.0447  30  LEU A C   
253  O O   . LEU A 49  ? 0.4217 0.2626 0.2301 0.0731  0.0354  0.0450  30  LEU A O   
254  C CB  . LEU A 49  ? 0.3515 0.2474 0.2039 -0.0174 0.0186  -0.0100 30  LEU A CB  
255  C CG  . LEU A 49  ? 0.3604 0.2717 0.2057 -0.0293 0.0206  -0.0027 30  LEU A CG  
256  C CD1 . LEU A 49  ? 0.3681 0.2747 0.1864 -0.0361 0.0585  0.0081  30  LEU A CD1 
257  C CD2 . LEU A 49  ? 0.3515 0.3006 0.2039 -0.0071 -0.0322 -0.0022 30  LEU A CD2 
258  N N   . GLN A 50  ? 0.3882 0.2361 0.2409 -0.0081 0.0431  0.0907  31  GLN A N   
259  C CA  . GLN A 50  ? 0.4328 0.3042 0.2749 -0.0261 0.0597  0.0851  31  GLN A CA  
260  C C   . GLN A 50  ? 0.4359 0.3286 0.2646 -0.0015 0.0620  0.0745  31  GLN A C   
261  O O   . GLN A 50  ? 0.4612 0.3745 0.2989 0.0303  0.0248  0.0806  31  GLN A O   
262  C CB  . GLN A 50  ? 0.4722 0.3664 0.3397 -0.0399 0.0581  0.0901  31  GLN A CB  
263  C CG  . GLN A 50  ? 0.5252 0.4141 0.4058 -0.0500 0.0363  0.0975  31  GLN A CG  
264  C CD  . GLN A 50  ? 0.5806 0.4533 0.4710 -0.0600 0.0422  0.0987  31  GLN A CD  
265  O OE1 . GLN A 50  ? 0.6171 0.4727 0.4917 -0.0490 0.0255  0.1075  31  GLN A OE1 
266  N NE2 . GLN A 50  ? 0.5911 0.4764 0.4920 -0.0930 0.0437  0.1040  31  GLN A NE2 
267  N N   . ARG A 51  ? 0.4021 0.2885 0.2684 -0.0147 0.0659  0.0223  32  ARG A N   
268  C CA  A ARG A 51  ? 0.3772 0.2852 0.2667 -0.0161 0.0589  0.0174  32  ARG A CA  
269  C CA  B ARG A 51  ? 0.3737 0.2650 0.2513 -0.0219 0.0548  0.0172  32  ARG A CA  
270  C C   . ARG A 51  ? 0.3715 0.2661 0.2544 -0.0182 0.0696  0.0279  32  ARG A C   
271  O O   . ARG A 51  ? 0.3972 0.2832 0.2480 -0.0135 0.0791  0.0424  32  ARG A O   
272  C CB  A ARG A 51  ? 0.3779 0.3379 0.2943 -0.0099 0.0494  0.0047  32  ARG A CB  
273  C CB  B ARG A 51  ? 0.3655 0.2823 0.2524 -0.0325 0.0315  0.0066  32  ARG A CB  
274  C CG  A ARG A 51  ? 0.3849 0.3659 0.3241 0.0088  0.0514  -0.0066 32  ARG A CG  
275  C CG  B ARG A 51  ? 0.3577 0.2732 0.2562 -0.0375 0.0132  -0.0102 32  ARG A CG  
276  C CD  A ARG A 51  ? 0.3967 0.3882 0.3514 0.0328  0.0399  -0.0081 32  ARG A CD  
277  C CD  B ARG A 51  ? 0.3528 0.2415 0.2427 -0.0271 0.0113  -0.0274 32  ARG A CD  
278  N NE  A ARG A 51  ? 0.4175 0.4255 0.3832 0.0469  0.0254  -0.0069 32  ARG A NE  
279  N NE  B ARG A 51  ? 0.3307 0.1948 0.2427 -0.0221 0.0187  -0.0172 32  ARG A NE  
280  C CZ  A ARG A 51  ? 0.3950 0.4351 0.3963 0.0494  0.0082  0.0004  32  ARG A CZ  
281  C CZ  B ARG A 51  ? 0.2953 0.2118 0.2437 -0.0043 0.0000  -0.0244 32  ARG A CZ  
282  N NH1 A ARG A 51  ? 0.3966 0.4486 0.4007 0.0488  0.0018  0.0136  32  ARG A NH1 
283  N NH1 B ARG A 51  ? 0.2907 0.2278 0.2530 -0.0076 -0.0123 -0.0565 32  ARG A NH1 
284  N NH2 A ARG A 51  ? 0.3787 0.4552 0.4076 0.0501  0.0059  -0.0195 32  ARG A NH2 
285  N NH2 B ARG A 51  ? 0.2819 0.2369 0.2546 0.0185  -0.0029 -0.0408 32  ARG A NH2 
286  N N   . HIS A 52  ? 0.3511 0.2242 0.2258 -0.0172 0.0793  0.0337  33  HIS A N   
287  C CA  . HIS A 52  ? 0.3412 0.1965 0.2143 -0.0113 0.0255  0.0370  33  HIS A CA  
288  C C   . HIS A 52  ? 0.3828 0.2270 0.2174 0.0040  0.0000  0.0342  33  HIS A C   
289  O O   . HIS A 52  ? 0.3949 0.2562 0.2014 0.0034  -0.0143 0.0522  33  HIS A O   
290  C CB  . HIS A 52  ? 0.3321 0.1843 0.2001 0.0093  0.0069  0.0027  33  HIS A CB  
291  C CG  . HIS A 52  ? 0.3088 0.1824 0.2036 0.0045  -0.0029 0.0283  33  HIS A CG  
292  N ND1 . HIS A 52  ? 0.2939 0.1762 0.1871 -0.0045 0.0257  0.0519  33  HIS A ND1 
293  C CD2 . HIS A 52  ? 0.3166 0.2074 0.2157 -0.0147 -0.0136 0.0220  33  HIS A CD2 
294  C CE1 . HIS A 52  ? 0.3237 0.1953 0.2080 -0.0239 0.0096  0.0505  33  HIS A CE1 
295  N NE2 . HIS A 52  ? 0.3133 0.2044 0.2266 -0.0319 0.0009  0.0231  33  HIS A NE2 
296  N N   . ARG A 53  ? 0.4210 0.2536 0.2344 0.0160  -0.0198 0.0099  34  ARG A N   
297  C CA  . ARG A 53  ? 0.4498 0.2640 0.2733 0.0361  -0.0051 0.0036  34  ARG A CA  
298  C C   . ARG A 53  ? 0.4253 0.1904 0.2228 0.0835  -0.0077 -0.0081 34  ARG A C   
299  O O   . ARG A 53  ? 0.4688 0.1819 0.2152 0.0514  -0.0034 0.0003  34  ARG A O   
300  C CB  . ARG A 53  ? 0.4946 0.3480 0.3907 0.0069  -0.0257 0.0211  34  ARG A CB  
301  C CG  . ARG A 53  ? 0.5422 0.4502 0.4772 -0.0247 -0.0514 0.0133  34  ARG A CG  
302  C CD  . ARG A 53  ? 0.6008 0.5459 0.5504 -0.0453 -0.0627 0.0146  34  ARG A CD  
303  N NE  . ARG A 53  ? 0.6410 0.6164 0.6119 -0.0430 -0.0737 0.0077  34  ARG A NE  
304  C CZ  . ARG A 53  ? 0.6690 0.6522 0.6560 -0.0257 -0.0619 -0.0137 34  ARG A CZ  
305  N NH1 . ARG A 53  ? 0.6741 0.6597 0.6714 -0.0300 -0.0697 -0.0166 34  ARG A NH1 
306  N NH2 . ARG A 53  ? 0.6879 0.6618 0.6715 -0.0050 -0.0418 -0.0251 34  ARG A NH2 
307  N N   . GLU A 54  ? 0.4247 0.2046 0.2032 0.0635  -0.0448 -0.0279 35  GLU A N   
308  C CA  . GLU A 54  ? 0.4276 0.2200 0.2018 0.0800  -0.0444 -0.0338 35  GLU A CA  
309  C C   . GLU A 54  ? 0.4419 0.2567 0.2449 0.0589  -0.0511 -0.0683 35  GLU A C   
310  O O   . GLU A 54  ? 0.4637 0.2875 0.2679 0.0970  -0.0226 -0.0808 35  GLU A O   
311  C CB  . GLU A 54  ? 0.4235 0.2479 0.1842 0.0722  -0.0545 -0.0567 35  GLU A CB  
312  C CG  . GLU A 54  ? 0.3805 0.2685 0.1868 0.0728  -0.0213 -0.0208 35  GLU A CG  
313  C CD  . GLU A 54  ? 0.3520 0.2598 0.1962 0.0606  0.0000  -0.0074 35  GLU A CD  
314  O OE1 . GLU A 54  ? 0.3288 0.2572 0.1916 0.0759  0.0436  -0.0127 35  GLU A OE1 
315  O OE2 . GLU A 54  ? 0.3467 0.2916 0.1893 0.0458  -0.0055 -0.0296 35  GLU A OE2 
316  N N   . LEU A 55  ? 0.4411 0.2395 0.2378 0.0375  -0.0875 -0.0371 36  LEU A N   
317  C CA  . LEU A 55  ? 0.4343 0.2497 0.2730 0.0203  -0.0743 -0.0381 36  LEU A CA  
318  C C   . LEU A 55  ? 0.3943 0.2549 0.2797 0.0212  -0.0736 -0.0307 36  LEU A C   
319  O O   . LEU A 55  ? 0.3960 0.2742 0.3007 0.0192  -0.0985 -0.0293 36  LEU A O   
320  C CB  . LEU A 55  ? 0.4371 0.2548 0.2974 -0.0050 -0.0602 -0.0170 36  LEU A CB  
321  C CG  . LEU A 55  ? 0.4575 0.2888 0.3250 -0.0488 -0.0171 -0.0305 36  LEU A CG  
322  C CD1 . LEU A 55  ? 0.4942 0.3123 0.3532 -0.0640 0.0128  -0.0465 36  LEU A CD1 
323  C CD2 . LEU A 55  ? 0.4641 0.2873 0.3474 -0.0273 0.0130  0.0091  36  LEU A CD2 
324  N N   . ALA A 56  ? 0.3937 0.2258 0.2512 0.0045  -0.0630 -0.0156 37  ALA A N   
325  C CA  . ALA A 56  ? 0.4153 0.2476 0.2532 0.0079  -0.0163 -0.0140 37  ALA A CA  
326  C C   . ALA A 56  ? 0.4242 0.2311 0.2480 0.0342  0.0047  -0.0013 37  ALA A C   
327  O O   . ALA A 56  ? 0.4473 0.2169 0.2440 0.0272  0.0206  0.0070  37  ALA A O   
328  C CB  . ALA A 56  ? 0.4001 0.2386 0.2467 0.0086  0.0044  -0.0151 37  ALA A CB  
329  N N   . ALA A 57  ? 0.4289 0.2513 0.2750 0.0574  -0.0268 0.0363  38  ALA A N   
330  C CA  . ALA A 57  ? 0.4450 0.2830 0.3003 0.0738  -0.0476 0.0392  38  ALA A CA  
331  C C   . ALA A 57  ? 0.4646 0.3075 0.3254 0.0843  -0.0868 0.0214  38  ALA A C   
332  O O   . ALA A 57  ? 0.5159 0.3386 0.3528 0.1038  -0.1064 0.0404  38  ALA A O   
333  C CB  . ALA A 57  ? 0.4360 0.2758 0.3138 0.0644  -0.0572 0.0493  38  ALA A CB  
334  N N   . VAL A 58  ? 0.4636 0.3214 0.3490 0.0538  -0.0965 -0.0159 39  VAL A N   
335  C CA  . VAL A 58  ? 0.4235 0.3111 0.3855 0.0271  -0.1002 -0.0436 39  VAL A CA  
336  C C   . VAL A 58  ? 0.4057 0.2936 0.4073 0.0258  -0.0987 -0.0749 39  VAL A C   
337  O O   . VAL A 58  ? 0.4241 0.3141 0.4252 0.0294  -0.0992 -0.1060 39  VAL A O   
338  C CB  . VAL A 58  ? 0.4096 0.3310 0.4209 -0.0090 -0.1060 -0.0218 39  VAL A CB  
339  C CG1 . VAL A 58  ? 0.3816 0.3195 0.4300 0.0164  -0.1045 0.0007  39  VAL A CG1 
340  C CG2 . VAL A 58  ? 0.4578 0.3703 0.4426 -0.0123 -0.0733 -0.0074 39  VAL A CG2 
341  N N   . VAL A 59  ? 0.3937 0.2150 0.4028 0.0138  -0.0854 -0.0718 40  VAL A N   
342  C CA  . VAL A 59  ? 0.3799 0.2053 0.3992 0.0016  -0.0855 -0.0524 40  VAL A CA  
343  C C   . VAL A 59  ? 0.3616 0.1924 0.3902 0.0133  -0.0848 -0.0003 40  VAL A C   
344  O O   . VAL A 59  ? 0.3623 0.2105 0.3981 0.0227  -0.0712 0.0060  40  VAL A O   
345  C CB  . VAL A 59  ? 0.3574 0.2215 0.4109 -0.0315 -0.0670 -0.0719 40  VAL A CB  
346  C CG1 . VAL A 59  ? 0.3376 0.2301 0.4234 -0.0613 -0.0632 -0.0942 40  VAL A CG1 
347  C CG2 . VAL A 59  ? 0.3815 0.2254 0.3983 0.0090  -0.0634 -0.0272 40  VAL A CG2 
348  N N   . SER A 60  ? 0.3858 0.1849 0.3716 0.0046  -0.1038 -0.0125 41  SER A N   
349  C CA  . SER A 60  ? 0.3664 0.2073 0.3627 0.0022  -0.1064 -0.0043 41  SER A CA  
350  C C   . SER A 60  ? 0.3460 0.2186 0.3547 -0.0149 -0.0776 0.0133  41  SER A C   
351  O O   . SER A 60  ? 0.3532 0.1812 0.3518 -0.0317 -0.0602 0.0293  41  SER A O   
352  C CB  . SER A 60  ? 0.3676 0.2112 0.3891 0.0429  -0.0837 -0.0108 41  SER A CB  
353  O OG  . SER A 60  ? 0.3762 0.2055 0.4300 0.0079  -0.0682 -0.0030 41  SER A OG  
354  N N   . GLY A 61  ? 0.3150 0.2184 0.3489 -0.0408 -0.0817 -0.0068 42  GLY A N   
355  C CA  . GLY A 61  ? 0.3346 0.2483 0.3545 -0.0599 -0.0680 0.0022  42  GLY A CA  
356  C C   . GLY A 61  ? 0.3421 0.2478 0.3755 -0.0382 -0.0626 0.0348  42  GLY A C   
357  O O   . GLY A 61  ? 0.3563 0.2444 0.3801 -0.0578 -0.0667 0.0674  42  GLY A O   
358  N N   . SER A 62  ? 0.3704 0.2550 0.3855 0.0066  -0.0454 0.0449  43  SER A N   
359  C CA  A SER A 62  ? 0.3626 0.2501 0.3965 0.0204  -0.0317 0.0578  43  SER A CA  
360  C CA  B SER A 62  ? 0.3755 0.2557 0.3910 0.0305  -0.0180 0.0554  43  SER A CA  
361  C C   . SER A 62  ? 0.3684 0.2315 0.3899 0.0145  -0.0250 0.0566  43  SER A C   
362  O O   . SER A 62  ? 0.3868 0.2078 0.3941 0.0289  -0.0267 0.0478  43  SER A O   
363  C CB  A SER A 62  ? 0.3656 0.2496 0.4158 0.0240  -0.0254 0.0696  43  SER A CB  
364  C CB  B SER A 62  ? 0.4024 0.2838 0.3987 0.0557  0.0159  0.0643  43  SER A CB  
365  O OG  A SER A 62  ? 0.3560 0.2454 0.4231 0.0169  -0.0584 0.0548  43  SER A OG  
366  O OG  B SER A 62  ? 0.4225 0.2940 0.3945 0.0850  0.0217  0.0551  43  SER A OG  
367  N N   . THR A 63  ? 0.3634 0.1902 0.3959 0.0103  0.0037  0.0479  44  THR A N   
368  C CA  . THR A 63  ? 0.3522 0.1991 0.4047 0.0277  -0.0132 0.0405  44  THR A CA  
369  C C   . THR A 63  ? 0.3499 0.1886 0.3868 0.0155  -0.0177 0.0458  44  THR A C   
370  O O   . THR A 63  ? 0.3641 0.1876 0.3765 0.0047  -0.0077 0.0581  44  THR A O   
371  C CB  . THR A 63  ? 0.3685 0.2118 0.4213 0.0420  -0.0426 0.0524  44  THR A CB  
372  O OG1 . THR A 63  ? 0.4020 0.2711 0.4515 0.0369  -0.0537 0.0383  44  THR A OG1 
373  C CG2 . THR A 63  ? 0.3660 0.2043 0.4119 0.0028  -0.0474 0.0911  44  THR A CG2 
374  N N   . TYR A 64  ? 0.3074 0.1833 0.3835 -0.0275 -0.0339 0.0556  45  TYR A N   
375  C CA  . TYR A 64  ? 0.3108 0.1891 0.3582 -0.0234 -0.0164 0.0369  45  TYR A CA  
376  C C   . TYR A 64  ? 0.3470 0.1600 0.3507 -0.0194 -0.0332 0.0470  45  TYR A C   
377  O O   . TYR A 64  ? 0.3158 0.1627 0.3389 -0.0203 -0.0326 0.0642  45  TYR A O   
378  C CB  . TYR A 64  ? 0.3260 0.1955 0.3377 0.0093  -0.0114 0.0202  45  TYR A CB  
379  C CG  . TYR A 64  ? 0.2922 0.1432 0.2906 0.0157  -0.0406 0.0299  45  TYR A CG  
380  C CD1 . TYR A 64  ? 0.2859 0.1551 0.2722 -0.0134 -0.0272 0.0063  45  TYR A CD1 
381  C CD2 . TYR A 64  ? 0.3127 0.1568 0.2962 0.0009  -0.0389 0.0263  45  TYR A CD2 
382  C CE1 . TYR A 64  ? 0.2665 0.1539 0.2636 -0.0011 -0.0181 -0.0077 45  TYR A CE1 
383  C CE2 . TYR A 64  ? 0.2752 0.1697 0.2868 0.0027  -0.0507 0.0303  45  TYR A CE2 
384  C CZ  . TYR A 64  ? 0.2858 0.1572 0.2713 -0.0148 -0.0387 0.0047  45  TYR A CZ  
385  O OH  . TYR A 64  ? 0.2933 0.1745 0.2736 -0.0303 -0.0238 -0.0312 45  TYR A OH  
386  N N   . THR A 65  ? 0.3503 0.1600 0.3541 -0.0271 -0.0238 -0.0018 46  THR A N   
387  C CA  A THR A 65  ? 0.3779 0.1893 0.3617 0.0031  -0.0138 0.0101  46  THR A CA  
388  C CA  B THR A 65  ? 0.3505 0.1429 0.3389 -0.0125 -0.0233 0.0178  46  THR A CA  
389  C C   . THR A 65  ? 0.3902 0.1770 0.3472 0.0255  -0.0104 0.0092  46  THR A C   
390  O O   . THR A 65  ? 0.4182 0.1583 0.3297 0.0341  -0.0311 0.0081  46  THR A O   
391  C CB  A THR A 65  ? 0.3884 0.2247 0.3888 0.0103  -0.0184 0.0260  46  THR A CB  
392  C CB  B THR A 65  ? 0.3257 0.1306 0.3223 -0.0364 -0.0427 0.0498  46  THR A CB  
393  O OG1 A THR A 65  ? 0.4129 0.2375 0.4061 0.0339  -0.0172 0.0211  46  THR A OG1 
394  O OG1 B THR A 65  ? 0.3291 0.1760 0.3245 -0.0533 -0.0549 0.0464  46  THR A OG1 
395  C CG2 A THR A 65  ? 0.3820 0.2662 0.3929 -0.0005 -0.0221 0.0388  46  THR A CG2 
396  C CG2 B THR A 65  ? 0.3115 0.1074 0.2908 -0.0383 -0.0323 0.0559  46  THR A CG2 
397  N N   . GLY A 66  ? 0.3740 0.1925 0.3417 0.0564  0.0342  0.0269  47  GLY A N   
398  C CA  . GLY A 66  ? 0.3895 0.2265 0.3695 0.0672  0.0443  0.0546  47  GLY A CA  
399  C C   . GLY A 66  ? 0.3882 0.2518 0.3746 0.0593  0.0649  0.0820  47  GLY A C   
400  O O   . GLY A 66  ? 0.3920 0.2950 0.3761 0.0377  0.0922  0.0580  47  GLY A O   
401  N N   . TRP A 67  ? 0.3708 0.2389 0.3988 0.0464  0.0434  0.0988  48  TRP A N   
402  C CA  . TRP A 67  ? 0.3870 0.2123 0.3675 0.0276  0.0371  0.0971  48  TRP A CA  
403  C C   . TRP A 67  ? 0.4182 0.2126 0.3659 0.0142  0.0559  0.0764  48  TRP A C   
404  O O   . TRP A 67  ? 0.4674 0.2197 0.3868 -0.0201 0.0384  0.0985  48  TRP A O   
405  C CB  . TRP A 67  ? 0.3642 0.2250 0.3717 0.0157  0.0335  0.0720  48  TRP A CB  
406  C CG  . TRP A 67  ? 0.3653 0.2308 0.3890 -0.0069 0.0287  0.0829  48  TRP A CG  
407  C CD1 . TRP A 67  ? 0.4214 0.2673 0.4013 -0.0163 0.0239  0.0821  48  TRP A CD1 
408  C CD2 . TRP A 67  ? 0.3917 0.2303 0.3907 -0.0347 0.0068  0.1166  48  TRP A CD2 
409  N NE1 . TRP A 67  ? 0.4204 0.2770 0.3803 -0.0238 0.0066  0.0919  48  TRP A NE1 
410  C CE2 . TRP A 67  ? 0.3913 0.2468 0.3952 -0.0468 0.0216  0.1006  48  TRP A CE2 
411  C CE3 . TRP A 67  ? 0.4153 0.2223 0.4017 -0.0325 -0.0084 0.1242  48  TRP A CE3 
412  C CZ2 . TRP A 67  ? 0.4043 0.2541 0.3943 -0.0503 0.0293  0.1312  48  TRP A CZ2 
413  C CZ3 . TRP A 67  ? 0.4161 0.2243 0.4055 -0.0430 -0.0146 0.1301  48  TRP A CZ3 
414  C CH2 . TRP A 67  ? 0.4255 0.2421 0.4136 -0.0306 0.0121  0.1119  48  TRP A CH2 
415  N N   . ASP A 68  ? 0.4178 0.1918 0.3434 0.0356  0.0726  0.0437  49  ASP A N   
416  C CA  . ASP A 68  ? 0.4233 0.2124 0.3064 0.0412  0.0274  0.0132  49  ASP A CA  
417  C C   . ASP A 68  ? 0.3981 0.1692 0.2500 0.0297  0.0486  -0.0068 49  ASP A C   
418  O O   . ASP A 68  ? 0.4191 0.1914 0.2090 0.0283  0.0639  0.0064  49  ASP A O   
419  C CB  . ASP A 68  ? 0.4613 0.2829 0.3336 0.0284  0.0099  0.0203  49  ASP A CB  
420  C CG  . ASP A 68  ? 0.5343 0.3775 0.3630 -0.0256 0.0131  0.0109  49  ASP A CG  
421  O OD1 . ASP A 68  ? 0.5671 0.4211 0.4105 0.0092  0.0172  0.0047  49  ASP A OD1 
422  O OD2 . ASP A 68  ? 0.5738 0.3946 0.3464 -0.1207 -0.0090 0.0382  49  ASP A OD2 
423  N N   . ILE A 69  ? 0.3409 0.1224 0.2371 0.0218  0.0427  -0.0420 50  ILE A N   
424  C CA  . ILE A 69  ? 0.3132 0.1363 0.2133 0.0104  0.0052  -0.0132 50  ILE A CA  
425  C C   . ILE A 69  ? 0.3174 0.1381 0.2054 -0.0420 0.0031  0.0024  50  ILE A C   
426  O O   . ILE A 69  ? 0.3349 0.1414 0.1957 -0.0339 0.0188  0.0212  50  ILE A O   
427  C CB  . ILE A 69  ? 0.3045 0.2055 0.1886 0.0286  -0.0029 -0.0421 50  ILE A CB  
428  C CG1 . ILE A 69  ? 0.3244 0.1984 0.2392 -0.0185 0.0069  -0.0011 50  ILE A CG1 
429  C CG2 . ILE A 69  ? 0.2763 0.1816 0.1810 0.0303  -0.0071 -0.0694 50  ILE A CG2 
430  C CD1 . ILE A 69  ? 0.3603 0.2226 0.2565 -0.0427 0.0291  0.0173  50  ILE A CD1 
431  N N   . THR A 70  ? 0.3027 0.1738 0.2106 -0.0352 -0.0057 -0.0035 51  THR A N   
432  C CA  A THR A 70  ? 0.2994 0.1916 0.2087 -0.0564 0.0124  -0.0014 51  THR A CA  
433  C CA  B THR A 70  ? 0.3083 0.1996 0.2111 -0.0628 0.0015  -0.0065 51  THR A CA  
434  C C   . THR A 70  ? 0.3232 0.2047 0.2013 -0.0322 0.0288  0.0049  51  THR A C   
435  O O   . THR A 70  ? 0.3374 0.2073 0.1972 -0.0315 0.0560  0.0095  51  THR A O   
436  C CB  A THR A 70  ? 0.2955 0.1886 0.2165 -0.0598 0.0380  0.0212  51  THR A CB  
437  C CB  B THR A 70  ? 0.3201 0.2325 0.2329 -0.0747 0.0130  0.0037  51  THR A CB  
438  O OG1 A THR A 70  ? 0.3001 0.1728 0.2279 -0.0728 0.0281  0.0224  51  THR A OG1 
439  O OG1 B THR A 70  ? 0.3316 0.2566 0.2476 -0.0554 0.0247  0.0265  51  THR A OG1 
440  C CG2 A THR A 70  ? 0.2920 0.2055 0.2178 -0.0350 0.0453  0.0411  51  THR A CG2 
441  C CG2 B THR A 70  ? 0.3062 0.2291 0.2460 -0.0708 -0.0097 -0.0061 51  THR A CG2 
442  N N   . GLU A 71  ? 0.3106 0.2099 0.1908 -0.0282 -0.0038 -0.0056 52  GLU A N   
443  C CA  . GLU A 71  ? 0.3038 0.1808 0.2011 -0.0509 0.0081  -0.0161 52  GLU A CA  
444  C C   . GLU A 71  ? 0.2863 0.1610 0.1904 -0.0220 -0.0220 -0.0139 52  GLU A C   
445  O O   . GLU A 71  ? 0.3105 0.1483 0.1650 0.0014  -0.0183 -0.0308 52  GLU A O   
446  C CB  . GLU A 71  ? 0.3228 0.2131 0.2371 -0.0522 0.0299  -0.0110 52  GLU A CB  
447  C CG  . GLU A 71  ? 0.3684 0.2449 0.2572 -0.0915 0.0030  -0.0147 52  GLU A CG  
448  C CD  . GLU A 71  ? 0.4482 0.3034 0.2979 -0.0946 0.0137  -0.0444 52  GLU A CD  
449  O OE1 . GLU A 71  ? 0.4769 0.3232 0.2996 -0.0771 0.0223  -0.0682 52  GLU A OE1 
450  O OE2 . GLU A 71  ? 0.5129 0.3190 0.3326 -0.1160 0.0175  -0.0750 52  GLU A OE2 
451  N N   . LEU A 72  ? 0.2714 0.1547 0.2015 0.0001  -0.0087 -0.0162 53  LEU A N   
452  C CA  . LEU A 72  ? 0.2611 0.1434 0.2084 -0.0236 -0.0107 -0.0351 53  LEU A CA  
453  C C   . LEU A 72  ? 0.2865 0.1431 0.1784 -0.0149 0.0016  -0.0161 53  LEU A C   
454  O O   . LEU A 72  ? 0.2870 0.1287 0.1625 -0.0139 -0.0272 -0.0059 53  LEU A O   
455  C CB  . LEU A 72  ? 0.2088 0.1305 0.2181 -0.0430 -0.0343 -0.0284 53  LEU A CB  
456  C CG  . LEU A 72  ? 0.2194 0.1621 0.2363 -0.0263 -0.0061 -0.0047 53  LEU A CG  
457  C CD1 . LEU A 72  ? 0.1818 0.1909 0.2650 -0.0230 0.0452  -0.0072 53  LEU A CD1 
458  C CD2 . LEU A 72  ? 0.2166 0.1955 0.2669 -0.0103 -0.0604 -0.0233 53  LEU A CD2 
459  N N   . ALA A 73  ? 0.2723 0.1672 0.1570 -0.0109 0.0208  -0.0259 54  ALA A N   
460  C CA  . ALA A 73  ? 0.2435 0.2052 0.1230 -0.0163 0.0222  -0.0261 54  ALA A CA  
461  C C   . ALA A 73  ? 0.2170 0.1921 0.1370 -0.0643 0.0051  -0.0345 54  ALA A C   
462  O O   . ALA A 73  ? 0.1929 0.1902 0.1491 -0.0348 0.0455  -0.0098 54  ALA A O   
463  C CB  . ALA A 73  ? 0.2530 0.2133 0.1222 -0.0528 0.0365  -0.0142 54  ALA A CB  
464  N N   . SER A 74  ? 0.2222 0.1571 0.1534 -0.0917 0.0086  -0.0195 55  SER A N   
465  C CA  A SER A 74  ? 0.2482 0.1589 0.1507 -0.0815 -0.0187 0.0043  55  SER A CA  
466  C CA  B SER A 74  ? 0.2489 0.1637 0.1530 -0.0826 -0.0116 0.0039  55  SER A CA  
467  C C   . SER A 74  ? 0.2377 0.1872 0.1641 -0.0760 0.0060  0.0043  55  SER A C   
468  O O   . SER A 74  ? 0.2546 0.2188 0.1931 -0.0447 -0.0187 0.0173  55  SER A O   
469  C CB  A SER A 74  ? 0.2825 0.1779 0.1617 -0.0883 -0.0221 0.0187  55  SER A CB  
470  C CB  B SER A 74  ? 0.2781 0.1853 0.1634 -0.0951 -0.0067 0.0208  55  SER A CB  
471  O OG  A SER A 74  ? 0.3110 0.1812 0.1614 -0.0570 -0.0287 0.0296  55  SER A OG  
472  O OG  B SER A 74  ? 0.2856 0.1925 0.1547 -0.0717 -0.0037 0.0460  55  SER A OG  
473  N N   . LEU A 75  ? 0.2325 0.1878 0.1746 -0.0357 -0.0016 -0.0426 56  LEU A N   
474  C CA  . LEU A 75  ? 0.2368 0.1338 0.1782 -0.0190 0.0163  -0.0339 56  LEU A CA  
475  C C   . LEU A 75  ? 0.2508 0.1643 0.1624 -0.0525 -0.0025 -0.0486 56  LEU A C   
476  O O   . LEU A 75  ? 0.2719 0.1816 0.1620 -0.0491 0.0028  -0.0107 56  LEU A O   
477  C CB  . LEU A 75  ? 0.2305 0.1453 0.1855 -0.0162 -0.0004 -0.0736 56  LEU A CB  
478  C CG  . LEU A 75  ? 0.2371 0.1419 0.1949 0.0021  0.0090  -0.0698 56  LEU A CG  
479  C CD1 . LEU A 75  ? 0.2668 0.1748 0.2047 0.0299  0.0266  -0.0369 56  LEU A CD1 
480  C CD2 . LEU A 75  ? 0.3312 0.1831 0.2014 -0.0202 0.0308  -0.0563 56  LEU A CD2 
481  N N   . VAL A 76  ? 0.2284 0.1428 0.1583 -0.0646 -0.0172 -0.0405 57  VAL A N   
482  C CA  A VAL A 76  ? 0.2284 0.1731 0.1714 -0.0645 -0.0307 -0.0439 57  VAL A CA  
483  C CA  B VAL A 76  ? 0.1683 0.1413 0.1374 -0.0523 -0.0233 -0.0307 57  VAL A CA  
484  C C   . VAL A 76  ? 0.1815 0.1654 0.1664 -0.0679 -0.0200 -0.0279 57  VAL A C   
485  O O   . VAL A 76  ? 0.2013 0.1625 0.1760 -0.0491 0.0282  -0.0082 57  VAL A O   
486  C CB  A VAL A 76  ? 0.2846 0.2174 0.1805 -0.0643 -0.0192 -0.0402 57  VAL A CB  
487  C CB  B VAL A 76  ? 0.1061 0.1331 0.0927 -0.0578 0.0225  -0.0135 57  VAL A CB  
488  C CG1 A VAL A 76  ? 0.2682 0.2129 0.1943 -0.0404 -0.0033 -0.0499 57  VAL A CG1 
489  C CG1 B VAL A 76  ? 0.0716 0.1169 0.1027 -0.0486 0.0179  -0.0229 57  VAL A CG1 
490  C CG2 A VAL A 76  ? 0.3244 0.2161 0.1633 -0.0832 -0.0247 -0.0300 57  VAL A CG2 
491  C CG2 B VAL A 76  ? 0.1153 0.1137 0.0456 0.0027  0.0333  0.0005  57  VAL A CG2 
492  N N   . TYR A 77  ? 0.1891 0.2090 0.1717 -0.0574 -0.0174 -0.0426 58  TYR A N   
493  C CA  . TYR A 77  ? 0.2043 0.2146 0.1432 -0.0576 0.0081  -0.0254 58  TYR A CA  
494  C C   . TYR A 77  ? 0.2179 0.2409 0.1394 -0.0747 -0.0010 -0.0198 58  TYR A C   
495  O O   . TYR A 77  ? 0.1704 0.2409 0.1526 -0.0740 -0.0018 -0.0229 58  TYR A O   
496  C CB  . TYR A 77  ? 0.2239 0.1924 0.1465 -0.0462 0.0126  -0.0500 58  TYR A CB  
497  C CG  . TYR A 77  ? 0.2016 0.1796 0.1507 -0.0479 0.0090  -0.0177 58  TYR A CG  
498  C CD1 . TYR A 77  ? 0.2012 0.1809 0.1582 -0.0513 0.0320  0.0176  58  TYR A CD1 
499  C CD2 . TYR A 77  ? 0.1992 0.2003 0.1623 -0.0563 0.0109  -0.0229 58  TYR A CD2 
500  C CE1 . TYR A 77  ? 0.1108 0.1798 0.1416 -0.0154 0.0147  0.0063  58  TYR A CE1 
501  C CE2 . TYR A 77  ? 0.1600 0.1787 0.1634 -0.0536 0.0169  -0.0302 58  TYR A CE2 
502  C CZ  . TYR A 77  ? 0.1472 0.1770 0.1483 -0.0240 0.0129  -0.0264 58  TYR A CZ  
503  O OH  . TYR A 77  ? 0.1520 0.1928 0.1778 -0.0367 0.0089  -0.0152 58  TYR A OH  
504  N N   . PRO A 78  ? 0.2371 0.2368 0.1336 -0.0714 0.0155  -0.0400 59  PRO A N   
505  C CA  . PRO A 78  ? 0.2217 0.2588 0.1579 -0.0929 0.0032  -0.0234 59  PRO A CA  
506  C C   . PRO A 78  ? 0.2270 0.2674 0.1781 -0.0930 -0.0298 -0.0093 59  PRO A C   
507  O O   . PRO A 78  ? 0.2842 0.2481 0.2280 -0.0630 -0.0508 -0.0025 59  PRO A O   
508  C CB  . PRO A 78  ? 0.2433 0.2553 0.1753 -0.1023 0.0161  -0.0261 59  PRO A CB  
509  C CG  . PRO A 78  ? 0.2634 0.2435 0.1537 -0.1113 0.0056  -0.0250 59  PRO A CG  
510  C CD  . PRO A 78  ? 0.2234 0.2571 0.1144 -0.1015 0.0290  -0.0326 59  PRO A CD  
511  N N   . GLU A 79  ? 0.2129 0.2648 0.1886 -0.0640 -0.0355 0.0185  60  GLU A N   
512  C CA  . GLU A 79  ? 0.2595 0.2820 0.2210 -0.0412 -0.0072 0.0341  60  GLU A CA  
513  C C   . GLU A 79  ? 0.2254 0.2852 0.2235 -0.0733 -0.0124 0.0315  60  GLU A C   
514  O O   . GLU A 79  ? 0.2474 0.3098 0.2656 -0.0715 -0.0314 0.0108  60  GLU A O   
515  C CB  . GLU A 79  ? 0.2695 0.3202 0.2499 -0.0393 0.0019  0.0700  60  GLU A CB  
516  C CG  . GLU A 79  ? 0.3426 0.3742 0.3252 -0.0132 -0.0108 0.0781  60  GLU A CG  
517  C CD  . GLU A 79  ? 0.4317 0.4156 0.4044 -0.0356 -0.0315 0.0170  60  GLU A CD  
518  O OE1 . GLU A 79  ? 0.4804 0.3895 0.4440 -0.0340 -0.0269 -0.0288 60  GLU A OE1 
519  O OE2 . GLU A 79  ? 0.4510 0.4778 0.4278 -0.0498 -0.0690 0.0107  60  GLU A OE2 
520  N N   . SER A 80  ? 0.2182 0.2483 0.1519 -0.0885 -0.0064 0.0198  61  SER A N   
521  C CA  . SER A 80  ? 0.2395 0.2640 0.1884 -0.0958 -0.0061 0.0244  61  SER A CA  
522  C C   . SER A 80  ? 0.2379 0.2611 0.1972 -0.1075 -0.0019 0.0172  61  SER A C   
523  O O   . SER A 80  ? 0.2546 0.2745 0.2050 -0.1489 -0.0126 0.0175  61  SER A O   
524  C CB  . SER A 80  ? 0.2609 0.2522 0.1954 -0.0351 -0.0697 0.0053  61  SER A CB  
525  O OG  . SER A 80  ? 0.2871 0.2387 0.2063 -0.0279 -0.0865 0.0080  61  SER A OG  
526  N N   . SER A 81  ? 0.2487 0.2570 0.1848 -0.0830 -0.0041 0.0271  62  SER A N   
527  C CA  . SER A 81  ? 0.2033 0.2692 0.2126 -0.0873 -0.0034 0.0200  62  SER A CA  
528  C C   . SER A 81  ? 0.2003 0.2398 0.2064 -0.1116 0.0014  0.0192  62  SER A C   
529  O O   . SER A 81  ? 0.1937 0.2511 0.2221 -0.1079 0.0008  0.0147  62  SER A O   
530  C CB  . SER A 81  ? 0.1887 0.2822 0.2165 -0.0921 0.0298  -0.0054 62  SER A CB  
531  O OG  . SER A 81  ? 0.1651 0.2956 0.2368 -0.0966 0.0137  -0.0102 62  SER A OG  
532  N N   . ALA A 82  ? 0.2682 0.2450 0.2041 -0.0969 0.0132  0.0105  63  ALA A N   
533  C CA  . ALA A 82  ? 0.2998 0.2191 0.2280 -0.1190 0.0293  0.0155  63  ALA A CA  
534  C C   . ALA A 82  ? 0.2861 0.2319 0.2257 -0.0804 0.0283  0.0093  63  ALA A C   
535  O O   . ALA A 82  ? 0.2763 0.2279 0.1961 -0.0575 0.0101  -0.0035 63  ALA A O   
536  C CB  . ALA A 82  ? 0.2768 0.2245 0.2340 -0.1354 0.0434  0.0224  63  ALA A CB  
537  N N   . GLU A 83  ? 0.2814 0.2356 0.2532 -0.0715 0.0307  0.0068  64  GLU A N   
538  C CA  . GLU A 83  ? 0.2421 0.2509 0.2628 -0.0789 -0.0050 -0.0044 64  GLU A CA  
539  C C   . GLU A 83  ? 0.2194 0.2158 0.2443 -0.0917 -0.0114 0.0250  64  GLU A C   
540  O O   . GLU A 83  ? 0.2151 0.2170 0.2377 -0.0854 -0.0042 0.0346  64  GLU A O   
541  C CB  . GLU A 83  ? 0.2841 0.3176 0.2975 -0.0834 0.0157  -0.0340 64  GLU A CB  
542  C CG  . GLU A 83  ? 0.3463 0.3530 0.3605 -0.0370 0.0495  -0.0352 64  GLU A CG  
543  C CD  . GLU A 83  ? 0.4147 0.4147 0.4472 -0.0179 0.0792  -0.0249 64  GLU A CD  
544  O OE1 . GLU A 83  ? 0.4259 0.4426 0.4859 0.0090  0.0990  0.0124  64  GLU A OE1 
545  O OE2 . GLU A 83  ? 0.4319 0.4131 0.4718 -0.0139 0.0897  -0.0271 64  GLU A OE2 
546  N N   . ASP A 84  ? 0.2069 0.1864 0.2239 -0.0760 0.0093  0.0356  65  ASP A N   
547  C CA  . ASP A 84  ? 0.1950 0.1922 0.2212 -0.0492 -0.0074 0.0333  65  ASP A CA  
548  C C   . ASP A 84  ? 0.1786 0.1607 0.1959 -0.0683 -0.0054 -0.0041 65  ASP A C   
549  O O   . ASP A 84  ? 0.1795 0.1640 0.1686 -0.0361 -0.0423 -0.0034 65  ASP A O   
550  C CB  . ASP A 84  ? 0.1897 0.2058 0.2346 -0.0201 -0.0023 0.0145  65  ASP A CB  
551  C CG  . ASP A 84  ? 0.2369 0.2375 0.2429 0.0015  0.0128  0.0443  65  ASP A CG  
552  O OD1 . ASP A 84  ? 0.2415 0.2118 0.2403 -0.0434 0.0295  0.0118  65  ASP A OD1 
553  O OD2 . ASP A 84  ? 0.2436 0.2850 0.2514 0.0326  -0.0286 0.0509  65  ASP A OD2 
554  N N   . LEU A 85  ? 0.2340 0.1488 0.1995 -0.0291 -0.0117 0.0093  66  LEU A N   
555  C CA  . LEU A 85  ? 0.2091 0.1351 0.1859 -0.0209 -0.0073 -0.0180 66  LEU A CA  
556  C C   . LEU A 85  ? 0.2243 0.1402 0.1731 -0.0565 0.0056  -0.0175 66  LEU A C   
557  O O   . LEU A 85  ? 0.2069 0.1527 0.2064 -0.0308 0.0238  -0.0179 66  LEU A O   
558  C CB  . LEU A 85  ? 0.2077 0.1410 0.2068 -0.0206 -0.0156 -0.0223 66  LEU A CB  
559  C CG  . LEU A 85  ? 0.2207 0.1391 0.2112 -0.0346 -0.0059 -0.0039 66  LEU A CG  
560  C CD1 . LEU A 85  ? 0.2310 0.1916 0.2369 -0.0298 -0.0031 -0.0055 66  LEU A CD1 
561  C CD2 . LEU A 85  ? 0.2778 0.1393 0.1817 -0.0217 -0.0277 -0.0059 66  LEU A CD2 
562  N N   . ALA A 86  ? 0.2571 0.1155 0.1419 -0.0473 0.0050  0.0290  67  ALA A N   
563  C CA  . ALA A 86  ? 0.2365 0.1492 0.1313 -0.0893 0.0147  0.0027  67  ALA A CA  
564  C C   . ALA A 86  ? 0.2271 0.1470 0.1487 -0.0484 0.0145  -0.0011 67  ALA A C   
565  O O   . ALA A 86  ? 0.2101 0.1775 0.1579 -0.0186 0.0203  0.0225  67  ALA A O   
566  C CB  . ALA A 86  ? 0.2459 0.1928 0.1461 -0.0911 -0.0076 0.0317  67  ALA A CB  
567  N N   . LEU A 87  ? 0.2096 0.1169 0.1768 -0.0506 0.0441  -0.0148 68  LEU A N   
568  C CA  . LEU A 87  ? 0.1722 0.1302 0.1791 -0.0195 0.0546  -0.0285 68  LEU A CA  
569  C C   . LEU A 87  ? 0.1797 0.1283 0.1694 -0.0473 0.0268  -0.0140 68  LEU A C   
570  O O   . LEU A 87  ? 0.1442 0.1514 0.1618 -0.0366 0.0060  -0.0135 68  LEU A O   
571  C CB  . LEU A 87  ? 0.2418 0.1385 0.1617 -0.0168 0.0430  -0.0104 68  LEU A CB  
572  C CG  . LEU A 87  ? 0.2596 0.1149 0.1524 -0.0323 0.0175  0.0176  68  LEU A CG  
573  C CD1 . LEU A 87  ? 0.3069 0.1554 0.1361 -0.0384 -0.0148 -0.0196 68  LEU A CD1 
574  C CD2 . LEU A 87  ? 0.2892 0.1360 0.1821 -0.0025 0.0162  -0.0009 68  LEU A CD2 
575  N N   . ALA A 88  ? 0.2008 0.1171 0.1744 -0.0038 0.0139  0.0041  69  ALA A N   
576  C CA  . ALA A 88  ? 0.2194 0.1408 0.1495 -0.0375 0.0239  0.0128  69  ALA A CA  
577  C C   . ALA A 88  ? 0.2175 0.1373 0.1510 -0.0442 0.0014  0.0249  69  ALA A C   
578  O O   . ALA A 88  ? 0.1910 0.1878 0.1485 -0.0139 0.0193  -0.0069 69  ALA A O   
579  C CB  . ALA A 88  ? 0.2494 0.1592 0.1356 -0.0483 0.0419  0.0254  69  ALA A CB  
580  N N   . ALA A 89  ? 0.2300 0.1184 0.1498 -0.0482 0.0102  0.0477  70  ALA A N   
581  C CA  . ALA A 89  ? 0.2863 0.0986 0.1476 -0.0370 0.0058  0.0363  70  ALA A CA  
582  C C   . ALA A 89  ? 0.2851 0.1107 0.1428 -0.0203 0.0028  0.0100  70  ALA A C   
583  O O   . ALA A 89  ? 0.2561 0.1229 0.1616 0.0083  -0.0067 -0.0047 70  ALA A O   
584  C CB  . ALA A 89  ? 0.3341 0.0962 0.1899 -0.0415 0.0136  0.0117  70  ALA A CB  
585  N N   . ASP A 90  ? 0.2980 0.1244 0.1259 -0.0310 0.0231  0.0178  71  ASP A N   
586  C CA  . ASP A 90  ? 0.2494 0.1373 0.1355 -0.0240 0.0307  0.0170  71  ASP A CA  
587  C C   . ASP A 90  ? 0.2582 0.1247 0.1474 -0.0160 -0.0160 0.0259  71  ASP A C   
588  O O   . ASP A 90  ? 0.2640 0.1395 0.1587 -0.0232 -0.0399 0.0319  71  ASP A O   
589  C CB  . ASP A 90  ? 0.2312 0.1387 0.1685 -0.0448 0.0333  -0.0074 71  ASP A CB  
590  C CG  . ASP A 90  ? 0.2317 0.1549 0.1732 -0.0098 0.0260  -0.0008 71  ASP A CG  
591  O OD1 . ASP A 90  ? 0.2184 0.1559 0.1923 -0.0075 0.0167  0.0230  71  ASP A OD1 
592  O OD2 . ASP A 90  ? 0.2266 0.1795 0.1438 -0.0202 0.0108  0.0076  71  ASP A OD2 
593  N N   . LEU A 91  ? 0.2516 0.1233 0.1421 -0.0636 0.0124  0.0312  72  LEU A N   
594  C CA  . LEU A 91  ? 0.2511 0.0882 0.1632 -0.0356 -0.0049 0.0368  72  LEU A CA  
595  C C   . LEU A 91  ? 0.2398 0.1414 0.1594 -0.0218 0.0122  0.0037  72  LEU A C   
596  O O   . LEU A 91  ? 0.2145 0.1601 0.1630 -0.0281 0.0063  -0.0068 72  LEU A O   
597  C CB  . LEU A 91  ? 0.2358 0.0903 0.1694 -0.0354 -0.0341 0.0469  72  LEU A CB  
598  C CG  . LEU A 91  ? 0.2689 0.1215 0.1871 -0.0266 -0.0431 0.0249  72  LEU A CG  
599  C CD1 . LEU A 91  ? 0.3137 0.1187 0.2126 -0.0239 -0.0229 -0.0196 72  LEU A CD1 
600  C CD2 . LEU A 91  ? 0.2832 0.1209 0.1852 -0.0524 -0.0213 0.0411  72  LEU A CD2 
601  N N   . MET A 92  ? 0.2382 0.1286 0.1525 0.0081  0.0504  -0.0117 73  MET A N   
602  C CA  A MET A 92  ? 0.2432 0.1512 0.1631 0.0063  0.0287  -0.0225 73  MET A CA  
603  C CA  B MET A 92  ? 0.2304 0.1391 0.1603 0.0042  0.0321  -0.0230 73  MET A CA  
604  C C   . MET A 92  ? 0.2484 0.1475 0.1648 -0.0082 0.0086  -0.0205 73  MET A C   
605  O O   . MET A 92  ? 0.2574 0.1482 0.1880 -0.0001 -0.0004 -0.0029 73  MET A O   
606  C CB  A MET A 92  ? 0.2700 0.1859 0.1864 -0.0130 0.0226  -0.0162 73  MET A CB  
607  C CB  B MET A 92  ? 0.2298 0.1468 0.1790 -0.0178 0.0321  -0.0125 73  MET A CB  
608  C CG  A MET A 92  ? 0.2725 0.2378 0.2072 -0.0191 0.0279  -0.0131 73  MET A CG  
609  C CG  B MET A 92  ? 0.1983 0.1778 0.1986 -0.0260 0.0471  0.0027  73  MET A CG  
610  S SD  A MET A 92  ? 0.2671 0.2861 0.2235 0.0012  0.0403  -0.0152 73  MET A SD  
611  S SD  B MET A 92  ? 0.1460 0.1960 0.2132 0.0129  0.0523  0.0105  73  MET A SD  
612  C CE  A MET A 92  ? 0.2628 0.2787 0.2578 0.0079  0.0271  -0.0273 73  MET A CE  
613  C CE  B MET A 92  ? 0.1736 0.2244 0.1986 0.0030  0.0541  0.0181  73  MET A CE  
614  N N   . GLY A 93  ? 0.2463 0.1754 0.1754 -0.0178 -0.0097 -0.0093 74  GLY A N   
615  C CA  . GLY A 93  ? 0.2510 0.1489 0.1623 -0.0173 -0.0120 0.0173  74  GLY A CA  
616  C C   . GLY A 93  ? 0.2812 0.1192 0.1760 -0.0067 -0.0299 0.0225  74  GLY A C   
617  O O   . GLY A 93  ? 0.3072 0.1476 0.1948 -0.0049 -0.0444 0.0119  74  GLY A O   
618  N N   . PHE A 94  ? 0.2613 0.1289 0.1563 -0.0028 -0.0148 0.0036  75  PHE A N   
619  C CA  . PHE A 94  ? 0.2552 0.1425 0.1770 0.0064  -0.0228 -0.0224 75  PHE A CA  
620  C C   . PHE A 94  ? 0.2595 0.1164 0.1833 -0.0263 -0.0499 0.0156  75  PHE A C   
621  O O   . PHE A 94  ? 0.2625 0.1401 0.1955 0.0032  -0.0613 0.0229  75  PHE A O   
622  C CB  . PHE A 94  ? 0.2693 0.1286 0.1804 0.0061  -0.0365 -0.0488 75  PHE A CB  
623  C CG  . PHE A 94  ? 0.2673 0.1225 0.1765 0.0001  -0.0295 -0.0364 75  PHE A CG  
624  C CD1 . PHE A 94  ? 0.2916 0.1194 0.1882 -0.0486 -0.0251 -0.0272 75  PHE A CD1 
625  C CD2 . PHE A 94  ? 0.2636 0.1387 0.1697 0.0060  -0.0530 -0.0316 75  PHE A CD2 
626  C CE1 . PHE A 94  ? 0.2841 0.1317 0.1809 -0.0103 -0.0112 -0.0220 75  PHE A CE1 
627  C CE2 . PHE A 94  ? 0.2491 0.1408 0.1980 -0.0277 -0.0332 -0.0106 75  PHE A CE2 
628  C CZ  . PHE A 94  ? 0.2628 0.1315 0.1927 0.0099  -0.0459 0.0033  75  PHE A CZ  
629  N N   . TYR A 95  ? 0.2702 0.1287 0.2010 -0.0296 -0.0429 0.0129  76  TYR A N   
630  C CA  . TYR A 95  ? 0.2577 0.1734 0.2172 0.0051  -0.0520 0.0387  76  TYR A CA  
631  C C   . TYR A 95  ? 0.2673 0.1598 0.2814 0.0182  -0.0664 0.0169  76  TYR A C   
632  O O   . TYR A 95  ? 0.2950 0.1433 0.3225 0.0018  -0.1405 -0.0283 76  TYR A O   
633  C CB  . TYR A 95  ? 0.2241 0.1760 0.1917 -0.0052 -0.0483 0.0438  76  TYR A CB  
634  C CG  . TYR A 95  ? 0.2210 0.1530 0.1995 0.0101  -0.0332 -0.0135 76  TYR A CG  
635  C CD1 . TYR A 95  ? 0.2007 0.1261 0.1940 -0.0015 -0.0020 -0.0262 76  TYR A CD1 
636  C CD2 . TYR A 95  ? 0.2241 0.1557 0.2489 -0.0305 -0.0187 -0.0075 76  TYR A CD2 
637  C CE1 . TYR A 95  ? 0.2029 0.1364 0.1671 0.0178  -0.0075 0.0088  76  TYR A CE1 
638  C CE2 . TYR A 95  ? 0.2154 0.1307 0.2207 -0.0300 0.0225  -0.0088 76  TYR A CE2 
639  C CZ  . TYR A 95  ? 0.1732 0.1240 0.1810 -0.0046 0.0003  0.0084  76  TYR A CZ  
640  O OH  . TYR A 95  ? 0.2005 0.1323 0.1766 -0.0027 -0.0010 0.0120  76  TYR A OH  
641  N N   . PHE A 96  ? 0.2723 0.1393 0.2891 0.0288  -0.0289 0.0363  77  PHE A N   
642  C CA  . PHE A 96  ? 0.2893 0.1579 0.3238 0.0277  -0.0353 -0.0056 77  PHE A CA  
643  C C   . PHE A 96  ? 0.2954 0.1704 0.3400 0.0194  -0.0845 -0.0011 77  PHE A C   
644  O O   . PHE A 96  ? 0.2935 0.1993 0.4046 -0.0045 -0.0672 0.0402  77  PHE A O   
645  C CB  . PHE A 96  ? 0.3041 0.1541 0.3271 0.0217  -0.0016 -0.0045 77  PHE A CB  
646  C CG  . PHE A 96  ? 0.3215 0.1861 0.3368 0.0550  0.0727  -0.0131 77  PHE A CG  
647  C CD1 . PHE A 96  ? 0.3263 0.2188 0.3360 0.0359  0.0862  0.0029  77  PHE A CD1 
648  C CD2 . PHE A 96  ? 0.3862 0.2305 0.3534 0.0304  0.0805  -0.0141 77  PHE A CD2 
649  C CE1 . PHE A 96  ? 0.3212 0.2239 0.3537 0.0369  0.0592  -0.0002 77  PHE A CE1 
650  C CE2 . PHE A 96  ? 0.3858 0.2369 0.3699 0.0108  0.0790  -0.0063 77  PHE A CE2 
651  C CZ  . PHE A 96  ? 0.3582 0.2456 0.3686 0.0076  0.0630  0.0086  77  PHE A CZ  
652  N N   . LEU A 97  ? 0.3101 0.1201 0.2936 0.0211  -0.0782 -0.0305 78  LEU A N   
653  C CA  . LEU A 97  ? 0.3440 0.1405 0.2916 -0.0064 -0.1086 -0.0309 78  LEU A CA  
654  C C   . LEU A 97  ? 0.3568 0.1429 0.3394 0.0286  -0.1888 -0.0127 78  LEU A C   
655  O O   . LEU A 97  ? 0.3640 0.1709 0.3548 0.0461  -0.1900 -0.0081 78  LEU A O   
656  C CB  . LEU A 97  ? 0.3358 0.1516 0.2684 -0.0238 -0.0818 -0.0090 78  LEU A CB  
657  C CG  . LEU A 97  ? 0.3493 0.1572 0.2730 0.0009  -0.0640 0.0200  78  LEU A CG  
658  C CD1 . LEU A 97  ? 0.3400 0.1733 0.2374 -0.0137 -0.0604 0.0056  78  LEU A CD1 
659  C CD2 . LEU A 97  ? 0.3680 0.1471 0.2661 0.0414  -0.0347 0.0586  78  LEU A CD2 
660  N N   . PHE A 98  ? 0.4187 0.1490 0.3537 0.0299  -0.1781 -0.0353 79  PHE A N   
661  C CA  . PHE A 98  ? 0.3976 0.1466 0.3736 0.0263  -0.1803 -0.0303 79  PHE A CA  
662  C C   . PHE A 98  ? 0.4258 0.1631 0.4380 0.0006  -0.1763 -0.0125 79  PHE A C   
663  O O   . PHE A 98  ? 0.4013 0.1939 0.4519 0.0128  -0.1900 0.0253  79  PHE A O   
664  C CB  . PHE A 98  ? 0.4392 0.1587 0.3500 0.0326  -0.1752 -0.0320 79  PHE A CB  
665  C CG  . PHE A 98  ? 0.4238 0.1453 0.3005 0.0158  -0.1362 -0.0400 79  PHE A CG  
666  C CD1 . PHE A 98  ? 0.4330 0.1553 0.2806 -0.0031 -0.1124 -0.0051 79  PHE A CD1 
667  C CD2 . PHE A 98  ? 0.4259 0.1790 0.3436 -0.0254 -0.0833 -0.0534 79  PHE A CD2 
668  C CE1 . PHE A 98  ? 0.4144 0.1689 0.2801 0.0230  -0.1046 -0.0046 79  PHE A CE1 
669  C CE2 . PHE A 98  ? 0.4295 0.1997 0.3491 -0.0264 -0.0548 -0.0345 79  PHE A CE2 
670  C CZ  . PHE A 98  ? 0.4161 0.1894 0.3281 -0.0108 -0.0691 -0.0240 79  PHE A CZ  
671  N N   . ASP A 99  ? 0.4766 0.2540 0.5040 -0.0046 -0.1096 0.0045  80  ASP A N   
672  C CA  . ASP A 99  ? 0.4814 0.3355 0.5408 0.0244  -0.0918 0.0446  80  ASP A CA  
673  C C   . ASP A 99  ? 0.4560 0.3257 0.5378 -0.0083 -0.1209 0.0813  80  ASP A C   
674  O O   . ASP A 99  ? 0.3942 0.2941 0.4922 -0.0795 -0.1445 0.0821  80  ASP A O   
675  C CB  . ASP A 99  ? 0.5346 0.4450 0.5575 0.0278  -0.0567 0.0572  80  ASP A CB  
676  C CG  . ASP A 99  ? 0.6215 0.5462 0.5888 0.0083  -0.0216 0.0454  80  ASP A CG  
677  O OD1 . ASP A 99  ? 0.6363 0.5799 0.6047 -0.0276 -0.0176 0.0475  80  ASP A OD1 
678  O OD2 . ASP A 99  ? 0.6580 0.5714 0.6003 0.0253  -0.0025 0.0354  80  ASP A OD2 
679  N N   . ASP A 100 ? 0.4591 0.3629 0.5720 0.0020  -0.1169 0.0819  81  ASP A N   
680  C CA  . ASP A 100 ? 0.4983 0.3667 0.5855 -0.0284 -0.0945 0.0666  81  ASP A CA  
681  C C   . ASP A 100 ? 0.4589 0.3543 0.5623 -0.0297 -0.0793 0.0697  81  ASP A C   
682  O O   . ASP A 100 ? 0.4753 0.3604 0.5587 -0.0298 -0.0884 0.0864  81  ASP A O   
683  C CB  . ASP A 100 ? 0.5378 0.3871 0.6056 -0.0511 -0.0983 0.0358  81  ASP A CB  
684  C CG  . ASP A 100 ? 0.5643 0.4054 0.6284 -0.0512 -0.0806 0.0176  81  ASP A CG  
685  O OD1 . ASP A 100 ? 0.5915 0.4299 0.6469 -0.0512 -0.0605 0.0015  81  ASP A OD1 
686  O OD2 . ASP A 100 ? 0.5546 0.3876 0.6277 -0.0485 -0.1026 0.0350  81  ASP A OD2 
687  N N   . GLN A 101 ? 0.4509 0.3733 0.5478 0.0145  -0.0519 0.0530  82  GLN A N   
688  C CA  . GLN A 101 ? 0.4746 0.4006 0.5206 0.0625  -0.0223 0.0331  82  GLN A CA  
689  C C   . GLN A 101 ? 0.4682 0.3710 0.4903 0.0753  0.0136  0.0314  82  GLN A C   
690  O O   . GLN A 101 ? 0.4926 0.3909 0.5001 0.0926  0.0443  0.0389  82  GLN A O   
691  C CB  . GLN A 101 ? 0.5123 0.4388 0.5269 0.0846  -0.0090 0.0208  82  GLN A CB  
692  C CG  . GLN A 101 ? 0.5498 0.4849 0.5342 0.0813  -0.0043 0.0158  82  GLN A CG  
693  C CD  . GLN A 101 ? 0.5620 0.5086 0.5199 0.0878  -0.0367 0.0191  82  GLN A CD  
694  O OE1 . GLN A 101 ? 0.5886 0.5369 0.4966 0.0725  -0.0451 0.0134  82  GLN A OE1 
695  N NE2 . GLN A 101 ? 0.5332 0.4748 0.5087 0.0966  -0.0425 0.0109  82  GLN A NE2 
696  N N   . PHE A 102 ? 0.4010 0.3247 0.4460 0.0824  0.0249  0.0339  83  PHE A N   
697  C CA  . PHE A 102 ? 0.3901 0.2988 0.4284 0.0797  -0.0170 0.0093  83  PHE A CA  
698  C C   . PHE A 102 ? 0.4079 0.3656 0.4274 0.0370  -0.0304 -0.0135 83  PHE A C   
699  O O   . PHE A 102 ? 0.4118 0.3915 0.4194 0.0287  -0.0332 -0.0143 83  PHE A O   
700  C CB  . PHE A 102 ? 0.3768 0.2739 0.4117 0.0737  -0.0572 -0.0090 83  PHE A CB  
701  C CG  . PHE A 102 ? 0.3499 0.2609 0.4156 0.0732  -0.0764 -0.0233 83  PHE A CG  
702  C CD1 . PHE A 102 ? 0.3520 0.2390 0.3983 0.0752  -0.1180 0.0102  83  PHE A CD1 
703  C CD2 . PHE A 102 ? 0.3693 0.2901 0.4231 0.0707  -0.0786 -0.0419 83  PHE A CD2 
704  C CE1 . PHE A 102 ? 0.3717 0.2443 0.4106 0.0621  -0.0874 0.0163  83  PHE A CE1 
705  C CE2 . PHE A 102 ? 0.3752 0.3012 0.4296 0.0533  -0.0828 -0.0244 83  PHE A CE2 
706  C CZ  . PHE A 102 ? 0.3543 0.2612 0.4111 0.0573  -0.0926 0.0133  83  PHE A CZ  
707  N N   . ASP A 103 ? 0.4280 0.3879 0.4462 0.0262  -0.0445 -0.0468 84  ASP A N   
708  C CA  . ASP A 103 ? 0.4772 0.4561 0.4989 0.0387  -0.0415 -0.0536 84  ASP A CA  
709  C C   . ASP A 103 ? 0.4930 0.4571 0.5202 0.0497  -0.0411 -0.0351 84  ASP A C   
710  O O   . ASP A 103 ? 0.5066 0.4367 0.5422 0.0639  -0.0296 -0.0418 84  ASP A O   
711  C CB  . ASP A 103 ? 0.5253 0.5240 0.5419 0.0461  -0.0122 -0.0748 84  ASP A CB  
712  C CG  . ASP A 103 ? 0.5816 0.5882 0.5875 0.0328  0.0234  -0.0849 84  ASP A CG  
713  O OD1 . ASP A 103 ? 0.6091 0.6210 0.6137 0.0458  0.0603  -0.0819 84  ASP A OD1 
714  O OD2 . ASP A 103 ? 0.6193 0.6135 0.5999 0.0386  0.0229  -0.0762 84  ASP A OD2 
715  N N   . SER A 104 ? 0.4857 0.4539 0.5120 0.0626  -0.0567 -0.0194 85  SER A N   
716  C CA  . SER A 104 ? 0.4725 0.4559 0.5055 0.0517  -0.0604 0.0018  85  SER A CA  
717  C C   . SER A 104 ? 0.4770 0.4221 0.5002 0.0342  -0.0646 0.0372  85  SER A C   
718  O O   . SER A 104 ? 0.4580 0.3858 0.4866 0.0454  -0.0665 0.0819  85  SER A O   
719  C CB  . SER A 104 ? 0.4510 0.4742 0.5039 0.0555  -0.0699 -0.0019 85  SER A CB  
720  O OG  . SER A 104 ? 0.4542 0.4838 0.4989 0.0480  -0.0713 -0.0131 85  SER A OG  
721  N N   . PRO A 105 ? 0.5073 0.4125 0.5142 0.0192  -0.0581 0.0576  86  PRO A N   
722  C CA  . PRO A 105 ? 0.4959 0.4227 0.5206 0.0293  -0.0643 0.0525  86  PRO A CA  
723  C C   . PRO A 105 ? 0.4665 0.3961 0.5274 0.0753  -0.0403 0.0313  86  PRO A C   
724  O O   . PRO A 105 ? 0.4776 0.3619 0.5304 0.1067  -0.0223 0.0422  86  PRO A O   
725  C CB  . PRO A 105 ? 0.5117 0.4419 0.5274 -0.0157 -0.0532 0.0624  86  PRO A CB  
726  C CG  . PRO A 105 ? 0.5417 0.4390 0.5237 -0.0304 -0.0464 0.0678  86  PRO A CG  
727  C CD  . PRO A 105 ? 0.5303 0.4182 0.5247 0.0010  -0.0433 0.0678  86  PRO A CD  
728  N N   . LEU A 106 ? 0.4319 0.3929 0.5316 0.1127  -0.0225 0.0188  87  LEU A N   
729  C CA  . LEU A 106 ? 0.4339 0.3929 0.5260 0.1026  -0.0157 0.0234  87  LEU A CA  
730  C C   . LEU A 106 ? 0.4524 0.3513 0.5016 0.1005  -0.0382 0.0336  87  LEU A C   
731  O O   . LEU A 106 ? 0.4708 0.3309 0.4974 0.1068  -0.0642 0.0400  87  LEU A O   
732  C CB  . LEU A 106 ? 0.4294 0.4386 0.5445 0.0657  -0.0002 0.0234  87  LEU A CB  
733  C CG  . LEU A 106 ? 0.4204 0.4748 0.5749 0.0307  0.0263  0.0161  87  LEU A CG  
734  C CD1 . LEU A 106 ? 0.4251 0.4800 0.5769 0.0320  0.0516  0.0111  87  LEU A CD1 
735  C CD2 . LEU A 106 ? 0.4056 0.4939 0.5971 0.0193  0.0385  0.0189  87  LEU A CD2 
736  N N   . GLY A 107 ? 0.4500 0.3331 0.4886 0.1083  -0.0301 0.0384  88  GLY A N   
737  C CA  . GLY A 107 ? 0.4367 0.3479 0.4746 0.0755  -0.0331 0.0144  88  GLY A CA  
738  C C   . GLY A 107 ? 0.4586 0.3663 0.4780 0.0663  -0.0621 -0.0134 88  GLY A C   
739  O O   . GLY A 107 ? 0.4482 0.3408 0.4577 0.0474  -0.0714 -0.0299 88  GLY A O   
740  N N   . ARG A 108 ? 0.4608 0.4010 0.5007 0.0787  -0.0820 -0.0221 89  ARG A N   
741  C CA  . ARG A 108 ? 0.4948 0.4509 0.5332 0.0961  -0.0691 -0.0297 89  ARG A CA  
742  C C   . ARG A 108 ? 0.4717 0.4371 0.5234 0.1055  -0.0719 -0.0250 89  ARG A C   
743  O O   . ARG A 108 ? 0.4899 0.4394 0.5317 0.0948  -0.0431 -0.0371 89  ARG A O   
744  C CB  . ARG A 108 ? 0.5549 0.5024 0.5720 0.1029  -0.0636 -0.0269 89  ARG A CB  
745  C CG  . ARG A 108 ? 0.6287 0.5545 0.6137 0.1101  -0.0372 -0.0284 89  ARG A CG  
746  C CD  . ARG A 108 ? 0.6851 0.6101 0.6491 0.0899  -0.0163 -0.0277 89  ARG A CD  
747  N NE  . ARG A 108 ? 0.7333 0.6579 0.6811 0.0718  0.0017  -0.0131 89  ARG A NE  
748  C CZ  . ARG A 108 ? 0.7810 0.6848 0.6935 0.0627  0.0074  -0.0041 89  ARG A CZ  
749  N NH1 . ARG A 108 ? 0.7919 0.6988 0.6985 0.0556  0.0182  0.0054  89  ARG A NH1 
750  N NH2 . ARG A 108 ? 0.8003 0.6861 0.6916 0.0623  -0.0039 -0.0123 89  ARG A NH2 
751  N N   . ARG A 109 ? 0.4254 0.4172 0.5074 0.1173  -0.0948 0.0131  90  ARG A N   
752  C CA  . ARG A 109 ? 0.4180 0.3948 0.4732 0.1156  -0.1178 0.0327  90  ARG A CA  
753  C C   . ARG A 109 ? 0.3690 0.3620 0.4061 0.0825  -0.1454 0.0493  90  ARG A C   
754  O O   . ARG A 109 ? 0.3852 0.3532 0.3529 0.0741  -0.1305 0.0542  90  ARG A O   
755  C CB  . ARG A 109 ? 0.4931 0.4531 0.5222 0.0988  -0.0837 0.0397  90  ARG A CB  
756  C CG  . ARG A 109 ? 0.5743 0.5180 0.5656 0.0726  -0.0377 0.0295  90  ARG A CG  
757  C CD  . ARG A 109 ? 0.6660 0.5788 0.6055 0.0520  -0.0152 0.0072  90  ARG A CD  
758  N NE  . ARG A 109 ? 0.7317 0.6378 0.6438 0.0337  0.0030  -0.0036 90  ARG A NE  
759  C CZ  . ARG A 109 ? 0.7712 0.6759 0.6756 0.0134  0.0032  -0.0138 90  ARG A CZ  
760  N NH1 . ARG A 109 ? 0.7804 0.6872 0.6911 -0.0004 0.0151  -0.0087 90  ARG A NH1 
761  N NH2 . ARG A 109 ? 0.7800 0.6882 0.6774 0.0140  -0.0079 -0.0317 90  ARG A NH2 
762  N N   . PRO A 110 ? 0.3481 0.3704 0.4061 0.0464  -0.1360 0.0454  91  PRO A N   
763  C CA  . PRO A 110 ? 0.3499 0.3461 0.3696 0.0373  -0.1317 0.0345  91  PRO A CA  
764  C C   . PRO A 110 ? 0.3689 0.3042 0.3376 -0.0013 -0.1298 0.0166  91  PRO A C   
765  O O   . PRO A 110 ? 0.3822 0.2237 0.3483 -0.0067 -0.1032 0.0178  91  PRO A O   
766  C CB  . PRO A 110 ? 0.3125 0.3420 0.3795 0.0643  -0.1260 0.0413  91  PRO A CB  
767  C CG  . PRO A 110 ? 0.3501 0.3661 0.3966 0.0452  -0.1396 0.0647  91  PRO A CG  
768  C CD  . PRO A 110 ? 0.3404 0.3778 0.4094 0.0553  -0.1336 0.0715  91  PRO A CD  
769  N N   . GLU A 111 ? 0.3972 0.3321 0.3121 -0.0331 -0.1082 0.0213  92  GLU A N   
770  C CA  . GLU A 111 ? 0.4226 0.3645 0.3492 -0.0386 -0.0944 0.0173  92  GLU A CA  
771  C C   . GLU A 111 ? 0.4184 0.3176 0.3472 -0.0237 -0.1193 0.0305  92  GLU A C   
772  O O   . GLU A 111 ? 0.4267 0.2937 0.3593 -0.0412 -0.1553 0.0463  92  GLU A O   
773  C CB  . GLU A 111 ? 0.4379 0.4375 0.4150 -0.0475 -0.0986 -0.0073 92  GLU A CB  
774  C CG  . GLU A 111 ? 0.5194 0.5092 0.4788 -0.0242 -0.0325 -0.0081 92  GLU A CG  
775  C CD  . GLU A 111 ? 0.5824 0.5727 0.5208 0.0030  -0.0001 -0.0038 92  GLU A CD  
776  O OE1 . GLU A 111 ? 0.6225 0.6135 0.5486 0.0049  -0.0076 0.0193  92  GLU A OE1 
777  O OE2 . GLU A 111 ? 0.5808 0.5828 0.5223 0.0473  0.0222  -0.0259 92  GLU A OE2 
778  N N   . GLN A 112 ? 0.4105 0.2917 0.3269 -0.0031 -0.1237 0.0450  93  GLN A N   
779  C CA  . GLN A 112 ? 0.3989 0.2647 0.3185 -0.0030 -0.1231 0.0839  93  GLN A CA  
780  C C   . GLN A 112 ? 0.3375 0.2405 0.2847 -0.0290 -0.1039 0.0906  93  GLN A C   
781  O O   . GLN A 112 ? 0.3507 0.2529 0.2537 -0.0610 -0.1307 0.0878  93  GLN A O   
782  C CB  . GLN A 112 ? 0.4587 0.3177 0.3530 0.0313  -0.1651 0.0945  93  GLN A CB  
783  C CG  . GLN A 112 ? 0.5181 0.4091 0.4185 0.0184  -0.1333 0.0629  93  GLN A CG  
784  C CD  . GLN A 112 ? 0.5959 0.4780 0.4692 -0.0015 -0.0988 0.0565  93  GLN A CD  
785  O OE1 . GLN A 112 ? 0.6388 0.5248 0.5248 0.0038  -0.0891 0.0540  93  GLN A OE1 
786  N NE2 . GLN A 112 ? 0.6333 0.5025 0.4881 -0.0361 -0.0823 0.0453  93  GLN A NE2 
787  N N   . VAL A 113 ? 0.2685 0.2028 0.2860 -0.0010 -0.1203 0.0952  94  VAL A N   
788  C CA  . VAL A 113 ? 0.2729 0.2028 0.2610 0.0142  -0.1096 0.0531  94  VAL A CA  
789  C C   . VAL A 113 ? 0.2766 0.1785 0.2384 -0.0106 -0.0881 0.0252  94  VAL A C   
790  O O   . VAL A 113 ? 0.2835 0.1779 0.1994 0.0086  -0.0930 0.0173  94  VAL A O   
791  C CB  . VAL A 113 ? 0.2499 0.1813 0.2856 0.0552  -0.0916 0.0527  94  VAL A CB  
792  C CG1 . VAL A 113 ? 0.3024 0.1881 0.2439 0.0271  -0.0748 0.0420  94  VAL A CG1 
793  C CG2 . VAL A 113 ? 0.2549 0.1901 0.3169 0.0531  -0.0690 0.0494  94  VAL A CG2 
794  N N   . ALA A 114 ? 0.2667 0.1967 0.2372 0.0022  -0.0993 0.0196  95  ALA A N   
795  C CA  . ALA A 114 ? 0.2596 0.2092 0.2406 -0.0152 -0.0655 0.0258  95  ALA A CA  
796  C C   . ALA A 114 ? 0.2678 0.2138 0.2089 -0.0236 -0.0393 0.0409  95  ALA A C   
797  O O   . ALA A 114 ? 0.2136 0.2070 0.1924 -0.0199 -0.0162 0.0286  95  ALA A O   
798  C CB  . ALA A 114 ? 0.2320 0.1884 0.2385 -0.0284 -0.0785 0.0142  95  ALA A CB  
799  N N   . LEU A 115 ? 0.3194 0.2249 0.1931 -0.0776 -0.0486 0.0633  96  LEU A N   
800  C CA  A LEU A 115 ? 0.3401 0.2595 0.1893 -0.0616 -0.0566 0.0749  96  LEU A CA  
801  C CA  B LEU A 115 ? 0.3372 0.2589 0.1903 -0.0670 -0.0541 0.0713  96  LEU A CA  
802  C C   . LEU A 115 ? 0.3363 0.2316 0.1901 -0.0613 -0.0311 0.0541  96  LEU A C   
803  O O   . LEU A 115 ? 0.3672 0.2308 0.1860 -0.0534 -0.0160 0.0688  96  LEU A O   
804  C CB  A LEU A 115 ? 0.3826 0.3269 0.2490 -0.0505 -0.0910 0.0649  96  LEU A CB  
805  C CB  B LEU A 115 ? 0.3728 0.3260 0.2501 -0.0675 -0.0867 0.0529  96  LEU A CB  
806  C CG  A LEU A 115 ? 0.4252 0.3591 0.3225 -0.0266 -0.0587 0.0663  96  LEU A CG  
807  C CG  B LEU A 115 ? 0.4066 0.3537 0.3233 -0.0591 -0.0578 0.0453  96  LEU A CG  
808  C CD1 A LEU A 115 ? 0.4713 0.4010 0.4010 -0.0083 -0.0418 0.0727  96  LEU A CD1 
809  C CD1 B LEU A 115 ? 0.4178 0.4010 0.4010 -0.0477 -0.0421 0.0456  96  LEU A CD1 
810  C CD2 A LEU A 115 ? 0.4420 0.3731 0.3348 0.0009  -0.0466 0.0783  96  LEU A CD2 
811  C CD2 B LEU A 115 ? 0.4205 0.3657 0.3304 -0.0751 -0.0601 0.0435  96  LEU A CD2 
812  N N   . ILE A 116 ? 0.2898 0.1744 0.2024 -0.0779 -0.0460 0.0341  97  ILE A N   
813  C CA  . ILE A 116 ? 0.3103 0.1853 0.1894 -0.0342 -0.0356 0.0505  97  ILE A CA  
814  C C   . ILE A 116 ? 0.2939 0.1763 0.1690 -0.0300 -0.0356 0.0481  97  ILE A C   
815  O O   . ILE A 116 ? 0.2675 0.1847 0.1671 -0.0133 -0.0202 0.0347  97  ILE A O   
816  C CB  . ILE A 116 ? 0.3008 0.1805 0.1903 -0.0206 -0.0235 0.0567  97  ILE A CB  
817  C CG1 . ILE A 116 ? 0.3379 0.2110 0.2426 0.0234  -0.0209 0.0472  97  ILE A CG1 
818  C CG2 . ILE A 116 ? 0.3010 0.2106 0.2023 -0.0232 -0.0508 0.0397  97  ILE A CG2 
819  C CD1 . ILE A 116 ? 0.3112 0.2400 0.2654 0.0426  -0.0471 0.0422  97  ILE A CD1 
820  N N   . CYS A 117 ? 0.3001 0.1751 0.1588 0.0037  0.0042  0.0306  98  CYS A N   
821  C CA  . CYS A 117 ? 0.2621 0.1749 0.1469 0.0053  -0.0128 0.0317  98  CYS A CA  
822  C C   . CYS A 117 ? 0.3095 0.1505 0.1303 0.0150  -0.0293 0.0357  98  CYS A C   
823  O O   . CYS A 117 ? 0.2667 0.1722 0.1237 -0.0318 -0.0308 0.0453  98  CYS A O   
824  C CB  . CYS A 117 ? 0.2649 0.1994 0.1418 0.0069  -0.0117 0.0116  98  CYS A CB  
825  S SG  . CYS A 117 ? 0.2516 0.2055 0.1922 0.0070  -0.0189 0.0287  98  CYS A SG  
826  N N   . GLU A 118 ? 0.3079 0.1558 0.1289 -0.0019 -0.0031 0.0133  99  GLU A N   
827  C CA  . GLU A 118 ? 0.2685 0.1545 0.1258 -0.0274 -0.0005 -0.0125 99  GLU A CA  
828  C C   . GLU A 118 ? 0.2991 0.1641 0.1315 -0.0286 0.0053  0.0112  99  GLU A C   
829  O O   . GLU A 118 ? 0.2877 0.1549 0.1351 -0.0158 0.0011  0.0291  99  GLU A O   
830  C CB  . GLU A 118 ? 0.2963 0.1578 0.1340 0.0025  -0.0256 -0.0122 99  GLU A CB  
831  C CG  . GLU A 118 ? 0.2856 0.1697 0.1455 0.0429  -0.0197 0.0056  99  GLU A CG  
832  C CD  . GLU A 118 ? 0.3228 0.1809 0.1653 0.0350  0.0126  0.0025  99  GLU A CD  
833  O OE1 . GLU A 118 ? 0.3722 0.2334 0.1886 0.0747  0.0057  0.0198  99  GLU A OE1 
834  O OE2 . GLU A 118 ? 0.3065 0.1819 0.1697 -0.0129 0.0059  0.0159  99  GLU A OE2 
835  N N   . ARG A 119 ? 0.3096 0.1768 0.1345 -0.0457 -0.0080 0.0304  100 ARG A N   
836  C CA  . ARG A 119 ? 0.3158 0.1944 0.1149 -0.0329 -0.0161 0.0479  100 ARG A CA  
837  C C   . ARG A 119 ? 0.2809 0.1732 0.1495 -0.0077 -0.0125 0.0287  100 ARG A C   
838  O O   . ARG A 119 ? 0.2877 0.1549 0.1660 0.0154  0.0292  0.0340  100 ARG A O   
839  C CB  . ARG A 119 ? 0.3089 0.2008 0.0995 -0.0281 -0.0377 0.0416  100 ARG A CB  
840  C CG  . ARG A 119 ? 0.2581 0.2207 0.1003 -0.0652 -0.0116 0.0057  100 ARG A CG  
841  C CD  . ARG A 119 ? 0.2634 0.2255 0.1407 -0.0537 -0.0155 0.0398  100 ARG A CD  
842  N NE  . ARG A 119 ? 0.2850 0.2028 0.1656 -0.0697 -0.0146 0.0442  100 ARG A NE  
843  C CZ  . ARG A 119 ? 0.3419 0.2070 0.1736 -0.0912 0.0169  0.0227  100 ARG A CZ  
844  N NH1 . ARG A 119 ? 0.3989 0.2189 0.1666 -0.0744 0.0135  0.0005  100 ARG A NH1 
845  N NH2 . ARG A 119 ? 0.3603 0.2327 0.1923 -0.0903 0.0199  0.0360  100 ARG A NH2 
846  N N   . LEU A 120 ? 0.2532 0.1730 0.1423 -0.0375 -0.0001 0.0397  101 LEU A N   
847  C CA  . LEU A 120 ? 0.2485 0.1395 0.1442 0.0181  -0.0244 0.0154  101 LEU A CA  
848  C C   . LEU A 120 ? 0.2509 0.1555 0.1552 0.0154  -0.0070 0.0317  101 LEU A C   
849  O O   . LEU A 120 ? 0.2520 0.1693 0.1551 0.0094  -0.0197 0.0186  101 LEU A O   
850  C CB  . LEU A 120 ? 0.2688 0.1083 0.1877 -0.0036 -0.0281 -0.0100 101 LEU A CB  
851  C CG  . LEU A 120 ? 0.2710 0.1113 0.2221 -0.0065 -0.0063 -0.0159 101 LEU A CG  
852  C CD1 . LEU A 120 ? 0.3142 0.1132 0.2459 0.0332  0.0065  0.0396  101 LEU A CD1 
853  C CD2 . LEU A 120 ? 0.2510 0.0984 0.2377 -0.0511 -0.0458 -0.0266 101 LEU A CD2 
854  N N   . SER A 121 ? 0.2625 0.1319 0.1657 -0.0188 0.0266  0.0261  102 SER A N   
855  C CA  . SER A 121 ? 0.2522 0.1543 0.1606 -0.0336 0.0398  0.0301  102 SER A CA  
856  C C   . SER A 121 ? 0.2741 0.1788 0.1467 -0.0033 0.0285  0.0427  102 SER A C   
857  O O   . SER A 121 ? 0.2804 0.2075 0.1436 -0.0145 0.0141  0.0559  102 SER A O   
858  C CB  . SER A 121 ? 0.2424 0.1468 0.1236 -0.0507 0.0237  0.0220  102 SER A CB  
859  O OG  . SER A 121 ? 0.2964 0.1814 0.0963 -0.0378 0.0002  0.0238  102 SER A OG  
860  N N   . ALA A 122 ? 0.2914 0.1677 0.1409 0.0059  0.0301  0.0294  103 ALA A N   
861  C CA  . ALA A 122 ? 0.2965 0.2091 0.1416 -0.0065 0.0160  0.0315  103 ALA A CA  
862  C C   . ALA A 122 ? 0.3076 0.1843 0.1762 0.0048  0.0385  0.0259  103 ALA A C   
863  O O   . ALA A 122 ? 0.3490 0.1812 0.1750 0.0234  0.0529  0.0033  103 ALA A O   
864  C CB  . ALA A 122 ? 0.3130 0.2095 0.1239 0.0077  0.0098  0.0252  103 ALA A CB  
865  N N   . ILE A 123 ? 0.2699 0.1688 0.1809 -0.0312 0.0395  0.0143  104 ILE A N   
866  C CA  . ILE A 123 ? 0.2592 0.1367 0.1800 -0.0375 0.0153  0.0366  104 ILE A CA  
867  C C   . ILE A 123 ? 0.2474 0.1416 0.1933 -0.0065 0.0348  0.0374  104 ILE A C   
868  O O   . ILE A 123 ? 0.2359 0.1554 0.2121 0.0060  0.0552  0.0228  104 ILE A O   
869  C CB  . ILE A 123 ? 0.2707 0.1407 0.2086 -0.0493 0.0099  0.0232  104 ILE A CB  
870  C CG1 . ILE A 123 ? 0.3294 0.1520 0.2462 -0.0549 0.0293  0.0479  104 ILE A CG1 
871  C CG2 . ILE A 123 ? 0.2637 0.1622 0.2307 -0.0272 0.0381  0.0087  104 ILE A CG2 
872  C CD1 . ILE A 123 ? 0.3553 0.1932 0.2930 -0.0563 0.0249  0.0493  104 ILE A CD1 
873  N N   . ALA A 124 ? 0.2827 0.1199 0.1849 -0.0458 0.0129  0.0486  105 ALA A N   
874  C CA  . ALA A 124 ? 0.2734 0.1522 0.1680 -0.0501 0.0504  0.0405  105 ALA A CA  
875  C C   . ALA A 124 ? 0.2695 0.1576 0.1638 -0.0118 0.0411  0.0273  105 ALA A C   
876  O O   . ALA A 124 ? 0.2700 0.1804 0.1868 0.0082  -0.0072 -0.0072 105 ALA A O   
877  C CB  . ALA A 124 ? 0.2502 0.1600 0.1583 0.0062  0.0617  0.0336  105 ALA A CB  
878  N N   . HIS A 125 ? 0.2901 0.1365 0.1618 -0.0610 0.0379  0.0129  106 HIS A N   
879  C CA  . HIS A 125 ? 0.2527 0.1393 0.1865 -0.0695 0.0431  0.0149  106 HIS A CA  
880  C C   . HIS A 125 ? 0.2706 0.1656 0.2196 -0.0412 0.0750  0.0056  106 HIS A C   
881  O O   . HIS A 125 ? 0.2847 0.1987 0.2785 -0.0133 0.0825  -0.0175 106 HIS A O   
882  C CB  . HIS A 125 ? 0.2561 0.1550 0.1925 -0.0670 0.0371  0.0128  106 HIS A CB  
883  C CG  . HIS A 125 ? 0.2026 0.1311 0.1935 -0.0330 0.0591  0.0251  106 HIS A CG  
884  N ND1 . HIS A 125 ? 0.1970 0.1170 0.1783 -0.0146 0.0327  0.0061  106 HIS A ND1 
885  C CD2 . HIS A 125 ? 0.2487 0.1519 0.1892 -0.0070 0.0451  0.0081  106 HIS A CD2 
886  C CE1 . HIS A 125 ? 0.1922 0.1151 0.2004 -0.0190 0.0307  0.0121  106 HIS A CE1 
887  N NE2 . HIS A 125 ? 0.2305 0.1454 0.1868 -0.0102 0.0203  0.0130  106 HIS A NE2 
888  N N   . GLY A 126 ? 0.2663 0.1973 0.2333 -0.0667 0.0530  0.0230  107 GLY A N   
889  C CA  . GLY A 126 ? 0.2939 0.2198 0.2542 -0.0317 0.0659  0.0333  107 GLY A CA  
890  C C   . GLY A 126 ? 0.3129 0.2650 0.2744 0.0071  0.0841  0.0439  107 GLY A C   
891  O O   . GLY A 126 ? 0.3427 0.3223 0.2997 0.0285  0.0465  0.0376  107 GLY A O   
892  N N   . THR A 127 ? 0.3442 0.2569 0.2762 -0.0073 0.1054  0.0506  108 THR A N   
893  C CA  . THR A 127 ? 0.3777 0.2627 0.3099 0.0105  0.0608  0.0547  108 THR A CA  
894  C C   . THR A 127 ? 0.4281 0.2709 0.3148 0.0191  0.0286  0.0480  108 THR A C   
895  O O   . THR A 127 ? 0.4708 0.3144 0.3115 0.0270  -0.0173 0.0200  108 THR A O   
896  C CB  . THR A 127 ? 0.3478 0.2386 0.3411 0.0099  0.1002  0.0548  108 THR A CB  
897  O OG1 . THR A 127 ? 0.3643 0.2713 0.4164 -0.0010 0.0582  0.0336  108 THR A OG1 
898  C CG2 . THR A 127 ? 0.3819 0.2188 0.3409 -0.0014 0.1284  0.0382  108 THR A CG2 
899  N N   . LEU A 128 ? 0.3519 0.2300 0.3371 -0.0185 0.0472  0.0694  109 LEU A N   
900  C CA  . LEU A 128 ? 0.3597 0.2333 0.3448 -0.0192 0.0501  0.0820  109 LEU A CA  
901  C C   . LEU A 128 ? 0.3991 0.2472 0.3685 -0.0159 0.0226  0.0540  109 LEU A C   
902  O O   . LEU A 128 ? 0.3515 0.2954 0.3920 -0.0140 0.0290  0.0875  109 LEU A O   
903  C CB  . LEU A 128 ? 0.3659 0.2804 0.3269 0.0578  0.0340  0.0758  109 LEU A CB  
904  C CG  . LEU A 128 ? 0.4049 0.3395 0.3354 0.0566  -0.0081 0.0925  109 LEU A CG  
905  C CD1 . LEU A 128 ? 0.3983 0.3481 0.3373 0.0388  0.0005  0.1159  109 LEU A CD1 
906  C CD2 . LEU A 128 ? 0.3813 0.3144 0.3010 0.0543  -0.0811 0.0953  109 LEU A CD2 
907  N N   . THR A 129 ? 0.4580 0.2473 0.3670 -0.0610 0.0237  0.0282  110 THR A N   
908  C CA  A THR A 129 ? 0.4441 0.2652 0.3451 -0.0658 0.0117  0.0038  110 THR A CA  
909  C CA  B THR A 129 ? 0.4499 0.2973 0.3690 -0.0563 0.0143  0.0131  110 THR A CA  
910  C C   . THR A 129 ? 0.4271 0.2804 0.3356 -0.0406 0.0159  0.0119  110 THR A C   
911  O O   . THR A 129 ? 0.4653 0.2791 0.3318 -0.0090 0.0021  -0.0001 110 THR A O   
912  C CB  A THR A 129 ? 0.4415 0.2432 0.3269 -0.0869 -0.0124 -0.0143 110 THR A CB  
913  C CB  B THR A 129 ? 0.4451 0.3421 0.3999 -0.0599 -0.0023 0.0206  110 THR A CB  
914  O OG1 A THR A 129 ? 0.4408 0.2306 0.3162 -0.0957 -0.0094 -0.0543 110 THR A OG1 
915  O OG1 B THR A 129 ? 0.4374 0.3637 0.4113 -0.0912 -0.0048 0.0301  110 THR A OG1 
916  C CG2 A THR A 129 ? 0.4151 0.2316 0.3198 -0.1266 -0.0322 0.0064  110 THR A CG2 
917  C CG2 B THR A 129 ? 0.4395 0.3609 0.4169 -0.0619 -0.0125 0.0205  110 THR A CG2 
