data_5I35
# 
_entry.id   5I35 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I35         
WWPDB D_1000218179 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          MPP-GO.128466 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I35 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-09 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bingman, C.A.'                           1 
'Stefely, J.A.'                           2 
'Pagliarini, D.J.'                        3 
'Mitochondrial Protein Partnership (MPP)' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            63 
_citation.language                  ? 
_citation.page_first                608 
_citation.page_last                 620 
_citation.title                     'Cerebellar Ataxia and Coenzyme Q Deficiency through Loss of Unorthodox Kinase Activity.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2016.06.030 
_citation.pdbx_database_id_PubMed   27499294 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Stefely, J.A.'     1  ? 
primary 'Licitra, F.'       2  ? 
primary 'Laredj, L.'        3  ? 
primary 'Reidenbach, A.G.'  4  ? 
primary 'Kemmerer, Z.A.'    5  ? 
primary 'Grangeray, A.'     6  ? 
primary 'Jaeg-Ehret, T.'    7  ? 
primary 'Minogue, C.E.'     8  ? 
primary 'Ulbrich, A.'       9  ? 
primary 'Hutchins, P.D.'    10 ? 
primary 'Wilkerson, E.M.'   11 ? 
primary 'Ruan, Z.'          12 ? 
primary 'Aydin, D.'         13 ? 
primary 'Hebert, A.S.'      14 ? 
primary 'Guo, X.'           15 ? 
primary 'Freiberger, E.C.'  16 ? 
primary 'Reutenauer, L.'    17 ? 
primary 'Jochem, A.'        18 ? 
primary 'Chergova, M.'      19 ? 
primary 'Johnson, I.E.'     20 ? 
primary 'Lohman, D.C.'      21 ? 
primary 'Rush, M.J.'        22 ? 
primary 'Kwiecien, N.W.'    23 ? 
primary 'Singh, P.K.'       24 ? 
primary 'Schlagowski, A.I.' 25 ? 
primary 'Floyd, B.J.'       26 ? 
primary 'Forsman, U.'       27 ? 
primary 'Sindelar, P.J.'    28 ? 
primary 'Westphall, M.S.'   29 ? 
primary 'Pierrel, F.'       30 ? 
primary 'Zoll, J.'          31 ? 
primary 'Dal Peraro, M.'    32 ? 
primary 'Kannan, N.'        33 ? 
primary 'Bingman, C.A.'     34 ? 
primary 'Coon, J.J.'        35 ? 
primary 'Isope, P.'         36 ? 
primary 'Puccio, H.'        37 ? 
primary 'Pagliarini, D.J.'  38 ? 
# 
_cell.entry_id           5I35 
_cell.length_a           150.050 
_cell.length_b           59.120 
_cell.length_c           51.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.69 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I35 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Atypical kinase ADCK3, mitochondrial'        45923.363 1  2.7.-.- R611K ? ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   1  ?       ?     ? ? 
3 water       nat water                                         18.015    26 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Chaperone activity of bc1 complex-like,Chaperone-ABC1-like,aarF domain-containing protein kinase 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SSEANAERIVRTLCKVRGAALKLGQ(MSE)LSIQDDAFINPHLAKIFERVRQSADF(MSE)PLKQ(MSE)(MSE)KTLNN
DLGPNWRDKLEYFEERPFAAASIGQVHLAR(MSE)KGGREVA(MSE)KIQYPGVAQSINSDVNNL(MSE)AVLN(MSE)S
N(MSE)LPEGLFPEHLIDVLRRELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEG
LSQEIRNEICYNILVLCLRELFEFHF(MSE)QTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDR
ETVRAKSIE(MSE)KFLTGYEVKV(MSE)EDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPV(MSE)LRHRLVPP
PEETYSLHKK(MSE)GGSFLICSKLKARFPCKA(MSE)FEEAYSNYCKRQAQQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERVRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEER
PFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAAC
ARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNF
FYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDE
PFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHKKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         MPP-GO.128466 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   GLU n 
1 4   ALA n 
1 5   ASN n 
1 6   ALA n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  VAL n 
1 11  ARG n 
1 12  THR n 
1 13  LEU n 
1 14  CYS n 
1 15  LYS n 
1 16  VAL n 
1 17  ARG n 
1 18  GLY n 
1 19  ALA n 
1 20  ALA n 
1 21  LEU n 
1 22  LYS n 
1 23  LEU n 
1 24  GLY n 
1 25  GLN n 
1 26  MSE n 
1 27  LEU n 
1 28  SER n 
1 29  ILE n 
1 30  GLN n 
1 31  ASP n 
1 32  ASP n 
1 33  ALA n 
1 34  PHE n 
1 35  ILE n 
1 36  ASN n 
1 37  PRO n 
1 38  HIS n 
1 39  LEU n 
1 40  ALA n 
1 41  LYS n 
1 42  ILE n 
1 43  PHE n 
1 44  GLU n 
1 45  ARG n 
1 46  VAL n 
1 47  ARG n 
1 48  GLN n 
1 49  SER n 
1 50  ALA n 
1 51  ASP n 
1 52  PHE n 
1 53  MSE n 
1 54  PRO n 
1 55  LEU n 
1 56  LYS n 
1 57  GLN n 
1 58  MSE n 
1 59  MSE n 
1 60  LYS n 
1 61  THR n 
1 62  LEU n 
1 63  ASN n 
1 64  ASN n 
1 65  ASP n 
1 66  LEU n 
1 67  GLY n 
1 68  PRO n 
1 69  ASN n 
1 70  TRP n 
1 71  ARG n 
1 72  ASP n 
1 73  LYS n 
1 74  LEU n 
1 75  GLU n 
1 76  TYR n 
1 77  PHE n 
1 78  GLU n 
1 79  GLU n 
1 80  ARG n 
1 81  PRO n 
1 82  PHE n 
1 83  ALA n 
1 84  ALA n 
1 85  ALA n 
1 86  SER n 
1 87  ILE n 
1 88  GLY n 
1 89  GLN n 
1 90  VAL n 
1 91  HIS n 
1 92  LEU n 
1 93  ALA n 
1 94  ARG n 
1 95  MSE n 
1 96  LYS n 
1 97  GLY n 
1 98  GLY n 
1 99  ARG n 
1 100 GLU n 
1 101 VAL n 
1 102 ALA n 
1 103 MSE n 
1 104 LYS n 
1 105 ILE n 
1 106 GLN n 
1 107 TYR n 
1 108 PRO n 
1 109 GLY n 
1 110 VAL n 
1 111 ALA n 
1 112 GLN n 
1 113 SER n 
1 114 ILE n 
1 115 ASN n 
1 116 SER n 
1 117 ASP n 
1 118 VAL n 
1 119 ASN n 
1 120 ASN n 
1 121 LEU n 
1 122 MSE n 
1 123 ALA n 
1 124 VAL n 
1 125 LEU n 
1 126 ASN n 
1 127 MSE n 
1 128 SER n 
1 129 ASN n 
1 130 MSE n 
1 131 LEU n 
1 132 PRO n 
1 133 GLU n 
1 134 GLY n 
1 135 LEU n 
1 136 PHE n 
1 137 PRO n 
1 138 GLU n 
1 139 HIS n 
1 140 LEU n 
1 141 ILE n 
1 142 ASP n 
1 143 VAL n 
1 144 LEU n 
1 145 ARG n 
1 146 ARG n 
1 147 GLU n 
1 148 LEU n 
1 149 ALA n 
1 150 LEU n 
1 151 GLU n 
1 152 CYS n 
1 153 ASP n 
1 154 TYR n 
1 155 GLN n 
1 156 ARG n 
1 157 GLU n 
1 158 ALA n 
1 159 ALA n 
1 160 CYS n 
1 161 ALA n 
1 162 ARG n 
1 163 LYS n 
1 164 PHE n 
1 165 ARG n 
1 166 ASP n 
1 167 LEU n 
1 168 LEU n 
1 169 LYS n 
1 170 GLY n 
1 171 HIS n 
1 172 PRO n 
1 173 PHE n 
1 174 PHE n 
1 175 TYR n 
1 176 VAL n 
1 177 PRO n 
1 178 GLU n 
1 179 ILE n 
1 180 VAL n 
1 181 ASP n 
1 182 GLU n 
1 183 LEU n 
1 184 CYS n 
1 185 SER n 
1 186 PRO n 
1 187 HIS n 
1 188 VAL n 
1 189 LEU n 
1 190 THR n 
1 191 THR n 
1 192 GLU n 
1 193 LEU n 
1 194 VAL n 
1 195 SER n 
1 196 GLY n 
1 197 PHE n 
1 198 PRO n 
1 199 LEU n 
1 200 ASP n 
1 201 GLN n 
1 202 ALA n 
1 203 GLU n 
1 204 GLY n 
1 205 LEU n 
1 206 SER n 
1 207 GLN n 
1 208 GLU n 
1 209 ILE n 
1 210 ARG n 
1 211 ASN n 
1 212 GLU n 
1 213 ILE n 
1 214 CYS n 
1 215 TYR n 
1 216 ASN n 
1 217 ILE n 
1 218 LEU n 
1 219 VAL n 
1 220 LEU n 
1 221 CYS n 
1 222 LEU n 
1 223 ARG n 
1 224 GLU n 
1 225 LEU n 
1 226 PHE n 
1 227 GLU n 
1 228 PHE n 
1 229 HIS n 
1 230 PHE n 
1 231 MSE n 
1 232 GLN n 
1 233 THR n 
1 234 ASP n 
1 235 PRO n 
1 236 ASN n 
1 237 TRP n 
1 238 SER n 
1 239 ASN n 
1 240 PHE n 
1 241 PHE n 
1 242 TYR n 
1 243 ASP n 
1 244 PRO n 
1 245 GLN n 
1 246 GLN n 
1 247 HIS n 
1 248 LYS n 
1 249 VAL n 
1 250 ALA n 
1 251 LEU n 
1 252 LEU n 
1 253 ASP n 
1 254 PHE n 
1 255 GLY n 
1 256 ALA n 
1 257 THR n 
1 258 ARG n 
1 259 GLU n 
1 260 TYR n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 PHE n 
1 265 THR n 
1 266 ASP n 
1 267 LEU n 
1 268 TYR n 
1 269 ILE n 
1 270 GLN n 
1 271 ILE n 
1 272 ILE n 
1 273 ARG n 
1 274 ALA n 
1 275 ALA n 
1 276 ALA n 
1 277 ASP n 
1 278 ARG n 
1 279 ASP n 
1 280 ARG n 
1 281 GLU n 
1 282 THR n 
1 283 VAL n 
1 284 ARG n 
1 285 ALA n 
1 286 LYS n 
1 287 SER n 
1 288 ILE n 
1 289 GLU n 
1 290 MSE n 
1 291 LYS n 
1 292 PHE n 
1 293 LEU n 
1 294 THR n 
1 295 GLY n 
1 296 TYR n 
1 297 GLU n 
1 298 VAL n 
1 299 LYS n 
1 300 VAL n 
1 301 MSE n 
1 302 GLU n 
1 303 ASP n 
1 304 ALA n 
1 305 HIS n 
1 306 LEU n 
1 307 ASP n 
1 308 ALA n 
1 309 ILE n 
1 310 LEU n 
1 311 ILE n 
1 312 LEU n 
1 313 GLY n 
1 314 GLU n 
1 315 ALA n 
1 316 PHE n 
1 317 ALA n 
1 318 SER n 
1 319 ASP n 
1 320 GLU n 
1 321 PRO n 
1 322 PHE n 
1 323 ASP n 
1 324 PHE n 
1 325 GLY n 
1 326 THR n 
1 327 GLN n 
1 328 SER n 
1 329 THR n 
1 330 THR n 
1 331 GLU n 
1 332 LYS n 
1 333 ILE n 
1 334 HIS n 
1 335 ASN n 
1 336 LEU n 
1 337 ILE n 
1 338 PRO n 
1 339 VAL n 
1 340 MSE n 
1 341 LEU n 
1 342 ARG n 
1 343 HIS n 
1 344 ARG n 
1 345 LEU n 
1 346 VAL n 
1 347 PRO n 
1 348 PRO n 
1 349 PRO n 
1 350 GLU n 
1 351 GLU n 
1 352 THR n 
1 353 TYR n 
1 354 SER n 
1 355 LEU n 
1 356 HIS n 
1 357 LYS n 
1 358 LYS n 
1 359 MSE n 
1 360 GLY n 
1 361 GLY n 
1 362 SER n 
1 363 PHE n 
1 364 LEU n 
1 365 ILE n 
1 366 CYS n 
1 367 SER n 
1 368 LYS n 
1 369 LEU n 
1 370 LYS n 
1 371 ALA n 
1 372 ARG n 
1 373 PHE n 
1 374 PRO n 
1 375 CYS n 
1 376 LYS n 
1 377 ALA n 
1 378 MSE n 
1 379 PHE n 
1 380 GLU n 
1 381 GLU n 
1 382 ALA n 
1 383 TYR n 
1 384 SER n 
1 385 ASN n 
1 386 TYR n 
1 387 CYS n 
1 388 LYS n 
1 389 ARG n 
1 390 GLN n 
1 391 ALA n 
1 392 GLN n 
1 393 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   393 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ADCK3, CABC1, PP265' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               B834 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVP68K 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADCK3_HUMAN 
_struct_ref.pdbx_db_accession          Q8NI60 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERVRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERP
FAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACA
RKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFF
YDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEP
FDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
;
_struct_ref.pdbx_align_begin           256 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5I35 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 393 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NI60 
_struct_ref_seq.db_align_beg                  256 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  647 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       256 
_struct_ref_seq.pdbx_auth_seq_align_end       647 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I35 SER A 1   ? UNP Q8NI60 ?   ?   'expression tag'      255 1 
1 5I35 LYS A 357 ? UNP Q8NI60 ARG 611 'engineered mutation' 611 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE                              ? 'C5 H11 N O2 Se'    196.106 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I35 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.44 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.61 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;One part of ADCK3 R611K, 0.2 mM, AMPPNP 2 mM, MgCl2, 4mM, mixed with an equal volume of sodium polyacrylate 5100, 26%; magnesium chloride, 20 mM; HEPES, 100 mM, pH 7.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96862 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.96862 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5I35 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19840 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.37 
_reflns.pdbx_Rmerge_I_obs                0.087 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.3 
_reflns_shell.d_res_low                   2.36 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.65 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.232 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.61 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I35 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18275 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.67 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.96 
_refine.ls_R_factor_obs                          0.18952 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18346 
_refine.ls_R_factor_R_free                       0.25887 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.8 
_refine.ls_number_reflns_R_free                  1556 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.B_iso_mean                               76.273 
_refine.aniso_B[1][1]                            0.82 
_refine.aniso_B[2][2]                            1.27 
_refine.aniso_B[3][3]                            -2.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.80 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.325 
_refine.pdbx_overall_ESU_R_Free                  0.255 
_refine.overall_SU_ML                            0.194 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             18.075 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3105 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             26 
_refine_hist.number_atoms_total               3162 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        44.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.019  ? 3207 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 3058 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.152  1.991  ? 4332 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.155  3.000  ? 7034 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       8.208  5.000  ? 383  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.669 23.648 ? 159  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.309 15.000 ? 526  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.846 15.000 ? 26   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.119  0.200  ? 466  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.021  ? 3586 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 761  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  4.601  6.586  ? 1535 'X-RAY DIFFRACTION' ? 
r_mcbond_other               4.598  6.585  ? 1534 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 6.628  9.861  ? 1917 'X-RAY DIFFRACTION' ? 
r_mcangle_other              6.628  9.863  ? 1918 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.345  7.104  ? 1672 'X-RAY DIFFRACTION' ? 
r_scbond_other               5.344  7.104  ? 1673 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              7.770  10.451 ? 2416 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       10.059 52.335 ? 3474 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         10.058 52.329 ? 3473 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             1324 
_refine_ls_shell.R_factor_R_work                  0.308 
_refine_ls_shell.percent_reflns_obs               99.79 
_refine_ls_shell.R_factor_R_free                  0.395 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             111 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5I35 
_struct.title                        
;Structure of the Human mitochondrial kinase COQ8A R611K with AMPPNP (Cerebellar Ataxia and Ubiquinone Deficiency Through Loss of Unorthodox Kinase Activity)
;
_struct.pdbx_descriptor              'Atypical kinase ADCK3, mitochondrial (E.C.2.7.-.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I35 
_struct_keywords.text            
;mitochondrial protein, kinase, ubiquinone biosynthesis, ubib clade kinase, Structural Genomics, PSI-2, Protein Structure Initiative, Mitochondrial Protein Partnership, MPP, TRANSFERASE, ADCK3, Coenzyme Q biosynthesis, ADCK3_HUMAN
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.details                      'Monomer confirmed by gel filtration' 
_struct_biol.id                           1 
_struct_biol.pdbx_parent_biol_id          ? 
_struct_biol.pdbx_formula_weight          ? 
_struct_biol.pdbx_formula_weight_method   ? 
_struct_biol.pdbx_aggregation_state       ? 
_struct_biol.pdbx_assembly_method         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ILE A 9   ? LYS A 15  ? ILE A 263 LYS A 269 1 ? 7  
HELX_P HELX_P2  AA2 VAL A 16  ? SER A 28  ? VAL A 270 SER A 282 1 ? 13 
HELX_P HELX_P3  AA3 ASN A 36  ? GLN A 48  ? ASN A 290 GLN A 302 1 ? 13 
HELX_P HELX_P4  AA4 PRO A 54  ? GLY A 67  ? PRO A 308 GLY A 321 1 ? 14 
HELX_P HELX_P5  AA5 ASN A 69  ? ASP A 72  ? ASN A 323 ASP A 326 5 ? 4  
HELX_P HELX_P6  AA6 VAL A 110 ? GLN A 112 ? VAL A 364 GLN A 366 5 ? 3  
HELX_P HELX_P7  AA7 SER A 113 ? SER A 128 ? SER A 367 SER A 382 1 ? 16 
HELX_P HELX_P8  AA8 PRO A 137 ? ASP A 153 ? PRO A 391 ASP A 407 1 ? 17 
HELX_P HELX_P9  AA9 ASP A 153 ? LEU A 168 ? ASP A 407 LEU A 422 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 180 ? CYS A 184 ? VAL A 434 CYS A 438 5 ? 5  
HELX_P HELX_P11 AB2 ASP A 200 ? ALA A 202 ? ASP A 454 ALA A 456 5 ? 3  
HELX_P HELX_P12 AB3 SER A 206 ? GLU A 227 ? SER A 460 GLU A 481 1 ? 22 
HELX_P HELX_P13 AB4 ASN A 236 ? SER A 238 ? ASN A 490 SER A 492 5 ? 3  
HELX_P HELX_P14 AB5 ASP A 253 ? GLY A 255 ? ASP A 507 GLY A 509 5 ? 3  
HELX_P HELX_P15 AB6 ASP A 261 ? ASP A 277 ? ASP A 515 ASP A 531 1 ? 17 
HELX_P HELX_P16 AB7 ASP A 279 ? MSE A 290 ? ASP A 533 MSE A 544 1 ? 12 
HELX_P HELX_P17 AB8 VAL A 298 ? SER A 318 ? VAL A 552 SER A 572 1 ? 21 
HELX_P HELX_P18 AB9 PHE A 324 ? SER A 328 ? PHE A 578 SER A 582 1 ? 5  
HELX_P HELX_P19 AC1 THR A 329 ? HIS A 334 ? THR A 583 HIS A 588 1 ? 6  
HELX_P HELX_P20 AC2 ASN A 335 ? ILE A 337 ? ASN A 589 ILE A 591 5 ? 3  
HELX_P HELX_P21 AC3 PRO A 349 ? LEU A 369 ? PRO A 603 LEU A 623 1 ? 21 
HELX_P HELX_P22 AC4 CYS A 375 ? ARG A 389 ? CYS A 629 ARG A 643 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A GLN 25  C ? ? ? 1_555 A MSE 26  N ? ? A GLN 279 A MSE 280 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2  covale both ? A MSE 26  C ? ? ? 1_555 A LEU 27  N ? ? A MSE 280 A LEU 281 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3  covale both ? A PHE 52  C ? ? ? 1_555 A MSE 53  N ? ? A PHE 306 A MSE 307 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4  covale both ? A MSE 53  C ? ? ? 1_555 A PRO 54  N ? ? A MSE 307 A PRO 308 1_555 ? ? ? ? ? ? ? 1.353 ? 
covale5  covale both ? A GLN 57  C ? ? ? 1_555 A MSE 58  N ? ? A GLN 311 A MSE 312 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale6  covale both ? A MSE 58  C ? ? ? 1_555 A MSE 59  N ? ? A MSE 312 A MSE 313 1_555 ? ? ? ? ? ? ? 1.345 ? 
covale7  covale both ? A MSE 59  C ? ? ? 1_555 A LYS 60  N ? ? A MSE 313 A LYS 314 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale8  covale both ? A ARG 94  C ? ? ? 1_555 A MSE 95  N ? ? A ARG 348 A MSE 349 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale9  covale both ? A MSE 95  C ? ? ? 1_555 A LYS 96  N ? ? A MSE 349 A LYS 350 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale10 covale both ? A ALA 102 C ? ? ? 1_555 A MSE 103 N ? ? A ALA 356 A MSE 357 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale11 covale both ? A MSE 103 C ? ? ? 1_555 A LYS 104 N ? ? A MSE 357 A LYS 358 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale12 covale both ? A LEU 121 C ? ? ? 1_555 A MSE 122 N ? ? A LEU 375 A MSE 376 1_555 ? ? ? ? ? ? ? 1.354 ? 
covale13 covale both ? A MSE 122 C ? ? ? 1_555 A ALA 123 N ? ? A MSE 376 A ALA 377 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale14 covale both ? A ASN 126 C ? ? ? 1_555 A MSE 127 N ? ? A ASN 380 A MSE 381 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale15 covale both ? A MSE 127 C ? ? ? 1_555 A SER 128 N ? ? A MSE 381 A SER 382 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale16 covale both ? A ASN 129 C ? ? ? 1_555 A MSE 130 N ? ? A ASN 383 A MSE 384 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale17 covale both ? A MSE 130 C ? ? ? 1_555 A LEU 131 N ? ? A MSE 384 A LEU 385 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale18 covale both ? A PHE 230 C ? ? ? 1_555 A MSE 231 N ? ? A PHE 484 A MSE 485 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale19 covale both ? A MSE 231 C ? ? ? 1_555 A GLN 232 N ? ? A MSE 485 A GLN 486 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale20 covale both ? A GLU 289 C ? ? ? 1_555 A MSE 290 N ? ? A GLU 543 A MSE 544 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale21 covale both ? A MSE 290 C ? ? ? 1_555 A LYS 291 N ? ? A MSE 544 A LYS 545 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale22 covale both ? A VAL 300 C ? ? ? 1_555 A MSE 301 N ? ? A VAL 554 A MSE 555 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale23 covale both ? A MSE 301 C ? ? ? 1_555 A GLU 302 N ? ? A MSE 555 A GLU 556 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale24 covale both ? A VAL 339 C ? ? ? 1_555 A MSE 340 N ? ? A VAL 593 A MSE 594 1_555 ? ? ? ? ? ? ? 1.346 ? 
covale25 covale both ? A MSE 340 C ? ? ? 1_555 A LEU 341 N ? ? A MSE 594 A LEU 595 1_555 ? ? ? ? ? ? ? 1.348 ? 
covale26 covale both ? A LYS 358 C ? ? ? 1_555 A MSE 359 N ? ? A LYS 612 A MSE 613 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale27 covale both ? A MSE 359 C ? ? ? 1_555 A GLY 360 N ? ? A MSE 613 A GLY 614 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale28 covale both ? A ALA 377 C ? ? ? 1_555 A MSE 378 N ? ? A ALA 631 A MSE 632 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale29 covale both ? A MSE 378 C ? ? ? 1_555 A PHE 379 N ? ? A MSE 632 A PHE 633 1_555 ? ? ? ? ? ? ? 1.336 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 74  ? PHE A 77  ? LEU A 328 PHE A 331 
AA1 2 GLY A 88  ? MSE A 95  ? GLY A 342 MSE A 349 
AA1 3 ALA A 83  ? ALA A 85  ? ALA A 337 ALA A 339 
AA2 1 LEU A 74  ? PHE A 77  ? LEU A 328 PHE A 331 
AA2 2 GLY A 88  ? MSE A 95  ? GLY A 342 MSE A 349 
AA2 3 GLU A 100 ? GLN A 106 ? GLU A 354 GLN A 360 
AA2 4 VAL A 188 ? GLU A 192 ? VAL A 442 GLU A 446 
AA3 1 PHE A 174 ? TYR A 175 ? PHE A 428 TYR A 429 
AA3 2 LYS A 248 ? LEU A 251 ? LYS A 502 LEU A 505 
AA3 3 PHE A 240 ? ASP A 243 ? PHE A 494 ASP A 497 
AA3 4 PHE A 197 ? PRO A 198 ? PHE A 451 PRO A 452 
AA4 1 MSE A 231 ? GLN A 232 ? MSE A 485 GLN A 486 
AA4 2 THR A 257 ? ARG A 258 ? THR A 511 ARG A 512 
AA5 1 PHE A 322 ? ASP A 323 ? PHE A 576 ASP A 577 
AA5 2 ARG A 372 ? PHE A 373 ? ARG A 626 PHE A 627 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 76  ? N TYR A 330 O ARG A 94  ? O ARG A 348 
AA1 2 3 O VAL A 90  ? O VAL A 344 N ALA A 83  ? N ALA A 337 
AA2 1 2 N TYR A 76  ? N TYR A 330 O ARG A 94  ? O ARG A 348 
AA2 2 3 N GLN A 89  ? N GLN A 343 O ILE A 105 ? O ILE A 359 
AA2 3 4 N LYS A 104 ? N LYS A 358 O LEU A 189 ? O LEU A 443 
AA3 1 2 N TYR A 175 ? N TYR A 429 O LEU A 251 ? O LEU A 505 
AA3 2 3 O ALA A 250 ? O ALA A 504 N PHE A 241 ? N PHE A 495 
AA3 3 4 O TYR A 242 ? O TYR A 496 N PHE A 197 ? N PHE A 451 
AA4 1 2 N MSE A 231 ? N MSE A 485 O ARG A 258 ? O ARG A 512 
AA5 1 2 N PHE A 322 ? N PHE A 576 O PHE A 373 ? O PHE A 627 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ANP 
_struct_site.pdbx_auth_seq_id     700 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'binding site for residue ANP A 700' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 PHE A 82  ? PHE A 336 . ? 1_555 ? 
2  AC1 12 ALA A 83  ? ALA A 337 . ? 1_555 ? 
3  AC1 12 ALA A 85  ? ALA A 339 . ? 1_555 ? 
4  AC1 12 SER A 86  ? SER A 340 . ? 1_555 ? 
5  AC1 12 VAL A 90  ? VAL A 344 . ? 1_555 ? 
6  AC1 12 LYS A 104 ? LYS A 358 . ? 1_555 ? 
7  AC1 12 THR A 191 ? THR A 445 . ? 1_555 ? 
8  AC1 12 GLU A 192 ? GLU A 446 . ? 1_555 ? 
9  AC1 12 VAL A 194 ? VAL A 448 . ? 1_555 ? 
10 AC1 12 ASN A 239 ? ASN A 493 . ? 1_555 ? 
11 AC1 12 PHE A 241 ? PHE A 495 . ? 1_555 ? 
12 AC1 12 ASP A 253 ? ASP A 507 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5I35 
_atom_sites.fract_transf_matrix[1][1]   0.006664 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000900 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016915 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019786 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 7   ? 65.399 46.485 41.723  1.00 115.85 ? 261 GLU A N     1 
ATOM   2    C  CA    . GLU A 1 7   ? 64.436 45.636 42.496  1.00 118.70 ? 261 GLU A CA    1 
ATOM   3    C  C     . GLU A 1 7   ? 63.887 44.435 41.688  1.00 113.08 ? 261 GLU A C     1 
ATOM   4    O  O     . GLU A 1 7   ? 63.407 44.562 40.558  1.00 95.18  ? 261 GLU A O     1 
ATOM   5    C  CB    . GLU A 1 7   ? 63.271 46.482 43.036  1.00 118.45 ? 261 GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 7   ? 62.377 45.757 44.047  1.00 115.89 ? 261 GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 7   ? 61.038 46.459 44.267  1.00 117.23 ? 261 GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 7   ? 60.644 47.310 43.455  1.00 110.15 ? 261 GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 7   ? 60.348 46.161 45.258  1.00 119.38 ? 261 GLU A OE2   1 
ATOM   10   N  N     . ARG A 1 8   ? 63.918 43.288 42.353  1.00 115.57 ? 262 ARG A N     1 
ATOM   11   C  CA    . ARG A 1 8   ? 63.668 41.995 41.779  1.00 106.51 ? 262 ARG A CA    1 
ATOM   12   C  C     . ARG A 1 8   ? 62.326 41.541 42.281  1.00 107.61 ? 262 ARG A C     1 
ATOM   13   O  O     . ARG A 1 8   ? 62.246 40.889 43.323  1.00 89.04  ? 262 ARG A O     1 
ATOM   14   C  CB    . ARG A 1 8   ? 64.736 41.043 42.265  1.00 110.94 ? 262 ARG A CB    1 
ATOM   15   C  CG    . ARG A 1 8   ? 66.157 41.510 41.953  1.00 113.89 ? 262 ARG A CG    1 
ATOM   16   C  CD    . ARG A 1 8   ? 66.447 41.523 40.454  1.00 115.99 ? 262 ARG A CD    1 
ATOM   17   N  NE    . ARG A 1 8   ? 67.575 40.658 40.119  1.00 116.37 ? 262 ARG A NE    1 
ATOM   18   C  CZ    . ARG A 1 8   ? 67.570 39.312 40.139  1.00 127.43 ? 262 ARG A CZ    1 
ATOM   19   N  NH1   . ARG A 1 8   ? 66.487 38.600 40.494  1.00 128.08 ? 262 ARG A NH1   1 
ATOM   20   N  NH2   . ARG A 1 8   ? 68.687 38.655 39.814  1.00 128.32 ? 262 ARG A NH2   1 
ATOM   21   N  N     . ILE A 1 9   ? 61.308 42.068 41.583  1.00 108.40 ? 263 ILE A N     1 
ATOM   22   C  CA    . ILE A 1 9   ? 59.908 41.568 41.397  1.00 93.28  ? 263 ILE A CA    1 
ATOM   23   C  C     . ILE A 1 9   ? 59.919 40.378 40.389  1.00 91.97  ? 263 ILE A C     1 
ATOM   24   O  O     . ILE A 1 9   ? 59.067 39.439 40.431  1.00 80.58  ? 263 ILE A O     1 
ATOM   25   C  CB    . ILE A 1 9   ? 59.050 42.758 40.811  1.00 94.46  ? 263 ILE A CB    1 
ATOM   26   C  CG1   . ILE A 1 9   ? 58.628 43.738 41.929  1.00 92.84  ? 263 ILE A CG1   1 
ATOM   27   C  CG2   . ILE A 1 9   ? 57.850 42.320 39.948  1.00 92.30  ? 263 ILE A CG2   1 
ATOM   28   C  CD1   . ILE A 1 9   ? 58.058 45.047 41.394  1.00 93.24  ? 263 ILE A CD1   1 
ATOM   29   N  N     . VAL A 1 10  ? 60.873 40.456 39.451  1.00 89.23  ? 264 VAL A N     1 
ATOM   30   C  CA    . VAL A 1 10  ? 61.135 39.396 38.465  1.00 87.77  ? 264 VAL A CA    1 
ATOM   31   C  C     . VAL A 1 10  ? 61.150 37.992 39.083  1.00 82.09  ? 264 VAL A C     1 
ATOM   32   O  O     . VAL A 1 10  ? 60.546 37.085 38.539  1.00 68.91  ? 264 VAL A O     1 
ATOM   33   C  CB    . VAL A 1 10  ? 62.471 39.608 37.702  1.00 94.58  ? 264 VAL A CB    1 
ATOM   34   C  CG1   . VAL A 1 10  ? 62.421 40.855 36.827  1.00 93.76  ? 264 VAL A CG1   1 
ATOM   35   C  CG2   . VAL A 1 10  ? 63.658 39.666 38.667  1.00 101.77 ? 264 VAL A CG2   1 
ATOM   36   N  N     . ARG A 1 11  ? 61.785 37.810 40.234  1.00 79.67  ? 265 ARG A N     1 
ATOM   37   C  CA    . ARG A 1 11  ? 61.883 36.459 40.770  1.00 90.55  ? 265 ARG A CA    1 
ATOM   38   C  C     . ARG A 1 11  ? 60.499 35.889 41.127  1.00 85.67  ? 265 ARG A C     1 
ATOM   39   O  O     . ARG A 1 11  ? 60.277 34.689 40.915  1.00 85.90  ? 265 ARG A O     1 
ATOM   40   C  CB    . ARG A 1 11  ? 62.949 36.298 41.904  1.00 95.35  ? 265 ARG A CB    1 
ATOM   41   C  CG    . ARG A 1 11  ? 64.289 35.657 41.422  1.00 103.43 ? 265 ARG A CG    1 
ATOM   42   C  CD    . ARG A 1 11  ? 65.202 35.153 42.551  1.00 112.89 ? 265 ARG A CD    1 
ATOM   43   N  NE    . ARG A 1 11  ? 64.427 34.406 43.566  1.00 123.07 ? 265 ARG A NE    1 
ATOM   44   C  CZ    . ARG A 1 11  ? 64.892 33.904 44.717  1.00 125.66 ? 265 ARG A CZ    1 
ATOM   45   N  NH1   . ARG A 1 11  ? 66.185 33.998 45.054  1.00 128.21 ? 265 ARG A NH1   1 
ATOM   46   N  NH2   . ARG A 1 11  ? 64.040 33.277 45.538  1.00 117.07 ? 265 ARG A NH2   1 
ATOM   47   N  N     . THR A 1 12  ? 59.566 36.731 41.591  1.00 79.94  ? 266 THR A N     1 
ATOM   48   C  CA    . THR A 1 12  ? 58.203 36.247 41.877  1.00 82.90  ? 266 THR A CA    1 
ATOM   49   C  C     . THR A 1 12  ? 57.336 36.014 40.608  1.00 72.93  ? 266 THR A C     1 
ATOM   50   O  O     . THR A 1 12  ? 56.621 35.066 40.530  1.00 70.89  ? 266 THR A O     1 
ATOM   51   C  CB    . THR A 1 12  ? 57.466 37.136 42.925  1.00 89.44  ? 266 THR A CB    1 
ATOM   52   O  OG1   . THR A 1 12  ? 57.414 38.513 42.490  1.00 93.75  ? 266 THR A OG1   1 
ATOM   53   C  CG2   . THR A 1 12  ? 58.162 37.026 44.285  1.00 82.83  ? 266 THR A CG2   1 
ATOM   54   N  N     . LEU A 1 13  ? 57.437 36.860 39.595  1.00 75.96  ? 267 LEU A N     1 
ATOM   55   C  CA    . LEU A 1 13  ? 56.694 36.623 38.352  1.00 69.11  ? 267 LEU A CA    1 
ATOM   56   C  C     . LEU A 1 13  ? 57.174 35.370 37.602  1.00 70.61  ? 267 LEU A C     1 
ATOM   57   O  O     . LEU A 1 13  ? 56.380 34.708 36.902  1.00 69.22  ? 267 LEU A O     1 
ATOM   58   C  CB    . LEU A 1 13  ? 56.737 37.854 37.446  1.00 68.01  ? 267 LEU A CB    1 
ATOM   59   C  CG    . LEU A 1 13  ? 56.150 39.170 37.966  1.00 69.30  ? 267 LEU A CG    1 
ATOM   60   C  CD1   . LEU A 1 13  ? 55.987 40.213 36.877  1.00 68.39  ? 267 LEU A CD1   1 
ATOM   61   C  CD2   . LEU A 1 13  ? 54.824 38.963 38.648  1.00 68.33  ? 267 LEU A CD2   1 
ATOM   62   N  N     . CYS A 1 14  ? 58.458 35.047 37.751  1.00 70.87  ? 268 CYS A N     1 
ATOM   63   C  CA    . CYS A 1 14  ? 59.039 33.796 37.226  1.00 74.99  ? 268 CYS A CA    1 
ATOM   64   C  C     . CYS A 1 14  ? 58.410 32.546 37.831  1.00 75.47  ? 268 CYS A C     1 
ATOM   65   O  O     . CYS A 1 14  ? 58.227 31.556 37.131  1.00 80.24  ? 268 CYS A O     1 
ATOM   66   C  CB    . CYS A 1 14  ? 60.562 33.804 37.368  1.00 74.36  ? 268 CYS A CB    1 
ATOM   67   S  SG    . CYS A 1 14  ? 61.270 34.932 36.124  1.00 85.24  ? 268 CYS A SG    1 
ATOM   68   N  N     . LYS A 1 15  ? 57.979 32.608 39.087  1.00 80.08  ? 269 LYS A N     1 
ATOM   69   C  CA    . LYS A 1 15  ? 57.133 31.517 39.642  1.00 81.87  ? 269 LYS A CA    1 
ATOM   70   C  C     . LYS A 1 15  ? 55.735 31.377 38.977  1.00 76.05  ? 269 LYS A C     1 
ATOM   71   O  O     . LYS A 1 15  ? 55.095 30.366 39.182  1.00 71.92  ? 269 LYS A O     1 
ATOM   72   C  CB    . LYS A 1 15  ? 56.981 31.635 41.190  1.00 85.91  ? 269 LYS A CB    1 
ATOM   73   C  CG    . LYS A 1 15  ? 58.261 31.321 41.989  1.00 90.52  ? 269 LYS A CG    1 
ATOM   74   C  CD    . LYS A 1 15  ? 58.052 31.590 43.473  1.00 93.98  ? 269 LYS A CD    1 
ATOM   75   C  CE    . LYS A 1 15  ? 59.233 32.294 44.132  1.00 101.32 ? 269 LYS A CE    1 
ATOM   76   N  NZ    . LYS A 1 15  ? 58.805 33.227 45.234  1.00 107.58 ? 269 LYS A NZ    1 
ATOM   77   N  N     . VAL A 1 16  ? 55.259 32.392 38.234  1.00 68.25  ? 270 VAL A N     1 
ATOM   78   C  CA    . VAL A 1 16  ? 53.968 32.324 37.515  1.00 66.07  ? 270 VAL A CA    1 
ATOM   79   C  C     . VAL A 1 16  ? 54.152 32.821 36.073  1.00 64.22  ? 270 VAL A C     1 
ATOM   80   O  O     . VAL A 1 16  ? 53.344 33.590 35.511  1.00 63.34  ? 270 VAL A O     1 
ATOM   81   C  CB    . VAL A 1 16  ? 52.810 33.116 38.242  1.00 67.27  ? 270 VAL A CB    1 
ATOM   82   C  CG1   . VAL A 1 16  ? 52.355 32.436 39.530  1.00 66.68  ? 270 VAL A CG1   1 
ATOM   83   C  CG2   . VAL A 1 16  ? 53.172 34.570 38.514  1.00 60.64  ? 270 VAL A CG2   1 
ATOM   84   N  N     . ARG A 1 17  ? 55.203 32.309 35.458  1.00 63.82  ? 271 ARG A N     1 
ATOM   85   C  CA    . ARG A 1 17  ? 55.702 32.806 34.188  1.00 67.11  ? 271 ARG A CA    1 
ATOM   86   C  C     . ARG A 1 17  ? 54.656 32.755 33.108  1.00 66.04  ? 271 ARG A C     1 
ATOM   87   O  O     . ARG A 1 17  ? 54.546 33.687 32.354  1.00 58.79  ? 271 ARG A O     1 
ATOM   88   C  CB    . ARG A 1 17  ? 56.901 31.983 33.753  1.00 68.46  ? 271 ARG A CB    1 
ATOM   89   C  CG    . ARG A 1 17  ? 57.679 32.580 32.609  1.00 67.14  ? 271 ARG A CG    1 
ATOM   90   C  CD    . ARG A 1 17  ? 59.208 32.259 32.667  1.00 67.74  ? 271 ARG A CD    1 
ATOM   91   N  NE    . ARG A 1 17  ? 59.772 32.623 31.366  1.00 68.06  ? 271 ARG A NE    1 
ATOM   92   C  CZ    . ARG A 1 17  ? 59.546 31.933 30.252  1.00 66.22  ? 271 ARG A CZ    1 
ATOM   93   N  NH1   . ARG A 1 17  ? 58.836 30.806 30.260  1.00 68.46  ? 271 ARG A NH1   1 
ATOM   94   N  NH2   . ARG A 1 17  ? 60.029 32.365 29.120  1.00 73.27  ? 271 ARG A NH2   1 
ATOM   95   N  N     . GLY A 1 18  ? 53.854 31.693 33.089  1.00 59.84  ? 272 GLY A N     1 
ATOM   96   C  CA    . GLY A 1 18  ? 52.801 31.541 32.082  1.00 58.73  ? 272 GLY A CA    1 
ATOM   97   C  C     . GLY A 1 18  ? 51.744 32.614 32.201  1.00 54.35  ? 272 GLY A C     1 
ATOM   98   O  O     . GLY A 1 18  ? 51.477 33.282 31.247  1.00 55.99  ? 272 GLY A O     1 
ATOM   99   N  N     . ALA A 1 19  ? 51.172 32.827 33.381  1.00 53.93  ? 273 ALA A N     1 
ATOM   100  C  CA    . ALA A 1 19  ? 50.180 33.904 33.555  1.00 49.28  ? 273 ALA A CA    1 
ATOM   101  C  C     . ALA A 1 19  ? 50.824 35.246 33.298  1.00 53.02  ? 273 ALA A C     1 
ATOM   102  O  O     . ALA A 1 19  ? 50.226 36.101 32.623  1.00 58.85  ? 273 ALA A O     1 
ATOM   103  C  CB    . ALA A 1 19  ? 49.559 33.858 34.940  1.00 50.18  ? 273 ALA A CB    1 
ATOM   104  N  N     . ALA A 1 20  ? 52.069 35.441 33.727  1.00 55.61  ? 274 ALA A N     1 
ATOM   105  C  CA    . ALA A 1 20  ? 52.745 36.766 33.450  1.00 57.46  ? 274 ALA A CA    1 
ATOM   106  C  C     . ALA A 1 20  ? 52.943 37.108 31.977  1.00 57.23  ? 274 ALA A C     1 
ATOM   107  O  O     . ALA A 1 20  ? 52.669 38.211 31.496  1.00 57.53  ? 274 ALA A O     1 
ATOM   108  C  CB    . ALA A 1 20  ? 54.058 36.830 34.161  1.00 54.28  ? 274 ALA A CB    1 
ATOM   109  N  N     . LEU A 1 21  ? 53.441 36.147 31.246  1.00 61.03  ? 275 LEU A N     1 
ATOM   110  C  CA    . LEU A 1 21  ? 53.658 36.327 29.838  1.00 60.10  ? 275 LEU A CA    1 
ATOM   111  C  C     . LEU A 1 21  ? 52.370 36.467 29.115  1.00 61.22  ? 275 LEU A C     1 
ATOM   112  O  O     . LEU A 1 21  ? 52.272 37.309 28.184  1.00 59.07  ? 275 LEU A O     1 
ATOM   113  C  CB    . LEU A 1 21  ? 54.409 35.156 29.243  1.00 63.11  ? 275 LEU A CB    1 
ATOM   114  C  CG    . LEU A 1 21  ? 55.818 34.963 29.768  1.00 70.24  ? 275 LEU A CG    1 
ATOM   115  C  CD1   . LEU A 1 21  ? 56.419 33.791 29.017  1.00 73.84  ? 275 LEU A CD1   1 
ATOM   116  C  CD2   . LEU A 1 21  ? 56.625 36.247 29.670  1.00 77.08  ? 275 LEU A CD2   1 
ATOM   117  N  N     . LYS A 1 22  ? 51.364 35.678 29.506  1.00 57.68  ? 276 LYS A N     1 
ATOM   118  C  CA    . LYS A 1 22  ? 50.077 35.812 28.797  1.00 58.74  ? 276 LYS A CA    1 
ATOM   119  C  C     . LYS A 1 22  ? 49.473 37.207 29.080  1.00 59.99  ? 276 LYS A C     1 
ATOM   120  O  O     . LYS A 1 22  ? 49.004 37.857 28.156  1.00 52.35  ? 276 LYS A O     1 
ATOM   121  C  CB    . LYS A 1 22  ? 49.068 34.714 29.176  1.00 60.17  ? 276 LYS A CB    1 
ATOM   122  C  CG    . LYS A 1 22  ? 47.762 34.848 28.369  1.00 65.69  ? 276 LYS A CG    1 
ATOM   123  C  CD    . LYS A 1 22  ? 47.977 34.723 26.856  1.00 62.55  ? 276 LYS A CD    1 
ATOM   124  C  CE    . LYS A 1 22  ? 48.497 33.283 26.610  1.00 66.10  ? 276 LYS A CE    1 
ATOM   125  N  NZ    . LYS A 1 22  ? 48.682 32.858 25.193  1.00 80.11  ? 276 LYS A NZ    1 
ATOM   126  N  N     . LEU A 1 23  ? 49.495 37.671 30.342  1.00 58.34  ? 277 LEU A N     1 
ATOM   127  C  CA    . LEU A 1 23  ? 49.147 39.106 30.608  1.00 57.77  ? 277 LEU A CA    1 
ATOM   128  C  C     . LEU A 1 23  ? 49.932 40.127 29.746  1.00 60.99  ? 277 LEU A C     1 
ATOM   129  O  O     . LEU A 1 23  ? 49.316 41.074 29.198  1.00 57.83  ? 277 LEU A O     1 
ATOM   130  C  CB    . LEU A 1 23  ? 49.315 39.498 32.066  1.00 58.73  ? 277 LEU A CB    1 
ATOM   131  C  CG    . LEU A 1 23  ? 48.735 40.892 32.428  1.00 67.34  ? 277 LEU A CG    1 
ATOM   132  C  CD1   . LEU A 1 23  ? 47.231 41.004 32.142  1.00 65.42  ? 277 LEU A CD1   1 
ATOM   133  C  CD2   . LEU A 1 23  ? 48.965 41.100 33.925  1.00 66.16  ? 277 LEU A CD2   1 
ATOM   134  N  N     . GLY A 1 24  ? 51.252 39.920 29.617  1.00 61.13  ? 278 GLY A N     1 
ATOM   135  C  CA    . GLY A 1 24  ? 52.141 40.792 28.810  1.00 60.07  ? 278 GLY A CA    1 
ATOM   136  C  C     . GLY A 1 24  ? 51.686 40.863 27.359  1.00 65.47  ? 278 GLY A C     1 
ATOM   137  O  O     . GLY A 1 24  ? 51.651 41.933 26.781  1.00 76.66  ? 278 GLY A O     1 
ATOM   138  N  N     . GLN A 1 25  ? 51.321 39.739 26.739  1.00 70.27  ? 279 GLN A N     1 
ATOM   139  C  CA    . GLN A 1 25  ? 50.777 39.788 25.352  1.00 73.64  ? 279 GLN A CA    1 
ATOM   140  C  C     . GLN A 1 25  ? 49.452 40.544 25.309  1.00 74.63  ? 279 GLN A C     1 
ATOM   141  O  O     . GLN A 1 25  ? 49.221 41.367 24.419  1.00 79.42  ? 279 GLN A O     1 
ATOM   142  C  CB    . GLN A 1 25  ? 50.491 38.425 24.756  1.00 72.15  ? 279 GLN A CB    1 
ATOM   143  C  CG    . GLN A 1 25  ? 51.681 37.545 24.456  1.00 78.23  ? 279 GLN A CG    1 
ATOM   144  C  CD    . GLN A 1 25  ? 51.195 36.190 23.967  1.00 84.99  ? 279 GLN A CD    1 
ATOM   145  O  OE1   . GLN A 1 25  ? 50.519 35.446 24.705  1.00 80.40  ? 279 GLN A OE1   1 
ATOM   146  N  NE2   . GLN A 1 25  ? 51.508 35.864 22.719  1.00 90.49  ? 279 GLN A NE2   1 
HETATM 147  N  N     . MSE A 1 26  ? 48.568 40.261 26.254  1.00 67.45  ? 280 MSE A N     1 
HETATM 148  C  CA    . MSE A 1 26  ? 47.267 40.921 26.221  1.00 72.71  ? 280 MSE A CA    1 
HETATM 149  C  C     . MSE A 1 26  ? 47.358 42.449 26.325  1.00 72.25  ? 280 MSE A C     1 
HETATM 150  O  O     . MSE A 1 26  ? 46.499 43.153 25.801  1.00 64.96  ? 280 MSE A O     1 
HETATM 151  C  CB    . MSE A 1 26  ? 46.371 40.398 27.348  1.00 67.17  ? 280 MSE A CB    1 
HETATM 152  C  CG    . MSE A 1 26  ? 45.826 39.002 27.069  1.00 70.86  ? 280 MSE A CG    1 
HETATM 153  SE SE    . MSE A 1 26  ? 44.994 38.363 28.754  1.00 79.21  ? 280 MSE A SE    1 
HETATM 154  C  CE    . MSE A 1 26  ? 43.435 39.564 28.777  1.00 83.08  ? 280 MSE A CE    1 
ATOM   155  N  N     . LEU A 1 27  ? 48.348 42.958 27.053  1.00 81.61  ? 281 LEU A N     1 
ATOM   156  C  CA    . LEU A 1 27  ? 48.432 44.383 27.340  1.00 91.58  ? 281 LEU A CA    1 
ATOM   157  C  C     . LEU A 1 27  ? 49.317 45.165 26.397  1.00 109.58 ? 281 LEU A C     1 
ATOM   158  O  O     . LEU A 1 27  ? 49.077 46.365 26.216  1.00 127.55 ? 281 LEU A O     1 
ATOM   159  C  CB    . LEU A 1 27  ? 48.918 44.626 28.769  1.00 86.54  ? 281 LEU A CB    1 
ATOM   160  C  CG    . LEU A 1 27  ? 47.889 44.279 29.827  1.00 87.87  ? 281 LEU A CG    1 
ATOM   161  C  CD1   . LEU A 1 27  ? 48.358 44.742 31.201  1.00 86.89  ? 281 LEU A CD1   1 
ATOM   162  C  CD2   . LEU A 1 27  ? 46.515 44.865 29.502  1.00 90.02  ? 281 LEU A CD2   1 
ATOM   163  N  N     . SER A 1 28  ? 50.318 44.530 25.787  1.00 115.04 ? 282 SER A N     1 
ATOM   164  C  CA    . SER A 1 28  ? 51.454 45.294 25.223  1.00 130.58 ? 282 SER A CA    1 
ATOM   165  C  C     . SER A 1 28  ? 52.296 45.990 26.362  1.00 137.05 ? 282 SER A C     1 
ATOM   166  O  O     . SER A 1 28  ? 52.365 47.238 26.493  1.00 136.43 ? 282 SER A O     1 
ATOM   167  C  CB    . SER A 1 28  ? 51.005 46.303 24.120  1.00 125.74 ? 282 SER A CB    1 
ATOM   168  O  OG    . SER A 1 28  ? 49.834 45.881 23.429  1.00 116.07 ? 282 SER A OG    1 
ATOM   169  N  N     . ILE A 1 29  ? 52.882 45.151 27.217  1.00 134.12 ? 283 ILE A N     1 
ATOM   170  C  CA    . ILE A 1 29  ? 54.151 45.462 27.835  1.00 134.56 ? 283 ILE A CA    1 
ATOM   171  C  C     . ILE A 1 29  ? 55.023 45.049 26.659  1.00 137.04 ? 283 ILE A C     1 
ATOM   172  O  O     . ILE A 1 29  ? 55.344 43.880 26.479  1.00 135.22 ? 283 ILE A O     1 
ATOM   173  C  CB    . ILE A 1 29  ? 54.402 44.626 29.080  1.00 133.65 ? 283 ILE A CB    1 
ATOM   174  N  N     . GLN A 1 30  ? 55.249 46.022 25.785  1.00 149.80 ? 284 GLN A N     1 
ATOM   175  C  CA    . GLN A 1 30  ? 55.889 45.855 24.471  1.00 153.05 ? 284 GLN A CA    1 
ATOM   176  C  C     . GLN A 1 30  ? 56.716 47.115 24.229  1.00 154.26 ? 284 GLN A C     1 
ATOM   177  O  O     . GLN A 1 30  ? 56.726 47.647 23.120  1.00 137.14 ? 284 GLN A O     1 
ATOM   178  C  CB    . GLN A 1 30  ? 54.818 45.747 23.351  1.00 156.17 ? 284 GLN A CB    1 
ATOM   179  C  CG    . GLN A 1 30  ? 54.393 44.341 22.916  1.00 147.08 ? 284 GLN A CG    1 
ATOM   180  C  CD    . GLN A 1 30  ? 54.585 44.093 21.422  1.00 140.86 ? 284 GLN A CD    1 
ATOM   181  O  OE1   . GLN A 1 30  ? 54.783 45.017 20.632  1.00 124.54 ? 284 GLN A OE1   1 
ATOM   182  N  NE2   . GLN A 1 30  ? 54.549 42.830 21.036  1.00 139.71 ? 284 GLN A NE2   1 
ATOM   183  N  N     . ASP A 1 31  ? 57.372 47.594 25.296  1.00 177.85 ? 285 ASP A N     1 
ATOM   184  C  CA    . ASP A 1 31  ? 58.037 48.925 25.375  1.00 183.61 ? 285 ASP A CA    1 
ATOM   185  C  C     . ASP A 1 31  ? 57.189 50.169 24.985  1.00 189.63 ? 285 ASP A C     1 
ATOM   186  O  O     . ASP A 1 31  ? 57.758 51.260 24.831  1.00 191.09 ? 285 ASP A O     1 
ATOM   187  C  CB    . ASP A 1 31  ? 59.373 48.919 24.577  1.00 174.12 ? 285 ASP A CB    1 
ATOM   188  C  CG    . ASP A 1 31  ? 60.505 48.179 25.296  1.00 159.93 ? 285 ASP A CG    1 
ATOM   189  O  OD1   . ASP A 1 31  ? 60.440 48.004 26.538  1.00 147.87 ? 285 ASP A OD1   1 
ATOM   190  O  OD2   . ASP A 1 31  ? 61.468 47.786 24.598  1.00 138.57 ? 285 ASP A OD2   1 
ATOM   191  N  N     . ASP A 1 32  ? 55.857 50.034 24.875  1.00 190.10 ? 286 ASP A N     1 
ATOM   192  C  CA    . ASP A 1 32  ? 55.035 51.075 24.216  1.00 189.54 ? 286 ASP A CA    1 
ATOM   193  C  C     . ASP A 1 32  ? 54.978 52.415 24.993  1.00 196.13 ? 286 ASP A C     1 
ATOM   194  O  O     . ASP A 1 32  ? 55.090 52.444 26.226  1.00 195.89 ? 286 ASP A O     1 
ATOM   195  C  CB    . ASP A 1 32  ? 53.640 50.545 23.749  1.00 181.11 ? 286 ASP A CB    1 
ATOM   196  C  CG    . ASP A 1 32  ? 52.663 50.188 24.900  1.00 173.66 ? 286 ASP A CG    1 
ATOM   197  O  OD1   . ASP A 1 32  ? 52.849 50.565 26.075  1.00 165.20 ? 286 ASP A OD1   1 
ATOM   198  O  OD2   . ASP A 1 32  ? 51.649 49.528 24.597  1.00 163.76 ? 286 ASP A OD2   1 
ATOM   199  N  N     . ALA A 1 33  ? 54.841 53.516 24.247  1.00 196.49 ? 287 ALA A N     1 
ATOM   200  C  CA    . ALA A 1 33  ? 55.021 54.881 24.777  1.00 188.78 ? 287 ALA A CA    1 
ATOM   201  C  C     . ALA A 1 33  ? 53.850 55.372 25.674  1.00 193.67 ? 287 ALA A C     1 
ATOM   202  O  O     . ALA A 1 33  ? 53.116 56.291 25.303  1.00 205.53 ? 287 ALA A O     1 
ATOM   203  C  CB    . ALA A 1 33  ? 55.285 55.855 23.618  1.00 171.65 ? 287 ALA A CB    1 
ATOM   204  N  N     . PHE A 1 34  ? 53.704 54.758 26.854  1.00 190.76 ? 288 PHE A N     1 
ATOM   205  C  CA    . PHE A 1 34  ? 52.670 55.113 27.866  1.00 193.22 ? 288 PHE A CA    1 
ATOM   206  C  C     . PHE A 1 34  ? 52.939 54.322 29.155  1.00 195.28 ? 288 PHE A C     1 
ATOM   207  O  O     . PHE A 1 34  ? 53.328 54.914 30.165  1.00 191.84 ? 288 PHE A O     1 
ATOM   208  C  CB    . PHE A 1 34  ? 51.210 54.880 27.361  1.00 194.06 ? 288 PHE A CB    1 
ATOM   209  C  CG    . PHE A 1 34  ? 50.161 54.752 28.477  1.00 190.57 ? 288 PHE A CG    1 
ATOM   210  C  CD1   . PHE A 1 34  ? 49.757 55.867 29.231  1.00 183.74 ? 288 PHE A CD1   1 
ATOM   211  C  CD2   . PHE A 1 34  ? 49.570 53.509 28.772  1.00 182.68 ? 288 PHE A CD2   1 
ATOM   212  C  CE1   . PHE A 1 34  ? 48.806 55.739 30.251  1.00 171.40 ? 288 PHE A CE1   1 
ATOM   213  C  CE2   . PHE A 1 34  ? 48.621 53.382 29.790  1.00 174.44 ? 288 PHE A CE2   1 
ATOM   214  C  CZ    . PHE A 1 34  ? 48.239 54.497 30.528  1.00 168.75 ? 288 PHE A CZ    1 
ATOM   215  N  N     . ILE A 1 35  ? 52.742 52.993 29.094  1.00 194.52 ? 289 ILE A N     1 
ATOM   216  C  CA    . ILE A 1 35  ? 52.944 52.058 30.231  1.00 175.99 ? 289 ILE A CA    1 
ATOM   217  C  C     . ILE A 1 35  ? 54.345 52.280 30.818  1.00 167.59 ? 289 ILE A C     1 
ATOM   218  O  O     . ILE A 1 35  ? 55.301 52.584 30.087  1.00 169.47 ? 289 ILE A O     1 
ATOM   219  C  CB    . ILE A 1 35  ? 52.694 50.559 29.806  1.00 170.22 ? 289 ILE A CB    1 
ATOM   220  C  CG1   . ILE A 1 35  ? 51.189 50.264 29.632  1.00 164.91 ? 289 ILE A CG1   1 
ATOM   221  C  CG2   . ILE A 1 35  ? 53.313 49.539 30.767  1.00 167.47 ? 289 ILE A CG2   1 
ATOM   222  C  CD1   . ILE A 1 35  ? 50.350 50.287 30.901  1.00 159.59 ? 289 ILE A CD1   1 
ATOM   223  N  N     . ASN A 1 36  ? 54.443 52.158 32.138  1.00 149.77 ? 290 ASN A N     1 
ATOM   224  C  CA    . ASN A 1 36  ? 55.673 52.457 32.862  1.00 148.83 ? 290 ASN A CA    1 
ATOM   225  C  C     . ASN A 1 36  ? 56.865 51.643 32.304  1.00 145.71 ? 290 ASN A C     1 
ATOM   226  O  O     . ASN A 1 36  ? 56.804 50.418 32.355  1.00 148.60 ? 290 ASN A O     1 
ATOM   227  C  CB    . ASN A 1 36  ? 55.432 52.159 34.350  1.00 142.12 ? 290 ASN A CB    1 
ATOM   228  C  CG    . ASN A 1 36  ? 56.583 52.585 35.243  1.00 142.87 ? 290 ASN A CG    1 
ATOM   229  O  OD1   . ASN A 1 36  ? 57.534 53.269 34.817  1.00 134.40 ? 290 ASN A OD1   1 
ATOM   230  N  ND2   . ASN A 1 36  ? 56.503 52.177 36.507  1.00 137.17 ? 290 ASN A ND2   1 
ATOM   231  N  N     . PRO A 1 37  ? 57.924 52.309 31.743  1.00 144.32 ? 291 PRO A N     1 
ATOM   232  C  CA    . PRO A 1 37  ? 59.114 51.546 31.268  1.00 145.12 ? 291 PRO A CA    1 
ATOM   233  C  C     . PRO A 1 37  ? 59.895 50.752 32.347  1.00 148.48 ? 291 PRO A C     1 
ATOM   234  O  O     . PRO A 1 37  ? 60.729 49.904 31.979  1.00 142.42 ? 291 PRO A O     1 
ATOM   235  C  CB    . PRO A 1 37  ? 60.013 52.623 30.620  1.00 138.05 ? 291 PRO A CB    1 
ATOM   236  C  CG    . PRO A 1 37  ? 59.086 53.732 30.286  1.00 139.16 ? 291 PRO A CG    1 
ATOM   237  C  CD    . PRO A 1 37  ? 58.036 53.733 31.370  1.00 140.01 ? 291 PRO A CD    1 
ATOM   238  N  N     . HIS A 1 38  ? 59.653 51.039 33.638  1.00 146.03 ? 292 HIS A N     1 
ATOM   239  C  CA    . HIS A 1 38  ? 60.079 50.152 34.751  1.00 149.36 ? 292 HIS A CA    1 
ATOM   240  C  C     . HIS A 1 38  ? 59.452 48.746 34.567  1.00 144.88 ? 292 HIS A C     1 
ATOM   241  O  O     . HIS A 1 38  ? 60.139 47.725 34.689  1.00 136.36 ? 292 HIS A O     1 
ATOM   242  C  CB    . HIS A 1 38  ? 59.658 50.705 36.156  1.00 150.95 ? 292 HIS A CB    1 
ATOM   243  C  CG    . HIS A 1 38  ? 60.770 51.290 36.996  1.00 149.13 ? 292 HIS A CG    1 
ATOM   244  N  ND1   . HIS A 1 38  ? 60.513 52.105 38.084  1.00 149.26 ? 292 HIS A ND1   1 
ATOM   245  C  CD2   . HIS A 1 38  ? 62.119 51.170 36.935  1.00 144.07 ? 292 HIS A CD2   1 
ATOM   246  C  CE1   . HIS A 1 38  ? 61.652 52.466 38.648  1.00 143.04 ? 292 HIS A CE1   1 
ATOM   247  N  NE2   . HIS A 1 38  ? 62.641 51.919 37.966  1.00 145.14 ? 292 HIS A NE2   1 
ATOM   248  N  N     . LEU A 1 39  ? 58.146 48.718 34.277  1.00 138.93 ? 293 LEU A N     1 
ATOM   249  C  CA    . LEU A 1 39  ? 57.356 47.471 34.234  1.00 132.96 ? 293 LEU A CA    1 
ATOM   250  C  C     . LEU A 1 39  ? 57.669 46.608 33.007  1.00 122.82 ? 293 LEU A C     1 
ATOM   251  O  O     . LEU A 1 39  ? 58.003 45.409 33.138  1.00 107.63 ? 293 LEU A O     1 
ATOM   252  C  CB    . LEU A 1 39  ? 55.858 47.793 34.276  1.00 136.15 ? 293 LEU A CB    1 
ATOM   253  C  CG    . LEU A 1 39  ? 54.890 46.605 34.373  1.00 142.78 ? 293 LEU A CG    1 
ATOM   254  C  CD1   . LEU A 1 39  ? 54.833 46.063 35.795  1.00 139.09 ? 293 LEU A CD1   1 
ATOM   255  C  CD2   . LEU A 1 39  ? 53.501 46.997 33.863  1.00 143.31 ? 293 LEU A CD2   1 
ATOM   256  N  N     . ALA A 1 40  ? 57.556 47.214 31.825  1.00 108.80 ? 294 ALA A N     1 
ATOM   257  C  CA    . ALA A 1 40  ? 57.930 46.533 30.591  1.00 105.62 ? 294 ALA A CA    1 
ATOM   258  C  C     . ALA A 1 40  ? 59.343 45.979 30.683  1.00 103.11 ? 294 ALA A C     1 
ATOM   259  O  O     . ALA A 1 40  ? 59.629 44.916 30.134  1.00 101.81 ? 294 ALA A O     1 
ATOM   260  C  CB    . ALA A 1 40  ? 57.802 47.455 29.409  1.00 104.84 ? 294 ALA A CB    1 
ATOM   261  N  N     . LYS A 1 41  ? 60.229 46.680 31.383  1.00 103.10 ? 295 LYS A N     1 
ATOM   262  C  CA    . LYS A 1 41  ? 61.565 46.140 31.621  1.00 109.55 ? 295 LYS A CA    1 
ATOM   263  C  C     . LYS A 1 41  ? 61.428 44.768 32.303  1.00 100.28 ? 295 LYS A C     1 
ATOM   264  O  O     . LYS A 1 41  ? 61.856 43.727 31.774  1.00 90.56  ? 295 LYS A O     1 
ATOM   265  C  CB    . LYS A 1 41  ? 62.418 47.102 32.474  1.00 119.51 ? 295 LYS A CB    1 
ATOM   266  C  CG    . LYS A 1 41  ? 63.592 46.426 33.180  1.00 129.29 ? 295 LYS A CG    1 
ATOM   267  C  CD    . LYS A 1 41  ? 64.656 47.403 33.623  1.00 132.83 ? 295 LYS A CD    1 
ATOM   268  C  CE    . LYS A 1 41  ? 65.847 46.654 34.192  1.00 135.63 ? 295 LYS A CE    1 
ATOM   269  N  NZ    . LYS A 1 41  ? 67.100 47.135 33.550  1.00 137.83 ? 295 LYS A NZ    1 
ATOM   270  N  N     . ILE A 1 42  ? 60.805 44.811 33.474  1.00 90.96  ? 296 ILE A N     1 
ATOM   271  C  CA    . ILE A 1 42  ? 60.549 43.639 34.306  1.00 86.96  ? 296 ILE A CA    1 
ATOM   272  C  C     . ILE A 1 42  ? 59.947 42.460 33.541  1.00 79.93  ? 296 ILE A C     1 
ATOM   273  O  O     . ILE A 1 42  ? 60.354 41.326 33.753  1.00 75.82  ? 296 ILE A O     1 
ATOM   274  C  CB    . ILE A 1 42  ? 59.653 44.030 35.516  1.00 87.78  ? 296 ILE A CB    1 
ATOM   275  C  CG1   . ILE A 1 42  ? 60.525 44.736 36.586  1.00 90.95  ? 296 ILE A CG1   1 
ATOM   276  C  CG2   . ILE A 1 42  ? 58.938 42.814 36.120  1.00 84.54  ? 296 ILE A CG2   1 
ATOM   277  C  CD1   . ILE A 1 42  ? 59.755 45.566 37.592  1.00 94.14  ? 296 ILE A CD1   1 
ATOM   278  N  N     . PHE A 1 43  ? 58.978 42.752 32.684  1.00 78.07  ? 297 PHE A N     1 
ATOM   279  C  CA    . PHE A 1 43  ? 58.314 41.760 31.890  1.00 78.06  ? 297 PHE A CA    1 
ATOM   280  C  C     . PHE A 1 43  ? 59.258 41.155 30.852  1.00 81.43  ? 297 PHE A C     1 
ATOM   281  O  O     . PHE A 1 43  ? 59.298 39.930 30.694  1.00 77.55  ? 297 PHE A O     1 
ATOM   282  C  CB    . PHE A 1 43  ? 57.022 42.324 31.286  1.00 76.52  ? 297 PHE A CB    1 
ATOM   283  C  CG    . PHE A 1 43  ? 55.811 42.038 32.136  1.00 80.18  ? 297 PHE A CG    1 
ATOM   284  C  CD1   . PHE A 1 43  ? 55.494 42.848 33.220  1.00 80.63  ? 297 PHE A CD1   1 
ATOM   285  C  CD2   . PHE A 1 43  ? 55.021 40.917 31.904  1.00 84.88  ? 297 PHE A CD2   1 
ATOM   286  C  CE1   . PHE A 1 43  ? 54.419 42.566 34.037  1.00 78.57  ? 297 PHE A CE1   1 
ATOM   287  C  CE2   . PHE A 1 43  ? 53.927 40.660 32.705  1.00 80.45  ? 297 PHE A CE2   1 
ATOM   288  C  CZ    . PHE A 1 43  ? 53.636 41.464 33.778  1.00 77.62  ? 297 PHE A CZ    1 
ATOM   289  N  N     . GLU A 1 44  ? 60.063 41.979 30.185  1.00 92.57  ? 298 GLU A N     1 
ATOM   290  C  CA    . GLU A 1 44  ? 61.112 41.429 29.289  1.00 94.67  ? 298 GLU A CA    1 
ATOM   291  C  C     . GLU A 1 44  ? 62.062 40.494 30.037  1.00 83.86  ? 298 GLU A C     1 
ATOM   292  O  O     . GLU A 1 44  ? 62.429 39.412 29.572  1.00 76.06  ? 298 GLU A O     1 
ATOM   293  C  CB    . GLU A 1 44  ? 61.974 42.529 28.690  1.00 106.64 ? 298 GLU A CB    1 
ATOM   294  C  CG    . GLU A 1 44  ? 61.319 43.408 27.652  1.00 117.73 ? 298 GLU A CG    1 
ATOM   295  C  CD    . GLU A 1 44  ? 62.104 44.702 27.482  1.00 128.88 ? 298 GLU A CD    1 
ATOM   296  O  OE1   . GLU A 1 44  ? 63.363 44.669 27.619  1.00 127.57 ? 298 GLU A OE1   1 
ATOM   297  O  OE2   . GLU A 1 44  ? 61.456 45.748 27.240  1.00 128.26 ? 298 GLU A OE2   1 
ATOM   298  N  N     . ARG A 1 45  ? 62.496 40.933 31.200  1.00 80.53  ? 299 ARG A N     1 
ATOM   299  C  CA    . ARG A 1 45  ? 63.426 40.148 31.964  1.00 81.86  ? 299 ARG A CA    1 
ATOM   300  C  C     . ARG A 1 45  ? 62.761 38.796 32.239  1.00 88.51  ? 299 ARG A C     1 
ATOM   301  O  O     . ARG A 1 45  ? 63.466 37.751 32.226  1.00 90.14  ? 299 ARG A O     1 
ATOM   302  C  CB    . ARG A 1 45  ? 63.833 40.888 33.258  1.00 89.02  ? 299 ARG A CB    1 
ATOM   303  C  CG    . ARG A 1 45  ? 64.408 42.313 33.044  1.00 95.14  ? 299 ARG A CG    1 
ATOM   304  C  CD    . ARG A 1 45  ? 65.864 42.473 33.444  1.00 98.91  ? 299 ARG A CD    1 
ATOM   305  N  NE    . ARG A 1 45  ? 66.076 42.487 34.909  1.00 104.39 ? 299 ARG A NE    1 
ATOM   306  C  CZ    . ARG A 1 45  ? 66.447 41.440 35.678  1.00 103.05 ? 299 ARG A CZ    1 
ATOM   307  N  NH1   . ARG A 1 45  ? 66.651 40.197 35.179  1.00 92.88  ? 299 ARG A NH1   1 
ATOM   308  N  NH2   . ARG A 1 45  ? 66.620 41.640 36.989  1.00 93.66  ? 299 ARG A NH2   1 
ATOM   309  N  N     . VAL A 1 46  ? 61.418 38.800 32.442  1.00 73.49  ? 300 VAL A N     1 
ATOM   310  C  CA    . VAL A 1 46  ? 60.704 37.552 32.697  1.00 72.76  ? 300 VAL A CA    1 
ATOM   311  C  C     . VAL A 1 46  ? 60.694 36.568 31.489  1.00 67.83  ? 300 VAL A C     1 
ATOM   312  O  O     . VAL A 1 46  ? 60.940 35.379 31.691  1.00 65.03  ? 300 VAL A O     1 
ATOM   313  C  CB    . VAL A 1 46  ? 59.318 37.792 33.391  1.00 69.43  ? 300 VAL A CB    1 
ATOM   314  C  CG1   . VAL A 1 46  ? 58.425 36.557 33.387  1.00 71.89  ? 300 VAL A CG1   1 
ATOM   315  C  CG2   . VAL A 1 46  ? 59.553 38.157 34.846  1.00 72.15  ? 300 VAL A CG2   1 
ATOM   316  N  N     . ARG A 1 47  ? 60.430 37.067 30.287  1.00 68.48  ? 301 ARG A N     1 
ATOM   317  C  CA    . ARG A 1 47  ? 60.415 36.265 29.065  1.00 83.36  ? 301 ARG A CA    1 
ATOM   318  C  C     . ARG A 1 47  ? 61.746 35.551 28.830  1.00 93.72  ? 301 ARG A C     1 
ATOM   319  O  O     . ARG A 1 47  ? 61.769 34.345 28.517  1.00 92.33  ? 301 ARG A O     1 
ATOM   320  C  CB    . ARG A 1 47  ? 60.074 37.141 27.850  1.00 86.82  ? 301 ARG A CB    1 
ATOM   321  C  CG    . ARG A 1 47  ? 59.287 36.422 26.746  1.00 95.74  ? 301 ARG A CG    1 
ATOM   322  C  CD    . ARG A 1 47  ? 58.638 37.369 25.704  1.00 101.98 ? 301 ARG A CD    1 
ATOM   323  N  NE    . ARG A 1 47  ? 57.977 38.578 26.262  1.00 104.38 ? 301 ARG A NE    1 
ATOM   324  C  CZ    . ARG A 1 47  ? 58.503 39.819 26.368  1.00 114.20 ? 301 ARG A CZ    1 
ATOM   325  N  NH1   . ARG A 1 47  ? 59.750 40.130 25.958  1.00 113.54 ? 301 ARG A NH1   1 
ATOM   326  N  NH2   . ARG A 1 47  ? 57.764 40.788 26.913  1.00 116.08 ? 301 ARG A NH2   1 
ATOM   327  N  N     . GLN A 1 48  ? 62.847 36.282 29.025  1.00 96.66  ? 302 GLN A N     1 
ATOM   328  C  CA    . GLN A 1 48  ? 64.204 35.755 28.774  1.00 104.17 ? 302 GLN A CA    1 
ATOM   329  C  C     . GLN A 1 48  ? 64.785 35.097 30.028  1.00 106.69 ? 302 GLN A C     1 
ATOM   330  O  O     . GLN A 1 48  ? 65.991 35.021 30.179  1.00 120.67 ? 302 GLN A O     1 
ATOM   331  C  CB    . GLN A 1 48  ? 65.134 36.861 28.179  1.00 94.86  ? 302 GLN A CB    1 
ATOM   332  C  CG    . GLN A 1 48  ? 65.612 37.944 29.140  1.00 95.17  ? 302 GLN A CG    1 
ATOM   333  C  CD    . GLN A 1 48  ? 65.696 39.387 28.559  1.00 102.54 ? 302 GLN A CD    1 
ATOM   334  O  OE1   . GLN A 1 48  ? 65.108 39.700 27.535  1.00 102.10 ? 302 GLN A OE1   1 
ATOM   335  N  NE2   . GLN A 1 48  ? 66.391 40.287 29.281  1.00 108.99 ? 302 GLN A NE2   1 
ATOM   336  N  N     . SER A 1 49  ? 63.932 34.603 30.916  1.00 109.25 ? 303 SER A N     1 
ATOM   337  C  CA    . SER A 1 49  ? 64.394 33.911 32.107  1.00 116.22 ? 303 SER A CA    1 
ATOM   338  C  C     . SER A 1 49  ? 64.047 32.428 31.946  1.00 124.67 ? 303 SER A C     1 
ATOM   339  O  O     . SER A 1 49  ? 62.926 31.958 32.233  1.00 118.99 ? 303 SER A O     1 
ATOM   340  C  CB    . SER A 1 49  ? 63.782 34.519 33.384  1.00 117.38 ? 303 SER A CB    1 