918  N N   . ALA A 130 ? 0.3696 0.2587 0.2984 -0.0141 0.0267  0.0048  111 ALA A N   
919  C CA  . ALA A 130 ? 0.3610 0.2225 0.2368 -0.0230 0.0307  0.0480  111 ALA A CA  
920  C C   . ALA A 130 ? 0.2919 0.1957 0.2007 -0.0209 0.0015  0.0388  111 ALA A C   
921  O O   . ALA A 130 ? 0.3512 0.2113 0.2252 -0.0058 0.0494  0.0340  111 ALA A O   
922  C CB  . ALA A 130 ? 0.4005 0.2404 0.2344 -0.0130 0.0475  0.0284  111 ALA A CB  
923  N N   . VAL A 131 ? 0.2428 0.1781 0.1690 -0.0292 -0.0001 0.0057  112 VAL A N   
924  C CA  A VAL A 131 ? 0.2576 0.1947 0.1693 -0.0246 -0.0313 0.0095  112 VAL A CA  
925  C CA  B VAL A 131 ? 0.2460 0.1787 0.1615 -0.0305 -0.0236 -0.0010 112 VAL A CA  
926  C C   . VAL A 131 ? 0.2734 0.1806 0.1683 -0.0413 -0.0187 0.0070  112 VAL A C   
927  O O   . VAL A 131 ? 0.3029 0.2121 0.1655 -0.0628 -0.0211 0.0186  112 VAL A O   
928  C CB  A VAL A 131 ? 0.2599 0.2164 0.1797 -0.0228 -0.0273 0.0509  112 VAL A CB  
929  C CB  B VAL A 131 ? 0.2250 0.1708 0.1581 -0.0331 -0.0016 0.0222  112 VAL A CB  
930  C CG1 A VAL A 131 ? 0.2558 0.2088 0.1730 -0.0114 -0.0467 0.0543  112 VAL A CG1 
931  C CG1 B VAL A 131 ? 0.1991 0.1414 0.1262 -0.0010 0.0327  0.0114  112 VAL A CG1 
932  C CG2 A VAL A 131 ? 0.2606 0.2326 0.1908 -0.0120 -0.0451 0.0754  112 VAL A CG2 
933  C CG2 B VAL A 131 ? 0.2249 0.1798 0.1638 -0.0202 -0.0308 0.0232  112 VAL A CG2 
934  N N   . THR A 132 ? 0.2912 0.1472 0.1655 -0.0251 -0.0260 0.0361  113 THR A N   
935  C CA  . THR A 132 ? 0.2847 0.1771 0.1427 -0.0422 -0.0470 0.0051  113 THR A CA  
936  C C   . THR A 132 ? 0.2990 0.1826 0.1310 -0.0196 -0.0201 0.0219  113 THR A C   
937  O O   . THR A 132 ? 0.3074 0.2140 0.1418 -0.0227 0.0130  0.0362  113 THR A O   
938  C CB  . THR A 132 ? 0.2906 0.1748 0.1771 -0.0657 -0.0206 -0.0099 113 THR A CB  
939  O OG1 . THR A 132 ? 0.3325 0.2052 0.1989 -0.0878 -0.0156 0.0220  113 THR A OG1 
940  C CG2 . THR A 132 ? 0.2841 0.1403 0.1667 -0.0517 0.0206  -0.0046 113 THR A CG2 
941  N N   . SER A 133 ? 0.3137 0.1903 0.1420 -0.0426 0.0168  0.0296  114 SER A N   
942  C CA  . SER A 133 ? 0.2945 0.1660 0.1536 -0.0536 0.0026  0.0158  114 SER A CA  
943  C C   . SER A 133 ? 0.3082 0.1721 0.1536 -0.0550 -0.0017 0.0245  114 SER A C   
944  O O   . SER A 133 ? 0.2927 0.1532 0.1636 -0.0385 0.0047  0.0124  114 SER A O   
945  C CB  . SER A 133 ? 0.2955 0.1599 0.1941 -0.0125 -0.0179 0.0239  114 SER A CB  
946  O OG  . SER A 133 ? 0.3214 0.1548 0.1933 -0.0372 0.0004  0.0363  114 SER A OG  
947  N N   . PRO A 134 ? 0.3333 0.1642 0.1379 -0.0151 0.0087  0.0179  115 PRO A N   
948  C CA  . PRO A 134 ? 0.3071 0.1374 0.1382 -0.0388 -0.0142 0.0058  115 PRO A CA  
949  C C   . PRO A 134 ? 0.2986 0.1391 0.1230 -0.0464 -0.0256 0.0056  115 PRO A C   
950  O O   . PRO A 134 ? 0.3378 0.1502 0.1270 -0.0354 -0.0444 0.0197  115 PRO A O   
951  C CB  . PRO A 134 ? 0.3233 0.1822 0.1486 0.0213  -0.0344 0.0176  115 PRO A CB  
952  C CG  . PRO A 134 ? 0.3499 0.1637 0.1514 0.0351  -0.0318 0.0359  115 PRO A CG  
953  C CD  . PRO A 134 ? 0.3451 0.1657 0.1637 0.0083  0.0026  0.0087  115 PRO A CD  
954  N N   . SER A 135 ? 0.2911 0.1342 0.1309 -0.0337 0.0101  0.0287  116 SER A N   
955  C CA  . SER A 135 ? 0.3146 0.1587 0.1722 -0.0336 0.0307  0.0269  116 SER A CA  
956  C C   . SER A 135 ? 0.3283 0.1592 0.1312 -0.0077 0.0058  0.0286  116 SER A C   
957  O O   . SER A 135 ? 0.3504 0.1650 0.1033 -0.0184 0.0266  0.0281  116 SER A O   
958  C CB  . SER A 135 ? 0.2914 0.1522 0.2481 -0.0177 0.0476  0.0065  116 SER A CB  
959  O OG  . SER A 135 ? 0.3527 0.1920 0.2895 0.0000  0.0308  0.0028  116 SER A OG  
960  N N   . GLU A 136 ? 0.3078 0.1444 0.1347 -0.0263 0.0210  -0.0002 117 GLU A N   
961  C CA  . GLU A 136 ? 0.3125 0.1270 0.1347 -0.0684 0.0020  -0.0324 117 GLU A CA  
962  C C   . GLU A 136 ? 0.3013 0.1399 0.1363 -0.0463 0.0186  0.0074  117 GLU A C   
963  O O   . GLU A 136 ? 0.3129 0.1345 0.1480 -0.0429 -0.0215 0.0411  117 GLU A O   
964  C CB  . GLU A 136 ? 0.3326 0.1476 0.1286 -0.0841 0.0092  -0.0322 117 GLU A CB  
965  C CG  . GLU A 136 ? 0.3297 0.1737 0.1565 -0.0628 -0.0081 0.0033  117 GLU A CG  
966  C CD  . GLU A 136 ? 0.3410 0.1765 0.1464 -0.0372 0.0052  0.0251  117 GLU A CD  
967  O OE1 . GLU A 136 ? 0.3430 0.2031 0.1311 -0.0560 0.0311  0.0269  117 GLU A OE1 
968  O OE2 . GLU A 136 ? 0.4118 0.1950 0.1550 -0.0429 0.0025  -0.0023 117 GLU A OE2 
969  N N   . ARG A 137 ? 0.2930 0.1276 0.1142 -0.0672 0.0125  0.0023  118 ARG A N   
970  C CA  . ARG A 137 ? 0.2791 0.1565 0.1356 -0.0958 0.0419  0.0123  118 ARG A CA  
971  C C   . ARG A 137 ? 0.3232 0.1597 0.1387 -0.0550 0.0418  0.0138  118 ARG A C   
972  O O   . ARG A 137 ? 0.2986 0.1955 0.1415 -0.0672 0.0155  0.0270  118 ARG A O   
973  C CB  . ARG A 137 ? 0.2640 0.1925 0.1758 -0.1026 0.0371  0.0434  118 ARG A CB  
974  C CG  . ARG A 137 ? 0.2641 0.2020 0.2208 -0.0938 0.0351  0.0768  118 ARG A CG  
975  C CD  . ARG A 137 ? 0.3581 0.2152 0.2530 -0.0915 -0.0004 0.0797  118 ARG A CD  
976  N NE  . ARG A 137 ? 0.4191 0.2371 0.2556 -0.0640 0.0120  0.1002  118 ARG A NE  
977  C CZ  . ARG A 137 ? 0.3989 0.2625 0.2472 -0.1128 0.0157  0.0591  118 ARG A CZ  
978  N NH1 . ARG A 137 ? 0.3807 0.2934 0.2314 -0.1087 0.0407  0.0538  118 ARG A NH1 
979  N NH2 . ARG A 137 ? 0.3632 0.2895 0.2839 -0.1372 0.0020  0.0630  118 ARG A NH2 
980  N N   . ALA A 138 ? 0.3260 0.1228 0.1324 -0.0508 0.0559  0.0126  119 ALA A N   
981  C CA  . ALA A 138 ? 0.3416 0.1196 0.1287 -0.0265 0.0294  0.0219  119 ALA A CA  
982  C C   . ALA A 138 ? 0.2880 0.1294 0.1393 -0.0392 0.0118  0.0153  119 ALA A C   
983  O O   . ALA A 138 ? 0.2734 0.1529 0.1609 -0.0271 -0.0170 0.0021  119 ALA A O   
984  C CB  . ALA A 138 ? 0.3599 0.1294 0.1211 -0.0352 0.0142  0.0200  119 ALA A CB  
985  N N   . PHE A 139 ? 0.2690 0.1330 0.1350 -0.0820 0.0074  0.0317  120 PHE A N   
986  C CA  . PHE A 139 ? 0.2557 0.1417 0.1622 -0.0750 0.0304  0.0435  120 PHE A CA  
987  C C   . PHE A 139 ? 0.2579 0.1459 0.1584 -0.0507 0.0420  0.0585  120 PHE A C   
988  O O   . PHE A 139 ? 0.2670 0.1529 0.1615 -0.0343 0.0436  0.0356  120 PHE A O   
989  C CB  . PHE A 139 ? 0.2639 0.1385 0.1557 -0.0536 0.0330  0.0550  120 PHE A CB  
990  C CG  . PHE A 139 ? 0.2290 0.1231 0.1462 -0.0423 0.0308  0.0547  120 PHE A CG  
991  C CD1 . PHE A 139 ? 0.2181 0.1496 0.1605 -0.0454 0.0239  0.0494  120 PHE A CD1 
992  C CD2 . PHE A 139 ? 0.2262 0.1201 0.1629 -0.0486 0.0478  0.0386  120 PHE A CD2 
993  C CE1 . PHE A 139 ? 0.2083 0.1102 0.1743 -0.0630 0.0189  0.0377  120 PHE A CE1 
994  C CE2 . PHE A 139 ? 0.2248 0.1423 0.1824 -0.0298 0.0596  0.0185  120 PHE A CE2 
995  C CZ  . PHE A 139 ? 0.2165 0.1323 0.1819 -0.0581 0.0292  0.0128  120 PHE A CZ  
996  N N   . ALA A 140 ? 0.2389 0.1867 0.1582 -0.0210 0.0395  0.0497  121 ALA A N   
997  C CA  . ALA A 140 ? 0.2449 0.1913 0.1239 -0.0032 0.0568  0.0254  121 ALA A CA  
998  C C   . ALA A 140 ? 0.2384 0.1868 0.1540 -0.0221 0.0583  0.0423  121 ALA A C   
999  O O   . ALA A 140 ? 0.2701 0.1895 0.1758 -0.0149 0.0499  0.0343  121 ALA A O   
1000 C CB  . ALA A 140 ? 0.2470 0.2212 0.1263 0.0163  0.0747  0.0124  121 ALA A CB  
1001 N N   . ASP A 141 ? 0.2328 0.1801 0.1747 -0.0429 0.0378  0.0312  122 ASP A N   
1002 C CA  . ASP A 141 ? 0.2847 0.1843 0.2104 -0.0464 0.0094  0.0373  122 ASP A CA  
1003 C C   . ASP A 141 ? 0.2837 0.1747 0.1880 -0.0309 0.0133  0.0147  122 ASP A C   
1004 O O   . ASP A 141 ? 0.3221 0.1562 0.1696 -0.0421 -0.0120 0.0237  122 ASP A O   
1005 C CB  . ASP A 141 ? 0.2684 0.1775 0.2243 -0.0714 -0.0124 0.0639  122 ASP A CB  
1006 C CG  . ASP A 141 ? 0.3257 0.2739 0.2724 -0.0361 0.0400  0.0800  122 ASP A CG  
1007 O OD1 . ASP A 141 ? 0.3318 0.3747 0.2975 0.0106  0.0080  0.1051  122 ASP A OD1 
1008 O OD2 . ASP A 141 ? 0.3412 0.2557 0.2595 -0.0435 0.0771  0.0335  122 ASP A OD2 
1009 N N   . LEU A 142 ? 0.2668 0.1455 0.1821 -0.0375 0.0387  0.0140  123 LEU A N   
1010 C CA  . LEU A 142 ? 0.2328 0.1043 0.1664 -0.0105 0.0322  0.0292  123 LEU A CA  
1011 C C   . LEU A 142 ? 0.2556 0.1166 0.1666 -0.0317 0.0360  -0.0024 123 LEU A C   
1012 O O   . LEU A 142 ? 0.2337 0.1703 0.1468 -0.0387 0.0199  -0.0128 123 LEU A O   
1013 C CB  . LEU A 142 ? 0.2020 0.1171 0.2025 -0.0093 0.0053  -0.0162 123 LEU A CB  
1014 C CG  . LEU A 142 ? 0.2321 0.1494 0.1884 -0.0062 -0.0236 -0.0342 123 LEU A CG  
1015 C CD1 . LEU A 142 ? 0.2617 0.1726 0.1987 -0.0111 -0.0824 -0.0214 123 LEU A CD1 
1016 C CD2 . LEU A 142 ? 0.2730 0.1630 0.1695 -0.0089 -0.0099 -0.0631 123 LEU A CD2 
1017 N N   . TRP A 143 ? 0.2318 0.1175 0.1664 -0.0359 0.0814  -0.0233 124 TRP A N   
1018 C CA  . TRP A 143 ? 0.2038 0.1358 0.1604 -0.0300 0.0465  -0.0284 124 TRP A CA  
1019 C C   . TRP A 143 ? 0.2365 0.1480 0.1756 -0.0196 0.0395  -0.0121 124 TRP A C   
1020 O O   . TRP A 143 ? 0.2381 0.1526 0.1964 -0.0082 0.0230  0.0034  124 TRP A O   
1021 C CB  . TRP A 143 ? 0.2232 0.1233 0.1617 -0.0395 0.0383  -0.0131 124 TRP A CB  
1022 C CG  . TRP A 143 ? 0.2335 0.1507 0.1535 -0.0613 0.0239  0.0269  124 TRP A CG  
1023 C CD1 . TRP A 143 ? 0.2447 0.1697 0.1455 -0.0520 0.0032  0.0292  124 TRP A CD1 
1024 C CD2 . TRP A 143 ? 0.2305 0.1634 0.1645 -0.0125 0.0186  0.0377  124 TRP A CD2 
1025 N NE1 . TRP A 143 ? 0.2418 0.1703 0.1525 -0.0846 -0.0044 0.0553  124 TRP A NE1 
1026 C CE2 . TRP A 143 ? 0.2251 0.1793 0.1626 -0.0452 -0.0086 0.0643  124 TRP A CE2 
1027 C CE3 . TRP A 143 ? 0.2192 0.1772 0.1757 -0.0037 0.0314  0.0503  124 TRP A CE3 
1028 C CZ2 . TRP A 143 ? 0.2498 0.1960 0.1894 -0.0400 0.0037  0.0545  124 TRP A CZ2 
1029 C CZ3 . TRP A 143 ? 0.2021 0.1483 0.1960 -0.0089 0.0083  0.0574  124 TRP A CZ3 
1030 C CH2 . TRP A 143 ? 0.2309 0.1785 0.1946 -0.0008 -0.0014 0.0628  124 TRP A CH2 
1031 N N   . ARG A 144 ? 0.2069 0.1932 0.1892 -0.0616 0.0228  -0.0201 125 ARG A N   
1032 C CA  . ARG A 144 ? 0.2034 0.1962 0.1846 -0.0712 0.0600  0.0122  125 ARG A CA  
1033 C C   . ARG A 144 ? 0.2270 0.2040 0.1681 -0.0151 0.0216  0.0182  125 ARG A C   
1034 O O   . ARG A 144 ? 0.2355 0.2498 0.1860 -0.0083 0.0132  0.0084  125 ARG A O   
1035 C CB  . ARG A 144 ? 0.2262 0.2668 0.2167 -0.0842 0.1030  0.0144  125 ARG A CB  
1036 C CG  . ARG A 144 ? 0.2529 0.3258 0.2505 -0.0883 0.1162  0.0378  125 ARG A CG  
1037 C CD  . ARG A 144 ? 0.3799 0.3963 0.3144 -0.0531 0.1051  0.0341  125 ARG A CD  
1038 N NE  . ARG A 144 ? 0.4688 0.4500 0.3839 -0.0660 0.0932  0.0413  125 ARG A NE  
1039 C CZ  . ARG A 144 ? 0.4976 0.4857 0.4214 -0.0622 0.0834  0.0263  125 ARG A CZ  
1040 N NH1 . ARG A 144 ? 0.5531 0.5203 0.4386 -0.0655 0.0598  0.0330  125 ARG A NH1 
1041 N NH2 . ARG A 144 ? 0.4786 0.4834 0.4242 -0.0811 0.1071  0.0223  125 ARG A NH2 
1042 N N   . ARG A 145 ? 0.2081 0.1645 0.1516 -0.0471 0.0181  -0.0075 126 ARG A N   
1043 C CA  . ARG A 145 ? 0.2226 0.1616 0.1572 -0.0616 0.0220  0.0246  126 ARG A CA  
1044 C C   . ARG A 145 ? 0.2209 0.1785 0.1647 -0.0609 0.0211  0.0262  126 ARG A C   
1045 O O   . ARG A 145 ? 0.2153 0.1833 0.1677 -0.0472 0.0350  0.0132  126 ARG A O   
1046 C CB  . ARG A 145 ? 0.2233 0.1347 0.1593 -0.0678 0.0318  0.0401  126 ARG A CB  
1047 C CG  . ARG A 145 ? 0.2557 0.1162 0.1852 -0.0356 0.0201  0.0451  126 ARG A CG  
1048 C CD  . ARG A 145 ? 0.2678 0.1262 0.1595 -0.0141 0.0316  0.0404  126 ARG A CD  
1049 N NE  . ARG A 145 ? 0.2662 0.1260 0.1807 -0.0284 0.0344  0.0283  126 ARG A NE  
1050 C CZ  . ARG A 145 ? 0.2850 0.1381 0.1735 -0.0256 0.0266  0.0383  126 ARG A CZ  
1051 N NH1 . ARG A 145 ? 0.2950 0.1587 0.1862 -0.0205 0.0504  0.0258  126 ARG A NH1 
1052 N NH2 . ARG A 145 ? 0.2666 0.1497 0.1633 -0.0396 0.0142  0.0278  126 ARG A NH2 
1053 N N   . ILE A 146 ? 0.1689 0.1696 0.1600 -0.0531 0.0505  0.0165  127 ILE A N   
1054 C CA  . ILE A 146 ? 0.2034 0.1494 0.1492 -0.0512 0.0345  0.0060  127 ILE A CA  
1055 C C   . ILE A 146 ? 0.2205 0.1625 0.1327 -0.0201 0.0313  -0.0020 127 ILE A C   
1056 O O   . ILE A 146 ? 0.2177 0.1739 0.1510 -0.0343 0.0134  0.0194  127 ILE A O   
1057 C CB  . ILE A 146 ? 0.2015 0.1468 0.1353 -0.0339 -0.0042 0.0080  127 ILE A CB  
1058 C CG1 . ILE A 146 ? 0.1577 0.1730 0.1367 0.0134  0.0027  -0.0076 127 ILE A CG1 
1059 C CG2 . ILE A 146 ? 0.1960 0.1802 0.1053 -0.0300 0.0028  0.0188  127 ILE A CG2 
1060 C CD1 . ILE A 146 ? 0.1796 0.1689 0.1576 0.0024  -0.0322 0.0020  127 ILE A CD1 
1061 N N   . THR A 147 ? 0.2240 0.1410 0.1918 -0.0176 0.0461  -0.0221 128 THR A N   
1062 C CA  . THR A 147 ? 0.1666 0.1637 0.2242 -0.0087 0.0326  -0.0087 128 THR A CA  
1063 C C   . THR A 147 ? 0.1533 0.1692 0.2527 -0.0305 0.0305  0.0048  128 THR A C   
1064 O O   . THR A 147 ? 0.1912 0.2001 0.2706 -0.0217 0.0104  0.0073  128 THR A O   
1065 C CB  . THR A 147 ? 0.1977 0.1935 0.2309 0.0057  -0.0109 -0.0112 128 THR A CB  
1066 O OG1 . THR A 147 ? 0.2763 0.2317 0.1975 -0.0006 0.0095  -0.0216 128 THR A OG1 
1067 C CG2 . THR A 147 ? 0.2054 0.2000 0.2607 -0.0204 -0.0604 -0.0166 128 THR A CG2 
1068 N N   . LEU A 148 ? 0.1241 0.2109 0.2446 -0.0330 0.0055  0.0174  129 LEU A N   
1069 C CA  . LEU A 148 ? 0.1480 0.2136 0.2901 -0.0701 0.0009  0.0473  129 LEU A CA  
1070 C C   . LEU A 148 ? 0.1996 0.2369 0.2895 -0.0448 -0.0160 0.0323  129 LEU A C   
1071 O O   . LEU A 148 ? 0.2138 0.2330 0.3035 -0.0293 -0.0230 0.0127  129 LEU A O   
1072 C CB  . LEU A 148 ? 0.2013 0.2436 0.3337 -0.0702 0.0178  0.0386  129 LEU A CB  
1073 C CG  . LEU A 148 ? 0.3074 0.3316 0.3841 -0.0376 0.0430  0.0093  129 LEU A CG  
1074 C CD1 . LEU A 148 ? 0.3178 0.3283 0.3981 -0.0841 0.0569  0.0122  129 LEU A CD1 
1075 C CD2 . LEU A 148 ? 0.3447 0.3866 0.4074 -0.0375 0.0792  -0.0011 129 LEU A CD2 
1076 N N   . GLY A 149 ? 0.1574 0.2042 0.2651 -0.0329 -0.0152 0.0584  130 GLY A N   
1077 C CA  . GLY A 149 ? 0.1619 0.2135 0.2751 -0.0295 -0.0274 0.0479  130 GLY A CA  
1078 C C   . GLY A 149 ? 0.1354 0.2269 0.2504 -0.0514 -0.0072 0.0397  130 GLY A C   
1079 O O   . GLY A 149 ? 0.1762 0.2750 0.2572 -0.0352 0.0104  0.0526  130 GLY A O   
1080 N N   . MET A 150 ? 0.1130 0.2025 0.2288 -0.0628 0.0176  -0.0046 131 MET A N   
1081 C CA  . MET A 150 ? 0.1384 0.1994 0.2303 0.0001  0.0371  -0.0004 131 MET A CA  
1082 C C   . MET A 150 ? 0.1554 0.1849 0.2046 0.0151  0.0704  -0.0192 131 MET A C   
1083 O O   . MET A 150 ? 0.1965 0.2066 0.1672 0.0045  0.0430  -0.0099 131 MET A O   
1084 C CB  . MET A 150 ? 0.1253 0.1898 0.2089 0.0044  0.0595  -0.0166 131 MET A CB  
1085 C CG  . MET A 150 ? 0.1378 0.1571 0.2033 -0.0134 0.0160  -0.0240 131 MET A CG  
1086 S SD  . MET A 150 ? 0.1570 0.1820 0.2101 -0.0276 0.0407  -0.0151 131 MET A SD  
1087 C CE  . MET A 150 ? 0.1345 0.2017 0.2135 -0.0335 0.0736  -0.0337 131 MET A CE  
1088 N N   . THR A 151 ? 0.1554 0.1512 0.2263 -0.0063 0.0308  -0.0217 132 THR A N   
1089 C CA  . THR A 151 ? 0.1579 0.1553 0.2229 -0.0095 0.0266  -0.0380 132 THR A CA  
1090 C C   . THR A 151 ? 0.1689 0.1917 0.2146 0.0066  0.0533  -0.0451 132 THR A C   
1091 O O   . THR A 151 ? 0.1199 0.1967 0.2133 -0.0232 0.0549  -0.0435 132 THR A O   
1092 C CB  . THR A 151 ? 0.1481 0.1952 0.2025 0.0017  0.0148  -0.0189 132 THR A CB  
1093 O OG1 . THR A 151 ? 0.1052 0.1731 0.2223 0.0052  0.0508  -0.0009 132 THR A OG1 
1094 C CG2 . THR A 151 ? 0.1666 0.2106 0.1840 0.0127  -0.0117 -0.0329 132 THR A CG2 
1095 N N   . ASP A 152 ? 0.1703 0.1976 0.2173 -0.0093 0.0868  -0.0623 133 ASP A N   
1096 C CA  . ASP A 152 ? 0.1570 0.2009 0.2345 -0.0277 0.0779  -0.0661 133 ASP A CA  
1097 C C   . ASP A 152 ? 0.1651 0.1944 0.2180 -0.0288 0.0376  -0.0511 133 ASP A C   
1098 O O   . ASP A 152 ? 0.1624 0.2147 0.2243 -0.0085 0.0016  -0.0410 133 ASP A O   
1099 C CB  . ASP A 152 ? 0.2250 0.2501 0.2616 -0.0086 0.1164  -0.0715 133 ASP A CB  
1100 C CG  . ASP A 152 ? 0.2741 0.2714 0.3114 -0.0053 0.1229  -0.0406 133 ASP A CG  
1101 O OD1 . ASP A 152 ? 0.2969 0.3095 0.3415 -0.0364 0.1384  -0.0269 133 ASP A OD1 
1102 O OD2 . ASP A 152 ? 0.3175 0.3058 0.3282 0.0226  0.1233  -0.0069 133 ASP A OD2 
1103 N N   . ARG A 153 ? 0.1791 0.1704 0.2054 -0.0046 0.0095  -0.0430 134 ARG A N   
1104 C CA  . ARG A 153 ? 0.2046 0.1807 0.1994 0.0206  0.0049  0.0025  134 ARG A CA  
1105 C C   . ARG A 153 ? 0.1609 0.1981 0.1872 0.0069  -0.0035 0.0038  134 ARG A C   
1106 O O   . ARG A 153 ? 0.0886 0.1812 0.2015 0.0005  -0.0011 0.0153  134 ARG A O   
1107 C CB  . ARG A 153 ? 0.2260 0.1654 0.1904 0.0058  0.0081  0.0388  134 ARG A CB  
1108 C CG  . ARG A 153 ? 0.2451 0.1905 0.1761 0.0088  -0.0002 0.0809  134 ARG A CG  
1109 C CD  . ARG A 153 ? 0.2605 0.2109 0.1915 0.0353  0.0109  0.0810  134 ARG A CD  
1110 N NE  . ARG A 153 ? 0.2615 0.2202 0.1808 0.0497  0.0461  0.0523  134 ARG A NE  
1111 C CZ  . ARG A 153 ? 0.2351 0.2358 0.1878 0.0336  0.0379  0.0407  134 ARG A CZ  
1112 N NH1 . ARG A 153 ? 0.2649 0.2553 0.1998 0.0370  0.0649  0.0487  134 ARG A NH1 
1113 N NH2 . ARG A 153 ? 0.2061 0.2471 0.1902 0.0149  0.0399  -0.0109 134 ARG A NH2 
1114 N N   . TRP A 154 ? 0.1756 0.1700 0.1520 -0.0058 0.0157  -0.0070 135 TRP A N   
1115 C CA  . TRP A 154 ? 0.1674 0.1591 0.1483 -0.0264 0.0020  -0.0099 135 TRP A CA  
1116 C C   . TRP A 154 ? 0.1508 0.1540 0.1426 -0.0006 0.0071  -0.0077 135 TRP A C   
1117 O O   . TRP A 154 ? 0.1061 0.1625 0.1465 -0.0001 0.0073  -0.0050 135 TRP A O   
1118 C CB  . TRP A 154 ? 0.1566 0.1607 0.1666 -0.0183 0.0056  -0.0342 135 TRP A CB  
1119 C CG  . TRP A 154 ? 0.1786 0.1405 0.1485 0.0174  0.0074  -0.0184 135 TRP A CG  
1120 C CD1 . TRP A 154 ? 0.1916 0.1429 0.1430 0.0371  0.0024  -0.0155 135 TRP A CD1 
1121 C CD2 . TRP A 154 ? 0.1548 0.1226 0.1435 0.0063  0.0111  0.0055  135 TRP A CD2 
1122 N NE1 . TRP A 154 ? 0.1387 0.1334 0.1621 -0.0037 -0.0057 0.0076  135 TRP A NE1 
1123 C CE2 . TRP A 154 ? 0.1427 0.1430 0.1620 -0.0223 0.0026  0.0164  135 TRP A CE2 
1124 C CE3 . TRP A 154 ? 0.1688 0.1511 0.1632 -0.0386 0.0347  0.0214  135 TRP A CE3 
1125 C CZ2 . TRP A 154 ? 0.1707 0.1449 0.1530 -0.0501 -0.0060 -0.0005 135 TRP A CZ2 
1126 C CZ3 . TRP A 154 ? 0.1935 0.1678 0.1684 -0.0735 0.0371  -0.0086 135 TRP A CZ3 
1127 C CH2 . TRP A 154 ? 0.1452 0.1577 0.1581 -0.0260 0.0175  -0.0151 135 TRP A CH2 
1128 N N   . ARG A 155 ? 0.1839 0.1687 0.1234 0.0040  0.0002  -0.0132 136 ARG A N   
1129 C CA  . ARG A 155 ? 0.1887 0.1808 0.1613 -0.0008 0.0233  -0.0074 136 ARG A CA  
1130 C C   . ARG A 155 ? 0.1863 0.1447 0.1537 -0.0105 0.0147  -0.0010 136 ARG A C   
1131 O O   . ARG A 155 ? 0.1816 0.1694 0.1582 -0.0136 0.0112  0.0033  136 ARG A O   
1132 C CB  . ARG A 155 ? 0.1999 0.2291 0.1713 -0.0237 0.0335  0.0149  136 ARG A CB  
1133 C CG  . ARG A 155 ? 0.2409 0.2838 0.2262 -0.0296 0.0649  0.0466  136 ARG A CG  
1134 C CD  . ARG A 155 ? 0.3064 0.3258 0.2720 0.0241  0.0928  0.0466  136 ARG A CD  
1135 N NE  . ARG A 155 ? 0.3552 0.4058 0.3105 0.0388  0.0986  0.0129  136 ARG A NE  
1136 C CZ  . ARG A 155 ? 0.3931 0.4392 0.3336 0.0438  0.1081  -0.0055 136 ARG A CZ  
1137 N NH1 . ARG A 155 ? 0.3847 0.4674 0.3290 0.0145  0.1248  0.0022  136 ARG A NH1 
1138 N NH2 . ARG A 155 ? 0.4333 0.4465 0.3646 0.0806  0.0842  -0.0054 136 ARG A NH2 
1139 N N   . ALA A 156 ? 0.1916 0.1243 0.1303 -0.0292 0.0124  -0.0143 137 ALA A N   
1140 C CA  . ALA A 156 ? 0.1742 0.1083 0.1520 -0.0177 0.0338  -0.0032 137 ALA A CA  
1141 C C   . ALA A 156 ? 0.1614 0.1572 0.1355 -0.0231 0.0122  -0.0144 137 ALA A C   
1142 O O   . ALA A 156 ? 0.1422 0.1435 0.1387 -0.0420 -0.0037 -0.0198 137 ALA A O   
1143 C CB  . ALA A 156 ? 0.2207 0.1145 0.1815 0.0470  0.0059  0.0059  137 ALA A CB  
1144 N N   . ARG A 157 ? 0.1769 0.1257 0.0930 0.0048  0.0218  -0.0026 138 ARG A N   
1145 C CA  . ARG A 157 ? 0.1370 0.1245 0.0728 -0.0091 0.0424  0.0308  138 ARG A CA  
1146 C C   . ARG A 157 ? 0.1698 0.0994 0.1115 -0.0187 0.0069  -0.0051 138 ARG A C   
1147 O O   . ARG A 157 ? 0.1621 0.1135 0.1321 -0.0084 -0.0057 0.0034  138 ARG A O   
1148 C CB  . ARG A 157 ? 0.1347 0.1761 0.1015 0.0473  0.0228  -0.0070 138 ARG A CB  
1149 C CG  . ARG A 157 ? 0.1404 0.1946 0.1159 -0.0145 0.0406  -0.0102 138 ARG A CG  
1150 C CD  . ARG A 157 ? 0.1533 0.1914 0.1224 -0.0118 0.0100  -0.0278 138 ARG A CD  
1151 N NE  . ARG A 157 ? 0.1714 0.1442 0.1316 -0.0243 -0.0055 -0.0250 138 ARG A NE  
1152 C CZ  . ARG A 157 ? 0.2000 0.1464 0.1599 -0.0023 0.0010  -0.0073 138 ARG A CZ  
1153 N NH1 . ARG A 157 ? 0.1977 0.1596 0.1659 -0.0510 0.0275  -0.0135 138 ARG A NH1 
1154 N NH2 . ARG A 157 ? 0.2059 0.1818 0.2061 -0.0258 0.0413  0.0339  138 ARG A NH2 
1155 N N   . ALA A 158 ? 0.1788 0.1193 0.1095 -0.0293 0.0335  -0.0034 139 ALA A N   
1156 C CA  . ALA A 158 ? 0.1311 0.1326 0.1440 -0.0350 -0.0140 0.0227  139 ALA A CA  
1157 C C   . ALA A 158 ? 0.1957 0.1357 0.1071 0.0185  0.0091  0.0019  139 ALA A C   
1158 O O   . ALA A 158 ? 0.1837 0.1443 0.1241 0.0203  0.0061  -0.0073 139 ALA A O   
1159 C CB  . ALA A 158 ? 0.2001 0.1189 0.1656 -0.0350 -0.0026 -0.0041 139 ALA A CB  
1160 N N   . ALA A 159 ? 0.1887 0.1228 0.0946 -0.0085 0.0267  0.0169  140 ALA A N   
1161 C CA  . ALA A 159 ? 0.1496 0.1319 0.0849 0.0051  0.0591  -0.0098 140 ALA A CA  
1162 C C   . ALA A 159 ? 0.1415 0.1442 0.0994 0.0043  0.0360  0.0120  140 ALA A C   
1163 O O   . ALA A 159 ? 0.1664 0.1574 0.1404 0.0016  0.0090  0.0111  140 ALA A O   
1164 C CB  . ALA A 159 ? 0.1892 0.1448 0.1309 -0.0126 0.0629  -0.0117 140 ALA A CB  
1165 N N   . CYS A 160 ? 0.1273 0.1288 0.1148 -0.0256 0.0460  0.0183  141 CYS A N   
1166 C CA  . CYS A 160 ? 0.1540 0.0934 0.1488 -0.0253 0.0075  0.0027  141 CYS A CA  
1167 C C   . CYS A 160 ? 0.1706 0.1164 0.1373 -0.0026 -0.0074 0.0107  141 CYS A C   
1168 O O   . CYS A 160 ? 0.1840 0.1255 0.1399 0.0232  -0.0222 0.0110  141 CYS A O   
1169 C CB  . CYS A 160 ? 0.1579 0.1014 0.1897 0.0075  -0.0043 0.0081  141 CYS A CB  
1170 S SG  . CYS A 160 ? 0.1694 0.1428 0.2348 0.0016  -0.0009 -0.0100 141 CYS A SG  
1171 N N   . ASN A 161 ? 0.1845 0.1321 0.1036 0.0145  0.0089  0.0055  142 ASN A N   
1172 C CA  . ASN A 161 ? 0.1697 0.1249 0.0940 -0.0132 -0.0022 -0.0071 142 ASN A CA  
1173 C C   . ASN A 161 ? 0.1844 0.1326 0.1184 -0.0094 0.0074  0.0132  142 ASN A C   
1174 O O   . ASN A 161 ? 0.1656 0.1522 0.1462 -0.0074 0.0039  0.0194  142 ASN A O   
1175 C CB  . ASN A 161 ? 0.1848 0.1340 0.0912 -0.0200 -0.0132 -0.0148 142 ASN A CB  
1176 C CG  . ASN A 161 ? 0.1662 0.1466 0.1080 -0.0440 -0.0197 -0.0072 142 ASN A CG  
1177 O OD1 . ASN A 161 ? 0.2083 0.1769 0.1325 -0.0427 -0.0131 0.0050  142 ASN A OD1 
1178 N ND2 . ASN A 161 ? 0.1308 0.1621 0.1082 -0.0015 -0.0103 -0.0409 142 ASN A ND2 
1179 N N   . TRP A 162 ? 0.1644 0.1419 0.0938 -0.0348 0.0067  0.0074  143 TRP A N   
1180 C CA  . TRP A 162 ? 0.1340 0.1394 0.1421 -0.0613 -0.0016 0.0279  143 TRP A CA  
1181 C C   . TRP A 162 ? 0.1916 0.1124 0.1436 -0.0287 -0.0185 0.0202  143 TRP A C   
1182 O O   . TRP A 162 ? 0.2163 0.1281 0.1328 -0.0097 -0.0114 0.0309  143 TRP A O   
1183 C CB  . TRP A 162 ? 0.1284 0.1725 0.1536 -0.0510 -0.0016 0.0093  143 TRP A CB  
1184 C CG  . TRP A 162 ? 0.1628 0.1275 0.1678 -0.0492 -0.0047 0.0157  143 TRP A CG  
1185 C CD1 . TRP A 162 ? 0.1884 0.1494 0.1529 -0.0041 -0.0027 0.0074  143 TRP A CD1 
1186 C CD2 . TRP A 162 ? 0.2010 0.1252 0.1651 -0.0039 -0.0150 0.0132  143 TRP A CD2 
1187 N NE1 . TRP A 162 ? 0.1988 0.1500 0.1767 -0.0285 0.0167  0.0061  143 TRP A NE1 
1188 C CE2 . TRP A 162 ? 0.2277 0.1131 0.1689 -0.0217 0.0005  0.0285  143 TRP A CE2 
1189 C CE3 . TRP A 162 ? 0.1896 0.1339 0.1710 0.0000  0.0076  0.0189  143 TRP A CE3 
1190 C CZ2 . TRP A 162 ? 0.2587 0.1065 0.1974 -0.0095 0.0030  0.0488  143 TRP A CZ2 
1191 C CZ3 . TRP A 162 ? 0.2071 0.1433 0.1974 -0.0349 0.0172  0.0244  143 TRP A CZ3 
1192 C CH2 . TRP A 162 ? 0.2347 0.1323 0.1969 -0.0174 -0.0176 0.0164  143 TRP A CH2 
1193 N N   . GLU A 163 ? 0.1858 0.0922 0.1449 -0.0377 -0.0133 -0.0086 144 GLU A N   
1194 C CA  . GLU A 163 ? 0.2234 0.1067 0.1546 -0.0275 0.0086  -0.0386 144 GLU A CA  
1195 C C   . GLU A 163 ? 0.1756 0.1375 0.1543 0.0181  -0.0175 -0.0178 144 GLU A C   
1196 O O   . GLU A 163 ? 0.1551 0.1176 0.1841 0.0037  -0.0208 -0.0184 144 GLU A O   
1197 C CB  . GLU A 163 ? 0.2283 0.0855 0.1589 -0.0231 -0.0246 -0.0122 144 GLU A CB  
1198 C CG  . GLU A 163 ? 0.2568 0.1061 0.1845 -0.0034 -0.0445 -0.0381 144 GLU A CG  
1199 C CD  . GLU A 163 ? 0.2699 0.1589 0.2300 -0.0208 -0.0645 -0.0479 144 GLU A CD  
1200 O OE1 . GLU A 163 ? 0.2791 0.1817 0.1594 -0.0098 -0.0252 0.0104  144 GLU A OE1 
1201 O OE2 . GLU A 163 ? 0.2854 0.1731 0.3299 0.0164  -0.0650 -0.0469 144 GLU A OE2 
1202 N N   . TYR A 164 ? 0.1460 0.1460 0.1126 0.0128  0.0280  0.0091  145 TYR A N   
1203 C CA  . TYR A 164 ? 0.1519 0.1520 0.1139 0.0109  0.0623  0.0080  145 TYR A CA  
1204 C C   . TYR A 164 ? 0.1774 0.1315 0.1512 0.0170  -0.0034 0.0071  145 TYR A C   
1205 O O   . TYR A 164 ? 0.1780 0.1273 0.1529 0.0264  -0.0098 -0.0124 145 TYR A O   
1206 C CB  . TYR A 164 ? 0.1315 0.1655 0.1169 -0.0071 0.0615  0.0361  145 TYR A CB  
1207 C CG  . TYR A 164 ? 0.1376 0.1556 0.1501 -0.0052 0.0112  0.0082  145 TYR A CG  
1208 C CD1 . TYR A 164 ? 0.1887 0.1549 0.1670 0.0085  -0.0178 0.0206  145 TYR A CD1 
1209 C CD2 . TYR A 164 ? 0.1771 0.1878 0.1588 -0.0312 0.0004  -0.0167 145 TYR A CD2 
1210 C CE1 . TYR A 164 ? 0.1970 0.1708 0.1782 0.0280  -0.0112 0.0006  145 TYR A CE1 
1211 C CE2 . TYR A 164 ? 0.1783 0.1689 0.1734 -0.0158 0.0070  -0.0111 145 TYR A CE2 
1212 C CZ  . TYR A 164 ? 0.1827 0.1699 0.1775 -0.0086 0.0103  -0.0164 145 TYR A CZ  
1213 O OH  . TYR A 164 ? 0.1814 0.1980 0.1634 0.0100  0.0005  -0.0134 145 TYR A OH  
1214 N N   . TYR A 165 ? 0.1878 0.1197 0.1657 -0.0244 0.0104  -0.0063 146 TYR A N   
1215 C CA  . TYR A 165 ? 0.2105 0.1115 0.1377 -0.0400 -0.0333 -0.0078 146 TYR A CA  
1216 C C   . TYR A 165 ? 0.2246 0.1362 0.1194 0.0190  -0.0283 0.0222  146 TYR A C   
1217 O O   . TYR A 165 ? 0.2345 0.1548 0.1487 0.0268  -0.0493 0.0235  146 TYR A O   
1218 C CB  . TYR A 165 ? 0.1953 0.1042 0.1673 -0.0124 -0.0216 -0.0177 146 TYR A CB  
1219 C CG  . TYR A 165 ? 0.1844 0.1286 0.1885 0.0099  -0.0192 0.0073  146 TYR A CG  
1220 C CD1 . TYR A 165 ? 0.1951 0.0980 0.2077 0.0129  -0.0227 -0.0275 146 TYR A CD1 
1221 C CD2 . TYR A 165 ? 0.1872 0.1111 0.1726 -0.0205 -0.0121 0.0286  146 TYR A CD2 
1222 C CE1 . TYR A 165 ? 0.1622 0.0934 0.2126 0.0103  -0.0159 -0.0277 146 TYR A CE1 
1223 C CE2 . TYR A 165 ? 0.2070 0.1313 0.1791 -0.0003 -0.0136 0.0118  146 TYR A CE2 
1224 C CZ  . TYR A 165 ? 0.1796 0.1018 0.1944 0.0146  0.0001  -0.0037 146 TYR A CZ  
1225 O OH  . TYR A 165 ? 0.2116 0.1443 0.1902 -0.0095 -0.0287 -0.0112 146 TYR A OH  
1226 N N   . PHE A 166 ? 0.2159 0.1234 0.1065 0.0300  0.0015  0.0013  147 PHE A N   
1227 C CA  . PHE A 166 ? 0.2245 0.1325 0.1144 0.0274  -0.0180 -0.0032 147 PHE A CA  
1228 C C   . PHE A 166 ? 0.2120 0.1213 0.1366 0.0231  -0.0248 -0.0034 147 PHE A C   
1229 O O   . PHE A 166 ? 0.2312 0.1536 0.1360 0.0202  -0.0446 -0.0046 147 PHE A O   
1230 C CB  . PHE A 166 ? 0.2201 0.1385 0.1248 -0.0199 0.0118  0.0130  147 PHE A CB  
1231 C CG  . PHE A 166 ? 0.2549 0.1994 0.1384 -0.0542 0.0120  -0.0002 147 PHE A CG  
1232 C CD1 . PHE A 166 ? 0.2608 0.2095 0.1445 -0.0855 0.0239  0.0011  147 PHE A CD1 
1233 C CD2 . PHE A 166 ? 0.2708 0.2076 0.1186 -0.0536 -0.0043 0.0097  147 PHE A CD2 
1234 C CE1 . PHE A 166 ? 0.2710 0.2363 0.1412 -0.0663 0.0427  0.0035  147 PHE A CE1 
1235 C CE2 . PHE A 166 ? 0.2987 0.2168 0.1329 -0.0438 0.0088  0.0272  147 PHE A CE2 
1236 C CZ  . PHE A 166 ? 0.2860 0.2281 0.1393 -0.0521 0.0242  0.0064  147 PHE A CZ  
1237 N N   . ALA A 167 ? 0.1843 0.0895 0.1671 -0.0013 -0.0091 -0.0208 148 ALA A N   
1238 C CA  . ALA A 167 ? 0.1885 0.0897 0.1664 0.0082  -0.0222 -0.0223 148 ALA A CA  
1239 C C   . ALA A 167 ? 0.2235 0.1294 0.1649 0.0090  -0.0116 -0.0059 148 ALA A C   
1240 O O   . ALA A 167 ? 0.2473 0.1517 0.1529 -0.0314 -0.0118 -0.0009 148 ALA A O   
1241 C CB  . ALA A 167 ? 0.1981 0.1014 0.1865 0.0214  -0.0277 -0.0019 148 ALA A CB  
1242 N N   . CYS A 168 ? 0.2207 0.1501 0.1621 0.0075  0.0026  0.0222  149 CYS A N   
1243 C CA  . CYS A 168 ? 0.2363 0.1930 0.1724 0.0222  -0.0066 0.0175  149 CYS A CA  
1244 C C   . CYS A 168 ? 0.2027 0.1775 0.1985 0.0221  -0.0278 0.0113  149 CYS A C   
1245 O O   . CYS A 168 ? 0.1678 0.1984 0.2067 0.0338  -0.0285 -0.0011 149 CYS A O   
1246 C CB  . CYS A 168 ? 0.2467 0.2209 0.1422 0.0869  0.0236  0.0382  149 CYS A CB  
1247 S SG  . CYS A 168 ? 0.2447 0.2177 0.1965 0.0279  -0.0058 -0.0098 149 CYS A SG  
1248 N N   . HIS A 169 ? 0.2131 0.1422 0.2113 0.0205  -0.0521 0.0151  150 HIS A N   
1249 C CA  . HIS A 169 ? 0.2145 0.1367 0.2350 -0.0098 -0.0652 0.0196  150 HIS A CA  
1250 C C   . HIS A 169 ? 0.2273 0.1494 0.2326 0.0188  -0.0687 0.0180  150 HIS A C   
1251 O O   . HIS A 169 ? 0.2412 0.1709 0.2480 0.0240  -0.0759 0.0187  150 HIS A O   
1252 C CB  . HIS A 169 ? 0.2513 0.1558 0.2484 -0.0125 -0.0493 0.0143  150 HIS A CB  
1253 C CG  . HIS A 169 ? 0.2230 0.1381 0.2500 -0.0132 -0.0633 0.0160  150 HIS A CG  
1254 N ND1 . HIS A 169 ? 0.2458 0.1576 0.2632 -0.0062 -0.0686 0.0176  150 HIS A ND1 
1255 C CD2 . HIS A 169 ? 0.2375 0.1555 0.2549 -0.0036 -0.0888 -0.0122 150 HIS A CD2 
1256 C CE1 . HIS A 169 ? 0.2518 0.1551 0.2700 -0.0013 -0.0562 0.0133  150 HIS A CE1 
1257 N NE2 . HIS A 169 ? 0.2274 0.1841 0.2851 0.0093  -0.0672 -0.0279 150 HIS A NE2 
1258 N N   . PRO A 170 ? 0.2078 0.1671 0.2405 0.0214  -0.0824 0.0085  151 PRO A N   
1259 C CA  . PRO A 170 ? 0.2424 0.1570 0.2237 -0.0087 -0.0762 -0.0070 151 PRO A CA  
1260 C C   . PRO A 170 ? 0.2497 0.1749 0.2309 0.0230  -0.0939 0.0033  151 PRO A C   
1261 O O   . PRO A 170 ? 0.2672 0.1683 0.2390 0.0464  -0.1089 0.0083  151 PRO A O   
1262 C CB  . PRO A 170 ? 0.1947 0.1491 0.2200 0.0236  -0.0730 -0.0020 151 PRO A CB  
1263 C CG  . PRO A 170 ? 0.1797 0.1551 0.2135 0.0041  -0.0451 -0.0020 151 PRO A CG  
1264 C CD  . PRO A 170 ? 0.1845 0.1652 0.2284 0.0339  -0.0305 -0.0037 151 PRO A CD  
1265 N N   . ALA A 171 ? 0.2481 0.1923 0.2193 0.0109  -0.0579 0.0104  152 ALA A N   
1266 C CA  . ALA A 171 ? 0.2273 0.2086 0.2444 0.0284  -0.0453 0.0021  152 ALA A CA  
1267 C C   . ALA A 171 ? 0.1969 0.2144 0.2680 0.0499  -0.0304 -0.0209 152 ALA A C   
1268 O O   . ALA A 171 ? 0.1895 0.2479 0.3010 0.0757  -0.0532 -0.0260 152 ALA A O   
1269 C CB  . ALA A 171 ? 0.2539 0.2144 0.2240 0.0570  -0.0412 -0.0107 152 ALA A CB  
1270 N N   . GLU A 172 ? 0.2302 0.1910 0.2456 0.0276  0.0017  -0.0366 153 GLU A N   
1271 C CA  A GLU A 172 ? 0.2822 0.2170 0.2744 0.0205  -0.0151 -0.0284 153 GLU A CA  
1272 C CA  B GLU A 172 ? 0.2575 0.1899 0.2573 0.0303  -0.0082 -0.0415 153 GLU A CA  
1273 C C   . GLU A 172 ? 0.2914 0.2206 0.2871 0.0369  -0.0218 -0.0213 153 GLU A C   
1274 O O   . GLU A 172 ? 0.2850 0.2377 0.3126 0.0464  -0.0434 -0.0238 153 GLU A O   
1275 C CB  A GLU A 172 ? 0.3232 0.2554 0.3018 -0.0055 -0.0348 -0.0289 153 GLU A CB  
1276 C CB  B GLU A 172 ? 0.2492 0.1774 0.2543 0.0200  -0.0148 -0.0696 153 GLU A CB  
1277 C CG  A GLU A 172 ? 0.3705 0.3064 0.3307 -0.0196 -0.0307 -0.0115 153 GLU A CG  
1278 C CG  B GLU A 172 ? 0.2462 0.1886 0.2638 0.0311  -0.0059 -0.0716 153 GLU A CG  
1279 C CD  A GLU A 172 ? 0.4308 0.3448 0.3631 -0.0460 -0.0231 0.0061  153 GLU A CD  
1280 C CD  B GLU A 172 ? 0.2412 0.1998 0.2731 -0.0147 -0.0079 -0.0604 153 GLU A CD  
1281 O OE1 A GLU A 172 ? 0.4415 0.3662 0.3681 -0.0640 -0.0371 0.0109  153 GLU A OE1 
1282 O OE1 B GLU A 172 ? 0.2978 0.2139 0.2915 -0.0454 -0.0518 -0.0743 153 GLU A OE1 
1283 O OE2 A GLU A 172 ? 0.4857 0.3450 0.3807 -0.0362 -0.0185 0.0215  153 GLU A OE2 
1284 O OE2 B GLU A 172 ? 0.2454 0.2371 0.2729 -0.0519 -0.0107 0.0025  153 GLU A OE2 
1285 N N   . ALA A 173 ? 0.3058 0.2265 0.2793 0.0248  -0.0385 0.0236  154 ALA A N   
1286 C CA  . ALA A 173 ? 0.2955 0.2583 0.3013 0.0600  -0.0632 0.0381  154 ALA A CA  
1287 C C   . ALA A 173 ? 0.2886 0.2817 0.3343 0.0724  -0.0634 0.0469  154 ALA A C   
1288 O O   . ALA A 173 ? 0.2836 0.3061 0.3492 0.0788  -0.0549 0.0379  154 ALA A O   
1289 C CB  . ALA A 173 ? 0.2663 0.2534 0.2942 0.0718  -0.0400 0.0247  154 ALA A CB  
1290 N N   . ALA A 174 ? 0.3138 0.2973 0.3540 0.0748  -0.0644 0.0523  155 ALA A N   
1291 C CA  . ALA A 174 ? 0.3098 0.3492 0.3956 0.0824  -0.0897 0.0408  155 ALA A CA  
1292 C C   . ALA A 174 ? 0.3372 0.3936 0.4376 0.1035  -0.0931 0.0377  155 ALA A C   
1293 O O   . ALA A 174 ? 0.3548 0.4245 0.4577 0.0695  -0.0891 0.0330  155 ALA A O   
1294 C CB  . ALA A 174 ? 0.3053 0.3665 0.4042 0.0574  -0.0993 0.0388  155 ALA A CB  
1295 N N   . GLY A 175 ? 0.3833 0.4189 0.4571 0.1249  -0.0718 0.0289  156 GLY A N   
1296 C CA  . GLY A 175 ? 0.4456 0.4524 0.4950 0.1111  -0.0578 0.0265  156 GLY A CA  
1297 C C   . GLY A 175 ? 0.4986 0.4924 0.5288 0.0984  -0.0395 0.0001  156 GLY A C   
1298 O O   . GLY A 175 ? 0.4838 0.5033 0.5431 0.1101  -0.0439 -0.0134 156 GLY A O   
1299 N N   . ARG A 176 ? 0.5438 0.5186 0.5568 0.0796  -0.0387 0.0068  157 ARG A N   
1300 C CA  . ARG A 176 ? 0.5922 0.5652 0.5927 0.0911  -0.0214 -0.0117 157 ARG A CA  
1301 C C   . ARG A 176 ? 0.6272 0.5659 0.5954 0.1081  -0.0012 -0.0263 157 ARG A C   
1302 O O   . ARG A 176 ? 0.6609 0.5677 0.5949 0.1205  0.0238  -0.0311 157 ARG A O   
1303 C CB  . ARG A 176 ? 0.5986 0.5993 0.6180 0.0773  -0.0152 -0.0064 157 ARG A CB  
1304 C CG  . ARG A 176 ? 0.6201 0.6358 0.6360 0.0577  -0.0201 -0.0129 157 ARG A CG  
1305 C CD  . ARG A 176 ? 0.6428 0.6612 0.6520 0.0415  -0.0150 -0.0273 157 ARG A CD  
1306 N NE  . ARG A 176 ? 0.6441 0.6743 0.6646 0.0414  -0.0115 -0.0253 157 ARG A NE  
1307 C CZ  . ARG A 176 ? 0.6565 0.6890 0.6726 0.0423  -0.0114 -0.0141 157 ARG A CZ  
1308 N NH1 . ARG A 176 ? 0.6864 0.6898 0.6819 0.0482  -0.0085 -0.0085 157 ARG A NH1 
1309 N NH2 . ARG A 176 ? 0.6580 0.7061 0.6738 0.0404  -0.0234 -0.0140 157 ARG A NH2 
1310 N N   . PRO A 181 ? 0.6110 0.6275 0.6332 -0.0107 0.0335  0.0356  162 PRO A N   
1311 C CA  . PRO A 181 ? 0.5984 0.6202 0.6297 -0.0238 0.0370  0.0326  162 PRO A CA  
1312 C C   . PRO A 181 ? 0.5750 0.6200 0.6245 -0.0302 -0.0002 0.0206  162 PRO A C   
1313 O O   . PRO A 181 ? 0.6103 0.6412 0.6373 -0.0257 0.0197  0.0243  162 PRO A O   
1314 C CB  . PRO A 181 ? 0.6053 0.6222 0.6246 -0.0282 0.0722  0.0348  162 PRO A CB  
1315 C CG  . PRO A 181 ? 0.6172 0.6266 0.6261 -0.0283 0.0762  0.0373  162 PRO A CG  
1316 C CD  . PRO A 181 ? 0.6235 0.6275 0.6320 -0.0182 0.0628  0.0381  162 PRO A CD  
1317 N N   . PRO A 182 ? 0.5247 0.5907 0.5936 -0.0383 -0.0488 -0.0012 163 PRO A N   
1318 C CA  . PRO A 182 ? 0.4751 0.5713 0.5660 -0.0361 -0.0626 -0.0346 163 PRO A CA  
1319 C C   . PRO A 182 ? 0.4156 0.5353 0.5257 -0.0325 -0.0571 -0.0721 163 PRO A C   
1320 O O   . PRO A 182 ? 0.4717 0.5464 0.5306 -0.0181 -0.0417 -0.0829 163 PRO A O   
1321 C CB  . PRO A 182 ? 0.4907 0.5758 0.5746 -0.0519 -0.0519 -0.0297 163 PRO A CB  
1322 C CG  . PRO A 182 ? 0.5132 0.5815 0.5759 -0.0431 -0.0623 -0.0191 163 PRO A CG  
1323 C CD  . PRO A 182 ? 0.5266 0.5780 0.5804 -0.0411 -0.0616 -0.0121 163 PRO A CD  
1324 N N   . ASP A 183 ? 0.3462 0.4780 0.4877 -0.0302 -0.0553 -0.1003 164 ASP A N   
1325 C CA  . ASP A 183 ? 0.3707 0.4484 0.4826 -0.0126 -0.0184 -0.1078 164 ASP A CA  
1326 C C   . ASP A 183 ? 0.3639 0.3933 0.4369 -0.0049 0.0260  -0.0831 164 ASP A C   
1327 O O   . ASP A 183 ? 0.3304 0.3742 0.4175 -0.0106 0.0564  -0.0770 164 ASP A O   
1328 C CB  . ASP A 183 ? 0.4097 0.4834 0.5113 0.0029  -0.0273 -0.1287 164 ASP A CB  
1329 C CG  . ASP A 183 ? 0.4820 0.5081 0.5262 0.0280  -0.0222 -0.1421 164 ASP A CG  
1330 O OD1 . ASP A 183 ? 0.5433 0.5455 0.5566 0.0458  0.0281  -0.1150 164 ASP A OD1 
1331 O OD2 . ASP A 183 ? 0.5191 0.4969 0.5378 0.0495  -0.0248 -0.1505 164 ASP A OD2 
1332 N N   . ARG A 184 ? 0.3790 0.3743 0.4065 -0.0189 0.0650  -0.0805 165 ARG A N   
1333 C CA  A ARG A 184 ? 0.3850 0.3872 0.3907 -0.0204 0.0671  -0.0653 165 ARG A CA  
1334 C CA  B ARG A 184 ? 0.3847 0.3881 0.3875 -0.0202 0.0676  -0.0695 165 ARG A CA  
1335 C C   . ARG A 184 ? 0.3852 0.3714 0.3608 -0.0424 0.0774  -0.0735 165 ARG A C   
1336 O O   . ARG A 184 ? 0.3553 0.3716 0.3144 -0.0807 0.1474  -0.0901 165 ARG A O   
1337 C CB  A ARG A 184 ? 0.4086 0.4165 0.4030 -0.0146 0.0658  -0.0429 165 ARG A CB  
1338 C CB  B ARG A 184 ? 0.4095 0.4179 0.3934 -0.0146 0.0666  -0.0551 165 ARG A CB  
1339 C CG  A ARG A 184 ? 0.4318 0.4372 0.4091 -0.0123 0.0585  -0.0190 165 ARG A CG  
1340 C CG  B ARG A 184 ? 0.4344 0.4372 0.3929 -0.0133 0.0581  -0.0410 165 ARG A CG  
1341 C CD  A ARG A 184 ? 0.4453 0.4541 0.4201 -0.0134 0.0508  0.0047  165 ARG A CD  
1342 C CD  B ARG A 184 ? 0.4504 0.4559 0.3956 -0.0119 0.0449  -0.0321 165 ARG A CD  
1343 N NE  A ARG A 184 ? 0.4456 0.4576 0.4290 -0.0189 0.0476  0.0300  165 ARG A NE  
1344 N NE  B ARG A 184 ? 0.4563 0.4633 0.3961 -0.0183 0.0417  -0.0258 165 ARG A NE  
1345 C CZ  A ARG A 184 ? 0.4371 0.4407 0.4249 -0.0360 0.0469  0.0559  165 ARG A CZ  
1346 C CZ  B ARG A 184 ? 0.4415 0.4545 0.3851 -0.0320 0.0321  -0.0075 165 ARG A CZ  
1347 N NH1 A ARG A 184 ? 0.4228 0.4354 0.4262 -0.0170 0.0461  0.0730  165 ARG A NH1 
1348 N NH1 B ARG A 184 ? 0.4316 0.4460 0.3870 -0.0509 0.0252  0.0006  165 ARG A NH1 
1349 N NH2 A ARG A 184 ? 0.4377 0.4391 0.4182 -0.0624 0.0390  0.0719  165 ARG A NH2 
1350 N NH2 B ARG A 184 ? 0.4363 0.4483 0.3709 -0.0175 0.0322  -0.0020 165 ARG A NH2 
1351 N N   . GLU A 185 ? 0.3966 0.3404 0.3514 -0.0355 0.0737  -0.0594 166 GLU A N   
1352 C CA  . GLU A 185 ? 0.3858 0.3492 0.3555 -0.0630 0.0576  -0.0478 166 GLU A CA  
1353 C C   . GLU A 185 ? 0.3476 0.3183 0.2918 -0.0585 0.0070  -0.0520 166 GLU A C   
1354 O O   . GLU A 185 ? 0.3260 0.3316 0.2903 -0.0415 -0.0179 -0.0596 166 GLU A O   
1355 C CB  . GLU A 185 ? 0.4660 0.4127 0.4292 -0.0679 0.0700  -0.0324 166 GLU A CB  
1356 C CG  . GLU A 185 ? 0.5417 0.5001 0.5093 -0.0498 0.0818  -0.0161 166 GLU A CG  
1357 C CD  . GLU A 185 ? 0.6306 0.5935 0.5674 -0.0434 0.1064  0.0106  166 GLU A CD  
1358 O OE1 . GLU A 185 ? 0.6229 0.5997 0.5842 -0.0548 0.1222  0.0263  166 GLU A OE1 
1359 O OE2 . GLU A 185 ? 0.6838 0.6465 0.6232 -0.0423 0.1042  0.0265  166 GLU A OE2 
1360 N N   . GLY A 186 ? 0.3126 0.2980 0.2435 -0.0591 -0.0161 -0.0465 167 GLY A N   
1361 C CA  . GLY A 186 ? 0.2632 0.3105 0.2262 -0.0366 -0.0153 -0.0221 167 GLY A CA  
1362 C C   . GLY A 186 ? 0.2304 0.3275 0.2147 -0.0274 -0.0009 -0.0413 167 GLY A C   
1363 O O   . GLY A 186 ? 0.1957 0.3269 0.1918 -0.0267 -0.0060 -0.0372 167 GLY A O   
1364 N N   . TYR A 187 ? 0.2061 0.3352 0.2263 -0.0415 0.0020  -0.0742 168 TYR A N   
1365 C CA  . TYR A 187 ? 0.2091 0.3210 0.2511 0.0005  -0.0047 -0.0790 168 TYR A CA  
1366 C C   . TYR A 187 ? 0.2342 0.3241 0.2225 -0.0163 0.0023  -0.0473 168 TYR A C   
1367 O O   . TYR A 187 ? 0.2026 0.3017 0.2046 -0.0512 0.0157  -0.0499 168 TYR A O   
1368 C CB  . TYR A 187 ? 0.2379 0.3097 0.2831 -0.0086 0.0137  -0.1176 168 TYR A CB  
1369 C CG  . TYR A 187 ? 0.2201 0.3221 0.3165 -0.0359 0.0191  -0.0886 168 TYR A CG  
1370 C CD1 . TYR A 187 ? 0.2239 0.3246 0.3215 -0.0517 0.0158  -0.0868 168 TYR A CD1 
1371 C CD2 . TYR A 187 ? 0.2153 0.3226 0.3132 -0.0526 0.0609  -0.0967 168 TYR A CD2 
1372 C CE1 . TYR A 187 ? 0.2354 0.3335 0.3277 -0.0684 0.0177  -0.0924 168 TYR A CE1 
1373 C CE2 . TYR A 187 ? 0.2163 0.3310 0.3256 -0.0838 0.0323  -0.0892 168 TYR A CE2 
1374 C CZ  . TYR A 187 ? 0.2222 0.3320 0.3171 -0.0850 0.0483  -0.0927 168 TYR A CZ  
1375 O OH  . TYR A 187 ? 0.2415 0.3594 0.3512 -0.0762 0.0629  -0.0630 168 TYR A OH  
1376 N N   . LEU A 188 ? 0.2423 0.3224 0.2237 -0.0093 -0.0115 -0.0418 169 LEU A N   
1377 C CA  . LEU A 188 ? 0.2809 0.3008 0.2234 -0.0061 -0.0086 -0.0446 169 LEU A CA  
1378 C C   . LEU A 188 ? 0.2379 0.2803 0.2032 0.0079  -0.0281 -0.0284 169 LEU A C   
1379 O O   . LEU A 188 ? 0.2643 0.2709 0.2117 0.0148  -0.0346 0.0100  169 LEU A O   
1380 C CB  . LEU A 188 ? 0.3462 0.3273 0.2353 -0.0278 -0.0130 -0.0584 169 LEU A CB  
1381 C CG  . LEU A 188 ? 0.4120 0.3669 0.2590 -0.0429 0.0185  -0.0474 169 LEU A CG  
1382 C CD1 . LEU A 188 ? 0.4162 0.4078 0.2746 -0.0216 0.0256  -0.0318 169 LEU A CD1 
1383 C CD2 . LEU A 188 ? 0.4533 0.3655 0.2684 -0.0520 0.0125  -0.0789 169 LEU A CD2 
1384 N N   . THR A 189 ? 0.2256 0.2843 0.1862 0.0031  -0.0317 -0.0271 170 THR A N   
1385 C CA  . THR A 189 ? 0.2109 0.2595 0.1903 -0.0341 -0.0446 -0.0221 170 THR A CA  
1386 C C   . THR A 189 ? 0.1936 0.2687 0.2068 -0.0106 -0.0472 0.0081  170 THR A C   
1387 O O   . THR A 189 ? 0.2142 0.3112 0.2139 -0.0070 -0.0358 0.0195  170 THR A O   
1388 C CB  . THR A 189 ? 0.2017 0.2076 0.1981 -0.0544 -0.0238 -0.0073 170 THR A CB  
1389 O OG1 . THR A 189 ? 0.2441 0.2465 0.2180 -0.0354 -0.0152 -0.0307 170 THR A OG1 
1390 C CG2 . THR A 189 ? 0.2243 0.1913 0.2158 -0.0074 -0.0083 0.0179  170 THR A CG2 
1391 N N   . LEU A 190 ? 0.1868 0.2301 0.1879 0.0108  -0.0282 0.0090  171 LEU A N   
1392 C CA  . LEU A 190 ? 0.1905 0.2435 0.1888 0.0125  -0.0485 -0.0050 171 LEU A CA  
1393 C C   . LEU A 190 ? 0.1926 0.2586 0.2109 -0.0139 -0.0377 -0.0367 171 LEU A C   
1394 O O   . LEU A 190 ? 0.1474 0.2310 0.2094 -0.0090 -0.0290 -0.0309 171 LEU A O   
1395 C CB  . LEU A 190 ? 0.1969 0.2644 0.2137 0.0225  -0.0462 0.0312  171 LEU A CB  
1396 C CG  . LEU A 190 ? 0.2067 0.2658 0.2507 0.0231  -0.0378 0.0389  171 LEU A CG  
1397 C CD1 . LEU A 190 ? 0.1954 0.2885 0.2485 -0.0205 0.0028  0.0076  171 LEU A CD1 
1398 C CD2 . LEU A 190 ? 0.2246 0.2904 0.2877 0.0141  -0.0773 0.0571  171 LEU A CD2 
1399 N N   . ARG A 191 ? 0.2186 0.2588 0.2110 -0.0011 -0.0479 -0.0602 172 ARG A N   
1400 C CA  . ARG A 191 ? 0.2277 0.2495 0.2277 -0.0190 -0.0437 -0.0592 172 ARG A CA  
1401 C C   . ARG A 191 ? 0.2482 0.2354 0.2144 -0.0105 -0.0275 -0.0381 172 ARG A C   
1402 O O   . ARG A 191 ? 0.2313 0.2140 0.2163 -0.0153 -0.0185 -0.0381 172 ARG A O   
1403 C CB  . ARG A 191 ? 0.2724 0.2818 0.2847 -0.0345 -0.0163 -0.1061 172 ARG A CB  
1404 C CG  . ARG A 191 ? 0.3828 0.3346 0.3660 -0.0268 0.0002  -0.0606 172 ARG A CG  
1405 C CD  . ARG A 191 ? 0.4662 0.3889 0.4315 -0.0512 0.0507  -0.0510 172 ARG A CD  
1406 N NE  . ARG A 191 ? 0.5056 0.4351 0.4722 -0.0606 0.0676  -0.0560 172 ARG A NE  
1407 C CZ  . ARG A 191 ? 0.4479 0.4348 0.4768 -0.0779 0.0497  -0.0840 172 ARG A CZ  
1408 N NH1 . ARG A 191 ? 0.4831 0.4423 0.4925 -0.0663 0.0825  -0.0904 172 ARG A NH1 
1409 N NH2 . ARG A 191 ? 0.3616 0.4124 0.4546 -0.0433 0.0849  -0.0994 172 ARG A NH2 
1410 N N   . ARG A 192 ? 0.2319 0.2210 0.1776 0.0054  -0.0132 -0.0232 173 ARG A N   
1411 C CA  . ARG A 192 ? 0.2073 0.2247 0.1626 -0.0323 -0.0308 0.0146  173 ARG A CA  
1412 C C   . ARG A 192 ? 0.2141 0.2110 0.1630 -0.0433 -0.0489 -0.0064 173 ARG A C   
1413 O O   . ARG A 192 ? 0.1825 0.2359 0.1723 -0.0628 -0.0566 -0.0055 173 ARG A O   
1414 C CB  . ARG A 192 ? 0.2053 0.2021 0.1629 -0.0455 -0.0069 0.0162  173 ARG A CB  
1415 C CG  . ARG A 192 ? 0.2346 0.2146 0.1820 -0.0108 0.0004  0.0288  173 ARG A CG  
1416 C CD  . ARG A 192 ? 0.2264 0.2400 0.1901 -0.0435 -0.0109 0.0414  173 ARG A CD  
1417 N NE  . ARG A 192 ? 0.2391 0.2172 0.1881 -0.0581 0.0150  0.0139  173 ARG A NE  
1418 C CZ  . ARG A 192 ? 0.2641 0.2267 0.1950 -0.0803 0.0419  -0.0414 173 ARG A CZ  
1419 N NH1 . ARG A 192 ? 0.3443 0.2520 0.2556 -0.0881 0.0640  -0.0532 173 ARG A NH1 
1420 N NH2 . ARG A 192 ? 0.2906 0.2522 0.2058 -0.0712 0.0368  -0.0310 173 ARG A NH2 
1421 N N   . GLY A 193 ? 0.2265 0.1591 0.1562 -0.0064 -0.0539 0.0042  174 GLY A N   
1422 C CA  . GLY A 193 ? 0.2331 0.1388 0.1455 0.0411  -0.0102 0.0178  174 GLY A CA  
1423 C C   . GLY A 193 ? 0.2112 0.1583 0.1565 0.0512  -0.0088 -0.0014 174 GLY A C   
1424 O O   . GLY A 193 ? 0.2120 0.1702 0.1556 0.0207  -0.0070 0.0033  174 GLY A O   
1425 N N   . THR A 194 ? 0.1875 0.1805 0.1687 0.0578  -0.0413 -0.0241 175 THR A N   
1426 C CA  . THR A 194 ? 0.1829 0.1840 0.1670 0.0534  -0.0766 0.0025  175 THR A CA  
1427 C C   . THR A 194 ? 0.2242 0.2017 0.1841 0.0179  -0.0321 -0.0125 175 THR A C   
1428 O O   . THR A 194 ? 0.2423 0.2104 0.1916 0.0033  0.0004  -0.0033 175 THR A O   
1429 C CB  . THR A 194 ? 0.2356 0.1971 0.1760 0.0634  -0.0617 -0.0138 175 THR A CB  
1430 O OG1 . THR A 194 ? 0.2446 0.2030 0.2128 0.0467  -0.0267 0.0039  175 THR A OG1 
1431 C CG2 . THR A 194 ? 0.2481 0.2298 0.1805 0.0652  -0.1015 -0.0078 175 THR A CG2 
1432 N N   . ALA A 195 ? 0.2084 0.1911 0.1450 -0.0057 -0.0160 -0.0409 176 ALA A N   
1433 C CA  . ALA A 195 ? 0.2156 0.2050 0.1591 0.0052  -0.0351 -0.0079 176 ALA A CA  
1434 C C   . ALA A 195 ? 0.1664 0.1800 0.1805 0.0019  -0.0331 -0.0159 176 ALA A C   
1435 O O   . ALA A 195 ? 0.1993 0.1903 0.1894 -0.0148 -0.0485 -0.0148 176 ALA A O   
1436 C CB  . ALA A 195 ? 0.2082 0.2046 0.1563 0.0034  -0.0277 -0.0475 176 ALA A CB  
1437 N N   . ALA A 196 ? 0.1575 0.1653 0.1623 0.0122  0.0185  -0.0112 177 ALA A N   
1438 C CA  . ALA A 196 ? 0.1388 0.1689 0.1553 -0.0141 -0.0192 0.0072  177 ALA A CA  
1439 C C   . ALA A 196 ? 0.1417 0.1531 0.1487 -0.0199 -0.0134 -0.0152 177 ALA A C   
1440 O O   . ALA A 196 ? 0.1339 0.1474 0.1522 0.0077  -0.0178 0.0052  177 ALA A O   
1441 C CB  . ALA A 196 ? 0.1879 0.2162 0.1683 -0.0400 -0.0392 0.0244  177 ALA A CB  
1442 N N   . MET A 197 ? 0.1336 0.1734 0.1379 0.0096  -0.0301 -0.0298 178 MET A N   
1443 C CA  . MET A 197 ? 0.1229 0.1888 0.1254 0.0365  -0.0169 -0.0429 178 MET A CA  
1444 C C   . MET A 197 ? 0.1518 0.1390 0.1290 0.0025  0.0372  -0.0176 178 MET A C   
1445 O O   . MET A 197 ? 0.1743 0.1661 0.1587 0.0146  0.0189  -0.0263 178 MET A O   
1446 C CB  . MET A 197 ? 0.1704 0.1778 0.1554 -0.0042 0.0199  -0.0249 178 MET A CB  
1447 C CG  . MET A 197 ? 0.1886 0.1752 0.1771 0.0045  -0.0107 -0.0304 178 MET A CG  
1448 S SD  . MET A 197 ? 0.2204 0.1671 0.1926 0.0172  -0.0052 -0.0042 178 MET A SD  
1449 C CE  . MET A 197 ? 0.2483 0.1742 0.2111 -0.0277 -0.0296 -0.0020 178 MET A CE  
1450 N N   . GLU A 198 ? 0.0882 0.1246 0.1514 -0.0022 0.0282  -0.0202 179 GLU A N   
1451 C CA  . GLU A 198 ? 0.1228 0.1154 0.1519 -0.0120 0.0349  -0.0281 179 GLU A CA  
1452 C C   . GLU A 198 ? 0.1394 0.1084 0.1512 -0.0152 0.0124  -0.0069 179 GLU A C   
1453 O O   . GLU A 198 ? 0.1443 0.1254 0.1558 -0.0113 -0.0074 0.0094  179 GLU A O   
1454 C CB  . GLU A 198 ? 0.0723 0.1204 0.1591 -0.0349 0.0391  -0.0181 179 GLU A CB  
1455 C CG  . GLU A 198 ? 0.0945 0.1858 0.1654 -0.0049 0.0237  0.0017  179 GLU A CG  
1456 C CD  . GLU A 198 ? 0.1920 0.1961 0.1742 -0.0097 -0.0071 -0.0213 179 GLU A CD  
1457 O OE1 . GLU A 198 ? 0.2475 0.2255 0.1718 -0.0222 -0.0424 -0.0057 179 GLU A OE1 
1458 O OE2 . GLU A 198 ? 0.1926 0.1889 0.1855 -0.0081 -0.0174 0.0009  179 GLU A OE2 
1459 N N   . SER A 199 ? 0.1602 0.1128 0.1321 -0.0233 0.0114  0.0120  180 SER A N   
1460 C CA  . SER A 199 ? 0.1690 0.1320 0.1257 -0.0298 0.0248  0.0211  180 SER A CA  
1461 C C   . SER A 199 ? 0.1609 0.1585 0.1168 0.0057  0.0138  -0.0014 180 SER A C   
1462 O O   . SER A 199 ? 0.1187 0.1744 0.1477 -0.0002 0.0192  -0.0157 180 SER A O   
1463 C CB  . SER A 199 ? 0.2034 0.1333 0.1335 -0.0344 -0.0165 0.0125  180 SER A CB  
1464 O OG  . SER A 199 ? 0.1685 0.1288 0.1523 -0.0089 -0.0028 0.0173  180 SER A OG  
1465 N N   . ILE A 200 ? 0.1923 0.1425 0.1263 -0.0166 -0.0036 -0.0162 181 ILE A N   
1466 C CA  . ILE A 200 ? 0.1826 0.1435 0.1414 0.0068  -0.0206 0.0130  181 ILE A CA  
1467 C C   . ILE A 200 ? 0.1433 0.1504 0.1302 -0.0553 -0.0223 -0.0206 181 ILE A C   
1468 O O   . ILE A 200 ? 0.1153 0.1609 0.1604 -0.0267 -0.0021 0.0173  181 ILE A O   
1469 C CB  . ILE A 200 ? 0.1817 0.1822 0.1632 0.0236  -0.0163 0.0010  181 ILE A CB  
1470 C CG1 . ILE A 200 ? 0.1690 0.2050 0.1865 0.0673  -0.0154 0.0215  181 ILE A CG1 
1471 C CG2 . ILE A 200 ? 0.1883 0.2014 0.2130 -0.0200 -0.0257 -0.0385 181 ILE A CG2 
1472 C CD1 . ILE A 200 ? 0.2168 0.2334 0.1863 0.0931  -0.0105 0.0270  181 ILE A CD1 
1473 N N   . PHE A 201 ? 0.1888 0.1575 0.1372 -0.0432 0.0051  0.0026  182 PHE A N   
1474 C CA  . PHE A 201 ? 0.1610 0.1885 0.1411 -0.0138 0.0158  0.0012  182 PHE A CA  
1475 C C   . PHE A 201 ? 0.1596 0.1734 0.1374 0.0058  0.0097  -0.0054 182 PHE A C   
1476 O O   . PHE A 201 ? 0.1176 0.1874 0.1309 -0.0063 -0.0107 0.0091  182 PHE A O   
1477 C CB  . PHE A 201 ? 0.1506 0.1638 0.1235 -0.0246 0.0392  -0.0153 182 PHE A CB  
1478 C CG  . PHE A 201 ? 0.1430 0.1502 0.1382 -0.0229 0.0177  -0.0141 182 PHE A CG  
1479 C CD1 . PHE A 201 ? 0.1540 0.1609 0.1409 0.0088  0.0042  -0.0164 182 PHE A CD1 
1480 C CD2 . PHE A 201 ? 0.1486 0.1575 0.1509 -0.0082 0.0108  -0.0208 182 PHE A CD2 
1481 C CE1 . PHE A 201 ? 0.1384 0.1465 0.1542 -0.0183 -0.0152 0.0058  182 PHE A CE1 
1482 C CE2 . PHE A 201 ? 0.1691 0.1628 0.1893 0.0162  0.0274  -0.0278 182 PHE A CE2 
1483 C CZ  . PHE A 201 ? 0.1588 0.1650 0.1933 -0.0127 0.0260  -0.0196 182 PHE A CZ  
1484 N N   . ASP A 202 ? 0.1249 0.1588 0.1644 -0.0004 0.0416  0.0018  183 ASP A N   
1485 C CA  . ASP A 202 ? 0.1186 0.1677 0.1342 -0.0007 0.0168  0.0011  183 ASP A CA  
1486 C C   . ASP A 202 ? 0.1278 0.1423 0.1533 -0.0140 -0.0132 -0.0155 183 ASP A C   
1487 O O   . ASP A 202 ? 0.1162 0.1383 0.1703 -0.0280 0.0146  0.0048  183 ASP A O   
1488 C CB  . ASP A 202 ? 0.1321 0.1670 0.1056 -0.0461 0.0047  -0.0123 183 ASP A CB  
1489 C CG  . ASP A 202 ? 0.1343 0.1555 0.1308 -0.0106 -0.0037 0.0147  183 ASP A CG  
1490 O OD1 . ASP A 202 ? 0.1225 0.1325 0.1433 -0.0103 0.0269  0.0180  183 ASP A OD1 
1491 O OD2 . ASP A 202 ? 0.1344 0.1441 0.1592 -0.0027 -0.0320 -0.0022 183 ASP A OD2 
1492 N N   . MET A 203 ? 0.1448 0.1392 0.1416 -0.0362 0.0070  0.0132  184 MET A N   
1493 C CA  A MET A 203 ? 0.1516 0.1836 0.1428 -0.0296 -0.0121 0.0242  184 MET A CA  
1494 C CA  B MET A 203 ? 0.1392 0.1480 0.1162 -0.0351 0.0040  0.0183  184 MET A CA  
1495 C C   . MET A 203 ? 0.1641 0.1724 0.1231 -0.0222 -0.0041 0.0172  184 MET A C   
1496 O O   . MET A 203 ? 0.1256 0.2008 0.1429 -0.0115 0.0198  0.0231  184 MET A O   
1497 C CB  A MET A 203 ? 0.1601 0.2377 0.1595 -0.0018 0.0003  0.0437  184 MET A CB  
1498 C CB  B MET A 203 ? 0.1231 0.1341 0.0869 -0.0273 0.0376  0.0388  184 MET A CB  
1499 C CG  A MET A 203 ? 0.1909 0.2825 0.1948 0.0151  -0.0170 0.0578  184 MET A CG  
1500 C CG  B MET A 203 ? 0.1451 0.1277 0.1078 -0.0467 0.0222  0.0469  184 MET A CG  
1501 S SD  A MET A 203 ? 0.1916 0.3159 0.2253 0.0275  -0.0057 0.0531  184 MET A SD  
1502 S SD  B MET A 203 ? 0.1579 0.1136 0.1033 -0.0464 0.0222  0.0253  184 MET A SD  
1503 C CE  A MET A 203 ? 0.2379 0.3397 0.2606 0.0436  0.0218  0.0454  184 MET A CE  
1504 C CE  B MET A 203 ? 0.1098 0.1281 0.0870 -0.0690 -0.0119 0.0215  184 MET A CE  
1505 N N   . ILE A 204 ? 0.1527 0.1738 0.1149 -0.0269 -0.0313 -0.0094 185 ILE A N   
1506 C CA  . ILE A 204 ? 0.1228 0.1826 0.1462 -0.0428 -0.0168 -0.0039 185 ILE A CA  
1507 C C   . ILE A 204 ? 0.1463 0.1389 0.1577 -0.0154 -0.0006 -0.0023 185 ILE A C   
1508 O O   . ILE A 204 ? 0.1789 0.1692 0.1645 -0.0424 0.0074  -0.0083 185 ILE A O   
1509 C CB  . ILE A 204 ? 0.1240 0.2086 0.1159 -0.0206 0.0248  -0.0120 185 ILE A CB  
1510 C CG1 . ILE A 204 ? 0.1385 0.2146 0.1292 -0.0263 0.0562  -0.0188 185 ILE A CG1 
1511 C CG2 . ILE A 204 ? 0.1487 0.2466 0.1158 -0.0078 0.0034  0.0103  185 ILE A CG2 
1512 C CD1 . ILE A 204 ? 0.1169 0.2676 0.1231 -0.0021 0.0075  0.0113  185 ILE A CD1 
1513 N N   . GLU A 205 ? 0.1359 0.1214 0.1678 -0.0055 0.0020  0.0020  186 GLU A N   
1514 C CA  . GLU A 205 ? 0.1436 0.1173 0.1826 -0.0110 -0.0055 0.0359  186 GLU A CA  
1515 C C   . GLU A 205 ? 0.1319 0.1469 0.1649 -0.0545 0.0009  0.0282  186 GLU A C   
1516 O O   . GLU A 205 ? 0.1243 0.1847 0.1696 -0.0582 -0.0059 -0.0044 186 GLU A O   
1517 C CB  . GLU A 205 ? 0.1611 0.1050 0.1907 -0.0487 0.0127  0.0293  186 GLU A CB  
1518 C CG  . GLU A 205 ? 0.1554 0.1295 0.1667 -0.0680 0.0110  0.0059  186 GLU A CG  
1519 C CD  . GLU A 205 ? 0.1631 0.1493 0.1728 -0.0324 -0.0059 0.0058  186 GLU A CD  
1520 O OE1 . GLU A 205 ? 0.1583 0.1703 0.1682 -0.0363 0.0047  -0.0005 186 GLU A OE1 
1521 O OE2 . GLU A 205 ? 0.1851 0.1548 0.1600 -0.0175 -0.0169 0.0231  186 GLU A OE2 
1522 N N   . ARG A 206 ? 0.1625 0.1752 0.1437 -0.0221 0.0359  0.0395  187 ARG A N   
1523 C CA  . ARG A 206 ? 0.1644 0.1885 0.1339 -0.0489 0.0102  0.0317  187 ARG A CA  
1524 C C   . ARG A 206 ? 0.1478 0.1681 0.1441 -0.0711 0.0083  0.0151  187 ARG A C   
1525 O O   . ARG A 206 ? 0.1766 0.1829 0.1708 -0.0600 0.0234  0.0038  187 ARG A O   
1526 C CB  . ARG A 206 ? 0.1759 0.1767 0.1258 -0.0631 0.0246  0.0274  187 ARG A CB  
1527 C CG  . ARG A 206 ? 0.1460 0.1914 0.1525 -0.0360 0.0431  0.0326  187 ARG A CG  
1528 C CD  . ARG A 206 ? 0.1586 0.1517 0.1596 -0.0158 0.0517  0.0001  187 ARG A CD  
1529 N NE  . ARG A 206 ? 0.1575 0.1761 0.1698 -0.0318 0.0240  0.0129  187 ARG A NE  
1530 C CZ  . ARG A 206 ? 0.1563 0.1992 0.1594 -0.0797 0.0174  0.0110  187 ARG A CZ  
1531 N NH1 . ARG A 206 ? 0.1677 0.2146 0.1647 -0.0757 -0.0042 0.0107  187 ARG A NH1 
1532 N NH2 . ARG A 206 ? 0.1731 0.2052 0.1341 -0.0545 0.0303  0.0180  187 ARG A NH2 
1533 N N   . LEU A 207 ? 0.1845 0.1431 0.1635 -0.0516 0.0120  -0.0155 188 LEU A N   
1534 C CA  . LEU A 207 ? 0.1613 0.1739 0.1506 -0.0299 -0.0053 -0.0023 188 LEU A CA  
1535 C C   . LEU A 207 ? 0.1631 0.1847 0.1855 -0.0425 -0.0167 -0.0161 188 LEU A C   
1536 O O   . LEU A 207 ? 0.2340 0.2137 0.1977 -0.0571 -0.0433 0.0018  188 LEU A O   
1537 C CB  . LEU A 207 ? 0.1577 0.2212 0.1441 -0.0213 -0.0061 0.0081  188 LEU A CB  
1538 C CG  . LEU A 207 ? 0.1127 0.2264 0.1458 0.0143  0.0011  0.0269  188 LEU A CG  
1539 C CD1 . LEU A 207 ? 0.1638 0.2200 0.2212 0.0041  -0.0428 0.0004  188 LEU A CD1 
1540 C CD2 . LEU A 207 ? 0.1531 0.2387 0.1512 -0.0219 0.0253  0.0499  188 LEU A CD2 
1541 N N   . GLY A 208 ? 0.1441 0.1847 0.1919 -0.0174 0.0048  -0.0169 189 GLY A N   
1542 C CA  . GLY A 208 ? 0.1831 0.1946 0.2090 -0.0102 -0.0310 0.0024  189 GLY A CA  
1543 C C   . GLY A 208 ? 0.1790 0.2001 0.2330 -0.0281 -0.0389 0.0031  189 GLY A C   
1544 O O   . GLY A 208 ? 0.1810 0.2285 0.2450 -0.0211 -0.0618 0.0064  189 GLY A O   
1545 N N   . HIS A 209 ? 0.1562 0.1780 0.2417 -0.0089 -0.0019 -0.0172 190 HIS A N   
1546 C CA  . HIS A 209 ? 0.0878 0.1911 0.2576 -0.0424 0.0199  0.0331  190 HIS A CA  
1547 C C   . HIS A 209 ? 0.0976 0.1856 0.2912 -0.0379 0.0170  0.0444  190 HIS A C   
1548 O O   . HIS A 209 ? 0.1369 0.2147 0.3324 -0.0321 0.0098  0.0331  190 HIS A O   
1549 C CB  . HIS A 209 ? 0.1582 0.2353 0.3060 -0.0512 0.0114  0.0500  190 HIS A CB  
1550 C CG  . HIS A 209 ? 0.2210 0.2829 0.3039 -0.0575 0.0442  0.0576  190 HIS A CG  
1551 N ND1 . HIS A 209 ? 0.2985 0.3314 0.3418 -0.0408 0.0824  0.0434  190 HIS A ND1 
1552 C CD2 . HIS A 209 ? 0.2447 0.3142 0.3167 -0.0304 0.0691  0.0286  190 HIS A CD2 
1553 C CE1 . HIS A 209 ? 0.3271 0.3445 0.3377 -0.0159 0.0621  0.0553  190 HIS A CE1 
1554 N NE2 . HIS A 209 ? 0.2426 0.3370 0.3272 -0.0042 0.0891  0.0534  190 HIS A NE2 
1555 N N   . PHE A 210 ? 0.1462 0.1659 0.2524 -0.0209 0.0351  0.0240  191 PHE A N   
1556 C CA  . PHE A 210 ? 0.1495 0.1667 0.2332 -0.0224 0.0142  0.0224  191 PHE A CA  
1557 C C   . PHE A 210 ? 0.1409 0.1769 0.2057 -0.0229 -0.0057 0.0166  191 PHE A C   
1558 O O   . PHE A 210 ? 0.1243 0.1796 0.2243 -0.0314 0.0095  0.0295  191 PHE A O   
1559 C CB  . PHE A 210 ? 0.1466 0.2075 0.2270 0.0125  0.0022  0.0001  191 PHE A CB  
1560 C CG  . PHE A 210 ? 0.1184 0.1946 0.2188 -0.0227 0.0010  -0.0153 191 PHE A CG  
1561 C CD1 . PHE A 210 ? 0.1408 0.2210 0.2021 -0.0250 -0.0016 0.0130  191 PHE A CD1 
1562 C CD2 . PHE A 210 ? 0.1627 0.2360 0.2288 -0.0117 0.0414  -0.0018 191 PHE A CD2 
1563 C CE1 . PHE A 210 ? 0.1389 0.2226 0.2166 -0.0157 -0.0131 -0.0043 191 PHE A CE1 
1564 C CE2 . PHE A 210 ? 0.1925 0.2285 0.2307 -0.0290 0.0343  -0.0125 191 PHE A CE2 
1565 C CZ  . PHE A 210 ? 0.1783 0.2368 0.2036 -0.0497 0.0137  -0.0213 191 PHE A CZ  
1566 N N   . GLU A 211 ? 0.1655 0.1885 0.1971 -0.0521 0.0543  -0.0102 192 GLU A N   
1567 C CA  . GLU A 211 ? 0.1473 0.1785 0.1838 -0.0379 0.0364  0.0177  192 GLU A CA  
1568 C C   . GLU A 211 ? 0.1664 0.2036 0.1890 -0.0208 0.0136  0.0299  192 GLU A C   
1569 O O   . GLU A 211 ? 0.1898 0.2530 0.2176 -0.0214 -0.0050 0.0596  192 GLU A O   
1570 C CB  . GLU A 211 ? 0.1977 0.1811 0.1732 -0.0254 0.0189  0.0276  192 GLU A CB  
1571 C CG  . GLU A 211 ? 0.1437 0.2037 0.1749 0.0137  0.0110  0.0227  192 GLU A CG  
1572 C CD  . GLU A 211 ? 0.1357 0.1976 0.1935 -0.0124 0.0122  0.0156  192 GLU A CD  
1573 O OE1 . GLU A 211 ? 0.1931 0.2026 0.2090 -0.0241 0.0297  -0.0124 192 GLU A OE1 
1574 O OE2 . GLU A 211 ? 0.1739 0.2063 0.1792 -0.0052 0.0279  0.0248  192 GLU A OE2 
1575 N N   . VAL A 212 ? 0.1210 0.1445 0.1588 0.0037  0.0104  0.0126  193 VAL A N   
1576 C CA  A VAL A 212 ? 0.1848 0.1502 0.1833 -0.0046 0.0256  0.0153  193 VAL A CA  
1577 C CA  B VAL A 212 ? 0.1387 0.1414 0.1432 -0.0100 0.0096  0.0065  193 VAL A CA  
1578 C C   . VAL A 212 ? 0.1641 0.1437 0.1480 -0.0191 0.0178  0.0133  193 VAL A C   
1579 O O   . VAL A 212 ? 0.1613 0.1521 0.1377 -0.0101 0.0254  0.0094  193 VAL A O   
1580 C CB  A VAL A 212 ? 0.2475 0.1448 0.2164 -0.0052 0.0152  0.0046  193 VAL A CB  
1581 C CB  B VAL A 212 ? 0.1258 0.1168 0.0983 -0.0134 -0.0131 -0.0159 193 VAL A CB  
1582 C CG1 A VAL A 212 ? 0.2447 0.1173 0.2098 -0.0165 -0.0259 0.0142  193 VAL A CG1 
1583 C CG1 B VAL A 212 ? 0.0481 0.0786 0.0860 0.0001  0.0353  -0.0044 193 VAL A CG1 
1584 C CG2 A VAL A 212 ? 0.2736 0.1560 0.2444 0.0142  0.0242  0.0158  193 VAL A CG2 
1585 C CG2 B VAL A 212 ? 0.1661 0.1285 0.0945 -0.0024 -0.0204 -0.0135 193 VAL A CG2 
1586 N N   . PRO A 213 ? 0.1649 0.1608 0.1741 -0.0033 -0.0242 -0.0137 194 PRO A N   
1587 C CA  . PRO A 213 ? 0.1784 0.1353 0.1612 -0.0171 -0.0355 0.0074  194 PRO A CA  
1588 C C   . PRO A 213 ? 0.1773 0.1419 0.1466 -0.0151 -0.0203 -0.0117 194 PRO A C   
1589 O O   . PRO A 213 ? 0.1737 0.1255 0.1430 0.0102  0.0239  -0.0100 194 PRO A O   
1590 C CB  . PRO A 213 ? 0.2323 0.1568 0.1824 -0.0056 -0.0184 -0.0145 194 PRO A CB  
1591 C CG  . PRO A 213 ? 0.2249 0.1718 0.1777 -0.0011 -0.0495 -0.0166 194 PRO A CG  
1592 C CD  . PRO A 213 ? 0.2118 0.1942 0.1748 0.0498  -0.0568 -0.0293 194 PRO A CD  
1593 N N   . GLN A 214 ? 0.1384 0.1333 0.1663 -0.0261 -0.0006 0.0097  195 GLN A N   
1594 C CA  . GLN A 214 ? 0.1589 0.1312 0.1400 0.0154  0.0187  -0.0123 195 GLN A CA  
1595 C C   . GLN A 214 ? 0.1748 0.1481 0.1313 0.0077  0.0287  -0.0098 195 GLN A C   
1596 O O   . GLN A 214 ? 0.1386 0.1451 0.1332 0.0124  0.0046  -0.0216 195 GLN A O   
1597 C CB  . GLN A 214 ? 0.1851 0.1240 0.1658 0.0427  -0.0126 -0.0352 195 GLN A CB  
1598 C CG  . GLN A 214 ? 0.1795 0.1444 0.1825 0.0296  -0.0067 -0.0243 195 GLN A CG  
1599 C CD  . GLN A 214 ? 0.1429 0.1375 0.1707 0.0183  -0.0062 -0.0045 195 GLN A CD  
1600 O OE1 . GLN A 214 ? 0.1877 0.1218 0.1530 0.0227  -0.0298 0.0011  195 GLN A OE1 
1601 N NE2 . GLN A 214 ? 0.1860 0.1067 0.1915 -0.0091 0.0236  0.0008  195 GLN A NE2 
1602 N N   . HIS A 215 ? 0.1626 0.1202 0.1190 -0.0293 0.0126  -0.0097 196 HIS A N   
1603 C CA  . HIS A 215 ? 0.1579 0.1239 0.1488 0.0189  -0.0180 0.0138  196 HIS A CA  
1604 C C   . HIS A 215 ? 0.1661 0.1192 0.1413 -0.0007 0.0029  -0.0151 196 HIS A C   
1605 O O   . HIS A 215 ? 0.0916 0.1581 0.1267 0.0076  0.0248  -0.0134 196 HIS A O   
1606 C CB  . HIS A 215 ? 0.1019 0.1339 0.1803 0.0130  -0.0332 0.0126  196 HIS A CB  
1607 C CG  . HIS A 215 ? 0.1774 0.1857 0.2529 0.0286  -0.0238 0.0136  196 HIS A CG  
1608 N ND1 . HIS A 215 ? 0.2066 0.2087 0.3002 0.0049  -0.0429 0.0633  196 HIS A ND1 
1609 C CD2 . HIS A 215 ? 0.1637 0.1676 0.2443 0.0407  -0.1098 -0.0518 196 HIS A CD2 
1610 C CE1 . HIS A 215 ? 0.1946 0.2252 0.3181 0.0075  -0.0653 0.0272  196 HIS A CE1 
1611 N NE2 . HIS A 215 ? 0.1823 0.2147 0.2948 0.0534  -0.0822 -0.0257 196 HIS A NE2 
1612 N N   . VAL A 216 ? 0.1698 0.0938 0.1662 0.0182  0.0020  -0.0202 197 VAL A N   
1613 C CA  . VAL A 216 ? 0.1580 0.1239 0.1410 -0.0049 -0.0012 -0.0078 197 VAL A CA  
1614 C C   . VAL A 216 ? 0.1920 0.1394 0.1376 0.0071  0.0342  -0.0033 197 VAL A C   
1615 O O   . VAL A 216 ? 0.1738 0.1543 0.1381 -0.0140 0.0262  -0.0300 197 VAL A O   
1616 C CB  . VAL A 216 ? 0.1412 0.1582 0.1553 0.0150  -0.0122 -0.0201 197 VAL A CB  
1617 C CG1 . VAL A 216 ? 0.1602 0.1491 0.1883 0.0371  -0.0203 -0.0143 197 VAL A CG1 
1618 C CG2 . VAL A 216 ? 0.1761 0.1954 0.1530 0.0094  -0.0238 0.0095  197 VAL A CG2 
1619 N N   . MET A 217 ? 0.1775 0.1047 0.1052 -0.0111 0.0053  0.0089  198 MET A N   
1620 C CA  . MET A 217 ? 0.1711 0.1324 0.1442 -0.0132 0.0149  0.0022  198 MET A CA  
1621 C C   . MET A 217 ? 0.1789 0.1276 0.1643 -0.0188 0.0287  0.0014  198 MET A C   
1622 O O   . MET A 217 ? 0.2177 0.1334 0.1306 0.0242  -0.0059 -0.0110 198 MET A O   
1623 C CB  . MET A 217 ? 0.1398 0.1605 0.1273 0.0126  0.0127  0.0199  198 MET A CB  
1624 C CG  . MET A 217 ? 0.1884 0.1809 0.1963 0.0209  -0.0067 0.0145  198 MET A CG  
1625 S SD  . MET A 217 ? 0.1863 0.2097 0.1976 0.0119  0.0228  0.0144  198 MET A SD  
1626 C CE  . MET A 217 ? 0.1693 0.2034 0.2056 -0.0107 -0.0181 0.0337  198 MET A CE  
1627 N N   . HIS A 218 ? 0.1663 0.1219 0.1427 -0.0121 0.0432  -0.0194 199 HIS A N   
1628 C CA  . HIS A 218 ? 0.1919 0.1286 0.1238 0.0097  0.0104  -0.0267 199 HIS A CA  
1629 C C   . HIS A 218 ? 0.1990 0.1363 0.1151 -0.0080 0.0062  -0.0193 199 HIS A C   
1630 O O   . HIS A 218 ? 0.1867 0.1614 0.1233 -0.0243 0.0263  -0.0149 199 HIS A O   
1631 C CB  . HIS A 218 ? 0.1771 0.1411 0.0942 0.0185  -0.0309 -0.0050 199 HIS A CB  
1632 C CG  . HIS A 218 ? 0.2032 0.1456 0.0956 0.0070  0.0104  -0.0092 199 HIS A CG  
1633 N ND1 . HIS A 218 ? 0.1862 0.1860 0.1258 0.0313  0.0016  -0.0098 199 HIS A ND1 
1634 C CD2 . HIS A 218 ? 0.2431 0.1792 0.1041 0.0095  0.0572  -0.0004 199 HIS A CD2 
1635 C CE1 . HIS A 218 ? 0.2194 0.1891 0.1527 0.0272  0.0287  0.0033  199 HIS A CE1 
1636 N NE2 . HIS A 218 ? 0.2336 0.1841 0.1427 0.0474  0.0168  -0.0020 199 HIS A NE2 
1637 N N   . HIS A 219 ? 0.1822 0.1371 0.0968 0.0297  0.0117  -0.0383 200 HIS A N   
1638 C CA  . HIS A 219 ? 0.1607 0.1561 0.0998 -0.0056 0.0110  -0.0093 200 HIS A CA  
1639 C C   . HIS A 219 ? 0.1710 0.1614 0.1161 -0.0034 0.0130  0.0058  200 HIS A C   
1640 O O   . HIS A 219 ? 0.1573 0.1363 0.1095 -0.0009 0.0238  -0.0163 200 HIS A O   
1641 C CB  . HIS A 219 ? 0.1558 0.1917 0.1264 -0.0069 0.0091  0.0079  200 HIS A CB  
1642 C CG  . HIS A 219 ? 0.1632 0.1836 0.1207 -0.0002 0.0121  0.0168  200 HIS A CG  
1643 N ND1 . HIS A 219 ? 0.1919 0.1889 0.1079 0.0153  0.0123  0.0040  200 HIS A ND1 
1644 C CD2 . HIS A 219 ? 0.1598 0.1971 0.1469 0.0263  -0.0133 0.0054  200 HIS A CD2 
1645 C CE1 . HIS A 219 ? 0.1809 0.1925 0.1322 0.0131  -0.0113 0.0023  200 HIS A CE1 
1646 N NE2 . HIS A 219 ? 0.2087 0.1937 0.1609 0.0272  -0.0160 -0.0051 200 HIS A NE2 
1647 N N   . PRO A 220 ? 0.1542 0.1416 0.1286 0.0191  -0.0189 0.0138  201 PRO A N   
1648 C CA  . PRO A 220 ? 0.1194 0.1615 0.1449 0.0033  -0.0005 0.0159  201 PRO A CA  
1649 C C   . PRO A 220 ? 0.1235 0.1652 0.1557 0.0208  -0.0046 -0.0097 201 PRO A C   
1650 O O   . PRO A 220 ? 0.1331 0.1630 0.1461 0.0322  0.0121  -0.0147 201 PRO A O   
1651 C CB  . PRO A 220 ? 0.1304 0.1868 0.1669 0.0072  0.0211  0.0140  201 PRO A CB  
1652 C CG  . PRO A 220 ? 0.0798 0.2020 0.1805 0.0166  0.0494  0.0330  201 PRO A CG  
1653 C CD  . PRO A 220 ? 0.1309 0.1633 0.1593 0.0022  0.0599  0.0411  201 PRO A CD  
1654 N N   . LEU A 221 ? 0.1407 0.1553 0.1356 -0.0325 0.0245  -0.0235 202 LEU A N   
1655 C CA  . LEU A 221 ? 0.1368 0.1488 0.1103 -0.0090 -0.0076 -0.0225 202 LEU A CA  
1656 C C   . LEU A 221 ? 0.1516 0.1597 0.1311 0.0209  0.0115  -0.0203 202 LEU A C   
1657 O O   . LEU A 221 ? 0.1382 0.1780 0.1516 0.0136  0.0000  -0.0073 202 LEU A O   
1658 C CB  . LEU A 221 ? 0.1966 0.1723 0.1070 0.0037  -0.0408 -0.0246 202 LEU A CB  
1659 C CG  . LEU A 221 ? 0.2132 0.1741 0.1310 -0.0141 -0.0641 -0.0150 202 LEU A CG  
1660 C CD1 . LEU A 221 ? 0.3058 0.2435 0.1249 -0.0054 -0.0885 -0.0224 202 LEU A CD1 
1661 C CD2 . LEU A 221 ? 0.2296 0.2077 0.1884 -0.0015 -0.0556 -0.0210 202 LEU A CD2 
1662 N N   . PHE A 222 ? 0.1216 0.1586 0.1343 0.0106  0.0380  -0.0063 203 PHE A N   
1663 C CA  . PHE A 222 ? 0.0804 0.1552 0.1308 -0.0134 0.0237  -0.0183 203 PHE A CA  
1664 C C   . PHE A 222 ? 0.1474 0.1625 0.1296 -0.0438 0.0037  0.0046  203 PHE A C   
1665 O O   . PHE A 222 ? 0.2042 0.1653 0.1303 -0.0368 0.0033  -0.0036 203 PHE A O   
1666 C CB  . PHE A 222 ? 0.0754 0.1555 0.1393 0.0098  0.0283  -0.0262 203 PHE A CB  
1667 C CG  . PHE A 222 ? 0.0973 0.1446 0.1442 -0.0197 -0.0046 0.0080  203 PHE A CG  
1668 C CD1 . PHE A 222 ? 0.0962 0.1711 0.1478 -0.0272 0.0279  -0.0559 203 PHE A CD1 
1669 C CD2 . PHE A 222 ? 0.0823 0.1879 0.1737 0.0143  -0.0085 0.0090  203 PHE A CD2 
1670 C CE1 . PHE A 222 ? 0.0875 0.1825 0.1450 0.0077  0.0325  -0.0419 203 PHE A CE1 
1671 C CE2 . PHE A 222 ? 0.0729 0.1770 0.1602 0.0009  -0.0139 -0.0241 203 PHE A CE2 
1672 C CZ  . PHE A 222 ? 0.0861 0.2046 0.1337 0.0123  0.0209  -0.0491 203 PHE A CZ  
1673 N N   . ARG A 223 ? 0.1293 0.1444 0.1054 -0.0310 0.0238  -0.0352 204 ARG A N   
1674 C CA  . ARG A 223 ? 0.1103 0.1389 0.1341 -0.0104 0.0091  -0.0504 204 ARG A CA  
1675 C C   . ARG A 223 ? 0.1206 0.1798 0.1274 0.0095  0.0271  -0.0185 204 ARG A C   
1676 O O   . ARG A 223 ? 0.1314 0.1854 0.1269 0.0051  0.0263  0.0034  204 ARG A O   
1677 C CB  . ARG A 223 ? 0.1598 0.1336 0.1408 -0.0109 0.0145  -0.0301 204 ARG A CB  
1678 C CG  . ARG A 223 ? 0.1734 0.1422 0.1350 0.0125  0.0316  -0.0107 204 ARG A CG  
1679 C CD  . ARG A 223 ? 0.1767 0.1907 0.1693 0.0120  0.0040  -0.0085 204 ARG A CD  
1680 N NE  . ARG A 223 ? 0.1826 0.2016 0.1419 0.0305  -0.0304 -0.0107 204 ARG A NE  
1681 C CZ  . ARG A 223 ? 0.1876 0.2723 0.1614 0.0083  -0.0315 -0.0240 204 ARG A CZ  
1682 N NH1 . ARG A 223 ? 0.1802 0.2964 0.1894 0.0345  -0.0329 -0.0126 204 ARG A NH1 
1683 N NH2 . ARG A 223 ? 0.2014 0.3018 0.1797 0.0479  -0.0290 -0.0245 204 ARG A NH2 
1684 N N   . GLN A 224 ? 0.0975 0.1954 0.1302 -0.0279 0.0145  -0.0242 205 GLN A N   
1685 C CA  . GLN A 224 ? 0.1006 0.2077 0.1270 -0.0103 0.0042  0.0095  205 GLN A CA  
1686 C C   . GLN A 224 ? 0.1080 0.1868 0.1193 -0.0275 0.0018  -0.0163 205 GLN A C   
1687 O O   . GLN A 224 ? 0.1269 0.1905 0.1430 -0.0030 -0.0073 -0.0143 205 GLN A O   
1688 C CB  . GLN A 224 ? 0.0924 0.1973 0.1512 -0.0367 0.0405  0.0174  205 GLN A CB  
1689 C CG  . GLN A 224 ? 0.1110 0.1908 0.1496 -0.0317 0.0497  0.0180  205 GLN A CG  
1690 C CD  . GLN A 224 ? 0.1176 0.2120 0.1887 -0.0089 0.0559  0.0136  205 GLN A CD  
1691 O OE1 . GLN A 224 ? 0.1042 0.2761 0.2370 0.0143  0.0712  0.0152  205 GLN A OE1 
1692 N NE2 . GLN A 224 ? 0.1760 0.2259 0.1842 -0.0402 0.0074  -0.0307 205 GLN A NE2 
1693 N N   . LEU A 225 ? 0.0923 0.1605 0.1201 -0.0358 -0.0022 -0.0064 206 LEU A N   
1694 C CA  . LEU A 225 ? 0.0846 0.1800 0.1024 -0.0517 -0.0193 -0.0014 206 LEU A CA  
1695 C C   . LEU A 225 ? 0.1154 0.1706 0.0968 -0.0225 0.0103  -0.0124 206 LEU A C   
1696 O O   . LEU A 225 ? 0.1257 0.1841 0.1409 0.0167  0.0073  -0.0049 206 LEU A O   
1697 C CB  . LEU A 225 ? 0.1268 0.2100 0.1025 -0.0205 -0.0313 -0.0074 206 LEU A CB  
1698 C CG  . LEU A 225 ? 0.1218 0.2198 0.0937 0.0203  -0.0148 -0.0272 206 LEU A CG  
1699 C CD1 . LEU A 225 ? 0.0932 0.2787 0.1231 0.0121  -0.0230 -0.0267 206 LEU A CD1 
1700 C CD2 . LEU A 225 ? 0.1712 0.1899 0.1043 0.0231  0.0127  -0.0535 206 LEU A CD2 
1701 N N   . ARG A 226 ? 0.1637 0.1800 0.0863 -0.0107 0.0437  -0.0209 207 ARG A N   
1702 C CA  . ARG A 226 ? 0.1347 0.1839 0.0831 -0.0010 0.0342  -0.0154 207 ARG A CA  
1703 C C   . ARG A 226 ? 0.1049 0.1757 0.1210 -0.0120 0.0310  -0.0047 207 ARG A C   
1704 O O   . ARG A 226 ? 0.1259 0.1662 0.1498 0.0014  0.0212  0.0040  207 ARG A O   
1705 C CB  . ARG A 226 ? 0.1196 0.1788 0.0922 -0.0349 0.0512  -0.0216 207 ARG A CB  
1706 C CG  . ARG A 226 ? 0.1137 0.1833 0.1066 -0.0098 0.0624  -0.0054 207 ARG A CG  
1707 C CD  . ARG A 226 ? 0.1705 0.2141 0.1214 -0.0059 0.0594  0.0086  207 ARG A CD  
1708 N NE  . ARG A 226 ? 0.1802 0.1653 0.1101 0.0107  0.0367  -0.0017 207 ARG A NE  
1709 C CZ  . ARG A 226 ? 0.1791 0.1382 0.1039 -0.0026 0.0095  0.0258  207 ARG A CZ  
1710 N NH1 . ARG A 226 ? 0.1327 0.1212 0.1300 -0.0123 0.0022  -0.0007 207 ARG A NH1 
1711 N NH2 . ARG A 226 ? 0.1947 0.1621 0.1128 -0.0019 0.0368  0.0243  207 ARG A NH2 
1712 N N   . GLN A 227 ? 0.1046 0.2030 0.1313 -0.0077 0.0133  -0.0228 208 GLN A N   
1713 C CA  . GLN A 227 ? 0.1168 0.2025 0.1532 -0.0083 0.0201  -0.0067 208 GLN A CA  
1714 C C   . GLN A 227 ? 0.1419 0.1941 0.1276 0.0203  0.0294  -0.0042 208 GLN A C   
1715 O O   . GLN A 227 ? 0.1587 0.1431 0.1717 0.0099  0.0143  -0.0207 208 GLN A O   
1716 C CB  . GLN A 227 ? 0.1242 0.2342 0.1615 -0.0243 -0.0257 -0.0114 208 GLN A CB  
1717 C CG  . GLN A 227 ? 0.1559 0.2625 0.1741 -0.0114 -0.0206 0.0110  208 GLN A CG  
1718 C CD  . GLN A 227 ? 0.2241 0.2195 0.1747 0.0109  0.0032  -0.0173 208 GLN A CD  
1719 O OE1 . GLN A 227 ? 0.3290 0.2079 0.1965 0.0286  0.0223  -0.0475 208 GLN A OE1 
1720 N NE2 . GLN A 227 ? 0.1655 0.2098 0.2086 0.0086  0.0050  -0.0030 208 GLN A NE2 
1721 N N   . LEU A 228 ? 0.1559 0.2010 0.1021 0.0171  0.0266  -0.0068 209 LEU A N   
1722 C CA  . LEU A 228 ? 0.1422 0.1857 0.1009 0.0216  0.0445  -0.0190 209 LEU A CA  
1723 C C   . LEU A 228 ? 0.1259 0.1751 0.1301 -0.0019 0.0196  -0.0060 209 LEU A C   
1724 O O   . LEU A 228 ? 0.1583 0.2041 0.1687 0.0155  0.0390  -0.0094 209 LEU A O   
1725 C CB  . LEU A 228 ? 0.1242 0.2032 0.1208 -0.0157 0.0413  -0.0305 209 LEU A CB  
1726 C CG  . LEU A 228 ? 0.0452 0.1734 0.1452 -0.0087 0.0095  -0.0056 209 LEU A CG  
1727 C CD1 . LEU A 228 ? 0.1163 0.2277 0.1164 -0.0165 0.0028  -0.0014 209 LEU A CD1 
1728 C CD2 . LEU A 228 ? 0.0644 0.2055 0.1724 0.0126  0.0316  -0.0203 209 LEU A CD2 
1729 N N   . ALA A 229 ? 0.0958 0.1746 0.1488 -0.0229 0.0141  -0.0049 210 ALA A N   
1730 C CA  . ALA A 229 ? 0.1029 0.1810 0.1406 0.0123  -0.0156 -0.0259 210 ALA A CA  
1731 C C   . ALA A 229 ? 0.1263 0.1536 0.1348 0.0071  0.0029  -0.0307 210 ALA A C   
1732 O O   . ALA A 229 ? 0.1500 0.1556 0.1616 -0.0022 0.0017  0.0042  210 ALA A O   
1733 C CB  . ALA A 229 ? 0.1192 0.2187 0.1296 0.0212  -0.0069 -0.0150 210 ALA A CB  
1734 N N   . ALA A 230 ? 0.1285 0.2119 0.1334 -0.0064 0.0138  -0.0421 211 ALA A N   
1735 C CA  . ALA A 230 ? 0.1501 0.1970 0.1323 0.0107  0.0168  -0.0206 211 ALA A CA  
1736 C C   . ALA A 230 ? 0.1661 0.2003 0.1590 0.0004  0.0016  -0.0073 211 ALA A C   
1737 O O   . ALA A 230 ? 0.1736 0.1939 0.1765 -0.0009 0.0161  0.0168  211 ALA A O   
1738 C CB  . ALA A 230 ? 0.1925 0.1934 0.1452 -0.0184 0.0230  -0.0335 211 ALA A CB  
1739 N N   . ASP A 231 ? 0.1215 0.1851 0.1628 0.0066  0.0157  -0.0192 212 ASP A N   
1740 C CA  . ASP A 231 ? 0.1352 0.1681 0.2017 0.0116  -0.0173 -0.0160 212 ASP A CA  
1741 C C   . ASP A 231 ? 0.1459 0.1775 0.2032 -0.0013 -0.0222 -0.0333 212 ASP A C   
1742 O O   . ASP A 231 ? 0.1529 0.1919 0.2259 0.0086  -0.0308 -0.0180 212 ASP A O   
1743 C CB  . ASP A 231 ? 0.1642 0.1552 0.1957 0.0023  -0.0075 -0.0021 212 ASP A CB  
1744 C CG  . ASP A 231 ? 0.2131 0.1888 0.2454 -0.0088 0.0153  0.0025  212 ASP A CG  
1745 O OD1 . ASP A 231 ? 0.2307 0.2016 0.2659 -0.0466 -0.0244 -0.0092 212 ASP A OD1 
1746 O OD2 . ASP A 231 ? 0.2416 0.1921 0.2409 0.0171  -0.0206 -0.0128 212 ASP A OD2 
1747 N N   . ILE A 232 ? 0.1692 0.1492 0.1855 -0.0133 0.0002  -0.0478 213 ILE A N   
1748 C CA  . ILE A 232 ? 0.1672 0.1611 0.1862 0.0007  0.0139  -0.0368 213 ILE A CA  
1749 C C   . ILE A 232 ? 0.2043 0.1725 0.2119 0.0009  0.0127  -0.0371 213 ILE A C   
1750 O O   . ILE A 232 ? 0.2199 0.1887 0.2236 0.0186  -0.0081 -0.0054 213 ILE A O   
1751 C CB  . ILE A 232 ? 0.1693 0.1507 0.1715 0.0116  0.0480  -0.0282 213 ILE A CB  
1752 C CG1 . ILE A 232 ? 0.1562 0.1905 0.1627 0.0087  0.0120  0.0003  213 ILE A CG1 
1753 C CG2 . ILE A 232 ? 0.1877 0.1737 0.1909 0.0163  0.0580  -0.0401 213 ILE A CG2 
1754 C CD1 . ILE A 232 ? 0.2450 0.2080 0.1515 0.0096  0.0095  -0.0265 213 ILE A CD1 
1755 N N   . PRO A 233 ? 0.1572 0.1707 0.2119 0.0293  0.0429  0.0014  214 PRO A N   
1756 C CA  . PRO A 233 ? 0.1895 0.1830 0.2301 0.0157  0.0597  0.0083  214 PRO A CA  
1757 C C   . PRO A 233 ? 0.2326 0.1917 0.2038 0.0419  0.0204  0.0027  214 PRO A C   
1758 O O   . PRO A 233 ? 0.2284 0.1991 0.2006 0.0299  -0.0015 0.0136  214 PRO A O   
1759 C CB  . PRO A 233 ? 0.1955 0.1899 0.2380 0.0084  0.0749  0.0263  214 PRO A CB  
1760 C CG  . PRO A 233 ? 0.1936 0.2079 0.2588 -0.0093 0.0750  0.0318  214 PRO A CG  
1761 C CD  . PRO A 233 ? 0.1600 0.1851 0.2354 0.0116  0.0872  0.0194  214 PRO A CD  
1762 N N   . SER A 234 ? 0.2721 0.2132 0.2057 0.0187  -0.0013 -0.0203 215 SER A N   
1763 C CA  A SER A 234 ? 0.2882 0.2347 0.2185 0.0160  -0.0046 -0.0188 215 SER A CA  
1764 C CA  B SER A 234 ? 0.2527 0.2154 0.1883 0.0254  -0.0209 -0.0169 215 SER A CA  
1765 C C   . SER A 234 ? 0.2281 0.2146 0.2044 0.0281  -0.0240 -0.0027 215 SER A C   
1766 O O   . SER A 234 ? 0.2498 0.1992 0.2431 0.0155  -0.0178 0.0339  215 SER A O   
1767 C CB  A SER A 234 ? 0.3467 0.2613 0.2629 0.0152  0.0205  -0.0228 215 SER A CB  
1768 C CB  B SER A 234 ? 0.2611 0.2097 0.1764 0.0590  -0.0174 -0.0119 215 SER A CB  
1769 O OG  A SER A 234 ? 0.3833 0.2791 0.3120 -0.0066 0.0144  -0.0372 215 SER A OG  
1770 O OG  B SER A 234 ? 0.2345 0.2067 0.1751 0.0583  -0.0510 -0.0111 215 SER A OG  
1771 N N   . PHE A 235 ? 0.2020 0.1912 0.1936 -0.0141 0.0005  -0.0207 216 PHE A N   
1772 C CA  . PHE A 235 ? 0.1683 0.1734 0.2071 -0.0256 -0.0055 -0.0055 216 PHE A CA  
1773 C C   . PHE A 235 ? 0.1826 0.1683 0.2214 0.0015  -0.0167 -0.0022 216 PHE A C   
1774 O O   . PHE A 235 ? 0.2246 0.1751 0.2717 0.0063  -0.0401 0.0056  216 PHE A O   
1775 C CB  . PHE A 235 ? 0.1665 0.1935 0.2036 -0.0088 0.0043  0.0274  216 PHE A CB  
1776 C CG  . PHE A 235 ? 0.1745 0.2090 0.2160 -0.0165 -0.0063 -0.0059 216 PHE A CG  
1777 C CD1 . PHE A 235 ? 0.1689 0.1923 0.2367 -0.0486 -0.0108 -0.0046 216 PHE A CD1 
1778 C CD2 . PHE A 235 ? 0.1710 0.2042 0.2078 0.0048  -0.0119 -0.0082 216 PHE A CD2 
1779 C CE1 . PHE A 235 ? 0.1987 0.2182 0.2487 -0.0264 0.0304  -0.0055 216 PHE A CE1 
1780 C CE2 . PHE A 235 ? 0.1805 0.2124 0.2005 -0.0376 0.0467  -0.0047 216 PHE A CE2 
1781 C CZ  . PHE A 235 ? 0.1780 0.2255 0.2146 -0.0350 0.0402  -0.0212 216 PHE A CZ  
1782 N N   . THR A 236 ? 0.1902 0.1850 0.2189 -0.0174 -0.0310 -0.0007 217 THR A N   
1783 C CA  . THR A 236 ? 0.1836 0.2150 0.2398 -0.0302 -0.0289 -0.0090 217 THR A CA  
1784 C C   . THR A 236 ? 0.1994 0.2203 0.2677 -0.0038 -0.0416 -0.0045 217 THR A C   
1785 O O   . THR A 236 ? 0.1940 0.1875 0.3015 0.0176  -0.0342 -0.0010 217 THR A O   
1786 C CB  . THR A 236 ? 0.1419 0.2412 0.2162 -0.0147 0.0066  -0.0059 217 THR A CB  
1787 O OG1 . THR A 236 ? 0.1364 0.2276 0.2246 0.0088  0.0106  -0.0054 217 THR A OG1 
1788 C CG2 . THR A 236 ? 0.1689 0.2190 0.2443 -0.0018 0.0368  0.0248  217 THR A CG2 
1789 N N   . ASN A 237 ? 0.2007 0.2286 0.2564 -0.0079 -0.0448 0.0223  218 ASN A N   
1790 C CA  . ASN A 237 ? 0.2342 0.2507 0.2627 -0.0081 -0.0677 0.0494  218 ASN A CA  
1791 C C   . ASN A 237 ? 0.2482 0.2624 0.2921 -0.0524 -0.0822 0.0489  218 ASN A C   
1792 O O   . ASN A 237 ? 0.2541 0.2814 0.3062 -0.0486 -0.0851 0.0504  218 ASN A O   
1793 C CB  . ASN A 237 ? 0.2935 0.3011 0.2501 0.0062  -0.0796 0.0693  218 ASN A CB  
1794 C CG  . ASN A 237 ? 0.3853 0.3390 0.3110 0.0034  -0.0602 0.0529  218 ASN A CG  
1795 O OD1 . ASN A 237 ? 0.4501 0.4199 0.3502 -0.0141 -0.0418 0.0223  218 ASN A OD1 
1796 N ND2 . ASN A 237 ? 0.4133 0.2973 0.3255 0.0089  -0.0441 0.0794  218 ASN A ND2 
1797 N N   . ASP A 238 ? 0.2241 0.2691 0.2840 -0.0405 -0.0717 0.0285  219 ASP A N   
1798 C CA  . ASP A 238 ? 0.2259 0.2659 0.3053 -0.0160 -0.0669 0.0129  219 ASP A CA  
1799 C C   . ASP A 238 ? 0.2479 0.2461 0.3404 -0.0038 -0.0946 0.0063  219 ASP A C   
1800 O O   . ASP A 238 ? 0.3095 0.2461 0.3687 -0.0182 -0.1066 0.0290  219 ASP A O   
1801 C CB  . ASP A 238 ? 0.2466 0.2907 0.2851 -0.0212 -0.0463 -0.0086 219 ASP A CB  
1802 C CG  . ASP A 238 ? 0.2431 0.2979 0.2802 -0.0204 -0.0064 -0.0039 219 ASP A CG  
1803 O OD1 . ASP A 238 ? 0.2820 0.3295 0.2863 -0.0452 -0.0044 -0.0141 219 ASP A OD1 
1804 O OD2 . ASP A 238 ? 0.2422 0.3052 0.2843 -0.0273 -0.0084 -0.0271 219 ASP A OD2 
1805 N N   . VAL A 239 ? 0.2383 0.2449 0.3426 -0.0096 -0.0978 -0.0158 220 VAL A N   
1806 C CA  . VAL A 239 ? 0.2299 0.2867 0.3580 0.0055  -0.0837 -0.0055 220 VAL A CA  
1807 C C   . VAL A 239 ? 0.2480 0.2765 0.3954 0.0395  -0.1075 0.0369  220 VAL A C   
1808 O O   . VAL A 239 ? 0.2806 0.3101 0.4274 0.0574  -0.0978 0.0545  220 VAL A O   
1809 C CB  . VAL A 239 ? 0.2399 0.3018 0.3275 0.0095  -0.0412 -0.0349 220 VAL A CB  
1810 C CG1 . VAL A 239 ? 0.2950 0.3264 0.3287 0.0415  -0.0330 -0.0361 220 VAL A CG1 
1811 C CG2 . VAL A 239 ? 0.2014 0.3207 0.3044 -0.0086 -0.0343 -0.0245 220 VAL A CG2 
1812 N N   . ARG A 240 ? 0.2629 0.2719 0.3958 0.0033  -0.0989 0.0624  221 ARG A N   
1813 C CA  . ARG A 240 ? 0.3208 0.2651 0.4329 0.0234  -0.0735 0.0583  221 ARG A CA  
1814 C C   . ARG A 240 ? 0.3642 0.2703 0.4754 0.0380  -0.0572 0.0600  221 ARG A C   
1815 O O   . ARG A 240 ? 0.4044 0.2707 0.5137 0.0528  -0.0791 0.0343  221 ARG A O   
1816 C CB  . ARG A 240 ? 0.3307 0.2673 0.4337 0.0193  -0.0638 0.0743  221 ARG A CB  
1817 C CG  . ARG A 240 ? 0.3733 0.3107 0.4289 -0.0240 -0.0463 0.0149  221 ARG A CG  
1818 C CD  . ARG A 240 ? 0.3745 0.2830 0.4118 0.0258  0.0149  -0.0232 221 ARG A CD  
1819 N NE  . ARG A 240 ? 0.3131 0.2511 0.4006 0.0048  0.0581  -0.0554 221 ARG A NE  
1820 C CZ  . ARG A 240 ? 0.3279 0.3024 0.4069 0.0074  0.0604  -0.0655 221 ARG A CZ  
1821 N NH1 . ARG A 240 ? 0.3438 0.3384 0.4240 0.0375  0.0646  -0.0691 221 ARG A NH1 
1822 N NH2 . ARG A 240 ? 0.2755 0.2914 0.3900 -0.0147 0.0450  -0.0848 221 ARG A NH2 
1823 N N   . SER A 241 ? 0.3930 0.3314 0.4779 0.0312  -0.0746 0.0853  222 SER A N   
1824 C CA  . SER A 241 ? 0.4252 0.4014 0.4721 0.0071  -0.0821 0.0859  222 SER A CA  
1825 C C   . SER A 241 ? 0.4422 0.4085 0.4807 0.0219  -0.0972 0.0906  222 SER A C   
1826 O O   . SER A 241 ? 0.4495 0.4097 0.4724 0.0093  -0.1096 0.0928  222 SER A O   
1827 C CB  . SER A 241 ? 0.4873 0.4363 0.4632 -0.0403 -0.0762 0.0836  222 SER A CB  
1828 O OG  . SER A 241 ? 0.5030 0.4892 0.4652 -0.0459 -0.0567 0.0923  222 SER A OG  
1829 N N   . PHE A 242 ? 0.4238 0.4271 0.5081 0.0483  -0.0877 0.0986  223 PHE A N   
1830 C CA  . PHE A 242 ? 0.4784 0.4832 0.5567 0.0512  -0.0504 0.0848  223 PHE A CA  
1831 C C   . PHE A 242 ? 0.5181 0.5000 0.5867 0.0446  -0.0538 0.0940  223 PHE A C   
1832 O O   . PHE A 242 ? 0.4991 0.4712 0.5767 0.0427  -0.0597 0.1253  223 PHE A O   
1833 C CB  . PHE A 242 ? 0.4977 0.5311 0.5725 0.0515  -0.0341 0.0596  223 PHE A CB  
1834 C CG  . PHE A 242 ? 0.5441 0.5804 0.5952 0.0193  -0.0084 0.0237  223 PHE A CG  
1835 C CD1 . PHE A 242 ? 0.5564 0.5983 0.6086 0.0237  -0.0123 0.0125  223 PHE A CD1 
1836 C CD2 . PHE A 242 ? 0.5586 0.5910 0.6017 0.0031  0.0031  0.0075  223 PHE A CD2 
1837 C CE1 . PHE A 242 ? 0.5785 0.6055 0.6160 0.0212  -0.0096 0.0013  223 PHE A CE1 
1838 C CE2 . PHE A 242 ? 0.5767 0.5997 0.6054 0.0136  -0.0087 0.0004  223 PHE A CE2 
1839 C CZ  . PHE A 242 ? 0.5658 0.6020 0.6105 0.0189  -0.0131 -0.0045 223 PHE A CZ  
1840 N N   . ALA A 243 ? 0.5613 0.5366 0.6270 0.0559  -0.0421 0.0773  224 ALA A N   
1841 C CA  . ALA A 243 ? 0.5768 0.5790 0.6682 0.0466  -0.0432 0.0700  224 ALA A CA  
1842 C C   . ALA A 243 ? 0.6174 0.6161 0.7130 0.0257  -0.0356 0.0718  224 ALA A C   
1843 O O   . ALA A 243 ? 0.6199 0.6140 0.7080 0.0127  -0.0283 0.0776  224 ALA A O   
1844 C CB  . ALA A 243 ? 0.5805 0.5805 0.6730 0.0465  -0.0300 0.0692  224 ALA A CB  
1845 N N   . GLN A 244 ? 0.6621 0.6594 0.7605 0.0210  -0.0402 0.0663  225 GLN A N   
1846 C CA  . GLN A 244 ? 0.7227 0.7154 0.7999 0.0089  -0.0351 0.0590  225 GLN A CA  
1847 C C   . GLN A 244 ? 0.7145 0.7139 0.7880 0.0049  -0.0368 0.0652  225 GLN A C   
1848 O O   . GLN A 244 ? 0.7155 0.7090 0.7761 0.0075  -0.0401 0.0834  225 GLN A O   
1849 C CB  . GLN A 244 ? 0.7863 0.7795 0.8453 0.0020  -0.0323 0.0473  225 GLN A CB  
1850 C CG  . GLN A 244 ? 0.8422 0.8478 0.8865 0.0040  -0.0151 0.0343  225 GLN A CG  
1851 C CD  . GLN A 244 ? 0.8926 0.8878 0.9219 -0.0072 0.0119  0.0222  225 GLN A CD  
1852 O OE1 . GLN A 244 ? 0.9068 0.8988 0.9409 -0.0067 0.0205  0.0180  225 GLN A OE1 
1853 N NE2 . GLN A 244 ? 0.9116 0.8975 0.9318 -0.0134 0.0226  0.0226  225 GLN A NE2 
1854 N N   . GLU A 245 ? 0.6975 0.7091 0.7843 0.0004  -0.0423 0.0581  226 GLU A N   
1855 C CA  . GLU A 245 ? 0.6895 0.7016 0.7804 -0.0046 -0.0525 0.0415  226 GLU A CA  
1856 C C   . GLU A 245 ? 0.6721 0.6842 0.7710 -0.0006 -0.0668 0.0493  226 GLU A C   
1857 O O   . GLU A 245 ? 0.6607 0.6702 0.7589 0.0025  -0.0722 0.0522  226 GLU A O   
1858 C CB  . GLU A 245 ? 0.6955 0.7121 0.7846 -0.0043 -0.0522 0.0176  226 GLU A CB  
1859 C CG  . GLU A 245 ? 0.7105 0.7237 0.7842 -0.0054 -0.0518 0.0040  226 GLU A CG  
1860 C CD  . GLU A 245 ? 0.7275 0.7256 0.7805 0.0007  -0.0512 -0.0092 226 GLU A CD  
1861 O OE1 . GLU A 245 ? 0.7043 0.7089 0.7751 -0.0015 -0.0500 -0.0055 226 GLU A OE1 
1862 O OE2 . GLU A 245 ? 0.7475 0.7337 0.7811 -0.0010 -0.0539 -0.0150 226 GLU A OE2 
1863 N N   . ALA A 252 ? 0.4740 0.5455 0.3019 -0.0526 -0.0835 -0.0089 233 ALA A N   
1864 C CA  . ALA A 252 ? 0.4164 0.5294 0.3029 -0.0511 -0.0507 -0.0005 233 ALA A CA  
1865 C C   . ALA A 252 ? 0.3747 0.4775 0.3171 -0.0723 -0.0268 0.0183  233 ALA A C   
1866 O O   . ALA A 252 ? 0.3595 0.4628 0.3350 -0.0670 -0.0058 0.0461  233 ALA A O   
1867 C CB  . ALA A 252 ? 0.4542 0.5510 0.3194 -0.0482 -0.0563 -0.0167 233 ALA A CB  
1868 N N   . ASN A 253 ? 0.3467 0.4350 0.2944 -0.0873 -0.0392 0.0112  234 ASN A N   
1869 C CA  . ASN A 253 ? 0.3133 0.3764 0.2921 -0.0719 -0.0345 -0.0230 234 ASN A CA  
1870 C C   . ASN A 253 ? 0.2427 0.3584 0.2766 -0.0607 -0.0520 -0.0250 234 ASN A C   
1871 O O   . ASN A 253 ? 0.1805 0.3716 0.2992 -0.0334 -0.0648 -0.0107 234 ASN A O   
1872 C CB  . ASN A 253 ? 0.2858 0.3566 0.3042 -0.0353 -0.0437 -0.0221 234 ASN A CB  
1873 C CG  . ASN A 253 ? 0.3260 0.3445 0.3243 -0.0225 -0.0373 -0.0267 234 ASN A CG  
1874 O OD1 . ASN A 253 ? 0.3730 0.3585 0.3322 -0.0628 0.0078  -0.0155 234 ASN A OD1 
1875 N ND2 . ASN A 253 ? 0.2958 0.3191 0.3252 -0.0097 -0.0714 -0.0344 234 ASN A ND2 
1876 N N   . LEU A 254 ? 0.2340 0.3387 0.2876 -0.0251 -0.0320 -0.0050 235 LEU A N   
1877 C CA  . LEU A 254 ? 0.2260 0.3436 0.2842 0.0096  -0.0699 -0.0102 235 LEU A CA  
1878 C C   . LEU A 254 ? 0.2056 0.3347 0.2944 -0.0248 -0.0608 -0.0112 235 LEU A C   
1879 O O   . LEU A 254 ? 0.1752 0.3496 0.3350 -0.0424 -0.0436 -0.0203 235 LEU A O   
1880 C CB  . LEU A 254 ? 0.2496 0.3400 0.2814 0.0151  -0.0715 -0.0061 235 LEU A CB  
1881 C CG  . LEU A 254 ? 0.2631 0.3621 0.2921 0.0109  -0.0543 -0.0287 235 LEU A CG  
1882 C CD1 . LEU A 254 ? 0.2933 0.3690 0.3093 -0.0078 -0.0091 -0.0559 235 LEU A CD1 
1883 C CD2 . LEU A 254 ? 0.2989 0.3825 0.2878 0.0498  -0.0591 -0.0271 235 LEU A CD2 
1884 N N   . VAL A 255 ? 0.1874 0.3197 0.3056 -0.0033 -0.0361 -0.0055 236 VAL A N   
1885 C CA  . VAL A 255 ? 0.1988 0.3227 0.3338 -0.0109 -0.0674 -0.0245 236 VAL A CA  
1886 C C   . VAL A 255 ? 0.2028 0.3715 0.3686 -0.0066 -0.0365 -0.0137 236 VAL A C   
1887 O O   . VAL A 255 ? 0.1942 0.3644 0.3400 0.0029  0.0105  -0.0135 236 VAL A O   
1888 C CB  . VAL A 255 ? 0.2020 0.2827 0.3398 0.0013  -0.0481 -0.0155 236 VAL A CB  
1889 C CG1 . VAL A 255 ? 0.1911 0.2826 0.3442 -0.0031 -0.0639 -0.0453 236 VAL A CG1 
1890 C CG2 . VAL A 255 ? 0.1978 0.2707 0.3311 -0.0384 -0.0184 -0.0272 236 VAL A CG2 
1891 N N   . MET A 256 ? 0.2407 0.4149 0.4139 -0.0244 -0.0456 -0.0119 237 MET A N   
1892 C CA  . MET A 256 ? 0.3003 0.4692 0.4402 -0.0061 -0.0606 0.0021  237 MET A CA  
1893 C C   . MET A 256 ? 0.2399 0.4349 0.3697 -0.0207 -0.0845 -0.0017 237 MET A C   
1894 O O   . MET A 256 ? 0.2202 0.4273 0.3642 -0.0026 -0.0943 -0.0053 237 MET A O   
1895 C CB  . MET A 256 ? 0.4808 0.6131 0.5858 0.0131  -0.0325 0.0037  237 MET A CB  
1896 C CG  . MET A 256 ? 0.6773 0.7185 0.6892 0.0208  0.0072  -0.0020 237 MET A CG  
1897 S SD  . MET A 256 ? 0.8667 0.8236 0.7951 0.0115  0.0440  -0.0039 237 MET A SD  
1898 C CE  . MET A 256 ? 0.9549 0.9137 0.8416 0.0100  0.0386  0.0029  237 MET A CE  
1899 N N   . ILE A 257 ? 0.2274 0.3878 0.3162 -0.0402 -0.0622 -0.0193 238 ILE A N   
1900 C CA  . ILE A 257 ? 0.2319 0.3960 0.3035 -0.0314 -0.0514 -0.0541 238 ILE A CA  
1901 C C   . ILE A 257 ? 0.2256 0.4014 0.3076 -0.0589 -0.0521 -0.0529 238 ILE A C   
1902 O O   . ILE A 257 ? 0.2456 0.4114 0.3441 -0.0583 -0.0327 -0.0711 238 ILE A O   
1903 C CB  . ILE A 257 ? 0.2950 0.3968 0.3288 -0.0319 -0.0238 -0.0568 238 ILE A CB  
1904 C CG1 . ILE A 257 ? 0.3061 0.4146 0.3583 -0.0299 -0.0083 -0.0492 238 ILE A CG1 
1905 C CG2 . ILE A 257 ? 0.3115 0.3963 0.3220 -0.0523 -0.0173 -0.0715 238 ILE A CG2 
1906 C CD1 . ILE A 257 ? 0.2768 0.4207 0.3669 -0.0420 0.0046  -0.0577 238 ILE A CD1 
1907 N N   . VAL A 258 ? 0.2260 0.4110 0.2647 -0.0457 -0.0685 -0.0377 239 VAL A N   
1908 C CA  . VAL A 258 ? 0.2060 0.4077 0.2836 -0.0199 -0.0754 -0.0369 239 VAL A CA  
1909 C C   . VAL A 258 ? 0.2007 0.4366 0.3005 -0.0011 -0.0661 -0.0225 239 VAL A C   
1910 O O   . VAL A 258 ? 0.2001 0.4496 0.2853 -0.0008 -0.0379 -0.0300 239 VAL A O   
1911 C CB  . VAL A 258 ? 0.2188 0.3786 0.2859 -0.0419 -0.0965 -0.0335 239 VAL A CB  
1912 C CG1 . VAL A 258 ? 0.2432 0.3679 0.2652 -0.0472 -0.0810 -0.0103 239 VAL A CG1 
1913 C CG2 . VAL A 258 ? 0.2364 0.3811 0.3030 -0.0355 -0.0920 -0.0289 239 VAL A CG2 
1914 N N   . ARG A 259 ? 0.1786 0.4231 0.3008 0.0181  -0.0893 0.0062  240 ARG A N   
1915 C CA  . ARG A 259 ? 0.2492 0.4789 0.3555 -0.0149 -0.0844 -0.0030 240 ARG A CA  
1916 C C   . ARG A 259 ? 0.2659 0.5303 0.3584 -0.0320 -0.0986 0.0107  240 ARG A C   
1917 O O   . ARG A 259 ? 0.2686 0.5475 0.3604 -0.0069 -0.0832 0.0254  240 ARG A O   
1918 C CB  . ARG A 259 ? 0.3043 0.4897 0.4191 0.0102  -0.0674 -0.0156 240 ARG A CB  
1919 C CG  . ARG A 259 ? 0.3710 0.5225 0.4793 0.0110  -0.0593 -0.0098 240 ARG A CG  
1920 C CD  . ARG A 259 ? 0.4451 0.5556 0.5384 0.0188  -0.0352 -0.0133 240 ARG A CD  
1921 N NE  . ARG A 259 ? 0.4715 0.5739 0.5836 0.0343  -0.0179 0.0111  240 ARG A NE  
1922 C CZ  . ARG A 259 ? 0.5373 0.6115 0.6333 0.0440  -0.0053 0.0321  240 ARG A CZ  
1923 N NH1 . ARG A 259 ? 0.5878 0.6319 0.6562 0.0454  0.0092  0.0221  240 ARG A NH1 
1924 N NH2 . ARG A 259 ? 0.5361 0.6135 0.6552 0.0462  -0.0121 0.0571  240 ARG A NH2 
1925 N N   . ARG A 260 ? 0.2865 0.5399 0.3603 -0.0809 -0.1133 0.0024  241 ARG A N   
1926 C CA  . ARG A 260 ? 0.3396 0.5667 0.3787 -0.1043 -0.0856 -0.0080 241 ARG A CA  
1927 C C   . ARG A 260 ? 0.3467 0.5648 0.3729 -0.1247 -0.0553 -0.0052 241 ARG A C   
1928 O O   . ARG A 260 ? 0.3404 0.5987 0.3410 -0.1202 -0.0557 0.0368  241 ARG A O   
1929 C CB  . ARG A 260 ? 0.3831 0.5809 0.4094 -0.0963 -0.0481 -0.0449 241 ARG A CB  
1930 C CG  . ARG A 260 ? 0.4335 0.5949 0.4630 -0.0696 -0.0068 -0.0548 241 ARG A CG  
1931 C CD  . ARG A 260 ? 0.5063 0.6146 0.5114 -0.0560 0.0227  -0.0616 241 ARG A CD  
1932 N NE  . ARG A 260 ? 0.5437 0.6240 0.5572 -0.0488 0.0458  -0.0537 241 ARG A NE  
1933 C CZ  . ARG A 260 ? 0.5463 0.6262 0.5839 -0.0307 0.0423  -0.0574 241 ARG A CZ  
1934 N NH1 . ARG A 260 ? 0.5274 0.6098 0.5868 -0.0290 0.0219  -0.0613 241 ARG A NH1 
1935 N NH2 . ARG A 260 ? 0.5773 0.6397 0.6025 -0.0185 0.0518  -0.0549 241 ARG A NH2 
1936 N N   . ASP A 261 ? 0.3448 0.5324 0.3819 -0.1303 -0.0311 -0.0378 242 ASP A N   
1937 C CA  . ASP A 261 ? 0.3732 0.5114 0.4120 -0.1207 -0.0003 -0.0527 242 ASP A CA  
1938 C C   . ASP A 261 ? 0.3693 0.4910 0.4177 -0.0958 0.0119  -0.0415 242 ASP A C   
1939 O O   . ASP A 261 ? 0.3844 0.4831 0.4111 -0.0912 0.0437  -0.0443 242 ASP A O   
1940 C CB  . ASP A 261 ? 0.4389 0.5135 0.4569 -0.1211 0.0209  -0.0682 242 ASP A CB  
1941 C CG  . ASP A 261 ? 0.4812 0.5316 0.5180 -0.0981 0.0376  -0.0699 242 ASP A CG  
1942 O OD1 . ASP A 261 ? 0.5024 0.5380 0.5288 -0.1340 0.0313  -0.0756 242 ASP A OD1 
1943 O OD2 . ASP A 261 ? 0.5221 0.5395 0.5556 -0.0769 0.0890  -0.0690 242 ASP A OD2 
1944 N N   . ARG A 262 ? 0.3353 0.4800 0.4261 -0.0577 -0.0073 -0.0201 243 ARG A N   
1945 C CA  . ARG A 262 ? 0.3275 0.4751 0.4295 -0.0426 -0.0189 0.0018  243 ARG A CA  
1946 C C   . ARG A 262 ? 0.3363 0.4578 0.4172 -0.0397 -0.0148 0.0193  243 ARG A C   
1947 O O   . ARG A 262 ? 0.3198 0.4571 0.4066 -0.0322 0.0087  0.0224  243 ARG A O   
1948 C CB  . ARG A 262 ? 0.3540 0.4896 0.4461 -0.0292 -0.0304 0.0228  243 ARG A CB  
1949 C CG  . ARG A 262 ? 0.4114 0.5170 0.4705 -0.0183 -0.0272 0.0384  243 ARG A CG  
1950 C CD  . ARG A 262 ? 0.4486 0.5345 0.4945 -0.0068 -0.0543 0.0614  243 ARG A CD  
1951 N NE  . ARG A 262 ? 0.5228 0.5596 0.5250 -0.0073 -0.0648 0.0726  243 ARG A NE  
1952 C CZ  . ARG A 262 ? 0.5617 0.5702 0.5504 0.0139  -0.0624 0.0912  243 ARG A CZ  
1953 N NH1 . ARG A 262 ? 0.5619 0.5598 0.5343 0.0118  -0.0679 0.0963  243 ARG A NH1 
1954 N NH2 . ARG A 262 ? 0.6043 0.5988 0.5822 0.0141  -0.0563 0.0896  243 ARG A NH2 
1955 N N   . CYS A 263 ? 0.3208 0.4485 0.4196 -0.0505 -0.0337 0.0357  244 CYS A N   
1956 C CA  . CYS A 263 ? 0.2676 0.4637 0.4409 -0.0539 -0.0472 0.0355  244 CYS A CA  
1957 C C   . CYS A 263 ? 0.2403 0.4712 0.4408 -0.0244 -0.0496 0.0412  244 CYS A C   
1958 O O   . CYS A 263 ? 0.2256 0.4813 0.4464 -0.0268 -0.0698 0.0369  244 CYS A O   
1959 C CB  . CYS A 263 ? 0.2776 0.4702 0.4714 -0.0794 -0.0741 0.0561  244 CYS A CB  
1960 S SG  . CYS A 263 ? 0.3189 0.5045 0.4993 -0.1648 -0.1092 0.0706  244 CYS A SG  
1961 N N   . CYS A 264 ? 0.2484 0.4640 0.4290 0.0270  -0.0600 0.0418  245 CYS A N   
1962 C CA  . CYS A 264 ? 0.2473 0.4562 0.4159 0.0579  -0.0582 0.0301  245 CYS A CA  
1963 C C   . CYS A 264 ? 0.2696 0.4608 0.4326 0.0818  -0.0638 0.0220  245 CYS A C   
1964 O O   . CYS A 264 ? 0.3030 0.4772 0.4393 0.0614  -0.0735 0.0455  245 CYS A O   
1965 C CB  . CYS A 264 ? 0.2416 0.4641 0.3950 0.0408  -0.0560 0.0197  245 CYS A CB  
1966 S SG  . CYS A 264 ? 0.1648 0.4733 0.3659 0.0330  -0.0421 0.0119  245 CYS A SG  
1967 N N   . SER A 265 ? 0.2642 0.4580 0.4481 0.1082  -0.0658 -0.0022 246 SER A N   
1968 C CA  . SER A 265 ? 0.3148 0.4721 0.4582 0.1157  -0.0562 -0.0138 246 SER A CA  
1969 C C   . SER A 265 ? 0.3230 0.4868 0.4639 0.1054  -0.0783 0.0288  246 SER A C   
1970 O O   . SER A 265 ? 0.2648 0.5024 0.4462 0.1311  -0.1049 0.0469  246 SER A O   
1971 C CB  . SER A 265 ? 0.3589 0.4744 0.4627 0.1470  -0.0315 -0.0624 246 SER A CB  
1972 O OG  . SER A 265 ? 0.3805 0.4777 0.4553 0.1552  -0.0207 -0.1130 246 SER A OG  
1973 N N   . THR A 266 ? 0.3669 0.4860 0.4838 0.1018  -0.1098 0.0508  247 THR A N   
1974 C CA  . THR A 266 ? 0.3910 0.4774 0.5011 0.0659  -0.1177 0.0440  247 THR A CA  
1975 C C   . THR A 266 ? 0.3985 0.4548 0.5191 0.0512  -0.1024 0.0159  247 THR A C   
1976 O O   . THR A 266 ? 0.3649 0.4283 0.5372 0.0209  -0.1003 0.0048  247 THR A O   
1977 C CB  . THR A 266 ? 0.4287 0.4971 0.5138 0.0726  -0.1268 0.0647  247 THR A CB  
1978 O OG1 . THR A 266 ? 0.4744 0.5121 0.5249 0.1036  -0.1221 0.0755  247 THR A OG1 
1979 C CG2 . THR A 266 ? 0.4435 0.5034 0.5182 0.0575  -0.1175 0.0734  247 THR A CG2 
1980 N N   . ALA A 267 ? 0.4083 0.4654 0.5099 0.0883  -0.1051 -0.0017 248 ALA A N   
1981 C CA  . ALA A 267 ? 0.4547 0.4978 0.5288 0.0923  -0.0691 -0.0273 248 ALA A CA  
1982 C C   . ALA A 267 ? 0.3839 0.4643 0.4779 0.1089  -0.0709 -0.0688 248 ALA A C   
1983 O O   . ALA A 267 ? 0.3099 0.4332 0.4472 0.1481  -0.1063 -0.0942 248 ALA A O   
1985 N N   . GLU A 268 ? 0.3681 0.4575 0.4580 0.1186  -0.0489 -0.0684 249 GLU A N   
1986 C CA  . GLU A 268 ? 0.3430 0.4587 0.4335 0.0706  -0.0260 -0.0637 249 GLU A CA  
1987 C C   . GLU A 268 ? 0.2236 0.3882 0.3628 0.0681  -0.0396 -0.0576 249 GLU A C   
1988 O O   . GLU A 268 ? 0.1648 0.3585 0.3261 0.0769  -0.0409 -0.0524 249 GLU A O   
1989 C CB  . GLU A 268 ? 0.4376 0.5326 0.5030 0.0453  0.0013  -0.0567 249 GLU A CB  
1990 C CG  . GLU A 268 ? 0.5504 0.6160 0.5789 0.0255  0.0223  -0.0273 249 GLU A CG  
1991 C CD  . GLU A 268 ? 0.6883 0.6794 0.6519 0.0144  0.0254  0.0039  249 GLU A CD  
1992 O OE1 . GLU A 268 ? 0.7282 0.7195 0.6915 0.0093  0.0410  0.0035  249 GLU A OE1 
1993 O OE2 . GLU A 268 ? 0.7115 0.7030 0.7030 0.0023  0.0175  0.0251  249 GLU A OE2 
1994 N N   . ALA A 269 ? 0.2172 0.3756 0.3478 0.0543  -0.0444 -0.0654 250 ALA A N   
1995 C CA  . ALA A 269 ? 0.1977 0.3611 0.3063 0.0423  -0.0656 -0.0542 250 ALA A CA  
1996 C C   . ALA A 269 ? 0.1937 0.3161 0.3063 0.0271  -0.0603 -0.0422 250 ALA A C   
1997 O O   . ALA A 269 ? 0.1557 0.3013 0.2974 0.0302  -0.0759 -0.0085 250 ALA A O   
1998 C CB  . ALA A 269 ? 0.1912 0.3740 0.2701 0.0064  -0.1144 -0.0647 250 ALA A CB  
1999 N N   . CYS A 270 ? 0.1825 0.2649 0.3144 0.0173  -0.0814 -0.0468 251 CYS A N   
2000 C CA  . CYS A 270 ? 0.2363 0.2607 0.3238 0.0257  -0.0770 -0.0324 251 CYS A CA  
2001 C C   . CYS A 270 ? 0.2385 0.2673 0.2986 0.0424  -0.0533 -0.0322 251 CYS A C   
2002 O O   . CYS A 270 ? 0.2629 0.2614 0.2985 0.0486  -0.0875 -0.0625 251 CYS A O   
2003 C CB  . CYS A 270 ? 0.3268 0.2950 0.3946 0.0475  -0.1084 -0.0204 251 CYS A CB  
2004 S SG  . CYS A 270 ? 0.4165 0.3111 0.4709 0.0499  -0.1278 0.0012  251 CYS A SG  
2005 N N   . ALA A 271 ? 0.1935 0.2811 0.2762 0.0568  -0.0234 -0.0593 252 ALA A N   
2006 C CA  . ALA A 271 ? 0.1962 0.3256 0.2656 0.0907  -0.0138 -0.0616 252 ALA A CA  
2007 C C   . ALA A 271 ? 0.1895 0.3275 0.2744 0.0816  -0.0226 -0.0557 252 ALA A C   
2008 O O   . ALA A 271 ? 0.1893 0.3297 0.2779 0.0879  -0.0296 -0.0470 252 ALA A O   
2009 C CB  . ALA A 271 ? 0.2000 0.3412 0.2605 0.1015  0.0129  -0.0566 252 ALA A CB  
2010 N N   . VAL A 272 ? 0.1782 0.3167 0.2793 0.0452  0.0002  -0.0566 253 VAL A N   
2011 C CA  . VAL A 272 ? 0.1839 0.3233 0.2898 0.0245  0.0079  -0.0670 253 VAL A CA  
2012 C C   . VAL A 272 ? 0.1611 0.2876 0.2807 0.0457  0.0175  -0.0404 253 VAL A C   
2013 O O   . VAL A 272 ? 0.1634 0.2921 0.2658 0.0426  -0.0157 -0.0315 253 VAL A O   
2014 C CB  . VAL A 272 ? 0.1732 0.3116 0.3045 0.0112  -0.0108 -0.0774 253 VAL A CB  
2015 C CG1 . VAL A 272 ? 0.1677 0.2941 0.2958 0.0348  -0.0132 -0.0676 253 VAL A CG1 
2016 C CG2 . VAL A 272 ? 0.1544 0.3371 0.3228 0.0268  0.0013  -0.0447 253 VAL A CG2 
2017 N N   . VAL A 273 ? 0.1310 0.2409 0.2579 0.0243  0.0157  -0.0156 254 VAL A N   
2018 C CA  . VAL A 273 ? 0.1161 0.2358 0.2518 0.0093  0.0067  -0.0195 254 VAL A CA  
2019 C C   . VAL A 273 ? 0.1115 0.2209 0.2680 0.0381  -0.0124 -0.0511 254 VAL A C   
2020 O O   . VAL A 273 ? 0.1444 0.2202 0.2667 0.0491  -0.0393 -0.0531 254 VAL A O   
2021 C CB  . VAL A 273 ? 0.1385 0.2638 0.2361 0.0045  -0.0062 0.0056  254 VAL A CB  
2022 C CG1 . VAL A 273 ? 0.1872 0.2750 0.2153 -0.0063 0.0184  0.0148  254 VAL A CG1 
2023 C CG2 . VAL A 273 ? 0.1476 0.2727 0.2260 -0.0235 -0.0485 0.0029  254 VAL A CG2 
2024 N N   . TRP A 274 ? 0.1268 0.2406 0.2828 -0.0003 -0.0147 -0.0604 255 TRP A N   
2025 C CA  . TRP A 274 ? 0.1648 0.2342 0.2823 0.0198  -0.0022 -0.0749 255 TRP A CA  
2026 C C   . TRP A 274 ? 0.1730 0.2469 0.2740 0.0259  -0.0170 -0.0744 255 TRP A C   
2027 O O   . TRP A 274 ? 0.1884 0.2259 0.2685 0.0472  -0.0377 -0.0809 255 TRP A O   
2028 C CB  . TRP A 274 ? 0.1870 0.2233 0.3016 0.0164  -0.0208 -0.0689 255 TRP A CB  
2029 C CG  . TRP A 274 ? 0.2080 0.2365 0.3087 0.0167  -0.0375 -0.0746 255 TRP A CG  
2030 C CD1 . TRP A 274 ? 0.2302 0.2718 0.3294 0.0600  -0.0102 -0.0728 255 TRP A CD1 
2031 C CD2 . TRP A 274 ? 0.2282 0.2329 0.3268 0.0086  -0.0157 -0.0669 255 TRP A CD2 
2032 N NE1 . TRP A 274 ? 0.2490 0.2769 0.3439 0.0585  -0.0307 -0.0560 255 TRP A NE1 
2033 C CE2 . TRP A 274 ? 0.2644 0.2621 0.3537 0.0250  0.0076  -0.0506 255 TRP A CE2 
2034 C CE3 . TRP A 274 ? 0.2486 0.2348 0.3694 0.0147  0.0392  -0.0420 255 TRP A CE3 
2035 C CZ2 . TRP A 274 ? 0.2676 0.2699 0.3704 0.0210  0.0102  -0.0525 255 TRP A CZ2 
2036 C CZ3 . TRP A 274 ? 0.2465 0.2425 0.3831 0.0311  0.0290  -0.0562 255 TRP A CZ3 
2037 C CH2 . TRP A 274 ? 0.2532 0.2704 0.3806 0.0425  0.0225  -0.0561 255 TRP A CH2 
2038 N N   . ASP A 275 ? 0.1983 0.2632 0.2712 0.0280  -0.0328 -0.0687 256 ASP A N   
2039 C CA  . ASP A 275 ? 0.1929 0.2703 0.2716 0.0477  0.0132  -0.0706 256 ASP A CA  
2040 C C   . ASP A 275 ? 0.1707 0.2462 0.2514 0.0500  0.0124  -0.0828 256 ASP A C   
2041 O O   . ASP A 275 ? 0.1642 0.2765 0.2167 0.0348  -0.0009 -0.0610 256 ASP A O   
2042 C CB  . ASP A 275 ? 0.1747 0.3261 0.2916 0.0803  0.0064  -0.0611 256 ASP A CB  
2043 C CG  . ASP A 275 ? 0.1847 0.3834 0.3063 0.0947  0.0291  -0.0591 256 ASP A CG  
2044 O OD1 . ASP A 275 ? 0.1923 0.4302 0.2958 0.0892  0.0578  -0.0343 256 ASP A OD1 
2045 O OD2 . ASP A 275 ? 0.2025 0.3926 0.3326 0.1418  0.0117  -0.0438 256 ASP A OD2 
2046 N N   . GLU A 276 ? 0.1434 0.2221 0.2547 0.0178  -0.0137 -0.0792 257 GLU A N   
2047 C CA  A GLU A 276 ? 0.1577 0.2107 0.2523 0.0262  -0.0162 -0.0850 257 GLU A CA  
2048 C CA  B GLU A 276 ? 0.1510 0.2002 0.2498 0.0175  -0.0169 -0.0884 257 GLU A CA  
2049 C C   . GLU A 276 ? 0.1853 0.2149 0.2431 0.0417  -0.0041 -0.0694 257 GLU A C   
2050 O O   . GLU A 276 ? 0.1767 0.2286 0.2168 0.0353  -0.0034 -0.0460 257 GLU A O   
2051 C CB  A GLU A 276 ? 0.1926 0.2186 0.2557 0.0645  -0.0143 -0.0929 257 GLU A CB  
2052 C CB  B GLU A 276 ? 0.1728 0.1894 0.2482 0.0434  -0.0121 -0.0991 257 GLU A CB  
2053 C CG  A GLU A 276 ? 0.2692 0.2456 0.2853 0.0432  -0.0008 -0.0837 257 GLU A CG  
2054 C CG  B GLU A 276 ? 0.2263 0.1945 0.2740 0.0040  -0.0006 -0.0864 257 GLU A CG  
2055 C CD  A GLU A 276 ? 0.3059 0.2725 0.3169 0.0520  0.0090  -0.0715 257 GLU A CD  
2056 C CD  B GLU A 276 ? 0.2532 0.2179 0.3020 0.0101  0.0187  -0.0930 257 GLU A CD  
2057 O OE1 A GLU A 276 ? 0.3108 0.2675 0.3119 0.0486  -0.0223 -0.0807 257 GLU A OE1 
2058 O OE1 B GLU A 276 ? 0.2708 0.2285 0.3289 0.0330  0.0381  -0.0854 257 GLU A OE1 
2059 O OE2 A GLU A 276 ? 0.3422 0.3181 0.3537 0.0458  0.0137  -0.0270 257 GLU A OE2 
2060 O OE2 B GLU A 276 ? 0.2189 0.2483 0.3105 -0.0167 0.0007  -0.0863 257 GLU A OE2 
2061 N N   . ALA A 277 ? 0.1406 0.2028 0.2061 0.0255  -0.0139 -0.0398 258 ALA A N   
2062 C CA  . ALA A 277 ? 0.1351 0.1995 0.1999 0.0046  -0.0095 -0.0069 258 ALA A CA  
2063 C C   . ALA A 277 ? 0.1894 0.1999 0.1775 0.0148  0.0036  -0.0286 258 ALA A C   
2064 O O   . ALA A 277 ? 0.1746 0.2095 0.1455 0.0432  0.0016  -0.0135 258 ALA A O   
2065 C CB  . ALA A 277 ? 0.1607 0.2074 0.2047 0.0189  0.0113  0.0075  258 ALA A CB  
2066 N N   . GLN A 278 ? 0.2136 0.2094 0.1749 0.0262  -0.0073 -0.0358 259 GLN A N   
2067 C CA  . GLN A 278 ? 0.1948 0.1721 0.1550 0.0321  -0.0044 -0.0458 259 GLN A CA  
2068 C C   . GLN A 278 ? 0.1478 0.1764 0.1791 0.0411  0.0155  -0.0230 259 GLN A C   
2069 O O   . GLN A 278 ? 0.1942 0.2120 0.2059 0.0735  0.0029  -0.0272 259 GLN A O   
2070 C CB  . GLN A 278 ? 0.1942 0.1906 0.1531 0.0430  -0.0216 -0.0628 259 GLN A CB  
2071 C CG  . GLN A 278 ? 0.1751 0.2523 0.1859 0.0407  -0.0189 -0.0584 259 GLN A CG  
2072 C CD  . GLN A 278 ? 0.1830 0.2430 0.1956 0.0598  -0.0229 -0.0575 259 GLN A CD  
2073 O OE1 . GLN A 278 ? 0.1993 0.2496 0.2226 0.0453  -0.0011 -0.0296 259 GLN A OE1 
2074 N NE2 . GLN A 278 ? 0.1626 0.2521 0.2028 0.0929  -0.0211 -0.0489 259 GLN A NE2 
2075 N N   . ARG A 279 ? 0.1377 0.1790 0.1966 0.0126  0.0371  -0.0269 260 ARG A N   
2076 C CA  . ARG A 279 ? 0.0929 0.2142 0.2058 0.0236  0.0426  -0.0209 260 ARG A CA  
2077 C C   . ARG A 279 ? 0.1292 0.2097 0.1833 0.0237  0.0407  0.0190  260 ARG A C   
2078 O O   . ARG A 279 ? 0.1274 0.2386 0.1591 0.0497  0.0244  0.0293  260 ARG A O   
2079 C CB  . ARG A 279 ? 0.1782 0.2664 0.2784 -0.0308 0.0291  -0.0035 260 ARG A CB  
2080 C CG  . ARG A 279 ? 0.2590 0.3677 0.3643 -0.0085 0.0504  0.0178  260 ARG A CG  
2081 C CD  . ARG A 279 ? 0.4026 0.4395 0.4453 -0.0235 0.0722  0.0388  260 ARG A CD  
2082 N NE  . ARG A 279 ? 0.4690 0.4800 0.4914 0.0217  0.0889  0.0524  260 ARG A NE  
2083 C CZ  . ARG A 279 ? 0.4910 0.5344 0.5215 -0.0019 0.0954  0.0828  260 ARG A CZ  
2084 N NH1 . ARG A 279 ? 0.4670 0.5447 0.5064 -0.0307 0.0750  0.1288  260 ARG A NH1 
2085 N NH2 . ARG A 279 ? 0.4720 0.5520 0.5440 0.0172  0.1339  0.0827  260 ARG A NH2 
2086 N N   . MET A 280 ? 0.1146 0.1981 0.1874 0.0084  0.0575  -0.0252 261 MET A N   
2087 C CA  . MET A 280 ? 0.0911 0.1878 0.1432 0.0198  0.0200  -0.0194 261 MET A CA  
2088 C C   . MET A 280 ? 0.1257 0.1835 0.1509 0.0218  -0.0035 -0.0288 261 MET A C   
2089 O O   . MET A 280 ? 0.1181 0.1873 0.1973 0.0253  0.0204  -0.0239 261 MET A O   
2090 C CB  . MET A 280 ? 0.1300 0.1992 0.1234 0.0350  0.0282  -0.0166 261 MET A CB  
2091 C CG  . MET A 280 ? 0.1711 0.2125 0.1234 -0.0221 0.0059  -0.0057 261 MET A CG  
2092 S SD  . MET A 280 ? 0.2192 0.2809 0.2149 0.0200  -0.0220 -0.0333 261 MET A SD  
2093 C CE  . MET A 280 ? 0.2567 0.2546 0.2726 0.0339  -0.0744 -0.0575 261 MET A CE  
2094 N N   . ALA A 281 ? 0.1513 0.1632 0.1436 -0.0016 -0.0131 -0.0471 262 ALA A N   
2095 C CA  . ALA A 281 ? 0.1497 0.1615 0.1568 0.0009  -0.0128 -0.0332 262 ALA A CA  
2096 C C   . ALA A 281 ? 0.1683 0.1779 0.1621 0.0357  0.0214  -0.0084 262 ALA A C   
2097 O O   . ALA A 281 ? 0.1159 0.1780 0.1644 0.0126  -0.0008 -0.0330 262 ALA A O   
2098 C CB  . ALA A 281 ? 0.1810 0.1397 0.1494 -0.0129 0.0009  -0.0554 262 ALA A CB  
2099 N N   . ASP A 282 ? 0.1786 0.1936 0.1485 0.0021  0.0474  -0.0084 263 ASP A N   
2100 C CA  . ASP A 282 ? 0.1519 0.2168 0.1541 0.0358  0.0327  0.0148  263 ASP A CA  
2101 C C   . ASP A 282 ? 0.2009 0.1984 0.1516 0.0137  0.0089  -0.0121 263 ASP A C   
2102 O O   . ASP A 282 ? 0.1965 0.2208 0.1565 0.0477  0.0161  -0.0063 263 ASP A O   
2103 C CB  . ASP A 282 ? 0.1441 0.2546 0.1738 0.0715  0.0594  -0.0158 263 ASP A CB  
2104 C CG  . ASP A 282 ? 0.1696 0.2814 0.2141 0.0690  0.0461  -0.0265 263 ASP A CG  
2105 O OD1 . ASP A 282 ? 0.1922 0.2645 0.2112 0.0709  0.0129  -0.0172 263 ASP A OD1 
2106 O OD2 . ASP A 282 ? 0.1842 0.3181 0.2624 0.0700  0.0709  -0.0264 263 ASP A OD2 
2107 N N   . ARG A 283 ? 0.1828 0.1619 0.1338 -0.0199 0.0254  -0.0151 264 ARG A N   
2108 C CA  . ARG A 283 ? 0.1456 0.1779 0.1552 -0.0338 0.0302  -0.0130 264 ARG A CA  
2109 C C   . ARG A 283 ? 0.1027 0.1859 0.1523 0.0013  0.0304  -0.0168 264 ARG A C   
2110 O O   . ARG A 283 ? 0.1515 0.2011 0.1683 -0.0065 0.0202  -0.0099 264 ARG A O   
2111 C CB  . ARG A 283 ? 0.1908 0.1946 0.1760 0.0108  -0.0102 -0.0173 264 ARG A CB  
2112 C CG  . ARG A 283 ? 0.2423 0.2205 0.2182 0.0686  0.0073  0.0000  264 ARG A CG  
2113 C CD  . ARG A 283 ? 0.3240 0.2490 0.2848 0.0903  0.0385  -0.0429 264 ARG A CD  
2114 N NE  . ARG A 283 ? 0.4251 0.2644 0.3556 0.0745  0.1102  -0.0145 264 ARG A NE  
2115 C CZ  . ARG A 283 ? 0.4761 0.3036 0.3423 0.0355  0.1726  0.0065  264 ARG A CZ  
2116 N NH1 . ARG A 283 ? 0.5057 0.3639 0.3603 0.0167  0.2035  0.0189  264 ARG A NH1 
2117 N NH2 . ARG A 283 ? 0.3856 0.2889 0.3070 0.0065  0.1920  -0.0144 264 ARG A NH2 
2118 N N   . PHE A 284 ? 0.1038 0.1493 0.1750 -0.0154 0.0255  -0.0158 265 PHE A N   
2119 C CA  . PHE A 284 ? 0.1142 0.1328 0.1427 -0.0392 -0.0067 -0.0040 265 PHE A CA  
2120 C C   . PHE A 284 ? 0.1688 0.1732 0.1628 -0.0084 0.0202  -0.0295 265 PHE A C   
2121 O O   . PHE A 284 ? 0.1528 0.1952 0.1632 0.0339  0.0480  -0.0481 265 PHE A O   
2122 C CB  . PHE A 284 ? 0.1069 0.1498 0.1366 -0.0309 0.0212  0.0369  265 PHE A CB  
2123 C CG  . PHE A 284 ? 0.0948 0.1506 0.1353 0.0033  0.0435  0.0284  265 PHE A CG  
2124 C CD1 . PHE A 284 ? 0.0752 0.1371 0.1210 0.0272  0.0470  0.0025  265 PHE A CD1 
2125 C CD2 . PHE A 284 ? 0.1360 0.1914 0.1613 -0.0284 0.0271  -0.0207 265 PHE A CD2 
2126 C CE1 . PHE A 284 ? 0.0762 0.1706 0.1310 0.0354  0.0057  -0.0124 265 PHE A CE1 
2127 C CE2 . PHE A 284 ? 0.1939 0.2169 0.1515 -0.0400 0.0313  -0.0329 265 PHE A CE2 
2128 C CZ  . PHE A 284 ? 0.1651 0.2077 0.1190 -0.0399 -0.0018 -0.0227 265 PHE A CZ  
2129 N N   . CYS A 285 ? 0.1654 0.1775 0.1833 -0.0394 -0.0169 -0.0425 266 CYS A N   
2130 C CA  . CYS A 285 ? 0.1692 0.1694 0.1603 0.0218  -0.0073 -0.0634 266 CYS A CA  
2131 C C   . CYS A 285 ? 0.1771 0.1730 0.1657 0.0297  -0.0159 -0.0279 266 CYS A C   
2132 O O   . CYS A 285 ? 0.1907 0.1878 0.1603 0.0545  -0.0375 -0.0481 266 CYS A O   
2133 C CB  . CYS A 285 ? 0.1584 0.1767 0.1965 0.0434  0.0174  -0.0562 266 CYS A CB  
2134 S SG  . CYS A 285 ? 0.1716 0.1955 0.2339 0.0065  -0.0058 -0.0331 266 CYS A SG  
2135 N N   . ASP A 286 ? 0.1895 0.2042 0.1602 0.0145  0.0263  -0.0318 267 ASP A N   
2136 C CA  . ASP A 286 ? 0.1945 0.2210 0.1600 0.0435  0.0308  -0.0445 267 ASP A CA  
2137 C C   . ASP A 286 ? 0.2140 0.1989 0.1512 0.0547  0.0018  -0.0164 267 ASP A C   
2138 O O   . ASP A 286 ? 0.2257 0.2185 0.1665 0.0768  0.0079  -0.0087 267 ASP A O   
2139 C CB  . ASP A 286 ? 0.2069 0.2728 0.1925 0.0177  0.0371  -0.0333 267 ASP A CB  
2140 C CG  . ASP A 286 ? 0.2751 0.3400 0.2267 0.0192  0.0408  0.0052  267 ASP A CG  
2141 O OD1 . ASP A 286 ? 0.3270 0.3395 0.2332 0.0457  0.0603  -0.0392 267 ASP A OD1 
2142 O OD2 . ASP A 286 ? 0.2841 0.3929 0.2842 0.0497  0.0490  0.0397  267 ASP A OD2 
2143 N N   . LEU A 287 ? 0.1865 0.1702 0.1222 0.0436  0.0235  -0.0255 268 LEU A N   
2144 C CA  . LEU A 287 ? 0.1767 0.1596 0.1259 0.0029  -0.0073 -0.0467 268 LEU A CA  
2145 C C   . LEU A 287 ? 0.2318 0.1683 0.1512 -0.0116 -0.0091 -0.0356 268 LEU A C   
2146 O O   . LEU A 287 ? 0.2474 0.1649 0.1619 -0.0046 0.0116  -0.0242 268 LEU A O   
2147 C CB  . LEU A 287 ? 0.1621 0.2022 0.1540 0.0112  -0.0310 -0.0492 268 LEU A CB  
2148 C CG  . LEU A 287 ? 0.1946 0.2070 0.1874 0.0042  -0.0730 -0.0327 268 LEU A CG  
2149 C CD1 . LEU A 287 ? 0.1963 0.2594 0.1787 0.0031  -0.0539 -0.0472 268 LEU A CD1 
2150 C CD2 . LEU A 287 ? 0.2462 0.2049 0.2285 0.0131  -0.0469 0.0046  268 LEU A CD2 
2151 N N   . ARG A 288 ? 0.2225 0.1615 0.1562 -0.0213 -0.0327 -0.0356 269 ARG A N   
2152 C CA  A ARG A 288 ? 0.2407 0.1773 0.2027 -0.0071 -0.0201 -0.0290 269 ARG A CA  
2153 C CA  B ARG A 288 ? 0.2145 0.1622 0.1877 -0.0019 -0.0197 -0.0312 269 ARG A CA  
2154 C C   . ARG A 288 ? 0.2214 0.1832 0.2032 0.0053  -0.0293 -0.0264 269 ARG A C   
2155 O O   . ARG A 288 ? 0.2312 0.1748 0.2296 0.0035  -0.0382 -0.0119 269 ARG A O   
2156 C CB  A ARG A 288 ? 0.2758 0.1905 0.2661 -0.0138 -0.0018 -0.0431 269 ARG A CB  
2157 C CB  B ARG A 288 ? 0.2075 0.1474 0.2245 -0.0081 0.0039  -0.0554 269 ARG A CB  
2158 C CG  A ARG A 288 ? 0.3209 0.2360 0.2964 -0.0162 0.0256  -0.0187 269 ARG A CG  
2159 C CG  B ARG A 288 ? 0.1953 0.1645 0.2230 0.0056  0.0416  -0.0424 269 ARG A CG  
2160 C CD  A ARG A 288 ? 0.3395 0.2501 0.2872 -0.0146 0.0205  -0.0013 269 ARG A CD  
2161 C CD  B ARG A 288 ? 0.2099 0.1934 0.2138 -0.0324 0.0468  -0.0234 269 ARG A CD  
2162 N NE  A ARG A 288 ? 0.3266 0.2316 0.2436 -0.0051 0.0308  0.0156  269 ARG A NE  
2163 N NE  B ARG A 288 ? 0.2105 0.1934 0.2163 -0.0497 0.0485  -0.0357 269 ARG A NE  
2164 C CZ  A ARG A 288 ? 0.2710 0.2375 0.2183 0.0021  0.0071  0.0311  269 ARG A CZ  
2165 C CZ  B ARG A 288 ? 0.2466 0.1568 0.1856 -0.0579 0.0204  -0.0254 269 ARG A CZ  
2166 N NH1 A ARG A 288 ? 0.2318 0.2346 0.2042 0.0059  0.0058  -0.0021 269 ARG A NH1 
2167 N NH1 B ARG A 288 ? 0.2664 0.1642 0.1756 -0.0554 0.0808  -0.0418 269 ARG A NH1 
2168 N NH2 A ARG A 288 ? 0.2707 0.2420 0.2029 0.0209  -0.0036 0.0477  269 ARG A NH2 
2169 N NH2 B ARG A 288 ? 0.2656 0.1438 0.1872 -0.0516 -0.0137 0.0050  269 ARG A NH2 
2170 N N   . ASP A 289 ? 0.2043 0.2063 0.1779 0.0288  -0.0279 -0.0121 270 ASP A N   
2171 C CA  . ASP A 289 ? 0.2267 0.2105 0.1724 0.0400  -0.0290 -0.0150 270 ASP A CA  
2172 C C   . ASP A 289 ? 0.2372 0.2381 0.1699 0.0547  -0.0225 0.0017  270 ASP A C   
2173 O O   . ASP A 289 ? 0.2446 0.2355 0.1686 0.0624  -0.0230 -0.0031 270 ASP A O   
2174 C CB  . ASP A 289 ? 0.2449 0.2497 0.1742 0.0631  -0.0073 -0.0373 270 ASP A CB  
2175 C CG  . ASP A 289 ? 0.2952 0.3020 0.2253 0.0616  0.0085  -0.0246 270 ASP A CG  
2176 O OD1 . ASP A 289 ? 0.2936 0.3278 0.2794 0.0750  -0.0218 -0.0190 270 ASP A OD1 
2177 O OD2 . ASP A 289 ? 0.3328 0.3209 0.2263 0.0897  0.0238  -0.0255 270 ASP A OD2 
2178 N N   . GLN A 290 ? 0.2066 0.2312 0.1587 0.0136  -0.0092 0.0075  271 GLN A N   
2179 C CA  . GLN A 290 ? 0.2237 0.2493 0.1699 -0.0093 -0.0042 0.0149  271 GLN A CA  
2180 C C   . GLN A 290 ? 0.2124 0.2306 0.1746 -0.0147 -0.0191 -0.0008 271 GLN A C   
2181 O O   . GLN A 290 ? 0.2141 0.2479 0.1708 0.0277  -0.0074 0.0003  271 GLN A O   
2182 C CB  . GLN A 290 ? 0.2280 0.2649 0.2060 -0.0267 0.0241  0.0429  271 GLN A CB  
2183 C CG  . GLN A 290 ? 0.2257 0.3069 0.2579 -0.0271 0.0182  0.0369  271 GLN A CG  
2184 C CD  . GLN A 290 ? 0.2988 0.3563 0.2988 -0.0324 0.0342  0.0159  271 GLN A CD  
2185 O OE1 . GLN A 290 ? 0.3467 0.3721 0.3172 -0.0541 0.0082  -0.0081 271 GLN A OE1 
2186 N NE2 . GLN A 290 ? 0.3068 0.4005 0.3194 -0.0246 0.0171  0.0296  271 GLN A NE2 
2187 N N   . LEU A 291 ? 0.1964 0.2334 0.1471 -0.0095 -0.0170 0.0150  272 LEU A N   
2188 C CA  . LEU A 291 ? 0.1989 0.2053 0.1575 0.0009  -0.0002 0.0199  272 LEU A CA  
2189 C C   . LEU A 291 ? 0.2043 0.2245 0.1494 -0.0098 0.0019  -0.0220 272 LEU A C   
2190 O O   . LEU A 291 ? 0.2320 0.2058 0.1575 0.0273  0.0290  -0.0120 272 LEU A O   
2191 C CB  . LEU A 291 ? 0.2333 0.1924 0.1457 0.0309  0.0417  0.0410  272 LEU A CB  
2192 C CG  . LEU A 291 ? 0.2613 0.2027 0.1198 -0.0139 0.0338  0.0264  272 LEU A CG  
2193 C CD1 . LEU A 291 ? 0.3443 0.2152 0.1399 0.0127  0.0418  0.0258  272 LEU A CD1 
2194 C CD2 . LEU A 291 ? 0.2618 0.2228 0.1513 0.0262  0.0095  0.0127  272 LEU A CD2 
2195 N N   . PRO A 292 ? 0.2010 0.2084 0.1514 0.0126  0.0010  -0.0438 273 PRO A N   
2196 C CA  . PRO A 292 ? 0.2370 0.2124 0.1655 -0.0097 -0.0334 -0.0345 273 PRO A CA  
2197 C C   . PRO A 292 ? 0.2610 0.2100 0.1723 0.0090  -0.0317 -0.0006 273 PRO A C   
2198 O O   . PRO A 292 ? 0.2866 0.2006 0.1991 0.0228  -0.0306 -0.0320 273 PRO A O   
2199 C CB  . PRO A 292 ? 0.2482 0.2241 0.1817 -0.0102 -0.0167 -0.0492 273 PRO A CB  
2200 C CG  . PRO A 292 ? 0.2583 0.2203 0.1836 0.0155  -0.0328 -0.0420 273 PRO A CG  
2201 C CD  . PRO A 292 ? 0.2493 0.1943 0.1552 0.0020  -0.0242 -0.0412 273 PRO A CD  
2202 N N   . ASP A 293 ? 0.2313 0.2131 0.1734 0.0061  0.0032  0.0129  274 ASP A N   
2203 C CA  . ASP A 293 ? 0.2457 0.2405 0.2006 -0.0016 0.0023  0.0246  274 ASP A CA  
2204 C C   . ASP A 293 ? 0.2205 0.2138 0.1937 0.0211  -0.0282 0.0246  274 ASP A C   
2205 O O   . ASP A 293 ? 0.2519 0.2033 0.2089 0.0240  -0.0027 0.0024  274 ASP A O   
2206 C CB  . ASP A 293 ? 0.2800 0.3016 0.2269 -0.0263 0.0547  0.0188  274 ASP A CB  
2207 C CG  . ASP A 293 ? 0.3524 0.3837 0.2688 -0.0258 0.0891  0.0158  274 ASP A CG  
2208 O OD1 . ASP A 293 ? 0.3894 0.3889 0.2441 -0.0006 0.0585  0.0074  274 ASP A OD1 
2209 O OD2 . ASP A 293 ? 0.4331 0.4223 0.3149 -0.0522 0.0912  0.0278  274 ASP A OD2 
2210 N N   . ALA A 294 ? 0.2051 0.2302 0.1685 0.0275  -0.0598 0.0038  275 ALA A N   
2211 C CA  . ALA A 294 ? 0.2032 0.2428 0.1776 0.0467  -0.0626 0.0052  275 ALA A CA  
2212 C C   . ALA A 294 ? 0.2166 0.2106 0.1815 0.0254  -0.0712 -0.0156 275 ALA A C   
2213 O O   . ALA A 294 ? 0.2812 0.2024 0.1928 0.0218  -0.0660 0.0045  275 ALA A O   
2214 C CB  . ALA A 294 ? 0.2065 0.2680 0.1982 0.0449  -0.0539 0.0192  275 ALA A CB  
2215 N N   . CYS A 295 ? 0.2153 0.2255 0.1967 0.0247  -0.0927 -0.0130 276 CYS A N   
2216 C CA  . CYS A 295 ? 0.2156 0.1742 0.1954 0.0231  -0.0664 0.0044  276 CYS A CA  
2217 C C   . CYS A 295 ? 0.2594 0.2013 0.1739 0.0202  -0.0623 -0.0219 276 CYS A C   
2218 O O   . CYS A 295 ? 0.2717 0.2181 0.1905 0.0158  -0.0244 -0.0199 276 CYS A O   
2219 C CB  . CYS A 295 ? 0.2282 0.1706 0.2113 0.0297  -0.0289 -0.0086 276 CYS A CB  
2220 S SG  . CYS A 295 ? 0.2498 0.1897 0.2223 0.0304  -0.0160 0.0214  276 CYS A SG  
2221 N N   . ARG A 296 ? 0.2801 0.1980 0.1703 0.0259  -0.0774 -0.0213 277 ARG A N   
2222 C CA  . ARG A 296 ? 0.3073 0.1848 0.1800 0.0099  -0.0810 -0.0198 277 ARG A CA  
2223 C C   . ARG A 296 ? 0.2566 0.1789 0.1989 0.0292  -0.0482 -0.0043 277 ARG A C   
2224 O O   . ARG A 296 ? 0.2844 0.2040 0.2153 0.0522  0.0025  -0.0075 277 ARG A O   
2225 C CB  . ARG A 296 ? 0.3171 0.2294 0.2034 0.0389  -0.1013 -0.0462 277 ARG A CB  
2226 C CG  . ARG A 296 ? 0.3427 0.3239 0.2356 0.0316  -0.1169 -0.0851 277 ARG A CG  
2227 C CD  . ARG A 296 ? 0.3978 0.4007 0.2969 0.0170  -0.1089 -0.1178 277 ARG A CD  
2228 N NE  . ARG A 296 ? 0.4601 0.4554 0.3546 0.0132  -0.1008 -0.1150 277 ARG A NE  
2229 C CZ  . ARG A 296 ? 0.5067 0.5065 0.3891 0.0232  -0.1073 -0.0635 277 ARG A CZ  
2230 N NH1 . ARG A 296 ? 0.5116 0.5381 0.3952 0.0443  -0.1136 -0.0482 277 ARG A NH1 
2231 N NH2 . ARG A 296 ? 0.5554 0.5065 0.4031 0.0048  -0.1143 -0.0547 277 ARG A NH2 
2232 N N   . SER A 297 ? 0.2610 0.1865 0.2049 0.0261  -0.0212 -0.0127 278 SER A N   
2233 C CA  . SER A 297 ? 0.2694 0.2029 0.1968 0.0393  -0.0272 -0.0024 278 SER A CA  
2234 C C   . SER A 297 ? 0.2834 0.1973 0.2023 0.0546  -0.0334 -0.0063 278 SER A C   
2235 O O   . SER A 297 ? 0.2987 0.2166 0.2222 0.0611  -0.0137 -0.0063 278 SER A O   
2236 C CB  . SER A 297 ? 0.3105 0.2143 0.2055 0.0364  -0.0669 0.0179  278 SER A CB  
2237 O OG  . SER A 297 ? 0.3781 0.2009 0.2139 0.0023  -0.0958 -0.0046 278 SER A OG  
2238 N N   . MET A 298 ? 0.3260 0.1772 0.2047 0.0035  -0.0559 0.0265  279 MET A N   
2239 C CA  . MET A 298 ? 0.2748 0.2030 0.2144 0.0038  -0.0634 0.0335  279 MET A CA  
2240 C C   . MET A 298 ? 0.2910 0.1896 0.2125 0.0088  -0.0936 0.0033  279 MET A C   
2241 O O   . MET A 298 ? 0.2631 0.1924 0.2236 0.0352  -0.0840 -0.0120 279 MET A O   
2242 C CB  . MET A 298 ? 0.2583 0.2324 0.2114 -0.0126 -0.0520 0.0235  279 MET A CB  
2243 C CG  . MET A 298 ? 0.2452 0.2454 0.2057 0.0265  -0.0345 0.0273  279 MET A CG  
2244 S SD  . MET A 298 ? 0.2066 0.2777 0.2026 0.0205  -0.0218 -0.0424 279 MET A SD  
2245 C CE  . MET A 298 ? 0.1760 0.2477 0.1838 -0.0119 -0.0064 -0.0137 279 MET A CE  
2246 N N   . SER A 299 ? 0.2920 0.1983 0.2059 0.0457  -0.0927 0.0108  280 SER A N   
2247 C CA  . SER A 299 ? 0.2660 0.1937 0.2262 0.0550  -0.0632 0.0388  280 SER A CA  
2248 C C   . SER A 299 ? 0.2525 0.2196 0.2471 0.0689  -0.0636 0.0356  280 SER A C   
2249 O O   . SER A 299 ? 0.2747 0.2331 0.2742 0.0692  -0.0428 0.0296  280 SER A O   
2250 C CB  . SER A 299 ? 0.3346 0.1988 0.2176 0.0255  -0.0627 0.0575  280 SER A CB  