ATOM   341  O  OG    . SER A 1 49  ? 64.781 34.855 34.352  1.00 108.67 ? 303 SER A OG    1 
ATOM   342  N  N     . ALA A 1 50  ? 65.033 31.701 31.434  1.00 131.71 ? 304 ALA A N     1 
ATOM   343  C  CA    . ALA A 1 50  ? 65.055 30.246 31.519  1.00 129.05 ? 304 ALA A CA    1 
ATOM   344  C  C     . ALA A 1 50  ? 65.063 29.808 33.005  1.00 122.69 ? 304 ALA A C     1 
ATOM   345  O  O     . ALA A 1 50  ? 66.132 29.518 33.549  1.00 120.04 ? 304 ALA A O     1 
ATOM   346  C  CB    . ALA A 1 50  ? 66.284 29.701 30.782  1.00 129.30 ? 304 ALA A CB    1 
ATOM   347  N  N     . ASP A 1 51  ? 63.881 29.789 33.643  1.00 109.53 ? 305 ASP A N     1 
ATOM   348  C  CA    . ASP A 1 51  ? 63.710 29.265 34.999  1.00 108.27 ? 305 ASP A CA    1 
ATOM   349  C  C     . ASP A 1 51  ? 63.383 27.732 34.878  1.00 108.45 ? 305 ASP A C     1 
ATOM   350  O  O     . ASP A 1 51  ? 62.225 27.341 34.658  1.00 105.29 ? 305 ASP A O     1 
ATOM   351  C  CB    . ASP A 1 51  ? 62.600 30.080 35.704  1.00 111.13 ? 305 ASP A CB    1 
ATOM   352  C  CG    . ASP A 1 51  ? 62.852 30.289 37.216  1.00 113.18 ? 305 ASP A CG    1 
ATOM   353  O  OD1   . ASP A 1 51  ? 62.197 29.623 38.054  1.00 106.22 ? 305 ASP A OD1   1 
ATOM   354  O  OD2   . ASP A 1 51  ? 63.679 31.159 37.571  1.00 110.74 ? 305 ASP A OD2   1 
ATOM   355  N  N     . PHE A 1 52  ? 64.401 26.867 34.983  1.00 107.35 ? 306 PHE A N     1 
ATOM   356  C  CA    . PHE A 1 52  ? 64.253 25.417 34.575  1.00 111.08 ? 306 PHE A CA    1 
ATOM   357  C  C     . PHE A 1 52  ? 64.085 24.432 35.746  1.00 110.18 ? 306 PHE A C     1 
ATOM   358  O  O     . PHE A 1 52  ? 64.372 24.727 36.919  1.00 106.01 ? 306 PHE A O     1 
ATOM   359  C  CB    . PHE A 1 52  ? 65.356 24.913 33.563  1.00 104.64 ? 306 PHE A CB    1 
ATOM   360  C  CG    . PHE A 1 52  ? 65.217 25.460 32.137  1.00 102.10 ? 306 PHE A CG    1 
ATOM   361  C  CD1   . PHE A 1 52  ? 63.965 25.557 31.486  1.00 100.19 ? 306 PHE A CD1   1 
ATOM   362  C  CD2   . PHE A 1 52  ? 66.353 25.888 31.428  1.00 101.33 ? 306 PHE A CD2   1 
ATOM   363  C  CE1   . PHE A 1 52  ? 63.867 26.083 30.206  1.00 92.01  ? 306 PHE A CE1   1 
ATOM   364  C  CE2   . PHE A 1 52  ? 66.245 26.413 30.130  1.00 95.12  ? 306 PHE A CE2   1 
ATOM   365  C  CZ    . PHE A 1 52  ? 65.008 26.515 29.523  1.00 87.65  ? 306 PHE A CZ    1 
HETATM 366  N  N     . MSE A 1 53  ? 63.622 23.247 35.365  1.00 107.36 ? 307 MSE A N     1 
HETATM 367  C  CA    . MSE A 1 53  ? 62.890 22.356 36.221  1.00 104.62 ? 307 MSE A CA    1 
HETATM 368  C  C     . MSE A 1 53  ? 63.609 21.045 36.146  1.00 103.44 ? 307 MSE A C     1 
HETATM 369  O  O     . MSE A 1 53  ? 64.083 20.686 35.047  1.00 89.88  ? 307 MSE A O     1 
HETATM 370  C  CB    . MSE A 1 53  ? 61.514 22.294 35.541  1.00 111.87 ? 307 MSE A CB    1 
HETATM 371  C  CG    . MSE A 1 53  ? 60.431 21.625 36.406  1.00 126.69 ? 307 MSE A CG    1 
HETATM 372  SE SE    . MSE A 1 53  ? 59.432 22.728 37.724  1.00 138.53 ? 307 MSE A SE    1 
HETATM 373  C  CE    . MSE A 1 53  ? 60.027 24.572 37.294  1.00 131.96 ? 307 MSE A CE    1 
ATOM   374  N  N     . PRO A 1 54  ? 63.705 20.297 37.269  1.00 106.71 ? 308 PRO A N     1 
ATOM   375  C  CA    . PRO A 1 54  ? 64.400 18.982 37.211  1.00 101.97 ? 308 PRO A CA    1 
ATOM   376  C  C     . PRO A 1 54  ? 63.721 18.009 36.231  1.00 102.54 ? 308 PRO A C     1 
ATOM   377  O  O     . PRO A 1 54  ? 62.475 18.024 36.114  1.00 95.41  ? 308 PRO A O     1 
ATOM   378  C  CB    . PRO A 1 54  ? 64.311 18.457 38.665  1.00 105.51 ? 308 PRO A CB    1 
ATOM   379  C  CG    . PRO A 1 54  ? 63.174 19.220 39.293  1.00 104.31 ? 308 PRO A CG    1 
ATOM   380  C  CD    . PRO A 1 54  ? 63.238 20.584 38.649  1.00 100.95 ? 308 PRO A CD    1 
ATOM   381  N  N     . LEU A 1 55  ? 64.531 17.196 35.545  1.00 99.07  ? 309 LEU A N     1 
ATOM   382  C  CA    . LEU A 1 55  ? 64.030 16.117 34.669  1.00 108.39 ? 309 LEU A CA    1 
ATOM   383  C  C     . LEU A 1 55  ? 62.822 15.389 35.206  1.00 104.42 ? 309 LEU A C     1 
ATOM   384  O  O     . LEU A 1 55  ? 61.804 15.329 34.514  1.00 100.64 ? 309 LEU A O     1 
ATOM   385  C  CB    . LEU A 1 55  ? 65.104 15.059 34.375  1.00 113.29 ? 309 LEU A CB    1 
ATOM   386  C  CG    . LEU A 1 55  ? 65.700 15.132 32.979  1.00 117.84 ? 309 LEU A CG    1 
ATOM   387  C  CD1   . LEU A 1 55  ? 66.151 16.559 32.674  1.00 127.75 ? 309 LEU A CD1   1 
ATOM   388  C  CD2   . LEU A 1 55  ? 66.859 14.147 32.874  1.00 115.54 ? 309 LEU A CD2   1 
ATOM   389  N  N     . LYS A 1 56  ? 62.970 14.834 36.413  1.00 101.48 ? 310 LYS A N     1 
ATOM   390  C  CA    . LYS A 1 56  ? 61.888 14.169 37.155  1.00 103.00 ? 310 LYS A CA    1 
ATOM   391  C  C     . LYS A 1 56  ? 60.516 14.713 36.751  1.00 94.61  ? 310 LYS A C     1 
ATOM   392  O  O     . LYS A 1 56  ? 59.749 13.990 36.146  1.00 87.01  ? 310 LYS A O     1 
ATOM   393  C  CB    . LYS A 1 56  ? 62.109 14.284 38.673  1.00 106.18 ? 310 LYS A CB    1 
ATOM   394  C  CG    . LYS A 1 56  ? 63.441 13.671 39.106  1.00 119.74 ? 310 LYS A CG    1 
ATOM   395  C  CD    . LYS A 1 56  ? 63.388 12.917 40.434  1.00 124.37 ? 310 LYS A CD    1 
ATOM   396  C  CE    . LYS A 1 56  ? 64.219 11.636 40.369  1.00 121.99 ? 310 LYS A CE    1 
ATOM   397  N  NZ    . LYS A 1 56  ? 64.124 10.844 41.623  1.00 119.79 ? 310 LYS A NZ    1 
ATOM   398  N  N     . GLN A 1 57  ? 60.276 16.008 36.991  1.00 94.57  ? 311 GLN A N     1 
ATOM   399  C  CA    . GLN A 1 57  ? 59.022 16.698 36.608  1.00 94.99  ? 311 GLN A CA    1 
ATOM   400  C  C     . GLN A 1 57  ? 58.596 16.514 35.112  1.00 88.04  ? 311 GLN A C     1 
ATOM   401  O  O     . GLN A 1 57  ? 57.432 16.214 34.815  1.00 86.82  ? 311 GLN A O     1 
ATOM   402  C  CB    . GLN A 1 57  ? 59.104 18.215 36.959  1.00 101.76 ? 311 GLN A CB    1 
ATOM   403  C  CG    . GLN A 1 57  ? 59.245 18.622 38.441  1.00 102.84 ? 311 GLN A CG    1 
ATOM   404  C  CD    . GLN A 1 57  ? 58.172 18.055 39.382  1.00 105.44 ? 311 GLN A CD    1 
ATOM   405  O  OE1   . GLN A 1 57  ? 57.010 17.896 39.015  1.00 104.39 ? 311 GLN A OE1   1 
ATOM   406  N  NE2   . GLN A 1 57  ? 58.574 17.754 40.612  1.00 108.73 ? 311 GLN A NE2   1 
HETATM 407  N  N     . MSE A 1 58  ? 59.542 16.689 34.191  1.00 82.76  ? 312 MSE A N     1 
HETATM 408  C  CA    . MSE A 1 58  ? 59.312 16.474 32.754  1.00 88.26  ? 312 MSE A CA    1 
HETATM 409  C  C     . MSE A 1 58  ? 58.984 15.025 32.473  1.00 90.23  ? 312 MSE A C     1 
HETATM 410  O  O     . MSE A 1 58  ? 57.957 14.769 31.852  1.00 93.96  ? 312 MSE A O     1 
HETATM 411  C  CB    . MSE A 1 58  ? 60.516 16.881 31.884  1.00 96.38  ? 312 MSE A CB    1 
HETATM 412  C  CG    . MSE A 1 58  ? 60.913 18.382 31.842  1.00 103.68 ? 312 MSE A CG    1 
HETATM 413  SE SE    . MSE A 1 58  ? 59.448 19.739 31.834  1.00 111.18 ? 312 MSE A SE    1 
HETATM 414  C  CE    . MSE A 1 58  ? 59.121 19.612 33.750  1.00 92.79  ? 312 MSE A CE    1 
HETATM 415  N  N     . MSE A 1 59  ? 59.815 14.084 32.955  1.00 81.01  ? 313 MSE A N     1 
HETATM 416  C  CA    . MSE A 1 59  ? 59.514 12.651 32.893  1.00 84.10  ? 313 MSE A CA    1 
HETATM 417  C  C     . MSE A 1 59  ? 58.109 12.310 33.452  1.00 86.06  ? 313 MSE A C     1 
HETATM 418  O  O     . MSE A 1 59  ? 57.377 11.514 32.868  1.00 75.58  ? 313 MSE A O     1 
HETATM 419  C  CB    . MSE A 1 59  ? 60.574 11.812 33.618  1.00 90.95  ? 313 MSE A CB    1 
HETATM 420  C  CG    . MSE A 1 59  ? 62.065 12.055 33.324  1.00 92.51  ? 313 MSE A CG    1 
HETATM 421  SE SE    . MSE A 1 59  ? 62.570 11.511 31.507  1.00 108.37 ? 313 MSE A SE    1 
HETATM 422  C  CE    . MSE A 1 59  ? 64.364 10.679 31.733  1.00 104.82 ? 313 MSE A CE    1 
ATOM   423  N  N     . LYS A 1 60  ? 57.697 12.941 34.561  1.00 87.31  ? 314 LYS A N     1 
ATOM   424  C  CA    . LYS A 1 60  ? 56.332 12.778 35.072  1.00 91.88  ? 314 LYS A CA    1 
ATOM   425  C  C     . LYS A 1 60  ? 55.334 12.990 33.936  1.00 90.30  ? 314 LYS A C     1 
ATOM   426  O  O     . LYS A 1 60  ? 54.608 12.065 33.588  1.00 86.49  ? 314 LYS A O     1 
ATOM   427  C  CB    . LYS A 1 60  ? 56.033 13.724 36.267  1.00 101.24 ? 314 LYS A CB    1 
ATOM   428  C  CG    . LYS A 1 60  ? 54.637 13.565 36.870  1.00 106.16 ? 314 LYS A CG    1 
ATOM   429  C  CD    . LYS A 1 60  ? 54.577 13.536 38.411  1.00 110.17 ? 314 LYS A CD    1 
ATOM   430  C  CE    . LYS A 1 60  ? 53.194 13.007 38.882  1.00 109.92 ? 314 LYS A CE    1 
ATOM   431  N  NZ    . LYS A 1 60  ? 53.038 12.585 40.307  1.00 104.33 ? 314 LYS A NZ    1 
ATOM   432  N  N     . THR A 1 61  ? 55.344 14.175 33.322  1.00 87.28  ? 315 THR A N     1 
ATOM   433  C  CA    . THR A 1 61  ? 54.485 14.424 32.155  1.00 86.61  ? 315 THR A CA    1 
ATOM   434  C  C     . THR A 1 61  ? 54.655 13.329 31.062  1.00 85.92  ? 315 THR A C     1 
ATOM   435  O  O     . THR A 1 61  ? 53.638 12.785 30.567  1.00 87.56  ? 315 THR A O     1 
ATOM   436  C  CB    . THR A 1 61  ? 54.667 15.844 31.532  1.00 87.24  ? 315 THR A CB    1 
ATOM   437  O  OG1   . THR A 1 61  ? 54.642 16.874 32.541  1.00 77.61  ? 315 THR A OG1   1 
ATOM   438  C  CG2   . THR A 1 61  ? 53.548 16.124 30.487  1.00 84.64  ? 315 THR A CG2   1 
ATOM   439  N  N     . LEU A 1 62  ? 55.906 12.973 30.726  1.00 82.71  ? 316 LEU A N     1 
ATOM   440  C  CA    . LEU A 1 62  ? 56.172 11.941 29.677  1.00 77.62  ? 316 LEU A CA    1 
ATOM   441  C  C     . LEU A 1 62  ? 55.637 10.555 30.026  1.00 78.54  ? 316 LEU A C     1 
ATOM   442  O  O     . LEU A 1 62  ? 54.878 9.980  29.236  1.00 74.23  ? 316 LEU A O     1 
ATOM   443  C  CB    . LEU A 1 62  ? 57.662 11.841 29.290  1.00 75.25  ? 316 LEU A CB    1 
ATOM   444  C  CG    . LEU A 1 62  ? 58.333 13.061 28.613  1.00 73.24  ? 316 LEU A CG    1 
ATOM   445  C  CD1   . LEU A 1 62  ? 59.786 12.798 28.229  1.00 72.99  ? 316 LEU A CD1   1 
ATOM   446  C  CD2   . LEU A 1 62  ? 57.579 13.623 27.406  1.00 68.31  ? 316 LEU A CD2   1 
ATOM   447  N  N     . ASN A 1 63  ? 55.984 10.008 31.191  1.00 86.04  ? 317 ASN A N     1 
ATOM   448  C  CA    . ASN A 1 63  ? 55.382 8.699  31.611  1.00 88.29  ? 317 ASN A CA    1 
ATOM   449  C  C     . ASN A 1 63  ? 53.829 8.740  31.726  1.00 84.71  ? 317 ASN A C     1 
ATOM   450  O  O     . ASN A 1 63  ? 53.120 7.904  31.149  1.00 80.16  ? 317 ASN A O     1 
ATOM   451  C  CB    . ASN A 1 63  ? 56.056 8.139  32.873  1.00 93.93  ? 317 ASN A CB    1 
ATOM   452  C  CG    . ASN A 1 63  ? 57.522 7.725  32.635  1.00 102.92 ? 317 ASN A CG    1 
ATOM   453  O  OD1   . ASN A 1 63  ? 58.457 8.196  33.310  1.00 96.69  ? 317 ASN A OD1   1 
ATOM   454  N  ND2   . ASN A 1 63  ? 57.727 6.830  31.675  1.00 113.23 ? 317 ASN A ND2   1 
ATOM   455  N  N     . ASN A 1 64  ? 53.293 9.756  32.386  1.00 91.36  ? 318 ASN A N     1 
ATOM   456  C  CA    . ASN A 1 64  ? 51.832 9.937  32.424  1.00 94.15  ? 318 ASN A CA    1 
ATOM   457  C  C     . ASN A 1 64  ? 51.187 9.875  31.070  1.00 94.78  ? 318 ASN A C     1 
ATOM   458  O  O     . ASN A 1 64  ? 50.248 9.108  30.904  1.00 102.30 ? 318 ASN A O     1 
ATOM   459  C  CB    . ASN A 1 64  ? 51.416 11.238 33.133  1.00 99.44  ? 318 ASN A CB    1 
ATOM   460  C  CG    . ASN A 1 64  ? 51.463 11.103 34.656  1.00 111.28 ? 318 ASN A CG    1 
ATOM   461  O  OD1   . ASN A 1 64  ? 51.480 9.982  35.197  1.00 112.79 ? 318 ASN A OD1   1 
ATOM   462  N  ND2   . ASN A 1 64  ? 51.501 12.239 35.357  1.00 113.34 ? 318 ASN A ND2   1 
ATOM   463  N  N     . ASP A 1 65  ? 51.693 10.655 30.103  1.00 90.47  ? 319 ASP A N     1 
ATOM   464  C  CA    . ASP A 1 65  ? 51.063 10.748 28.777  1.00 79.09  ? 319 ASP A CA    1 
ATOM   465  C  C     . ASP A 1 65  ? 51.503 9.687  27.761  1.00 76.91  ? 319 ASP A C     1 
ATOM   466  O  O     . ASP A 1 65  ? 50.744 9.318  26.904  1.00 73.23  ? 319 ASP A O     1 
ATOM   467  C  CB    . ASP A 1 65  ? 51.322 12.110 28.152  1.00 81.88  ? 319 ASP A CB    1 
ATOM   468  C  CG    . ASP A 1 65  ? 50.414 13.203 28.674  1.00 84.29  ? 319 ASP A CG    1 
ATOM   469  O  OD1   . ASP A 1 65  ? 49.905 13.101 29.806  1.00 87.77  ? 319 ASP A OD1   1 
ATOM   470  O  OD2   . ASP A 1 65  ? 50.226 14.193 27.934  1.00 83.69  ? 319 ASP A OD2   1 
ATOM   471  N  N     . LEU A 1 66  ? 52.732 9.224  27.763  1.00 80.97  ? 320 LEU A N     1 
ATOM   472  C  CA    . LEU A 1 66  ? 53.123 8.345  26.657  1.00 86.22  ? 320 LEU A CA    1 
ATOM   473  C  C     . LEU A 1 66  ? 53.295 6.884  27.028  1.00 90.38  ? 320 LEU A C     1 
ATOM   474  O  O     . LEU A 1 66  ? 53.546 6.045  26.140  1.00 90.96  ? 320 LEU A O     1 
ATOM   475  C  CB    . LEU A 1 66  ? 54.371 8.909  25.986  1.00 89.79  ? 320 LEU A CB    1 
ATOM   476  C  CG    . LEU A 1 66  ? 54.086 10.198 25.207  1.00 91.10  ? 320 LEU A CG    1 
ATOM   477  C  CD1   . LEU A 1 66  ? 55.383 10.774 24.634  1.00 92.58  ? 320 LEU A CD1   1 
ATOM   478  C  CD2   . LEU A 1 66  ? 53.038 9.932  24.117  1.00 92.56  ? 320 LEU A CD2   1 
ATOM   479  N  N     . GLY A 1 67  ? 53.121 6.573  28.313  1.00 85.65  ? 321 GLY A N     1 
ATOM   480  C  CA    . GLY A 1 67  ? 53.323 5.225  28.800  1.00 96.59  ? 321 GLY A CA    1 
ATOM   481  C  C     . GLY A 1 67  ? 54.745 5.045  29.234  1.00 101.45 ? 321 GLY A C     1 
ATOM   482  O  O     . GLY A 1 67  ? 55.499 6.005  29.265  1.00 113.13 ? 321 GLY A O     1 
ATOM   483  N  N     . PRO A 1 68  ? 55.125 3.817  29.595  1.00 107.74 ? 322 PRO A N     1 
ATOM   484  C  CA    . PRO A 1 68  ? 56.537 3.574  29.880  1.00 104.42 ? 322 PRO A CA    1 
ATOM   485  C  C     . PRO A 1 68  ? 57.323 3.108  28.642  1.00 95.87  ? 322 PRO A C     1 
ATOM   486  O  O     . PRO A 1 68  ? 58.532 3.090  28.673  1.00 93.14  ? 322 PRO A O     1 
ATOM   487  C  CB    . PRO A 1 68  ? 56.481 2.488  30.974  1.00 109.51 ? 322 PRO A CB    1 
ATOM   488  C  CG    . PRO A 1 68  ? 55.015 2.267  31.271  1.00 107.91 ? 322 PRO A CG    1 
ATOM   489  C  CD    . PRO A 1 68  ? 54.302 2.680  30.034  1.00 107.98 ? 322 PRO A CD    1 
ATOM   490  N  N     . ASN A 1 69  ? 56.641 2.717  27.571  1.00 97.25  ? 323 ASN A N     1 
ATOM   491  C  CA    . ASN A 1 69  ? 57.315 2.369  26.295  1.00 102.55 ? 323 ASN A CA    1 
ATOM   492  C  C     . ASN A 1 69  ? 58.142 3.543  25.657  1.00 100.29 ? 323 ASN A C     1 
ATOM   493  O  O     . ASN A 1 69  ? 59.161 3.278  25.028  1.00 90.32  ? 323 ASN A O     1 
ATOM   494  C  CB    . ASN A 1 69  ? 56.307 1.776  25.243  1.00 104.15 ? 323 ASN A CB    1 
ATOM   495  C  CG    . ASN A 1 69  ? 55.024 2.660  25.030  1.00 113.65 ? 323 ASN A CG    1 
ATOM   496  O  OD1   . ASN A 1 69  ? 54.815 3.678  25.727  1.00 111.65 ? 323 ASN A OD1   1 
ATOM   497  N  ND2   . ASN A 1 69  ? 54.152 2.248  24.080  1.00 108.58 ? 323 ASN A ND2   1 
ATOM   498  N  N     . TRP A 1 70  ? 57.716 4.804  25.883  1.00 97.88  ? 324 TRP A N     1 
ATOM   499  C  CA    . TRP A 1 70  ? 58.067 5.990  25.050  1.00 93.95  ? 324 TRP A CA    1 
ATOM   500  C  C     . TRP A 1 70  ? 59.535 6.190  24.702  1.00 91.81  ? 324 TRP A C     1 
ATOM   501  O  O     . TRP A 1 70  ? 59.835 6.687  23.614  1.00 97.85  ? 324 TRP A O     1 
ATOM   502  C  CB    . TRP A 1 70  ? 57.547 7.303  25.677  1.00 89.89  ? 324 TRP A CB    1 
ATOM   503  C  CG    . TRP A 1 70  ? 58.368 7.783  26.840  1.00 88.67  ? 324 TRP A CG    1 
ATOM   504  C  CD1   . TRP A 1 70  ? 58.204 7.439  28.140  1.00 94.51  ? 324 TRP A CD1   1 
ATOM   505  C  CD2   . TRP A 1 70  ? 59.487 8.677  26.804  1.00 85.51  ? 324 TRP A CD2   1 
ATOM   506  N  NE1   . TRP A 1 70  ? 59.152 8.057  28.925  1.00 92.03  ? 324 TRP A NE1   1 
ATOM   507  C  CE2   . TRP A 1 70  ? 59.955 8.819  28.126  1.00 86.85  ? 324 TRP A CE2   1 
ATOM   508  C  CE3   . TRP A 1 70  ? 60.148 9.351  25.788  1.00 86.23  ? 324 TRP A CE3   1 
ATOM   509  C  CZ2   . TRP A 1 70  ? 61.048 9.612  28.455  1.00 86.64  ? 324 TRP A CZ2   1 
ATOM   510  C  CZ3   . TRP A 1 70  ? 61.234 10.144 26.115  1.00 89.94  ? 324 TRP A CZ3   1 
ATOM   511  C  CH2   . TRP A 1 70  ? 61.676 10.264 27.435  1.00 87.91  ? 324 TRP A CH2   1 
ATOM   512  N  N     . ARG A 1 71  ? 60.436 5.838  25.613  1.00 87.10  ? 325 ARG A N     1 
ATOM   513  C  CA    . ARG A 1 71  ? 61.861 5.968  25.327  1.00 92.87  ? 325 ARG A CA    1 
ATOM   514  C  C     . ARG A 1 71  ? 62.285 5.069  24.103  1.00 86.96  ? 325 ARG A C     1 
ATOM   515  O  O     . ARG A 1 71  ? 63.224 5.413  23.311  1.00 85.17  ? 325 ARG A O     1 
ATOM   516  C  CB    . ARG A 1 71  ? 62.646 5.754  26.642  1.00 94.28  ? 325 ARG A CB    1 
ATOM   517  C  CG    . ARG A 1 71  ? 64.128 6.120  26.667  1.00 99.47  ? 325 ARG A CG    1 
ATOM   518  C  CD    . ARG A 1 71  ? 64.448 7.560  26.318  1.00 100.77 ? 325 ARG A CD    1 
ATOM   519  N  NE    . ARG A 1 71  ? 65.894 7.871  26.332  1.00 101.05 ? 325 ARG A NE    1 
ATOM   520  C  CZ    . ARG A 1 71  ? 66.770 7.595  25.347  1.00 102.57 ? 325 ARG A CZ    1 
ATOM   521  N  NH1   . ARG A 1 71  ? 66.421 6.961  24.235  1.00 100.51 ? 325 ARG A NH1   1 
ATOM   522  N  NH2   . ARG A 1 71  ? 68.039 7.948  25.478  1.00 111.35 ? 325 ARG A NH2   1 
ATOM   523  N  N     . ASP A 1 72  ? 61.537 3.983  23.897  1.00 88.67  ? 326 ASP A N     1 
ATOM   524  C  CA    . ASP A 1 72  ? 61.799 2.980  22.807  1.00 93.40  ? 326 ASP A CA    1 
ATOM   525  C  C     . ASP A 1 72  ? 61.646 3.518  21.365  1.00 88.97  ? 326 ASP A C     1 
ATOM   526  O  O     . ASP A 1 72  ? 62.359 3.062  20.472  1.00 83.19  ? 326 ASP A O     1 
ATOM   527  C  CB    . ASP A 1 72  ? 60.908 1.710  22.956  1.00 97.58  ? 326 ASP A CB    1 
ATOM   528  C  CG    . ASP A 1 72  ? 61.099 0.977  24.299  1.00 95.27  ? 326 ASP A CG    1 
ATOM   529  O  OD1   . ASP A 1 72  ? 62.205 1.066  24.843  1.00 85.81  ? 326 ASP A OD1   1 
ATOM   530  O  OD2   . ASP A 1 72  ? 60.131 0.339  24.803  1.00 94.35  ? 326 ASP A OD2   1 
ATOM   531  N  N     . LYS A 1 73  ? 60.751 4.486  21.133  1.00 86.77  ? 327 LYS A N     1 
ATOM   532  C  CA    . LYS A 1 73  ? 60.707 5.209  19.822  1.00 84.84  ? 327 LYS A CA    1 
ATOM   533  C  C     . LYS A 1 73  ? 61.960 6.059  19.468  1.00 81.89  ? 327 LYS A C     1 
ATOM   534  O  O     . LYS A 1 73  ? 62.123 6.433  18.309  1.00 74.47  ? 327 LYS A O     1 
ATOM   535  C  CB    . LYS A 1 73  ? 59.483 6.125  19.750  1.00 90.67  ? 327 LYS A CB    1 
ATOM   536  C  CG    . LYS A 1 73  ? 58.206 5.395  19.472  1.00 92.36  ? 327 LYS A CG    1 
ATOM   537  C  CD    . LYS A 1 73  ? 56.993 6.045  20.099  1.00 94.77  ? 327 LYS A CD    1 
ATOM   538  C  CE    . LYS A 1 73  ? 55.774 5.220  19.675  1.00 98.44  ? 327 LYS A CE    1 
ATOM   539  N  NZ    . LYS A 1 73  ? 54.504 5.744  20.241  1.00 104.91 ? 327 LYS A NZ    1 
ATOM   540  N  N     . LEU A 1 74  ? 62.842 6.349  20.435  1.00 83.91  ? 328 LEU A N     1 
ATOM   541  C  CA    . LEU A 1 74  ? 63.951 7.287  20.227  1.00 80.65  ? 328 LEU A CA    1 
ATOM   542  C  C     . LEU A 1 74  ? 65.328 6.651  20.205  1.00 80.27  ? 328 LEU A C     1 
ATOM   543  O  O     . LEU A 1 74  ? 65.569 5.778  21.003  1.00 85.28  ? 328 LEU A O     1 
ATOM   544  C  CB    . LEU A 1 74  ? 63.926 8.288  21.358  1.00 77.48  ? 328 LEU A CB    1 
ATOM   545  C  CG    . LEU A 1 74  ? 62.573 8.980  21.595  1.00 76.82  ? 328 LEU A CG    1 
ATOM   546  C  CD1   . LEU A 1 74  ? 62.627 9.903  22.806  1.00 76.50  ? 328 LEU A CD1   1 
ATOM   547  C  CD2   . LEU A 1 74  ? 62.119 9.752  20.370  1.00 70.19  ? 328 LEU A CD2   1 
ATOM   548  N  N     . GLU A 1 75  ? 66.210 7.105  19.299  1.00 79.17  ? 329 GLU A N     1 
ATOM   549  C  CA    . GLU A 1 75  ? 67.688 6.968  19.439  1.00 77.31  ? 329 GLU A CA    1 
ATOM   550  C  C     . GLU A 1 75  ? 68.338 7.899  20.509  1.00 76.41  ? 329 GLU A C     1 
ATOM   551  O  O     . GLU A 1 75  ? 69.370 7.567  21.026  1.00 78.05  ? 329 GLU A O     1 
ATOM   552  C  CB    . GLU A 1 75  ? 68.407 7.310  18.117  1.00 80.09  ? 329 GLU A CB    1 
ATOM   553  C  CG    . GLU A 1 75  ? 68.314 6.291  16.985  1.00 82.65  ? 329 GLU A CG    1 
ATOM   554  C  CD    . GLU A 1 75  ? 69.010 6.773  15.693  1.00 92.71  ? 329 GLU A CD    1 
ATOM   555  O  OE1   . GLU A 1 75  ? 69.547 7.909  15.667  1.00 94.48  ? 329 GLU A OE1   1 
ATOM   556  O  OE2   . GLU A 1 75  ? 69.038 6.019  14.680  1.00 97.53  ? 329 GLU A OE2   1 
ATOM   557  N  N     . TYR A 1 76  ? 67.768 9.066  20.817  1.00 74.63  ? 330 TYR A N     1 
ATOM   558  C  CA    . TYR A 1 76  ? 68.408 10.054 21.707  1.00 66.00  ? 330 TYR A CA    1 
ATOM   559  C  C     . TYR A 1 76  ? 67.325 11.007 22.279  1.00 67.63  ? 330 TYR A C     1 
ATOM   560  O  O     . TYR A 1 76  ? 66.322 11.294 21.611  1.00 69.90  ? 330 TYR A O     1 
ATOM   561  C  CB    . TYR A 1 76  ? 69.506 10.764 20.894  1.00 65.98  ? 330 TYR A CB    1 
ATOM   562  C  CG    . TYR A 1 76  ? 70.117 12.030 21.502  1.00 65.81  ? 330 TYR A CG    1 
ATOM   563  C  CD1   . TYR A 1 76  ? 70.884 11.966 22.652  1.00 64.75  ? 330 TYR A CD1   1 
ATOM   564  C  CD2   . TYR A 1 76  ? 69.913 13.304 20.905  1.00 65.99  ? 330 TYR A CD2   1 
ATOM   565  C  CE1   . TYR A 1 76  ? 71.423 13.095 23.236  1.00 64.28  ? 330 TYR A CE1   1 
ATOM   566  C  CE2   . TYR A 1 76  ? 70.468 14.468 21.464  1.00 68.74  ? 330 TYR A CE2   1 
ATOM   567  C  CZ    . TYR A 1 76  ? 71.231 14.366 22.644  1.00 70.62  ? 330 TYR A CZ    1 
ATOM   568  O  OH    . TYR A 1 76  ? 71.788 15.498 23.267  1.00 67.23  ? 330 TYR A OH    1 
ATOM   569  N  N     . PHE A 1 77  ? 67.515 11.446 23.519  1.00 66.15  ? 331 PHE A N     1 
ATOM   570  C  CA    . PHE A 1 77  ? 66.685 12.425 24.205  1.00 63.29  ? 331 PHE A CA    1 
ATOM   571  C  C     . PHE A 1 77  ? 67.605 13.378 24.960  1.00 63.19  ? 331 PHE A C     1 
ATOM   572  O  O     . PHE A 1 77  ? 68.292 13.013 25.904  1.00 69.12  ? 331 PHE A O     1 
ATOM   573  C  CB    . PHE A 1 77  ? 65.680 11.790 25.190  1.00 66.97  ? 331 PHE A CB    1 
ATOM   574  C  CG    . PHE A 1 77  ? 64.790 12.812 25.897  1.00 67.31  ? 331 PHE A CG    1 
ATOM   575  C  CD1   . PHE A 1 77  ? 63.640 13.327 25.270  1.00 65.37  ? 331 PHE A CD1   1 
ATOM   576  C  CD2   . PHE A 1 77  ? 65.118 13.299 27.161  1.00 66.97  ? 331 PHE A CD2   1 
ATOM   577  C  CE1   . PHE A 1 77  ? 62.830 14.311 25.909  1.00 67.01  ? 331 PHE A CE1   1 
ATOM   578  C  CE2   . PHE A 1 77  ? 64.345 14.289 27.790  1.00 63.20  ? 331 PHE A CE2   1 
ATOM   579  C  CZ    . PHE A 1 77  ? 63.179 14.789 27.180  1.00 64.03  ? 331 PHE A CZ    1 
ATOM   580  N  N     . GLU A 1 78  ? 67.638 14.615 24.530  1.00 66.55  ? 332 GLU A N     1 
ATOM   581  C  CA    . GLU A 1 78  ? 68.518 15.612 25.135  1.00 65.75  ? 332 GLU A CA    1 
ATOM   582  C  C     . GLU A 1 78  ? 67.920 16.162 26.445  1.00 67.13  ? 332 GLU A C     1 
ATOM   583  O  O     . GLU A 1 78  ? 66.810 16.728 26.492  1.00 66.23  ? 332 GLU A O     1 
ATOM   584  C  CB    . GLU A 1 78  ? 68.759 16.686 24.098  1.00 65.80  ? 332 GLU A CB    1 
ATOM   585  C  CG    . GLU A 1 78  ? 69.746 17.783 24.440  1.00 64.88  ? 332 GLU A CG    1 
ATOM   586  C  CD    . GLU A 1 78  ? 70.317 18.413 23.167  1.00 68.04  ? 332 GLU A CD    1 
ATOM   587  O  OE1   . GLU A 1 78  ? 69.925 19.531 22.783  1.00 72.27  ? 332 GLU A OE1   1 
ATOM   588  O  OE2   . GLU A 1 78  ? 71.141 17.784 22.498  1.00 72.32  ? 332 GLU A OE2   1 
ATOM   589  N  N     . GLU A 1 79  ? 68.662 16.003 27.530  1.00 70.43  ? 333 GLU A N     1 
ATOM   590  C  CA    . GLU A 1 79  ? 68.109 16.233 28.889  1.00 70.75  ? 333 GLU A CA    1 
ATOM   591  C  C     . GLU A 1 79  ? 68.007 17.704 29.277  1.00 64.35  ? 333 GLU A C     1 
ATOM   592  O  O     . GLU A 1 79  ? 67.149 18.070 30.027  1.00 65.73  ? 333 GLU A O     1 
ATOM   593  C  CB    . GLU A 1 79  ? 68.865 15.364 29.923  1.00 69.43  ? 333 GLU A CB    1 
ATOM   594  C  CG    . GLU A 1 79  ? 68.663 13.846 29.601  1.00 73.08  ? 333 GLU A CG    1 
ATOM   595  C  CD    . GLU A 1 79  ? 69.391 12.877 30.519  1.00 69.74  ? 333 GLU A CD    1 
ATOM   596  O  OE1   . GLU A 1 79  ? 69.940 13.340 31.509  1.00 67.09  ? 333 GLU A OE1   1 
ATOM   597  O  OE2   . GLU A 1 79  ? 69.385 11.665 30.256  1.00 72.84  ? 333 GLU A OE2   1 
ATOM   598  N  N     . ARG A 1 80  ? 68.840 18.547 28.706  1.00 63.11  ? 334 ARG A N     1 
ATOM   599  C  CA    . ARG A 1 80  ? 68.769 19.951 28.940  1.00 63.73  ? 334 ARG A CA    1 
ATOM   600  C  C     . ARG A 1 80  ? 67.805 20.432 27.867  1.00 62.57  ? 334 ARG A C     1 
ATOM   601  O  O     . ARG A 1 80  ? 67.998 20.063 26.695  1.00 65.56  ? 334 ARG A O     1 
ATOM   602  C  CB    . ARG A 1 80  ? 70.148 20.595 28.741  1.00 65.99  ? 334 ARG A CB    1 
ATOM   603  C  CG    . ARG A 1 80  ? 70.194 22.133 28.892  1.00 70.91  ? 334 ARG A CG    1 
ATOM   604  C  CD    . ARG A 1 80  ? 71.648 22.629 29.064  1.00 72.16  ? 334 ARG A CD    1 
ATOM   605  N  NE    . ARG A 1 80  ? 72.424 22.271 27.872  1.00 75.59  ? 334 ARG A NE    1 
ATOM   606  C  CZ    . ARG A 1 80  ? 72.679 23.073 26.826  1.00 77.61  ? 334 ARG A CZ    1 
ATOM   607  N  NH1   . ARG A 1 80  ? 72.298 24.352 26.856  1.00 77.83  ? 334 ARG A NH1   1 
ATOM   608  N  NH2   . ARG A 1 80  ? 73.370 22.597 25.757  1.00 70.08  ? 334 ARG A NH2   1 
ATOM   609  N  N     . PRO A 1 81  ? 66.793 21.262 28.230  1.00 58.82  ? 335 PRO A N     1 
ATOM   610  C  CA    . PRO A 1 81  ? 65.954 21.854 27.180  1.00 59.63  ? 335 PRO A CA    1 
ATOM   611  C  C     . PRO A 1 81  ? 66.736 22.854 26.341  1.00 60.52  ? 335 PRO A C     1 
ATOM   612  O  O     . PRO A 1 81  ? 67.707 23.421 26.849  1.00 60.62  ? 335 PRO A O     1 
ATOM   613  C  CB    . PRO A 1 81  ? 64.891 22.543 27.950  1.00 57.58  ? 335 PRO A CB    1 
ATOM   614  C  CG    . PRO A 1 81  ? 65.516 22.925 29.220  1.00 61.53  ? 335 PRO A CG    1 
ATOM   615  C  CD    . PRO A 1 81  ? 66.589 21.935 29.517  1.00 61.58  ? 335 PRO A CD    1 
ATOM   616  N  N     . PHE A 1 82  ? 66.384 23.034 25.071  1.00 61.83  ? 336 PHE A N     1 
ATOM   617  C  CA    . PHE A 1 82  ? 67.029 24.111 24.288  1.00 68.53  ? 336 PHE A CA    1 
ATOM   618  C  C     . PHE A 1 82  ? 66.195 25.408 24.168  1.00 66.42  ? 336 PHE A C     1 
ATOM   619  O  O     . PHE A 1 82  ? 66.606 26.359 23.541  1.00 69.61  ? 336 PHE A O     1 
ATOM   620  C  CB    . PHE A 1 82  ? 67.489 23.617 22.919  1.00 70.17  ? 336 PHE A CB    1 
ATOM   621  C  CG    . PHE A 1 82  ? 66.446 23.697 21.846  1.00 75.39  ? 336 PHE A CG    1 
ATOM   622  C  CD1   . PHE A 1 82  ? 66.415 24.773 20.968  1.00 71.73  ? 336 PHE A CD1   1 
ATOM   623  C  CD2   . PHE A 1 82  ? 65.505 22.667 21.694  1.00 82.73  ? 336 PHE A CD2   1 
ATOM   624  C  CE1   . PHE A 1 82  ? 65.452 24.853 19.986  1.00 79.43  ? 336 PHE A CE1   1 
ATOM   625  C  CE2   . PHE A 1 82  ? 64.552 22.728 20.678  1.00 83.49  ? 336 PHE A CE2   1 
ATOM   626  C  CZ    . PHE A 1 82  ? 64.532 23.825 19.823  1.00 81.28  ? 336 PHE A CZ    1 
ATOM   627  N  N     . ALA A 1 83  ? 65.020 25.414 24.760  1.00 68.84  ? 337 ALA A N     1 
ATOM   628  C  CA    . ALA A 1 83  ? 64.177 26.575 24.796  1.00 67.08  ? 337 ALA A CA    1 
ATOM   629  C  C     . ALA A 1 83  ? 63.033 26.380 25.788  1.00 65.49  ? 337 ALA A C     1 
ATOM   630  O  O     . ALA A 1 83  ? 62.476 25.254 26.006  1.00 64.04  ? 337 ALA A O     1 
ATOM   631  C  CB    . ALA A 1 83  ? 63.658 26.899 23.407  1.00 66.78  ? 337 ALA A CB    1 
ATOM   632  N  N     . ALA A 1 84  ? 62.719 27.504 26.396  1.00 68.84  ? 338 ALA A N     1 
ATOM   633  C  CA    . ALA A 1 84  ? 61.652 27.626 27.351  1.00 69.59  ? 338 ALA A CA    1 
ATOM   634  C  C     . ALA A 1 84  ? 60.422 27.945 26.533  1.00 66.88  ? 338 ALA A C     1 
ATOM   635  O  O     . ALA A 1 84  ? 60.516 28.607 25.562  1.00 64.17  ? 338 ALA A O     1 
ATOM   636  C  CB    . ALA A 1 84  ? 61.958 28.762 28.311  1.00 72.67  ? 338 ALA A CB    1 
ATOM   637  N  N     . ALA A 1 85  ? 59.305 27.341 26.881  1.00 67.44  ? 339 ALA A N     1 
ATOM   638  C  CA    . ALA A 1 85  ? 58.008 27.737 26.399  1.00 67.26  ? 339 ALA A CA    1 
ATOM   639  C  C     . ALA A 1 85  ? 57.290 28.312 27.638  1.00 68.68  ? 339 ALA A C     1 
ATOM   640  O  O     . ALA A 1 85  ? 57.766 28.220 28.805  1.00 61.70  ? 339 ALA A O     1 
ATOM   641  C  CB    . ALA A 1 85  ? 57.254 26.537 25.836  1.00 68.88  ? 339 ALA A CB    1 
ATOM   642  N  N     . SER A 1 86  ? 56.143 28.897 27.379  1.00 64.83  ? 340 SER A N     1 
ATOM   643  C  CA    . SER A 1 86  ? 55.388 29.635 28.409  1.00 70.38  ? 340 SER A CA    1 
ATOM   644  C  C     . SER A 1 86  ? 54.909 28.745 29.587  1.00 68.39  ? 340 SER A C     1 
ATOM   645  O  O     . SER A 1 86  ? 54.836 29.230 30.702  1.00 74.19  ? 340 SER A O     1 
ATOM   646  C  CB    . SER A 1 86  ? 54.208 30.389 27.766  1.00 65.97  ? 340 SER A CB    1 
ATOM   647  O  OG    . SER A 1 86  ? 53.358 29.472 27.076  1.00 71.27  ? 340 SER A OG    1 
ATOM   648  N  N     . ILE A 1 87  ? 54.630 27.456 29.351  1.00 63.73  ? 341 ILE A N     1 
ATOM   649  C  CA    . ILE A 1 87  ? 54.078 26.577 30.388  1.00 61.58  ? 341 ILE A CA    1 
ATOM   650  C  C     . ILE A 1 87  ? 54.841 25.248 30.441  1.00 65.16  ? 341 ILE A C     1 
ATOM   651  O  O     . ILE A 1 87  ? 54.238 24.235 30.681  1.00 62.72  ? 341 ILE A O     1 
ATOM   652  C  CB    . ILE A 1 87  ? 52.585 26.251 30.107  1.00 64.48  ? 341 ILE A CB    1 
ATOM   653  C  CG1   . ILE A 1 87  ? 52.379 25.694 28.689  1.00 67.92  ? 341 ILE A CG1   1 
ATOM   654  C  CG2   . ILE A 1 87  ? 51.707 27.477 30.216  1.00 65.48  ? 341 ILE A CG2   1 
ATOM   655  C  CD1   . ILE A 1 87  ? 50.976 25.166 28.466  1.00 64.24  ? 341 ILE A CD1   1 
ATOM   656  N  N     . GLY A 1 88  ? 56.150 25.258 30.172  1.00 70.19  ? 342 GLY A N     1 
ATOM   657  C  CA    . GLY A 1 88  ? 56.942 24.032 29.918  1.00 67.71  ? 342 GLY A CA    1 
ATOM   658  C  C     . GLY A 1 88  ? 58.266 24.261 29.174  1.00 67.27  ? 342 GLY A C     1 
ATOM   659  O  O     . GLY A 1 88  ? 58.787 25.373 29.200  1.00 65.15  ? 342 GLY A O     1 
ATOM   660  N  N     . GLN A 1 89  ? 58.819 23.215 28.521  1.00 62.12  ? 343 GLN A N     1 
ATOM   661  C  CA    . GLN A 1 89  ? 60.144 23.292 27.901  1.00 60.44  ? 343 GLN A CA    1 
ATOM   662  C  C     . GLN A 1 89  ? 60.145 22.481 26.673  1.00 62.96  ? 343 GLN A C     1 
ATOM   663  O  O     . GLN A 1 89  ? 59.283 21.605 26.489  1.00 66.77  ? 343 GLN A O     1 
ATOM   664  C  CB    . GLN A 1 89  ? 61.279 22.752 28.784  1.00 70.32  ? 343 GLN A CB    1 
ATOM   665  C  CG    . GLN A 1 89  ? 60.909 22.394 30.222  1.00 71.56  ? 343 GLN A CG    1 
ATOM   666  C  CD    . GLN A 1 89  ? 62.112 22.012 31.112  1.00 81.86  ? 343 GLN A CD    1 
ATOM   667  O  OE1   . GLN A 1 89  ? 62.732 20.956 30.931  1.00 79.88  ? 343 GLN A OE1   1 
ATOM   668  N  NE2   . GLN A 1 89  ? 62.407 22.855 32.109  1.00 82.67  ? 343 GLN A NE2   1 
ATOM   669  N  N     . VAL A 1 90  ? 61.118 22.770 25.814  1.00 60.79  ? 344 VAL A N     1 
ATOM   670  C  CA    . VAL A 1 90  ? 61.224 22.034 24.587  1.00 64.82  ? 344 VAL A CA    1 
ATOM   671  C  C     . VAL A 1 90  ? 62.547 21.300 24.520  1.00 64.34  ? 344 VAL A C     1 
ATOM   672  O  O     . VAL A 1 90  ? 63.607 21.912 24.709  1.00 62.24  ? 344 VAL A O     1 
ATOM   673  C  CB    . VAL A 1 90  ? 61.083 22.947 23.348  1.00 68.29  ? 344 VAL A CB    1 
ATOM   674  C  CG1   . VAL A 1 90  ? 60.968 22.095 22.085  1.00 65.81  ? 344 VAL A CG1   1 
ATOM   675  C  CG2   . VAL A 1 90  ? 59.885 23.923 23.496  1.00 67.68  ? 344 VAL A CG2   1 
ATOM   676  N  N     . HIS A 1 91  ? 62.494 20.008 24.197  1.00 61.25  ? 345 HIS A N     1 
ATOM   677  C  CA    . HIS A 1 91  ? 63.704 19.140 24.191  1.00 57.84  ? 345 HIS A CA    1 
ATOM   678  C  C     . HIS A 1 91  ? 63.901 18.585 22.778  1.00 59.73  ? 345 HIS A C     1 
ATOM   679  O  O     . HIS A 1 91  ? 62.933 18.152 22.122  1.00 56.95  ? 345 HIS A O     1 
ATOM   680  C  CB    . HIS A 1 91  ? 63.495 17.973 25.222  1.00 62.46  ? 345 HIS A CB    1 
ATOM   681  C  CG    . HIS A 1 91  ? 63.503 18.410 26.667  1.00 60.29  ? 345 HIS A CG    1 
ATOM   682  N  ND1   . HIS A 1 91  ? 64.618 18.316 27.471  1.00 64.25  ? 345 HIS A ND1   1 
ATOM   683  C  CD2   . HIS A 1 91  ? 62.535 18.941 27.440  1.00 61.50  ? 345 HIS A CD2   1 
ATOM   684  C  CE1   . HIS A 1 91  ? 64.342 18.817 28.667  1.00 66.42  ? 345 HIS A CE1   1 
ATOM   685  N  NE2   . HIS A 1 91  ? 63.085 19.209 28.671  1.00 62.19  ? 345 HIS A NE2   1 
ATOM   686  N  N     . LEU A 1 92  ? 65.147 18.571 22.302  1.00 63.98  ? 346 LEU A N     1 
ATOM   687  C  CA    . LEU A 1 92  ? 65.487 17.905 21.053  1.00 65.50  ? 346 LEU A CA    1 
ATOM   688  C  C     . LEU A 1 92  ? 65.540 16.418 21.345  1.00 68.64  ? 346 LEU A C     1 
ATOM   689  O  O     . LEU A 1 92  ? 65.953 16.001 22.438  1.00 62.91  ? 346 LEU A O     1 
ATOM   690  C  CB    . LEU A 1 92  ? 66.835 18.338 20.534  1.00 74.43  ? 346 LEU A CB    1 
ATOM   691  C  CG    . LEU A 1 92  ? 66.895 19.863 20.397  1.00 83.20  ? 346 LEU A CG    1 
ATOM   692  C  CD1   . LEU A 1 92  ? 68.289 20.384 20.055  1.00 88.34  ? 346 LEU A CD1   1 
ATOM   693  C  CD2   . LEU A 1 92  ? 65.888 20.276 19.334  1.00 87.84  ? 346 LEU A CD2   1 
ATOM   694  N  N     . ALA A 1 93  ? 65.103 15.648 20.358  1.00 64.23  ? 347 ALA A N     1 
ATOM   695  C  CA    . ALA A 1 93  ? 65.186 14.197 20.379  1.00 69.57  ? 347 ALA A CA    1 
ATOM   696  C  C     . ALA A 1 93  ? 65.484 13.730 18.994  1.00 66.57  ? 347 ALA A C     1 
ATOM   697  O  O     . ALA A 1 93  ? 65.368 14.471 18.014  1.00 63.86  ? 347 ALA A O     1 
ATOM   698  C  CB    . ALA A 1 93  ? 63.876 13.577 20.872  1.00 70.27  ? 347 ALA A CB    1 
ATOM   699  N  N     . ARG A 1 94  ? 65.898 12.492 18.895  1.00 73.24  ? 348 ARG A N     1 
ATOM   700  C  CA    . ARG A 1 94  ? 66.024 11.866 17.573  1.00 74.29  ? 348 ARG A CA    1 
ATOM   701  C  C     . ARG A 1 94  ? 65.292 10.556 17.653  1.00 74.34  ? 348 ARG A C     1 
ATOM   702  O  O     . ARG A 1 94  ? 65.549 9.733  18.533  1.00 78.17  ? 348 ARG A O     1 
ATOM   703  C  CB    . ARG A 1 94  ? 67.480 11.642 17.167  1.00 71.00  ? 348 ARG A CB    1 
ATOM   704  C  CG    . ARG A 1 94  ? 67.603 11.317 15.672  1.00 79.13  ? 348 ARG A CG    1 
ATOM   705  C  CD    . ARG A 1 94  ? 69.023 11.002 15.178  1.00 82.62  ? 348 ARG A CD    1 
ATOM   706  N  NE    . ARG A 1 94  ? 69.951 11.661 16.033  1.00 81.58  ? 348 ARG A NE    1 
ATOM   707  C  CZ    . ARG A 1 94  ? 70.704 11.110 16.973  1.00 80.67  ? 348 ARG A CZ    1 
ATOM   708  N  NH1   . ARG A 1 94  ? 70.790 9.796  17.163  1.00 84.27  ? 348 ARG A NH1   1 
ATOM   709  N  NH2   . ARG A 1 94  ? 71.391 11.934 17.733  1.00 69.64  ? 348 ARG A NH2   1 
HETATM 710  N  N     . MSE A 1 95  ? 64.387 10.371 16.713  1.00 77.27  ? 349 MSE A N     1 
HETATM 711  C  CA    . MSE A 1 95  ? 63.618 9.126  16.605  1.00 77.50  ? 349 MSE A CA    1 
HETATM 712  C  C     . MSE A 1 95  ? 64.426 8.023  15.944  1.00 77.60  ? 349 MSE A C     1 
HETATM 713  O  O     . MSE A 1 95  ? 65.331 8.290  15.150  1.00 68.52  ? 349 MSE A O     1 
HETATM 714  C  CB    . MSE A 1 95  ? 62.385 9.387  15.798  1.00 73.57  ? 349 MSE A CB    1 
HETATM 715  C  CG    . MSE A 1 95  ? 61.565 10.461 16.556  1.00 79.20  ? 349 MSE A CG    1 
HETATM 716  SE SE    . MSE A 1 95  ? 59.837 10.355 15.692  1.00 94.84  ? 349 MSE A SE    1 
HETATM 717  C  CE    . MSE A 1 95  ? 60.350 10.781 13.876  1.00 92.27  ? 349 MSE A CE    1 
ATOM   718  N  N     . LYS A 1 96  ? 64.036 6.790  16.251  1.00 76.43  ? 350 LYS A N     1 
ATOM   719  C  CA    . LYS A 1 96  ? 64.729 5.600  15.823  1.00 81.93  ? 350 LYS A CA    1 
ATOM   720  C  C     . LYS A 1 96  ? 65.354 5.661  14.416  1.00 82.39  ? 350 LYS A C     1 
ATOM   721  O  O     . LYS A 1 96  ? 66.554 5.424  14.297  1.00 85.98  ? 350 LYS A O     1 
ATOM   722  C  CB    . LYS A 1 96  ? 63.871 4.358  16.023  1.00 84.34  ? 350 LYS A CB    1 
ATOM   723  C  CG    . LYS A 1 96  ? 64.675 3.174  16.516  1.00 89.20  ? 350 LYS A CG    1 
ATOM   724  C  CD    . LYS A 1 96  ? 65.023 3.292  17.981  1.00 89.62  ? 350 LYS A CD    1 
ATOM   725  C  CE    . LYS A 1 96  ? 65.475 1.965  18.558  1.00 90.35  ? 350 LYS A CE    1 
ATOM   726  N  NZ    . LYS A 1 96  ? 64.675 1.629  19.758  1.00 86.17  ? 350 LYS A NZ    1 
ATOM   727  N  N     . GLY A 1 97  ? 64.641 6.051  13.365  1.00 78.04  ? 351 GLY A N     1 
ATOM   728  C  CA    . GLY A 1 97  ? 65.343 6.124  12.047  1.00 78.96  ? 351 GLY A CA    1 
ATOM   729  C  C     . GLY A 1 97  ? 66.431 7.179  11.800  1.00 80.27  ? 351 GLY A C     1 
ATOM   730  O  O     . GLY A 1 97  ? 67.096 7.138  10.790  1.00 80.64  ? 351 GLY A O     1 
ATOM   731  N  N     . GLY A 1 98  ? 66.583 8.142  12.714  1.00 82.52  ? 352 GLY A N     1 
ATOM   732  C  CA    . GLY A 1 98  ? 67.378 9.365  12.512  1.00 83.32  ? 352 GLY A CA    1 
ATOM   733  C  C     . GLY A 1 98  ? 66.537 10.667 12.462  1.00 82.40  ? 352 GLY A C     1 
ATOM   734  O  O     . GLY A 1 98  ? 67.110 11.732 12.322  1.00 75.74  ? 352 GLY A O     1 
ATOM   735  N  N     . ARG A 1 99  ? 65.199 10.619 12.534  1.00 74.68  ? 353 ARG A N     1 
ATOM   736  C  CA    . ARG A 1 99  ? 64.423 11.858 12.279  1.00 74.78  ? 353 ARG A CA    1 
ATOM   737  C  C     . ARG A 1 99  ? 64.433 12.689 13.548  1.00 67.90  ? 353 ARG A C     1 
ATOM   738  O  O     . ARG A 1 99  ? 64.072 12.185 14.601  1.00 75.53  ? 353 ARG A O     1 
ATOM   739  C  CB    . ARG A 1 99  ? 62.992 11.584 11.815  1.00 75.87  ? 353 ARG A CB    1 
ATOM   740  C  CG    . ARG A 1 99  ? 62.226 12.810 11.256  1.00 80.03  ? 353 ARG A CG    1 
ATOM   741  C  CD    . ARG A 1 99  ? 60.728 12.552 11.267  1.00 77.40  ? 353 ARG A CD    1 
ATOM   742  N  NE    . ARG A 1 99  ? 59.900 13.473 10.477  1.00 78.56  ? 353 ARG A NE    1 
ATOM   743  C  CZ    . ARG A 1 99  ? 58.562 13.390 10.451  1.00 81.06  ? 353 ARG A CZ    1 
ATOM   744  N  NH1   . ARG A 1 99  ? 57.891 12.475 11.168  1.00 79.48  ? 353 ARG A NH1   1 
ATOM   745  N  NH2   . ARG A 1 99  ? 57.865 14.222 9.709   1.00 85.21  ? 353 ARG A NH2   1 
ATOM   746  N  N     . GLU A 1 100 ? 64.912 13.908 13.418  1.00 59.29  ? 354 GLU A N     1 
ATOM   747  C  CA    . GLU A 1 100 ? 65.034 14.903 14.485  1.00 66.08  ? 354 GLU A CA    1 
ATOM   748  C  C     . GLU A 1 100 ? 63.731 15.582 14.787  1.00 61.73  ? 354 GLU A C     1 
ATOM   749  O  O     . GLU A 1 100 ? 62.985 16.020 13.888  1.00 64.91  ? 354 GLU A O     1 
ATOM   750  C  CB    . GLU A 1 100 ? 66.060 16.002 14.092  1.00 69.10  ? 354 GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 100 ? 67.500 15.454 14.040  1.00 72.64  ? 354 GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 100 ? 68.551 16.518 13.769  1.00 75.35  ? 354 GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 100 ? 69.159 16.496 12.687  1.00 83.62  ? 354 GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 100 ? 68.789 17.390 14.624  1.00 78.92  ? 354 GLU A OE2   1 
ATOM   755  N  N     . VAL A 1 101 ? 63.469 15.721 16.063  1.00 61.67  ? 355 VAL A N     1 
ATOM   756  C  CA    . VAL A 1 101 ? 62.225 16.350 16.511  1.00 62.52  ? 355 VAL A CA    1 
ATOM   757  C  C     . VAL A 1 101 ? 62.414 17.307 17.643  1.00 60.13  ? 355 VAL A C     1 
ATOM   758  O  O     . VAL A 1 101 ? 63.451 17.300 18.283  1.00 60.03  ? 355 VAL A O     1 
ATOM   759  C  CB    . VAL A 1 101 ? 61.201 15.271 16.906  1.00 64.37  ? 355 VAL A CB    1 
ATOM   760  C  CG1   . VAL A 1 101 ? 60.820 14.500 15.665  1.00 65.94  ? 355 VAL A CG1   1 
ATOM   761  C  CG2   . VAL A 1 101 ? 61.727 14.297 17.954  1.00 64.22  ? 355 VAL A CG2   1 
ATOM   762  N  N     . ALA A 1 102 ? 61.417 18.166 17.856  1.00 62.63  ? 356 ALA A N     1 
ATOM   763  C  CA    . ALA A 1 102 ? 61.328 19.026 19.060  1.00 56.61  ? 356 ALA A CA    1 
ATOM   764  C  C     . ALA A 1 102 ? 60.089 18.614 19.905  1.00 60.02  ? 356 ALA A C     1 
ATOM   765  O  O     . ALA A 1 102 ? 58.972 18.618 19.394  1.00 54.83  ? 356 ALA A O     1 
ATOM   766  C  CB    . ALA A 1 102 ? 61.284 20.496 18.681  1.00 55.43  ? 356 ALA A CB    1 
HETATM 767  N  N     . MSE A 1 103 ? 60.313 18.213 21.164  1.00 55.43  ? 357 MSE A N     1 
HETATM 768  C  CA    . MSE A 1 103 ? 59.256 17.783 22.007  1.00 59.26  ? 357 MSE A CA    1 
HETATM 769  C  C     . MSE A 1 103 ? 58.957 18.893 22.962  1.00 64.45  ? 357 MSE A C     1 
HETATM 770  O  O     . MSE A 1 103 ? 59.810 19.235 23.790  1.00 59.72  ? 357 MSE A O     1 
HETATM 771  C  CB    . MSE A 1 103 ? 59.657 16.549 22.791  1.00 56.99  ? 357 MSE A CB    1 
HETATM 772  C  CG    . MSE A 1 103 ? 60.031 15.388 21.848  1.00 65.25  ? 357 MSE A CG    1 
HETATM 773  SE SE    . MSE A 1 103 ? 60.480 13.676 22.779  1.00 65.61  ? 357 MSE A SE    1 
HETATM 774  C  CE    . MSE A 1 103 ? 58.727 13.308 23.481  1.00 61.93  ? 357 MSE A CE    1 
ATOM   775  N  N     . LYS A 1 104 ? 57.747 19.454 22.869  1.00 60.67  ? 358 LYS A N     1 
ATOM   776  C  CA    . LYS A 1 104 ? 57.336 20.487 23.798  1.00 61.15  ? 358 LYS A CA    1 
ATOM   777  C  C     . LYS A 1 104 ? 56.573 19.869 24.962  1.00 60.18  ? 358 LYS A C     1 
ATOM   778  O  O     . LYS A 1 104 ? 55.513 19.297 24.770  1.00 59.07  ? 358 LYS A O     1 
ATOM   779  C  CB    . LYS A 1 104 ? 56.460 21.487 23.090  1.00 58.79  ? 358 LYS A CB    1 
ATOM   780  C  CG    . LYS A 1 104 ? 56.498 22.802 23.795  1.00 64.80  ? 358 LYS A CG    1 
ATOM   781  C  CD    . LYS A 1 104 ? 55.220 23.557 23.639  1.00 67.17  ? 358 LYS A CD    1 
ATOM   782  C  CE    . LYS A 1 104 ? 55.198 24.513 22.504  1.00 65.14  ? 358 LYS A CE    1 
ATOM   783  N  NZ    . LYS A 1 104 ? 53.819 24.790 21.963  1.00 58.89  ? 358 LYS A NZ    1 
ATOM   784  N  N     . ILE A 1 105 ? 57.081 19.993 26.171  1.00 56.38  ? 359 ILE A N     1 
ATOM   785  C  CA    . ILE A 1 105 ? 56.526 19.208 27.278  1.00 57.17  ? 359 ILE A CA    1 
ATOM   786  C  C     . ILE A 1 105 ? 56.017 20.157 28.324  1.00 57.58  ? 359 ILE A C     1 
ATOM   787  O  O     . ILE A 1 105 ? 56.749 21.042 28.702  1.00 57.38  ? 359 ILE A O     1 
ATOM   788  C  CB    . ILE A 1 105 ? 57.614 18.320 27.911  1.00 58.58  ? 359 ILE A CB    1 
ATOM   789  C  CG1   . ILE A 1 105 ? 58.247 17.413 26.842  1.00 61.43  ? 359 ILE A CG1   1 
ATOM   790  C  CG2   . ILE A 1 105 ? 56.995 17.411 28.967  1.00 61.56  ? 359 ILE A CG2   1 
ATOM   791  C  CD1   . ILE A 1 105 ? 59.573 16.834 27.220  1.00 61.69  ? 359 ILE A CD1   1 
ATOM   792  N  N     . GLN A 1 106 ? 54.784 20.008 28.798  1.00 61.44  ? 360 GLN A N     1 
ATOM   793  C  CA    . GLN A 1 106 ? 54.321 20.938 29.867  1.00 65.90  ? 360 GLN A CA    1 
ATOM   794  C  C     . GLN A 1 106 ? 54.878 20.585 31.228  1.00 69.55  ? 360 GLN A C     1 
ATOM   795  O  O     . GLN A 1 106 ? 55.092 19.407 31.507  1.00 73.72  ? 360 GLN A O     1 
ATOM   796  C  CB    . GLN A 1 106 ? 52.817 20.897 30.011  1.00 65.69  ? 360 GLN A CB    1 
ATOM   797  C  CG    . GLN A 1 106 ? 52.043 21.289 28.783  1.00 66.11  ? 360 GLN A CG    1 
ATOM   798  C  CD    . GLN A 1 106 ? 50.579 21.365 29.061  1.00 63.99  ? 360 GLN A CD    1 
ATOM   799  O  OE1   . GLN A 1 106 ? 50.158 21.324 30.215  1.00 70.95  ? 360 GLN A OE1   1 
ATOM   800  N  NE2   . GLN A 1 106 ? 49.791 21.438 28.024  1.00 63.14  ? 360 GLN A NE2   1 
ATOM   801  N  N     . TYR A 1 107 ? 55.060 21.589 32.091  1.00 72.79  ? 361 TYR A N     1 
ATOM   802  C  CA    . TYR A 1 107 ? 55.184 21.326 33.544  1.00 74.93  ? 361 TYR A CA    1 
ATOM   803  C  C     . TYR A 1 107 ? 53.941 20.548 34.005  1.00 73.08  ? 361 TYR A C     1 
ATOM   804  O  O     . TYR A 1 107 ? 52.848 20.752 33.472  1.00 67.90  ? 361 TYR A O     1 
ATOM   805  C  CB    . TYR A 1 107 ? 55.329 22.629 34.363  1.00 77.51  ? 361 TYR A CB    1 
ATOM   806  C  CG    . TYR A 1 107 ? 56.471 23.507 33.907  1.00 77.56  ? 361 TYR A CG    1 
ATOM   807  C  CD1   . TYR A 1 107 ? 57.765 23.013 33.871  1.00 80.98  ? 361 TYR A CD1   1 
ATOM   808  C  CD2   . TYR A 1 107 ? 56.268 24.842 33.504  1.00 85.31  ? 361 TYR A CD2   1 
ATOM   809  C  CE1   . TYR A 1 107 ? 58.834 23.789 33.429  1.00 85.62  ? 361 TYR A CE1   1 
ATOM   810  C  CE2   . TYR A 1 107 ? 57.340 25.641 33.071  1.00 85.71  ? 361 TYR A CE2   1 
ATOM   811  C  CZ    . TYR A 1 107 ? 58.621 25.109 33.039  1.00 86.36  ? 361 TYR A CZ    1 
ATOM   812  O  OH    . TYR A 1 107 ? 59.699 25.863 32.629  1.00 89.94  ? 361 TYR A OH    1 
ATOM   813  N  N     . PRO A 1 108 ? 54.090 19.630 34.972  1.00 79.85  ? 362 PRO A N     1 
ATOM   814  C  CA    . PRO A 1 108 ? 52.868 18.924 35.416  1.00 86.49  ? 362 PRO A CA    1 
ATOM   815  C  C     . PRO A 1 108 ? 51.829 19.862 36.069  1.00 85.59  ? 362 PRO A C     1 
ATOM   816  O  O     . PRO A 1 108 ? 52.218 20.842 36.703  1.00 81.83  ? 362 PRO A O     1 
ATOM   817  C  CB    . PRO A 1 108 ? 53.397 17.913 36.448  1.00 83.36  ? 362 PRO A CB    1 
ATOM   818  C  CG    . PRO A 1 108 ? 54.833 17.767 36.133  1.00 84.57  ? 362 PRO A CG    1 
ATOM   819  C  CD    . PRO A 1 108 ? 55.282 19.128 35.670  1.00 82.80  ? 362 PRO A CD    1 
ATOM   820  N  N     . GLY A 1 109 ? 50.541 19.562 35.877  1.00 86.00  ? 363 GLY A N     1 
ATOM   821  C  CA    . GLY A 1 109 ? 49.442 20.264 36.547  1.00 81.39  ? 363 GLY A CA    1 
ATOM   822  C  C     . GLY A 1 109 ? 49.258 21.735 36.222  1.00 81.81  ? 363 GLY A C     1 
ATOM   823  O  O     . GLY A 1 109 ? 48.779 22.523 37.065  1.00 76.13  ? 363 GLY A O     1 
ATOM   824  N  N     . VAL A 1 110 ? 49.599 22.103 34.988  1.00 76.49  ? 364 VAL A N     1 
ATOM   825  C  CA    . VAL A 1 110 ? 49.476 23.505 34.544  1.00 69.67  ? 364 VAL A CA    1 
ATOM   826  C  C     . VAL A 1 110 ? 48.010 23.994 34.501  1.00 68.30  ? 364 VAL A C     1 
ATOM   827  O  O     . VAL A 1 110 ? 47.689 25.055 35.046  1.00 72.41  ? 364 VAL A O     1 
ATOM   828  C  CB    . VAL A 1 110 ? 50.189 23.698 33.194  1.00 68.48  ? 364 VAL A CB    1 
ATOM   829  C  CG1   . VAL A 1 110 ? 49.560 24.792 32.357  1.00 74.63  ? 364 VAL A CG1   1 
ATOM   830  C  CG2   . VAL A 1 110 ? 51.605 24.100 33.462  1.00 69.77  ? 364 VAL A CG2   1 
ATOM   831  N  N     . ALA A 1 111 ? 47.134 23.221 33.861  1.00 60.91  ? 365 ALA A N     1 
ATOM   832  C  CA    . ALA A 1 111 ? 45.707 23.560 33.790  1.00 67.48  ? 365 ALA A CA    1 
ATOM   833  C  C     . ALA A 1 111 ? 45.181 23.845 35.160  1.00 68.15  ? 365 ALA A C     1 
ATOM   834  O  O     . ALA A 1 111 ? 44.385 24.768 35.372  1.00 72.52  ? 365 ALA A O     1 
ATOM   835  C  CB    . ALA A 1 111 ? 44.860 22.427 33.165  1.00 61.14  ? 365 ALA A CB    1 
ATOM   836  N  N     . GLN A 1 112 ? 45.615 22.999 36.073  1.00 71.03  ? 366 GLN A N     1 
ATOM   837  C  CA    . GLN A 1 112 ? 45.054 22.884 37.374  1.00 71.13  ? 366 GLN A CA    1 
ATOM   838  C  C     . GLN A 1 112 ? 45.478 24.074 38.219  1.00 68.81  ? 366 GLN A C     1 
ATOM   839  O  O     . GLN A 1 112 ? 44.764 24.444 39.123  1.00 73.48  ? 366 GLN A O     1 
ATOM   840  C  CB    . GLN A 1 112 ? 45.596 21.586 37.998  1.00 84.11  ? 366 GLN A CB    1 
ATOM   841  C  CG    . GLN A 1 112 ? 44.820 21.089 39.204  1.00 90.35  ? 366 GLN A CG    1 
ATOM   842  C  CD    . GLN A 1 112 ? 43.432 20.661 38.818  1.00 95.61  ? 366 GLN A CD    1 
ATOM   843  O  OE1   . GLN A 1 112 ? 43.245 20.047 37.771  1.00 98.73  ? 366 GLN A OE1   1 
ATOM   844  N  NE2   . GLN A 1 112 ? 42.441 21.016 39.642  1.00 100.34 ? 366 GLN A NE2   1 
ATOM   845  N  N     . SER A 1 113 ? 46.646 24.655 37.977  1.00 61.99  ? 367 SER A N     1 
ATOM   846  C  CA    . SER A 1 113 ? 47.048 25.825 38.771  1.00 64.76  ? 367 SER A CA    1 
ATOM   847  C  C     . SER A 1 113 ? 46.745 27.234 38.141  1.00 60.02  ? 367 SER A C     1 
ATOM   848  O  O     . SER A 1 113 ? 47.164 28.276 38.669  1.00 62.00  ? 367 SER A O     1 
ATOM   849  C  CB    . SER A 1 113 ? 48.506 25.663 39.226  1.00 63.20  ? 367 SER A CB    1 
ATOM   850  O  OG    . SER A 1 113 ? 49.286 25.253 38.171  1.00 66.19  ? 367 SER A OG    1 
ATOM   851  N  N     . ILE A 1 114 ? 45.960 27.272 37.065  1.00 59.32  ? 368 ILE A N     1 
ATOM   852  C  CA    . ILE A 1 114 ? 45.615 28.528 36.407  1.00 58.95  ? 368 ILE A CA    1 
ATOM   853  C  C     . ILE A 1 114 ? 45.054 29.559 37.394  1.00 58.97  ? 368 ILE A C     1 
ATOM   854  O  O     . ILE A 1 114 ? 45.540 30.704 37.457  1.00 53.84  ? 368 ILE A O     1 
ATOM   855  C  CB    . ILE A 1 114 ? 44.611 28.282 35.250  1.00 60.37  ? 368 ILE A CB    1 
ATOM   856  C  CG1   . ILE A 1 114 ? 45.374 27.672 34.053  1.00 59.00  ? 368 ILE A CG1   1 
ATOM   857  C  CG2   . ILE A 1 114 ? 43.905 29.582 34.894  1.00 65.37  ? 368 ILE A CG2   1 
ATOM   858  C  CD1   . ILE A 1 114 ? 44.558 27.261 32.851  1.00 56.66  ? 368 ILE A CD1   1 
ATOM   859  N  N     . ASN A 1 115 ? 44.101 29.123 38.199  1.00 59.97  ? 369 ASN A N     1 
ATOM   860  C  CA    . ASN A 1 115 ? 43.363 30.009 39.112  1.00 66.99  ? 369 ASN A CA    1 
ATOM   861  C  C     . ASN A 1 115 ? 44.250 30.582 40.178  1.00 66.26  ? 369 ASN A C     1 
ATOM   862  O  O     . ASN A 1 115 ? 44.295 31.783 40.355  1.00 64.41  ? 369 ASN A O     1 
ATOM   863  C  CB    . ASN A 1 115 ? 42.154 29.303 39.742  1.00 66.10  ? 369 ASN A CB    1 
ATOM   864  C  CG    . ASN A 1 115 ? 40.951 29.335 38.831  1.00 67.39  ? 369 ASN A CG    1 
ATOM   865  O  OD1   . ASN A 1 115 ? 40.997 29.923 37.770  1.00 69.70  ? 369 ASN A OD1   1 
ATOM   866  N  ND2   . ASN A 1 115 ? 39.852 28.742 39.260  1.00 72.00  ? 369 ASN A ND2   1 
ATOM   867  N  N     . SER A 1 116 ? 45.011 29.713 40.808  1.00 69.87  ? 370 SER A N     1 
ATOM   868  C  CA    . SER A 1 116 ? 45.996 30.117 41.819  1.00 71.18  ? 370 SER A CA    1 
ATOM   869  C  C     . SER A 1 116 ? 47.127 31.035 41.230  1.00 67.40  ? 370 SER A C     1 
ATOM   870  O  O     . SER A 1 116 ? 47.473 32.040 41.805  1.00 63.79  ? 370 SER A O     1 
ATOM   871  C  CB    . SER A 1 116 ? 46.632 28.852 42.436  1.00 72.00  ? 370 SER A CB    1 
ATOM   872  O  OG    . SER A 1 116 ? 47.245 29.148 43.677  1.00 74.88  ? 370 SER A OG    1 
ATOM   873  N  N     . ASP A 1 117 ? 47.702 30.647 40.105  1.00 59.28  ? 371 ASP A N     1 
ATOM   874  C  CA    . ASP A 1 117 ? 48.728 31.448 39.489  1.00 64.84  ? 371 ASP A CA    1 
ATOM   875  C  C     . ASP A 1 117 ? 48.270 32.881 39.087  1.00 57.50  ? 371 ASP A C     1 
ATOM   876  O  O     . ASP A 1 117 ? 49.033 33.857 39.218  1.00 55.13  ? 371 ASP A O     1 
ATOM   877  C  CB    . ASP A 1 117 ? 49.263 30.708 38.249  1.00 69.56  ? 371 ASP A CB    1 
ATOM   878  C  CG    . ASP A 1 117 ? 50.230 29.520 38.580  1.00 71.17  ? 371 ASP A CG    1 
ATOM   879  O  OD1   . ASP A 1 117 ? 50.684 29.313 39.718  1.00 73.90  ? 371 ASP A OD1   1 
ATOM   880  O  OD2   . ASP A 1 117 ? 50.570 28.807 37.607  1.00 78.52  ? 371 ASP A OD2   1 
ATOM   881  N  N     . VAL A 1 118 ? 47.051 32.998 38.583  1.00 59.14  ? 372 VAL A N     1 
ATOM   882  C  CA    . VAL A 1 118 ? 46.478 34.301 38.203  1.00 58.19  ? 372 VAL A CA    1 
ATOM   883  C  C     . VAL A 1 118 ? 46.246 35.185 39.434  1.00 60.33  ? 372 VAL A C     1 
ATOM   884  O  O     . VAL A 1 118 ? 46.509 36.396 39.426  1.00 61.18  ? 372 VAL A O     1 
ATOM   885  C  CB    . VAL A 1 118 ? 45.159 34.134 37.386  1.00 57.31  ? 372 VAL A CB    1 
ATOM   886  C  CG1   . VAL A 1 118 ? 44.345 35.465 37.286  1.00 60.39  ? 372 VAL A CG1   1 
ATOM   887  C  CG2   . VAL A 1 118 ? 45.492 33.603 35.984  1.00 59.82  ? 372 VAL A CG2   1 
ATOM   888  N  N     . ASN A 1 119 ? 45.726 34.574 40.474  1.00 57.80  ? 373 ASN A N     1 
ATOM   889  C  CA    . ASN A 1 119 ? 45.530 35.252 41.716  1.00 59.77  ? 373 ASN A CA    1 
ATOM   890  C  C     . ASN A 1 119 ? 46.801 35.830 42.278  1.00 59.77  ? 373 ASN A C     1 
ATOM   891  O  O     . ASN A 1 119 ? 46.839 37.017 42.572  1.00 59.76  ? 373 ASN A O     1 
ATOM   892  C  CB    . ASN A 1 119 ? 44.815 34.323 42.726  1.00 67.04  ? 373 ASN A CB    1 
ATOM   893  C  CG    . ASN A 1 119 ? 43.294 34.438 42.626  1.00 76.71  ? 373 ASN A CG    1 
ATOM   894  O  OD1   . ASN A 1 119 ? 42.726 35.120 41.725  1.00 87.56  ? 373 ASN A OD1   1 
ATOM   895  N  ND2   . ASN A 1 119 ? 42.625 33.834 43.563  1.00 91.89  ? 373 ASN A ND2   1 
ATOM   896  N  N     . ASN A 1 120 ? 47.839 34.997 42.343  1.00 57.54  ? 374 ASN A N     1 
ATOM   897  C  CA    . ASN A 1 120 ? 49.163 35.422 42.749  1.00 59.82  ? 374 ASN A CA    1 
ATOM   898  C  C     . ASN A 1 120 ? 49.800 36.501 41.909  1.00 57.26  ? 374 ASN A C     1 
ATOM   899  O  O     . ASN A 1 120 ? 50.365 37.395 42.427  1.00 58.95  ? 374 ASN A O     1 
ATOM   900  C  CB    . ASN A 1 120 ? 50.128 34.272 42.751  1.00 66.14  ? 374 ASN A CB    1 
ATOM   901  C  CG    . ASN A 1 120 ? 51.401 34.616 43.475  1.00 72.20  ? 374 ASN A CG    1 
ATOM   902  O  OD1   . ASN A 1 120 ? 51.400 35.388 44.449  1.00 78.69  ? 374 ASN A OD1   1 
ATOM   903  N  ND2   . ASN A 1 120 ? 52.488 34.068 43.011  1.00 76.96  ? 374 ASN A ND2   1 
ATOM   904  N  N     . LEU A 1 121 ? 49.674 36.415 40.605  1.00 59.00  ? 375 LEU A N     1 
ATOM   905  C  CA    . LEU A 1 121 ? 50.083 37.487 39.732  1.00 57.41  ? 375 LEU A CA    1 
ATOM   906  C  C     . LEU A 1 121 ? 49.386 38.814 40.005  1.00 59.71  ? 375 LEU A C     1 
ATOM   907  O  O     . LEU A 1 121 ? 50.044 39.878 39.899  1.00 58.70  ? 375 LEU A O     1 
ATOM   908  C  CB    . LEU A 1 121 ? 49.792 37.095 38.281  1.00 53.79  ? 375 LEU A CB    1 
ATOM   909  C  CG    . LEU A 1 121 ? 49.957 38.132 37.176  1.00 54.77  ? 375 LEU A CG    1 
ATOM   910  C  CD1   . LEU A 1 121 ? 51.424 38.531 37.071  1.00 54.78  ? 375 LEU A CD1   1 
ATOM   911  C  CD2   . LEU A 1 121 ? 49.466 37.606 35.844  1.00 58.14  ? 375 LEU A CD2   1 
HETATM 912  N  N     . MSE A 1 122 ? 48.044 38.783 40.180  1.00 56.72  ? 376 MSE A N     1 
HETATM 913  C  CA    . MSE A 1 122 ? 47.262 40.032 40.434  1.00 56.77  ? 376 MSE A CA    1 
HETATM 914  C  C     . MSE A 1 122 ? 47.749 40.562 41.784  1.00 56.41  ? 376 MSE A C     1 
HETATM 915  O  O     . MSE A 1 122 ? 47.952 41.722 41.936  1.00 54.69  ? 376 MSE A O     1 
HETATM 916  C  CB    . MSE A 1 122 ? 45.737 39.815 40.437  1.00 58.83  ? 376 MSE A CB    1 
HETATM 917  C  CG    . MSE A 1 122 ? 45.169 39.447 39.054  1.00 63.63  ? 376 MSE A CG    1 
HETATM 918  SE SE    . MSE A 1 122 ? 45.561 40.903 37.750  1.00 73.71  ? 376 MSE A SE    1 
HETATM 919  C  CE    . MSE A 1 122 ? 46.698 39.739 36.703  1.00 79.67  ? 376 MSE A CE    1 
ATOM   920  N  N     . ALA A 1 123 ? 48.018 39.670 42.728  1.00 53.41  ? 377 ALA A N     1 
ATOM   921  C  CA    . ALA A 1 123 ? 48.567 40.025 44.012  1.00 58.84  ? 377 ALA A CA    1 
ATOM   922  C  C     . ALA A 1 123 ? 49.952 40.743 43.908  1.00 63.10  ? 377 ALA A C     1 
ATOM   923  O  O     . ALA A 1 123 ? 50.155 41.804 44.532  1.00 63.33  ? 377 ALA A O     1 
ATOM   924  C  CB    . ALA A 1 123 ? 48.598 38.785 44.921  1.00 54.78  ? 377 ALA A CB    1 
ATOM   925  N  N     . VAL A 1 124 ? 50.856 40.234 43.068  1.00 61.47  ? 378 VAL A N     1 
ATOM   926  C  CA    . VAL A 1 124 ? 52.175 40.840 42.917  1.00 60.79  ? 378 VAL A CA    1 
ATOM   927  C  C     . VAL A 1 124 ? 52.055 42.204 42.279  1.00 61.78  ? 378 VAL A C     1 
ATOM   928  O  O     . VAL A 1 124 ? 52.636 43.184 42.737  1.00 61.67  ? 378 VAL A O     1 
ATOM   929  C  CB    . VAL A 1 124 ? 53.111 39.949 42.091  1.00 63.22  ? 378 VAL A CB    1 
ATOM   930  C  CG1   . VAL A 1 124 ? 54.297 40.752 41.531  1.00 65.56  ? 378 VAL A CG1   1 
ATOM   931  C  CG2   . VAL A 1 124 ? 53.541 38.763 42.947  1.00 65.40  ? 378 VAL A CG2   1 
ATOM   932  N  N     . LEU A 1 125 ? 51.282 42.274 41.228  1.00 57.71  ? 379 LEU A N     1 
ATOM   933  C  CA    . LEU A 1 125 ? 51.011 43.559 40.617  1.00 60.97  ? 379 LEU A CA    1 
ATOM   934  C  C     . LEU A 1 125 ? 50.260 44.538 41.531  1.00 63.57  ? 379 LEU A C     1 
ATOM   935  O  O     . LEU A 1 125 ? 50.512 45.725 41.469  1.00 68.80  ? 379 LEU A O     1 
ATOM   936  C  CB    . LEU A 1 125 ? 50.228 43.347 39.311  1.00 62.18  ? 379 LEU A CB    1 
ATOM   937  C  CG    . LEU A 1 125 ? 50.952 42.536 38.212  1.00 64.81  ? 379 LEU A CG    1 