2251 O OG  . SER A 299 ? 0.3587 0.2395 0.2535 0.0907  -0.0942 0.0509  280 SER A OG  
2252 N N   . LEU A 300 ? 0.2268 0.1969 0.2480 0.0418  -0.0505 0.0292  281 LEU A N   
2253 C CA  . LEU A 300 ? 0.2050 0.2049 0.2513 0.0384  -0.0612 0.0107  281 LEU A CA  
2254 C C   . LEU A 300 ? 0.2188 0.2558 0.2680 0.0552  -0.0594 0.0026  281 LEU A C   
2255 O O   . LEU A 300 ? 0.2446 0.2895 0.2788 0.0387  -0.0837 0.0115  281 LEU A O   
2256 C CB  . LEU A 300 ? 0.1971 0.2000 0.2443 0.0283  -0.0717 -0.0166 281 LEU A CB  
2257 C CG  . LEU A 300 ? 0.1811 0.1979 0.2279 0.0388  -0.0613 -0.0106 281 LEU A CG  
2258 C CD1 . LEU A 300 ? 0.2070 0.2318 0.2515 0.0285  -0.0568 -0.0061 281 LEU A CD1 
2259 C CD2 . LEU A 300 ? 0.2324 0.1811 0.1984 0.0438  -0.0277 0.0014  281 LEU A CD2 
2260 N N   . ASP A 301 ? 0.2015 0.2676 0.2806 0.0409  -0.0547 -0.0034 282 ASP A N   
2261 C CA  . ASP A 301 ? 0.2295 0.2761 0.3018 0.0391  -0.0449 -0.0174 282 ASP A CA  
2262 C C   . ASP A 301 ? 0.2233 0.2632 0.2916 0.0660  -0.0768 -0.0277 282 ASP A C   
2263 O O   . ASP A 301 ? 0.2002 0.2454 0.2762 0.0570  -0.0698 -0.0061 282 ASP A O   
2264 C CB  . ASP A 301 ? 0.2591 0.2713 0.3333 0.0822  -0.0450 -0.0347 282 ASP A CB  
2265 C CG  . ASP A 301 ? 0.2635 0.2909 0.3344 0.0919  -0.0357 -0.0470 282 ASP A CG  
2266 O OD1 . ASP A 301 ? 0.2697 0.3060 0.3239 0.0726  -0.0516 -0.0053 282 ASP A OD1 
2267 O OD2 . ASP A 301 ? 0.3010 0.3492 0.3632 0.1129  0.0284  -0.0462 282 ASP A OD2 
2268 N N   . PRO A 302 ? 0.1967 0.2678 0.3320 0.0634  -0.1149 -0.0288 283 PRO A N   
2269 C CA  . PRO A 302 ? 0.2182 0.2876 0.3306 0.0156  -0.1287 -0.0374 283 PRO A CA  
2270 C C   . PRO A 302 ? 0.2220 0.2872 0.3253 0.0362  -0.0999 -0.0332 283 PRO A C   
2271 O O   . PRO A 302 ? 0.2294 0.2819 0.3100 0.0341  -0.1045 -0.0591 283 PRO A O   
2272 C CB  . PRO A 302 ? 0.2110 0.2960 0.3632 0.0236  -0.1442 -0.0108 283 PRO A CB  
2273 C CG  . PRO A 302 ? 0.2086 0.3151 0.3507 0.0304  -0.1491 -0.0070 283 PRO A CG  
2274 C CD  . PRO A 302 ? 0.1796 0.2936 0.3532 0.0611  -0.1184 -0.0113 283 PRO A CD  
2275 N N   . ALA A 303 ? 0.1910 0.2839 0.3255 0.0263  -0.0736 -0.0103 284 ALA A N   
2276 C CA  . ALA A 303 ? 0.1346 0.2536 0.3251 0.0067  -0.0333 -0.0136 284 ALA A CA  
2277 C C   . ALA A 303 ? 0.1729 0.2164 0.2971 -0.0057 -0.0440 -0.0163 284 ALA A C   
2278 O O   . ALA A 303 ? 0.1373 0.1982 0.2834 0.0034  -0.0060 0.0080  284 ALA A O   
2279 C CB  . ALA A 303 ? 0.0839 0.2420 0.3341 0.0074  0.0001  0.0017  284 ALA A CB  
2280 N N   . GLN A 304 ? 0.1649 0.2224 0.2803 -0.0047 -0.0523 -0.0136 285 GLN A N   
2281 C CA  . GLN A 304 ? 0.1659 0.1983 0.2310 0.0065  -0.0356 -0.0211 285 GLN A CA  
2282 C C   . GLN A 304 ? 0.1561 0.2084 0.1948 0.0350  -0.0442 -0.0188 285 GLN A C   
2283 O O   . GLN A 304 ? 0.1426 0.2124 0.1910 0.0271  -0.0567 0.0033  285 GLN A O   
2284 C CB  . GLN A 304 ? 0.1953 0.1668 0.2149 0.0167  -0.0212 -0.0383 285 GLN A CB  
2285 C CG  . GLN A 304 ? 0.2001 0.1800 0.2199 0.0373  -0.0279 -0.0271 285 GLN A CG  
2286 C CD  . GLN A 304 ? 0.2173 0.2170 0.2167 0.0406  -0.0409 -0.0024 285 GLN A CD  
2287 O OE1 . GLN A 304 ? 0.2736 0.2427 0.2209 0.0467  -0.0574 0.0149  285 GLN A OE1 
2288 N NE2 . GLN A 304 ? 0.2114 0.2615 0.2200 0.0153  -0.0356 -0.0379 285 GLN A NE2 
2289 N N   . ARG A 305 ? 0.2140 0.2482 0.1853 0.0104  -0.0323 -0.0222 286 ARG A N   
2290 C CA  . ARG A 305 ? 0.2539 0.2444 0.1899 0.0398  -0.0509 -0.0153 286 ARG A CA  
2291 C C   . ARG A 305 ? 0.2128 0.2209 0.1935 0.0002  -0.0469 0.0054  286 ARG A C   
2292 O O   . ARG A 305 ? 0.2232 0.1912 0.1843 -0.0133 -0.0702 0.0032  286 ARG A O   
2293 C CB  . ARG A 305 ? 0.2208 0.2574 0.1716 0.0404  -0.0792 -0.0336 286 ARG A CB  
2294 C CG  . ARG A 305 ? 0.2289 0.2533 0.2199 0.0104  -0.0968 -0.0512 286 ARG A CG  
2295 C CD  . ARG A 305 ? 0.2358 0.2279 0.2205 0.0070  -0.0672 -0.0495 286 ARG A CD  
2296 N NE  . ARG A 305 ? 0.2901 0.2516 0.2315 0.0407  -0.0357 -0.0490 286 ARG A NE  
2297 C CZ  . ARG A 305 ? 0.3298 0.2425 0.2715 0.0442  -0.0501 -0.0370 286 ARG A CZ  
2298 N NH1 . ARG A 305 ? 0.3471 0.2623 0.2917 0.0215  -0.0324 -0.0414 286 ARG A NH1 
2299 N NH2 . ARG A 305 ? 0.3666 0.2266 0.2894 0.0363  -0.0660 -0.0431 286 ARG A NH2 
2300 N N   . LEU A 306 ? 0.1553 0.2292 0.2061 0.0045  -0.0447 -0.0001 287 LEU A N   
2301 C CA  . LEU A 306 ? 0.1343 0.2279 0.2204 -0.0397 -0.0578 -0.0020 287 LEU A CA  
2302 C C   . LEU A 306 ? 0.1388 0.2271 0.2095 -0.0342 -0.0198 -0.0208 287 LEU A C   
2303 O O   . LEU A 306 ? 0.1347 0.2038 0.2111 -0.0034 -0.0162 -0.0152 287 LEU A O   
2304 C CB  . LEU A 306 ? 0.1936 0.2457 0.2748 -0.0352 -0.0813 -0.0374 287 LEU A CB  
2305 C CG  . LEU A 306 ? 0.2944 0.2745 0.3118 0.0011  -0.0270 -0.0558 287 LEU A CG  
2306 C CD1 . LEU A 306 ? 0.3959 0.3659 0.3865 0.0150  0.0011  -0.0316 287 LEU A CD1 
2307 C CD2 . LEU A 306 ? 0.2661 0.2159 0.3309 0.0311  -0.0037 -0.0810 287 LEU A CD2 
2308 N N   . ALA A 307 ? 0.1109 0.2379 0.1932 -0.0409 -0.0191 -0.0206 288 ALA A N   
2309 C CA  . ALA A 307 ? 0.1073 0.2122 0.1749 -0.0349 -0.0286 -0.0273 288 ALA A CA  
2310 C C   . ALA A 307 ? 0.1324 0.1828 0.1689 -0.0234 0.0194  -0.0121 288 ALA A C   
2311 O O   . ALA A 307 ? 0.1613 0.2020 0.1666 -0.0043 0.0135  -0.0131 288 ALA A O   
2312 C CB  . ALA A 307 ? 0.1227 0.2303 0.2050 0.0061  0.0096  0.0010  288 ALA A CB  
2313 N N   . ALA A 308 ? 0.1009 0.1696 0.1740 0.0006  0.0530  0.0004  289 ALA A N   
2314 C CA  . ALA A 308 ? 0.1304 0.1460 0.1847 0.0243  0.0233  -0.0125 289 ALA A CA  
2315 C C   . ALA A 308 ? 0.1528 0.1562 0.1688 0.0129  -0.0028 -0.0153 289 ALA A C   
2316 O O   . ALA A 308 ? 0.1145 0.1698 0.1766 0.0152  -0.0212 -0.0075 289 ALA A O   
2317 C CB  . ALA A 308 ? 0.1517 0.1712 0.1677 0.0163  0.0099  -0.0210 289 ALA A CB  
2318 N N   . GLU A 309 ? 0.1703 0.1653 0.1576 -0.0036 -0.0432 -0.0291 290 GLU A N   
2319 C CA  . GLU A 309 ? 0.1960 0.1997 0.1480 -0.0023 -0.0218 -0.0252 290 GLU A CA  
2320 C C   . GLU A 309 ? 0.1426 0.2082 0.1711 0.0041  -0.0045 -0.0150 290 GLU A C   
2321 O O   . GLU A 309 ? 0.0979 0.2283 0.1776 -0.0254 -0.0150 0.0037  290 GLU A O   
2322 C CB  . GLU A 309 ? 0.2491 0.1997 0.1424 -0.0095 -0.0787 -0.0113 290 GLU A CB  
2323 C CG  . GLU A 309 ? 0.3340 0.2465 0.1560 -0.0576 -0.0897 0.0099  290 GLU A CG  
2324 C CD  . GLU A 309 ? 0.4334 0.2935 0.2421 -0.0876 -0.0971 0.0231  290 GLU A CD  
2325 O OE1 . GLU A 309 ? 0.4622 0.2959 0.2681 -0.0563 -0.0667 0.0412  290 GLU A OE1 
2326 O OE2 . GLU A 309 ? 0.4967 0.3287 0.2889 -0.0733 -0.1226 -0.0005 290 GLU A OE2 
2327 N N   . ARG A 310 ? 0.1237 0.2069 0.1711 -0.0260 0.0090  -0.0197 291 ARG A N   
2328 C CA  . ARG A 310 ? 0.0897 0.1822 0.1804 -0.0372 -0.0065 -0.0149 291 ARG A CA  
2329 C C   . ARG A 310 ? 0.1063 0.1666 0.1777 -0.0337 -0.0231 -0.0403 291 ARG A C   
2330 O O   . ARG A 310 ? 0.1166 0.1755 0.1839 0.0205  -0.0024 -0.0264 291 ARG A O   
2331 C CB  . ARG A 310 ? 0.0756 0.2169 0.2128 -0.0365 -0.0232 -0.0174 291 ARG A CB  
2332 C CG  . ARG A 310 ? 0.0939 0.2257 0.2201 -0.0330 0.0203  -0.0078 291 ARG A CG  
2333 C CD  . ARG A 310 ? 0.1540 0.2283 0.2309 -0.0574 0.0074  0.0248  291 ARG A CD  
2334 N NE  . ARG A 310 ? 0.1811 0.2334 0.2403 -0.0578 -0.0044 0.0319  291 ARG A NE  
2335 C CZ  . ARG A 310 ? 0.2183 0.2584 0.2600 -0.0198 -0.0211 0.0159  291 ARG A CZ  
2336 N NH1 . ARG A 310 ? 0.1724 0.2808 0.2642 -0.0255 -0.0293 -0.0334 291 ARG A NH1 
2337 N NH2 . ARG A 310 ? 0.2170 0.2534 0.2750 -0.0375 -0.0411 0.0419  291 ARG A NH2 
2338 N N   . TYR A 311 ? 0.1176 0.1758 0.1511 -0.0570 -0.0045 -0.0443 292 TYR A N   
2339 C CA  . TYR A 311 ? 0.0896 0.1422 0.1486 -0.0253 0.0426  -0.0469 292 TYR A CA  
2340 C C   . TYR A 311 ? 0.1388 0.1481 0.1417 0.0027  0.0276  0.0081  292 TYR A C   
2341 O O   . TYR A 311 ? 0.1455 0.1401 0.1722 -0.0148 0.0112  -0.0016 292 TYR A O   
2342 C CB  . TYR A 311 ? 0.1381 0.1192 0.1486 -0.0566 0.0261  -0.0464 292 TYR A CB  
2343 C CG  . TYR A 311 ? 0.1581 0.1219 0.1351 -0.0222 -0.0103 -0.0378 292 TYR A CG  
2344 C CD1 . TYR A 311 ? 0.1245 0.1673 0.1208 -0.0421 -0.0157 -0.0079 292 TYR A CD1 
2345 C CD2 . TYR A 311 ? 0.1218 0.1236 0.1438 -0.0367 -0.0096 -0.0474 292 TYR A CD2 
2346 C CE1 . TYR A 311 ? 0.1477 0.1871 0.1246 -0.0684 -0.0378 -0.0024 292 TYR A CE1 
2347 C CE2 . TYR A 311 ? 0.1274 0.1351 0.1302 -0.0254 -0.0062 -0.0234 292 TYR A CE2 
2348 C CZ  . TYR A 311 ? 0.1389 0.1635 0.1318 -0.0374 -0.0342 -0.0062 292 TYR A CZ  
2349 O OH  . TYR A 311 ? 0.1973 0.1834 0.1541 -0.0280 -0.0200 0.0187  292 TYR A OH  
2350 N N   . ALA A 312 ? 0.1310 0.1660 0.1339 -0.0066 0.0283  0.0174  293 ALA A N   
2351 C CA  . ALA A 312 ? 0.1801 0.1748 0.1518 0.0204  0.0192  0.0050  293 ALA A CA  
2352 C C   . ALA A 312 ? 0.2021 0.1629 0.1688 -0.0111 -0.0013 -0.0031 293 ALA A C   
2353 O O   . ALA A 312 ? 0.2157 0.1704 0.1702 -0.0207 0.0094  -0.0103 293 ALA A O   
2354 C CB  . ALA A 312 ? 0.1898 0.2115 0.1718 0.0290  0.0224  0.0019  293 ALA A CB  
2355 N N   . ASP A 313 ? 0.1877 0.1467 0.1699 -0.0316 -0.0128 -0.0237 294 ASP A N   
2356 C CA  . ASP A 313 ? 0.1603 0.1619 0.1802 -0.0467 -0.0219 -0.0198 294 ASP A CA  
2357 C C   . ASP A 313 ? 0.1826 0.1589 0.1802 0.0042  0.0013  -0.0219 294 ASP A C   
2358 O O   . ASP A 313 ? 0.1774 0.1190 0.1913 -0.0041 -0.0107 -0.0032 294 ASP A O   
2359 C CB  . ASP A 313 ? 0.1589 0.1974 0.2111 -0.0382 -0.0343 -0.0154 294 ASP A CB  
2360 C CG  . ASP A 313 ? 0.2032 0.2356 0.2312 -0.0046 -0.0571 -0.0314 294 ASP A CG  
2361 O OD1 . ASP A 313 ? 0.2504 0.2150 0.2021 -0.0076 0.0535  -0.0109 294 ASP A OD1 
2362 O OD2 . ASP A 313 ? 0.2685 0.2895 0.2699 0.0036  -0.0863 -0.0637 294 ASP A OD2 
2363 N N   . GLY A 314 ? 0.1417 0.1992 0.1265 -0.0330 0.0170  -0.0115 295 GLY A N   
2364 C CA  . GLY A 314 ? 0.1529 0.1863 0.1521 -0.0130 -0.0113 -0.0125 295 GLY A CA  
2365 C C   . GLY A 314 ? 0.1370 0.1774 0.1577 -0.0056 -0.0102 -0.0065 295 GLY A C   
2366 O O   . GLY A 314 ? 0.1058 0.1790 0.1719 -0.0004 0.0311  -0.0107 295 GLY A O   
2367 N N   . MET A 315 ? 0.1489 0.1817 0.1591 -0.0226 -0.0109 -0.0057 296 MET A N   
2368 C CA  . MET A 315 ? 0.1447 0.1614 0.1536 -0.0051 -0.0175 -0.0257 296 MET A CA  
2369 C C   . MET A 315 ? 0.1543 0.1735 0.1312 0.0312  -0.0026 -0.0237 296 MET A C   
2370 O O   . MET A 315 ? 0.1338 0.1637 0.1432 -0.0009 0.0152  -0.0423 296 MET A O   
2371 C CB  . MET A 315 ? 0.1539 0.1429 0.1678 -0.0136 -0.0085 -0.0326 296 MET A CB  
2372 C CG  . MET A 315 ? 0.1639 0.1187 0.1847 -0.0027 0.0214  -0.0537 296 MET A CG  
2373 S SD  . MET A 315 ? 0.1657 0.1703 0.1976 -0.0052 -0.0027 -0.0281 296 MET A SD  
2374 C CE  . MET A 315 ? 0.1612 0.1485 0.1913 0.0083  0.0092  0.0127  296 MET A CE  
2375 N N   . ALA A 316 ? 0.1420 0.1711 0.1023 -0.0200 0.0018  -0.0313 297 ALA A N   
2376 C CA  . ALA A 316 ? 0.1701 0.1626 0.1091 -0.0235 -0.0097 0.0027  297 ALA A CA  
2377 C C   . ALA A 316 ? 0.1418 0.1515 0.1131 -0.0248 0.0242  -0.0118 297 ALA A C   
2378 O O   . ALA A 316 ? 0.1750 0.1650 0.1450 0.0081  0.0116  -0.0117 297 ALA A O   
2379 C CB  . ALA A 316 ? 0.2309 0.1582 0.0892 -0.0141 -0.0121 0.0191  297 ALA A CB  
2380 N N   . LEU A 317 ? 0.1342 0.1599 0.1475 -0.0455 0.0356  -0.0109 298 LEU A N   
2381 C CA  . LEU A 317 ? 0.0946 0.1748 0.1583 -0.0167 0.0180  -0.0206 298 LEU A CA  
2382 C C   . LEU A 317 ? 0.1378 0.1727 0.1380 -0.0003 0.0130  -0.0219 298 LEU A C   
2383 O O   . LEU A 317 ? 0.1557 0.1410 0.1391 0.0358  -0.0129 -0.0225 298 LEU A O   
2384 C CB  . LEU A 317 ? 0.0979 0.1674 0.1692 -0.0235 -0.0108 -0.0142 298 LEU A CB  
2385 C CG  . LEU A 317 ? 0.1092 0.1722 0.1939 -0.0180 0.0096  -0.0163 298 LEU A CG  
2386 C CD1 . LEU A 317 ? 0.1533 0.1886 0.2228 -0.0347 -0.0067 0.0118  298 LEU A CD1 
2387 C CD2 . LEU A 317 ? 0.1820 0.1821 0.2269 -0.0128 0.0070  -0.0324 298 LEU A CD2 
2388 N N   . TRP A 318 ? 0.1949 0.1928 0.1137 -0.0251 -0.0030 -0.0330 299 TRP A N   
2389 C CA  . TRP A 318 ? 0.1547 0.1446 0.1072 0.0028  -0.0429 -0.0480 299 TRP A CA  
2390 C C   . TRP A 318 ? 0.1607 0.1360 0.1278 0.0008  -0.0171 -0.0017 299 TRP A C   
2391 O O   . TRP A 318 ? 0.1754 0.1758 0.1495 0.0265  0.0362  0.0079  299 TRP A O   
2392 C CB  . TRP A 318 ? 0.2157 0.1478 0.1227 0.0234  -0.0531 -0.0537 299 TRP A CB  
2393 C CG  . TRP A 318 ? 0.2154 0.1562 0.1693 0.0311  -0.0315 -0.0206 299 TRP A CG  
2394 C CD1 . TRP A 318 ? 0.2356 0.1469 0.1884 -0.0019 -0.0560 -0.0279 299 TRP A CD1 
2395 C CD2 . TRP A 318 ? 0.2118 0.1471 0.2073 0.0171  -0.0515 -0.0321 299 TRP A CD2 
2396 N NE1 . TRP A 318 ? 0.2182 0.1776 0.1960 0.0056  -0.0615 -0.0054 299 TRP A NE1 
2397 C CE2 . TRP A 318 ? 0.2124 0.1576 0.1975 -0.0196 -0.0736 -0.0382 299 TRP A CE2 
2398 C CE3 . TRP A 318 ? 0.2642 0.1621 0.2131 0.0477  -0.0671 -0.0414 299 TRP A CE3 
2399 C CZ2 . TRP A 318 ? 0.2437 0.1481 0.2401 0.0063  -0.0651 -0.0235 299 TRP A CZ2 
2400 C CZ3 . TRP A 318 ? 0.2658 0.1915 0.2222 0.0463  -0.0821 -0.0677 299 TRP A CZ3 
2401 C CH2 . TRP A 318 ? 0.2594 0.1778 0.2446 0.0437  -0.0888 -0.0396 299 TRP A CH2 
2402 N N   . LEU A 319 ? 0.1871 0.1418 0.1573 -0.0145 0.0188  -0.0104 300 LEU A N   
2403 C CA  A LEU A 319 ? 0.1908 0.1557 0.1879 -0.0160 0.0101  0.0119  300 LEU A CA  
2404 C CA  B LEU A 319 ? 0.1543 0.1415 0.1719 -0.0176 0.0173  0.0076  300 LEU A CA  
2405 C C   . LEU A 319 ? 0.2063 0.1487 0.1864 -0.0030 -0.0023 0.0134  300 LEU A C   
2406 O O   . LEU A 319 ? 0.1838 0.1655 0.1923 0.0222  0.0090  0.0052  300 LEU A O   
2407 C CB  A LEU A 319 ? 0.1925 0.1831 0.2135 -0.0325 -0.0059 0.0297  300 LEU A CB  
2408 C CB  B LEU A 319 ? 0.0988 0.1452 0.1713 -0.0383 0.0255  0.0065  300 LEU A CB  
2409 C CG  A LEU A 319 ? 0.1906 0.2058 0.2241 -0.0327 -0.0290 0.0481  300 LEU A CG  
2410 C CG  B LEU A 319 ? 0.0449 0.1474 0.1324 -0.0208 0.0160  -0.0033 300 LEU A CG  
2411 C CD1 A LEU A 319 ? 0.1407 0.2042 0.2292 -0.0361 -0.0318 0.0468  300 LEU A CD1 
2412 C CD1 B LEU A 319 ? 0.0402 0.1355 0.1308 -0.0105 0.0216  0.0018  300 LEU A CD1 
2413 C CD2 A LEU A 319 ? 0.1716 0.2000 0.2064 0.0099  -0.0515 0.0707  300 LEU A CD2 
2414 C CD2 B LEU A 319 ? 0.0626 0.1667 0.1614 -0.0311 0.0244  -0.0320 300 LEU A CD2 
2415 N N   . ALA A 320 ? 0.2113 0.1559 0.1892 -0.0415 -0.0114 -0.0073 301 ALA A N   
2416 C CA  . ALA A 320 ? 0.2279 0.1436 0.1806 -0.0172 -0.0216 -0.0067 301 ALA A CA  
2417 C C   . ALA A 320 ? 0.2252 0.1304 0.1992 -0.0110 0.0073  0.0054  301 ALA A C   
2418 O O   . ALA A 320 ? 0.2639 0.1415 0.2116 -0.0237 0.0002  -0.0058 301 ALA A O   
2419 C CB  . ALA A 320 ? 0.2624 0.1490 0.1824 0.0149  -0.0491 -0.0232 301 ALA A CB  
2420 N N   . GLY A 321 ? 0.2215 0.1365 0.2103 -0.0098 -0.0015 0.0308  302 GLY A N   
2421 C CA  . GLY A 321 ? 0.1697 0.1097 0.2092 -0.0066 -0.0270 0.0347  302 GLY A CA  
2422 C C   . GLY A 321 ? 0.1488 0.1137 0.2253 0.0214  0.0002  0.0361  302 GLY A C   
2423 O O   . GLY A 321 ? 0.1675 0.1144 0.2119 0.0193  -0.0060 0.0133  302 GLY A O   
2424 N N   . TYR A 322 ? 0.1726 0.1500 0.2271 0.0065  -0.0092 0.0118  303 TYR A N   
2425 C CA  . TYR A 322 ? 0.1780 0.1400 0.2209 0.0410  -0.0140 -0.0231 303 TYR A CA  
2426 C C   . TYR A 322 ? 0.2314 0.1714 0.2616 -0.0006 0.0157  -0.0150 303 TYR A C   
2427 O O   . TYR A 322 ? 0.1954 0.1539 0.2810 -0.0059 0.0124  -0.0295 303 TYR A O   
2428 C CB  . TYR A 322 ? 0.2329 0.1243 0.1993 -0.0002 -0.0506 -0.0403 303 TYR A CB  
2429 C CG  . TYR A 322 ? 0.2261 0.1541 0.2132 0.0178  -0.0269 -0.0193 303 TYR A CG  
2430 C CD1 . TYR A 322 ? 0.2075 0.1667 0.2335 0.0120  -0.0106 -0.0236 303 TYR A CD1 
2431 C CD2 . TYR A 322 ? 0.2500 0.1700 0.2136 -0.0098 -0.0413 0.0171  303 TYR A CD2 
2432 C CE1 . TYR A 322 ? 0.1944 0.1810 0.2333 0.0190  -0.0286 -0.0278 303 TYR A CE1 
2433 C CE2 . TYR A 322 ? 0.2066 0.1926 0.2405 -0.0070 -0.0463 -0.0027 303 TYR A CE2 
2434 C CZ  . TYR A 322 ? 0.1968 0.1867 0.2351 0.0201  -0.0464 -0.0150 303 TYR A CZ  
2435 O OH  . TYR A 322 ? 0.2454 0.2087 0.2702 -0.0059 -0.0387 -0.0136 303 TYR A OH  
2436 N N   . LEU A 323 ? 0.2199 0.1655 0.2467 0.0092  0.0305  -0.0155 304 LEU A N   
2437 C CA  . LEU A 323 ? 0.1979 0.1585 0.2503 0.0148  0.0416  -0.0234 304 LEU A CA  
2438 C C   . LEU A 323 ? 0.1755 0.1592 0.2699 -0.0130 0.0259  -0.0213 304 LEU A C   
2439 O O   . LEU A 323 ? 0.2301 0.1920 0.3027 0.0204  0.0523  -0.0075 304 LEU A O   
2440 C CB  . LEU A 323 ? 0.1813 0.1500 0.2469 0.0136  0.0231  0.0145  304 LEU A CB  
2441 C CG  . LEU A 323 ? 0.1592 0.1717 0.2381 0.0223  0.0087  0.0050  304 LEU A CG  
2442 C CD1 . LEU A 323 ? 0.1721 0.1915 0.2331 -0.0155 0.0297  -0.0053 304 LEU A CD1 
2443 C CD2 . LEU A 323 ? 0.1370 0.1750 0.2602 0.0396  0.0317  -0.0347 304 LEU A CD2 
2444 N N   . HIS A 324 ? 0.1894 0.1626 0.2745 -0.0417 -0.0316 -0.0290 305 HIS A N   
2445 C CA  . HIS A 324 ? 0.2288 0.1766 0.2955 -0.0148 -0.0032 -0.0365 305 HIS A CA  
2446 C C   . HIS A 324 ? 0.2596 0.1711 0.3302 -0.0100 0.0248  -0.0128 305 HIS A C   
2447 O O   . HIS A 324 ? 0.2773 0.1820 0.3701 -0.0106 0.0199  -0.0238 305 HIS A O   
2448 C CB  . HIS A 324 ? 0.2581 0.1552 0.2748 -0.0179 0.0001  -0.0641 305 HIS A CB  
2449 C CG  . HIS A 324 ? 0.3220 0.1795 0.2902 -0.0315 0.0054  -0.0484 305 HIS A CG  
2450 N ND1 . HIS A 324 ? 0.3437 0.1807 0.2962 -0.0102 0.0249  -0.0673 305 HIS A ND1 
2451 C CD2 . HIS A 324 ? 0.3400 0.1731 0.3026 -0.0733 0.0194  -0.0622 305 HIS A CD2 
2452 C CE1 . HIS A 324 ? 0.3553 0.1882 0.2975 -0.0286 0.0340  -0.0625 305 HIS A CE1 
2453 N NE2 . HIS A 324 ? 0.3546 0.2010 0.2964 -0.0177 0.0145  -0.0864 305 HIS A NE2 
2454 N N   . TRP A 325 ? 0.2528 0.1769 0.2999 0.0449  0.0240  0.0092  306 TRP A N   
2455 C CA  . TRP A 325 ? 0.2456 0.1902 0.2969 0.0039  0.0425  0.0159  306 TRP A CA  
2456 C C   . TRP A 325 ? 0.2379 0.1772 0.3280 0.0119  0.0473  0.0161  306 TRP A C   
2457 O O   . TRP A 325 ? 0.2942 0.1819 0.3832 -0.0100 0.0237  0.0112  306 TRP A O   
2458 C CB  . TRP A 325 ? 0.2076 0.1868 0.2591 0.0034  0.0086  0.0054  306 TRP A CB  
2459 C CG  . TRP A 325 ? 0.2226 0.1882 0.2518 0.0079  0.0059  0.0286  306 TRP A CG  
2460 C CD1 . TRP A 325 ? 0.2136 0.2102 0.2471 0.0025  0.0167  0.0348  306 TRP A CD1 
2461 C CD2 . TRP A 325 ? 0.2133 0.2197 0.2447 -0.0013 0.0000  0.0584  306 TRP A CD2 
2462 N NE1 . TRP A 325 ? 0.2267 0.2169 0.2462 0.0186  -0.0094 0.0549  306 TRP A NE1 
2463 C CE2 . TRP A 325 ? 0.2149 0.2283 0.2577 0.0149  -0.0122 0.0518  306 TRP A CE2 
2464 C CE3 . TRP A 325 ? 0.2047 0.2324 0.2427 -0.0144 0.0040  0.0603  306 TRP A CE3 
2465 C CZ2 . TRP A 325 ? 0.2196 0.2393 0.2708 0.0143  -0.0139 0.0339  306 TRP A CZ2 
2466 C CZ3 . TRP A 325 ? 0.2128 0.2386 0.2541 -0.0033 -0.0048 0.0304  306 TRP A CZ3 
2467 C CH2 . TRP A 325 ? 0.2391 0.2365 0.2596 -0.0013 -0.0192 0.0185  306 TRP A CH2 
2468 N N   . GLU A 326 ? 0.1962 0.1920 0.3453 0.0124  0.0544  0.0172  307 GLU A N   
2469 C CA  . GLU A 326 ? 0.1998 0.2110 0.3735 0.0253  0.0355  0.0239  307 GLU A CA  
2470 C C   . GLU A 326 ? 0.2436 0.2583 0.4242 0.0649  0.0093  0.0153  307 GLU A C   
2471 O O   . GLU A 326 ? 0.2647 0.2727 0.4405 0.0688  -0.0408 0.0180  307 GLU A O   
2472 C CB  . GLU A 326 ? 0.1398 0.2076 0.3540 0.0083  0.0264  0.0481  307 GLU A CB  
2473 C CG  . GLU A 326 ? 0.1869 0.2100 0.3206 -0.0028 0.0031  0.0608  307 GLU A CG  
2474 C CD  . GLU A 326 ? 0.2418 0.2295 0.3084 -0.0221 0.0034  0.0459  307 GLU A CD  
2475 O OE1 . GLU A 326 ? 0.2319 0.2113 0.3057 0.0077  -0.0085 0.0329  307 GLU A OE1 
2476 O OE2 . GLU A 326 ? 0.2374 0.2639 0.3022 -0.0225 0.0148  0.0323  307 GLU A OE2 
2477 N N   . SER A 327 ? 0.2607 0.2675 0.4281 0.0974  0.0561  -0.0098 308 SER A N   
2478 C CA  . SER A 327 ? 0.3483 0.3280 0.4778 0.0663  0.0906  -0.0515 308 SER A CA  
2479 C C   . SER A 327 ? 0.4198 0.3903 0.5397 0.0419  0.0997  -0.0692 308 SER A C   
2480 O O   . SER A 327 ? 0.4168 0.3999 0.5491 0.0605  0.1091  -0.0641 308 SER A O   
2481 C CB  . SER A 327 ? 0.3700 0.3831 0.4663 0.0893  0.1085  -0.0899 308 SER A CB  
2482 O OG  . SER A 327 ? 0.4659 0.4362 0.4709 0.0853  0.1160  -0.0866 308 SER A OG  
2483 N N   . HIS A 328 ? 0.4859 0.4390 0.5955 0.0206  0.0908  -0.0585 309 HIS A N   
2484 C CA  . HIS A 328 ? 0.5714 0.5240 0.6516 0.0063  0.0643  -0.0361 309 HIS A CA  
2485 C C   . HIS A 328 ? 0.6374 0.6122 0.7070 0.0052  0.0607  -0.0012 309 HIS A C   
2486 O O   . HIS A 328 ? 0.6573 0.6147 0.6973 -0.0004 0.0901  0.0180  309 HIS A O   
2487 C CB  . HIS A 328 ? 0.5938 0.5207 0.6506 -0.0218 0.0450  -0.0488 309 HIS A CB  
2488 C CG  . HIS A 328 ? 0.6039 0.5403 0.6359 -0.0263 0.0331  -0.0616 309 HIS A CG  
2489 N ND1 . HIS A 328 ? 0.6187 0.5532 0.6286 -0.0155 0.0255  -0.0764 309 HIS A ND1 
2490 C CD2 . HIS A 328 ? 0.6158 0.5741 0.6388 -0.0249 0.0305  -0.0501 309 HIS A CD2 
2491 C CE1 . HIS A 328 ? 0.6174 0.5723 0.6332 -0.0152 0.0199  -0.0703 309 HIS A CE1 
2492 N NE2 . HIS A 328 ? 0.6286 0.5824 0.6368 -0.0168 0.0281  -0.0625 309 HIS A NE2 
2493 N N   . THR A 329 ? 0.6825 0.6900 0.7617 0.0146  0.0289  0.0042  310 THR A N   
2494 C CA  . THR A 329 ? 0.7276 0.7591 0.8058 0.0318  0.0227  0.0033  310 THR A CA  
2495 C C   . THR A 329 ? 0.7607 0.7673 0.7974 0.0675  0.0199  0.0049  310 THR A C   
2496 O O   . THR A 329 ? 0.7807 0.7594 0.7911 0.0957  0.0126  0.0067  310 THR A O   
2500 N N   . SER B 25  ? 0.5411 0.5920 0.5949 -0.0298 -0.0061 0.0278  6   SER B N   
2501 C CA  . SER B 25  ? 0.5384 0.5841 0.5770 -0.0059 -0.0147 0.0341  6   SER B CA  
2502 C C   . SER B 25  ? 0.4757 0.5480 0.5288 0.0233  -0.0019 0.0504  6   SER B C   
2503 O O   . SER B 25  ? 0.5065 0.5735 0.5450 0.0211  0.0331  0.0761  6   SER B O   
2504 C CB  . SER B 25  ? 0.5717 0.6134 0.6060 0.0014  -0.0331 0.0389  6   SER B CB  
2505 O OG  . SER B 25  ? 0.5870 0.6348 0.6216 0.0149  -0.0490 0.0486  6   SER B OG  
2506 N N   . LEU B 26  ? 0.3699 0.4899 0.4618 0.0091  -0.0132 0.0250  7   LEU B N   
2507 C CA  . LEU B 26  ? 0.3283 0.4471 0.4107 0.0094  -0.0216 -0.0060 7   LEU B CA  
2508 C C   . LEU B 26  ? 0.2905 0.4188 0.3722 0.0027  -0.0212 -0.0064 7   LEU B C   
2509 O O   . LEU B 26  ? 0.3030 0.4107 0.3712 0.0190  -0.0369 -0.0288 7   LEU B O   
2510 C CB  . LEU B 26  ? 0.3818 0.4282 0.4159 0.0457  -0.0183 -0.0174 7   LEU B CB  
2511 C CG  . LEU B 26  ? 0.4556 0.4332 0.4306 0.0898  -0.0200 -0.0159 7   LEU B CG  
2512 C CD1 . LEU B 26  ? 0.5026 0.4343 0.4558 0.0831  -0.0173 -0.0085 7   LEU B CD1 
2513 C CD2 . LEU B 26  ? 0.4566 0.4297 0.4278 0.1028  -0.0208 -0.0240 7   LEU B CD2 
2514 N N   . GLU B 27  ? 0.2041 0.3963 0.3547 -0.0140 -0.0058 -0.0099 8   GLU B N   
2515 C CA  . GLU B 27  ? 0.2269 0.4195 0.3540 0.0053  0.0039  -0.0157 8   GLU B CA  
2516 C C   . GLU B 27  ? 0.2368 0.4169 0.3344 -0.0024 0.0184  -0.0240 8   GLU B C   
2517 O O   . GLU B 27  ? 0.2435 0.4129 0.3218 -0.0117 0.0346  -0.0133 8   GLU B O   
2518 C CB  . GLU B 27  ? 0.2762 0.4463 0.3872 0.0348  0.0108  -0.0034 8   GLU B CB  
2519 C CG  . GLU B 27  ? 0.3339 0.4854 0.4351 0.0506  0.0419  0.0131  8   GLU B CG  
2520 C CD  . GLU B 27  ? 0.3941 0.5215 0.4786 0.0478  0.0545  0.0467  8   GLU B CD  
2521 O OE1 . GLU B 27  ? 0.4231 0.5342 0.4909 0.0537  0.0504  0.0465  8   GLU B OE1 
2522 O OE2 . GLU B 27  ? 0.4254 0.5428 0.4990 0.0431  0.0646  0.0661  8   GLU B OE2 
2523 N N   . LEU B 28  ? 0.2134 0.4102 0.3135 0.0008  -0.0205 -0.0386 9   LEU B N   
2524 C CA  . LEU B 28  ? 0.2342 0.4285 0.3265 -0.0099 -0.0058 -0.0398 9   LEU B CA  
2525 C C   . LEU B 28  ? 0.2093 0.4107 0.3127 -0.0279 -0.0286 -0.0322 9   LEU B C   
2526 O O   . LEU B 28  ? 0.1528 0.4412 0.3114 -0.0379 -0.0069 -0.0366 9   LEU B O   
2527 C CB  . LEU B 28  ? 0.2302 0.4199 0.3361 -0.0119 -0.0126 -0.0423 9   LEU B CB  
2528 C CG  . LEU B 28  ? 0.2179 0.3932 0.3319 -0.0347 -0.0307 -0.0515 9   LEU B CG  
2529 C CD1 . LEU B 28  ? 0.2125 0.3688 0.3324 -0.0254 -0.0303 -0.0483 9   LEU B CD1 
2530 C CD2 . LEU B 28  ? 0.2227 0.3791 0.3240 -0.0496 -0.0591 -0.0597 9   LEU B CD2 
2531 N N   . PRO B 29  ? 0.2624 0.3932 0.3185 -0.0215 -0.0614 -0.0355 10  PRO B N   
2532 C CA  . PRO B 29  ? 0.2637 0.4122 0.3531 -0.0143 -0.0833 -0.0188 10  PRO B CA  
2533 C C   . PRO B 29  ? 0.2828 0.4476 0.3560 -0.0253 -0.0959 -0.0274 10  PRO B C   
2534 O O   . PRO B 29  ? 0.2894 0.5051 0.3732 -0.0191 -0.1131 -0.0269 10  PRO B O   
2535 C CB  . PRO B 29  ? 0.2906 0.4130 0.3727 -0.0028 -0.0983 -0.0200 10  PRO B CB  
2536 C CG  . PRO B 29  ? 0.2916 0.3905 0.3572 -0.0092 -0.1036 -0.0354 10  PRO B CG  
2537 C CD  . PRO B 29  ? 0.2888 0.3902 0.3292 0.0008  -0.0878 -0.0223 10  PRO B CD  
2538 N N   . PHE B 30  ? 0.2864 0.4272 0.3456 -0.0063 -0.0624 -0.0310 11  PHE B N   
2539 C CA  . PHE B 30  ? 0.3127 0.4150 0.3585 -0.0204 -0.0377 -0.0238 11  PHE B CA  
2540 C C   . PHE B 30  ? 0.3252 0.4169 0.3789 -0.0244 -0.0360 -0.0468 11  PHE B C   
2541 O O   . PHE B 30  ? 0.3051 0.4054 0.3711 -0.0322 -0.0349 -0.0332 11  PHE B O   
2542 C CB  . PHE B 30  ? 0.3076 0.4241 0.3595 -0.0276 0.0140  0.0026  11  PHE B CB  
2543 C CG  . PHE B 30  ? 0.3060 0.4116 0.3676 -0.0443 0.0405  0.0403  11  PHE B CG  
2544 C CD1 . PHE B 30  ? 0.2919 0.4041 0.3648 -0.0442 0.0308  0.0635  11  PHE B CD1 
2545 C CD2 . PHE B 30  ? 0.3172 0.4063 0.3729 -0.0458 0.0523  0.0384  11  PHE B CD2 
2546 C CE1 . PHE B 30  ? 0.2704 0.3861 0.3465 -0.0775 0.0192  0.0706  11  PHE B CE1 
2547 C CE2 . PHE B 30  ? 0.2861 0.4051 0.3641 -0.0461 0.0394  0.0489  11  PHE B CE2 
2548 C CZ  . PHE B 30  ? 0.2683 0.4046 0.3448 -0.0655 0.0188  0.0652  11  PHE B CZ  
2549 N N   . THR B 31  ? 0.3324 0.4264 0.4027 -0.0408 -0.0461 -0.0590 12  THR B N   
2550 C CA  . THR B 31  ? 0.3670 0.4227 0.4206 -0.0614 -0.0142 -0.0644 12  THR B CA  
2551 C C   . THR B 31  ? 0.3419 0.3828 0.4126 -0.0640 -0.0103 -0.0663 12  THR B C   
2552 O O   . THR B 31  ? 0.3432 0.3736 0.4045 -0.0495 0.0034  -0.0346 12  THR B O   
2553 C CB  . THR B 31  ? 0.4239 0.4769 0.4361 -0.0606 -0.0059 -0.0720 12  THR B CB  
2554 O OG1 . THR B 31  ? 0.4726 0.5137 0.4441 -0.0524 -0.0278 -0.0702 12  THR B OG1 
2555 C CG2 . THR B 31  ? 0.4283 0.4876 0.4407 -0.0573 -0.0139 -0.0638 12  THR B CG2 
2556 N N   . HIS B 32  ? 0.3142 0.3588 0.4062 -0.0544 -0.0194 -0.0653 13  HIS B N   
2557 C CA  . HIS B 32  ? 0.2930 0.3526 0.4013 -0.0613 -0.0309 -0.0598 13  HIS B CA  
2558 C C   . HIS B 32  ? 0.2697 0.3505 0.3831 -0.0844 -0.0371 -0.0729 13  HIS B C   
2559 O O   . HIS B 32  ? 0.3059 0.4173 0.4040 -0.0473 -0.0452 -0.0625 13  HIS B O   
2560 C CB  . HIS B 32  ? 0.2966 0.3572 0.4191 -0.0476 -0.0586 -0.0449 13  HIS B CB  
2561 C CG  . HIS B 32  ? 0.3289 0.3770 0.4479 -0.0384 -0.0541 -0.0248 13  HIS B CG  
2562 N ND1 . HIS B 32  ? 0.3467 0.3759 0.4596 -0.0411 -0.0361 -0.0037 13  HIS B ND1 
2563 C CD2 . HIS B 32  ? 0.3451 0.3711 0.4703 -0.0330 -0.0433 -0.0194 13  HIS B CD2 
2564 C CE1 . HIS B 32  ? 0.3392 0.3581 0.4715 -0.0447 -0.0287 -0.0095 13  HIS B CE1 
2565 N NE2 . HIS B 32  ? 0.3593 0.3607 0.4849 -0.0597 -0.0229 -0.0084 13  HIS B NE2 
2566 N N   . ARG B 33  ? 0.2663 0.3290 0.3601 -0.0738 -0.0059 -0.0649 14  ARG B N   
2567 C CA  . ARG B 33  ? 0.2731 0.3087 0.3654 -0.0294 -0.0286 -0.0548 14  ARG B CA  
2568 C C   . ARG B 33  ? 0.2343 0.2768 0.3556 -0.0433 -0.0360 -0.0645 14  ARG B C   
2569 O O   . ARG B 33  ? 0.2392 0.2433 0.3367 -0.0285 -0.0577 -0.0480 14  ARG B O   
2570 C CB  . ARG B 33  ? 0.3020 0.3592 0.3838 -0.0073 -0.0311 -0.0403 14  ARG B CB  
2571 C CG  . ARG B 33  ? 0.3646 0.4116 0.4319 -0.0293 -0.0312 -0.0158 14  ARG B CG  
2572 C CD  . ARG B 33  ? 0.4185 0.4633 0.4805 -0.0379 -0.0460 0.0130  14  ARG B CD  
2573 N NE  . ARG B 33  ? 0.5111 0.5318 0.5325 -0.0412 -0.0305 0.0157  14  ARG B NE  
2574 C CZ  . ARG B 33  ? 0.5828 0.5981 0.5766 -0.0125 -0.0145 0.0322  14  ARG B CZ  
2575 N NH1 . ARG B 33  ? 0.5974 0.6197 0.5634 -0.0216 0.0025  0.0416  14  ARG B NH1 
2576 N NH2 . ARG B 33  ? 0.6313 0.6281 0.6181 0.0221  -0.0171 0.0318  14  ARG B NH2 
2577 N N   . ARG B 34  ? 0.2768 0.2301 0.3771 -0.0416 -0.0111 -0.0554 15  ARG B N   
2578 C CA  . ARG B 34  ? 0.3013 0.2391 0.3694 -0.0785 -0.0192 -0.0416 15  ARG B CA  
2579 C C   . ARG B 34  ? 0.2844 0.2466 0.3502 -0.0585 -0.0306 -0.0608 15  ARG B C   
2580 O O   . ARG B 34  ? 0.2983 0.2884 0.2876 -0.0253 -0.0462 -0.0739 15  ARG B O   
2581 C CB  . ARG B 34  ? 0.3392 0.2533 0.3968 -0.0956 -0.0034 -0.0179 15  ARG B CB  
2582 C CG  . ARG B 34  ? 0.3588 0.2544 0.4040 -0.0884 0.0133  0.0108  15  ARG B CG  
2583 C CD  . ARG B 34  ? 0.3924 0.2831 0.4141 -0.0711 0.0449  0.0378  15  ARG B CD  
2584 N NE  . ARG B 34  ? 0.4184 0.2945 0.4307 -0.0851 0.0338  0.0599  15  ARG B NE  
2585 C CZ  . ARG B 34  ? 0.4248 0.3176 0.4545 -0.0885 0.0168  0.0252  15  ARG B CZ  
2586 N NH1 . ARG B 34  ? 0.4476 0.3489 0.4704 -0.0541 -0.0143 0.0261  15  ARG B NH1 
2587 N NH2 . ARG B 34  ? 0.4284 0.2937 0.4607 -0.1083 0.0391  -0.0009 15  ARG B NH2 
2588 N N   . ASN B 35  ? 0.2522 0.2169 0.3527 -0.0471 -0.0316 -0.0681 16  ASN B N   
2589 C CA  . ASN B 35  ? 0.2536 0.2103 0.3325 -0.0579 -0.0443 -0.0690 16  ASN B CA  
2590 C C   . ASN B 35  ? 0.2703 0.2220 0.3456 -0.0489 -0.0724 -0.0689 16  ASN B C   
2591 O O   . ASN B 35  ? 0.3314 0.2302 0.3444 -0.0462 -0.0882 -0.0410 16  ASN B O   
2592 C CB  . ASN B 35  ? 0.2417 0.2175 0.3125 -0.0672 -0.0299 -0.0581 16  ASN B CB  
2593 C CG  . ASN B 35  ? 0.2852 0.2144 0.2789 -0.0421 -0.0509 -0.0484 16  ASN B CG  
2594 O OD1 . ASN B 35  ? 0.3033 0.1906 0.2604 -0.0332 -0.0436 -0.0543 16  ASN B OD1 
2595 N ND2 . ASN B 35  ? 0.2996 0.1941 0.2732 -0.0348 -0.0965 -0.0605 16  ASN B ND2 
2596 N N   . PRO B 36  ? 0.2754 0.2334 0.3353 -0.0222 -0.0887 -0.0770 17  PRO B N   
2597 C CA  . PRO B 36  ? 0.3011 0.2480 0.3416 -0.0642 -0.0912 -0.0829 17  PRO B CA  
2598 C C   . PRO B 36  ? 0.3055 0.2041 0.3459 -0.0413 -0.0765 -0.0799 17  PRO B C   
2599 O O   . PRO B 36  ? 0.3443 0.1968 0.3902 -0.0438 -0.0599 -0.0897 17  PRO B O   
2600 C CB  . PRO B 36  ? 0.3016 0.2700 0.3371 -0.0764 -0.1052 -0.0637 17  PRO B CB  
2601 C CG  . PRO B 36  ? 0.3243 0.2684 0.3199 -0.0307 -0.0986 -0.0917 17  PRO B CG  
2602 C CD  . PRO B 36  ? 0.3198 0.2675 0.3144 -0.0155 -0.0944 -0.0879 17  PRO B CD  
2603 N N   . HIS B 37  ? 0.2717 0.2122 0.3151 -0.0312 -0.0840 -0.0619 18  HIS B N   
2604 C CA  . HIS B 37  ? 0.2841 0.1815 0.3008 -0.0381 -0.0717 -0.0633 18  HIS B CA  
2605 C C   . HIS B 37  ? 0.2914 0.1606 0.3015 -0.0239 -0.0577 -0.0156 18  HIS B C   
2606 O O   . HIS B 37  ? 0.2750 0.1533 0.2825 -0.0226 -0.0643 -0.0216 18  HIS B O   
2607 C CB  . HIS B 37  ? 0.3197 0.1864 0.2884 -0.0086 -0.0802 -0.0509 18  HIS B CB  
2608 C CG  . HIS B 37  ? 0.3678 0.2384 0.2901 0.0081  -0.0862 -0.0619 18  HIS B CG  
2609 N ND1 . HIS B 37  ? 0.3752 0.2903 0.3052 0.0188  -0.0856 -0.0653 18  HIS B ND1 
2610 C CD2 . HIS B 37  ? 0.3904 0.2615 0.2844 0.0317  -0.0959 -0.0742 18  HIS B CD2 
2611 C CE1 . HIS B 37  ? 0.3878 0.3079 0.2879 0.0178  -0.0918 -0.0658 18  HIS B CE1 
2612 N NE2 . HIS B 37  ? 0.4017 0.2722 0.2758 0.0111  -0.1234 -0.0642 18  HIS B NE2 
2613 N N   . GLN B 38  ? 0.3008 0.1441 0.3086 -0.0298 -0.0553 -0.0423 19  GLN B N   
2614 C CA  . GLN B 38  ? 0.3224 0.1861 0.3551 -0.0364 -0.0610 -0.0245 19  GLN B CA  
2615 C C   . GLN B 38  ? 0.3070 0.1511 0.3553 -0.0610 -0.0640 -0.0276 19  GLN B C   
2616 O O   . GLN B 38  ? 0.3076 0.1727 0.3499 -0.0209 -0.0551 -0.0328 19  GLN B O   
2617 C CB  . GLN B 38  ? 0.3492 0.2179 0.3788 -0.0498 -0.0381 -0.0169 19  GLN B CB  
2618 C CG  . GLN B 38  ? 0.3874 0.2776 0.4052 -0.0446 -0.0181 -0.0302 19  GLN B CG  
2619 C CD  . GLN B 38  ? 0.4223 0.3500 0.4365 -0.0308 -0.0118 -0.0019 19  GLN B CD  
2620 O OE1 . GLN B 38  ? 0.4640 0.4190 0.4514 -0.0502 -0.0028 0.0103  19  GLN B OE1 
2621 N NE2 . GLN B 38  ? 0.4314 0.3366 0.4398 -0.0103 -0.0131 0.0039  19  GLN B NE2 
2622 N N   . THR B 39  ? 0.3224 0.1848 0.3801 -0.0150 -0.0423 -0.0268 20  THR B N   
2623 C CA  A THR B 39  ? 0.3267 0.1862 0.3768 -0.0135 -0.0286 -0.0317 20  THR B CA  
2624 C CA  B THR B 39  ? 0.3347 0.2010 0.3853 -0.0189 -0.0374 -0.0355 20  THR B CA  
2625 C C   . THR B 39  ? 0.3448 0.1872 0.3675 0.0017  -0.0308 -0.0328 20  THR B C   
2626 O O   . THR B 39  ? 0.3719 0.1858 0.3971 -0.0139 -0.0040 -0.0162 20  THR B O   
2627 C CB  A THR B 39  ? 0.3179 0.1638 0.3685 0.0003  -0.0302 -0.0022 20  THR B CB  
2628 C CB  B THR B 39  ? 0.3380 0.2364 0.3937 -0.0138 -0.0550 -0.0155 20  THR B CB  
2629 O OG1 A THR B 39  ? 0.3253 0.1662 0.3770 -0.0171 -0.0194 0.0305  20  THR B OG1 
2630 O OG1 B THR B 39  ? 0.3696 0.2622 0.4042 -0.0158 -0.0578 -0.0238 20  THR B OG1 
2631 C CG2 A THR B 39  ? 0.3150 0.1306 0.3623 0.0130  -0.0149 -0.0248 20  THR B CG2 
2632 C CG2 B THR B 39  ? 0.3243 0.2401 0.3935 -0.0224 -0.0539 -0.0012 20  THR B CG2 
2633 N N   . GLU B 40  ? 0.3571 0.1668 0.3047 -0.0047 -0.0660 -0.0154 21  GLU B N   
2634 C CA  . GLU B 40  ? 0.3334 0.1814 0.3124 0.0006  -0.0577 0.0152  21  GLU B CA  
2635 C C   . GLU B 40  ? 0.3185 0.1586 0.2998 -0.0009 -0.0364 0.0156  21  GLU B C   
2636 O O   . GLU B 40  ? 0.3476 0.1727 0.3116 0.0278  -0.0394 0.0049  21  GLU B O   
2637 C CB  . GLU B 40  ? 0.3509 0.2142 0.3414 0.0069  -0.0249 0.0117  21  GLU B CB  
2638 C CG  . GLU B 40  ? 0.4333 0.2653 0.3648 0.0612  -0.0155 0.0241  21  GLU B CG  
2639 C CD  . GLU B 40  ? 0.4981 0.2853 0.4008 0.0665  0.0179  0.0154  21  GLU B CD  
2640 O OE1 . GLU B 40  ? 0.5147 0.2560 0.3974 0.0381  -0.0148 -0.0033 21  GLU B OE1 
2641 O OE2 . GLU B 40  ? 0.5293 0.3291 0.4072 0.1149  0.0641  0.0041  21  GLU B OE2 
2642 N N   . ALA B 41  ? 0.2954 0.1319 0.2727 0.0072  -0.0186 -0.0161 22  ALA B N   
2643 C CA  . ALA B 41  ? 0.2954 0.0978 0.2372 0.0139  -0.0626 -0.0132 22  ALA B CA  
2644 C C   . ALA B 41  ? 0.3585 0.0966 0.2604 -0.0154 -0.0533 -0.0010 22  ALA B C   
2645 O O   . ALA B 41  ? 0.3880 0.1053 0.2610 -0.0193 -0.0616 -0.0044 22  ALA B O   
2646 C CB  . ALA B 41  ? 0.2684 0.1021 0.2408 0.0019  -0.0509 -0.0076 22  ALA B CB  
2647 N N   . ALA B 42  ? 0.3603 0.1084 0.2503 -0.0024 -0.0159 0.0075  23  ALA B N   
2648 C CA  . ALA B 42  ? 0.3576 0.1254 0.2716 -0.0057 -0.0113 0.0267  23  ALA B CA  
2649 C C   . ALA B 42  ? 0.3373 0.1169 0.2881 0.0038  -0.0515 0.0220  23  ALA B C   
2650 O O   . ALA B 42  ? 0.3379 0.1202 0.3101 -0.0217 -0.0635 0.0212  23  ALA B O   
2651 C CB  . ALA B 42  ? 0.3740 0.1447 0.2796 -0.0388 -0.0148 0.0201  23  ALA B CB  
2652 N N   . ASP B 43  ? 0.3148 0.1229 0.3143 -0.0074 -0.0337 0.0078  24  ASP B N   
2653 C CA  . ASP B 43  ? 0.3302 0.1467 0.3195 -0.0031 -0.0589 -0.0155 24  ASP B CA  
2654 C C   . ASP B 43  ? 0.3563 0.1398 0.2769 -0.0053 -0.0522 -0.0082 24  ASP B C   
2655 O O   . ASP B 43  ? 0.3771 0.1596 0.2809 -0.0314 -0.0557 0.0010  24  ASP B O   
2656 C CB  . ASP B 43  ? 0.3009 0.1227 0.3598 0.0038  -0.0824 -0.0553 24  ASP B CB  
2657 C CG  . ASP B 43  ? 0.3629 0.1647 0.4374 -0.0190 -0.0722 -0.0498 24  ASP B CG  
2658 O OD1 . ASP B 43  ? 0.4146 0.1590 0.4845 -0.0301 -0.0648 0.0051  24  ASP B OD1 
2659 O OD2 . ASP B 43  ? 0.4135 0.2350 0.5119 -0.0662 -0.0747 -0.0833 24  ASP B OD2 
2660 N N   . ARG B 44  ? 0.3647 0.1357 0.2341 -0.0193 -0.0405 -0.0150 25  ARG B N   
2661 C CA  . ARG B 44  ? 0.3478 0.1615 0.2129 -0.0219 -0.0673 0.0137  25  ARG B CA  
2662 C C   . ARG B 44  ? 0.3317 0.1627 0.2043 -0.0342 -0.0577 -0.0095 25  ARG B C   
2663 O O   . ARG B 44  ? 0.3326 0.1665 0.2019 -0.0323 -0.0538 -0.0129 25  ARG B O   
2664 C CB  . ARG B 44  ? 0.3271 0.1975 0.2287 -0.0491 -0.0797 0.0295  25  ARG B CB  
2665 C CG  . ARG B 44  ? 0.3697 0.2709 0.2477 -0.0936 -0.0654 0.0386  25  ARG B CG  
2666 C CD  . ARG B 44  ? 0.4479 0.3626 0.3074 -0.0596 -0.0420 0.0449  25  ARG B CD  
2667 N NE  . ARG B 44  ? 0.5197 0.4446 0.3776 -0.0694 -0.0201 0.0501  25  ARG B NE  
2668 C CZ  . ARG B 44  ? 0.5868 0.4681 0.4121 -0.0897 0.0052  0.0761  25  ARG B CZ  
2669 N NH1 . ARG B 44  ? 0.5915 0.4610 0.4154 -0.1181 0.0013  0.0904  25  ARG B NH1 
2670 N NH2 . ARG B 44  ? 0.6216 0.5042 0.4381 -0.0652 0.0062  0.0788  25  ARG B NH2 
2671 N N   . HIS B 45  ? 0.3475 0.1379 0.2008 -0.0244 -0.0159 -0.0189 26  HIS B N   
2672 C CA  . HIS B 45  ? 0.3559 0.1497 0.2178 0.0128  -0.0203 -0.0066 26  HIS B CA  
2673 C C   . HIS B 45  ? 0.3313 0.1399 0.2490 -0.0194 -0.0576 -0.0015 26  HIS B C   
2674 O O   . HIS B 45  ? 0.3312 0.1264 0.2627 -0.0221 -0.0644 0.0034  26  HIS B O   
2675 C CB  . HIS B 45  ? 0.3283 0.1554 0.1901 0.0152  -0.0495 -0.0166 26  HIS B CB  
2676 C CG  . HIS B 45  ? 0.3357 0.1645 0.1917 -0.0208 0.0005  -0.0300 26  HIS B CG  
2677 N ND1 . HIS B 45  ? 0.3437 0.1567 0.2012 -0.0224 0.0018  -0.0187 26  HIS B ND1 
2678 C CD2 . HIS B 45  ? 0.3534 0.1746 0.2180 -0.0281 0.0159  0.0155  26  HIS B CD2 
2679 C CE1 . HIS B 45  ? 0.3175 0.1388 0.2370 -0.0277 0.0216  -0.0066 26  HIS B CE1 
2680 N NE2 . HIS B 45  ? 0.3139 0.1658 0.2431 -0.0505 0.0152  0.0218  26  HIS B NE2 
2681 N N   . LEU B 46  ? 0.2978 0.1407 0.2777 0.0061  -0.0604 0.0170  27  LEU B N   
2682 C CA  . LEU B 46  ? 0.3021 0.1598 0.3079 -0.0410 -0.0575 0.0221  27  LEU B CA  
2683 C C   . LEU B 46  ? 0.3163 0.1666 0.3174 -0.0115 -0.0511 -0.0080 27  LEU B C   
2684 O O   . LEU B 46  ? 0.3212 0.1824 0.3210 0.0020  -0.0755 -0.0126 27  LEU B O   
2685 C CB  . LEU B 46  ? 0.3008 0.1761 0.3399 -0.0221 -0.0757 0.0293  27  LEU B CB  
2686 C CG  . LEU B 46  ? 0.3516 0.2081 0.3532 -0.0765 -0.0736 0.0419  27  LEU B CG  
2687 C CD1 . LEU B 46  ? 0.3703 0.2305 0.3754 -0.0843 -0.0810 0.0245  27  LEU B CD1 
2688 C CD2 . LEU B 46  ? 0.3538 0.2516 0.3630 -0.0493 -0.0920 0.0625  27  LEU B CD2 
2689 N N   . GLU B 47  ? 0.3134 0.1495 0.3000 -0.0269 -0.0155 -0.0252 28  GLU B N   
2690 C CA  . GLU B 47  ? 0.3496 0.1800 0.3009 -0.0050 -0.0188 -0.0425 28  GLU B CA  
2691 C C   . GLU B 47  ? 0.3131 0.1576 0.2842 0.0236  -0.0247 -0.0041 28  GLU B C   
2692 O O   . GLU B 47  ? 0.3278 0.1921 0.3237 0.0504  0.0152  0.0163  28  GLU B O   
2693 C CB  . GLU B 47  ? 0.4050 0.2087 0.3284 -0.0284 0.0087  -0.0675 28  GLU B CB  
2694 C CG  . GLU B 47  ? 0.4512 0.2605 0.3774 -0.0544 0.0359  -0.0610 28  GLU B CG  
2695 C CD  . GLU B 47  ? 0.5446 0.3193 0.4142 -0.0677 0.0510  -0.0513 28  GLU B CD  
2696 O OE1 . GLU B 47  ? 0.6020 0.3721 0.4324 -0.0638 0.0842  -0.0137 28  GLU B OE1 
2697 O OE2 . GLU B 47  ? 0.5720 0.3623 0.4213 -0.0610 0.0350  -0.0742 28  GLU B OE2 
2698 N N   . TRP B 48  ? 0.3226 0.1258 0.2523 0.0223  -0.0417 -0.0114 29  TRP B N   
2699 C CA  . TRP B 48  ? 0.3108 0.1252 0.2780 0.0172  -0.0442 -0.0170 29  TRP B CA  
2700 C C   . TRP B 48  ? 0.3057 0.1411 0.3056 -0.0022 -0.0644 -0.0133 29  TRP B C   
2701 O O   . TRP B 48  ? 0.3328 0.1493 0.3157 -0.0117 -0.0897 -0.0279 29  TRP B O   
2702 C CB  . TRP B 48  ? 0.3288 0.1152 0.2891 -0.0008 -0.0335 -0.0188 29  TRP B CB  
2703 C CG  . TRP B 48  ? 0.3135 0.1375 0.2878 -0.0227 -0.0467 -0.0005 29  TRP B CG  
2704 C CD1 . TRP B 48  ? 0.3128 0.1618 0.2982 -0.0083 -0.0469 -0.0060 29  TRP B CD1 
2705 C CD2 . TRP B 48  ? 0.3315 0.1398 0.2648 -0.0008 -0.0328 0.0029  29  TRP B CD2 
2706 N NE1 . TRP B 48  ? 0.2968 0.1463 0.2645 0.0057  -0.0575 0.0211  29  TRP B NE1 
2707 C CE2 . TRP B 48  ? 0.3326 0.1451 0.2594 0.0045  -0.0226 -0.0033 29  TRP B CE2 
2708 C CE3 . TRP B 48  ? 0.3298 0.1640 0.2709 0.0118  0.0114  -0.0177 29  TRP B CE3 
2709 C CZ2 . TRP B 48  ? 0.3755 0.1684 0.2732 -0.0123 -0.0055 -0.0106 29  TRP B CZ2 
2710 C CZ3 . TRP B 48  ? 0.3642 0.1802 0.2813 0.0127  -0.0111 -0.0120 29  TRP B CZ3 
2711 C CH2 . TRP B 48  ? 0.3798 0.1652 0.2776 -0.0153 -0.0075 -0.0272 29  TRP B CH2 
2712 N N   . LEU B 49  ? 0.3060 0.1501 0.2926 -0.0082 -0.0544 0.0031  30  LEU B N   
2713 C CA  . LEU B 49  ? 0.3165 0.1817 0.2957 -0.0077 -0.0584 -0.0050 30  LEU B CA  
2714 C C   . LEU B 49  ? 0.3767 0.2255 0.3270 0.0134  -0.0900 -0.0022 30  LEU B C   
2715 O O   . LEU B 49  ? 0.4095 0.2329 0.3429 0.0032  -0.1047 0.0010  30  LEU B O   
2716 C CB  . LEU B 49  ? 0.3400 0.1881 0.2718 -0.0097 -0.0450 0.0113  30  LEU B CB  
2717 C CG  . LEU B 49  ? 0.3200 0.2262 0.2587 -0.0324 -0.0335 -0.0149 30  LEU B CG  
2718 C CD1 . LEU B 49  ? 0.3497 0.2302 0.2503 -0.0336 -0.0291 0.0164  30  LEU B CD1 
2719 C CD2 . LEU B 49  ? 0.3000 0.2500 0.2659 -0.0220 -0.0319 -0.0431 30  LEU B CD2 
2720 N N   . GLN B 50  ? 0.3851 0.2448 0.3491 0.0144  -0.0919 -0.0001 31  GLN B N   
2721 C CA  . GLN B 50  ? 0.4094 0.3033 0.3955 0.0220  -0.0901 -0.0262 31  GLN B CA  
2722 C C   . GLN B 50  ? 0.4180 0.3296 0.4165 0.0718  -0.1039 -0.0070 31  GLN B C   
2723 O O   . GLN B 50  ? 0.4492 0.3394 0.4256 0.0761  -0.1352 0.0168  31  GLN B O   
2724 C CB  . GLN B 50  ? 0.4716 0.3601 0.4166 0.0152  -0.0370 -0.0465 31  GLN B CB  
2725 C CG  . GLN B 50  ? 0.5358 0.4300 0.4519 0.0239  0.0066  -0.0444 31  GLN B CG  
2726 C CD  . GLN B 50  ? 0.6050 0.4952 0.5097 0.0104  0.0701  -0.0426 31  GLN B CD  
2727 O OE1 . GLN B 50  ? 0.6602 0.5181 0.5218 0.0341  0.1088  -0.0456 31  GLN B OE1 
2728 N NE2 . GLN B 50  ? 0.6245 0.5191 0.5318 -0.0117 0.0896  -0.0429 31  GLN B NE2 
2729 N N   . ARG B 51  ? 0.4141 0.3190 0.4060 0.0590  -0.0816 -0.0315 32  ARG B N   
2730 C CA  . ARG B 51  ? 0.4206 0.3675 0.4188 0.0449  -0.0632 -0.0520 32  ARG B CA  
2731 C C   . ARG B 51  ? 0.3763 0.3368 0.3950 0.0217  -0.0501 -0.0809 32  ARG B C   
2732 O O   . ARG B 51  ? 0.4077 0.4126 0.4154 0.0260  -0.0120 -0.1264 32  ARG B O   
2733 C CB  . ARG B 51  ? 0.4887 0.4442 0.4707 0.0102  -0.0411 -0.0282 32  ARG B CB  
2734 C CG  . ARG B 51  ? 0.5551 0.5173 0.5227 0.0067  -0.0419 -0.0108 32  ARG B CG  
2735 C CD  . ARG B 51  ? 0.5887 0.5761 0.5675 -0.0014 -0.0634 -0.0095 32  ARG B CD  
2736 N NE  . ARG B 51  ? 0.6328 0.6173 0.6014 -0.0025 -0.0595 -0.0083 32  ARG B NE  
2737 C CZ  . ARG B 51  ? 0.6395 0.6346 0.6015 0.0175  -0.0562 0.0089  32  ARG B CZ  
2738 N NH1 . ARG B 51  ? 0.6221 0.6287 0.6025 0.0631  -0.0449 0.0149  32  ARG B NH1 
2739 N NH2 . ARG B 51  ? 0.6389 0.6384 0.5967 -0.0095 -0.0644 0.0172  32  ARG B NH2 
2740 N N   . HIS B 52  ? 0.3495 0.2499 0.3449 0.0192  -0.0387 -0.0311 33  HIS B N   
2741 C CA  . HIS B 52  ? 0.3399 0.2193 0.3308 0.0341  -0.0543 0.0106  33  HIS B CA  
2742 C C   . HIS B 52  ? 0.3719 0.2464 0.3337 0.0142  -0.0608 0.0235  33  HIS B C   
2743 O O   . HIS B 52  ? 0.3748 0.2272 0.3487 0.0060  -0.0643 0.0357  33  HIS B O   
2744 C CB  . HIS B 52  ? 0.3237 0.2079 0.3191 0.0396  -0.0446 0.0260  33  HIS B CB  
2745 C CG  . HIS B 52  ? 0.3049 0.2027 0.3137 0.0238  -0.0201 0.0292  33  HIS B CG  
2746 N ND1 . HIS B 52  ? 0.2856 0.1747 0.3199 0.0434  -0.0020 0.0285  33  HIS B ND1 
2747 C CD2 . HIS B 52  ? 0.3015 0.1981 0.2967 0.0347  -0.0401 0.0321  33  HIS B CD2 
2748 C CE1 . HIS B 52  ? 0.3023 0.1747 0.3199 0.0540  0.0068  0.0238  33  HIS B CE1 
2749 N NE2 . HIS B 52  ? 0.2742 0.1904 0.3001 0.0428  -0.0138 0.0106  33  HIS B NE2 
2750 N N   . ARG B 53  ? 0.4390 0.2851 0.3528 0.0287  -0.0431 0.0060  34  ARG B N   
2751 C CA  . ARG B 53  ? 0.4788 0.3350 0.4083 0.0434  -0.0552 0.0211  34  ARG B CA  
2752 C C   . ARG B 53  ? 0.4640 0.3375 0.4094 0.0654  -0.0496 0.0489  34  ARG B C   
2753 O O   . ARG B 53  ? 0.4580 0.3360 0.4073 0.0372  -0.0295 0.0474  34  ARG B O   
2754 C CB  . ARG B 53  ? 0.5303 0.3910 0.4805 0.0540  -0.0456 -0.0004 34  ARG B CB  
2755 C CG  . ARG B 53  ? 0.6060 0.4876 0.5626 0.0293  -0.0347 -0.0314 34  ARG B CG  
2756 C CD  . ARG B 53  ? 0.6535 0.5576 0.6271 0.0143  -0.0396 -0.0508 34  ARG B CD  
2757 N NE  . ARG B 53  ? 0.7253 0.6371 0.6829 0.0129  -0.0370 -0.0496 34  ARG B NE  
2758 C CZ  . ARG B 53  ? 0.7551 0.6786 0.7134 0.0131  -0.0411 -0.0385 34  ARG B CZ  
2759 N NH1 . ARG B 53  ? 0.7746 0.7029 0.7274 0.0004  -0.0285 -0.0417 34  ARG B NH1 
2760 N NH2 . ARG B 53  ? 0.7637 0.6838 0.7115 0.0276  -0.0537 -0.0253 34  ARG B NH2 
2761 N N   . GLU B 54  ? 0.4481 0.3332 0.4000 0.0873  -0.0675 0.0647  35  GLU B N   
2762 C CA  . GLU B 54  ? 0.4600 0.3564 0.4094 0.0685  -0.0575 0.0630  35  GLU B CA  
2763 C C   . GLU B 54  ? 0.4546 0.3430 0.3780 0.0458  -0.0490 0.0732  35  GLU B C   
2764 O O   . GLU B 54  ? 0.4738 0.3483 0.3750 0.0344  -0.0512 0.0827  35  GLU B O   
2765 C CB  . GLU B 54  ? 0.4927 0.4311 0.4525 0.0433  -0.0566 0.0550  35  GLU B CB  
2766 C CG  . GLU B 54  ? 0.5396 0.4926 0.5050 0.0256  -0.0680 0.0624  35  GLU B CG  
2767 C CD  . GLU B 54  ? 0.5805 0.5313 0.5213 0.0513  -0.0832 0.0619  35  GLU B CD  
2768 O OE1 . GLU B 54  ? 0.6071 0.5532 0.5318 0.0739  -0.1046 0.0653  35  GLU B OE1 
2769 O OE2 . GLU B 54  ? 0.5897 0.5297 0.5212 0.0503  -0.0782 0.0555  35  GLU B OE2 
2770 N N   . LEU B 55  ? 0.4268 0.3119 0.3509 0.0244  -0.0566 0.0731  36  LEU B N   
2771 C CA  . LEU B 55  ? 0.4083 0.2917 0.3173 0.0422  -0.0405 0.0798  36  LEU B CA  
2772 C C   . LEU B 55  ? 0.4543 0.3424 0.3611 0.0335  -0.0092 0.1027  36  LEU B C   
2773 O O   . LEU B 55  ? 0.4935 0.3631 0.3666 -0.0138 0.0198  0.1620  36  LEU B O   
2774 C CB  . LEU B 55  ? 0.4303 0.2579 0.2682 0.0362  -0.0398 0.0706  36  LEU B CB  
2775 C CG  . LEU B 55  ? 0.4300 0.2647 0.2465 0.0257  -0.0316 0.0562  36  LEU B CG  
2776 C CD1 . LEU B 55  ? 0.4640 0.2909 0.2204 0.0132  -0.0091 0.0484  36  LEU B CD1 
2777 C CD2 . LEU B 55  ? 0.4449 0.2708 0.2711 0.0401  -0.0184 0.0684  36  LEU B CD2 
2778 N N   . ALA B 56  ? 0.4535 0.3584 0.3998 0.0105  -0.0272 0.0917  37  ALA B N   
2779 C CA  . ALA B 56  ? 0.4521 0.3740 0.4274 -0.0072 -0.0096 0.1035  37  ALA B CA  
2780 C C   . ALA B 56  ? 0.5001 0.3760 0.4642 0.0096  -0.0109 0.1238  37  ALA B C   
2781 O O   . ALA B 56  ? 0.5463 0.3779 0.4744 0.0363  -0.0091 0.1241  37  ALA B O   
2782 C CB  . ALA B 56  ? 0.4338 0.3918 0.4394 -0.0288 -0.0049 0.0891  37  ALA B CB  
2783 N N   . ALA B 57  ? 0.5337 0.3859 0.4812 0.0325  -0.0323 0.1323  38  ALA B N   
2784 C CA  . ALA B 57  ? 0.5672 0.4173 0.5019 0.0541  -0.0316 0.1386  38  ALA B CA  
2785 C C   . ALA B 57  ? 0.6296 0.4653 0.5363 0.0635  -0.0256 0.1171  38  ALA B C   
2786 O O   . ALA B 57  ? 0.6480 0.4660 0.5385 0.0944  -0.0379 0.1352  38  ALA B O   
2787 C CB  . ALA B 57  ? 0.5260 0.4108 0.4929 0.0525  -0.0219 0.1525  38  ALA B CB  
2788 N N   . VAL B 58  ? 0.6527 0.5063 0.5717 0.0421  -0.0176 0.0771  39  VAL B N   
2789 C CA  . VAL B 58  ? 0.6770 0.5543 0.5987 0.0230  -0.0120 0.0367  39  VAL B CA  
2790 C C   . VAL B 58  ? 0.6838 0.5740 0.6185 0.0087  -0.0143 0.0325  39  VAL B C   
2791 O O   . VAL B 58  ? 0.6957 0.5812 0.6229 0.0252  0.0053  0.0333  39  VAL B O   
2792 C CB  . VAL B 58  ? 0.6926 0.5839 0.6130 0.0174  -0.0243 0.0052  39  VAL B CB  
2793 C CG1 . VAL B 58  ? 0.6820 0.5846 0.6165 0.0412  -0.0281 0.0074  39  VAL B CG1 
2794 C CG2 . VAL B 58  ? 0.7040 0.6044 0.6258 -0.0071 -0.0302 -0.0052 39  VAL B CG2 
2795 N N   . VAL B 59  ? 0.6812 0.5885 0.6333 -0.0069 -0.0291 0.0346  40  VAL B N   
2796 C CA  . VAL B 59  ? 0.6744 0.6059 0.6502 -0.0021 -0.0290 0.0262  40  VAL B CA  
2797 C C   . VAL B 59  ? 0.6795 0.6050 0.6613 -0.0179 -0.0394 0.0324  40  VAL B C   
2798 O O   . VAL B 59  ? 0.6697 0.5794 0.6614 -0.0034 -0.0289 0.0523  40  VAL B O   
2799 C CB  . VAL B 59  ? 0.6685 0.6103 0.6522 0.0165  -0.0198 0.0193  40  VAL B CB  
2800 C CG1 . VAL B 59  ? 0.6735 0.6024 0.6520 0.0205  -0.0295 0.0227  40  VAL B CG1 
2801 C CG2 . VAL B 59  ? 0.6671 0.6193 0.6565 0.0156  -0.0040 0.0121  40  VAL B CG2 
2802 N N   . SER B 60  ? 0.6988 0.6271 0.6733 -0.0402 -0.0627 0.0236  41  SER B N   
2803 C CA  . SER B 60  ? 0.7133 0.6568 0.6917 -0.0491 -0.0639 0.0168  41  SER B CA  
2804 C C   . SER B 60  ? 0.7240 0.6653 0.7078 -0.0382 -0.0616 0.0065  41  SER B C   
2805 O O   . SER B 60  ? 0.7337 0.6719 0.7150 -0.0269 -0.0593 0.0122  41  SER B O   
2806 C CB  . SER B 60  ? 0.7126 0.6709 0.6947 -0.0747 -0.0472 0.0167  41  SER B CB  
2807 O OG  . SER B 60  ? 0.7159 0.6932 0.6995 -0.0853 -0.0405 0.0061  41  SER B OG  
2808 N N   . GLY B 61  ? 0.7204 0.6571 0.7133 -0.0260 -0.0553 -0.0040 42  GLY B N   
2809 C CA  . GLY B 61  ? 0.7233 0.6576 0.7153 -0.0201 -0.0420 -0.0041 42  GLY B CA  
2810 C C   . GLY B 61  ? 0.7316 0.6628 0.7210 -0.0118 -0.0366 -0.0018 42  GLY B C   
2811 O O   . GLY B 61  ? 0.7212 0.6535 0.7165 -0.0001 -0.0688 0.0033  42  GLY B O   
2812 N N   . SER B 62  ? 0.7338 0.6727 0.7287 -0.0150 -0.0089 0.0012  43  SER B N   
2813 C CA  . SER B 62  ? 0.7467 0.6782 0.7294 -0.0121 -0.0058 0.0118  43  SER B CA  
2814 C C   . SER B 62  ? 0.7553 0.6802 0.7072 -0.0129 -0.0087 0.0293  43  SER B C   
2815 O O   . SER B 62  ? 0.7559 0.6855 0.7027 -0.0180 -0.0189 0.0337  43  SER B O   
2816 C CB  . SER B 62  ? 0.7527 0.6861 0.7446 -0.0011 -0.0019 0.0150  43  SER B CB  
2817 O OG  . SER B 62  ? 0.7618 0.7008 0.7544 0.0049  0.0026  0.0189  43  SER B OG  
2818 N N   . THR B 63  ? 0.7440 0.6707 0.6827 -0.0108 -0.0059 0.0346  44  THR B N   
2819 C CA  . THR B 63  ? 0.7440 0.6749 0.6593 -0.0117 -0.0025 0.0379  44  THR B CA  
2820 C C   . THR B 63  ? 0.7158 0.6586 0.6286 -0.0097 0.0224  0.0597  44  THR B C   
2821 O O   . THR B 63  ? 0.7059 0.6477 0.6104 0.0082  0.0424  0.0673  44  THR B O   
2822 C CB  . THR B 63  ? 0.7665 0.6844 0.6632 -0.0080 -0.0239 0.0268  44  THR B CB  
2823 O OG1 . THR B 63  ? 0.7824 0.6863 0.6632 -0.0064 -0.0265 0.0325  44  THR B OG1 
2824 C CG2 . THR B 63  ? 0.7691 0.6878 0.6689 -0.0031 -0.0285 0.0234  44  THR B CG2 
2825 N N   . TYR B 64  ? 0.6838 0.6498 0.6207 -0.0202 0.0249  0.0703  45  TYR B N   
2826 C CA  . TYR B 64  ? 0.6527 0.6264 0.6166 -0.0263 0.0309  0.0724  45  TYR B CA  
2827 C C   . TYR B 64  ? 0.6568 0.6422 0.6485 -0.0144 0.0209  0.0551  45  TYR B C   
2828 O O   . TYR B 64  ? 0.6521 0.6420 0.6549 0.0083  0.0190  0.0610  45  TYR B O   
2829 C CB  . TYR B 64  ? 0.6356 0.5810 0.5781 -0.0400 0.0361  0.0836  45  TYR B CB  
2830 C CG  . TYR B 64  ? 0.6128 0.5379 0.5491 -0.0453 0.0382  0.0803  45  TYR B CG  
2831 C CD1 . TYR B 64  ? 0.5927 0.5110 0.5285 -0.0496 0.0460  0.0759  45  TYR B CD1 
2832 C CD2 . TYR B 64  ? 0.5952 0.5255 0.5340 -0.0390 0.0374  0.0702  45  TYR B CD2 
2833 C CE1 . TYR B 64  ? 0.5877 0.5029 0.5226 -0.0583 0.0490  0.0533  45  TYR B CE1 
2834 C CE2 . TYR B 64  ? 0.5791 0.5103 0.5215 -0.0428 0.0463  0.0556  45  TYR B CE2 
2835 C CZ  . TYR B 64  ? 0.5838 0.4825 0.5058 -0.0351 0.0406  0.0435  45  TYR B CZ  
2836 O OH  . TYR B 64  ? 0.5844 0.4272 0.4528 -0.0207 0.0121  0.0558  45  TYR B OH  
2837 N N   . THR B 65  ? 0.6701 0.6599 0.6735 -0.0188 0.0082  0.0379  46  THR B N   
2838 C CA  . THR B 65  ? 0.6979 0.6710 0.6946 -0.0172 0.0017  0.0208  46  THR B CA  
2839 C C   . THR B 65  ? 0.7135 0.6825 0.7117 -0.0290 -0.0036 0.0338  46  THR B C   
2840 O O   . THR B 65  ? 0.7272 0.6890 0.7319 -0.0457 -0.0230 0.0455  46  THR B O   
2841 C CB  . THR B 65  ? 0.7158 0.6703 0.6941 -0.0097 0.0003  0.0091  46  THR B CB  
2842 O OG1 . THR B 65  ? 0.7396 0.6659 0.6929 -0.0117 0.0101  0.0096  46  THR B OG1 
2843 C CG2 . THR B 65  ? 0.7122 0.6734 0.6978 -0.0008 -0.0023 0.0000  46  THR B CG2 
2844 N N   . GLY B 66  ? 0.7195 0.6790 0.7093 -0.0084 0.0291  0.0393  47  GLY B N   
2845 C CA  . GLY B 66  ? 0.7271 0.6842 0.7128 0.0071  0.0505  0.0426  47  GLY B CA  
2846 C C   . GLY B 66  ? 0.7226 0.6974 0.7154 0.0119  0.0635  0.0420  47  GLY B C   
2847 O O   . GLY B 66  ? 0.7315 0.7167 0.7358 0.0008  0.0682  0.0402  47  GLY B O   
2848 N N   . TRP B 67  ? 0.7138 0.6791 0.6840 0.0200  0.0593  0.0459  48  TRP B N   
2849 C CA  . TRP B 67  ? 0.7074 0.6462 0.6530 0.0046  0.0481  0.0416  48  TRP B CA  
2850 C C   . TRP B 67  ? 0.6989 0.5706 0.6089 -0.0043 0.0566  0.0617  48  TRP B C   
2851 O O   . TRP B 67  ? 0.7168 0.5857 0.6145 0.0270  0.0702  0.0446  48  TRP B O   
2852 C CB  . TRP B 67  ? 0.7026 0.6858 0.6682 -0.0031 0.0369  0.0174  48  TRP B CB  
2853 C CG  . TRP B 67  ? 0.6798 0.7234 0.6918 -0.0144 0.0345  -0.0013 48  TRP B CG  
2854 C CD1 . TRP B 67  ? 0.6858 0.7459 0.7038 -0.0269 0.0301  -0.0074 48  TRP B CD1 
2855 C CD2 . TRP B 67  ? 0.6721 0.7312 0.7045 -0.0109 0.0422  -0.0031 48  TRP B CD2 
2856 N NE1 . TRP B 67  ? 0.6956 0.7545 0.7107 -0.0227 0.0287  -0.0091 48  TRP B NE1 
2857 C CE2 . TRP B 67  ? 0.6747 0.7416 0.7050 -0.0136 0.0272  -0.0083 48  TRP B CE2 
2858 C CE3 . TRP B 67  ? 0.6633 0.7195 0.7055 -0.0098 0.0468  0.0002  48  TRP B CE3 
2859 C CZ2 . TRP B 67  ? 0.6497 0.7234 0.6944 -0.0088 0.0120  -0.0082 48  TRP B CZ2 
2860 C CZ3 . TRP B 67  ? 0.6490 0.7091 0.6995 -0.0067 0.0336  0.0032  48  TRP B CZ3 
2861 C CH2 . TRP B 67  ? 0.6346 0.7048 0.6888 -0.0078 0.0126  -0.0017 48  TRP B CH2 
2862 N N   . ASP B 68  ? 0.6552 0.4809 0.5645 -0.0466 0.0512  0.0810  49  ASP B N   
2863 C CA  . ASP B 68  ? 0.5731 0.4032 0.5319 -0.0701 0.0316  0.0705  49  ASP B CA  
2864 C C   . ASP B 68  ? 0.4693 0.3141 0.4535 -0.0778 0.0184  0.0629  49  ASP B C   
2865 O O   . ASP B 68  ? 0.4447 0.2823 0.4351 -0.1348 0.0152  0.0395  49  ASP B O   
2866 C CB  . ASP B 68  ? 0.5887 0.4156 0.5635 -0.0662 0.0139  0.0713  49  ASP B CB  
2867 C CG  . ASP B 68  ? 0.5886 0.4287 0.6036 -0.0764 -0.0026 0.0617  49  ASP B CG  
2868 O OD1 . ASP B 68  ? 0.5952 0.4626 0.6224 -0.1231 0.0061  0.0699  49  ASP B OD1 
2869 O OD2 . ASP B 68  ? 0.5905 0.4056 0.6107 -0.0543 -0.0077 0.0553  49  ASP B OD2 
2870 N N   . ILE B 69  ? 0.3730 0.2753 0.4009 -0.0537 0.0265  0.0604  50  ILE B N   
2871 C CA  . ILE B 69  ? 0.3364 0.2327 0.3465 -0.0518 0.0154  0.0397  50  ILE B CA  
2872 C C   . ILE B 69  ? 0.2966 0.2150 0.3335 -0.0112 -0.0234 -0.0075 50  ILE B C   
2873 O O   . ILE B 69  ? 0.2983 0.2068 0.3008 0.0269  -0.0566 -0.0038 50  ILE B O   
2874 C CB  . ILE B 69  ? 0.3350 0.2588 0.3172 -0.0547 -0.0143 0.0391  50  ILE B CB  
2875 C CG1 . ILE B 69  ? 0.3895 0.3035 0.3213 -0.0351 -0.0017 0.0096  50  ILE B CG1 
2876 C CG2 . ILE B 69  ? 0.3435 0.2320 0.3167 -0.0772 -0.0184 0.0565  50  ILE B CG2 
2877 C CD1 . ILE B 69  ? 0.4105 0.3111 0.3134 -0.0084 0.0196  -0.0141 50  ILE B CD1 
2878 N N   . THR B 70  ? 0.3121 0.2575 0.3846 -0.0062 0.0141  -0.0515 51  THR B N   
2879 C CA  A THR B 70  ? 0.3467 0.2871 0.3973 -0.0076 0.0229  -0.0782 51  THR B CA  
2880 C CA  B THR B 70  ? 0.3451 0.2839 0.3956 -0.0068 0.0300  -0.0740 51  THR B CA  
2881 C C   . THR B 70  ? 0.3383 0.2564 0.3739 -0.0273 0.0336  -0.0716 51  THR B C   
2882 O O   . THR B 70  ? 0.3080 0.2459 0.3129 0.0002  0.0086  -0.0473 51  THR B O   
2883 C CB  A THR B 70  ? 0.4223 0.3601 0.4189 -0.0085 0.0207  -0.1041 51  THR B CB  
2884 C CB  B THR B 70  ? 0.4089 0.3655 0.4269 -0.0083 0.0432  -0.0900 51  THR B CB  
2885 O OG1 A THR B 70  ? 0.4599 0.4441 0.4441 -0.0056 0.0077  -0.1216 51  THR B OG1 
2886 O OG1 B THR B 70  ? 0.4441 0.4441 0.4441 0.0072  0.0496  -0.0936 51  THR B OG1 
2887 C CG2 A THR B 70  ? 0.4134 0.3800 0.4591 0.0012  0.0226  -0.1083 51  THR B CG2 
2888 C CG2 B THR B 70  ? 0.4036 0.3923 0.4766 -0.0063 0.0427  -0.0984 51  THR B CG2 
2889 N N   . GLU B 71  ? 0.3293 0.2245 0.3724 -0.0598 0.0449  -0.0616 52  GLU B N   
2890 C CA  . GLU B 71  ? 0.3223 0.2113 0.3685 -0.0501 0.0614  -0.0528 52  GLU B CA  
2891 C C   . GLU B 71  ? 0.2925 0.1923 0.3288 -0.0430 0.0236  -0.0457 52  GLU B C   
2892 O O   . GLU B 71  ? 0.3013 0.1803 0.3095 -0.0548 0.0080  -0.0382 52  GLU B O   
2893 C CB  . GLU B 71  ? 0.3624 0.2293 0.4083 -0.0571 0.0744  -0.0515 52  GLU B CB  
2894 C CG  . GLU B 71  ? 0.4315 0.2892 0.4549 -0.0801 0.0460  -0.0620 52  GLU B CG  
2895 C CD  . GLU B 71  ? 0.4824 0.3780 0.4943 -0.0594 0.0620  -0.0698 52  GLU B CD  
2896 O OE1 . GLU B 71  ? 0.4807 0.4151 0.5030 -0.0630 0.0761  -0.0639 52  GLU B OE1 
2897 O OE2 . GLU B 71  ? 0.5155 0.4176 0.5183 -0.0378 0.0574  -0.0798 52  GLU B OE2 
2898 N N   . LEU B 72  ? 0.2282 0.1748 0.2842 -0.0552 0.0332  -0.0342 53  LEU B N   
2899 C CA  . LEU B 72  ? 0.2473 0.1827 0.2663 -0.0448 0.0029  -0.0048 53  LEU B CA  
2900 C C   . LEU B 72  ? 0.2569 0.1963 0.2621 -0.0160 0.0034  0.0044  53  LEU B C   
2901 O O   . LEU B 72  ? 0.2398 0.1996 0.2601 -0.0249 -0.0216 0.0126  53  LEU B O   
2902 C CB  . LEU B 72  ? 0.3050 0.1813 0.2377 -0.0635 -0.0128 -0.0219 53  LEU B CB  
2903 C CG  . LEU B 72  ? 0.3414 0.2084 0.2626 -0.0893 -0.0058 -0.0272 53  LEU B CG  
2904 C CD1 . LEU B 72  ? 0.3585 0.2107 0.2662 -0.0490 0.0386  -0.0263 53  LEU B CD1 
2905 C CD2 . LEU B 72  ? 0.3534 0.2056 0.2691 -0.1119 -0.0295 -0.0102 53  LEU B CD2 
2906 N N   . ALA B 73  ? 0.2357 0.1889 0.2473 -0.0177 0.0085  0.0069  54  ALA B N   
2907 C CA  . ALA B 73  ? 0.2207 0.1759 0.2364 -0.0225 0.0037  0.0103  54  ALA B CA  
2908 C C   . ALA B 73  ? 0.2393 0.1591 0.2521 -0.0297 0.0007  -0.0388 54  ALA B C   
2909 O O   . ALA B 73  ? 0.2584 0.1495 0.2628 -0.0244 -0.0071 -0.0309 54  ALA B O   
2910 C CB  . ALA B 73  ? 0.2342 0.1950 0.2303 -0.0159 0.0349  0.0097  54  ALA B CB  
2911 N N   . SER B 74  ? 0.2174 0.1710 0.2681 -0.0595 0.0074  -0.0649 55  SER B N   
2912 C CA  . SER B 74  ? 0.2529 0.1627 0.2914 -0.0627 0.0063  -0.0585 55  SER B CA  
2913 C C   . SER B 74  ? 0.2790 0.1790 0.2821 -0.0517 -0.0169 -0.0362 55  SER B C   
2914 O O   . SER B 74  ? 0.3317 0.2040 0.2799 -0.0432 -0.0255 -0.0207 55  SER B O   
2915 C CB  . SER B 74  ? 0.2949 0.1644 0.3393 0.0016  0.0636  -0.0396 55  SER B CB  
2916 O OG  . SER B 74  ? 0.3939 0.2314 0.3719 0.0011  0.0721  -0.0170 55  SER B OG  
2917 N N   . LEU B 75  ? 0.2661 0.1784 0.2766 -0.0758 -0.0223 -0.0308 56  LEU B N   
2918 C CA  . LEU B 75  ? 0.2363 0.1956 0.2680 -0.0838 -0.0105 -0.0256 56  LEU B CA  
2919 C C   . LEU B 75  ? 0.2295 0.2137 0.2511 -0.0625 0.0058  -0.0401 56  LEU B C   
2920 O O   . LEU B 75  ? 0.2058 0.2379 0.2585 -0.0416 -0.0043 -0.0572 56  LEU B O   
2921 C CB  . LEU B 75  ? 0.2770 0.1971 0.2727 -0.0964 -0.0140 -0.0391 56  LEU B CB  
2922 C CG  . LEU B 75  ? 0.2879 0.2274 0.2960 -0.1313 -0.0606 -0.0013 56  LEU B CG  
2923 C CD1 . LEU B 75  ? 0.3193 0.2106 0.2928 -0.0783 -0.0562 0.0322  56  LEU B CD1 
2924 C CD2 . LEU B 75  ? 0.2916 0.2622 0.3195 -0.1605 -0.0445 0.0026  56  LEU B CD2 
2925 N N   . VAL B 76  ? 0.2140 0.2041 0.2236 -0.0775 0.0252  -0.0534 57  VAL B N   
2926 C CA  . VAL B 76  ? 0.2021 0.2025 0.2001 -0.0828 0.0207  -0.0434 57  VAL B CA  
2927 C C   . VAL B 76  ? 0.2138 0.2047 0.2048 -0.0478 0.0173  -0.0395 57  VAL B C   
2928 O O   . VAL B 76  ? 0.1615 0.2053 0.2171 -0.0260 0.0035  -0.0433 57  VAL B O   
2929 C CB  . VAL B 76  ? 0.1339 0.2200 0.1893 -0.0509 0.0127  -0.0399 57  VAL B CB  
2930 C CG1 . VAL B 76  ? 0.2121 0.2445 0.1954 -0.0283 -0.0044 -0.0308 57  VAL B CG1 
2931 C CG2 . VAL B 76  ? 0.1517 0.2170 0.1902 -0.0420 0.0035  -0.0633 57  VAL B CG2 
2932 N N   . TYR B 77  ? 0.2147 0.1981 0.2085 -0.0485 -0.0238 -0.0544 58  TYR B N   
2933 C CA  . TYR B 77  ? 0.1861 0.2136 0.2244 -0.0260 -0.0265 -0.0575 58  TYR B CA  
2934 C C   . TYR B 77  ? 0.2147 0.2127 0.2413 -0.0238 -0.0335 -0.0526 58  TYR B C   
2935 O O   . TYR B 77  ? 0.2445 0.2073 0.2306 0.0021  -0.0643 -0.0578 58  TYR B O   
2936 C CB  . TYR B 77  ? 0.1878 0.2009 0.2167 -0.0364 -0.0096 -0.0502 58  TYR B CB  
2937 C CG  . TYR B 77  ? 0.1980 0.1645 0.1826 -0.0402 -0.0158 -0.0198 58  TYR B CG  
2938 C CD1 . TYR B 77  ? 0.2113 0.1546 0.1984 -0.0085 0.0038  -0.0218 58  TYR B CD1 
2939 C CD2 . TYR B 77  ? 0.2318 0.1759 0.2053 -0.0064 0.0006  -0.0309 58  TYR B CD2 
2940 C CE1 . TYR B 77  ? 0.2095 0.1345 0.1901 -0.0290 -0.0004 -0.0260 58  TYR B CE1 
2941 C CE2 . TYR B 77  ? 0.2137 0.1370 0.1856 -0.0153 -0.0190 -0.0435 58  TYR B CE2 
2942 C CZ  . TYR B 77  ? 0.1912 0.1392 0.1740 -0.0287 -0.0168 -0.0375 58  TYR B CZ  
2943 O OH  . TYR B 77  ? 0.2309 0.1626 0.1910 -0.0237 -0.0134 -0.0385 58  TYR B OH  
2944 N N   . PRO B 78  ? 0.2176 0.2110 0.2758 -0.0065 -0.0710 -0.0498 59  PRO B N   
2945 C CA  . PRO B 78  ? 0.2288 0.2289 0.2909 -0.0159 -0.0838 -0.0664 59  PRO B CA  
2946 C C   . PRO B 78  ? 0.2444 0.2022 0.2773 -0.0227 -0.1095 -0.0596 59  PRO B C   
2947 O O   . PRO B 78  ? 0.2244 0.2277 0.2910 -0.0146 -0.0945 -0.0568 59  PRO B O   
2948 C CB  . PRO B 78  ? 0.2477 0.2340 0.2969 -0.0356 -0.0623 -0.0733 59  PRO B CB  
2949 C CG  . PRO B 78  ? 0.2381 0.2167 0.2928 -0.0449 -0.0871 -0.0825 59  PRO B CG  
2950 C CD  . PRO B 78  ? 0.2132 0.2182 0.2960 -0.0345 -0.0821 -0.0547 59  PRO B CD  
2951 N N   . GLU B 79  ? 0.3064 0.2251 0.2842 0.0090  -0.0681 -0.0414 60  GLU B N   
2952 C CA  . GLU B 79  ? 0.3423 0.2252 0.2840 0.0084  -0.0686 -0.0133 60  GLU B CA  
2953 C C   . GLU B 79  ? 0.3342 0.2079 0.2422 -0.0016 -0.0554 -0.0021 60  GLU B C   
2954 O O   . GLU B 79  ? 0.3843 0.2254 0.2550 -0.0355 -0.0653 0.0047  60  GLU B O   
2955 C CB  . GLU B 79  ? 0.3959 0.3165 0.3459 0.0287  -0.0684 -0.0144 60  GLU B CB  
2956 C CG  . GLU B 79  ? 0.4579 0.4306 0.4152 0.0180  -0.0809 -0.0201 60  GLU B CG  
2957 C CD  . GLU B 79  ? 0.5377 0.5267 0.4907 0.0112  -0.0333 -0.0272 60  GLU B CD  
2958 O OE1 . GLU B 79  ? 0.5602 0.5560 0.5258 0.0200  -0.0291 -0.0115 60  GLU B OE1 
2959 O OE2 . GLU B 79  ? 0.5954 0.5617 0.5412 -0.0013 -0.0141 -0.0360 60  GLU B OE2 
2960 N N   . SER B 80  ? 0.2773 0.2015 0.2256 0.0080  -0.0621 -0.0140 61  SER B N   
2961 C CA  . SER B 80  ? 0.2581 0.1858 0.1917 0.0160  -0.0540 -0.0271 61  SER B CA  
2962 C C   . SER B 80  ? 0.2905 0.1995 0.1989 0.0123  -0.0502 -0.0317 61  SER B C   
2963 O O   . SER B 80  ? 0.3163 0.1899 0.2341 0.0150  -0.0541 -0.0477 61  SER B O   
2964 C CB  . SER B 80  ? 0.2771 0.1734 0.2221 0.0082  -0.0300 0.0097  61  SER B CB  
2965 O OG  . SER B 80  ? 0.3200 0.1956 0.2686 0.0101  -0.0124 -0.0143 61  SER B OG  
2966 N N   . SER B 81  ? 0.2970 0.2136 0.1640 0.0011  -0.0315 -0.0465 62  SER B N   
2967 C CA  . SER B 81  ? 0.2903 0.1833 0.1637 -0.0092 -0.0467 -0.0484 62  SER B CA  
2968 C C   . SER B 81  ? 0.3014 0.1762 0.1807 -0.0173 -0.0485 -0.0446 62  SER B C   
2969 O O   . SER B 81  ? 0.3273 0.1930 0.1852 -0.0314 -0.0255 -0.0574 62  SER B O   
2970 C CB  . SER B 81  ? 0.3286 0.2353 0.1436 -0.0164 -0.0534 -0.0336 62  SER B CB  
2971 O OG  . SER B 81  ? 0.3258 0.2340 0.1638 0.0272  -0.0341 -0.0741 62  SER B OG  
2972 N N   . ALA B 82  ? 0.3365 0.1957 0.2247 -0.0047 -0.0750 -0.0532 63  ALA B N   
2973 C CA  . ALA B 82  ? 0.3142 0.1464 0.2432 0.0102  -0.0607 -0.0662 63  ALA B CA  
2974 C C   . ALA B 82  ? 0.2833 0.1616 0.2318 0.0065  -0.0546 -0.0242 63  ALA B C   
2975 O O   . ALA B 82  ? 0.3052 0.1536 0.2163 -0.0008 -0.0554 -0.0109 63  ALA B O   
2976 C CB  . ALA B 82  ? 0.2897 0.1686 0.2561 0.0184  0.0123  -0.1113 63  ALA B CB  
2977 N N   . GLU B 83  ? 0.3002 0.1619 0.2408 0.0227  -0.0342 -0.0335 64  GLU B N   
2978 C CA  . GLU B 83  ? 0.3247 0.1838 0.2433 -0.0054 0.0207  -0.0498 64  GLU B CA  
2979 C C   . GLU B 83  ? 0.2823 0.1785 0.2088 0.0079  -0.0181 -0.0336 64  GLU B C   
2980 O O   . GLU B 83  ? 0.2790 0.1657 0.2012 -0.0056 -0.0119 -0.0171 64  GLU B O   
2981 C CB  . GLU B 83  ? 0.3727 0.2693 0.2820 -0.0436 0.0665  -0.0772 64  GLU B CB  
2982 C CG  . GLU B 83  ? 0.4981 0.3446 0.3301 -0.0503 0.0694  -0.0676 64  GLU B CG  
2983 C CD  . GLU B 83  ? 0.5584 0.4003 0.3553 -0.0800 0.0618  -0.0678 64  GLU B CD  
2984 O OE1 . GLU B 83  ? 0.6015 0.4274 0.3596 -0.1025 0.0664  -0.0821 64  GLU B OE1 
2985 O OE2 . GLU B 83  ? 0.5491 0.4279 0.3773 -0.0687 0.0634  -0.0601 64  GLU B OE2 
2986 N N   . ASP B 84  ? 0.2641 0.1516 0.2189 0.0192  -0.0041 -0.0249 65  ASP B N   
2987 C CA  . ASP B 84  ? 0.2538 0.1474 0.1936 0.0206  -0.0127 0.0145  65  ASP B CA  
2988 C C   . ASP B 84  ? 0.2303 0.1568 0.2142 -0.0357 -0.0021 -0.0005 65  ASP B C   
2989 O O   . ASP B 84  ? 0.2243 0.1352 0.2016 -0.0553 -0.0157 -0.0255 65  ASP B O   
2990 C CB  . ASP B 84  ? 0.2892 0.1281 0.1804 0.0142  -0.0107 -0.0005 65  ASP B CB  
2991 C CG  . ASP B 84  ? 0.3189 0.1825 0.2045 0.0092  -0.0485 0.0169  65  ASP B CG  
2992 O OD1 . ASP B 84  ? 0.3300 0.1703 0.2305 -0.0019 -0.0448 0.0027  65  ASP B OD1 
2993 O OD2 . ASP B 84  ? 0.3705 0.2463 0.2185 -0.0136 -0.0408 0.0447  65  ASP B OD2 
2994 N N   . LEU B 85  ? 0.2195 0.1179 0.2184 -0.0240 0.0261  0.0235  66  LEU B N   
2995 C CA  . LEU B 85  ? 0.1920 0.1555 0.2269 -0.0397 -0.0182 0.0191  66  LEU B CA  
2996 C C   . LEU B 85  ? 0.2334 0.1564 0.2171 -0.0099 -0.0177 0.0157  66  LEU B C   
2997 O O   . LEU B 85  ? 0.2461 0.1556 0.1916 -0.0350 -0.0490 0.0098  66  LEU B O   
2998 C CB  . LEU B 85  ? 0.1772 0.1805 0.2503 -0.0970 0.0051  0.0098  66  LEU B CB  
2999 C CG  . LEU B 85  ? 0.1714 0.1554 0.2498 -0.0596 0.0155  0.0084  66  LEU B CG  
3000 C CD1 . LEU B 85  ? 0.2417 0.1723 0.2528 -0.0180 -0.0127 -0.0217 66  LEU B CD1 
3001 C CD2 . LEU B 85  ? 0.1765 0.1517 0.2489 -0.0663 -0.0348 0.0328  66  LEU B CD2 
3002 N N   . ALA B 86  ? 0.1859 0.1381 0.2040 -0.0128 -0.0185 -0.0065 67  ALA B N   
3003 C CA  . ALA B 86  ? 0.1957 0.1478 0.1929 0.0078  -0.0171 -0.0493 67  ALA B CA  
3004 C C   . ALA B 86  ? 0.2357 0.1003 0.1633 0.0034  -0.0045 -0.0099 67  ALA B C   
3005 O O   . ALA B 86  ? 0.2270 0.1627 0.1732 0.0107  0.0108  -0.0019 67  ALA B O   
3006 C CB  . ALA B 86  ? 0.2433 0.1718 0.2180 0.0469  -0.0413 -0.0623 67  ALA B CB  
3007 N N   . LEU B 87  ? 0.2040 0.0712 0.2106 -0.0113 0.0169  0.0035  68  LEU B N   
3008 C CA  . LEU B 87  ? 0.2106 0.1179 0.1829 -0.0438 0.0160  0.0044  68  LEU B CA  
3009 C C   . LEU B 87  ? 0.2245 0.1159 0.1832 -0.0249 0.0173  -0.0161 68  LEU B C   
3010 O O   . LEU B 87  ? 0.2225 0.1331 0.1530 -0.0384 -0.0050 -0.0182 68  LEU B O   
3011 C CB  . LEU B 87  ? 0.2426 0.1089 0.1990 -0.0692 -0.0300 0.0264  68  LEU B CB  
3012 C CG  . LEU B 87  ? 0.2245 0.1061 0.1591 -0.0517 -0.0573 0.0225  68  LEU B CG  
3013 C CD1 . LEU B 87  ? 0.2111 0.1399 0.1618 -0.0316 -0.0276 0.0013  68  LEU B CD1 
3014 C CD2 . LEU B 87  ? 0.2746 0.1424 0.1781 -0.0297 0.0087  0.0156  68  LEU B CD2 
3015 N N   . ALA B 88  ? 0.2164 0.1300 0.1866 -0.0428 0.0267  0.0069  69  ALA B N   
3016 C CA  . ALA B 88  ? 0.2009 0.1569 0.1885 -0.0264 -0.0020 0.0127  69  ALA B CA  
3017 C C   . ALA B 88  ? 0.2129 0.1265 0.1838 -0.0093 -0.0019 0.0088  69  ALA B C   
3018 O O   . ALA B 88  ? 0.2148 0.1793 0.1749 -0.0216 -0.0316 -0.0130 69  ALA B O   
3019 C CB  . ALA B 88  ? 0.1868 0.1719 0.1977 -0.0133 -0.0637 0.0022  69  ALA B CB  
3020 N N   . ALA B 89  ? 0.2009 0.1303 0.1958 0.0066  0.0149  0.0149  70  ALA B N   
3021 C CA  . ALA B 89  ? 0.2295 0.1154 0.2024 -0.0218 -0.0271 0.0016  70  ALA B CA  
3022 C C   . ALA B 89  ? 0.2561 0.1095 0.1700 -0.0375 -0.0056 0.0008  70  ALA B C   
3023 O O   . ALA B 89  ? 0.2882 0.1504 0.1543 -0.0407 -0.0336 0.0064  70  ALA B O   
3024 C CB  . ALA B 89  ? 0.2619 0.1134 0.1835 -0.0340 -0.0205 0.0002  70  ALA B CB  
3025 N N   . ASP B 90  ? 0.2116 0.1142 0.1890 -0.0081 0.0083  -0.0032 71  ASP B N   
3026 C CA  . ASP B 90  ? 0.2073 0.1154 0.1611 0.0078  0.0264  -0.0169 71  ASP B CA  
3027 C C   . ASP B 90  ? 0.2046 0.1320 0.1809 0.0224  0.0042  -0.0136 71  ASP B C   
3028 O O   . ASP B 90  ? 0.2399 0.1357 0.1895 0.0114  -0.0371 0.0085  71  ASP B O   
3029 C CB  . ASP B 90  ? 0.2369 0.1064 0.1473 0.0222  0.0530  -0.0060 71  ASP B CB  
3030 C CG  . ASP B 90  ? 0.2853 0.1083 0.1758 -0.0178 0.0112  0.0198  71  ASP B CG  
3031 O OD1 . ASP B 90  ? 0.2762 0.1073 0.2104 -0.0085 -0.0048 0.0030  71  ASP B OD1 
3032 O OD2 . ASP B 90  ? 0.2649 0.1193 0.1722 0.0015  -0.0075 0.0264  71  ASP B OD2 
3033 N N   . LEU B 91  ? 0.2120 0.1125 0.1980 0.0150  0.0149  -0.0362 72  LEU B N   
3034 C CA  . LEU B 91  ? 0.2294 0.1029 0.1775 0.0148  -0.0064 0.0007  72  LEU B CA  
3035 C C   . LEU B 91  ? 0.2629 0.1441 0.1669 -0.0030 0.0036  -0.0151 72  LEU B C   
3036 O O   . LEU B 91  ? 0.2928 0.1479 0.1302 -0.0176 -0.0065 -0.0044 72  LEU B O   
3037 C CB  . LEU B 91  ? 0.2362 0.1128 0.1658 0.0123  -0.0085 0.0058  72  LEU B CB  
3038 C CG  . LEU B 91  ? 0.2196 0.1309 0.2012 0.0030  -0.0024 0.0014  72  LEU B CG  
3039 C CD1 . LEU B 91  ? 0.2770 0.1586 0.2176 -0.0296 0.0466  -0.0242 72  LEU B CD1 
3040 C CD2 . LEU B 91  ? 0.2339 0.1392 0.1793 -0.0089 0.0133  0.0252  72  LEU B CD2 
3041 N N   . MET B 92  ? 0.2518 0.1624 0.1949 -0.0452 0.0069  -0.0231 73  MET B N   
3042 C CA  . MET B 92  ? 0.2787 0.2086 0.2133 0.0053  0.0168  -0.0052 73  MET B CA  
3043 C C   . MET B 92  ? 0.2907 0.1877 0.1972 -0.0164 0.0286  0.0069  73  MET B C   
3044 O O   . MET B 92  ? 0.3111 0.1992 0.2016 -0.0452 0.0492  -0.0221 73  MET B O   
3045 C CB  . MET B 92  ? 0.2562 0.2484 0.2541 0.0352  0.0178  -0.0151 73  MET B CB  
3046 C CG  . MET B 92  ? 0.3212 0.2861 0.3021 0.0679  0.0065  -0.0620 73  MET B CG  
3047 S SD  . MET B 92  ? 0.3656 0.3313 0.3574 0.0583  -0.0559 -0.0675 73  MET B SD  
3048 C CE  . MET B 92  ? 0.3841 0.3660 0.3768 0.0631  -0.0630 -0.0599 73  MET B CE  
3049 N N   . GLY B 93  ? 0.3032 0.1439 0.1869 0.0080  -0.0007 0.0396  74  GLY B N   
3050 C CA  . GLY B 93  ? 0.3003 0.1529 0.1774 -0.0111 -0.0027 0.0323  74  GLY B CA  
3051 C C   . GLY B 93  ? 0.3104 0.1569 0.1860 -0.0272 -0.0136 0.0263  74  GLY B C   
3052 O O   . GLY B 93  ? 0.3907 0.1714 0.1771 -0.0182 0.0035  0.0249  74  GLY B O   
3053 N N   . PHE B 94  ? 0.2765 0.1664 0.2024 -0.0425 -0.0177 0.0111  75  PHE B N   
3054 C CA  . PHE B 94  ? 0.2671 0.1821 0.1686 -0.0408 -0.0028 0.0013  75  PHE B CA  
3055 C C   . PHE B 94  ? 0.3033 0.1742 0.1923 -0.0384 -0.0033 0.0102  75  PHE B C   
3056 O O   . PHE B 94  ? 0.3087 0.2034 0.1714 -0.0560 -0.0331 0.0289  75  PHE B O   
3057 C CB  . PHE B 94  ? 0.2637 0.1716 0.1940 -0.0424 0.0031  0.0282  75  PHE B CB  
3058 C CG  . PHE B 94  ? 0.2356 0.1806 0.2028 -0.0538 -0.0151 0.0331  75  PHE B CG  
3059 C CD1 . PHE B 94  ? 0.2578 0.1891 0.1871 -0.0126 -0.0394 0.0400  75  PHE B CD1 
3060 C CD2 . PHE B 94  ? 0.2441 0.1844 0.2001 -0.0184 -0.0241 0.0334  75  PHE B CD2 
3061 C CE1 . PHE B 94  ? 0.2597 0.1947 0.1889 0.0217  -0.0320 0.0164  75  PHE B CE1 
3062 C CE2 . PHE B 94  ? 0.2677 0.2031 0.2029 0.0020  -0.0350 0.0394  75  PHE B CE2 
3063 C CZ  . PHE B 94  ? 0.2725 0.1845 0.1725 0.0018  -0.0574 0.0427  75  PHE B CZ  
3064 N N   . TYR B 95  ? 0.2865 0.1539 0.1786 -0.0214 0.0270  -0.0094 76  TYR B N   
3065 C CA  . TYR B 95  ? 0.3511 0.1693 0.1640 -0.0298 -0.0368 0.0224  76  TYR B CA  
3066 C C   . TYR B 95  ? 0.4069 0.1636 0.1832 -0.0575 -0.0239 0.0432  76  TYR B C   
3067 O O   . TYR B 95  ? 0.4420 0.1816 0.1539 -0.0622 -0.0523 0.0275  76  TYR B O   
3068 C CB  . TYR B 95  ? 0.3032 0.1667 0.1759 -0.0113 -0.0253 0.0410  76  TYR B CB  
3069 C CG  . TYR B 95  ? 0.2826 0.1650 0.1540 -0.0048 -0.0291 0.0152  76  TYR B CG  
3070 C CD1 . TYR B 95  ? 0.2808 0.1950 0.1548 -0.0050 -0.0126 0.0165  76  TYR B CD1 
3071 C CD2 . TYR B 95  ? 0.2808 0.1970 0.1715 -0.0009 0.0142  0.0177  76  TYR B CD2 
3072 C CE1 . TYR B 95  ? 0.2373 0.2049 0.1260 0.0120  0.0137  0.0025  76  TYR B CE1 
3073 C CE2 . TYR B 95  ? 0.2457 0.1735 0.1716 0.0141  0.0359  -0.0252 76  TYR B CE2 
3074 C CZ  . TYR B 95  ? 0.2391 0.1919 0.1614 0.0109  0.0066  -0.0075 76  TYR B CZ  
3075 O OH  . TYR B 95  ? 0.2376 0.1819 0.1460 -0.0231 0.0081  0.0024  76  TYR B OH  
3076 N N   . PHE B 96  ? 0.3951 0.1351 0.2058 -0.0323 0.0192  0.0501  77  PHE B N   
3077 C CA  . PHE B 96  ? 0.4241 0.2025 0.2326 -0.0354 0.0145  0.0571  77  PHE B CA  
3078 C C   . PHE B 96  ? 0.4197 0.1951 0.2192 -0.0248 -0.0258 0.0444  77  PHE B C   
3079 O O   . PHE B 96  ? 0.4623 0.2140 0.2079 -0.0139 -0.0191 0.0212  77  PHE B O   
3080 C CB  . PHE B 96  ? 0.4443 0.2768 0.2846 -0.0423 0.0328  0.0910  77  PHE B CB  
3081 C CG  . PHE B 96  ? 0.4807 0.3975 0.3826 -0.0231 0.0683  0.0817  77  PHE B CG  
3082 C CD1 . PHE B 96  ? 0.5262 0.4430 0.4125 -0.0153 0.0689  0.0638  77  PHE B CD1 
3083 C CD2 . PHE B 96  ? 0.5340 0.4883 0.4521 -0.0059 0.0584  0.0779  77  PHE B CD2 
3084 C CE1 . PHE B 96  ? 0.5048 0.4762 0.4499 0.0061  0.0745  0.0634  77  PHE B CE1 
3085 C CE2 . PHE B 96  ? 0.5329 0.5212 0.4600 0.0319  0.0670  0.0780  77  PHE B CE2 
3086 C CZ  . PHE B 96  ? 0.5253 0.5117 0.4789 0.0262  0.0654  0.0718  77  PHE B CZ  
3087 N N   . LEU B 97  ? 0.3684 0.1846 0.2214 -0.0029 -0.0710 0.0205  78  LEU B N   
3088 C CA  . LEU B 97  ? 0.3705 0.2141 0.2217 0.0000  -0.0667 0.0000  78  LEU B CA  
3089 C C   . LEU B 97  ? 0.3624 0.2052 0.2232 0.0146  -0.0894 0.0480  78  LEU B C   
3090 O O   . LEU B 97  ? 0.4177 0.2093 0.2237 -0.0175 -0.1059 0.0758  78  LEU B O   
3091 C CB  . LEU B 97  ? 0.3854 0.2203 0.2182 -0.0021 -0.0260 0.0071  78  LEU B CB  
3092 C CG  . LEU B 97  ? 0.3952 0.2317 0.1989 0.0006  -0.0047 0.0321  78  LEU B CG  
3093 C CD1 . LEU B 97  ? 0.3731 0.2608 0.2218 0.0194  -0.0117 -0.0052 78  LEU B CD1 
3094 C CD2 . LEU B 97  ? 0.4166 0.2312 0.2157 -0.0026 0.0121  0.0320  78  LEU B CD2 
3095 N N   . PHE B 98  ? 0.3629 0.2111 0.2410 -0.0502 -0.0724 0.0249  79  PHE B N   
3096 C CA  . PHE B 98  ? 0.3338 0.1866 0.2036 -0.0452 -0.0663 0.0318  79  PHE B CA  
3097 C C   . PHE B 98  ? 0.3302 0.2178 0.2251 -0.0299 -0.0853 0.0268  79  PHE B C   
3098 O O   . PHE B 98  ? 0.3492 0.2615 0.2265 -0.0152 -0.1150 0.0272  79  PHE B O   
3099 C CB  . PHE B 98  ? 0.3458 0.1376 0.2091 -0.0492 -0.0334 0.0193  79  PHE B CB  
3100 C CG  . PHE B 98  ? 0.3280 0.1667 0.2126 -0.0385 -0.0332 0.0003  79  PHE B CG  
3101 C CD1 . PHE B 98  ? 0.3212 0.2080 0.2239 -0.0180 -0.0376 0.0062  79  PHE B CD1 
3102 C CD2 . PHE B 98  ? 0.3598 0.1888 0.2276 -0.0263 -0.0485 -0.0201 79  PHE B CD2 
3103 C CE1 . PHE B 98  ? 0.3214 0.2084 0.2240 -0.0490 -0.0366 0.0200  79  PHE B CE1 
3104 C CE2 . PHE B 98  ? 0.3528 0.1864 0.2559 -0.0331 -0.0515 -0.0108 79  PHE B CE2 
3105 C CZ  . PHE B 98  ? 0.3312 0.1803 0.2340 -0.0316 -0.0268 0.0086  79  PHE B CZ  
3106 N N   . ASP B 99  ? 0.3559 0.2329 0.2434 -0.0212 -0.0438 0.0365  80  ASP B N   
3107 C CA  . ASP B 99  ? 0.3516 0.2296 0.2452 -0.0068 -0.0173 0.0328  80  ASP B CA  
3108 C C   . ASP B 99  ? 0.3908 0.2227 0.2262 -0.0071 -0.0221 0.0171  80  ASP B C   
3109 O O   . ASP B 99  ? 0.4489 0.2463 0.1946 -0.0083 -0.0885 0.0059  80  ASP B O   
3110 C CB  . ASP B 99  ? 0.3018 0.2363 0.2860 -0.0041 -0.0089 0.0342  80  ASP B CB  
3111 C CG  . ASP B 99  ? 0.2873 0.2420 0.3264 0.0165  -0.0228 0.0246  80  ASP B CG  
3112 O OD1 . ASP B 99  ? 0.2956 0.2207 0.3256 -0.0123 -0.0032 0.0451  80  ASP B OD1 
3113 O OD2 . ASP B 99  ? 0.2757 0.2544 0.3678 0.0288  -0.0001 -0.0028 80  ASP B OD2 
3114 N N   . ASP B 100 ? 0.4098 0.2229 0.2280 -0.0160 0.0140  0.0241  81  ASP B N   
3115 C CA  . ASP B 100 ? 0.4364 0.2283 0.2488 -0.0025 -0.0189 0.0143  81  ASP B CA  
3116 C C   . ASP B 100 ? 0.4480 0.2407 0.2522 -0.0045 0.0067  0.0017  81  ASP B C   
3117 O O   . ASP B 100 ? 0.4751 0.2373 0.2185 -0.0176 -0.0043 0.0193  81  ASP B O   
3118 C CB  . ASP B 100 ? 0.4625 0.2260 0.2726 -0.0318 -0.0407 0.0149  81  ASP B CB  
3119 C CG  . ASP B 100 ? 0.5095 0.3033 0.3077 -0.0126 -0.0144 0.0278  81  ASP B CG  
3120 O OD1 . ASP B 100 ? 0.4719 0.3150 0.3289 -0.0755 0.0099  0.0215  81  ASP B OD1 
3121 O OD2 . ASP B 100 ? 0.5646 0.3335 0.3020 0.0249  -0.0127 0.0533  81  ASP B OD2 
3122 N N   . GLN B 101 ? 0.4356 0.2466 0.2747 0.0147  0.0006  -0.0009 82  GLN B N   
3123 C CA  . GLN B 101 ? 0.3869 0.2584 0.2988 0.0548  0.0004  0.0398  82  GLN B CA  
3124 C C   . GLN B 101 ? 0.3726 0.2625 0.2841 0.0945  -0.0429 0.0628  82  GLN B C   
3125 O O   . GLN B 101 ? 0.3905 0.3066 0.3134 0.0932  -0.0659 0.0761  82  GLN B O   
3126 C CB  . GLN B 101 ? 0.4091 0.2289 0.3272 0.0550  0.0265  0.0493  82  GLN B CB  
3127 C CG  . GLN B 101 ? 0.4271 0.2288 0.3236 0.0256  -0.0136 0.0022  82  GLN B CG  
3128 C CD  . GLN B 101 ? 0.4096 0.2578 0.3093 0.0134  -0.0431 0.0095  82  GLN B CD  
3129 O OE1 . GLN B 101 ? 0.4038 0.2969 0.3012 0.0320  -0.0410 0.0175  82  GLN B OE1 
3130 N NE2 . GLN B 101 ? 0.3674 0.2662 0.2961 0.0398  -0.0754 0.0074  82  GLN B NE2 
3131 N N   . PHE B 102 ? 0.3601 0.2430 0.2755 0.0756  0.0010  0.0509  83  PHE B N   
3132 C CA  . PHE B 102 ? 0.3659 0.2089 0.2638 0.0591  -0.0035 0.0422  83  PHE B CA  
3133 C C   . PHE B 102 ? 0.4161 0.2434 0.2781 0.0384  -0.0124 0.0354  83  PHE B C   
3134 O O   . PHE B 102 ? 0.4461 0.2514 0.2625 0.0366  -0.0462 0.0357  83  PHE B O   
3135 C CB  . PHE B 102 ? 0.3440 0.2226 0.2605 0.0298  -0.0174 0.0256  83  PHE B CB  
3136 C CG  . PHE B 102 ? 0.3365 0.2110 0.2303 0.0007  -0.0089 0.0258  83  PHE B CG  
3137 C CD1 . PHE B 102 ? 0.3463 0.2073 0.2250 0.0313  0.0096  0.0217  83  PHE B CD1 
3138 C CD2 . PHE B 102 ? 0.3006 0.2160 0.2161 -0.0476 0.0241  0.0046  83  PHE B CD2 
3139 C CE1 . PHE B 102 ? 0.3238 0.2314 0.2370 0.0450  0.0095  0.0190  83  PHE B CE1 
3140 C CE2 . PHE B 102 ? 0.3572 0.2530 0.2459 -0.0453 0.0087  -0.0147 83  PHE B CE2 
3141 C CZ  . PHE B 102 ? 0.3462 0.2516 0.2505 0.0153  0.0006  -0.0023 83  PHE B CZ  
3142 N N   . ASP B 103 ? 0.4219 0.3039 0.3147 -0.0125 -0.0163 0.0369  84  ASP B N   
3143 C CA  . ASP B 103 ? 0.4606 0.3722 0.3520 -0.0296 0.0100  0.0461  84  ASP B CA  
3144 C C   . ASP B 103 ? 0.4593 0.3452 0.3304 -0.0192 0.0111  0.0378  84  ASP B C   
3145 O O   . ASP B 103 ? 0.5052 0.3562 0.3711 -0.0158 0.0304  0.0334  84  ASP B O   
3146 C CB  . ASP B 103 ? 0.5054 0.4730 0.4284 -0.0325 0.0437  0.0606  84  ASP B CB  
3147 C CG  . ASP B 103 ? 0.5589 0.5498 0.4899 -0.0273 0.0938  0.0937  84  ASP B CG  
3148 O OD1 . ASP B 103 ? 0.6039 0.5919 0.5234 -0.0329 0.1228  0.1093  84  ASP B OD1 
3149 O OD2 . ASP B 103 ? 0.5681 0.5709 0.5232 -0.0531 0.1195  0.1012  84  ASP B OD2 
3150 N N   . SER B 104 ? 0.4320 0.2919 0.2825 -0.0266 -0.0111 0.0231  85  SER B N   
3151 C CA  . SER B 104 ? 0.3999 0.2908 0.2721 -0.0101 -0.0205 0.0221  85  SER B CA  
3152 C C   . SER B 104 ? 0.3834 0.2820 0.2573 0.0063  -0.0282 0.0501  85  SER B C   
3153 O O   . SER B 104 ? 0.3792 0.2788 0.2381 0.0154  -0.0516 0.0175  85  SER B O   
3154 C CB  . SER B 104 ? 0.3849 0.2670 0.2746 -0.0530 0.0031  0.0068  85  SER B CB  
3155 O OG  . SER B 104 ? 0.4155 0.2894 0.2527 -0.0436 0.0315  -0.0048 85  SER B OG  
3156 N N   . PRO B 105 ? 0.4102 0.2759 0.2860 0.0405  0.0081  0.0575  86  PRO B N   
3157 C CA  . PRO B 105 ? 0.3765 0.2650 0.2605 0.0598  0.0365  0.0663  86  PRO B CA  
3158 C C   . PRO B 105 ? 0.3145 0.2874 0.2496 0.0154  0.0235  0.0688  86  PRO B C   
3159 O O   . PRO B 105 ? 0.2938 0.3352 0.2521 -0.0141 0.0126  0.0641  86  PRO B O   
3160 C CB  . PRO B 105 ? 0.4349 0.2740 0.2798 0.0549  0.0606  0.0626  86  PRO B CB  
3161 C CG  . PRO B 105 ? 0.4429 0.2859 0.2902 0.0465  0.0796  0.0607  86  PRO B CG  
3162 C CD  . PRO B 105 ? 0.4404 0.2893 0.2901 0.0401  0.0708  0.0627  86  PRO B CD  
3163 N N   . LEU B 106 ? 0.2876 0.2714 0.2394 -0.0111 0.0183  0.0773  87  LEU B N   
3164 C CA  . LEU B 106 ? 0.2330 0.2604 0.2059 -0.0277 -0.0093 0.0501  87  LEU B CA  
3165 C C   . LEU B 106 ? 0.2718 0.2559 0.2049 -0.0155 -0.0181 0.0413  87  LEU B C   
3166 O O   . LEU B 106 ? 0.2967 0.3035 0.2104 -0.0557 0.0102  0.0046  87  LEU B O   
3167 C CB  . LEU B 106 ? 0.2319 0.2875 0.2026 -0.0385 -0.0066 0.0830  87  LEU B CB  
3168 C CG  . LEU B 106 ? 0.2483 0.3004 0.2150 -0.0519 -0.0216 0.0855  87  LEU B CG  
3169 C CD1 . LEU B 106 ? 0.2667 0.3118 0.2259 -0.0305 -0.0761 0.1109  87  LEU B CD1 
3170 C CD2 . LEU B 106 ? 0.2376 0.3179 0.2132 -0.0513 0.0313  0.0615  87  LEU B CD2 
3171 N N   . GLY B 107 ? 0.2448 0.2460 0.2203 0.0229  -0.0289 0.0768  88  GLY B N   
3172 C CA  . GLY B 107 ? 0.2247 0.2734 0.2128 0.0086  -0.0429 0.0751  88  GLY B CA  
3173 C C   . GLY B 107 ? 0.2299 0.2892 0.1857 0.0281  -0.0241 0.0675  88  GLY B C   
3174 O O   . GLY B 107 ? 0.2762 0.3541 0.2322 0.0415  0.0039  0.0835  88  GLY B O   
3175 N N   . ARG B 108 ? 0.2427 0.2238 0.1592 -0.0160 0.0103  0.0269  89  ARG B N   
3176 C CA  A ARG B 108 ? 0.2099 0.2256 0.1709 -0.0018 -0.0236 0.0072  89  ARG B CA  
3177 C CA  B ARG B 108 ? 0.1891 0.1963 0.1484 0.0077  -0.0331 0.0290  89  ARG B CA  
3178 C C   . ARG B 108 ? 0.1849 0.2063 0.1696 -0.0044 0.0019  0.0235  89  ARG B C   
3179 O O   . ARG B 108 ? 0.1788 0.2395 0.1880 -0.0363 0.0334  0.0239  89  ARG B O   
3180 C CB  A ARG B 108 ? 0.2828 0.2132 0.2248 0.0069  0.0012  -0.0190 89  ARG B CB  
3181 C CB  B ARG B 108 ? 0.2345 0.1285 0.1672 0.0244  -0.0093 0.0455  89  ARG B CB  
3182 C CG  A ARG B 108 ? 0.3504 0.2554 0.2990 -0.0077 0.0173  -0.0123 89  ARG B CG  
3183 C CG  B ARG B 108 ? 0.2571 0.1578 0.2175 0.0329  -0.0116 0.0741  89  ARG B CG  
3184 C CD  A ARG B 108 ? 0.4046 0.3240 0.3543 0.0124  0.0260  -0.0150 89  ARG B CD  
3185 C CD  B ARG B 108 ? 0.2786 0.2077 0.2534 0.0571  -0.0108 0.1005  89  ARG B CD  
3186 N NE  A ARG B 108 ? 0.4499 0.3783 0.3962 0.0308  0.0274  -0.0236 89  ARG B NE  
3187 N NE  B ARG B 108 ? 0.3222 0.2433 0.2878 0.0501  0.0015  0.1058  89  ARG B NE  
3188 C CZ  A ARG B 108 ? 0.4610 0.4164 0.4146 0.0254  0.0267  -0.0420 89  ARG B CZ  
3189 C CZ  B ARG B 108 ? 0.3352 0.2528 0.2906 0.0783  -0.0171 0.0814  89  ARG B CZ  
3190 N NH1 A ARG B 108 ? 0.4750 0.4323 0.4321 0.0154  0.0156  -0.0374 89  ARG B NH1 
3191 N NH1 B ARG B 108 ? 0.3348 0.2573 0.2685 0.0949  -0.0349 0.0945  89  ARG B NH1 
3192 N NH2 A ARG B 108 ? 0.4443 0.4257 0.4016 0.0207  0.0268  -0.0503 89  ARG B NH2 
3193 N NH2 B ARG B 108 ? 0.3586 0.2644 0.3199 0.1101  -0.0109 0.0528  89  ARG B NH2 
3194 N N   . ARG B 109 ? 0.1911 0.1851 0.1620 0.0015  -0.0471 0.0210  90  ARG B N   
3195 C CA  . ARG B 109 ? 0.1951 0.1685 0.1666 0.0300  -0.0663 0.0227  90  ARG B CA  
3196 C C   . ARG B 109 ? 0.2016 0.1842 0.1581 0.0084  -0.0499 0.0228  90  ARG B C   
3197 O O   . ARG B 109 ? 0.1887 0.1686 0.1608 0.0335  -0.0328 0.0242  90  ARG B O   
3198 C CB  . ARG B 109 ? 0.2308 0.2197 0.2054 0.0354  -0.0743 0.0549  90  ARG B CB  
3199 C CG  . ARG B 109 ? 0.2858 0.2652 0.2612 0.0207  -0.1032 0.0805  90  ARG B CG  
3200 C CD  . ARG B 109 ? 0.3100 0.3733 0.3402 0.0237  -0.1162 0.1089  90  ARG B CD  
3201 N NE  . ARG B 109 ? 0.4732 0.5177 0.4549 0.0042  -0.1037 0.0769  90  ARG B NE  
3202 C CZ  . ARG B 109 ? 0.5975 0.5808 0.5238 -0.0145 -0.0473 0.0580  90  ARG B CZ  
3203 N NH1 . ARG B 109 ? 0.6598 0.6045 0.5426 0.0008  -0.0383 0.0552  90  ARG B NH1 
3204 N NH2 . ARG B 109 ? 0.6269 0.5895 0.5341 -0.0406 0.0034  0.0440  90  ARG B NH2 
3205 N N   . PRO B 110 ? 0.2036 0.2095 0.1367 0.0365  0.0140  0.0053  91  PRO B N   
3206 C CA  . PRO B 110 ? 0.1869 0.1868 0.1697 0.0551  -0.0044 -0.0050 91  PRO B CA  
3207 C C   . PRO B 110 ? 0.1858 0.1773 0.1575 0.0383  -0.0101 0.0141  91  PRO B C   
3208 O O   . PRO B 110 ? 0.1562 0.1924 0.1481 0.0376  -0.0024 0.0143  91  PRO B O   
3209 C CB  . PRO B 110 ? 0.1905 0.2062 0.1803 0.0544  0.0092  -0.0079 91  PRO B CB  
3210 C CG  . PRO B 110 ? 0.1681 0.2589 0.1834 0.0638  -0.0058 0.0179  91  PRO B CG  
3211 C CD  . PRO B 110 ? 0.2032 0.2435 0.1618 0.0639  0.0102  0.0054  91  PRO B CD  
3212 N N   . GLU B 111 ? 0.1640 0.1843 0.1821 0.0093  -0.0145 -0.0021 92  GLU B N   
3213 C CA  . GLU B 111 ? 0.1932 0.2086 0.2163 -0.0124 -0.0559 0.0098  92  GLU B CA  
3214 C C   . GLU B 111 ? 0.2016 0.2118 0.2176 0.0470  -0.0448 0.0164  92  GLU B C   
3215 O O   . GLU B 111 ? 0.1244 0.2337 0.2113 0.0321  -0.0139 0.0219  92  GLU B O   
3216 C CB  . GLU B 111 ? 0.2487 0.2547 0.2621 -0.0426 -0.0684 0.0568  92  GLU B CB  
3217 C CG  . GLU B 111 ? 0.3006 0.2946 0.2795 -0.0355 -0.0971 0.0609  92  GLU B CG  
3218 C CD  . GLU B 111 ? 0.3406 0.3108 0.2892 -0.0411 -0.1471 0.0642  92  GLU B CD  
3219 O OE1 . GLU B 111 ? 0.3236 0.3500 0.3413 -0.0113 -0.1534 0.0641  92  GLU B OE1 
3220 O OE2 . GLU B 111 ? 0.3835 0.2551 0.2638 -0.0314 -0.1545 0.0694  92  GLU B OE2 
3221 N N   . GLN B 112 ? 0.1783 0.1839 0.2297 0.0520  -0.0799 0.0112  93  GLN B N   
3222 C CA  . GLN B 112 ? 0.2056 0.1995 0.2288 0.0607  -0.0756 0.0360  93  GLN B CA  
3223 C C   . GLN B 112 ? 0.1739 0.1893 0.2160 0.0288  -0.0673 0.0267  93  GLN B C   
3224 O O   . GLN B 112 ? 0.1790 0.2121 0.2246 0.0133  -0.0618 0.0255  93  GLN B O   
3225 C CB  . GLN B 112 ? 0.2422 0.2027 0.2438 0.0726  -0.0971 0.0130  93  GLN B CB  
3226 C CG  . GLN B 112 ? 0.3282 0.2950 0.2911 0.0492  -0.1312 0.0302  93  GLN B CG  
3227 C CD  . GLN B 112 ? 0.3890 0.3944 0.3583 0.0123  -0.1689 0.0317  93  GLN B CD  
3228 O OE1 . GLN B 112 ? 0.4315 0.4480 0.3921 -0.0030 -0.1456 0.0293  93  GLN B OE1 
3229 N NE2 . GLN B 112 ? 0.4112 0.4536 0.4024 0.0592  -0.1797 0.0447  93  GLN B NE2 
3230 N N   . VAL B 113 ? 0.1334 0.1654 0.1814 0.0452  -0.0641 0.0356  94  VAL B N   
3231 C CA  . VAL B 113 ? 0.1415 0.1728 0.1650 0.0280  -0.0469 0.0470  94  VAL B CA  
3232 C C   . VAL B 113 ? 0.1652 0.1648 0.1637 0.0573  0.0106  0.0208  94  VAL B C   
3233 O O   . VAL B 113 ? 0.1579 0.1694 0.1575 -0.0007 -0.0142 -0.0061 94  VAL B O   
3234 C CB  . VAL B 113 ? 0.1634 0.1847 0.1558 0.0194  -0.0255 0.0671  94  VAL B CB  
3235 C CG1 . VAL B 113 ? 0.1575 0.1849 0.1279 0.0093  -0.0165 0.0225  94  VAL B CG1 
3236 C CG2 . VAL B 113 ? 0.1887 0.1671 0.1512 -0.0078 -0.0506 0.0692  94  VAL B CG2 
3237 N N   . ALA B 114 ? 0.1352 0.1441 0.1708 0.0405  -0.0249 0.0293  95  ALA B N   
3238 C CA  . ALA B 114 ? 0.1114 0.1238 0.1872 0.0014  0.0195  0.0196  95  ALA B CA  
3239 C C   . ALA B 114 ? 0.1176 0.1535 0.1919 0.0438  0.0392  0.0439  95  ALA B C   
3240 O O   . ALA B 114 ? 0.1633 0.1949 0.1978 0.0402  0.0211  0.0361  95  ALA B O   
3241 C CB  . ALA B 114 ? 0.1574 0.1324 0.1776 -0.0146 -0.0233 -0.0133 95  ALA B CB  
3242 N N   . LEU B 115 ? 0.1617 0.1870 0.1887 0.0328  0.0339  0.0112  96  LEU B N   
3243 C CA  . LEU B 115 ? 0.1875 0.2181 0.1984 0.0582  0.0282  0.0039  96  LEU B CA  
3244 C C   . LEU B 115 ? 0.2020 0.2032 0.2130 0.0619  -0.0067 -0.0062 96  LEU B C   
3245 O O   . LEU B 115 ? 0.2091 0.2000 0.2397 0.0652  0.0177  -0.0177 96  LEU B O   
3246 C CB  . LEU B 115 ? 0.1299 0.2986 0.2364 0.0840  0.0415  0.0643  96  LEU B CB  
3247 C CG  . LEU B 115 ? 0.2809 0.3601 0.3483 0.0897  0.0136  0.1056  96  LEU B CG  
3248 C CD1 . LEU B 115 ? 0.3865 0.3974 0.4191 0.0854  0.0473  0.1056  96  LEU B CD1 
3249 C CD2 . LEU B 115 ? 0.2980 0.4029 0.4117 0.0640  -0.0429 0.1110  96  LEU B CD2 
3250 N N   . ILE B 116 ? 0.1978 0.2105 0.2321 0.0536  -0.0393 -0.0020 97  ILE B N   
3251 C CA  . ILE B 116 ? 0.2171 0.1827 0.2238 0.0444  -0.0481 -0.0009 97  ILE B CA  
3252 C C   . ILE B 116 ? 0.2148 0.1811 0.1839 0.0474  -0.0403 -0.0088 97  ILE B C   
3253 O O   . ILE B 116 ? 0.2771 0.2073 0.1591 0.0431  -0.0423 -0.0176 97  ILE B O   
3254 C CB  . ILE B 116 ? 0.2453 0.1664 0.2222 0.0122  -0.0331 0.0222  97  ILE B CB  
3255 C CG1 . ILE B 116 ? 0.2922 0.1692 0.2489 0.0257  -0.0201 0.0270  97  ILE B CG1 
3256 C CG2 . ILE B 116 ? 0.2503 0.2001 0.2389 -0.0017 -0.0229 0.0206  97  ILE B CG2 
3257 C CD1 . ILE B 116 ? 0.2760 0.1668 0.2689 0.0299  -0.0348 0.0488  97  ILE B CD1 
3258 N N   . CYS B 117 ? 0.1919 0.1487 0.2082 0.0501  -0.0461 -0.0069 98  CYS B N   
3259 C CA  . CYS B 117 ? 0.1759 0.1452 0.1935 0.0601  -0.0233 0.0144  98  CYS B CA  
3260 C C   . CYS B 117 ? 0.1589 0.1645 0.1824 0.0323  -0.0074 0.0052  98  CYS B C   
3261 O O   . CYS B 117 ? 0.1621 0.1580 0.1725 0.0241  -0.0067 0.0020  98  CYS B O   
3262 C CB  . CYS B 117 ? 0.1909 0.1704 0.1884 0.0331  -0.0094 0.0243  98  CYS B CB  
3263 S SG  . CYS B 117 ? 0.1884 0.2241 0.1566 0.0026  0.0023  0.0102  98  CYS B SG  
3264 N N   . GLU B 118 ? 0.1647 0.1583 0.1788 0.0095  0.0061  0.0024  99  GLU B N   
3265 C CA  . GLU B 118 ? 0.1453 0.1257 0.1733 0.0029  0.0096  -0.0077 99  GLU B CA  
3266 C C   . GLU B 118 ? 0.1793 0.1342 0.1782 0.0760  0.0141  0.0065  99  GLU B C   
3267 O O   . GLU B 118 ? 0.1945 0.1805 0.1604 0.0488  0.0095  0.0055  99  GLU B O   
3268 C CB  . GLU B 118 ? 0.1478 0.1520 0.1800 -0.0329 0.0186  0.0066  99  GLU B CB  
3269 C CG  . GLU B 118 ? 0.1567 0.1957 0.2158 0.0345  0.0432  0.0285  99  GLU B CG  
3270 C CD  . GLU B 118 ? 0.1943 0.2286 0.2284 0.0144  0.0403  0.0151  99  GLU B CD  
3271 O OE1 . GLU B 118 ? 0.2223 0.2742 0.2385 -0.0080 0.0270  0.0411  99  GLU B OE1 
3272 O OE2 . GLU B 118 ? 0.1728 0.2225 0.2153 0.0200  0.0340  0.0003  99  GLU B OE2 
3273 N N   . ARG B 119 ? 0.1567 0.1556 0.2037 0.0856  0.0061  -0.0384 100 ARG B N   
3274 C CA  . ARG B 119 ? 0.1786 0.1712 0.2310 0.0952  -0.0180 -0.0380 100 ARG B CA  
3275 C C   . ARG B 119 ? 0.2081 0.1885 0.2265 0.0820  0.0056  -0.0300 100 ARG B C   
3276 O O   . ARG B 119 ? 0.1898 0.2221 0.1924 0.0345  0.0424  -0.0256 100 ARG B O   
3277 C CB  . ARG B 119 ? 0.1832 0.2078 0.2529 0.0883  -0.0394 -0.0330 100 ARG B CB  
3278 C CG  . ARG B 119 ? 0.1930 0.2408 0.2818 0.0975  -0.0585 -0.0334 100 ARG B CG  
3279 C CD  . ARG B 119 ? 0.2008 0.2798 0.3225 0.0912  -0.0445 -0.0521 100 ARG B CD  
3280 N NE  . ARG B 119 ? 0.2160 0.3094 0.3493 0.0610  -0.0211 -0.0813 100 ARG B NE  
3281 C CZ  . ARG B 119 ? 0.2738 0.3364 0.3745 0.0404  0.0273  -0.1239 100 ARG B CZ  
3282 N NH1 . ARG B 119 ? 0.3474 0.3777 0.3885 0.0168  0.0502  -0.1207 100 ARG B NH1 
3283 N NH2 . ARG B 119 ? 0.2700 0.3158 0.3793 0.0912  0.0417  -0.1448 100 ARG B NH2 
3284 N N   . LEU B 120 ? 0.1740 0.1726 0.2215 0.0545  -0.0131 -0.0261 101 LEU B N   
3285 C CA  A LEU B 120 ? 0.1914 0.1601 0.1926 0.0542  -0.0120 -0.0309 101 LEU B CA  
3286 C CA  B LEU B 120 ? 0.1971 0.1803 0.2109 0.0472  -0.0064 -0.0266 101 LEU B CA  
3287 C C   . LEU B 120 ? 0.1847 0.1683 0.1833 0.0672  0.0093  -0.0205 101 LEU B C   
3288 O O   . LEU B 120 ? 0.2144 0.1761 0.1610 0.0503  0.0180  -0.0317 101 LEU B O   
3289 C CB  A LEU B 120 ? 0.1856 0.1241 0.1702 0.0620  -0.0143 -0.0434 101 LEU B CB  
3290 C CB  B LEU B 120 ? 0.2045 0.1842 0.2222 0.0415  0.0064  -0.0290 101 LEU B CB  
3291 C CG  A LEU B 120 ? 0.1832 0.1247 0.1488 0.0806  -0.0163 -0.0366 101 LEU B CG  
3292 C CG  B LEU B 120 ? 0.2217 0.2059 0.2379 0.0331  0.0175  -0.0152 101 LEU B CG  
3293 C CD1 A LEU B 120 ? 0.1774 0.1235 0.1568 0.0682  -0.0642 -0.0152 101 LEU B CD1 
3294 C CD1 B LEU B 120 ? 0.2477 0.2205 0.2427 0.0437  0.0196  -0.0048 101 LEU B CD1 
3295 C CD2 A LEU B 120 ? 0.1865 0.1143 0.1299 0.0533  0.0040  -0.0513 101 LEU B CD2 
3296 C CD2 B LEU B 120 ? 0.2280 0.1981 0.2486 0.0264  -0.0014 -0.0213 101 LEU B CD2 
3297 N N   . SER B 121 ? 0.1631 0.1716 0.1598 0.0568  0.0385  -0.0048 102 SER B N   
3298 C CA  . SER B 121 ? 0.1630 0.2027 0.1407 0.0739  0.0414  -0.0191 102 SER B CA  
3299 C C   . SER B 121 ? 0.1908 0.2293 0.1546 0.0736  0.0199  -0.0187 102 SER B C   
3300 O O   . SER B 121 ? 0.2156 0.2140 0.1304 0.0577  0.0201  -0.0067 102 SER B O   
3301 C CB  . SER B 121 ? 0.1509 0.1914 0.1525 0.0794  0.0354  -0.0328 102 SER B CB  
3302 O OG  . SER B 121 ? 0.1454 0.1968 0.1381 0.0380  0.0362  -0.0209 102 SER B OG  
3303 N N   . ALA B 122 ? 0.1661 0.2302 0.1681 0.0857  0.0488  -0.0299 103 ALA B N   
3304 C CA  . ALA B 122 ? 0.1372 0.2623 0.1785 0.0627  0.0369  -0.0383 103 ALA B CA  
3305 C C   . ALA B 122 ? 0.1880 0.2405 0.1867 0.0600  0.0455  -0.0339 103 ALA B C   
3306 O O   . ALA B 122 ? 0.1829 0.2686 0.1715 0.0309  0.0456  -0.0085 103 ALA B O   
3307 C CB  . ALA B 122 ? 0.1557 0.2727 0.2111 0.0595  0.0267  -0.0333 103 ALA B CB  
3308 N N   . ILE B 123 ? 0.2267 0.1836 0.1870 0.0707  0.0229  -0.0436 104 ILE B N   
3309 C CA  . ILE B 123 ? 0.2691 0.1627 0.2096 0.0555  0.0007  -0.0196 104 ILE B CA  
3310 C C   . ILE B 123 ? 0.3162 0.1542 0.1822 0.0545  0.0258  -0.0169 104 ILE B C   
3311 O O   . ILE B 123 ? 0.3377 0.1715 0.1882 0.0105  0.0634  -0.0311 104 ILE B O   
3312 C CB  . ILE B 123 ? 0.2687 0.1993 0.2136 0.0666  0.0015  -0.0079 104 ILE B CB  
3313 C CG1 . ILE B 123 ? 0.3402 0.2322 0.2233 0.0931  0.0259  0.0116  104 ILE B CG1 
3314 C CG2 . ILE B 123 ? 0.2850 0.2107 0.2169 0.0527  0.0510  -0.0188 104 ILE B CG2 
3315 C CD1 . ILE B 123 ? 0.3848 0.2492 0.2262 0.1204  0.0171  0.0303  104 ILE B CD1 
3316 N N   . ALA B 124 ? 0.3074 0.1258 0.1831 0.0570  0.0250  0.0047  105 ALA B N   
3317 C CA  . ALA B 124 ? 0.2502 0.1392 0.2021 0.0575  0.0354  -0.0166 105 ALA B CA  
3318 C C   . ALA B 124 ? 0.2121 0.1459 0.1919 0.0200  0.0102  -0.0175 105 ALA B C   
3319 O O   . ALA B 124 ? 0.2685 0.1712 0.1888 0.0312  -0.0151 -0.0160 105 ALA B O   
3320 C CB  . ALA B 124 ? 0.2466 0.1403 0.2119 0.0427  0.0321  0.0156  105 ALA B CB  
3321 N N   . HIS B 125 ? 0.1855 0.1530 0.2244 -0.0141 0.0508  -0.0065 106 HIS B N   
3322 C CA  . HIS B 125 ? 0.1705 0.1600 0.2239 0.0014  0.0348  -0.0598 106 HIS B CA  
3323 C C   . HIS B 125 ? 0.2432 0.1994 0.2306 0.0002  0.0784  -0.0225 106 HIS B C   
3324 O O   . HIS B 125 ? 0.2749 0.2250 0.2641 -0.0144 0.0701  0.0085  106 HIS B O   
3325 C CB  . HIS B 125 ? 0.1596 0.1639 0.2054 0.0060  0.0208  -0.0605 106 HIS B CB  
3326 C CG  . HIS B 125 ? 0.1782 0.1903 0.1916 -0.0142 0.0152  -0.0346 106 HIS B CG  
3327 N ND1 . HIS B 125 ? 0.1777 0.2123 0.1951 -0.0251 0.0214  -0.0276 106 HIS B ND1 
3328 C CD2 . HIS B 125 ? 0.1979 0.1967 0.2268 -0.0468 0.0203  -0.0106 106 HIS B CD2 
3329 C CE1 . HIS B 125 ? 0.1888 0.2075 0.2083 -0.0327 0.0206  -0.0245 106 HIS B CE1 
3330 N NE2 . HIS B 125 ? 0.1873 0.1890 0.2090 -0.0433 0.0015  -0.0056 106 HIS B NE2 
3331 N N   . GLY B 126 ? 0.2606 0.2117 0.2473 0.0289  0.1052  -0.0131 107 GLY B N   
3332 C CA  . GLY B 126 ? 0.2752 0.2485 0.2603 0.0295  0.1500  -0.0086 107 GLY B CA  
3333 C C   . GLY B 126 ? 0.2934 0.3345 0.2787 0.0080  0.1327  0.0056  107 GLY B C   
3334 O O   . GLY B 126 ? 0.3362 0.3744 0.2749 0.0047  0.1355  0.0229  107 GLY B O   
3335 N N   . THR B 127 ? 0.3196 0.3521 0.3073 -0.0131 0.0637  0.0033  108 THR B N   
3336 C CA  . THR B 127 ? 0.3197 0.3458 0.3473 0.0017  0.0639  -0.0128 108 THR B CA  
3337 C C   . THR B 127 ? 0.3335 0.3756 0.3980 0.0262  0.0076  -0.0058 108 THR B C   
3338 O O   . THR B 127 ? 0.3839 0.3771 0.4367 -0.0068 -0.0676 0.0026  108 THR B O   
3339 C CB  . THR B 127 ? 0.3000 0.2847 0.3411 -0.0428 0.1056  -0.0156 108 THR B CB  
3340 O OG1 . THR B 127 ? 0.3368 0.2540 0.3768 -0.0663 0.1324  -0.0570 108 THR B OG1 
3341 C CG2 . THR B 127 ? 0.2797 0.2902 0.3069 -0.0183 0.0985  0.0199  108 THR B CG2 
3342 N N   . LEU B 128 ? 0.3091 0.4113 0.4065 0.0677  0.0593  -0.0084 109 LEU B N   
3343 C CA  . LEU B 128 ? 0.3827 0.4502 0.4357 0.0774  0.0586  -0.0191 109 LEU B CA  
3344 C C   . LEU B 128 ? 0.4622 0.5118 0.4904 0.0507  0.0647  -0.0056 109 LEU B C   
3345 O O   . LEU B 128 ? 0.4821 0.5396 0.4953 0.0388  0.1109  0.0005  109 LEU B O   
3346 C CB  . LEU B 128 ? 0.3931 0.4306 0.3834 0.1077  0.0416  -0.0100 109 LEU B CB  
3347 C CG  . LEU B 128 ? 0.3827 0.4090 0.3569 0.1410  0.0111  -0.0372 109 LEU B CG  
3348 C CD1 . LEU B 128 ? 0.3642 0.4080 0.3350 0.1282  0.0064  -0.0583 109 LEU B CD1 
3349 C CD2 . LEU B 128 ? 0.3972 0.4186 0.3516 0.1407  0.0019  -0.0223 109 LEU B CD2 
3350 N N   . THR B 129 ? 0.5291 0.5394 0.5361 0.0569  0.0473  0.0084  110 THR B N   
3351 C CA  . THR B 129 ? 0.5567 0.5453 0.5488 0.0752  0.0279  0.0116  110 THR B CA  
3352 C C   . THR B 129 ? 0.5665 0.5422 0.5261 0.0833  0.0377  0.0151  110 THR B C   
3353 O O   . THR B 129 ? 0.6177 0.5676 0.5351 0.0850  0.0490  0.0281  110 THR B O   
3354 C CB  . THR B 129 ? 0.5916 0.5575 0.5695 0.0701  0.0081  0.0175  110 THR B CB  
3355 O OG1 . THR B 129 ? 0.6234 0.5600 0.5727 0.0721  0.0016  0.0116  110 THR B OG1 
3356 C CG2 . THR B 129 ? 0.5857 0.5649 0.5752 0.0727  0.0166  0.0310  110 THR B CG2 
3357 N N   . ALA B 130 ? 0.5029 0.5074 0.4906 0.0722  0.0382  0.0161  111 ALA B N   
3358 C CA  . ALA B 130 ? 0.4672 0.4784 0.4765 0.0614  0.0413  -0.0158 111 ALA B CA  
3359 C C   . ALA B 130 ? 0.4406 0.4475 0.4572 0.0493  0.0194  -0.0524 111 ALA B C   
3360 O O   . ALA B 130 ? 0.4494 0.4445 0.4290 0.0355  0.0182  -0.0564 111 ALA B O   
3361 C CB  . ALA B 130 ? 0.4668 0.4847 0.4855 0.0729  0.0528  -0.0169 111 ALA B CB  
3362 N N   . VAL B 131 ? 0.4191 0.4364 0.4493 0.0693  -0.0020 -0.0700 112 VAL B N   
3363 C CA  . VAL B 131 ? 0.3644 0.4100 0.4476 0.0581  -0.0019 -0.0917 112 VAL B CA  
3364 C C   . VAL B 131 ? 0.3233 0.3699 0.4525 0.0936  -0.0018 -0.0970 112 VAL B C   
3365 O O   . VAL B 131 ? 0.3593 0.3572 0.4722 0.1550  0.0410  -0.1162 112 VAL B O   
3366 C CB  . VAL B 131 ? 0.4007 0.4446 0.4578 0.0467  -0.0156 -0.0786 112 VAL B CB  
3367 C CG1 . VAL B 131 ? 0.4019 0.4438 0.4551 0.0117  -0.0066 -0.0974 112 VAL B CG1 
3368 C CG2 . VAL B 131 ? 0.3949 0.4595 0.4682 0.0564  -0.0211 -0.0830 112 VAL B CG2 
3369 N N   . THR B 132 ? 0.2632 0.3367 0.4426 0.0999  -0.0486 -0.0731 113 THR B N   
3370 C CA  . THR B 132 ? 0.3251 0.3522 0.4452 0.0964  -0.0432 -0.0465 113 THR B CA  
3371 C C   . THR B 132 ? 0.3582 0.2879 0.4212 0.1140  -0.0450 -0.0528 113 THR B C   
3372 O O   . THR B 132 ? 0.4454 0.3057 0.4614 0.1374  -0.0168 -0.0478 113 THR B O   
3373 C CB  . THR B 132 ? 0.3678 0.4104 0.4706 0.0687  -0.0528 -0.0127 113 THR B CB  
3374 O OG1 . THR B 132 ? 0.3961 0.4338 0.4836 0.0474  -0.0570 -0.0241 113 THR B OG1 
3375 C CG2 . THR B 132 ? 0.3925 0.4340 0.4960 0.0795  -0.0516 -0.0134 113 THR B CG2 
3376 N N   . SER B 133 ? 0.2817 0.2549 0.3353 0.0815  -0.0521 -0.0737 114 SER B N   
3377 C CA  . SER B 133 ? 0.2668 0.2410 0.3025 0.0693  -0.0936 -0.0855 114 SER B CA  
3378 C C   . SER B 133 ? 0.2648 0.2288 0.2698 0.0677  -0.0825 -0.0596 114 SER B C   
3379 O O   . SER B 133 ? 0.2630 0.2122 0.2761 0.0997  -0.0575 -0.0477 114 SER B O   
3380 C CB  . SER B 133 ? 0.2517 0.2464 0.3111 0.0937  -0.0575 -0.0695 114 SER B CB  
3381 O OG  . SER B 133 ? 0.2698 0.2223 0.2910 0.0891  -0.0464 -0.0429 114 SER B OG  
3382 N N   . PRO B 134 ? 0.2732 0.2004 0.2319 0.0601  -0.0889 -0.0132 115 PRO B N   
3383 C CA  . PRO B 134 ? 0.2766 0.1912 0.2320 0.0729  -0.0739 0.0301  115 PRO B CA  
3384 C C   . PRO B 134 ? 0.2760 0.2044 0.2215 0.0937  -0.0541 -0.0021 115 PRO B C   
3385 O O   . PRO B 134 ? 0.2935 0.2192 0.2047 0.1014  -0.0396 -0.0025 115 PRO B O   
3386 C CB  . PRO B 134 ? 0.3054 0.1806 0.2481 0.0535  -0.0681 0.0669  115 PRO B CB  
3387 C CG  . PRO B 134 ? 0.3201 0.2212 0.2552 0.0311  -0.0662 0.0490  115 PRO B CG  
3388 C CD  . PRO B 134 ? 0.3040 0.2175 0.2338 0.0296  -0.0830 0.0030  115 PRO B CD  
3389 N N   . SER B 135 ? 0.2401 0.1862 0.2247 0.0802  -0.0380 -0.0155 116 SER B N   
3390 C CA  . SER B 135 ? 0.2398 0.1883 0.1918 0.0918  -0.0027 -0.0089 116 SER B CA  
3391 C C   . SER B 135 ? 0.2253 0.1935 0.1995 0.0594  -0.0002 0.0062  116 SER B C   
3392 O O   . SER B 135 ? 0.2448 0.2002 0.2042 0.0718  -0.0213 0.0169  116 SER B O   
3393 C CB  . SER B 135 ? 0.2756 0.2007 0.1813 0.0721  0.0329  -0.0114 116 SER B CB  
3394 O OG  . SER B 135 ? 0.2810 0.2182 0.1506 0.0681  0.0297  0.0052  116 SER B OG  
3395 N N   . GLU B 136 ? 0.2241 0.1725 0.1997 0.0187  0.0053  -0.0060 117 GLU B N   
3396 C CA  . GLU B 136 ? 0.2106 0.1784 0.1778 0.0148  -0.0341 -0.0309 117 GLU B CA  
3397 C C   . GLU B 136 ? 0.2174 0.1804 0.1927 0.0804  -0.0083 -0.0253 117 GLU B C   
3398 O O   . GLU B 136 ? 0.2317 0.2222 0.2056 0.0774  -0.0183 -0.0030 117 GLU B O   
3399 C CB  . GLU B 136 ? 0.2138 0.1774 0.2139 0.0438  -0.0225 -0.0333 117 GLU B CB  
3400 C CG  . GLU B 136 ? 0.2384 0.1836 0.2133 0.0457  -0.0271 -0.0413 117 GLU B CG  
3401 C CD  . GLU B 136 ? 0.2621 0.2257 0.2373 0.0630  0.0049  -0.0627 117 GLU B CD  
3402 O OE1 . GLU B 136 ? 0.2797 0.2305 0.2450 0.0854  0.0306  -0.0715 117 GLU B OE1 
3403 O OE2 . GLU B 136 ? 0.2908 0.2580 0.2537 0.0747  0.0000  -0.0671 117 GLU B OE2 
3404 N N   . ARG B 137 ? 0.2422 0.1743 0.2159 0.0731  0.0025  -0.0513 118 ARG B N   
3405 C CA  A ARG B 137 ? 0.2746 0.2037 0.2410 0.0689  0.0066  -0.0299 118 ARG B CA  
3406 C CA  B ARG B 137 ? 0.2575 0.1834 0.2252 0.0856  0.0064  -0.0283 118 ARG B CA  
3407 C C   . ARG B 137 ? 0.2561 0.1739 0.2214 0.0647  0.0046  -0.0153 118 ARG B C   
3408 O O   . ARG B 137 ? 0.3025 0.1851 0.2560 0.0517  -0.0286 -0.0268 118 ARG B O   
3409 C CB  A ARG B 137 ? 0.3393 0.2635 0.2949 0.0662  0.0131  -0.0341 118 ARG B CB  
3410 C CB  B ARG B 137 ? 0.2861 0.2087 0.2538 0.1149  0.0116  -0.0360 118 ARG B CB  
3411 C CG  A ARG B 137 ? 0.3974 0.3229 0.3450 0.0619  0.0282  -0.0338 118 ARG B CG  
3412 C CG  B ARG B 137 ? 0.2849 0.2481 0.2846 0.1492  0.0268  -0.0381 118 ARG B CG  
3413 C CD  A ARG B 137 ? 0.4542 0.3814 0.3957 0.0569  0.0296  -0.0554 118 ARG B CD  
3414 C CD  B ARG B 137 ? 0.3450 0.2980 0.3199 0.1602  0.0255  -0.0387 118 ARG B CD  
3415 N NE  A ARG B 137 ? 0.4913 0.4372 0.4375 0.0434  0.0213  -0.0640 118 ARG B NE  
3416 N NE  B ARG B 137 ? 0.4119 0.3444 0.3725 0.1347  0.0435  -0.0328 118 ARG B NE  
3417 C CZ  A ARG B 137 ? 0.5304 0.4711 0.4576 0.0210  0.0191  -0.0545 118 ARG B CZ  
3418 C CZ  B ARG B 137 ? 0.4211 0.3505 0.3789 0.1092  0.0484  -0.0352 118 ARG B CZ  
3419 N NH1 A ARG B 137 ? 0.5402 0.4778 0.4661 0.0138  0.0147  -0.0485 118 ARG B NH1 
3420 N NH1 B ARG B 137 ? 0.4314 0.3497 0.3758 0.0759  0.0417  -0.0661 118 ARG B NH1 
3421 N NH2 A ARG B 137 ? 0.5543 0.4849 0.4623 0.0094  0.0131  -0.0482 118 ARG B NH2 
3422 N NH2 B ARG B 137 ? 0.4312 0.3628 0.3763 0.1084  0.0617  -0.0330 118 ARG B NH2 
3423 N N   . ALA B 138 ? 0.1886 0.1521 0.1919 0.0567  -0.0041 0.0032  119 ALA B N   
3424 C CA  . ALA B 138 ? 0.1984 0.1471 0.1796 0.0373  -0.0034 0.0153  119 ALA B CA  
3425 C C   . ALA B 138 ? 0.2545 0.1461 0.1674 0.0337  -0.0086 -0.0039 119 ALA B C   
3426 O O   . ALA B 138 ? 0.2823 0.1469 0.1425 0.0394  -0.0131 -0.0018 119 ALA B O   
3427 C CB  . ALA B 138 ? 0.1994 0.1688 0.2029 0.0196  0.0003  0.0068  119 ALA B CB  
3428 N N   . PHE B 139 ? 0.2626 0.1370 0.1680 0.0183  0.0041  -0.0027 120 PHE B N   
3429 C CA  . PHE B 139 ? 0.2272 0.1137 0.1506 0.0046  0.0023  -0.0112 120 PHE B CA  
3430 C C   . PHE B 139 ? 0.2417 0.1465 0.1579 0.0221  0.0150  -0.0044 120 PHE B C   
3431 O O   . PHE B 139 ? 0.2476 0.1525 0.1479 0.0245  0.0172  -0.0066 120 PHE B O   
3432 C CB  . PHE B 139 ? 0.2837 0.1311 0.1719 0.0231  -0.0171 -0.0289 120 PHE B CB  
3433 C CG  . PHE B 139 ? 0.2661 0.1049 0.1726 0.0257  -0.0070 0.0012  120 PHE B CG  
3434 C CD1 . PHE B 139 ? 0.2373 0.1304 0.1694 0.0567  0.0254  -0.0134 120 PHE B CD1 
3435 C CD2 . PHE B 139 ? 0.2585 0.0961 0.1871 0.0413  0.0062  -0.0378 120 PHE B CD2 
3436 C CE1 . PHE B 139 ? 0.2315 0.1330 0.1475 0.0437  0.0032  -0.0201 120 PHE B CE1 
3437 C CE2 . PHE B 139 ? 0.2301 0.1277 0.1637 0.0533  -0.0360 -0.0274 120 PHE B CE2 
3438 C CZ  . PHE B 139 ? 0.2471 0.1345 0.1646 0.0565  -0.0226 -0.0256 120 PHE B CZ  
3439 N N   . ALA B 140 ? 0.2132 0.1635 0.1585 0.0513  0.0105  0.0028  121 ALA B N   
3440 C CA  . ALA B 140 ? 0.2022 0.1662 0.1834 0.0502  -0.0059 -0.0067 121 ALA B CA  
3441 C C   . ALA B 140 ? 0.2139 0.1365 0.1970 0.0205  0.0435  -0.0226 121 ALA B C   
3442 O O   . ALA B 140 ? 0.2230 0.1472 0.1964 0.0442  0.0355  0.0148  121 ALA B O   
3443 C CB  . ALA B 140 ? 0.1883 0.1871 0.2140 0.0615  -0.0272 -0.0021 121 ALA B CB  
3444 N N   . ASP B 141 ? 0.2686 0.1350 0.2051 0.0191  0.0320  -0.0597 122 ASP B N   
3445 C CA  . ASP B 141 ? 0.2814 0.1332 0.1794 0.0291  0.0278  -0.0535 122 ASP B CA  
3446 C C   . ASP B 141 ? 0.2609 0.1392 0.1688 0.0169  0.0166  -0.0235 122 ASP B C   
3447 O O   . ASP B 141 ? 0.2568 0.1580 0.1465 0.0151  0.0198  -0.0361 122 ASP B O   
3448 C CB  . ASP B 141 ? 0.3451 0.1369 0.1650 0.0346  -0.0063 -0.0284 122 ASP B CB  
3449 C CG  . ASP B 141 ? 0.3455 0.2069 0.1929 0.0125  -0.0141 -0.0295 122 ASP B CG  
3450 O OD1 . ASP B 141 ? 0.4064 0.2753 0.1812 0.0063  -0.0443 -0.0433 122 ASP B OD1 
3451 O OD2 . ASP B 141 ? 0.2993 0.1905 0.2064 0.0130  -0.0182 0.0030  122 ASP B OD2 
3452 N N   . LEU B 142 ? 0.2506 0.1221 0.1810 0.0344  0.0146  -0.0111 123 LEU B N   
3453 C CA  . LEU B 142 ? 0.2252 0.1207 0.1553 0.0143  0.0485  0.0103  123 LEU B CA  
3454 C C   . LEU B 142 ? 0.2103 0.1049 0.1401 -0.0090 0.0473  0.0010  123 LEU B C   
3455 O O   . LEU B 142 ? 0.2535 0.1457 0.1278 0.0052  0.0248  -0.0045 123 LEU B O   
3456 C CB  . LEU B 142 ? 0.2300 0.1520 0.1352 -0.0281 0.0184  0.0142  123 LEU B CB  
3457 C CG  . LEU B 142 ? 0.2195 0.2132 0.1206 -0.0214 -0.0073 0.0226  123 LEU B CG  
3458 C CD1 . LEU B 142 ? 0.2667 0.2315 0.1246 -0.0355 0.0368  0.0287  123 LEU B CD1 
3459 C CD2 . LEU B 142 ? 0.2386 0.2396 0.1532 -0.0251 -0.0233 0.0145  123 LEU B CD2 
3460 N N   . TRP B 143 ? 0.2134 0.1124 0.1556 -0.0184 0.0482  -0.0046 124 TRP B N   
3461 C CA  . TRP B 143 ? 0.2031 0.1118 0.1518 -0.0350 0.0155  -0.0461 124 TRP B CA  
3462 C C   . TRP B 143 ? 0.2159 0.1250 0.1411 0.0080  0.0080  -0.0234 124 TRP B C   
3463 O O   . TRP B 143 ? 0.2096 0.1261 0.1626 0.0137  0.0125  -0.0139 124 TRP B O   
3464 C CB  . TRP B 143 ? 0.1841 0.0921 0.1458 -0.0064 -0.0103 -0.0463 124 TRP B CB  
3465 C CG  . TRP B 143 ? 0.1754 0.1086 0.1579 0.0016  -0.0033 -0.0131 124 TRP B CG  
3466 C CD1 . TRP B 143 ? 0.2055 0.1271 0.1594 -0.0081 -0.0120 -0.0161 124 TRP B CD1 
3467 C CD2 . TRP B 143 ? 0.1848 0.1324 0.1317 0.0200  0.0085  -0.0196 124 TRP B CD2 
3468 N NE1 . TRP B 143 ? 0.2166 0.1380 0.1674 0.0359  -0.0121 -0.0060 124 TRP B NE1 
3469 C CE2 . TRP B 143 ? 0.1867 0.1397 0.1322 0.0088  0.0056  -0.0007 124 TRP B CE2 
3470 C CE3 . TRP B 143 ? 0.1936 0.1617 0.1321 0.0589  0.0468  0.0141  124 TRP B CE3 
3471 C CZ2 . TRP B 143 ? 0.1600 0.1534 0.1159 0.0043  0.0297  -0.0027 124 TRP B CZ2 
3472 C CZ3 . TRP B 143 ? 0.1935 0.1960 0.1495 0.0544  0.0488  0.0268  124 TRP B CZ3 
3473 C CH2 . TRP B 143 ? 0.1612 0.1643 0.1235 0.0174  0.0290  0.0096  124 TRP B CH2 
3474 N N   . ARG B 144 ? 0.1695 0.1396 0.1107 -0.0123 0.0105  -0.0428 125 ARG B N   
3475 C CA  . ARG B 144 ? 0.2346 0.1350 0.1254 0.0287  0.0344  -0.0385 125 ARG B CA  
3476 C C   . ARG B 144 ? 0.2449 0.1351 0.1321 -0.0156 0.0298  -0.0222 125 ARG B C   
3477 O O   . ARG B 144 ? 0.2388 0.1697 0.1262 0.0199  0.0139  -0.0031 125 ARG B O   
3478 C CB  . ARG B 144 ? 0.2801 0.1528 0.1412 0.0468  0.0441  -0.0207 125 ARG B CB  
3479 C CG  . ARG B 144 ? 0.3098 0.1513 0.1516 0.0473  0.0440  -0.0137 125 ARG B CG  
3480 C CD  . ARG B 144 ? 0.3043 0.1752 0.1643 0.0209  0.0317  -0.0104 125 ARG B CD  
3481 N NE  . ARG B 144 ? 0.2929 0.1562 0.1759 -0.0128 0.0222  -0.0432 125 ARG B NE  
3482 C CZ  . ARG B 144 ? 0.2691 0.2020 0.1569 -0.0063 0.0348  -0.0184 125 ARG B CZ  
3483 N NH1 . ARG B 144 ? 0.2508 0.2252 0.1709 -0.0362 0.0569  -0.0276 125 ARG B NH1 
3484 N NH2 . ARG B 144 ? 0.2578 0.1568 0.1574 0.0225  0.0118  0.0132  125 ARG B NH2 
3485 N N   . ARG B 145 ? 0.2106 0.1476 0.1267 -0.0123 0.0018  -0.0024 126 ARG B N   
3486 C CA  . ARG B 145 ? 0.2243 0.1140 0.1274 0.0181  -0.0042 0.0061  126 ARG B CA  
3487 C C   . ARG B 145 ? 0.2423 0.1384 0.1322 0.0281  0.0096  -0.0052 126 ARG B C   
3488 O O   . ARG B 145 ? 0.2676 0.1580 0.1615 0.0230  -0.0043 -0.0114 126 ARG B O   
3489 C CB  . ARG B 145 ? 0.2687 0.0917 0.1325 0.0464  0.0019  0.0029  126 ARG B CB  
3490 C CG  . ARG B 145 ? 0.2804 0.1131 0.1617 0.0112  0.0082  -0.0006 126 ARG B CG  
3491 C CD  . ARG B 145 ? 0.2851 0.1116 0.1785 -0.0217 0.0105  0.0060  126 ARG B CD  
3492 N NE  . ARG B 145 ? 0.2859 0.1152 0.2007 -0.0481 0.0438  -0.0073 126 ARG B NE  
3493 C CZ  . ARG B 145 ? 0.2535 0.1239 0.1739 -0.0296 0.0268  0.0018  126 ARG B CZ  
3494 N NH1 . ARG B 145 ? 0.2710 0.1570 0.1768 -0.0271 0.0231  -0.0214 126 ARG B NH1 
3495 N NH2 . ARG B 145 ? 0.2706 0.1235 0.1687 -0.0455 0.0295  -0.0257 126 ARG B NH2 
3496 N N   . ILE B 146 ? 0.2197 0.1246 0.1562 0.0064  0.0256  -0.0277 127 ILE B N   
3497 C CA  . ILE B 146 ? 0.1769 0.1382 0.1210 0.0155  0.0385  -0.0201 127 ILE B CA  
3498 C C   . ILE B 146 ? 0.1778 0.1398 0.1242 0.0153  0.0253  0.0006  127 ILE B C   
3499 O O   . ILE B 146 ? 0.1809 0.1502 0.1406 0.0234  0.0075  0.0085  127 ILE B O   
3500 C CB  . ILE B 146 ? 0.1681 0.1407 0.0953 0.0034  0.0524  0.0051  127 ILE B CB  
3501 C CG1 . ILE B 146 ? 0.2016 0.1567 0.1065 -0.0278 0.0168  0.0025  127 ILE B CG1 
3502 C CG2 . ILE B 146 ? 0.1823 0.1706 0.1405 -0.0105 0.0393  0.0159  127 ILE B CG2 
3503 C CD1 . ILE B 146 ? 0.2399 0.1545 0.1149 0.0066  0.0323  0.0030  127 ILE B CD1 
3504 N N   . THR B 147 ? 0.2396 0.1210 0.1281 -0.0657 0.0516  0.0017  128 THR B N   
3505 C CA  . THR B 147 ? 0.2553 0.1371 0.1231 -0.0552 0.0643  -0.0219 128 THR B CA  
3506 C C   . THR B 147 ? 0.2534 0.1330 0.1277 -0.0132 0.0442  -0.0434 128 THR B C   
3507 O O   . THR B 147 ? 0.3027 0.1388 0.1374 -0.0212 0.0250  -0.0140 128 THR B O   
3508 C CB  . THR B 147 ? 0.2402 0.1785 0.1282 -0.0123 0.0353  -0.0343 128 THR B CB  
3509 O OG1 . THR B 147 ? 0.2469 0.1732 0.1650 0.0240  0.0300  -0.0220 128 THR B OG1 
3510 C CG2 . THR B 147 ? 0.2896 0.1857 0.1053 -0.0192 0.0170  -0.0345 128 THR B CG2 
3511 N N   . LEU B 148 ? 0.2461 0.1469 0.1299 0.0126  0.0357  -0.0669 129 LEU B N   
3512 C CA  . LEU B 148 ? 0.2223 0.1481 0.1543 0.0142  0.0448  -0.0527 129 LEU B CA  
3513 C C   . LEU B 148 ? 0.2364 0.1529 0.1513 -0.0016 0.0502  0.0031  129 LEU B C   
3514 O O   . LEU B 148 ? 0.2370 0.1850 0.1492 -0.0249 0.0306  -0.0077 129 LEU B O   
3515 C CB  . LEU B 148 ? 0.2138 0.1322 0.1737 0.0292  0.0506  -0.0454 129 LEU B CB  
3516 C CG  . LEU B 148 ? 0.2401 0.1495 0.1958 0.0499  0.0618  -0.0228 129 LEU B CG  
3517 C CD1 . LEU B 148 ? 0.2854 0.1781 0.2049 0.0699  0.0710  -0.0169 129 LEU B CD1 
3518 C CD2 . LEU B 148 ? 0.2529 0.1693 0.1997 0.0104  0.0605  -0.0182 129 LEU B CD2 
3519 N N   . GLY B 149 ? 0.2476 0.1340 0.1434 0.0334  0.0298  0.0037  130 GLY B N   
3520 C CA  . GLY B 149 ? 0.2598 0.1651 0.1369 0.0465  0.0511  -0.0289 130 GLY B CA  
3521 C C   . GLY B 149 ? 0.2796 0.1784 0.1421 0.0470  0.0637  -0.0064 130 GLY B C   
3522 O O   . GLY B 149 ? 0.3342 0.2213 0.1750 0.0805  0.0145  -0.0410 130 GLY B O   
3523 N N   A MET B 150 ? 0.2319 0.1663 0.1166 0.0214  0.0578  -0.0110 131 MET B N   
3524 N N   B MET B 150 ? 0.2334 0.1515 0.1014 0.0173  0.0598  -0.0091 131 MET B N   
3525 C CA  A MET B 150 ? 0.2467 0.1790 0.1345 0.0102  0.0486  -0.0058 131 MET B CA  
3526 C CA  B MET B 150 ? 0.2496 0.1496 0.1116 -0.0032 0.0594  -0.0032 131 MET B CA  
3527 C C   A MET B 150 ? 0.2511 0.1847 0.1407 0.0182  0.0227  0.0020  131 MET B C   
3528 C C   B MET B 150 ? 0.2540 0.1752 0.1308 0.0096  0.0293  0.0052  131 MET B C   
3529 O O   A MET B 150 ? 0.2373 0.1938 0.1593 0.0023  0.0372  0.0034  131 MET B O   
3530 O O   B MET B 150 ? 0.2378 0.1898 0.1518 -0.0145 0.0468  0.0119  131 MET B O   
3531 C CB  A MET B 150 ? 0.2509 0.1900 0.1566 -0.0076 0.0435  -0.0034 131 MET B CB  
3532 C CB  B MET B 150 ? 0.2531 0.1233 0.1191 -0.0284 0.0674  0.0021  131 MET B CB  
3533 C CG  A MET B 150 ? 0.2647 0.1900 0.1676 0.0025  0.0091  -0.0129 131 MET B CG  
3534 C CG  B MET B 150 ? 0.2314 0.1042 0.1204 -0.0206 0.0281  -0.0064 131 MET B CG  
3535 S SD  A MET B 150 ? 0.2708 0.1979 0.1869 0.0268  -0.0164 -0.0290 131 MET B SD  
3536 S SD  B MET B 150 ? 0.2040 0.1107 0.1358 -0.0169 0.0093  -0.0272 131 MET B SD  
3537 C CE  A MET B 150 ? 0.3047 0.2373 0.2214 0.0382  -0.0006 -0.0138 131 MET B CE  
3538 C CE  B MET B 150 ? 0.1420 0.0590 0.1057 0.0157  0.0057  -0.0068 131 MET B CE  
3539 N N   . THR B 151 ? 0.2730 0.1580 0.1308 0.0008  0.0036  0.0037  132 THR B N   
3540 C CA  . THR B 151 ? 0.2532 0.1908 0.1366 -0.0205 -0.0007 -0.0108 132 THR B CA  
3541 C C   . THR B 151 ? 0.2500 0.1866 0.1463 -0.0246 0.0311  -0.0164 132 THR B C   
3542 O O   . THR B 151 ? 0.2355 0.1618 0.1322 -0.0368 0.0243  0.0136  132 THR B O   
3543 C CB  . THR B 151 ? 0.2948 0.1961 0.1092 -0.0081 -0.0127 0.0061  132 THR B CB  
3544 O OG1 . THR B 151 ? 0.3219 0.1425 0.1035 -0.0176 0.0118  0.0045  132 THR B OG1 
3545 C CG2 . THR B 151 ? 0.3294 0.1748 0.1154 0.0160  -0.0189 0.0311  132 THR B CG2 
3546 N N   . ASP B 152 ? 0.1946 0.1950 0.1811 -0.0290 0.0201  -0.0207 133 ASP B N   
3547 C CA  . ASP B 152 ? 0.2265 0.2141 0.1913 -0.0414 0.0208  -0.0226 133 ASP B CA  
3548 C C   . ASP B 152 ? 0.2126 0.1902 0.1682 -0.0161 0.0117  -0.0258 133 ASP B C   
3549 O O   . ASP B 152 ? 0.2751 0.1548 0.1560 -0.0076 0.0276  0.0022  133 ASP B O   
3550 C CB  . ASP B 152 ? 0.2773 0.2543 0.2242 -0.0484 0.0485  0.0042  133 ASP B CB  
3551 C CG  . ASP B 152 ? 0.2671 0.3077 0.2861 -0.0407 0.0691  0.0328  133 ASP B CG  
3552 O OD1 . ASP B 152 ? 0.2666 0.3063 0.3058 0.0016  0.0501  0.0178  133 ASP B OD1 
3553 O OD2 . ASP B 152 ? 0.2940 0.3750 0.3114 -0.0402 0.0712  0.0095  133 ASP B OD2 
3554 N N   . ARG B 153 ? 0.2423 0.1895 0.1681 -0.0107 -0.0104 -0.0100 134 ARG B N   
3555 C CA  . ARG B 153 ? 0.2301 0.1804 0.1795 0.0023  -0.0124 0.0171  134 ARG B CA  
3556 C C   . ARG B 153 ? 0.2082 0.1655 0.1478 0.0053  0.0051  -0.0079 134 ARG B C   
3557 O O   . ARG B 153 ? 0.2363 0.1346 0.1600 -0.0164 0.0144  -0.0196 134 ARG B O   
3558 C CB  . ARG B 153 ? 0.2314 0.1847 0.1879 0.0294  -0.0399 0.0018  134 ARG B CB  
3559 C CG  . ARG B 153 ? 0.1543 0.2106 0.2156 0.0525  -0.0269 -0.0027 134 ARG B CG  
3560 C CD  . ARG B 153 ? 0.1974 0.2122 0.2312 0.0700  -0.0240 0.0015  134 ARG B CD  
3561 N NE  . ARG B 153 ? 0.2108 0.2069 0.2254 0.0572  -0.0381 0.0014  134 ARG B NE  
3562 C CZ  . ARG B 153 ? 0.2258 0.2107 0.2236 0.0122  0.0142  0.0045  134 ARG B CZ  
3563 N NH1 . ARG B 153 ? 0.2016 0.2089 0.2421 -0.0113 0.0266  -0.0047 134 ARG B NH1 
3564 N NH2 . ARG B 153 ? 0.2250 0.2259 0.2115 -0.0319 0.0467  0.0227  134 ARG B NH2 
3565 N N   . TRP B 154 ? 0.2176 0.1343 0.1500 -0.0462 0.0023  -0.0053 135 TRP B N   
3566 C CA  . TRP B 154 ? 0.1913 0.1245 0.1505 -0.0141 -0.0247 -0.0191 135 TRP B CA  
3567 C C   . TRP B 154 ? 0.1771 0.1406 0.1356 0.0034  -0.0135 0.0191  135 TRP B C   
3568 O O   . TRP B 154 ? 0.1874 0.1607 0.1358 -0.0254 -0.0024 0.0046  135 TRP B O   
3569 C CB  . TRP B 154 ? 0.2062 0.1212 0.1553 -0.0555 -0.0305 -0.0151 135 TRP B CB  
3570 C CG  . TRP B 154 ? 0.1683 0.1381 0.1438 -0.0309 -0.0077 -0.0052 135 TRP B CG  
3571 C CD1 . TRP B 154 ? 0.1953 0.1563 0.1248 -0.0409 0.0015  -0.0246 135 TRP B CD1 
3572 C CD2 . TRP B 154 ? 0.1653 0.1602 0.1341 -0.0254 0.0010  0.0109  135 TRP B CD2 
3573 N NE1 . TRP B 154 ? 0.1794 0.1795 0.0997 -0.0231 0.0020  -0.0167 135 TRP B NE1 
3574 C CE2 . TRP B 154 ? 0.1836 0.1780 0.1078 0.0055  0.0280  -0.0021 135 TRP B CE2 
3575 C CE3 . TRP B 154 ? 0.1853 0.1320 0.1286 0.0051  0.0184  -0.0141 135 TRP B CE3 
3576 C CZ2 . TRP B 154 ? 0.1747 0.1863 0.1248 -0.0045 0.0392  -0.0204 135 TRP B CZ2 
3577 C CZ3 . TRP B 154 ? 0.2029 0.1437 0.1318 -0.0495 0.0479  -0.0139 135 TRP B CZ3 
3578 C CH2 . TRP B 154 ? 0.1393 0.1780 0.1254 -0.0326 0.0706  -0.0152 135 TRP B CH2 
3579 N N   . ARG B 155 ? 0.1566 0.1364 0.1160 0.0122  -0.0015 -0.0021 136 ARG B N   
3580 C CA  A ARG B 155 ? 0.1920 0.1562 0.1490 0.0136  0.0419  -0.0155 136 ARG B CA  
3581 C CA  B ARG B 155 ? 0.1876 0.1353 0.1276 0.0216  0.0340  -0.0249 136 ARG B CA  
3582 C C   . ARG B 155 ? 0.1929 0.1405 0.1293 -0.0012 0.0311  -0.0049 136 ARG B C   
3583 O O   . ARG B 155 ? 0.1884 0.1673 0.1123 0.0250  0.0055  0.0242  136 ARG B O   
3584 C CB  A ARG B 155 ? 0.1976 0.1975 0.1960 -0.0065 0.0819  -0.0220 136 ARG B CB  
3585 C CB  B ARG B 155 ? 0.1800 0.1363 0.1288 0.0130  0.0558  -0.0490 136 ARG B CB  