ATOM   938  C  CD1   . LEU A 1 125 ? 49.959 42.271 37.077  1.00 74.48  ? 379 LEU A CD1   1 
ATOM   939  C  CD2   . LEU A 1 125 ? 52.134 43.293 37.654  1.00 62.42  ? 379 LEU A CD2   1 
ATOM   940  N  N     . ASN A 1 126 ? 49.287 44.076 42.321  1.00 67.68  ? 380 ASN A N     1 
ATOM   941  C  CA    . ASN A 1 126 ? 48.500 44.990 43.161  1.00 63.82  ? 380 ASN A CA    1 
ATOM   942  C  C     . ASN A 1 126 ? 49.500 45.589 44.170  1.00 71.28  ? 380 ASN A C     1 
ATOM   943  O  O     . ASN A 1 126 ? 49.718 46.824 44.206  1.00 70.24  ? 380 ASN A O     1 
ATOM   944  C  CB    . ASN A 1 126 ? 47.381 44.231 43.824  1.00 69.06  ? 380 ASN A CB    1 
ATOM   945  C  CG    . ASN A 1 126 ? 46.641 45.029 44.915  1.00 75.14  ? 380 ASN A CG    1 
ATOM   946  O  OD1   . ASN A 1 126 ? 46.469 46.275 44.847  1.00 76.30  ? 380 ASN A OD1   1 
ATOM   947  N  ND2   . ASN A 1 126 ? 46.157 44.286 45.934  1.00 73.70  ? 380 ASN A ND2   1 
HETATM 948  N  N     . MSE A 1 127 ? 50.199 44.723 44.892  1.00 70.02  ? 381 MSE A N     1 
HETATM 949  C  CA    . MSE A 1 127 ? 51.195 45.177 45.890  1.00 78.57  ? 381 MSE A CA    1 
HETATM 950  C  C     . MSE A 1 127 ? 52.294 46.147 45.425  1.00 78.77  ? 381 MSE A C     1 
HETATM 951  O  O     . MSE A 1 127 ? 52.812 46.914 46.229  1.00 90.67  ? 381 MSE A O     1 
HETATM 952  C  CB    . MSE A 1 127 ? 51.799 43.936 46.540  1.00 82.28  ? 381 MSE A CB    1 
HETATM 953  C  CG    . MSE A 1 127 ? 52.807 44.316 47.627  1.00 92.28  ? 381 MSE A CG    1 
HETATM 954  SE SE    . MSE A 1 127 ? 53.133 42.630 48.545  1.00 109.01 ? 381 MSE A SE    1 
HETATM 955  C  CE    . MSE A 1 127 ? 52.582 41.097 47.400  1.00 88.86  ? 381 MSE A CE    1 
ATOM   956  N  N     . SER A 1 128 ? 52.648 46.140 44.150  1.00 79.91  ? 382 SER A N     1 
ATOM   957  C  CA    . SER A 1 128 ? 53.526 47.150 43.532  1.00 83.93  ? 382 SER A CA    1 
ATOM   958  C  C     . SER A 1 128 ? 52.732 48.280 42.806  1.00 92.00  ? 382 SER A C     1 
ATOM   959  O  O     . SER A 1 128 ? 53.251 48.928 41.893  1.00 88.17  ? 382 SER A O     1 
ATOM   960  C  CB    . SER A 1 128 ? 54.438 46.420 42.546  1.00 87.14  ? 382 SER A CB    1 
ATOM   961  O  OG    . SER A 1 128 ? 55.075 45.304 43.188  1.00 90.21  ? 382 SER A OG    1 
ATOM   962  N  N     . ASN A 1 129 ? 51.501 48.540 43.285  1.00 99.26  ? 383 ASN A N     1 
ATOM   963  C  CA    . ASN A 1 129 ? 50.411 49.357 42.630  1.00 108.34 ? 383 ASN A CA    1 
ATOM   964  C  C     . ASN A 1 129 ? 50.517 49.797 41.148  1.00 116.12 ? 383 ASN A C     1 
ATOM   965  O  O     . ASN A 1 129 ? 50.620 50.999 40.842  1.00 116.45 ? 383 ASN A O     1 
ATOM   966  C  CB    . ASN A 1 129 ? 49.879 50.512 43.558  1.00 107.53 ? 383 ASN A CB    1 
ATOM   967  C  CG    . ASN A 1 129 ? 50.912 51.599 43.877  1.00 104.96 ? 383 ASN A CG    1 
ATOM   968  O  OD1   . ASN A 1 129 ? 50.542 52.700 44.254  1.00 99.77  ? 383 ASN A OD1   1 
ATOM   969  N  ND2   . ASN A 1 129 ? 52.192 51.301 43.725  1.00 109.55 ? 383 ASN A ND2   1 
HETATM 970  N  N     . MSE A 1 130 ? 50.416 48.812 40.243  1.00 120.39 ? 384 MSE A N     1 
HETATM 971  C  CA    . MSE A 1 130 ? 50.351 49.074 38.790  1.00 121.65 ? 384 MSE A CA    1 
HETATM 972  C  C     . MSE A 1 130 ? 49.090 48.471 38.234  1.00 112.99 ? 384 MSE A C     1 
HETATM 973  O  O     . MSE A 1 130 ? 49.101 47.924 37.139  1.00 107.24 ? 384 MSE A O     1 
HETATM 974  C  CB    . MSE A 1 130 ? 51.616 48.686 38.003  1.00 130.66 ? 384 MSE A CB    1 
HETATM 975  C  CG    . MSE A 1 130 ? 52.369 47.435 38.451  1.00 144.29 ? 384 MSE A CG    1 
HETATM 976  SE SE    . MSE A 1 130 ? 54.226 47.952 38.875  1.00 186.30 ? 384 MSE A SE    1 
HETATM 977  C  CE    . MSE A 1 130 ? 55.204 46.233 38.980  1.00 177.86 ? 384 MSE A CE    1 
ATOM   978  N  N     . LEU A 1 131 ? 47.975 48.631 38.950  1.00 104.26 ? 385 LEU A N     1 
ATOM   979  C  CA    . LEU A 1 131 ? 46.685 48.110 38.480  1.00 116.98 ? 385 LEU A CA    1 
ATOM   980  C  C     . LEU A 1 131 ? 45.969 48.922 37.327  1.00 134.30 ? 385 LEU A C     1 
ATOM   981  O  O     . LEU A 1 131 ? 44.977 48.427 36.767  1.00 126.37 ? 385 LEU A O     1 
ATOM   982  C  CB    . LEU A 1 131 ? 45.765 47.733 39.662  1.00 117.03 ? 385 LEU A CB    1 
ATOM   983  C  CG    . LEU A 1 131 ? 46.151 46.424 40.423  1.00 113.07 ? 385 LEU A CG    1 
ATOM   984  C  CD1   . LEU A 1 131 ? 45.442 46.347 41.760  1.00 114.15 ? 385 LEU A CD1   1 
ATOM   985  C  CD2   . LEU A 1 131 ? 45.884 45.129 39.668  1.00 109.73 ? 385 LEU A CD2   1 
ATOM   986  N  N     . PRO A 1 132 ? 46.320 50.187 37.027  1.00 151.06 ? 386 PRO A N     1 
ATOM   987  C  CA    . PRO A 1 132 ? 46.212 51.304 37.952  1.00 145.69 ? 386 PRO A CA    1 
ATOM   988  C  C     . PRO A 1 132 ? 44.846 52.012 37.681  1.00 136.86 ? 386 PRO A C     1 
ATOM   989  O  O     . PRO A 1 132 ? 44.760 53.243 37.712  1.00 137.88 ? 386 PRO A O     1 
ATOM   990  C  CB    . PRO A 1 132 ? 47.439 52.201 37.616  1.00 144.58 ? 386 PRO A CB    1 
ATOM   991  C  CG    . PRO A 1 132 ? 48.218 51.486 36.559  1.00 145.64 ? 386 PRO A CG    1 
ATOM   992  C  CD    . PRO A 1 132 ? 47.283 50.480 35.943  1.00 151.33 ? 386 PRO A CD    1 
ATOM   993  N  N     . GLU A 1 133 ? 43.807 51.229 37.360  1.00 126.55 ? 387 GLU A N     1 
ATOM   994  C  CA    . GLU A 1 133 ? 42.429 51.604 37.658  1.00 131.86 ? 387 GLU A CA    1 
ATOM   995  C  C     . GLU A 1 133 ? 42.296 51.721 39.192  1.00 132.16 ? 387 GLU A C     1 
ATOM   996  O  O     . GLU A 1 133 ? 41.596 52.604 39.692  1.00 116.62 ? 387 GLU A O     1 
ATOM   997  C  CB    . GLU A 1 133 ? 41.429 50.564 37.077  1.00 137.83 ? 387 GLU A CB    1 
ATOM   998  C  CG    . GLU A 1 133 ? 39.920 50.924 37.148  1.00 137.69 ? 387 GLU A CG    1 
ATOM   999  C  CD    . GLU A 1 133 ? 39.293 51.522 35.859  1.00 133.93 ? 387 GLU A CD    1 
ATOM   1000 O  OE1   . GLU A 1 133 ? 39.895 52.401 35.202  1.00 129.42 ? 387 GLU A OE1   1 
ATOM   1001 O  OE2   . GLU A 1 133 ? 38.155 51.140 35.500  1.00 120.13 ? 387 GLU A OE2   1 
ATOM   1002 N  N     . GLY A 1 134 ? 42.983 50.827 39.919  1.00 137.33 ? 388 GLY A N     1 
ATOM   1003 C  CA    . GLY A 1 134 ? 43.046 50.811 41.403  1.00 125.34 ? 388 GLY A CA    1 
ATOM   1004 C  C     . GLY A 1 134 ? 42.531 49.519 42.043  1.00 122.64 ? 388 GLY A C     1 
ATOM   1005 O  O     . GLY A 1 134 ? 42.852 49.216 43.219  1.00 105.21 ? 388 GLY A O     1 
ATOM   1006 N  N     . LEU A 1 135 ? 41.733 48.786 41.243  1.00 112.40 ? 389 LEU A N     1 
ATOM   1007 C  CA    . LEU A 1 135 ? 41.023 47.558 41.602  1.00 103.54 ? 389 LEU A CA    1 
ATOM   1008 C  C     . LEU A 1 135 ? 41.581 46.328 40.854  1.00 96.78  ? 389 LEU A C     1 
ATOM   1009 O  O     . LEU A 1 135 ? 42.513 46.429 40.030  1.00 91.51  ? 389 LEU A O     1 
ATOM   1010 C  CB    . LEU A 1 135 ? 39.522 47.712 41.245  1.00 104.89 ? 389 LEU A CB    1 
ATOM   1011 C  CG    . LEU A 1 135 ? 38.762 48.984 41.678  1.00 102.98 ? 389 LEU A CG    1 
ATOM   1012 C  CD1   . LEU A 1 135 ? 37.243 48.859 41.520  1.00 99.59  ? 389 LEU A CD1   1 
ATOM   1013 C  CD2   . LEU A 1 135 ? 39.134 49.279 43.114  1.00 99.93  ? 389 LEU A CD2   1 
ATOM   1014 N  N     . PHE A 1 136 ? 41.015 45.161 41.163  1.00 88.59  ? 390 PHE A N     1 
ATOM   1015 C  CA    . PHE A 1 136 ? 41.236 43.959 40.365  1.00 83.46  ? 390 PHE A CA    1 
ATOM   1016 C  C     . PHE A 1 136 ? 40.292 44.122 39.178  1.00 82.10  ? 390 PHE A C     1 
ATOM   1017 O  O     . PHE A 1 136 ? 39.074 44.207 39.378  1.00 73.20  ? 390 PHE A O     1 
ATOM   1018 C  CB    . PHE A 1 136 ? 40.887 42.661 41.134  1.00 82.55  ? 390 PHE A CB    1 
ATOM   1019 C  CG    . PHE A 1 136 ? 41.861 42.295 42.240  1.00 76.42  ? 390 PHE A CG    1 
ATOM   1020 C  CD1   . PHE A 1 136 ? 43.238 42.206 42.007  1.00 81.51  ? 390 PHE A CD1   1 
ATOM   1021 C  CD2   . PHE A 1 136 ? 41.397 41.963 43.494  1.00 78.39  ? 390 PHE A CD2   1 
ATOM   1022 C  CE1   . PHE A 1 136 ? 44.133 41.848 43.048  1.00 80.92  ? 390 PHE A CE1   1 
ATOM   1023 C  CE2   . PHE A 1 136 ? 42.274 41.599 44.540  1.00 78.57  ? 390 PHE A CE2   1 
ATOM   1024 C  CZ    . PHE A 1 136 ? 43.638 41.533 44.313  1.00 77.03  ? 390 PHE A CZ    1 
ATOM   1025 N  N     . PRO A 1 137 ? 40.839 44.185 37.945  1.00 80.62  ? 391 PRO A N     1 
ATOM   1026 C  CA    . PRO A 1 137 ? 39.949 44.314 36.785  1.00 74.69  ? 391 PRO A CA    1 
ATOM   1027 C  C     . PRO A 1 137 ? 39.238 42.959 36.465  1.00 73.99  ? 391 PRO A C     1 
ATOM   1028 O  O     . PRO A 1 137 ? 39.843 42.030 35.971  1.00 73.74  ? 391 PRO A O     1 
ATOM   1029 C  CB    . PRO A 1 137 ? 40.905 44.749 35.680  1.00 80.54  ? 391 PRO A CB    1 
ATOM   1030 C  CG    . PRO A 1 137 ? 42.234 44.102 36.050  1.00 85.37  ? 391 PRO A CG    1 
ATOM   1031 C  CD    . PRO A 1 137 ? 42.271 44.043 37.564  1.00 80.54  ? 391 PRO A CD    1 
ATOM   1032 N  N     . GLU A 1 138 ? 37.963 42.848 36.795  1.00 72.80  ? 392 GLU A N     1 
ATOM   1033 C  CA    . GLU A 1 138 ? 37.244 41.575 36.695  1.00 76.64  ? 392 GLU A CA    1 
ATOM   1034 C  C     . GLU A 1 138 ? 37.287 40.984 35.267  1.00 74.16  ? 392 GLU A C     1 
ATOM   1035 O  O     . GLU A 1 138 ? 37.563 39.785 35.071  1.00 67.23  ? 392 GLU A O     1 
ATOM   1036 C  CB    . GLU A 1 138 ? 35.803 41.786 37.190  1.00 78.46  ? 392 GLU A CB    1 
ATOM   1037 C  CG    . GLU A 1 138 ? 34.791 40.646 37.020  1.00 86.35  ? 392 GLU A CG    1 
ATOM   1038 C  CD    . GLU A 1 138 ? 33.894 40.423 38.261  1.00 94.84  ? 392 GLU A CD    1 
ATOM   1039 O  OE1   . GLU A 1 138 ? 33.911 41.271 39.187  1.00 93.26  ? 392 GLU A OE1   1 
ATOM   1040 O  OE2   . GLU A 1 138 ? 33.209 39.372 38.337  1.00 100.78 ? 392 GLU A OE2   1 
ATOM   1041 N  N     . HIS A 1 139 ? 37.017 41.807 34.266  1.00 71.26  ? 393 HIS A N     1 
ATOM   1042 C  CA    . HIS A 1 139 ? 36.886 41.251 32.923  1.00 68.48  ? 393 HIS A CA    1 
ATOM   1043 C  C     . HIS A 1 139 ? 38.266 40.770 32.415  1.00 63.78  ? 393 HIS A C     1 
ATOM   1044 O  O     . HIS A 1 139 ? 38.371 39.763 31.743  1.00 63.56  ? 393 HIS A O     1 
ATOM   1045 C  CB    . HIS A 1 139 ? 36.163 42.196 31.935  1.00 69.27  ? 393 HIS A CB    1 
ATOM   1046 C  CG    . HIS A 1 139 ? 35.903 41.548 30.615  1.00 78.16  ? 393 HIS A CG    1 
ATOM   1047 N  ND1   . HIS A 1 139 ? 36.685 41.783 29.494  1.00 79.30  ? 393 HIS A ND1   1 
ATOM   1048 C  CD2   . HIS A 1 139 ? 35.024 40.576 30.260  1.00 84.27  ? 393 HIS A CD2   1 
ATOM   1049 C  CE1   . HIS A 1 139 ? 36.258 41.029 28.491  1.00 78.81  ? 393 HIS A CE1   1 
ATOM   1050 N  NE2   . HIS A 1 139 ? 35.252 40.288 28.929  1.00 84.45  ? 393 HIS A NE2   1 
ATOM   1051 N  N     . LEU A 1 140 ? 39.333 41.442 32.759  1.00 61.29  ? 394 LEU A N     1 
ATOM   1052 C  CA    . LEU A 1 140 ? 40.621 41.006 32.320  1.00 62.26  ? 394 LEU A CA    1 
ATOM   1053 C  C     . LEU A 1 140 ? 41.059 39.690 32.988  1.00 63.05  ? 394 LEU A C     1 
ATOM   1054 O  O     . LEU A 1 140 ? 41.682 38.858 32.327  1.00 66.47  ? 394 LEU A O     1 
ATOM   1055 C  CB    . LEU A 1 140 ? 41.630 42.123 32.553  1.00 68.13  ? 394 LEU A CB    1 
ATOM   1056 C  CG    . LEU A 1 140 ? 43.093 41.931 32.196  1.00 75.57  ? 394 LEU A CG    1 
ATOM   1057 C  CD1   . LEU A 1 140 ? 43.287 42.294 30.756  1.00 83.15  ? 394 LEU A CD1   1 
ATOM   1058 C  CD2   . LEU A 1 140 ? 43.981 42.822 33.038  1.00 80.90  ? 394 LEU A CD2   1 
ATOM   1059 N  N     . ILE A 1 141 ? 40.753 39.485 34.263  1.00 57.39  ? 395 ILE A N     1 
ATOM   1060 C  CA    . ILE A 1 141 ? 41.089 38.204 34.945  1.00 64.96  ? 395 ILE A CA    1 
ATOM   1061 C  C     . ILE A 1 141 ? 40.355 37.069 34.208  1.00 67.45  ? 395 ILE A C     1 
ATOM   1062 O  O     . ILE A 1 141 ? 40.901 35.999 33.948  1.00 67.33  ? 395 ILE A O     1 
ATOM   1063 C  CB    . ILE A 1 141 ? 40.588 38.155 36.436  1.00 67.03  ? 395 ILE A CB    1 
ATOM   1064 C  CG1   . ILE A 1 141 ? 41.185 39.267 37.342  1.00 77.16  ? 395 ILE A CG1   1 
ATOM   1065 C  CG2   . ILE A 1 141 ? 40.745 36.770 37.066  1.00 66.71  ? 395 ILE A CG2   1 
ATOM   1066 C  CD1   . ILE A 1 141 ? 42.430 39.970 36.858  1.00 75.54  ? 395 ILE A CD1   1 
ATOM   1067 N  N     . ASP A 1 142 ? 39.102 37.327 33.853  1.00 58.78  ? 396 ASP A N     1 
ATOM   1068 C  CA    . ASP A 1 142 ? 38.338 36.318 33.214  1.00 59.74  ? 396 ASP A CA    1 
ATOM   1069 C  C     . ASP A 1 142 ? 38.896 35.888 31.856  1.00 59.98  ? 396 ASP A C     1 
ATOM   1070 O  O     . ASP A 1 142 ? 38.987 34.688 31.558  1.00 62.50  ? 396 ASP A O     1 
ATOM   1071 C  CB    . ASP A 1 142 ? 36.912 36.784 33.119  1.00 62.75  ? 396 ASP A CB    1 
ATOM   1072 C  CG    . ASP A 1 142 ? 36.020 35.684 32.749  1.00 74.26  ? 396 ASP A CG    1 
ATOM   1073 O  OD1   . ASP A 1 142 ? 35.528 34.985 33.652  1.00 86.73  ? 396 ASP A OD1   1 
ATOM   1074 O  OD2   . ASP A 1 142 ? 35.876 35.455 31.541  1.00 78.09  ? 396 ASP A OD2   1 
ATOM   1075 N  N     . VAL A 1 143 ? 39.274 36.872 31.034  1.00 58.42  ? 397 VAL A N     1 
ATOM   1076 C  CA    . VAL A 1 143 ? 39.898 36.626 29.732  1.00 57.75  ? 397 VAL A CA    1 
ATOM   1077 C  C     . VAL A 1 143 ? 41.295 35.941 29.915  1.00 61.51  ? 397 VAL A C     1 
ATOM   1078 O  O     . VAL A 1 143 ? 41.584 34.934 29.260  1.00 58.50  ? 397 VAL A O     1 
ATOM   1079 C  CB    . VAL A 1 143 ? 40.054 37.934 28.927  1.00 57.74  ? 397 VAL A CB    1 
ATOM   1080 C  CG1   . VAL A 1 143 ? 40.718 37.727 27.571  1.00 58.14  ? 397 VAL A CG1   1 
ATOM   1081 C  CG2   . VAL A 1 143 ? 38.684 38.503 28.691  1.00 61.88  ? 397 VAL A CG2   1 
ATOM   1082 N  N     . LEU A 1 144 ? 42.138 36.443 30.807  1.00 56.18  ? 398 LEU A N     1 
ATOM   1083 C  CA    . LEU A 1 144 ? 43.429 35.771 31.063  1.00 59.15  ? 398 LEU A CA    1 
ATOM   1084 C  C     . LEU A 1 144 ? 43.308 34.276 31.516  1.00 58.87  ? 398 LEU A C     1 
ATOM   1085 O  O     . LEU A 1 144 ? 44.085 33.445 31.093  1.00 58.10  ? 398 LEU A O     1 
ATOM   1086 C  CB    . LEU A 1 144 ? 44.207 36.583 32.069  1.00 56.18  ? 398 LEU A CB    1 
ATOM   1087 C  CG    . LEU A 1 144 ? 45.494 36.071 32.652  1.00 57.37  ? 398 LEU A CG    1 
ATOM   1088 C  CD1   . LEU A 1 144 ? 46.583 36.123 31.616  1.00 58.62  ? 398 LEU A CD1   1 
ATOM   1089 C  CD2   . LEU A 1 144 ? 45.864 36.941 33.850  1.00 57.95  ? 398 LEU A CD2   1 
ATOM   1090 N  N     . ARG A 1 145 ? 42.327 33.934 32.327  1.00 57.11  ? 399 ARG A N     1 
ATOM   1091 C  CA    . ARG A 1 145 ? 42.030 32.486 32.600  1.00 59.94  ? 399 ARG A CA    1 
ATOM   1092 C  C     . ARG A 1 145 ? 41.620 31.622 31.391  1.00 55.84  ? 399 ARG A C     1 
ATOM   1093 O  O     . ARG A 1 145 ? 42.135 30.556 31.201  1.00 53.68  ? 399 ARG A O     1 
ATOM   1094 C  CB    . ARG A 1 145 ? 40.857 32.334 33.545  1.00 61.28  ? 399 ARG A CB    1 
ATOM   1095 C  CG    . ARG A 1 145 ? 41.129 32.593 34.976  1.00 65.39  ? 399 ARG A CG    1 
ATOM   1096 C  CD    . ARG A 1 145 ? 39.806 32.531 35.724  1.00 69.04  ? 399 ARG A CD    1 
ATOM   1097 N  NE    . ARG A 1 145 ? 40.043 32.511 37.161  1.00 73.22  ? 399 ARG A NE    1 
ATOM   1098 C  CZ    . ARG A 1 145 ? 39.088 32.483 38.076  1.00 76.76  ? 399 ARG A CZ    1 
ATOM   1099 N  NH1   . ARG A 1 145 ? 37.812 32.454 37.714  1.00 77.07  ? 399 ARG A NH1   1 
ATOM   1100 N  NH2   . ARG A 1 145 ? 39.410 32.449 39.365  1.00 83.77  ? 399 ARG A NH2   1 
ATOM   1101 N  N     . ARG A 1 146 ? 40.679 32.115 30.588  1.00 55.04  ? 400 ARG A N     1 
ATOM   1102 C  CA    . ARG A 1 146 ? 40.303 31.451 29.327  1.00 53.58  ? 400 ARG A CA    1 
ATOM   1103 C  C     . ARG A 1 146 ? 41.477 31.274 28.359  1.00 54.00  ? 400 ARG A C     1 
ATOM   1104 O  O     . ARG A 1 146 ? 41.698 30.188 27.797  1.00 54.35  ? 400 ARG A O     1 
ATOM   1105 C  CB    . ARG A 1 146 ? 39.114 32.180 28.656  1.00 52.79  ? 400 ARG A CB    1 
ATOM   1106 C  CG    . ARG A 1 146 ? 37.830 32.082 29.521  1.00 58.05  ? 400 ARG A CG    1 
ATOM   1107 C  CD    . ARG A 1 146 ? 36.575 32.833 29.002  1.00 63.54  ? 400 ARG A CD    1 
ATOM   1108 N  NE    . ARG A 1 146 ? 35.789 33.200 30.167  1.00 61.83  ? 400 ARG A NE    1 
ATOM   1109 C  CZ    . ARG A 1 146 ? 35.002 32.352 30.890  1.00 67.15  ? 400 ARG A CZ    1 
ATOM   1110 N  NH1   . ARG A 1 146 ? 34.784 31.059 30.543  1.00 63.31  ? 400 ARG A NH1   1 
ATOM   1111 N  NH2   . ARG A 1 146 ? 34.442 32.800 32.009  1.00 65.48  ? 400 ARG A NH2   1 
ATOM   1112 N  N     . GLU A 1 147 ? 42.243 32.328 28.148  1.00 51.95  ? 401 GLU A N     1 
ATOM   1113 C  CA    . GLU A 1 147 ? 43.378 32.232 27.252  1.00 52.93  ? 401 GLU A CA    1 
ATOM   1114 C  C     . GLU A 1 147 ? 44.374 31.236 27.784  1.00 52.40  ? 401 GLU A C     1 
ATOM   1115 O  O     . GLU A 1 147 ? 44.970 30.492 27.005  1.00 52.52  ? 401 GLU A O     1 
ATOM   1116 C  CB    . GLU A 1 147 ? 44.093 33.600 27.106  1.00 57.05  ? 401 GLU A CB    1 
ATOM   1117 C  CG    . GLU A 1 147 ? 43.292 34.690 26.395  1.00 59.62  ? 401 GLU A CG    1 
ATOM   1118 C  CD    . GLU A 1 147 ? 43.138 34.429 24.932  1.00 60.63  ? 401 GLU A CD    1 
ATOM   1119 O  OE1   . GLU A 1 147 ? 44.065 33.863 24.349  1.00 68.94  ? 401 GLU A OE1   1 
ATOM   1120 O  OE2   . GLU A 1 147 ? 42.132 34.848 24.350  1.00 75.85  ? 401 GLU A OE2   1 
ATOM   1121 N  N     . LEU A 1 148 ? 44.606 31.225 29.100  1.00 52.94  ? 402 LEU A N     1 
ATOM   1122 C  CA    . LEU A 1 148 ? 45.512 30.172 29.651  1.00 56.91  ? 402 LEU A CA    1 
ATOM   1123 C  C     . LEU A 1 148 ? 44.977 28.721 29.458  1.00 56.25  ? 402 LEU A C     1 
ATOM   1124 O  O     . LEU A 1 148 ? 45.760 27.840 29.193  1.00 54.11  ? 402 LEU A O     1 
ATOM   1125 C  CB    . LEU A 1 148 ? 45.811 30.384 31.104  1.00 53.40  ? 402 LEU A CB    1 
ATOM   1126 C  CG    . LEU A 1 148 ? 46.702 31.578 31.333  1.00 55.89  ? 402 LEU A CG    1 
ATOM   1127 C  CD1   . LEU A 1 148 ? 46.682 31.957 32.785  1.00 56.96  ? 402 LEU A CD1   1 
ATOM   1128 C  CD2   . LEU A 1 148 ? 48.136 31.357 30.911  1.00 58.04  ? 402 LEU A CD2   1 
ATOM   1129 N  N     . ALA A 1 149 ? 43.675 28.469 29.607  1.00 60.27  ? 403 ALA A N     1 
ATOM   1130 C  CA    . ALA A 1 149 ? 43.153 27.097 29.413  1.00 59.31  ? 403 ALA A CA    1 
ATOM   1131 C  C     . ALA A 1 149 ? 43.391 26.716 27.924  1.00 59.55  ? 403 ALA A C     1 
ATOM   1132 O  O     . ALA A 1 149 ? 43.819 25.602 27.588  1.00 59.79  ? 403 ALA A O     1 
ATOM   1133 C  CB    . ALA A 1 149 ? 41.689 27.013 29.775  1.00 56.17  ? 403 ALA A CB    1 
ATOM   1134 N  N     . LEU A 1 150 ? 43.230 27.684 27.046  1.00 55.73  ? 404 LEU A N     1 
ATOM   1135 C  CA    . LEU A 1 150 ? 43.375 27.430 25.621  1.00 60.34  ? 404 LEU A CA    1 
ATOM   1136 C  C     . LEU A 1 150 ? 44.834 27.041 25.299  1.00 59.68  ? 404 LEU A C     1 
ATOM   1137 O  O     . LEU A 1 150 ? 45.115 26.044 24.589  1.00 52.35  ? 404 LEU A O     1 
ATOM   1138 C  CB    . LEU A 1 150 ? 42.953 28.671 24.880  1.00 63.64  ? 404 LEU A CB    1 
ATOM   1139 C  CG    . LEU A 1 150 ? 42.614 28.825 23.400  1.00 70.01  ? 404 LEU A CG    1 
ATOM   1140 C  CD1   . LEU A 1 150 ? 41.784 27.715 22.870  1.00 73.61  ? 404 LEU A CD1   1 
ATOM   1141 C  CD2   . LEU A 1 150 ? 41.766 30.078 23.322  1.00 70.94  ? 404 LEU A CD2   1 
ATOM   1142 N  N     . GLU A 1 151 ? 45.746 27.800 25.885  1.00 57.82  ? 405 GLU A N     1 
ATOM   1143 C  CA    . GLU A 1 151 ? 47.171 27.589 25.720  1.00 60.56  ? 405 GLU A CA    1 
ATOM   1144 C  C     . GLU A 1 151 ? 47.599 26.193 26.197  1.00 59.47  ? 405 GLU A C     1 
ATOM   1145 O  O     . GLU A 1 151 ? 48.479 25.637 25.624  1.00 59.82  ? 405 GLU A O     1 
ATOM   1146 C  CB    . GLU A 1 151 ? 47.941 28.634 26.540  1.00 68.59  ? 405 GLU A CB    1 
ATOM   1147 C  CG    . GLU A 1 151 ? 49.460 28.479 26.498  1.00 81.95  ? 405 GLU A CG    1 
ATOM   1148 C  CD    . GLU A 1 151 ? 50.161 29.788 26.639  1.00 84.25  ? 405 GLU A CD    1 
ATOM   1149 O  OE1   . GLU A 1 151 ? 50.453 30.423 25.598  1.00 93.33  ? 405 GLU A OE1   1 
ATOM   1150 O  OE2   . GLU A 1 151 ? 50.356 30.201 27.804  1.00 102.05 ? 405 GLU A OE2   1 
ATOM   1151 N  N     . CYS A 1 152 ? 47.015 25.714 27.306  1.00 61.67  ? 406 CYS A N     1 
ATOM   1152 C  CA    . CYS A 1 152 ? 47.209 24.368 27.880  1.00 63.45  ? 406 CYS A CA    1 
ATOM   1153 C  C     . CYS A 1 152 ? 46.762 23.218 27.051  1.00 57.74  ? 406 CYS A C     1 
ATOM   1154 O  O     . CYS A 1 152 ? 47.169 22.109 27.356  1.00 57.68  ? 406 CYS A O     1 
ATOM   1155 C  CB    . CYS A 1 152 ? 46.370 24.183 29.161  1.00 63.86  ? 406 CYS A CB    1 
ATOM   1156 S  SG    . CYS A 1 152 ? 47.101 25.064 30.437  1.00 72.82  ? 406 CYS A SG    1 
ATOM   1157 N  N     . ASP A 1 153 ? 45.874 23.447 26.088  1.00 55.91  ? 407 ASP A N     1 
ATOM   1158 C  CA    . ASP A 1 153 ? 45.318 22.376 25.292  1.00 53.29  ? 407 ASP A CA    1 
ATOM   1159 C  C     . ASP A 1 153 ? 46.174 22.015 24.049  1.00 56.39  ? 407 ASP A C     1 
ATOM   1160 O  O     . ASP A 1 153 ? 45.943 22.539 22.949  1.00 54.63  ? 407 ASP A O     1 
ATOM   1161 C  CB    . ASP A 1 153 ? 43.921 22.749 24.916  1.00 54.52  ? 407 ASP A CB    1 
ATOM   1162 C  CG    . ASP A 1 153 ? 43.123 21.592 24.299  1.00 53.45  ? 407 ASP A CG    1 
ATOM   1163 O  OD1   . ASP A 1 153 ? 43.686 20.573 23.801  1.00 58.50  ? 407 ASP A OD1   1 
ATOM   1164 O  OD2   . ASP A 1 153 ? 41.899 21.785 24.250  1.00 56.24  ? 407 ASP A OD2   1 
ATOM   1165 N  N     . TYR A 1 154 ? 47.083 21.034 24.212  1.00 56.02  ? 408 TYR A N     1 
ATOM   1166 C  CA    . TYR A 1 154 ? 47.962 20.610 23.118  1.00 52.77  ? 408 TYR A CA    1 
ATOM   1167 C  C     . TYR A 1 154 ? 47.271 19.758 22.041  1.00 59.73  ? 408 TYR A C     1 
ATOM   1168 O  O     . TYR A 1 154 ? 47.752 19.693 20.921  1.00 63.20  ? 408 TYR A O     1 
ATOM   1169 C  CB    . TYR A 1 154 ? 49.245 19.987 23.700  1.00 56.20  ? 408 TYR A CB    1 
ATOM   1170 C  CG    . TYR A 1 154 ? 50.297 20.952 24.297  1.00 53.82  ? 408 TYR A CG    1 
ATOM   1171 C  CD1   . TYR A 1 154 ? 50.089 22.320 24.343  1.00 56.45  ? 408 TYR A CD1   1 
ATOM   1172 C  CD2   . TYR A 1 154 ? 51.534 20.478 24.810  1.00 56.65  ? 408 TYR A CD2   1 
ATOM   1173 C  CE1   . TYR A 1 154 ? 51.056 23.198 24.848  1.00 57.03  ? 408 TYR A CE1   1 
ATOM   1174 C  CE2   . TYR A 1 154 ? 52.513 21.362 25.315  1.00 55.75  ? 408 TYR A CE2   1 
ATOM   1175 C  CZ    . TYR A 1 154 ? 52.255 22.728 25.313  1.00 54.86  ? 408 TYR A CZ    1 
ATOM   1176 O  OH    . TYR A 1 154 ? 53.083 23.690 25.804  1.00 61.81  ? 408 TYR A OH    1 
ATOM   1177 N  N     . GLN A 1 155 ? 46.113 19.166 22.332  1.00 59.30  ? 409 GLN A N     1 
ATOM   1178 C  CA    . GLN A 1 155 ? 45.366 18.455 21.318  1.00 64.55  ? 409 GLN A CA    1 
ATOM   1179 C  C     . GLN A 1 155 ? 44.830 19.469 20.330  1.00 61.03  ? 409 GLN A C     1 
ATOM   1180 O  O     . GLN A 1 155 ? 44.909 19.306 19.134  1.00 60.36  ? 409 GLN A O     1 
ATOM   1181 C  CB    . GLN A 1 155 ? 44.188 17.644 21.937  1.00 65.20  ? 409 GLN A CB    1 
ATOM   1182 C  CG    . GLN A 1 155 ? 44.659 16.652 23.028  1.00 73.20  ? 409 GLN A CG    1 
ATOM   1183 C  CD    . GLN A 1 155 ? 43.568 15.707 23.539  1.00 76.50  ? 409 GLN A CD    1 
ATOM   1184 O  OE1   . GLN A 1 155 ? 43.062 15.863 24.655  1.00 80.11  ? 409 GLN A OE1   1 
ATOM   1185 N  NE2   . GLN A 1 155 ? 43.176 14.763 22.709  1.00 70.84  ? 409 GLN A NE2   1 
ATOM   1186 N  N     . ARG A 1 156 ? 44.221 20.497 20.873  1.00 61.38  ? 410 ARG A N     1 
ATOM   1187 C  CA    . ARG A 1 156 ? 43.766 21.634 20.087  1.00 61.99  ? 410 ARG A CA    1 
ATOM   1188 C  C     . ARG A 1 156 ? 44.922 22.262 19.288  1.00 58.52  ? 410 ARG A C     1 
ATOM   1189 O  O     . ARG A 1 156 ? 44.770 22.498 18.047  1.00 55.46  ? 410 ARG A O     1 
ATOM   1190 C  CB    . ARG A 1 156 ? 43.200 22.686 21.012  1.00 61.47  ? 410 ARG A CB    1 
ATOM   1191 C  CG    . ARG A 1 156 ? 42.504 23.760 20.266  1.00 64.05  ? 410 ARG A CG    1 
ATOM   1192 C  CD    . ARG A 1 156 ? 42.506 25.008 21.072  1.00 66.49  ? 410 ARG A CD    1 
ATOM   1193 N  NE    . ARG A 1 156 ? 41.785 25.939 20.250  1.00 74.76  ? 410 ARG A NE    1 
ATOM   1194 C  CZ    . ARG A 1 156 ? 42.328 26.853 19.445  1.00 82.35  ? 410 ARG A CZ    1 
ATOM   1195 N  NH1   . ARG A 1 156 ? 43.680 27.071 19.396  1.00 82.41  ? 410 ARG A NH1   1 
ATOM   1196 N  NH2   . ARG A 1 156 ? 41.477 27.584 18.712  1.00 79.89  ? 410 ARG A NH2   1 
ATOM   1197 N  N     . GLU A 1 157 ? 46.050 22.529 19.978  1.00 49.45  ? 411 GLU A N     1 
ATOM   1198 C  CA    . GLU A 1 157 ? 47.217 23.035 19.279  1.00 53.56  ? 411 GLU A CA    1 
ATOM   1199 C  C     . GLU A 1 157 ? 47.669 22.134 18.057  1.00 54.83  ? 411 GLU A C     1 
ATOM   1200 O  O     . GLU A 1 157 ? 47.992 22.659 16.946  1.00 52.64  ? 411 GLU A O     1 
ATOM   1201 C  CB    . GLU A 1 157 ? 48.362 23.325 20.210  1.00 56.29  ? 411 GLU A CB    1 
ATOM   1202 C  CG    . GLU A 1 157 ? 49.506 24.077 19.516  1.00 59.56  ? 411 GLU A CG    1 
ATOM   1203 C  CD    . GLU A 1 157 ? 50.587 24.515 20.500  1.00 62.80  ? 411 GLU A CD    1 
ATOM   1204 O  OE1   . GLU A 1 157 ? 50.283 24.891 21.648  1.00 66.62  ? 411 GLU A OE1   1 
ATOM   1205 O  OE2   . GLU A 1 157 ? 51.737 24.479 20.111  1.00 61.96  ? 411 GLU A OE2   1 
ATOM   1206 N  N     . ALA A 1 158 ? 47.597 20.820 18.242  1.00 56.35  ? 412 ALA A N     1 
ATOM   1207 C  CA    . ALA A 1 158 ? 48.059 19.822 17.253  1.00 62.04  ? 412 ALA A CA    1 
ATOM   1208 C  C     . ALA A 1 158 ? 47.124 19.868 16.075  1.00 61.34  ? 412 ALA A C     1 
ATOM   1209 O  O     . ALA A 1 158 ? 47.567 19.901 14.932  1.00 59.98  ? 412 ALA A O     1 
ATOM   1210 C  CB    . ALA A 1 158 ? 48.107 18.420 17.836  1.00 64.11  ? 412 ALA A CB    1 
ATOM   1211 N  N     . ALA A 1 159 ? 45.832 20.004 16.351  1.00 59.26  ? 413 ALA A N     1 
ATOM   1212 C  CA    . ALA A 1 159 ? 44.873 20.118 15.260  1.00 57.06  ? 413 ALA A CA    1 
ATOM   1213 C  C     . ALA A 1 159 ? 45.005 21.433 14.452  1.00 60.58  ? 413 ALA A C     1 
ATOM   1214 O  O     . ALA A 1 159 ? 44.770 21.453 13.233  1.00 60.31  ? 413 ALA A O     1 
ATOM   1215 C  CB    . ALA A 1 159 ? 43.463 19.970 15.774  1.00 55.84  ? 413 ALA A CB    1 
ATOM   1216 N  N     . CYS A 1 160 ? 45.353 22.523 15.119  1.00 61.13  ? 414 CYS A N     1 
ATOM   1217 C  CA    . CYS A 1 160 ? 45.538 23.827 14.420  1.00 58.01  ? 414 CYS A CA    1 
ATOM   1218 C  C     . CYS A 1 160 ? 46.806 23.812 13.537  1.00 56.29  ? 414 CYS A C     1 
ATOM   1219 O  O     . CYS A 1 160 ? 46.778 24.192 12.395  1.00 57.10  ? 414 CYS A O     1 
ATOM   1220 C  CB    . CYS A 1 160 ? 45.597 24.965 15.437  1.00 61.32  ? 414 CYS A CB    1 
ATOM   1221 S  SG    . CYS A 1 160 ? 44.007 25.360 16.247  1.00 65.52  ? 414 CYS A SG    1 
ATOM   1222 N  N     . ALA A 1 161 ? 47.906 23.352 14.070  1.00 55.13  ? 415 ALA A N     1 
ATOM   1223 C  CA    . ALA A 1 161 ? 49.066 23.041 13.251  1.00 56.23  ? 415 ALA A CA    1 
ATOM   1224 C  C     . ALA A 1 161 ? 48.761 22.162 12.034  1.00 58.53  ? 415 ALA A C     1 
ATOM   1225 O  O     . ALA A 1 161 ? 49.167 22.512 10.932  1.00 58.41  ? 415 ALA A O     1 
ATOM   1226 C  CB    . ALA A 1 161 ? 50.164 22.394 14.106  1.00 55.18  ? 415 ALA A CB    1 
ATOM   1227 N  N     . ARG A 1 162 ? 48.093 21.013 12.202  1.00 64.99  ? 416 ARG A N     1 
ATOM   1228 C  CA    . ARG A 1 162 ? 47.763 20.161 11.030  1.00 67.14  ? 416 ARG A CA    1 
ATOM   1229 C  C     . ARG A 1 162 ? 46.935 20.931 10.024  1.00 64.29  ? 416 ARG A C     1 
ATOM   1230 O  O     . ARG A 1 162 ? 47.111 20.797 8.828   1.00 62.69  ? 416 ARG A O     1 
ATOM   1231 C  CB    . ARG A 1 162 ? 46.991 18.881 11.415  1.00 75.98  ? 416 ARG A CB    1 
ATOM   1232 C  CG    . ARG A 1 162 ? 47.806 17.831 12.178  1.00 81.79  ? 416 ARG A CG    1 
ATOM   1233 C  CD    . ARG A 1 162 ? 46.944 16.630 12.604  1.00 85.89  ? 416 ARG A CD    1 
ATOM   1234 N  NE    . ARG A 1 162 ? 47.607 15.839 13.655  1.00 85.70  ? 416 ARG A NE    1 
ATOM   1235 C  CZ    . ARG A 1 162 ? 47.220 15.738 14.939  1.00 88.56  ? 416 ARG A CZ    1 
ATOM   1236 N  NH1   . ARG A 1 162 ? 46.108 16.334 15.399  1.00 80.33  ? 416 ARG A NH1   1 
ATOM   1237 N  NH2   . ARG A 1 162 ? 47.969 15.021 15.792  1.00 87.09  ? 416 ARG A NH2   1 
ATOM   1238 N  N     . LYS A 1 163 ? 46.017 21.736 10.517  1.00 60.89  ? 417 LYS A N     1 
ATOM   1239 C  CA    . LYS A 1 163 ? 45.157 22.503 9.653   1.00 64.71  ? 417 LYS A CA    1 
ATOM   1240 C  C     . LYS A 1 163 ? 45.962 23.624 8.938   1.00 65.07  ? 417 LYS A C     1 
ATOM   1241 O  O     . LYS A 1 163 ? 45.812 23.819 7.751   1.00 66.11  ? 417 LYS A O     1 
ATOM   1242 C  CB    . LYS A 1 163 ? 43.948 22.972 10.460  1.00 73.52  ? 417 LYS A CB    1 
ATOM   1243 C  CG    . LYS A 1 163 ? 42.805 23.494 9.635   1.00 87.96  ? 417 LYS A CG    1 
ATOM   1244 C  CD    . LYS A 1 163 ? 42.637 24.981 9.783   1.00 103.81 ? 417 LYS A CD    1 
ATOM   1245 C  CE    . LYS A 1 163 ? 43.885 25.922 9.803   1.00 122.66 ? 417 LYS A CE    1 
ATOM   1246 N  NZ    . LYS A 1 163 ? 44.412 26.475 11.123  1.00 119.53 ? 417 LYS A NZ    1 
ATOM   1247 N  N     . PHE A 1 164 ? 46.871 24.311 9.623   1.00 59.68  ? 418 PHE A N     1 
ATOM   1248 C  CA    . PHE A 1 164 ? 47.650 25.357 8.957   1.00 63.77  ? 418 PHE A CA    1 
ATOM   1249 C  C     . PHE A 1 164 ? 48.507 24.703 7.914   1.00 66.17  ? 418 PHE A C     1 
ATOM   1250 O  O     . PHE A 1 164 ? 48.763 25.293 6.871   1.00 62.11  ? 418 PHE A O     1 
ATOM   1251 C  CB    . PHE A 1 164 ? 48.541 26.189 9.910   1.00 68.95  ? 418 PHE A CB    1 
ATOM   1252 C  CG    . PHE A 1 164 ? 48.251 27.638 9.816   1.00 75.11  ? 418 PHE A CG    1 
ATOM   1253 C  CD1   . PHE A 1 164 ? 48.734 28.367 8.752   1.00 77.12  ? 418 PHE A CD1   1 
ATOM   1254 C  CD2   . PHE A 1 164 ? 47.359 28.231 10.693  1.00 75.02  ? 418 PHE A CD2   1 
ATOM   1255 C  CE1   . PHE A 1 164 ? 48.390 29.681 8.576   1.00 74.44  ? 418 PHE A CE1   1 
ATOM   1256 C  CE2   . PHE A 1 164 ? 47.030 29.558 10.556  1.00 79.76  ? 418 PHE A CE2   1 
ATOM   1257 C  CZ    . PHE A 1 164 ? 47.546 30.294 9.496   1.00 81.93  ? 418 PHE A CZ    1 
ATOM   1258 N  N     . ARG A 1 165 ? 48.987 23.500 8.222   1.00 65.82  ? 419 ARG A N     1 
ATOM   1259 C  CA    . ARG A 1 165 ? 49.897 22.794 7.322   1.00 71.72  ? 419 ARG A CA    1 
ATOM   1260 C  C     . ARG A 1 165 ? 49.171 22.501 5.997   1.00 70.18  ? 419 ARG A C     1 
ATOM   1261 O  O     . ARG A 1 165 ? 49.717 22.811 4.967   1.00 73.62  ? 419 ARG A O     1 
ATOM   1262 C  CB    . ARG A 1 165 ? 50.439 21.529 7.987   1.00 71.05  ? 419 ARG A CB    1 
ATOM   1263 C  CG    . ARG A 1 165 ? 51.303 20.655 7.092   1.00 72.27  ? 419 ARG A CG    1 
ATOM   1264 C  CD    . ARG A 1 165 ? 52.181 19.787 7.971   1.00 69.83  ? 419 ARG A CD    1 
ATOM   1265 N  NE    . ARG A 1 165 ? 52.607 18.649 7.186   1.00 76.43  ? 419 ARG A NE    1 
ATOM   1266 C  CZ    . ARG A 1 165 ? 53.827 18.420 6.740   1.00 78.32  ? 419 ARG A CZ    1 
ATOM   1267 N  NH1   . ARG A 1 165 ? 54.867 19.251 6.986   1.00 81.36  ? 419 ARG A NH1   1 
ATOM   1268 N  NH2   . ARG A 1 165 ? 54.015 17.321 6.063   1.00 72.11  ? 419 ARG A NH2   1 
ATOM   1269 N  N     . ASP A 1 166 ? 47.928 22.014 6.015   1.00 69.79  ? 420 ASP A N     1 
ATOM   1270 C  CA    . ASP A 1 166 ? 47.126 21.973 4.769   1.00 74.15  ? 420 ASP A CA    1 
ATOM   1271 C  C     . ASP A 1 166 ? 47.089 23.250 3.945   1.00 72.80  ? 420 ASP A C     1 
ATOM   1272 O  O     . ASP A 1 166 ? 47.361 23.221 2.779   1.00 79.25  ? 420 ASP A O     1 
ATOM   1273 C  CB    . ASP A 1 166 ? 45.650 21.704 5.037   1.00 78.99  ? 420 ASP A CB    1 
ATOM   1274 C  CG    . ASP A 1 166 ? 45.393 20.356 5.540   1.00 81.85  ? 420 ASP A CG    1 
ATOM   1275 O  OD1   . ASP A 1 166 ? 46.398 19.627 5.716   1.00 74.86  ? 420 ASP A OD1   1 
ATOM   1276 O  OD2   . ASP A 1 166 ? 44.173 20.058 5.755   1.00 87.49  ? 420 ASP A OD2   1 
ATOM   1277 N  N     . LEU A 1 167 ? 46.675 24.354 4.555   1.00 73.92  ? 421 LEU A N     1 
ATOM   1278 C  CA    . LEU A 1 167 ? 46.480 25.660 3.872   1.00 69.88  ? 421 LEU A CA    1 
ATOM   1279 C  C     . LEU A 1 167 ? 47.745 26.175 3.176   1.00 65.76  ? 421 LEU A C     1 
ATOM   1280 O  O     . LEU A 1 167 ? 47.642 26.945 2.258   1.00 69.78  ? 421 LEU A O     1 
ATOM   1281 C  CB    . LEU A 1 167 ? 46.020 26.744 4.890   1.00 65.85  ? 421 LEU A CB    1 
ATOM   1282 C  CG    . LEU A 1 167 ? 44.613 26.586 5.479   1.00 66.24  ? 421 LEU A CG    1 
ATOM   1283 C  CD1   . LEU A 1 167 ? 44.435 27.543 6.649   1.00 65.94  ? 421 LEU A CD1   1 
ATOM   1284 C  CD2   . LEU A 1 167 ? 43.559 26.812 4.395   1.00 60.52  ? 421 LEU A CD2   1 
ATOM   1285 N  N     . LEU A 1 168 ? 48.920 25.792 3.670   1.00 67.53  ? 422 LEU A N     1 
ATOM   1286 C  CA    . LEU A 1 168 ? 50.204 26.125 3.081   1.00 68.83  ? 422 LEU A CA    1 
ATOM   1287 C  C     . LEU A 1 168 ? 50.867 24.979 2.284   1.00 71.22  ? 422 LEU A C     1 
ATOM   1288 O  O     . LEU A 1 168 ? 52.008 25.107 1.846   1.00 68.59  ? 422 LEU A O     1 
ATOM   1289 C  CB    . LEU A 1 168 ? 51.133 26.679 4.192   1.00 70.92  ? 422 LEU A CB    1 
ATOM   1290 C  CG    . LEU A 1 168 ? 50.671 28.048 4.725   1.00 69.44  ? 422 LEU A CG    1 
ATOM   1291 C  CD1   . LEU A 1 168 ? 51.579 28.567 5.821   1.00 65.36  ? 422 LEU A CD1   1 
ATOM   1292 C  CD2   . LEU A 1 168 ? 50.572 29.079 3.610   1.00 66.29  ? 422 LEU A CD2   1 
ATOM   1293 N  N     . LYS A 1 169 ? 50.152 23.871 2.085   1.00 79.13  ? 423 LYS A N     1 
ATOM   1294 C  CA    . LYS A 1 169 ? 50.608 22.732 1.232   1.00 84.08  ? 423 LYS A CA    1 
ATOM   1295 C  C     . LYS A 1 169 ? 51.172 23.273 -0.045  1.00 75.86  ? 423 LYS A C     1 
ATOM   1296 O  O     . LYS A 1 169 ? 50.507 24.031 -0.697  1.00 78.94  ? 423 LYS A O     1 
ATOM   1297 C  CB    . LYS A 1 169 ? 49.417 21.825 0.873   1.00 87.70  ? 423 LYS A CB    1 
ATOM   1298 C  CG    . LYS A 1 169 ? 49.684 20.330 0.676   1.00 94.59  ? 423 LYS A CG    1 
ATOM   1299 C  CD    . LYS A 1 169 ? 48.353 19.521 0.622   1.00 103.49 ? 423 LYS A CD    1 
ATOM   1300 C  CE    . LYS A 1 169 ? 47.272 20.032 1.627   1.00 107.00 ? 423 LYS A CE    1 
ATOM   1301 N  NZ    . LYS A 1 169 ? 46.253 19.103 2.221   1.00 106.38 ? 423 LYS A NZ    1 
ATOM   1302 N  N     . GLY A 1 170 ? 52.401 22.933 -0.367  1.00 78.39  ? 424 GLY A N     1 
ATOM   1303 C  CA    . GLY A 1 170 ? 52.969 23.352 -1.629  1.00 78.35  ? 424 GLY A CA    1 
ATOM   1304 C  C     . GLY A 1 170 ? 53.457 24.783 -1.728  1.00 78.09  ? 424 GLY A C     1 
ATOM   1305 O  O     . GLY A 1 170 ? 53.819 25.216 -2.803  1.00 76.93  ? 424 GLY A O     1 
ATOM   1306 N  N     . HIS A 1 171 ? 53.496 25.519 -0.623  1.00 74.21  ? 425 HIS A N     1 
ATOM   1307 C  CA    . HIS A 1 171 ? 53.742 26.956 -0.675  1.00 70.59  ? 425 HIS A CA    1 
ATOM   1308 C  C     . HIS A 1 171 ? 55.225 27.208 -0.964  1.00 67.35  ? 425 HIS A C     1 
ATOM   1309 O  O     . HIS A 1 171 ? 56.085 26.549 -0.422  1.00 69.29  ? 425 HIS A O     1 
ATOM   1310 C  CB    . HIS A 1 171 ? 53.244 27.674 0.611   1.00 66.28  ? 425 HIS A CB    1 
ATOM   1311 C  CG    . HIS A 1 171 ? 53.098 29.163 0.482   1.00 60.66  ? 425 HIS A CG    1 
ATOM   1312 N  ND1   . HIS A 1 171 ? 54.172 30.011 0.495   1.00 64.66  ? 425 HIS A ND1   1 
ATOM   1313 C  CD2   . HIS A 1 171 ? 52.008 29.956 0.372   1.00 58.08  ? 425 HIS A CD2   1 
ATOM   1314 C  CE1   . HIS A 1 171 ? 53.771 31.255 0.322   1.00 60.86  ? 425 HIS A CE1   1 
ATOM   1315 N  NE2   . HIS A 1 171 ? 52.456 31.249 0.273   1.00 60.72  ? 425 HIS A NE2   1 
ATOM   1316 N  N     . PRO A 1 172 ? 55.512 28.150 -1.860  1.00 66.39  ? 426 PRO A N     1 
ATOM   1317 C  CA    . PRO A 1 172 ? 56.913 28.355 -2.270  1.00 70.41  ? 426 PRO A CA    1 
ATOM   1318 C  C     . PRO A 1 172 ? 57.838 29.019 -1.237  1.00 71.75  ? 426 PRO A C     1 
ATOM   1319 O  O     . PRO A 1 172 ? 59.045 29.028 -1.438  1.00 81.39  ? 426 PRO A O     1 
ATOM   1320 C  CB    . PRO A 1 172 ? 56.778 29.292 -3.492  1.00 69.51  ? 426 PRO A CB    1 
ATOM   1321 C  CG    . PRO A 1 172 ? 55.474 30.013 -3.255  1.00 64.65  ? 426 PRO A CG    1 
ATOM   1322 C  CD    . PRO A 1 172 ? 54.567 28.966 -2.667  1.00 65.08  ? 426 PRO A CD    1 
ATOM   1323 N  N     . PHE A 1 173 ? 57.291 29.638 -0.199  1.00 68.27  ? 427 PHE A N     1 
ATOM   1324 C  CA    . PHE A 1 173 ? 58.080 30.317 0.813   1.00 65.24  ? 427 PHE A CA    1 
ATOM   1325 C  C     . PHE A 1 173 ? 57.845 29.974 2.307   1.00 65.60  ? 427 PHE A C     1 
ATOM   1326 O  O     . PHE A 1 173 ? 58.819 29.960 3.075   1.00 66.72  ? 427 PHE A O     1 
ATOM   1327 C  CB    . PHE A 1 173 ? 57.853 31.784 0.595   1.00 66.11  ? 427 PHE A CB    1 
ATOM   1328 C  CG    . PHE A 1 173 ? 58.699 32.677 1.435   1.00 63.16  ? 427 PHE A CG    1 
ATOM   1329 C  CD1   . PHE A 1 173 ? 59.982 32.975 1.046   1.00 63.94  ? 427 PHE A CD1   1 
ATOM   1330 C  CD2   . PHE A 1 173 ? 58.189 33.234 2.583   1.00 63.84  ? 427 PHE A CD2   1 
ATOM   1331 C  CE1   . PHE A 1 173 ? 60.759 33.807 1.781   1.00 66.50  ? 427 PHE A CE1   1 
ATOM   1332 C  CE2   . PHE A 1 173 ? 58.982 34.061 3.349   1.00 64.83  ? 427 PHE A CE2   1 
ATOM   1333 C  CZ    . PHE A 1 173 ? 60.254 34.375 2.923   1.00 66.78  ? 427 PHE A CZ    1 
ATOM   1334 N  N     . PHE A 1 174 ? 56.592 29.782 2.723   1.00 58.80  ? 428 PHE A N     1 
ATOM   1335 C  CA    . PHE A 1 174 ? 56.276 29.416 4.064   1.00 59.77  ? 428 PHE A CA    1 
ATOM   1336 C  C     . PHE A 1 174 ? 56.018 27.907 4.176   1.00 65.23  ? 428 PHE A C     1 
ATOM   1337 O  O     . PHE A 1 174 ? 55.487 27.293 3.253   1.00 66.96  ? 428 PHE A O     1 
ATOM   1338 C  CB    . PHE A 1 174 ? 55.028 30.148 4.511   1.00 59.44  ? 428 PHE A CB    1 
ATOM   1339 C  CG    . PHE A 1 174 ? 55.180 31.661 4.669   1.00 57.34  ? 428 PHE A CG    1 
ATOM   1340 C  CD1   . PHE A 1 174 ? 55.866 32.196 5.748   1.00 55.49  ? 428 PHE A CD1   1 
ATOM   1341 C  CD2   . PHE A 1 174 ? 54.541 32.533 3.808   1.00 56.18  ? 428 PHE A CD2   1 
ATOM   1342 C  CE1   . PHE A 1 174 ? 55.996 33.528 5.908   1.00 55.51  ? 428 PHE A CE1   1 
ATOM   1343 C  CE2   . PHE A 1 174 ? 54.627 33.892 3.984   1.00 53.53  ? 428 PHE A CE2   1 
ATOM   1344 C  CZ    . PHE A 1 174 ? 55.346 34.399 5.030   1.00 56.81  ? 428 PHE A CZ    1 
ATOM   1345 N  N     . TYR A 1 175 ? 56.342 27.316 5.324   1.00 66.59  ? 429 TYR A N     1 
ATOM   1346 C  CA    . TYR A 1 175 ? 55.884 25.963 5.657   1.00 61.47  ? 429 TYR A CA    1 
ATOM   1347 C  C     . TYR A 1 175 ? 55.713 25.721 7.157   1.00 60.55  ? 429 TYR A C     1 
ATOM   1348 O  O     . TYR A 1 175 ? 56.190 26.479 8.015   1.00 61.62  ? 429 TYR A O     1 
ATOM   1349 C  CB    . TYR A 1 175 ? 56.875 24.945 5.101   1.00 70.23  ? 429 TYR A CB    1 
ATOM   1350 C  CG    . TYR A 1 175 ? 58.179 24.823 5.840   1.00 64.87  ? 429 TYR A CG    1 
ATOM   1351 C  CD1   . TYR A 1 175 ? 59.160 25.770 5.657   1.00 74.51  ? 429 TYR A CD1   1 
ATOM   1352 C  CD2   . TYR A 1 175 ? 58.421 23.762 6.725   1.00 70.71  ? 429 TYR A CD2   1 
ATOM   1353 C  CE1   . TYR A 1 175 ? 60.403 25.696 6.320   1.00 76.33  ? 429 TYR A CE1   1 
ATOM   1354 C  CE2   . TYR A 1 175 ? 59.637 23.657 7.424   1.00 74.82  ? 429 TYR A CE2   1 
ATOM   1355 C  CZ    . TYR A 1 175 ? 60.650 24.643 7.213   1.00 78.43  ? 429 TYR A CZ    1 
ATOM   1356 O  OH    . TYR A 1 175 ? 61.895 24.629 7.830   1.00 77.05  ? 429 TYR A OH    1 
ATOM   1357 N  N     . VAL A 1 176 ? 55.081 24.615 7.470   1.00 60.14  ? 430 VAL A N     1 
ATOM   1358 C  CA    . VAL A 1 176 ? 54.701 24.267 8.828   1.00 63.12  ? 430 VAL A CA    1 
ATOM   1359 C  C     . VAL A 1 176 ? 55.269 22.889 9.138   1.00 63.25  ? 430 VAL A C     1 
ATOM   1360 O  O     . VAL A 1 176 ? 54.914 21.941 8.444   1.00 61.27  ? 430 VAL A O     1 
ATOM   1361 C  CB    . VAL A 1 176 ? 53.166 24.210 8.958   1.00 62.13  ? 430 VAL A CB    1 
ATOM   1362 C  CG1   . VAL A 1 176 ? 52.773 23.895 10.401  1.00 59.99  ? 430 VAL A CG1   1 
ATOM   1363 C  CG2   . VAL A 1 176 ? 52.594 25.538 8.527   1.00 66.58  ? 430 VAL A CG2   1 
ATOM   1364 N  N     . PRO A 1 177 ? 56.127 22.769 10.175  1.00 63.21  ? 431 PRO A N     1 
ATOM   1365 C  CA    . PRO A 1 177 ? 56.719 21.476 10.448  1.00 63.52  ? 431 PRO A CA    1 
ATOM   1366 C  C     . PRO A 1 177 ? 55.629 20.495 10.759  1.00 63.13  ? 431 PRO A C     1 
ATOM   1367 O  O     . PRO A 1 177 ? 54.620 20.893 11.335  1.00 61.11  ? 431 PRO A O     1 
ATOM   1368 C  CB    . PRO A 1 177 ? 57.570 21.732 11.708  1.00 61.88  ? 431 PRO A CB    1 
ATOM   1369 C  CG    . PRO A 1 177 ? 56.928 22.830 12.407  1.00 59.43  ? 431 PRO A CG    1 
ATOM   1370 C  CD    . PRO A 1 177 ? 56.499 23.721 11.235  1.00 65.04  ? 431 PRO A CD    1 
ATOM   1371 N  N     . GLU A 1 178 ? 55.807 19.259 10.302  1.00 61.89  ? 432 GLU A N     1 
ATOM   1372 C  CA    . GLU A 1 178 ? 54.832 18.199 10.546  1.00 64.74  ? 432 GLU A CA    1 
ATOM   1373 C  C     . GLU A 1 178 ? 54.801 17.826 12.020  1.00 66.15  ? 432 GLU A C     1 
ATOM   1374 O  O     . GLU A 1 178 ? 55.830 17.807 12.690  1.00 64.73  ? 432 GLU A O     1 
ATOM   1375 C  CB    . GLU A 1 178 ? 55.199 16.923 9.764   1.00 72.23  ? 432 GLU A CB    1 
ATOM   1376 C  CG    . GLU A 1 178 ? 53.981 16.072 9.414   1.00 83.49  ? 432 GLU A CG    1 
ATOM   1377 C  CD    . GLU A 1 178 ? 54.310 14.797 8.605   1.00 91.07  ? 432 GLU A CD    1 
ATOM   1378 O  OE1   . GLU A 1 178 ? 55.421 14.220 8.759   1.00 83.67  ? 432 GLU A OE1   1 
ATOM   1379 O  OE2   . GLU A 1 178 ? 53.422 14.357 7.832   1.00 95.38  ? 432 GLU A OE2   1 
ATOM   1380 N  N     . ILE A 1 179 ? 53.621 17.440 12.462  1.00 65.84  ? 433 ILE A N     1 
ATOM   1381 C  CA    . ILE A 1 179 ? 53.331 16.937 13.782  1.00 68.53  ? 433 ILE A CA    1 
ATOM   1382 C  C     . ILE A 1 179 ? 53.640 15.445 13.804  1.00 68.76  ? 433 ILE A C     1 
ATOM   1383 O  O     . ILE A 1 179 ? 53.380 14.744 12.829  1.00 69.36  ? 433 ILE A O     1 
ATOM   1384 C  CB    . ILE A 1 179 ? 51.824 17.129 14.057  1.00 73.72  ? 433 ILE A CB    1 
ATOM   1385 C  CG1   . ILE A 1 179 ? 51.464 18.615 14.045  1.00 76.95  ? 433 ILE A CG1   1 
ATOM   1386 C  CG2   . ILE A 1 179 ? 51.371 16.485 15.377  1.00 82.61  ? 433 ILE A CG2   1 
ATOM   1387 C  CD1   . ILE A 1 179 ? 51.802 19.311 15.329  1.00 77.13  ? 433 ILE A CD1   1 
ATOM   1388 N  N     . VAL A 1 180 ? 54.190 14.956 14.909  1.00 66.46  ? 434 VAL A N     1 
ATOM   1389 C  CA    . VAL A 1 180 ? 54.537 13.528 15.048  1.00 67.44  ? 434 VAL A CA    1 
ATOM   1390 C  C     . VAL A 1 180 ? 53.518 12.913 16.023  1.00 71.65  ? 434 VAL A C     1 
ATOM   1391 O  O     . VAL A 1 180 ? 53.727 13.036 17.250  1.00 70.20  ? 434 VAL A O     1 
ATOM   1392 C  CB    . VAL A 1 180 ? 55.972 13.422 15.559  1.00 62.67  ? 434 VAL A CB    1 
ATOM   1393 C  CG1   . VAL A 1 180 ? 56.449 11.969 15.785  1.00 63.67  ? 434 VAL A CG1   1 
ATOM   1394 C  CG2   . VAL A 1 180 ? 56.855 14.063 14.546  1.00 63.84  ? 434 VAL A CG2   1 
ATOM   1395 N  N     . ASP A 1 181 ? 52.417 12.319 15.497  1.00 66.67  ? 435 ASP A N     1 
ATOM   1396 C  CA    . ASP A 1 181 ? 51.230 11.927 16.344  1.00 69.08  ? 435 ASP A CA    1 
ATOM   1397 C  C     . ASP A 1 181 ? 51.552 10.948 17.488  1.00 68.41  ? 435 ASP A C     1 
ATOM   1398 O  O     . ASP A 1 181 ? 51.066 11.078 18.617  1.00 72.54  ? 435 ASP A O     1 
ATOM   1399 C  CB    . ASP A 1 181 ? 50.054 11.298 15.536  1.00 73.09  ? 435 ASP A CB    1 
ATOM   1400 C  CG    . ASP A 1 181 ? 49.629 12.115 14.287  1.00 78.57  ? 435 ASP A CG    1 
ATOM   1401 O  OD1   . ASP A 1 181 ? 49.598 13.382 14.248  1.00 83.13  ? 435 ASP A OD1   1 
ATOM   1402 O  OD2   . ASP A 1 181 ? 49.266 11.437 13.307  1.00 94.28  ? 435 ASP A OD2   1 
ATOM   1403 N  N     . GLU A 1 182 ? 52.425 10.002 17.205  1.00 68.18  ? 436 GLU A N     1 
ATOM   1404 C  CA    . GLU A 1 182 ? 52.776 8.997  18.150  1.00 77.41  ? 436 GLU A CA    1 
ATOM   1405 C  C     . GLU A 1 182 ? 53.486 9.630  19.361  1.00 79.39  ? 436 GLU A C     1 
ATOM   1406 O  O     . GLU A 1 182 ? 53.578 8.966  20.412  1.00 86.28  ? 436 GLU A O     1 
ATOM   1407 C  CB    . GLU A 1 182 ? 53.672 7.898  17.522  1.00 79.41  ? 436 GLU A CB    1 
ATOM   1408 C  CG    . GLU A 1 182 ? 53.405 7.561  16.044  1.00 83.08  ? 436 GLU A CG    1 
ATOM   1409 C  CD    . GLU A 1 182 ? 54.259 8.396  15.072  1.00 82.94  ? 436 GLU A CD    1 
ATOM   1410 O  OE1   . GLU A 1 182 ? 55.500 8.283  15.147  1.00 80.70  ? 436 GLU A OE1   1 
ATOM   1411 O  OE2   . GLU A 1 182 ? 53.699 9.160  14.239  1.00 77.70  ? 436 GLU A OE2   1 
ATOM   1412 N  N     . LEU A 1 183 ? 54.071 10.835 19.183  1.00 70.57  ? 437 LEU A N     1 
ATOM   1413 C  CA    . LEU A 1 183 ? 54.663 11.600 20.287  1.00 68.62  ? 437 LEU A CA    1 
ATOM   1414 C  C     . LEU A 1 183 ? 53.865 12.842 20.657  1.00 69.45  ? 437 LEU A C     1 
ATOM   1415 O  O     . LEU A 1 183 ? 54.397 13.711 21.354  1.00 67.42  ? 437 LEU A O     1 
ATOM   1416 C  CB    . LEU A 1 183 ? 56.104 11.965 19.980  1.00 69.63  ? 437 LEU A CB    1 
ATOM   1417 C  CG    . LEU A 1 183 ? 57.049 10.764 20.047  1.00 72.74  ? 437 LEU A CG    1 
ATOM   1418 C  CD1   . LEU A 1 183 ? 58.367 11.069 19.392  1.00 71.86  ? 437 LEU A CD1   1 
ATOM   1419 C  CD2   . LEU A 1 183 ? 57.294 10.367 21.497  1.00 78.58  ? 437 LEU A CD2   1 
ATOM   1420 N  N     . CYS A 1 184 ? 52.570 12.881 20.271  1.00 72.66  ? 438 CYS A N     1 
ATOM   1421 C  CA    . CYS A 1 184 ? 51.650 13.965 20.653  1.00 73.72  ? 438 CYS A CA    1 
ATOM   1422 C  C     . CYS A 1 184 ? 50.625 13.413 21.601  1.00 75.15  ? 438 CYS A C     1 
ATOM   1423 O  O     . CYS A 1 184 ? 50.278 12.235 21.543  1.00 80.65  ? 438 CYS A O     1 
ATOM   1424 C  CB    . CYS A 1 184 ? 51.000 14.641 19.456  1.00 67.53  ? 438 CYS A CB    1 
ATOM   1425 S  SG    . CYS A 1 184 ? 52.182 15.673 18.571  1.00 64.66  ? 438 CYS A SG    1 
ATOM   1426 N  N     . SER A 1 185 ? 50.194 14.268 22.514  1.00 72.35  ? 439 SER A N     1 
ATOM   1427 C  CA    . SER A 1 185 ? 49.261 13.868 23.569  1.00 71.03  ? 439 SER A CA    1 
ATOM   1428 C  C     . SER A 1 185 ? 48.717 15.166 24.200  1.00 69.91  ? 439 SER A C     1 
ATOM   1429 O  O     . SER A 1 185 ? 49.039 16.243 23.721  1.00 66.18  ? 439 SER A O     1 
ATOM   1430 C  CB    . SER A 1 185 ? 49.936 12.918 24.574  1.00 71.67  ? 439 SER A CB    1 
ATOM   1431 O  OG    . SER A 1 185 ? 50.698 13.593 25.538  1.00 68.60  ? 439 SER A OG    1 
ATOM   1432 N  N     . PRO A 1 186 ? 47.880 15.076 25.246  1.00 68.49  ? 440 PRO A N     1 
ATOM   1433 C  CA    . PRO A 1 186 ? 47.364 16.336 25.799  1.00 68.88  ? 440 PRO A CA    1 
ATOM   1434 C  C     . PRO A 1 186 ? 48.392 17.304 26.376  1.00 64.46  ? 440 PRO A C     1 
ATOM   1435 O  O     . PRO A 1 186 ? 48.123 18.531 26.474  1.00 62.53  ? 440 PRO A O     1 
ATOM   1436 C  CB    . PRO A 1 186 ? 46.446 15.855 26.937  1.00 72.93  ? 440 PRO A CB    1 
ATOM   1437 C  CG    . PRO A 1 186 ? 46.031 14.468 26.513  1.00 73.70  ? 440 PRO A CG    1 
ATOM   1438 C  CD    . PRO A 1 186 ? 47.222 13.893 25.846  1.00 67.53  ? 440 PRO A CD    1 
ATOM   1439 N  N     . HIS A 1 187 ? 49.511 16.769 26.845  1.00 62.01  ? 441 HIS A N     1 
ATOM   1440 C  CA    . HIS A 1 187 ? 50.487 17.614 27.582  1.00 66.61  ? 441 HIS A CA    1 
ATOM   1441 C  C     . HIS A 1 187 ? 51.896 17.693 26.923  1.00 64.19  ? 441 HIS A C     1 
ATOM   1442 O  O     . HIS A 1 187 ? 52.851 18.389 27.441  1.00 68.53  ? 441 HIS A O     1 
ATOM   1443 C  CB    . HIS A 1 187 ? 50.514 17.180 29.063  1.00 64.78  ? 441 HIS A CB    1 
ATOM   1444 C  CG    . HIS A 1 187 ? 49.164 17.194 29.709  1.00 65.57  ? 441 HIS A CG    1 
ATOM   1445 N  ND1   . HIS A 1 187 ? 48.452 16.047 29.986  1.00 73.83  ? 441 HIS A ND1   1 
ATOM   1446 C  CD2   . HIS A 1 187 ? 48.371 18.232 30.087  1.00 67.33  ? 441 HIS A CD2   1 
ATOM   1447 C  CE1   . HIS A 1 187 ? 47.275 16.380 30.505  1.00 76.45  ? 441 HIS A CE1   1 
ATOM   1448 N  NE2   . HIS A 1 187 ? 47.201 17.703 30.575  1.00 63.83  ? 441 HIS A NE2   1 
ATOM   1449 N  N     . VAL A 1 188 ? 51.981 17.056 25.756  1.00 60.82  ? 442 VAL A N     1 
ATOM   1450 C  CA    . VAL A 1 188 ? 53.183 17.021 24.931  1.00 59.89  ? 442 VAL A CA    1 
ATOM   1451 C  C     . VAL A 1 188 ? 52.836 17.249 23.474  1.00 59.59  ? 442 VAL A C     1 
ATOM   1452 O  O     . VAL A 1 188 ? 51.944 16.589 22.906  1.00 65.56  ? 442 VAL A O     1 
ATOM   1453 C  CB    . VAL A 1 188 ? 53.882 15.663 25.031  1.00 62.37  ? 442 VAL A CB    1 
ATOM   1454 C  CG1   . VAL A 1 188 ? 55.184 15.675 24.271  1.00 56.32  ? 442 VAL A CG1   1 
ATOM   1455 C  CG2   . VAL A 1 188 ? 54.138 15.337 26.481  1.00 67.12  ? 442 VAL A CG2   1 
ATOM   1456 N  N     . LEU A 1 189 ? 53.558 18.170 22.858  1.00 62.28  ? 443 LEU A N     1 
ATOM   1457 C  CA    . LEU A 1 189 ? 53.385 18.445 21.448  1.00 62.06  ? 443 LEU A CA    1 
ATOM   1458 C  C     . LEU A 1 189 ? 54.720 18.223 20.745  1.00 59.02  ? 443 LEU A C     1 
ATOM   1459 O  O     . LEU A 1 189 ? 55.696 18.971 21.048  1.00 54.55  ? 443 LEU A O     1 
ATOM   1460 C  CB    . LEU A 1 189 ? 52.918 19.884 21.254  1.00 60.14  ? 443 LEU A CB    1 
ATOM   1461 C  CG    . LEU A 1 189 ? 52.446 20.043 19.787  1.00 69.16  ? 443 LEU A CG    1 
ATOM   1462 C  CD1   . LEU A 1 189 ? 51.129 19.334 19.553  1.00 67.86  ? 443 LEU A CD1   1 
ATOM   1463 C  CD2   . LEU A 1 189 ? 52.302 21.510 19.422  1.00 77.01  ? 443 LEU A CD2   1 
ATOM   1464 N  N     . THR A 1 190 ? 54.788 17.228 19.846  1.00 56.46  ? 444 THR A N     1 
ATOM   1465 C  CA    . THR A 1 190 ? 56.060 16.932 19.111  1.00 54.63  ? 444 THR A CA    1 
ATOM   1466 C  C     . THR A 1 190 ? 56.037 17.266 17.605  1.00 53.00  ? 444 THR A C     1 
ATOM   1467 O  O     . THR A 1 190 ? 55.229 16.737 16.879  1.00 57.88  ? 444 THR A O     1 
ATOM   1468 C  CB    . THR A 1 190 ? 56.504 15.482 19.391  1.00 53.80  ? 444 THR A CB    1 
ATOM   1469 O  OG1   . THR A 1 190 ? 56.708 15.316 20.789  1.00 56.01  ? 444 THR A OG1   1 
ATOM   1470 C  CG2   . THR A 1 190 ? 57.811 15.107 18.743  1.00 51.49  ? 444 THR A CG2   1 
ATOM   1471 N  N     . THR A 1 191 ? 56.906 18.167 17.147  1.00 53.45  ? 445 THR A N     1 
ATOM   1472 C  CA    . THR A 1 191 ? 57.064 18.485 15.701  1.00 60.36  ? 445 THR A CA    1 
ATOM   1473 C  C     . THR A 1 191 ? 58.444 18.164 15.162  1.00 62.41  ? 445 THR A C     1 
ATOM   1474 O  O     . THR A 1 191 ? 59.397 18.155 15.905  1.00 63.36  ? 445 THR A O     1 
ATOM   1475 C  CB    . THR A 1 191 ? 56.756 19.977 15.385  1.00 63.41  ? 445 THR A CB    1 
ATOM   1476 O  OG1   . THR A 1 191 ? 57.508 20.830 16.207  1.00 69.09  ? 445 THR A OG1   1 
ATOM   1477 C  CG2   . THR A 1 191 ? 55.287 20.327 15.679  1.00 63.18  ? 445 THR A CG2   1 
ATOM   1478 N  N     . GLU A 1 192 ? 58.539 17.822 13.885  1.00 66.09  ? 446 GLU A N     1 
ATOM   1479 C  CA    . GLU A 1 192 ? 59.802 17.954 13.137  1.00 69.62  ? 446 GLU A CA    1 
ATOM   1480 C  C     . GLU A 1 192 ? 60.618 19.212 13.493  1.00 61.18  ? 446 GLU A C     1 
ATOM   1481 O  O     . GLU A 1 192 ? 60.102 20.339 13.485  1.00 66.36  ? 446 GLU A O     1 
ATOM   1482 C  CB    . GLU A 1 192 ? 59.528 18.093 11.655  1.00 73.63  ? 446 GLU A CB    1 
ATOM   1483 C  CG    . GLU A 1 192 ? 59.214 16.815 10.931  1.00 84.48  ? 446 GLU A CG    1 
ATOM   1484 C  CD    . GLU A 1 192 ? 58.945 17.099 9.442   1.00 93.67  ? 446 GLU A CD    1 
ATOM   1485 O  OE1   . GLU A 1 192 ? 58.331 18.163 9.062   1.00 81.29  ? 446 GLU A OE1   1 
ATOM   1486 O  OE2   . GLU A 1 192 ? 59.360 16.216 8.662   1.00 94.75  ? 446 GLU A OE2   1 
ATOM   1487 N  N     . LEU A 1 193 ? 61.892 19.011 13.727  1.00 56.31  ? 447 LEU A N     1 
ATOM   1488 C  CA    . LEU A 1 193 ? 62.832 20.098 13.952  1.00 60.94  ? 447 LEU A CA    1 
ATOM   1489 C  C     . LEU A 1 193 ? 62.923 20.952 12.681  1.00 62.01  ? 447 LEU A C     1 
ATOM   1490 O  O     . LEU A 1 193 ? 62.916 20.419 11.572  1.00 57.48  ? 447 LEU A O     1 
ATOM   1491 C  CB    . LEU A 1 193 ? 64.156 19.461 14.288  1.00 59.98  ? 447 LEU A CB    1 
ATOM   1492 C  CG    . LEU A 1 193 ? 65.201 20.384 14.837  1.00 68.15  ? 447 LEU A CG    1 
ATOM   1493 C  CD1   . LEU A 1 193 ? 64.864 20.745 16.274  1.00 70.36  ? 447 LEU A CD1   1 
ATOM   1494 C  CD2   . LEU A 1 193 ? 66.593 19.818 14.665  1.00 65.69  ? 447 LEU A CD2   1 
ATOM   1495 N  N     . VAL A 1 194 ? 62.960 22.272 12.824  1.00 69.23  ? 448 VAL A N     1 
ATOM   1496 C  CA    . VAL A 1 194 ? 63.185 23.165 11.635  1.00 72.54  ? 448 VAL A CA    1 
ATOM   1497 C  C     . VAL A 1 194 ? 64.575 23.838 11.672  1.00 73.08  ? 448 VAL A C     1 
ATOM   1498 O  O     . VAL A 1 194 ? 65.078 24.266 12.729  1.00 70.69  ? 448 VAL A O     1 
ATOM   1499 C  CB    . VAL A 1 194 ? 62.104 24.279 11.435  1.00 70.69  ? 448 VAL A CB    1 
ATOM   1500 C  CG1   . VAL A 1 194 ? 60.664 23.745 11.541  1.00 74.84  ? 448 VAL A CG1   1 
ATOM   1501 C  CG2   . VAL A 1 194 ? 62.280 25.394 12.417  1.00 73.26  ? 448 VAL A CG2   1 
ATOM   1502 N  N     . SER A 1 195 ? 65.143 23.961 10.486  1.00 73.86  ? 449 SER A N     1 
ATOM   1503 C  CA    . SER A 1 195 ? 66.373 24.697 10.237  1.00 79.87  ? 449 SER A CA    1 
ATOM   1504 C  C     . SER A 1 195 ? 66.187 26.211 10.330  1.00 76.07  ? 449 SER A C     1 
ATOM   1505 O  O     . SER A 1 195 ? 65.105 26.727 10.444  1.00 79.06  ? 449 SER A O     1 
ATOM   1506 C  CB    . SER A 1 195 ? 66.802 24.409 8.804   1.00 84.84  ? 449 SER A CB    1 
ATOM   1507 O  OG    . SER A 1 195 ? 65.829 24.982 7.916   1.00 86.89  ? 449 SER A OG    1 
ATOM   1508 N  N     . GLY A 1 196 ? 67.283 26.922 10.214  1.00 77.65  ? 450 GLY A N     1 
ATOM   1509 C  CA    . GLY A 1 196 ? 67.267 28.365 10.103  1.00 71.72  ? 450 GLY A CA    1 
ATOM   1510 C  C     . GLY A 1 196 ? 67.282 28.949 11.474  1.00 67.93  ? 450 GLY A C     1 
ATOM   1511 O  O     . GLY A 1 196 ? 67.319 28.201 12.416  1.00 72.86  ? 450 GLY A O     1 
ATOM   1512 N  N     . PHE A 1 197 ? 67.139 30.269 11.572  1.00 67.65  ? 451 PHE A N     1 
ATOM   1513 C  CA    . PHE A 1 197 ? 67.112 30.981 12.836  1.00 70.79  ? 451 PHE A CA    1 
ATOM   1514 C  C     . PHE A 1 197 ? 65.831 31.848 12.944  1.00 74.11  ? 451 PHE A C     1 
ATOM   1515 O  O     . PHE A 1 197 ? 65.254 32.253 11.929  1.00 74.23  ? 451 PHE A O     1 
ATOM   1516 C  CB    . PHE A 1 197 ? 68.370 31.849 12.924  1.00 71.89  ? 451 PHE A CB    1 
ATOM   1517 C  CG    . PHE A 1 197 ? 68.716 32.580 11.628  1.00 73.39  ? 451 PHE A CG    1 
ATOM   1518 C  CD1   . PHE A 1 197 ? 69.546 31.976 10.657  1.00 83.68  ? 451 PHE A CD1   1 
ATOM   1519 C  CD2   . PHE A 1 197 ? 68.228 33.861 11.367  1.00 72.66  ? 451 PHE A CD2   1 
ATOM   1520 C  CE1   . PHE A 1 197 ? 69.862 32.654 9.470   1.00 79.87  ? 451 PHE A CE1   1 
ATOM   1521 C  CE2   . PHE A 1 197 ? 68.538 34.533 10.198  1.00 71.09  ? 451 PHE A CE2   1 
ATOM   1522 C  CZ    . PHE A 1 197 ? 69.358 33.938 9.251   1.00 74.82  ? 451 PHE A CZ    1 
ATOM   1523 N  N     . PRO A 1 198 ? 65.396 32.179 14.161  1.00 71.36  ? 452 PRO A N     1 
ATOM   1524 C  CA    . PRO A 1 198 ? 64.254 33.110 14.315  1.00 72.76  ? 452 PRO A CA    1 
ATOM   1525 C  C     . PRO A 1 198 ? 64.515 34.559 13.865  1.00 73.27  ? 452 PRO A C     1 
ATOM   1526 O  O     . PRO A 1 198 ? 65.604 35.055 14.060  1.00 71.40  ? 452 PRO A O     1 
ATOM   1527 C  CB    . PRO A 1 198 ? 64.024 33.133 15.823  1.00 74.90  ? 452 PRO A CB    1 
ATOM   1528 C  CG    . PRO A 1 198 ? 65.372 32.818 16.402  1.00 74.09  ? 452 PRO A CG    1 
ATOM   1529 C  CD    . PRO A 1 198 ? 65.990 31.819 15.454  1.00 71.65  ? 452 PRO A CD    1 
ATOM   1530 N  N     . LEU A 1 199 ? 63.495 35.268 13.375  1.00 69.33  ? 453 LEU A N     1 
ATOM   1531 C  CA    . LEU A 1 199 ? 63.701 36.612 12.827  1.00 65.99  ? 453 LEU A CA    1 
ATOM   1532 C  C     . LEU A 1 199 ? 64.238 37.624 13.826  1.00 69.05  ? 453 LEU A C     1 
ATOM   1533 O  O     . LEU A 1 199 ? 64.725 38.671 13.383  1.00 76.58  ? 453 LEU A O     1 
ATOM   1534 C  CB    . LEU A 1 199 ? 62.445 37.170 12.145  1.00 64.08  ? 453 LEU A CB    1 