3586 C CG  A ARG B 155 ? 0.2236 0.2532 0.2305 -0.0011 0.0797  -0.0094 136 ARG B CG  
3587 C CG  B ARG B 155 ? 0.2086 0.1537 0.1148 0.0352  0.0460  -0.0483 136 ARG B CG  
3588 C CD  A ARG B 155 ? 0.2681 0.2917 0.2777 0.0340  0.0725  0.0068  136 ARG B CD  
3589 C CD  B ARG B 155 ? 0.2411 0.1456 0.1357 0.0606  0.0462  -0.0386 136 ARG B CD  
3590 N NE  A ARG B 155 ? 0.2384 0.3200 0.2986 0.0144  0.0749  0.0110  136 ARG B NE  
3591 N NE  B ARG B 155 ? 0.2298 0.1160 0.1063 0.0312  0.0532  -0.0250 136 ARG B NE  
3592 C CZ  A ARG B 155 ? 0.2996 0.3676 0.3094 0.0073  0.0767  0.0167  136 ARG B CZ  
3593 C CZ  B ARG B 155 ? 0.2242 0.1607 0.1044 0.0076  0.0640  0.0111  136 ARG B CZ  
3594 N NH1 A ARG B 155 ? 0.3413 0.3710 0.3133 0.0051  0.0748  0.0164  136 ARG B NH1 
3595 N NH1 B ARG B 155 ? 0.2722 0.2046 0.1448 -0.0078 0.0823  -0.0017 136 ARG B NH1 
3596 N NH2 A ARG B 155 ? 0.3076 0.4005 0.3251 0.0034  0.0878  0.0242  136 ARG B NH2 
3597 N NH2 B ARG B 155 ? 0.2318 0.1967 0.1145 0.0492  0.0734  0.0431  136 ARG B NH2 
3598 N N   . ALA B 156 ? 0.1909 0.1391 0.1406 -0.0155 0.0242  -0.0344 137 ALA B N   
3599 C CA  . ALA B 156 ? 0.1853 0.1214 0.1387 -0.0137 0.0422  -0.0146 137 ALA B CA  
3600 C C   . ALA B 156 ? 0.1752 0.1260 0.1295 -0.0009 0.0116  0.0004  137 ALA B C   
3601 O O   . ALA B 156 ? 0.1945 0.1447 0.1102 -0.0157 -0.0034 0.0028  137 ALA B O   
3602 C CB  . ALA B 156 ? 0.1869 0.1157 0.1591 -0.0125 0.0347  0.0262  137 ALA B CB  
3603 N N   . ARG B 157 ? 0.1345 0.1255 0.1394 -0.0053 0.0152  0.0086  138 ARG B N   
3604 C CA  . ARG B 157 ? 0.1246 0.1253 0.1325 0.0221  0.0017  0.0040  138 ARG B CA  
3605 C C   . ARG B 157 ? 0.1339 0.1002 0.1176 0.0316  0.0262  0.0089  138 ARG B C   
3606 O O   . ARG B 157 ? 0.1399 0.1305 0.1198 -0.0008 0.0169  0.0267  138 ARG B O   
3607 C CB  . ARG B 157 ? 0.1741 0.1305 0.1258 0.0110  0.0026  0.0256  138 ARG B CB  
3608 C CG  . ARG B 157 ? 0.2066 0.1513 0.1278 -0.0243 -0.0074 -0.0212 138 ARG B CG  
3609 C CD  . ARG B 157 ? 0.2057 0.1496 0.1446 0.0007  -0.0232 -0.0617 138 ARG B CD  
3610 N NE  . ARG B 157 ? 0.2098 0.1282 0.1537 0.0284  -0.0389 -0.0457 138 ARG B NE  
3611 C CZ  . ARG B 157 ? 0.2230 0.1345 0.1481 -0.0131 -0.0339 -0.0195 138 ARG B CZ  
3612 N NH1 . ARG B 157 ? 0.2288 0.1875 0.1608 -0.0027 -0.0129 0.0103  138 ARG B NH1 
3613 N NH2 . ARG B 157 ? 0.2199 0.1029 0.1605 -0.0056 -0.0560 -0.0469 138 ARG B NH2 
3614 N N   . ALA B 158 ? 0.1316 0.0867 0.1337 -0.0032 0.0257  -0.0021 139 ALA B N   
3615 C CA  . ALA B 158 ? 0.1216 0.0985 0.1396 -0.0259 -0.0144 -0.0436 139 ALA B CA  
3616 C C   . ALA B 158 ? 0.1538 0.1228 0.1295 -0.0174 -0.0043 -0.0214 139 ALA B C   
3617 O O   . ALA B 158 ? 0.1664 0.1283 0.1069 -0.0272 0.0187  -0.0048 139 ALA B O   
3618 C CB  . ALA B 158 ? 0.1187 0.1101 0.1423 -0.0165 -0.0181 -0.0423 139 ALA B CB  
3619 N N   . ALA B 159 ? 0.1559 0.1193 0.1307 -0.0224 -0.0033 -0.0228 140 ALA B N   
3620 C CA  . ALA B 159 ? 0.1483 0.1353 0.1449 -0.0091 0.0340  -0.0321 140 ALA B CA  
3621 C C   . ALA B 159 ? 0.1745 0.1004 0.1501 -0.0097 -0.0165 -0.0195 140 ALA B C   
3622 O O   . ALA B 159 ? 0.2052 0.1366 0.1298 0.0079  -0.0264 0.0018  140 ALA B O   
3623 C CB  . ALA B 159 ? 0.1150 0.1608 0.1390 -0.0158 0.0533  -0.0252 140 ALA B CB  
3624 N N   . CYS B 160 ? 0.1983 0.0776 0.1510 0.0236  0.0531  -0.0196 141 CYS B N   
3625 C CA  . CYS B 160 ? 0.2161 0.0880 0.1327 0.0038  0.0569  -0.0046 141 CYS B CA  
3626 C C   . CYS B 160 ? 0.1864 0.1329 0.1419 -0.0150 0.0209  -0.0089 141 CYS B C   
3627 O O   . CYS B 160 ? 0.1839 0.1235 0.1245 -0.0032 0.0190  0.0171  141 CYS B O   
3628 C CB  . CYS B 160 ? 0.2474 0.0904 0.1396 -0.0022 0.0536  -0.0261 141 CYS B CB  
3629 S SG  . CYS B 160 ? 0.2494 0.1473 0.1648 -0.0311 0.0202  -0.0052 141 CYS B SG  
3630 N N   . ASN B 161 ? 0.1108 0.1367 0.1376 -0.0189 0.0095  -0.0068 142 ASN B N   
3631 C CA  . ASN B 161 ? 0.0746 0.1514 0.1525 0.0124  0.0019  0.0163  142 ASN B CA  
3632 C C   . ASN B 161 ? 0.1140 0.1311 0.1454 0.0166  0.0055  -0.0041 142 ASN B C   
3633 O O   . ASN B 161 ? 0.1734 0.1359 0.1373 0.0143  0.0271  -0.0113 142 ASN B O   
3634 C CB  . ASN B 161 ? 0.0529 0.1729 0.1533 -0.0040 -0.0124 -0.0059 142 ASN B CB  
3635 C CG  . ASN B 161 ? 0.0882 0.1708 0.1414 0.0276  -0.0287 -0.0017 142 ASN B CG  
3636 O OD1 . ASN B 161 ? 0.1666 0.1857 0.1588 0.0259  0.0016  -0.0163 142 ASN B OD1 
3637 N ND2 . ASN B 161 ? 0.1323 0.1700 0.1552 -0.0111 -0.0273 0.0194  142 ASN B ND2 
3638 N N   . TRP B 162 ? 0.1114 0.1344 0.1583 0.0362  -0.0042 -0.0176 143 TRP B N   
3639 C CA  . TRP B 162 ? 0.1499 0.1485 0.1418 0.0435  0.0117  -0.0247 143 TRP B CA  
3640 C C   . TRP B 162 ? 0.1732 0.1515 0.1404 0.0346  -0.0048 0.0030  143 TRP B C   
3641 O O   . TRP B 162 ? 0.1474 0.1623 0.1434 0.0228  0.0057  0.0229  143 TRP B O   
3642 C CB  . TRP B 162 ? 0.1644 0.1517 0.1456 0.0425  0.0046  -0.0313 143 TRP B CB  
3643 C CG  . TRP B 162 ? 0.1817 0.1191 0.1354 0.0335  -0.0245 -0.0213 143 TRP B CG  
3644 C CD1 . TRP B 162 ? 0.2208 0.1527 0.1302 0.0118  0.0066  -0.0302 143 TRP B CD1 
3645 C CD2 . TRP B 162 ? 0.1783 0.1326 0.1343 -0.0046 -0.0039 -0.0155 143 TRP B CD2 
3646 N NE1 . TRP B 162 ? 0.2375 0.1242 0.1458 0.0014  -0.0017 0.0011  143 TRP B NE1 
3647 C CE2 . TRP B 162 ? 0.2001 0.1123 0.1513 0.0161  -0.0018 0.0049  143 TRP B CE2 
3648 C CE3 . TRP B 162 ? 0.2361 0.1198 0.1544 0.0234  0.0014  -0.0007 143 TRP B CE3 
3649 C CZ2 . TRP B 162 ? 0.2641 0.0888 0.1526 0.0270  0.0108  0.0130  143 TRP B CZ2 
3650 C CZ3 . TRP B 162 ? 0.2546 0.1094 0.1636 0.0224  0.0121  -0.0062 143 TRP B CZ3 
3651 C CH2 . TRP B 162 ? 0.2649 0.1236 0.1565 -0.0013 -0.0044 -0.0070 143 TRP B CH2 
3652 N N   . GLU B 163 ? 0.1478 0.1188 0.1415 0.0052  -0.0083 -0.0062 144 GLU B N   
3653 C CA  . GLU B 163 ? 0.1609 0.1211 0.1417 -0.0301 0.0073  -0.0160 144 GLU B CA  
3654 C C   . GLU B 163 ? 0.1461 0.1511 0.1420 0.0034  0.0147  0.0082  144 GLU B C   
3655 O O   . GLU B 163 ? 0.1970 0.1581 0.1132 -0.0004 0.0003  0.0034  144 GLU B O   
3656 C CB  . GLU B 163 ? 0.1353 0.1246 0.1537 -0.0464 -0.0161 -0.0009 144 GLU B CB  
3657 C CG  . GLU B 163 ? 0.1975 0.1117 0.1418 -0.0344 -0.0134 0.0079  144 GLU B CG  
3658 C CD  . GLU B 163 ? 0.2616 0.1765 0.1874 -0.0491 -0.0220 0.0161  144 GLU B CD  
3659 O OE1 . GLU B 163 ? 0.2390 0.1488 0.2293 0.0142  0.0027  -0.0133 144 GLU B OE1 
3660 O OE2 . GLU B 163 ? 0.3578 0.2415 0.2031 -0.1057 -0.0147 0.0289  144 GLU B OE2 
3661 N N   . TYR B 164 ? 0.0831 0.1391 0.1310 -0.0172 0.0198  0.0250  145 TYR B N   
3662 C CA  . TYR B 164 ? 0.0806 0.1121 0.1628 0.0114  0.0307  0.0327  145 TYR B CA  
3663 C C   . TYR B 164 ? 0.1404 0.1327 0.1515 -0.0112 0.0114  0.0108  145 TYR B C   
3664 O O   . TYR B 164 ? 0.1266 0.1776 0.1404 0.0347  -0.0127 0.0077  145 TYR B O   
3665 C CB  . TYR B 164 ? 0.0970 0.1392 0.1749 0.0196  0.0015  0.0136  145 TYR B CB  
3666 C CG  . TYR B 164 ? 0.1413 0.1581 0.1513 -0.0123 0.0081  -0.0058 145 TYR B CG  
3667 C CD1 . TYR B 164 ? 0.1376 0.1608 0.1270 -0.0086 0.0294  0.0216  145 TYR B CD1 
3668 C CD2 . TYR B 164 ? 0.1461 0.2044 0.1709 0.0161  0.0230  -0.0155 145 TYR B CD2 
3669 C CE1 . TYR B 164 ? 0.0957 0.1607 0.1429 -0.0014 -0.0112 0.0304  145 TYR B CE1 
3670 C CE2 . TYR B 164 ? 0.1627 0.2038 0.1584 -0.0040 0.0396  -0.0128 145 TYR B CE2 
3671 C CZ  . TYR B 164 ? 0.1049 0.1641 0.1364 -0.0135 0.0196  0.0055  145 TYR B CZ  
3672 O OH  . TYR B 164 ? 0.1515 0.1741 0.1893 0.0079  0.0206  -0.0071 145 TYR B OH  
3673 N N   . TYR B 165 ? 0.0991 0.1063 0.1701 -0.0120 0.0198  0.0035  146 TYR B N   
3674 C CA  . TYR B 165 ? 0.1323 0.1361 0.1401 -0.0250 -0.0099 -0.0087 146 TYR B CA  
3675 C C   . TYR B 165 ? 0.1343 0.1401 0.1214 -0.0017 -0.0106 -0.0064 146 TYR B C   
3676 O O   . TYR B 165 ? 0.1870 0.1723 0.1140 0.0053  -0.0097 -0.0061 146 TYR B O   
3677 C CB  . TYR B 165 ? 0.1491 0.1036 0.1492 -0.0189 -0.0082 -0.0130 146 TYR B CB  
3678 C CG  . TYR B 165 ? 0.1719 0.1172 0.1278 -0.0156 0.0084  -0.0165 146 TYR B CG  
3679 C CD1 . TYR B 165 ? 0.1827 0.1383 0.1435 -0.0309 -0.0281 -0.0230 146 TYR B CD1 
3680 C CD2 . TYR B 165 ? 0.1820 0.1392 0.1537 0.0049  -0.0159 0.0119  146 TYR B CD2 
3681 C CE1 . TYR B 165 ? 0.1996 0.1332 0.1533 -0.0249 -0.0412 -0.0262 146 TYR B CE1 
3682 C CE2 . TYR B 165 ? 0.1710 0.1244 0.1646 -0.0255 0.0131  0.0137  146 TYR B CE2 
3683 C CZ  . TYR B 165 ? 0.1907 0.1217 0.1661 -0.0154 0.0160  -0.0018 146 TYR B CZ  
3684 O OH  . TYR B 165 ? 0.1906 0.1448 0.1710 -0.0199 0.0004  -0.0032 146 TYR B OH  
3685 N N   . PHE B 166 ? 0.1219 0.1325 0.1472 0.0322  -0.0121 -0.0119 147 PHE B N   
3686 C CA  . PHE B 166 ? 0.1389 0.1396 0.1237 0.0339  -0.0198 -0.0064 147 PHE B CA  
3687 C C   . PHE B 166 ? 0.1605 0.0994 0.1397 0.0224  -0.0242 0.0220  147 PHE B C   
3688 O O   . PHE B 166 ? 0.1370 0.1381 0.1683 0.0147  -0.0225 0.0154  147 PHE B O   
3689 C CB  . PHE B 166 ? 0.1343 0.1519 0.1020 0.0095  0.0511  -0.0258 147 PHE B CB  
3690 C CG  . PHE B 166 ? 0.1491 0.1433 0.1263 0.0219  0.0289  -0.0510 147 PHE B CG  
3691 C CD1 . PHE B 166 ? 0.1897 0.1405 0.1512 0.0065  -0.0009 -0.0396 147 PHE B CD1 
3692 C CD2 . PHE B 166 ? 0.1513 0.2027 0.1124 0.0142  -0.0195 -0.0684 147 PHE B CD2 
3693 C CE1 . PHE B 166 ? 0.1965 0.1700 0.1480 0.0240  0.0106  -0.0201 147 PHE B CE1 
3694 C CE2 . PHE B 166 ? 0.1832 0.1912 0.1500 -0.0048 -0.0187 -0.0508 147 PHE B CE2 
3695 C CZ  . PHE B 166 ? 0.2191 0.1686 0.1401 0.0124  0.0075  -0.0380 147 PHE B CZ  
3696 N N   . ALA B 167 ? 0.1312 0.0911 0.1391 0.0093  0.0086  0.0014  148 ALA B N   
3697 C CA  . ALA B 167 ? 0.1507 0.1170 0.1396 -0.0102 0.0036  0.0002  148 ALA B CA  
3698 C C   . ALA B 167 ? 0.1332 0.1554 0.1438 -0.0049 0.0070  0.0096  148 ALA B C   
3699 O O   . ALA B 167 ? 0.1155 0.1454 0.1416 -0.0170 -0.0181 -0.0023 148 ALA B O   
3700 C CB  . ALA B 167 ? 0.1519 0.1164 0.1582 -0.0085 0.0210  0.0164  148 ALA B CB  
3701 N N   . CYS B 168 ? 0.0905 0.1626 0.1512 0.0397  0.0409  0.0186  149 CYS B N   
3702 C CA  . CYS B 168 ? 0.1029 0.1789 0.1490 0.0225  0.0375  0.0145  149 CYS B CA  
3703 C C   . CYS B 168 ? 0.1411 0.1786 0.1334 0.0358  -0.0157 0.0109  149 CYS B C   
3704 O O   . CYS B 168 ? 0.1697 0.1810 0.1208 0.0124  -0.0264 0.0137  149 CYS B O   
3705 C CB  . CYS B 168 ? 0.1398 0.1982 0.1685 0.0529  0.0108  0.0490  149 CYS B CB  
3706 S SG  . CYS B 168 ? 0.1621 0.2063 0.1608 0.0233  0.0078  0.0073  149 CYS B SG  
3707 N N   . HIS B 169 ? 0.1513 0.1460 0.1348 0.0480  -0.0385 0.0370  150 HIS B N   
3708 C CA  . HIS B 169 ? 0.1654 0.1569 0.1171 0.0166  -0.0037 0.0092  150 HIS B CA  
3709 C C   . HIS B 169 ? 0.1491 0.1938 0.1335 0.0082  -0.0044 0.0033  150 HIS B C   
3710 O O   . HIS B 169 ? 0.1417 0.2167 0.1263 0.0112  0.0071  -0.0099 150 HIS B O   
3711 C CB  . HIS B 169 ? 0.2093 0.1444 0.1303 0.0020  -0.0090 -0.0146 150 HIS B CB  
3712 C CG  . HIS B 169 ? 0.2012 0.1557 0.1135 -0.0320 -0.0252 -0.0069 150 HIS B CG  
3713 N ND1 . HIS B 169 ? 0.2314 0.1685 0.1361 -0.0364 -0.0434 0.0088  150 HIS B ND1 
3714 C CD2 . HIS B 169 ? 0.2460 0.1966 0.1554 -0.0419 -0.0678 -0.0056 150 HIS B CD2 
3715 C CE1 . HIS B 169 ? 0.2779 0.1934 0.1517 -0.0268 -0.0570 0.0325  150 HIS B CE1 
3716 N NE2 . HIS B 169 ? 0.2873 0.2321 0.1631 -0.0484 -0.0649 0.0277  150 HIS B NE2 
3717 N N   . PRO B 170 ? 0.1323 0.2132 0.1190 0.0005  0.0145  -0.0022 151 PRO B N   
3718 C CA  . PRO B 170 ? 0.1041 0.1889 0.1340 0.0058  0.0190  0.0116  151 PRO B CA  
3719 C C   . PRO B 170 ? 0.0955 0.1927 0.1180 0.0532  0.0109  0.0331  151 PRO B C   
3720 O O   . PRO B 170 ? 0.0962 0.1906 0.1291 0.0385  0.0293  0.0309  151 PRO B O   
3721 C CB  . PRO B 170 ? 0.1372 0.1927 0.1318 0.0012  0.0107  0.0092  151 PRO B CB  
3722 C CG  . PRO B 170 ? 0.0907 0.1786 0.1244 0.0480  0.0101  0.0140  151 PRO B CG  
3723 C CD  . PRO B 170 ? 0.1280 0.2179 0.1500 -0.0062 -0.0030 0.0363  151 PRO B CD  
3724 N N   . ALA B 171 ? 0.1287 0.1717 0.1301 0.0506  0.0211  0.0268  152 ALA B N   
3725 C CA  . ALA B 171 ? 0.1373 0.1996 0.1273 0.0378  0.0056  0.0237  152 ALA B CA  
3726 C C   . ALA B 171 ? 0.1569 0.1841 0.1149 -0.0042 -0.0325 0.0211  152 ALA B C   
3727 O O   . ALA B 171 ? 0.1587 0.1738 0.1231 -0.0066 -0.0069 0.0289  152 ALA B O   
3728 C CB  . ALA B 171 ? 0.1227 0.2180 0.1323 0.0617  0.0284  0.0485  152 ALA B CB  
3729 N N   . GLU B 172 ? 0.1842 0.1563 0.1667 -0.0136 -0.0361 -0.0047 153 GLU B N   
3730 C CA  . GLU B 172 ? 0.1665 0.1882 0.1706 -0.0070 -0.0298 0.0047  153 GLU B CA  
3731 C C   . GLU B 172 ? 0.1920 0.1884 0.1792 0.0001  -0.0135 0.0316  153 GLU B C   
3732 O O   . GLU B 172 ? 0.2129 0.2283 0.1679 -0.0190 -0.0038 0.0213  153 GLU B O   
3733 C CB  . GLU B 172 ? 0.1565 0.2251 0.1776 -0.0586 -0.0268 -0.0028 153 GLU B CB  
3734 C CG  . GLU B 172 ? 0.2124 0.2613 0.2163 -0.0818 -0.0350 -0.0166 153 GLU B CG  
3735 C CD  . GLU B 172 ? 0.2748 0.3555 0.2907 -0.0983 -0.0067 0.0013  153 GLU B CD  
3736 O OE1 . GLU B 172 ? 0.2922 0.4011 0.3386 -0.0632 -0.0167 0.0222  153 GLU B OE1 
3737 O OE2 . GLU B 172 ? 0.3302 0.4205 0.3098 -0.1313 -0.0054 0.0086  153 GLU B OE2 
3738 N N   . ALA B 173 ? 0.2196 0.1670 0.1725 0.0324  -0.0293 0.0336  154 ALA B N   
3739 C CA  . ALA B 173 ? 0.2199 0.1741 0.1433 0.0381  -0.0128 0.0352  154 ALA B CA  
3740 C C   . ALA B 173 ? 0.2236 0.1762 0.1378 0.0180  0.0116  0.0332  154 ALA B C   
3741 O O   . ALA B 173 ? 0.2184 0.2245 0.1469 0.0168  0.0092  0.0501  154 ALA B O   
3742 C CB  . ALA B 173 ? 0.1701 0.1975 0.1778 0.0423  0.0008  0.0277  154 ALA B CB  
3743 N N   . ALA B 174 ? 0.2077 0.1752 0.1258 0.0195  0.0141  0.0193  155 ALA B N   
3744 C CA  . ALA B 174 ? 0.2142 0.1904 0.1379 -0.0222 0.0030  0.0109  155 ALA B CA  
3745 C C   . ALA B 174 ? 0.2311 0.2190 0.1588 0.0114  0.0001  0.0255  155 ALA B C   
3746 O O   . ALA B 174 ? 0.2619 0.2747 0.1675 0.0073  -0.0096 0.0355  155 ALA B O   
3747 C CB  . ALA B 174 ? 0.2709 0.2050 0.1637 -0.0259 -0.0262 -0.0337 155 ALA B CB  
3748 N N   . GLY B 175 ? 0.2131 0.2243 0.1715 0.0000  0.0082  0.0223  156 GLY B N   
3749 C CA  . GLY B 175 ? 0.2058 0.2816 0.1978 0.0207  0.0358  0.0331  156 GLY B CA  
3750 C C   . GLY B 175 ? 0.2375 0.3338 0.2158 0.0039  0.0720  0.0313  156 GLY B C   
3751 O O   . GLY B 175 ? 0.2593 0.4112 0.2319 -0.0092 0.0809  0.0343  156 GLY B O   
3752 N N   . ARG B 176 ? 0.3265 0.3171 0.2335 -0.0068 0.0564  0.0228  157 ARG B N   
3753 C CA  A ARG B 176 ? 0.3825 0.3429 0.2822 -0.0038 0.0557  0.0233  157 ARG B CA  
3754 C CA  B ARG B 176 ? 0.3587 0.3060 0.2515 -0.0075 0.0570  0.0326  157 ARG B CA  
3755 C C   . ARG B 176 ? 0.3860 0.3489 0.2777 0.0197  0.0642  0.0395  157 ARG B C   
3756 O O   . ARG B 176 ? 0.3825 0.3636 0.3050 -0.0099 0.1067  0.0655  157 ARG B O   
3757 C CB  A ARG B 176 ? 0.4072 0.3677 0.3488 -0.0078 0.0556  0.0272  157 ARG B CB  
3758 C CB  B ARG B 176 ? 0.3445 0.2592 0.2533 -0.0118 0.0595  0.0566  157 ARG B CB  
3759 C CG  A ARG B 176 ? 0.4357 0.4086 0.3913 -0.0167 0.0472  0.0272  157 ARG B CG  
3760 C CG  B ARG B 176 ? 0.3329 0.2394 0.2366 -0.0084 0.0357  0.0634  157 ARG B CG  
3761 C CD  A ARG B 176 ? 0.4656 0.4296 0.4228 -0.0373 0.0366  0.0211  157 ARG B CD  
3762 C CD  B ARG B 176 ? 0.2926 0.2085 0.2219 0.0514  0.0112  0.0920  157 ARG B CD  
3763 N NE  A ARG B 176 ? 0.4931 0.4336 0.4420 -0.0307 0.0410  0.0261  157 ARG B NE  
3764 N NE  B ARG B 176 ? 0.2632 0.2019 0.2074 0.0337  -0.0012 0.0817  157 ARG B NE  
3765 C CZ  A ARG B 176 ? 0.4949 0.4469 0.4584 -0.0145 0.0531  0.0122  157 ARG B CZ  
3766 C CZ  B ARG B 176 ? 0.2235 0.2082 0.1777 0.0047  0.0025  0.0576  157 ARG B CZ  
3767 N NH1 A ARG B 176 ? 0.4977 0.4550 0.4664 -0.0194 0.0560  0.0067  157 ARG B NH1 
3768 N NH1 B ARG B 176 ? 0.2102 0.2070 0.1864 0.0061  0.0081  0.0356  157 ARG B NH1 
3769 N NH2 A ARG B 176 ? 0.5032 0.4571 0.4645 0.0050  0.0452  0.0165  157 ARG B NH2 
3770 N NH2 B ARG B 176 ? 0.1820 0.2343 0.1382 -0.0224 -0.0042 0.0814  157 ARG B NH2 
3771 N N   . THR B 177 ? 0.4119 0.3626 0.2738 0.0605  0.0270  0.0379  158 THR B N   
3772 C CA  . THR B 177 ? 0.4766 0.4153 0.3056 0.0905  -0.0477 0.0155  158 THR B CA  
3773 C C   . THR B 177 ? 0.5667 0.4681 0.3604 0.1269  -0.0436 -0.0068 158 THR B C   
3774 O O   . THR B 177 ? 0.5914 0.4761 0.3497 0.1651  -0.0712 -0.0166 158 THR B O   
3775 C CB  . THR B 177 ? 0.5002 0.4095 0.3158 0.0660  -0.0952 0.0164  158 THR B CB  
3776 O OG1 . THR B 177 ? 0.5402 0.3914 0.3014 0.0397  -0.1283 0.0188  158 THR B OG1 
3777 C CG2 . THR B 177 ? 0.5070 0.4354 0.3381 0.0615  -0.0923 0.0093  158 THR B CG2 
3778 N N   . ILE B 178 ? 0.5796 0.4947 0.4545 0.1310  0.0123  -0.0017 159 ILE B N   
3779 C CA  . ILE B 178 ? 0.5986 0.5338 0.5258 0.0919  0.0611  -0.0122 159 ILE B CA  
3780 C C   . ILE B 178 ? 0.6319 0.5455 0.5447 0.1059  0.0919  -0.0179 159 ILE B C   
3781 O O   . ILE B 178 ? 0.6363 0.5335 0.5590 0.1222  0.1006  -0.0062 159 ILE B O   
3782 C CB  . ILE B 178 ? 0.6032 0.5568 0.5783 0.0567  0.0493  -0.0162 159 ILE B CB  
3783 C CG1 . ILE B 178 ? 0.5918 0.5537 0.6043 0.0214  0.0434  -0.0214 159 ILE B CG1 
3784 C CG2 . ILE B 178 ? 0.6077 0.5636 0.5830 0.0488  0.0487  -0.0153 159 ILE B CG2 
3785 C CD1 . ILE B 178 ? 0.6036 0.5644 0.6204 0.0137  0.0535  -0.0264 159 ILE B CD1 
3786 N N   . PRO B 181 ? 0.6158 0.6244 0.5372 0.0349  0.0459  0.0547  162 PRO B N   
3787 C CA  . PRO B 181 ? 0.5617 0.5918 0.5265 0.0430  0.0320  0.0416  162 PRO B CA  
3788 C C   . PRO B 181 ? 0.4660 0.5429 0.4823 0.0487  0.0204  0.0138  162 PRO B C   
3789 O O   . PRO B 181 ? 0.4584 0.5331 0.4799 0.0304  0.0002  -0.0150 162 PRO B O   
3790 C CB  . PRO B 181 ? 0.6016 0.6099 0.5468 0.0543  0.0350  0.0494  162 PRO B CB  
3791 C CG  . PRO B 181 ? 0.6229 0.6326 0.5530 0.0516  0.0450  0.0558  162 PRO B CG  
3792 C CD  . PRO B 181 ? 0.6386 0.6400 0.5540 0.0423  0.0466  0.0584  162 PRO B CD  
3793 N N   . PRO B 182 ? 0.3817 0.5022 0.4313 0.0448  0.0399  0.0047  163 PRO B N   
3794 C CA  . PRO B 182 ? 0.3679 0.4764 0.4069 0.0078  0.0499  -0.0199 163 PRO B CA  
3795 C C   . PRO B 182 ? 0.4219 0.4420 0.3580 -0.0207 0.0703  -0.0514 163 PRO B C   
3796 O O   . PRO B 182 ? 0.3966 0.4646 0.3641 -0.0100 0.0615  -0.0553 163 PRO B O   
3797 C CB  . PRO B 182 ? 0.3373 0.4724 0.4229 0.0193  0.0612  -0.0079 163 PRO B CB  
3798 C CG  . PRO B 182 ? 0.3496 0.4882 0.4292 0.0532  0.0588  0.0073  163 PRO B CG  
3799 C CD  . PRO B 182 ? 0.3444 0.4889 0.4283 0.0588  0.0721  0.0065  163 PRO B CD  
3800 N N   . ASP B 183 ? 0.4589 0.4074 0.3195 -0.0442 0.0978  -0.0738 164 ASP B N   
3801 C CA  . ASP B 183 ? 0.4576 0.3691 0.3521 -0.0340 0.1084  -0.0707 164 ASP B CA  
3802 C C   . ASP B 183 ? 0.4194 0.3315 0.3820 -0.0090 0.1355  -0.0205 164 ASP B C   
3803 O O   . ASP B 183 ? 0.4249 0.3100 0.3663 0.0242  0.1587  -0.0146 164 ASP B O   
3804 C CB  . ASP B 183 ? 0.5232 0.4146 0.3949 -0.0025 0.0701  -0.0907 164 ASP B CB  
3805 C CG  . ASP B 183 ? 0.5369 0.4472 0.3975 0.0240  0.0645  -0.1262 164 ASP B CG  
3806 O OD1 . ASP B 183 ? 0.5491 0.4748 0.4149 0.0695  0.0436  -0.1349 164 ASP B OD1 
3807 O OD2 . ASP B 183 ? 0.5451 0.4607 0.3763 0.0009  0.1208  -0.1488 164 ASP B OD2 
3808 N N   . ARG B 184 ? 0.3776 0.3127 0.3994 -0.0211 0.1504  0.0066  165 ARG B N   
3809 C CA  . ARG B 184 ? 0.3246 0.3094 0.4192 -0.0296 0.1448  0.0061  165 ARG B CA  
3810 C C   . ARG B 184 ? 0.2918 0.2852 0.3828 -0.0402 0.1337  -0.0125 165 ARG B C   
3811 O O   . ARG B 184 ? 0.2276 0.2899 0.4165 -0.0202 0.1463  0.0091  165 ARG B O   
3812 C CB  . ARG B 184 ? 0.3771 0.3393 0.4495 0.0240  0.1163  0.0115  165 ARG B CB  
3813 C CG  . ARG B 184 ? 0.3919 0.3845 0.4823 0.0345  0.0882  -0.0037 165 ARG B CG  
3814 C CD  . ARG B 184 ? 0.4382 0.4417 0.5075 0.0280  0.0666  -0.0045 165 ARG B CD  
3815 N NE  . ARG B 184 ? 0.4920 0.4696 0.5266 0.0126  0.0563  -0.0159 165 ARG B NE  
3816 C CZ  . ARG B 184 ? 0.5458 0.4671 0.5377 0.0055  0.0472  -0.0218 165 ARG B CZ  
3817 N NH1 . ARG B 184 ? 0.5629 0.4532 0.5525 -0.0246 0.0517  0.0018  165 ARG B NH1 
3818 N NH2 . ARG B 184 ? 0.5530 0.4635 0.5302 0.0277  0.0213  -0.0591 165 ARG B NH2 
3819 N N   . GLU B 185 ? 0.2595 0.2599 0.3449 -0.0435 0.1141  -0.0192 166 GLU B N   
3820 C CA  . GLU B 185 ? 0.2675 0.2527 0.3147 -0.0274 0.0920  -0.0186 166 GLU B CA  
3821 C C   . GLU B 185 ? 0.2109 0.2485 0.2539 -0.0361 0.0617  -0.0061 166 GLU B C   
3822 O O   . GLU B 185 ? 0.1912 0.2793 0.2385 -0.0202 0.0545  0.0074  166 GLU B O   
3823 C CB  . GLU B 185 ? 0.3378 0.3256 0.3905 -0.0133 0.1179  -0.0267 166 GLU B CB  
3824 C CG  . GLU B 185 ? 0.4420 0.4352 0.4622 0.0036  0.1134  -0.0194 166 GLU B CG  
3825 C CD  . GLU B 185 ? 0.5457 0.5395 0.5320 0.0354  0.1164  -0.0302 166 GLU B CD  
3826 O OE1 . GLU B 185 ? 0.6085 0.6017 0.5884 0.0351  0.1151  -0.0339 166 GLU B OE1 
3827 O OE2 . GLU B 185 ? 0.5424 0.5408 0.5438 0.0816  0.1298  -0.0325 166 GLU B OE2 
3828 N N   . GLY B 186 ? 0.2007 0.2295 0.2399 -0.0392 0.0495  -0.0305 167 GLY B N   
3829 C CA  . GLY B 186 ? 0.1919 0.2269 0.2166 -0.0383 0.0321  -0.0289 167 GLY B CA  
3830 C C   . GLY B 186 ? 0.1666 0.2277 0.1937 -0.0327 0.0355  -0.0428 167 GLY B C   
3831 O O   . GLY B 186 ? 0.1352 0.2502 0.1735 0.0071  0.0315  -0.0451 167 GLY B O   
3832 N N   . TYR B 187 ? 0.1860 0.2129 0.1944 -0.0464 0.0179  -0.0317 168 TYR B N   
3833 C CA  . TYR B 187 ? 0.1930 0.2505 0.1889 -0.0925 0.0464  -0.0034 168 TYR B CA  
3834 C C   . TYR B 187 ? 0.1791 0.2678 0.2141 -0.0512 0.0129  -0.0095 168 TYR B C   
3835 O O   . TYR B 187 ? 0.1291 0.2862 0.2177 -0.0320 0.0033  0.0002  168 TYR B O   
3836 C CB  . TYR B 187 ? 0.1972 0.2634 0.2085 -0.0904 0.0777  -0.0015 168 TYR B CB  
3837 C CG  . TYR B 187 ? 0.2177 0.2511 0.2256 -0.0799 0.0763  -0.0110 168 TYR B CG  
3838 C CD1 . TYR B 187 ? 0.2351 0.2560 0.2520 -0.0734 0.0754  -0.0085 168 TYR B CD1 
3839 C CD2 . TYR B 187 ? 0.2701 0.2651 0.2614 -0.0884 0.0414  -0.0163 168 TYR B CD2 
3840 C CE1 . TYR B 187 ? 0.2433 0.2748 0.2781 -0.0842 0.0805  -0.0068 168 TYR B CE1 
3841 C CE2 . TYR B 187 ? 0.2682 0.2859 0.2787 -0.0645 0.0558  -0.0460 168 TYR B CE2 
3842 C CZ  . TYR B 187 ? 0.2567 0.2887 0.3031 -0.0751 0.0528  -0.0483 168 TYR B CZ  
3843 O OH  . TYR B 187 ? 0.2781 0.2953 0.3305 -0.0529 0.0189  -0.0748 168 TYR B OH  
3844 N N   . LEU B 188 ? 0.1646 0.2603 0.2392 -0.0663 0.0306  -0.0220 169 LEU B N   
3845 C CA  . LEU B 188 ? 0.1466 0.2696 0.2533 -0.0314 0.0235  -0.0007 169 LEU B CA  
3846 C C   . LEU B 188 ? 0.1301 0.2381 0.2063 -0.0252 0.0144  -0.0148 169 LEU B C   
3847 O O   . LEU B 188 ? 0.1625 0.2345 0.2071 -0.0217 -0.0103 -0.0127 169 LEU B O   
3848 C CB  . LEU B 188 ? 0.1864 0.3384 0.3048 -0.0011 0.0179  0.0361  169 LEU B CB  
3849 C CG  . LEU B 188 ? 0.2299 0.3738 0.3642 0.0105  0.0245  0.0369  169 LEU B CG  
3850 C CD1 . LEU B 188 ? 0.2672 0.4275 0.4069 0.0059  0.0333  0.0419  169 LEU B CD1 
3851 C CD2 . LEU B 188 ? 0.2448 0.3808 0.3613 -0.0129 0.0231  0.0259  169 LEU B CD2 
3852 N N   . THR B 189 ? 0.1065 0.2211 0.1972 -0.0276 0.0227  0.0006  170 THR B N   
3853 C CA  . THR B 189 ? 0.1147 0.2069 0.1713 0.0039  0.0208  -0.0163 170 THR B CA  
3854 C C   . THR B 189 ? 0.1392 0.2149 0.1493 0.0073  0.0064  -0.0064 170 THR B C   
3855 O O   . THR B 189 ? 0.1174 0.2450 0.1445 0.0223  0.0350  -0.0175 170 THR B O   
3856 C CB  . THR B 189 ? 0.0900 0.2317 0.1718 -0.0027 0.0097  -0.0242 170 THR B CB  
3857 O OG1 . THR B 189 ? 0.1256 0.2489 0.1968 0.0005  0.0095  -0.0215 170 THR B OG1 
3858 C CG2 . THR B 189 ? 0.0817 0.2439 0.1689 -0.0434 0.0279  -0.0250 170 THR B CG2 
3859 N N   . LEU B 190 ? 0.1466 0.1958 0.1551 0.0046  -0.0695 -0.0084 171 LEU B N   
3860 C CA  . LEU B 190 ? 0.1353 0.1872 0.1597 0.0302  -0.0431 0.0221  171 LEU B CA  
3861 C C   . LEU B 190 ? 0.1034 0.1933 0.1676 -0.0207 -0.0217 0.0189  171 LEU B C   
3862 O O   . LEU B 190 ? 0.1262 0.2098 0.1726 -0.0239 -0.0049 -0.0127 171 LEU B O   
3863 C CB  . LEU B 190 ? 0.1654 0.1919 0.1711 0.0517  -0.0401 0.0305  171 LEU B CB  
3864 C CG  . LEU B 190 ? 0.1837 0.2288 0.1880 0.0284  -0.0240 0.0376  171 LEU B CG  
3865 C CD1 . LEU B 190 ? 0.1453 0.2175 0.2259 0.0196  -0.0385 -0.0303 171 LEU B CD1 
3866 C CD2 . LEU B 190 ? 0.2725 0.2913 0.1930 0.0708  -0.0264 0.0508  171 LEU B CD2 
3867 N N   . ARG B 191 ? 0.0922 0.2114 0.1753 -0.0287 -0.0319 0.0147  172 ARG B N   
3868 C CA  . ARG B 191 ? 0.1423 0.2235 0.1890 -0.0476 0.0008  -0.0085 172 ARG B CA  
3869 C C   . ARG B 191 ? 0.1477 0.2064 0.1671 -0.0186 0.0214  -0.0028 172 ARG B C   
3870 O O   . ARG B 191 ? 0.1590 0.1977 0.1959 -0.0551 0.0098  -0.0215 172 ARG B O   
3871 C CB  . ARG B 191 ? 0.1349 0.2682 0.2391 -0.0598 -0.0135 -0.0399 172 ARG B CB  
3872 C CG  . ARG B 191 ? 0.2338 0.3097 0.2798 -0.0565 -0.0144 -0.0563 172 ARG B CG  
3873 C CD  . ARG B 191 ? 0.3202 0.3114 0.3508 -0.0537 -0.0227 -0.0377 172 ARG B CD  
3874 N NE  . ARG B 191 ? 0.3952 0.3615 0.3955 -0.0266 -0.0086 -0.0216 172 ARG B NE  
3875 C CZ  . ARG B 191 ? 0.3886 0.3701 0.4189 -0.0877 -0.0262 -0.0193 172 ARG B CZ  
3876 N NH1 . ARG B 191 ? 0.2662 0.3267 0.3892 -0.1739 -0.0219 -0.0027 172 ARG B NH1 
3877 N NH2 . ARG B 191 ? 0.4360 0.4145 0.4519 -0.0738 -0.0512 -0.0125 172 ARG B NH2 
3878 N N   . ARG B 192 ? 0.1508 0.2016 0.1694 -0.0188 0.0000  0.0209  173 ARG B N   
3879 C CA  . ARG B 192 ? 0.1463 0.1584 0.1703 0.0263  -0.0174 0.0242  173 ARG B CA  
3880 C C   . ARG B 192 ? 0.1333 0.1656 0.1528 0.0071  -0.0107 0.0026  173 ARG B C   
3881 O O   . ARG B 192 ? 0.1917 0.2387 0.1670 0.0346  -0.0165 -0.0208 173 ARG B O   
3882 C CB  . ARG B 192 ? 0.1109 0.1737 0.2071 0.0607  0.0019  0.0085  173 ARG B CB  
3883 C CG  . ARG B 192 ? 0.1004 0.2014 0.2185 0.0714  -0.0229 -0.0002 173 ARG B CG  
3884 C CD  . ARG B 192 ? 0.0873 0.2042 0.2154 0.0555  -0.0342 0.0082  173 ARG B CD  
3885 N NE  . ARG B 192 ? 0.1125 0.2294 0.2686 0.0620  -0.0466 -0.0185 173 ARG B NE  
3886 C CZ  . ARG B 192 ? 0.1509 0.2315 0.3120 0.0184  -0.0219 -0.0281 173 ARG B CZ  
3887 N NH1 . ARG B 192 ? 0.2069 0.2591 0.3648 0.0109  -0.0109 -0.0190 173 ARG B NH1 
3888 N NH2 . ARG B 192 ? 0.1300 0.2497 0.2783 0.0050  -0.0269 -0.0249 173 ARG B NH2 
3889 N N   . GLY B 193 ? 0.0672 0.1552 0.1857 -0.0137 0.0031  0.0011  174 GLY B N   
3890 C CA  . GLY B 193 ? 0.1242 0.1329 0.1677 -0.0132 0.0452  -0.0066 174 GLY B CA  
3891 C C   . GLY B 193 ? 0.1362 0.1527 0.1628 -0.0332 0.0316  0.0023  174 GLY B C   
3892 O O   . GLY B 193 ? 0.1753 0.1807 0.1578 0.0189  0.0153  0.0110  174 GLY B O   
3893 N N   . THR B 194 ? 0.1405 0.1713 0.1356 -0.0055 0.0002  0.0044  175 THR B N   
3894 C CA  . THR B 194 ? 0.1783 0.1466 0.1288 -0.0321 -0.0220 0.0118  175 THR B CA  
3895 C C   . THR B 194 ? 0.1957 0.1856 0.1373 -0.0259 0.0039  -0.0041 175 THR B C   
3896 O O   . THR B 194 ? 0.2023 0.1959 0.1768 -0.0213 0.0256  0.0029  175 THR B O   
3897 C CB  . THR B 194 ? 0.1683 0.1668 0.1397 -0.0533 0.0067  0.0154  175 THR B CB  
3898 O OG1 . THR B 194 ? 0.1785 0.1849 0.1665 -0.0090 0.0187  -0.0041 175 THR B OG1 
3899 C CG2 . THR B 194 ? 0.1961 0.2153 0.1554 -0.0080 -0.0210 0.0072  175 THR B CG2 
3900 N N   . ALA B 195 ? 0.1911 0.1837 0.1139 -0.0110 0.0032  0.0032  176 ALA B N   
3901 C CA  . ALA B 195 ? 0.1591 0.1728 0.1468 0.0051  0.0068  0.0228  176 ALA B CA  
3902 C C   . ALA B 195 ? 0.1920 0.1924 0.1486 -0.0221 0.0036  0.0017  176 ALA B C   
3903 O O   . ALA B 195 ? 0.2130 0.2007 0.1534 -0.0504 0.0025  -0.0259 176 ALA B O   
3904 C CB  . ALA B 195 ? 0.1438 0.1941 0.2037 0.0074  -0.0082 0.0027  176 ALA B CB  
3905 N N   . ALA B 196 ? 0.2002 0.1830 0.1282 -0.0038 0.0141  0.0233  177 ALA B N   
3906 C CA  . ALA B 196 ? 0.1556 0.2017 0.1262 0.0219  0.0148  0.0117  177 ALA B CA  
3907 C C   . ALA B 196 ? 0.1089 0.1829 0.1390 -0.0245 0.0378  0.0143  177 ALA B C   
3908 O O   . ALA B 196 ? 0.1499 0.1593 0.1508 -0.0026 0.0088  0.0215  177 ALA B O   
3909 C CB  . ALA B 196 ? 0.1637 0.2430 0.1390 0.0352  -0.0155 -0.0101 177 ALA B CB  
3910 N N   . MET B 197 ? 0.0807 0.1994 0.1577 -0.0314 0.0145  0.0037  178 MET B N   
3911 C CA  . MET B 197 ? 0.0933 0.1850 0.1527 -0.0351 0.0208  0.0142  178 MET B CA  
3912 C C   . MET B 197 ? 0.1682 0.1667 0.1478 -0.0089 0.0309  -0.0015 178 MET B C   
3913 O O   . MET B 197 ? 0.1717 0.1584 0.1258 -0.0284 0.0015  -0.0011 178 MET B O   
3914 C CB  . MET B 197 ? 0.1652 0.1869 0.1753 -0.0182 0.0310  0.0223  178 MET B CB  
3915 C CG  . MET B 197 ? 0.1528 0.1938 0.1931 -0.0617 0.0213  0.0009  178 MET B CG  
3916 S SD  . MET B 197 ? 0.1795 0.2057 0.2355 -0.0046 -0.0045 0.0320  178 MET B SD  
3917 C CE  . MET B 197 ? 0.1365 0.2299 0.2122 -0.0204 -0.0409 0.0344  178 MET B CE  
3918 N N   . GLU B 198 ? 0.1443 0.1536 0.1244 -0.0335 0.0296  0.0128  179 GLU B N   
3919 C CA  . GLU B 198 ? 0.1809 0.1245 0.1393 0.0004  0.0024  -0.0186 179 GLU B CA  
3920 C C   . GLU B 198 ? 0.1580 0.1329 0.1327 0.0175  -0.0119 0.0305  179 GLU B C   
3921 O O   . GLU B 198 ? 0.1348 0.1444 0.1515 0.0116  -0.0468 0.0224  179 GLU B O   
3922 C CB  . GLU B 198 ? 0.1942 0.1588 0.1384 0.0144  -0.0166 -0.0506 179 GLU B CB  
3923 C CG  . GLU B 198 ? 0.1873 0.2007 0.1511 0.0511  -0.0437 -0.0270 179 GLU B CG  
3924 C CD  . GLU B 198 ? 0.2113 0.1981 0.1734 0.0393  -0.0218 -0.0356 179 GLU B CD  
3925 O OE1 . GLU B 198 ? 0.2019 0.2362 0.2144 0.0365  -0.0263 -0.0385 179 GLU B OE1 
3926 O OE2 . GLU B 198 ? 0.2533 0.1903 0.1427 0.0295  -0.0277 -0.0161 179 GLU B OE2 
3927 N N   . SER B 199 ? 0.1649 0.1279 0.1559 0.0050  0.0147  0.0018  180 SER B N   
3928 C CA  . SER B 199 ? 0.1414 0.1463 0.1491 0.0266  -0.0152 -0.0025 180 SER B CA  
3929 C C   . SER B 199 ? 0.1555 0.1425 0.1331 -0.0010 0.0146  0.0169  180 SER B C   
3930 O O   . SER B 199 ? 0.1622 0.1550 0.1178 -0.0216 0.0258  -0.0030 180 SER B O   
3931 C CB  . SER B 199 ? 0.1492 0.1701 0.1494 -0.0042 -0.0505 0.0102  180 SER B CB  
3932 O OG  . SER B 199 ? 0.1659 0.1629 0.1499 -0.0181 -0.0345 -0.0339 180 SER B OG  
3933 N N   . ILE B 200 ? 0.1678 0.1400 0.1593 -0.0024 -0.0022 0.0090  181 ILE B N   
3934 C CA  . ILE B 200 ? 0.1795 0.1577 0.1493 0.0022  0.0008  0.0354  181 ILE B CA  
3935 C C   . ILE B 200 ? 0.1743 0.1548 0.1540 0.0075  0.0043  -0.0033 181 ILE B C   
3936 O O   . ILE B 200 ? 0.1985 0.1332 0.1396 -0.0116 -0.0051 -0.0208 181 ILE B O   
3937 C CB  . ILE B 200 ? 0.1834 0.1795 0.1585 -0.0466 0.0205  0.0111  181 ILE B CB  
3938 C CG1 . ILE B 200 ? 0.2931 0.2085 0.1423 0.0097  0.0459  0.0257  181 ILE B CG1 
3939 C CG2 . ILE B 200 ? 0.1409 0.2398 0.1737 -0.0848 0.0232  -0.0312 181 ILE B CG2 
3940 C CD1 . ILE B 200 ? 0.2994 0.2320 0.1386 0.0408  0.0380  0.0295  181 ILE B CD1 
3941 N N   . PHE B 201 ? 0.1443 0.1516 0.1611 -0.0019 0.0128  0.0042  182 PHE B N   
3942 C CA  . PHE B 201 ? 0.1460 0.1610 0.1381 -0.0133 0.0277  -0.0087 182 PHE B CA  
3943 C C   . PHE B 201 ? 0.1315 0.1568 0.1352 0.0017  0.0226  0.0062  182 PHE B C   
3944 O O   . PHE B 201 ? 0.1299 0.1690 0.1338 0.0075  0.0330  0.0071  182 PHE B O   
3945 C CB  . PHE B 201 ? 0.1401 0.1525 0.1357 -0.0493 -0.0132 0.0087  182 PHE B CB  
3946 C CG  . PHE B 201 ? 0.1732 0.1893 0.1567 -0.0511 -0.0279 -0.0046 182 PHE B CG  
3947 C CD1 . PHE B 201 ? 0.2098 0.2178 0.1708 -0.0313 -0.0141 0.0015  182 PHE B CD1 
3948 C CD2 . PHE B 201 ? 0.2135 0.1728 0.1893 -0.0460 -0.0109 -0.0217 182 PHE B CD2 
3949 C CE1 . PHE B 201 ? 0.2395 0.2155 0.1917 -0.0294 -0.0213 -0.0220 182 PHE B CE1 
3950 C CE2 . PHE B 201 ? 0.2015 0.1962 0.2089 -0.0432 0.0041  -0.0178 182 PHE B CE2 
3951 C CZ  . PHE B 201 ? 0.2092 0.1949 0.1915 -0.0370 -0.0040 -0.0157 182 PHE B CZ  
3952 N N   . ASP B 202 ? 0.1368 0.1456 0.1464 -0.0131 0.0261  -0.0065 183 ASP B N   
3953 C CA  . ASP B 202 ? 0.1451 0.1435 0.1416 -0.0334 -0.0053 -0.0204 183 ASP B CA  
3954 C C   . ASP B 202 ? 0.1845 0.1400 0.1291 -0.0325 -0.0251 -0.0132 183 ASP B C   
3955 O O   . ASP B 202 ? 0.2193 0.1601 0.1285 -0.0031 -0.0244 -0.0154 183 ASP B O   
3956 C CB  . ASP B 202 ? 0.1726 0.1474 0.1472 -0.0444 -0.0148 -0.0363 183 ASP B CB  
3957 C CG  . ASP B 202 ? 0.1696 0.1327 0.1275 -0.0137 -0.0307 0.0010  183 ASP B CG  
3958 O OD1 . ASP B 202 ? 0.2212 0.1220 0.1219 -0.0029 -0.0069 0.0097  183 ASP B OD1 
3959 O OD2 . ASP B 202 ? 0.1591 0.1462 0.1331 -0.0234 -0.0194 -0.0074 183 ASP B OD2 
3960 N N   . MET B 203 ? 0.1737 0.1134 0.1572 -0.0246 -0.0091 -0.0216 184 MET B N   
3961 C CA  A MET B 203 ? 0.1971 0.1389 0.1666 -0.0073 -0.0324 -0.0035 184 MET B CA  
3962 C CA  B MET B 203 ? 0.1857 0.1183 0.1528 -0.0076 -0.0301 -0.0097 184 MET B CA  
3963 C C   . MET B 203 ? 0.2007 0.1526 0.1629 0.0101  -0.0268 0.0005  184 MET B C   
3964 O O   . MET B 203 ? 0.1916 0.1498 0.1674 0.0115  0.0148  -0.0176 184 MET B O   
3965 C CB  A MET B 203 ? 0.2002 0.1635 0.1906 0.0331  -0.0283 0.0057  184 MET B CB  
3966 C CB  B MET B 203 ? 0.1598 0.1103 0.1541 0.0331  -0.0235 -0.0087 184 MET B CB  
3967 C CG  A MET B 203 ? 0.2220 0.1925 0.2085 0.0494  -0.0292 0.0113  184 MET B CG  
3968 C CG  B MET B 203 ? 0.1427 0.1189 0.1430 0.0417  -0.0287 -0.0024 184 MET B CG  
3969 S SD  A MET B 203 ? 0.2726 0.2310 0.2474 0.0276  -0.0187 0.0063  184 MET B SD  
3970 S SD  B MET B 203 ? 0.1433 0.1349 0.1551 0.0077  -0.0109 -0.0295 184 MET B SD  
3971 C CE  A MET B 203 ? 0.2909 0.2534 0.2762 0.0553  -0.0035 0.0176  184 MET B CE  
3972 C CE  B MET B 203 ? 0.0981 0.0969 0.1111 0.0202  0.0149  -0.0371 184 MET B CE  
3973 N N   . ILE B 204 ? 0.1778 0.1714 0.1595 0.0082  -0.0427 0.0294  185 ILE B N   
3974 C CA  . ILE B 204 ? 0.2085 0.1772 0.1445 -0.0244 -0.0210 0.0016  185 ILE B CA  
3975 C C   . ILE B 204 ? 0.2313 0.1281 0.1400 -0.0012 -0.0200 -0.0023 185 ILE B C   
3976 O O   . ILE B 204 ? 0.2472 0.1583 0.1631 0.0339  -0.0352 -0.0087 185 ILE B O   
3977 C CB  . ILE B 204 ? 0.1836 0.2117 0.1367 0.0264  -0.0104 -0.0107 185 ILE B CB  
3978 C CG1 . ILE B 204 ? 0.1614 0.2326 0.1772 0.0169  0.0384  -0.0097 185 ILE B CG1 
3979 C CG2 . ILE B 204 ? 0.1712 0.2131 0.1690 0.0316  -0.0539 -0.0340 185 ILE B CG2 
3980 C CD1 . ILE B 204 ? 0.1103 0.2373 0.1700 0.0369  0.0183  -0.0279 185 ILE B CD1 
3981 N N   . GLU B 205 ? 0.2287 0.1034 0.1260 -0.0336 -0.0195 0.0139  186 GLU B N   
3982 C CA  . GLU B 205 ? 0.2335 0.1045 0.1379 -0.0066 -0.0137 -0.0155 186 GLU B CA  
3983 C C   . GLU B 205 ? 0.2321 0.1560 0.1148 0.0178  -0.0089 -0.0133 186 GLU B C   
3984 O O   . GLU B 205 ? 0.2320 0.1572 0.1165 0.0076  -0.0141 -0.0312 186 GLU B O   
3985 C CB  . GLU B 205 ? 0.2237 0.0898 0.1567 -0.0134 -0.0240 -0.0109 186 GLU B CB  
3986 C CG  . GLU B 205 ? 0.2119 0.1019 0.1585 -0.0127 -0.0252 -0.0380 186 GLU B CG  
3987 C CD  . GLU B 205 ? 0.2100 0.1408 0.1396 -0.0032 -0.0122 -0.0149 186 GLU B CD  
3988 O OE1 . GLU B 205 ? 0.2450 0.1741 0.1443 -0.0085 -0.0371 0.0310  186 GLU B OE1 
3989 O OE2 . GLU B 205 ? 0.2016 0.1600 0.1413 0.0004  -0.0353 -0.0101 186 GLU B OE2 
3990 N N   . ARG B 206 ? 0.2225 0.1541 0.1435 -0.0079 -0.0079 -0.0122 187 ARG B N   
3991 C CA  . ARG B 206 ? 0.2321 0.1432 0.1380 0.0065  -0.0233 -0.0230 187 ARG B CA  
3992 C C   . ARG B 206 ? 0.2480 0.1261 0.1339 -0.0034 -0.0375 -0.0098 187 ARG B C   
3993 O O   . ARG B 206 ? 0.2562 0.1474 0.1298 -0.0218 -0.0066 -0.0093 187 ARG B O   
3994 C CB  . ARG B 206 ? 0.2083 0.1355 0.1428 -0.0118 -0.0193 -0.0299 187 ARG B CB  
3995 C CG  . ARG B 206 ? 0.2202 0.1363 0.1413 0.0121  0.0237  -0.0130 187 ARG B CG  
3996 C CD  . ARG B 206 ? 0.2281 0.1589 0.1410 0.0151  0.0161  -0.0286 187 ARG B CD  
3997 N NE  . ARG B 206 ? 0.2489 0.1431 0.1300 0.0134  0.0355  -0.0373 187 ARG B NE  
3998 C CZ  . ARG B 206 ? 0.2542 0.1581 0.1317 0.0127  -0.0081 -0.0360 187 ARG B CZ  
3999 N NH1 . ARG B 206 ? 0.2454 0.1621 0.1288 -0.0350 -0.0169 -0.0238 187 ARG B NH1 
4000 N NH2 . ARG B 206 ? 0.2370 0.1810 0.1451 0.0472  -0.0062 -0.0248 187 ARG B NH2 
4001 N N   . LEU B 207 ? 0.1954 0.1414 0.1597 -0.0485 -0.0323 -0.0155 188 LEU B N   
4002 C CA  . LEU B 207 ? 0.2362 0.1614 0.1318 -0.0368 -0.0494 0.0122  188 LEU B CA  
4003 C C   . LEU B 207 ? 0.2792 0.1692 0.1730 -0.0310 -0.0555 -0.0242 188 LEU B C   
4004 O O   . LEU B 207 ? 0.3389 0.1664 0.2209 -0.0343 -0.0328 -0.0366 188 LEU B O   
4005 C CB  . LEU B 207 ? 0.1947 0.2064 0.1305 -0.0291 -0.0082 0.0142  188 LEU B CB  
4006 C CG  . LEU B 207 ? 0.1576 0.1885 0.1508 0.0044  0.0216  0.0216  188 LEU B CG  
4007 C CD1 . LEU B 207 ? 0.1951 0.1563 0.1509 -0.0193 0.0460  0.0168  188 LEU B CD1 
4008 C CD2 . LEU B 207 ? 0.2165 0.1681 0.1706 0.0423  0.0156  0.0050  188 LEU B CD2 
4009 N N   . GLY B 208 ? 0.2713 0.1787 0.1380 -0.0161 -0.0279 -0.0227 189 GLY B N   
4010 C CA  . GLY B 208 ? 0.2687 0.1927 0.1632 -0.0306 -0.0287 -0.0089 189 GLY B CA  
4011 C C   . GLY B 208 ? 0.3293 0.1871 0.1785 0.0146  -0.0141 -0.0173 189 GLY B C   
4012 O O   . GLY B 208 ? 0.3874 0.2370 0.1811 0.0086  -0.0302 -0.0187 189 GLY B O   
4013 N N   . HIS B 209 ? 0.2899 0.1498 0.1697 0.0257  0.0143  -0.0270 190 HIS B N   
4014 C CA  . HIS B 209 ? 0.3441 0.1678 0.1695 0.0383  0.0144  -0.0532 190 HIS B CA  
4015 C C   . HIS B 209 ? 0.3567 0.1608 0.1394 0.0073  0.0066  -0.0264 190 HIS B C   
4016 O O   . HIS B 209 ? 0.4362 0.1669 0.1178 0.0210  -0.0047 -0.0106 190 HIS B O   
4017 C CB  . HIS B 209 ? 0.3271 0.1577 0.1993 0.0729  0.0108  -0.0169 190 HIS B CB  
4018 C CG  . HIS B 209 ? 0.3445 0.1979 0.2644 0.0564  0.0070  0.0046  190 HIS B CG  
4019 N ND1 . HIS B 209 ? 0.3996 0.2234 0.3214 0.0473  0.0447  0.0375  190 HIS B ND1 
4020 C CD2 . HIS B 209 ? 0.3478 0.1978 0.2313 0.0047  -0.0077 0.0077  190 HIS B CD2 
4021 C CE1 . HIS B 209 ? 0.3921 0.1986 0.3148 0.0331  0.0400  0.0390  190 HIS B CE1 
4022 N NE2 . HIS B 209 ? 0.3612 0.1862 0.2542 0.0027  0.0400  0.0028  190 HIS B NE2 
4023 N N   . PHE B 210 ? 0.3434 0.1667 0.1528 -0.0070 -0.0022 -0.0222 191 PHE B N   
4024 C CA  . PHE B 210 ? 0.3166 0.1619 0.1386 -0.0381 -0.0180 -0.0061 191 PHE B CA  
4025 C C   . PHE B 210 ? 0.3196 0.1559 0.1203 -0.0389 -0.0210 -0.0117 191 PHE B C   
4026 O O   . PHE B 210 ? 0.3383 0.1581 0.1256 -0.0252 -0.0568 -0.0142 191 PHE B O   
4027 C CB  . PHE B 210 ? 0.3121 0.2221 0.1356 -0.0066 -0.0398 0.0015  191 PHE B CB  
4028 C CG  . PHE B 210 ? 0.3026 0.2307 0.1615 0.0026  -0.0153 -0.0160 191 PHE B CG  
4029 C CD1 . PHE B 210 ? 0.2993 0.2271 0.1515 -0.0002 0.0207  -0.0392 191 PHE B CD1 
4030 C CD2 . PHE B 210 ? 0.3224 0.2322 0.1682 -0.0061 -0.0182 -0.0086 191 PHE B CD2 
4031 C CE1 . PHE B 210 ? 0.2735 0.2416 0.1664 -0.0143 -0.0300 -0.0274 191 PHE B CE1 
4032 C CE2 . PHE B 210 ? 0.2945 0.2332 0.1850 0.0196  -0.0314 -0.0209 191 PHE B CE2 
4033 C CZ  . PHE B 210 ? 0.2607 0.2509 0.1790 -0.0159 -0.0850 -0.0336 191 PHE B CZ  
4034 N N   . GLU B 211 ? 0.3000 0.1569 0.1571 0.0134  0.0076  -0.0145 192 GLU B N   
4035 C CA  . GLU B 211 ? 0.2643 0.1558 0.1666 0.0076  -0.0044 0.0102  192 GLU B CA  
4036 C C   . GLU B 211 ? 0.2435 0.1654 0.1525 0.0235  -0.0283 0.0038  192 GLU B C   
4037 O O   . GLU B 211 ? 0.2891 0.1946 0.1716 0.0455  -0.0801 -0.0107 192 GLU B O   
4038 C CB  . GLU B 211 ? 0.2330 0.1508 0.1580 0.0227  -0.0056 -0.0204 192 GLU B CB  
4039 C CG  . GLU B 211 ? 0.2372 0.1797 0.1578 0.0608  0.0057  -0.0001 192 GLU B CG  
4040 C CD  . GLU B 211 ? 0.2561 0.1501 0.1491 0.0401  -0.0085 0.0088  192 GLU B CD  
4041 O OE1 . GLU B 211 ? 0.2788 0.2027 0.1726 -0.0063 -0.0098 -0.0091 192 GLU B OE1 
4042 O OE2 . GLU B 211 ? 0.2773 0.1414 0.1676 0.0378  -0.0011 -0.0014 192 GLU B OE2 
4043 N N   . VAL B 212 ? 0.1928 0.1689 0.1429 0.0329  -0.0367 -0.0029 193 VAL B N   
4044 C CA  A VAL B 212 ? 0.2129 0.1994 0.1755 0.0294  -0.0280 0.0052  193 VAL B CA  
4045 C CA  B VAL B 212 ? 0.1722 0.1319 0.1606 0.0143  -0.0412 0.0187  193 VAL B CA  
4046 C C   . VAL B 212 ? 0.2077 0.1731 0.1714 0.0194  -0.0435 -0.0033 193 VAL B C   
4047 O O   . VAL B 212 ? 0.2308 0.1516 0.2068 0.0024  -0.0640 -0.0066 193 VAL B O   
4048 C CB  A VAL B 212 ? 0.2668 0.2670 0.2134 0.0171  -0.0174 -0.0111 193 VAL B CB  
4049 C CB  B VAL B 212 ? 0.1512 0.0682 0.1546 0.0037  -0.0687 0.0221  193 VAL B CB  
4050 C CG1 A VAL B 212 ? 0.2530 0.3049 0.2250 0.0195  -0.0239 -0.0159 193 VAL B CG1 
4051 C CG1 B VAL B 212 ? 0.1866 0.0756 0.1846 0.0061  -0.0394 0.0271  193 VAL B CG1 
4052 C CG2 A VAL B 212 ? 0.2869 0.2698 0.2232 0.0093  0.0027  -0.0247 193 VAL B CG2 
4053 C CG2 B VAL B 212 ? 0.1223 0.0586 0.1582 -0.0180 -0.0498 0.0291  193 VAL B CG2 
4054 N N   . PRO B 213 ? 0.2524 0.1677 0.1480 0.0120  -0.0652 -0.0081 194 PRO B N   
4055 C CA  . PRO B 213 ? 0.2579 0.1366 0.1529 -0.0087 -0.0913 -0.0040 194 PRO B CA  
4056 C C   . PRO B 213 ? 0.2463 0.1329 0.1769 0.0179  -0.0539 -0.0180 194 PRO B C   
4057 O O   . PRO B 213 ? 0.2433 0.1149 0.1943 0.0193  -0.0330 -0.0157 194 PRO B O   
4058 C CB  . PRO B 213 ? 0.2755 0.1798 0.1639 -0.0013 -0.0816 -0.0126 194 PRO B CB  
4059 C CG  . PRO B 213 ? 0.2888 0.1919 0.1687 0.0055  -0.0829 -0.0210 194 PRO B CG  
4060 C CD  . PRO B 213 ? 0.2645 0.1897 0.1454 0.0119  -0.0766 -0.0055 194 PRO B CD  
4061 N N   . GLN B 214 ? 0.2472 0.1236 0.1581 -0.0230 -0.0259 -0.0158 195 GLN B N   
4062 C CA  . GLN B 214 ? 0.2047 0.1325 0.1587 -0.0322 -0.0156 -0.0352 195 GLN B CA  
4063 C C   . GLN B 214 ? 0.2366 0.1415 0.1787 0.0067  -0.0435 0.0081  195 GLN B C   
4064 O O   . GLN B 214 ? 0.1996 0.1558 0.1746 -0.0259 -0.0359 0.0074  195 GLN B O   
4065 C CB  . GLN B 214 ? 0.2194 0.1393 0.1584 -0.0612 -0.0262 -0.0112 195 GLN B CB  
4066 C CG  . GLN B 214 ? 0.2206 0.1314 0.1762 -0.0572 -0.0168 0.0270  195 GLN B CG  
4067 C CD  . GLN B 214 ? 0.2458 0.1339 0.1512 -0.0174 -0.0062 0.0347  195 GLN B CD  
4068 O OE1 . GLN B 214 ? 0.2600 0.1682 0.1610 -0.0245 -0.0087 0.0370  195 GLN B OE1 
4069 N NE2 . GLN B 214 ? 0.2531 0.1430 0.1271 0.0038  0.0589  0.0386  195 GLN B NE2 
4070 N N   . HIS B 215 ? 0.2487 0.1136 0.1663 0.0182  -0.0611 -0.0005 196 HIS B N   
4071 C CA  . HIS B 215 ? 0.2205 0.1553 0.1726 0.0555  -0.0574 0.0409  196 HIS B CA  
4072 C C   . HIS B 215 ? 0.2435 0.1622 0.1866 0.0522  -0.0479 0.0314  196 HIS B C   
4073 O O   . HIS B 215 ? 0.2444 0.1529 0.1926 0.0346  -0.0040 0.0191  196 HIS B O   
4074 C CB  . HIS B 215 ? 0.2471 0.1811 0.1558 0.0427  -0.0395 0.0197  196 HIS B CB  
4075 C CG  . HIS B 215 ? 0.3004 0.2000 0.1730 0.0254  -0.0032 0.0205  196 HIS B CG  
4076 N ND1 . HIS B 215 ? 0.3675 0.2106 0.1878 0.0582  -0.0055 0.0260  196 HIS B ND1 
4077 C CD2 . HIS B 215 ? 0.3217 0.1935 0.1868 -0.0156 0.0022  -0.0003 196 HIS B CD2 
4078 C CE1 . HIS B 215 ? 0.3580 0.2085 0.1983 0.0167  0.0019  -0.0238 196 HIS B CE1 
4079 N NE2 . HIS B 215 ? 0.3601 0.2094 0.2168 -0.0178 0.0031  -0.0149 196 HIS B NE2 
4080 N N   . VAL B 216 ? 0.2352 0.1552 0.1840 -0.0188 -0.0552 0.0259  197 VAL B N   
4081 C CA  . VAL B 216 ? 0.2335 0.1645 0.1778 -0.0146 -0.0629 -0.0028 197 VAL B CA  
4082 C C   . VAL B 216 ? 0.2086 0.1549 0.1809 -0.0040 -0.0237 0.0075  197 VAL B C   
4083 O O   . VAL B 216 ? 0.2018 0.1597 0.1728 -0.0254 -0.0002 -0.0016 197 VAL B O   
4084 C CB  . VAL B 216 ? 0.2214 0.1737 0.1756 -0.0496 -0.0337 0.0108  197 VAL B CB  
4085 C CG1 . VAL B 216 ? 0.2169 0.1540 0.1988 -0.0654 -0.0341 0.0073  197 VAL B CG1 
4086 C CG2 . VAL B 216 ? 0.2160 0.2172 0.1842 -0.0184 -0.0262 0.0195  197 VAL B CG2 
4087 N N   . MET B 217 ? 0.1941 0.1619 0.1663 0.0081  -0.0386 -0.0070 198 MET B N   
4088 C CA  A MET B 217 ? 0.2118 0.1757 0.1843 0.0284  -0.0183 0.0097  198 MET B CA  
4089 C CA  B MET B 217 ? 0.2140 0.1478 0.1525 0.0485  -0.0426 -0.0232 198 MET B CA  
4090 C C   . MET B 217 ? 0.2085 0.1538 0.1698 0.0313  -0.0342 -0.0160 198 MET B C   
4091 O O   . MET B 217 ? 0.2084 0.1642 0.1561 0.0299  -0.0411 0.0029  198 MET B O   
4092 C CB  A MET B 217 ? 0.2178 0.1863 0.2115 0.0019  -0.0137 0.0368  198 MET B CB  
4093 C CB  B MET B 217 ? 0.2332 0.1492 0.1779 0.0598  -0.1035 -0.0330 198 MET B CB  
4094 C CG  A MET B 217 ? 0.2600 0.2478 0.2096 0.0038  -0.0191 0.0284  198 MET B CG  
4095 C CG  B MET B 217 ? 0.2420 0.1497 0.1701 0.0813  -0.1043 -0.0424 198 MET B CG  
4096 S SD  A MET B 217 ? 0.2595 0.2673 0.2273 0.0110  -0.0059 0.0521  198 MET B SD  
4097 S SD  B MET B 217 ? 0.4170 0.2216 0.2204 0.1183  -0.0697 -0.0879 198 MET B SD  
4098 C CE  A MET B 217 ? 0.0606 0.0862 0.0935 -0.0097 0.0275  0.0334  198 MET B CE  
4099 C CE  B MET B 217 ? 0.4534 0.3084 0.2538 0.1646  -0.1271 -0.1186 198 MET B CE  
4100 N N   . HIS B 218 ? 0.1831 0.1119 0.1625 -0.0134 -0.0407 -0.0377 199 HIS B N   
4101 C CA  . HIS B 218 ? 0.1413 0.1440 0.1818 0.0054  -0.0563 -0.0403 199 HIS B CA  
4102 C C   . HIS B 218 ? 0.1584 0.1575 0.1986 0.0436  -0.0726 -0.0090 199 HIS B C   
4103 O O   . HIS B 218 ? 0.2016 0.1934 0.2010 0.0093  -0.0227 -0.0168 199 HIS B O   
4104 C CB  . HIS B 218 ? 0.1719 0.1310 0.1791 -0.0068 -0.0499 -0.0209 199 HIS B CB  
4105 C CG  . HIS B 218 ? 0.1592 0.1575 0.1712 0.0192  -0.0326 -0.0108 199 HIS B CG  
4106 N ND1 . HIS B 218 ? 0.1905 0.1962 0.1812 0.0213  -0.0177 -0.0214 199 HIS B ND1 
4107 C CD2 . HIS B 218 ? 0.1471 0.1775 0.2064 0.0035  -0.0292 0.0275  199 HIS B CD2 
4108 C CE1 . HIS B 218 ? 0.2022 0.2016 0.1856 0.0301  -0.0121 -0.0234 199 HIS B CE1 
4109 N NE2 . HIS B 218 ? 0.1869 0.2083 0.2084 0.0000  -0.0437 0.0089  199 HIS B NE2 
4110 N N   . HIS B 219 ? 0.1725 0.1973 0.2130 0.0022  -0.0334 0.0028  200 HIS B N   
4111 C CA  . HIS B 219 ? 0.1926 0.1738 0.2187 0.0339  -0.0476 0.0023  200 HIS B CA  
4112 C C   . HIS B 219 ? 0.1816 0.1730 0.2112 0.0436  -0.0375 0.0085  200 HIS B C   
4113 O O   . HIS B 219 ? 0.1483 0.1660 0.2016 0.0152  -0.0277 -0.0208 200 HIS B O   
4114 C CB  . HIS B 219 ? 0.1860 0.1968 0.2262 0.0221  -0.0841 -0.0243 200 HIS B CB  
4115 C CG  . HIS B 219 ? 0.1792 0.2023 0.2358 0.0183  -0.0598 -0.0292 200 HIS B CG  
4116 N ND1 . HIS B 219 ? 0.1827 0.1983 0.2236 0.0299  -0.0635 -0.0187 200 HIS B ND1 
4117 C CD2 . HIS B 219 ? 0.1847 0.2100 0.2443 0.0139  -0.0498 -0.0124 200 HIS B CD2 
4118 C CE1 . HIS B 219 ? 0.1812 0.2341 0.2380 0.0139  -0.0523 -0.0087 200 HIS B CE1 
4119 N NE2 . HIS B 219 ? 0.1956 0.2359 0.2454 -0.0023 -0.0580 0.0015  200 HIS B NE2 
4120 N N   . PRO B 220 ? 0.1833 0.1572 0.1958 0.0187  -0.0282 -0.0005 201 PRO B N   
4121 C CA  . PRO B 220 ? 0.1712 0.1795 0.1891 0.0463  -0.0153 0.0066  201 PRO B CA  
4122 C C   . PRO B 220 ? 0.1460 0.1988 0.1696 0.0098  0.0014  -0.0168 201 PRO B C   
4123 O O   . PRO B 220 ? 0.1426 0.2272 0.1866 0.0234  -0.0115 0.0297  201 PRO B O   
4124 C CB  . PRO B 220 ? 0.2025 0.2029 0.2051 0.0749  -0.0297 -0.0080 201 PRO B CB  
4125 C CG  . PRO B 220 ? 0.2303 0.2301 0.2107 0.0594  -0.0354 -0.0094 201 PRO B CG  
4126 C CD  . PRO B 220 ? 0.2066 0.1665 0.2055 0.0773  -0.0117 -0.0172 201 PRO B CD  
4127 N N   . LEU B 221 ? 0.1598 0.1983 0.2010 0.0031  -0.0174 -0.0045 202 LEU B N   
4128 C CA  A LEU B 221 ? 0.1689 0.2255 0.2212 0.0001  -0.0214 -0.0020 202 LEU B CA  
4129 C CA  B LEU B 221 ? 0.1376 0.2062 0.2020 0.0157  -0.0472 0.0042  202 LEU B CA  
4130 C C   . LEU B 221 ? 0.1486 0.2209 0.1957 0.0181  -0.0439 -0.0058 202 LEU B C   
4131 O O   . LEU B 221 ? 0.1635 0.2325 0.1996 0.0379  -0.0475 -0.0025 202 LEU B O   
4132 C CB  A LEU B 221 ? 0.2132 0.2494 0.2401 -0.0050 0.0091  0.0077  202 LEU B CB  
4133 C CB  B LEU B 221 ? 0.1313 0.2000 0.1824 0.0306  -0.0505 0.0173  202 LEU B CB  
4134 C CG  A LEU B 221 ? 0.2663 0.2802 0.2754 -0.0062 0.0557  -0.0023 202 LEU B CG  
4135 C CG  B LEU B 221 ? 0.1426 0.1996 0.2032 0.0335  -0.0434 0.0167  202 LEU B CG  
4136 C CD1 A LEU B 221 ? 0.2845 0.2831 0.3011 -0.0166 0.0575  -0.0047 202 LEU B CD1 
4137 C CD1 B LEU B 221 ? 0.1087 0.1946 0.1778 0.0255  -0.0697 0.0267  202 LEU B CD1 
4138 C CD2 A LEU B 221 ? 0.2822 0.2913 0.2645 -0.0083 0.0889  -0.0079 202 LEU B CD2 
4139 C CD2 B LEU B 221 ? 0.1843 0.2066 0.2259 0.0188  -0.0121 0.0018  202 LEU B CD2 
4140 N N   . PHE B 222 ? 0.1295 0.2200 0.1802 0.0163  -0.0271 -0.0259 203 PHE B N   
4141 C CA  . PHE B 222 ? 0.1415 0.2298 0.1453 0.0267  0.0202  0.0071  203 PHE B CA  
4142 C C   . PHE B 222 ? 0.1310 0.2102 0.1721 0.0090  -0.0034 0.0118  203 PHE B C   
4143 O O   . PHE B 222 ? 0.1623 0.2098 0.2103 0.0052  -0.0167 0.0395  203 PHE B O   
4144 C CB  . PHE B 222 ? 0.1513 0.2131 0.1233 -0.0015 -0.0289 0.0138  203 PHE B CB  
4145 C CG  . PHE B 222 ? 0.1692 0.1747 0.1262 -0.0209 -0.0536 0.0065  203 PHE B CG  
4146 C CD1 . PHE B 222 ? 0.1751 0.2155 0.1417 -0.0687 -0.0576 -0.0065 203 PHE B CD1 
4147 C CD2 . PHE B 222 ? 0.1825 0.2219 0.1668 -0.0359 -0.0171 0.0310  203 PHE B CD2 
4148 C CE1 . PHE B 222 ? 0.1675 0.2379 0.1467 -0.0346 -0.0439 0.0223  203 PHE B CE1 
4149 C CE2 . PHE B 222 ? 0.1596 0.2115 0.1988 -0.0172 -0.0150 0.0099  203 PHE B CE2 
4150 C CZ  . PHE B 222 ? 0.1569 0.2362 0.1903 -0.0356 -0.0239 -0.0055 203 PHE B CZ  
4151 N N   . ARG B 223 ? 0.1110 0.2337 0.1585 -0.0361 -0.0212 0.0123  204 ARG B N   
4152 C CA  A ARG B 223 ? 0.1286 0.2429 0.1843 -0.0390 -0.0187 0.0226  204 ARG B CA  
4153 C CA  B ARG B 223 ? 0.1209 0.2252 0.1519 -0.0462 -0.0374 0.0111  204 ARG B CA  
4154 C C   . ARG B 223 ? 0.1380 0.2385 0.1772 -0.0422 -0.0136 0.0098  204 ARG B C   
4155 O O   . ARG B 223 ? 0.1698 0.2520 0.1387 -0.0503 0.0005  0.0121  204 ARG B O   
4156 C CB  A ARG B 223 ? 0.1345 0.2377 0.2181 -0.0382 -0.0066 0.0324  204 ARG B CB  
4157 C CB  B ARG B 223 ? 0.1098 0.1763 0.1272 -0.0525 -0.0480 -0.0075 204 ARG B CB  
4158 C CG  A ARG B 223 ? 0.1718 0.2579 0.2651 -0.0273 0.0054  0.0225  204 ARG B CG  
4159 C CG  B ARG B 223 ? 0.1258 0.1759 0.1230 -0.0455 -0.0420 -0.0418 204 ARG B CG  
4160 C CD  A ARG B 223 ? 0.2410 0.2726 0.3045 -0.0112 -0.0028 0.0202  204 ARG B CD  
4161 C CD  B ARG B 223 ? 0.1535 0.1863 0.1151 -0.0296 -0.0634 -0.0380 204 ARG B CD  
4162 N NE  A ARG B 223 ? 0.2852 0.3000 0.3327 -0.0129 0.0036  0.0310  204 ARG B NE  
4163 N NE  B ARG B 223 ? 0.1185 0.1949 0.1024 -0.0404 -0.0502 -0.0010 204 ARG B NE  
4164 C CZ  A ARG B 223 ? 0.2931 0.3188 0.3629 0.0177  0.0076  0.0278  204 ARG B CZ  
4165 C CZ  B ARG B 223 ? 0.1049 0.2022 0.1168 -0.0157 -0.0580 -0.0021 204 ARG B CZ  
4166 N NH1 A ARG B 223 ? 0.2903 0.3241 0.3909 0.0352  0.0131  0.0352  204 ARG B NH1 
4167 N NH1 B ARG B 223 ? 0.0719 0.2261 0.1152 -0.0025 -0.0286 0.0193  204 ARG B NH1 
4168 N NH2 A ARG B 223 ? 0.2728 0.3044 0.3683 0.0416  -0.0130 0.0343  204 ARG B NH2 
4169 N NH2 B ARG B 223 ? 0.1314 0.2245 0.1387 0.0040  -0.0514 0.0003  204 ARG B NH2 
4170 N N   . GLN B 224 ? 0.1543 0.2423 0.1731 -0.0081 -0.0254 -0.0060 205 GLN B N   
4171 C CA  . GLN B 224 ? 0.1775 0.2105 0.1875 0.0157  -0.0264 -0.0304 205 GLN B CA  
4172 C C   . GLN B 224 ? 0.2195 0.2245 0.2008 0.0063  -0.0093 -0.0325 205 GLN B C   
4173 O O   . GLN B 224 ? 0.2161 0.2341 0.2246 0.0306  -0.0152 -0.0109 205 GLN B O   
4174 C CB  . GLN B 224 ? 0.1976 0.2383 0.2035 0.0171  -0.0133 -0.0446 205 GLN B CB  
4175 C CG  . GLN B 224 ? 0.2166 0.2520 0.2124 0.0504  -0.0074 -0.0429 205 GLN B CG  
4176 C CD  . GLN B 224 ? 0.2381 0.2806 0.2251 0.0214  0.0474  -0.0372 205 GLN B CD  
4177 O OE1 . GLN B 224 ? 0.2019 0.3194 0.2632 0.0143  0.0599  -0.0559 205 GLN B OE1 
4178 N NE2 . GLN B 224 ? 0.2438 0.2836 0.2340 0.0124  0.0204  -0.0258 205 GLN B NE2 
4179 N N   . LEU B 225 ? 0.1966 0.2017 0.1866 -0.0252 -0.0130 -0.0250 206 LEU B N   
4180 C CA  . LEU B 225 ? 0.1596 0.2048 0.1789 0.0181  -0.0156 -0.0100 206 LEU B CA  
4181 C C   . LEU B 225 ? 0.1841 0.2244 0.1724 0.0225  -0.0248 -0.0033 206 LEU B C   
4182 O O   . LEU B 225 ? 0.1802 0.2012 0.1533 0.0033  0.0024  0.0029  206 LEU B O   
4183 C CB  . LEU B 225 ? 0.1409 0.2394 0.1972 -0.0162 0.0036  -0.0156 206 LEU B CB  
4184 C CG  . LEU B 225 ? 0.1447 0.2624 0.1909 -0.0263 0.0390  0.0082  206 LEU B CG  
4185 C CD1 . LEU B 225 ? 0.2115 0.2714 0.1922 -0.0089 0.0078  -0.0030 206 LEU B CD1 
4186 C CD2 . LEU B 225 ? 0.1064 0.2715 0.2003 0.0054  0.0708  -0.0071 206 LEU B CD2 
4187 N N   . ARG B 226 ? 0.1522 0.2175 0.1622 -0.0141 -0.0428 -0.0154 207 ARG B N   
4188 C CA  A ARG B 226 ? 0.1623 0.2305 0.1904 -0.0131 -0.0275 -0.0114 207 ARG B CA  
4189 C CA  B ARG B 226 ? 0.1456 0.2150 0.1644 -0.0067 -0.0345 -0.0229 207 ARG B CA  
4190 C C   . ARG B 226 ? 0.1681 0.1908 0.1774 -0.0075 0.0041  -0.0001 207 ARG B C   
4191 O O   . ARG B 226 ? 0.1772 0.1757 0.1807 -0.0286 -0.0097 0.0107  207 ARG B O   
4192 C CB  A ARG B 226 ? 0.1994 0.2583 0.2187 -0.0080 -0.0046 0.0029  207 ARG B CB  
4193 C CB  B ARG B 226 ? 0.1432 0.2076 0.1356 0.0132  -0.0292 -0.0265 207 ARG B CB  
4194 C CG  A ARG B 226 ? 0.2476 0.2728 0.2565 -0.0101 -0.0020 0.0339  207 ARG B CG  
4195 C CG  B ARG B 226 ? 0.1455 0.1691 0.1202 0.0305  -0.0380 -0.0024 207 ARG B CG  
4196 C CD  A ARG B 226 ? 0.3263 0.3106 0.2988 -0.0349 -0.0044 0.0426  207 ARG B CD  
4197 C CD  B ARG B 226 ? 0.1571 0.1539 0.1180 0.0185  -0.0682 -0.0137 207 ARG B CD  
4198 N NE  A ARG B 226 ? 0.3948 0.3363 0.3636 -0.0340 -0.0300 0.0642  207 ARG B NE  
4199 N NE  B ARG B 226 ? 0.1769 0.1819 0.1783 0.0503  -0.0872 0.0211  207 ARG B NE  
4200 C CZ  A ARG B 226 ? 0.3896 0.3047 0.3632 -0.0431 -0.0666 0.1044  207 ARG B CZ  
4201 C CZ  B ARG B 226 ? 0.1065 0.1100 0.1299 0.0227  -0.0629 0.0090  207 ARG B CZ  
4202 N NH1 A ARG B 226 ? 0.3958 0.2696 0.3606 -0.0811 -0.1118 0.1456  207 ARG B NH1 
4203 N NH1 B ARG B 226 ? 0.0759 0.0829 0.0996 -0.0121 0.0428  -0.0370 207 ARG B NH1 
4204 N NH2 A ARG B 226 ? 0.3903 0.2868 0.3564 -0.0194 -0.0777 0.1216  207 ARG B NH2 
4205 N NH2 B ARG B 226 ? 0.0620 0.0928 0.1003 0.0352  -0.0214 0.0160  207 ARG B NH2 
4206 N N   . GLN B 227 ? 0.1823 0.2059 0.1780 -0.0171 -0.0064 -0.0062 208 GLN B N   
4207 C CA  . GLN B 227 ? 0.1452 0.1981 0.1646 -0.0229 -0.0299 -0.0200 208 GLN B CA  
4208 C C   . GLN B 227 ? 0.0878 0.2074 0.1515 0.0063  -0.0014 0.0305  208 GLN B C   
4209 O O   . GLN B 227 ? 0.1370 0.2056 0.1619 -0.0040 -0.0014 0.0383  208 GLN B O   
4210 C CB  . GLN B 227 ? 0.1618 0.2145 0.1751 -0.0271 -0.0471 -0.0119 208 GLN B CB  
4211 C CG  . GLN B 227 ? 0.1973 0.2414 0.2020 0.0129  -0.0655 0.0094  208 GLN B CG  
4212 C CD  . GLN B 227 ? 0.2472 0.2458 0.2311 0.0147  -0.0456 0.0177  208 GLN B CD  
4213 O OE1 . GLN B 227 ? 0.3032 0.2300 0.2877 0.0139  -0.0446 0.0274  208 GLN B OE1 
4214 N NE2 . GLN B 227 ? 0.2192 0.2359 0.2045 0.0286  -0.0272 0.0157  208 GLN B NE2 
4215 N N   . LEU B 228 ? 0.1140 0.2209 0.1831 -0.0038 0.0235  -0.0101 209 LEU B N   
4216 C CA  . LEU B 228 ? 0.1285 0.2155 0.2071 0.0321  -0.0047 -0.0166 209 LEU B CA  
4217 C C   . LEU B 228 ? 0.1114 0.2166 0.1944 0.0309  0.0077  -0.0365 209 LEU B C   
4218 O O   . LEU B 228 ? 0.0921 0.2337 0.2160 -0.0032 0.0333  -0.0460 209 LEU B O   
4219 C CB  . LEU B 228 ? 0.1560 0.2394 0.2140 0.0500  -0.0264 -0.0003 209 LEU B CB  
4220 C CG  . LEU B 228 ? 0.1650 0.2541 0.1640 0.0685  -0.0173 -0.0100 209 LEU B CG  
4221 C CD1 . LEU B 228 ? 0.1695 0.2632 0.1984 0.0579  -0.0213 -0.0298 209 LEU B CD1 
4222 C CD2 . LEU B 228 ? 0.2238 0.2812 0.1561 0.0514  0.0205  -0.0079 209 LEU B CD2 
4223 N N   . ALA B 229 ? 0.1105 0.2242 0.1702 0.0110  0.0154  -0.0094 210 ALA B N   
4224 C CA  . ALA B 229 ? 0.1387 0.2416 0.1515 0.0101  0.0119  -0.0215 210 ALA B CA  
4225 C C   . ALA B 229 ? 0.1262 0.2355 0.1686 -0.0240 0.0013  -0.0297 210 ALA B C   
4226 O O   . ALA B 229 ? 0.1481 0.2557 0.1981 -0.0511 -0.0047 -0.0050 210 ALA B O   
4227 C CB  . ALA B 229 ? 0.1658 0.2427 0.1340 0.0005  0.0164  -0.0068 210 ALA B CB  
4228 N N   . ALA B 230 ? 0.1073 0.2267 0.1720 -0.0020 -0.0077 -0.0432 211 ALA B N   
4229 C CA  . ALA B 230 ? 0.1478 0.2022 0.1690 -0.0204 0.0050  0.0126  211 ALA B CA  
4230 C C   . ALA B 230 ? 0.1661 0.2062 0.1545 -0.0208 0.0344  0.0253  211 ALA B C   
4231 O O   . ALA B 230 ? 0.1832 0.1993 0.1755 0.0030  0.0154  0.0512  211 ALA B O   
4232 C CB  . ALA B 230 ? 0.1263 0.2000 0.2034 0.0077  0.0122  0.0113  211 ALA B CB  
4233 N N   . ASP B 231 ? 0.1620 0.2140 0.1478 -0.0050 0.0197  -0.0013 212 ASP B N   
4234 C CA  . ASP B 231 ? 0.1743 0.2145 0.1706 -0.0221 0.0142  0.0129  212 ASP B CA  
4235 C C   . ASP B 231 ? 0.2193 0.2379 0.1820 -0.0280 0.0169  0.0124  212 ASP B C   
4236 O O   . ASP B 231 ? 0.2670 0.2520 0.1672 -0.0510 0.0028  0.0165  212 ASP B O   
4237 C CB  . ASP B 231 ? 0.1565 0.1970 0.1910 0.0035  0.0136  0.0092  212 ASP B CB  
4238 C CG  . ASP B 231 ? 0.1744 0.2108 0.2241 0.0176  -0.0104 -0.0016 212 ASP B CG  
4239 O OD1 . ASP B 231 ? 0.2118 0.2118 0.2606 0.0084  -0.0103 -0.0384 212 ASP B OD1 
4240 O OD2 . ASP B 231 ? 0.1834 0.2320 0.2347 -0.0088 -0.0005 -0.0043 212 ASP B OD2 
4241 N N   . ILE B 232 ? 0.1414 0.2391 0.1841 -0.0730 0.0213  0.0181  213 ILE B N   
4242 C CA  . ILE B 232 ? 0.1588 0.2273 0.2059 -0.0380 0.0078  0.0159  213 ILE B CA  
4243 C C   . ILE B 232 ? 0.1997 0.2235 0.2385 -0.0200 0.0374  0.0339  213 ILE B C   
4244 O O   . ILE B 232 ? 0.1963 0.2282 0.2530 -0.0007 0.0132  0.0486  213 ILE B O   
4245 C CB  . ILE B 232 ? 0.1816 0.2366 0.2367 -0.0486 0.0099  0.0128  213 ILE B CB  
4246 C CG1 . ILE B 232 ? 0.1902 0.2263 0.2007 -0.0391 0.0004  0.0082  213 ILE B CG1 
4247 C CG2 . ILE B 232 ? 0.2008 0.2337 0.2756 -0.0779 0.0108  0.0307  213 ILE B CG2 
4248 C CD1 . ILE B 232 ? 0.1920 0.2313 0.1922 -0.0174 -0.0143 -0.0324 213 ILE B CD1 
4249 N N   . PRO B 233 ? 0.2277 0.2115 0.2382 -0.0223 0.0537  0.0545  214 PRO B N   
4250 C CA  . PRO B 233 ? 0.2283 0.2049 0.2548 -0.0558 0.0833  0.0342  214 PRO B CA  
4251 C C   . PRO B 233 ? 0.2468 0.2123 0.2688 -0.0405 0.0426  0.0367  214 PRO B C   
4252 O O   . PRO B 233 ? 0.2313 0.2180 0.2735 -0.0454 0.0140  0.0632  214 PRO B O   
4253 C CB  . PRO B 233 ? 0.2355 0.2278 0.2464 -0.0424 0.1219  0.0362  214 PRO B CB  
4254 C CG  . PRO B 233 ? 0.2796 0.2589 0.2470 0.0068  0.0944  0.0199  214 PRO B CG  
4255 C CD  . PRO B 233 ? 0.2245 0.2429 0.2139 -0.0020 0.0932  0.0122  214 PRO B CD  
4256 N N   . SER B 234 ? 0.2252 0.2226 0.2948 -0.0440 0.0169  0.0383  215 SER B N   
4257 C CA  A SER B 234 ? 0.2118 0.2198 0.2863 -0.0564 -0.0113 0.0169  215 SER B CA  
4258 C CA  B SER B 234 ? 0.2454 0.2212 0.2885 -0.0555 -0.0007 0.0279  215 SER B CA  
4259 C C   . SER B 234 ? 0.1979 0.2280 0.2882 -0.0584 -0.0217 0.0232  215 SER B C   
4260 O O   . SER B 234 ? 0.2166 0.2727 0.3088 -0.0166 -0.0388 0.0421  215 SER B O   
4261 C CB  A SER B 234 ? 0.1995 0.2153 0.2947 -0.0510 -0.0054 0.0339  215 SER B CB  
4262 C CB  B SER B 234 ? 0.2895 0.2185 0.3007 -0.0472 0.0195  0.0648  215 SER B CB  
4263 O OG  A SER B 234 ? 0.1849 0.2319 0.2882 -0.0490 -0.0241 0.0275  215 SER B OG  
4264 O OG  B SER B 234 ? 0.3341 0.2393 0.3020 -0.0334 0.0197  0.0798  215 SER B OG  
4265 N N   . PHE B 235 ? 0.1577 0.2192 0.2788 -0.0249 0.0017  0.0292  216 PHE B N   
4266 C CA  . PHE B 235 ? 0.1800 0.2491 0.2405 -0.0480 0.0037  0.0324  216 PHE B CA  
4267 C C   . PHE B 235 ? 0.2460 0.2523 0.2427 -0.0510 -0.0173 0.0321  216 PHE B C   
4268 O O   . PHE B 235 ? 0.2759 0.2417 0.2341 -0.0602 -0.0383 0.0236  216 PHE B O   
4269 C CB  . PHE B 235 ? 0.1734 0.2693 0.2339 -0.0054 0.0093  0.0245  216 PHE B CB  
4270 C CG  . PHE B 235 ? 0.1512 0.2724 0.2210 0.0028  0.0032  0.0116  216 PHE B CG  
4271 C CD1 . PHE B 235 ? 0.2167 0.2692 0.2143 -0.0063 0.0228  -0.0061 216 PHE B CD1 
4272 C CD2 . PHE B 235 ? 0.1209 0.2578 0.2028 -0.0457 0.0040  0.0249  216 PHE B CD2 
4273 C CE1 . PHE B 235 ? 0.2208 0.3004 0.2364 -0.0235 0.0096  0.0074  216 PHE B CE1 
4274 C CE2 . PHE B 235 ? 0.1834 0.2935 0.2263 -0.0095 0.0189  0.0361  216 PHE B CE2 
4275 C CZ  . PHE B 235 ? 0.2186 0.2882 0.2293 -0.0216 0.0164  0.0011  216 PHE B CZ  
4276 N N   . THR B 236 ? 0.2574 0.2213 0.2260 -0.0880 -0.0207 0.0469  217 THR B N   
4277 C CA  . THR B 236 ? 0.2526 0.2365 0.2476 -0.0738 -0.0283 0.0558  217 THR B CA  
4278 C C   . THR B 236 ? 0.2667 0.2627 0.2850 -0.0744 -0.0257 0.0558  217 THR B C   
4279 O O   . THR B 236 ? 0.3066 0.3077 0.3147 -0.0954 0.0248  0.0693  217 THR B O   
4280 C CB  . THR B 236 ? 0.2369 0.2530 0.2292 -0.0631 -0.0209 0.0790  217 THR B CB  
4281 O OG1 . THR B 236 ? 0.2457 0.2667 0.2204 -0.0769 -0.0100 0.0618  217 THR B OG1 
4282 C CG2 . THR B 236 ? 0.2532 0.2717 0.2366 -0.0589 -0.0394 0.1076  217 THR B CG2 
4283 N N   . ASN B 237 ? 0.2431 0.2661 0.3071 -0.0439 -0.0367 0.0428  218 ASN B N   
4284 C CA  . ASN B 237 ? 0.3007 0.3018 0.3287 -0.0061 -0.0529 0.0547  218 ASN B CA  
4285 C C   . ASN B 237 ? 0.3071 0.2925 0.3192 -0.0293 -0.0599 0.0620  218 ASN B C   
4286 O O   . ASN B 237 ? 0.3424 0.2895 0.3233 -0.0409 -0.0803 0.0813  218 ASN B O   
4287 C CB  . ASN B 237 ? 0.3362 0.3145 0.3687 0.0209  -0.0645 0.0524  218 ASN B CB  
4288 C CG  . ASN B 237 ? 0.4040 0.3427 0.4120 0.0311  -0.0841 0.0474  218 ASN B CG  
4289 O OD1 . ASN B 237 ? 0.4530 0.3901 0.4491 0.0340  -0.0888 0.0653  218 ASN B OD1 
4290 N ND2 . ASN B 237 ? 0.4437 0.3202 0.4110 0.0480  -0.0627 0.0368  218 ASN B ND2 
4291 N N   . ASP B 238 ? 0.2622 0.2638 0.3008 -0.0737 -0.0492 0.0352  219 ASP B N   
4292 C CA  . ASP B 238 ? 0.2798 0.2676 0.2819 -0.0507 -0.0504 0.0576  219 ASP B CA  
4293 C C   . ASP B 238 ? 0.3099 0.3029 0.3080 -0.0939 -0.0713 0.0797  219 ASP B C   
4294 O O   . ASP B 238 ? 0.3437 0.3248 0.3302 -0.1334 -0.0731 0.0898  219 ASP B O   
4295 C CB  . ASP B 238 ? 0.2616 0.2501 0.2423 -0.0575 -0.0465 0.0154  219 ASP B CB  
4296 C CG  . ASP B 238 ? 0.3041 0.2550 0.2549 -0.0425 -0.0071 -0.0113 219 ASP B CG  
4297 O OD1 . ASP B 238 ? 0.2918 0.2917 0.2722 -0.0505 0.0026  -0.0060 219 ASP B OD1 
4298 O OD2 . ASP B 238 ? 0.3056 0.2577 0.2702 -0.0401 0.0143  -0.0221 219 ASP B OD2 
4299 N N   . VAL B 239 ? 0.3126 0.2987 0.3206 -0.1133 -0.0485 0.0915  220 VAL B N   
4300 C CA  . VAL B 239 ? 0.3510 0.3192 0.3666 -0.1054 -0.0153 0.0921  220 VAL B CA  
4301 C C   . VAL B 239 ? 0.4083 0.3232 0.4014 -0.1134 0.0209  0.1032  220 VAL B C   
4302 O O   . VAL B 239 ? 0.4447 0.3418 0.4091 -0.1177 0.0266  0.1316  220 VAL B O   
4303 C CB  . VAL B 239 ? 0.3277 0.3512 0.3882 -0.1201 0.0109  0.1087  220 VAL B CB  
4304 C CG1 . VAL B 239 ? 0.3160 0.3658 0.3992 -0.1454 -0.0053 0.1004  220 VAL B CG1 
4305 C CG2 . VAL B 239 ? 0.3313 0.3922 0.3949 -0.0986 0.0245  0.1194  220 VAL B CG2 
4306 N N   . ARG B 240 ? 0.4085 0.3435 0.4288 -0.1172 -0.0104 0.0824  221 ARG B N   
4307 C CA  . ARG B 240 ? 0.4336 0.3576 0.4760 -0.1180 0.0061  0.0731  221 ARG B CA  
4308 C C   . ARG B 240 ? 0.4989 0.3783 0.5200 -0.1431 0.0120  0.0554  221 ARG B C   
4309 O O   . ARG B 240 ? 0.5422 0.3753 0.5177 -0.1879 0.0140  0.0721  221 ARG B O   
4310 C CB  . ARG B 240 ? 0.4439 0.3771 0.4764 -0.0846 0.0105  0.0537  221 ARG B CB  
4311 C CG  . ARG B 240 ? 0.4562 0.4104 0.4875 -0.0714 0.0090  0.0354  221 ARG B CG  
4312 C CD  . ARG B 240 ? 0.4472 0.4464 0.4833 -0.0820 0.0134  0.0522  221 ARG B CD  
4313 N NE  . ARG B 240 ? 0.4474 0.4741 0.4973 -0.0822 0.0102  0.0716  221 ARG B NE  
4314 C CZ  . ARG B 240 ? 0.4556 0.4990 0.5054 -0.0935 0.0089  0.1085  221 ARG B CZ  
4315 N NH1 . ARG B 240 ? 0.4714 0.4985 0.4991 -0.0984 -0.0103 0.1281  221 ARG B NH1 
4316 N NH2 . ARG B 240 ? 0.4452 0.5105 0.5139 -0.1283 0.0097  0.1065  221 ARG B NH2 
4317 N N   . SER B 241 ? 0.5390 0.4291 0.5639 -0.1228 0.0296  0.0242  222 SER B N   
4318 C CA  . SER B 241 ? 0.5685 0.4807 0.5995 -0.1031 0.0178  -0.0018 222 SER B CA  
4319 C C   . SER B 241 ? 0.6253 0.5497 0.6181 -0.1075 0.0162  -0.0088 222 SER B C   
4320 O O   . SER B 241 ? 0.6959 0.5866 0.6256 -0.0847 0.0223  0.0020  222 SER B O   
4321 C CB  . SER B 241 ? 0.5865 0.4963 0.6202 -0.0555 0.0215  0.0000  222 SER B CB  
4322 O OG  . SER B 241 ? 0.5829 0.5255 0.6299 -0.0336 0.0252  0.0272  222 SER B OG  
4323 N N   . PHE B 242 ? 0.6400 0.6015 0.6355 -0.0469 0.0044  -0.0408 223 PHE B N   
4324 C CA  . PHE B 242 ? 0.6448 0.6128 0.6465 -0.0042 -0.0001 -0.0443 223 PHE B CA  
4325 C C   . PHE B 242 ? 0.6402 0.6020 0.6562 -0.0047 -0.0107 -0.0523 223 PHE B C   
4326 O O   . PHE B 242 ? 0.6506 0.6048 0.6659 0.0096  -0.0189 -0.0520 223 PHE B O   
4327 C CB  . PHE B 242 ? 0.6666 0.6198 0.6486 0.0109  0.0149  -0.0249 223 PHE B CB  
4328 C CG  . PHE B 242 ? 0.6710 0.6474 0.6635 0.0255  0.0334  -0.0179 223 PHE B CG  
4329 C CD1 . PHE B 242 ? 0.6691 0.6555 0.6670 0.0275  0.0422  -0.0202 223 PHE B CD1 
4330 C CD2 . PHE B 242 ? 0.6639 0.6463 0.6713 0.0250  0.0347  -0.0071 223 PHE B CD2 
4331 C CE1 . PHE B 242 ? 0.6689 0.6513 0.6699 0.0328  0.0433  -0.0107 223 PHE B CE1 
4332 C CE2 . PHE B 242 ? 0.6649 0.6557 0.6734 0.0240  0.0364  -0.0053 223 PHE B CE2 
4333 C CZ  . PHE B 242 ? 0.6706 0.6566 0.6729 0.0337  0.0465  -0.0113 223 PHE B CZ  
4334 N N   . VAL B 251 ? 0.6333 0.6844 0.7129 -0.0148 -0.0241 0.0546  232 VAL B N   
4335 C CA  . VAL B 251 ? 0.6286 0.7009 0.6968 -0.0247 -0.0245 0.0434  232 VAL B CA  
4336 C C   . VAL B 251 ? 0.5246 0.6415 0.6299 -0.0532 -0.0597 0.0424  232 VAL B C   
4337 O O   . VAL B 251 ? 0.4606 0.6214 0.6097 -0.0871 -0.0789 0.0407  232 VAL B O   
4338 C CB  . VAL B 251 ? 0.7184 0.7384 0.7237 -0.0046 -0.0073 0.0314  232 VAL B CB  
4339 C CG1 . VAL B 251 ? 0.7614 0.7614 0.7614 -0.0061 0.0088  0.0259  232 VAL B CG1 
4340 C CG2 . VAL B 251 ? 0.7264 0.7437 0.7368 0.0060  -0.0176 0.0307  232 VAL B CG2 
4341 N N   . ALA B 252 ? 0.4770 0.5942 0.5729 -0.0498 -0.0754 0.0378  233 ALA B N   
4342 C CA  . ALA B 252 ? 0.4055 0.5404 0.5130 -0.0441 -0.0694 0.0429  233 ALA B CA  
4343 C C   . ALA B 252 ? 0.3548 0.4649 0.4616 -0.0516 -0.0586 0.0439  233 ALA B C   
4344 O O   . ALA B 252 ? 0.3515 0.4630 0.4479 -0.0179 -0.0458 0.0653  233 ALA B O   
4345 C CB  . ALA B 252 ? 0.4189 0.5615 0.5197 -0.0143 -0.0717 0.0363  233 ALA B CB  
4346 N N   . ASN B 253 ? 0.2634 0.4032 0.4174 -0.0696 -0.0615 0.0372  234 ASN B N   
4347 C CA  . ASN B 253 ? 0.2858 0.3676 0.3777 -0.0752 -0.0433 0.0489  234 ASN B CA  
4348 C C   . ASN B 253 ? 0.2801 0.3621 0.3369 -0.0631 -0.0172 0.0348  234 ASN B C   
4349 O O   . ASN B 253 ? 0.2554 0.3631 0.3207 -0.0752 -0.0081 0.0343  234 ASN B O   
4350 C CB  . ASN B 253 ? 0.3177 0.3695 0.3908 -0.0963 -0.0330 0.0834  234 ASN B CB  
4351 C CG  . ASN B 253 ? 0.3202 0.3521 0.3843 -0.0978 -0.0443 0.0868  234 ASN B CG  
4352 O OD1 . ASN B 253 ? 0.3729 0.3889 0.4032 -0.1234 -0.0413 0.0659  234 ASN B OD1 
4353 N ND2 . ASN B 253 ? 0.3138 0.3098 0.3591 -0.0738 -0.0489 0.0941  234 ASN B ND2 
4354 N N   . LEU B 254 ? 0.2185 0.3308 0.3041 -0.0508 -0.0004 0.0464  235 LEU B N   
4355 C CA  . LEU B 254 ? 0.2360 0.3513 0.2789 -0.0481 -0.0014 0.0425  235 LEU B CA  
4356 C C   . LEU B 254 ? 0.2377 0.3751 0.2763 -0.0602 0.0087  0.0509  235 LEU B C   
4357 O O   . LEU B 254 ? 0.2796 0.4016 0.2598 -0.0850 0.0024  0.0418  235 LEU B O   
4358 C CB  . LEU B 254 ? 0.2434 0.3324 0.2709 -0.0366 -0.0411 0.0118  235 LEU B CB  
4359 C CG  . LEU B 254 ? 0.2542 0.3251 0.2607 -0.0494 -0.0342 -0.0181 235 LEU B CG  
4360 C CD1 . LEU B 254 ? 0.2560 0.3008 0.2767 -0.0499 -0.0172 -0.0231 235 LEU B CD1 
4361 C CD2 . LEU B 254 ? 0.2574 0.3298 0.2536 -0.0253 -0.0099 -0.0257 235 LEU B CD2 
4362 N N   . VAL B 255 ? 0.2265 0.3907 0.2872 -0.0924 0.0255  0.0489  236 VAL B N   
4363 C CA  . VAL B 255 ? 0.2356 0.3822 0.2881 -0.0838 0.0286  0.0638  236 VAL B CA  
4364 C C   . VAL B 255 ? 0.2869 0.4243 0.3114 -0.0895 0.0111  0.0402  236 VAL B C   
4365 O O   . VAL B 255 ? 0.2560 0.4200 0.3007 -0.1271 -0.0059 0.0471  236 VAL B O   
4366 C CB  . VAL B 255 ? 0.2209 0.3812 0.2921 -0.0499 0.0702  0.0666  236 VAL B CB  
4367 C CG1 . VAL B 255 ? 0.2140 0.3796 0.2991 -0.0655 0.0889  0.0478  236 VAL B CG1 
4368 C CG2 . VAL B 255 ? 0.2608 0.4006 0.3066 -0.0246 0.1003  0.0841  236 VAL B CG2 
4369 N N   . MET B 256 ? 0.3445 0.4654 0.3545 -0.0917 0.0171  0.0535  237 MET B N   
4370 C CA  . MET B 256 ? 0.4206 0.4986 0.4248 -0.1058 0.0534  0.0593  237 MET B CA  
4371 C C   . MET B 256 ? 0.3474 0.4636 0.3722 -0.1126 0.0492  0.0376  237 MET B C   
4372 O O   . MET B 256 ? 0.3691 0.4569 0.3488 -0.1198 0.0843  0.0188  237 MET B O   
4373 C CB  . MET B 256 ? 0.5893 0.5972 0.5722 -0.0950 0.0849  0.0919  237 MET B CB  
4374 C CG  . MET B 256 ? 0.7465 0.7191 0.6689 -0.0750 0.1061  0.1048  237 MET B CG  
4375 S SD  . MET B 256 ? 0.8632 0.8144 0.7856 -0.0611 0.1230  0.1011  237 MET B SD  
4376 C CE  . MET B 256 ? 0.9466 0.9143 0.8345 -0.0540 0.1124  0.0892  237 MET B CE  
4377 N N   . ILE B 257 ? 0.2393 0.4112 0.3509 -0.1441 0.0458  0.0294  238 ILE B N   
4378 C CA  . ILE B 257 ? 0.2509 0.4081 0.3229 -0.1005 0.0584  0.0155  238 ILE B CA  
4379 C C   . ILE B 257 ? 0.2612 0.4391 0.3192 -0.0800 0.0517  0.0049  238 ILE B C   
4380 O O   . ILE B 257 ? 0.2667 0.4991 0.3413 -0.0898 0.0478  -0.0078 238 ILE B O   
4381 C CB  . ILE B 257 ? 0.2639 0.3923 0.3046 -0.0843 0.0921  0.0194  238 ILE B CB  
4382 C CG1 . ILE B 257 ? 0.2301 0.3970 0.2629 -0.0665 0.1255  0.0171  238 ILE B CG1 
4383 C CG2 . ILE B 257 ? 0.3137 0.3949 0.3275 -0.0553 0.1164  0.0455  238 ILE B CG2 
4384 C CD1 . ILE B 257 ? 0.2232 0.4033 0.2421 -0.0510 0.1193  0.0109  238 ILE B CD1 
4385 N N   . VAL B 258 ? 0.2304 0.4184 0.2896 -0.0747 0.0383  0.0285  239 VAL B N   
4386 C CA  . VAL B 258 ? 0.2812 0.4166 0.3077 -0.1006 0.0521  0.0343  239 VAL B CA  
4387 C C   . VAL B 258 ? 0.3268 0.4023 0.3383 -0.1124 0.0477  0.0375  239 VAL B C   
4388 O O   . VAL B 258 ? 0.3591 0.3916 0.3497 -0.1305 0.0347  0.0309  239 VAL B O   
4389 C CB  . VAL B 258 ? 0.2965 0.4318 0.3137 -0.0752 0.0598  0.0305  239 VAL B CB  
4390 C CG1 . VAL B 258 ? 0.2667 0.4261 0.3178 -0.0480 0.0324  0.0090  239 VAL B CG1 
4391 C CG2 . VAL B 258 ? 0.3243 0.4345 0.3085 -0.0651 0.0745  0.0161  239 VAL B CG2 
4392 N N   . ARG B 259 ? 0.3090 0.3754 0.3375 -0.1009 0.0588  0.0750  240 ARG B N   
4393 C CA  . ARG B 259 ? 0.3262 0.4087 0.3622 -0.1342 0.0867  0.0587  240 ARG B CA  
4394 C C   . ARG B 259 ? 0.4022 0.4416 0.4140 -0.1494 0.0852  0.0263  240 ARG B C   
4395 O O   . ARG B 259 ? 0.4160 0.4245 0.4301 -0.1829 0.0659  -0.0030 240 ARG B O   
4396 C CB  . ARG B 259 ? 0.2824 0.3741 0.3434 -0.1217 0.1050  0.0890  240 ARG B CB  
4397 C CG  . ARG B 259 ? 0.2890 0.3937 0.3479 -0.1107 0.1090  0.1055  240 ARG B CG  
4398 C CD  . ARG B 259 ? 0.2737 0.4062 0.3713 -0.0702 0.0791  0.1034  240 ARG B CD  
4399 N NE  . ARG B 259 ? 0.3412 0.4334 0.4069 -0.0274 0.0797  0.0733  240 ARG B NE  
4400 C CZ  . ARG B 259 ? 0.3356 0.4317 0.4190 -0.0025 0.0372  0.0543  240 ARG B CZ  
4401 N NH1 . ARG B 259 ? 0.3355 0.3886 0.3839 -0.0317 0.0799  0.0383  240 ARG B NH1 
4402 N NH2 . ARG B 259 ? 0.3484 0.4619 0.4643 0.0163  -0.0151 0.0444  240 ARG B NH2 
4403 N N   . ARG B 260 ? 0.4049 0.4941 0.4487 -0.1226 0.0785  0.0199  241 ARG B N   
4404 C CA  . ARG B 260 ? 0.4976 0.5452 0.5056 -0.0969 0.0635  -0.0025 241 ARG B CA  
4405 C C   . ARG B 260 ? 0.4979 0.5063 0.5138 -0.0854 0.0854  -0.0057 241 ARG B C   
4406 O O   . ARG B 260 ? 0.5034 0.4673 0.5207 -0.1108 0.1048  0.0041  241 ARG B O   
4407 C CB  . ARG B 260 ? 0.5967 0.6357 0.5613 -0.0913 0.0406  -0.0136 241 ARG B CB  
4408 C CG  . ARG B 260 ? 0.6480 0.7093 0.6267 -0.0856 0.0250  -0.0097 241 ARG B CG  
4409 C CD  . ARG B 260 ? 0.7034 0.7633 0.6883 -0.0773 0.0133  -0.0064 241 ARG B CD  
4410 N NE  . ARG B 260 ? 0.7260 0.8099 0.7444 -0.0712 0.0031  0.0011  241 ARG B NE  
4411 C CZ  . ARG B 260 ? 0.7588 0.8504 0.7764 -0.0708 0.0098  0.0063  241 ARG B CZ  
4412 N NH1 . ARG B 260 ? 0.7526 0.8663 0.7910 -0.0763 0.0154  0.0055  241 ARG B NH1 
4413 N NH2 . ARG B 260 ? 0.7465 0.8630 0.7886 -0.0693 0.0091  0.0069  241 ARG B NH2 
4414 N N   . ASP B 261 ? 0.4684 0.4918 0.5105 -0.0706 0.0912  -0.0268 242 ASP B N   
4415 C CA  . ASP B 261 ? 0.4789 0.4974 0.5245 -0.0784 0.0899  -0.0325 242 ASP B CA  
4416 C C   . ASP B 261 ? 0.5061 0.4674 0.5303 -0.0879 0.0970  -0.0514 242 ASP B C   
4417 O O   . ASP B 261 ? 0.5180 0.4291 0.5449 -0.1076 0.1066  -0.0633 242 ASP B O   
4418 C CB  . ASP B 261 ? 0.5019 0.5013 0.5296 -0.0864 0.0841  -0.0240 242 ASP B CB  
4419 C CG  . ASP B 261 ? 0.5623 0.5263 0.5464 -0.0876 0.0763  -0.0134 242 ASP B CG  
4420 O OD1 . ASP B 261 ? 0.5468 0.5456 0.5519 -0.0880 0.0496  -0.0103 242 ASP B OD1 
4421 O OD2 . ASP B 261 ? 0.5758 0.5108 0.5547 -0.1123 0.1075  -0.0118 242 ASP B OD2 
4422 N N   . ARG B 262 ? 0.4799 0.4521 0.5193 -0.1221 0.0858  -0.0588 243 ARG B N   
4423 C CA  . ARG B 262 ? 0.4707 0.4684 0.5104 -0.0888 0.1029  -0.0342 243 ARG B CA  
4424 C C   . ARG B 262 ? 0.4575 0.4478 0.4837 -0.0953 0.1054  -0.0308 243 ARG B C   
4425 O O   . ARG B 262 ? 0.4645 0.4364 0.4951 -0.0936 0.1234  -0.0044 243 ARG B O   
4426 C CB  . ARG B 262 ? 0.5015 0.5254 0.5331 -0.0473 0.1062  -0.0087 243 ARG B CB  
4427 C CG  . ARG B 262 ? 0.5732 0.5732 0.5636 -0.0194 0.0869  -0.0051 243 ARG B CG  
4428 C CD  . ARG B 262 ? 0.6178 0.6135 0.5848 -0.0233 0.0709  -0.0105 243 ARG B CD  
4429 N NE  . ARG B 262 ? 0.6631 0.6388 0.6067 -0.0420 0.0445  -0.0245 243 ARG B NE  
4430 C CZ  . ARG B 262 ? 0.6781 0.6492 0.6191 -0.0567 0.0234  -0.0464 243 ARG B CZ  
4431 N NH1 . ARG B 262 ? 0.6809 0.6563 0.6276 -0.0612 0.0076  -0.0642 243 ARG B NH1 
4432 N NH2 . ARG B 262 ? 0.6883 0.6533 0.6163 -0.0534 0.0151  -0.0426 243 ARG B NH2 
4433 N N   . CYS B 263 ? 0.4517 0.4567 0.4564 -0.1216 0.0957  -0.0557 244 CYS B N   
4434 C CA  . CYS B 263 ? 0.4388 0.4456 0.4291 -0.1387 0.0961  -0.0580 244 CYS B CA  
4435 C C   . CYS B 263 ? 0.4145 0.3611 0.3837 -0.1142 0.0829  -0.0203 244 CYS B C   
4436 O O   . CYS B 263 ? 0.3918 0.3228 0.3805 -0.1075 0.0768  -0.0166 244 CYS B O   
4437 C CB  . CYS B 263 ? 0.4503 0.5021 0.4502 -0.1467 0.1187  -0.1068 244 CYS B CB  
4438 S SG  . CYS B 263 ? 0.5129 0.5794 0.4836 -0.1539 0.1309  -0.1285 244 CYS B SG  
4439 N N   . CYS B 264 ? 0.4151 0.3440 0.3419 -0.0860 0.0874  0.0156  245 CYS B N   
4440 C CA  . CYS B 264 ? 0.3753 0.3474 0.3186 -0.0547 0.0613  0.0257  245 CYS B CA  
4441 C C   . CYS B 264 ? 0.3599 0.3342 0.2981 -0.0801 0.0632  0.0255  245 CYS B C   
4442 O O   . CYS B 264 ? 0.3481 0.3522 0.2734 -0.0738 0.0953  0.0261  245 CYS B O   
4443 C CB  . CYS B 264 ? 0.3697 0.3677 0.3205 -0.0481 0.0880  0.0190  245 CYS B CB  
4444 S SG  . CYS B 264 ? 0.3536 0.3699 0.3277 -0.0479 0.0920  0.0093  245 CYS B SG  
4445 N N   . SER B 265 ? 0.3335 0.3189 0.3101 -0.0771 0.0433  0.0219  246 SER B N   
4446 C CA  . SER B 265 ? 0.3052 0.3077 0.3098 -0.0671 0.0242  0.0051  246 SER B CA  
4447 C C   . SER B 265 ? 0.2733 0.2940 0.2905 -0.0663 0.0025  0.0129  246 SER B C   
4448 O O   . SER B 265 ? 0.2154 0.2695 0.2552 -0.0332 -0.0001 0.0313  246 SER B O   
4449 C CB  . SER B 265 ? 0.2782 0.2853 0.2971 -0.0854 -0.0167 0.0216  246 SER B CB  
4450 O OG  . SER B 265 ? 0.2812 0.3142 0.3063 -0.0634 -0.0250 0.0092  246 SER B OG  
4451 N N   . THR B 266 ? 0.2647 0.3095 0.3139 -0.0839 -0.0108 0.0133  247 THR B N   
4452 C CA  . THR B 266 ? 0.2476 0.3325 0.3126 -0.0715 0.0006  0.0270  247 THR B CA  
4453 C C   . THR B 266 ? 0.2376 0.3586 0.3457 -0.0947 0.0299  0.0519  247 THR B C   
4454 O O   . THR B 266 ? 0.2698 0.4044 0.3745 -0.0683 0.0165  0.0554  247 THR B O   
4455 C CB  . THR B 266 ? 0.2674 0.3417 0.3057 -0.0490 -0.0184 0.0280  247 THR B CB  
4456 O OG1 . THR B 266 ? 0.3091 0.3564 0.3452 -0.0576 0.0129  0.0323  247 THR B OG1 
4457 C CG2 . THR B 266 ? 0.2472 0.3437 0.2936 -0.0293 -0.0005 -0.0001 247 THR B CG2 
4458 N N   . ALA B 267 ? 0.2638 0.3679 0.3607 -0.1013 0.0632  0.0642  248 ALA B N   
4459 C CA  . ALA B 267 ? 0.3630 0.3912 0.4005 -0.0839 0.0069  0.0746  248 ALA B CA  
4460 C C   . ALA B 267 ? 0.3257 0.3363 0.3970 -0.0703 -0.0032 0.0795  248 ALA B C   
4461 O O   . ALA B 267 ? 0.3643 0.3551 0.4290 -0.0447 0.0109  0.0502  248 ALA B O   
4463 N N   . GLU B 268 ? 0.2950 0.3164 0.3689 -0.0840 -0.0043 0.0664  249 GLU B N   
4464 C CA  . GLU B 268 ? 0.3101 0.3696 0.3716 -0.0457 0.0218  0.0549  249 GLU B CA  
4465 C C   . GLU B 268 ? 0.2878 0.3880 0.3537 -0.0674 0.0398  0.0616  249 GLU B C   
4466 O O   . GLU B 268 ? 0.2758 0.4009 0.3482 -0.0466 0.0720  0.0488  249 GLU B O   
4467 C CB  . GLU B 268 ? 0.3651 0.4016 0.3906 -0.0217 0.0289  0.0376  249 GLU B CB  
4468 C CG  . GLU B 268 ? 0.4476 0.4412 0.4117 -0.0163 0.0152  0.0267  249 GLU B CG  
4469 C CD  . GLU B 268 ? 0.4966 0.4849 0.4599 -0.0189 0.0090  0.0207  249 GLU B CD  
4470 O OE1 . GLU B 268 ? 0.4694 0.4964 0.4418 -0.0160 -0.0037 0.0401  249 GLU B OE1 
4471 O OE2 . GLU B 268 ? 0.4950 0.4941 0.4514 -0.0225 -0.0005 0.0194  249 GLU B OE2 
4472 N N   . ALA B 269 ? 0.2213 0.3796 0.3251 -0.0843 0.0424  0.0523  250 ALA B N   
4473 C CA  . ALA B 269 ? 0.2197 0.3854 0.3096 -0.1111 0.0411  0.0306  250 ALA B CA  
4474 C C   . ALA B 269 ? 0.2643 0.3739 0.3113 -0.1279 0.0377  0.0130  250 ALA B C   
4475 O O   . ALA B 269 ? 0.2683 0.3834 0.3171 -0.1518 0.0921  0.0122  250 ALA B O   
4476 C CB  . ALA B 269 ? 0.2126 0.4135 0.2780 -0.0771 0.0140  0.0271  250 ALA B CB  
4477 N N   . CYS B 270 ? 0.2897 0.3578 0.3299 -0.1045 0.0085  0.0156  251 CYS B N   
4478 C CA  . CYS B 270 ? 0.3202 0.3847 0.3405 -0.0544 0.0154  0.0234  251 CYS B CA  
4479 C C   . CYS B 270 ? 0.3042 0.4072 0.3559 -0.0500 0.0293  0.0222  251 CYS B C   
4480 O O   . CYS B 270 ? 0.2763 0.4067 0.3657 -0.1031 0.0332  0.0270  251 CYS B O   
4481 C CB  . CYS B 270 ? 0.3082 0.3716 0.3419 -0.0450 -0.0115 0.0490  251 CYS B CB  
4482 S SG  . CYS B 270 ? 0.3803 0.3920 0.3690 -0.0630 0.0038  0.0543  251 CYS B SG  
4483 N N   . ALA B 271 ? 0.2859 0.4354 0.3654 -0.0144 0.0176  0.0356  252 ALA B N   
4484 C CA  . ALA B 271 ? 0.3251 0.4500 0.3665 -0.0213 0.0300  0.0587  252 ALA B CA  
4485 C C   . ALA B 271 ? 0.3239 0.4612 0.3375 -0.0474 0.0653  0.0675  252 ALA B C   
4486 O O   . ALA B 271 ? 0.3269 0.5209 0.3335 -0.0397 0.0350  0.0436  252 ALA B O   
4487 C CB  . ALA B 271 ? 0.3342 0.4789 0.3938 -0.0054 0.0146  0.0739  252 ALA B CB  
4488 N N   . VAL B 272 ? 0.3156 0.3951 0.3181 -0.0886 0.0718  0.0594  253 VAL B N   
4489 C CA  . VAL B 272 ? 0.3396 0.4164 0.2999 -0.0837 0.0913  0.0510  253 VAL B CA  
4490 C C   . VAL B 272 ? 0.2922 0.4294 0.2950 -0.0626 0.0920  0.0438  253 VAL B C   
4491 O O   . VAL B 272 ? 0.3095 0.4359 0.2934 -0.0799 0.0806  0.0240  253 VAL B O   
4492 C CB  . VAL B 272 ? 0.3615 0.3939 0.2791 -0.0954 0.1329  0.0674  253 VAL B CB  
4493 C CG1 . VAL B 272 ? 0.3713 0.3951 0.2712 -0.0770 0.1302  0.0936  253 VAL B CG1 
4494 C CG2 . VAL B 272 ? 0.3935 0.4151 0.3126 -0.0595 0.1423  0.0447  253 VAL B CG2 
4495 N N   . VAL B 273 ? 0.2588 0.4129 0.2805 -0.0366 0.0748  0.0236  254 VAL B N   
4496 C CA  . VAL B 273 ? 0.2418 0.4101 0.2814 -0.0465 0.0405  0.0372  254 VAL B CA  
4497 C C   . VAL B 273 ? 0.2308 0.3991 0.2815 -0.0660 0.0234  0.0422  254 VAL B C   
4498 O O   . VAL B 273 ? 0.2306 0.3815 0.2809 -0.0548 0.0327  0.0749  254 VAL B O   
4499 C CB  . VAL B 273 ? 0.2313 0.4132 0.2706 -0.0605 0.0461  0.0601  254 VAL B CB  
4500 C CG1 . VAL B 273 ? 0.2076 0.4036 0.2656 -0.0756 0.0479  0.0845  254 VAL B CG1 
4501 C CG2 . VAL B 273 ? 0.2106 0.3974 0.2716 -0.0730 0.0169  0.0491  254 VAL B CG2 
4502 N N   . TRP B 274 ? 0.2298 0.4036 0.2826 -0.1117 -0.0130 0.0244  255 TRP B N   
4503 C CA  . TRP B 274 ? 0.2351 0.4150 0.2889 -0.1148 -0.0180 0.0230  255 TRP B CA  
4504 C C   . TRP B 274 ? 0.2635 0.4448 0.2922 -0.0871 0.0129  0.0118  255 TRP B C   
4505 O O   . TRP B 274 ? 0.2258 0.4553 0.2636 -0.0974 0.0266  0.0449  255 TRP B O   
4506 C CB  . TRP B 274 ? 0.2852 0.4029 0.3227 -0.1262 -0.0455 0.0144  255 TRP B CB  
4507 C CG  . TRP B 274 ? 0.3186 0.4108 0.3607 -0.1325 -0.0265 -0.0077 255 TRP B CG  
4508 C CD1 . TRP B 274 ? 0.3570 0.4344 0.3843 -0.1178 -0.0201 -0.0368 255 TRP B CD1 
4509 C CD2 . TRP B 274 ? 0.3373 0.3911 0.3741 -0.1403 -0.0017 -0.0100 255 TRP B CD2 
4510 N NE1 . TRP B 274 ? 0.3672 0.4183 0.4118 -0.1037 0.0034  -0.0416 255 TRP B NE1 
4511 C CE2 . TRP B 274 ? 0.3832 0.3987 0.4132 -0.1241 0.0271  -0.0099 255 TRP B CE2 
4512 C CE3 . TRP B 274 ? 0.3737 0.3882 0.3915 -0.1429 0.0115  -0.0018 255 TRP B CE3 
4513 C CZ2 . TRP B 274 ? 0.3955 0.3905 0.4186 -0.1369 0.0413  0.0137  255 TRP B CZ2 
4514 C CZ3 . TRP B 274 ? 0.3916 0.3919 0.4161 -0.1481 0.0096  0.0194  255 TRP B CZ3 
4515 C CH2 . TRP B 274 ? 0.4065 0.3953 0.4254 -0.1457 0.0240  0.0276  255 TRP B CH2 
4516 N N   . ASP B 275 ? 0.2395 0.4622 0.3124 -0.0915 0.0294  0.0035  256 ASP B N   
4517 C CA  . ASP B 275 ? 0.2459 0.4665 0.3151 -0.0852 0.0076  -0.0037 256 ASP B CA  
4518 C C   . ASP B 275 ? 0.1906 0.4383 0.2725 -0.0534 -0.0094 0.0066  256 ASP B C   
4519 O O   . ASP B 275 ? 0.1904 0.4452 0.2440 -0.0376 -0.0273 0.0118  256 ASP B O   
4520 C CB  . ASP B 275 ? 0.2933 0.4947 0.3529 -0.0824 0.0383  -0.0094 256 ASP B CB  
4521 C CG  . ASP B 275 ? 0.3941 0.5249 0.3830 -0.0818 0.0590  -0.0204 256 ASP B CG  
4522 O OD1 . ASP B 275 ? 0.4112 0.5654 0.4112 -0.0736 0.1006  -0.0054 256 ASP B OD1 
4523 O OD2 . ASP B 275 ? 0.4018 0.5208 0.4128 -0.0990 0.0488  -0.0396 256 ASP B OD2 
4524 N N   . GLU B 276 ? 0.2130 0.4103 0.2790 -0.0633 0.0069  -0.0058 257 GLU B N   
4525 C CA  . GLU B 276 ? 0.2142 0.3881 0.2980 -0.0315 0.0181  -0.0203 257 GLU B CA  
4526 C C   . GLU B 276 ? 0.1907 0.3337 0.2773 -0.0342 0.0038  -0.0133 257 GLU B C   
4527 O O   . GLU B 276 ? 0.1778 0.3368 0.2691 -0.0572 0.0334  -0.0207 257 GLU B O   
4528 C CB  . GLU B 276 ? 0.2601 0.4204 0.3282 -0.0307 0.0244  -0.0510 257 GLU B CB  
4529 C CG  . GLU B 276 ? 0.3566 0.4635 0.3929 -0.0372 0.0234  -0.0748 257 GLU B CG  
4530 C CD  . GLU B 276 ? 0.4673 0.4988 0.4508 -0.0337 0.0627  -0.0632 257 GLU B CD  
4531 O OE1 . GLU B 276 ? 0.4797 0.5012 0.4576 -0.0286 0.0853  -0.0732 257 GLU B OE1 
4532 O OE2 . GLU B 276 ? 0.4903 0.5186 0.4745 -0.0385 0.0776  -0.0515 257 GLU B OE2 
4533 N N   . ALA B 277 ? 0.1888 0.3003 0.2763 -0.0492 -0.0080 0.0092  258 ALA B N   
4534 C CA  . ALA B 277 ? 0.1753 0.2986 0.2635 -0.0293 0.0168  0.0097  258 ALA B CA  
4535 C C   . ALA B 277 ? 0.1795 0.2903 0.2474 -0.0317 0.0208  0.0105  258 ALA B C   
4536 O O   . ALA B 277 ? 0.2126 0.2889 0.2212 -0.0497 0.0319  -0.0170 258 ALA B O   
4537 C CB  . ALA B 277 ? 0.1502 0.2986 0.2636 -0.0405 0.0148  0.0211  258 ALA B CB  
4538 N N   . GLN B 278 ? 0.1669 0.2933 0.2610 -0.0180 -0.0029 0.0109  259 GLN B N   
4539 C CA  . GLN B 278 ? 0.1439 0.3157 0.3003 -0.0672 0.0040  0.0106  259 GLN B CA  
4540 C C   . GLN B 278 ? 0.1720 0.3401 0.3103 -0.0619 0.0166  0.0070  259 GLN B C   
4541 O O   . GLN B 278 ? 0.2005 0.3222 0.3101 -0.0425 -0.0026 0.0371  259 GLN B O   
4542 C CB  . GLN B 278 ? 0.1418 0.3414 0.3161 -0.0573 -0.0094 -0.0140 259 GLN B CB  
4543 C CG  . GLN B 278 ? 0.1553 0.3445 0.3070 -0.0678 -0.0455 -0.0314 259 GLN B CG  
4544 C CD  . GLN B 278 ? 0.2139 0.3506 0.3213 -0.0522 -0.0337 -0.0280 259 GLN B CD  
4545 O OE1 . GLN B 278 ? 0.1808 0.3859 0.3537 -0.0592 -0.0395 -0.0193 259 GLN B OE1 
4546 N NE2 . GLN B 278 ? 0.2446 0.3357 0.3013 -0.0700 -0.0344 -0.0314 259 GLN B NE2 
4547 N N   . ARG B 279 ? 0.1812 0.3500 0.3032 -0.0613 0.0669  -0.0236 260 ARG B N   
4548 C CA  . ARG B 279 ? 0.1961 0.3665 0.2938 -0.0160 0.0376  -0.0470 260 ARG B CA  
4549 C C   . ARG B 279 ? 0.1342 0.3260 0.2689 -0.0072 0.0164  -0.0314 260 ARG B C   
4550 O O   . ARG B 279 ? 0.1272 0.3286 0.2985 0.0232  0.0007  -0.0279 260 ARG B O   
4551 C CB  . ARG B 279 ? 0.2753 0.4161 0.3203 -0.0218 0.0483  -0.0607 260 ARG B CB  
4552 C CG  . ARG B 279 ? 0.3726 0.4624 0.3723 -0.0189 0.0360  -0.0823 260 ARG B CG  
4553 C CD  . ARG B 279 ? 0.4547 0.4964 0.4124 0.0063  0.0142  -0.0975 260 ARG B CD  
4554 N NE  . ARG B 279 ? 0.5265 0.5307 0.4463 0.0296  0.0024  -0.0857 260 ARG B NE  
4555 C CZ  . ARG B 279 ? 0.5628 0.5493 0.4532 0.0225  -0.0214 -0.0814 260 ARG B CZ  
4556 N NH1 . ARG B 279 ? 0.5969 0.5699 0.4402 0.0147  -0.0189 -0.0727 260 ARG B NH1 
4557 N NH2 . ARG B 279 ? 0.5882 0.5517 0.4781 0.0353  -0.0319 -0.0753 260 ARG B NH2 
4558 N N   . MET B 280 ? 0.1535 0.3228 0.2466 -0.0022 0.0216  -0.0239 261 MET B N   
4559 C CA  A MET B 280 ? 0.1150 0.3057 0.2378 -0.0215 0.0137  -0.0165 261 MET B CA  
4560 C CA  B MET B 280 ? 0.1089 0.3193 0.2301 -0.0162 0.0138  -0.0072 261 MET B CA  
4561 C C   . MET B 280 ? 0.1297 0.2920 0.2355 -0.0287 0.0187  -0.0177 261 MET B C   
4562 O O   . MET B 280 ? 0.1939 0.2930 0.2379 0.0001  0.0028  -0.0123 261 MET B O   
4563 C CB  A MET B 280 ? 0.1266 0.2921 0.2367 -0.0086 0.0017  -0.0243 261 MET B CB  
4564 C CB  B MET B 280 ? 0.1023 0.3340 0.2184 0.0053  0.0030  0.0057  261 MET B CB  
4565 C CG  A MET B 280 ? 0.1671 0.2820 0.2526 -0.0180 -0.0208 -0.0266 261 MET B CG  
4566 C CG  B MET B 280 ? 0.1295 0.3607 0.2290 -0.0077 -0.0157 0.0196  261 MET B CG  
4567 S SD  A MET B 280 ? 0.2105 0.2729 0.2631 -0.0110 -0.0076 -0.0205 261 MET B SD  
4568 S SD  B MET B 280 ? 0.1645 0.3888 0.2237 -0.0097 -0.0098 0.0385  261 MET B SD  
4569 C CE  A MET B 280 ? 0.2016 0.2465 0.2635 -0.0206 -0.0118 -0.0072 261 MET B CE  
4570 C CE  B MET B 280 ? 0.1470 0.3735 0.2254 -0.0070 -0.0211 0.0598  261 MET B CE  
4571 N N   . ALA B 281 ? 0.1442 0.2959 0.2440 -0.0126 0.0162  -0.0203 262 ALA B N   
4572 C CA  . ALA B 281 ? 0.1695 0.2931 0.2501 -0.0102 -0.0180 -0.0081 262 ALA B CA  
4573 C C   . ALA B 281 ? 0.1622 0.3458 0.2629 -0.0398 -0.0300 -0.0218 262 ALA B C   
4574 O O   . ALA B 281 ? 0.1941 0.3536 0.2496 -0.0297 -0.0336 -0.0207 262 ALA B O   
4575 C CB  . ALA B 281 ? 0.2151 0.2606 0.2690 0.0086  -0.0045 -0.0230 262 ALA B CB  
4576 N N   . ASP B 282 ? 0.1623 0.3725 0.2733 -0.0211 -0.0292 0.0022  263 ASP B N   
4577 C CA  . ASP B 282 ? 0.1756 0.3847 0.3012 0.0110  -0.0401 0.0136  263 ASP B CA  
4578 C C   . ASP B 282 ? 0.1604 0.3746 0.2943 0.0134  -0.0306 0.0040  263 ASP B C   
4579 O O   . ASP B 282 ? 0.1377 0.3607 0.2945 0.0396  -0.0542 -0.0022 263 ASP B O   
4580 C CB  . ASP B 282 ? 0.1886 0.3960 0.3258 -0.0038 -0.0139 0.0075  263 ASP B CB  
4581 C CG  . ASP B 282 ? 0.2430 0.4173 0.3729 -0.0144 -0.0184 -0.0134 263 ASP B CG  
4582 O OD1 . ASP B 282 ? 0.2418 0.4298 0.3966 0.0003  -0.0412 -0.0323 263 ASP B OD1 
4583 O OD2 . ASP B 282 ? 0.2658 0.4335 0.4049 -0.0586 0.0057  0.0007  263 ASP B OD2 
4584 N N   . ARG B 283 ? 0.1409 0.3513 0.2753 0.0160  -0.0379 -0.0045 264 ARG B N   
4585 C CA  . ARG B 283 ? 0.1461 0.3060 0.2614 0.0106  -0.0347 -0.0261 264 ARG B CA  
4586 C C   . ARG B 283 ? 0.1562 0.2915 0.2528 0.0164  -0.0293 -0.0382 264 ARG B C   
4587 O O   . ARG B 283 ? 0.1617 0.3168 0.2549 0.0074  -0.0371 -0.0600 264 ARG B O   
4588 C CB  . ARG B 283 ? 0.1865 0.2910 0.2562 0.0052  -0.0107 -0.0221 264 ARG B CB  
4589 C CG  . ARG B 283 ? 0.2803 0.3005 0.3003 -0.0294 0.0077  -0.0278 264 ARG B CG  
4590 C CD  . ARG B 283 ? 0.3556 0.3471 0.3637 -0.0024 0.0557  0.0001  264 ARG B CD  
4591 N NE  . ARG B 283 ? 0.4283 0.3470 0.4184 0.0076  0.0830  0.0082  264 ARG B NE  
4592 C CZ  . ARG B 283 ? 0.4122 0.3722 0.4591 0.0039  0.0857  -0.0001 264 ARG B CZ  
4593 N NH1 . ARG B 283 ? 0.4117 0.3852 0.4757 0.0267  0.1020  -0.0352 264 ARG B NH1 
4594 N NH2 . ARG B 283 ? 0.4042 0.3667 0.4747 -0.0336 0.0679  0.0193  264 ARG B NH2 
4595 N N   . PHE B 284 ? 0.1449 0.2630 0.2442 0.0258  -0.0281 -0.0384 265 PHE B N   
4596 C CA  . PHE B 284 ? 0.1612 0.2401 0.2385 0.0313  -0.0386 -0.0128 265 PHE B CA  
4597 C C   . PHE B 284 ? 0.1920 0.2615 0.2664 0.0062  -0.0540 0.0029  265 PHE B C   
4598 O O   . PHE B 284 ? 0.2407 0.2297 0.2735 0.0050  -0.0537 0.0285  265 PHE B O   
4599 C CB  . PHE B 284 ? 0.1591 0.2565 0.2645 0.0262  -0.0469 -0.0126 265 PHE B CB  
4600 C CG  . PHE B 284 ? 0.2003 0.2382 0.2680 0.0264  -0.0415 -0.0330 265 PHE B CG  
4601 C CD1 . PHE B 284 ? 0.2085 0.2203 0.2598 0.0024  -0.0377 -0.0048 265 PHE B CD1 
4602 C CD2 . PHE B 284 ? 0.2070 0.2274 0.2526 0.0020  -0.0354 -0.0509 265 PHE B CD2 
4603 C CE1 . PHE B 284 ? 0.2058 0.2189 0.2520 0.0176  -0.0418 0.0011  265 PHE B CE1 
4604 C CE2 . PHE B 284 ? 0.1988 0.2624 0.2700 0.0044  -0.0203 -0.0432 265 PHE B CE2 
4605 C CZ  . PHE B 284 ? 0.2007 0.2421 0.2700 0.0015  -0.0403 -0.0241 265 PHE B CZ  
4606 N N   . CYS B 285 ? 0.2117 0.2975 0.2879 -0.0066 -0.0846 -0.0151 266 CYS B N   
4607 C CA  . CYS B 285 ? 0.1936 0.3087 0.3032 -0.0586 -0.0941 0.0101  266 CYS B CA  
4608 C C   . CYS B 285 ? 0.1883 0.3290 0.3051 -0.0413 -0.1151 0.0101  266 CYS B C   
4609 O O   . CYS B 285 ? 0.2325 0.3552 0.3180 -0.0285 -0.1144 0.0121  266 CYS B O   
4610 C CB  . CYS B 285 ? 0.2431 0.3144 0.3129 -0.0355 -0.0965 0.0278  266 CYS B CB  
4611 S SG  . CYS B 285 ? 0.3115 0.3321 0.3215 -0.0561 -0.0650 0.0266  266 CYS B SG  
4612 N N   . ASP B 286 ? 0.2019 0.3410 0.3047 -0.0081 -0.0844 0.0189  267 ASP B N   
4613 C CA  . ASP B 286 ? 0.2059 0.3615 0.3150 0.0043  -0.0593 0.0313  267 ASP B CA  
4614 C C   . ASP B 286 ? 0.2356 0.3365 0.2976 0.0263  -0.0654 0.0505  267 ASP B C   
4615 O O   . ASP B 286 ? 0.2606 0.3665 0.3071 0.0500  -0.0618 0.0739  267 ASP B O   
4616 C CB  . ASP B 286 ? 0.2657 0.4077 0.3356 0.0161  -0.0380 0.0158  267 ASP B CB  
4617 C CG  . ASP B 286 ? 0.3978 0.4624 0.3879 0.0151  -0.0138 -0.0045 267 ASP B CG  
4618 O OD1 . ASP B 286 ? 0.4018 0.4801 0.4269 -0.0135 -0.0105 0.0106  267 ASP B OD1 
4619 O OD2 . ASP B 286 ? 0.4416 0.4839 0.4086 0.0476  0.0359  -0.0208 267 ASP B OD2 
4620 N N   . LEU B 287 ? 0.1956 0.2687 0.2755 0.0069  -0.0405 0.0278  268 LEU B N   
4621 C CA  A LEU B 287 ? 0.1935 0.2719 0.2790 -0.0111 -0.0499 0.0096  268 LEU B CA  
4622 C CA  B LEU B 287 ? 0.1820 0.2597 0.2725 -0.0187 -0.0445 0.0070  268 LEU B CA  
4623 C C   . LEU B 287 ? 0.2207 0.2618 0.2895 -0.0183 -0.0347 0.0092  268 LEU B C   
4624 O O   . LEU B 287 ? 0.2377 0.2350 0.3212 -0.0411 -0.0397 0.0046  268 LEU B O   
4625 C CB  A LEU B 287 ? 0.2170 0.2854 0.2790 0.0036  -0.0730 0.0109  268 LEU B CB  
4626 C CB  B LEU B 287 ? 0.1871 0.2492 0.2596 -0.0176 -0.0531 0.0039  268 LEU B CB  
4627 C CG  A LEU B 287 ? 0.2393 0.3095 0.2853 0.0414  -0.0559 0.0180  268 LEU B CG  
4628 C CG  B LEU B 287 ? 0.1955 0.2541 0.2524 0.0069  -0.0141 0.0027  268 LEU B CG  
4629 C CD1 A LEU B 287 ? 0.2742 0.3125 0.2916 0.0468  -0.0414 0.0314  268 LEU B CD1 
4630 C CD1 B LEU B 287 ? 0.2107 0.2669 0.2504 -0.0026 -0.0282 0.0043  268 LEU B CD1 
4631 C CD2 A LEU B 287 ? 0.2194 0.3190 0.2766 0.0419  -0.0797 0.0186  268 LEU B CD2 
4632 C CD2 B LEU B 287 ? 0.2020 0.2408 0.2549 0.0168  0.0003  -0.0014 268 LEU B CD2 
4633 N N   . ARG B 288 ? 0.2014 0.2691 0.2859 -0.0328 -0.0199 -0.0037 269 ARG B N   
4634 C CA  . ARG B 288 ? 0.2654 0.2732 0.2997 -0.0116 -0.0079 -0.0008 269 ARG B CA  
4635 C C   . ARG B 288 ? 0.2828 0.3334 0.2802 -0.0284 -0.0049 -0.0036 269 ARG B C   
4636 O O   . ARG B 288 ? 0.3322 0.3586 0.2533 -0.0136 0.0456  0.0187  269 ARG B O   
4637 C CB  . ARG B 288 ? 0.3493 0.2874 0.3424 -0.0017 0.0191  -0.0126 269 ARG B CB  
4638 C CG  . ARG B 288 ? 0.4201 0.3355 0.4010 0.0092  -0.0119 -0.0012 269 ARG B CG  
4639 C CD  . ARG B 288 ? 0.4954 0.3910 0.4518 0.0155  -0.0344 -0.0321 269 ARG B CD  
4640 N NE  . ARG B 288 ? 0.5541 0.4520 0.4859 0.0025  -0.0312 -0.0638 269 ARG B NE  
4641 C CZ  . ARG B 288 ? 0.6097 0.4962 0.5061 -0.0381 -0.0180 -0.0766 269 ARG B CZ  
4642 N NH1 . ARG B 288 ? 0.6158 0.5024 0.5041 -0.0550 -0.0456 -0.0751 269 ARG B NH1 
4643 N NH2 . ARG B 288 ? 0.6396 0.5191 0.5216 -0.0444 0.0138  -0.0787 269 ARG B NH2 
4644 N N   . ASP B 289 ? 0.2732 0.3666 0.2968 -0.0459 -0.0389 0.0152  270 ASP B N   
4645 C CA  . ASP B 289 ? 0.2915 0.3831 0.3004 -0.0096 -0.0879 0.0325  270 ASP B CA  
4646 C C   . ASP B 289 ? 0.2770 0.3544 0.2885 0.0043  -0.1107 0.0081  270 ASP B C   
4647 O O   . ASP B 289 ? 0.2650 0.3852 0.3146 0.0163  -0.1230 0.0161  270 ASP B O   
4648 C CB  . ASP B 289 ? 0.3006 0.4274 0.3269 -0.0217 -0.0948 0.0589  270 ASP B CB  
4649 C CG  . ASP B 289 ? 0.3872 0.4808 0.3778 -0.0406 -0.0649 0.0554  270 ASP B CG  
4650 O OD1 . ASP B 289 ? 0.4369 0.4858 0.3982 -0.0722 -0.0623 0.0333  270 ASP B OD1 
4651 O OD2 . ASP B 289 ? 0.3999 0.5121 0.3969 -0.0489 -0.0663 0.0929  270 ASP B OD2 
4652 N N   . GLN B 290 ? 0.2283 0.3296 0.2947 -0.0182 -0.0874 -0.0069 271 GLN B N   
4653 C CA  . GLN B 290 ? 0.2401 0.3324 0.2938 0.0356  -0.0855 0.0058  271 GLN B CA  
4654 C C   . GLN B 290 ? 0.2461 0.3091 0.2849 0.0254  -0.0864 0.0185  271 GLN B C   
4655 O O   . GLN B 290 ? 0.2985 0.3051 0.3077 0.0218  -0.0943 0.0132  271 GLN B O   
4656 C CB  . GLN B 290 ? 0.2586 0.3532 0.3209 0.0627  -0.0729 0.0042  271 GLN B CB  
4657 C CG  . GLN B 290 ? 0.3213 0.3993 0.3531 0.0398  -0.0343 0.0087  271 GLN B CG  
4658 C CD  . GLN B 290 ? 0.3757 0.4353 0.3820 0.0353  0.0002  0.0169  271 GLN B CD  
4659 O OE1 . GLN B 290 ? 0.4358 0.4621 0.3874 0.0346  0.0095  -0.0054 271 GLN B OE1 
4660 N NE2 . GLN B 290 ? 0.4015 0.4444 0.4004 0.0504  -0.0161 0.0554  271 GLN B NE2 
4661 N N   . LEU B 291 ? 0.1813 0.2814 0.2843 0.0488  -0.0663 0.0171  272 LEU B N   
4662 C CA  . LEU B 291 ? 0.2076 0.2624 0.3105 0.0414  -0.0668 0.0422  272 LEU B CA  
4663 C C   . LEU B 291 ? 0.2463 0.2611 0.2968 0.0185  -0.0876 0.0434  272 LEU B C   
4664 O O   . LEU B 291 ? 0.2797 0.2351 0.2917 0.0310  -0.0709 0.0506  272 LEU B O   
4665 C CB  . LEU B 291 ? 0.2313 0.2670 0.3524 -0.0038 -0.0564 0.0216  272 LEU B CB  
4666 C CG  . LEU B 291 ? 0.2332 0.2258 0.3508 -0.0173 -0.0948 0.0238  272 LEU B CG  
4667 C CD1 . LEU B 291 ? 0.2426 0.2379 0.3693 -0.0145 -0.1020 0.0364  272 LEU B CD1 
4668 C CD2 . LEU B 291 ? 0.2587 0.2059 0.3532 -0.0251 -0.0881 0.0366  272 LEU B CD2 
4669 N N   . PRO B 292 ? 0.2769 0.2834 0.3000 -0.0256 -0.1087 0.0404  273 PRO B N   
4670 C CA  . PRO B 292 ? 0.2794 0.2695 0.2902 -0.0346 -0.1314 0.0440  273 PRO B CA  
4671 C C   . PRO B 292 ? 0.2936 0.2750 0.3166 0.0018  -0.1383 0.0503  273 PRO B C   
4672 O O   . PRO B 292 ? 0.3122 0.2349 0.2998 -0.0260 -0.1437 0.0520  273 PRO B O   
4673 C CB  . PRO B 292 ? 0.2550 0.2853 0.3001 -0.0653 -0.1144 0.0531  273 PRO B CB  
4674 C CG  . PRO B 292 ? 0.2693 0.3032 0.3059 -0.0553 -0.1101 0.0174  273 PRO B CG  
4675 C CD  . PRO B 292 ? 0.2771 0.2923 0.3003 -0.0548 -0.1093 0.0204  273 PRO B CD  
4676 N N   . ASP B 293 ? 0.3097 0.2992 0.3456 0.0441  -0.1243 0.0310  274 ASP B N   
4677 C CA  . ASP B 293 ? 0.3725 0.3340 0.3732 0.0434  -0.0984 0.0334  274 ASP B CA  
4678 C C   . ASP B 293 ? 0.3842 0.2797 0.3570 0.0323  -0.0859 0.0428  274 ASP B C   
4679 O O   . ASP B 293 ? 0.4317 0.2522 0.3682 0.0017  -0.0987 0.0331  274 ASP B O   
4680 C CB  . ASP B 293 ? 0.3981 0.4014 0.4142 0.0580  -0.0798 0.0286  274 ASP B CB  
4681 C CG  . ASP B 293 ? 0.4829 0.4724 0.4468 0.0483  -0.0676 0.0401  274 ASP B CG  
4682 O OD1 . ASP B 293 ? 0.4749 0.4991 0.4569 0.0712  -0.1038 0.0489  274 ASP B OD1 
4683 O OD2 . ASP B 293 ? 0.5091 0.5131 0.4678 0.0147  -0.0508 0.0396  274 ASP B OD2 
4684 N N   . ALA B 294 ? 0.3603 0.2469 0.3269 0.0539  -0.1142 0.0381  275 ALA B N   
4685 C CA  . ALA B 294 ? 0.3246 0.2498 0.3108 0.0422  -0.1425 0.0252  275 ALA B CA  
4686 C C   . ALA B 294 ? 0.3226 0.2379 0.3218 0.0070  -0.1202 0.0154  275 ALA B C   
4687 O O   . ALA B 294 ? 0.3676 0.2545 0.3346 -0.0238 -0.1218 0.0151  275 ALA B O   
4688 C CB  . ALA B 294 ? 0.3337 0.2468 0.2741 0.0406  -0.1670 -0.0014 275 ALA B CB  
4689 N N   . CYS B 295 ? 0.2982 0.2116 0.3113 0.0067  -0.0892 0.0030  276 CYS B N   
4690 C CA  . CYS B 295 ? 0.3186 0.2135 0.2857 0.0193  -0.0945 0.0126  276 CYS B CA  
4691 C C   . CYS B 295 ? 0.3042 0.2550 0.2934 0.0115  -0.1048 0.0217  276 CYS B C   
4692 O O   . CYS B 295 ? 0.3122 0.2653 0.2946 -0.0087 -0.0697 0.0134  276 CYS B O   
4693 C CB  . CYS B 295 ? 0.3156 0.2098 0.2850 0.0117  -0.0937 0.0170  276 CYS B CB  
4694 S SG  . CYS B 295 ? 0.3166 0.2453 0.2917 -0.0091 -0.0851 0.0510  276 CYS B SG  
4695 N N   . ARG B 296 ? 0.3147 0.2832 0.3058 0.0177  -0.1328 0.0617  277 ARG B N   
4696 C CA  . ARG B 296 ? 0.3492 0.3020 0.3437 0.0084  -0.1234 0.0768  277 ARG B CA  
4697 C C   . ARG B 296 ? 0.3373 0.2960 0.3602 0.0042  -0.1211 0.0720  277 ARG B C   
4698 O O   . ARG B 296 ? 0.3527 0.3048 0.3649 -0.0170 -0.1198 0.0831  277 ARG B O   
4699 C CB  . ARG B 296 ? 0.3796 0.3255 0.3774 0.0301  -0.1408 0.0867  277 ARG B CB  
4700 C CG  . ARG B 296 ? 0.3753 0.3667 0.4138 -0.0198 -0.1565 0.0727  277 ARG B CG  
4701 C CD  . ARG B 296 ? 0.3937 0.4269 0.4337 -0.0473 -0.1434 0.0811  277 ARG B CD  
4702 N NE  . ARG B 296 ? 0.4314 0.4820 0.4529 -0.0582 -0.1310 0.0821  277 ARG B NE  
4703 C CZ  . ARG B 296 ? 0.4210 0.5392 0.4785 -0.0500 -0.1382 0.0687  277 ARG B CZ  
4704 N NH1 . ARG B 296 ? 0.3816 0.5745 0.4573 -0.0387 -0.1673 0.0654  277 ARG B NH1 
4705 N NH2 . ARG B 296 ? 0.4425 0.5474 0.5092 -0.0472 -0.1456 0.0794  277 ARG B NH2 
4706 N N   . SER B 297 ? 0.3099 0.2822 0.3634 -0.0023 -0.1192 0.0479  278 SER B N   
4707 C CA  . SER B 297 ? 0.3051 0.2995 0.3630 0.0235  -0.1146 0.0374  278 SER B CA  
4708 C C   . SER B 297 ? 0.3110 0.2770 0.3619 0.0278  -0.1062 0.0435  278 SER B C   
4709 O O   . SER B 297 ? 0.3311 0.2642 0.4018 0.0008  -0.1065 0.0389  278 SER B O   
4710 C CB  . SER B 297 ? 0.2708 0.3032 0.3625 0.0282  -0.1508 0.0150  278 SER B CB  
4711 O OG  . SER B 297 ? 0.2767 0.3194 0.3755 0.0338  -0.1825 -0.0071 278 SER B OG  
4712 N N   . MET B 298 ? 0.3358 0.2927 0.3309 0.0273  -0.1082 0.0277  279 MET B N   
4713 C CA  . MET B 298 ? 0.2956 0.2760 0.3078 0.0320  -0.1271 0.0362  279 MET B CA  
4714 C C   . MET B 298 ? 0.3151 0.2781 0.3180 0.0192  -0.1115 0.0591  279 MET B C   
4715 O O   . MET B 298 ? 0.2940 0.2792 0.3196 -0.0319 -0.0857 0.0584  279 MET B O   
4716 C CB  . MET B 298 ? 0.2888 0.2846 0.2859 0.0280  -0.1494 0.0130  279 MET B CB  
4717 C CG  . MET B 298 ? 0.2703 0.2680 0.2697 0.0330  -0.1411 0.0001  279 MET B CG  
4718 S SD  . MET B 298 ? 0.2535 0.2658 0.2447 -0.0151 -0.0833 0.0057  279 MET B SD  
4719 C CE  . MET B 298 ? 0.2632 0.2770 0.2667 -0.0139 -0.0650 0.0027  279 MET B CE  
4720 N N   . SER B 299 ? 0.3681 0.3072 0.3017 0.0216  -0.1278 0.0439  280 SER B N   
4721 C CA  . SER B 299 ? 0.4032 0.3105 0.3163 0.0248  -0.1113 0.0627  280 SER B CA  
4722 C C   . SER B 299 ? 0.4203 0.3206 0.3056 -0.0317 -0.1036 0.0618  280 SER B C   
4723 O O   . SER B 299 ? 0.4365 0.3146 0.3126 -0.0472 -0.0894 0.1032  280 SER B O   
4724 C CB  . SER B 299 ? 0.3884 0.3440 0.3606 0.0302  -0.1266 0.0622  280 SER B CB  
4725 O OG  . SER B 299 ? 0.4382 0.3673 0.3988 0.0420  -0.1295 0.1053  280 SER B OG  
4726 N N   . LEU B 300 ? 0.3986 0.2763 0.2480 -0.0506 -0.1213 0.0649  281 LEU B N   
4727 C CA  . LEU B 300 ? 0.4070 0.3068 0.2420 -0.0373 -0.1170 0.0553  281 LEU B CA  
4728 C C   . LEU B 300 ? 0.3967 0.3353 0.2598 -0.0388 -0.1368 0.0697  281 LEU B C   
4729 O O   . LEU B 300 ? 0.3797 0.3291 0.2917 -0.0761 -0.1419 0.1017  281 LEU B O   
4730 C CB  . LEU B 300 ? 0.3913 0.2594 0.1949 -0.0098 -0.0915 0.0370  281 LEU B CB  
4731 C CG  . LEU B 300 ? 0.3502 0.2276 0.1922 -0.0123 -0.1112 0.0417  281 LEU B CG  
4732 C CD1 . LEU B 300 ? 0.3616 0.2636 0.2045 -0.0289 -0.0630 0.0811  281 LEU B CD1 
4733 C CD2 . LEU B 300 ? 0.3076 0.2270 0.2067 0.0018  -0.1182 0.0486  281 LEU B CD2 
4734 N N   . ASP B 301 ? 0.3947 0.3253 0.2558 -0.0093 -0.1276 0.0635  282 ASP B N   
4735 C CA  . ASP B 301 ? 0.4041 0.3264 0.2420 -0.0088 -0.0943 0.0679  282 ASP B CA  
4736 C C   . ASP B 301 ? 0.4353 0.3663 0.2402 -0.0153 -0.1225 0.0495  282 ASP B C   
4737 O O   . ASP B 301 ? 0.4279 0.3740 0.2148 -0.0079 -0.1356 0.0250  282 ASP B O   
4738 C CB  . ASP B 301 ? 0.4035 0.3359 0.2632 0.0070  -0.0784 0.0771  282 ASP B CB  
4739 C CG  . ASP B 301 ? 0.4322 0.3310 0.2938 -0.0080 -0.0316 0.0709  282 ASP B CG  
4740 O OD1 . ASP B 301 ? 0.4270 0.3338 0.2715 0.0067  -0.0667 0.0746  282 ASP B OD1 
4741 O OD2 . ASP B 301 ? 0.4551 0.3247 0.3328 -0.0255 0.0182  0.0732  282 ASP B OD2 
4742 N N   . PRO B 302 ? 0.4519 0.3714 0.1941 -0.0267 -0.1317 0.0413  283 PRO B N   
4743 C CA  . PRO B 302 ? 0.4371 0.3683 0.2038 -0.0215 -0.1328 0.0076  283 PRO B CA  
4744 C C   . PRO B 302 ? 0.4252 0.3545 0.2133 -0.0351 -0.1094 0.0041  283 PRO B C   
4745 O O   . PRO B 302 ? 0.4447 0.3398 0.2106 -0.0463 -0.1018 0.0362  283 PRO B O   
4746 C CB  . PRO B 302 ? 0.4494 0.3858 0.2243 -0.0004 -0.1335 0.0302  283 PRO B CB  
4747 C CG  . PRO B 302 ? 0.4741 0.3895 0.2346 -0.0077 -0.1269 0.0384  283 PRO B CG  
4748 C CD  . PRO B 302 ? 0.4658 0.3797 0.2113 -0.0208 -0.1285 0.0424  283 PRO B CD  
4749 N N   . ALA B 303 ? 0.3785 0.3404 0.1913 -0.0229 -0.0741 -0.0259 284 ALA B N   
4750 C CA  . ALA B 303 ? 0.3799 0.3347 0.2106 -0.0445 -0.0611 -0.0297 284 ALA B CA  
4751 C C   . ALA B 303 ? 0.3996 0.2876 0.2054 -0.0333 -0.0731 -0.0144 284 ALA B C   
4752 O O   . ALA B 303 ? 0.4367 0.2608 0.2208 -0.0320 -0.0830 -0.0167 284 ALA B O   
4753 C CB  . ALA B 303 ? 0.3576 0.3675 0.2168 -0.0581 -0.0419 -0.0235 284 ALA B CB  
4754 N N   . GLN B 304 ? 0.3496 0.2644 0.1908 -0.0140 -0.0736 -0.0464 285 GLN B N   
4755 C CA  . GLN B 304 ? 0.3376 0.2523 0.1927 -0.0476 -0.0659 -0.0134 285 GLN B CA  
4756 C C   . GLN B 304 ? 0.3051 0.2407 0.1792 -0.0500 -0.0625 -0.0082 285 GLN B C   
4757 O O   . GLN B 304 ? 0.3186 0.2140 0.1617 -0.0463 -0.0497 -0.0082 285 GLN B O   
4758 C CB  . GLN B 304 ? 0.3286 0.2533 0.2243 -0.0124 -0.0665 0.0460  285 GLN B CB  
4759 C CG  . GLN B 304 ? 0.3604 0.2339 0.2349 -0.0166 -0.0595 0.0688  285 GLN B CG  
4760 C CD  . GLN B 304 ? 0.3761 0.2509 0.2390 -0.0135 -0.0728 0.0729  285 GLN B CD  
4761 O OE1 . GLN B 304 ? 0.4001 0.2885 0.2374 -0.0337 -0.0586 0.0597  285 GLN B OE1 
4762 N NE2 . GLN B 304 ? 0.3817 0.2677 0.2424 -0.0017 -0.0575 0.0780  285 GLN B NE2 
4763 N N   . ARG B 305 ? 0.3101 0.2526 0.1648 -0.0384 -0.0888 -0.0013 286 ARG B N   
4764 C CA  . ARG B 305 ? 0.2896 0.2456 0.2084 -0.0455 -0.0826 0.0258  286 ARG B CA  
4765 C C   . ARG B 305 ? 0.3248 0.2455 0.2185 -0.0356 -0.0652 0.0095  286 ARG B C   
4766 O O   . ARG B 305 ? 0.3327 0.2509 0.2053 -0.0653 -0.0942 0.0034  286 ARG B O   
4767 C CB  . ARG B 305 ? 0.2936 0.2606 0.2323 -0.0445 -0.0959 0.0374  286 ARG B CB  
4768 C CG  . ARG B 305 ? 0.2982 0.2625 0.2532 -0.0170 -0.0862 0.0307  286 ARG B CG  
4769 C CD  . ARG B 305 ? 0.3266 0.2915 0.2920 -0.0070 -0.1002 0.0201  286 ARG B CD  
4770 N NE  . ARG B 305 ? 0.3580 0.3013 0.3372 -0.0094 -0.0902 -0.0184 286 ARG B NE  
4771 C CZ  . ARG B 305 ? 0.3767 0.3186 0.3495 0.0003  -0.1013 0.0032  286 ARG B CZ  
4772 N NH1 . ARG B 305 ? 0.3956 0.3162 0.3449 0.0359  -0.1080 0.0429  286 ARG B NH1 
4773 N NH2 . ARG B 305 ? 0.3916 0.3406 0.3652 -0.0254 -0.1023 -0.0115 286 ARG B NH2 
4774 N N   . LEU B 306 ? 0.3383 0.2296 0.2135 -0.0341 -0.0826 -0.0062 287 LEU B N   
4775 C CA  . LEU B 306 ? 0.3404 0.2411 0.2146 -0.0145 -0.0850 -0.0168 287 LEU B CA  
4776 C C   . LEU B 306 ? 0.3282 0.2534 0.1908 -0.0329 -0.0697 -0.0191 287 LEU B C   
4777 O O   . LEU B 306 ? 0.3717 0.2649 0.1583 -0.0431 -0.0610 -0.0021 287 LEU B O   
4778 C CB  . LEU B 306 ? 0.3594 0.2483 0.2212 -0.0289 -0.0745 -0.0634 287 LEU B CB  
4779 C CG  . LEU B 306 ? 0.3941 0.2877 0.2414 -0.0323 -0.0748 -0.0633 287 LEU B CG  
4780 C CD1 . LEU B 306 ? 0.3936 0.2848 0.2853 -0.0474 -0.0953 -0.0458 287 LEU B CD1 
4781 C CD2 . LEU B 306 ? 0.4381 0.3134 0.2816 -0.0109 -0.0741 -0.0601 287 LEU B CD2 
4782 N N   . ALA B 307 ? 0.2884 0.2573 0.1994 -0.0047 -0.0686 -0.0285 288 ALA B N   
4783 C CA  . ALA B 307 ? 0.2627 0.2094 0.1867 -0.0366 -0.0690 -0.0355 288 ALA B CA  
4784 C C   . ALA B 307 ? 0.2544 0.1853 0.1731 -0.0188 -0.0717 -0.0239 288 ALA B C   
4785 O O   . ALA B 307 ? 0.2788 0.1527 0.1683 -0.0169 -0.0553 -0.0070 288 ALA B O   
4786 C CB  . ALA B 307 ? 0.2120 0.2486 0.1999 -0.0090 -0.0156 -0.0265 288 ALA B CB  
4787 N N   . ALA B 308 ? 0.2749 0.1963 0.1772 -0.0162 -0.0567 0.0039  289 ALA B N   
4788 C CA  . ALA B 308 ? 0.2544 0.2009 0.2070 -0.0379 -0.0652 0.0013  289 ALA B CA  
4789 C C   . ALA B 308 ? 0.2740 0.2126 0.2129 -0.0421 -0.0755 0.0116  289 ALA B C   
4790 O O   . ALA B 308 ? 0.2678 0.2107 0.2005 -0.0180 -0.0792 0.0094  289 ALA B O   
4791 C CB  . ALA B 308 ? 0.1906 0.2129 0.1878 -0.0186 -0.0885 0.0196  289 ALA B CB  
4792 N N   . GLU B 309 ? 0.2313 0.2143 0.2344 -0.0726 -0.1081 0.0106  290 GLU B N   
4793 C CA  . GLU B 309 ? 0.2572 0.1938 0.2364 -0.0338 -0.1226 -0.0181 290 GLU B CA  
4794 C C   . GLU B 309 ? 0.2774 0.2112 0.2168 -0.0271 -0.0972 -0.0013 290 GLU B C   
4795 O O   . GLU B 309 ? 0.2902 0.2366 0.2199 -0.0170 -0.0883 0.0259  290 GLU B O   
4796 C CB  . GLU B 309 ? 0.2911 0.2269 0.2763 -0.0276 -0.1454 -0.0026 290 GLU B CB  
4797 C CG  . GLU B 309 ? 0.2909 0.2623 0.3518 -0.0051 -0.1851 -0.0127 290 GLU B CG  
4798 C CD  . GLU B 309 ? 0.3454 0.3114 0.4049 0.0095  -0.1757 0.0099  290 GLU B CD  
4799 O OE1 . GLU B 309 ? 0.3986 0.3092 0.4077 0.0243  -0.1666 -0.0339 290 GLU B OE1 
4800 O OE2 . GLU B 309 ? 0.3360 0.3621 0.4414 0.0171  -0.1880 0.0560  290 GLU B OE2 
4801 N N   . ARG B 310 ? 0.2883 0.2070 0.2184 -0.0182 -0.0939 -0.0459 291 ARG B N   
4802 C CA  . ARG B 310 ? 0.2400 0.2168 0.1740 -0.0008 -0.0676 -0.0586 291 ARG B CA  
4803 C C   . ARG B 310 ? 0.2501 0.2313 0.1630 -0.0459 -0.0637 -0.0347 291 ARG B C   
4804 O O   . ARG B 310 ? 0.2612 0.2318 0.1485 -0.0323 -0.0159 -0.0109 291 ARG B O   
4805 C CB  . ARG B 310 ? 0.2418 0.2292 0.1967 0.0119  -0.0614 -0.0803 291 ARG B CB  
4806 C CG  . ARG B 310 ? 0.2794 0.2542 0.1917 0.0159  -0.0521 -0.0731 291 ARG B CG  
4807 C CD  . ARG B 310 ? 0.3211 0.2638 0.2052 0.0370  -0.0612 -0.0699 291 ARG B CD  
4808 N NE  . ARG B 310 ? 0.2859 0.2902 0.2142 0.0413  -0.0845 -0.0445 291 ARG B NE  
4809 C CZ  . ARG B 310 ? 0.3333 0.3038 0.2540 0.0222  -0.0777 -0.0547 291 ARG B CZ  
4810 N NH1 . ARG B 310 ? 0.3601 0.3237 0.2465 0.0008  -0.0778 -0.0493 291 ARG B NH1 
4811 N NH2 . ARG B 310 ? 0.3558 0.3098 0.2774 0.0499  -0.0895 -0.0426 291 ARG B NH2 
4812 N N   . TYR B 311 ? 0.2284 0.2125 0.1695 -0.0578 -0.0857 -0.0312 292 TYR B N   
4813 C CA  . TYR B 311 ? 0.1999 0.2061 0.1652 -0.0429 -0.0600 -0.0268 292 TYR B CA  
4814 C C   . TYR B 311 ? 0.2060 0.2055 0.1885 -0.0261 -0.0645 0.0027  292 TYR B C   
4815 O O   . TYR B 311 ? 0.2008 0.1957 0.2027 -0.0192 -0.0624 0.0274  292 TYR B O   
4816 C CB  . TYR B 311 ? 0.1824 0.1950 0.1620 -0.0252 -0.0579 -0.0385 292 TYR B CB  
4817 C CG  . TYR B 311 ? 0.1829 0.1484 0.1620 -0.0315 -0.0396 -0.0141 292 TYR B CG  
4818 C CD1 . TYR B 311 ? 0.2064 0.1871 0.1478 -0.0271 -0.0479 -0.0199 292 TYR B CD1 
4819 C CD2 . TYR B 311 ? 0.1902 0.1806 0.1706 -0.0535 -0.0388 -0.0240 292 TYR B CD2 
4820 C CE1 . TYR B 311 ? 0.2227 0.1658 0.1623 0.0068  -0.0510 -0.0327 292 TYR B CE1 
4821 C CE2 . TYR B 311 ? 0.1929 0.1682 0.1483 0.0020  -0.0705 -0.0111 292 TYR B CE2 
4822 C CZ  . TYR B 311 ? 0.2392 0.1559 0.1571 0.0125  -0.0864 -0.0178 292 TYR B CZ  
4823 O OH  . TYR B 311 ? 0.2441 0.1784 0.1800 0.0257  -0.0816 -0.0272 292 TYR B OH  
4824 N N   . ALA B 312 ? 0.1693 0.1860 0.2247 -0.0226 -0.0423 0.0131  293 ALA B N   
4825 C CA  . ALA B 312 ? 0.1368 0.1951 0.2567 0.0126  -0.0300 0.0317  293 ALA B CA  
4826 C C   . ALA B 312 ? 0.1752 0.1828 0.2515 -0.0035 -0.0188 0.0038  293 ALA B C   
4827 O O   . ALA B 312 ? 0.2049 0.1879 0.2393 -0.0222 -0.0253 0.0076  293 ALA B O   
4828 C CB  . ALA B 312 ? 0.1338 0.2159 0.2873 0.0308  -0.0154 0.0349  293 ALA B CB  
4829 N N   . ASP B 313 ? 0.1821 0.1906 0.2540 -0.0118 -0.0488 -0.0295 294 ASP B N   
4830 C CA  . ASP B 313 ? 0.2459 0.2154 0.2379 0.0205  -0.0426 -0.0139 294 ASP B CA  
4831 C C   . ASP B 313 ? 0.2599 0.2313 0.2149 -0.0176 -0.0480 -0.0183 294 ASP B C   
4832 O O   . ASP B 313 ? 0.2718 0.2202 0.2189 -0.0583 -0.0215 -0.0032 294 ASP B O   
4833 C CB  . ASP B 313 ? 0.2400 0.2508 0.2310 0.0116  -0.1114 -0.0110 294 ASP B CB  
4834 C CG  . ASP B 313 ? 0.3200 0.3465 0.2897 -0.0461 -0.1109 -0.0124 294 ASP B CG  
4835 O OD1 . ASP B 313 ? 0.3074 0.3896 0.3282 -0.0739 -0.0549 -0.0004 294 ASP B OD1 
4836 O OD2 . ASP B 313 ? 0.3720 0.3945 0.3233 -0.0885 -0.1675 -0.0157 294 ASP B OD2 
4837 N N   . GLY B 314 ? 0.2368 0.2268 0.1838 0.0130  -0.0496 -0.0191 295 GLY B N   
4838 C CA  . GLY B 314 ? 0.2563 0.2339 0.1677 0.0176  -0.0207 -0.0425 295 GLY B CA  
4839 C C   . GLY B 314 ? 0.2157 0.2050 0.1655 -0.0413 -0.0072 -0.0365 295 GLY B C   
4840 O O   . GLY B 314 ? 0.1906 0.2054 0.1936 -0.0255 0.0008  -0.0115 295 GLY B O   
4841 N N   . MET B 315 ? 0.2021 0.1571 0.1765 -0.0299 -0.0152 -0.0398 296 MET B N   
4842 C CA  . MET B 315 ? 0.1837 0.1556 0.2111 -0.0449 -0.0050 -0.0634 296 MET B CA  
4843 C C   . MET B 315 ? 0.2295 0.2014 0.2365 -0.0225 -0.0300 -0.0246 296 MET B C   
4844 O O   . MET B 315 ? 0.2219 0.2183 0.2263 -0.0210 -0.0252 -0.0019 296 MET B O   
4845 C CB  . MET B 315 ? 0.1922 0.1547 0.2395 -0.0762 0.0018  -0.0334 296 MET B CB  
4846 C CG  . MET B 315 ? 0.1952 0.1718 0.2493 -0.0666 0.0031  -0.0470 296 MET B CG  
4847 S SD  . MET B 315 ? 0.2159 0.2143 0.2317 -0.0133 -0.0114 -0.0256 296 MET B SD  
4848 C CE  . MET B 315 ? 0.2205 0.2148 0.2344 0.0012  -0.0353 0.0253  296 MET B CE  
4849 N N   . ALA B 316 ? 0.2075 0.2242 0.2509 -0.0255 -0.0181 -0.0225 297 ALA B N   
4850 C CA  . ALA B 316 ? 0.1873 0.2427 0.2581 -0.0196 -0.0395 -0.0245 297 ALA B CA  
4851 C C   . ALA B 316 ? 0.1974 0.2086 0.2480 -0.0107 -0.0139 -0.0216 297 ALA B C   
4852 O O   . ALA B 316 ? 0.1906 0.2191 0.2378 -0.0401 0.0017  -0.0180 297 ALA B O   
4853 C CB  . ALA B 316 ? 0.1375 0.2813 0.2478 0.0076  -0.0473 0.0060  297 ALA B CB  
4854 N N   . LEU B 317 ? 0.2206 0.1740 0.2605 -0.0346 -0.0006 -0.0332 298 LEU B N   
4855 C CA  . LEU B 317 ? 0.2539 0.1792 0.2445 -0.0228 0.0014  -0.0171 298 LEU B CA  
4856 C C   . LEU B 317 ? 0.2061 0.1915 0.2577 -0.0078 -0.0027 -0.0072 298 LEU B C   
4857 O O   . LEU B 317 ? 0.1893 0.2106 0.2521 -0.0164 0.0000  -0.0024 298 LEU B O   
4858 C CB  . LEU B 317 ? 0.3412 0.1919 0.2504 -0.0430 -0.0243 -0.0315 298 LEU B CB  
4859 C CG  . LEU B 317 ? 0.3704 0.2288 0.2740 -0.0391 -0.0679 -0.0367 298 LEU B CG  
4860 C CD1 . LEU B 317 ? 0.4296 0.2499 0.2927 -0.0073 -0.0558 -0.0555 298 LEU B CD1 
4861 C CD2 . LEU B 317 ? 0.4099 0.2770 0.3057 -0.0261 -0.1007 -0.0372 298 LEU B CD2 
4862 N N   . TRP B 318 ? 0.1588 0.1958 0.2416 -0.0243 -0.0395 0.0089  299 TRP B N   
4863 C CA  . TRP B 318 ? 0.1605 0.2131 0.2215 -0.0428 -0.0346 0.0055  299 TRP B CA  
4864 C C   . TRP B 318 ? 0.1736 0.2089 0.2330 -0.0344 0.0224  0.0108  299 TRP B C   
4865 O O   . TRP B 318 ? 0.2345 0.1900 0.2316 -0.0452 0.0406  0.0039  299 TRP B O   
4866 C CB  . TRP B 318 ? 0.1831 0.1939 0.2309 -0.0600 -0.0677 0.0218  299 TRP B CB  
4867 C CG  . TRP B 318 ? 0.2152 0.1850 0.2185 -0.0675 -0.0431 0.0164  299 TRP B CG  
4868 C CD1 . TRP B 318 ? 0.2197 0.1959 0.2304 -0.0494 -0.0304 0.0140  299 TRP B CD1 
4869 C CD2 . TRP B 318 ? 0.2204 0.2244 0.1992 -0.0849 -0.0338 0.0272  299 TRP B CD2 
4870 N NE1 . TRP B 318 ? 0.2355 0.2377 0.2287 -0.0738 -0.0583 -0.0075 299 TRP B NE1 
4871 C CE2 . TRP B 318 ? 0.2361 0.2469 0.2025 -0.1027 -0.0487 0.0246  299 TRP B CE2 
4872 C CE3 . TRP B 318 ? 0.2285 0.2509 0.1983 -0.1096 -0.0551 0.0272  299 TRP B CE3 
4873 C CZ2 . TRP B 318 ? 0.2737 0.2729 0.2118 -0.0883 -0.0510 0.0370  299 TRP B CZ2 
4874 C CZ3 . TRP B 318 ? 0.2539 0.2797 0.2108 -0.1112 -0.0573 0.0419  299 TRP B CZ3 
4875 C CH2 . TRP B 318 ? 0.2603 0.2808 0.2060 -0.1023 -0.0606 0.0467  299 TRP B CH2 
4876 N N   . LEU B 319 ? 0.2373 0.1989 0.2493 -0.0081 0.0374  -0.0029 300 LEU B N   
4877 C CA  A LEU B 319 ? 0.2225 0.1965 0.2649 0.0104  0.0365  0.0123  300 LEU B CA  
4878 C CA  B LEU B 319 ? 0.2198 0.2047 0.2566 0.0142  0.0405  0.0020  300 LEU B CA  
4879 C C   . LEU B 319 ? 0.2185 0.2231 0.2690 0.0027  0.0332  0.0010  300 LEU B C   
4880 O O   . LEU B 319 ? 0.2516 0.2052 0.2775 -0.0162 0.0176  0.0249  300 LEU B O   
4881 C CB  A LEU B 319 ? 0.2007 0.1973 0.2688 0.0332  0.0046  0.0353  300 LEU B CB  
4882 C CB  B LEU B 319 ? 0.1960 0.2202 0.2425 0.0486  0.0196  0.0078  300 LEU B CB  
4883 C CG  A LEU B 319 ? 0.1683 0.1855 0.2554 0.0070  -0.0239 0.0450  300 LEU B CG  
4884 C CG  B LEU B 319 ? 0.1794 0.2181 0.2159 0.0329  0.0062  0.0035  300 LEU B CG  
4885 C CD1 A LEU B 319 ? 0.1622 0.1935 0.2690 0.0259  -0.0184 0.0495  300 LEU B CD1 
4886 C CD1 B LEU B 319 ? 0.1941 0.2240 0.1963 -0.0147 -0.0234 -0.0170 300 LEU B CD1 
4887 C CD2 A LEU B 319 ? 0.1684 0.1911 0.2421 -0.0193 -0.0365 0.0457  300 LEU B CD2 
4888 C CD2 B LEU B 319 ? 0.2167 0.2231 0.2282 0.0301  0.0309  0.0209  300 LEU B CD2 
4889 N N   . ALA B 320 ? 0.1667 0.2401 0.2767 -0.0137 0.0461  -0.0354 301 ALA B N   
4890 C CA  . ALA B 320 ? 0.2038 0.2645 0.2951 -0.0483 0.0043  -0.0193 301 ALA B CA  
4891 C C   . ALA B 320 ? 0.2220 0.2628 0.2935 -0.0482 0.0122  -0.0060 301 ALA B C   
4892 O O   . ALA B 320 ? 0.2632 0.2568 0.3083 -0.0507 0.0013  0.0200  301 ALA B O   
4893 C CB  . ALA B 320 ? 0.1806 0.3026 0.3159 -0.0558 -0.0081 0.0159  301 ALA B CB  
4894 N N   . GLY B 321 ? 0.1789 0.2530 0.2976 -0.0376 0.0132  -0.0084 302 GLY B N   
4895 C CA  . GLY B 321 ? 0.2109 0.2468 0.2905 -0.0362 -0.0009 -0.0009 302 GLY B CA  
4896 C C   . GLY B 321 ? 0.2348 0.2174 0.2776 -0.0161 0.0107  0.0193  302 GLY B C   
4897 O O   . GLY B 321 ? 0.2727 0.2112 0.3001 -0.0183 -0.0031 0.0124  302 GLY B O   
4898 N N   . TYR B 322 ? 0.2587 0.2304 0.2632 -0.0575 0.0001  0.0333  303 TYR B N   
4899 C CA  . TYR B 322 ? 0.2633 0.2074 0.2530 -0.0662 0.0050  0.0495  303 TYR B CA  
4900 C C   . TYR B 322 ? 0.3269 0.2180 0.2696 -0.0419 0.0199  0.0333  303 TYR B C   
4901 O O   . TYR B 322 ? 0.4011 0.2109 0.2659 -0.0618 0.0230  0.0220  303 TYR B O   
4902 C CB  . TYR B 322 ? 0.2438 0.2041 0.2511 -0.0528 0.0010  0.0319  303 TYR B CB  
4903 C CG  . TYR B 322 ? 0.2297 0.2073 0.2440 -0.0643 0.0224  0.0372  303 TYR B CG  
4904 C CD1 . TYR B 322 ? 0.2415 0.2142 0.2483 -0.0606 0.0594  -0.0030 303 TYR B CD1 
4905 C CD2 . TYR B 322 ? 0.2525 0.2196 0.2555 -0.0431 0.0111  0.0399  303 TYR B CD2 
4906 C CE1 . TYR B 322 ? 0.2761 0.2470 0.2420 -0.0394 0.0269  0.0117  303 TYR B CE1 
4907 C CE2 . TYR B 322 ? 0.2659 0.2536 0.2594 -0.0395 0.0192  0.0101  303 TYR B CE2 
4908 C CZ  . TYR B 322 ? 0.3041 0.2563 0.2498 -0.0342 0.0109  0.0074  303 TYR B CZ  
4909 O OH  . TYR B 322 ? 0.3519 0.2796 0.2671 -0.0256 0.0217  0.0066  303 TYR B OH  
4910 N N   . LEU B 323 ? 0.3122 0.2152 0.2810 -0.0563 0.0353  0.0333  304 LEU B N   
4911 C CA  . LEU B 323 ? 0.3359 0.2312 0.2824 -0.0756 0.0351  0.0117  304 LEU B CA  
4912 C C   . LEU B 323 ? 0.3763 0.2596 0.3029 -0.0905 0.0527  0.0148  304 LEU B C   
4913 O O   . LEU B 323 ? 0.3977 0.2336 0.3007 -0.0913 0.0642  0.0471  304 LEU B O   
4914 C CB  . LEU B 323 ? 0.3148 0.2622 0.2775 -0.0626 0.0134  0.0146  304 LEU B CB  
4915 C CG  . LEU B 323 ? 0.3112 0.2634 0.2519 -0.0559 0.0038  0.0067  304 LEU B CG  
4916 C CD1 . LEU B 323 ? 0.3042 0.2744 0.2714 -0.0204 0.0319  0.0000  304 LEU B CD1 
4917 C CD2 . LEU B 323 ? 0.3021 0.2828 0.2465 -0.0509 -0.0428 -0.0094 304 LEU B CD2 