ATOM   1535 C  CG    . LEU A 1 199 ? 61.983 36.314 10.963  1.00 67.61  ? 453 LEU A CG    1 
ATOM   1536 C  CD1   . LEU A 1 199 ? 60.708 36.862 10.307  1.00 66.39  ? 453 LEU A CD1   1 
ATOM   1537 C  CD2   . LEU A 1 199 ? 63.089 36.116 9.932   1.00 65.03  ? 453 LEU A CD2   1 
ATOM   1538 N  N     . ASP A 1 200 ? 64.158 37.331 15.130  1.00 74.26  ? 454 ASP A N     1 
ATOM   1539 C  CA    . ASP A 1 200 ? 64.934 38.035 16.240  1.00 80.96  ? 454 ASP A CA    1 
ATOM   1540 C  C     . ASP A 1 200 ? 66.370 38.269 15.928  1.00 74.28  ? 454 ASP A C     1 
ATOM   1541 O  O     . ASP A 1 200 ? 66.894 39.281 16.314  1.00 76.78  ? 454 ASP A O     1 
ATOM   1542 C  CB    . ASP A 1 200 ? 65.107 37.176 17.504  1.00 76.37  ? 454 ASP A CB    1 
ATOM   1543 C  CG    . ASP A 1 200 ? 63.881 36.962 18.219  1.00 80.63  ? 454 ASP A CG    1 
ATOM   1544 O  OD1   . ASP A 1 200 ? 63.152 37.945 18.449  1.00 96.43  ? 454 ASP A OD1   1 
ATOM   1545 O  OD2   . ASP A 1 200 ? 63.649 35.801 18.579  1.00 80.95  ? 454 ASP A OD2   1 
ATOM   1546 N  N     . GLN A 1 201 ? 67.004 37.227 15.379  1.00 73.85  ? 455 GLN A N     1 
ATOM   1547 C  CA    . GLN A 1 201 ? 68.438 37.193 15.094  1.00 79.04  ? 455 GLN A CA    1 
ATOM   1548 C  C     . GLN A 1 201 ? 68.753 37.621 13.679  1.00 80.84  ? 455 GLN A C     1 
ATOM   1549 O  O     . GLN A 1 201 ? 69.830 37.306 13.200  1.00 81.13  ? 455 GLN A O     1 
ATOM   1550 C  CB    . GLN A 1 201 ? 68.987 35.767 15.256  1.00 82.76  ? 455 GLN A CB    1 
ATOM   1551 C  CG    . GLN A 1 201 ? 69.006 35.218 16.689  1.00 85.32  ? 455 GLN A CG    1 
ATOM   1552 C  CD    . GLN A 1 201 ? 69.286 33.691 16.726  1.00 86.33  ? 455 GLN A CD    1 
ATOM   1553 O  OE1   . GLN A 1 201 ? 70.054 33.107 15.897  1.00 83.11  ? 455 GLN A OE1   1 
ATOM   1554 N  NE2   . GLN A 1 201 ? 68.680 33.039 17.706  1.00 83.31  ? 455 GLN A NE2   1 
ATOM   1555 N  N     . ALA A 1 202 ? 67.854 38.366 13.023  1.00 89.34  ? 456 ALA A N     1 
ATOM   1556 C  CA    . ALA A 1 202 ? 67.902 38.585 11.559  1.00 87.72  ? 456 ALA A CA    1 
ATOM   1557 C  C     . ALA A 1 202 ? 67.988 40.036 11.064  1.00 89.49  ? 456 ALA A C     1 
ATOM   1558 O  O     . ALA A 1 202 ? 67.987 40.242 9.849   1.00 86.73  ? 456 ALA A O     1 
ATOM   1559 C  CB    . ALA A 1 202 ? 66.715 37.901 10.892  1.00 88.48  ? 456 ALA A CB    1 
ATOM   1560 N  N     . GLU A 1 203 ? 68.084 41.033 11.954  1.00 92.06  ? 457 GLU A N     1 
ATOM   1561 C  CA    . GLU A 1 203 ? 68.392 42.415 11.504  1.00 93.86  ? 457 GLU A CA    1 
ATOM   1562 C  C     . GLU A 1 203 ? 69.711 42.466 10.683  1.00 93.20  ? 457 GLU A C     1 
ATOM   1563 O  O     . GLU A 1 203 ? 69.845 43.306 9.807   1.00 91.65  ? 457 GLU A O     1 
ATOM   1564 C  CB    . GLU A 1 203 ? 68.485 43.406 12.673  1.00 95.23  ? 457 GLU A CB    1 
ATOM   1565 C  CG    . GLU A 1 203 ? 67.221 43.627 13.469  1.00 96.44  ? 457 GLU A CG    1 
ATOM   1566 C  CD    . GLU A 1 203 ? 67.499 44.288 14.807  1.00 101.23 ? 457 GLU A CD    1 
ATOM   1567 O  OE1   . GLU A 1 203 ? 67.542 43.577 15.838  1.00 97.84  ? 457 GLU A OE1   1 
ATOM   1568 O  OE2   . GLU A 1 203 ? 67.689 45.523 14.819  1.00 108.47 ? 457 GLU A OE2   1 
ATOM   1569 N  N     . GLY A 1 204 ? 70.653 41.556 10.963  1.00 94.51  ? 458 GLY A N     1 
ATOM   1570 C  CA    . GLY A 1 204 ? 71.920 41.473 10.242  1.00 93.85  ? 458 GLY A CA    1 
ATOM   1571 C  C     . GLY A 1 204 ? 71.874 41.041 8.781   1.00 98.06  ? 458 GLY A C     1 
ATOM   1572 O  O     . GLY A 1 204 ? 72.865 41.232 8.030   1.00 88.50  ? 458 GLY A O     1 
ATOM   1573 N  N     . LEU A 1 205 ? 70.737 40.482 8.353   1.00 93.50  ? 459 LEU A N     1 
ATOM   1574 C  CA    . LEU A 1 205 ? 70.517 40.200 6.920   1.00 86.04  ? 459 LEU A CA    1 
ATOM   1575 C  C     . LEU A 1 205 ? 70.405 41.463 6.036   1.00 77.59  ? 459 LEU A C     1 
ATOM   1576 O  O     . LEU A 1 205 ? 70.371 42.596 6.509   1.00 83.31  ? 459 LEU A O     1 
ATOM   1577 C  CB    . LEU A 1 205 ? 69.279 39.333 6.752   1.00 86.75  ? 459 LEU A CB    1 
ATOM   1578 C  CG    . LEU A 1 205 ? 69.349 37.979 7.440   1.00 86.26  ? 459 LEU A CG    1 
ATOM   1579 C  CD1   . LEU A 1 205 ? 68.011 37.280 7.215   1.00 84.79  ? 459 LEU A CD1   1 
ATOM   1580 C  CD2   . LEU A 1 205 ? 70.534 37.128 6.963   1.00 82.83  ? 459 LEU A CD2   1 
ATOM   1581 N  N     . SER A 1 206 ? 70.394 41.261 4.734   1.00 78.99  ? 460 SER A N     1 
ATOM   1582 C  CA    . SER A 1 206 ? 70.413 42.370 3.790   1.00 76.92  ? 460 SER A CA    1 
ATOM   1583 C  C     . SER A 1 206 ? 69.044 43.010 3.648   1.00 80.39  ? 460 SER A C     1 
ATOM   1584 O  O     . SER A 1 206 ? 68.036 42.387 3.985   1.00 76.56  ? 460 SER A O     1 
ATOM   1585 C  CB    . SER A 1 206 ? 70.839 41.866 2.430   1.00 74.53  ? 460 SER A CB    1 
ATOM   1586 O  OG    . SER A 1 206 ? 69.825 41.026 1.893   1.00 75.99  ? 460 SER A OG    1 
ATOM   1587 N  N     . GLN A 1 207 ? 69.021 44.241 3.111   1.00 77.74  ? 461 GLN A N     1 
ATOM   1588 C  CA    . GLN A 1 207 ? 67.791 44.995 2.902   1.00 80.56  ? 461 GLN A CA    1 
ATOM   1589 C  C     . GLN A 1 207 ? 66.832 44.284 1.928   1.00 78.33  ? 461 GLN A C     1 
ATOM   1590 O  O     . GLN A 1 207 ? 65.625 44.383 2.072   1.00 80.19  ? 461 GLN A O     1 
ATOM   1591 C  CB    . GLN A 1 207 ? 68.087 46.409 2.385   1.00 80.55  ? 461 GLN A CB    1 
ATOM   1592 C  CG    . GLN A 1 207 ? 66.900 47.385 2.424   1.00 78.62  ? 461 GLN A CG    1 
ATOM   1593 C  CD    . GLN A 1 207 ? 66.457 47.703 3.837   1.00 80.54  ? 461 GLN A CD    1 
ATOM   1594 O  OE1   . GLN A 1 207 ? 67.283 47.898 4.732   1.00 82.34  ? 461 GLN A OE1   1 
ATOM   1595 N  NE2   . GLN A 1 207 ? 65.139 47.747 4.054   1.00 83.21  ? 461 GLN A NE2   1 
ATOM   1596 N  N     . GLU A 1 208 ? 67.369 43.563 0.969   1.00 75.94  ? 462 GLU A N     1 
ATOM   1597 C  CA    . GLU A 1 208 ? 66.548 42.880 -0.049  1.00 78.27  ? 462 GLU A CA    1 
ATOM   1598 C  C     . GLU A 1 208 ? 65.806 41.684 0.556   1.00 71.77  ? 462 GLU A C     1 
ATOM   1599 O  O     . GLU A 1 208 ? 64.678 41.424 0.191   1.00 71.00  ? 462 GLU A O     1 
ATOM   1600 C  CB    . GLU A 1 208 ? 67.415 42.393 -1.237  1.00 78.85  ? 462 GLU A CB    1 
ATOM   1601 C  CG    . GLU A 1 208 ? 68.043 43.503 -2.098  1.00 86.66  ? 462 GLU A CG    1 
ATOM   1602 C  CD    . GLU A 1 208 ? 69.127 44.354 -1.398  1.00 88.99  ? 462 GLU A CD    1 
ATOM   1603 O  OE1   . GLU A 1 208 ? 70.215 43.823 -1.032  1.00 91.03  ? 462 GLU A OE1   1 
ATOM   1604 O  OE2   . GLU A 1 208 ? 68.880 45.563 -1.203  1.00 83.99  ? 462 GLU A OE2   1 
ATOM   1605 N  N     . ILE A 1 209 ? 66.475 40.963 1.450   1.00 73.13  ? 463 ILE A N     1 
ATOM   1606 C  CA    . ILE A 1 209 ? 66.012 39.690 2.057   1.00 72.43  ? 463 ILE A CA    1 
ATOM   1607 C  C     . ILE A 1 209 ? 64.969 40.042 3.114   1.00 72.35  ? 463 ILE A C     1 
ATOM   1608 O  O     . ILE A 1 209 ? 63.946 39.382 3.243   1.00 71.33  ? 463 ILE A O     1 
ATOM   1609 C  CB    . ILE A 1 209 ? 67.186 38.939 2.761   1.00 71.74  ? 463 ILE A CB    1 
ATOM   1610 C  CG1   . ILE A 1 209 ? 68.223 38.471 1.733   1.00 78.39  ? 463 ILE A CG1   1 
ATOM   1611 C  CG2   . ILE A 1 209 ? 66.709 37.774 3.648   1.00 70.34  ? 463 ILE A CG2   1 
ATOM   1612 C  CD1   . ILE A 1 209 ? 67.887 37.236 0.932   1.00 78.39  ? 463 ILE A CD1   1 
ATOM   1613 N  N     . ARG A 1 210 ? 65.299 41.061 3.897   1.00 69.14  ? 464 ARG A N     1 
ATOM   1614 C  CA    . ARG A 1 210 ? 64.429 41.576 4.921   1.00 68.99  ? 464 ARG A CA    1 
ATOM   1615 C  C     . ARG A 1 210 ? 63.147 42.094 4.282   1.00 67.23  ? 464 ARG A C     1 
ATOM   1616 O  O     . ARG A 1 210 ? 62.056 41.741 4.741   1.00 67.71  ? 464 ARG A O     1 
ATOM   1617 C  CB    . ARG A 1 210 ? 65.149 42.586 5.840   1.00 68.58  ? 464 ARG A CB    1 
ATOM   1618 C  CG    . ARG A 1 210 ? 65.927 41.895 6.994   1.00 75.34  ? 464 ARG A CG    1 
ATOM   1619 C  CD    . ARG A 1 210 ? 67.108 42.681 7.654   1.00 79.36  ? 464 ARG A CD    1 
ATOM   1620 N  NE    . ARG A 1 210 ? 66.847 44.103 7.792   1.00 84.87  ? 464 ARG A NE    1 
ATOM   1621 C  CZ    . ARG A 1 210 ? 67.400 45.099 7.098   1.00 86.00  ? 464 ARG A CZ    1 
ATOM   1622 N  NH1   . ARG A 1 210 ? 68.359 44.923 6.221   1.00 90.15  ? 464 ARG A NH1   1 
ATOM   1623 N  NH2   . ARG A 1 210 ? 66.972 46.322 7.315   1.00 92.87  ? 464 ARG A NH2   1 
ATOM   1624 N  N     . ASN A 1 211 ? 63.262 42.833 3.180   1.00 67.52  ? 465 ASN A N     1 
ATOM   1625 C  CA    . ASN A 1 211 ? 62.067 43.305 2.435   1.00 66.89  ? 465 ASN A CA    1 
ATOM   1626 C  C     . ASN A 1 211 ? 61.201 42.160 1.979   1.00 65.83  ? 465 ASN A C     1 
ATOM   1627 O  O     . ASN A 1 211 ? 60.009 42.194 2.123   1.00 65.57  ? 465 ASN A O     1 
ATOM   1628 C  CB    . ASN A 1 211 ? 62.459 44.142 1.221   1.00 66.63  ? 465 ASN A CB    1 
ATOM   1629 C  CG    . ASN A 1 211 ? 63.077 45.469 1.629   1.00 73.75  ? 465 ASN A CG    1 
ATOM   1630 O  OD1   . ASN A 1 211 ? 62.991 45.881 2.808   1.00 70.09  ? 465 ASN A OD1   1 
ATOM   1631 N  ND2   . ASN A 1 211 ? 63.726 46.132 0.678   1.00 71.85  ? 465 ASN A ND2   1 
ATOM   1632 N  N     . GLU A 1 212 ? 61.839 41.139 1.474   1.00 61.21  ? 466 GLU A N     1 
ATOM   1633 C  CA    . GLU A 1 212 ? 61.172 40.032 0.953   1.00 67.98  ? 466 GLU A CA    1 
ATOM   1634 C  C     . GLU A 1 212 ? 60.507 39.166 2.027   1.00 63.29  ? 466 GLU A C     1 
ATOM   1635 O  O     . GLU A 1 212 ? 59.451 38.586 1.796   1.00 59.90  ? 466 GLU A O     1 
ATOM   1636 C  CB    . GLU A 1 212 ? 62.195 39.257 0.145   1.00 76.59  ? 466 GLU A CB    1 
ATOM   1637 C  CG    . GLU A 1 212 ? 61.635 38.276 -0.860  1.00 83.67  ? 466 GLU A CG    1 
ATOM   1638 C  CD    . GLU A 1 212 ? 62.748 37.626 -1.706  1.00 96.85  ? 466 GLU A CD    1 
ATOM   1639 O  OE1   . GLU A 1 212 ? 63.969 38.002 -1.565  1.00 87.70  ? 466 GLU A OE1   1 
ATOM   1640 O  OE2   . GLU A 1 212 ? 62.383 36.714 -2.509  1.00 102.09 ? 466 GLU A OE2   1 
ATOM   1641 N  N     . ILE A 1 213 ? 61.133 39.032 3.178   1.00 62.72  ? 467 ILE A N     1 
ATOM   1642 C  CA    . ILE A 1 213 ? 60.545 38.267 4.255   1.00 60.56  ? 467 ILE A CA    1 
ATOM   1643 C  C     . ILE A 1 213 ? 59.298 38.973 4.725   1.00 58.43  ? 467 ILE A C     1 
ATOM   1644 O  O     . ILE A 1 213 ? 58.244 38.403 4.806   1.00 64.79  ? 467 ILE A O     1 
ATOM   1645 C  CB    . ILE A 1 213 ? 61.554 38.073 5.411   1.00 63.14  ? 467 ILE A CB    1 
ATOM   1646 C  CG1   . ILE A 1 213 ? 62.642 37.083 4.957   1.00 69.36  ? 467 ILE A CG1   1 
ATOM   1647 C  CG2   . ILE A 1 213 ? 60.879 37.482 6.642   1.00 60.11  ? 467 ILE A CG2   1 
ATOM   1648 C  CD1   . ILE A 1 213 ? 63.926 37.136 5.790   1.00 73.37  ? 467 ILE A CD1   1 
ATOM   1649 N  N     . CYS A 1 214 ? 59.428 40.239 5.027   1.00 57.64  ? 468 CYS A N     1 
ATOM   1650 C  CA    . CYS A 1 214 ? 58.311 41.026 5.473   1.00 56.27  ? 468 CYS A CA    1 
ATOM   1651 C  C     . CYS A 1 214 ? 57.151 41.222 4.415   1.00 53.96  ? 468 CYS A C     1 
ATOM   1652 O  O     . CYS A 1 214 ? 55.968 41.232 4.772   1.00 53.76  ? 468 CYS A O     1 
ATOM   1653 C  CB    . CYS A 1 214 ? 58.886 42.345 5.976   1.00 56.84  ? 468 CYS A CB    1 
ATOM   1654 S  SG    . CYS A 1 214 ? 59.916 42.190 7.509   1.00 62.16  ? 468 CYS A SG    1 
ATOM   1655 N  N     . TYR A 1 215 ? 57.491 41.394 3.143   1.00 52.54  ? 469 TYR A N     1 
ATOM   1656 C  CA    . TYR A 1 215 ? 56.525 41.458 2.060   1.00 49.21  ? 469 TYR A CA    1 
ATOM   1657 C  C     . TYR A 1 215 ? 55.700 40.168 2.150   1.00 54.68  ? 469 TYR A C     1 
ATOM   1658 O  O     . TYR A 1 215 ? 54.503 40.230 2.218   1.00 50.14  ? 469 TYR A O     1 
ATOM   1659 C  CB    . TYR A 1 215 ? 57.173 41.515 0.671   1.00 52.04  ? 469 TYR A CB    1 
ATOM   1660 C  CG    . TYR A 1 215 ? 56.151 41.688 -0.489  1.00 52.91  ? 469 TYR A CG    1 
ATOM   1661 C  CD1   . TYR A 1 215 ? 55.555 40.594 -1.048  1.00 54.05  ? 469 TYR A CD1   1 
ATOM   1662 C  CD2   . TYR A 1 215 ? 55.791 42.966 -0.999  1.00 58.27  ? 469 TYR A CD2   1 
ATOM   1663 C  CE1   . TYR A 1 215 ? 54.620 40.710 -2.067  1.00 60.02  ? 469 TYR A CE1   1 
ATOM   1664 C  CE2   . TYR A 1 215 ? 54.847 43.104 -2.075  1.00 58.85  ? 469 TYR A CE2   1 
ATOM   1665 C  CZ    . TYR A 1 215 ? 54.232 41.965 -2.581  1.00 60.61  ? 469 TYR A CZ    1 
ATOM   1666 O  OH    . TYR A 1 215 ? 53.253 41.971 -3.631  1.00 67.57  ? 469 TYR A OH    1 
ATOM   1667 N  N     . ASN A 1 216 ? 56.354 39.020 2.221   1.00 52.99  ? 470 ASN A N     1 
ATOM   1668 C  CA    . ASN A 1 216 ? 55.635 37.773 2.339   1.00 56.99  ? 470 ASN A CA    1 
ATOM   1669 C  C     . ASN A 1 216 ? 54.814 37.630 3.616   1.00 57.31  ? 470 ASN A C     1 
ATOM   1670 O  O     . ASN A 1 216 ? 53.739 37.042 3.560   1.00 60.22  ? 470 ASN A O     1 
ATOM   1671 C  CB    . ASN A 1 216 ? 56.592 36.594 2.211   1.00 58.18  ? 470 ASN A CB    1 
ATOM   1672 C  CG    . ASN A 1 216 ? 57.067 36.401 0.764   1.00 60.85  ? 470 ASN A CG    1 
ATOM   1673 O  OD1   . ASN A 1 216 ? 56.279 36.161 -0.103  1.00 62.67  ? 470 ASN A OD1   1 
ATOM   1674 N  ND2   . ASN A 1 216 ? 58.346 36.467 0.537   1.00 66.16  ? 470 ASN A ND2   1 
ATOM   1675 N  N     . ILE A 1 217 ? 55.314 38.160 4.734   1.00 53.61  ? 471 ILE A N     1 
ATOM   1676 C  CA    . ILE A 1 217 ? 54.623 38.099 6.011   1.00 51.26  ? 471 ILE A CA    1 
ATOM   1677 C  C     . ILE A 1 217 ? 53.344 38.915 5.906   1.00 52.60  ? 471 ILE A C     1 
ATOM   1678 O  O     . ILE A 1 217 ? 52.263 38.426 6.245   1.00 50.89  ? 471 ILE A O     1 
ATOM   1679 C  CB    . ILE A 1 217 ? 55.528 38.516 7.209   1.00 51.35  ? 471 ILE A CB    1 
ATOM   1680 C  CG1   . ILE A 1 217 ? 56.512 37.417 7.532   1.00 55.03  ? 471 ILE A CG1   1 
ATOM   1681 C  CG2   . ILE A 1 217 ? 54.738 38.723 8.506   1.00 54.33  ? 471 ILE A CG2   1 
ATOM   1682 C  CD1   . ILE A 1 217 ? 57.457 37.719 8.698   1.00 56.01  ? 471 ILE A CD1   1 
ATOM   1683 N  N     . LEU A 1 218 ? 53.418 40.105 5.343   1.00 52.85  ? 472 LEU A N     1 
ATOM   1684 C  CA    . LEU A 1 218 ? 52.214 40.906 5.302   1.00 55.62  ? 472 LEU A CA    1 
ATOM   1685 C  C     . LEU A 1 218 ? 51.130 40.344 4.310   1.00 58.70  ? 472 LEU A C     1 
ATOM   1686 O  O     . LEU A 1 218 ? 49.888 40.379 4.594   1.00 51.67  ? 472 LEU A O     1 
ATOM   1687 C  CB    . LEU A 1 218 ? 52.594 42.343 5.015   1.00 58.83  ? 472 LEU A CB    1 
ATOM   1688 C  CG    . LEU A 1 218 ? 51.494 43.345 5.251   1.00 61.14  ? 472 LEU A CG    1 
ATOM   1689 C  CD1   . LEU A 1 218 ? 50.979 43.246 6.685   1.00 62.19  ? 472 LEU A CD1   1 
ATOM   1690 C  CD2   . LEU A 1 218 ? 52.094 44.713 5.017   1.00 62.36  ? 472 LEU A CD2   1 
ATOM   1691 N  N     . VAL A 1 219 ? 51.584 39.786 3.176   1.00 59.64  ? 473 VAL A N     1 
ATOM   1692 C  CA    . VAL A 1 219 ? 50.662 39.095 2.268   1.00 57.51  ? 473 VAL A CA    1 
ATOM   1693 C  C     . VAL A 1 219 ? 49.907 37.960 3.030   1.00 56.08  ? 473 VAL A C     1 
ATOM   1694 O  O     . VAL A 1 219 ? 48.673 37.843 2.963   1.00 52.17  ? 473 VAL A O     1 
ATOM   1695 C  CB    . VAL A 1 219 ? 51.357 38.570 1.013   1.00 57.50  ? 473 VAL A CB    1 
ATOM   1696 C  CG1   . VAL A 1 219 ? 50.393 37.750 0.135   1.00 59.61  ? 473 VAL A CG1   1 
ATOM   1697 C  CG2   . VAL A 1 219 ? 51.842 39.727 0.138   1.00 63.23  ? 473 VAL A CG2   1 
ATOM   1698 N  N     . LEU A 1 220 ? 50.669 37.177 3.772   1.00 51.98  ? 474 LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 220 ? 50.140 36.061 4.468   1.00 56.33  ? 474 LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 220 ? 49.108 36.571 5.478   1.00 51.10  ? 474 LEU A C     1 
ATOM   1701 O  O     . LEU A 1 220 ? 48.013 36.035 5.593   1.00 50.29  ? 474 LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 220 ? 51.274 35.258 5.162   1.00 55.94  ? 474 LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 220 ? 50.759 34.099 6.016   1.00 51.79  ? 474 LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 220 ? 50.125 33.059 5.126   1.00 55.20  ? 474 LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 220 ? 51.857 33.494 6.832   1.00 54.76  ? 474 LEU A CD2   1 
ATOM   1706 N  N     . CYS A 1 221 ? 49.456 37.645 6.168   1.00 49.89  ? 475 CYS A N     1 
ATOM   1707 C  CA    . CYS A 1 221 ? 48.524 38.282 7.070   1.00 51.28  ? 475 CYS A CA    1 
ATOM   1708 C  C     . CYS A 1 221 ? 47.193 38.675 6.402   1.00 52.69  ? 475 CYS A C     1 
ATOM   1709 O  O     . CYS A 1 221 ? 46.076 38.324 6.899   1.00 47.20  ? 475 CYS A O     1 
ATOM   1710 C  CB    . CYS A 1 221 ? 49.205 39.464 7.757   1.00 52.47  ? 475 CYS A CB    1 
ATOM   1711 S  SG    . CYS A 1 221 ? 48.140 40.536 8.817   1.00 57.69  ? 475 CYS A SG    1 
ATOM   1712 N  N     . LEU A 1 222 ? 47.269 39.346 5.251   1.00 53.56  ? 476 LEU A N     1 
ATOM   1713 C  CA    . LEU A 1 222 ? 46.006 39.650 4.560   1.00 51.74  ? 476 LEU A CA    1 
ATOM   1714 C  C     . LEU A 1 222 ? 45.188 38.420 4.209   1.00 50.81  ? 476 LEU A C     1 
ATOM   1715 O  O     . LEU A 1 222 ? 43.966 38.435 4.331   1.00 54.52  ? 476 LEU A O     1 
ATOM   1716 C  CB    . LEU A 1 222 ? 46.286 40.447 3.334   1.00 58.21  ? 476 LEU A CB    1 
ATOM   1717 C  CG    . LEU A 1 222 ? 46.843 41.815 3.663   1.00 54.17  ? 476 LEU A CG    1 
ATOM   1718 C  CD1   . LEU A 1 222 ? 47.136 42.415 2.308   1.00 54.86  ? 476 LEU A CD1   1 
ATOM   1719 C  CD2   . LEU A 1 222 ? 45.821 42.592 4.431   1.00 57.15  ? 476 LEU A CD2   1 
ATOM   1720 N  N     . ARG A 1 223 ? 45.871 37.325 3.836   1.00 56.40  ? 477 ARG A N     1 
ATOM   1721 C  CA    . ARG A 1 223 ? 45.212 36.032 3.535   1.00 58.57  ? 477 ARG A CA    1 
ATOM   1722 C  C     . ARG A 1 223 ? 44.555 35.418 4.771   1.00 57.23  ? 477 ARG A C     1 
ATOM   1723 O  O     . ARG A 1 223 ? 43.424 34.888 4.675   1.00 53.94  ? 477 ARG A O     1 
ATOM   1724 C  CB    . ARG A 1 223 ? 46.193 35.012 2.925   1.00 59.77  ? 477 ARG A CB    1 
ATOM   1725 C  CG    . ARG A 1 223 ? 46.940 35.597 1.695   1.00 64.41  ? 477 ARG A CG    1 
ATOM   1726 C  CD    . ARG A 1 223 ? 47.695 34.603 0.874   1.00 58.83  ? 477 ARG A CD    1 
ATOM   1727 N  NE    . ARG A 1 223 ? 46.820 33.517 0.393   1.00 65.61  ? 477 ARG A NE    1 
ATOM   1728 C  CZ    . ARG A 1 223 ? 47.234 32.286 0.079   1.00 63.66  ? 477 ARG A CZ    1 
ATOM   1729 N  NH1   . ARG A 1 223 ? 48.497 31.925 0.200   1.00 62.71  ? 477 ARG A NH1   1 
ATOM   1730 N  NH2   . ARG A 1 223 ? 46.361 31.391 -0.319  1.00 64.87  ? 477 ARG A NH2   1 
ATOM   1731 N  N     . GLU A 1 224 ? 45.288 35.451 5.891   1.00 55.87  ? 478 GLU A N     1 
ATOM   1732 C  CA    . GLU A 1 224 ? 44.771 34.972 7.188   1.00 60.28  ? 478 GLU A CA    1 
ATOM   1733 C  C     . GLU A 1 224 ? 43.528 35.766 7.608   1.00 57.51  ? 478 GLU A C     1 
ATOM   1734 O  O     . GLU A 1 224 ? 42.563 35.187 7.995   1.00 54.70  ? 478 GLU A O     1 
ATOM   1735 C  CB    . GLU A 1 224 ? 45.822 35.032 8.283   1.00 56.65  ? 478 GLU A CB    1 
ATOM   1736 C  CG    . GLU A 1 224 ? 46.944 33.956 8.234   1.00 61.03  ? 478 GLU A CG    1 
ATOM   1737 C  CD    . GLU A 1 224 ? 47.994 34.267 9.324   1.00 68.24  ? 478 GLU A CD    1 
ATOM   1738 O  OE1   . GLU A 1 224 ? 47.785 33.901 10.489  1.00 68.97  ? 478 GLU A OE1   1 
ATOM   1739 O  OE2   . GLU A 1 224 ? 48.957 35.045 9.089   1.00 74.64  ? 478 GLU A OE2   1 
ATOM   1740 N  N     . LEU A 1 225 ? 43.529 37.081 7.434   1.00 57.78  ? 479 LEU A N     1 
ATOM   1741 C  CA    . LEU A 1 225 ? 42.348 37.876 7.770   1.00 58.26  ? 479 LEU A CA    1 
ATOM   1742 C  C     . LEU A 1 225 ? 41.178 37.640 6.810   1.00 59.90  ? 479 LEU A C     1 
ATOM   1743 O  O     . LEU A 1 225 ? 40.035 37.441 7.272   1.00 63.39  ? 479 LEU A O     1 
ATOM   1744 C  CB    . LEU A 1 225 ? 42.685 39.371 7.777   1.00 55.29  ? 479 LEU A CB    1 
ATOM   1745 C  CG    . LEU A 1 225 ? 43.728 39.693 8.825   1.00 53.88  ? 479 LEU A CG    1 
ATOM   1746 C  CD1   . LEU A 1 225 ? 44.264 41.063 8.565   1.00 54.42  ? 479 LEU A CD1   1 
ATOM   1747 C  CD2   . LEU A 1 225 ? 43.119 39.678 10.225  1.00 54.21  ? 479 LEU A CD2   1 
ATOM   1748 N  N     . PHE A 1 226 ? 41.450 37.697 5.498   1.00 59.39  ? 480 PHE A N     1 
ATOM   1749 C  CA    . PHE A 1 226 ? 40.376 37.843 4.490   1.00 59.20  ? 480 PHE A CA    1 
ATOM   1750 C  C     . PHE A 1 226 ? 40.073 36.661 3.528   1.00 58.11  ? 480 PHE A C     1 
ATOM   1751 O  O     . PHE A 1 226 ? 39.139 36.747 2.730   1.00 63.79  ? 480 PHE A O     1 
ATOM   1752 C  CB    . PHE A 1 226 ? 40.652 39.130 3.719   1.00 59.21  ? 480 PHE A CB    1 
ATOM   1753 C  CG    . PHE A 1 226 ? 40.795 40.341 4.631   1.00 59.18  ? 480 PHE A CG    1 
ATOM   1754 C  CD1   . PHE A 1 226 ? 39.907 40.564 5.630   1.00 57.64  ? 480 PHE A CD1   1 
ATOM   1755 C  CD2   . PHE A 1 226 ? 41.826 41.234 4.466   1.00 57.78  ? 480 PHE A CD2   1 
ATOM   1756 C  CE1   . PHE A 1 226 ? 40.055 41.634 6.503   1.00 61.24  ? 480 PHE A CE1   1 
ATOM   1757 C  CE2   . PHE A 1 226 ? 41.986 42.300 5.308   1.00 59.83  ? 480 PHE A CE2   1 
ATOM   1758 C  CZ    . PHE A 1 226 ? 41.078 42.523 6.332   1.00 60.27  ? 480 PHE A CZ    1 
ATOM   1759 N  N     . GLU A 1 227 ? 40.830 35.571 3.612   1.00 57.79  ? 481 GLU A N     1 
ATOM   1760 C  CA    . GLU A 1 227 ? 40.634 34.418 2.731   1.00 58.39  ? 481 GLU A CA    1 
ATOM   1761 C  C     . GLU A 1 227 ? 40.556 33.143 3.592   1.00 60.49  ? 481 GLU A C     1 
ATOM   1762 O  O     . GLU A 1 227 ? 39.681 32.334 3.416   1.00 61.64  ? 481 GLU A O     1 
ATOM   1763 C  CB    . GLU A 1 227 ? 41.764 34.387 1.677   1.00 59.15  ? 481 GLU A CB    1 
ATOM   1764 C  CG    . GLU A 1 227 ? 41.872 33.132 0.775   1.00 62.54  ? 481 GLU A CG    1 
ATOM   1765 C  CD    . GLU A 1 227 ? 43.289 32.881 0.204   1.00 62.78  ? 481 GLU A CD    1 
ATOM   1766 O  OE1   . GLU A 1 227 ? 44.022 33.839 -0.110  1.00 65.47  ? 481 GLU A OE1   1 
ATOM   1767 O  OE2   . GLU A 1 227 ? 43.705 31.705 0.096   1.00 59.90  ? 481 GLU A OE2   1 
ATOM   1768 N  N     . PHE A 1 228 ? 41.458 32.926 4.529   1.00 64.58  ? 482 PHE A N     1 
ATOM   1769 C  CA    . PHE A 1 228 ? 41.426 31.651 5.278   1.00 62.43  ? 482 PHE A CA    1 
ATOM   1770 C  C     . PHE A 1 228 ? 40.350 31.648 6.374   1.00 65.08  ? 482 PHE A C     1 
ATOM   1771 O  O     . PHE A 1 228 ? 39.886 32.699 6.819   1.00 68.61  ? 482 PHE A O     1 
ATOM   1772 C  CB    . PHE A 1 228 ? 42.778 31.316 5.948   1.00 62.08  ? 482 PHE A CB    1 
ATOM   1773 C  CG    . PHE A 1 228 ? 43.956 31.222 5.048   1.00 57.10  ? 482 PHE A CG    1 
ATOM   1774 C  CD1   . PHE A 1 228 ? 43.863 30.836 3.716   1.00 63.38  ? 482 PHE A CD1   1 
ATOM   1775 C  CD2   . PHE A 1 228 ? 45.233 31.486 5.579   1.00 59.13  ? 482 PHE A CD2   1 
ATOM   1776 C  CE1   . PHE A 1 228 ? 45.004 30.710 2.917   1.00 65.04  ? 482 PHE A CE1   1 
ATOM   1777 C  CE2   . PHE A 1 228 ? 46.375 31.351 4.804   1.00 62.90  ? 482 PHE A CE2   1 
ATOM   1778 C  CZ    . PHE A 1 228 ? 46.264 30.967 3.455   1.00 69.95  ? 482 PHE A CZ    1 
ATOM   1779 N  N     . HIS A 1 229 ? 39.953 30.477 6.855   1.00 71.56  ? 483 HIS A N     1 
ATOM   1780 C  CA    . HIS A 1 229 ? 39.012 30.493 8.017   1.00 91.82  ? 483 HIS A CA    1 
ATOM   1781 C  C     . HIS A 1 229 ? 39.770 30.681 9.372   1.00 87.19  ? 483 HIS A C     1 
ATOM   1782 O  O     . HIS A 1 229 ? 39.128 30.642 10.413  1.00 82.09  ? 483 HIS A O     1 
ATOM   1783 C  CB    . HIS A 1 229 ? 38.106 29.225 8.053   1.00 96.87  ? 483 HIS A CB    1 
ATOM   1784 C  CG    . HIS A 1 229 ? 37.051 29.190 6.973   1.00 111.37 ? 483 HIS A CG    1 
ATOM   1785 N  ND1   . HIS A 1 229 ? 35.847 29.864 7.074   1.00 116.12 ? 483 HIS A ND1   1 
ATOM   1786 C  CD2   . HIS A 1 229 ? 37.023 28.555 5.770   1.00 115.47 ? 483 HIS A CD2   1 
ATOM   1787 C  CE1   . HIS A 1 229 ? 35.128 29.647 5.984   1.00 116.30 ? 483 HIS A CE1   1 
ATOM   1788 N  NE2   . HIS A 1 229 ? 35.816 28.851 5.180   1.00 112.77 ? 483 HIS A NE2   1 
ATOM   1789 N  N     . PHE A 1 230 ? 41.105 30.894 9.319   1.00 80.25  ? 484 PHE A N     1 
ATOM   1790 C  CA    . PHE A 1 230 ? 42.047 30.632 10.407  1.00 76.99  ? 484 PHE A CA    1 
ATOM   1791 C  C     . PHE A 1 230 ? 43.173 31.699 10.448  1.00 74.34  ? 484 PHE A C     1 
ATOM   1792 O  O     . PHE A 1 230 ? 43.730 32.045 9.388   1.00 79.55  ? 484 PHE A O     1 
ATOM   1793 C  CB    . PHE A 1 230 ? 42.650 29.216 10.235  1.00 77.63  ? 484 PHE A CB    1 
ATOM   1794 C  CG    . PHE A 1 230 ? 41.731 28.119 10.679  1.00 90.52  ? 484 PHE A CG    1 
ATOM   1795 C  CD1   . PHE A 1 230 ? 41.552 27.839 12.041  1.00 93.24  ? 484 PHE A CD1   1 
ATOM   1796 C  CD2   . PHE A 1 230 ? 40.980 27.375 9.741   1.00 100.40 ? 484 PHE A CD2   1 
ATOM   1797 C  CE1   . PHE A 1 230 ? 40.672 26.819 12.454  1.00 103.60 ? 484 PHE A CE1   1 
ATOM   1798 C  CE2   . PHE A 1 230 ? 40.083 26.358 10.153  1.00 106.31 ? 484 PHE A CE2   1 
ATOM   1799 C  CZ    . PHE A 1 230 ? 39.938 26.073 11.515  1.00 106.18 ? 484 PHE A CZ    1 
HETATM 1800 N  N     . MSE A 1 231 ? 43.568 32.174 11.637  1.00 67.36  ? 485 MSE A N     1 
HETATM 1801 C  CA    . MSE A 1 231 ? 44.720 33.130 11.739  1.00 65.32  ? 485 MSE A CA    1 
HETATM 1802 C  C     . MSE A 1 231 ? 45.579 32.916 12.966  1.00 63.76  ? 485 MSE A C     1 
HETATM 1803 O  O     . MSE A 1 231 ? 45.076 32.566 14.030  1.00 68.83  ? 485 MSE A O     1 
HETATM 1804 C  CB    . MSE A 1 231 ? 44.170 34.571 11.691  1.00 63.57  ? 485 MSE A CB    1 
HETATM 1805 C  CG    . MSE A 1 231 ? 43.551 34.965 13.003  1.00 70.93  ? 485 MSE A CG    1 
HETATM 1806 SE SE    . MSE A 1 231 ? 42.912 36.814 13.062  1.00 78.08  ? 485 MSE A SE    1 
HETATM 1807 C  CE    . MSE A 1 231 ? 41.653 36.386 11.644  1.00 71.92  ? 485 MSE A CE    1 
ATOM   1808 N  N     . GLN A 1 232 ? 46.871 33.165 12.846  1.00 64.77  ? 486 GLN A N     1 
ATOM   1809 C  CA    . GLN A 1 232 ? 47.788 33.229 13.987  1.00 70.61  ? 486 GLN A CA    1 
ATOM   1810 C  C     . GLN A 1 232 ? 47.617 34.626 14.609  1.00 69.83  ? 486 GLN A C     1 
ATOM   1811 O  O     . GLN A 1 232 ? 47.956 35.618 13.952  1.00 67.70  ? 486 GLN A O     1 
ATOM   1812 C  CB    . GLN A 1 232 ? 49.269 33.120 13.559  1.00 72.35  ? 486 GLN A CB    1 
ATOM   1813 C  CG    . GLN A 1 232 ? 49.670 31.836 12.879  1.00 85.86  ? 486 GLN A CG    1 
ATOM   1814 C  CD    . GLN A 1 232 ? 50.553 30.984 13.772  1.00 98.45  ? 486 GLN A CD    1 
ATOM   1815 O  OE1   . GLN A 1 232 ? 51.773 30.858 13.545  1.00 106.45 ? 486 GLN A OE1   1 
ATOM   1816 N  NE2   . GLN A 1 232 ? 49.947 30.400 14.806  1.00 99.89  ? 486 GLN A NE2   1 
ATOM   1817 N  N     . THR A 1 233 ? 47.179 34.687 15.867  1.00 61.87  ? 487 THR A N     1 
ATOM   1818 C  CA    . THR A 1 233 ? 47.065 35.928 16.635  1.00 63.84  ? 487 THR A CA    1 
ATOM   1819 C  C     . THR A 1 233 ? 48.385 36.293 17.392  1.00 59.74  ? 487 THR A C     1 
ATOM   1820 O  O     . THR A 1 233 ? 49.280 35.524 17.497  1.00 67.20  ? 487 THR A O     1 
ATOM   1821 C  CB    . THR A 1 233 ? 45.879 35.821 17.584  1.00 60.19  ? 487 THR A CB    1 
ATOM   1822 O  OG1   . THR A 1 233 ? 46.075 34.699 18.407  1.00 66.57  ? 487 THR A OG1   1 
ATOM   1823 C  CG2   . THR A 1 233 ? 44.605 35.626 16.841  1.00 61.41  ? 487 THR A CG2   1 
ATOM   1824 N  N     . ASP A 1 234 ? 48.540 37.517 17.838  1.00 70.46  ? 488 ASP A N     1 
ATOM   1825 C  CA    . ASP A 1 234 ? 49.805 37.924 18.452  1.00 72.85  ? 488 ASP A CA    1 
ATOM   1826 C  C     . ASP A 1 234 ? 51.052 37.527 17.613  1.00 71.83  ? 488 ASP A C     1 
ATOM   1827 O  O     . ASP A 1 234 ? 51.986 36.882 18.104  1.00 82.03  ? 488 ASP A O     1 
ATOM   1828 C  CB    . ASP A 1 234 ? 49.830 37.412 19.910  1.00 76.17  ? 488 ASP A CB    1 
ATOM   1829 C  CG    . ASP A 1 234 ? 48.679 38.080 20.800  1.00 86.19  ? 488 ASP A CG    1 
ATOM   1830 O  OD1   . ASP A 1 234 ? 48.432 39.307 20.620  1.00 85.43  ? 488 ASP A OD1   1 
ATOM   1831 O  OD2   . ASP A 1 234 ? 48.010 37.389 21.649  1.00 87.11  ? 488 ASP A OD2   1 
ATOM   1832 N  N     . PRO A 1 235 ? 51.077 37.907 16.325  1.00 67.67  ? 489 PRO A N     1 
ATOM   1833 C  CA    . PRO A 1 235 ? 52.242 37.560 15.487  1.00 66.96  ? 489 PRO A CA    1 
ATOM   1834 C  C     . PRO A 1 235 ? 53.559 38.020 16.131  1.00 69.43  ? 489 PRO A C     1 
ATOM   1835 O  O     . PRO A 1 235 ? 53.643 39.155 16.654  1.00 65.88  ? 489 PRO A O     1 
ATOM   1836 C  CB    . PRO A 1 235 ? 51.998 38.311 14.177  1.00 68.82  ? 489 PRO A CB    1 
ATOM   1837 C  CG    . PRO A 1 235 ? 51.005 39.369 14.524  1.00 73.08  ? 489 PRO A CG    1 
ATOM   1838 C  CD    . PRO A 1 235 ? 50.158 38.817 15.640  1.00 66.79  ? 489 PRO A CD    1 
ATOM   1839 N  N     . ASN A 1 236 ? 54.557 37.138 16.138  1.00 66.66  ? 490 ASN A N     1 
ATOM   1840 C  CA    . ASN A 1 236 ? 55.775 37.438 16.865  1.00 70.50  ? 490 ASN A CA    1 
ATOM   1841 C  C     . ASN A 1 236 ? 56.978 36.994 16.064  1.00 66.13  ? 490 ASN A C     1 
ATOM   1842 O  O     . ASN A 1 236 ? 57.149 35.812 15.741  1.00 57.93  ? 490 ASN A O     1 
ATOM   1843 C  CB    . ASN A 1 236 ? 55.749 36.838 18.284  1.00 77.12  ? 490 ASN A CB    1 
ATOM   1844 C  CG    . ASN A 1 236 ? 57.124 36.905 19.007  1.00 93.04  ? 490 ASN A CG    1 
ATOM   1845 O  OD1   . ASN A 1 236 ? 57.929 37.847 18.864  1.00 82.71  ? 490 ASN A OD1   1 
ATOM   1846 N  ND2   . ASN A 1 236 ? 57.394 35.868 19.789  1.00 104.33 ? 490 ASN A ND2   1 
ATOM   1847 N  N     . TRP A 1 237 ? 57.852 37.958 15.817  1.00 64.88  ? 491 TRP A N     1 
ATOM   1848 C  CA    . TRP A 1 237 ? 59.050 37.704 15.082  1.00 67.09  ? 491 TRP A CA    1 
ATOM   1849 C  C     . TRP A 1 237 ? 59.936 36.565 15.587  1.00 65.25  ? 491 TRP A C     1 
ATOM   1850 O  O     . TRP A 1 237 ? 60.624 35.934 14.808  1.00 71.37  ? 491 TRP A O     1 
ATOM   1851 C  CB    . TRP A 1 237 ? 59.825 39.014 14.854  1.00 68.37  ? 491 TRP A CB    1 
ATOM   1852 C  CG    . TRP A 1 237 ? 60.565 39.696 15.962  1.00 60.76  ? 491 TRP A CG    1 
ATOM   1853 C  CD1   . TRP A 1 237 ? 60.276 39.707 17.267  1.00 64.66  ? 491 TRP A CD1   1 
ATOM   1854 C  CD2   . TRP A 1 237 ? 61.690 40.565 15.789  1.00 65.94  ? 491 TRP A CD2   1 
ATOM   1855 N  NE1   . TRP A 1 237 ? 61.161 40.526 17.958  1.00 63.40  ? 491 TRP A NE1   1 
ATOM   1856 C  CE2   . TRP A 1 237 ? 62.035 41.067 17.065  1.00 67.03  ? 491 TRP A CE2   1 
ATOM   1857 C  CE3   . TRP A 1 237 ? 62.476 40.941 14.670  1.00 65.98  ? 491 TRP A CE3   1 
ATOM   1858 C  CZ2   . TRP A 1 237 ? 63.121 41.921 17.260  1.00 68.73  ? 491 TRP A CZ2   1 
ATOM   1859 C  CZ3   . TRP A 1 237 ? 63.513 41.836 14.856  1.00 70.13  ? 491 TRP A CZ3   1 
ATOM   1860 C  CH2   . TRP A 1 237 ? 63.835 42.321 16.133  1.00 66.68  ? 491 TRP A CH2   1 
ATOM   1861 N  N     . SER A 1 238 ? 59.853 36.236 16.851  1.00 71.15  ? 492 SER A N     1 
ATOM   1862 C  CA    . SER A 1 238 ? 60.507 35.024 17.380  1.00 80.17  ? 492 SER A CA    1 
ATOM   1863 C  C     . SER A 1 238 ? 59.888 33.705 16.932  1.00 79.96  ? 492 SER A C     1 
ATOM   1864 O  O     . SER A 1 238 ? 60.539 32.658 17.086  1.00 73.63  ? 492 SER A O     1 
ATOM   1865 C  CB    . SER A 1 238 ? 60.587 35.076 18.916  1.00 76.87  ? 492 SER A CB    1 
ATOM   1866 O  OG    . SER A 1 238 ? 60.854 36.431 19.290  1.00 85.73  ? 492 SER A OG    1 
ATOM   1867 N  N     . ASN A 1 239 ? 58.677 33.719 16.360  1.00 76.84  ? 493 ASN A N     1 
ATOM   1868 C  CA    . ASN A 1 239 ? 58.093 32.436 15.817  1.00 72.23  ? 493 ASN A CA    1 
ATOM   1869 C  C     . ASN A 1 239 ? 58.145 32.211 14.314  1.00 68.32  ? 493 ASN A C     1 
ATOM   1870 O  O     . ASN A 1 239 ? 57.499 31.288 13.814  1.00 69.45  ? 493 ASN A O     1 
ATOM   1871 C  CB    . ASN A 1 239 ? 56.693 32.286 16.341  1.00 69.27  ? 493 ASN A CB    1 
ATOM   1872 C  CG    . ASN A 1 239 ? 56.677 32.233 17.854  1.00 82.09  ? 493 ASN A CG    1 
ATOM   1873 O  OD1   . ASN A 1 239 ? 55.818 32.861 18.478  1.00 82.71  ? 493 ASN A OD1   1 
ATOM   1874 N  ND2   . ASN A 1 239 ? 57.680 31.513 18.469  1.00 78.57  ? 493 ASN A ND2   1 
ATOM   1875 N  N     . PHE A 1 240 ? 58.971 33.007 13.619  1.00 60.49  ? 494 PHE A N     1 
ATOM   1876 C  CA    . PHE A 1 240 ? 59.215 32.854 12.221  1.00 61.75  ? 494 PHE A CA    1 
ATOM   1877 C  C     . PHE A 1 240 ? 60.698 32.442 12.133  1.00 66.76  ? 494 PHE A C     1 
ATOM   1878 O  O     . PHE A 1 240 ? 61.575 33.209 12.573  1.00 63.30  ? 494 PHE A O     1 
ATOM   1879 C  CB    . PHE A 1 240 ? 58.947 34.200 11.492  1.00 71.10  ? 494 PHE A CB    1 
ATOM   1880 C  CG    . PHE A 1 240 ? 57.482 34.653 11.464  1.00 68.03  ? 494 PHE A CG    1 
ATOM   1881 C  CD1   . PHE A 1 240 ? 56.937 35.393 12.516  1.00 68.46  ? 494 PHE A CD1   1 
ATOM   1882 C  CD2   . PHE A 1 240 ? 56.667 34.369 10.375  1.00 71.00  ? 494 PHE A CD2   1 
ATOM   1883 C  CE1   . PHE A 1 240 ? 55.605 35.805 12.500  1.00 71.85  ? 494 PHE A CE1   1 
ATOM   1884 C  CE2   . PHE A 1 240 ? 55.340 34.797 10.341  1.00 67.21  ? 494 PHE A CE2   1 
ATOM   1885 C  CZ    . PHE A 1 240 ? 54.804 35.508 11.397  1.00 69.56  ? 494 PHE A CZ    1 
ATOM   1886 N  N     . PHE A 1 241 ? 60.979 31.230 11.618  1.00 65.05  ? 495 PHE A N     1 
ATOM   1887 C  CA    . PHE A 1 241 ? 62.378 30.740 11.389  1.00 65.60  ? 495 PHE A CA    1 
ATOM   1888 C  C     . PHE A 1 241 ? 62.786 30.780 9.920   1.00 65.98  ? 495 PHE A C     1 
ATOM   1889 O  O     . PHE A 1 241 ? 62.262 30.048 9.109   1.00 67.88  ? 495 PHE A O     1 
ATOM   1890 C  CB    . PHE A 1 241 ? 62.592 29.319 11.941  1.00 69.96  ? 495 PHE A CB    1 
ATOM   1891 C  CG    . PHE A 1 241 ? 62.785 29.277 13.423  1.00 70.55  ? 495 PHE A CG    1 
ATOM   1892 C  CD1   . PHE A 1 241 ? 61.910 29.943 14.272  1.00 72.41  ? 495 PHE A CD1   1 
ATOM   1893 C  CD2   . PHE A 1 241 ? 63.852 28.570 13.980  1.00 83.84  ? 495 PHE A CD2   1 
ATOM   1894 C  CE1   . PHE A 1 241 ? 62.090 29.924 15.646  1.00 83.37  ? 495 PHE A CE1   1 
ATOM   1895 C  CE2   . PHE A 1 241 ? 64.057 28.552 15.361  1.00 85.61  ? 495 PHE A CE2   1 
ATOM   1896 C  CZ    . PHE A 1 241 ? 63.162 29.219 16.192  1.00 89.01  ? 495 PHE A CZ    1 
ATOM   1897 N  N     . TYR A 1 242 ? 63.691 31.680 9.590   1.00 63.34  ? 496 TYR A N     1 
ATOM   1898 C  CA    . TYR A 1 242 ? 64.161 31.837 8.261   1.00 68.58  ? 496 TYR A CA    1 
ATOM   1899 C  C     . TYR A 1 242 ? 65.402 30.946 8.036   1.00 79.02  ? 496 TYR A C     1 
ATOM   1900 O  O     . TYR A 1 242 ? 66.333 31.049 8.831   1.00 77.07  ? 496 TYR A O     1 
ATOM   1901 C  CB    . TYR A 1 242 ? 64.571 33.286 8.062   1.00 66.18  ? 496 TYR A CB    1 
ATOM   1902 C  CG    . TYR A 1 242 ? 65.134 33.516 6.703   1.00 67.02  ? 496 TYR A CG    1 
ATOM   1903 C  CD1   . TYR A 1 242 ? 64.379 33.238 5.568   1.00 65.24  ? 496 TYR A CD1   1 
ATOM   1904 C  CD2   . TYR A 1 242 ? 66.431 33.980 6.534   1.00 71.37  ? 496 TYR A CD2   1 
ATOM   1905 C  CE1   . TYR A 1 242 ? 64.904 33.438 4.289   1.00 70.06  ? 496 TYR A CE1   1 
ATOM   1906 C  CE2   . TYR A 1 242 ? 66.977 34.160 5.239   1.00 73.46  ? 496 TYR A CE2   1 
ATOM   1907 C  CZ    . TYR A 1 242 ? 66.206 33.889 4.144   1.00 66.35  ? 496 TYR A CZ    1 
ATOM   1908 O  OH    . TYR A 1 242 ? 66.703 34.063 2.932   1.00 67.81  ? 496 TYR A OH    1 
ATOM   1909 N  N     . ASP A 1 243 ? 65.410 30.115 6.973   1.00 74.43  ? 497 ASP A N     1 
ATOM   1910 C  CA    . ASP A 1 243 ? 66.566 29.307 6.524   1.00 73.58  ? 497 ASP A CA    1 
ATOM   1911 C  C     . ASP A 1 243 ? 67.236 29.907 5.240   1.00 78.45  ? 497 ASP A C     1 
ATOM   1912 O  O     . ASP A 1 243 ? 66.686 29.732 4.157   1.00 82.97  ? 497 ASP A O     1 
ATOM   1913 C  CB    . ASP A 1 243 ? 66.044 27.867 6.255   1.00 77.22  ? 497 ASP A CB    1 
ATOM   1914 C  CG    . ASP A 1 243 ? 67.119 26.885 5.694   1.00 80.83  ? 497 ASP A CG    1 
ATOM   1915 O  OD1   . ASP A 1 243 ? 68.313 27.228 5.651   1.00 80.79  ? 497 ASP A OD1   1 
ATOM   1916 O  OD2   . ASP A 1 243 ? 66.740 25.771 5.260   1.00 81.66  ? 497 ASP A OD2   1 
ATOM   1917 N  N     . PRO A 1 244 ? 68.412 30.614 5.343   1.00 83.47  ? 498 PRO A N     1 
ATOM   1918 C  CA    . PRO A 1 244 ? 69.185 31.103 4.175   1.00 81.82  ? 498 PRO A CA    1 
ATOM   1919 C  C     . PRO A 1 244 ? 69.330 30.101 3.034   1.00 84.95  ? 498 PRO A C     1 
ATOM   1920 O  O     . PRO A 1 244 ? 69.150 30.445 1.859   1.00 85.02  ? 498 PRO A O     1 
ATOM   1921 C  CB    . PRO A 1 244 ? 70.577 31.334 4.764   1.00 85.66  ? 498 PRO A CB    1 
ATOM   1922 C  CG    . PRO A 1 244 ? 70.333 31.734 6.159   1.00 85.78  ? 498 PRO A CG    1 
ATOM   1923 C  CD    . PRO A 1 244 ? 69.032 31.089 6.598   1.00 84.69  ? 498 PRO A CD    1 
ATOM   1924 N  N     . GLN A 1 245 ? 69.624 28.860 3.393   1.00 81.81  ? 499 GLN A N     1 
ATOM   1925 C  CA    . GLN A 1 245 ? 69.965 27.869 2.393   1.00 93.37  ? 499 GLN A CA    1 
ATOM   1926 C  C     . GLN A 1 245 ? 68.729 27.710 1.467   1.00 92.50  ? 499 GLN A C     1 
ATOM   1927 O  O     . GLN A 1 245 ? 68.831 27.916 0.265   1.00 91.96  ? 499 GLN A O     1 
ATOM   1928 C  CB    . GLN A 1 245 ? 70.454 26.538 3.028   1.00 91.65  ? 499 GLN A CB    1 
ATOM   1929 C  CG    . GLN A 1 245 ? 71.578 26.642 4.092   1.00 93.84  ? 499 GLN A CG    1 
ATOM   1930 C  CD    . GLN A 1 245 ? 72.279 25.273 4.344   1.00 105.88 ? 499 GLN A CD    1 
ATOM   1931 O  OE1   . GLN A 1 245 ? 71.625 24.242 4.612   1.00 107.03 ? 499 GLN A OE1   1 
ATOM   1932 N  NE2   . GLN A 1 245 ? 73.613 25.258 4.235   1.00 103.78 ? 499 GLN A NE2   1 
ATOM   1933 N  N     . GLN A 1 246 ? 67.556 27.469 2.041   1.00 84.41  ? 500 GLN A N     1 
ATOM   1934 C  CA    . GLN A 1 246 ? 66.381 27.202 1.234   1.00 82.24  ? 500 GLN A CA    1 
ATOM   1935 C  C     . GLN A 1 246 ? 65.560 28.426 0.884   1.00 80.76  ? 500 GLN A C     1 
ATOM   1936 O  O     . GLN A 1 246 ? 64.691 28.352 -0.019  1.00 78.46  ? 500 GLN A O     1 
ATOM   1937 C  CB    . GLN A 1 246 ? 65.505 26.194 1.927   1.00 89.20  ? 500 GLN A CB    1 
ATOM   1938 C  CG    . GLN A 1 246 ? 66.179 24.851 2.106   1.00 97.44  ? 500 GLN A CG    1 
ATOM   1939 C  CD    . GLN A 1 246 ? 65.155 23.801 2.510   1.00 108.05 ? 500 GLN A CD    1 
ATOM   1940 O  OE1   . GLN A 1 246 ? 64.249 24.079 3.307   1.00 111.30 ? 500 GLN A OE1   1 
ATOM   1941 N  NE2   . GLN A 1 246 ? 65.286 22.587 1.957   1.00 108.13 ? 500 GLN A NE2   1 
ATOM   1942 N  N     . HIS A 1 247 ? 65.847 29.546 1.546   1.00 71.69  ? 501 HIS A N     1 
ATOM   1943 C  CA    . HIS A 1 247 ? 65.085 30.786 1.362   1.00 79.00  ? 501 HIS A CA    1 
ATOM   1944 C  C     . HIS A 1 247 ? 63.579 30.600 1.716   1.00 80.72  ? 501 HIS A C     1 
ATOM   1945 O  O     . HIS A 1 247 ? 62.697 31.035 0.970   1.00 81.13  ? 501 HIS A O     1 
ATOM   1946 C  CB    . HIS A 1 247 ? 65.274 31.382 -0.038  1.00 75.02  ? 501 HIS A CB    1 
ATOM   1947 C  CG    . HIS A 1 247 ? 64.720 32.768 -0.181  1.00 75.73  ? 501 HIS A CG    1 
ATOM   1948 N  ND1   . HIS A 1 247 ? 64.990 33.778 0.724   1.00 78.86  ? 501 HIS A ND1   1 
ATOM   1949 C  CD2   . HIS A 1 247 ? 63.900 33.306 -1.117  1.00 72.53  ? 501 HIS A CD2   1 
ATOM   1950 C  CE1   . HIS A 1 247 ? 64.357 34.881 0.352   1.00 78.84  ? 501 HIS A CE1   1 
ATOM   1951 N  NE2   . HIS A 1 247 ? 63.686 34.619 -0.759  1.00 79.24  ? 501 HIS A NE2   1 
ATOM   1952 N  N     . LYS A 1 248 ? 63.338 29.950 2.870   1.00 74.70  ? 502 LYS A N     1 
ATOM   1953 C  CA    . LYS A 1 248 ? 62.026 29.665 3.391   1.00 73.17  ? 502 LYS A CA    1 
ATOM   1954 C  C     . LYS A 1 248 ? 61.897 30.053 4.861   1.00 72.95  ? 502 LYS A C     1 
ATOM   1955 O  O     . LYS A 1 248 ? 62.873 30.138 5.635   1.00 73.36  ? 502 LYS A O     1 
ATOM   1956 C  CB    . LYS A 1 248 ? 61.711 28.205 3.166   1.00 75.47  ? 502 LYS A CB    1 
ATOM   1957 C  CG    . LYS A 1 248 ? 61.736 27.871 1.667   1.00 78.86  ? 502 LYS A CG    1 
ATOM   1958 C  CD    . LYS A 1 248 ? 61.324 26.445 1.326   1.00 87.97  ? 502 LYS A CD    1 
ATOM   1959 C  CE    . LYS A 1 248 ? 59.824 26.182 1.542   1.00 90.41  ? 502 LYS A CE    1 
ATOM   1960 N  NZ    . LYS A 1 248 ? 59.450 24.750 1.344   1.00 88.99  ? 502 LYS A NZ    1 
ATOM   1961 N  N     . VAL A 1 249 ? 60.673 30.367 5.230   1.00 68.99  ? 503 VAL A N     1 
ATOM   1962 C  CA    . VAL A 1 249 ? 60.351 30.738 6.580   1.00 61.52  ? 503 VAL A CA    1 
ATOM   1963 C  C     . VAL A 1 249 ? 59.429 29.671 7.117   1.00 63.51  ? 503 VAL A C     1 
ATOM   1964 O  O     . VAL A 1 249 ? 58.375 29.439 6.496   1.00 62.86  ? 503 VAL A O     1 
ATOM   1965 C  CB    . VAL A 1 249 ? 59.709 32.098 6.600   1.00 58.88  ? 503 VAL A CB    1 
ATOM   1966 C  CG1   . VAL A 1 249 ? 59.213 32.484 7.980   1.00 57.25  ? 503 VAL A CG1   1 
ATOM   1967 C  CG2   . VAL A 1 249 ? 60.716 33.121 6.100   1.00 64.53  ? 503 VAL A CG2   1 
ATOM   1968 N  N     . ALA A 1 250 ? 59.840 29.015 8.232   1.00 61.72  ? 504 ALA A N     1 
ATOM   1969 C  CA    . ALA A 1 250 ? 58.955 28.144 9.053   1.00 57.41  ? 504 ALA A CA    1 
ATOM   1970 C  C     . ALA A 1 250 ? 58.096 28.893 10.114  1.00 58.84  ? 504 ALA A C     1 
ATOM   1971 O  O     . ALA A 1 250 ? 58.497 29.908 10.711  1.00 55.76  ? 504 ALA A O     1 
ATOM   1972 C  CB    . ALA A 1 250 ? 59.771 27.082 9.714   1.00 60.48  ? 504 ALA A CB    1 
ATOM   1973 N  N     . LEU A 1 251 ? 56.884 28.405 10.304  1.00 62.61  ? 505 LEU A N     1 
ATOM   1974 C  CA    . LEU A 1 251 ? 55.920 29.031 11.187  1.00 64.02  ? 505 LEU A CA    1 
ATOM   1975 C  C     . LEU A 1 251 ? 55.800 28.153 12.441  1.00 66.65  ? 505 LEU A C     1 
ATOM   1976 O  O     . LEU A 1 251 ? 55.447 26.985 12.336  1.00 60.19  ? 505 LEU A O     1 
ATOM   1977 C  CB    . LEU A 1 251 ? 54.549 29.104 10.562  1.00 64.24  ? 505 LEU A CB    1 
ATOM   1978 C  CG    . LEU A 1 251 ? 54.193 30.309 9.731   1.00 73.61  ? 505 LEU A CG    1 
ATOM   1979 C  CD1   . LEU A 1 251 ? 55.259 30.503 8.701   1.00 79.32  ? 505 LEU A CD1   1 
ATOM   1980 C  CD2   . LEU A 1 251 ? 52.858 30.057 9.042   1.00 78.91  ? 505 LEU A CD2   1 
ATOM   1981 N  N     . LEU A 1 252 ? 56.069 28.722 13.613  1.00 66.39  ? 506 LEU A N     1 
ATOM   1982 C  CA    . LEU A 1 252 ? 55.906 27.958 14.845  1.00 74.12  ? 506 LEU A CA    1 
ATOM   1983 C  C     . LEU A 1 252 ? 54.813 28.565 15.696  1.00 72.56  ? 506 LEU A C     1 
ATOM   1984 O  O     . LEU A 1 252 ? 54.571 29.753 15.603  1.00 72.77  ? 506 LEU A O     1 
ATOM   1985 C  CB    . LEU A 1 252 ? 57.238 27.876 15.578  1.00 71.40  ? 506 LEU A CB    1 
ATOM   1986 C  CG    . LEU A 1 252 ? 58.280 27.041 14.830  1.00 74.47  ? 506 LEU A CG    1 
ATOM   1987 C  CD1   . LEU A 1 252 ? 59.635 27.160 15.544  1.00 79.75  ? 506 LEU A CD1   1 
ATOM   1988 C  CD2   . LEU A 1 252 ? 57.819 25.577 14.752  1.00 73.56  ? 506 LEU A CD2   1 
ATOM   1989 N  N     . ASP A 1 253 ? 54.124 27.711 16.446  1.00 71.42  ? 507 ASP A N     1 
ATOM   1990 C  CA    . ASP A 1 253 ? 53.312 28.071 17.596  1.00 73.22  ? 507 ASP A CA    1 
ATOM   1991 C  C     . ASP A 1 253 ? 51.872 28.314 17.130  1.00 66.17  ? 507 ASP A C     1 
ATOM   1992 O  O     . ASP A 1 253 ? 51.445 29.405 16.899  1.00 67.40  ? 507 ASP A O     1 
ATOM   1993 C  CB    . ASP A 1 253 ? 53.871 29.248 18.452  1.00 78.84  ? 507 ASP A CB    1 
ATOM   1994 C  CG    . ASP A 1 253 ? 52.987 29.555 19.758  1.00 87.49  ? 507 ASP A CG    1 
ATOM   1995 O  OD1   . ASP A 1 253 ? 52.177 28.676 20.186  1.00 90.34  ? 507 ASP A OD1   1 
ATOM   1996 O  OD2   . ASP A 1 253 ? 53.119 30.654 20.375  1.00 78.85  ? 507 ASP A OD2   1 
ATOM   1997 N  N     . PHE A 1 254 ? 51.115 27.255 17.137  1.00 70.50  ? 508 PHE A N     1 
ATOM   1998 C  CA    . PHE A 1 254 ? 49.738 27.284 16.738  1.00 75.21  ? 508 PHE A CA    1 
ATOM   1999 C  C     . PHE A 1 254 ? 48.787 27.263 17.916  1.00 71.17  ? 508 PHE A C     1 
ATOM   2000 O  O     . PHE A 1 254 ? 47.646 26.920 17.728  1.00 76.08  ? 508 PHE A O     1 
ATOM   2001 C  CB    . PHE A 1 254 ? 49.503 26.139 15.726  1.00 73.17  ? 508 PHE A CB    1 
ATOM   2002 C  CG    . PHE A 1 254 ? 50.296 26.347 14.475  1.00 83.11  ? 508 PHE A CG    1 
ATOM   2003 C  CD1   . PHE A 1 254 ? 49.893 27.306 13.536  1.00 81.68  ? 508 PHE A CD1   1 
ATOM   2004 C  CD2   . PHE A 1 254 ? 51.531 25.699 14.283  1.00 90.25  ? 508 PHE A CD2   1 
ATOM   2005 C  CE1   . PHE A 1 254 ? 50.666 27.575 12.400  1.00 86.17  ? 508 PHE A CE1   1 
ATOM   2006 C  CE2   . PHE A 1 254 ? 52.299 25.968 13.141  1.00 92.49  ? 508 PHE A CE2   1 
ATOM   2007 C  CZ    . PHE A 1 254 ? 51.857 26.907 12.203  1.00 86.75  ? 508 PHE A CZ    1 
ATOM   2008 N  N     . GLY A 1 255 ? 49.277 27.615 19.118  1.00 74.37  ? 509 GLY A N     1 
ATOM   2009 C  CA    . GLY A 1 255 ? 48.444 27.896 20.303  1.00 70.73  ? 509 GLY A CA    1 
ATOM   2010 C  C     . GLY A 1 255 ? 47.752 29.197 20.001  1.00 70.11  ? 509 GLY A C     1 
ATOM   2011 O  O     . GLY A 1 255 ? 46.592 29.387 20.321  1.00 67.16  ? 509 GLY A O     1 
ATOM   2012 N  N     . ALA A 1 256 ? 48.470 30.040 19.268  1.00 70.58  ? 510 ALA A N     1 
ATOM   2013 C  CA    . ALA A 1 256 ? 47.998 31.307 18.745  1.00 74.12  ? 510 ALA A CA    1 
ATOM   2014 C  C     . ALA A 1 256 ? 46.796 31.261 17.777  1.00 74.59  ? 510 ALA A C     1 
ATOM   2015 O  O     . ALA A 1 256 ? 46.141 32.302 17.623  1.00 78.12  ? 510 ALA A O     1 
ATOM   2016 C  CB    . ALA A 1 256 ? 49.184 32.059 18.113  1.00 75.79  ? 510 ALA A CB    1 
ATOM   2017 N  N     . THR A 1 257 ? 46.482 30.098 17.171  1.00 69.03  ? 511 THR A N     1 
ATOM   2018 C  CA    . THR A 1 257 ? 45.474 30.015 16.093  1.00 63.53  ? 511 THR A CA    1 
ATOM   2019 C  C     . THR A 1 257 ? 44.041 30.237 16.557  1.00 68.25  ? 511 THR A C     1 
ATOM   2020 O  O     . THR A 1 257 ? 43.635 29.653 17.565  1.00 69.13  ? 511 THR A O     1 
ATOM   2021 C  CB    . THR A 1 257 ? 45.515 28.640 15.417  1.00 65.14  ? 511 THR A CB    1 
ATOM   2022 O  OG1   . THR A 1 257 ? 46.828 28.380 14.963  1.00 63.45  ? 511 THR A OG1   1 
ATOM   2023 C  CG2   . THR A 1 257 ? 44.629 28.558 14.206  1.00 61.02  ? 511 THR A CG2   1 
ATOM   2024 N  N     . ARG A 1 258 ? 43.274 31.056 15.809  1.00 63.89  ? 512 ARG A N     1 
ATOM   2025 C  CA    . ARG A 1 258 ? 41.837 31.243 16.044  1.00 59.58  ? 512 ARG A CA    1 
ATOM   2026 C  C     . ARG A 1 258 ? 41.054 31.278 14.768  1.00 62.66  ? 512 ARG A C     1 
ATOM   2027 O  O     . ARG A 1 258 ? 41.562 31.673 13.731  1.00 69.18  ? 512 ARG A O     1 
ATOM   2028 C  CB    . ARG A 1 258 ? 41.484 32.531 16.806  1.00 61.79  ? 512 ARG A CB    1 
ATOM   2029 C  CG    . ARG A 1 258 ? 42.310 32.813 18.061  1.00 68.27  ? 512 ARG A CG    1 
ATOM   2030 C  CD    . ARG A 1 258 ? 41.751 32.073 19.238  1.00 69.74  ? 512 ARG A CD    1 
ATOM   2031 N  NE    . ARG A 1 258 ? 42.445 32.379 20.497  1.00 63.10  ? 512 ARG A NE    1 
ATOM   2032 C  CZ    . ARG A 1 258 ? 43.627 31.898 20.861  1.00 62.83  ? 512 ARG A CZ    1 
ATOM   2033 N  NH1   . ARG A 1 258 ? 44.386 31.131 20.059  1.00 61.13  ? 512 ARG A NH1   1 
ATOM   2034 N  NH2   . ARG A 1 258 ? 44.079 32.239 22.048  1.00 64.39  ? 512 ARG A NH2   1 
ATOM   2035 N  N     . GLU A 1 259 ? 39.780 30.932 14.899  1.00 62.85  ? 513 GLU A N     1 
ATOM   2036 C  CA    . GLU A 1 259 ? 38.822 30.933 13.838  1.00 70.53  ? 513 GLU A CA    1 
ATOM   2037 C  C     . GLU A 1 259 ? 37.657 31.709 14.358  1.00 68.07  ? 513 GLU A C     1 
ATOM   2038 O  O     . GLU A 1 259 ? 37.026 31.316 15.298  1.00 66.71  ? 513 GLU A O     1 
ATOM   2039 C  CB    . GLU A 1 259 ? 38.426 29.494 13.545  1.00 80.26  ? 513 GLU A CB    1 
ATOM   2040 C  CG    . GLU A 1 259 ? 37.019 29.256 13.047  1.00 92.61  ? 513 GLU A CG    1 
ATOM   2041 C  CD    . GLU A 1 259 ? 36.884 27.868 12.436  1.00 106.69 ? 513 GLU A CD    1 
ATOM   2042 O  OE1   . GLU A 1 259 ? 37.454 26.904 13.033  1.00 98.15  ? 513 GLU A OE1   1 
ATOM   2043 O  OE2   . GLU A 1 259 ? 36.223 27.764 11.357  1.00 111.20 ? 513 GLU A OE2   1 
ATOM   2044 N  N     . TYR A 1 260 ? 37.319 32.788 13.693  1.00 73.93  ? 514 TYR A N     1 
ATOM   2045 C  CA    . TYR A 1 260 ? 36.288 33.686 14.197  1.00 72.98  ? 514 TYR A CA    1 
ATOM   2046 C  C     . TYR A 1 260 ? 35.112 33.759 13.200  1.00 69.05  ? 514 TYR A C     1 
ATOM   2047 O  O     . TYR A 1 260 ? 35.258 33.487 12.038  1.00 65.13  ? 514 TYR A O     1 
ATOM   2048 C  CB    . TYR A 1 260 ? 36.917 35.106 14.462  1.00 73.36  ? 514 TYR A CB    1 
ATOM   2049 C  CG    . TYR A 1 260 ? 37.963 35.243 15.606  1.00 66.48  ? 514 TYR A CG    1 
ATOM   2050 C  CD1   . TYR A 1 260 ? 37.739 34.682 16.866  1.00 65.93  ? 514 TYR A CD1   1 
ATOM   2051 C  CD2   . TYR A 1 260 ? 39.160 35.940 15.415  1.00 65.18  ? 514 TYR A CD2   1 
ATOM   2052 C  CE1   . TYR A 1 260 ? 38.640 34.840 17.917  1.00 63.65  ? 514 TYR A CE1   1 
ATOM   2053 C  CE2   . TYR A 1 260 ? 40.087 36.095 16.454  1.00 63.36  ? 514 TYR A CE2   1 
ATOM   2054 C  CZ    . TYR A 1 260 ? 39.828 35.534 17.706  1.00 69.06  ? 514 TYR A CZ    1 
ATOM   2055 O  OH    . TYR A 1 260 ? 40.719 35.667 18.784  1.00 71.02  ? 514 TYR A OH    1 
ATOM   2056 N  N     . ASP A 1 261 ? 33.951 34.179 13.681  1.00 68.74  ? 515 ASP A N     1 
ATOM   2057 C  CA    . ASP A 1 261 ? 32.798 34.479 12.859  1.00 64.31  ? 515 ASP A CA    1 
ATOM   2058 C  C     . ASP A 1 261 ? 33.168 35.421 11.788  1.00 64.71  ? 515 ASP A C     1 
ATOM   2059 O  O     . ASP A 1 261 ? 33.752 36.473 12.035  1.00 67.92  ? 515 ASP A O     1 
ATOM   2060 C  CB    . ASP A 1 261 ? 31.705 35.133 13.710  1.00 73.63  ? 515 ASP A CB    1 
ATOM   2061 C  CG    . ASP A 1 261 ? 30.325 34.978 13.123  1.00 82.39  ? 515 ASP A CG    1 
ATOM   2062 O  OD1   . ASP A 1 261 ? 30.116 35.167 11.895  1.00 83.78  ? 515 ASP A OD1   1 
ATOM   2063 O  OD2   . ASP A 1 261 ? 29.413 34.717 13.933  1.00 99.72  ? 515 ASP A OD2   1 
ATOM   2064 N  N     . ARG A 1 262 ? 32.804 35.063 10.577  1.00 69.73  ? 516 ARG A N     1 
ATOM   2065 C  CA    . ARG A 1 262 ? 32.951 35.954 9.432   1.00 72.48  ? 516 ARG A CA    1 
ATOM   2066 C  C     . ARG A 1 262 ? 32.410 37.426 9.551   1.00 74.00  ? 516 ARG A C     1 
ATOM   2067 O  O     . ARG A 1 262 ? 32.898 38.322 8.828   1.00 69.27  ? 516 ARG A O     1 
ATOM   2068 C  CB    . ARG A 1 262 ? 32.358 35.273 8.174   1.00 77.97  ? 516 ARG A CB    1 
ATOM   2069 C  CG    . ARG A 1 262 ? 30.946 34.693 8.307   1.00 84.83  ? 516 ARG A CG    1 
ATOM   2070 C  CD    . ARG A 1 262 ? 30.485 34.053 6.984   1.00 92.19  ? 516 ARG A CD    1 
ATOM   2071 N  NE    . ARG A 1 262 ? 30.681 35.017 5.887   1.00 102.03 ? 516 ARG A NE    1 
ATOM   2072 C  CZ    . ARG A 1 262 ? 31.559 34.938 4.875   1.00 99.04  ? 516 ARG A CZ    1 
ATOM   2073 N  NH1   . ARG A 1 262 ? 32.349 33.876 4.708   1.00 107.12 ? 516 ARG A NH1   1 
ATOM   2074 N  NH2   . ARG A 1 262 ? 31.632 35.948 3.991   1.00 93.34  ? 516 ARG A NH2   1 
ATOM   2075 N  N     . SER A 1 263 ? 31.413 37.659 10.413  1.00 70.04  ? 517 SER A N     1 
ATOM   2076 C  CA    . SER A 1 263 ? 30.840 38.984 10.613  1.00 68.94  ? 517 SER A CA    1 
ATOM   2077 C  C     . SER A 1 263 ? 31.846 40.015 11.094  1.00 66.26  ? 517 SER A C     1 
ATOM   2078 O  O     . SER A 1 263 ? 31.723 41.175 10.727  1.00 73.50  ? 517 SER A O     1 
ATOM   2079 C  CB    . SER A 1 263 ? 29.685 38.945 11.621  1.00 73.78  ? 517 SER A CB    1 
ATOM   2080 O  OG    . SER A 1 263 ? 30.178 38.626 12.915  1.00 79.63  ? 517 SER A OG    1 
ATOM   2081 N  N     . PHE A 1 264 ? 32.791 39.621 11.950  1.00 62.09  ? 518 PHE A N     1 
ATOM   2082 C  CA    . PHE A 1 264 ? 33.809 40.541 12.425  1.00 61.17  ? 518 PHE A CA    1 
ATOM   2083 C  C     . PHE A 1 264 ? 34.761 40.949 11.239  1.00 62.50  ? 518 PHE A C     1 
ATOM   2084 O  O     . PHE A 1 264 ? 35.107 42.127 11.019  1.00 57.21  ? 518 PHE A O     1 
ATOM   2085 C  CB    . PHE A 1 264 ? 34.602 39.899 13.560  1.00 63.25  ? 518 PHE A CB    1 
ATOM   2086 C  CG    . PHE A 1 264 ? 33.850 39.754 14.858  1.00 64.50  ? 518 PHE A CG    1 
ATOM   2087 C  CD1   . PHE A 1 264 ? 33.637 40.838 15.675  1.00 68.15  ? 518 PHE A CD1   1 
ATOM   2088 C  CD2   . PHE A 1 264 ? 33.395 38.527 15.276  1.00 69.24  ? 518 PHE A CD2   1 
ATOM   2089 C  CE1   . PHE A 1 264 ? 32.937 40.718 16.876  1.00 71.34  ? 518 PHE A CE1   1 
ATOM   2090 C  CE2   . PHE A 1 264 ? 32.691 38.379 16.477  1.00 73.13  ? 518 PHE A CE2   1 
ATOM   2091 C  CZ    . PHE A 1 264 ? 32.462 39.471 17.281  1.00 70.14  ? 518 PHE A CZ    1 
ATOM   2092 N  N     . THR A 1 265 ? 35.150 39.950 10.453  1.00 61.91  ? 519 THR A N     1 
ATOM   2093 C  CA    . THR A 1 265 ? 36.147 40.104 9.404   1.00 60.53  ? 519 THR A CA    1 
ATOM   2094 C  C     . THR A 1 265 ? 35.581 40.843 8.242   1.00 55.56  ? 519 THR A C     1 
ATOM   2095 O  O     . THR A 1 265 ? 36.291 41.608 7.557   1.00 61.25  ? 519 THR A O     1 
ATOM   2096 C  CB    . THR A 1 265 ? 36.708 38.726 8.929   1.00 64.42  ? 519 THR A CB    1 
ATOM   2097 O  OG1   . THR A 1 265 ? 35.659 37.928 8.458   1.00 69.01  ? 519 THR A OG1   1 
ATOM   2098 C  CG2   . THR A 1 265 ? 37.323 37.986 10.029  1.00 68.98  ? 519 THR A CG2   1 
ATOM   2099 N  N     . ASP A 1 266 ? 34.314 40.594 7.990   1.00 54.07  ? 520 ASP A N     1 
ATOM   2100 C  CA    . ASP A 1 266 ? 33.519 41.332 7.002   1.00 61.37  ? 520 ASP A CA    1 
ATOM   2101 C  C     . ASP A 1 266 ? 33.496 42.852 7.355   1.00 66.64  ? 520 ASP A C     1 
ATOM   2102 O  O     . ASP A 1 266 ? 33.707 43.732 6.523   1.00 62.94  ? 520 ASP A O     1 
ATOM   2103 C  CB    . ASP A 1 266 ? 32.059 40.751 6.998   1.00 70.16  ? 520 ASP A CB    1 
ATOM   2104 C  CG    . ASP A 1 266 ? 31.909 39.353 6.201   1.00 78.70  ? 520 ASP A CG    1 
ATOM   2105 O  OD1   . ASP A 1 266 ? 32.804 38.958 5.436   1.00 83.76  ? 520 ASP A OD1   1 
ATOM   2106 O  OD2   . ASP A 1 266 ? 30.877 38.632 6.301   1.00 89.72  ? 520 ASP A OD2   1 
ATOM   2107 N  N     . LEU A 1 267 ? 33.288 43.169 8.626   1.00 66.62  ? 521 LEU A N     1 
ATOM   2108 C  CA    . LEU A 1 267 ? 33.340 44.558 9.041   1.00 63.58  ? 521 LEU A CA    1 
ATOM   2109 C  C     . LEU A 1 267 ? 34.792 45.103 9.059   1.00 62.38  ? 521 LEU A C     1 
ATOM   2110 O  O     . LEU A 1 267 ? 35.007 46.271 8.748   1.00 54.97  ? 521 LEU A O     1 
ATOM   2111 C  CB    . LEU A 1 267 ? 32.655 44.738 10.413  1.00 63.85  ? 521 LEU A CB    1 
ATOM   2112 C  CG    . LEU A 1 267 ? 31.160 44.540 10.465  1.00 61.27  ? 521 LEU A CG    1 
ATOM   2113 C  CD1   . LEU A 1 267 ? 30.697 44.365 11.919  1.00 63.27  ? 521 LEU A CD1   1 
ATOM   2114 C  CD2   . LEU A 1 267 ? 30.435 45.687 9.817   1.00 58.54  ? 521 LEU A CD2   1 
ATOM   2115 N  N     . TYR A 1 268 ? 35.766 44.260 9.411   1.00 58.60  ? 522 TYR A N     1 
ATOM   2116 C  CA    . TYR A 1 268 ? 37.185 44.685 9.496   1.00 53.43  ? 522 TYR A CA    1 
ATOM   2117 C  C     . TYR A 1 268 ? 37.717 45.033 8.109   1.00 54.59  ? 522 TYR A C     1 
ATOM   2118 O  O     . TYR A 1 268 ? 38.444 46.013 7.958   1.00 58.84  ? 522 TYR A O     1 
ATOM   2119 C  CB    . TYR A 1 268 ? 38.062 43.580 10.207  1.00 55.06  ? 522 TYR A CB    1 
ATOM   2120 C  CG    . TYR A 1 268 ? 39.388 44.118 10.649  1.00 53.34  ? 522 TYR A CG    1 
ATOM   2121 C  CD1   . TYR A 1 268 ? 39.450 45.022 11.738  1.00 55.11  ? 522 TYR A CD1   1 
ATOM   2122 C  CD2   . TYR A 1 268 ? 40.566 43.817 9.963   1.00 51.31  ? 522 TYR A CD2   1 
ATOM   2123 C  CE1   . TYR A 1 268 ? 40.650 45.610 12.115  1.00 56.57  ? 522 TYR A CE1   1 
ATOM   2124 C  CE2   . TYR A 1 268 ? 41.795 44.417 10.341  1.00 58.35  ? 522 TYR A CE2   1 
ATOM   2125 C  CZ    . TYR A 1 268 ? 41.830 45.292 11.441  1.00 56.22  ? 522 TYR A CZ    1 
ATOM   2126 O  OH    . TYR A 1 268 ? 42.971 45.913 11.851  1.00 65.00  ? 522 TYR A OH    1 
ATOM   2127 N  N     . ILE A 1 269 ? 37.361 44.258 7.078   1.00 57.90  ? 523 ILE A N     1 
ATOM   2128 C  CA    . ILE A 1 269 ? 37.712 44.623 5.663   1.00 60.14  ? 523 ILE A CA    1 
ATOM   2129 C  C     . ILE A 1 269 ? 37.202 46.067 5.300   1.00 55.00  ? 523 ILE A C     1 
ATOM   2130 O  O     . ILE A 1 269 ? 37.923 46.892 4.769   1.00 52.32  ? 523 ILE A O     1 
ATOM   2131 C  CB    . ILE A 1 269 ? 37.257 43.496 4.650   1.00 64.16  ? 523 ILE A CB    1 
ATOM   2132 C  CG1   . ILE A 1 269 ? 37.974 43.534 3.318   1.00 72.57  ? 523 ILE A CG1   1 
ATOM   2133 C  CG2   . ILE A 1 269 ? 35.792 43.605 4.228   1.00 64.49  ? 523 ILE A CG2   1 
ATOM   2134 C  CD1   . ILE A 1 269 ? 39.336 42.971 3.339   1.00 78.84  ? 523 ILE A CD1   1 
ATOM   2135 N  N     . GLN A 1 270 ? 36.004 46.399 5.708   1.00 56.16  ? 524 GLN A N     1 
ATOM   2136 C  CA    . GLN A 1 270 ? 35.418 47.719 5.455   1.00 55.50  ? 524 GLN A CA    1 
ATOM   2137 C  C     . GLN A 1 270 ? 36.207 48.779 6.199   1.00 62.75  ? 524 GLN A C     1 
ATOM   2138 O  O     . GLN A 1 270 ? 36.450 49.929 5.670   1.00 61.84  ? 524 GLN A O     1 
ATOM   2139 C  CB    . GLN A 1 270 ? 33.942 47.721 5.918   1.00 59.83  ? 524 GLN A CB    1 
ATOM   2140 C  CG    . GLN A 1 270 ? 33.084 46.706 5.132   1.00 65.08  ? 524 GLN A CG    1 
ATOM   2141 C  CD    . GLN A 1 270 ? 31.620 46.729 5.513   1.00 69.78  ? 524 GLN A CD    1 
ATOM   2142 O  OE1   . GLN A 1 270 ? 30.947 47.712 5.259   1.00 74.33  ? 524 GLN A OE1   1 
ATOM   2143 N  NE2   . GLN A 1 270 ? 31.109 45.646 6.066   1.00 71.38  ? 524 GLN A NE2   1 
ATOM   2144 N  N     . ILE A 1 271 ? 36.674 48.421 7.406   1.00 56.56  ? 525 ILE A N     1 
ATOM   2145 C  CA    . ILE A 1 271 ? 37.468 49.413 8.142   1.00 61.83  ? 525 ILE A CA    1 
ATOM   2146 C  C     . ILE A 1 271 ? 38.714 49.754 7.352   1.00 59.53  ? 525 ILE A C     1 
ATOM   2147 O  O     . ILE A 1 271 ? 39.063 50.931 7.218   1.00 58.76  ? 525 ILE A O     1 
ATOM   2148 C  CB    . ILE A 1 271 ? 37.848 48.965 9.618   1.00 60.84  ? 525 ILE A CB    1 
ATOM   2149 C  CG1   . ILE A 1 271 ? 36.563 48.934 10.438  1.00 57.39  ? 525 ILE A CG1   1 
ATOM   2150 C  CG2   . ILE A 1 271 ? 38.917 49.909 10.235  1.00 54.69  ? 525 ILE A CG2   1 
ATOM   2151 C  CD1   . ILE A 1 271 ? 36.672 48.261 11.763  1.00 59.63  ? 525 ILE A CD1   1 
ATOM   2152 N  N     . ILE A 1 272 ? 39.411 48.716 6.880   1.00 58.49  ? 526 ILE A N     1 
ATOM   2153 C  CA    . ILE A 1 272 ? 40.709 48.911 6.239   1.00 57.05  ? 526 ILE A CA    1 
ATOM   2154 C  C     . ILE A 1 272 ? 40.520 49.529 4.826   1.00 59.67  ? 526 ILE A C     1 
ATOM   2155 O  O     . ILE A 1 272 ? 41.275 50.422 4.464   1.00 56.41  ? 526 ILE A O     1 
ATOM   2156 C  CB    . ILE A 1 272 ? 41.495 47.608 6.129   1.00 58.93  ? 526 ILE A CB    1 
ATOM   2157 C  CG1   . ILE A 1 272 ? 41.631 46.868 7.484   1.00 62.81  ? 526 ILE A CG1   1 
ATOM   2158 C  CG2   . ILE A 1 272 ? 42.867 47.894 5.548   1.00 57.38  ? 526 ILE A CG2   1 
ATOM   2159 C  CD1   . ILE A 1 272 ? 42.479 47.583 8.505   1.00 62.04  ? 526 ILE A CD1   1 
ATOM   2160 N  N     . ARG A 1 273 ? 39.535 49.047 4.055   1.00 57.62  ? 527 ARG A N     1 
ATOM   2161 C  CA    . ARG A 1 273 ? 39.087 49.743 2.796   1.00 65.11  ? 527 ARG A CA    1 
ATOM   2162 C  C     . ARG A 1 273 ? 38.916 51.228 3.033   1.00 60.17  ? 527 ARG A C     1 
ATOM   2163 O  O     . ARG A 1 273 ? 39.539 51.997 2.347   1.00 59.00  ? 527 ARG A O     1 
ATOM   2164 C  CB    . ARG A 1 273 ? 37.759 49.199 2.212   1.00 65.27  ? 527 ARG A CB    1 
ATOM   2165 C  CG    . ARG A 1 273 ? 37.215 49.883 0.914   1.00 68.93  ? 527 ARG A CG    1 
ATOM   2166 C  CD    . ARG A 1 273 ? 37.967 49.481 -0.368  1.00 67.52  ? 527 ARG A CD    1 
ATOM   2167 N  NE    . ARG A 1 273 ? 39.161 50.325 -0.606  1.00 70.87  ? 527 ARG A NE    1 
ATOM   2168 C  CZ    . ARG A 1 273 ? 40.187 50.009 -1.407  1.00 69.24  ? 527 ARG A CZ    1 
ATOM   2169 N  NH1   . ARG A 1 273 ? 40.240 48.856 -2.062  1.00 69.12  ? 527 ARG A NH1   1 
ATOM   2170 N  NH2   . ARG A 1 273 ? 41.204 50.849 -1.519  1.00 72.06  ? 527 ARG A NH2   1 
ATOM   2171 N  N     . ALA A 1 274 ? 38.140 51.607 4.040   1.00 59.31  ? 528 ALA A N     1 
ATOM   2172 C  CA    . ALA A 1 274 ? 37.812 53.029 4.276   1.00 59.25  ? 528 ALA A CA    1 
ATOM   2173 C  C     . ALA A 1 274 ? 39.013 53.810 4.653   1.00 64.00  ? 528 ALA A C     1 
ATOM   2174 O  O     . ALA A 1 274 ? 39.125 55.002 4.295   1.00 66.83  ? 528 ALA A O     1 
ATOM   2175 C  CB    . ALA A 1 274 ? 36.764 53.186 5.353   1.00 60.33  ? 528 ALA A CB    1 
ATOM   2176 N  N     . ALA A 1 275 ? 39.903 53.148 5.395   1.00 62.05  ? 529 ALA A N     1 
ATOM   2177 C  CA    . ALA A 1 275 ? 41.179 53.745 5.739   1.00 60.23  ? 529 ALA A CA    1 
ATOM   2178 C  C     . ALA A 1 275 ? 42.164 53.890 4.561   1.00 62.16  ? 529 ALA A C     1 
ATOM   2179 O  O     . ALA A 1 275 ? 42.980 54.820 4.525   1.00 58.28  ? 529 ALA A O     1 
ATOM   2180 C  CB    . ALA A 1 275 ? 41.835 52.972 6.848   1.00 56.12  ? 529 ALA A CB    1 
ATOM   2181 N  N     . ALA A 1 276 ? 42.156 52.925 3.651   1.00 68.24  ? 530 ALA A N     1 
ATOM   2182 C  CA    . ALA A 1 276 ? 42.953 53.014 2.427   1.00 71.05  ? 530 ALA A CA    1 
ATOM   2183 C  C     . ALA A 1 276 ? 42.450 54.213 1.587   1.00 78.57  ? 530 ALA A C     1 
ATOM   2184 O  O     . ALA A 1 276 ? 43.247 54.932 0.989   1.00 83.41  ? 530 ALA A O     1 
ATOM   2185 C  CB    . ALA A 1 276 ? 42.833 51.700 1.636   1.00 68.80  ? 530 ALA A CB    1 
ATOM   2186 N  N     . ASP A 1 277 ? 41.129 54.441 1.631   1.00 73.53  ? 531 ASP A N     1 
ATOM   2187 C  CA    . ASP A 1 277 ? 40.454 55.544 0.968   1.00 74.09  ? 531 ASP A CA    1 
ATOM   2188 C  C     . ASP A 1 277 ? 40.369 56.818 1.788   1.00 74.05  ? 531 ASP A C     1 
ATOM   2189 O  O     . ASP A 1 277 ? 39.619 57.713 1.438   1.00 80.18  ? 531 ASP A O     1 
ATOM   2190 C  CB    . ASP A 1 277 ? 39.032 55.104 0.587   1.00 71.18  ? 531 ASP A CB    1 
ATOM   2191 C  CG    . ASP A 1 277 ? 39.040 53.874 -0.300  1.00 72.44  ? 531 ASP A CG    1 
ATOM   2192 O  OD1   . ASP A 1 277 ? 40.102 53.614 -0.887  1.00 65.52  ? 531 ASP A OD1   1 
ATOM   2193 O  OD2   . ASP A 1 277 ? 38.018 53.139 -0.341  1.00 74.26  ? 531 ASP A OD2   1 
ATOM   2194 N  N     . ARG A 1 278 ? 41.087 56.892 2.898   1.00 72.98  ? 532 ARG A N     1 
ATOM   2195 C  CA    . ARG A 1 278 ? 41.204 58.113 3.664   1.00 73.35  ? 532 ARG A CA    1 
ATOM   2196 C  C     . ARG A 1 278 ? 39.851 58.668 4.136   1.00 71.54  ? 532 ARG A C     1 
ATOM   2197 O  O     . ARG A 1 278 ? 39.736 59.852 4.368   1.00 79.21  ? 532 ARG A O     1 
ATOM   2198 C  CB    . ARG A 1 278 ? 41.980 59.158 2.848   1.00 82.46  ? 532 ARG A CB    1 
ATOM   2199 C  CG    . ARG A 1 278 ? 43.152 58.626 2.012   1.00 81.91  ? 532 ARG A CG    1 
ATOM   2200 C  CD    . ARG A 1 278 ? 44.132 57.711 2.750   1.00 84.47  ? 532 ARG A CD    1 
ATOM   2201 N  NE    . ARG A 1 278 ? 44.995 58.428 3.707   1.00 87.57  ? 532 ARG A NE    1 
ATOM   2202 C  CZ    . ARG A 1 278 ? 45.370 57.983 4.929   1.00 89.57  ? 532 ARG A CZ    1 
ATOM   2203 N  NH1   . ARG A 1 278 ? 44.976 56.788 5.408   1.00 85.44  ? 532 ARG A NH1   1 
ATOM   2204 N  NH2   . ARG A 1 278 ? 46.161 58.744 5.704   1.00 85.43  ? 532 ARG A NH2   1 
ATOM   2205 N  N     . ASP A 1 279 ? 38.848 57.797 4.311   1.00 72.07  ? 533 ASP A N     1 
ATOM   2206 C  CA    . ASP A 1 279 ? 37.488 58.161 4.807   1.00 76.08  ? 533 ASP A CA    1 
ATOM   2207 C  C     . ASP A 1 279 ? 37.298 57.869 6.345   1.00 75.46  ? 533 ASP A C     1 
ATOM   2208 O  O     . ASP A 1 279 ? 36.837 56.773 6.753   1.00 78.36  ? 533 ASP A O     1 
ATOM   2209 C  CB    . ASP A 1 279 ? 36.453 57.434 3.909   1.00 73.74  ? 533 ASP A CB    1 
ATOM   2210 C  CG    . ASP A 1 279 ? 35.039 57.531 4.414   1.00 76.24  ? 533 ASP A CG    1 
ATOM   2211 O  OD1   . ASP A 1 279 ? 34.757 58.215 5.424   1.00 80.01  ? 533 ASP A OD1   1 
ATOM   2212 O  OD2   . ASP A 1 279 ? 34.175 56.894 3.793   1.00 73.31  ? 533 ASP A OD2   1 
ATOM   2213 N  N     . ARG A 1 280 ? 37.617 58.876 7.161   1.00 71.74  ? 534 ARG A N     1 
ATOM   2214 C  CA    . ARG A 1 280 ? 37.656 58.799 8.648   1.00 71.40  ? 534 ARG A CA    1 
ATOM   2215 C  C     . ARG A 1 280 ? 36.297 58.464 9.231   1.00 67.70  ? 534 ARG A C     1 
ATOM   2216 O  O     . ARG A 1 280 ? 36.211 57.740 10.230  1.00 61.09  ? 534 ARG A O     1 
ATOM   2217 C  CB    . ARG A 1 280 ? 38.284 60.097 9.303   1.00 70.75  ? 534 ARG A CB    1 
ATOM   2218 C  CG    . ARG A 1 280 ? 37.891 60.365 10.749  1.00 75.79  ? 534 ARG A CG    1 
ATOM   2219 C  CD    . ARG A 1 280 ? 38.533 61.577 11.474  1.00 72.15  ? 534 ARG A CD    1 
ATOM   2220 N  NE    . ARG A 1 280 ? 39.942 61.357 11.513  1.00 66.15  ? 534 ARG A NE    1 
ATOM   2221 C  CZ    . ARG A 1 280 ? 40.727 61.270 12.578  1.00 68.33  ? 534 ARG A CZ    1 
ATOM   2222 N  NH1   . ARG A 1 280 ? 40.294 61.427 13.820  1.00 76.21  ? 534 ARG A NH1   1 
ATOM   2223 N  NH2   . ARG A 1 280 ? 42.028 61.031 12.373  1.00 70.36  ? 534 ARG A NH2   1 
ATOM   2224 N  N     . GLU A 1 281 ? 35.251 58.992 8.604   1.00 68.09  ? 535 GLU A N     1 
ATOM   2225 C  CA    . GLU A 1 281 ? 33.838 58.768 9.008   1.00 73.35  ? 535 GLU A CA    1 
ATOM   2226 C  C     . GLU A 1 281 ? 33.376 57.343 8.753   1.00 67.10  ? 535 GLU A C     1 
ATOM   2227 O  O     . GLU A 1 281 ? 32.647 56.800 9.560   1.00 68.92  ? 535 GLU A O     1 
ATOM   2228 C  CB    . GLU A 1 281 ? 32.841 59.751 8.294   1.00 74.82  ? 535 GLU A CB    1 
ATOM   2229 C  CG    . GLU A 1 281 ? 33.043 61.207 8.691   1.00 84.67  ? 535 GLU A CG    1 
ATOM   2230 C  CD    . GLU A 1 281 ? 32.828 61.454 10.205  1.00 92.69  ? 535 GLU A CD    1 
ATOM   2231 O  OE1   . GLU A 1 281 ? 31.700 61.168 10.703  1.00 82.16  ? 535 GLU A OE1   1 
ATOM   2232 O  OE2   . GLU A 1 281 ? 33.801 61.900 10.892  1.00 93.60  ? 535 GLU A OE2   1 
ATOM   2233 N  N     . THR A 1 282 ? 33.782 56.737 7.645   1.00 62.42  ? 536 THR A N     1 
ATOM   2234 C  CA    . THR A 1 282 ? 33.494 55.314 7.482   1.00 66.19  ? 536 THR A CA    1 
ATOM   2235 C  C     . THR A 1 282 ? 34.278 54.430 8.520   1.00 59.61  ? 536 THR A C     1 
ATOM   2236 O  O     . THR A 1 282 ? 33.694 53.535 9.170   1.00 56.26  ? 536 THR A O     1 
ATOM   2237 C  CB    . THR A 1 282 ? 33.611 54.903 6.020   1.00 68.16  ? 536 THR A CB    1 
ATOM   2238 O  OG1   . THR A 1 282 ? 32.703 55.725 5.282   1.00 73.51  ? 536 THR A OG1   1 
ATOM   2239 C  CG2   . THR A 1 282 ? 33.202 53.458 5.831   1.00 67.34  ? 536 THR A CG2   1 
ATOM   2240 N  N     . VAL A 1 283 ? 35.519 54.809 8.800   1.00 62.49  ? 537 VAL A N     1 
ATOM   2241 C  CA    . VAL A 1 283 ? 36.375 54.057 9.748   1.00 59.90  ? 537 VAL A CA    1 
ATOM   2242 C  C     . VAL A 1 283 ? 35.801 53.996 11.119  1.00 58.23  ? 537 VAL A C     1 
ATOM   2243 O  O     . VAL A 1 283 ? 35.657 52.925 11.690  1.00 61.56  ? 537 VAL A O     1 
ATOM   2244 C  CB    . VAL A 1 283 ? 37.796 54.600 9.729   1.00 60.53  ? 537 VAL A CB    1 
ATOM   2245 C  CG1   . VAL A 1 283 ? 38.611 54.042 10.861  1.00 61.04  ? 537 VAL A CG1   1 
ATOM   2246 C  CG2   . VAL A 1 283 ? 38.397 54.171 8.408   1.00 58.87  ? 537 VAL A CG2   1 
ATOM   2247 N  N     . ARG A 1 284 ? 35.342 55.148 11.578  1.00 57.99  ? 538 ARG A N     1 
ATOM   2248 C  CA    . ARG A 1 284 ? 34.726 55.334 12.843  1.00 50.49  ? 538 ARG A CA    1 
ATOM   2249 C  C     . ARG A 1 284 ? 33.415 54.567 12.929  1.00 53.08  ? 538 ARG A C     1 
ATOM   2250 O  O     . ARG A 1 284 ? 33.147 53.886 13.961  1.00 51.68  ? 538 ARG A O     1 
ATOM   2251 C  CB    . ARG A 1 284 ? 34.533 56.873 13.073  1.00 61.13  ? 538 ARG A CB    1 
ATOM   2252 C  CG    . ARG A 1 284 ? 33.700 57.235 14.283  1.00 63.97  ? 538 ARG A CG    1 
ATOM   2253 C  CD    . ARG A 1 284 ? 33.614 58.710 14.570  1.00 71.37  ? 538 ARG A CD    1 
ATOM   2254 N  NE    . ARG A 1 284 ? 32.903 58.804 15.842  1.00 72.11  ? 538 ARG A NE    1 
ATOM   2255 C  CZ    . ARG A 1 284 ? 31.586 58.740 15.971  1.00 67.23  ? 538 ARG A CZ    1 
ATOM   2256 N  NH1   . ARG A 1 284 ? 30.788 58.632 14.922  1.00 65.15  ? 538 ARG A NH1   1 
ATOM   2257 N  NH2   . ARG A 1 284 ? 31.087 58.758 17.185  1.00 71.13  ? 538 ARG A NH2   1 
ATOM   2258 N  N     . ALA A 1 285 ? 32.576 54.678 11.899  1.00 54.39  ? 539 ALA A N     1 
ATOM   2259 C  CA    . ALA A 1 285 ? 31.187 54.101 11.937  1.00 56.83  ? 539 ALA A CA    1 
ATOM   2260 C  C     . ALA A 1 285 ? 31.219 52.572 11.946  1.00 56.82  ? 539 ALA A C     1 
ATOM   2261 O  O     . ALA A 1 285 ? 30.467 51.926 12.672  1.00 60.38  ? 539 ALA A O     1 
ATOM   2262 C  CB    . ALA A 1 285 ? 30.358 54.543 10.744  1.00 54.22  ? 539 ALA A CB    1 
ATOM   2263 N  N     . LYS A 1 286 ? 32.089 52.000 11.139  1.00 55.40  ? 540 LYS A N     1 
ATOM   2264 C  CA    . LYS A 1 286 ? 32.287 50.556 11.137  1.00 54.64  ? 540 LYS A CA    1 
ATOM   2265 C  C     . LYS A 1 286 ? 32.989 50.048 12.391  1.00 56.48  ? 540 LYS A C     1 
ATOM   2266 O  O     . LYS A 1 286 ? 32.630 48.963 12.911  1.00 55.06  ? 540 LYS A O     1 
ATOM   2267 C  CB    . LYS A 1 286 ? 32.983 50.111 9.869   1.00 61.84  ? 540 LYS A CB    1 
ATOM   2268 C  CG    . LYS A 1 286 ? 32.091 50.204 8.640   1.00 62.05  ? 540 LYS A CG    1 
ATOM   2269 C  CD    . LYS A 1 286 ? 30.816 49.423 8.849   1.00 72.11  ? 540 LYS A CD    1 
ATOM   2270 C  CE    . LYS A 1 286 ? 30.208 48.801 7.606   1.00 78.43  ? 540 LYS A CE    1 
ATOM   2271 N  NZ    . LYS A 1 286 ? 29.013 49.472 7.050   1.00 76.08  ? 540 LYS A NZ    1 
ATOM   2272 N  N     . SER A 1 287 ? 33.880 50.864 12.952  1.00 54.10  ? 541 SER A N     1 
ATOM   2273 C  CA    . SER A 1 287 ? 34.490 50.533 14.240  1.00 50.02  ? 541 SER A CA    1 
ATOM   2274 C  C     . SER A 1 287 ? 33.438 50.456 15.343  1.00 50.28  ? 541 SER A C     1 
ATOM   2275 O  O     . SER A 1 287 ? 33.561 49.636 16.281  1.00 51.10  ? 541 SER A O     1 
ATOM   2276 C  CB    . SER A 1 287 ? 35.584 51.574 14.599  1.00 48.22  ? 541 SER A CB    1 
ATOM   2277 O  OG    . SER A 1 287 ? 36.677 51.509 13.720  1.00 50.62  ? 541 SER A OG    1 
ATOM   2278 N  N     . ILE A 1 288 ? 32.401 51.319 15.261  1.00 50.56  ? 542 ILE A N     1 
ATOM   2279 C  CA    . ILE A 1 288 ? 31.280 51.298 16.215  1.00 47.51  ? 542 ILE A CA    1 
ATOM   2280 C  C     . ILE A 1 288 ? 30.411 50.102 15.898  1.00 51.15  ? 542 ILE A C     1 
ATOM   2281 O  O     . ILE A 1 288 ? 30.056 49.352 16.793  1.00 52.96  ? 542 ILE A O     1 
ATOM   2282 C  CB    . ILE A 1 288 ? 30.463 52.607 16.123  1.00 50.38  ? 542 ILE A CB    1 
ATOM   2283 C  CG1   . ILE A 1 288 ? 31.309 53.784 16.665  1.00 52.34  ? 542 ILE A CG1   1 
ATOM   2284 C  CG2   . ILE A 1 288 ? 29.090 52.529 16.821  1.00 44.43  ? 542 ILE A CG2   1 
ATOM   2285 C  CD1   . ILE A 1 288 ? 30.812 55.167 16.126  1.00 55.65  ? 542 ILE A CD1   1 
ATOM   2286 N  N     . GLU A 1 289 ? 30.107 49.870 14.621  1.00 55.71  ? 543 GLU A N     1 
ATOM   2287 C  CA    . GLU A 1 289 ? 29.274 48.728 14.267  1.00 59.04  ? 543 GLU A CA    1 
ATOM   2288 C  C     . GLU A 1 289 ? 29.933 47.382 14.697  1.00 57.76  ? 543 GLU A C     1 
ATOM   2289 O  O     . GLU A 1 289 ? 29.266 46.470 15.126  1.00 58.08  ? 543 GLU A O     1 
ATOM   2290 C  CB    . GLU A 1 289 ? 29.011 48.747 12.759  1.00 60.72  ? 543 GLU A CB    1 
ATOM   2291 C  CG    . GLU A 1 289 ? 27.943 47.738 12.356  1.00 65.94  ? 543 GLU A CG    1 
ATOM   2292 C  CD    . GLU A 1 289 ? 27.670 47.644 10.820  1.00 73.09  ? 543 GLU A CD    1 
ATOM   2293 O  OE1   . GLU A 1 289 ? 28.166 48.530 10.026  1.00 67.95  ? 543 GLU A OE1   1 
ATOM   2294 O  OE2   . GLU A 1 289 ? 26.953 46.645 10.418  1.00 65.13  ? 543 GLU A OE2   1 
HETATM 2295 N  N     . MSE A 1 290 ? 31.254 47.297 14.623  1.00 57.70  ? 544 MSE A N     1 
HETATM 2296 C  CA    . MSE A 1 290 ? 32.015 46.115 15.095  1.00 59.17  ? 544 MSE A CA    1 
HETATM 2297 C  C     . MSE A 1 290 ? 32.030 45.988 16.605  1.00 54.61  ? 544 MSE A C     1 
HETATM 2298 O  O     . MSE A 1 290 ? 32.375 44.941 17.135  1.00 60.98  ? 544 MSE A O     1 
HETATM 2299 C  CB    . MSE A 1 290 ? 33.475 46.136 14.505  1.00 61.33  ? 544 MSE A CB    1 
HETATM 2300 C  CG    . MSE A 1 290 ? 33.980 44.713 14.220  1.00 63.57  ? 544 MSE A CG    1 
HETATM 2301 SE SE    . MSE A 1 290 ? 35.791 44.828 13.500  1.00 63.60  ? 544 MSE A SE    1 
HETATM 2302 C  CE    . MSE A 1 290 ? 36.685 46.085 14.717  1.00 62.83  ? 544 MSE A CE    1 
ATOM   2303 N  N     . LYS A 1 291 ? 31.706 47.069 17.291  1.00 55.75  ? 545 LYS A N     1 
ATOM   2304 C  CA    . LYS A 1 291 ? 31.642 47.189 18.741  1.00 52.23  ? 545 LYS A CA    1 
ATOM   2305 C  C     . LYS A 1 291 ? 32.983 47.290 19.368  1.00 49.11  ? 545 LYS A C     1 
ATOM   2306 O  O     . LYS A 1 291 ? 33.080 47.136 20.602  1.00 50.75  ? 545 LYS A O     1 
ATOM   2307 C  CB    . LYS A 1 291 ? 30.834 46.137 19.487  1.00 57.08  ? 545 LYS A CB    1 
ATOM   2308 C  CG    . LYS A 1 291 ? 29.390 45.952 19.029  1.00 66.49  ? 545 LYS A CG    1 
ATOM   2309 C  CD    . LYS A 1 291 ? 28.784 44.775 19.831  1.00 73.37  ? 545 LYS A CD    1 
ATOM   2310 C  CE    . LYS A 1 291 ? 27.623 44.068 19.157  1.00 77.43  ? 545 LYS A CE    1 
ATOM   2311 N  NZ    . LYS A 1 291 ? 26.529 45.070 18.937  1.00 78.10  ? 545 LYS A NZ    1 
ATOM   2312 N  N     . PHE A 1 292 ? 34.008 47.698 18.610  1.00 50.68  ? 546 PHE A N     1 
ATOM   2313 C  CA    . PHE A 1 292 ? 35.274 48.127 19.268  1.00 53.36  ? 546 PHE A CA    1 
ATOM   2314 C  C     . PHE A 1 292 ? 35.058 49.446 20.044  1.00 51.39  ? 546 PHE A C     1 
ATOM   2315 O  O     . PHE A 1 292 ? 35.437 49.562 21.183  1.00 57.70  ? 546 PHE A O     1 
ATOM   2316 C  CB    . PHE A 1 292 ? 36.442 48.322 18.265  1.00 52.66  ? 546 PHE A CB    1 
ATOM   2317 C  CG    . PHE A 1 292 ? 37.814 48.342 18.919  1.00 51.45  ? 546 PHE A CG    1 
ATOM   2318 C  CD1   . PHE A 1 292 ? 38.332 47.182 19.515  1.00 56.49  ? 546 PHE A CD1   1 
ATOM   2319 C  CD2   . PHE A 1 292 ? 38.585 49.480 18.923  1.00 53.90  ? 546 PHE A CD2   1 
ATOM   2320 C  CE1   . PHE A 1 292 ? 39.575 47.160 20.115  1.00 52.04  ? 546 PHE A CE1   1 
ATOM   2321 C  CE2   . PHE A 1 292 ? 39.844 49.485 19.507  1.00 52.69  ? 546 PHE A CE2   1 
ATOM   2322 C  CZ    . PHE A 1 292 ? 40.355 48.324 20.059  1.00 56.59  ? 546 PHE A CZ    1 
ATOM   2323 N  N     . LEU A 1 293 ? 34.533 50.440 19.328  1.00 57.55  ? 547 LEU A N     1 
ATOM   2324 C  CA    . LEU A 1 293 ? 34.055 51.740 19.856  1.00 57.09  ? 547 LEU A CA    1 
ATOM   2325 C  C     . LEU A 1 293 ? 32.550 51.683 20.173  1.00 52.79  ? 547 LEU A C     1 
ATOM   2326 O  O     . LEU A 1 293 ? 31.809 50.993 19.463  1.00 58.96  ? 547 LEU A O     1 
ATOM   2327 C  CB    . LEU A 1 293 ? 34.290 52.860 18.812  1.00 52.46  ? 547 LEU A CB    1 
ATOM   2328 C  CG    . LEU A 1 293 ? 35.701 53.188 18.433  1.00 53.49  ? 547 LEU A CG    1 
ATOM   2329 C  CD1   . LEU A 1 293 ? 35.727 54.373 17.510  1.00 58.16  ? 547 LEU A CD1   1 
ATOM   2330 C  CD2   . LEU A 1 293 ? 36.535 53.471 19.659  1.00 52.86  ? 547 LEU A CD2   1 
ATOM   2331 N  N     . THR A 1 294 ? 32.152 52.397 21.230  1.00 52.67  ? 548 THR A N     1 
ATOM   2332 C  CA    . THR A 1 294 ? 30.766 52.592 21.663  1.00 54.89  ? 548 THR A CA    1 
ATOM   2333 C  C     . THR A 1 294 ? 30.073 53.759 20.898  1.00 56.72  ? 548 THR A C     1 
ATOM   2334 O  O     . THR A 1 294 ? 28.866 53.780 20.772  1.00 57.70  ? 548 THR A O     1 
ATOM   2335 C  CB    . THR A 1 294 ? 30.666 52.919 23.161  1.00 52.38  ? 548 THR A CB    1 
ATOM   2336 O  OG1   . THR A 1 294 ? 31.254 54.191 23.414  1.00 53.44  ? 548 THR A OG1   1 
ATOM   2337 C  CG2   . THR A 1 294 ? 31.344 51.848 24.048  1.00 52.03  ? 548 THR A CG2   1 
ATOM   2338 N  N     . GLY A 1 295 ? 30.845 54.718 20.377  1.00 53.67  ? 549 GLY A N     1 
ATOM   2339 C  CA    . GLY A 1 295 ? 30.274 55.868 19.753  1.00 55.01  ? 549 GLY A CA    1 
ATOM   2340 C  C     . GLY A 1 295 ? 30.245 57.008 20.786  1.00 57.49  ? 549 GLY A C     1 
ATOM   2341 O  O     . GLY A 1 295 ? 29.850 58.116 20.445  1.00 57.76  ? 549 GLY A O     1 
ATOM   2342 N  N     . TYR A 1 296 ? 30.614 56.755 22.043  1.00 52.31  ? 550 TYR A N     1 
ATOM   2343 C  CA    . TYR A 1 296 ? 30.557 57.847 23.038  1.00 55.78  ? 550 TYR A CA    1 
ATOM   2344 C  C     . TYR A 1 296 ? 31.794 57.973 23.838  1.00 53.35  ? 550 TYR A C     1 
ATOM   2345 O  O     . TYR A 1 296 ? 31.729 58.448 24.939  1.00 56.37  ? 550 TYR A O     1 
ATOM   2346 C  CB    . TYR A 1 296 ? 29.286 57.817 23.953  1.00 50.35  ? 550 TYR A CB    1 
ATOM   2347 C  CG    . TYR A 1 296 ? 28.996 56.600 24.794  1.00 52.76  ? 550 TYR A CG    1 
ATOM   2348 C  CD1   . TYR A 1 296 ? 29.501 56.442 26.082  1.00 53.55  ? 550 TYR A CD1   1 
ATOM   2349 C  CD2   . TYR A 1 296 ? 28.171 55.595 24.296  1.00 57.91  ? 550 TYR A CD2   1 
ATOM   2350 C  CE1   . TYR A 1 296 ? 29.166 55.318 26.864  1.00 52.18  ? 550 TYR A CE1   1 
ATOM   2351 C  CE2   . TYR A 1 296 ? 27.869 54.487 25.038  1.00 53.26  ? 550 TYR A CE2   1 
ATOM   2352 C  CZ    . TYR A 1 296 ? 28.362 54.353 26.298  1.00 54.21  ? 550 TYR A CZ    1 
ATOM   2353 O  OH    . TYR A 1 296 ? 27.985 53.216 26.944  1.00 59.67  ? 550 TYR A OH    1 
ATOM   2354 N  N     . GLU A 1 297 ? 32.919 57.493 23.295  1.00 60.97  ? 551 GLU A N     1 
ATOM   2355 C  CA    . GLU A 1 297 ? 34.246 57.713 23.889  1.00 63.05  ? 551 GLU A CA    1 
ATOM   2356 C  C     . GLU A 1 297 ? 34.520 59.232 23.868  1.00 58.94  ? 551 GLU A C     1 
ATOM   2357 O  O     . GLU A 1 297 ? 33.951 59.980 23.033  1.00 60.34  ? 551 GLU A O     1 
ATOM   2358 C  CB    . GLU A 1 297 ? 35.345 56.971 23.088  1.00 62.49  ? 551 GLU A CB    1 
ATOM   2359 C  CG    . GLU A 1 297 ? 35.511 55.490 23.409  1.00 63.93  ? 551 GLU A CG    1 
ATOM   2360 C  CD    . GLU A 1 297 ? 34.553 54.519 22.673  1.00 66.90  ? 551 GLU A CD    1 
ATOM   2361 O  OE1   . GLU A 1 297 ? 34.038 54.838 21.551  1.00 61.61  ? 551 GLU A OE1   1 
ATOM   2362 O  OE2   . GLU A 1 297 ? 34.289 53.418 23.264  1.00 65.58  ? 551 GLU A OE2   1 
ATOM   2363 N  N     . VAL A 1 298 ? 35.357 59.685 24.787  1.00 59.47  ? 552 VAL A N     1 
ATOM   2364 C  CA    . VAL A 1 298 ? 35.967 61.032 24.713  1.00 66.73  ? 552 VAL A CA    1 
ATOM   2365 C  C     . VAL A 1 298 ? 36.627 61.223 23.352  1.00 65.22  ? 552 VAL A C     1 
ATOM   2366 O  O     . VAL A 1 298 ? 37.408 60.385 22.916  1.00 64.96  ? 552 VAL A O     1 
ATOM   2367 C  CB    . VAL A 1 298 ? 37.151 61.253 25.689  1.00 70.24  ? 552 VAL A CB    1 
ATOM   2368 C  CG1   . VAL A 1 298 ? 37.431 62.743 25.741  1.00 70.70  ? 552 VAL A CG1   1 
ATOM   2369 C  CG2   . VAL A 1 298 ? 36.893 60.697 27.113  1.00 73.10  ? 552 VAL A CG2   1 
ATOM   2370 N  N     . LYS A 1 299 ? 36.317 62.329 22.706  1.00 65.58  ? 553 LYS A N     1 
ATOM   2371 C  CA    . LYS A 1 299 ? 36.895 62.673 21.431  1.00 74.00  ? 553 LYS A CA    1 
ATOM   2372 C  C     . LYS A 1 299 ? 38.426 62.388 21.357  1.00 74.91  ? 553 LYS A C     1 
ATOM   2373 O  O     . LYS A 1 299 ? 38.906 61.777 20.409  1.00 73.09  ? 553 LYS A O     1 
ATOM   2374 C  CB    . LYS A 1 299 ? 36.582 64.132 21.097  1.00 74.06  ? 553 LYS A CB    1 
ATOM   2375 C  CG    . LYS A 1 299 ? 36.965 64.662 19.718  1.00 77.85  ? 553 LYS A CG    1 
ATOM   2376 C  CD    . LYS A 1 299 ? 36.321 63.866 18.593  1.00 84.68  ? 553 LYS A CD    1 
ATOM   2377 C  CE    . LYS A 1 299 ? 35.638 64.742 17.529  1.00 85.69  ? 553 LYS A CE    1 
ATOM   2378 N  NZ    . LYS A 1 299 ? 36.566 65.690 16.876  1.00 86.78  ? 553 LYS A NZ    1 
ATOM   2379 N  N     . VAL A 1 300 ? 39.171 62.838 22.337  1.00 69.42  ? 554 VAL A N     1 
ATOM   2380 C  CA    . VAL A 1 300 ? 40.612 62.875 22.215  1.00 72.85  ? 554 VAL A CA    1 
ATOM   2381 C  C     . VAL A 1 300 ? 41.118 61.447 22.036  1.00 65.09  ? 554 VAL A C     1 
ATOM   2382 O  O     . VAL A 1 300 ? 41.930 61.200 21.180  1.00 65.58  ? 554 VAL A O     1 
ATOM   2383 C  CB    . VAL A 1 300 ? 41.263 63.658 23.415  1.00 79.76  ? 554 VAL A CB    1 
ATOM   2384 C  CG1   . VAL A 1 300 ? 42.763 63.414 23.524  1.00 83.23  ? 554 VAL A CG1   1 
ATOM   2385 C  CG2   . VAL A 1 300 ? 40.967 65.144 23.261  1.00 77.78  ? 554 VAL A CG2   1 
HETATM 2386 N  N     . MSE A 1 301 ? 40.611 60.523 22.825  1.00 65.83  ? 555 MSE A N     1 
HETATM 2387 C  CA    . MSE A 1 301 ? 40.977 59.136 22.690  1.00 68.86  ? 555 MSE A CA    1 
HETATM 2388 C  C     . MSE A 1 301 ? 40.428 58.548 21.390  1.00 63.43  ? 555 MSE A C     1 
HETATM 2389 O  O     . MSE A 1 301 ? 41.115 57.822 20.682  1.00 66.90  ? 555 MSE A O     1 
HETATM 2390 C  CB    . MSE A 1 301 ? 40.559 58.407 23.956  1.00 74.79  ? 555 MSE A CB    1 
HETATM 2391 C  CG    . MSE A 1 301 ? 41.103 56.983 23.951  1.00 90.14  ? 555 MSE A CG    1 
HETATM 2392 SE SE    . MSE A 1 301 ? 39.564 55.783 23.758  1.00 115.98 ? 555 MSE A SE    1 
HETATM 2393 C  CE    . MSE A 1 301 ? 39.362 55.545 25.736  1.00 99.70  ? 555 MSE A CE    1 
ATOM   2394 N  N     . GLU A 1 302 ? 39.232 58.931 20.989  1.00 61.10  ? 556 GLU A N     1 
ATOM   2395 C  CA    . GLU A 1 302 ? 38.718 58.427 19.743  1.00 60.01  ? 556 GLU A CA    1 
ATOM   2396 C  C     . GLU A 1 302 ? 39.651 58.860 18.624  1.00 60.62  ? 556 GLU A C     1 
ATOM   2397 O  O     . GLU A 1 302 ? 40.054 58.039 17.777  1.00 61.86  ? 556 GLU A O     1 
ATOM   2398 C  CB    . GLU A 1 302 ? 37.285 58.866 19.525  1.00 63.78  ? 556 GLU A CB    1 
ATOM   2399 C  CG    . GLU A 1 302 ? 36.607 58.236 18.311  1.00 65.17  ? 556 GLU A CG    1 
ATOM   2400 C  CD    . GLU A 1 302 ? 35.293 58.911 18.013  1.00 67.39  ? 556 GLU A CD    1 
ATOM   2401 O  OE1   . GLU A 1 302 ? 34.276 58.385 18.523  1.00 71.84  ? 556 GLU A OE1   1 
ATOM   2402 O  OE2   . GLU A 1 302 ? 35.290 59.991 17.315  1.00 69.52  ? 556 GLU A OE2   1 
ATOM   2403 N  N     . ASP A 1 303 ? 40.035 60.125 18.635  1.00 58.49  ? 557 ASP A N     1 
ATOM   2404 C  CA    . ASP A 1 303 ? 40.823 60.683 17.546  1.00 63.09  ? 557 ASP A CA    1 
ATOM   2405 C  C     . ASP A 1 303 ? 42.150 60.000 17.525  1.00 64.44  ? 557 ASP A C     1 
ATOM   2406 O  O     . ASP A 1 303 ? 42.635 59.688 16.426  1.00 63.35  ? 557 ASP A O     1 
ATOM   2407 C  CB    . ASP A 1 303 ? 40.976 62.214 17.631  1.00 67.44  ? 557 ASP A CB    1 
ATOM   2408 C  CG    . ASP A 1 303 ? 39.749 62.954 17.109  1.00 70.80  ? 557 ASP A CG    1 
ATOM   2409 O  OD1   . ASP A 1 303 ? 39.105 62.397 16.197  1.00 71.42  ? 557 ASP A OD1   1 
ATOM   2410 O  OD2   . ASP A 1 303 ? 39.441 64.072 17.609  1.00 74.29  ? 557 ASP A OD2   1 
ATOM   2411 N  N     . ALA A 1 304 ? 42.698 59.655 18.700  1.00 61.76  ? 558 ALA A N     1 
ATOM   2412 C  CA    . ALA A 1 304 ? 44.038 58.947 18.692  1.00 65.17  ? 558 ALA A CA    1 
ATOM   2413 C  C     . ALA A 1 304 ? 44.027 57.534 18.005  1.00 58.93  ? 558 ALA A C     1 
ATOM   2414 O  O     . ALA A 1 304 ? 44.976 57.131 17.323  1.00 70.17  ? 558 ALA A O     1 
ATOM   2415 C  CB    . ALA A 1 304 ? 44.619 58.856 20.125  1.00 64.35  ? 558 ALA A CB    1 
ATOM   2416 N  N     . HIS A 1 305 ? 42.945 56.798 18.247  1.00 56.15  ? 559 HIS A N     1 
ATOM   2417 C  CA    . HIS A 1 305 ? 42.689 55.499 17.667  1.00 56.64  ? 559 HIS A CA    1 
ATOM   2418 C  C     . HIS A 1 305 ? 42.386 55.577 16.153  1.00 58.61  ? 559 HIS A C     1 
ATOM   2419 O  O     . HIS A 1 305 ? 42.937 54.784 15.375  1.00 60.62  ? 559 HIS A O     1 
ATOM   2420 C  CB    . HIS A 1 305 ? 41.581 54.799 18.479  1.00 59.15  ? 559 HIS A CB    1 
ATOM   2421 C  CG    . HIS A 1 305 ? 41.033 53.557 17.838  1.00 59.34  ? 559 HIS A CG    1 
ATOM   2422 N  ND1   . HIS A 1 305 ? 41.696 52.353 17.852  1.00 58.65  ? 559 HIS A ND1   1 
ATOM   2423 C  CD2   . HIS A 1 305 ? 39.862 53.337 17.193  1.00 57.61  ? 559 HIS A CD2   1 
ATOM   2424 C  CE1   . HIS A 1 305 ? 40.965 51.449 17.223  1.00 55.44  ? 559 HIS A CE1   1 
ATOM   2425 N  NE2   . HIS A 1 305 ? 39.857 52.028 16.803  1.00 55.07  ? 559 HIS A NE2   1 
ATOM   2426 N  N     . LEU A 1 306 ? 41.585 56.552 15.726  1.00 60.45  ? 560 LEU A N     1 
ATOM   2427 C  CA    . LEU A 1 306 ? 41.328 56.774 14.282  1.00 60.31  ? 560 LEU A CA    1 
ATOM   2428 C  C     . LEU A 1 306 ? 42.630 57.157 13.570  1.00 64.53  ? 560 LEU A C     1 
ATOM   2429 O  O     . LEU A 1 306 ? 42.893 56.630 12.507  1.00 63.95  ? 560 LEU A O     1 
ATOM   2430 C  CB    . LEU A 1 306 ? 40.229 57.796 14.052  1.00 58.75  ? 560 LEU A CB    1 
ATOM   2431 C  CG    . LEU A 1 306 ? 38.877 57.384 14.676  1.00 65.82  ? 560 LEU A CG    1 
ATOM   2432 C  CD1   . LEU A 1 306 ? 37.919 58.543 14.694  1.00 65.05  ? 560 LEU A CD1   1 
ATOM   2433 C  CD2   . LEU A 1 306 ? 38.241 56.229 13.923  1.00 68.36  ? 560 LEU A CD2   1 
ATOM   2434 N  N     . ASP A 1 307 ? 43.480 58.004 14.184  1.00 63.65  ? 561 ASP A N     1 
ATOM   2435 C  CA    . ASP A 1 307 ? 44.775 58.373 13.568  1.00 60.14  ? 561 ASP A CA    1 
ATOM   2436 C  C     . ASP A 1 307 ? 45.607 57.129 13.320  1.00 60.09  ? 561 ASP A C     1 
ATOM   2437 O  O     . ASP A 1 307 ? 46.169 56.982 12.250  1.00 58.44  ? 561 ASP A O     1 
ATOM   2438 C  CB    . ASP A 1 307 ? 45.594 59.371 14.433  1.00 64.52  ? 561 ASP A CB    1 
ATOM   2439 C  CG    . ASP A 1 307 ? 44.886 60.735 14.575  1.00 70.05  ? 561 ASP A CG    1 
ATOM   2440 O  OD1   . ASP A 1 307 ? 44.047 61.057 13.684  1.00 63.55  ? 561 ASP A OD1   1 
ATOM   2441 O  OD2   . ASP A 1 307 ? 45.117 61.439 15.590  1.00 76.70  ? 561 ASP A OD2   1 
ATOM   2442 N  N     . ALA A 1 308 ? 45.665 56.230 14.311  1.00 59.71  ? 562 ALA A N     1 
ATOM   2443 C  CA    . ALA A 1 308 ? 46.480 55.036 14.184  1.00 56.18  ? 562 ALA A CA    1 
ATOM   2444 C  C     . ALA A 1 308 ? 45.981 54.132 13.064  1.00 59.87  ? 562 ALA A C     1 
ATOM   2445 O  O     . ALA A 1 308 ? 46.768 53.606 12.267  1.00 60.92  ? 562 ALA A O     1 
ATOM   2446 C  CB    . ALA A 1 308 ? 46.524 54.291 15.493  1.00 60.33  ? 562 ALA A CB    1 
ATOM   2447 N  N     . ILE A 1 309 ? 44.668 53.991 12.941  1.00 60.96  ? 563 ILE A N     1 
ATOM   2448 C  CA    . ILE A 1 309 ? 44.144 53.155 11.894  1.00 58.19  ? 563 ILE A CA    1 
ATOM   2449 C  C     . ILE A 1 309 ? 44.558 53.763 10.543  1.00 60.64  ? 563 ILE A C     1 
ATOM   2450 O  O     . ILE A 1 309 ? 44.969 53.025 9.665   1.00 56.24  ? 563 ILE A O     1 
ATOM   2451 C  CB    . ILE A 1 309 ? 42.623 52.875 12.004  1.00 58.70  ? 563 ILE A CB    1 
ATOM   2452 C  CG1   . ILE A 1 309 ? 42.304 51.978 13.204  1.00 63.36  ? 563 ILE A CG1   1 
ATOM   2453 C  CG2   . ILE A 1 309 ? 42.109 52.095 10.813  1.00 59.34  ? 563 ILE A CG2   1 
ATOM   2454 C  CD1   . ILE A 1 309 ? 40.809 51.982 13.567  1.00 61.25  ? 563 ILE A CD1   1 
ATOM   2455 N  N     . LEU A 1 310 ? 44.463 55.076 10.386  1.00 59.32  ? 564 LEU A N     1 
ATOM   2456 C  CA    . LEU A 1 310 ? 44.776 55.726 9.103   1.00 62.61  ? 564 LEU A CA    1 
ATOM   2457 C  C     . LEU A 1 310 ? 46.258 55.679 8.720   1.00 65.30  ? 564 LEU A C     1 
ATOM   2458 O  O     . LEU A 1 310 ? 46.569 55.722 7.508   1.00 62.09  ? 564 LEU A O     1 
ATOM   2459 C  CB    . LEU A 1 310 ? 44.255 57.179 9.066   1.00 67.53  ? 564 LEU A CB    1 
ATOM   2460 C  CG    . LEU A 1 310 ? 42.697 57.210 9.090   1.00 72.63  ? 564 LEU A CG    1 
ATOM   2461 C  CD1   . LEU A 1 310 ? 42.172 58.490 9.736   1.00 75.25  ? 564 LEU A CD1   1 
ATOM   2462 C  CD2   . LEU A 1 310 ? 42.149 57.065 7.688   1.00 71.87  ? 564 LEU A CD2   1 
ATOM   2463 N  N     . ILE A 1 311 ? 47.175 55.560 9.690   1.00 59.77  ? 565 ILE A N     1 
ATOM   2464 C  CA    . ILE A 1 311 ? 48.580 55.213 9.317   1.00 63.71  ? 565 ILE A CA    1 
ATOM   2465 C  C     . ILE A 1 311 ? 48.669 53.882 8.555   1.00 61.91  ? 565 ILE A C     1 
ATOM   2466 O  O     . ILE A 1 311 ? 49.348 53.778 7.556   1.00 62.33  ? 565 ILE A O     1 
ATOM   2467 C  CB    . ILE A 1 311 ? 49.508 55.219 10.537  1.00 66.57  ? 565 ILE A CB    1 
ATOM   2468 C  CG1   . ILE A 1 311 ? 49.702 56.669 10.990  1.00 66.63  ? 565 ILE A CG1   1 
ATOM   2469 C  CG2   . ILE A 1 311 ? 50.851 54.536 10.236  1.00 65.45  ? 565 ILE A CG2   1 
ATOM   2470 C  CD1   . ILE A 1 311 ? 50.336 56.825 12.352  1.00 68.79  ? 565 ILE A CD1   1 
ATOM   2471 N  N     . LEU A 1 312 ? 47.940 52.868 8.988   1.00 63.36  ? 566 LEU A N     1 
ATOM   2472 C  CA    . LEU A 1 312 ? 47.854 51.642 8.200   1.00 62.21  ? 566 LEU A CA    1 
ATOM   2473 C  C     . LEU A 1 312 ? 47.182 51.895 6.849   1.00 64.62  ? 566 LEU A C     1 
ATOM   2474 O  O     . LEU A 1 312 ? 47.529 51.281 5.842   1.00 60.19  ? 566 LEU A O     1 
ATOM   2475 C  CB    . LEU A 1 312 ? 47.114 50.505 8.902   1.00 59.68  ? 566 LEU A CB    1 
ATOM   2476 C  CG    . LEU A 1 312 ? 47.287 50.172 10.368  1.00 57.44  ? 566 LEU A CG    1 
ATOM   2477 C  CD1   . LEU A 1 312 ? 46.311 49.056 10.771  1.00 57.89  ? 566 LEU A CD1   1 
ATOM   2478 C  CD2   . LEU A 1 312 ? 48.730 49.785 10.550  1.00 66.22  ? 566 LEU A CD2   1 
ATOM   2479 N  N     . GLY A 1 313 ? 46.197 52.767 6.818   1.00 63.91  ? 567 GLY A N     1 
ATOM   2480 C  CA    . GLY A 1 313 ? 45.605 53.167 5.542   1.00 61.93  ? 567 GLY A CA    1 
ATOM   2481 C  C     . GLY A 1 313 ? 46.590 53.828 4.561   1.00 68.72  ? 567 GLY A C     1 
ATOM   2482 O  O     . GLY A 1 313 ? 46.472 53.586 3.366   1.00 75.36  ? 567 GLY A O     1 
ATOM   2483 N  N     . GLU A 1 314 ? 47.536 54.642 5.066   1.00 64.54  ? 568 GLU A N     1 
ATOM   2484 C  CA    . GLU A 1 314 ? 48.544 55.353 4.256   1.00 68.94  ? 568 GLU A CA    1 
ATOM   2485 C  C     . GLU A 1 314 ? 49.301 54.260 3.482   1.00 67.79  ? 568 GLU A C     1 
ATOM   2486 O  O     . GLU A 1 314 ? 49.390 54.345 2.282   1.00 62.88  ? 568 GLU A O     1 
ATOM   2487 C  CB    . GLU A 1 314 ? 49.611 56.080 5.113   1.00 72.71  ? 568 GLU A CB    1 
ATOM   2488 C  CG    . GLU A 1 314 ? 49.609 57.582 5.314   1.00 80.80  ? 568 GLU A CG    1 
ATOM   2489 C  CD    . GLU A 1 314 ? 50.515 57.952 6.504   1.00 87.74  ? 568 GLU A CD    1 
ATOM   2490 O  OE1   . GLU A 1 314 ? 51.770 57.915 6.358   1.00 92.71  ? 568 GLU A OE1   1 
ATOM   2491 O  OE2   . GLU A 1 314 ? 49.971 58.224 7.607   1.00 87.19  ? 568 GLU A OE2   1 
ATOM   2492 N  N     . ALA A 1 315 ? 49.856 53.253 4.180   1.00 60.19  ? 569 ALA A N     1 
ATOM   2493 C  CA    . ALA A 1 315 ? 50.554 52.159 3.496   1.00 60.67  ? 569 ALA A CA    1 
ATOM   2494 C  C     . ALA A 1 315 ? 49.683 51.564 2.367   1.00 65.32  ? 569 ALA A C     1 
ATOM   2495 O  O     . ALA A 1 315 ? 50.175 51.357 1.206   1.00 63.48  ? 569 ALA A O     1 
ATOM   2496 C  CB    . ALA A 1 315 ? 50.986 51.071 4.468   1.00 61.69  ? 569 ALA A CB    1 
ATOM   2497 N  N     . PHE A 1 316 ? 48.411 51.275 2.677   1.00 59.04  ? 570 PHE A N     1 
ATOM   2498 C  CA    . PHE A 1 316 ? 47.593 50.584 1.689   1.00 58.59  ? 570 PHE A CA    1 
ATOM   2499 C  C     . PHE A 1 316 ? 47.079 51.547 0.583   1.00 57.84  ? 570 PHE A C     1 
ATOM   2500 O  O     . PHE A 1 316 ? 46.706 51.064 -0.434  1.00 57.93  ? 570 PHE A O     1 
ATOM   2501 C  CB    . PHE A 1 316 ? 46.432 49.817 2.329   1.00 58.88  ? 570 PHE A CB    1 
ATOM   2502 C  CG    . PHE A 1 316 ? 46.848 48.660 3.185   1.00 59.26  ? 570 PHE A CG    1 
ATOM   2503 C  CD1   . PHE A 1 316 ? 47.714 47.695 2.708   1.00 60.64  ? 570 PHE A CD1   1 
ATOM   2504 C  CD2   . PHE A 1 316 ? 46.366 48.528 4.489   1.00 58.98  ? 570 PHE A CD2   1 
ATOM   2505 C  CE1   . PHE A 1 316 ? 48.096 46.616 3.494   1.00 61.26  ? 570 PHE A CE1   1 
ATOM   2506 C  CE2   . PHE A 1 316 ? 46.761 47.434 5.294   1.00 58.87  ? 570 PHE A CE2   1 
ATOM   2507 C  CZ    . PHE A 1 316 ? 47.612 46.481 4.797   1.00 59.95  ? 570 PHE A CZ    1 
ATOM   2508 N  N     . ALA A 1 317 ? 47.053 52.869 0.817   1.00 61.46  ? 571 ALA A N     1 
ATOM   2509 C  CA    . ALA A 1 317 ? 46.722 53.918 -0.182  1.00 67.56  ? 571 ALA A CA    1 
ATOM   2510 C  C     . ALA A 1 317 ? 47.807 54.278 -1.190  1.00 73.90  ? 571 ALA A C     1 
ATOM   2511 O  O     . ALA A 1 317 ? 47.473 54.774 -2.283  1.00 75.46  ? 571 ALA A O     1 
ATOM   2512 C  CB    . ALA A 1 317 ? 46.372 55.203 0.497   1.00 68.39  ? 571 ALA A CB    1 
ATOM   2513 N  N     . SER A 1 318 ? 49.077 54.089 -0.799  1.00 74.18  ? 572 SER A N     1 
ATOM   2514 C  CA    . SER A 1 318 ? 50.236 54.583 -1.545  1.00 77.86  ? 572 SER A CA    1 
ATOM   2515 C  C     . SER A 1 318 ? 50.871 53.616 -2.558  1.00 76.52  ? 572 SER A C     1 
ATOM   2516 O  O     . SER A 1 318 ? 51.114 52.424 -2.308  1.00 71.81  ? 572 SER A O     1 
ATOM   2517 C  CB    . SER A 1 318 ? 51.333 55.027 -0.575  1.00 76.64  ? 572 SER A CB    1 
ATOM   2518 O  OG    . SER A 1 318 ? 52.409 55.583 -1.326  1.00 79.10  ? 572 SER A OG    1 
ATOM   2519 N  N     . ASP A 1 319 ? 51.250 54.157 -3.693  1.00 81.33  ? 573 ASP A N     1 
ATOM   2520 C  CA    . ASP A 1 319 ? 52.058 53.326 -4.574  1.00 93.63  ? 573 ASP A CA    1 
ATOM   2521 C  C     . ASP A 1 319 ? 53.554 53.476 -4.310  1.00 89.70  ? 573 ASP A C     1 
ATOM   2522 O  O     . ASP A 1 319 ? 54.364 52.690 -4.793  1.00 92.00  ? 573 ASP A O     1 
ATOM   2523 C  CB    . ASP A 1 319 ? 51.665 53.461 -6.038  1.00 101.76 ? 573 ASP A CB    1 
ATOM   2524 C  CG    . ASP A 1 319 ? 51.836 52.140 -6.799  1.00 118.22 ? 573 ASP A CG    1 
ATOM   2525 O  OD1   . ASP A 1 319 ? 51.593 51.026 -6.242  1.00 112.07 ? 573 ASP A OD1   1 
ATOM   2526 O  OD2   . ASP A 1 319 ? 52.244 52.219 -7.978  1.00 143.57 ? 573 ASP A OD2   1 
ATOM   2527 N  N     . GLU A 1 320 ? 53.926 54.407 -3.446  1.00 90.75  ? 574 GLU A N     1 
ATOM   2528 C  CA    . GLU A 1 320 ? 55.330 54.518 -3.082  1.00 90.69  ? 574 GLU A CA    1 
ATOM   2529 C  C     . GLU A 1 320 ? 55.616 53.417 -2.059  1.00 86.01  ? 574 GLU A C     1 
ATOM   2530 O  O     . GLU A 1 320 ? 54.690 52.910 -1.411  1.00 83.35  ? 574 GLU A O     1 
ATOM   2531 C  CB    . GLU A 1 320 ? 55.664 55.927 -2.541  1.00 94.69  ? 574 GLU A CB    1 
ATOM   2532 C  CG    . GLU A 1 320 ? 55.057 57.077 -3.366  1.00 99.42  ? 574 GLU A CG    1 
ATOM   2533 C  CD    . GLU A 1 320 ? 56.086 58.059 -3.882  1.00 106.25 ? 574 GLU A CD    1 
ATOM   2534 O  OE1   . GLU A 1 320 ? 55.985 59.269 -3.561  1.00 112.52 ? 574 GLU A OE1   1 
ATOM   2535 O  OE2   . GLU A 1 320 ? 56.989 57.607 -4.618  1.00 105.68 ? 574 GLU A OE2   1 
ATOM   2536 N  N     . PRO A 1 321 ? 56.887 53.038 -1.912  1.00 78.35  ? 575 PRO A N     1 
ATOM   2537 C  CA    . PRO A 1 321 ? 57.166 52.143 -0.799  1.00 69.35  ? 575 PRO A CA    1 
ATOM   2538 C  C     . PRO A 1 321 ? 57.002 52.845 0.545   1.00 71.16  ? 575 PRO A C     1 
ATOM   2539 O  O     . PRO A 1 321 ? 57.354 53.987 0.685   1.00 76.39  ? 575 PRO A O     1 
ATOM   2540 C  CB    . PRO A 1 321 ? 58.623 51.731 -0.991  1.00 71.17  ? 575 PRO A CB    1 
ATOM   2541 C  CG    . PRO A 1 321 ? 59.068 52.347 -2.302  1.00 76.34  ? 575 PRO A CG    1 
ATOM   2542 C  CD    . PRO A 1 321 ? 58.102 53.458 -2.631  1.00 73.24  ? 575 PRO A CD    1 
ATOM   2543 N  N     . PHE A 1 322 ? 56.465 52.108 1.516   1.00 68.33  ? 576 PHE A N     1 
ATOM   2544 C  CA    . PHE A 1 322 ? 56.215 52.547 2.858   1.00 67.86  ? 576 PHE A CA    1 
ATOM   2545 C  C     . PHE A 1 322 ? 57.398 52.208 3.790   1.00 70.17  ? 576 PHE A C     1 
ATOM   2546 O  O     . PHE A 1 322 ? 57.853 51.046 3.837   1.00 63.34  ? 576 PHE A O     1 
ATOM   2547 C  CB    . PHE A 1 322 ? 54.946 51.818 3.293   1.00 67.23  ? 576 PHE A CB    1 
ATOM   2548 C  CG    . PHE A 1 322 ? 54.349 52.318 4.554   1.00 67.61  ? 576 PHE A CG    1 
ATOM   2549 C  CD1   . PHE A 1 322 ? 53.695 53.557 4.591   1.00 62.61  ? 576 PHE A CD1   1 
ATOM   2550 C  CD2   . PHE A 1 322 ? 54.391 51.519 5.728   1.00 70.13  ? 576 PHE A CD2   1 
ATOM   2551 C  CE1   . PHE A 1 322 ? 53.094 53.986 5.776   1.00 63.30  ? 576 PHE A CE1   1 
ATOM   2552 C  CE2   . PHE A 1 322 ? 53.771 51.947 6.899   1.00 64.29  ? 576 PHE A CE2   1 
ATOM   2553 C  CZ    . PHE A 1 322 ? 53.122 53.170 6.910   1.00 62.17  ? 576 PHE A CZ    1 
ATOM   2554 N  N     . ASP A 1 323 ? 57.926 53.216 4.496   1.00 72.27  ? 577 ASP A N     1 
ATOM   2555 C  CA    . ASP A 1 323 ? 59.073 52.998 5.374   1.00 72.71  ? 577 ASP A CA    1 
ATOM   2556 C  C     . ASP A 1 323 ? 58.472 52.613 6.737   1.00 71.15  ? 577 ASP A C     1 
ATOM   2557 O  O     . ASP A 1 323 ? 58.189 53.480 7.557   1.00 70.58  ? 577 ASP A O     1 
ATOM   2558 C  CB    . ASP A 1 323 ? 60.002 54.247 5.417   1.00 79.29  ? 577 ASP A CB    1 
ATOM   2559 C  CG    . ASP A 1 323 ? 61.401 53.960 6.055   1.00 80.70  ? 577 ASP A CG    1 
ATOM   2560 O  OD1   . ASP A 1 323 ? 62.285 53.381 5.381   1.00 90.45  ? 577 ASP A OD1   1 
ATOM   2561 O  OD2   . ASP A 1 323 ? 61.633 54.359 7.211   1.00 76.14  ? 577 ASP A OD2   1 
ATOM   2562 N  N     . PHE A 1 324 ? 58.248 51.303 6.943   1.00 71.26  ? 578 PHE A N     1 
ATOM   2563 C  CA    . PHE A 1 324 ? 57.701 50.758 8.230   1.00 65.25  ? 578 PHE A CA    1 
ATOM   2564 C  C     . PHE A 1 324 ? 58.538 51.152 9.449   1.00 66.71  ? 578 PHE A C     1 
ATOM   2565 O  O     . PHE A 1 324 ? 57.985 51.357 10.527  1.00 59.80  ? 578 PHE A O     1 
ATOM   2566 C  CB    . PHE A 1 324 ? 57.601 49.213 8.236   1.00 58.85  ? 578 PHE A CB    1 
ATOM   2567 C  CG    . PHE A 1 324 ? 56.606 48.671 7.268   1.00 56.96  ? 578 PHE A CG    1 
ATOM   2568 C  CD1   . PHE A 1 324 ? 55.323 48.419 7.654   1.00 59.23  ? 578 PHE A CD1   1 
ATOM   2569 C  CD2   . PHE A 1 324 ? 56.966 48.414 5.952   1.00 59.23  ? 578 PHE A CD2   1 
ATOM   2570 C  CE1   . PHE A 1 324 ? 54.402 47.906 6.768   1.00 56.79  ? 578 PHE A CE1   1 
ATOM   2571 C  CE2   . PHE A 1 324 ? 56.048 47.947 5.053   1.00 60.79  ? 578 PHE A CE2   1 
ATOM   2572 C  CZ    . PHE A 1 324 ? 54.758 47.662 5.467   1.00 59.65  ? 578 PHE A CZ    1 
ATOM   2573 N  N     . GLY A 1 325 ? 59.868 51.232 9.260   1.00 71.27  ? 579 GLY A N     1 
ATOM   2574 C  CA    . GLY A 1 325 ? 60.840 51.564 10.299  1.00 67.89  ? 579 GLY A CA    1 
ATOM   2575 C  C     . GLY A 1 325 ? 60.677 52.927 10.947  1.00 70.46  ? 579 GLY A C     1 
ATOM   2576 O  O     . GLY A 1 325 ? 61.070 53.076 12.082  1.00 72.11  ? 579 GLY A O     1 
ATOM   2577 N  N     . THR A 1 326 ? 60.124 53.910 10.237  1.00 75.35  ? 580 THR A N     1 
ATOM   2578 C  CA    . THR A 1 326 ? 59.841 55.283 10.780  1.00 81.27  ? 580 THR A CA    1 
ATOM   2579 C  C     . THR A 1 326 ? 58.354 55.764 10.729  1.00 81.73  ? 580 THR A C     1 
ATOM   2580 O  O     . THR A 1 326 ? 57.974 56.693 11.463  1.00 74.55  ? 580 THR A O     1 
ATOM   2581 C  CB    . THR A 1 326 ? 60.653 56.373 10.027  1.00 80.49  ? 580 THR A CB    1 
ATOM   2582 O  OG1   . THR A 1 326 ? 60.070 56.592 8.741   1.00 81.50  ? 580 THR A OG1   1 
ATOM   2583 C  CG2   . THR A 1 326 ? 62.149 55.989 9.844   1.00 83.86  ? 580 THR A CG2   1 
ATOM   2584 N  N     . GLN A 1 327 ? 57.540 55.186 9.832   1.00 79.56  ? 581 GLN A N     1 
ATOM   2585 C  CA    . GLN A 1 327 ? 56.105 55.561 9.736   1.00 80.10  ? 581 GLN A CA    1 
ATOM   2586 C  C     . GLN A 1 327 ? 55.181 54.629 10.595  1.00 78.92  ? 581 GLN A C     1 
ATOM   2587 O  O     . GLN A 1 327 ? 54.085 55.003 10.905  1.00 78.63  ? 581 GLN A O     1 
ATOM   2588 C  CB    . GLN A 1 327 ? 55.645 55.625 8.266   1.00 78.29  ? 581 GLN A CB    1 
ATOM   2589 C  CG    . GLN A 1 327 ? 56.224 56.782 7.424   1.00 84.15  ? 581 GLN A CG    1 
ATOM   2590 C  CD    . GLN A 1 327 ? 55.872 56.659 5.928   1.00 89.53  ? 581 GLN A CD    1 
ATOM   2591 O  OE1   . GLN A 1 327 ? 56.669 56.147 5.082   1.00 84.17  ? 581 GLN A OE1   1 
ATOM   2592 N  NE2   . GLN A 1 327 ? 54.650 57.082 5.596   1.00 87.14  ? 581 GLN A NE2   1 
ATOM   2593 N  N     . SER A 1 328 ? 55.685 53.477 11.036  1.00 76.78  ? 582 SER A N     1 
ATOM   2594 C  CA    . SER A 1 328 ? 54.891 52.394 11.619  1.00 77.16  ? 582 SER A CA    1 
ATOM   2595 C  C     . SER A 1 328 ? 55.473 51.778 12.938  1.00 75.94  ? 582 SER A C     1 
ATOM   2596 O  O     . SER A 1 328 ? 55.300 50.555 13.214  1.00 80.73  ? 582 SER A O     1 
ATOM   2597 C  CB    . SER A 1 328 ? 54.805 51.302 10.544  1.00 76.17  ? 582 SER A CB    1 
ATOM   2598 O  OG    . SER A 1 328 ? 53.599 50.686 10.600  1.00 74.80  ? 582 SER A OG    1 
ATOM   2599 N  N     . THR A 1 329 ? 56.182 52.589 13.736  1.00 78.32  ? 583 THR A N     1 
ATOM   2600 C  CA    . THR A 1 329 ? 56.723 52.134 15.044  1.00 73.86  ? 583 THR A CA    1 
ATOM   2601 C  C     . THR A 1 329 ? 55.606 52.006 16.050  1.00 72.57  ? 583 THR A C     1 
ATOM   2602 O  O     . THR A 1 329 ? 54.532 52.635 15.882  1.00 70.35  ? 583 THR A O     1 
ATOM   2603 C  CB    . THR A 1 329 ? 57.642 53.169 15.659  1.00 72.57  ? 583 THR A CB    1 
ATOM   2604 O  OG1   . THR A 1 329 ? 57.010 54.452 15.556  1.00 72.75  ? 583 THR A OG1   1 
ATOM   2605 C  CG2   . THR A 1 329 ? 58.971 53.188 14.951  1.00 72.25  ? 583 THR A CG2   1 
ATOM   2606 N  N     . THR A 1 330 ? 55.882 51.251 17.119  1.00 74.70  ? 584 THR A N     1 
ATOM   2607 C  CA    . THR A 1 330 ? 54.963 51.153 18.269  1.00 74.49  ? 584 THR A CA    1 
ATOM   2608 C  C     . THR A 1 330 ? 54.438 52.533 18.669  1.00 70.85  ? 584 THR A C     1 
ATOM   2609 O  O     . THR A 1 330 ? 53.237 52.704 18.896  1.00 76.61  ? 584 THR A O     1 
ATOM   2610 C  CB    . THR A 1 330 ? 55.590 50.460 19.508  1.00 75.77  ? 584 THR A CB    1 
ATOM   2611 O  OG1   . THR A 1 330 ? 56.820 51.101 19.842  1.00 76.33  ? 584 THR A OG1   1 
ATOM   2612 C  CG2   . THR A 1 330 ? 55.880 49.007 19.237  1.00 76.00  ? 584 THR A CG2   1 
ATOM   2613 N  N     . GLU A 1 331 ? 55.328 53.521 18.681  1.00 76.29  ? 585 GLU A N     1 
ATOM   2614 C  CA    . GLU A 1 331 ? 54.973 54.907 18.981  1.00 77.00  ? 585 GLU A CA    1 
ATOM   2615 C  C     . GLU A 1 331 ? 53.918 55.404 17.980  1.00 75.56  ? 585 GLU A C     1 
ATOM   2616 O  O     . GLU A 1 331 ? 52.861 55.901 18.377  1.00 69.34  ? 585 GLU A O     1 
ATOM   2617 C  CB    . GLU A 1 331 ? 56.226 55.816 18.986  1.00 90.45  ? 585 GLU A CB    1 
ATOM   2618 C  CG    . GLU A 1 331 ? 56.122 57.012 19.935  1.00 99.53  ? 585 GLU A CG    1 
ATOM   2619 C  CD    . GLU A 1 331 ? 56.695 58.318 19.397  1.00 102.59 ? 585 GLU A CD    1 
ATOM   2620 O  OE1   . GLU A 1 331 ? 57.685 58.300 18.632  1.00 104.19 ? 585 GLU A OE1   1 
ATOM   2621 O  OE2   . GLU A 1 331 ? 56.141 59.379 19.775  1.00 110.57 ? 585 GLU A OE2   1 
ATOM   2622 N  N     . LYS A 1 332 ? 54.170 55.231 16.690  1.00 73.76  ? 586 LYS A N     1 
ATOM   2623 C  CA    . LYS A 1 332 ? 53.168 55.648 15.696  1.00 79.43  ? 586 LYS A CA    1 
ATOM   2624 C  C     . LYS A 1 332 ? 51.753 55.003 15.818  1.00 71.51  ? 586 LYS A C     1 
ATOM   2625 O  O     . LYS A 1 332 ? 50.784 55.669 15.515  1.00 63.02  ? 586 LYS A O     1 
ATOM   2626 C  CB    . LYS A 1 332 ? 53.695 55.397 14.279  1.00 84.72  ? 586 LYS A CB    1 
ATOM   2627 C  CG    . LYS A 1 332 ? 54.851 56.290 13.894  1.00 88.64  ? 586 LYS A CG    1 
ATOM   2628 C  CD    . LYS A 1 332 ? 54.416 57.720 13.605  1.00 83.99  ? 586 LYS A CD    1 
ATOM   2629 C  CE    . LYS A 1 332 ? 55.619 58.469 13.041  1.00 81.37  ? 586 LYS A CE    1 
ATOM   2630 N  NZ    . LYS A 1 332 ? 55.678 59.791 13.682  1.00 86.35  ? 586 LYS A NZ    1 
ATOM   2631 N  N     . ILE A 1 333 ? 51.676 53.724 16.229  1.00 69.74  ? 587 ILE A N     1 
ATOM   2632 C  CA    . ILE A 1 333 ? 50.470 52.895 16.076  1.00 69.14  ? 587 ILE A CA    1 
ATOM   2633 C  C     . ILE A 1 333 ? 49.945 52.164 17.322  1.00 69.13  ? 587 ILE A C     1 
ATOM   2634 O  O     . ILE A 1 333 ? 49.078 51.315 17.198  1.00 74.46  ? 587 ILE A O     1 
ATOM   2635 C  CB    . ILE A 1 333 ? 50.633 51.795 14.971  1.00 64.79  ? 587 ILE A CB    1 
ATOM   2636 C  CG1   . ILE A 1 333 ? 51.551 50.684 15.361  1.00 64.13  ? 587 ILE A CG1   1 
ATOM   2637 C  CG2   . ILE A 1 333 ? 51.070 52.355 13.634  1.00 67.22  ? 587 ILE A CG2   1 
ATOM   2638 C  CD1   . ILE A 1 333 ? 51.586 49.567 14.321  1.00 63.70  ? 587 ILE A CD1   1 
ATOM   2639 N  N     . HIS A 1 334 ? 50.458 52.453 18.512  1.00 71.74  ? 588 HIS A N     1 
ATOM   2640 C  CA    . HIS A 1 334 ? 50.002 51.725 19.686  1.00 73.50  ? 588 HIS A CA    1 
ATOM   2641 C  C     . HIS A 1 334 ? 48.523 52.022 19.996  1.00 73.25  ? 588 HIS A C     1 
ATOM   2642 O  O     . HIS A 1 334 ? 47.816 51.138 20.562  1.00 73.10  ? 588 HIS A O     1 
ATOM   2643 C  CB    . HIS A 1 334 ? 50.871 52.010 20.925  1.00 76.44  ? 588 HIS A CB    1 
ATOM   2644 C  CG    . HIS A 1 334 ? 50.578 53.331 21.591  1.00 83.06  ? 588 HIS A CG    1 
ATOM   2645 N  ND1   . HIS A 1 334 ? 51.184 54.515 21.206  1.00 80.42  ? 588 HIS A ND1   1 
ATOM   2646 C  CD2   . HIS A 1 334 ? 49.733 53.648 22.602  1.00 84.24  ? 588 HIS A CD2   1 
ATOM   2647 C  CE1   . HIS A 1 334 ? 50.736 55.498 21.961  1.00 83.48  ? 588 HIS A CE1   1 
ATOM   2648 N  NE2   . HIS A 1 334 ? 49.860 54.999 22.821  1.00 86.29  ? 588 HIS A NE2   1 
ATOM   2649 N  N     . ASN A 1 335 ? 48.057 53.226 19.615  1.00 63.83  ? 589 ASN A N     1 
ATOM   2650 C  CA    . ASN A 1 335 ? 46.622 53.560 19.686  1.00 66.34  ? 589 ASN A CA    1 
ATOM   2651 C  C     . ASN A 1 335 ? 45.640 52.727 18.831  1.00 69.87  ? 589 ASN A C     1 
ATOM   2652 O  O     . ASN A 1 335 ? 44.408 52.904 18.990  1.00 70.34  ? 589 ASN A O     1 
ATOM   2653 C  CB    . ASN A 1 335 ? 46.378 55.077 19.518  1.00 67.39  ? 589 ASN A CB    1 
ATOM   2654 C  CG    . ASN A 1 335 ? 46.873 55.875 20.727  1.00 71.85  ? 589 ASN A CG    1 
ATOM   2655 O  OD1   . ASN A 1 335 ? 46.648 55.454 21.890  1.00 68.77  ? 589 ASN A OD1   1 
ATOM   2656 N  ND2   . ASN A 1 335 ? 47.563 57.012 20.473  1.00 66.20  ? 589 ASN A ND2   1 
ATOM   2657 N  N     . LEU A 1 336 ? 46.122 51.822 17.959  1.00 60.21  ? 590 LEU A N     1 
ATOM   2658 C  CA    . LEU A 1 336 ? 45.237 50.766 17.469  1.00 64.12  ? 590 LEU A CA    1 
ATOM   2659 C  C     . LEU A 1 336 ? 44.424 50.103 18.602  1.00 65.12  ? 590 LEU A C     1 
ATOM   2660 O  O     . LEU A 1 336 ? 43.286 49.685 18.398  1.00 66.42  ? 590 LEU A O     1 
ATOM   2661 C  CB    . LEU A 1 336 ? 46.010 49.661 16.769  1.00 66.68  ? 590 LEU A CB    1 
ATOM   2662 C  CG    . LEU A 1 336 ? 46.296 49.853 15.296  1.00 68.78  ? 590 LEU A CG    1 
ATOM   2663 C  CD1   . LEU A 1 336 ? 46.938 48.580 14.774  1.00 69.59  ? 590 LEU A CD1   1 
ATOM   2664 C  CD2   . LEU A 1 336 ? 45.044 50.210 14.520  1.00 71.87  ? 590 LEU A CD2   1 
ATOM   2665 N  N     . ILE A 1 337 ? 45.068 49.917 19.746  1.00 61.95  ? 591 ILE A N     1 
ATOM   2666 C  CA    . ILE A 1 337 ? 44.443 49.313 20.893  1.00 67.08  ? 591 ILE A CA    1 
ATOM   2667 C  C     . ILE A 1 337 ? 44.569 50.295 22.083  1.00 65.95  ? 591 ILE A C     1 
ATOM   2668 O  O     . ILE A 1 337 ? 45.543 50.294 22.834  1.00 71.05  ? 591 ILE A O     1 
ATOM   2669 C  CB    . ILE A 1 337 ? 45.084 47.981 21.312  1.00 71.60  ? 591 ILE A CB    1 
ATOM   2670 C  CG1   . ILE A 1 337 ? 45.377 47.030 20.150  1.00 74.54  ? 591 ILE A CG1   1 
ATOM   2671 C  CG2   . ILE A 1 337 ? 44.224 47.350 22.414  1.00 77.42  ? 591 ILE A CG2   1 
ATOM   2672 C  CD1   . ILE A 1 337 ? 44.197 46.431 19.488  1.00 75.54  ? 591 ILE A CD1   1 
ATOM   2673 N  N     . PRO A 1 338 ? 43.628 51.180 22.236  1.00 62.21  ? 592 PRO A N     1 
ATOM   2674 C  CA    . PRO A 1 338 ? 43.676 51.942 23.467  1.00 68.74  ? 592 PRO A CA    1 
ATOM   2675 C  C     . PRO A 1 338 ? 43.375 50.961 24.592  1.00 77.62  ? 592 PRO A C     1 
ATOM   2676 O  O     . PRO A 1 338 ? 42.365 50.218 24.507  1.00 72.39  ? 592 PRO A O     1 
ATOM   2677 C  CB    . PRO A 1 338 ? 42.568 52.970 23.276  1.00 73.78  ? 592 PRO A CB    1 
ATOM   2678 C  CG    . PRO A 1 338 ? 42.309 52.982 21.771  1.00 70.19  ? 592 PRO A CG    1 
ATOM   2679 C  CD    . PRO A 1 338 ? 42.502 51.555 21.393  1.00 67.64  ? 592 PRO A CD    1 
ATOM   2680 N  N     . VAL A 1 339 ? 44.278 50.866 25.575  1.00 88.45  ? 593 VAL A N     1 
ATOM   2681 C  CA    . VAL A 1 339 ? 44.142 49.808 26.601  1.00 99.98  ? 593 VAL A CA    1 
ATOM   2682 C  C     . VAL A 1 339 ? 43.083 50.203 27.653  1.00 99.00  ? 593 VAL A C     1 
ATOM   2683 O  O     . VAL A 1 339 ? 42.581 49.328 28.337  1.00 95.16  ? 593 VAL A O     1 
ATOM   2684 C  CB    . VAL A 1 339 ? 45.509 49.338 27.212  1.00 107.22 ? 593 VAL A CB    1 
ATOM   2685 C  CG1   . VAL A 1 339 ? 45.929 50.187 28.431  1.00 103.53 ? 593 VAL A CG1   1 
ATOM   2686 C  CG2   . VAL A 1 339 ? 45.465 47.835 27.533  1.00 99.23  ? 593 VAL A CG2   1 
HETATM 2687 N  N     . MSE A 1 340 ? 42.715 51.496 27.729  1.00 103.75 ? 594 MSE A N     1 
HETATM 2688 C  CA    . MSE A 1 340 ? 41.513 51.925 28.468  1.00 107.87 ? 594 MSE A CA    1 
HETATM 2689 C  C     . MSE A 1 340 ? 40.316 51.719 27.561  1.00 109.82 ? 594 MSE A C     1 
HETATM 2690 O  O     . MSE A 1 340 ? 39.836 52.671 26.924  1.00 110.26 ? 594 MSE A O     1 
HETATM 2691 C  CB    . MSE A 1 340 ? 41.605 53.362 29.023  1.00 118.97 ? 594 MSE A CB    1 
HETATM 2692 C  CG    . MSE A 1 340 ? 42.395 53.514 30.361  1.00 128.79 ? 594 MSE A CG    1 
HETATM 2693 SE SE    . MSE A 1 340 ? 42.338 52.026 31.720  1.00 142.01 ? 594 MSE A SE    1 
HETATM 2694 C  CE    . MSE A 1 340 ? 44.256 51.564 31.650  1.00 131.83 ? 594 MSE A CE    1 
ATOM   2695 N  N     . LEU A 1 341 ? 39.864 50.450 27.501  1.00 93.03  ? 595 LEU A N     1 
ATOM   2696 C  CA    . LEU A 1 341 ? 38.635 49.998 26.779  1.00 82.31  ? 595 LEU A CA    1 
ATOM   2697 C  C     . LEU A 1 341 ? 38.162 48.668 27.384  1.00 75.64  ? 595 LEU A C     1 
ATOM   2698 O  O     . LEU A 1 341 ? 36.950 48.460 27.646  1.00 69.97  ? 595 LEU A O     1 
ATOM   2699 C  CB    . LEU A 1 341 ? 38.794 49.832 25.229  1.00 80.22  ? 595 LEU A CB    1 
ATOM   2700 C  CG    . LEU A 1 341 ? 38.845 50.956 24.173  1.00 80.75  ? 595 LEU A CG    1 
ATOM   2701 C  CD1   . LEU A 1 341 ? 38.593 50.357 22.799  1.00 80.70  ? 595 LEU A CD1   1 
ATOM   2702 C  CD2   . LEU A 1 341 ? 37.851 52.078 24.364  1.00 83.79  ? 595 LEU A CD2   1 
ATOM   2703 N  N     . ARG A 1 342 ? 39.099 47.766 27.632  1.00 70.87  ? 596 ARG A N     1 
ATOM   2704 C  CA    . ARG A 1 342 ? 38.817 46.545 28.414  1.00 83.61  ? 596 ARG A CA    1 
ATOM   2705 C  C     . ARG A 1 342 ? 38.125 46.857 29.773  1.00 85.66  ? 596 ARG A C     1 
ATOM   2706 O  O     . ARG A 1 342 ? 37.556 45.929 30.370  1.00 86.89  ? 596 ARG A O     1 
ATOM   2707 C  CB    . ARG A 1 342 ? 40.091 45.676 28.689  1.00 94.72  ? 596 ARG A CB    1 
ATOM   2708 C  CG    . ARG A 1 342 ? 41.180 45.642 27.615  1.00 103.03 ? 596 ARG A CG    1 
ATOM   2709 C  CD    . ARG A 1 342 ? 42.478 44.910 28.000  1.00 113.98 ? 596 ARG A CD    1 
ATOM   2710 N  NE    . ARG A 1 342 ? 42.962 44.030 26.903  1.00 105.54 ? 596 ARG A NE    1 
ATOM   2711 C  CZ    . ARG A 1 342 ? 42.300 42.954 26.457  1.00 96.76  ? 596 ARG A CZ    1 
ATOM   2712 N  NH1   . ARG A 1 342 ? 41.114 42.613 27.001  1.00 79.63  ? 596 ARG A NH1   1 
ATOM   2713 N  NH2   . ARG A 1 342 ? 42.813 42.219 25.455  1.00 93.40  ? 596 ARG A NH2   1 
ATOM   2714 N  N     . HIS A 1 343 ? 38.212 48.109 30.262  1.00 76.12  ? 597 HIS A N     1 
ATOM   2715 C  CA    . HIS A 1 343 ? 37.656 48.525 31.555  1.00 87.49  ? 597 HIS A CA    1 
ATOM   2716 C  C     . HIS A 1 343 ? 36.517 49.463 31.232  1.00 90.56  ? 597 HIS A C     1 
ATOM   2717 O  O     . HIS A 1 343 ? 36.668 50.695 31.275  1.00 101.22 ? 597 HIS A O     1 
ATOM   2718 C  CB    . HIS A 1 343 ? 38.723 49.237 32.421  1.00 90.36  ? 597 HIS A CB    1 
ATOM   2719 C  CG    . HIS A 1 343 ? 39.961 48.417 32.641  1.00 104.62 ? 597 HIS A CG    1 
ATOM   2720 N  ND1   . HIS A 1 343 ? 41.137 48.644 31.953  1.00 110.67 ? 597 HIS A ND1   1 
ATOM   2721 C  CD2   . HIS A 1 343 ? 40.187 47.331 33.420  1.00 113.20 ? 597 HIS A CD2   1 
ATOM   2722 C  CE1   . HIS A 1 343 ? 42.035 47.740 32.303  1.00 115.28 ? 597 HIS A CE1   1 
ATOM   2723 N  NE2   . HIS A 1 343 ? 41.485 46.935 33.195  1.00 116.33 ? 597 HIS A NE2   1 
ATOM   2724 N  N     . ARG A 1 344 ? 35.398 48.876 30.833  1.00 78.37  ? 598 ARG A N     1 
ATOM   2725 C  CA    . ARG A 1 344 ? 34.171 49.641 30.569  1.00 77.04  ? 598 ARG A CA    1 
ATOM   2726 C  C     . ARG A 1 344 ? 33.030 48.671 30.782  1.00 72.53  ? 598 ARG A C     1 
ATOM   2727 O  O     . ARG A 1 344 ? 33.247 47.479 30.756  1.00 66.45  ? 598 ARG A O     1 
ATOM   2728 C  CB    . ARG A 1 344 ? 34.147 50.348 29.163  1.00 70.30  ? 598 ARG A CB    1 