4918 N N   . HIS B 324 ? 0.3596 0.2769 0.3041 -0.1082 0.0359  -0.0212 305 HIS B N   
4919 C CA  . HIS B 324 ? 0.3865 0.2739 0.3409 -0.1064 0.0207  -0.0212 305 HIS B CA  
4920 C C   . HIS B 324 ? 0.4207 0.2740 0.3240 -0.1153 0.0149  -0.0011 305 HIS B C   
4921 O O   . HIS B 324 ? 0.4636 0.2834 0.3382 -0.1753 0.0255  0.0036  305 HIS B O   
4922 C CB  . HIS B 324 ? 0.3824 0.2897 0.3732 -0.1204 0.0111  -0.0218 305 HIS B CB  
4923 C CG  . HIS B 324 ? 0.4044 0.2883 0.4149 -0.1372 0.0228  -0.0302 305 HIS B CG  
4924 N ND1 . HIS B 324 ? 0.3921 0.2770 0.4439 -0.1574 0.0299  -0.0487 305 HIS B ND1 
4925 C CD2 . HIS B 324 ? 0.4097 0.2980 0.4221 -0.1746 0.0427  -0.0460 305 HIS B CD2 
4926 C CE1 . HIS B 324 ? 0.3977 0.2920 0.4528 -0.1453 0.0637  -0.0230 305 HIS B CE1 
4927 N NE2 . HIS B 324 ? 0.4110 0.3040 0.4485 -0.1611 0.0530  -0.0259 305 HIS B NE2 
4928 N N   . TRP B 325 ? 0.3837 0.2580 0.3101 -0.0657 0.0020  0.0299  306 TRP B N   
4929 C CA  . TRP B 325 ? 0.3887 0.2669 0.3254 -0.0714 0.0487  0.0166  306 TRP B CA  
4930 C C   . TRP B 325 ? 0.4153 0.2462 0.3300 -0.0523 0.0542  0.0331  306 TRP B C   
4931 O O   . TRP B 325 ? 0.4400 0.2385 0.3609 -0.0474 0.0491  0.0362  306 TRP B O   
4932 C CB  . TRP B 325 ? 0.3595 0.2803 0.3173 -0.1057 0.0338  0.0183  306 TRP B CB  
4933 C CG  . TRP B 325 ? 0.3684 0.2707 0.3200 -0.0986 0.0130  0.0289  306 TRP B CG  
4934 C CD1 . TRP B 325 ? 0.3794 0.2700 0.3176 -0.0890 -0.0184 0.0337  306 TRP B CD1 
4935 C CD2 . TRP B 325 ? 0.3812 0.2857 0.3144 -0.0831 -0.0098 0.0292  306 TRP B CD2 
4936 N NE1 . TRP B 325 ? 0.3587 0.2661 0.3176 -0.0746 -0.0499 0.0219  306 TRP B NE1 
4937 C CE2 . TRP B 325 ? 0.3796 0.2770 0.3195 -0.0783 -0.0209 0.0251  306 TRP B CE2 
4938 C CE3 . TRP B 325 ? 0.3699 0.2806 0.2930 -0.1089 -0.0389 0.0126  306 TRP B CE3 
4939 C CZ2 . TRP B 325 ? 0.3961 0.2825 0.3107 -0.0812 -0.0320 0.0203  306 TRP B CZ2 
4940 C CZ3 . TRP B 325 ? 0.3940 0.3053 0.3097 -0.0861 -0.0415 0.0155  306 TRP B CZ3 
4941 C CH2 . TRP B 325 ? 0.4017 0.3013 0.3090 -0.0754 -0.0370 0.0305  306 TRP B CH2 
4942 N N   . GLU B 326 ? 0.3797 0.2299 0.3114 -0.0569 0.0787  0.0286  307 GLU B N   
4943 C CA  . GLU B 326 ? 0.3967 0.2711 0.3302 -0.0497 0.0693  0.0388  307 GLU B CA  
4944 C C   . GLU B 326 ? 0.4576 0.3053 0.3488 -0.0623 0.0550  0.0736  307 GLU B C   
4945 O O   . GLU B 326 ? 0.5108 0.3297 0.3382 -0.0631 0.0479  0.0907  307 GLU B O   
4946 C CB  . GLU B 326 ? 0.3644 0.2559 0.2915 -0.0296 0.0546  0.0209  307 GLU B CB  
4947 C CG  . GLU B 326 ? 0.3696 0.2665 0.2835 -0.0122 0.0389  0.0067  307 GLU B CG  
4948 C CD  . GLU B 326 ? 0.3610 0.2926 0.2856 -0.0158 0.0308  0.0102  307 GLU B CD  
4949 O OE1 . GLU B 326 ? 0.3633 0.3266 0.2602 -0.0295 0.0271  0.0212  307 GLU B OE1 
4950 O OE2 . GLU B 326 ? 0.3980 0.3068 0.3299 0.0010  0.0581  -0.0018 307 GLU B OE2 
4951 N N   . SER B 327 ? 0.4516 0.3382 0.3915 -0.0862 0.0679  0.0743  308 SER B N   
4952 C CA  . SER B 327 ? 0.4579 0.3908 0.4432 -0.1115 0.0868  0.0774  308 SER B CA  
4953 C C   . SER B 327 ? 0.5012 0.4075 0.4787 -0.1408 0.0895  0.0812  308 SER B C   
4954 O O   . SER B 327 ? 0.5158 0.4038 0.4683 -0.1503 0.1239  0.1077  308 SER B O   
4955 C CB  . SER B 327 ? 0.4420 0.4418 0.4601 -0.1090 0.0777  0.0708  308 SER B CB  
4956 O OG  . SER B 327 ? 0.4619 0.4808 0.4852 -0.1030 0.0430  0.0501  308 SER B OG  
4957 N N   . HIS B 328 ? 0.5631 0.4613 0.5249 -0.1036 0.0548  0.0481  309 HIS B N   
4958 C CA  . HIS B 328 ? 0.6109 0.5237 0.5793 -0.0857 0.0331  0.0448  309 HIS B CA  
4959 C C   . HIS B 328 ? 0.6426 0.5254 0.5943 -0.0801 0.0367  0.0435  309 HIS B C   
4960 O O   . HIS B 328 ? 0.6554 0.5252 0.6021 -0.0936 0.0487  0.0441  309 HIS B O   
4961 C CB  . HIS B 328 ? 0.6325 0.5776 0.6146 -0.0635 0.0028  0.0299  309 HIS B CB  
4962 C CG  . HIS B 328 ? 0.6757 0.6174 0.6451 -0.0205 -0.0051 0.0243  309 HIS B CG  
4963 N ND1 . HIS B 328 ? 0.6994 0.6218 0.6425 0.0001  -0.0174 0.0316  309 HIS B ND1 
4964 C CD2 . HIS B 328 ? 0.6897 0.6312 0.6602 -0.0151 -0.0029 0.0223  309 HIS B CD2 
4965 C CE1 . HIS B 328 ? 0.7018 0.6403 0.6531 -0.0007 -0.0237 0.0231  309 HIS B CE1 
4966 N NE2 . HIS B 328 ? 0.6973 0.6426 0.6642 -0.0110 -0.0185 0.0155  309 HIS B NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -18 ?   ?   ?   A . n 
A 1 2   GLY 2   -17 ?   ?   ?   A . n 
A 1 3   SER 3   -16 ?   ?   ?   A . n 
A 1 4   SER 4   -15 ?   ?   ?   A . n 
A 1 5   HIS 5   -14 ?   ?   ?   A . n 
A 1 6   HIS 6   -13 ?   ?   ?   A . n 
A 1 7   HIS 7   -12 ?   ?   ?   A . n 
A 1 8   HIS 8   -11 ?   ?   ?   A . n 
A 1 9   HIS 9   -10 ?   ?   ?   A . n 
A 1 10  HIS 10  -9  ?   ?   ?   A . n 
A 1 11  SER 11  -8  ?   ?   ?   A . n 
A 1 12  SER 12  -7  ?   ?   ?   A . n 
A 1 13  GLY 13  -6  ?   ?   ?   A . n 
A 1 14  LEU 14  -5  ?   ?   ?   A . n 
A 1 15  VAL 15  -4  ?   ?   ?   A . n 
A 1 16  PRO 16  -3  ?   ?   ?   A . n 
A 1 17  ARG 17  -2  ?   ?   ?   A . n 
A 1 18  GLY 18  -1  ?   ?   ?   A . n 
A 1 19  SER 19  0   ?   ?   ?   A . n 
A 1 20  MET 20  1   1   MET MET A . n 
A 1 21  SER 21  2   2   SER SER A . n 
A 1 22  ASP 22  3   3   ASP ASP A . n 
A 1 23  ASP 23  4   4   ASP ASP A . n 
A 1 24  THR 24  5   5   THR THR A . n 
A 1 25  SER 25  6   6   SER SER A . n 
A 1 26  LEU 26  7   7   LEU LEU A . n 
A 1 27  GLU 27  8   8   GLU GLU A . n 
A 1 28  LEU 28  9   9   LEU LEU A . n 
A 1 29  PRO 29  10  10  PRO PRO A . n 
A 1 30  PHE 30  11  11  PHE PHE A . n 
A 1 31  THR 31  12  12  THR THR A . n 
A 1 32  HIS 32  13  13  HIS HIS A . n 
A 1 33  ARG 33  14  14  ARG ARG A . n 
A 1 34  ARG 34  15  15  ARG ARG A . n 
A 1 35  ASN 35  16  16  ASN ASN A . n 
A 1 36  PRO 36  17  17  PRO PRO A . n 
A 1 37  HIS 37  18  18  HIS HIS A . n 
A 1 38  GLN 38  19  19  GLN GLN A . n 
A 1 39  THR 39  20  20  THR THR A . n 
A 1 40  GLU 40  21  21  GLU GLU A . n 
A 1 41  ALA 41  22  22  ALA ALA A . n 
A 1 42  ALA 42  23  23  ALA ALA A . n 
A 1 43  ASP 43  24  24  ASP ASP A . n 
A 1 44  ARG 44  25  25  ARG ARG A . n 
A 1 45  HIS 45  26  26  HIS HIS A . n 
A 1 46  LEU 46  27  27  LEU LEU A . n 
A 1 47  GLU 47  28  28  GLU GLU A . n 
A 1 48  TRP 48  29  29  TRP TRP A . n 
A 1 49  LEU 49  30  30  LEU LEU A . n 
A 1 50  GLN 50  31  31  GLN GLN A . n 
A 1 51  ARG 51  32  32  ARG ARG A . n 
A 1 52  HIS 52  33  33  HIS HIS A . n 
A 1 53  ARG 53  34  34  ARG ARG A . n 
A 1 54  GLU 54  35  35  GLU GLU A . n 
A 1 55  LEU 55  36  36  LEU LEU A . n 
A 1 56  ALA 56  37  37  ALA ALA A . n 
A 1 57  ALA 57  38  38  ALA ALA A . n 
A 1 58  VAL 58  39  39  VAL VAL A . n 
A 1 59  VAL 59  40  40  VAL VAL A . n 
A 1 60  SER 60  41  41  SER SER A . n 
A 1 61  GLY 61  42  42  GLY GLY A . n 
A 1 62  SER 62  43  43  SER SER A . n 
A 1 63  THR 63  44  44  THR THR A . n 
A 1 64  TYR 64  45  45  TYR TYR A . n 
A 1 65  THR 65  46  46  THR THR A . n 
A 1 66  GLY 66  47  47  GLY GLY A . n 
A 1 67  TRP 67  48  48  TRP TRP A . n 
A 1 68  ASP 68  49  49  ASP ASP A . n 
A 1 69  ILE 69  50  50  ILE ILE A . n 
A 1 70  THR 70  51  51  THR THR A . n 
A 1 71  GLU 71  52  52  GLU GLU A . n 
A 1 72  LEU 72  53  53  LEU LEU A . n 
A 1 73  ALA 73  54  54  ALA ALA A . n 
A 1 74  SER 74  55  55  SER SER A . n 
A 1 75  LEU 75  56  56  LEU LEU A . n 
A 1 76  VAL 76  57  57  VAL VAL A . n 
A 1 77  TYR 77  58  58  TYR TYR A . n 
A 1 78  PRO 78  59  59  PRO PRO A . n 
A 1 79  GLU 79  60  60  GLU GLU A . n 
A 1 80  SER 80  61  61  SER SER A . n 
A 1 81  SER 81  62  62  SER SER A . n 
A 1 82  ALA 82  63  63  ALA ALA A . n 
A 1 83  GLU 83  64  64  GLU GLU A . n 
A 1 84  ASP 84  65  65  ASP ASP A . n 
A 1 85  LEU 85  66  66  LEU LEU A . n 
A 1 86  ALA 86  67  67  ALA ALA A . n 
A 1 87  LEU 87  68  68  LEU LEU A . n 
A 1 88  ALA 88  69  69  ALA ALA A . n 
A 1 89  ALA 89  70  70  ALA ALA A . n 
A 1 90  ASP 90  71  71  ASP ASP A . n 
A 1 91  LEU 91  72  72  LEU LEU A . n 
A 1 92  MET 92  73  73  MET MET A . n 
A 1 93  GLY 93  74  74  GLY GLY A . n 
A 1 94  PHE 94  75  75  PHE PHE A . n 
A 1 95  TYR 95  76  76  TYR TYR A . n 
A 1 96  PHE 96  77  77  PHE PHE A . n 
A 1 97  LEU 97  78  78  LEU LEU A . n 
A 1 98  PHE 98  79  79  PHE PHE A . n 
A 1 99  ASP 99  80  80  ASP ASP A . n 
A 1 100 ASP 100 81  81  ASP ASP A . n 
A 1 101 GLN 101 82  82  GLN GLN A . n 
A 1 102 PHE 102 83  83  PHE PHE A . n 
A 1 103 ASP 103 84  84  ASP ASP A . n 
A 1 104 SER 104 85  85  SER SER A . n 
A 1 105 PRO 105 86  86  PRO PRO A . n 
A 1 106 LEU 106 87  87  LEU LEU A . n 
A 1 107 GLY 107 88  88  GLY GLY A . n 
A 1 108 ARG 108 89  89  ARG ARG A . n 
A 1 109 ARG 109 90  90  ARG ARG A . n 
A 1 110 PRO 110 91  91  PRO PRO A . n 
A 1 111 GLU 111 92  92  GLU GLU A . n 
A 1 112 GLN 112 93  93  GLN GLN A . n 
A 1 113 VAL 113 94  94  VAL VAL A . n 
A 1 114 ALA 114 95  95  ALA ALA A . n 
A 1 115 LEU 115 96  96  LEU LEU A . n 
A 1 116 ILE 116 97  97  ILE ILE A . n 
A 1 117 CYS 117 98  98  CYS CYS A . n 
A 1 118 GLU 118 99  99  GLU GLU A . n 
A 1 119 ARG 119 100 100 ARG ARG A . n 
A 1 120 LEU 120 101 101 LEU LEU A . n 
A 1 121 SER 121 102 102 SER SER A . n 
A 1 122 ALA 122 103 103 ALA ALA A . n 
A 1 123 ILE 123 104 104 ILE ILE A . n 
A 1 124 ALA 124 105 105 ALA ALA A . n 
A 1 125 HIS 125 106 106 HIS HIS A . n 
A 1 126 GLY 126 107 107 GLY GLY A . n 
A 1 127 THR 127 108 108 THR THR A . n 
A 1 128 LEU 128 109 109 LEU LEU A . n 
A 1 129 THR 129 110 110 THR THR A . n 
A 1 130 ALA 130 111 111 ALA ALA A . n 
A 1 131 VAL 131 112 112 VAL VAL A . n 
A 1 132 THR 132 113 113 THR THR A . n 
A 1 133 SER 133 114 114 SER SER A . n 
A 1 134 PRO 134 115 115 PRO PRO A . n 
A 1 135 SER 135 116 116 SER SER A . n 
A 1 136 GLU 136 117 117 GLU GLU A . n 
A 1 137 ARG 137 118 118 ARG ARG A . n 
A 1 138 ALA 138 119 119 ALA ALA A . n 
A 1 139 PHE 139 120 120 PHE PHE A . n 
A 1 140 ALA 140 121 121 ALA ALA A . n 
A 1 141 ASP 141 122 122 ASP ASP A . n 
A 1 142 LEU 142 123 123 LEU LEU A . n 
A 1 143 TRP 143 124 124 TRP TRP A . n 
A 1 144 ARG 144 125 125 ARG ARG A . n 
A 1 145 ARG 145 126 126 ARG ARG A . n 
A 1 146 ILE 146 127 127 ILE ILE A . n 
A 1 147 THR 147 128 128 THR THR A . n 
A 1 148 LEU 148 129 129 LEU LEU A . n 
A 1 149 GLY 149 130 130 GLY GLY A . n 
A 1 150 MET 150 131 131 MET MET A . n 
A 1 151 THR 151 132 132 THR THR A . n 
A 1 152 ASP 152 133 133 ASP ASP A . n 
A 1 153 ARG 153 134 134 ARG ARG A . n 
A 1 154 TRP 154 135 135 TRP TRP A . n 
A 1 155 ARG 155 136 136 ARG ARG A . n 
A 1 156 ALA 156 137 137 ALA ALA A . n 
A 1 157 ARG 157 138 138 ARG ARG A . n 
A 1 158 ALA 158 139 139 ALA ALA A . n 
A 1 159 ALA 159 140 140 ALA ALA A . n 
A 1 160 CYS 160 141 141 CYS CYS A . n 
A 1 161 ASN 161 142 142 ASN ASN A . n 
A 1 162 TRP 162 143 143 TRP TRP A . n 
A 1 163 GLU 163 144 144 GLU GLU A . n 
A 1 164 TYR 164 145 145 TYR TYR A . n 
A 1 165 TYR 165 146 146 TYR TYR A . n 
A 1 166 PHE 166 147 147 PHE PHE A . n 
A 1 167 ALA 167 148 148 ALA ALA A . n 
A 1 168 CYS 168 149 149 CYS CYS A . n 
A 1 169 HIS 169 150 150 HIS HIS A . n 
A 1 170 PRO 170 151 151 PRO PRO A . n 
A 1 171 ALA 171 152 152 ALA ALA A . n 
A 1 172 GLU 172 153 153 GLU GLU A . n 
A 1 173 ALA 173 154 154 ALA ALA A . n 
A 1 174 ALA 174 155 155 ALA ALA A . n 
A 1 175 GLY 175 156 156 GLY GLY A . n 
A 1 176 ARG 176 157 157 ARG ARG A . n 
A 1 177 THR 177 158 ?   ?   ?   A . n 
A 1 178 ILE 178 159 ?   ?   ?   A . n 
A 1 179 GLY 179 160 ?   ?   ?   A . n 
A 1 180 GLN 180 161 ?   ?   ?   A . n 
A 1 181 PRO 181 162 162 PRO PRO A . n 
A 1 182 PRO 182 163 163 PRO PRO A . n 
A 1 183 ASP 183 164 164 ASP ASP A . n 
A 1 184 ARG 184 165 165 ARG ARG A . n 
A 1 185 GLU 185 166 166 GLU GLU A . n 
A 1 186 GLY 186 167 167 GLY GLY A . n 
A 1 187 TYR 187 168 168 TYR TYR A . n 
A 1 188 LEU 188 169 169 LEU LEU A . n 
A 1 189 THR 189 170 170 THR THR A . n 
A 1 190 LEU 190 171 171 LEU LEU A . n 
A 1 191 ARG 191 172 172 ARG ARG A . n 
A 1 192 ARG 192 173 173 ARG ARG A . n 
A 1 193 GLY 193 174 174 GLY GLY A . n 
A 1 194 THR 194 175 175 THR THR A . n 
A 1 195 ALA 195 176 176 ALA ALA A . n 
A 1 196 ALA 196 177 177 ALA ALA A . n 
A 1 197 MET 197 178 178 MET MET A . n 
A 1 198 GLU 198 179 179 GLU GLU A . n 
A 1 199 SER 199 180 180 SER SER A . n 
A 1 200 ILE 200 181 181 ILE ILE A . n 
A 1 201 PHE 201 182 182 PHE PHE A . n 
A 1 202 ASP 202 183 183 ASP ASP A . n 
A 1 203 MET 203 184 184 MET MET A . n 
A 1 204 ILE 204 185 185 ILE ILE A . n 
A 1 205 GLU 205 186 186 GLU GLU A . n 
A 1 206 ARG 206 187 187 ARG ARG A . n 
A 1 207 LEU 207 188 188 LEU LEU A . n 
A 1 208 GLY 208 189 189 GLY GLY A . n 
A 1 209 HIS 209 190 190 HIS HIS A . n 
A 1 210 PHE 210 191 191 PHE PHE A . n 
A 1 211 GLU 211 192 192 GLU GLU A . n 
A 1 212 VAL 212 193 193 VAL VAL A . n 
A 1 213 PRO 213 194 194 PRO PRO A . n 
A 1 214 GLN 214 195 195 GLN GLN A . n 
A 1 215 HIS 215 196 196 HIS HIS A . n 
A 1 216 VAL 216 197 197 VAL VAL A . n 
A 1 217 MET 217 198 198 MET MET A . n 
A 1 218 HIS 218 199 199 HIS HIS A . n 
A 1 219 HIS 219 200 200 HIS HIS A . n 
A 1 220 PRO 220 201 201 PRO PRO A . n 
A 1 221 LEU 221 202 202 LEU LEU A . n 
A 1 222 PHE 222 203 203 PHE PHE A . n 
A 1 223 ARG 223 204 204 ARG ARG A . n 
A 1 224 GLN 224 205 205 GLN GLN A . n 
A 1 225 LEU 225 206 206 LEU LEU A . n 
A 1 226 ARG 226 207 207 ARG ARG A . n 
A 1 227 GLN 227 208 208 GLN GLN A . n 
A 1 228 LEU 228 209 209 LEU LEU A . n 
A 1 229 ALA 229 210 210 ALA ALA A . n 
A 1 230 ALA 230 211 211 ALA ALA A . n 
A 1 231 ASP 231 212 212 ASP ASP A . n 
A 1 232 ILE 232 213 213 ILE ILE A . n 
A 1 233 PRO 233 214 214 PRO PRO A . n 
A 1 234 SER 234 215 215 SER SER A . n 
A 1 235 PHE 235 216 216 PHE PHE A . n 
A 1 236 THR 236 217 217 THR THR A . n 
A 1 237 ASN 237 218 218 ASN ASN A . n 
A 1 238 ASP 238 219 219 ASP ASP A . n 
A 1 239 VAL 239 220 220 VAL VAL A . n 
A 1 240 ARG 240 221 221 ARG ARG A . n 
A 1 241 SER 241 222 222 SER SER A . n 
A 1 242 PHE 242 223 223 PHE PHE A . n 
A 1 243 ALA 243 224 224 ALA ALA A . n 
A 1 244 GLN 244 225 225 GLN GLN A . n 
A 1 245 GLU 245 226 226 GLU GLU A . n 
A 1 246 SER 246 227 ?   ?   ?   A . n 
A 1 247 GLU 247 228 ?   ?   ?   A . n 
A 1 248 ARG 248 229 ?   ?   ?   A . n 
A 1 249 GLY 249 230 ?   ?   ?   A . n 
A 1 250 ASP 250 231 ?   ?   ?   A . n 
A 1 251 VAL 251 232 ?   ?   ?   A . n 
A 1 252 ALA 252 233 233 ALA ALA A . n 
A 1 253 ASN 253 234 234 ASN ASN A . n 
A 1 254 LEU 254 235 235 LEU LEU A . n 
A 1 255 VAL 255 236 236 VAL VAL A . n 
A 1 256 MET 256 237 237 MET MET A . n 
A 1 257 ILE 257 238 238 ILE ILE A . n 
A 1 258 VAL 258 239 239 VAL VAL A . n 
A 1 259 ARG 259 240 240 ARG ARG A . n 
A 1 260 ARG 260 241 241 ARG ARG A . n 
A 1 261 ASP 261 242 242 ASP ASP A . n 
A 1 262 ARG 262 243 243 ARG ARG A . n 
A 1 263 CYS 263 244 244 CYS CYS A . n 
A 1 264 CYS 264 245 245 CYS CYS A . n 
A 1 265 SER 265 246 246 SER SER A . n 
A 1 266 THR 266 247 247 THR THR A . n 
A 1 267 ALA 267 248 248 ALA ALA A . n 
A 1 268 GLU 268 249 249 GLU GLU A . n 
A 1 269 ALA 269 250 250 ALA ALA A . n 
A 1 270 CYS 270 251 251 CYS CYS A . n 
A 1 271 ALA 271 252 252 ALA ALA A . n 
A 1 272 VAL 272 253 253 VAL VAL A . n 
A 1 273 VAL 273 254 254 VAL VAL A . n 
A 1 274 TRP 274 255 255 TRP TRP A . n 
A 1 275 ASP 275 256 256 ASP ASP A . n 
A 1 276 GLU 276 257 257 GLU GLU A . n 
A 1 277 ALA 277 258 258 ALA ALA A . n 
A 1 278 GLN 278 259 259 GLN GLN A . n 
A 1 279 ARG 279 260 260 ARG ARG A . n 
A 1 280 MET 280 261 261 MET MET A . n 
A 1 281 ALA 281 262 262 ALA ALA A . n 
A 1 282 ASP 282 263 263 ASP ASP A . n 
A 1 283 ARG 283 264 264 ARG ARG A . n 
A 1 284 PHE 284 265 265 PHE PHE A . n 
A 1 285 CYS 285 266 266 CYS CYS A . n 
A 1 286 ASP 286 267 267 ASP ASP A . n 
A 1 287 LEU 287 268 268 LEU LEU A . n 
A 1 288 ARG 288 269 269 ARG ARG A . n 
A 1 289 ASP 289 270 270 ASP ASP A . n 
A 1 290 GLN 290 271 271 GLN GLN A . n 
A 1 291 LEU 291 272 272 LEU LEU A . n 
A 1 292 PRO 292 273 273 PRO PRO A . n 
A 1 293 ASP 293 274 274 ASP ASP A . n 
A 1 294 ALA 294 275 275 ALA ALA A . n 
A 1 295 CYS 295 276 276 CYS CYS A . n 
A 1 296 ARG 296 277 277 ARG ARG A . n 
A 1 297 SER 297 278 278 SER SER A . n 
A 1 298 MET 298 279 279 MET MET A . n 
A 1 299 SER 299 280 280 SER SER A . n 
A 1 300 LEU 300 281 281 LEU LEU A . n 
A 1 301 ASP 301 282 282 ASP ASP A . n 
A 1 302 PRO 302 283 283 PRO PRO A . n 
A 1 303 ALA 303 284 284 ALA ALA A . n 
A 1 304 GLN 304 285 285 GLN GLN A . n 
A 1 305 ARG 305 286 286 ARG ARG A . n 
A 1 306 LEU 306 287 287 LEU LEU A . n 
A 1 307 ALA 307 288 288 ALA ALA A . n 
A 1 308 ALA 308 289 289 ALA ALA A . n 
A 1 309 GLU 309 290 290 GLU GLU A . n 
A 1 310 ARG 310 291 291 ARG ARG A . n 
A 1 311 TYR 311 292 292 TYR TYR A . n 
A 1 312 ALA 312 293 293 ALA ALA A . n 
A 1 313 ASP 313 294 294 ASP ASP A . n 
A 1 314 GLY 314 295 295 GLY GLY A . n 
A 1 315 MET 315 296 296 MET MET A . n 
A 1 316 ALA 316 297 297 ALA ALA A . n 
A 1 317 LEU 317 298 298 LEU LEU A . n 
A 1 318 TRP 318 299 299 TRP TRP A . n 
A 1 319 LEU 319 300 300 LEU LEU A . n 
A 1 320 ALA 320 301 301 ALA ALA A . n 
A 1 321 GLY 321 302 302 GLY GLY A . n 
A 1 322 TYR 322 303 303 TYR TYR A . n 
A 1 323 LEU 323 304 304 LEU LEU A . n 
A 1 324 HIS 324 305 305 HIS HIS A . n 
A 1 325 TRP 325 306 306 TRP TRP A . n 
A 1 326 GLU 326 307 307 GLU GLU A . n 
A 1 327 SER 327 308 308 SER SER A . n 
A 1 328 HIS 328 309 309 HIS HIS A . n 
A 1 329 THR 329 310 310 THR THR A . n 
A 1 330 ARG 330 311 ?   ?   ?   A . n 
A 1 331 ARG 331 312 ?   ?   ?   A . n 
A 1 332 TYR 332 313 ?   ?   ?   A . n 
A 1 333 HIS 333 314 ?   ?   ?   A . n 
A 1 334 HIS 334 315 ?   ?   ?   A . n 
A 1 335 GLY 335 316 ?   ?   ?   A . n 
B 1 1   MET 1   -18 ?   ?   ?   B . n 
B 1 2   GLY 2   -17 ?   ?   ?   B . n 
B 1 3   SER 3   -16 ?   ?   ?   B . n 
B 1 4   SER 4   -15 ?   ?   ?   B . n 
B 1 5   HIS 5   -14 ?   ?   ?   B . n 
B 1 6   HIS 6   -13 ?   ?   ?   B . n 
B 1 7   HIS 7   -12 ?   ?   ?   B . n 
B 1 8   HIS 8   -11 ?   ?   ?   B . n 
B 1 9   HIS 9   -10 ?   ?   ?   B . n 
B 1 10  HIS 10  -9  ?   ?   ?   B . n 
B 1 11  SER 11  -8  ?   ?   ?   B . n 
B 1 12  SER 12  -7  ?   ?   ?   B . n 
B 1 13  GLY 13  -6  ?   ?   ?   B . n 
B 1 14  LEU 14  -5  ?   ?   ?   B . n 
B 1 15  VAL 15  -4  ?   ?   ?   B . n 
B 1 16  PRO 16  -3  ?   ?   ?   B . n 
B 1 17  ARG 17  -2  ?   ?   ?   B . n 
B 1 18  GLY 18  -1  ?   ?   ?   B . n 
B 1 19  SER 19  0   ?   ?   ?   B . n 
B 1 20  MET 20  1   ?   ?   ?   B . n 
B 1 21  SER 21  2   ?   ?   ?   B . n 
B 1 22  ASP 22  3   ?   ?   ?   B . n 
B 1 23  ASP 23  4   ?   ?   ?   B . n 
B 1 24  THR 24  5   ?   ?   ?   B . n 
B 1 25  SER 25  6   6   SER SER B . n 
B 1 26  LEU 26  7   7   LEU LEU B . n 
B 1 27  GLU 27  8   8   GLU GLU B . n 
B 1 28  LEU 28  9   9   LEU LEU B . n 
B 1 29  PRO 29  10  10  PRO PRO B . n 
B 1 30  PHE 30  11  11  PHE PHE B . n 
B 1 31  THR 31  12  12  THR THR B . n 
B 1 32  HIS 32  13  13  HIS HIS B . n 
B 1 33  ARG 33  14  14  ARG ARG B . n 
B 1 34  ARG 34  15  15  ARG ARG B . n 
B 1 35  ASN 35  16  16  ASN ASN B . n 
B 1 36  PRO 36  17  17  PRO PRO B . n 
B 1 37  HIS 37  18  18  HIS HIS B . n 
B 1 38  GLN 38  19  19  GLN GLN B . n 
B 1 39  THR 39  20  20  THR THR B . n 
B 1 40  GLU 40  21  21  GLU GLU B . n 
B 1 41  ALA 41  22  22  ALA ALA B . n 
B 1 42  ALA 42  23  23  ALA ALA B . n 
B 1 43  ASP 43  24  24  ASP ASP B . n 
B 1 44  ARG 44  25  25  ARG ARG B . n 
B 1 45  HIS 45  26  26  HIS HIS B . n 
B 1 46  LEU 46  27  27  LEU LEU B . n 
B 1 47  GLU 47  28  28  GLU GLU B . n 
B 1 48  TRP 48  29  29  TRP TRP B . n 
B 1 49  LEU 49  30  30  LEU LEU B . n 
B 1 50  GLN 50  31  31  GLN GLN B . n 
B 1 51  ARG 51  32  32  ARG ARG B . n 
B 1 52  HIS 52  33  33  HIS HIS B . n 
B 1 53  ARG 53  34  34  ARG ARG B . n 
B 1 54  GLU 54  35  35  GLU GLU B . n 
B 1 55  LEU 55  36  36  LEU LEU B . n 
B 1 56  ALA 56  37  37  ALA ALA B . n 
B 1 57  ALA 57  38  38  ALA ALA B . n 
B 1 58  VAL 58  39  39  VAL VAL B . n 
B 1 59  VAL 59  40  40  VAL VAL B . n 
B 1 60  SER 60  41  41  SER SER B . n 
B 1 61  GLY 61  42  42  GLY GLY B . n 
B 1 62  SER 62  43  43  SER SER B . n 
B 1 63  THR 63  44  44  THR THR B . n 
B 1 64  TYR 64  45  45  TYR TYR B . n 
B 1 65  THR 65  46  46  THR THR B . n 
B 1 66  GLY 66  47  47  GLY GLY B . n 
B 1 67  TRP 67  48  48  TRP TRP B . n 
B 1 68  ASP 68  49  49  ASP ASP B . n 
B 1 69  ILE 69  50  50  ILE ILE B . n 
B 1 70  THR 70  51  51  THR THR B . n 
B 1 71  GLU 71  52  52  GLU GLU B . n 
B 1 72  LEU 72  53  53  LEU LEU B . n 
B 1 73  ALA 73  54  54  ALA ALA B . n 
B 1 74  SER 74  55  55  SER SER B . n 
B 1 75  LEU 75  56  56  LEU LEU B . n 
B 1 76  VAL 76  57  57  VAL VAL B . n 
B 1 77  TYR 77  58  58  TYR TYR B . n 
B 1 78  PRO 78  59  59  PRO PRO B . n 
B 1 79  GLU 79  60  60  GLU GLU B . n 
B 1 80  SER 80  61  61  SER SER B . n 
B 1 81  SER 81  62  62  SER SER B . n 
B 1 82  ALA 82  63  63  ALA ALA B . n 
B 1 83  GLU 83  64  64  GLU GLU B . n 
B 1 84  ASP 84  65  65  ASP ASP B . n 
B 1 85  LEU 85  66  66  LEU LEU B . n 
B 1 86  ALA 86  67  67  ALA ALA B . n 
B 1 87  LEU 87  68  68  LEU LEU B . n 
B 1 88  ALA 88  69  69  ALA ALA B . n 
B 1 89  ALA 89  70  70  ALA ALA B . n 
B 1 90  ASP 90  71  71  ASP ASP B . n 
B 1 91  LEU 91  72  72  LEU LEU B . n 
B 1 92  MET 92  73  73  MET MET B . n 
B 1 93  GLY 93  74  74  GLY GLY B . n 
B 1 94  PHE 94  75  75  PHE PHE B . n 
B 1 95  TYR 95  76  76  TYR TYR B . n 
B 1 96  PHE 96  77  77  PHE PHE B . n 
B 1 97  LEU 97  78  78  LEU LEU B . n 
B 1 98  PHE 98  79  79  PHE PHE B . n 
B 1 99  ASP 99  80  80  ASP ASP B . n 
B 1 100 ASP 100 81  81  ASP ASP B . n 
B 1 101 GLN 101 82  82  GLN GLN B . n 
B 1 102 PHE 102 83  83  PHE PHE B . n 
B 1 103 ASP 103 84  84  ASP ASP B . n 
B 1 104 SER 104 85  85  SER SER B . n 
B 1 105 PRO 105 86  86  PRO PRO B . n 
B 1 106 LEU 106 87  87  LEU LEU B . n 
B 1 107 GLY 107 88  88  GLY GLY B . n 
B 1 108 ARG 108 89  89  ARG ARG B . n 
B 1 109 ARG 109 90  90  ARG ARG B . n 
B 1 110 PRO 110 91  91  PRO PRO B . n 
B 1 111 GLU 111 92  92  GLU GLU B . n 
B 1 112 GLN 112 93  93  GLN GLN B . n 
B 1 113 VAL 113 94  94  VAL VAL B . n 
B 1 114 ALA 114 95  95  ALA ALA B . n 
B 1 115 LEU 115 96  96  LEU LEU B . n 
B 1 116 ILE 116 97  97  ILE ILE B . n 
B 1 117 CYS 117 98  98  CYS CYS B . n 
B 1 118 GLU 118 99  99  GLU GLU B . n 
B 1 119 ARG 119 100 100 ARG ARG B . n 
B 1 120 LEU 120 101 101 LEU LEU B . n 
B 1 121 SER 121 102 102 SER SER B . n 
B 1 122 ALA 122 103 103 ALA ALA B . n 
B 1 123 ILE 123 104 104 ILE ILE B . n 
B 1 124 ALA 124 105 105 ALA ALA B . n 
B 1 125 HIS 125 106 106 HIS HIS B . n 
B 1 126 GLY 126 107 107 GLY GLY B . n 
B 1 127 THR 127 108 108 THR THR B . n 
B 1 128 LEU 128 109 109 LEU LEU B . n 
B 1 129 THR 129 110 110 THR THR B . n 
B 1 130 ALA 130 111 111 ALA ALA B . n 
B 1 131 VAL 131 112 112 VAL VAL B . n 
B 1 132 THR 132 113 113 THR THR B . n 
B 1 133 SER 133 114 114 SER SER B . n 
B 1 134 PRO 134 115 115 PRO PRO B . n 
B 1 135 SER 135 116 116 SER SER B . n 
B 1 136 GLU 136 117 117 GLU GLU B . n 
B 1 137 ARG 137 118 118 ARG ARG B . n 
B 1 138 ALA 138 119 119 ALA ALA B . n 
B 1 139 PHE 139 120 120 PHE PHE B . n 
B 1 140 ALA 140 121 121 ALA ALA B . n 
B 1 141 ASP 141 122 122 ASP ASP B . n 
B 1 142 LEU 142 123 123 LEU LEU B . n 
B 1 143 TRP 143 124 124 TRP TRP B . n 
B 1 144 ARG 144 125 125 ARG ARG B . n 
B 1 145 ARG 145 126 126 ARG ARG B . n 
B 1 146 ILE 146 127 127 ILE ILE B . n 
B 1 147 THR 147 128 128 THR THR B . n 
B 1 148 LEU 148 129 129 LEU LEU B . n 
B 1 149 GLY 149 130 130 GLY GLY B . n 
B 1 150 MET 150 131 131 MET MET B . n 
B 1 151 THR 151 132 132 THR THR B . n 
B 1 152 ASP 152 133 133 ASP ASP B . n 
B 1 153 ARG 153 134 134 ARG ARG B . n 
B 1 154 TRP 154 135 135 TRP TRP B . n 
B 1 155 ARG 155 136 136 ARG ARG B . n 
B 1 156 ALA 156 137 137 ALA ALA B . n 
B 1 157 ARG 157 138 138 ARG ARG B . n 
B 1 158 ALA 158 139 139 ALA ALA B . n 
B 1 159 ALA 159 140 140 ALA ALA B . n 
B 1 160 CYS 160 141 141 CYS CYS B . n 
B 1 161 ASN 161 142 142 ASN ASN B . n 
B 1 162 TRP 162 143 143 TRP TRP B . n 
B 1 163 GLU 163 144 144 GLU GLU B . n 
B 1 164 TYR 164 145 145 TYR TYR B . n 
B 1 165 TYR 165 146 146 TYR TYR B . n 
B 1 166 PHE 166 147 147 PHE PHE B . n 
B 1 167 ALA 167 148 148 ALA ALA B . n 
B 1 168 CYS 168 149 149 CYS CYS B . n 
B 1 169 HIS 169 150 150 HIS HIS B . n 
B 1 170 PRO 170 151 151 PRO PRO B . n 
B 1 171 ALA 171 152 152 ALA ALA B . n 
B 1 172 GLU 172 153 153 GLU GLU B . n 
B 1 173 ALA 173 154 154 ALA ALA B . n 
B 1 174 ALA 174 155 155 ALA ALA B . n 
B 1 175 GLY 175 156 156 GLY GLY B . n 
B 1 176 ARG 176 157 157 ARG ARG B . n 
B 1 177 THR 177 158 158 THR THR B . n 
B 1 178 ILE 178 159 159 ILE ILE B . n 
B 1 179 GLY 179 160 ?   ?   ?   B . n 
B 1 180 GLN 180 161 ?   ?   ?   B . n 
B 1 181 PRO 181 162 162 PRO PRO B . n 
B 1 182 PRO 182 163 163 PRO PRO B . n 
B 1 183 ASP 183 164 164 ASP ASP B . n 
B 1 184 ARG 184 165 165 ARG ARG B . n 
B 1 185 GLU 185 166 166 GLU GLU B . n 
B 1 186 GLY 186 167 167 GLY GLY B . n 
B 1 187 TYR 187 168 168 TYR TYR B . n 
B 1 188 LEU 188 169 169 LEU LEU B . n 
B 1 189 THR 189 170 170 THR THR B . n 
B 1 190 LEU 190 171 171 LEU LEU B . n 
B 1 191 ARG 191 172 172 ARG ARG B . n 
B 1 192 ARG 192 173 173 ARG ARG B . n 
B 1 193 GLY 193 174 174 GLY GLY B . n 
B 1 194 THR 194 175 175 THR THR B . n 
B 1 195 ALA 195 176 176 ALA ALA B . n 
B 1 196 ALA 196 177 177 ALA ALA B . n 
B 1 197 MET 197 178 178 MET MET B . n 
B 1 198 GLU 198 179 179 GLU GLU B . n 
B 1 199 SER 199 180 180 SER SER B . n 
B 1 200 ILE 200 181 181 ILE ILE B . n 
B 1 201 PHE 201 182 182 PHE PHE B . n 
B 1 202 ASP 202 183 183 ASP ASP B . n 
B 1 203 MET 203 184 184 MET MET B . n 
B 1 204 ILE 204 185 185 ILE ILE B . n 
B 1 205 GLU 205 186 186 GLU GLU B . n 
B 1 206 ARG 206 187 187 ARG ARG B . n 
B 1 207 LEU 207 188 188 LEU LEU B . n 
B 1 208 GLY 208 189 189 GLY GLY B . n 
B 1 209 HIS 209 190 190 HIS HIS B . n 
B 1 210 PHE 210 191 191 PHE PHE B . n 
B 1 211 GLU 211 192 192 GLU GLU B . n 
B 1 212 VAL 212 193 193 VAL VAL B . n 
B 1 213 PRO 213 194 194 PRO PRO B . n 
B 1 214 GLN 214 195 195 GLN GLN B . n 
B 1 215 HIS 215 196 196 HIS HIS B . n 
B 1 216 VAL 216 197 197 VAL VAL B . n 
B 1 217 MET 217 198 198 MET MET B . n 
B 1 218 HIS 218 199 199 HIS HIS B . n 
B 1 219 HIS 219 200 200 HIS HIS B . n 
B 1 220 PRO 220 201 201 PRO PRO B . n 
B 1 221 LEU 221 202 202 LEU LEU B . n 
B 1 222 PHE 222 203 203 PHE PHE B . n 
B 1 223 ARG 223 204 204 ARG ARG B . n 
B 1 224 GLN 224 205 205 GLN GLN B . n 
B 1 225 LEU 225 206 206 LEU LEU B . n 
B 1 226 ARG 226 207 207 ARG ARG B . n 
B 1 227 GLN 227 208 208 GLN GLN B . n 
B 1 228 LEU 228 209 209 LEU LEU B . n 
B 1 229 ALA 229 210 210 ALA ALA B . n 
B 1 230 ALA 230 211 211 ALA ALA B . n 
B 1 231 ASP 231 212 212 ASP ASP B . n 
B 1 232 ILE 232 213 213 ILE ILE B . n 
B 1 233 PRO 233 214 214 PRO PRO B . n 
B 1 234 SER 234 215 215 SER SER B . n 
B 1 235 PHE 235 216 216 PHE PHE B . n 
B 1 236 THR 236 217 217 THR THR B . n 
B 1 237 ASN 237 218 218 ASN ASN B . n 
B 1 238 ASP 238 219 219 ASP ASP B . n 
B 1 239 VAL 239 220 220 VAL VAL B . n 
B 1 240 ARG 240 221 221 ARG ARG B . n 
B 1 241 SER 241 222 222 SER SER B . n 
B 1 242 PHE 242 223 223 PHE PHE B . n 
B 1 243 ALA 243 224 ?   ?   ?   B . n 
B 1 244 GLN 244 225 ?   ?   ?   B . n 
B 1 245 GLU 245 226 ?   ?   ?   B . n 
B 1 246 SER 246 227 ?   ?   ?   B . n 
B 1 247 GLU 247 228 ?   ?   ?   B . n 
B 1 248 ARG 248 229 ?   ?   ?   B . n 
B 1 249 GLY 249 230 ?   ?   ?   B . n 
B 1 250 ASP 250 231 ?   ?   ?   B . n 
B 1 251 VAL 251 232 232 VAL VAL B . n 
B 1 252 ALA 252 233 233 ALA ALA B . n 
B 1 253 ASN 253 234 234 ASN ASN B . n 
B 1 254 LEU 254 235 235 LEU LEU B . n 
B 1 255 VAL 255 236 236 VAL VAL B . n 
B 1 256 MET 256 237 237 MET MET B . n 
B 1 257 ILE 257 238 238 ILE ILE B . n 
B 1 258 VAL 258 239 239 VAL VAL B . n 
B 1 259 ARG 259 240 240 ARG ARG B . n 
B 1 260 ARG 260 241 241 ARG ARG B . n 
B 1 261 ASP 261 242 242 ASP ASP B . n 
B 1 262 ARG 262 243 243 ARG ARG B . n 
B 1 263 CYS 263 244 244 CYS CYS B . n 
B 1 264 CYS 264 245 245 CYS CYS B . n 
B 1 265 SER 265 246 246 SER SER B . n 
B 1 266 THR 266 247 247 THR THR B . n 
B 1 267 ALA 267 248 248 ALA ALA B . n 
B 1 268 GLU 268 249 249 GLU GLU B . n 
B 1 269 ALA 269 250 250 ALA ALA B . n 
B 1 270 CYS 270 251 251 CYS CYS B . n 
B 1 271 ALA 271 252 252 ALA ALA B . n 
B 1 272 VAL 272 253 253 VAL VAL B . n 
B 1 273 VAL 273 254 254 VAL VAL B . n 
B 1 274 TRP 274 255 255 TRP TRP B . n 
B 1 275 ASP 275 256 256 ASP ASP B . n 
B 1 276 GLU 276 257 257 GLU GLU B . n 
B 1 277 ALA 277 258 258 ALA ALA B . n 
B 1 278 GLN 278 259 259 GLN GLN B . n 
B 1 279 ARG 279 260 260 ARG ARG B . n 
B 1 280 MET 280 261 261 MET MET B . n 
B 1 281 ALA 281 262 262 ALA ALA B . n 
B 1 282 ASP 282 263 263 ASP ASP B . n 
B 1 283 ARG 283 264 264 ARG ARG B . n 
B 1 284 PHE 284 265 265 PHE PHE B . n 
B 1 285 CYS 285 266 266 CYS CYS B . n 
B 1 286 ASP 286 267 267 ASP ASP B . n 
B 1 287 LEU 287 268 268 LEU LEU B . n 
B 1 288 ARG 288 269 269 ARG ARG B . n 
B 1 289 ASP 289 270 270 ASP ASP B . n 
B 1 290 GLN 290 271 271 GLN GLN B . n 
B 1 291 LEU 291 272 272 LEU LEU B . n 
B 1 292 PRO 292 273 273 PRO PRO B . n 
B 1 293 ASP 293 274 274 ASP ASP B . n 
B 1 294 ALA 294 275 275 ALA ALA B . n 
B 1 295 CYS 295 276 276 CYS CYS B . n 
B 1 296 ARG 296 277 277 ARG ARG B . n 
B 1 297 SER 297 278 278 SER SER B . n 
B 1 298 MET 298 279 279 MET MET B . n 
B 1 299 SER 299 280 280 SER SER B . n 
B 1 300 LEU 300 281 281 LEU LEU B . n 
B 1 301 ASP 301 282 282 ASP ASP B . n 
B 1 302 PRO 302 283 283 PRO PRO B . n 
B 1 303 ALA 303 284 284 ALA ALA B . n 
B 1 304 GLN 304 285 285 GLN GLN B . n 
B 1 305 ARG 305 286 286 ARG ARG B . n 
B 1 306 LEU 306 287 287 LEU LEU B . n 
B 1 307 ALA 307 288 288 ALA ALA B . n 
B 1 308 ALA 308 289 289 ALA ALA B . n 
B 1 309 GLU 309 290 290 GLU GLU B . n 
B 1 310 ARG 310 291 291 ARG ARG B . n 
B 1 311 TYR 311 292 292 TYR TYR B . n 
B 1 312 ALA 312 293 293 ALA ALA B . n 
B 1 313 ASP 313 294 294 ASP ASP B . n 
B 1 314 GLY 314 295 295 GLY GLY B . n 
B 1 315 MET 315 296 296 MET MET B . n 
B 1 316 ALA 316 297 297 ALA ALA B . n 
B 1 317 LEU 317 298 298 LEU LEU B . n 
B 1 318 TRP 318 299 299 TRP TRP B . n 
B 1 319 LEU 319 300 300 LEU LEU B . n 
B 1 320 ALA 320 301 301 ALA ALA B . n 
B 1 321 GLY 321 302 302 GLY GLY B . n 
B 1 322 TYR 322 303 303 TYR TYR B . n 
B 1 323 LEU 323 304 304 LEU LEU B . n 
B 1 324 HIS 324 305 305 HIS HIS B . n 
B 1 325 TRP 325 306 306 TRP TRP B . n 
B 1 326 GLU 326 307 307 GLU GLU B . n 
B 1 327 SER 327 308 308 SER SER B . n 
B 1 328 HIS 328 309 309 HIS HIS B . n 
B 1 329 THR 329 310 ?   ?   ?   B . n 
B 1 330 ARG 330 311 ?   ?   ?   B . n 
B 1 331 ARG 331 312 ?   ?   ?   B . n 
B 1 332 TYR 332 313 ?   ?   ?   B . n 
B 1 333 HIS 333 314 ?   ?   ?   B . n 
B 1 334 HIS 334 315 ?   ?   ?   B . n 
B 1 335 GLY 335 316 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   401 1   SO4 SO4 A . 
D 2 SO4 1   401 2   SO4 SO4 B . 
E 3 HOH 1   501 628 HOH HOH A . 
E 3 HOH 2   502 200 HOH HOH A . 
E 3 HOH 3   503 637 HOH HOH A . 
E 3 HOH 4   504 569 HOH HOH A . 
E 3 HOH 5   505 183 HOH HOH A . 
E 3 HOH 6   506 498 HOH HOH A . 
E 3 HOH 7   507 575 HOH HOH A . 
E 3 HOH 8   508 573 HOH HOH A . 
E 3 HOH 9   509 392 HOH HOH A . 
E 3 HOH 10  510 687 HOH HOH A . 
E 3 HOH 11  511 142 HOH HOH A . 
E 3 HOH 12  512 418 HOH HOH A . 
E 3 HOH 13  513 647 HOH HOH A . 
E 3 HOH 14  514 489 HOH HOH A . 
E 3 HOH 15  515 478 HOH HOH A . 
E 3 HOH 16  516 222 HOH HOH A . 
E 3 HOH 17  517 334 HOH HOH A . 
E 3 HOH 18  518 510 HOH HOH A . 
E 3 HOH 19  519 29  HOH HOH A . 
E 3 HOH 20  520 485 HOH HOH A . 
E 3 HOH 21  521 312 HOH HOH A . 
E 3 HOH 22  522 642 HOH HOH A . 
E 3 HOH 23  523 173 HOH HOH A . 
E 3 HOH 24  524 520 HOH HOH A . 
E 3 HOH 25  525 472 HOH HOH A . 
E 3 HOH 26  526 65  HOH HOH A . 
E 3 HOH 27  527 19  HOH HOH A . 
E 3 HOH 28  528 185 HOH HOH A . 
E 3 HOH 29  529 60  HOH HOH A . 
E 3 HOH 30  530 22  HOH HOH A . 
E 3 HOH 31  531 70  HOH HOH A . 
E 3 HOH 32  532 225 HOH HOH A . 
E 3 HOH 33  533 28  HOH HOH A . 
E 3 HOH 34  534 88  HOH HOH A . 
E 3 HOH 35  535 525 HOH HOH A . 
E 3 HOH 36  536 263 HOH HOH A . 
E 3 HOH 37  537 530 HOH HOH A . 
E 3 HOH 38  538 32  HOH HOH A . 
E 3 HOH 39  539 348 HOH HOH A . 
E 3 HOH 40  540 543 HOH HOH A . 
E 3 HOH 41  541 368 HOH HOH A . 
E 3 HOH 42  542 199 HOH HOH A . 
E 3 HOH 43  543 258 HOH HOH A . 
E 3 HOH 44  544 68  HOH HOH A . 
E 3 HOH 45  545 157 HOH HOH A . 
E 3 HOH 46  546 257 HOH HOH A . 
E 3 HOH 47  547 69  HOH HOH A . 
E 3 HOH 48  548 549 HOH HOH A . 
E 3 HOH 49  549 212 HOH HOH A . 
E 3 HOH 50  550 188 HOH HOH A . 
E 3 HOH 51  551 201 HOH HOH A . 
E 3 HOH 52  552 531 HOH HOH A . 
E 3 HOH 53  553 217 HOH HOH A . 
E 3 HOH 54  554 344 HOH HOH A . 
E 3 HOH 55  555 247 HOH HOH A . 
E 3 HOH 56  556 230 HOH HOH A . 
E 3 HOH 57  557 63  HOH HOH A . 
E 3 HOH 58  558 419 HOH HOH A . 
E 3 HOH 59  559 383 HOH HOH A . 
E 3 HOH 60  560 153 HOH HOH A . 
E 3 HOH 61  561 191 HOH HOH A . 
E 3 HOH 62  562 26  HOH HOH A . 
E 3 HOH 63  563 387 HOH HOH A . 
E 3 HOH 64  564 30  HOH HOH A . 
E 3 HOH 65  565 237 HOH HOH A . 
E 3 HOH 66  566 580 HOH HOH A . 
E 3 HOH 67  567 338 HOH HOH A . 
E 3 HOH 68  568 408 HOH HOH A . 
E 3 HOH 69  569 213 HOH HOH A . 
E 3 HOH 70  570 209 HOH HOH A . 
E 3 HOH 71  571 355 HOH HOH A . 
E 3 HOH 72  572 579 HOH HOH A . 
E 3 HOH 73  573 551 HOH HOH A . 
E 3 HOH 74  574 71  HOH HOH A . 
E 3 HOH 75  575 310 HOH HOH A . 
E 3 HOH 76  576 224 HOH HOH A . 
E 3 HOH 77  577 515 HOH HOH A . 
E 3 HOH 78  578 171 HOH HOH A . 
E 3 HOH 79  579 296 HOH HOH A . 
E 3 HOH 80  580 214 HOH HOH A . 
E 3 HOH 81  581 394 HOH HOH A . 
E 3 HOH 82  582 500 HOH HOH A . 
E 3 HOH 83  583 358 HOH HOH A . 
E 3 HOH 84  584 390 HOH HOH A . 
E 3 HOH 85  585 20  HOH HOH A . 
E 3 HOH 86  586 211 HOH HOH A . 
E 3 HOH 87  587 17  HOH HOH A . 
E 3 HOH 88  588 546 HOH HOH A . 
E 3 HOH 89  589 14  HOH HOH A . 
E 3 HOH 90  590 18  HOH HOH A . 
E 3 HOH 91  591 72  HOH HOH A . 
E 3 HOH 92  592 345 HOH HOH A . 
E 3 HOH 93  593 128 HOH HOH A . 
E 3 HOH 94  594 239 HOH HOH A . 
E 3 HOH 95  595 227 HOH HOH A . 
E 3 HOH 96  596 152 HOH HOH A . 
E 3 HOH 97  597 281 HOH HOH A . 
E 3 HOH 98  598 253 HOH HOH A . 
E 3 HOH 99  599 13  HOH HOH A . 
E 3 HOH 100 600 196 HOH HOH A . 
E 3 HOH 101 601 208 HOH HOH A . 
E 3 HOH 102 602 524 HOH HOH A . 
E 3 HOH 103 603 491 HOH HOH A . 
E 3 HOH 104 604 340 HOH HOH A . 
E 3 HOH 105 605 150 HOH HOH A . 
E 3 HOH 106 606 304 HOH HOH A . 
E 3 HOH 107 607 109 HOH HOH A . 
E 3 HOH 108 608 67  HOH HOH A . 
E 3 HOH 109 609 497 HOH HOH A . 
E 3 HOH 110 610 301 HOH HOH A . 
E 3 HOH 111 611 24  HOH HOH A . 
E 3 HOH 112 612 255 HOH HOH A . 
E 3 HOH 113 613 218 HOH HOH A . 
E 3 HOH 114 614 386 HOH HOH A . 
E 3 HOH 115 615 313 HOH HOH A . 
E 3 HOH 116 616 297 HOH HOH A . 
E 3 HOH 117 617 488 HOH HOH A . 
E 3 HOH 118 618 563 HOH HOH A . 
E 3 HOH 119 619 347 HOH HOH A . 
E 3 HOH 120 620 420 HOH HOH A . 
E 3 HOH 121 621 352 HOH HOH A . 
E 3 HOH 122 622 550 HOH HOH A . 
E 3 HOH 123 623 364 HOH HOH A . 
E 3 HOH 124 624 674 HOH HOH A . 
E 3 HOH 125 625 584 HOH HOH A . 
E 3 HOH 126 626 6   HOH HOH A . 
E 3 HOH 127 627 74  HOH HOH A . 
E 3 HOH 128 628 356 HOH HOH A . 
E 3 HOH 129 629 210 HOH HOH A . 
E 3 HOH 130 630 108 HOH HOH A . 
E 3 HOH 131 631 21  HOH HOH A . 
E 3 HOH 132 632 220 HOH HOH A . 
E 3 HOH 133 633 146 HOH HOH A . 
E 3 HOH 134 634 583 HOH HOH A . 
E 3 HOH 135 635 31  HOH HOH A . 
E 3 HOH 136 636 181 HOH HOH A . 
E 3 HOH 137 637 490 HOH HOH A . 
E 3 HOH 138 638 56  HOH HOH A . 
E 3 HOH 139 639 638 HOH HOH A . 
E 3 HOH 140 640 502 HOH HOH A . 
E 3 HOH 141 641 529 HOH HOH A . 
E 3 HOH 142 642 357 HOH HOH A . 
E 3 HOH 143 643 193 HOH HOH A . 
E 3 HOH 144 644 512 HOH HOH A . 
E 3 HOH 145 645 195 HOH HOH A . 
E 3 HOH 146 646 471 HOH HOH A . 
E 3 HOH 147 647 134 HOH HOH A . 
E 3 HOH 148 648 129 HOH HOH A . 
E 3 HOH 149 649 64  HOH HOH A . 
E 3 HOH 150 650 665 HOH HOH A . 
E 3 HOH 151 651 248 HOH HOH A . 
E 3 HOH 152 652 314 HOH HOH A . 
E 3 HOH 153 653 427 HOH HOH A . 
E 3 HOH 154 654 401 HOH HOH A . 
E 3 HOH 155 655 349 HOH HOH A . 
E 3 HOH 156 656 508 HOH HOH A . 
E 3 HOH 157 657 409 HOH HOH A . 
E 3 HOH 158 658 174 HOH HOH A . 
E 3 HOH 159 659 300 HOH HOH A . 
E 3 HOH 160 660 33  HOH HOH A . 
E 3 HOH 161 661 613 HOH HOH A . 
E 3 HOH 162 662 34  HOH HOH A . 
E 3 HOH 163 663 155 HOH HOH A . 
E 3 HOH 164 664 379 HOH HOH A . 
E 3 HOH 165 665 179 HOH HOH A . 
E 3 HOH 166 666 234 HOH HOH A . 
E 3 HOH 167 667 331 HOH HOH A . 
E 3 HOH 168 668 232 HOH HOH A . 
E 3 HOH 169 669 412 HOH HOH A . 
E 3 HOH 170 670 148 HOH HOH A . 
E 3 HOH 171 671 137 HOH HOH A . 
E 3 HOH 172 672 27  HOH HOH A . 
E 3 HOH 173 673 341 HOH HOH A . 
E 3 HOH 174 674 186 HOH HOH A . 
E 3 HOH 175 675 668 HOH HOH A . 
E 3 HOH 176 676 564 HOH HOH A . 
E 3 HOH 177 677 332 HOH HOH A . 
E 3 HOH 178 678 189 HOH HOH A . 
E 3 HOH 179 679 351 HOH HOH A . 
E 3 HOH 180 680 487 HOH HOH A . 
E 3 HOH 181 681 640 HOH HOH A . 
E 3 HOH 182 682 5   HOH HOH A . 
E 3 HOH 183 683 226 HOH HOH A . 
E 3 HOH 184 684 468 HOH HOH A . 
E 3 HOH 185 685 466 HOH HOH A . 
E 3 HOH 186 686 370 HOH HOH A . 
E 3 HOH 187 687 147 HOH HOH A . 
E 3 HOH 188 688 521 HOH HOH A . 
E 3 HOH 189 689 474 HOH HOH A . 
E 3 HOH 190 690 77  HOH HOH A . 
E 3 HOH 191 691 486 HOH HOH A . 
E 3 HOH 192 692 236 HOH HOH A . 
E 3 HOH 193 693 382 HOH HOH A . 
E 3 HOH 194 694 75  HOH HOH A . 
E 3 HOH 195 695 506 HOH HOH A . 
E 3 HOH 196 696 140 HOH HOH A . 
E 3 HOH 197 697 346 HOH HOH A . 
E 3 HOH 198 698 106 HOH HOH A . 
E 3 HOH 199 699 207 HOH HOH A . 
E 3 HOH 200 700 309 HOH HOH A . 
E 3 HOH 201 701 138 HOH HOH A . 
E 3 HOH 202 702 235 HOH HOH A . 
E 3 HOH 203 703 299 HOH HOH A . 
E 3 HOH 204 704 39  HOH HOH A . 
E 3 HOH 205 705 391 HOH HOH A . 
E 3 HOH 206 706 330 HOH HOH A . 
E 3 HOH 207 707 177 HOH HOH A . 
E 3 HOH 208 708 73  HOH HOH A . 
E 3 HOH 209 709 192 HOH HOH A . 
E 3 HOH 210 710 630 HOH HOH A . 
E 3 HOH 211 711 10  HOH HOH A . 
E 3 HOH 212 712 154 HOH HOH A . 
E 3 HOH 213 713 184 HOH HOH A . 
E 3 HOH 214 714 99  HOH HOH A . 
E 3 HOH 215 715 306 HOH HOH A . 
E 3 HOH 216 716 219 HOH HOH A . 
E 3 HOH 217 717 367 HOH HOH A . 
E 3 HOH 218 718 366 HOH HOH A . 
E 3 HOH 219 719 688 HOH HOH A . 
E 3 HOH 220 720 139 HOH HOH A . 
E 3 HOH 221 721 461 HOH HOH A . 
E 3 HOH 222 722 673 HOH HOH A . 
E 3 HOH 223 723 548 HOH HOH A . 
E 3 HOH 224 724 229 HOH HOH A . 
E 3 HOH 225 725 567 HOH HOH A . 
E 3 HOH 226 726 141 HOH HOH A . 
E 3 HOH 227 727 361 HOH HOH A . 
E 3 HOH 228 728 565 HOH HOH A . 
E 3 HOH 229 729 362 HOH HOH A . 
E 3 HOH 230 730 570 HOH HOH A . 
E 3 HOH 231 731 518 HOH HOH A . 
E 3 HOH 232 732 413 HOH HOH A . 
E 3 HOH 233 733 180 HOH HOH A . 
E 3 HOH 234 734 643 HOH HOH A . 
E 3 HOH 235 735 517 HOH HOH A . 
E 3 HOH 236 736 242 HOH HOH A . 
E 3 HOH 237 737 354 HOH HOH A . 
E 3 HOH 238 738 644 HOH HOH A . 
E 3 HOH 239 739 504 HOH HOH A . 
E 3 HOH 240 740 190 HOH HOH A . 
E 3 HOH 241 741 363 HOH HOH A . 
E 3 HOH 242 742 528 HOH HOH A . 
E 3 HOH 243 743 483 HOH HOH A . 
E 3 HOH 244 744 666 HOH HOH A . 
E 3 HOH 245 745 250 HOH HOH A . 
E 3 HOH 246 746 182 HOH HOH A . 
E 3 HOH 247 747 475 HOH HOH A . 
E 3 HOH 248 748 144 HOH HOH A . 
E 3 HOH 249 749 639 HOH HOH A . 
E 3 HOH 250 750 442 HOH HOH A . 
E 3 HOH 251 751 298 HOH HOH A . 
E 3 HOH 252 752 215 HOH HOH A . 
E 3 HOH 253 753 467 HOH HOH A . 
E 3 HOH 254 754 503 HOH HOH A . 
E 3 HOH 255 755 166 HOH HOH A . 
E 3 HOH 256 756 482 HOH HOH A . 
E 3 HOH 257 757 568 HOH HOH A . 
E 3 HOH 258 758 131 HOH HOH A . 
E 3 HOH 259 759 477 HOH HOH A . 
E 3 HOH 260 760 151 HOH HOH A . 
E 3 HOH 261 761 484 HOH HOH A . 
E 3 HOH 262 762 501 HOH HOH A . 
E 3 HOH 263 763 385 HOH HOH A . 
E 3 HOH 264 764 371 HOH HOH A . 
E 3 HOH 265 765 393 HOH HOH A . 
E 3 HOH 266 766 143 HOH HOH A . 
E 3 HOH 267 767 457 HOH HOH A . 
E 3 HOH 268 768 505 HOH HOH A . 
E 3 HOH 269 769 158 HOH HOH A . 
E 3 HOH 270 770 507 HOH HOH A . 
E 3 HOH 271 771 198 HOH HOH A . 
E 3 HOH 272 772 238 HOH HOH A . 
E 3 HOH 273 773 365 HOH HOH A . 
E 3 HOH 274 774 523 HOH HOH A . 
E 3 HOH 275 775 667 HOH HOH A . 
E 3 HOH 276 776 496 HOH HOH A . 
E 3 HOH 277 777 249 HOH HOH A . 
E 3 HOH 278 778 574 HOH HOH A . 
E 3 HOH 279 779 389 HOH HOH A . 
E 3 HOH 280 780 416 HOH HOH A . 
E 3 HOH 281 781 522 HOH HOH A . 
E 3 HOH 282 782 672 HOH HOH A . 
E 3 HOH 283 783 254 HOH HOH A . 
E 3 HOH 284 784 132 HOH HOH A . 
E 3 HOH 285 785 176 HOH HOH A . 
E 3 HOH 286 786 566 HOH HOH A . 
E 3 HOH 287 787 470 HOH HOH A . 
E 3 HOH 288 788 136 HOH HOH A . 
E 3 HOH 289 789 350 HOH HOH A . 
E 3 HOH 290 790 303 HOH HOH A . 
E 3 HOH 291 791 473 HOH HOH A . 
E 3 HOH 292 792 156 HOH HOH A . 
E 3 HOH 293 793 684 HOH HOH A . 
E 3 HOH 294 794 101 HOH HOH A . 
E 3 HOH 295 795 562 HOH HOH A . 
E 3 HOH 296 796 686 HOH HOH A . 
E 3 HOH 297 797 221 HOH HOH A . 
E 3 HOH 298 798 342 HOH HOH A . 
E 3 HOH 299 799 585 HOH HOH A . 
E 3 HOH 300 800 561 HOH HOH A . 
E 3 HOH 301 801 645 HOH HOH A . 
E 3 HOH 302 802 400 HOH HOH A . 
E 3 HOH 303 803 203 HOH HOH A . 
E 3 HOH 304 804 175 HOH HOH A . 
E 3 HOH 305 805 127 HOH HOH A . 
E 3 HOH 306 806 571 HOH HOH A . 
E 3 HOH 307 807 669 HOH HOH A . 
E 3 HOH 308 808 499 HOH HOH A . 
E 3 HOH 309 809 641 HOH HOH A . 
E 3 HOH 310 810 519 HOH HOH A . 
E 3 HOH 311 811 305 HOH HOH A . 
E 3 HOH 312 812 495 HOH HOH A . 
E 3 HOH 313 813 294 HOH HOH A . 
E 3 HOH 314 814 194 HOH HOH A . 
E 3 HOH 315 815 335 HOH HOH A . 
E 3 HOH 316 816 388 HOH HOH A . 
E 3 HOH 317 817 414 HOH HOH A . 
E 3 HOH 318 818 577 HOH HOH A . 
E 3 HOH 319 819 646 HOH HOH A . 
E 3 HOH 320 820 476 HOH HOH A . 
E 3 HOH 321 821 410 HOH HOH A . 
E 3 HOH 322 822 343 HOH HOH A . 
E 3 HOH 323 823 405 HOH HOH A . 
E 3 HOH 324 824 197 HOH HOH A . 
E 3 HOH 325 825 527 HOH HOH A . 
E 3 HOH 326 826 202 HOH HOH A . 
E 3 HOH 327 827 516 HOH HOH A . 
E 3 HOH 328 828 670 HOH HOH A . 
E 3 HOH 329 829 102 HOH HOH A . 
E 3 HOH 330 830 494 HOH HOH A . 
E 3 HOH 331 831 511 HOH HOH A . 
E 3 HOH 332 832 513 HOH HOH A . 
E 3 HOH 333 833 438 HOH HOH A . 
E 3 HOH 334 834 576 HOH HOH A . 
E 3 HOH 335 835 415 HOH HOH A . 
E 3 HOH 336 836 307 HOH HOH A . 
E 3 HOH 337 837 233 HOH HOH A . 
E 3 HOH 338 838 629 HOH HOH A . 
E 3 HOH 339 839 149 HOH HOH A . 
E 3 HOH 340 840 526 HOH HOH A . 
E 3 HOH 341 841 509 HOH HOH A . 
E 3 HOH 342 842 407 HOH HOH A . 
E 3 HOH 343 843 228 HOH HOH A . 
E 3 HOH 344 844 493 HOH HOH A . 
E 3 HOH 345 845 111 HOH HOH A . 
E 3 HOH 346 846 329 HOH HOH A . 
E 3 HOH 347 847 360 HOH HOH A . 
E 3 HOH 348 848 535 HOH HOH A . 
E 3 HOH 349 849 514 HOH HOH A . 
E 3 HOH 350 850 100 HOH HOH A . 
E 3 HOH 351 851 671 HOH HOH A . 
E 3 HOH 352 852 187 HOH HOH A . 
E 3 HOH 353 853 369 HOH HOH A . 
F 3 HOH 1   501 86  HOH HOH B . 
F 3 HOH 2   502 267 HOH HOH B . 
F 3 HOH 3   503 293 HOH HOH B . 
F 3 HOH 4   504 49  HOH HOH B . 
F 3 HOH 5   505 677 HOH HOH B . 
F 3 HOH 6   506 663 HOH HOH B . 
F 3 HOH 7   507 246 HOH HOH B . 
F 3 HOH 8   508 378 HOH HOH B . 
F 3 HOH 9   509 145 HOH HOH B . 
F 3 HOH 10  510 121 HOH HOH B . 
F 3 HOH 11  511 657 HOH HOH B . 
F 3 HOH 12  512 280 HOH HOH B . 
F 3 HOH 13  513 614 HOH HOH B . 
F 3 HOH 14  514 84  HOH HOH B . 
F 3 HOH 15  515 610 HOH HOH B . 
F 3 HOH 16  516 480 HOH HOH B . 
F 3 HOH 17  517 240 HOH HOH B . 
F 3 HOH 18  518 274 HOH HOH B . 
F 3 HOH 19  519 683 HOH HOH B . 
F 3 HOH 20  520 458 HOH HOH B . 
F 3 HOH 21  521 167 HOH HOH B . 
F 3 HOH 22  522 375 HOH HOH B . 
F 3 HOH 23  523 268 HOH HOH B . 
F 3 HOH 24  524 286 HOH HOH B . 
F 3 HOH 25  525 451 HOH HOH B . 
F 3 HOH 26  526 559 HOH HOH B . 
F 3 HOH 27  527 444 HOH HOH B . 
F 3 HOH 28  528 602 HOH HOH B . 
F 3 HOH 29  529 432 HOH HOH B . 
F 3 HOH 30  530 123 HOH HOH B . 
F 3 HOH 31  531 465 HOH HOH B . 
F 3 HOH 32  532 324 HOH HOH B . 
F 3 HOH 33  533 119 HOH HOH B . 
F 3 HOH 34  534 450 HOH HOH B . 
F 3 HOH 35  535 272 HOH HOH B . 
F 3 HOH 36  536 377 HOH HOH B . 
F 3 HOH 37  537 278 HOH HOH B . 
F 3 HOH 38  538 557 HOH HOH B . 
F 3 HOH 39  539 624 HOH HOH B . 
F 3 HOH 40  540 58  HOH HOH B . 
F 3 HOH 41  541 589 HOH HOH B . 
F 3 HOH 42  542 326 HOH HOH B . 
F 3 HOH 43  543 93  HOH HOH B . 
F 3 HOH 44  544 87  HOH HOH B . 
F 3 HOH 45  545 36  HOH HOH B . 
F 3 HOH 46  546 320 HOH HOH B . 
F 3 HOH 47  547 269 HOH HOH B . 
F 3 HOH 48  548 445 HOH HOH B . 
F 3 HOH 49  549 92  HOH HOH B . 
F 3 HOH 50  550 261 HOH HOH B . 
F 3 HOH 51  551 57  HOH HOH B . 
F 3 HOH 52  552 126 HOH HOH B . 
F 3 HOH 53  553 11  HOH HOH B . 
F 3 HOH 54  554 434 HOH HOH B . 
F 3 HOH 55  555 588 HOH HOH B . 
F 3 HOH 56  556 35  HOH HOH B . 
F 3 HOH 57  557 231 HOH HOH B . 
F 3 HOH 58  558 433 HOH HOH B . 
F 3 HOH 59  559 53  HOH HOH B . 
F 3 HOH 60  560 323 HOH HOH B . 
F 3 HOH 61  561 98  HOH HOH B . 
F 3 HOH 62  562 591 HOH HOH B . 
F 3 HOH 63  563 4   HOH HOH B . 
F 3 HOH 64  564 169 HOH HOH B . 
F 3 HOH 65  565 94  HOH HOH B . 
F 3 HOH 66  566 353 HOH HOH B . 
F 3 HOH 67  567 587 HOH HOH B . 
F 3 HOH 68  568 251 HOH HOH B . 
F 3 HOH 69  569 555 HOH HOH B . 
F 3 HOH 70  570 52  HOH HOH B . 
F 3 HOH 71  571 2   HOH HOH B . 
F 3 HOH 72  572 662 HOH HOH B . 
F 3 HOH 73  573 7   HOH HOH B . 
F 3 HOH 74  574 424 HOH HOH B . 
F 3 HOH 75  575 82  HOH HOH B . 
F 3 HOH 76  576 325 HOH HOH B . 
F 3 HOH 77  577 321 HOH HOH B . 
F 3 HOH 78  578 680 HOH HOH B . 
F 3 HOH 79  579 291 HOH HOH B . 
F 3 HOH 80  580 89  HOH HOH B . 
F 3 HOH 81  581 50  HOH HOH B . 
F 3 HOH 82  582 322 HOH HOH B . 
F 3 HOH 83  583 78  HOH HOH B . 
F 3 HOH 84  584 48  HOH HOH B . 
F 3 HOH 85  585 448 HOH HOH B . 
F 3 HOH 86  586 8   HOH HOH B . 
F 3 HOH 87  587 600 HOH HOH B . 
F 3 HOH 88  588 204 HOH HOH B . 
F 3 HOH 89  589 66  HOH HOH B . 
F 3 HOH 90  590 532 HOH HOH B . 
F 3 HOH 91  591 634 HOH HOH B . 
F 3 HOH 92  592 558 HOH HOH B . 
F 3 HOH 93  593 552 HOH HOH B . 
F 3 HOH 94  594 446 HOH HOH B . 
F 3 HOH 95  595 110 HOH HOH B . 
F 3 HOH 96  596 205 HOH HOH B . 
F 3 HOH 97  597 581 HOH HOH B . 
F 3 HOH 98  598 276 HOH HOH B . 
F 3 HOH 99  599 290 HOH HOH B . 
F 3 HOH 100 600 541 HOH HOH B . 
F 3 HOH 101 601 95  HOH HOH B . 
F 3 HOH 102 602 266 HOH HOH B . 
F 3 HOH 103 603 161 HOH HOH B . 
F 3 HOH 104 604 283 HOH HOH B . 
F 3 HOH 105 605 655 HOH HOH B . 
F 3 HOH 106 606 275 HOH HOH B . 
F 3 HOH 107 607 597 HOH HOH B . 
F 3 HOH 108 608 625 HOH HOH B . 
F 3 HOH 109 609 327 HOH HOH B . 
F 3 HOH 110 610 23  HOH HOH B . 
F 3 HOH 111 611 395 HOH HOH B . 
F 3 HOH 112 612 373 HOH HOH B . 
F 3 HOH 113 613 38  HOH HOH B . 
F 3 HOH 114 614 40  HOH HOH B . 
F 3 HOH 115 615 611 HOH HOH B . 
F 3 HOH 116 616 545 HOH HOH B . 
F 3 HOH 117 617 90  HOH HOH B . 
F 3 HOH 118 618 593 HOH HOH B . 
F 3 HOH 119 619 59  HOH HOH B . 
F 3 HOH 120 620 277 HOH HOH B . 
F 3 HOH 121 621 37  HOH HOH B . 
F 3 HOH 122 622 55  HOH HOH B . 
F 3 HOH 123 623 396 HOH HOH B . 
F 3 HOH 124 624 164 HOH HOH B . 
F 3 HOH 125 625 241 HOH HOH B . 
F 3 HOH 126 626 107 HOH HOH B . 
F 3 HOH 127 627 12  HOH HOH B . 
F 3 HOH 128 628 243 HOH HOH B . 
F 3 HOH 129 629 83  HOH HOH B . 
F 3 HOH 130 630 318 HOH HOH B . 
F 3 HOH 131 631 626 HOH HOH B . 
F 3 HOH 132 632 648 HOH HOH B . 
F 3 HOH 133 633 259 HOH HOH B . 
F 3 HOH 134 634 452 HOH HOH B . 
F 3 HOH 135 635 336 HOH HOH B . 
F 3 HOH 136 636 122 HOH HOH B . 
F 3 HOH 137 637 112 HOH HOH B . 
F 3 HOH 138 638 96  HOH HOH B . 
F 3 HOH 139 639 319 HOH HOH B . 
F 3 HOH 140 640 544 HOH HOH B . 
F 3 HOH 141 641 125 HOH HOH B . 
F 3 HOH 142 642 287 HOH HOH B . 
F 3 HOH 143 643 91  HOH HOH B . 
F 3 HOH 144 644 481 HOH HOH B . 
F 3 HOH 145 645 534 HOH HOH B . 
F 3 HOH 146 646 81  HOH HOH B . 
F 3 HOH 147 647 620 HOH HOH B . 
F 3 HOH 148 648 113 HOH HOH B . 
F 3 HOH 149 649 616 HOH HOH B . 
F 3 HOH 150 650 285 HOH HOH B . 
F 3 HOH 151 651 533 HOH HOH B . 
F 3 HOH 152 652 265 HOH HOH B . 
F 3 HOH 153 653 116 HOH HOH B . 
F 3 HOH 154 654 168 HOH HOH B . 
F 3 HOH 155 655 429 HOH HOH B . 
F 3 HOH 156 656 422 HOH HOH B . 
F 3 HOH 157 657 659 HOH HOH B . 
F 3 HOH 158 658 455 HOH HOH B . 
F 3 HOH 159 659 537 HOH HOH B . 
F 3 HOH 160 660 441 HOH HOH B . 
F 3 HOH 161 661 538 HOH HOH B . 
F 3 HOH 162 662 1   HOH HOH B . 
F 3 HOH 163 663 273 HOH HOH B . 
F 3 HOH 164 664 9   HOH HOH B . 
F 3 HOH 165 665 133 HOH HOH B . 
F 3 HOH 166 666 260 HOH HOH B . 
F 3 HOH 167 667 104 HOH HOH B . 
F 3 HOH 168 668 288 HOH HOH B . 
F 3 HOH 169 669 590 HOH HOH B . 
F 3 HOH 170 670 651 HOH HOH B . 
F 3 HOH 171 671 578 HOH HOH B . 
F 3 HOH 172 672 80  HOH HOH B . 
F 3 HOH 173 673 118 HOH HOH B . 
F 3 HOH 174 674 264 HOH HOH B . 
F 3 HOH 175 675 165 HOH HOH B . 
F 3 HOH 176 676 411 HOH HOH B . 
F 3 HOH 177 677 653 HOH HOH B . 
F 3 HOH 178 678 79  HOH HOH B . 
F 3 HOH 179 679 554 HOH HOH B . 
F 3 HOH 180 680 216 HOH HOH B . 
F 3 HOH 181 681 612 HOH HOH B . 
F 3 HOH 182 682 54  HOH HOH B . 
F 3 HOH 183 683 599 HOH HOH B . 
F 3 HOH 184 684 120 HOH HOH B . 
F 3 HOH 185 685 333 HOH HOH B . 
F 3 HOH 186 686 459 HOH HOH B . 
F 3 HOH 187 687 163 HOH HOH B . 
F 3 HOH 188 688 245 HOH HOH B . 
F 3 HOH 189 689 115 HOH HOH B . 
F 3 HOH 190 690 284 HOH HOH B . 
F 3 HOH 191 691 359 HOH HOH B . 
F 3 HOH 192 692 619 HOH HOH B . 
F 3 HOH 193 693 62  HOH HOH B . 
F 3 HOH 194 694 542 HOH HOH B . 
F 3 HOH 195 695 675 HOH HOH B . 
F 3 HOH 196 696 596 HOH HOH B . 
F 3 HOH 197 697 586 HOH HOH B . 
F 3 HOH 198 698 592 HOH HOH B . 
F 3 HOH 199 699 3   HOH HOH B . 
F 3 HOH 200 700 160 HOH HOH B . 
F 3 HOH 201 701 279 HOH HOH B . 
F 3 HOH 202 702 97  HOH HOH B . 
F 3 HOH 203 703 627 HOH HOH B . 
F 3 HOH 204 704 464 HOH HOH B . 
F 3 HOH 205 705 135 HOH HOH B . 
F 3 HOH 206 706 328 HOH HOH B . 
F 3 HOH 207 707 252 HOH HOH B . 
F 3 HOH 208 708 678 HOH HOH B . 
F 3 HOH 209 709 660 HOH HOH B . 
F 3 HOH 210 710 170 HOH HOH B . 
F 3 HOH 211 711 454 HOH HOH B . 
F 3 HOH 212 712 456 HOH HOH B . 
F 3 HOH 213 713 605 HOH HOH B . 
F 3 HOH 214 714 469 HOH HOH B . 
F 3 HOH 215 715 316 HOH HOH B . 
F 3 HOH 216 716 399 HOH HOH B . 
F 3 HOH 217 717 633 HOH HOH B . 
F 3 HOH 218 718 679 HOH HOH B . 
F 3 HOH 219 719 295 HOH HOH B . 
F 3 HOH 220 720 114 HOH HOH B . 
F 3 HOH 221 721 423 HOH HOH B . 
F 3 HOH 222 722 289 HOH HOH B . 
F 3 HOH 223 723 582 HOH HOH B . 
F 3 HOH 224 724 560 HOH HOH B . 
F 3 HOH 225 725 536 HOH HOH B . 
F 3 HOH 226 726 403 HOH HOH B . 
F 3 HOH 227 727 425 HOH HOH B . 
F 3 HOH 228 728 449 HOH HOH B . 
F 3 HOH 229 729 603 HOH HOH B . 
F 3 HOH 230 730 460 HOH HOH B . 
F 3 HOH 231 731 437 HOH HOH B . 
F 3 HOH 232 732 608 HOH HOH B . 
F 3 HOH 233 733 595 HOH HOH B . 
F 3 HOH 234 734 317 HOH HOH B . 
F 3 HOH 235 735 404 HOH HOH B . 
F 3 HOH 236 736 681 HOH HOH B . 
F 3 HOH 237 737 421 HOH HOH B . 
F 3 HOH 238 738 556 HOH HOH B . 
F 3 HOH 239 739 428 HOH HOH B . 
F 3 HOH 240 740 372 HOH HOH B . 
F 3 HOH 241 741 443 HOH HOH B . 
F 3 HOH 242 742 426 HOH HOH B . 
F 3 HOH 243 743 271 HOH HOH B . 
F 3 HOH 244 744 594 HOH HOH B . 
F 3 HOH 245 745 553 HOH HOH B . 
F 3 HOH 246 746 374 HOH HOH B . 
F 3 HOH 247 747 631 HOH HOH B . 
F 3 HOH 248 748 162 HOH HOH B . 
F 3 HOH 249 749 51  HOH HOH B . 
F 3 HOH 250 750 652 HOH HOH B . 
F 3 HOH 251 751 76  HOH HOH B . 
F 3 HOH 252 752 656 HOH HOH B . 
F 3 HOH 253 753 676 HOH HOH B . 
F 3 HOH 254 754 632 HOH HOH B . 
F 3 HOH 255 755 244 HOH HOH B . 
F 3 HOH 256 756 339 HOH HOH B . 
F 3 HOH 257 757 302 HOH HOH B . 
F 3 HOH 258 758 430 HOH HOH B . 
F 3 HOH 259 759 85  HOH HOH B . 
F 3 HOH 260 760 623 HOH HOH B . 
F 3 HOH 261 761 649 HOH HOH B . 
F 3 HOH 262 762 547 HOH HOH B . 
F 3 HOH 263 763 658 HOH HOH B . 
F 3 HOH 264 764 635 HOH HOH B . 
F 3 HOH 265 765 417 HOH HOH B . 
F 3 HOH 266 766 462 HOH HOH B . 
F 3 HOH 267 767 664 HOH HOH B . 
F 3 HOH 268 768 436 HOH HOH B . 
F 3 HOH 269 769 601 HOH HOH B . 
F 3 HOH 270 770 682 HOH HOH B . 
F 3 HOH 271 771 685 HOH HOH B . 
F 3 HOH 272 772 621 HOH HOH B . 
F 3 HOH 273 773 61  HOH HOH B . 
F 3 HOH 274 774 615 HOH HOH B . 
F 3 HOH 275 775 105 HOH HOH B . 
F 3 HOH 276 776 606 HOH HOH B . 
F 3 HOH 277 777 540 HOH HOH B . 
F 3 HOH 278 778 402 HOH HOH B . 
F 3 HOH 279 779 572 HOH HOH B . 
F 3 HOH 280 780 636 HOH HOH B . 
F 3 HOH 281 781 650 HOH HOH B . 
F 3 HOH 282 782 435 HOH HOH B . 
F 3 HOH 283 783 618 HOH HOH B . 
F 3 HOH 284 784 598 HOH HOH B . 
F 3 HOH 285 785 453 HOH HOH B . 
F 3 HOH 286 786 492 HOH HOH B . 
F 3 HOH 287 787 479 HOH HOH B . 
F 3 HOH 288 788 607 HOH HOH B . 
F 3 HOH 289 789 447 HOH HOH B . 
F 3 HOH 290 790 270 HOH HOH B . 
F 3 HOH 291 791 117 HOH HOH B . 
F 3 HOH 292 792 431 HOH HOH B . 
F 3 HOH 293 793 397 HOH HOH B . 
F 3 HOH 294 794 622 HOH HOH B . 
F 3 HOH 295 795 398 HOH HOH B . 
F 3 HOH 296 796 384 HOH HOH B . 
F 3 HOH 297 797 609 HOH HOH B . 
F 3 HOH 298 798 661 HOH HOH B . 
F 3 HOH 299 799 654 HOH HOH B . 
F 3 HOH 300 800 376 HOH HOH B . 
F 3 HOH 301 801 617 HOH HOH B . 
F 3 HOH 302 802 463 HOH HOH B . 
F 3 HOH 303 803 308 HOH HOH B . 
F 3 HOH 304 804 206 HOH HOH B . 
F 3 HOH 305 805 124 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3480  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  25690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-03-30 
2 'Structure model' 1 1 2016-04-06 
3 'Structure model' 1 2 2016-05-04 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? dev_1839 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA    ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 576 ? ? O A HOH 614 ? ? 1.98 
2  1 OE1 A GLU 249 ? ? O A HOH 501 ? ? 2.02 
3  1 OD1 B ASP 24  ? ? O B HOH 501 ? ? 2.07 
4  1 O   A HOH 685 ? ? O A HOH 829 ? ? 2.07 
5  1 O   A HOH 720 ? ? O A HOH 770 ? ? 2.07 
6  1 O   A HOH 506 ? ? O A HOH 817 ? ? 2.08 
7  1 O   A HOH 537 ? ? O A HOH 552 ? ? 2.12 
8  1 OD2 B ASP 294 ? ? O B HOH 502 ? ? 2.13 
9  1 O   A HOH 502 ? ? O A HOH 776 ? ? 2.14 
10 1 O   B HOH 716 ? ? O B HOH 764 ? ? 2.16 
11 1 NH1 B ARG 204 ? A O B HOH 503 ? ? 2.16 
12 1 O   B HOH 716 ? ? O B HOH 795 ? ? 2.16 
13 1 NH2 B ARG 207 ? A O B HOH 504 ? ? 2.16 
14 1 O   A HOH 763 ? ? O B HOH 557 ? ? 2.16 
15 1 O   A HOH 649 ? ? O A HOH 818 ? ? 2.17 
16 1 O   A HOH 774 ? ? O B HOH 521 ? ? 2.18 
17 1 O   B HOH 783 ? ? O B HOH 801 ? ? 2.18 
18 1 O   A HOH 528 ? ? O A HOH 753 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 118 ? ? CZ A ARG 118 ? ? NH1 A ARG 118 ? ? 116.36 120.30 -3.94  0.50 N 
2 1 CG B MET 198 ? A SD B MET 198 ? A CE  B MET 198 ? A 87.74  100.20 -12.46 1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP B 49 ? ? -23.97 114.86 
2 1 ASP B 84 ? ? -82.36 42.09  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   TRP 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    48 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    49 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -131.38 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 851 ? 5.82 . 
2 1 O ? A HOH 852 ? 6.66 . 
3 1 O ? A HOH 853 ? 7.67 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -18 ? A MET 1   
2  1 Y 1 A GLY -17 ? A GLY 2   
3  1 Y 1 A SER -16 ? A SER 3   
4  1 Y 1 A SER -15 ? A SER 4   
5  1 Y 1 A HIS -14 ? A HIS 5   
6  1 Y 1 A HIS -13 ? A HIS 6   
7  1 Y 1 A HIS -12 ? A HIS 7   
8  1 Y 1 A HIS -11 ? A HIS 8   
9  1 Y 1 A HIS -10 ? A HIS 9   
10 1 Y 1 A HIS -9  ? A HIS 10  
11 1 Y 1 A SER -8  ? A SER 11  
12 1 Y 1 A SER -7  ? A SER 12  
13 1 Y 1 A GLY -6  ? A GLY 13  
14 1 Y 1 A LEU -5  ? A LEU 14  
15 1 Y 1 A VAL -4  ? A VAL 15  
16 1 Y 1 A PRO -3  ? A PRO 16  
17 1 Y 1 A ARG -2  ? A ARG 17  
18 1 Y 1 A GLY -1  ? A GLY 18  
19 1 Y 1 A SER 0   ? A SER 19  
20 1 Y 1 A THR 158 ? A THR 177 
21 1 Y 1 A ILE 159 ? A ILE 178 
22 1 Y 1 A GLY 160 ? A GLY 179 
23 1 Y 1 A GLN 161 ? A GLN 180 
24 1 Y 1 A SER 227 ? A SER 246 
25 1 Y 1 A GLU 228 ? A GLU 247 
26 1 Y 1 A ARG 229 ? A ARG 248 
27 1 Y 1 A GLY 230 ? A GLY 249 
28 1 Y 1 A ASP 231 ? A ASP 250 
29 1 Y 1 A VAL 232 ? A VAL 251 
30 1 Y 1 A ARG 311 ? A ARG 330 
31 1 Y 1 A ARG 312 ? A ARG 331 
32 1 Y 1 A TYR 313 ? A TYR 332 
33 1 Y 1 A HIS 314 ? A HIS 333 
34 1 Y 1 A HIS 315 ? A HIS 334 
35 1 Y 1 A GLY 316 ? A GLY 335 
36 1 Y 1 B MET -18 ? B MET 1   
37 1 Y 1 B GLY -17 ? B GLY 2   
38 1 Y 1 B SER -16 ? B SER 3   
39 1 Y 1 B SER -15 ? B SER 4   
40 1 Y 1 B HIS -14 ? B HIS 5   
41 1 Y 1 B HIS -13 ? B HIS 6   
42 1 Y 1 B HIS -12 ? B HIS 7   
43 1 Y 1 B HIS -11 ? B HIS 8   
44 1 Y 1 B HIS -10 ? B HIS 9   
45 1 Y 1 B HIS -9  ? B HIS 10  
46 1 Y 1 B SER -8  ? B SER 11  
47 1 Y 1 B SER -7  ? B SER 12  
48 1 Y 1 B GLY -6  ? B GLY 13  
49 1 Y 1 B LEU -5  ? B LEU 14  
50 1 Y 1 B VAL -4  ? B VAL 15  
51 1 Y 1 B PRO -3  ? B PRO 16  
52 1 Y 1 B ARG -2  ? B ARG 17  
53 1 Y 1 B GLY -1  ? B GLY 18  
54 1 Y 1 B SER 0   ? B SER 19  
55 1 Y 1 B MET 1   ? B MET 20  
56 1 Y 1 B SER 2   ? B SER 21  
57 1 Y 1 B ASP 3   ? B ASP 22  
58 1 Y 1 B ASP 4   ? B ASP 23  
59 1 Y 1 B THR 5   ? B THR 24  
60 1 Y 1 B GLY 160 ? B GLY 179 
61 1 Y 1 B GLN 161 ? B GLN 180 
62 1 Y 1 B ALA 224 ? B ALA 243 
63 1 Y 1 B GLN 225 ? B GLN 244 
64 1 Y 1 B GLU 226 ? B GLU 245 
65 1 Y 1 B SER 227 ? B SER 246 
66 1 Y 1 B GLU 228 ? B GLU 247 
67 1 Y 1 B ARG 229 ? B ARG 248 
68 1 Y 1 B GLY 230 ? B GLY 249 
69 1 Y 1 B ASP 231 ? B ASP 250 
70 1 Y 1 B THR 310 ? B THR 329 
71 1 Y 1 B ARG 311 ? B ARG 330 
72 1 Y 1 B ARG 312 ? B ARG 331 
73 1 Y 1 B TYR 313 ? B TYR 332 
74 1 Y 1 B HIS 314 ? B HIS 333 
75 1 Y 1 B HIS 315 ? B HIS 334 
76 1 Y 1 B GLY 316 ? B GLY 335 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM56838 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#