ATOM   2729 C  CG    . ARG A 1 344 ? 33.730 49.472 27.976  1.00 68.31  ? 598 ARG A CG    1 
ATOM   2730 C  CD    . ARG A 1 344 ? 33.743 50.187 26.619  1.00 62.27  ? 598 ARG A CD    1 
ATOM   2731 N  NE    . ARG A 1 344 ? 33.340 49.245 25.560  1.00 53.76  ? 598 ARG A NE    1 
ATOM   2732 C  CZ    . ARG A 1 344 ? 33.734 49.289 24.293  1.00 55.10  ? 598 ARG A CZ    1 
ATOM   2733 N  NH1   . ARG A 1 344 ? 34.586 50.220 23.851  1.00 63.52  ? 598 ARG A NH1   1 
ATOM   2734 N  NH2   . ARG A 1 344 ? 33.307 48.371 23.432  1.00 53.56  ? 598 ARG A NH2   1 
ATOM   2735 N  N     . LEU A 1 345 ? 31.820 49.176 31.003  1.00 78.31  ? 599 LEU A N     1 
ATOM   2736 C  CA    . LEU A 1 345 ? 30.683 48.278 31.298  1.00 82.68  ? 599 LEU A CA    1 
ATOM   2737 C  C     . LEU A 1 345 ? 30.663 47.028 30.406  1.00 77.54  ? 599 LEU A C     1 
ATOM   2738 O  O     . LEU A 1 345 ? 30.549 45.886 30.920  1.00 71.72  ? 599 LEU A O     1 
ATOM   2739 C  CB    . LEU A 1 345 ? 29.319 49.005 31.184  1.00 83.42  ? 599 LEU A CB    1 
ATOM   2740 C  CG    . LEU A 1 345 ? 28.110 48.209 31.735  1.00 83.39  ? 599 LEU A CG    1 
ATOM   2741 C  CD1   . LEU A 1 345 ? 28.268 47.971 33.232  1.00 81.02  ? 599 LEU A CD1   1 
ATOM   2742 C  CD2   . LEU A 1 345 ? 26.779 48.882 31.466  1.00 80.57  ? 599 LEU A CD2   1 
ATOM   2743 N  N     . VAL A 1 346 ? 30.771 47.260 29.088  1.00 72.50  ? 600 VAL A N     1 
ATOM   2744 C  CA    . VAL A 1 346 ? 30.696 46.196 28.087  1.00 67.30  ? 600 VAL A CA    1 
ATOM   2745 C  C     . VAL A 1 346 ? 31.914 46.246 27.184  1.00 68.55  ? 600 VAL A C     1 
ATOM   2746 O  O     . VAL A 1 346 ? 31.940 46.965 26.171  1.00 57.50  ? 600 VAL A O     1 
ATOM   2747 C  CB    . VAL A 1 346 ? 29.397 46.274 27.289  1.00 71.76  ? 600 VAL A CB    1 
ATOM   2748 C  CG1   . VAL A 1 346 ? 29.390 45.323 26.083  1.00 70.03  ? 600 VAL A CG1   1 
ATOM   2749 C  CG2   . VAL A 1 346 ? 28.248 45.933 28.228  1.00 76.87  ? 600 VAL A CG2   1 
ATOM   2750 N  N     . PRO A 1 347 ? 32.936 45.450 27.523  1.00 69.51  ? 601 PRO A N     1 
ATOM   2751 C  CA    . PRO A 1 347 ? 34.145 45.604 26.776  1.00 68.77  ? 601 PRO A CA    1 
ATOM   2752 C  C     . PRO A 1 347 ? 34.017 45.074 25.332  1.00 60.76  ? 601 PRO A C     1 
ATOM   2753 O  O     . PRO A 1 347 ? 33.105 44.321 25.058  1.00 61.13  ? 601 PRO A O     1 
ATOM   2754 C  CB    . PRO A 1 347 ? 35.178 44.807 27.597  1.00 69.65  ? 601 PRO A CB    1 
ATOM   2755 C  CG    . PRO A 1 347 ? 34.409 43.939 28.506  1.00 70.10  ? 601 PRO A CG    1 
ATOM   2756 C  CD    . PRO A 1 347 ? 32.952 44.202 28.298  1.00 74.44  ? 601 PRO A CD    1 
ATOM   2757 N  N     . PRO A 1 348 ? 34.932 45.503 24.441  1.00 59.13  ? 602 PRO A N     1 
ATOM   2758 C  CA    . PRO A 1 348 ? 35.020 45.047 23.039  1.00 62.11  ? 602 PRO A CA    1 
ATOM   2759 C  C     . PRO A 1 348 ? 35.022 43.528 23.011  1.00 57.33  ? 602 PRO A C     1 
ATOM   2760 O  O     . PRO A 1 348 ? 35.650 42.948 23.883  1.00 59.84  ? 602 PRO A O     1 
ATOM   2761 C  CB    . PRO A 1 348 ? 36.371 45.595 22.560  1.00 63.30  ? 602 PRO A CB    1 
ATOM   2762 C  CG    . PRO A 1 348 ? 36.765 46.686 23.519  1.00 61.20  ? 602 PRO A CG    1 
ATOM   2763 C  CD    . PRO A 1 348 ? 35.988 46.488 24.786  1.00 58.56  ? 602 PRO A CD    1 
ATOM   2764 N  N     . PRO A 1 349 ? 34.241 42.900 22.113  1.00 52.87  ? 603 PRO A N     1 
ATOM   2765 C  CA    . PRO A 1 349 ? 34.366 41.438 21.836  1.00 57.69  ? 603 PRO A CA    1 
ATOM   2766 C  C     . PRO A 1 349 ? 35.863 41.136 21.578  1.00 62.19  ? 603 PRO A C     1 
ATOM   2767 O  O     . PRO A 1 349 ? 36.575 41.932 20.860  1.00 57.41  ? 603 PRO A O     1 
ATOM   2768 C  CB    . PRO A 1 349 ? 33.609 41.254 20.508  1.00 57.04  ? 603 PRO A CB    1 
ATOM   2769 C  CG    . PRO A 1 349 ? 32.741 42.499 20.340  1.00 55.05  ? 603 PRO A CG    1 
ATOM   2770 C  CD    . PRO A 1 349 ? 33.476 43.611 21.068  1.00 53.10  ? 603 PRO A CD    1 
ATOM   2771 N  N     . GLU A 1 350 ? 36.387 40.072 22.179  1.00 60.48  ? 604 GLU A N     1 
ATOM   2772 C  CA    . GLU A 1 350 ? 37.850 39.759 21.994  1.00 65.33  ? 604 GLU A CA    1 
ATOM   2773 C  C     . GLU A 1 350 ? 38.288 39.563 20.530  1.00 62.04  ? 604 GLU A C     1 
ATOM   2774 O  O     . GLU A 1 350 ? 39.418 39.838 20.202  1.00 65.48  ? 604 GLU A O     1 
ATOM   2775 C  CB    . GLU A 1 350 ? 38.361 38.594 22.920  1.00 68.45  ? 604 GLU A CB    1 
ATOM   2776 C  CG    . GLU A 1 350 ? 38.555 39.008 24.415  1.00 76.49  ? 604 GLU A CG    1 
ATOM   2777 C  CD    . GLU A 1 350 ? 39.720 40.056 24.728  1.00 84.65  ? 604 GLU A CD    1 
ATOM   2778 O  OE1   . GLU A 1 350 ? 40.889 39.850 24.239  1.00 72.74  ? 604 GLU A OE1   1 
ATOM   2779 O  OE2   . GLU A 1 350 ? 39.467 41.082 25.492  1.00 75.56  ? 604 GLU A OE2   1 
ATOM   2780 N  N     . GLU A 1 351 ? 37.385 39.170 19.653  1.00 57.22  ? 605 GLU A N     1 
ATOM   2781 C  CA    . GLU A 1 351 ? 37.694 39.064 18.255  1.00 66.62  ? 605 GLU A CA    1 
ATOM   2782 C  C     . GLU A 1 351 ? 38.217 40.408 17.665  1.00 63.71  ? 605 GLU A C     1 
ATOM   2783 O  O     . GLU A 1 351 ? 39.137 40.419 16.843  1.00 60.01  ? 605 GLU A O     1 
ATOM   2784 C  CB    . GLU A 1 351 ? 36.479 38.532 17.452  1.00 68.22  ? 605 GLU A CB    1 
ATOM   2785 C  CG    . GLU A 1 351 ? 36.023 37.136 17.916  1.00 69.91  ? 605 GLU A CG    1 
ATOM   2786 C  CD    . GLU A 1 351 ? 34.910 37.165 18.951  1.00 69.99  ? 605 GLU A CD    1 
ATOM   2787 O  OE1   . GLU A 1 351 ? 34.969 37.995 19.881  1.00 69.47  ? 605 GLU A OE1   1 
ATOM   2788 O  OE2   . GLU A 1 351 ? 33.956 36.383 18.797  1.00 75.84  ? 605 GLU A OE2   1 
ATOM   2789 N  N     . THR A 1 352 ? 37.711 41.519 18.171  1.00 57.82  ? 606 THR A N     1 
ATOM   2790 C  CA    . THR A 1 352 ? 38.109 42.801 17.656  1.00 53.56  ? 606 THR A CA    1 
ATOM   2791 C  C     . THR A 1 352 ? 39.535 43.108 17.986  1.00 50.99  ? 606 THR A C     1 
ATOM   2792 O  O     . THR A 1 352 ? 40.302 43.528 17.119  1.00 54.62  ? 606 THR A O     1 
ATOM   2793 C  CB    . THR A 1 352 ? 37.094 43.946 17.980  1.00 48.46  ? 606 THR A CB    1 
ATOM   2794 O  OG1   . THR A 1 352 ? 37.019 44.260 19.363  1.00 51.98  ? 606 THR A OG1   1 
ATOM   2795 C  CG2   . THR A 1 352 ? 35.777 43.561 17.465  1.00 49.99  ? 606 THR A CG2   1 
ATOM   2796 N  N     . TYR A 1 353 ? 39.881 42.868 19.228  1.00 54.32  ? 607 TYR A N     1 
ATOM   2797 C  CA    . TYR A 1 353 ? 41.229 42.978 19.720  1.00 56.01  ? 607 TYR A CA    1 
ATOM   2798 C  C     . TYR A 1 353 ? 42.216 42.178 18.897  1.00 55.87  ? 607 TYR A C     1 
ATOM   2799 O  O     . TYR A 1 353 ? 43.239 42.699 18.394  1.00 59.13  ? 607 TYR A O     1 
ATOM   2800 C  CB    . TYR A 1 353 ? 41.258 42.472 21.180  1.00 60.15  ? 607 TYR A CB    1 
ATOM   2801 C  CG    . TYR A 1 353 ? 40.942 43.542 22.176  1.00 57.86  ? 607 TYR A CG    1 
ATOM   2802 C  CD1   . TYR A 1 353 ? 41.809 44.610 22.372  1.00 68.07  ? 607 TYR A CD1   1 
ATOM   2803 C  CD2   . TYR A 1 353 ? 39.843 43.448 23.000  1.00 63.33  ? 607 TYR A CD2   1 
ATOM   2804 C  CE1   . TYR A 1 353 ? 41.528 45.593 23.319  1.00 71.50  ? 607 TYR A CE1   1 
ATOM   2805 C  CE2   . TYR A 1 353 ? 39.546 44.444 23.949  1.00 64.15  ? 607 TYR A CE2   1 
ATOM   2806 C  CZ    . TYR A 1 353 ? 40.381 45.516 24.093  1.00 68.68  ? 607 TYR A CZ    1 
ATOM   2807 O  OH    . TYR A 1 353 ? 40.126 46.518 25.036  1.00 71.22  ? 607 TYR A OH    1 
ATOM   2808 N  N     . SER A 1 354 ? 41.909 40.910 18.721  1.00 57.52  ? 608 SER A N     1 
ATOM   2809 C  CA    . SER A 1 354 ? 42.690 40.107 17.785  1.00 57.39  ? 608 SER A CA    1 
ATOM   2810 C  C     . SER A 1 354 ? 42.965 40.704 16.438  1.00 56.67  ? 608 SER A C     1 
ATOM   2811 O  O     . SER A 1 354 ? 44.067 40.619 15.933  1.00 55.36  ? 608 SER A O     1 
ATOM   2812 C  CB    . SER A 1 354 ? 41.984 38.796 17.500  1.00 60.69  ? 608 SER A CB    1 
ATOM   2813 O  OG    . SER A 1 354 ? 42.097 37.975 18.588  1.00 58.79  ? 608 SER A OG    1 
ATOM   2814 N  N     . LEU A 1 355 ? 41.927 41.238 15.800  1.00 58.70  ? 609 LEU A N     1 
ATOM   2815 C  CA    . LEU A 1 355 ? 42.092 41.634 14.407  1.00 55.28  ? 609 LEU A CA    1 
ATOM   2816 C  C     . LEU A 1 355 ? 43.010 42.825 14.314  1.00 51.98  ? 609 LEU A C     1 
ATOM   2817 O  O     . LEU A 1 355 ? 43.909 42.847 13.478  1.00 51.14  ? 609 LEU A O     1 
ATOM   2818 C  CB    . LEU A 1 355 ? 40.742 41.925 13.810  1.00 59.73  ? 609 LEU A CB    1 
ATOM   2819 C  CG    . LEU A 1 355 ? 39.831 40.714 13.645  1.00 58.55  ? 609 LEU A CG    1 
ATOM   2820 C  CD1   . LEU A 1 355 ? 38.511 41.219 13.077  1.00 60.35  ? 609 LEU A CD1   1 
ATOM   2821 C  CD2   . LEU A 1 355 ? 40.397 39.717 12.678  1.00 60.79  ? 609 LEU A CD2   1 
ATOM   2822 N  N     . HIS A 1 356 ? 42.824 43.790 15.227  1.00 53.64  ? 610 HIS A N     1 
ATOM   2823 C  CA    . HIS A 1 356 ? 43.764 44.893 15.346  1.00 50.90  ? 610 HIS A CA    1 
ATOM   2824 C  C     . HIS A 1 356 ? 45.156 44.482 15.756  1.00 52.95  ? 610 HIS A C     1 
ATOM   2825 O  O     . HIS A 1 356 ? 46.118 45.092 15.252  1.00 53.57  ? 610 HIS A O     1 
ATOM   2826 C  CB    . HIS A 1 356 ? 43.275 45.991 16.272  1.00 49.25  ? 610 HIS A CB    1 
ATOM   2827 C  CG    . HIS A 1 356 ? 42.194 46.865 15.680  1.00 52.69  ? 610 HIS A CG    1 
ATOM   2828 N  ND1   . HIS A 1 356 ? 42.306 47.481 14.453  1.00 54.93  ? 610 HIS A ND1   1 
ATOM   2829 C  CD2   . HIS A 1 356 ? 41.011 47.270 16.184  1.00 54.69  ? 610 HIS A CD2   1 
ATOM   2830 C  CE1   . HIS A 1 356 ? 41.234 48.210 14.228  1.00 53.66  ? 610 HIS A CE1   1 
ATOM   2831 N  NE2   . HIS A 1 356 ? 40.430 48.095 15.253  1.00 51.75  ? 610 HIS A NE2   1 
ATOM   2832 N  N     . LYS A 1 357 ? 45.289 43.512 16.678  1.00 57.44  ? 611 LYS A N     1 
ATOM   2833 C  CA    . LYS A 1 357 ? 46.619 43.038 17.111  1.00 60.28  ? 611 LYS A CA    1 
ATOM   2834 C  C     . LYS A 1 357 ? 47.232 42.299 15.926  1.00 55.38  ? 611 LYS A C     1 
ATOM   2835 O  O     . LYS A 1 357 ? 48.439 42.418 15.668  1.00 56.86  ? 611 LYS A O     1 
ATOM   2836 C  CB    . LYS A 1 357 ? 46.596 42.059 18.281  1.00 69.43  ? 611 LYS A CB    1 
ATOM   2837 C  CG    . LYS A 1 357 ? 46.220 42.635 19.634  1.00 90.94  ? 611 LYS A CG    1 
ATOM   2838 C  CD    . LYS A 1 357 ? 45.675 41.543 20.603  1.00 102.11 ? 611 LYS A CD    1 
ATOM   2839 C  CE    . LYS A 1 357 ? 44.810 42.088 21.762  1.00 103.47 ? 611 LYS A CE    1 
ATOM   2840 N  NZ    . LYS A 1 357 ? 45.510 42.706 22.941  1.00 103.68 ? 611 LYS A NZ    1 
ATOM   2841 N  N     . LYS A 1 358 ? 46.436 41.557 15.169  1.00 50.90  ? 612 LYS A N     1 
ATOM   2842 C  CA    . LYS A 1 358 ? 47.041 40.809 14.046  1.00 50.95  ? 612 LYS A CA    1 
ATOM   2843 C  C     . LYS A 1 358 ? 47.658 41.769 13.016  1.00 54.40  ? 612 LYS A C     1 
ATOM   2844 O  O     . LYS A 1 358 ? 48.829 41.567 12.586  1.00 60.65  ? 612 LYS A O     1 
ATOM   2845 C  CB    . LYS A 1 358 ? 46.035 39.880 13.377  1.00 51.45  ? 612 LYS A CB    1 
ATOM   2846 C  CG    . LYS A 1 358 ? 46.565 39.266 12.073  1.00 50.01  ? 612 LYS A CG    1 
ATOM   2847 C  CD    . LYS A 1 358 ? 47.464 38.092 12.393  1.00 49.82  ? 612 LYS A CD    1 
ATOM   2848 C  CE    . LYS A 1 358 ? 48.140 37.488 11.232  1.00 53.28  ? 612 LYS A CE    1 
ATOM   2849 N  NZ    . LYS A 1 358 ? 48.994 36.354 11.645  1.00 59.48  ? 612 LYS A NZ    1 
HETATM 2850 N  N     . MSE A 1 359 ? 46.898 42.792 12.605  1.00 54.31  ? 613 MSE A N     1 
HETATM 2851 C  CA    . MSE A 1 359 ? 47.370 43.751 11.559  1.00 51.31  ? 613 MSE A CA    1 
HETATM 2852 C  C     . MSE A 1 359 ? 48.464 44.592 12.126  1.00 58.38  ? 613 MSE A C     1 
HETATM 2853 O  O     . MSE A 1 359 ? 49.541 44.735 11.503  1.00 59.94  ? 613 MSE A O     1 
HETATM 2854 C  CB    . MSE A 1 359 ? 46.269 44.720 11.105  1.00 52.09  ? 613 MSE A CB    1 
HETATM 2855 C  CG    . MSE A 1 359 ? 46.550 45.643 9.903   1.00 54.19  ? 613 MSE A CG    1 
HETATM 2856 SE SE    . MSE A 1 359 ? 46.742 44.507 8.259   1.00 63.86  ? 613 MSE A SE    1 
HETATM 2857 C  CE    . MSE A 1 359 ? 44.933 44.917 7.769   1.00 55.88  ? 613 MSE A CE    1 
ATOM   2858 N  N     . GLY A 1 360 ? 48.254 45.117 13.343  1.00 52.93  ? 614 GLY A N     1 
ATOM   2859 C  CA    . GLY A 1 360 ? 49.272 45.977 13.982  1.00 52.08  ? 614 GLY A CA    1 
ATOM   2860 C  C     . GLY A 1 360 ? 50.587 45.311 14.223  1.00 48.98  ? 614 GLY A C     1 
ATOM   2861 O  O     . GLY A 1 360 ? 51.702 45.834 13.908  1.00 54.20  ? 614 GLY A O     1 
ATOM   2862 N  N     . GLY A 1 361 ? 50.457 44.102 14.673  1.00 49.85  ? 615 GLY A N     1 
ATOM   2863 C  CA    . GLY A 1 361 ? 51.615 43.308 14.963  1.00 50.67  ? 615 GLY A CA    1 
ATOM   2864 C  C     . GLY A 1 361 ? 52.407 42.987 13.745  1.00 52.94  ? 615 GLY A C     1 
ATOM   2865 O  O     . GLY A 1 361 ? 53.633 42.908 13.844  1.00 55.62  ? 615 GLY A O     1 
ATOM   2866 N  N     . SER A 1 362 ? 51.731 42.774 12.595  1.00 53.33  ? 616 SER A N     1 
ATOM   2867 C  CA    . SER A 1 362 ? 52.439 42.422 11.370  1.00 51.16  ? 616 SER A CA    1 
ATOM   2868 C  C     . SER A 1 362 ? 53.163 43.671 10.897  1.00 57.19  ? 616 SER A C     1 
ATOM   2869 O  O     . SER A 1 362 ? 54.348 43.579 10.500  1.00 54.58  ? 616 SER A O     1 
ATOM   2870 C  CB    . SER A 1 362 ? 51.510 41.924 10.276  1.00 52.97  ? 616 SER A CB    1 
ATOM   2871 O  OG    . SER A 1 362 ? 50.924 40.753 10.713  1.00 50.59  ? 616 SER A OG    1 
ATOM   2872 N  N     . PHE A 1 363 ? 52.483 44.821 11.022  1.00 52.23  ? 617 PHE A N     1 
ATOM   2873 C  CA    . PHE A 1 363 ? 53.133 46.068 10.759  1.00 60.01  ? 617 PHE A CA    1 
ATOM   2874 C  C     . PHE A 1 363 ? 54.408 46.251 11.611  1.00 59.87  ? 617 PHE A C     1 
ATOM   2875 O  O     . PHE A 1 363 ? 55.359 46.781 11.105  1.00 57.96  ? 617 PHE A O     1 
ATOM   2876 C  CB    . PHE A 1 363 ? 52.172 47.294 10.907  1.00 56.80  ? 617 PHE A CB    1 
ATOM   2877 C  CG    . PHE A 1 363 ? 51.413 47.620 9.644   1.00 57.54  ? 617 PHE A CG    1 
ATOM   2878 C  CD1   . PHE A 1 363 ? 50.511 46.718 9.115   1.00 51.81  ? 617 PHE A CD1   1 
ATOM   2879 C  CD2   . PHE A 1 363 ? 51.630 48.822 8.950   1.00 56.51  ? 617 PHE A CD2   1 
ATOM   2880 C  CE1   . PHE A 1 363 ? 49.796 47.003 7.977   1.00 54.12  ? 617 PHE A CE1   1 
ATOM   2881 C  CE2   . PHE A 1 363 ? 50.934 49.107 7.816   1.00 53.51  ? 617 PHE A CE2   1 
ATOM   2882 C  CZ    . PHE A 1 363 ? 50.012 48.190 7.323   1.00 55.67  ? 617 PHE A CZ    1 
ATOM   2883 N  N     . LEU A 1 364 ? 54.396 45.848 12.885  1.00 58.02  ? 618 LEU A N     1 
ATOM   2884 C  CA    . LEU A 1 364 ? 55.566 45.985 13.769  1.00 59.38  ? 618 LEU A CA    1 
ATOM   2885 C  C     . LEU A 1 364 ? 56.761 45.144 13.437  1.00 59.20  ? 618 LEU A C     1 
ATOM   2886 O  O     . LEU A 1 364 ? 57.901 45.563 13.635  1.00 65.63  ? 618 LEU A O     1 
ATOM   2887 C  CB    . LEU A 1 364 ? 55.193 45.650 15.218  1.00 61.18  ? 618 LEU A CB    1 
ATOM   2888 C  CG    . LEU A 1 364 ? 54.224 46.605 15.858  1.00 67.84  ? 618 LEU A CG    1 
ATOM   2889 C  CD1   . LEU A 1 364 ? 54.146 46.323 17.372  1.00 71.76  ? 618 LEU A CD1   1 
ATOM   2890 C  CD2   . LEU A 1 364 ? 54.586 48.060 15.560  1.00 69.70  ? 618 LEU A CD2   1 
ATOM   2891 N  N     . ILE A 1 365 ? 56.506 43.927 13.000  1.00 61.12  ? 619 ILE A N     1 
ATOM   2892 C  CA    . ILE A 1 365 ? 57.576 43.052 12.545  1.00 59.30  ? 619 ILE A CA    1 
ATOM   2893 C  C     . ILE A 1 365 ? 58.262 43.724 11.376  1.00 58.14  ? 619 ILE A C     1 
ATOM   2894 O  O     . ILE A 1 365 ? 59.472 43.656 11.275  1.00 62.36  ? 619 ILE A O     1 
ATOM   2895 C  CB    . ILE A 1 365 ? 57.027 41.704 12.137  1.00 57.80  ? 619 ILE A CB    1 
ATOM   2896 C  CG1   . ILE A 1 365 ? 56.390 41.052 13.374  1.00 58.15  ? 619 ILE A CG1   1 
ATOM   2897 C  CG2   . ILE A 1 365 ? 58.122 40.845 11.467  1.00 55.56  ? 619 ILE A CG2   1 
ATOM   2898 C  CD1   . ILE A 1 365 ? 55.732 39.716 13.071  1.00 65.16  ? 619 ILE A CD1   1 
ATOM   2899 N  N     . CYS A 1 366 ? 57.510 44.422 10.526  1.00 57.82  ? 620 CYS A N     1 
ATOM   2900 C  CA    . CYS A 1 366 ? 58.122 45.072 9.355   1.00 57.92  ? 620 CYS A CA    1 
ATOM   2901 C  C     . CYS A 1 366 ? 58.934 46.312 9.806   1.00 59.54  ? 620 CYS A C     1 
ATOM   2902 O  O     . CYS A 1 366 ? 59.968 46.611 9.215   1.00 57.49  ? 620 CYS A O     1 
ATOM   2903 C  CB    . CYS A 1 366 ? 57.103 45.437 8.279   1.00 57.59  ? 620 CYS A CB    1 
ATOM   2904 S  SG    . CYS A 1 366 ? 56.102 44.079 7.553   1.00 61.12  ? 620 CYS A SG    1 
ATOM   2905 N  N     . SER A 1 367 ? 58.467 46.980 10.859  1.00 60.67  ? 621 SER A N     1 
ATOM   2906 C  CA    . SER A 1 367 ? 59.120 48.143 11.455  1.00 63.85  ? 621 SER A CA    1 
ATOM   2907 C  C     . SER A 1 367 ? 60.376 47.646 12.100  1.00 62.95  ? 621 SER A C     1 
ATOM   2908 O  O     . SER A 1 367 ? 61.437 48.102 11.741  1.00 62.27  ? 621 SER A O     1 
ATOM   2909 C  CB    . SER A 1 367 ? 58.223 48.875 12.470  1.00 63.81  ? 621 SER A CB    1 
ATOM   2910 O  OG    . SER A 1 367 ? 58.750 50.180 12.797  1.00 69.51  ? 621 SER A OG    1 
ATOM   2911 N  N     . LYS A 1 368 ? 60.262 46.666 12.988  1.00 67.04  ? 622 LYS A N     1 
ATOM   2912 C  CA    . LYS A 1 368 ? 61.454 46.021 13.618  1.00 68.70  ? 622 LYS A CA    1 
ATOM   2913 C  C     . LYS A 1 368 ? 62.565 45.642 12.619  1.00 70.95  ? 622 LYS A C     1 
ATOM   2914 O  O     . LYS A 1 368 ? 63.729 45.909 12.871  1.00 76.09  ? 622 LYS A O     1 
ATOM   2915 C  CB    . LYS A 1 368 ? 61.059 44.810 14.492  1.00 63.57  ? 622 LYS A CB    1 
ATOM   2916 C  CG    . LYS A 1 368 ? 60.436 45.235 15.818  1.00 71.87  ? 622 LYS A CG    1 
ATOM   2917 C  CD    . LYS A 1 368 ? 59.860 44.074 16.621  1.00 79.18  ? 622 LYS A CD    1 
ATOM   2918 C  CE    . LYS A 1 368 ? 59.653 44.527 18.056  1.00 87.75  ? 622 LYS A CE    1 
ATOM   2919 N  NZ    . LYS A 1 368 ? 58.622 43.738 18.775  1.00 89.65  ? 622 LYS A NZ    1 
ATOM   2920 N  N     . LEU A 1 369 ? 62.212 45.044 11.490  1.00 66.09  ? 623 LEU A N     1 
ATOM   2921 C  CA    . LEU A 1 369 ? 63.206 44.572 10.541  1.00 62.34  ? 623 LEU A CA    1 
ATOM   2922 C  C     . LEU A 1 369 ? 63.610 45.617 9.489   1.00 71.29  ? 623 LEU A C     1 
ATOM   2923 O  O     . LEU A 1 369 ? 64.399 45.297 8.556   1.00 71.66  ? 623 LEU A O     1 
ATOM   2924 C  CB    . LEU A 1 369 ? 62.684 43.336 9.847   1.00 63.76  ? 623 LEU A CB    1 
ATOM   2925 C  CG    . LEU A 1 369 ? 62.797 42.106 10.709  1.00 68.31  ? 623 LEU A CG    1 
ATOM   2926 C  CD1   . LEU A 1 369 ? 61.978 40.981 10.097  1.00 68.68  ? 623 LEU A CD1   1 
ATOM   2927 C  CD2   . LEU A 1 369 ? 64.263 41.676 10.899  1.00 65.21  ? 623 LEU A CD2   1 
ATOM   2928 N  N     . LYS A 1 370 ? 63.058 46.831 9.613   1.00 67.63  ? 624 LYS A N     1 
ATOM   2929 C  CA    . LYS A 1 370 ? 63.402 47.975 8.788   1.00 75.38  ? 624 LYS A CA    1 
ATOM   2930 C  C     . LYS A 1 370 ? 63.108 47.795 7.329   1.00 73.74  ? 624 LYS A C     1 
ATOM   2931 O  O     . LYS A 1 370 ? 63.840 48.287 6.443   1.00 71.39  ? 624 LYS A O     1 
ATOM   2932 C  CB    . LYS A 1 370 ? 64.856 48.406 9.062   1.00 82.62  ? 624 LYS A CB    1 
ATOM   2933 C  CG    . LYS A 1 370 ? 64.904 49.492 10.116  1.00 88.00  ? 624 LYS A CG    1 
ATOM   2934 C  CD    . LYS A 1 370 ? 66.057 49.340 11.095  1.00 95.90  ? 624 LYS A CD    1 
ATOM   2935 C  CE    . LYS A 1 370 ? 65.710 50.020 12.416  1.00 99.90  ? 624 LYS A CE    1 
ATOM   2936 N  NZ    . LYS A 1 370 ? 66.921 50.678 12.933  1.00 104.28 ? 624 LYS A NZ    1 
ATOM   2937 N  N     . ALA A 1 371 ? 61.984 47.133 7.076   1.00 73.31  ? 625 ALA A N     1 
ATOM   2938 C  CA    . ALA A 1 371 ? 61.583 46.801 5.717   1.00 72.50  ? 625 ALA A CA    1 
ATOM   2939 C  C     . ALA A 1 371 ? 60.996 47.999 4.975   1.00 64.35  ? 625 ALA A C     1 
ATOM   2940 O  O     . ALA A 1 371 ? 60.495 48.918 5.571   1.00 65.84  ? 625 ALA A O     1 
ATOM   2941 C  CB    . ALA A 1 371 ? 60.602 45.631 5.716   1.00 73.08  ? 625 ALA A CB    1 
ATOM   2942 N  N     . ARG A 1 372 ? 61.017 47.924 3.669   1.00 64.29  ? 626 ARG A N     1 
ATOM   2943 C  CA    . ARG A 1 372 ? 60.520 48.988 2.836   1.00 78.47  ? 626 ARG A CA    1 
ATOM   2944 C  C     . ARG A 1 372 ? 60.008 48.413 1.495   1.00 78.94  ? 626 ARG A C     1 
ATOM   2945 O  O     . ARG A 1 372 ? 60.774 47.866 0.706   1.00 81.98  ? 626 ARG A O     1 
ATOM   2946 C  CB    . ARG A 1 372 ? 61.621 50.043 2.657   1.00 84.15  ? 626 ARG A CB    1 
ATOM   2947 C  CG    . ARG A 1 372 ? 61.233 51.296 1.904   1.00 90.00  ? 626 ARG A CG    1 
ATOM   2948 C  CD    . ARG A 1 372 ? 62.365 52.350 1.983   1.00 98.91  ? 626 ARG A CD    1 
ATOM   2949 N  NE    . ARG A 1 372 ? 62.042 53.494 1.119   1.00 98.12  ? 626 ARG A NE    1 
ATOM   2950 C  CZ    . ARG A 1 372 ? 62.115 53.492 -0.219  1.00 99.17  ? 626 ARG A CZ    1 
ATOM   2951 N  NH1   . ARG A 1 372 ? 62.544 52.412 -0.894  1.00 97.34  ? 626 ARG A NH1   1 
ATOM   2952 N  NH2   . ARG A 1 372 ? 61.721 54.573 -0.897  1.00 98.06  ? 626 ARG A NH2   1 
ATOM   2953 N  N     . PHE A 1 373 ? 58.686 48.497 1.303   1.00 76.89  ? 627 PHE A N     1 
ATOM   2954 C  CA    . PHE A 1 373 ? 58.019 47.960 0.128   1.00 68.39  ? 627 PHE A CA    1 
ATOM   2955 C  C     . PHE A 1 373 ? 56.625 48.552 -0.071  1.00 66.29  ? 627 PHE A C     1 
ATOM   2956 O  O     . PHE A 1 373 ? 56.070 49.029 0.849   1.00 60.69  ? 627 PHE A O     1 
ATOM   2957 C  CB    . PHE A 1 373 ? 57.916 46.456 0.215   1.00 65.80  ? 627 PHE A CB    1 
ATOM   2958 C  CG    . PHE A 1 373 ? 57.214 45.915 1.436   1.00 65.03  ? 627 PHE A CG    1 
ATOM   2959 C  CD1   . PHE A 1 373 ? 55.842 45.822 1.480   1.00 59.03  ? 627 PHE A CD1   1 
ATOM   2960 C  CD2   . PHE A 1 373 ? 57.938 45.339 2.442   1.00 66.27  ? 627 PHE A CD2   1 
ATOM   2961 C  CE1   . PHE A 1 373 ? 55.214 45.222 2.502   1.00 56.46  ? 627 PHE A CE1   1 
ATOM   2962 C  CE2   . PHE A 1 373 ? 57.311 44.744 3.534   1.00 64.89  ? 627 PHE A CE2   1 
ATOM   2963 C  CZ    . PHE A 1 373 ? 55.933 44.718 3.571   1.00 64.74  ? 627 PHE A CZ    1 
ATOM   2964 N  N     . PRO A 1 374 ? 56.079 48.541 -1.302  1.00 71.45  ? 628 PRO A N     1 
ATOM   2965 C  CA    . PRO A 1 374 ? 54.735 49.103 -1.525  1.00 67.54  ? 628 PRO A CA    1 
ATOM   2966 C  C     . PRO A 1 374 ? 53.662 48.155 -1.058  1.00 65.10  ? 628 PRO A C     1 
ATOM   2967 O  O     . PRO A 1 374 ? 53.807 46.954 -1.263  1.00 72.36  ? 628 PRO A O     1 
ATOM   2968 C  CB    . PRO A 1 374 ? 54.661 49.239 -3.068  1.00 69.47  ? 628 PRO A CB    1 
ATOM   2969 C  CG    . PRO A 1 374 ? 56.059 49.089 -3.582  1.00 67.80  ? 628 PRO A CG    1 
ATOM   2970 C  CD    . PRO A 1 374 ? 56.731 48.187 -2.590  1.00 70.69  ? 628 PRO A CD    1 
ATOM   2971 N  N     . CYS A 1 375 ? 52.576 48.679 -0.503  1.00 61.19  ? 629 CYS A N     1 
ATOM   2972 C  CA    . CYS A 1 375 ? 51.477 47.850 0.066   1.00 59.85  ? 629 CYS A CA    1 
ATOM   2973 C  C     . CYS A 1 375 ? 50.140 47.955 -0.679  1.00 59.19  ? 629 CYS A C     1 
ATOM   2974 O  O     . CYS A 1 375 ? 49.192 47.176 -0.442  1.00 59.13  ? 629 CYS A O     1 
ATOM   2975 C  CB    . CYS A 1 375 ? 51.295 48.200 1.507   1.00 57.51  ? 629 CYS A CB    1 
ATOM   2976 S  SG    . CYS A 1 375 ? 52.788 47.903 2.452   1.00 64.80  ? 629 CYS A SG    1 
ATOM   2977 N  N     . LYS A 1 376 ? 50.059 48.842 -1.650  1.00 57.53  ? 630 LYS A N     1 
ATOM   2978 C  CA    . LYS A 1 376 ? 48.765 49.057 -2.335  1.00 56.30  ? 630 LYS A CA    1 
ATOM   2979 C  C     . LYS A 1 376 ? 48.262 47.867 -3.099  1.00 57.66  ? 630 LYS A C     1 
ATOM   2980 O  O     . LYS A 1 376 ? 47.064 47.485 -2.999  1.00 62.85  ? 630 LYS A O     1 
ATOM   2981 C  CB    . LYS A 1 376 ? 48.837 50.223 -3.273  1.00 56.04  ? 630 LYS A CB    1 
ATOM   2982 C  CG    . LYS A 1 376 ? 47.519 50.537 -3.910  1.00 60.51  ? 630 LYS A CG    1 
ATOM   2983 C  CD    . LYS A 1 376 ? 47.684 51.721 -4.860  1.00 68.59  ? 630 LYS A CD    1 
ATOM   2984 C  CE    . LYS A 1 376 ? 46.309 52.336 -5.140  1.00 78.35  ? 630 LYS A CE    1 
ATOM   2985 N  NZ    . LYS A 1 376 ? 45.990 52.645 -6.560  1.00 86.45  ? 630 LYS A NZ    1 
ATOM   2986 N  N     . ALA A 1 377 ? 49.138 47.286 -3.890  1.00 57.79  ? 631 ALA A N     1 
ATOM   2987 C  CA    . ALA A 1 377 ? 48.707 46.202 -4.770  1.00 59.80  ? 631 ALA A CA    1 
ATOM   2988 C  C     . ALA A 1 377 ? 48.305 44.981 -3.960  1.00 61.92  ? 631 ALA A C     1 
ATOM   2989 O  O     . ALA A 1 377 ? 47.331 44.338 -4.301  1.00 59.95  ? 631 ALA A O     1 
ATOM   2990 C  CB    . ALA A 1 377 ? 49.797 45.829 -5.732  1.00 59.13  ? 631 ALA A CB    1 
HETATM 2991 N  N     . MSE A 1 378 ? 49.044 44.658 -2.888  1.00 61.70  ? 632 MSE A N     1 
HETATM 2992 C  CA    . MSE A 1 378 ? 48.631 43.522 -2.026  1.00 59.81  ? 632 MSE A CA    1 
HETATM 2993 C  C     . MSE A 1 378 ? 47.220 43.764 -1.502  1.00 59.67  ? 632 MSE A C     1 
HETATM 2994 O  O     . MSE A 1 378 ? 46.359 42.901 -1.637  1.00 57.47  ? 632 MSE A O     1 
HETATM 2995 C  CB    . MSE A 1 378 ? 49.565 43.162 -0.881  1.00 55.52  ? 632 MSE A CB    1 
HETATM 2996 C  CG    . MSE A 1 378 ? 49.906 44.307 0.086   1.00 56.79  ? 632 MSE A CG    1 
HETATM 2997 SE SE    . MSE A 1 378 ? 51.000 43.431 1.471   1.00 58.68  ? 632 MSE A SE    1 
HETATM 2998 C  CE    . MSE A 1 378 ? 52.706 43.323 0.499   1.00 61.73  ? 632 MSE A CE    1 
ATOM   2999 N  N     . PHE A 1 379 ? 46.942 44.958 -0.972  1.00 59.61  ? 633 PHE A N     1 
ATOM   3000 C  CA    . PHE A 1 379 ? 45.610 45.216 -0.438  1.00 57.81  ? 633 PHE A CA    1 
ATOM   3001 C  C     . PHE A 1 379 ? 44.512 45.228 -1.514  1.00 58.97  ? 633 PHE A C     1 
ATOM   3002 O  O     . PHE A 1 379 ? 43.485 44.601 -1.336  1.00 59.41  ? 633 PHE A O     1 
ATOM   3003 C  CB    . PHE A 1 379 ? 45.521 46.503 0.378   1.00 59.33  ? 633 PHE A CB    1 
ATOM   3004 C  CG    . PHE A 1 379 ? 44.156 46.702 0.945   1.00 55.49  ? 633 PHE A CG    1 
ATOM   3005 C  CD1   . PHE A 1 379 ? 43.686 45.825 1.904   1.00 58.54  ? 633 PHE A CD1   1 
ATOM   3006 C  CD2   . PHE A 1 379 ? 43.329 47.626 0.440   1.00 54.35  ? 633 PHE A CD2   1 
ATOM   3007 C  CE1   . PHE A 1 379 ? 42.423 45.931 2.420   1.00 61.89  ? 633 PHE A CE1   1 
ATOM   3008 C  CE2   . PHE A 1 379 ? 42.047 47.743 0.921   1.00 61.08  ? 633 PHE A CE2   1 
ATOM   3009 C  CZ    . PHE A 1 379 ? 41.579 46.878 1.900   1.00 60.80  ? 633 PHE A CZ    1 
ATOM   3010 N  N     . GLU A 1 380 ? 44.720 45.904 -2.635  1.00 60.99  ? 634 GLU A N     1 
ATOM   3011 C  CA    . GLU A 1 380 ? 43.700 45.879 -3.723  1.00 64.51  ? 634 GLU A CA    1 
ATOM   3012 C  C     . GLU A 1 380 ? 43.394 44.441 -4.235  1.00 65.82  ? 634 GLU A C     1 
ATOM   3013 O  O     . GLU A 1 380 ? 42.212 44.067 -4.409  1.00 65.23  ? 634 GLU A O     1 
ATOM   3014 C  CB    . GLU A 1 380 ? 44.080 46.830 -4.881  1.00 64.90  ? 634 GLU A CB    1 
ATOM   3015 C  CG    . GLU A 1 380 ? 44.137 48.343 -4.512  1.00 65.08  ? 634 GLU A CG    1 
ATOM   3016 C  CD    . GLU A 1 380 ? 42.811 48.950 -4.120  1.00 68.11  ? 634 GLU A CD    1 
ATOM   3017 O  OE1   . GLU A 1 380 ? 41.735 48.450 -4.551  1.00 74.54  ? 634 GLU A OE1   1 
ATOM   3018 O  OE2   . GLU A 1 380 ? 42.832 49.905 -3.330  1.00 70.55  ? 634 GLU A OE2   1 
ATOM   3019 N  N     . GLU A 1 381 ? 44.445 43.626 -4.402  1.00 66.88  ? 635 GLU A N     1 
ATOM   3020 C  CA    . GLU A 1 381 ? 44.289 42.183 -4.682  1.00 69.33  ? 635 GLU A CA    1 
ATOM   3021 C  C     . GLU A 1 381 ? 43.425 41.493 -3.599  1.00 66.16  ? 635 GLU A C     1 
ATOM   3022 O  O     . GLU A 1 381 ? 42.448 40.809 -3.924  1.00 64.97  ? 635 GLU A O     1 
ATOM   3023 C  CB    . GLU A 1 381 ? 45.651 41.477 -4.807  1.00 72.49  ? 635 GLU A CB    1 
ATOM   3024 C  CG    . GLU A 1 381 ? 45.605 39.914 -4.762  1.00 84.39  ? 635 GLU A CG    1 
ATOM   3025 C  CD    . GLU A 1 381 ? 45.942 39.189 -6.072  1.00 91.04  ? 635 GLU A CD    1 
ATOM   3026 O  OE1   . GLU A 1 381 ? 46.992 38.488 -6.109  1.00 97.12  ? 635 GLU A OE1   1 
ATOM   3027 O  OE2   . GLU A 1 381 ? 45.171 39.323 -7.057  1.00 98.01  ? 635 GLU A OE2   1 
ATOM   3028 N  N     . ALA A 1 382 ? 43.796 41.631 -2.327  1.00 62.30  ? 636 ALA A N     1 
ATOM   3029 C  CA    . ALA A 1 382 ? 42.994 40.955 -1.269  1.00 64.79  ? 636 ALA A CA    1 
ATOM   3030 C  C     . ALA A 1 382 ? 41.535 41.435 -1.236  1.00 60.56  ? 636 ALA A C     1 
ATOM   3031 O  O     . ALA A 1 382 ? 40.604 40.622 -1.132  1.00 66.69  ? 636 ALA A O     1 
ATOM   3032 C  CB    . ALA A 1 382 ? 43.637 41.118 0.090   1.00 58.93  ? 636 ALA A CB    1 
ATOM   3033 N  N     . TYR A 1 383 ? 41.331 42.738 -1.356  1.00 58.95  ? 637 TYR A N     1 
ATOM   3034 C  CA    . TYR A 1 383 ? 39.989 43.292 -1.353  1.00 61.37  ? 637 TYR A CA    1 
ATOM   3035 C  C     . TYR A 1 383 ? 39.218 42.777 -2.574  1.00 66.40  ? 637 TYR A C     1 
ATOM   3036 O  O     . TYR A 1 383 ? 38.058 42.432 -2.488  1.00 68.57  ? 637 TYR A O     1 
ATOM   3037 C  CB    . TYR A 1 383 ? 40.034 44.803 -1.392  1.00 65.09  ? 637 TYR A CB    1 
ATOM   3038 C  CG    . TYR A 1 383 ? 38.678 45.438 -1.251  1.00 62.13  ? 637 TYR A CG    1 
ATOM   3039 C  CD1   . TYR A 1 383 ? 38.046 45.424 -0.022  1.00 65.50  ? 637 TYR A CD1   1 
ATOM   3040 C  CD2   . TYR A 1 383 ? 38.048 46.102 -2.317  1.00 61.38  ? 637 TYR A CD2   1 
ATOM   3041 C  CE1   . TYR A 1 383 ? 36.803 46.005 0.155   1.00 64.38  ? 637 TYR A CE1   1 
ATOM   3042 C  CE2   . TYR A 1 383 ? 36.779 46.678 -2.160  1.00 60.60  ? 637 TYR A CE2   1 
ATOM   3043 C  CZ    . TYR A 1 383 ? 36.177 46.601 -0.914  1.00 61.66  ? 637 TYR A CZ    1 
ATOM   3044 O  OH    . TYR A 1 383 ? 34.984 47.104 -0.612  1.00 69.15  ? 637 TYR A OH    1 
ATOM   3045 N  N     . SER A 1 384 ? 39.862 42.712 -3.712  1.00 67.71  ? 638 SER A N     1 
ATOM   3046 C  CA    . SER A 1 384 ? 39.143 42.226 -4.928  1.00 73.93  ? 638 SER A CA    1 
ATOM   3047 C  C     . SER A 1 384 ? 38.729 40.743 -4.837  1.00 72.45  ? 638 SER A C     1 
ATOM   3048 O  O     . SER A 1 384 ? 37.583 40.385 -5.205  1.00 62.93  ? 638 SER A O     1 
ATOM   3049 C  CB    . SER A 1 384 ? 39.974 42.480 -6.180  1.00 71.04  ? 638 SER A CB    1 
ATOM   3050 O  OG    . SER A 1 384 ? 39.533 41.643 -7.211  1.00 87.75  ? 638 SER A OG    1 
ATOM   3051 N  N     . ASN A 1 385 ? 39.621 39.876 -4.335  1.00 67.04  ? 639 ASN A N     1 
ATOM   3052 C  CA    . ASN A 1 385 ? 39.240 38.444 -4.211  1.00 69.13  ? 639 ASN A CA    1 
ATOM   3053 C  C     . ASN A 1 385 ? 38.229 38.155 -3.137  1.00 75.37  ? 639 ASN A C     1 
ATOM   3054 O  O     . ASN A 1 385 ? 37.417 37.234 -3.270  1.00 77.29  ? 639 ASN A O     1 
ATOM   3055 C  CB    . ASN A 1 385 ? 40.429 37.512 -4.035  1.00 72.59  ? 639 ASN A CB    1 
ATOM   3056 C  CG    . ASN A 1 385 ? 41.446 37.664 -5.151  1.00 74.01  ? 639 ASN A CG    1 
ATOM   3057 O  OD1   . ASN A 1 385 ? 41.124 38.096 -6.264  1.00 80.80  ? 639 ASN A OD1   1 
ATOM   3058 N  ND2   . ASN A 1 385 ? 42.678 37.383 -4.838  1.00 70.55  ? 639 ASN A ND2   1 
ATOM   3059 N  N     . TYR A 1 386 ? 38.258 38.936 -2.066  1.00 75.44  ? 640 TYR A N     1 
ATOM   3060 C  CA    . TYR A 1 386 ? 37.189 38.863 -1.077  1.00 67.36  ? 640 TYR A CA    1 
ATOM   3061 C  C     . TYR A 1 386 ? 35.799 39.205 -1.720  1.00 65.80  ? 640 TYR A C     1 
ATOM   3062 O  O     . TYR A 1 386 ? 34.794 38.584 -1.387  1.00 64.54  ? 640 TYR A O     1 
ATOM   3063 C  CB    . TYR A 1 386 ? 37.528 39.812 0.104   1.00 64.34  ? 640 TYR A CB    1 
ATOM   3064 C  CG    . TYR A 1 386 ? 36.426 39.891 1.148   1.00 65.36  ? 640 TYR A CG    1 
ATOM   3065 C  CD1   . TYR A 1 386 ? 36.381 38.988 2.221   1.00 66.00  ? 640 TYR A CD1   1 
ATOM   3066 C  CD2   . TYR A 1 386 ? 35.444 40.858 1.057   1.00 64.78  ? 640 TYR A CD2   1 
ATOM   3067 C  CE1   . TYR A 1 386 ? 35.385 39.038 3.127   1.00 64.43  ? 640 TYR A CE1   1 
ATOM   3068 C  CE2   . TYR A 1 386 ? 34.460 40.951 1.994   1.00 64.36  ? 640 TYR A CE2   1 
ATOM   3069 C  CZ    . TYR A 1 386 ? 34.428 40.024 3.000   1.00 67.24  ? 640 TYR A CZ    1 
ATOM   3070 O  OH    . TYR A 1 386 ? 33.414 40.094 3.894   1.00 73.10  ? 640 TYR A OH    1 
ATOM   3071 N  N     . CYS A 1 387 ? 35.757 40.231 -2.580  1.00 69.33  ? 641 CYS A N     1 
ATOM   3072 C  CA    . CYS A 1 387 ? 34.524 40.652 -3.284  1.00 74.91  ? 641 CYS A CA    1 
ATOM   3073 C  C     . CYS A 1 387 ? 34.072 39.660 -4.373  1.00 73.69  ? 641 CYS A C     1 
ATOM   3074 O  O     . CYS A 1 387 ? 32.883 39.471 -4.584  1.00 81.04  ? 641 CYS A O     1 
ATOM   3075 C  CB    . CYS A 1 387 ? 34.709 42.033 -3.930  1.00 79.14  ? 641 CYS A CB    1 
ATOM   3076 S  SG    . CYS A 1 387 ? 34.786 43.418 -2.768  1.00 80.36  ? 641 CYS A SG    1 
ATOM   3077 N  N     . LYS A 1 388 ? 34.998 39.020 -5.065  1.00 78.51  ? 642 LYS A N     1 
ATOM   3078 C  CA    . LYS A 1 388 ? 34.626 37.877 -5.945  1.00 81.53  ? 642 LYS A CA    1 
ATOM   3079 C  C     . LYS A 1 388 ? 33.972 36.780 -5.137  1.00 85.57  ? 642 LYS A C     1 
ATOM   3080 O  O     . LYS A 1 388 ? 32.850 36.384 -5.465  1.00 91.70  ? 642 LYS A O     1 
ATOM   3081 C  CB    . LYS A 1 388 ? 35.793 37.316 -6.720  1.00 77.88  ? 642 LYS A CB    1 
ATOM   3082 C  CG    . LYS A 1 388 ? 36.384 38.304 -7.709  1.00 80.41  ? 642 LYS A CG    1 
ATOM   3083 C  CD    . LYS A 1 388 ? 37.268 37.588 -8.726  1.00 89.47  ? 642 LYS A CD    1 
ATOM   3084 C  CE    . LYS A 1 388 ? 38.276 38.514 -9.431  1.00 91.97  ? 642 LYS A CE    1 
ATOM   3085 N  NZ    . LYS A 1 388 ? 37.604 39.443 -10.373 1.00 87.08  ? 642 LYS A NZ    1 
ATOM   3086 N  N     . ARG A 1 389 ? 34.612 36.348 -4.049  1.00 86.20  ? 643 ARG A N     1 
ATOM   3087 C  CA    . ARG A 1 389 ? 34.031 35.313 -3.165  1.00 88.30  ? 643 ARG A CA    1 
ATOM   3088 C  C     . ARG A 1 389 ? 32.541 35.539 -2.705  1.00 90.91  ? 643 ARG A C     1 
ATOM   3089 O  O     . ARG A 1 389 ? 31.899 34.574 -2.293  1.00 87.73  ? 643 ARG A O     1 
ATOM   3090 C  CB    . ARG A 1 389 ? 34.944 35.013 -1.965  1.00 89.10  ? 643 ARG A CB    1 
ATOM   3091 C  CG    . ARG A 1 389 ? 35.461 33.587 -1.891  1.00 96.00  ? 643 ARG A CG    1 
ATOM   3092 C  CD    . ARG A 1 389 ? 36.568 33.462 -0.834  1.00 99.64  ? 643 ARG A CD    1 
ATOM   3093 N  NE    . ARG A 1 389 ? 37.821 34.061 -1.316  1.00 99.54  ? 643 ARG A NE    1 
ATOM   3094 C  CZ    . ARG A 1 389 ? 38.486 35.114 -0.804  1.00 96.22  ? 643 ARG A CZ    1 
ATOM   3095 N  NH1   . ARG A 1 389 ? 38.090 35.778 0.306   1.00 88.82  ? 643 ARG A NH1   1 
ATOM   3096 N  NH2   . ARG A 1 389 ? 39.596 35.509 -1.440  1.00 92.89  ? 643 ARG A NH2   1 
ATOM   3097 N  N     . GLN A 1 390 ? 31.998 36.761 -2.771  1.00 95.16  ? 644 GLN A N     1 
ATOM   3098 C  CA    . GLN A 1 390 ? 30.507 36.933 -2.969  1.00 103.55 ? 644 GLN A CA    1 
ATOM   3099 C  C     . GLN A 1 390 ? 30.179 37.690 -4.254  1.00 96.26  ? 644 GLN A C     1 
ATOM   3100 O  O     . GLN A 1 390 ? 29.385 37.223 -5.050  1.00 99.54  ? 644 GLN A O     1 
ATOM   3101 C  CB    . GLN A 1 390 ? 29.799 37.626 -1.801  1.00 109.72 ? 644 GLN A CB    1 
ATOM   3102 C  CG    . GLN A 1 390 ? 30.286 37.224 -0.408  1.00 113.75 ? 644 GLN A CG    1 
ATOM   3103 C  CD    . GLN A 1 390 ? 31.441 38.071 0.106   1.00 108.42 ? 644 GLN A CD    1 
ATOM   3104 O  OE1   . GLN A 1 390 ? 31.710 39.167 -0.415  1.00 96.85  ? 644 GLN A OE1   1 
ATOM   3105 N  NE2   . GLN A 1 390 ? 32.128 37.570 1.140   1.00 100.31 ? 644 GLN A NE2   1 
HETATM 3106 P  PG    . ANP B 2 .   ? 55.940 31.535 22.339  1.00 112.98 ? 700 ANP A PG    1 
HETATM 3107 O  O1G   . ANP B 2 .   ? 56.018 30.980 20.930  1.00 96.90  ? 700 ANP A O1G   1 
HETATM 3108 O  O2G   . ANP B 2 .   ? 57.161 32.412 22.600  1.00 96.46  ? 700 ANP A O2G   1 
HETATM 3109 O  O3G   . ANP B 2 .   ? 54.480 31.955 22.654  1.00 94.48  ? 700 ANP A O3G   1 
HETATM 3110 P  PB    . ANP B 2 .   ? 55.301 28.815 23.506  1.00 85.96  ? 700 ANP A PB    1 
HETATM 3111 O  O1B   . ANP B 2 .   ? 54.036 29.127 22.647  1.00 87.59  ? 700 ANP A O1B   1 
HETATM 3112 O  O2B   . ANP B 2 .   ? 55.006 28.484 24.949  1.00 73.27  ? 700 ANP A O2B   1 
HETATM 3113 N  N3B   . ANP B 2 .   ? 56.279 30.272 23.525  1.00 93.00  ? 700 ANP A N3B   1 
HETATM 3114 P  PA    . ANP B 2 .   ? 56.578 27.465 21.176  1.00 75.90  ? 700 ANP A PA    1 
HETATM 3115 O  O1A   . ANP B 2 .   ? 55.878 26.346 20.380  1.00 76.13  ? 700 ANP A O1A   1 
HETATM 3116 O  O2A   . ANP B 2 .   ? 56.800 28.808 20.526  1.00 67.36  ? 700 ANP A O2A   1 
HETATM 3117 O  O3A   . ANP B 2 .   ? 56.173 27.611 22.779  1.00 82.97  ? 700 ANP A O3A   1 
HETATM 3118 O  "O5'" . ANP B 2 .   ? 58.107 26.950 21.357  1.00 75.07  ? 700 ANP A "O5'" 1 
HETATM 3119 C  "C5'" . ANP B 2 .   ? 59.074 27.788 22.035  1.00 71.85  ? 700 ANP A "C5'" 1 
HETATM 3120 C  "C4'" . ANP B 2 .   ? 60.407 27.818 21.285  1.00 69.17  ? 700 ANP A "C4'" 1 
HETATM 3121 O  "O4'" . ANP B 2 .   ? 60.969 26.473 21.151  1.00 74.92  ? 700 ANP A "O4'" 1 
HETATM 3122 C  "C3'" . ANP B 2 .   ? 60.325 28.330 19.861  1.00 72.76  ? 700 ANP A "C3'" 1 
HETATM 3123 O  "O3'" . ANP B 2 .   ? 60.108 29.739 19.758  1.00 69.16  ? 700 ANP A "O3'" 1 
HETATM 3124 C  "C2'" . ANP B 2 .   ? 61.644 27.776 19.301  1.00 75.02  ? 700 ANP A "C2'" 1 
HETATM 3125 O  "O2'" . ANP B 2 .   ? 62.771 28.629 19.684  1.00 73.50  ? 700 ANP A "O2'" 1 
HETATM 3126 C  "C1'" . ANP B 2 .   ? 61.629 26.336 19.895  1.00 73.69  ? 700 ANP A "C1'" 1 
HETATM 3127 N  N9    . ANP B 2 .   ? 60.914 25.326 19.010  1.00 71.60  ? 700 ANP A N9    1 
HETATM 3128 C  C8    . ANP B 2 .   ? 59.644 24.825 19.113  1.00 71.64  ? 700 ANP A C8    1 
HETATM 3129 N  N7    . ANP B 2 .   ? 59.336 23.971 18.064  1.00 69.63  ? 700 ANP A N7    1 
HETATM 3130 C  C5    . ANP B 2 .   ? 60.472 23.906 17.308  1.00 64.72  ? 700 ANP A C5    1 
HETATM 3131 C  C6    . ANP B 2 .   ? 60.894 23.223 16.060  1.00 65.30  ? 700 ANP A C6    1 
HETATM 3132 N  N6    . ANP B 2 .   ? 60.032 22.396 15.427  1.00 62.41  ? 700 ANP A N6    1 
HETATM 3133 N  N1    . ANP B 2 .   ? 62.157 23.454 15.576  1.00 69.20  ? 700 ANP A N1    1 
HETATM 3134 C  C2    . ANP B 2 .   ? 63.040 24.290 16.201  1.00 63.31  ? 700 ANP A C2    1 
HETATM 3135 N  N3    . ANP B 2 .   ? 62.700 24.955 17.328  1.00 65.54  ? 700 ANP A N3    1 
HETATM 3136 C  C4    . ANP B 2 .   ? 61.475 24.802 17.906  1.00 63.36  ? 700 ANP A C4    1 
HETATM 3137 O  O     . HOH C 3 .   ? 50.675 19.949 32.598  1.00 62.15  ? 801 HOH A O     1 
HETATM 3138 O  O     . HOH C 3 .   ? 33.164 56.624 20.039  1.00 67.97  ? 802 HOH A O     1 
HETATM 3139 O  O     . HOH C 3 .   ? 60.365 39.193 42.807  1.00 59.98  ? 803 HOH A O     1 
HETATM 3140 O  O     . HOH C 3 .   ? 52.568 11.572 13.008  1.00 89.08  ? 804 HOH A O     1 
HETATM 3141 O  O     . HOH C 3 .   ? 34.199 47.632 1.834   1.00 69.36  ? 805 HOH A O     1 
HETATM 3142 O  O     . HOH C 3 .   ? 30.581 56.509 6.647   1.00 71.45  ? 806 HOH A O     1 
HETATM 3143 O  O     . HOH C 3 .   ? 48.908 17.060 21.145  1.00 63.28  ? 807 HOH A O     1 
HETATM 3144 O  O     . HOH C 3 .   ? 38.296 50.013 15.301  1.00 49.72  ? 808 HOH A O     1 
HETATM 3145 O  O     . HOH C 3 .   ? 66.976 20.016 24.082  1.00 58.76  ? 809 HOH A O     1 
HETATM 3146 O  O     . HOH C 3 .   ? 44.967 16.568 18.330  1.00 70.21  ? 810 HOH A O     1 
HETATM 3147 O  O     . HOH C 3 .   ? 58.625 56.859 15.308  1.00 85.55  ? 811 HOH A O     1 
HETATM 3148 O  O     . HOH C 3 .   ? 31.351 58.546 12.051  1.00 66.99  ? 812 HOH A O     1 
HETATM 3149 O  O     . HOH C 3 .   ? 62.465 31.866 19.146  1.00 76.70  ? 813 HOH A O     1 
HETATM 3150 O  O     . HOH C 3 .   ? 34.453 38.406 23.642  1.00 71.01  ? 814 HOH A O     1 
HETATM 3151 O  O     . HOH C 3 .   ? 54.963 41.918 16.357  1.00 56.17  ? 815 HOH A O     1 
HETATM 3152 O  O     . HOH C 3 .   ? 64.673 49.025 0.842   1.00 74.59  ? 816 HOH A O     1 
HETATM 3153 O  O     . HOH C 3 .   ? 51.678 30.453 35.279  1.00 68.36  ? 817 HOH A O     1 
HETATM 3154 O  O     . HOH C 3 .   ? 70.627 19.851 15.015  1.00 82.16  ? 818 HOH A O     1 
HETATM 3155 O  O     . HOH C 3 .   ? 50.007 17.016 33.971  1.00 69.78  ? 819 HOH A O     1 
HETATM 3156 O  O     . HOH C 3 .   ? 48.241 10.171 23.158  1.00 98.75  ? 820 HOH A O     1 
HETATM 3157 O  O     . HOH C 3 .   ? 52.979 34.953 0.863   1.00 60.29  ? 821 HOH A O     1 
HETATM 3158 O  O     . HOH C 3 .   ? 64.556 47.349 30.014  1.00 98.03  ? 822 HOH A O     1 
HETATM 3159 O  O     . HOH C 3 .   ? 62.366 15.107 30.331  1.00 82.53  ? 823 HOH A O     1 
HETATM 3160 O  O     . HOH C 3 .   ? 48.535 16.158 36.854  1.00 90.62  ? 824 HOH A O     1 
HETATM 3161 O  O     . HOH C 3 .   ? 47.094 15.389 19.945  1.00 75.52  ? 825 HOH A O     1 
HETATM 3162 O  O     . HOH C 3 .   ? 45.727 37.060 47.287  1.00 57.95  ? 826 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLU A 7   ? 1.4479 1.5025 1.4515 0.0064  0.0275  -0.0694 261 GLU A N   
2    C  CA  . GLU A 7   ? 1.4857 1.5439 1.4803 0.0094  0.0264  -0.0622 261 GLU A CA  
3    C  C   . GLU A 7   ? 1.4172 1.4698 1.4095 0.0075  0.0273  -0.0531 261 GLU A C   
4    O  O   . GLU A 7   ? 1.1922 1.2377 1.1867 0.0040  0.0303  -0.0504 261 GLU A O   
5    C  CB  . GLU A 7   ? 1.4831 1.5435 1.4738 0.0107  0.0284  -0.0619 261 GLU A CB  
6    C  CG  . GLU A 7   ? 1.4518 1.5181 1.4335 0.0143  0.0274  -0.0557 261 GLU A CG  
7    C  CD  . GLU A 7   ? 1.4696 1.5367 1.4479 0.0147  0.0302  -0.0540 261 GLU A CD  
8    O  OE1 . GLU A 7   ? 1.3805 1.4419 1.3629 0.0119  0.0329  -0.0557 261 GLU A OE1 
9    O  OE2 . GLU A 7   ? 1.4968 1.5706 1.4683 0.0181  0.0298  -0.0507 261 GLU A OE2 
10   N  N   . ARG A 8   ? 1.4492 1.5053 1.4368 0.0102  0.0245  -0.0485 262 ARG A N   
11   C  CA  . ARG A 8   ? 1.3361 1.3881 1.3228 0.0090  0.0241  -0.0409 262 ARG A CA  
12   C  C   . ARG A 8   ? 1.3518 1.4050 1.3318 0.0103  0.0252  -0.0330 262 ARG A C   
13   O  O   . ARG A 8   ? 1.1165 1.1753 1.0914 0.0137  0.0230  -0.0296 262 ARG A O   
14   C  CB  . ARG A 8   ? 1.3911 1.4463 1.3780 0.0114  0.0197  -0.0415 262 ARG A CB  
15   C  CG  . ARG A 8   ? 1.4259 1.4815 1.4198 0.0106  0.0183  -0.0504 262 ARG A CG  
16   C  CD  . ARG A 8   ? 1.4527 1.5010 1.4532 0.0061  0.0206  -0.0510 262 ARG A CD  
17   N  NE  . ARG A 8   ? 1.4562 1.5043 1.4610 0.0062  0.0177  -0.0527 262 ARG A NE  
18   C  CZ  . ARG A 8   ? 1.5971 1.6444 1.6002 0.0074  0.0149  -0.0472 262 ARG A CZ  
19   N  NH1 . ARG A 8   ? 1.6075 1.6541 1.6048 0.0086  0.0149  -0.0388 262 ARG A NH1 
20   N  NH2 . ARG A 8   ? 1.6067 1.6542 1.6148 0.0075  0.0121  -0.0501 262 ARG A NH2 
21   N  N   . ILE A 9   ? 1.3631 1.4119 1.3436 0.0078  0.0288  -0.0309 263 ILE A N   
22   C  CA  . ILE A 9   ? 1.1735 1.2202 1.1507 0.0070  0.0310  -0.0228 263 ILE A CA  
23   C  C   . ILE A 9   ? 1.1579 1.1983 1.1382 0.0047  0.0304  -0.0175 263 ILE A C   
24   O  O   . ILE A 9   ? 1.0146 1.0541 0.9931 0.0048  0.0305  -0.0099 263 ILE A O   
25   C  CB  . ILE A 9   ? 1.1891 1.2326 1.1675 0.0050  0.0347  -0.0249 263 ILE A CB  
26   C  CG1 . ILE A 9   ? 1.1675 1.2178 1.1421 0.0078  0.0353  -0.0284 263 ILE A CG1 
27   C  CG2 . ILE A 9   ? 1.1634 1.2015 1.1419 0.0028  0.0370  -0.0183 263 ILE A CG2 
28   C  CD1 . ILE A 9   ? 1.1729 1.2200 1.1499 0.0062  0.0382  -0.0322 263 ILE A CD1 
29   N  N   . VAL A 10  ? 1.1228 1.1590 1.1085 0.0027  0.0299  -0.0218 264 VAL A N   
30   C  CA  . VAL A 10  ? 1.1048 1.1358 1.0943 0.0009  0.0288  -0.0187 264 VAL A CA  
31   C  C   . VAL A 10  ? 1.0328 1.0657 1.0207 0.0029  0.0256  -0.0128 264 VAL A C   
32   O  O   . VAL A 10  ? 0.8666 0.8958 0.8559 0.0018  0.0255  -0.0071 264 VAL A O   
33   C  CB  . VAL A 10  ? 1.1898 1.2188 1.1849 -0.0006 0.0280  -0.0252 264 VAL A CB  
34   C  CG1 . VAL A 10  ? 1.1797 1.2052 1.1775 -0.0033 0.0316  -0.0296 264 VAL A CG1 
35   C  CG2 . VAL A 10  ? 1.2788 1.3137 1.2742 0.0019  0.0249  -0.0303 264 VAL A CG2 
36   N  N   . ARG A 11  ? 1.0011 1.0399 0.9861 0.0060  0.0228  -0.0140 265 ARG A N   
37   C  CA  . ARG A 11  ? 1.1390 1.1788 1.1227 0.0080  0.0196  -0.0080 265 ARG A CA  
38   C  C   . ARG A 11  ? 1.0784 1.1182 1.0585 0.0082  0.0211  0.0010  265 ARG A C   
39   O  O   . ARG A 11  ? 1.0815 1.1184 1.0638 0.0078  0.0196  0.0072  265 ARG A O   
40   C  CB  . ARG A 11  ? 1.1986 1.2447 1.1798 0.0118  0.0157  -0.0109 265 ARG A CB  
41   C  CG  . ARG A 11  ? 1.2996 1.3438 1.2864 0.0118  0.0121  -0.0148 265 ARG A CG  
42   C  CD  . ARG A 11  ? 1.4185 1.4683 1.4026 0.0161  0.0075  -0.0157 265 ARG A CD  
43   N  NE  . ARG A 11  ? 1.5487 1.6011 1.5262 0.0188  0.0066  -0.0070 265 ARG A NE  
44   C  CZ  . ARG A 11  ? 1.5814 1.6391 1.5542 0.0231  0.0031  -0.0052 265 ARG A CZ  
45   N  NH1 . ARG A 11  ? 1.6120 1.6731 1.5862 0.0256  -0.0007 -0.0121 265 ARG A NH1 
46   N  NH2 . ARG A 11  ? 1.4740 1.5337 1.4407 0.0251  0.0033  0.0038  265 ARG A NH2 
47   N  N   . THR A 12  ? 1.0062 1.0491 0.9822 0.0084  0.0243  0.0015  266 THR A N   
48   C  CA  . THR A 12  ? 1.0444 1.0877 1.0178 0.0082  0.0263  0.0098  266 THR A CA  
49   C  C   . THR A 12  ? 0.9188 0.9550 0.8972 0.0047  0.0284  0.0126  266 THR A C   
50   O  O   . THR A 12  ? 0.8931 0.9275 0.8729 0.0041  0.0284  0.0195  266 THR A O   
51   C  CB  . THR A 12  ? 1.1270 1.1773 1.0940 0.0103  0.0287  0.0096  266 THR A CB  
52   O  OG1 . THR A 12  ? 1.1815 1.2311 1.1495 0.0091  0.0310  0.0023  266 THR A OG1 
53   C  CG2 . THR A 12  ? 1.0427 1.1006 1.0040 0.0145  0.0262  0.0088  266 THR A CG2 
54   N  N   . LEU A 13  ? 0.9575 0.9898 0.9388 0.0025  0.0301  0.0071  267 LEU A N   
55   C  CA  . LEU A 13  ? 0.8714 0.8974 0.8571 -0.0003 0.0316  0.0092  267 LEU A CA  
56   C  C   . LEU A 13  ? 0.8901 0.9116 0.8811 -0.0012 0.0288  0.0114  267 LEU A C   
57   O  O   . LEU A 13  ? 0.8726 0.8903 0.8672 -0.0027 0.0291  0.0156  267 LEU A O   
58   C  CB  . LEU A 13  ? 0.8581 0.8810 0.8450 -0.0021 0.0340  0.0031  267 LEU A CB  
59   C  CG  . LEU A 13  ? 0.8747 0.9007 0.8578 -0.0014 0.0368  0.0003  267 LEU A CG  
60   C  CD1 . LEU A 13  ? 0.8641 0.8852 0.8493 -0.0035 0.0392  -0.0039 267 LEU A CD1 
61   C  CD2 . LEU A 13  ? 0.8623 0.8916 0.8423 -0.0005 0.0384  0.0062  267 LEU A CD2 
62   N  N   . CYS A 14  ? 0.8927 0.9150 0.8850 -0.0002 0.0258  0.0081  268 CYS A N   
63   C  CA  . CYS A 14  ? 0.9443 0.9633 0.9417 -0.0004 0.0224  0.0098  268 CYS A CA  
64   C  C   . CYS A 14  ? 0.9501 0.9693 0.9480 0.0006  0.0207  0.0182  268 CYS A C   
65   O  O   . CYS A 14  ? 1.0101 1.0251 1.0135 -0.0005 0.0190  0.0211  268 CYS A O   
66   C  CB  . CYS A 14  ? 0.9353 0.9560 0.9339 0.0009  0.0195  0.0039  268 CYS A CB  
67   S  SG  . CYS A 14  ? 1.0729 1.0911 1.0747 -0.0015 0.0218  -0.0049 268 CYS A SG  
68   N  N   . LYS A 15  ? 1.0088 1.0330 1.0010 0.0025  0.0213  0.0224  269 LYS A N   
69   C  CA  . LYS A 15  ? 1.0312 1.0555 1.0238 0.0029  0.0209  0.0317  269 LYS A CA  
70   C  C   . LYS A 15  ? 0.9574 0.9786 0.9535 0.0004  0.0237  0.0359  269 LYS A C   
71   O  O   . LYS A 15  ? 0.9045 0.9245 0.9035 0.0001  0.0232  0.0432  269 LYS A O   
72   C  CB  . LYS A 15  ? 1.0826 1.1140 1.0675 0.0058  0.0214  0.0356  269 LYS A CB  
73   C  CG  . LYS A 15  ? 1.1409 1.1754 1.1230 0.0090  0.0174  0.0338  269 LYS A CG  
74   C  CD  . LYS A 15  ? 1.1849 1.2273 1.1585 0.0123  0.0182  0.0370  269 LYS A CD  
75   C  CE  . LYS A 15  ? 1.2777 1.3252 1.2467 0.0154  0.0160  0.0296  269 LYS A CE  
76   N  NZ  . LYS A 15  ? 1.3570 1.4127 1.3179 0.0179  0.0184  0.0286  269 LYS A NZ  
77   N  N   . VAL A 16  ? 0.8592 0.8790 0.8551 -0.0012 0.0267  0.0315  270 VAL A N   
78   C  CA  . VAL A 16  ? 0.8313 0.8482 0.8308 -0.0034 0.0290  0.0344  270 VAL A CA  
79   C  C   . VAL A 16  ? 0.8084 0.8203 0.8114 -0.0051 0.0293  0.0283  270 VAL A C   
80   O  O   . VAL A 16  ? 0.7977 0.8084 0.8003 -0.0062 0.0321  0.0268  270 VAL A O   
81   C  CB  . VAL A 16  ? 0.8466 0.8682 0.8412 -0.0031 0.0330  0.0367  270 VAL A CB  
82   C  CG1 . VAL A 16  ? 0.8384 0.8649 0.8302 -0.0017 0.0332  0.0444  270 VAL A CG1 
83   C  CG2 . VAL A 16  ? 0.7635 0.7881 0.7523 -0.0021 0.0348  0.0300  270 VAL A CG2 
84   N  N   . ARG A 17  ? 0.8030 0.8120 0.8097 -0.0051 0.0264  0.0252  271 ARG A N   
85   C  CA  . ARG A 17  ? 0.8451 0.8506 0.8541 -0.0063 0.0266  0.0189  271 ARG A CA  
86   C  C   . ARG A 17  ? 0.8316 0.8333 0.8441 -0.0078 0.0279  0.0199  271 ARG A C   
87   O  O   . ARG A 17  ? 0.7408 0.7410 0.7519 -0.0086 0.0301  0.0159  271 ARG A O   
88   C  CB  . ARG A 17  ? 0.8613 0.8651 0.8747 -0.0059 0.0229  0.0164  271 ARG A CB  
89   C  CG  . ARG A 17  ? 0.8448 0.8465 0.8596 -0.0069 0.0234  0.0094  271 ARG A CG  
90   C  CD  . ARG A 17  ? 0.8514 0.8543 0.8681 -0.0060 0.0204  0.0050  271 ARG A CD  
91   N  NE  . ARG A 17  ? 0.8553 0.8560 0.8746 -0.0072 0.0212  -0.0007 271 ARG A NE  
92   C  CZ  . ARG A 17  ? 0.8314 0.8290 0.8556 -0.0077 0.0201  -0.0007 271 ARG A CZ  
93   N  NH1 . ARG A 17  ? 0.8591 0.8550 0.8872 -0.0073 0.0177  0.0041  271 ARG A NH1 
94   N  NH2 . ARG A 17  ? 0.9207 0.9171 0.9460 -0.0086 0.0213  -0.0057 271 ARG A NH2 
95   N  N   . GLY A 18  ? 0.7520 0.7524 0.7692 -0.0082 0.0267  0.0254  272 GLY A N   
96   C  CA  . GLY A 18  ? 0.7376 0.7349 0.7591 -0.0093 0.0274  0.0261  272 GLY A CA  
97   C  C   . GLY A 18  ? 0.6830 0.6816 0.7004 -0.0097 0.0313  0.0263  272 GLY A C   
98   O  O   . GLY A 18  ? 0.7046 0.7009 0.7217 -0.0102 0.0326  0.0228  272 GLY A O   
99   N  N   . ALA A 19  ? 0.6776 0.6803 0.6914 -0.0093 0.0331  0.0303  273 ALA A N   
100  C  CA  . ALA A 19  ? 0.6192 0.6239 0.6292 -0.0094 0.0367  0.0299  273 ALA A CA  
101  C  C   . ALA A 19  ? 0.6684 0.6728 0.6733 -0.0091 0.0381  0.0235  273 ALA A C   
102  O  O   . ALA A 19  ? 0.7432 0.7457 0.7471 -0.0095 0.0401  0.0210  273 ALA A O   
103  C  CB  . ALA A 19  ? 0.6298 0.6401 0.6366 -0.0087 0.0384  0.0350  273 ALA A CB  
104  N  N   . ALA A 20  ? 0.7016 0.7074 0.7039 -0.0083 0.0370  0.0205  274 ALA A N   
105  C  CA  . ALA A 20  ? 0.7264 0.7316 0.7251 -0.0084 0.0386  0.0140  274 ALA A CA  
106  C  C   . ALA A 20  ? 0.7245 0.7244 0.7254 -0.0095 0.0389  0.0102  274 ALA A C   
107  O  O   . ALA A 20  ? 0.7296 0.7278 0.7284 -0.0099 0.0412  0.0073  274 ALA A O   
108  C  CB  . ALA A 20  ? 0.6858 0.6938 0.6826 -0.0074 0.0370  0.0112  274 ALA A CB  
109  N  N   . LEU A 21  ? 0.7721 0.7695 0.7773 -0.0099 0.0365  0.0103  275 LEU A N   
110  C  CA  . LEU A 21  ? 0.7610 0.7543 0.7681 -0.0107 0.0367  0.0070  275 LEU A CA  
111  C  C   . LEU A 21  ? 0.7758 0.7667 0.7836 -0.0109 0.0379  0.0087  275 LEU A C   
112  O  O   . LEU A 21  ? 0.7501 0.7382 0.7562 -0.0111 0.0396  0.0058  275 LEU A O   
113  C  CB  . LEU A 21  ? 0.7979 0.7900 0.8100 -0.0106 0.0335  0.0065  275 LEU A CB  
114  C  CG  . LEU A 21  ? 0.8875 0.8817 0.8996 -0.0103 0.0318  0.0039  275 LEU A CG  
115  C  CD1 . LEU A 21  ? 0.9317 0.9245 0.9496 -0.0101 0.0285  0.0031  275 LEU A CD1 
116  C  CD2 . LEU A 21  ? 0.9751 0.9698 0.9838 -0.0108 0.0342  -0.0013 275 LEU A CD2 
117  N  N   . LYS A 22  ? 0.7297 0.7217 0.7403 -0.0107 0.0370  0.0134  276 LYS A N   
118  C  CA  . LYS A 22  ? 0.7432 0.7333 0.7554 -0.0107 0.0380  0.0146  276 LYS A CA  
119  C  C   . LYS A 22  ? 0.7606 0.7513 0.7675 -0.0105 0.0412  0.0133  276 LYS A C   
120  O  O   . LYS A 22  ? 0.6650 0.6529 0.6710 -0.0104 0.0423  0.0114  276 LYS A O   
121  C  CB  . LYS A 22  ? 0.7591 0.7505 0.7765 -0.0109 0.0367  0.0198  276 LYS A CB  
122  C  CG  . LYS A 22  ? 0.8288 0.8185 0.8488 -0.0108 0.0374  0.0201  276 LYS A CG  
123  C  CD  . LYS A 22  ? 0.7896 0.7753 0.8117 -0.0103 0.0358  0.0164  276 LYS A CD  
124  C  CE  . LYS A 22  ? 0.8325 0.8177 0.8615 -0.0105 0.0321  0.0172  276 LYS A CE  
125  N  NZ  . LYS A 22  ? 1.0096 0.9921 1.0420 -0.0097 0.0298  0.0136  276 LYS A NZ  
126  N  N   . LEU A 23  ? 0.7395 0.7343 0.7430 -0.0102 0.0426  0.0143  277 LEU A N   
127  C  CA  . LEU A 23  ? 0.7336 0.7290 0.7325 -0.0098 0.0454  0.0118  277 LEU A CA  
128  C  C   . LEU A 23  ? 0.7764 0.7679 0.7731 -0.0101 0.0463  0.0068  277 LEU A C   
129  O  O   . LEU A 23  ? 0.7377 0.7267 0.7327 -0.0099 0.0480  0.0053  277 LEU A O   
130  C  CB  . LEU A 23  ? 0.7451 0.7460 0.7405 -0.0090 0.0463  0.0121  277 LEU A CB  
131  C  CG  . LEU A 23  ? 0.8549 0.8571 0.8467 -0.0083 0.0488  0.0096  277 LEU A CG  
132  C  CD1 . LEU A 23  ? 0.8302 0.8322 0.8232 -0.0081 0.0500  0.0118  277 LEU A CD1 
133  C  CD2 . LEU A 23  ? 0.8388 0.8476 0.8273 -0.0071 0.0492  0.0097  277 LEU A CD2 
134  N  N   . GLY A 24  ? 0.7782 0.7692 0.7752 -0.0106 0.0452  0.0044  278 GLY A N   
135  C  CA  . GLY A 24  ? 0.7663 0.7540 0.7622 -0.0113 0.0464  0.0000  278 GLY A CA  
136  C  C   . GLY A 24  ? 0.8361 0.8191 0.8325 -0.0114 0.0469  -0.0001 278 GLY A C   
137  O  O   . GLY A 24  ? 0.9796 0.9596 0.9737 -0.0116 0.0489  -0.0021 278 GLY A O   
138  N  N   . GLN A 25  ? 0.8960 0.8783 0.8956 -0.0111 0.0448  0.0019  279 GLN A N   
139  C  CA  . GLN A 25  ? 0.9398 0.9184 0.9397 -0.0106 0.0449  0.0015  279 GLN A CA  
140  C  C   . GLN A 25  ? 0.9534 0.9308 0.9513 -0.0098 0.0464  0.0027  279 GLN A C   
141  O  O   . GLN A 25  ? 1.0162 0.9901 1.0115 -0.0093 0.0477  0.0013  279 GLN A O   
142  C  CB  . GLN A 25  ? 0.9194 0.8980 0.9241 -0.0101 0.0419  0.0029  279 GLN A CB  
143  C  CG  . GLN A 25  ? 0.9951 0.9744 1.0027 -0.0104 0.0398  0.0012  279 GLN A CG  
144  C  CD  . GLN A 25  ? 1.0788 1.0581 1.0922 -0.0097 0.0366  0.0026  279 GLN A CD  
145  O  OE1 . GLN A 25  ? 1.0190 0.9999 1.0361 -0.0098 0.0351  0.0061  279 GLN A OE1 
146  N  NE2 . GLN A 25  ? 1.1485 1.1265 1.1633 -0.0089 0.0354  0.0000  279 GLN A NE2 
147  N  N   . MSE A 26  ? 0.8611 0.8415 0.8602 -0.0096 0.0461  0.0054  280 MSE A N   
148  C  CA  . MSE A 26  ? 0.9282 0.9081 0.9263 -0.0087 0.0473  0.0062  280 MSE A CA  
149  C  C   . MSE A 26  ? 0.9246 0.9027 0.9181 -0.0085 0.0498  0.0037  280 MSE A C   
150  O  O   . MSE A 26  ? 0.8334 0.8091 0.8255 -0.0075 0.0507  0.0034  280 MSE A O   
151  C  CB  . MSE A 26  ? 0.8557 0.8403 0.8561 -0.0087 0.0472  0.0095  280 MSE A CB  
152  C  CG  . MSE A 26  ? 0.9003 0.8856 0.9066 -0.0088 0.0449  0.0124  280 MSE A CG  
153  SE SE  . MSE A 26  ? 1.0029 0.9949 1.0117 -0.0093 0.0456  0.0176  280 MSE A SE  
154  C  CE  . MSE A 26  ? 1.0522 1.0452 1.0592 -0.0081 0.0481  0.0167  280 MSE A CE  
155  N  N   . LEU A 27  ? 1.0432 1.0227 1.0350 -0.0093 0.0508  0.0019  281 LEU A N   
156  C  CA  . LEU A 27  ? 1.1708 1.1491 1.1596 -0.0091 0.0529  -0.0007 281 LEU A CA  
157  C  C   . LEU A 27  ? 1.4009 1.3742 1.3883 -0.0098 0.0542  -0.0033 281 LEU A C   
158  O  O   . LEU A 27  ? 1.6301 1.6004 1.6156 -0.0095 0.0558  -0.0047 281 LEU A O   
159  C  CB  . LEU A 27  ? 1.1055 1.0887 1.0938 -0.0092 0.0532  -0.0019 281 LEU A CB  
160  C  CG  . LEU A 27  ? 1.1205 1.1090 1.1090 -0.0083 0.0530  0.0006  281 LEU A CG  
161  C  CD1 . LEU A 27  ? 1.1070 1.1007 1.0938 -0.0078 0.0535  -0.0013 281 LEU A CD1 
162  C  CD2 . LEU A 27  ? 1.1483 1.1355 1.1364 -0.0072 0.0540  0.0011  281 LEU A CD2 
163  N  N   . SER A 28  ? 1.4700 1.4425 1.4584 -0.0107 0.0535  -0.0038 282 SER A N   
164  C  CA  . SER A 28  ? 1.6681 1.6376 1.6557 -0.0119 0.0552  -0.0064 282 SER A CA  
165  C  C   . SER A 28  ? 1.7489 1.7210 1.7372 -0.0128 0.0561  -0.0093 282 SER A C   
166  O  O   . SER A 28  ? 1.7421 1.7120 1.7297 -0.0131 0.0580  -0.0113 282 SER A O   
167  C  CB  . SER A 28  ? 1.6096 1.5734 1.5946 -0.0115 0.0571  -0.0063 282 SER A CB  
168  O  OG  . SER A 28  ? 1.4878 1.4503 1.4719 -0.0098 0.0560  -0.0040 282 SER A OG  
169  N  N   . ILE A 29  ? 1.7097 1.6864 1.6996 -0.0130 0.0544  -0.0096 283 ILE A N   
170  C  CA  . ILE A 29  ? 1.7141 1.6931 1.7055 -0.0139 0.0546  -0.0130 283 ILE A CA  
171  C  C   . ILE A 29  ? 1.7458 1.7223 1.7386 -0.0151 0.0548  -0.0136 283 ILE A C   
172  O  O   . ILE A 29  ? 1.7218 1.7000 1.7161 -0.0149 0.0528  -0.0127 283 ILE A O   
173  C  CB  . ILE A 29  ? 1.7004 1.6853 1.6925 -0.0132 0.0523  -0.0127 283 ILE A CB  
174  N  N   . GLN A 30  ? 1.9092 1.8812 1.9013 -0.0160 0.0574  -0.0148 284 GLN A N   
175  C  CA  . GLN A 30  ? 1.9511 1.9205 1.9435 -0.0169 0.0585  -0.0149 284 GLN A CA  
176  C  C   . GLN A 30  ? 1.9670 1.9337 1.9604 -0.0187 0.0617  -0.0175 284 GLN A C   
177  O  O   . GLN A 30  ? 1.7521 1.7146 1.7440 -0.0192 0.0640  -0.0165 284 GLN A O   
178  C  CB  . GLN A 30  ? 1.9930 1.9586 1.9823 -0.0157 0.0588  -0.0118 284 GLN A CB  
179  C  CG  . GLN A 30  ? 1.8770 1.8444 1.8670 -0.0144 0.0560  -0.0100 284 GLN A CG  
180  C  CD  . GLN A 30  ? 1.7993 1.7645 1.7881 -0.0140 0.0565  -0.0098 284 GLN A CD  
181  O  OE1 . GLN A 30  ? 1.5947 1.5564 1.5809 -0.0144 0.0593  -0.0099 284 GLN A OE1 
182  N  NE2 . GLN A 30  ? 1.7835 1.7508 1.7741 -0.0131 0.0539  -0.0095 284 GLN A NE2 
183  N  N   . ASP A 31  ? 2.2640 2.2334 2.2602 -0.0194 0.0617  -0.0207 285 ASP A N   
184  C  CA  . ASP A 31  ? 2.3368 2.3039 2.3355 -0.0211 0.0644  -0.0237 285 ASP A CA  
185  C  C   . ASP A 31  ? 2.4156 2.3769 2.4124 -0.0210 0.0666  -0.0222 285 ASP A C   
186  O  O   . ASP A 31  ? 2.4342 2.3926 2.4338 -0.0226 0.0691  -0.0241 285 ASP A O   
187  C  CB  . ASP A 31  ? 2.2157 2.1825 2.2174 -0.0233 0.0664  -0.0255 285 ASP A CB  
188  C  CG  . ASP A 31  ? 2.0328 2.0055 2.0385 -0.0237 0.0644  -0.0290 285 ASP A CG  
189  O  OD1 . ASP A 31  ? 1.8785 1.8550 1.8848 -0.0226 0.0619  -0.0307 285 ASP A OD1 
190  O  OD2 . ASP A 31  ? 1.7612 1.7348 1.7691 -0.0250 0.0653  -0.0302 285 ASP A OD2 
191  N  N   . ASP A 32  ? 2.4233 2.3832 2.4163 -0.0190 0.0656  -0.0191 286 ASP A N   
192  C  CA  . ASP A 32  ? 2.4191 2.3728 2.4098 -0.0186 0.0675  -0.0172 286 ASP A CA  
193  C  C   . ASP A 32  ? 2.5022 2.4543 2.4956 -0.0188 0.0684  -0.0200 286 ASP A C   
194  O  O   . ASP A 32  ? 2.4969 2.4537 2.4925 -0.0184 0.0669  -0.0231 286 ASP A O   
195  C  CB  . ASP A 32  ? 2.3141 2.2667 2.3006 -0.0162 0.0660  -0.0136 286 ASP A CB  
196  C  CG  . ASP A 32  ? 2.2184 2.1753 2.2047 -0.0145 0.0636  -0.0136 286 ASP A CG  
197  O  OD1 . ASP A 32  ? 2.1095 2.0697 2.0978 -0.0146 0.0632  -0.0163 286 ASP A OD1 
198  O  OD2 . ASP A 32  ? 2.0936 2.0509 2.0778 -0.0130 0.0622  -0.0109 286 ASP A OD2 
199  N  N   . ALA A 33  ? 2.5090 2.4546 2.5023 -0.0194 0.0708  -0.0190 287 ALA A N   
200  C  CA  . ALA A 33  ? 2.4108 2.3538 2.4082 -0.0201 0.0720  -0.0220 287 ALA A CA  
201  C  C   . ALA A 33  ? 2.4727 2.4166 2.4695 -0.0178 0.0701  -0.0231 287 ALA A C   
202  O  O   . ALA A 33  ? 2.6249 2.5633 2.6210 -0.0169 0.0708  -0.0220 287 ALA A O   
203  C  CB  . ALA A 33  ? 2.1963 2.1314 2.1942 -0.0216 0.0753  -0.0197 287 ALA A CB  
204  N  N   . PHE A 34  ? 2.4332 2.3843 2.4303 -0.0166 0.0677  -0.0254 288 PHE A N   
205  C  CA  . PHE A 34  ? 2.4635 2.4177 2.4601 -0.0142 0.0661  -0.0271 288 PHE A CA  
206  C  C   . PHE A 34  ? 2.4866 2.4497 2.4835 -0.0134 0.0640  -0.0295 288 PHE A C   
207  O  O   . PHE A 34  ? 2.4407 2.4073 2.4408 -0.0130 0.0633  -0.0342 288 PHE A O   
208  C  CB  . PHE A 34  ? 2.4764 2.4285 2.4685 -0.0121 0.0655  -0.0231 288 PHE A CB  
209  C  CG  . PHE A 34  ? 2.4305 2.3886 2.4217 -0.0097 0.0636  -0.0243 288 PHE A CG  
210  C  CD1 . PHE A 34  ? 2.3431 2.3016 2.3366 -0.0084 0.0634  -0.0280 288 PHE A CD1 
211  C  CD2 . PHE A 34  ? 2.3297 2.2931 2.3182 -0.0087 0.0622  -0.0216 288 PHE A CD2 
212  C  CE1 . PHE A 34  ? 2.1849 2.1499 2.1775 -0.0061 0.0620  -0.0292 288 PHE A CE1 
213  C  CE2 . PHE A 34  ? 2.2236 2.1930 2.2113 -0.0067 0.0611  -0.0222 288 PHE A CE2 
214  C  CZ  . PHE A 34  ? 2.1505 2.1211 2.1400 -0.0053 0.0611  -0.0261 288 PHE A CZ  
215  N  N   . ILE A 35  ? 2.4769 2.4434 2.4707 -0.0130 0.0628  -0.0262 289 ILE A N   
216  C  CA  . ILE A 35  ? 2.2396 2.2143 2.2329 -0.0121 0.0608  -0.0270 289 ILE A CA  
217  C  C   . ILE A 35  ? 2.1311 2.1086 2.1281 -0.0132 0.0605  -0.0316 289 ILE A C   
218  O  O   . ILE A 35  ? 2.1553 2.1288 2.1551 -0.0153 0.0619  -0.0328 289 ILE A O   
219  C  CB  . ILE A 35  ? 2.1669 2.1430 2.1575 -0.0120 0.0597  -0.0223 289 ILE A CB  
220  C  CG1 . ILE A 35  ? 2.1007 2.0765 2.0885 -0.0104 0.0594  -0.0186 289 ILE A CG1 
221  C  CG2 . ILE A 35  ? 2.1298 2.1128 2.1205 -0.0117 0.0578  -0.0227 289 ILE A CG2 
222  C  CD1 . ILE A 35  ? 2.0316 2.0137 2.0184 -0.0085 0.0585  -0.0191 289 ILE A CD1 
223  N  N   . ASN A 36  ? 1.9030 1.8876 1.9001 -0.0116 0.0588  -0.0345 290 ASN A N   
224  C  CA  . ASN A 36  ? 1.8886 1.8769 1.8895 -0.0119 0.0580  -0.0398 290 ASN A CA  
225  C  C   . ASN A 36  ? 1.8487 1.8365 1.8512 -0.0139 0.0579  -0.0393 290 ASN A C   
226  O  O   . ASN A 36  ? 1.8854 1.8759 1.8850 -0.0133 0.0565  -0.0360 290 ASN A O   
227  C  CB  . ASN A 36  ? 1.8013 1.7984 1.8000 -0.0091 0.0557  -0.0418 290 ASN A CB  
228  C  CG  . ASN A 36  ? 1.8080 1.8099 1.8106 -0.0087 0.0543  -0.0483 290 ASN A CG  
229  O  OD1 . ASN A 36  ? 1.7000 1.6985 1.7081 -0.0106 0.0552  -0.0521 290 ASN A OD1 
230  N  ND2 . ASN A 36  ? 1.7339 1.7441 1.7338 -0.0059 0.0522  -0.0497 290 ASN A ND2 
231  N  N   . PRO A 37  ? 1.8305 1.8148 1.8380 -0.0162 0.0594  -0.0425 291 PRO A N   
232  C  CA  . PRO A 37  ? 1.8398 1.8247 1.8494 -0.0180 0.0593  -0.0428 291 PRO A CA  
233  C  C   . PRO A 37  ? 1.8796 1.8722 1.8898 -0.0166 0.0563  -0.0456 291 PRO A C   
234  O  O   . PRO A 37  ? 1.8021 1.7957 1.8135 -0.0175 0.0557  -0.0452 291 PRO A O   
235  C  CB  . PRO A 37  ? 1.7497 1.7300 1.7654 -0.0207 0.0620  -0.0461 291 PRO A CB  
236  C  CG  . PRO A 37  ? 1.7658 1.7405 1.7811 -0.0206 0.0638  -0.0449 291 PRO A CG  
237  C  CD  . PRO A 37  ? 1.7764 1.7553 1.7882 -0.0176 0.0616  -0.0453 291 PRO A CD  
238  N  N   . HIS A 38  ? 1.8469 1.8451 1.8564 -0.0142 0.0544  -0.0486 292 HIS A N   
239  C  CA  . HIS A 38  ? 1.8870 1.8930 1.8948 -0.0119 0.0512  -0.0497 292 HIS A CA  
240  C  C   . HIS A 38  ? 1.8319 1.8384 1.8345 -0.0111 0.0502  -0.0430 292 HIS A C   
241  O  O   . HIS A 38  ? 1.7232 1.7323 1.7258 -0.0108 0.0482  -0.0422 292 HIS A O   
242  C  CB  . HIS A 38  ? 1.9056 1.9180 1.9118 -0.0088 0.0496  -0.0532 292 HIS A CB  
243  C  CG  . HIS A 38  ? 1.8794 1.8967 1.8904 -0.0079 0.0479  -0.0610 292 HIS A CG  
244  N  ND1 . HIS A 38  ? 1.8792 1.9016 1.8905 -0.0053 0.0467  -0.0659 292 HIS A ND1 
245  C  CD2 . HIS A 38  ? 1.8131 1.8316 1.8293 -0.0090 0.0469  -0.0652 292 HIS A CD2 
246  C  CE1 . HIS A 38  ? 1.7973 1.8237 1.8137 -0.0048 0.0449  -0.0729 292 HIS A CE1 
247  N  NE2 . HIS A 38  ? 1.8236 1.8477 1.8433 -0.0071 0.0451  -0.0725 292 HIS A NE2 
248  N  N   . LEU A 39  ? 1.7586 1.7626 1.7575 -0.0107 0.0513  -0.0383 293 LEU A N   
249  C  CA  . LEU A 39  ? 1.6840 1.6890 1.6788 -0.0098 0.0503  -0.0321 293 LEU A CA  
250  C  C   . LEU A 39  ? 1.5567 1.5571 1.5527 -0.0117 0.0505  -0.0290 293 LEU A C   
251  O  O   . LEU A 39  ? 1.3637 1.3663 1.3594 -0.0113 0.0483  -0.0267 293 LEU A O   
252  C  CB  . LEU A 39  ? 1.7258 1.7298 1.7174 -0.0089 0.0515  -0.0289 293 LEU A CB  
253  C  CG  . LEU A 39  ? 1.8102 1.8159 1.7987 -0.0080 0.0507  -0.0225 293 LEU A CG  
254  C  CD1 . LEU A 39  ? 1.7618 1.7754 1.7475 -0.0056 0.0489  -0.0217 293 LEU A CD1 
255  C  CD2 . LEU A 39  ? 1.8185 1.8210 1.8056 -0.0079 0.0524  -0.0198 293 LEU A CD2 
256  N  N   . ALA A 40  ? 1.3809 1.3750 1.3782 -0.0136 0.0528  -0.0289 294 ALA A N   
257  C  CA  . ALA A 40  ? 1.3415 1.3319 1.3399 -0.0151 0.0532  -0.0268 294 ALA A CA  
258  C  C   . ALA A 40  ? 1.3076 1.3008 1.3093 -0.0158 0.0518  -0.0298 294 ALA A C   
259  O  O   . ALA A 40  ? 1.2910 1.2840 1.2932 -0.0160 0.0506  -0.0279 294 ALA A O   
260  C  CB  . ALA A 40  ? 1.3334 1.3175 1.3324 -0.0168 0.0563  -0.0270 294 ALA A CB  
261  N  N   . LYS A 41  ? 1.3057 1.3016 1.3102 -0.0159 0.0518  -0.0350 295 LYS A N   
262  C  CA  . LYS A 41  ? 1.3850 1.3844 1.3930 -0.0162 0.0500  -0.0383 295 LYS A CA  
263  C  C   . LYS A 41  ? 1.2670 1.2706 1.2726 -0.0140 0.0464  -0.0353 295 LYS A C   
264  O  O   . LYS A 41  ? 1.1435 1.1469 1.1503 -0.0143 0.0450  -0.0338 295 LYS A O   
265  C  CB  . LYS A 41  ? 1.5087 1.5116 1.5204 -0.0161 0.0498  -0.0448 295 LYS A CB  
266  C  CG  . LYS A 41  ? 1.6298 1.6384 1.6441 -0.0150 0.0467  -0.0484 295 LYS A CG  
267  C  CD  . LYS A 41  ? 1.6720 1.6830 1.6920 -0.0157 0.0470  -0.0557 295 LYS A CD  
268  C  CE  . LYS A 41  ? 1.7046 1.7213 1.7275 -0.0145 0.0437  -0.0593 295 LYS A CE  
269  N  NZ  . LYS A 41  ? 1.7302 1.7461 1.7607 -0.0172 0.0454  -0.0646 295 LYS A NZ  
270  N  N   . ILE A 42  ? 1.1488 1.1563 1.1511 -0.0118 0.0451  -0.0344 296 ILE A N   
271  C  CA  . ILE A 42  ? 1.0976 1.1093 1.0970 -0.0096 0.0421  -0.0307 296 ILE A CA  
272  C  C   . ILE A 42  ? 1.0099 1.0184 1.0087 -0.0101 0.0415  -0.0249 296 ILE A C   
273  O  O   . ILE A 42  ? 0.9569 0.9673 0.9564 -0.0092 0.0388  -0.0231 296 ILE A O   
274  C  CB  . ILE A 42  ? 1.1081 1.1241 1.1031 -0.0073 0.0420  -0.0296 296 ILE A CB  
275  C  CG1 . ILE A 42  ? 1.1461 1.1676 1.1420 -0.0057 0.0407  -0.0359 296 ILE A CG1 
276  C  CG2 . ILE A 42  ? 1.0673 1.0861 1.0587 -0.0055 0.0401  -0.0233 296 ILE A CG2 
277  C  CD1 . ILE A 42  ? 1.1862 1.2119 1.1789 -0.0036 0.0413  -0.0372 296 ILE A CD1 
278  N  N   . PHE A 43  ? 0.9881 0.9921 0.9860 -0.0112 0.0438  -0.0222 297 PHE A N   
279  C  CA  . PHE A 43  ? 0.9889 0.9900 0.9869 -0.0115 0.0432  -0.0174 297 PHE A CA  
280  C  C   . PHE A 43  ? 1.0312 1.0300 1.0328 -0.0127 0.0425  -0.0190 297 PHE A C   
281  O  O   . PHE A 43  ? 0.9815 0.9806 0.9846 -0.0122 0.0400  -0.0164 297 PHE A O   
282  C  CB  . PHE A 43  ? 0.9714 0.9687 0.9674 -0.0120 0.0457  -0.0149 297 PHE A CB  
283  C  CG  . PHE A 43  ? 1.0177 1.0177 1.0111 -0.0105 0.0453  -0.0107 297 PHE A CG  
284  C  CD1 . PHE A 43  ? 1.0230 1.0268 1.0138 -0.0093 0.0461  -0.0121 297 PHE A CD1 
285  C  CD2 . PHE A 43  ? 1.0773 1.0766 1.0713 -0.0103 0.0441  -0.0056 297 PHE A CD2 
286  C  CE1 . PHE A 43  ? 0.9966 1.0039 0.9848 -0.0079 0.0461  -0.0082 297 PHE A CE1 
287  C  CE2 . PHE A 43  ? 1.0208 1.0231 1.0130 -0.0092 0.0442  -0.0016 297 PHE A CE2 
288  C  CZ  . PHE A 43  ? 0.9846 0.9911 0.9736 -0.0080 0.0453  -0.0027 297 PHE A CZ  
289  N  N   . GLU A 44  ? 1.1722 1.1692 1.1758 -0.0143 0.0445  -0.0233 298 GLU A N   
290  C  CA  . GLU A 44  ? 1.1978 1.1942 1.2050 -0.0153 0.0439  -0.0255 298 GLU A CA  
291  C  C   . GLU A 44  ? 1.0586 1.0594 1.0683 -0.0142 0.0404  -0.0270 298 GLU A C   
292  O  O   . GLU A 44  ? 0.9590 0.9599 0.9711 -0.0139 0.0381  -0.0263 298 GLU A O   
293  C  CB  . GLU A 44  ? 1.3491 1.3441 1.3586 -0.0173 0.0470  -0.0300 298 GLU A CB  
294  C  CG  . GLU A 44  ? 1.4919 1.4818 1.4996 -0.0186 0.0506  -0.0287 298 GLU A CG  
295  C  CD  . GLU A 44  ? 1.6326 1.6215 1.6428 -0.0205 0.0538  -0.0328 298 GLU A CD  
296  O  OE1 . GLU A 44  ? 1.6137 1.6054 1.6281 -0.0214 0.0535  -0.0370 298 GLU A OE1 
297  O  OE2 . GLU A 44  ? 1.6265 1.6117 1.6349 -0.0211 0.0564  -0.0319 298 GLU A OE2 
298  N  N   . ARG A 45  ? 1.0154 1.0200 1.0246 -0.0132 0.0395  -0.0295 299 ARG A N   
299  C  CA  . ARG A 45  ? 1.0301 1.0391 1.0412 -0.0117 0.0359  -0.0312 299 ARG A CA  
300  C  C   . ARG A 45  ? 1.1147 1.1238 1.1243 -0.0101 0.0330  -0.0254 299 ARG A C   
301  O  O   . ARG A 45  ? 1.1340 1.1443 1.1465 -0.0092 0.0298  -0.0256 299 ARG A O   
302  C  CB  . ARG A 45  ? 1.1196 1.1332 1.1296 -0.0103 0.0353  -0.0348 299 ARG A CB  
303  C  CG  . ARG A 45  ? 1.1963 1.2095 1.2089 -0.0121 0.0383  -0.0407 299 ARG A CG  
304  C  CD  . ARG A 45  ? 1.2411 1.2584 1.2585 -0.0119 0.0368  -0.0473 299 ARG A CD  
305  N  NE  . ARG A 45  ? 1.3092 1.3323 1.3247 -0.0089 0.0338  -0.0493 299 ARG A NE  
306  C  CZ  . ARG A 45  ? 1.2913 1.3184 1.3056 -0.0063 0.0296  -0.0482 299 ARG A CZ  
307  N  NH1 . ARG A 45  ? 1.1627 1.1884 1.1780 -0.0062 0.0276  -0.0451 299 ARG A NH1 
308  N  NH2 . ARG A 45  ? 1.1713 1.2041 1.1832 -0.0034 0.0273  -0.0504 299 ARG A NH2 
309  N  N   . VAL A 46  ? 0.9261 0.9338 0.9322 -0.0097 0.0340  -0.0203 300 VAL A N   
310  C  CA  . VAL A 46  ? 0.9172 0.9247 0.9228 -0.0085 0.0316  -0.0144 300 VAL A CA  
311  C  C   . VAL A 46  ? 0.8545 0.8584 0.8643 -0.0094 0.0303  -0.0130 300 VAL A C   
312  O  O   . VAL A 46  ? 0.8180 0.8224 0.8303 -0.0083 0.0269  -0.0109 300 VAL A O   
313  C  CB  . VAL A 46  ? 0.8761 0.8843 0.8774 -0.0078 0.0330  -0.0095 300 VAL A CB  
314  C  CG1 . VAL A 46  ? 0.9073 0.9144 0.9096 -0.0074 0.0314  -0.0029 300 VAL A CG1 
315  C  CG2 . VAL A 46  ? 0.9100 0.9238 0.9077 -0.0058 0.0323  -0.0103 300 VAL A CG2 
316  N  N   . ARG A 47  ? 0.8637 0.8640 0.8741 -0.0110 0.0328  -0.0144 301 ARG A N   
317  C  CA  . ARG A 47  ? 1.0519 1.0494 1.0659 -0.0114 0.0318  -0.0141 301 ARG A CA  
318  C  C   . ARG A 47  ? 1.1810 1.1803 1.1994 -0.0111 0.0292  -0.0177 301 ARG A C   
319  O  O   . ARG A 47  ? 1.1624 1.1611 1.1845 -0.0103 0.0260  -0.0163 301 ARG A O   
320  C  CB  . ARG A 47  ? 1.0972 1.0915 1.1100 -0.0128 0.0354  -0.0156 301 ARG A CB  
321  C  CG  . ARG A 47  ? 1.2106 1.2020 1.2250 -0.0126 0.0346  -0.0133 301 ARG A CG  
322  C  CD  . ARG A 47  ? 1.2917 1.2798 1.3033 -0.0134 0.0381  -0.0136 301 ARG A CD  
323  N  NE  . ARG A 47  ? 1.3238 1.3111 1.3311 -0.0138 0.0410  -0.0126 301 ARG A NE  
324  C  CZ  . ARG A 47  ? 1.4489 1.4359 1.4543 -0.0149 0.0439  -0.0155 301 ARG A CZ  
325  N  NH1 . ARG A 47  ? 1.4397 1.4273 1.4469 -0.0159 0.0449  -0.0196 301 ARG A NH1 
326  N  NH2 . ARG A 47  ? 1.4741 1.4603 1.4763 -0.0149 0.0459  -0.0145 301 ARG A NH2 
327  N  N   . GLN A 48  ? 1.2175 1.2190 1.2362 -0.0116 0.0302  -0.0227 302 GLN A N   
328  C  CA  . GLN A 48  ? 1.3103 1.3141 1.3336 -0.0114 0.0281  -0.0272 302 GLN A CA  
329  C  C   . GLN A 48  ? 1.3408 1.3481 1.3649 -0.0095 0.0241  -0.0271 302 GLN A C   
330  O  O   . GLN A 48  ? 1.5159 1.5260 1.5431 -0.0091 0.0226  -0.0318 302 GLN A O   
331  C  CB  . GLN A 48  ? 1.1918 1.1964 1.2162 -0.0133 0.0316  -0.0330 302 GLN A CB  
332  C  CG  . GLN A 48  ? 1.1953 1.2023 1.2186 -0.0136 0.0330  -0.0360 302 GLN A CG  
333  C  CD  . GLN A 48  ? 1.2893 1.2946 1.3121 -0.0160 0.0379  -0.0386 302 GLN A CD  
334  O  OE1 . GLN A 48  ? 1.2854 1.2871 1.3068 -0.0172 0.0407  -0.0368 302 GLN A OE1 
335  N  NE2 . GLN A 48  ? 1.3697 1.3775 1.3938 -0.0164 0.0388  -0.0428 302 GLN A NE2 
336  N  N   . SER A 49  ? 1.3742 1.3814 1.3956 -0.0081 0.0225  -0.0217 303 SER A N   
337  C  CA  . SER A 49  ? 1.4614 1.4717 1.4827 -0.0058 0.0186  -0.0204 303 SER A CA  
338  C  C   . SER A 49  ? 1.5679 1.5762 1.5926 -0.0048 0.0149  -0.0158 303 SER A C   
339  O  O   . SER A 49  ? 1.4970 1.5036 1.5203 -0.0045 0.0148  -0.0095 303 SER A O   
340  C  CB  . SER A 49  ? 1.4773 1.4901 1.4927 -0.0047 0.0197  -0.0177 303 SER A CB  
341  O  OG  . SER A 49  ? 1.3657 1.3832 1.3803 -0.0031 0.0181  -0.0217 303 SER A OG  
342  N  N   . ALA A 50  ? 1.6553 1.6639 1.6853 -0.0043 0.0120  -0.0193 304 ALA A N   
343  C  CA  . ALA A 50  ? 1.6206 1.6279 1.6549 -0.0027 0.0073  -0.0161 304 ALA A CA  
344  C  C   . ALA A 50  ? 1.5403 1.5497 1.5717 -0.0004 0.0045  -0.0117 304 ALA A C   
345  O  O   . ALA A 50  ? 1.5054 1.5175 1.5380 0.0015  0.0013  -0.0146 304 ALA A O   
346  C  CB  . ALA A 50  ? 1.6212 1.6296 1.6619 -0.0022 0.0046  -0.0220 304 ALA A CB  
347  N  N   . ASP A 51  ? 1.3752 1.3837 1.4026 -0.0003 0.0058  -0.0049 305 ASP A N   
348  C  CA  . ASP A 51  ? 1.3597 1.3701 1.3838 0.0020  0.0036  0.0008  305 ASP A CA  
349  C  C   . ASP A 51  ? 1.3612 1.3681 1.3911 0.0027  -0.0003 0.0066  305 ASP A C   
350  O  O   . ASP A 51  ? 1.3218 1.3258 1.3530 0.0015  0.0008  0.0122  305 ASP A O   
351  C  CB  . ASP A 51  ? 1.3976 1.4097 1.4150 0.0016  0.0075  0.0049  305 ASP A CB  
352  C  CG  . ASP A 51  ? 1.4240 1.4412 1.4351 0.0042  0.0066  0.0067  305 ASP A CG  
353  O  OD1 . ASP A 51  ? 1.3364 1.3542 1.3451 0.0056  0.0057  0.0142  305 ASP A OD1 
354  O  OD2 . ASP A 51  ? 1.3927 1.4137 1.4013 0.0051  0.0069  0.0006  305 ASP A OD2 
355  N  N   . PHE A 52  ? 1.3459 1.3529 1.3800 0.0045  -0.0051 0.0048  306 PHE A N   
356  C  CA  . PHE A 52  ? 1.3920 1.3948 1.4338 0.0050  -0.0092 0.0085  306 PHE A CA  
357  C  C   . PHE A 52  ? 1.3810 1.3832 1.4222 0.0073  -0.0126 0.0165  306 PHE A C   
358  O  O   . PHE A 52  ? 1.3291 1.3350 1.3638 0.0093  -0.0128 0.0184  306 PHE A O   
359  C  CB  . PHE A 52  ? 1.3082 1.3102 1.3576 0.0053  -0.0126 0.0012  306 PHE A CB  
360  C  CG  . PHE A 52  ? 1.2754 1.2765 1.3274 0.0030  -0.0095 -0.0043 306 PHE A CG  
361  C  CD1 . PHE A 52  ? 1.2521 1.2503 1.3044 0.0010  -0.0067 -0.0011 306 PHE A CD1 
362  C  CD2 . PHE A 52  ? 1.2642 1.2678 1.3182 0.0028  -0.0094 -0.0129 306 PHE A CD2 
363  C  CE1 . PHE A 52  ? 1.1482 1.1459 1.2019 -0.0006 -0.0041 -0.0060 306 PHE A CE1 
364  C  CE2 . PHE A 52  ? 1.1851 1.1883 1.2405 0.0008  -0.0063 -0.0174 306 PHE A CE2 
365  C  CZ  . PHE A 52  ? 1.0918 1.0919 1.1466 -0.0007 -0.0038 -0.0139 306 PHE A CZ  
366  N  N   . MSE A 53  ? 1.3443 1.3420 1.3928 0.0070  -0.0154 0.0210  307 MSE A N   
367  C  CA  . MSE A 53  ? 1.3102 1.3059 1.3592 0.0078  -0.0168 0.0309  307 MSE A CA  
368  C  C   . MSE A 53  ? 1.2936 1.2861 1.3506 0.0097  -0.0230 0.0315  307 MSE A C   
369  O  O   . MSE A 53  ? 1.1199 1.1105 1.1846 0.0093  -0.0253 0.0253  307 MSE A O   
370  C  CB  . MSE A 53  ? 1.4018 1.3944 1.4544 0.0049  -0.0137 0.0345  307 MSE A CB  
371  C  CG  . MSE A 53  ? 1.5900 1.5811 1.6427 0.0047  -0.0131 0.0455  307 MSE A CG  
372  SE SE  . MSE A 53  ? 1.7423 1.7389 1.7822 0.0045  -0.0068 0.0518  307 MSE A SE  
373  C  CE  . MSE A 53  ? 1.6603 1.6616 1.6922 0.0041  -0.0030 0.0404  307 MSE A CE  
374  N  N   . PRO A 54  ? 1.3356 1.3277 1.3911 0.0121  -0.0259 0.0387  308 PRO A N   
375  C  CA  . PRO A 54  ? 1.2740 1.2624 1.3380 0.0141  -0.0324 0.0396  308 PRO A CA  
376  C  C   . PRO A 54  ? 1.2793 1.2617 1.3550 0.0122  -0.0341 0.0414  308 PRO A C   
377  O  O   . PRO A 54  ? 1.1893 1.1700 1.2660 0.0098  -0.0307 0.0469  308 PRO A O   
378  C  CB  . PRO A 54  ? 1.3205 1.3092 1.3793 0.0167  -0.0341 0.0493  308 PRO A CB  
379  C  CG  . PRO A 54  ? 1.3071 1.2986 1.3576 0.0151  -0.0280 0.0553  308 PRO A CG  
380  C  CD  . PRO A 54  ? 1.2647 1.2599 1.3109 0.0133  -0.0237 0.0464  308 PRO A CD  
381  N  N   . LEU A 55  ? 1.2331 1.2131 1.3180 0.0135  -0.0394 0.0364  309 LEU A N   
382  C  CA  . LEU A 55  ? 1.3489 1.3233 1.4463 0.0125  -0.0424 0.0374  309 LEU A CA  
383  C  C   . LEU A 55  ? 1.2988 1.2690 1.3997 0.0112  -0.0418 0.0487  309 LEU A C   
384  O  O   . LEU A 55  ? 1.2500 1.2181 1.3560 0.0086  -0.0396 0.0496  309 LEU A O   
385  C  CB  . LEU A 55  ? 1.4086 1.3807 1.5153 0.0151  -0.0496 0.0333  309 LEU A CB  
386  C  CG  . LEU A 55  ? 1.4636 1.4370 1.5769 0.0149  -0.0510 0.0220  309 LEU A CG  
387  C  CD1 . LEU A 55  ? 1.5901 1.5695 1.6942 0.0139  -0.0460 0.0145  309 LEU A CD1 
388  C  CD2 . LEU A 55  ? 1.4321 1.4042 1.5536 0.0180  -0.0582 0.0178  309 LEU A CD2 
389  N  N   . LYS A 56  ? 1.2628 1.2319 1.3610 0.0132  -0.0439 0.0569  310 LYS A N   
390  C  CA  . LYS A 56  ? 1.2825 1.2482 1.3827 0.0122  -0.0429 0.0692  310 LYS A CA  
391  C  C   . LYS A 56  ? 1.1762 1.1425 1.2762 0.0085  -0.0369 0.0714  310 LYS A C   
392  O  O   . LYS A 56  ? 1.0778 1.0396 1.1887 0.0066  -0.0378 0.0737  310 LYS A O   
393  C  CB  . LYS A 56  ? 1.3255 1.2939 1.4149 0.0146  -0.0423 0.0771  310 LYS A CB  
394  C  CG  . LYS A 56  ? 1.4972 1.4649 1.5873 0.0187  -0.0487 0.0754  310 LYS A CG  
395  C  CD  . LYS A 56  ? 1.5575 1.5235 1.6444 0.0211  -0.0507 0.0872  310 LYS A CD  
396  C  CE  . LYS A 56  ? 1.5260 1.4863 1.6227 0.0239  -0.0586 0.0877  310 LYS A CE  
397  N  NZ  . LYS A 56  ? 1.4999 1.4577 1.5939 0.0263  -0.0607 0.1003  310 LYS A NZ  
398  N  N   . GLN A 57  ? 1.1777 1.1494 1.2663 0.0077  -0.0314 0.0693  311 GLN A N   
399  C  CA  . GLN A 57  ? 1.1830 1.1559 1.2701 0.0045  -0.0256 0.0703  311 GLN A CA  
400  C  C   . GLN A 57  ? 1.0925 1.0624 1.1900 0.0024  -0.0262 0.0640  311 GLN A C   
401  O  O   . GLN A 57  ? 1.0758 1.0435 1.1795 0.0001  -0.0245 0.0681  311 GLN A O   
402  C  CB  . GLN A 57  ? 1.2711 1.2505 1.3448 0.0045  -0.0204 0.0664  311 GLN A CB  
403  C  CG  . GLN A 57  ? 1.2872 1.2711 1.3493 0.0065  -0.0186 0.0723  311 GLN A CG  
404  C  CD  . GLN A 57  ? 1.3203 1.3037 1.3822 0.0058  -0.0165 0.0847  311 GLN A CD  
405  O  OE1 . GLN A 57  ? 1.3059 1.2874 1.3731 0.0030  -0.0137 0.0884  311 GLN A OE1 
406  N  NE2 . GLN A 57  ? 1.3635 1.3487 1.4190 0.0085  -0.0178 0.0911  311 GLN A NE2 
407  N  N   . MSE A 58  ? 1.0248 0.9952 1.1244 0.0034  -0.0288 0.0539  312 MSE A N   
408  C  CA  . MSE A 58  ? 1.0922 1.0606 1.2009 0.0023  -0.0300 0.0471  312 MSE A CA  
409  C  C   . MSE A 58  ? 1.1142 1.0770 1.2373 0.0023  -0.0350 0.0506  312 MSE A C   
410  O  O   . MSE A 58  ? 1.1596 1.1203 1.2900 0.0004  -0.0341 0.0516  312 MSE A O   
411  C  CB  . MSE A 58  ? 1.1944 1.1651 1.3023 0.0037  -0.0318 0.0359  312 MSE A CB  
412  C  CG  . MSE A 58  ? 1.2892 1.2651 1.3850 0.0033  -0.0270 0.0303  312 MSE A CG  
413  SE SE  . MSE A 58  ? 1.3863 1.3645 1.4734 0.0003  -0.0189 0.0331  312 MSE A SE  
414  C  CE  . MSE A 58  ? 1.1555 1.1348 1.2354 0.0010  -0.0176 0.0446  312 MSE A CE  
415  N  N   . MSE A 59  ? 0.9967 0.9569 1.1243 0.0045  -0.0404 0.0526  313 MSE A N   
416  C  CA  . MSE A 59  ? 1.0332 0.9874 1.1749 0.0047  -0.0454 0.0574  313 MSE A CA  
417  C  C   . MSE A 59  ? 1.0578 1.0094 1.2028 0.0021  -0.0423 0.0683  313 MSE A C   
418  O  O   . MSE A 59  ? 0.9221 0.8696 1.0800 0.0007  -0.0442 0.0696  313 MSE A O   
419  C  CB  . MSE A 59  ? 1.1200 1.0719 1.2637 0.0077  -0.0510 0.0599  313 MSE A CB  
420  C  CG  . MSE A 59  ? 1.1399 1.0947 1.2804 0.0106  -0.0544 0.0502  313 MSE A CG  
421  SE SE  . MSE A 59  ? 1.3363 1.2902 1.4909 0.0112  -0.0593 0.0368  313 MSE A SE  
422  C  CE  . MSE A 59  ? 1.2900 1.2435 1.4492 0.0158  -0.0676 0.0315  313 MSE A CE  
423  N  N   . LYS A 60  ? 1.0764 1.0309 1.2101 0.0015  -0.0374 0.0758  314 LYS A N   
424  C  CA  . LYS A 60  ? 1.1339 1.0873 1.2697 -0.0011 -0.0335 0.0857  314 LYS A CA  
425  C  C   . LYS A 60  ? 1.1116 1.0647 1.2546 -0.0037 -0.0315 0.0811  314 LYS A C   
426  O  O   . LYS A 60  ? 1.0603 1.0092 1.2168 -0.0052 -0.0334 0.0843  314 LYS A O   
427  C  CB  . LYS A 60  ? 1.2557 1.2145 1.3764 -0.0013 -0.0276 0.0918  314 LYS A CB  
428  C  CG  . LYS A 60  ? 1.3175 1.2762 1.4399 -0.0039 -0.0230 0.1023  314 LYS A CG  
429  C  CD  . LYS A 60  ? 1.3705 1.3318 1.4837 -0.0029 -0.0206 0.1133  314 LYS A CD  
430  C  CE  . LYS A 60  ? 1.3656 1.3257 1.4851 -0.0058 -0.0170 0.1246  314 LYS A CE  
431  N  NZ  . LYS A 60  ? 1.2963 1.2573 1.4104 -0.0050 -0.0153 0.1374  314 LYS A NZ  
432  N  N   . THR A 61  ? 1.0746 1.0321 1.2094 -0.0040 -0.0280 0.0733  315 THR A N   
433  C  CA  . THR A 61  ? 1.0642 1.0217 1.2050 -0.0058 -0.0266 0.0679  315 THR A CA  
434  C  C   . THR A 61  ? 1.0517 1.0048 1.2082 -0.0052 -0.0327 0.0627  315 THR A C   
435  O  O   . THR A 61  ? 1.0695 1.0202 1.2372 -0.0069 -0.0332 0.0641  315 THR A O   
436  C  CB  . THR A 61  ? 1.0743 1.0366 1.2040 -0.0058 -0.0227 0.0595  315 THR A CB  
437  O  OG1 . THR A 61  ? 0.9556 0.9220 1.0712 -0.0059 -0.0177 0.0631  315 THR A OG1 
438  C  CG2 . THR A 61  ? 1.0396 1.0019 1.1744 -0.0075 -0.0207 0.0560  315 THR A CG2 
439  N  N   . LEU A 62  ? 1.0107 0.9631 1.1687 -0.0027 -0.0376 0.0565  316 LEU A N   
440  C  CA  . LEU A 62  ? 0.9424 0.8914 1.1153 -0.0016 -0.0439 0.0504  316 LEU A CA  
441  C  C   . LEU A 62  ? 0.9511 0.8942 1.1390 -0.0023 -0.0478 0.0579  316 LEU A C   
442  O  O   . LEU A 62  ? 0.8930 0.8338 1.0937 -0.0033 -0.0497 0.0559  316 LEU A O   
443  C  CB  . LEU A 62  ? 0.9124 0.8626 1.0841 0.0014  -0.0482 0.0420  316 LEU A CB  
444  C  CG  . LEU A 62  ? 0.8888 0.8446 1.0493 0.0021  -0.0453 0.0325  316 LEU A CG  
445  C  CD1 . LEU A 62  ? 0.8848 0.8419 1.0466 0.0049  -0.0499 0.0244  316 LEU A CD1 
446  C  CD2 . LEU A 62  ? 0.8254 0.7832 0.9869 0.0010  -0.0428 0.0263  316 LEU A CD2 
447  N  N   . ASN A 63  ? 1.0472 0.9876 1.2341 -0.0017 -0.0491 0.0667  317 ASN A N   
448  C  CA  . ASN A 63  ? 1.0730 1.0071 1.2744 -0.0028 -0.0522 0.0756  317 ASN A CA  
449  C  C   . ASN A 63  ? 1.0263 0.9601 1.2324 -0.0064 -0.0476 0.0824  317 ASN A C   
450  O  O   . ASN A 63  ? 0.9645 0.8945 1.1866 -0.0077 -0.0502 0.0825  317 ASN A O   
451  C  CB  . ASN A 63  ? 1.1464 1.0778 1.3446 -0.0013 -0.0543 0.0846  317 ASN A CB  
452  C  CG  . ASN A 63  ? 1.2602 1.1907 1.4597 0.0024  -0.0607 0.0776  317 ASN A CG  
453  O  OD1 . ASN A 63  ? 1.1844 1.1177 1.3718 0.0046  -0.0605 0.0775  317 ASN A OD1 
454  N  ND2 . ASN A 63  ? 1.3868 1.3138 1.6016 0.0033  -0.0668 0.0712  317 ASN A ND2 
455  N  N   . ASN A 64  ? 1.1134 1.0516 1.3062 -0.0078 -0.0407 0.0869  318 ASN A N   
456  C  CA  . ASN A 64  ? 1.1473 1.0863 1.3437 -0.0111 -0.0359 0.0920  318 ASN A CA  
457  C  C   . ASN A 64  ? 1.1518 1.0905 1.3590 -0.0120 -0.0373 0.0835  318 ASN A C   
458  O  O   . ASN A 64  ? 1.2433 1.1789 1.4648 -0.0140 -0.0382 0.0872  318 ASN A O   
459  C  CB  . ASN A 64  ? 1.2179 1.1630 1.3975 -0.0121 -0.0285 0.0951  318 ASN A CB  
460  C  CG  . ASN A 64  ? 1.3701 1.3157 1.5422 -0.0121 -0.0259 0.1071  318 ASN A CG  
461  O  OD1 . ASN A 64  ? 1.3879 1.3288 1.5690 -0.0122 -0.0288 0.1152  318 ASN A OD1 
462  N  ND2 . ASN A 64  ? 1.3997 1.3512 1.5554 -0.0117 -0.0207 0.1083  318 ASN A ND2 
463  N  N   . ASP A 65  ? 1.0982 1.0403 1.2990 -0.0103 -0.0376 0.0723  319 ASP A N   
464  C  CA  . ASP A 65  ? 0.9512 0.8941 1.1599 -0.0106 -0.0386 0.0637  319 ASP A CA  
465  C  C   . ASP A 65  ? 0.9196 0.8591 1.1437 -0.0088 -0.0460 0.0563  319 ASP A C   
466  O  O   . ASP A 65  ? 0.8693 0.8081 1.1050 -0.0093 -0.0478 0.0523  319 ASP A O   
467  C  CB  . ASP A 65  ? 0.9894 0.9376 1.1839 -0.0097 -0.0351 0.0554  319 ASP A CB  
468  C  CG  . ASP A 65  ? 1.0223 0.9743 1.2060 -0.0117 -0.0279 0.0599  319 ASP A CG  
469  O  OD1 . ASP A 65  ? 1.0671 1.0188 1.2491 -0.0134 -0.0248 0.0699  319 ASP A OD1 
470  O  OD2 . ASP A 65  ? 1.0160 0.9714 1.1925 -0.0113 -0.0253 0.0532  319 ASP A OD2 
471  N  N   . LEU A 66  ? 0.9713 0.9093 1.1959 -0.0063 -0.0507 0.0532  320 LEU A N   
472  C  CA  . LEU A 66  ? 1.0337 0.9698 1.2724 -0.0042 -0.0577 0.0442  320 LEU A CA  
473  C  C   . LEU A 66  ? 1.0832 1.0128 1.3381 -0.0039 -0.0638 0.0490  320 LEU A C   
474  O  O   . LEU A 66  ? 1.0865 1.0141 1.3554 -0.0021 -0.0701 0.0416  320 LEU A O   
475  C  CB  . LEU A 66  ? 1.0806 1.0206 1.3103 -0.0013 -0.0591 0.0338  320 LEU A CB  
476  C  CG  . LEU A 66  ? 1.0992 1.0449 1.3173 -0.0014 -0.0542 0.0271  320 LEU A CG  
477  C  CD1 . LEU A 66  ? 1.1196 1.0694 1.3285 0.0013  -0.0550 0.0178  320 LEU A CD1 
478  C  CD2 . LEU A 66  ? 1.1139 1.0598 1.3432 -0.0017 -0.0556 0.0222  320 LEU A CD2 
479  N  N   . GLY A 67  ? 1.0249 0.9512 1.2784 -0.0055 -0.0620 0.0612  321 GLY A N   
480  C  CA  . GLY A 67  ? 1.1609 1.0804 1.4286 -0.0053 -0.0674 0.0674  321 GLY A CA  
481  C  C   . GLY A 67  ? 1.2248 1.1436 1.4864 -0.0022 -0.0711 0.0663  321 GLY A C   
482  O  O   . GLY A 67  ? 1.3762 1.3000 1.6222 -0.0007 -0.0687 0.0618  321 GLY A O   
483  N  N   . PRO A 68  ? 1.3024 1.2148 1.5765 -0.0011 -0.0770 0.0706  322 PRO A N   
484  C  CA  . PRO A 68  ? 1.2620 1.1737 1.5318 0.0024  -0.0816 0.0680  322 PRO A CA  
485  C  C   . PRO A 68  ? 1.1502 1.0625 1.4301 0.0054  -0.0885 0.0543  322 PRO A C   
486  O  O   . PRO A 68  ? 1.1167 1.0301 1.3921 0.0084  -0.0919 0.0495  322 PRO A O   
487  C  CB  . PRO A 68  ? 1.3263 1.2306 1.6042 0.0020  -0.0844 0.0808  322 PRO A CB  
488  C  CG  . PRO A 68  ? 1.3042 1.2061 1.5897 -0.0021 -0.0802 0.0903  322 PRO A CG  
489  C  CD  . PRO A 68  ? 1.3022 1.2077 1.5928 -0.0033 -0.0790 0.0804  322 PRO A CD  
490  N  N   . ASN A 69  ? 1.1633 1.0751 1.4569 0.0048  -0.0907 0.0478  323 ASN A N   
491  C  CA  . ASN A 69  ? 1.2268 1.1406 1.5291 0.0079  -0.0968 0.0337  323 ASN A CA  
492  C  C   . ASN A 69  ? 1.2008 1.1229 1.4870 0.0099  -0.0940 0.0231  323 ASN A C   
493  O  O   . ASN A 69  ? 1.0728 0.9969 1.3619 0.0131  -0.0989 0.0135  323 ASN A O   
494  C  CB  . ASN A 69  ? 1.2416 1.1542 1.5616 0.0071  -0.0996 0.0284  323 ASN A CB  
495  C  CG  . ASN A 69  ? 1.3626 1.2788 1.6767 0.0039  -0.0924 0.0303  323 ASN A CG  
496  O  OD1 . ASN A 69  ? 1.3420 1.2609 1.6393 0.0020  -0.0853 0.0364  323 ASN A OD1 
497  N  ND2 . ASN A 69  ? 1.2937 1.2097 1.6221 0.0035  -0.0947 0.0247  323 ASN A ND2 
498  N  N   . TRP A 70  ? 1.1741 1.1008 1.4440 0.0078  -0.0862 0.0255  324 TRP A N   
499  C  CA  . TRP A 70  ? 1.1260 1.0603 1.3832 0.0087  -0.0824 0.0157  324 TRP A CA  
500  C  C   . TRP A 70  ? 1.0996 1.0378 1.3511 0.0119  -0.0850 0.0068  324 TRP A C   
501  O  O   . TRP A 70  ? 1.1752 1.1188 1.4240 0.0133  -0.0846 -0.0037 324 TRP A O   
502  C  CB  . TRP A 70  ? 1.0794 1.0169 1.3190 0.0061  -0.0738 0.0217  324 TRP A CB  
503  C  CG  . TRP A 70  ? 1.0682 1.0064 1.2944 0.0064  -0.0715 0.0273  324 TRP A CG  
504  C  CD1 . TRP A 70  ? 1.1440 1.0783 1.3687 0.0054  -0.0708 0.0389  324 TRP A CD1 
505  C  CD2 . TRP A 70  ? 1.0309 0.9743 1.2437 0.0081  -0.0698 0.0213  324 TRP A CD2 
506  N  NE1 . TRP A 70  ? 1.1163 1.0533 1.3272 0.0067  -0.0691 0.0402  324 TRP A NE1 
507  C  CE2 . TRP A 70  ? 1.0511 0.9936 1.2552 0.0082  -0.0685 0.0293  324 TRP A CE2 
508  C  CE3 . TRP A 70  ? 1.0399 0.9889 1.2477 0.0095  -0.0691 0.0101  324 TRP A CE3 
509  C  CZ2 . TRP A 70  ? 1.0512 0.9981 1.2426 0.0096  -0.0669 0.0258  324 TRP A CZ2 
510  C  CZ3 . TRP A 70  ? 1.0896 1.0428 1.2850 0.0106  -0.0671 0.0071  324 TRP A CZ3 
511  C  CH2 . TRP A 70  ? 1.0668 1.0188 1.2546 0.0106  -0.0662 0.0146  324 TRP A CH2 
512  N  N   . ARG A 71  ? 1.0414 0.9773 1.2908 0.0132  -0.0875 0.0109  325 ARG A N   
513  C  CA  . ARG A 71  ? 1.1144 1.0543 1.3599 0.0163  -0.0903 0.0022  325 ARG A CA  
514  C  C   . ARG A 71  ? 1.0343 0.9748 1.2951 0.0192  -0.0974 -0.0092 325 ARG A C   
515  O  O   . ARG A 71  ? 1.0106 0.9571 1.2682 0.0216  -0.0984 -0.0200 325 ARG A O   
516  C  CB  . ARG A 71  ? 1.1349 1.0721 1.3753 0.0173  -0.0917 0.0097  325 ARG A CB  
517  C  CG  . ARG A 71  ? 1.2016 1.1434 1.4345 0.0201  -0.0932 0.0025  325 ARG A CG  
518  C  CD  . ARG A 71  ? 1.2206 1.1700 1.4381 0.0193  -0.0866 -0.0032 325 ARG A CD  
519  N  NE  . ARG A 71  ? 1.2243 1.1785 1.4365 0.0218  -0.0881 -0.0104 325 ARG A NE  
520  C  CZ  . ARG A 71  ? 1.2402 1.1983 1.4587 0.0243  -0.0920 -0.0219 325 ARG A CZ  
521  N  NH1 . ARG A 71  ? 1.2102 1.1681 1.4406 0.0251  -0.0953 -0.0282 325 ARG A NH1 
522  N  NH2 . ARG A 71  ? 1.3517 1.3144 1.5648 0.0263  -0.0926 -0.0276 325 ARG A NH2 
523  N  N   . ASP A 72  ? 1.0522 0.9872 1.3297 0.0190  -0.1021 -0.0071 326 ASP A N   
524  C  CA  . ASP A 72  ? 1.1064 1.0413 1.4010 0.0219  -0.1097 -0.0174 326 ASP A CA  
525  C  C   . ASP A 72  ? 1.0482 0.9905 1.3416 0.0230  -0.1083 -0.0296 326 ASP A C   
526  O  O   . ASP A 72  ? 0.9715 0.9172 1.2724 0.0264  -0.1135 -0.0405 326 ASP A O   
527  C  CB  . ASP A 72  ? 1.1556 1.0825 1.4697 0.0211  -0.1148 -0.0119 326 ASP A CB  
528  C  CG  . ASP A 72  ? 1.1277 1.0467 1.4454 0.0205  -0.1172 0.0002  326 ASP A CG  
529  O  OD1 . ASP A 72  ? 1.0101 0.9298 1.3205 0.0225  -0.1184 0.0002  326 ASP A OD1 
530  O  OD2 . ASP A 72  ? 1.1149 1.0273 1.4425 0.0181  -0.1175 0.0097  326 ASP A OD2 
531  N  N   . LYS A 73  ? 1.0226 0.9677 1.3064 0.0206  -0.1016 -0.0278 327 LYS A N   
532  C  CA  . LYS A 73  ? 0.9975 0.9502 1.2761 0.0218  -0.0993 -0.0386 327 LYS A CA  
533  C  C   . LYS A 73  ? 0.9620 0.9220 1.2273 0.0237  -0.0969 -0.0461 327 LYS A C   
534  O  O   . LYS A 73  ? 0.8665 0.8330 1.1298 0.0255  -0.0963 -0.0559 327 LYS A O   
535  C  CB  . LYS A 73  ? 1.0738 1.0275 1.3440 0.0188  -0.0925 -0.0342 327 LYS A CB  
536  C  CG  . LYS A 73  ? 1.0916 1.0413 1.3764 0.0178  -0.0950 -0.0322 327 LYS A CG  
537  C  CD  . LYS A 73  ? 1.1250 1.0727 1.4032 0.0139  -0.0886 -0.0224 327 LYS A CD  
538  C  CE  . LYS A 73  ? 1.1668 1.1112 1.4622 0.0132  -0.0919 -0.0222 327 LYS A CE  
539  N  NZ  . LYS A 73  ? 1.2507 1.1933 1.5421 0.0095  -0.0860 -0.0130 327 LYS A NZ  
540  N  N   . LEU A 74  ? 0.9906 0.9500 1.2474 0.0233  -0.0955 -0.0417 328 LEU A N   
541  C  CA  . LEU A 74  ? 0.9515 0.9177 1.1952 0.0243  -0.0921 -0.0477 328 LEU A CA  
542  C  C   . LEU A 74  ? 0.9442 0.9122 1.1936 0.0275  -0.0978 -0.0542 328 LEU A C   
543  O  O   . LEU A 74  ? 1.0069 0.9694 1.2641 0.0282  -0.1026 -0.0493 328 LEU A O   
544  C  CB  . LEU A 74  ? 0.9167 0.8821 1.1452 0.0215  -0.0856 -0.0387 328 LEU A CB  
545  C  CG  . LEU A 74  ? 0.9111 0.8747 1.1331 0.0181  -0.0795 -0.0311 328 LEU A CG  
546  C  CD1 . LEU A 74  ? 0.9121 0.8751 1.1196 0.0158  -0.0738 -0.0225 328 LEU A CD1 
547  C  CD2 . LEU A 74  ? 0.8270 0.7958 1.0442 0.0181  -0.0759 -0.0381 328 LEU A CD2 
548  N  N   . GLU A 75  ? 0.9289 0.9049 1.1743 0.0295  -0.0970 -0.0648 329 GLU A N   
549  C  CA  . GLU A 75  ? 0.9042 0.8839 1.1494 0.0320  -0.0998 -0.0707 329 GLU A CA  
550  C  C   . GLU A 75  ? 0.8972 0.8777 1.1282 0.0303  -0.0948 -0.0652 329 GLU A C   
551  O  O   . GLU A 75  ? 0.9173 0.8982 1.1500 0.0320  -0.0982 -0.0667 329 GLU A O   
552  C  CB  . GLU A 75  ? 0.9366 0.9258 1.1807 0.0343  -0.0991 -0.0836 329 GLU A CB  
553  C  CG  . GLU A 75  ? 0.9633 0.9545 1.2223 0.0376  -0.1056 -0.0929 329 GLU A CG  
554  C  CD  . GLU A 75  ? 1.0883 1.0903 1.3438 0.0399  -0.1038 -0.1052 329 GLU A CD  
555  O  OE1 . GLU A 75  ? 1.1135 1.1208 1.3553 0.0385  -0.0971 -0.1059 329 GLU A OE1 
556  O  OE2 . GLU A 75  ? 1.1446 1.1501 1.4112 0.0432  -0.1089 -0.1144 329 GLU A OE2 
557  N  N   . TYR A 76  ? 0.8791 0.8601 1.0964 0.0271  -0.0872 -0.0597 330 TYR A N   
558  C  CA  . TYR A 76  ? 0.7736 0.7566 0.9776 0.0257  -0.0824 -0.0563 330 TYR A CA  
559  C  C   . TYR A 76  ? 0.7987 0.7793 0.9915 0.0221  -0.0754 -0.0471 330 TYR A C   
560  O  O   . TYR A 76  ? 0.8278 0.8083 1.0199 0.0208  -0.0726 -0.0469 330 TYR A O   
561  C  CB  . TYR A 76  ? 0.7721 0.7639 0.9711 0.0268  -0.0799 -0.0667 330 TYR A CB  
562  C  CG  . TYR A 76  ? 0.7733 0.7687 0.9584 0.0249  -0.0737 -0.0653 330 TYR A CG  
563  C  CD1 . TYR A 76  ? 0.7610 0.7551 0.9439 0.0256  -0.0754 -0.0622 330 TYR A CD1 
564  C  CD2 . TYR A 76  ? 0.7777 0.7776 0.9521 0.0228  -0.0662 -0.0674 330 TYR A CD2 
565  C  CE1 . TYR A 76  ? 0.7579 0.7553 0.9292 0.0241  -0.0702 -0.0614 330 TYR A CE1 
566  C  CE2 . TYR A 76  ? 0.8153 0.8182 0.9783 0.0210  -0.0606 -0.0664 330 TYR A CE2 
567  C  CZ  . TYR A 76  ? 0.8399 0.8417 1.0016 0.0217  -0.0627 -0.0637 330 TYR A CZ  
568  O  OH  . TYR A 76  ? 0.7993 0.8043 0.9507 0.0201  -0.0578 -0.0631 330 TYR A OH  
569  N  N   . PHE A 77  ? 0.7833 0.7622 0.9678 0.0210  -0.0732 -0.0399 331 PHE A N   
570  C  CA  . PHE A 77  ? 0.7514 0.7290 0.9244 0.0180  -0.0666 -0.0319 331 PHE A CA  
571  C  C   . PHE A 77  ? 0.7527 0.7340 0.9141 0.0177  -0.0632 -0.0320 331 PHE A C   
572  O  O   . PHE A 77  ? 0.8282 0.8083 0.9898 0.0191  -0.0663 -0.0295 331 PHE A O   
573  C  CB  . PHE A 77  ? 0.7993 0.7698 0.9755 0.0168  -0.0679 -0.0205 331 PHE A CB  
574  C  CG  . PHE A 77  ? 0.8077 0.7778 0.9720 0.0139  -0.0610 -0.0126 331 PHE A CG  
575  C  CD1 . PHE A 77  ? 0.7836 0.7539 0.9461 0.0117  -0.0568 -0.0118 331 PHE A CD1 
576  C  CD2 . PHE A 77  ? 0.8065 0.7768 0.9614 0.0136  -0.0589 -0.0066 331 PHE A CD2 
577  C  CE1 . PHE A 77  ? 0.8081 0.7784 0.9598 0.0092  -0.0505 -0.0052 331 PHE A CE1 
578  C  CE2 . PHE A 77  ? 0.7622 0.7330 0.9061 0.0112  -0.0526 -0.0004 331 PHE A CE2 
579  C  CZ  . PHE A 77  ? 0.7732 0.7438 0.9157 0.0089  -0.0483 0.0005  331 PHE A CZ  
580  N  N   . GLU A 78  ? 0.7970 0.7828 0.9487 0.0160  -0.0570 -0.0353 332 GLU A N   
581  C  CA  . GLU A 78  ? 0.7888 0.7787 0.9307 0.0156  -0.0535 -0.0367 332 GLU A CA  
582  C  C   . GLU A 78  ? 0.8101 0.7974 0.9430 0.0140  -0.0502 -0.0271 332 GLU A C   
583  O  O   . GLU A 78  ? 0.8010 0.7867 0.9287 0.0118  -0.0458 -0.0220 332 GLU A O   
584  C  CB  . GLU A 78  ? 0.7895 0.7849 0.9258 0.0144  -0.0481 -0.0438 332 GLU A CB  
585  C  CG  . GLU A 78  ? 0.7789 0.7793 0.9068 0.0137  -0.0442 -0.0472 332 GLU A CG  
586  C  CD  . GLU A 78  ? 0.8173 0.8236 0.9444 0.0133  -0.0409 -0.0562 332 GLU A CD  
587  O  OE1 . GLU A 78  ? 0.8730 0.8808 0.9923 0.0111  -0.0346 -0.0560 332 GLU A OE1 
588  O  OE2 . GLU A 78  ? 0.8679 0.8774 1.0024 0.0153  -0.0445 -0.0634 332 GLU A OE2 
589  N  N   . GLU A 79  ? 0.8526 0.8399 0.9834 0.0155  -0.0526 -0.0248 333 GLU A N   
590  C  CA  . GLU A 79  ? 0.8599 0.8447 0.9835 0.0149  -0.0510 -0.0151 333 GLU A CA  
591  C  C   . GLU A 79  ? 0.7817 0.7702 0.8929 0.0130  -0.0442 -0.0148 333 GLU A C   
592  O  O   . GLU A 79  ? 0.8018 0.7887 0.9069 0.0117  -0.0412 -0.0073 333 GLU A O   
593  C  CB  . GLU A 79  ? 0.8428 0.8259 0.9693 0.0178  -0.0569 -0.0121 333 GLU A CB  
594  C  CG  . GLU A 79  ? 0.8864 0.8642 1.0263 0.0194  -0.0635 -0.0104 333 GLU A CG  
595  C  CD  . GLU A 79  ? 0.8435 0.8188 0.9875 0.0226  -0.0700 -0.0072 333 GLU A CD  
596  O  OE1 . GLU A 79  ? 0.8119 0.7895 0.9477 0.0237  -0.0694 -0.0053 333 GLU A OE1 
597  O  OE2 . GLU A 79  ? 0.8803 0.8513 1.0359 0.0241  -0.0759 -0.0067 333 GLU A OE2 
598  N  N   . ARG A 80  ? 0.7654 0.7589 0.8737 0.0126  -0.0417 -0.0230 334 ARG A N   
599  C  CA  . ARG A 80  ? 0.7755 0.7722 0.8736 0.0107  -0.0355 -0.0235 334 ARG A CA  
600  C  C   . ARG A 80  ? 0.7614 0.7572 0.8587 0.0083  -0.0311 -0.0241 334 ARG A C   
601  O  O   . ARG A 80  ? 0.7970 0.7936 0.9005 0.0086  -0.0324 -0.0297 334 ARG A O   
602  C  CB  . ARG A 80  ? 0.8027 0.8051 0.8996 0.0113  -0.0348 -0.0323 334 ARG A CB  
603  C  CG  . ARG A 80  ? 0.8669 0.8727 0.9546 0.0091  -0.0283 -0.0340 334 ARG A CG  
604  C  CD  . ARG A 80  ? 0.8809 0.8922 0.9686 0.0100  -0.0286 -0.0416 334 ARG A CD  
605  N  NE  . ARG A 80  ? 0.9211 0.9350 1.0161 0.0103  -0.0299 -0.0496 334 ARG A NE  
606  C  CZ  . ARG A 80  ? 0.9458 0.9630 1.0402 0.0083  -0.0252 -0.0553 334 ARG A CZ  
607  N  NH1 . ARG A 80  ? 0.9509 0.9687 1.0378 0.0057  -0.0190 -0.0542 334 ARG A NH1 
608  N  NH2 . ARG A 80  ? 0.8471 0.8673 0.9484 0.0090  -0.0268 -0.0623 334 ARG A NH2 
609  N  N   . PRO A 81  ? 0.7167 0.7115 0.8065 0.0063  -0.0262 -0.0188 335 PRO A N   
610  C  CA  . PRO A 81  ? 0.7277 0.7220 0.8160 0.0043  -0.0220 -0.0200 335 PRO A CA  
611  C  C   . PRO A 81  ? 0.7385 0.7372 0.8236 0.0035  -0.0183 -0.0279 335 PRO A C   
612  O  O   . PRO A 81  ? 0.7399 0.7418 0.8218 0.0037  -0.0175 -0.0309 335 PRO A O   
613  C  CB  . PRO A 81  ? 0.7047 0.6976 0.7857 0.0027  -0.0179 -0.0130 335 PRO A CB  
614  C  CG  . PRO A 81  ? 0.7559 0.7509 0.8313 0.0035  -0.0179 -0.0113 335 PRO A CG  
615  C  CD  . PRO A 81  ? 0.7544 0.7498 0.8357 0.0060  -0.0237 -0.0135 335 PRO A CD  
616  N  N   . PHE A 82  ? 0.7546 0.7536 0.8411 0.0028  -0.0164 -0.0314 336 PHE A N   
617  C  CA  . PHE A 82  ? 0.8396 0.8425 0.9219 0.0017  -0.0119 -0.0376 336 PHE A CA  
618  C  C   . PHE A 82  ? 0.8160 0.8180 0.8898 -0.0006 -0.0056 -0.0350 336 PHE A C   
619  O  O   . PHE A 82  ? 0.8567 0.8612 0.9269 -0.0018 -0.0014 -0.0389 336 PHE A O   
620  C  CB  . PHE A 82  ? 0.8575 0.8629 0.9458 0.0027  -0.0134 -0.0444 336 PHE A CB  
621  C  CG  . PHE A 82  ? 0.9242 0.9281 1.0120 0.0024  -0.0116 -0.0439 336 PHE A CG  
622  C  CD1 . PHE A 82  ? 0.8791 0.8852 0.9610 0.0011  -0.0062 -0.0466 336 PHE A CD1 
623  C  CD2 . PHE A 82  ? 1.0164 1.0168 1.1102 0.0035  -0.0155 -0.0408 336 PHE A CD2 
624  C  CE1 . PHE A 82  ? 0.9774 0.9822 1.0582 0.0013  -0.0048 -0.0462 336 PHE A CE1 
625  C  CE2 . PHE A 82  ? 1.0262 1.0258 1.1200 0.0035  -0.0142 -0.0411 336 PHE A CE2 
626  C  CZ  . PHE A 82  ? 0.9998 1.0017 1.0866 0.0026  -0.0090 -0.0439 336 PHE A CZ  
627  N  N   . ALA A 83  ? 0.8486 0.8472 0.9199 -0.0012 -0.0050 -0.0282 337 ALA A N   
628  C  CA  . ALA A 83  ? 0.8292 0.8268 0.8929 -0.0030 0.0003  -0.0254 337 ALA A CA  
629  C  C   . ALA A 83  ? 0.8106 0.8052 0.8725 -0.0033 0.0000  -0.0176 337 ALA A C   
630  O  O   . ALA A 83  ? 0.7911 0.7833 0.8587 -0.0024 -0.0038 -0.0137 337 ALA A O   
631  C  CB  . ALA A 83  ? 0.8256 0.8228 0.8889 -0.0035 0.0027  -0.0279 337 ALA A CB  
632  N  N   . ALA A 84  ? 0.8553 0.8504 0.9099 -0.0045 0.0042  -0.0156 338 ALA A N   
633  C  CA  . ALA A 84  ? 0.8665 0.8600 0.9176 -0.0050 0.0053  -0.0088 338 ALA A CA  
634  C  C   . ALA A 84  ? 0.8332 0.8244 0.8835 -0.0059 0.0079  -0.0072 338 ALA A C   
635  O  O   . ALA A 84  ? 0.7994 0.7909 0.8479 -0.0065 0.0103  -0.0112 338 ALA A O   
636  C  CB  . ALA A 84  ? 0.9072 0.9031 0.9509 -0.0055 0.0085  -0.0087 338 ALA A CB  
637  N  N   . ALA A 85  ? 0.8402 0.8294 0.8930 -0.0060 0.0068  -0.0015 339 ALA A N   
638  C  CA  . ALA A 85  ? 0.8389 0.8264 0.8904 -0.0068 0.0094  0.0007  339 ALA A CA  
639  C  C   . ALA A 85  ? 0.8584 0.8466 0.9044 -0.0075 0.0121  0.0062  339 ALA A C   
640  O  O   . ALA A 85  ? 0.7702 0.7601 0.8139 -0.0071 0.0114  0.0086  339 ALA A O   
641  C  CB  . ALA A 85  ? 0.8574 0.8425 0.9174 -0.0063 0.0060  0.0025  339 ALA A CB  
642  N  N   . SER A 86  ? 0.8108 0.7980 0.8544 -0.0083 0.0150  0.0081  340 SER A N   
643  C  CA  . SER A 86  ? 0.8825 0.8711 0.9205 -0.0089 0.0181  0.0123  340 SER A CA  
644  C  C   . SER A 86  ? 0.8563 0.8456 0.8967 -0.0087 0.0165  0.0192  340 SER A C   
645  O  O   . SER A 86  ? 0.9307 0.9226 0.9657 -0.0085 0.0184  0.0220  340 SER A O   
646  C  CB  . SER A 86  ? 0.8278 0.8152 0.8637 -0.0096 0.0212  0.0124  340 SER A CB  
647  O  OG  . SER A 86  ? 0.8933 0.8786 0.9363 -0.0095 0.0191  0.0140  340 SER A OG  
648  N  N   . ILE A 87  ? 0.7952 0.7824 0.8438 -0.0085 0.0131  0.0219  341 ILE A N   
649  C  CA  . ILE A 87  ? 0.7669 0.7543 0.8186 -0.0086 0.0119  0.0294  341 ILE A CA  
650  C  C   . ILE A 87  ? 0.8104 0.7960 0.8695 -0.0077 0.0069  0.0303  341 ILE A C   
651  O  O   . ILE A 87  ? 0.7778 0.7615 0.8437 -0.0080 0.0050  0.0356  341 ILE A O   
652  C  CB  . ILE A 87  ? 0.8023 0.7883 0.8592 -0.0097 0.0130  0.0334  341 ILE A CB  
653  C  CG1 . ILE A 87  ? 0.8443 0.8273 0.9092 -0.0097 0.0104  0.0293  341 ILE A CG1 
654  C  CG2 . ILE A 87  ? 0.8166 0.8046 0.8668 -0.0104 0.0177  0.0334  341 ILE A CG2 
655  C  CD1 . ILE A 87  ? 0.7956 0.7774 0.8678 -0.0107 0.0105  0.0331  341 ILE A CD1 
656  N  N   . GLY A 88  ? 0.8742 0.8602 0.9325 -0.0066 0.0048  0.0249  342 GLY A N   
657  C  CA  . GLY A 88  ? 0.8408 0.8249 0.9071 -0.0054 -0.0005 0.0238  342 GLY A CA  
658  C  C   . GLY A 88  ? 0.8349 0.8201 0.9010 -0.0045 -0.0020 0.0155  342 GLY A C   
659  O  O   . GLY A 88  ? 0.8097 0.7974 0.8685 -0.0047 0.0010  0.0117  342 GLY A O   
660  N  N   . GLN A 89  ? 0.7674 0.7509 0.8420 -0.0034 -0.0067 0.0127  343 GLN A N   
661  C  CA  . GLN A 89  ? 0.7454 0.7306 0.8206 -0.0023 -0.0084 0.0050  343 GLN A CA  
662  C  C   . GLN A 89  ? 0.7748 0.7586 0.8589 -0.0017 -0.0116 0.0008  343 GLN A C   
663  O  O   . GLN A 89  ? 0.8215 0.8024 0.9129 -0.0017 -0.0139 0.0042  343 GLN A O   
664  C  CB  . GLN A 89  ? 0.8699 0.8562 0.9459 -0.0007 -0.0119 0.0052  343 GLN A CB  
665  C  CG  . GLN A 89  ? 0.8866 0.8722 0.9603 -0.0003 -0.0125 0.0136  343 GLN A CG  
666  C  CD  . GLN A 89  ? 1.0168 1.0039 1.0897 0.0018  -0.0160 0.0133  343 GLN A CD  
667  O  OE1 . GLN A 89  ? 0.9897 0.9751 1.0701 0.0034  -0.0211 0.0121  343 GLN A OE1 
668  N  NE2 . GLN A 89  ? 1.0289 1.0193 1.0929 0.0022  -0.0136 0.0143  343 GLN A NE2 
669  N  N   . VAL A 90  ? 0.7465 0.7327 0.8304 -0.0010 -0.0118 -0.0069 344 VAL A N   
670  C  CA  . VAL A 90  ? 0.7951 0.7810 0.8869 0.0001  -0.0150 -0.0120 344 VAL A CA  
671  C  C   . VAL A 90  ? 0.7867 0.7741 0.8838 0.0020  -0.0195 -0.0168 344 VAL A C   
672  O  O   . VAL A 90  ? 0.7605 0.7511 0.8530 0.0021  -0.0181 -0.0206 344 VAL A O   
673  C  CB  . VAL A 90  ? 0.8397 0.8276 0.9273 -0.0003 -0.0112 -0.0173 344 VAL A CB  
674  C  CG1 . VAL A 90  ? 0.8055 0.7935 0.9014 0.0013  -0.0148 -0.0222 344 VAL A CG1 
675  C  CG2 . VAL A 90  ? 0.8348 0.8214 0.9153 -0.0020 -0.0063 -0.0130 344 VAL A CG2 
676  N  N   . HIS A 91  ? 0.7447 0.7302 0.8525 0.0034  -0.0249 -0.0174 345 HIS A N   
677  C  CA  . HIS A 91  ? 0.6989 0.6854 0.8133 0.0056  -0.0302 -0.0218 345 HIS A CA  
678  C  C   . HIS A 91  ? 0.7197 0.7079 0.8418 0.0071  -0.0329 -0.0295 345 HIS A C   
679  O  O   . HIS A 91  ? 0.6834 0.6697 0.8108 0.0072  -0.0340 -0.0290 345 HIS A O   
680  C  CB  . HIS A 91  ? 0.7565 0.7388 0.8778 0.0063  -0.0350 -0.0150 345 HIS A CB  
681  C  CG  . HIS A 91  ? 0.7319 0.7136 0.8454 0.0056  -0.0330 -0.0079 345 HIS A CG  
682  N  ND1 . HIS A 91  ? 0.7822 0.7654 0.8938 0.0071  -0.0351 -0.0086 345 HIS A ND1 
683  C  CD2 . HIS A 91  ? 0.7498 0.7302 0.8570 0.0039  -0.0291 -0.0005 345 HIS A CD2 
684  C  CE1 . HIS A 91  ? 0.8122 0.7953 0.9160 0.0064  -0.0325 -0.0020 345 HIS A CE1 
685  N  NE2 . HIS A 91  ? 0.7602 0.7417 0.8611 0.0045  -0.0287 0.0030  345 HIS A NE2 
686  N  N   . LEU A 92  ? 0.7718 0.7641 0.8951 0.0085  -0.0343 -0.0370 346 LEU A N   
687  C  CA  . LEU A 92  ? 0.7875 0.7824 0.9189 0.0106  -0.0377 -0.0448 346 LEU A CA  
688  C  C   . LEU A 92  ? 0.8242 0.8157 0.9679 0.0126  -0.0451 -0.0439 346 LEU A C   
689  O  O   . LEU A 92  ? 0.7520 0.7412 0.8970 0.0128  -0.0476 -0.0397 346 LEU A O   
690  C  CB  . LEU A 92  ? 0.8993 0.9003 1.0285 0.0115  -0.0366 -0.0529 346 LEU A CB  
691  C  CG  . LEU A 92  ? 1.0135 1.0172 1.1307 0.0092  -0.0290 -0.0530 346 LEU A CG  
692  C  CD1 . LEU A 92  ? 1.0772 1.0870 1.1924 0.0095  -0.0272 -0.0601 346 LEU A CD1 
693  C  CD2 . LEU A 92  ? 1.0731 1.0769 1.1877 0.0088  -0.0260 -0.0534 346 LEU A CD2 
694  N  N   . ALA A 93  ? 0.7654 0.7568 0.9181 0.0141  -0.0486 -0.0478 347 ALA A N   
695  C  CA  . ALA A 93  ? 0.8295 0.8179 0.9960 0.0162  -0.0561 -0.0487 347 ALA A CA  
696  C  C   . ALA A 93  ? 0.7877 0.7804 0.9614 0.0188  -0.0591 -0.0586 347 ALA A C   
697  O  O   . ALA A 93  ? 0.7538 0.7511 0.9217 0.0188  -0.0552 -0.0634 347 ALA A O   
698  C  CB  . ALA A 93  ? 0.8386 0.8206 1.0109 0.0151  -0.0577 -0.0405 347 ALA A CB  
699  N  N   . ARG A 94  ? 0.8683 0.8599 1.0546 0.0213  -0.0662 -0.0620 348 ARG A N   
700  C  CA  . ARG A 94  ? 0.8773 0.8729 1.0726 0.0242  -0.0701 -0.0716 348 ARG A CA  
701  C  C   . ARG A 94  ? 0.8748 0.8647 1.0849 0.0253  -0.0768 -0.0695 348 ARG A C   
702  O  O   . ARG A 94  ? 0.9226 0.9076 1.1399 0.0256  -0.0814 -0.0653 348 ARG A O   
703  C  CB  . ARG A 94  ? 0.8326 0.8343 1.0305 0.0268  -0.0727 -0.0807 348 ARG A CB  
704  C  CG  . ARG A 94  ? 0.9317 0.9397 1.1353 0.0298  -0.0749 -0.0914 348 ARG A CG  
705  C  CD  . ARG A 94  ? 0.9722 0.9873 1.1798 0.0327  -0.0777 -0.1014 348 ARG A CD  
706  N  NE  . ARG A 94  ? 0.9613 0.9773 1.1610 0.0311  -0.0744 -0.0989 348 ARG A NE  
707  C  CZ  . ARG A 94  ? 0.9492 0.9625 1.1535 0.0317  -0.0785 -0.0974 348 ARG A CZ  
708  N  NH1 . ARG A 94  ? 0.9914 1.0011 1.2093 0.0342  -0.0866 -0.0984 348 ARG A NH1 
709  N  NH2 . ARG A 94  ? 0.8122 0.8268 1.0073 0.0299  -0.0744 -0.0948 348 ARG A NH2 
710  N  N   . MSE A 95  ? 0.9102 0.9008 1.1250 0.0260  -0.0776 -0.0726 349 MSE A N   
711  C  CA  . MSE A 95  ? 0.9094 0.8951 1.1401 0.0271  -0.0841 -0.0720 349 MSE A CA  
712  C  C   . MSE A 95  ? 0.9053 0.8936 1.1495 0.0310  -0.0917 -0.0816 349 MSE A C   
713  O  O   . MSE A 95  ? 0.7889 0.7846 1.0299 0.0333  -0.0914 -0.0907 349 MSE A O   
714  C  CB  . MSE A 95  ? 0.8594 0.8459 1.0903 0.0267  -0.0822 -0.0729 349 MSE A CB  
715  C  CG  . MSE A 95  ? 0.9358 0.9194 1.1539 0.0228  -0.0748 -0.0629 349 MSE A CG  
716  SE SE  . MSE A 95  ? 1.1322 1.1148 1.3564 0.0227  -0.0749 -0.0634 349 MSE A SE  
717  C  CE  . MSE A 95  ? 1.0976 1.0905 1.3177 0.0268  -0.0748 -0.0775 349 MSE A CE  
718  N  N   . LYS A 96  ? 0.8874 0.8696 1.1471 0.0317  -0.0984 -0.0794 350 LYS A N   
719  C  CA  . LYS A 96  ? 0.9517 0.9346 1.2265 0.0354  -0.1067 -0.0874 350 LYS A CA  
720  C  C   . LYS A 96  ? 0.9540 0.9466 1.2297 0.0392  -0.1081 -0.1012 350 LYS A C   
721  O  O   . LYS A 96  ? 0.9976 0.9943 1.2748 0.0416  -0.1107 -0.1076 350 LYS A O   
722  C  CB  . LYS A 96  ? 0.9788 0.9542 1.2715 0.0356  -0.1132 -0.0841 350 LYS A CB  
723  C  CG  . LYS A 96  ? 1.0374 1.0086 1.3433 0.0377  -0.1210 -0.0849 350 LYS A CG  
724  C  CD  . LYS A 96  ? 1.0468 1.0120 1.3464 0.0354  -0.1193 -0.0736 350 LYS A CD  
725  C  CE  . LYS A 96  ? 1.0531 1.0118 1.3681 0.0373  -0.1276 -0.0719 350 LYS A CE  
726  N  NZ  . LYS A 96  ? 1.0025 0.9516 1.3199 0.0342  -0.1270 -0.0577 350 LYS A NZ  
727  N  N   . GLY A 97  ? 0.8982 0.8954 1.1716 0.0400  -0.1059 -0.1059 351 GLY A N   
728  C  CA  . GLY A 97  ? 0.9066 0.9140 1.1795 0.0439  -0.1070 -0.1190 351 GLY A CA  
729  C  C   . GLY A 97  ? 0.9255 0.9408 1.1835 0.0439  -0.1009 -0.1226 351 GLY A C   
730  O  O   . GLY A 97  ? 0.9272 0.9511 1.1858 0.0473  -0.1020 -0.1330 351 GLY A O   
731  N  N   . GLY A 98  ? 0.9593 0.9720 1.2040 0.0402  -0.0944 -0.1140 352 GLY A N   
732  C  CA  . GLY A 98  ? 0.9723 0.9918 1.2018 0.0392  -0.0872 -0.1158 352 GLY A CA  
733  C  C   . GLY A 98  ? 0.9658 0.9848 1.1803 0.0361  -0.0789 -0.1097 352 GLY A C   
734  O  O   . GLY A 98  ? 0.8840 0.9077 1.0861 0.0349  -0.0726 -0.1103 352 GLY A O   
735  N  N   . ARG A 99  ? 0.8693 0.8831 1.0853 0.0348  -0.0787 -0.1042 353 ARG A N   
736  C  CA  . ARG A 99  ? 0.8749 0.8895 1.0771 0.0326  -0.0712 -0.1001 353 ARG A CA  
737  C  C   . ARG A 99  ? 0.7927 0.8024 0.9847 0.0284  -0.0658 -0.0901 353 ARG A C   
738  O  O   . ARG A 99  ? 0.8899 0.8927 1.0871 0.0268  -0.0681 -0.0829 353 ARG A O   
739  C  CB  . ARG A 99  ? 0.8879 0.8998 1.0952 0.0330  -0.0728 -0.0989 353 ARG A CB  
740  C  CG  . ARG A 99  ? 0.9443 0.9584 1.1381 0.0320  -0.0659 -0.0971 353 ARG A CG  
741  C  CD  . ARG A 99  ? 0.9108 0.9201 1.1099 0.0313  -0.0673 -0.0930 353 ARG A CD  
742  N  NE  . ARG A 99  ? 0.9278 0.9399 1.1173 0.0317  -0.0628 -0.0935 353 ARG A NE  
743  C  CZ  . ARG A 99  ? 0.9594 0.9680 1.1525 0.0311  -0.0634 -0.0902 353 ARG A CZ  
744  N  NH1 . ARG A 99  ? 0.9372 0.9395 1.1431 0.0298  -0.0677 -0.0858 353 ARG A NH1 
745  N  NH2 . ARG A 99  ? 1.0141 1.0254 1.1982 0.0319  -0.0597 -0.0911 353 ARG A NH2 
746  N  N   . GLU A 100 ? 0.6869 0.7006 0.8653 0.0271  -0.0590 -0.0901 354 GLU A N   
747  C  CA  . GLU A 100 ? 0.7775 0.7883 0.9448 0.0234  -0.0532 -0.0822 354 GLU A CA  
748  C  C   . GLU A 100 ? 0.7261 0.7324 0.8868 0.0209  -0.0491 -0.0745 354 GLU A C   
749  O  O   . GLU A 100 ? 0.7669 0.7752 0.9240 0.0215  -0.0468 -0.0763 354 GLU A O   
750  C  CB  . GLU A 100 ? 0.8173 0.8347 0.9736 0.0230  -0.0474 -0.0862 354 GLU A CB  
751  C  CG  . GLU A 100 ? 0.8586 0.8807 1.0207 0.0249  -0.0507 -0.0932 354 GLU A CG  
752  C  CD  . GLU A 100 ? 0.8940 0.9225 1.0465 0.0239  -0.0448 -0.0966 354 GLU A CD  
753  O  OE1 . GLU A 100 ? 0.9959 1.0319 1.1492 0.0261  -0.0445 -0.1048 354 GLU A OE1 
754  O  OE2 . GLU A 100 ? 0.9425 0.9691 1.0870 0.0210  -0.0402 -0.0914 354 GLU A OE2 
755  N  N   . VAL A 101 ? 0.7279 0.7288 0.8865 0.0183  -0.0479 -0.0660 355 VAL A N   
756  C  CA  . VAL A 101 ? 0.7420 0.7386 0.8947 0.0157  -0.0439 -0.0582 355 VAL A CA  
757  C  C   . VAL A 101 ? 0.7159 0.7107 0.8580 0.0128  -0.0388 -0.0515 355 VAL A C   
758  O  O   . VAL A 101 ? 0.7147 0.7104 0.8557 0.0127  -0.0392 -0.0517 355 VAL A O   
759  C  CB  . VAL A 101 ? 0.7634 0.7544 0.9278 0.0157  -0.0487 -0.0537 355 VAL A CB  
760  C  CG1 . VAL A 101 ? 0.7792 0.7724 0.9536 0.0186  -0.0533 -0.0610 355 VAL A CG1 
761  C  CG2 . VAL A 101 ? 0.7602 0.7473 0.9328 0.0156  -0.0534 -0.0501 355 VAL A CG2 
762  N  N   . ALA A 102 ? 0.7508 0.7436 0.8853 0.0107  -0.0340 -0.0460 356 ALA A N   
763  C  CA  . ALA A 102 ? 0.6784 0.6690 0.8037 0.0080  -0.0294 -0.0388 356 ALA A CA  
764  C  C   . ALA A 102 ? 0.7221 0.7074 0.8511 0.0065  -0.0302 -0.0304 356 ALA A C   
765  O  O   . ALA A 102 ? 0.6561 0.6402 0.7869 0.0064  -0.0297 -0.0295 356 ALA A O   
766  C  CB  . ALA A 102 ? 0.6666 0.6598 0.7795 0.0067  -0.0226 -0.0395 356 ALA A CB  
767  N  N   . MSE A 103 ? 0.6644 0.6469 0.7948 0.0057  -0.0316 -0.0245 357 MSE A N   
768  C  CA  . MSE A 103 ? 0.7132 0.6913 0.8472 0.0042  -0.0320 -0.0162 357 MSE A CA  
769  C  C   . MSE A 103 ? 0.7828 0.7610 0.9051 0.0021  -0.0263 -0.0102 357 MSE A C   
770  O  O   . MSE A 103 ? 0.7245 0.7037 0.8410 0.0019  -0.0253 -0.0090 357 MSE A O   
771  C  CB  . MSE A 103 ? 0.6824 0.6573 0.8257 0.0050  -0.0374 -0.0128 357 MSE A CB  
772  C  CG  . MSE A 103 ? 0.7827 0.7576 0.9389 0.0075  -0.0439 -0.0196 357 MSE A CG  
773  SE SE  . MSE A 103 ? 0.7843 0.7539 0.9548 0.0087  -0.0518 -0.0151 357 MSE A SE  
774  C  CE  . MSE A 103 ? 0.7379 0.7019 0.9135 0.0060  -0.0504 -0.0038 357 MSE A CE  
775  N  N   . LYS A 104 ? 0.7363 0.7136 0.8554 0.0006  -0.0227 -0.0069 358 LYS A N   
776  C  CA  . LYS A 104 ? 0.7457 0.7232 0.8545 -0.0013 -0.0174 -0.0013 358 LYS A CA  
777  C  C   . LYS A 104 ? 0.7331 0.7078 0.8457 -0.0024 -0.0181 0.0076  358 LYS A C   
778  O  O   . LYS A 104 ? 0.7173 0.6898 0.8373 -0.0030 -0.0192 0.0105  358 LYS A O   
779  C  CB  . LYS A 104 ? 0.7174 0.6959 0.8204 -0.0020 -0.0131 -0.0027 358 LYS A CB  
780  C  CG  . LYS A 104 ? 0.7970 0.7770 0.8880 -0.0034 -0.0076 -0.0003 358 LYS A CG  
781  C  CD  . LYS A 104 ? 0.8286 0.8081 0.9156 -0.0045 -0.0038 0.0022  358 LYS A CD  
782  C  CE  . LYS A 104 ? 0.8043 0.7852 0.8856 -0.0040 -0.0011 -0.0032 358 LYS A CE  
783  N  NZ  . LYS A 104 ? 0.7252 0.7052 0.8071 -0.0042 0.0004  -0.0021 358 LYS A NZ  
784  N  N   . ILE A 105 ? 0.6865 0.6614 0.7941 -0.0027 -0.0173 0.0122  359 ILE A N   
785  C  CA  . ILE A 105 ? 0.6961 0.6684 0.8079 -0.0034 -0.0186 0.0210  359 ILE A CA  
786  C  C   . ILE A 105 ? 0.7040 0.6782 0.8055 -0.0047 -0.0134 0.0268  359 ILE A C   
787  O  O   . ILE A 105 ? 0.7038 0.6807 0.7957 -0.0043 -0.0111 0.0247  359 ILE A O   
788  C  CB  . ILE A 105 ? 0.7130 0.6841 0.8285 -0.0018 -0.0232 0.0221  359 ILE A CB  
789  C  CG1 . ILE A 105 ? 0.7459 0.7160 0.8720 -0.0001 -0.0287 0.0150  359 ILE A CG1 
790  C  CG2 . ILE A 105 ? 0.7501 0.7181 0.8709 -0.0024 -0.0247 0.0319  359 ILE A CG2 
791  C  CD1 . ILE A 105 ? 0.7486 0.7187 0.8765 0.0019  -0.0331 0.0130  359 ILE A CD1 
792  N  N   . GLN A 106 ? 0.7527 0.7257 0.8561 -0.0062 -0.0114 0.0337  360 GLN A N   
793  C  CA  . GLN A 106 ? 0.8117 0.7874 0.9047 -0.0072 -0.0063 0.0389  360 GLN A CA  
794  C  C   . GLN A 106 ? 0.8589 0.8353 0.9486 -0.0064 -0.0072 0.0450  360 GLN A C   
795  O  O   . GLN A 106 ? 0.9100 0.8835 1.0075 -0.0058 -0.0113 0.0487  360 GLN A O   
796  C  CB  . GLN A 106 ? 0.8081 0.7834 0.9043 -0.0090 -0.0036 0.0445  360 GLN A CB  
797  C  CG  . GLN A 106 ? 0.8127 0.7876 0.9117 -0.0096 -0.0026 0.0394  360 GLN A CG  
798  C  CD  . GLN A 106 ? 0.7849 0.7602 0.8864 -0.0114 0.0004  0.0448  360 GLN A CD  
799  O  OE1 . GLN A 106 ? 0.8734 0.8500 0.9725 -0.0123 0.0027  0.0523  360 GLN A OE1 
800  N  NE2 . GLN A 106 ? 0.7726 0.7472 0.8791 -0.0116 0.0004  0.0411  360 GLN A NE2 
801  N  N   . TYR A 107 ? 0.9024 0.8825 0.9807 -0.0062 -0.0035 0.0462  361 TYR A N   
802  C  CA  . TYR A 107 ? 0.9304 0.9121 1.0044 -0.0054 -0.0033 0.0538  361 TYR A CA  
803  C  C   . TYR A 107 ? 0.9055 0.8854 0.9856 -0.0069 -0.0024 0.0630  361 TYR A C   
804  O  O   . TYR A 107 ? 0.8389 0.8185 0.9224 -0.0087 0.0000  0.0632  361 TYR A O   
805  C  CB  . TYR A 107 ? 0.9658 0.9526 1.0267 -0.0049 0.0010  0.0532  361 TYR A CB  
806  C  CG  . TYR A 107 ? 0.9676 0.9562 1.0232 -0.0039 0.0009  0.0442  361 TYR A CG  
807  C  CD1 . TYR A 107 ? 1.0104 0.9984 1.0680 -0.0022 -0.0034 0.0406  361 TYR A CD1 
808  C  CD2 . TYR A 107 ? 1.0671 1.0579 1.1163 -0.0048 0.0050  0.0392  361 TYR A CD2 
809  C  CE1 . TYR A 107 ? 1.0697 1.0598 1.1236 -0.0015 -0.0033 0.0322  361 TYR A CE1 
810  C  CE2 . TYR A 107 ? 1.0730 1.0653 1.1182 -0.0042 0.0051  0.0312  361 TYR A CE2 
811  C  CZ  . TYR A 107 ? 1.0804 1.0726 1.1282 -0.0027 0.0011  0.0278  361 TYR A CZ  
812  O  OH  . TYR A 107 ? 1.1261 1.1202 1.1710 -0.0023 0.0014  0.0200  361 TYR A OH  
813  N  N   . PRO A 108 ? 0.9909 0.9698 1.0733 -0.0062 -0.0045 0.0707  362 PRO A N   
814  C  CA  . PRO A 108 ? 1.0733 1.0508 1.1620 -0.0080 -0.0030 0.0800  362 PRO A CA  
815  C  C   . PRO A 108 ? 1.0630 1.0453 1.1437 -0.0092 0.0033  0.0839  362 PRO A C   
816  O  O   . PRO A 108 ? 1.0178 1.0048 1.0866 -0.0080 0.0058  0.0823  362 PRO A O   
817  C  CB  . PRO A 108 ? 1.0337 1.0096 1.1238 -0.0065 -0.0061 0.0879  362 PRO A CB  
818  C  CG  . PRO A 108 ? 1.0498 1.0244 1.1392 -0.0041 -0.0109 0.0811  362 PRO A CG  
819  C  CD  . PRO A 108 ? 1.0291 1.0077 1.1092 -0.0037 -0.0083 0.0719  362 PRO A CD  
820  N  N   . GLY A 109 ? 1.0660 1.0476 1.1539 -0.0116 0.0055  0.0882  363 GLY A N   
821  C  CA  . GLY A 109 ? 1.0080 0.9943 1.0903 -0.0128 0.0113  0.0929  363 GLY A CA  
822  C  C   . GLY A 109 ? 1.0151 1.0054 1.0880 -0.0127 0.0150  0.0859  363 GLY A C   
823  O  O   . GLY A 109 ? 0.9442 0.9398 1.0085 -0.0126 0.0194  0.0887  363 GLY A O   
824  N  N   . VAL A 110 ? 0.9478 0.9357 1.0228 -0.0126 0.0132  0.0769  364 VAL A N   
825  C  CA  . VAL A 110 ? 0.8632 0.8538 0.9301 -0.0125 0.0164  0.0701  364 VAL A CA  
826  C  C   . VAL A 110 ? 0.8448 0.8377 0.9126 -0.0141 0.0206  0.0722  364 VAL A C   
827  O  O   . VAL A 110 ? 0.8984 0.8957 0.9572 -0.0139 0.0246  0.0719  364 VAL A O   
828  C  CB  . VAL A 110 ? 0.8485 0.8359 0.9176 -0.0119 0.0135  0.0608  364 VAL A CB  
829  C  CG1 . VAL A 110 ? 0.9271 0.9154 0.9931 -0.0125 0.0165  0.0553  364 VAL A CG1 
830  C  CG2 . VAL A 110 ? 0.8669 0.8554 0.9286 -0.0101 0.0121  0.0567  364 VAL A CG2 
831  N  N   . ALA A 111 ? 0.7483 0.7384 0.8276 -0.0157 0.0196  0.0739  365 ALA A N   
832  C  CA  . ALA A 111 ? 0.8299 0.8222 0.9119 -0.0173 0.0232  0.0759  365 ALA A CA  
833  C  C   . ALA A 111 ? 0.8386 0.8362 0.9144 -0.0177 0.0276  0.0832  365 ALA A C   
834  O  O   . ALA A 111 ? 0.8941 0.8960 0.9651 -0.0180 0.0317  0.0826  365 ALA A O   
835  C  CB  . ALA A 111 ? 0.7456 0.7345 0.8428 -0.0191 0.0211  0.0783  365 ALA A CB  
836  N  N   . GLN A 112 ? 0.8748 0.8725 0.9514 -0.0174 0.0265  0.0902  366 GLN A N   
837  C  CA  . GLN A 112 ? 0.8756 0.8781 0.9489 -0.0178 0.0302  0.0991  366 GLN A CA  
838  C  C   . GLN A 112 ? 0.8492 0.8576 0.9076 -0.0158 0.0331  0.0972  366 GLN A C   
839  O  O   . GLN A 112 ? 0.9080 0.9224 0.9617 -0.0159 0.0374  0.1019  366 GLN A O   
840  C  CB  . GLN A 112 ? 1.0393 1.0390 1.1174 -0.0177 0.0273  0.1068  366 GLN A CB  
841  C  CG  . GLN A 112 ? 1.1169 1.1205 1.1955 -0.0187 0.0309  0.1181  366 GLN A CG  
842  C  CD  . GLN A 112 ? 1.1797 1.1828 1.2703 -0.0218 0.0332  0.1214  366 GLN A CD  
843  O  OE1 . GLN A 112 ? 1.2170 1.2146 1.3197 -0.0231 0.0299  0.1183  366 GLN A OE1 
844  N  NE2 . GLN A 112 ? 1.2384 1.2480 1.3260 -0.0228 0.0387  0.1271  366 GLN A NE2 
845  N  N   . SER A 113 ? 0.7654 0.7730 0.8168 -0.0138 0.0309  0.0903  367 SER A N   
846  C  CA  . SER A 113 ? 0.8029 0.8162 0.8412 -0.0118 0.0334  0.0877  367 SER A CA  
847  C  C   . SER A 113 ? 0.7440 0.7588 0.7776 -0.0118 0.0357  0.0794  367 SER A C   
848  O  O   . SER A 113 ? 0.7710 0.7900 0.7948 -0.0101 0.0373  0.0758  367 SER A O   
849  C  CB  . SER A 113 ? 0.7852 0.7981 0.8179 -0.0095 0.0300  0.0863  367 SER A CB  
850  O  OG  . SER A 113 ? 0.8231 0.8300 0.8617 -0.0096 0.0258  0.0810  367 SER A OG  
851  N  N   . ILE A 114 ? 0.7339 0.7456 0.7746 -0.0135 0.0360  0.0767  368 ILE A N   
852  C  CA  . ILE A 114 ? 0.7303 0.7425 0.7671 -0.0134 0.0379  0.0696  368 ILE A CA  
853  C  C   . ILE A 114 ? 0.7310 0.7502 0.7593 -0.0126 0.0423  0.0704  368 ILE A C   
854  O  O   . ILE A 114 ? 0.6681 0.6891 0.6886 -0.0112 0.0431  0.0646  368 ILE A O   
855  C  CB  . ILE A 114 ? 0.7462 0.7550 0.7924 -0.0151 0.0377  0.0680  368 ILE A CB  
856  C  CG1 . ILE A 114 ? 0.7290 0.7314 0.7813 -0.0151 0.0331  0.0636  368 ILE A CG1 
857  C  CG2 . ILE A 114 ? 0.8103 0.8212 0.8521 -0.0148 0.0407  0.0631  368 ILE A CG2 
858  C  CD1 . ILE A 114 ? 0.6973 0.6961 0.7593 -0.0162 0.0317  0.0615  368 ILE A CD1 
859  N  N   . ASN A 115 ? 0.7416 0.7652 0.7720 -0.0133 0.0450  0.0777  369 ASN A N   
860  C  CA  . ASN A 115 ? 0.8302 0.8614 0.8539 -0.0125 0.0495  0.0787  369 ASN A CA  
861  C  C   . ASN A 115 ? 0.8230 0.8591 0.8357 -0.0100 0.0498  0.0779  369 ASN A C   
862  O  O   . ASN A 115 ? 0.8007 0.8401 0.8065 -0.0086 0.0514  0.0724  369 ASN A O   
863  C  CB  . ASN A 115 ? 0.8158 0.8511 0.8448 -0.0141 0.0525  0.0872  369 ASN A CB  
864  C  CG  . ASN A 115 ? 0.8297 0.8633 0.8676 -0.0161 0.0537  0.0857  369 ASN A CG  
865  O  OD1 . ASN A 115 ? 0.8600 0.8895 0.8988 -0.0160 0.0522  0.0785  369 ASN A OD1 
866  N  ND2 . ASN A 115 ? 0.8848 0.9218 0.9290 -0.0178 0.0564  0.0924  369 ASN A ND2 
867  N  N   . SER A 116 ? 0.8690 0.9049 0.8807 -0.0092 0.0478  0.0828  370 SER A N   
868  C  CA  . SER A 116 ? 0.8874 0.9279 0.8891 -0.0063 0.0472  0.0819  370 SER A CA  
869  C  C   . SER A 116 ? 0.8418 0.8795 0.8395 -0.0051 0.0448  0.0720  370 SER A C   
870  O  O   . SER A 116 ? 0.7971 0.8396 0.7869 -0.0031 0.0458  0.0676  370 SER A O   
871  C  CB  . SER A 116 ? 0.8978 0.9372 0.9006 -0.0057 0.0447  0.0892  370 SER A CB  
872  O  OG  . SER A 116 ? 0.9354 0.9814 0.9282 -0.0025 0.0450  0.0905  370 SER A OG  
873  N  N   . ASP A 117 ? 0.7395 0.7698 0.7431 -0.0063 0.0416  0.0685  371 ASP A N   
874  C  CA  . ASP A 117 ? 0.8118 0.8394 0.8126 -0.0055 0.0397  0.0599  371 ASP A CA  
875  C  C   . ASP A 117 ? 0.7195 0.7483 0.7170 -0.0056 0.0425  0.0533  371 ASP A C   
876  O  O   . ASP A 117 ? 0.6908 0.7209 0.6828 -0.0043 0.0423  0.0471  371 ASP A O   
877  C  CB  . ASP A 117 ? 0.8716 0.8915 0.8801 -0.0069 0.0362  0.0577  371 ASP A CB  
878  C  CG  . ASP A 117 ? 0.8918 0.9098 0.9026 -0.0061 0.0323  0.0612  371 ASP A CG  
879  O  OD1 . ASP A 117 ? 0.9267 0.9488 0.9324 -0.0042 0.0319  0.0647  371 ASP A OD1 
880  O  OD2 . ASP A 117 ? 0.9843 0.9966 1.0024 -0.0071 0.0293  0.0598  371 ASP A OD2 
881  N  N   . VAL A 118 ? 0.7392 0.7672 0.7406 -0.0072 0.0447  0.0545  372 VAL A N   
882  C  CA  . VAL A 118 ? 0.7278 0.7566 0.7267 -0.0071 0.0471  0.0490  372 VAL A CA  
883  C  C   . VAL A 118 ? 0.7547 0.7915 0.7460 -0.0051 0.0498  0.0486  372 VAL A C   
884  O  O   . VAL A 118 ? 0.7666 0.8045 0.7535 -0.0041 0.0505  0.0422  372 VAL A O   
885  C  CB  . VAL A 118 ? 0.7152 0.7416 0.7207 -0.0089 0.0485  0.0505  372 VAL A CB  
886  C  CG1 . VAL A 118 ? 0.7545 0.7833 0.7568 -0.0084 0.0514  0.0462  372 VAL A CG1 
887  C  CG2 . VAL A 118 ? 0.7473 0.7661 0.7593 -0.0102 0.0456  0.0481  372 VAL A CG2 
888  N  N   . ASN A 119 ? 0.7211 0.7636 0.7112 -0.0046 0.0513  0.0554  373 ASN A N   
889  C  CA  . ASN A 119 ? 0.7457 0.7969 0.7284 -0.0023 0.0537  0.0555  373 ASN A CA  
890  C  C   . ASN A 119 ? 0.7472 0.8006 0.7231 0.0001  0.0518  0.0505  373 ASN A C   
891  O  O   . ASN A 119 ? 0.7474 0.8044 0.7188 0.0017  0.0529  0.0446  373 ASN A O   
892  C  CB  . ASN A 119 ? 0.8359 0.8930 0.8185 -0.0022 0.0558  0.0649  373 ASN A CB  
893  C  CG  . ASN A 119 ? 0.9560 1.0159 0.9426 -0.0037 0.0595  0.0676  373 ASN A CG  
894  O  OD1 . ASN A 119 ? 1.0934 1.1501 1.0833 -0.0048 0.0600  0.0626  373 ASN A OD1 
895  N  ND2 . ASN A 119 ? 1.1463 1.2126 1.1324 -0.0036 0.0621  0.0752  373 ASN A ND2 
896  N  N   . ASN A 120 ? 0.7198 0.7705 0.6961 0.0004  0.0487  0.0523  374 ASN A N   
897  C  CA  . ASN A 120 ? 0.7499 0.8019 0.7212 0.0027  0.0462  0.0471  374 ASN A CA  
898  C  C   . ASN A 120 ? 0.7186 0.7665 0.6905 0.0022  0.0454  0.0378  374 ASN A C   
899  O  O   . ASN A 120 ? 0.7403 0.7919 0.7077 0.0041  0.0452  0.0324  374 ASN A O   
900  C  CB  . ASN A 120 ? 0.8304 0.8791 0.8036 0.0028  0.0426  0.0504  374 ASN A CB  
901  C  CG  . ASN A 120 ? 0.9078 0.9601 0.8753 0.0057  0.0402  0.0460  374 ASN A CG  
902  O  OD1 . ASN A 120 ? 0.9897 1.0494 0.9505 0.0084  0.0414  0.0437  374 ASN A OD1 
903  N  ND2 . ASN A 120 ? 0.9687 1.0162 0.9392 0.0056  0.0366  0.0443  374 ASN A ND2 
904  N  N   . LEU A 121 ? 0.7412 0.7816 0.7191 -0.0003 0.0450  0.0362  375 LEU A N   
905  C  CA  . LEU A 121 ? 0.7222 0.7585 0.7007 -0.0010 0.0450  0.0284  375 LEU A CA  
906  C  C   . LEU A 121 ? 0.7512 0.7911 0.7266 -0.0002 0.0478  0.0245  375 LEU A C   
907  O  O   . LEU A 121 ? 0.7391 0.7785 0.7129 0.0004  0.0476  0.0175  375 LEU A O   
908  C  CB  . LEU A 121 ? 0.6767 0.7052 0.6617 -0.0036 0.0446  0.0286  375 LEU A CB  
909  C  CG  . LEU A 121 ? 0.6905 0.7140 0.6766 -0.0046 0.0452  0.0221  375 LEU A CG  
910  C  CD1 . LEU A 121 ? 0.6914 0.7136 0.6763 -0.0042 0.0434  0.0164  375 LEU A CD1 
911  C  CD2 . LEU A 121 ? 0.7334 0.7505 0.7251 -0.0065 0.0448  0.0233  375 LEU A CD2 
912  N  N   . MSE A 122 ? 0.7122 0.7547 0.6882 -0.0005 0.0504  0.0284  376 MSE A N   
913  C  CA  . MSE A 122 ? 0.7125 0.7585 0.6859 0.0005  0.0529  0.0245  376 MSE A CA  
914  C  C   . MSE A 122 ? 0.7073 0.7617 0.6744 0.0035  0.0530  0.0221  376 MSE A C   
915  O  O   . MSE A 122 ? 0.6856 0.7416 0.6508 0.0047  0.0533  0.0156  376 MSE A O   
916  C  CB  . MSE A 122 ? 0.7371 0.7854 0.7127 -0.0002 0.0556  0.0291  376 MSE A CB  
917  C  CG  . MSE A 122 ? 0.7983 0.8388 0.7805 -0.0027 0.0553  0.0301  376 MSE A CG  
918  SE SE  . MSE A 122 ? 0.9285 0.9613 0.9110 -0.0032 0.0548  0.0211  376 MSE A SE  
919  C  CE  . MSE A 122 ? 1.0052 1.0302 0.9919 -0.0050 0.0516  0.0224  376 MSE A CE  
920  N  N   . ALA A 123 ? 0.6685 0.7279 0.6328 0.0048  0.0523  0.0272  377 ALA A N   
921  C  CA  . ALA A 123 ? 0.7367 0.8044 0.6945 0.0082  0.0518  0.0252  377 ALA A CA  
922  C  C   . ALA A 123 ? 0.7916 0.8574 0.7485 0.0092  0.0491  0.0170  377 ALA A C   
923  O  O   . ALA A 123 ? 0.7938 0.8648 0.7475 0.0115  0.0492  0.0108  377 ALA A O   
924  C  CB  . ALA A 123 ? 0.6847 0.7571 0.6396 0.0093  0.0514  0.0335  377 ALA A CB  
925  N  N   . VAL A 124 ? 0.7721 0.8307 0.7329 0.0074  0.0467  0.0164  378 VAL A N   
926  C  CA  . VAL A 124 ? 0.7639 0.8208 0.7251 0.0079  0.0444  0.0090  378 VAL A CA  
927  C  C   . VAL A 124 ? 0.7767 0.8305 0.7401 0.0070  0.0458  0.0018  378 VAL A C   
928  O  O   . VAL A 124 ? 0.7746 0.8316 0.7368 0.0086  0.0452  -0.0050 378 VAL A O   
929  C  CB  . VAL A 124 ? 0.7955 0.8457 0.7610 0.0061  0.0418  0.0100  378 VAL A CB  
930  C  CG1 . VAL A 124 ? 0.8255 0.8722 0.7934 0.0055  0.0405  0.0017  378 VAL A CG1 
931  C  CG2 . VAL A 124 ? 0.8227 0.8766 0.7856 0.0080  0.0396  0.0156  378 VAL A CG2 
932  N  N   . LEU A 125 ? 0.7261 0.7738 0.6930 0.0045  0.0475  0.0034  379 LEU A N   
933  C  CA  . LEU A 125 ? 0.7678 0.8122 0.7365 0.0037  0.0489  -0.0023 379 LEU A CA  
934  C  C   . LEU A 125 ? 0.7995 0.8509 0.7651 0.0061  0.0506  -0.0051 379 LEU A C   
935  O  O   . LEU A 125 ? 0.8656 0.9164 0.8322 0.0065  0.0507  -0.0118 379 LEU A O   
936  C  CB  . LEU A 125 ? 0.7844 0.8212 0.7570 0.0010  0.0502  0.0006  379 LEU A CB  
937  C  CG  . LEU A 125 ? 0.8189 0.8486 0.7952 -0.0012 0.0486  0.0020  379 LEU A CG  
938  C  CD1 . LEU A 125 ? 0.9421 0.9661 0.9216 -0.0031 0.0498  0.0052  379 LEU A CD1 
939  C  CD2 . LEU A 125 ? 0.7893 0.8151 0.7673 -0.0020 0.0479  -0.0044 379 LEU A CD2 
940  N  N   . ASN A 126 ? 0.8504 0.9082 0.8129 0.0074  0.0520  -0.0001 380 ASN A N   
941  C  CA  . ASN A 126 ? 0.8000 0.8652 0.7597 0.0099  0.0537  -0.0030 380 ASN A CA  
942  C  C   . ASN A 126 ? 0.8934 0.9650 0.8499 0.0129  0.0518  -0.0092 380 ASN A C   
943  O  O   . ASN A 126 ? 0.8797 0.9515 0.8375 0.0138  0.0516  -0.0169 380 ASN A O   
944  C  CB  . ASN A 126 ? 0.8651 0.9368 0.8223 0.0106  0.0557  0.0041  380 ASN A CB  
945  C  CG  . ASN A 126 ? 0.9400 1.0218 0.8933 0.0138  0.0575  0.0014  380 ASN A CG  
946  O  OD1 . ASN A 126 ? 0.9542 1.0363 0.9085 0.0147  0.0577  -0.0057 380 ASN A OD1 
947  N  ND2 . ASN A 126 ? 0.9202 1.0107 0.8692 0.0154  0.0588  0.0073  380 ASN A ND2 
948  N  N   . MSE A 127 ? 0.8771 0.9529 0.8302 0.0143  0.0501  -0.0063 381 MSE A N   
949  C  CA  . MSE A 127 ? 0.9843 1.0668 0.9342 0.0177  0.0478  -0.0122 381 MSE A CA  
950  C  C   . MSE A 127 ? 0.9868 1.0649 0.9410 0.0171  0.0459  -0.0213 381 MSE A C   
951  O  O   . MSE A 127 ? 1.1360 1.2202 1.0889 0.0201  0.0445  -0.0281 381 MSE A O   
952  C  CB  . MSE A 127 ? 1.0314 1.1174 0.9775 0.0191  0.0460  -0.0066 381 MSE A CB  
953  C  CG  . MSE A 127 ? 1.1568 1.2506 1.0990 0.0231  0.0433  -0.0126 381 MSE A CG  
954  SE SE  . MSE A 127 ? 1.3690 1.4679 1.3048 0.0254  0.0416  -0.0027 381 MSE A SE  
955  C  CE  . MSE A 127 ? 1.1158 1.2042 1.0562 0.0205  0.0428  0.0088  381 MSE A CE  
956  N  N   . SER A 128 ? 1.0029 1.0709 0.9624 0.0135  0.0460  -0.0216 382 SER A N   
957  C  CA  . SER A 128 ? 1.0538 1.1167 1.0185 0.0123  0.0451  -0.0294 382 SER A CA  
958  C  C   . SER A 128 ? 1.1566 1.2145 1.1247 0.0108  0.0474  -0.0323 382 SER A C   
959  O  O   . SER A 128 ? 1.1088 1.1593 1.0818 0.0085  0.0475  -0.0360 382 SER A O   
960  C  CB  . SER A 128 ? 1.0958 1.1510 1.0640 0.0093  0.0440  -0.0275 382 SER A CB  
961  O  OG  . SER A 128 ? 1.1344 1.1937 1.0997 0.0109  0.0417  -0.0243 382 SER A OG  
962  N  N   . ASN A 129 ? 1.2479 1.3104 1.2133 0.0123  0.0491  -0.0307 383 ASN A N   
963  C  CA  . ASN A 129 ? 1.3634 1.4217 1.3312 0.0113  0.0513  -0.0314 383 ASN A CA  
964  C  C   . ASN A 129 ? 1.4642 1.5109 1.4371 0.0078  0.0520  -0.0320 383 ASN A C   
965  O  O   . ASN A 129 ? 1.4683 1.5116 1.4446 0.0077  0.0522  -0.0377 383 ASN A O   
966  C  CB  . ASN A 129 ? 1.3510 1.4167 1.3179 0.0145  0.0515  -0.0376 383 ASN A CB  
967  C  CG  . ASN A 129 ? 1.3172 1.3835 1.2874 0.0157  0.0496  -0.0469 383 ASN A CG  
968  O  OD1 . ASN A 129 ? 1.2499 1.3190 1.2218 0.0176  0.0496  -0.0529 383 ASN A OD1 
969  N  ND2 . ASN A 129 ? 1.3754 1.4394 1.3473 0.0147  0.0478  -0.0485 383 ASN A ND2 
970  N  N   . MSE A 130 ? 1.5199 1.5609 1.4933 0.0054  0.0524  -0.0258 384 MSE A N   
971  C  CA  . MSE A 130 ? 1.5381 1.5689 1.5151 0.0025  0.0533  -0.0252 384 MSE A CA  
972  C  C   . MSE A 130 ? 1.4293 1.4581 1.4058 0.0017  0.0547  -0.0191 384 MSE A C   
973  O  O   . MSE A 130 ? 1.3580 1.3802 1.3362 -0.0004 0.0548  -0.0159 384 MSE A O   
974  C  CB  . MSE A 130 ? 1.6533 1.6783 1.6328 0.0002  0.0523  -0.0256 384 MSE A CB  
975  C  CG  . MSE A 130 ? 1.8253 1.8539 1.8033 0.0004  0.0505  -0.0227 384 MSE A CG  
976  SE SE  . MSE A 130 ? 2.3559 2.3861 2.3366 0.0007  0.0484  -0.0305 384 MSE A SE  
977  C  CE  . MSE A 130 ? 2.2488 2.2806 2.2286 0.0005  0.0459  -0.0261 384 MSE A CE  
978  N  N   . LEU A 131 ? 1.3174 1.3522 1.2918 0.0036  0.0557  -0.0182 385 LEU A N   
979  C  CA  . LEU A 131 ? 1.4787 1.5123 1.4535 0.0030  0.0570  -0.0129 385 LEU A CA  
980  C  C   . LEU A 131 ? 1.6997 1.7258 1.6772 0.0021  0.0579  -0.0143 385 LEU A C   
981  O  O   . LEU A 131 ? 1.5996 1.6239 1.5781 0.0015  0.0586  -0.0102 385 LEU A O   
982  C  CB  . LEU A 131 ? 1.4770 1.5206 1.4490 0.0051  0.0581  -0.0101 385 LEU A CB  
983  C  CG  . LEU A 131 ? 1.4259 1.4748 1.3953 0.0053  0.0575  -0.0048 385 LEU A CG  
984  C  CD1 . LEU A 131 ? 1.4372 1.4972 1.4029 0.0078  0.0589  -0.0032 385 LEU A CD1 
985  C  CD2 . LEU A 131 ? 1.3842 1.4287 1.3561 0.0029  0.0574  0.0022  385 LEU A CD2 
986  N  N   . PRO A 132 ? 1.9129 1.9349 1.8919 0.0023  0.0578  -0.0199 386 PRO A N   
987  C  CA  . PRO A 132 ? 1.8432 1.8703 1.8220 0.0046  0.0579  -0.0257 386 PRO A CA  
988  C  C   . PRO A 132 ? 1.7314 1.7575 1.7112 0.0057  0.0589  -0.0263 386 PRO A C   
989  O  O   . PRO A 132 ? 1.7442 1.7687 1.7259 0.0069  0.0587  -0.0316 386 PRO A O   
990  C  CB  . PRO A 132 ? 1.8301 1.8518 1.8116 0.0037  0.0570  -0.0312 386 PRO A CB  
991  C  CG  . PRO A 132 ? 1.8455 1.8602 1.8278 0.0010  0.0569  -0.0279 386 PRO A CG  
992  C  CD  . PRO A 132 ? 1.9185 1.9317 1.8997 0.0002  0.0574  -0.0214 386 PRO A CD  
993  N  N   . GLU A 133 ? 1.6007 1.6274 1.5801 0.0054  0.0598  -0.0210 387 GLU A N   
994  C  CA  . GLU A 133 ? 1.6664 1.6974 1.6462 0.0072  0.0608  -0.0213 387 GLU A CA  
995  C  C   . GLU A 133 ? 1.6671 1.7099 1.6446 0.0097  0.0613  -0.0236 387 GLU A C   
996  O  O   . GLU A 133 ? 1.4686 1.5157 1.4466 0.0120  0.0617  -0.0277 387 GLU A O   
997  C  CB  . GLU A 133 ? 1.7419 1.7722 1.7227 0.0060  0.0616  -0.0151 387 GLU A CB  
998  C  CG  . GLU A 133 ? 1.7385 1.7722 1.7208 0.0076  0.0626  -0.0153 387 GLU A CG  
999  C  CD  . GLU A 133 ? 1.6930 1.7179 1.6780 0.0075  0.0621  -0.0163 387 GLU A CD  
1000 O  OE1 . GLU A 133 ? 1.6384 1.6556 1.6236 0.0073  0.0611  -0.0195 387 GLU A OE1 
1001 O  OE2 . GLU A 133 ? 1.5172 1.5429 1.5042 0.0076  0.0625  -0.0138 387 GLU A OE2 
1002 N  N   . GLY A 134 ? 1.7317 1.7798 1.7064 0.0096  0.0611  -0.0209 388 GLY A N   
1003 C  CA  . GLY A 134 ? 1.5771 1.6369 1.5483 0.0122  0.0613  -0.0225 388 GLY A CA  
1004 C  C   . GLY A 134 ? 1.5414 1.6085 1.5098 0.0122  0.0628  -0.0153 388 GLY A C   
1005 O  O   . GLY A 134 ? 1.3190 1.3952 1.2834 0.0142  0.0629  -0.0149 388 GLY A O   
1006 N  N   . LEU A 135 ? 1.4122 1.4752 1.3832 0.0101  0.0638  -0.0097 389 LEU A N   
1007 C  CA  . LEU A 135 ? 1.2984 1.3665 1.2691 0.0094  0.0654  -0.0021 389 LEU A CA  
1008 C  C   . LEU A 135 ? 1.2146 1.2759 1.1869 0.0065  0.0644  0.0036  389 LEU A C   
1009 O  O   . LEU A 135 ? 1.1502 1.2032 1.1236 0.0052  0.0625  0.0017  389 LEU A O   
1010 C  CB  . LEU A 135 ? 1.3140 1.3832 1.2881 0.0093  0.0673  -0.0010 389 LEU A CB  
1011 C  CG  . LEU A 135 ? 1.2881 1.3624 1.2622 0.0119  0.0681  -0.0072 389 LEU A CG  
1012 C  CD1 . LEU A 135 ? 1.2431 1.3206 1.2205 0.0119  0.0702  -0.0050 389 LEU A CD1 
1013 C  CD2 . LEU A 135 ? 1.2475 1.3326 1.2167 0.0148  0.0686  -0.0098 389 LEU A CD2 
1014 N  N   . PHE A 136 ? 1.1092 1.1744 1.0823 0.0057  0.0656  0.0107  390 PHE A N   
1015 C  CA  . PHE A 136 ? 1.0453 1.1041 1.0218 0.0030  0.0646  0.0163  390 PHE A CA  
1016 C  C   . PHE A 136 ? 1.0283 1.0810 1.0101 0.0016  0.0648  0.0159  390 PHE A C   
1017 O  O   . PHE A 136 ? 0.9134 0.9706 0.8971 0.0020  0.0668  0.0171  390 PHE A O   
1018 C  CB  . PHE A 136 ? 1.0317 1.0965 1.0083 0.0025  0.0659  0.0243  390 PHE A CB  
1019 C  CG  . PHE A 136 ? 0.9541 1.0243 0.9252 0.0040  0.0652  0.0258  390 PHE A CG  
1020 C  CD1 . PHE A 136 ? 1.0206 1.0860 0.9903 0.0039  0.0624  0.0235  390 PHE A CD1 
1021 C  CD2 . PHE A 136 ? 0.9768 1.0573 0.9444 0.0056  0.0674  0.0299  390 PHE A CD2 
1022 C  CE1 . PHE A 136 ? 1.0131 1.0838 0.9778 0.0057  0.0614  0.0247  390 PHE A CE1 
1023 C  CE2 . PHE A 136 ? 0.9792 1.0652 0.9410 0.0075  0.0666  0.0316  390 PHE A CE2 
1024 C  CZ  . PHE A 136 ? 0.9618 1.0427 0.9222 0.0076  0.0634  0.0290  390 PHE A CZ  
1025 N  N   . PRO A 137 ? 1.0121 1.0551 0.9959 0.0002  0.0629  0.0141  391 PRO A N   
1026 C  CA  . PRO A 137 ? 0.9375 0.9748 0.9257 -0.0006 0.0628  0.0137  391 PRO A CA  
1027 C  C   . PRO A 137 ? 0.9268 0.9643 0.9202 -0.0023 0.0629  0.0200  391 PRO A C   
1028 O  O   . PRO A 137 ? 0.9244 0.9576 0.9198 -0.0038 0.0612  0.0227  391 PRO A O   
1029 C  CB  . PRO A 137 ? 1.0148 1.0428 1.0026 -0.0012 0.0608  0.0102  391 PRO A CB  
1030 C  CG  . PRO A 137 ? 1.0766 1.1046 1.0625 -0.0020 0.0595  0.0115  391 PRO A CG  
1031 C  CD  . PRO A 137 ? 1.0134 1.0508 0.9958 -0.0005 0.0607  0.0126  391 PRO A CD  
1032 N  N   . GLU A 138 ? 0.9089 0.9518 0.9053 -0.0021 0.0648  0.0220  392 GLU A N   
1033 C  CA  . GLU A 138 ? 0.9551 0.9994 0.9575 -0.0038 0.0653  0.0281  392 GLU A CA  
1034 C  C   . GLU A 138 ? 0.9249 0.9604 0.9326 -0.0053 0.0628  0.0283  392 GLU A C   
1035 O  O   . GLU A 138 ? 0.8364 0.8701 0.8480 -0.0069 0.0616  0.0326  392 GLU A O   
1036 C  CB  . GLU A 138 ? 0.9748 1.0264 0.9800 -0.0032 0.0680  0.0290  392 GLU A CB  
1037 C  CG  . GLU A 138 ? 1.0713 1.1249 1.0847 -0.0051 0.0690  0.0345  392 GLU A CG  
1038 C  CD  . GLU A 138 ? 1.1748 1.2395 1.1890 -0.0050 0.0728  0.0385  392 GLU A CD  
1039 O  OE1 . GLU A 138 ? 1.1546 1.2259 1.1629 -0.0030 0.0746  0.0361  392 GLU A OE1 
1040 O  OE2 . GLU A 138 ? 1.2470 1.3140 1.2681 -0.0070 0.0740  0.0442  392 GLU A OE2 
1041 N  N   . HIS A 139 ? 0.8898 0.9200 0.8976 -0.0044 0.0617  0.0236  393 HIS A N   
1042 C  CA  . HIS A 139 ? 0.8554 0.8786 0.8680 -0.0052 0.0594  0.0236  393 HIS A CA  
1043 C  C   . HIS A 139 ? 0.7983 0.8158 0.8092 -0.0061 0.0572  0.0237  393 HIS A C   
1044 O  O   . HIS A 139 ? 0.7951 0.8093 0.8107 -0.0072 0.0553  0.0257  393 HIS A O   
1045 C  CB  . HIS A 139 ? 0.8666 0.8858 0.8796 -0.0037 0.0588  0.0191  393 HIS A CB  
1046 C  CG  . HIS A 139 ? 0.9794 0.9929 0.9974 -0.0041 0.0563  0.0192  393 HIS A CG  
1047 N  ND1 . HIS A 139 ? 0.9971 1.0031 1.0126 -0.0037 0.0542  0.0166  393 HIS A ND1 
1048 C  CD2 . HIS A 139 ? 1.0538 1.0685 1.0797 -0.0049 0.0555  0.0216  393 HIS A CD2 
1049 C  CE1 . HIS A 139 ? 0.9901 0.9933 1.0110 -0.0037 0.0521  0.0170  393 HIS A CE1 
1050 N  NE2 . HIS A 139 ? 1.0577 1.0658 1.0854 -0.0045 0.0527  0.0198  393 HIS A NE2 
1051 N  N   . LEU A 140 ? 0.7691 0.7856 0.7739 -0.0056 0.0572  0.0211  394 LEU A N   
1052 C  CA  . LEU A 140 ? 0.7833 0.7953 0.7870 -0.0064 0.0553  0.0209  394 LEU A CA  
1053 C  C   . LEU A 140 ? 0.7915 0.8064 0.7976 -0.0076 0.0547  0.0259  394 LEU A C   
1054 O  O   . LEU A 140 ? 0.8354 0.8461 0.8442 -0.0085 0.0525  0.0268  394 LEU A O   
1055 C  CB  . LEU A 140 ? 0.8602 0.8708 0.8578 -0.0056 0.0557  0.0165  394 LEU A CB  
1056 C  CG  . LEU A 140 ? 0.9563 0.9629 0.9522 -0.0063 0.0541  0.0151  394 LEU A CG  
1057 C  CD1 . LEU A 140 ? 1.0546 1.0538 1.0510 -0.0065 0.0531  0.0124  394 LEU A CD1 
1058 C  CD2 . LEU A 140 ? 1.0246 1.0335 1.0157 -0.0056 0.0549  0.0119  394 LEU A CD2 
1059 N  N   . ILE A 141 ? 0.7179 0.7398 0.7228 -0.0074 0.0565  0.0292  395 ILE A N   
1060 C  CA  . ILE A 141 ? 0.8122 0.8368 0.8193 -0.0084 0.0560  0.0350  395 ILE A CA  
1061 C  C   . ILE A 141 ? 0.8416 0.8636 0.8574 -0.0100 0.0548  0.0385  395 ILE A C   
1062 O  O   . ILE A 141 ? 0.8398 0.8589 0.8594 -0.0110 0.0526  0.0412  395 ILE A O   
1063 C  CB  . ILE A 141 ? 0.8362 0.8698 0.8408 -0.0078 0.0587  0.0389  395 ILE A CB  
1064 C  CG1 . ILE A 141 ? 0.9658 1.0038 0.9622 -0.0058 0.0598  0.0350  395 ILE A CG1 
1065 C  CG2 . ILE A 141 ? 0.8304 0.8663 0.8380 -0.0089 0.0584  0.0461  395 ILE A CG2 
1066 C  CD1 . ILE A 141 ? 0.9482 0.9810 0.9410 -0.0053 0.0578  0.0293  395 ILE A CD1 
1067 N  N   . ASP A 142 ? 0.7302 0.7532 0.7498 -0.0100 0.0560  0.0381  396 ASP A N   
1068 C  CA  . ASP A 142 ? 0.7399 0.7612 0.7685 -0.0113 0.0549  0.0408  396 ASP A CA  
1069 C  C   . ASP A 142 ? 0.7445 0.7583 0.7763 -0.0115 0.0513  0.0381  396 ASP A C   
1070 O  O   . ASP A 142 ? 0.7746 0.7866 0.8133 -0.0126 0.0493  0.0409  396 ASP A O   
1071 C  CB  . ASP A 142 ? 0.7759 0.8004 0.8078 -0.0109 0.0568  0.0400  396 ASP A CB  
1072 C  CG  . ASP A 142 ? 0.9181 0.9428 0.9605 -0.0125 0.0561  0.0434  396 ASP A CG  
1073 O  OD1 . ASP A 142 ? 1.0730 1.1030 1.1193 -0.0138 0.0582  0.0491  396 ASP A OD1 
1074 O  OD2 . ASP A 142 ? 0.9668 0.9863 1.0138 -0.0123 0.0534  0.0406  396 ASP A OD2 
1075 N  N   . VAL A 143 ? 0.7277 0.7373 0.7547 -0.0102 0.0506  0.0325  397 VAL A N   
1076 C  CA  . VAL A 143 ? 0.7209 0.7241 0.7493 -0.0100 0.0477  0.0294  397 VAL A CA  
1077 C  C   . VAL A 143 ? 0.7694 0.7709 0.7967 -0.0107 0.0459  0.0304  397 VAL A C   
1078 O  O   . VAL A 143 ? 0.7304 0.7291 0.7632 -0.0112 0.0432  0.0310  397 VAL A O   
1079 C  CB  . VAL A 143 ? 0.7240 0.7234 0.7465 -0.0084 0.0479  0.0240  397 VAL A CB  
1080 C  CG1 . VAL A 143 ? 0.7309 0.7244 0.7538 -0.0080 0.0453  0.0210  397 VAL A CG1 
1081 C  CG2 . VAL A 143 ? 0.7753 0.7761 0.7996 -0.0075 0.0490  0.0229  397 VAL A CG2 
1082 N  N   . LEU A 144 ? 0.7035 0.7070 0.7242 -0.0105 0.0472  0.0303  398 LEU A N   
1083 C  CA  . LEU A 144 ? 0.7416 0.7442 0.7617 -0.0109 0.0454  0.0312  398 LEU A CA  
1084 C  C   . LEU A 144 ? 0.7354 0.7393 0.7623 -0.0120 0.0439  0.0370  398 LEU A C   
1085 O  O   . LEU A 144 ? 0.7255 0.7264 0.7556 -0.0123 0.0411  0.0370  398 LEU A O   
1086 C  CB  . LEU A 144 ? 0.7055 0.7111 0.7181 -0.0103 0.0470  0.0300  398 LEU A CB  
1087 C  CG  . LEU A 144 ? 0.7210 0.7273 0.7317 -0.0103 0.0455  0.0308  398 LEU A CG  
1088 C  CD1 . LEU A 144 ? 0.7385 0.7396 0.7492 -0.0104 0.0434  0.0264  398 LEU A CD1 
1089 C  CD2 . LEU A 144 ? 0.7289 0.7402 0.7327 -0.0092 0.0474  0.0298  398 LEU A CD2 
1090 N  N   . ARG A 145 ? 0.7106 0.7190 0.7403 -0.0126 0.0457  0.0418  399 ARG A N   
1091 C  CA  . ARG A 145 ? 0.7436 0.7524 0.7815 -0.0139 0.0444  0.0478  399 ARG A CA  
1092 C  C   . ARG A 145 ? 0.6899 0.6942 0.7376 -0.0146 0.0415  0.0469  399 ARG A C   
1093 O  O   . ARG A 145 ? 0.6615 0.6633 0.7148 -0.0152 0.0387  0.0486  399 ARG A O   
1094 C  CB  . ARG A 145 ? 0.7578 0.7724 0.7981 -0.0147 0.0475  0.0532  399 ARG A CB  
1095 C  CG  . ARG A 145 ? 0.8103 0.8307 0.8436 -0.0141 0.0500  0.0567  399 ARG A CG  
1096 C  CD  . ARG A 145 ? 0.8535 0.8802 0.8896 -0.0148 0.0536  0.0614  399 ARG A CD  
1097 N  NE  . ARG A 145 ? 0.9063 0.9394 0.9363 -0.0141 0.0559  0.0662  399 ARG A NE  
1098 C  CZ  . ARG A 145 ? 0.9487 0.9889 0.9790 -0.0144 0.0595  0.0710  399 ARG A CZ  
1099 N  NH1 . ARG A 145 ? 0.9498 0.9914 0.9871 -0.0157 0.0613  0.0716  399 ARG A NH1 
1100 N  NH2 . ARG A 145 ? 1.0376 1.0839 1.0614 -0.0134 0.0614  0.0752  399 ARG A NH2 
1101 N  N   . ARG A 146 ? 0.6792 0.6827 0.7292 -0.0143 0.0420  0.0437  400 ARG A N   
1102 C  CA  . ARG A 146 ? 0.6592 0.6588 0.7177 -0.0143 0.0389  0.0414  400 ARG A CA  
1103 C  C   . ARG A 146 ? 0.6666 0.6614 0.7238 -0.0134 0.0356  0.0370  400 ARG A C   
1104 O  O   . ARG A 146 ? 0.6692 0.6615 0.7342 -0.0137 0.0323  0.0370  400 ARG A O   
1105 C  CB  . ARG A 146 ? 0.6487 0.6488 0.7084 -0.0135 0.0399  0.0382  400 ARG A CB  
1106 C  CG  . ARG A 146 ? 0.7120 0.7174 0.7761 -0.0146 0.0428  0.0426  400 ARG A CG  
1107 C  CD  . ARG A 146 ? 0.7807 0.7875 0.8463 -0.0136 0.0440  0.0394  400 ARG A CD  
1108 N  NE  . ARG A 146 ? 0.7572 0.7703 0.8217 -0.0143 0.0479  0.0430  400 ARG A NE  
1109 C  CZ  . ARG A 146 ? 0.8204 0.8379 0.8931 -0.0162 0.0495  0.0486  400 ARG A CZ  
1110 N  NH1 . ARG A 146 ? 0.7686 0.7843 0.8526 -0.0178 0.0473  0.0513  400 ARG A NH1 
1111 N  NH2 . ARG A 146 ? 0.7981 0.8221 0.8678 -0.0166 0.0536  0.0517  400 ARG A NH2 
1112 N  N   . GLU A 147 ? 0.6441 0.6378 0.6921 -0.0123 0.0365  0.0330  401 GLU A N   
1113 C  CA  . GLU A 147 ? 0.6583 0.6482 0.7047 -0.0116 0.0340  0.0288  401 GLU A CA  
1114 C  C   . GLU A 147 ? 0.6508 0.6406 0.6997 -0.0123 0.0320  0.0313  401 GLU A C   
1115 O  O   . GLU A 147 ? 0.6516 0.6388 0.7050 -0.0119 0.0288  0.0291  401 GLU A O   
1116 C  CB  . GLU A 147 ? 0.7141 0.7031 0.7503 -0.0107 0.0360  0.0248  401 GLU A CB  
1117 C  CG  . GLU A 147 ? 0.7482 0.7360 0.7810 -0.0096 0.0376  0.0217  401 GLU A CG  
1118 C  CD  . GLU A 147 ? 0.7610 0.7456 0.7969 -0.0084 0.0351  0.0183  401 GLU A CD  
1119 O  OE1 . GLU A 147 ? 0.8665 0.8492 0.9036 -0.0082 0.0329  0.0164  401 GLU A OE1 
1120 O  OE2 . GLU A 147 ? 0.9538 0.9379 0.9904 -0.0073 0.0354  0.0169  401 GLU A OE2 
1121 N  N   . LEU A 148 ? 0.6576 0.6505 0.7034 -0.0129 0.0337  0.0355  402 LEU A N   
1122 C  CA  . LEU A 148 ? 0.7070 0.6996 0.7557 -0.0133 0.0313  0.0385  402 LEU A CA  
1123 C  C   . LEU A 148 ? 0.6952 0.6864 0.7556 -0.0142 0.0286  0.0423  402 LEU A C   
1124 O  O   . LEU A 148 ? 0.6674 0.6563 0.7323 -0.0140 0.0252  0.0419  402 LEU A O   
1125 C  CB  . LEU A 148 ? 0.6631 0.6597 0.7061 -0.0134 0.0334  0.0427  402 LEU A CB  
1126 C  CG  . LEU A 148 ? 0.6976 0.6952 0.7308 -0.0124 0.0349  0.0384  402 LEU A CG  
1127 C  CD1 . LEU A 148 ? 0.7114 0.7142 0.7387 -0.0120 0.0373  0.0419  402 LEU A CD1 
1128 C  CD2 . LEU A 148 ? 0.7259 0.7210 0.7582 -0.0119 0.0322  0.0347  402 LEU A CD2 
1129 N  N   . ALA A 149 ? 0.7437 0.7364 0.8099 -0.0151 0.0299  0.0457  403 ALA A N   
1130 C  CA  . ALA A 149 ? 0.7278 0.7190 0.8067 -0.0162 0.0272  0.0491  403 ALA A CA  
1131 C  C   . ALA A 149 ? 0.7302 0.7174 0.8148 -0.0152 0.0232  0.0428  403 ALA A C   
1132 O  O   . ALA A 149 ? 0.7314 0.7161 0.8242 -0.0152 0.0194  0.0429  403 ALA A O   
1133 C  CB  . ALA A 149 ? 0.6852 0.6792 0.7697 -0.0175 0.0298  0.0531  403 ALA A CB  
1134 N  N   . LEU A 150 ? 0.6837 0.6705 0.7632 -0.0139 0.0240  0.0371  404 LEU A N   
1135 C  CA  . LEU A 150 ? 0.7417 0.7257 0.8253 -0.0125 0.0206  0.0310  404 LEU A CA  
1136 C  C   . LEU A 150 ? 0.7345 0.7166 0.8165 -0.0117 0.0178  0.0282  404 LEU A C   
1137 O  O   . LEU A 150 ? 0.6395 0.6197 0.7299 -0.0110 0.0137  0.0259  404 LEU A O   
1138 C  CB  . LEU A 150 ? 0.7858 0.7700 0.8622 -0.0111 0.0225  0.0265  404 LEU A CB  
1139 C  CG  . LEU A 150 ? 0.8665 0.8491 0.9447 -0.0091 0.0204  0.0205  404 LEU A CG  
1140 C  CD1 . LEU A 150 ? 0.9078 0.8902 0.9989 -0.0090 0.0170  0.0201  404 LEU A CD1 
1141 C  CD2 . LEU A 150 ? 0.8801 0.8637 0.9516 -0.0085 0.0236  0.0196  404 LEU A CD2 
1142 N  N   . GLU A 151 ? 0.7140 0.6968 0.7861 -0.0117 0.0200  0.0282  405 GLU A N   
1143 C  CA  . GLU A 151 ? 0.7498 0.7316 0.8196 -0.0110 0.0180  0.0254  405 GLU A CA  
1144 C  C   . GLU A 151 ? 0.7334 0.7143 0.8117 -0.0115 0.0144  0.0287  405 GLU A C   
1145 O  O   . GLU A 151 ? 0.7374 0.7168 0.8186 -0.0105 0.0112  0.0253  405 GLU A O   
1146 C  CB  . GLU A 151 ? 0.8547 0.8381 0.9135 -0.0112 0.0211  0.0256  405 GLU A CB  
1147 C  CG  . GLU A 151 ? 1.0248 1.0078 1.0813 -0.0106 0.0193  0.0227  405 GLU A CG  
1148 C  CD  . GLU A 151 ? 1.0570 1.0410 1.1033 -0.0104 0.0224  0.0196  405 GLU A CD  
1149 O  OE1 . GLU A 151 ? 1.1733 1.1562 1.2168 -0.0098 0.0230  0.0146  405 GLU A OE1 
1150 O  OE2 . GLU A 151 ? 1.2833 1.2695 1.3248 -0.0108 0.0243  0.0224  405 GLU A OE2 
1151 N  N   . CYS A 152 ? 0.7599 0.7419 0.8414 -0.0128 0.0154  0.0357  406 CYS A N   
1152 C  CA  . CYS A 152 ? 0.7800 0.7607 0.8702 -0.0134 0.0124  0.0406  406 CYS A CA  
1153 C  C   . CYS A 152 ? 0.7041 0.6822 0.8077 -0.0134 0.0083  0.0395  406 CYS A C   
1154 O  O   . CYS A 152 ? 0.7015 0.6776 0.8126 -0.0136 0.0051  0.0423  406 CYS A O   
1155 C  CB  . CYS A 152 ? 0.7841 0.7670 0.8751 -0.0150 0.0152  0.0491  406 CYS A CB  
1156 S  SG  . CYS A 152 ? 0.9009 0.8871 0.9786 -0.0146 0.0185  0.0516  406 CYS A SG  
1157 N  N   . ASP A 153 ? 0.6798 0.6577 0.7869 -0.0131 0.0083  0.0358  407 ASP A N   
1158 C  CA  . ASP A 153 ? 0.6426 0.6187 0.7635 -0.0130 0.0043  0.0341  407 ASP A CA  
1159 C  C   . ASP A 153 ? 0.6815 0.6560 0.8051 -0.0107 -0.0002 0.0262  407 ASP A C   
1160 O  O   . ASP A 153 ? 0.6597 0.6349 0.7812 -0.0092 -0.0004 0.0201  407 ASP A O   
1161 C  CB  . ASP A 153 ? 0.6567 0.6341 0.7807 -0.0134 0.0061  0.0338  407 ASP A CB  
1162 C  CG  . ASP A 153 ? 0.6382 0.6142 0.7784 -0.0136 0.0022  0.0330  407 ASP A CG  
1163 O  OD1 . ASP A 153 ? 0.6999 0.6736 0.8490 -0.0127 -0.0026 0.0304  407 ASP A OD1 
1164 O  OD2 . ASP A 153 ? 0.6717 0.6492 0.8159 -0.0144 0.0039  0.0340  407 ASP A OD2 
1165 N  N   . TYR A 154 ? 0.6755 0.6482 0.8048 -0.0104 -0.0039 0.0266  408 TYR A N   
1166 C  CA  . TYR A 154 ? 0.6335 0.6055 0.7659 -0.0082 -0.0083 0.0191  408 TYR A CA  
1167 C  C   . TYR A 154 ? 0.7176 0.6888 0.8632 -0.0071 -0.0126 0.0147  408 TYR A C   
1168 O  O   . TYR A 154 ? 0.7610 0.7330 0.9074 -0.0047 -0.0154 0.0071  408 TYR A O   
1169 C  CB  . TYR A 154 ? 0.6772 0.6480 0.8100 -0.0079 -0.0107 0.0203  408 TYR A CB  
1170 C  CG  . TYR A 154 ? 0.6511 0.6236 0.7701 -0.0078 -0.0076 0.0204  408 TYR A CG  
1171 C  CD1 . TYR A 154 ? 0.6877 0.6623 0.7948 -0.0082 -0.0026 0.0197  408 TYR A CD1 
1172 C  CD2 . TYR A 154 ? 0.6873 0.6592 0.8059 -0.0073 -0.0099 0.0207  408 TYR A CD2 
1173 C  CE1 . TYR A 154 ? 0.6983 0.6745 0.7942 -0.0081 0.0000  0.0190  408 TYR A CE1 
1174 C  CE2 . TYR A 154 ? 0.6791 0.6530 0.7860 -0.0070 -0.0073 0.0198  408 TYR A CE2 
1175 C  CZ  . TYR A 154 ? 0.6709 0.6469 0.7668 -0.0076 -0.0023 0.0189  408 TYR A CZ  
1176 O  OH  . TYR A 154 ? 0.7617 0.7397 0.8471 -0.0076 0.0006  0.0179  408 TYR A OH  
1177 N  N   . GLN A 155 ? 0.7090 0.6792 0.8651 -0.0086 -0.0130 0.0189  409 GLN A N   
1178 C  CA  . GLN A 155 ? 0.7712 0.7412 0.9403 -0.0074 -0.0171 0.0141  409 GLN A CA  
1179 C  C   . GLN A 155 ? 0.7282 0.7007 0.8900 -0.0056 -0.0153 0.0083  409 GLN A C   
1180 O  O   . GLN A 155 ? 0.7184 0.6919 0.8832 -0.0030 -0.0186 0.0007  409 GLN A O   
1181 C  CB  . GLN A 155 ? 0.7754 0.7440 0.9580 -0.0099 -0.0173 0.0205  409 GLN A CB  
1182 C  CG  . GLN A 155 ? 0.8755 0.8411 1.0648 -0.0118 -0.0186 0.0279  409 GLN A CG  
1183 C  CD  . GLN A 155 ? 0.9127 0.8766 1.1175 -0.0143 -0.0192 0.0343  409 GLN A CD  
1184 O  OE1 . GLN A 155 ? 0.9590 0.9233 1.1615 -0.0169 -0.0150 0.0430  409 GLN A OE1 
1185 N  NE2 . GLN A 155 ? 0.8362 0.7986 1.0568 -0.0135 -0.0243 0.0298  409 GLN A NE2 
1186 N  N   . ARG A 156 ? 0.7353 0.7091 0.8879 -0.0070 -0.0101 0.0121  410 ARG A N   
1187 C  CA  . ARG A 156 ? 0.7454 0.7212 0.8889 -0.0053 -0.0078 0.0076  410 ARG A CA  
1188 C  C   . ARG A 156 ? 0.7048 0.6813 0.8376 -0.0029 -0.0079 0.0016  410 ARG A C   
1189 O  O   . ARG A 156 ? 0.6659 0.6437 0.7977 -0.0002 -0.0096 -0.0051 410 ARG A O   
1190 C  CB  . ARG A 156 ? 0.7416 0.7184 0.8757 -0.0072 -0.0020 0.0131  410 ARG A CB  
1191 C  CG  . ARG A 156 ? 0.7760 0.7544 0.9031 -0.0056 0.0000  0.0093  410 ARG A CG  
1192 C  CD  . ARG A 156 ? 0.8109 0.7902 0.9252 -0.0068 0.0055  0.0129  410 ARG A CD  
1193 N  NE  . ARG A 156 ? 0.9171 0.8973 1.0263 -0.0049 0.0067  0.0090  410 ARG A NE  
1194 C  CZ  . ARG A 156 ? 1.0167 0.9966 1.1154 -0.0028 0.0075  0.0045  410 ARG A CZ  
1195 N  NH1 . ARG A 156 ? 1.0203 0.9994 1.1117 -0.0026 0.0078  0.0031  410 ARG A NH1 
1196 N  NH2 . ARG A 156 ? 0.9865 0.9669 1.0821 -0.0010 0.0081  0.0016  410 ARG A NH2 
1197 N  N   . GLU A 157 ? 0.5926 0.5686 0.7176 -0.0038 -0.0062 0.0039  411 GLU A N   
1198 C  CA  . GLU A 157 ? 0.6472 0.6241 0.7636 -0.0020 -0.0062 -0.0016 411 GLU A CA  
1199 C  C   . GLU A 157 ? 0.6603 0.6380 0.7849 0.0008  -0.0116 -0.0089 411 GLU A C   
1200 O  O   . GLU A 157 ? 0.6339 0.6135 0.7525 0.0033  -0.0117 -0.0150 411 GLU A O   
1201 C  CB  . GLU A 157 ? 0.6843 0.6609 0.7935 -0.0033 -0.0041 0.0014  411 GLU A CB  
1202 C  CG  . GLU A 157 ? 0.7285 0.7065 0.8279 -0.0018 -0.0029 -0.0040 411 GLU A CG  
1203 C  CD  . GLU A 157 ? 0.7720 0.7501 0.8640 -0.0033 -0.0005 -0.0014 411 GLU A CD  
1204 O  OE1 . GLU A 157 ? 0.8217 0.7994 0.9102 -0.0051 0.0023  0.0043  411 GLU A OE1 
1205 O  OE2 . GLU A 157 ? 0.7617 0.7408 0.8517 -0.0023 -0.0015 -0.0055 411 GLU A OE2 
1206 N  N   . ALA A 158 ? 0.6755 0.6518 0.8136 0.0005  -0.0162 -0.0082 412 ALA A N   
1207 C  CA  . ALA A 158 ? 0.7441 0.7212 0.8919 0.0031  -0.0220 -0.0151 412 ALA A CA  
1208 C  C   . ALA A 158 ? 0.7334 0.7123 0.8848 0.0056  -0.0238 -0.0207 412 ALA A C   
1209 O  O   . ALA A 158 ? 0.7159 0.6975 0.8655 0.0088  -0.0259 -0.0281 412 ALA A O   
1210 C  CB  . ALA A 158 ? 0.7663 0.7408 0.9289 0.0021  -0.0264 -0.0124 412 ALA A CB  
1211 N  N   . ALA A 159 ? 0.7061 0.6844 0.8612 0.0044  -0.0225 -0.0173 413 ALA A N   
1212 C  CA  . ALA A 159 ? 0.6765 0.6568 0.8347 0.0070  -0.0243 -0.0227 413 ALA A CA  
1213 C  C   . ALA A 159 ? 0.7254 0.7080 0.8681 0.0092  -0.0210 -0.0263 413 ALA A C   
1214 O  O   . ALA A 159 ? 0.7211 0.7062 0.8641 0.0128  -0.0236 -0.0330 413 ALA A O   
1215 C  CB  . ALA A 159 ? 0.6586 0.6380 0.8249 0.0050  -0.0235 -0.0183 413 ALA A CB  
1216 N  N   . CYS A 160 ? 0.7371 0.7188 0.8666 0.0074  -0.0155 -0.0217 414 CYS A N   
1217 C  CA  . CYS A 160 ? 0.7020 0.6851 0.8169 0.0092  -0.0120 -0.0242 414 CYS A CA  
1218 C  C   . CYS A 160 ? 0.6812 0.6664 0.7911 0.0116  -0.0132 -0.0300 414 CYS A C   
1219 O  O   . CYS A 160 ? 0.6924 0.6799 0.7974 0.0148  -0.0137 -0.0351 414 CYS A O   
1220 C  CB  . CYS A 160 ? 0.7482 0.7297 0.8519 0.0064  -0.0061 -0.0180 414 CYS A CB  
1221 S  SG  . CYS A 160 ? 0.8009 0.7815 0.9070 0.0044  -0.0035 -0.0124 414 CYS A SG  
1222 N  N   . ALA A 161 ? 0.6662 0.6510 0.7775 0.0102  -0.0137 -0.0291 415 ALA A N   
1223 C  CA  . ALA A 161 ? 0.6796 0.6669 0.7899 0.0125  -0.0159 -0.0351 415 ALA A CA  
1224 C  C   . ALA A 161 ? 0.7047 0.6950 0.8241 0.0164  -0.0215 -0.0426 415 ALA A C   
1225 O  O   . ALA A 161 ? 0.7042 0.6979 0.8174 0.0195  -0.0215 -0.0481 415 ALA A O   
1226 C  CB  . ALA A 161 ? 0.6654 0.6517 0.7796 0.0106  -0.0169 -0.0333 415 ALA A CB  
1227 N  N   . ARG A 162 ? 0.7820 0.7712 0.9163 0.0163  -0.0263 -0.0429 416 ARG A N   
1228 C  CA  . ARG A 162 ? 0.8049 0.7972 0.9491 0.0203  -0.0322 -0.0509 416 ARG A CA  
1229 C  C   . ARG A 162 ? 0.7702 0.7651 0.9076 0.0234  -0.0312 -0.0542 416 ARG A C   
1230 O  O   . ARG A 162 ? 0.7488 0.7479 0.8854 0.0276  -0.0339 -0.0616 416 ARG A O   
1231 C  CB  . ARG A 162 ? 0.9114 0.9016 1.0740 0.0194  -0.0373 -0.0502 416 ARG A CB  
1232 C  CG  . ARG A 162 ? 0.9824 0.9703 1.1549 0.0176  -0.0401 -0.0483 416 ARG A CG  
1233 C  CD  . ARG A 162 ? 1.0291 1.0141 1.2201 0.0163  -0.0446 -0.0465 416 ARG A CD  
1234 N  NE  . ARG A 162 ? 1.0256 1.0069 1.2236 0.0135  -0.0458 -0.0414 416 ARG A NE  
1235 C  CZ  . ARG A 162 ? 1.0623 1.0396 1.2628 0.0095  -0.0433 -0.0321 416 ARG A CZ  
1236 N  NH1 . ARG A 162 ? 0.9593 0.9358 1.1570 0.0074  -0.0394 -0.0268 416 ARG A NH1 
1237 N  NH2 . ARG A 162 ? 1.0431 1.0174 1.2485 0.0078  -0.0448 -0.0280 416 ARG A NH2 
1238 N  N   . LYS A 163 ? 0.7296 0.7222 0.8618 0.0215  -0.0274 -0.0490 417 LYS A N   
1239 C  CA  . LYS A 163 ? 0.7795 0.7740 0.9053 0.0244  -0.0266 -0.0515 417 LYS A CA  
1240 C  C   . LYS A 163 ? 0.7890 0.7854 0.8978 0.0264  -0.0227 -0.0531 417 LYS A C   
1241 O  O   . LYS A 163 ? 0.8024 0.8024 0.9073 0.0307  -0.0242 -0.0587 417 LYS A O   
1242 C  CB  . LYS A 163 ? 0.8918 0.8833 1.0184 0.0218  -0.0239 -0.0455 417 LYS A CB  
1243 C  CG  . LYS A 163 ? 1.0748 1.0681 1.1991 0.0249  -0.0246 -0.0485 417 LYS A CG  
1244 C  CD  . LYS A 163 ? 1.2812 1.2731 1.3900 0.0244  -0.0188 -0.0445 417 LYS A CD  
1245 C  CE  . LYS A 163 ? 1.5252 1.5164 1.6188 0.0237  -0.0140 -0.0426 417 LYS A CE  
1246 N  NZ  . LYS A 163 ? 1.4885 1.4764 1.5768 0.0190  -0.0091 -0.0355 417 LYS A NZ  
1247 N  N   . PHE A 164 ? 0.7245 0.7191 0.8240 0.0235  -0.0179 -0.0486 418 PHE A N   
1248 C  CA  . PHE A 164 ? 0.7806 0.7769 0.8655 0.0249  -0.0139 -0.0498 418 PHE A CA  
1249 C  C   . PHE A 164 ? 0.8087 0.8098 0.8956 0.0284  -0.0173 -0.0571 418 PHE A C   
1250 O  O   . PHE A 164 ? 0.7593 0.7637 0.8368 0.0316  -0.0159 -0.0604 418 PHE A O   
1251 C  CB  . PHE A 164 ? 0.8501 0.8438 0.9260 0.0210  -0.0083 -0.0443 418 PHE A CB  
1252 C  CG  . PHE A 164 ? 0.9330 0.9251 0.9958 0.0207  -0.0030 -0.0410 418 PHE A CG  
1253 C  CD1 . PHE A 164 ? 0.9612 0.9555 1.0135 0.0234  -0.0009 -0.0438 418 PHE A CD1 
1254 C  CD2 . PHE A 164 ? 0.9334 0.9220 0.9949 0.0183  -0.0005 -0.0356 418 PHE A CD2 
1255 C  CE1 . PHE A 164 ? 0.9317 0.9240 0.9726 0.0235  0.0036  -0.0408 418 PHE A CE1 
1256 C  CE2 . PHE A 164 ? 0.9979 0.9847 1.0480 0.0185  0.0038  -0.0331 418 PHE A CE2 
1257 C  CZ  . PHE A 164 ? 1.0282 1.0165 1.0681 0.0210  0.0058  -0.0355 418 PHE A CZ  
1258 N  N   . ARG A 165 ? 0.8002 0.8019 0.8990 0.0278  -0.0215 -0.0593 419 ARG A N   
1259 C  CA  . ARG A 165 ? 0.8722 0.8789 0.9741 0.0311  -0.0250 -0.0667 419 ARG A CA  
1260 C  C   . ARG A 165 ? 0.8504 0.8616 0.9547 0.0365  -0.0291 -0.0738 419 ARG A C   
1261 O  O   . ARG A 165 ? 0.8949 0.9109 0.9914 0.0399  -0.0285 -0.0785 419 ARG A O   
1262 C  CB  . ARG A 165 ? 0.8594 0.8651 0.9751 0.0295  -0.0293 -0.0675 419 ARG A CB  
1263 C  CG  . ARG A 165 ? 0.8712 0.8823 0.9926 0.0331  -0.0338 -0.0760 419 ARG A CG  
1264 C  CD  . ARG A 165 ? 0.8379 0.8471 0.9684 0.0306  -0.0360 -0.0749 419 ARG A CD  
1265 N  NE  . ARG A 165 ? 0.9164 0.9300 1.0576 0.0344  -0.0424 -0.0834 419 ARG A NE  
1266 C  CZ  . ARG A 165 ? 0.9393 0.9574 1.0793 0.0361  -0.0431 -0.0887 419 ARG A CZ  
1267 N  NH1 . ARG A 165 ? 0.9813 1.0003 1.1097 0.0342  -0.0376 -0.0863 419 ARG A NH1 
1268 N  NH2 . ARG A 165 ? 0.8555 0.8775 1.0070 0.0397  -0.0495 -0.0967 419 ARG A NH2 
1269 N  N   . ASP A 166 ? 0.8426 0.8525 0.9565 0.0372  -0.0328 -0.0744 420 ASP A N   
1270 C  CA  . ASP A 166 ? 0.8963 0.9105 1.0104 0.0426  -0.0362 -0.0808 420 ASP A CA  
1271 C  C   . ASP A 166 ? 0.8842 0.9005 0.9812 0.0453  -0.0318 -0.0806 420 ASP A C   
1272 O  O   . ASP A 166 ? 0.9655 0.9874 1.0582 0.0501  -0.0335 -0.0868 420 ASP A O   
1273 C  CB  . ASP A 166 ? 0.9553 0.9671 1.0790 0.0423  -0.0388 -0.0796 420 ASP A CB  
1274 C  CG  . ASP A 166 ? 0.9856 0.9961 1.1282 0.0409  -0.0442 -0.0811 420 ASP A CG  
1275 O  OD1 . ASP A 166 ? 0.8952 0.9062 1.0431 0.0402  -0.0460 -0.0828 420 ASP A OD1 
1276 O  OD2 . ASP A 166 ? 1.0544 1.0632 1.2067 0.0404  -0.0464 -0.0803 420 ASP A OD2 
1277 N  N   . LEU A 167 ? 0.9031 0.9149 0.9907 0.0424  -0.0264 -0.0734 421 LEU A N   
1278 C  CA  . LEU A 167 ? 0.8571 0.8695 0.9287 0.0446  -0.0222 -0.0719 421 LEU A CA  
1279 C  C   . LEU A 167 ? 0.8077 0.8236 0.8674 0.0461  -0.0188 -0.0735 421 LEU A C   
1280 O  O   . LEU A 167 ? 0.8616 0.8798 0.9101 0.0495  -0.0169 -0.0743 421 LEU A O   
1281 C  CB  . LEU A 167 ? 0.8104 0.8166 0.8751 0.0403  -0.0167 -0.0634 421 LEU A CB  
1282 C  CG  . LEU A 167 ? 0.8136 0.8168 0.8866 0.0392  -0.0185 -0.0611 421 LEU A CG  
1283 C  CD1 . LEU A 167 ? 0.8135 0.8114 0.8806 0.0344  -0.0130 -0.0530 421 LEU A CD1 
1284 C  CD2 . LEU A 167 ? 0.7409 0.7468 0.8119 0.0444  -0.0213 -0.0654 421 LEU A CD2 
1285 N  N   . LEU A 168 ? 0.8291 0.8453 0.8914 0.0433  -0.0178 -0.0732 422 LEU A N   
1286 C  CA  . LEU A 168 ? 0.8471 0.8674 0.9007 0.0442  -0.0147 -0.0752 422 LEU A CA  
1287 C  C   . LEU A 168 ? 0.8725 0.8997 0.9338 0.0479  -0.0198 -0.0838 422 LEU A C   
1288 O  O   . LEU A 168 ? 0.8396 0.8711 0.8955 0.0486  -0.0176 -0.0860 422 LEU A O   
1289 C  CB  . LEU A 168 ? 0.8761 0.8924 0.9260 0.0386  -0.0094 -0.0690 422 LEU A CB  
1290 C  CG  . LEU A 168 ? 0.8628 0.8735 0.9021 0.0358  -0.0036 -0.0615 422 LEU A CG  
1291 C  CD1 . LEU A 168 ? 0.8131 0.8205 0.8497 0.0306  0.0012  -0.0564 422 LEU A CD1 
1292 C  CD2 . LEU A 168 ? 0.8267 0.8394 0.8524 0.0392  -0.0003 -0.0617 422 LEU A CD2 
1293 N  N   . LYS A 169 ? 0.9678 0.9966 1.0423 0.0504  -0.0267 -0.0889 423 LYS A N   
1294 C  CA  . LYS A 169 ? 1.0252 1.0609 1.1084 0.0548  -0.0326 -0.0983 423 LYS A CA  
1295 C  C   . LYS A 169 ? 0.9229 0.9658 0.9936 0.0595  -0.0305 -0.1025 423 LYS A C   
1296 O  O   . LYS A 169 ? 0.9649 1.0086 1.0258 0.0622  -0.0288 -0.1016 423 LYS A O   
1297 C  CB  . LYS A 169 ? 1.0664 1.1032 1.1625 0.0582  -0.0398 -0.1036 423 LYS A CB  
1298 C  CG  . LYS A 169 ? 1.1470 1.1873 1.2600 0.0603  -0.0473 -0.1115 423 LYS A CG  
1299 C  CD  . LYS A 169 ? 1.2551 1.2943 1.3829 0.0620  -0.0538 -0.1148 423 LYS A CD  
1300 C  CE  . LYS A 169 ? 1.3018 1.3333 1.4303 0.0575  -0.0511 -0.1062 423 LYS A CE  
1301 N  NZ  . LYS A 169 ? 1.2891 1.3170 1.4357 0.0558  -0.0561 -0.1061 423 LYS A NZ  
1302 N  N   . GLY A 170 ? 0.9534 1.0015 1.0238 0.0602  -0.0301 -0.1065 424 GLY A N   
1303 C  CA  . GLY A 170 ? 0.9539 1.0101 1.0130 0.0649  -0.0281 -0.1109 424 GLY A CA  
1304 C  C   . GLY A 170 ? 0.9567 1.0117 0.9985 0.0630  -0.0195 -0.1042 424 GLY A C   
1305 O  O   . GLY A 170 ? 0.9434 1.0049 0.9748 0.0669  -0.0172 -0.1067 424 GLY A O   
1306 N  N   . HIS A 171 ? 0.9112 0.9584 0.9500 0.0570  -0.0147 -0.0958 425 HIS A N   
1307 C  CA  . HIS A 171 ? 0.8713 0.9161 0.8947 0.0551  -0.0069 -0.0890 425 HIS A CA  
1308 C  C   . HIS A 171 ? 0.8305 0.8803 0.8483 0.0542  -0.0023 -0.0900 425 HIS A C   
1309 O  O   . HIS A 171 ? 0.8520 0.9028 0.8781 0.0518  -0.0035 -0.0922 425 HIS A O   
1310 C  CB  . HIS A 171 ? 0.8202 0.8552 0.8429 0.0494  -0.0036 -0.0803 425 HIS A CB  
1311 C  CG  . HIS A 171 ? 0.7551 0.7867 0.7632 0.0483  0.0032  -0.0736 425 HIS A CG  
1312 N  ND1 . HIS A 171 ? 0.8085 0.8404 0.8079 0.0457  0.0097  -0.0704 425 HIS A ND1 
1313 C  CD2 . HIS A 171 ? 0.7260 0.7534 0.7275 0.0493  0.0043  -0.0696 425 HIS A CD2 
1314 C  CE1 . HIS A 171 ? 0.7654 0.7935 0.7534 0.0454  0.0145  -0.0647 425 HIS A CE1 
1315 N  NE2 . HIS A 171 ? 0.7644 0.7895 0.7533 0.0476  0.0112  -0.0641 425 HIS A NE2 
1316 N  N   . PRO A 172 ? 0.8218 0.8749 0.8259 0.0562  0.0029  -0.0885 426 PRO A N   
1317 C  CA  . PRO A 172 ? 0.8722 0.9315 0.8715 0.0557  0.0074  -0.0900 426 PRO A CA  
1318 C  C   . PRO A 172 ? 0.8911 0.9456 0.8895 0.0490  0.0133  -0.0842 426 PRO A C   
1319 O  O   . PRO A 172 ? 1.0117 1.0715 1.0091 0.0481  0.0164  -0.0862 426 PRO A O   
1320 C  CB  . PRO A 172 ? 0.8646 0.9279 0.8487 0.0597  0.0118  -0.0884 426 PRO A CB  
1321 C  CG  . PRO A 172 ? 0.8072 0.8626 0.7864 0.0596  0.0119  -0.0826 426 PRO A CG  
1322 C  CD  . PRO A 172 ? 0.8091 0.8617 0.8019 0.0599  0.0043  -0.0860 426 PRO A CD  
1323 N  N   . PHE A 173 ? 0.8502 0.8955 0.8482 0.0447  0.0151  -0.0772 427 PHE A N   
1324 C  CA  . PHE A 173 ? 0.8136 0.8544 0.8107 0.0386  0.0204  -0.0720 427 PHE A CA  
1325 C  C   . PHE A 173 ? 0.8174 0.8512 0.8240 0.0341  0.0180  -0.0692 427 PHE A C   
1326 O  O   . PHE A 173 ? 0.8305 0.8638 0.8406 0.0303  0.0199  -0.0685 427 PHE A O   
1327 C  CB  . PHE A 173 ? 0.8303 0.8672 0.8146 0.0374  0.0270  -0.0652 427 PHE A CB  
1328 C  CG  . PHE A 173 ? 0.7949 0.8278 0.7770 0.0317  0.0332  -0.0601 427 PHE A CG  
1329 C  CD1 . PHE A 173 ? 0.8040 0.8421 0.7832 0.0306  0.0379  -0.0612 427 PHE A CD1 
1330 C  CD2 . PHE A 173 ? 0.8060 0.8305 0.7892 0.0277  0.0342  -0.0545 427 PHE A CD2 
1331 C  CE1 . PHE A 173 ? 0.8379 0.8727 0.8160 0.0254  0.0434  -0.0571 427 PHE A CE1 
1332 C  CE2 . PHE A 173 ? 0.8201 0.8415 0.8018 0.0228  0.0395  -0.0506 427 PHE A CE2 
1333 C  CZ  . PHE A 173 ? 0.8440 0.8703 0.8232 0.0216  0.0441  -0.0518 427 PHE A CZ  
1334 N  N   . PHE A 174 ? 0.7318 0.7605 0.7418 0.0345  0.0145  -0.0672 428 PHE A N   
1335 C  CA  . PHE A 174 ? 0.7433 0.7661 0.7617 0.0308  0.0123  -0.0643 428 PHE A CA  
1336 C  C   . PHE A 174 ? 0.8072 0.8321 0.8391 0.0327  0.0048  -0.0695 428 PHE A C   
1337 O  O   . PHE A 174 ? 0.8269 0.8558 0.8614 0.0372  0.0005  -0.0746 428 PHE A O   
1338 C  CB  . PHE A 174 ? 0.7425 0.7587 0.7571 0.0298  0.0135  -0.0585 428 PHE A CB  
1339 C  CG  . PHE A 174 ? 0.7211 0.7334 0.7242 0.0272  0.0205  -0.0525 428 PHE A CG  
1340 C  CD1 . PHE A 174 ? 0.6988 0.7077 0.7019 0.0223  0.0242  -0.0486 428 PHE A CD1 
1341 C  CD2 . PHE A 174 ? 0.7099 0.7216 0.7030 0.0299  0.0229  -0.0506 428 PHE A CD2 
1342 C  CE1 . PHE A 174 ? 0.7032 0.7085 0.6975 0.0200  0.0302  -0.0437 428 PHE A CE1 
1343 C  CE2 . PHE A 174 ? 0.6808 0.6882 0.6646 0.0275  0.0289  -0.0449 428 PHE A CE2 
1344 C  CZ  . PHE A 174 ? 0.7232 0.7273 0.7079 0.0225  0.0326  -0.0415 428 PHE A CZ  
1345 N  N   . TYR A 175 ? 0.8225 0.8444 0.8633 0.0293  0.0029  -0.0683 429 TYR A N   
1346 C  CA  . TYR A 175 ? 0.7532 0.7747 0.8076 0.0303  -0.0042 -0.0713 429 TYR A CA  
1347 C  C   . TYR A 175 ? 0.7415 0.7568 0.8025 0.0260  -0.0048 -0.0659 429 TYR A C   
1348 O  O   . TYR A 175 ? 0.7577 0.7699 0.8135 0.0222  -0.0003 -0.0610 429 TYR A O   
1349 C  CB  . TYR A 175 ? 0.8596 0.8876 0.9211 0.0328  -0.0079 -0.0788 429 TYR A CB  
1350 C  CG  . TYR A 175 ? 0.7908 0.8193 0.8547 0.0297  -0.0064 -0.0785 429 TYR A CG  
1351 C  CD1 . TYR A 175 ? 0.9153 0.9461 0.9696 0.0282  -0.0003 -0.0776 429 TYR A CD1 
1352 C  CD2 . TYR A 175 ? 0.8614 0.8878 0.9373 0.0283  -0.0112 -0.0791 429 TYR A CD2 
1353 C  CE1 . TYR A 175 ? 0.9372 0.9690 0.9940 0.0254  0.0011  -0.0780 429 TYR A CE1 
1354 C  CE2 . TYR A 175 ? 0.9127 0.9395 0.9906 0.0258  -0.0101 -0.0791 429 TYR A CE2 
1355 C  CZ  . TYR A 175 ? 0.9606 0.9905 1.0289 0.0244  -0.0040 -0.0789 429 TYR A CZ  
1356 O  OH  . TYR A 175 ? 0.9421 0.9732 1.0122 0.0221  -0.0026 -0.0795 429 TYR A OH  
1357 N  N   . VAL A 176 ? 0.7328 0.7467 0.8056 0.0266  -0.0106 -0.0671 430 VAL A N   
1358 C  CA  . VAL A 176 ? 0.7702 0.7785 0.8498 0.0230  -0.0117 -0.0617 430 VAL A CA  
1359 C  C   . VAL A 176 ? 0.7670 0.7763 0.8597 0.0234  -0.0174 -0.0651 430 VAL A C   
1360 O  O   . VAL A 176 ? 0.7382 0.7499 0.8399 0.0266  -0.0228 -0.0705 430 VAL A O   
1361 C  CB  . VAL A 176 ? 0.7576 0.7625 0.8405 0.0233  -0.0133 -0.0589 430 VAL A CB  
1362 C  CG1 . VAL A 176 ? 0.7302 0.7298 0.8195 0.0194  -0.0137 -0.0525 430 VAL A CG1 
1363 C  CG2 . VAL A 176 ? 0.8185 0.8226 0.8888 0.0237  -0.0084 -0.0563 430 VAL A CG2 
1364 N  N   . PRO A 177 ? 0.7667 0.7741 0.8610 0.0203  -0.0165 -0.0622 431 PRO A N   
1365 C  CA  . PRO A 177 ? 0.7662 0.7743 0.8728 0.0210  -0.0221 -0.0654 431 PRO A CA  
1366 C  C   . PRO A 177 ? 0.7585 0.7630 0.8771 0.0212  -0.0272 -0.0639 431 PRO A C   
1367 O  O   . PRO A 177 ? 0.7349 0.7354 0.8518 0.0192  -0.0253 -0.0580 431 PRO A O   
1368 C  CB  . PRO A 177 ? 0.7472 0.7525 0.8515 0.0174  -0.0196 -0.0606 431 PRO A CB  
1369 C  CG  . PRO A 177 ? 0.7204 0.7219 0.8158 0.0145  -0.0144 -0.0535 431 PRO A CG  
1370 C  CD  . PRO A 177 ? 0.7936 0.7977 0.8800 0.0164  -0.0112 -0.0559 431 PRO A CD  
1371 N  N   . GLU A 178 ? 0.7380 0.7446 0.8689 0.0238  -0.0336 -0.0697 432 GLU A N   
1372 C  CA  . GLU A 178 ? 0.7705 0.7738 0.9154 0.0240  -0.0390 -0.0690 432 GLU A CA  
1373 C  C   . GLU A 178 ? 0.7887 0.7861 0.9387 0.0202  -0.0391 -0.0611 432 GLU A C   
1374 O  O   . GLU A 178 ? 0.7716 0.7684 0.9196 0.0188  -0.0383 -0.0595 432 GLU A O   
1375 C  CB  . GLU A 178 ? 0.8598 0.8666 1.0178 0.0278  -0.0462 -0.0776 432 GLU A CB  
1376 C  CG  . GLU A 178 ? 0.9986 1.0041 1.1697 0.0294  -0.0515 -0.0795 432 GLU A CG  
1377 C  CD  . GLU A 178 ? 1.0886 1.0977 1.2738 0.0334  -0.0592 -0.0889 432 GLU A CD  
1378 O  OE1 . GLU A 178 ? 0.9931 1.0034 1.1826 0.0339  -0.0616 -0.0918 432 GLU A OE1 
1379 O  OE2 . GLU A 178 ? 1.1401 1.1510 1.3330 0.0362  -0.0631 -0.0938 432 GLU A OE2 
1380 N  N   . ILE A 179 ? 0.7835 0.7770 0.9410 0.0189  -0.0406 -0.0568 433 ILE A N   
1381 C  CA  . ILE A 179 ? 0.8172 0.8052 0.9813 0.0156  -0.0412 -0.0490 433 ILE A CA  
1382 C  C   . ILE A 179 ? 0.8151 0.8018 0.9956 0.0169  -0.0483 -0.0518 433 ILE A C   
1383 O  O   . ILE A 179 ? 0.8187 0.8078 1.0087 0.0199  -0.0532 -0.0589 433 ILE A O   
1384 C  CB  . ILE A 179 ? 0.8831 0.8684 1.0494 0.0141  -0.0397 -0.0439 433 ILE A CB  
1385 C  CG1 . ILE A 179 ? 0.9290 0.9152 1.0796 0.0130  -0.0330 -0.0411 433 ILE A CG1 
1386 C  CG2 . ILE A 179 ? 0.9946 0.9747 1.1694 0.0107  -0.0404 -0.0355 433 ILE A CG2 
1387 C  CD1 . ILE A 179 ? 0.9351 0.9187 1.0769 0.0095  -0.0281 -0.0334 433 ILE A CD1 
1388 N  N   . VAL A 180 ? 0.7860 0.7692 0.9701 0.0148  -0.0492 -0.0465 434 VAL A N   
1389 C  CA  . VAL A 180 ? 0.7938 0.7748 0.9939 0.0158  -0.0561 -0.0483 434 VAL A CA  
1390 C  C   . VAL A 180 ? 0.8458 0.8209 1.0557 0.0130  -0.0570 -0.0397 434 VAL A C   
1391 O  O   . VAL A 180 ? 0.8299 0.8015 1.0359 0.0102  -0.0545 -0.0314 434 VAL A O   
1392 C  CB  . VAL A 180 ? 0.7343 0.7157 0.9311 0.0159  -0.0566 -0.0487 434 VAL A CB  
1393 C  CG1 . VAL A 180 ? 0.7425 0.7212 0.9553 0.0172  -0.0639 -0.0502 434 VAL A CG1 
1394 C  CG2 . VAL A 180 ? 0.7500 0.7378 0.9377 0.0184  -0.0550 -0.0570 434 VAL A CG2 
1395 N  N   . ASP A 181 ? 0.7790 0.7532 1.0009 0.0136  -0.0602 -0.0416 435 ASP A N   
1396 C  CA  . ASP A 181 ? 0.8083 0.7777 1.0388 0.0105  -0.0597 -0.0330 435 ASP A CA  
1397 C  C   . ASP A 181 ? 0.7985 0.7623 1.0386 0.0084  -0.0622 -0.0258 435 ASP A C   
1398 O  O   . ASP A 181 ? 0.8525 0.8130 1.0908 0.0051  -0.0588 -0.0158 435 ASP A O   
1399 C  CB  . ASP A 181 ? 0.8542 0.8238 1.0991 0.0117  -0.0636 -0.0373 435 ASP A CB  
1400 C  CG  . ASP A 181 ? 0.9243 0.8995 1.1615 0.0145  -0.0622 -0.0452 435 ASP A CG  
1401 O  OD1 . ASP A 181 ? 0.9868 0.9643 1.2074 0.0140  -0.0563 -0.0437 435 ASP A OD1 
1402 O  OD2 . ASP A 181 ? 1.1187 1.0960 1.3676 0.0174  -0.0676 -0.0530 435 ASP A OD2 
1403 N  N   . GLU A 182 ? 0.7925 0.7559 1.0421 0.0107  -0.0682 -0.0307 436 GLU A N   
1404 C  CA  . GLU A 182 ? 0.9079 0.8659 1.1676 0.0094  -0.0716 -0.0247 436 GLU A CA  
1405 C  C   . GLU A 182 ? 0.9381 0.8948 1.1837 0.0074  -0.0669 -0.0167 436 GLU A C   
1406 O  O   . GLU A 182 ? 1.0251 0.9769 1.2763 0.0058  -0.0682 -0.0086 436 GLU A O   
1407 C  CB  . GLU A 182 ? 0.9289 0.8869 1.2012 0.0128  -0.0794 -0.0330 436 GLU A CB  
1408 C  CG  . GLU A 182 ? 0.9710 0.9334 1.2522 0.0164  -0.0839 -0.0449 436 GLU A CG  
1409 C  CD  . GLU A 182 ? 0.9714 0.9411 1.2391 0.0195  -0.0822 -0.0542 436 GLU A CD  
1410 O  OE1 . GLU A 182 ? 0.9435 0.9147 1.2081 0.0209  -0.0837 -0.0571 436 GLU A OE1 
1411 O  OE2 . GLU A 182 ? 0.9058 0.8800 1.1663 0.0205  -0.0794 -0.0585 436 GLU A OE2 
1412 N  N   . LEU A 183 ? 0.8305 0.7917 1.0590 0.0079  -0.0621 -0.0193 437 LEU A N   
1413 C  CA  . LEU A 183 ? 0.8107 0.7716 1.0251 0.0061  -0.0572 -0.0126 437 LEU A CA  
1414 C  C   . LEU A 183 ? 0.8251 0.7874 1.0264 0.0037  -0.0499 -0.0076 437 LEU A C   
1415 O  O   . LEU A 183 ? 0.8034 0.7669 0.9914 0.0028  -0.0455 -0.0043 437 LEU A O   
1416 C  CB  . LEU A 183 ? 0.8249 0.7894 1.0312 0.0083  -0.0576 -0.0191 437 LEU A CB  
1417 C  CG  . LEU A 183 ? 0.8611 0.8238 1.0789 0.0104  -0.0645 -0.0219 437 LEU A CG  
1418 C  CD1 . LEU A 183 ? 0.8502 0.8179 1.0623 0.0130  -0.0654 -0.0309 437 LEU A CD1 
1419 C  CD2 . LEU A 183 ? 0.9367 0.8945 1.1547 0.0087  -0.0648 -0.0119 437 LEU A CD2 
1420 N  N   . CYS A 184 ? 0.8641 0.8261 1.0704 0.0028  -0.0489 -0.0068 438 CYS A N   
1421 C  CA  . CYS A 184 ? 0.8808 0.8438 1.0767 0.0006  -0.0424 -0.0018 438 CYS A CA  
1422 C  C   . CYS A 184 ? 0.8972 0.8566 1.1014 -0.0022 -0.0417 0.0076  438 CYS A C   
1423 O  O   . CYS A 184 ? 0.9627 0.9189 1.1828 -0.0023 -0.0465 0.0085  438 CYS A O   
1424 C  CB  . CYS A 184 ? 0.8022 0.7687 0.9949 0.0019  -0.0410 -0.0086 438 CYS A CB  
1425 S  SG  . CYS A 184 ? 0.7691 0.7405 0.9472 0.0045  -0.0391 -0.0170 438 CYS A SG  
1426 N  N   . SER A 185 ? 0.8652 0.8251 1.0587 -0.0045 -0.0358 0.0148  439 SER A N   
1427 C  CA  . SER A 185 ? 0.8475 0.8048 1.0466 -0.0074 -0.0340 0.0249  439 SER A CA  
1428 C  C   . SER A 185 ? 0.8372 0.7972 1.0218 -0.0091 -0.0268 0.0294  439 SER A C   
1429 O  O   . SER A 185 ? 0.7929 0.7560 0.9655 -0.0080 -0.0241 0.0243  439 SER A O   
1430 C  CB  . SER A 185 ? 0.8551 0.8086 1.0594 -0.0079 -0.0367 0.0315  439 SER A CB  
1431 O  OG  . SER A 185 ? 0.8205 0.7752 1.0106 -0.0081 -0.0333 0.0357  439 SER A OG  
1432 N  N   . PRO A 186 ? 0.8189 0.7782 1.0050 -0.0117 -0.0236 0.0388  440 PRO A N   
1433 C  CA  . PRO A 186 ? 0.8273 0.7899 0.9999 -0.0130 -0.0170 0.0420  440 PRO A CA  
1434 C  C   . PRO A 186 ? 0.7761 0.7408 0.9322 -0.0122 -0.0140 0.0420  440 PRO A C   
1435 O  O   . PRO A 186 ? 0.7546 0.7223 0.8988 -0.0125 -0.0093 0.0413  440 PRO A O   
1436 C  CB  . PRO A 186 ? 0.8771 0.8387 1.0553 -0.0157 -0.0146 0.0526  440 PRO A CB  
1437 C  CG  . PRO A 186 ? 0.8817 0.8395 1.0791 -0.0162 -0.0197 0.0529  440 PRO A CG  
1438 C  CD  . PRO A 186 ? 0.8032 0.7589 1.0039 -0.0137 -0.0255 0.0463  440 PRO A CD  
1439 N  N   . HIS A 187 ? 0.7457 0.7088 0.9015 -0.0113 -0.0168 0.0431  441 HIS A N   
1440 C  CA  . HIS A 187 ? 0.8082 0.7735 0.9494 -0.0106 -0.0142 0.0438  441 HIS A CA  
1441 C  C   . HIS A 187 ? 0.7784 0.7441 0.9164 -0.0083 -0.0173 0.0357  441 HIS A C   
1442 O  O   . HIS A 187 ? 0.8364 0.8042 0.9633 -0.0076 -0.0156 0.0349  441 HIS A O   
1443 C  CB  . HIS A 187 ? 0.7856 0.7502 0.9256 -0.0116 -0.0131 0.0539  441 HIS A CB  
1444 C  CG  . HIS A 187 ? 0.7946 0.7600 0.9369 -0.0140 -0.0093 0.0618  441 HIS A CG  
1445 N  ND1 . HIS A 187 ? 0.8958 0.8581 1.0514 -0.0155 -0.0111 0.0683  441 HIS A ND1 
1446 C  CD2 . HIS A 187 ? 0.8186 0.7876 0.9522 -0.0151 -0.0037 0.0638  441 HIS A CD2 
1447 C  CE1 . HIS A 187 ? 0.9284 0.8929 1.0835 -0.0176 -0.0064 0.0740  441 HIS A CE1 
1448 N  NE2 . HIS A 187 ? 0.7717 0.7404 0.9133 -0.0173 -0.0020 0.0712  441 HIS A NE2 
1449 N  N   . VAL A 188 ? 0.7329 0.6974 0.8806 -0.0071 -0.0216 0.0291  442 VAL A N   
1450 C  CA  . VAL A 188 ? 0.7211 0.6865 0.8679 -0.0048 -0.0247 0.0206  442 VAL A CA  
1451 C  C   . VAL A 188 ? 0.7159 0.6830 0.8654 -0.0036 -0.0255 0.0124  442 VAL A C   
1452 O  O   . VAL A 188 ? 0.7883 0.7539 0.9487 -0.0036 -0.0279 0.0116  442 VAL A O   
1453 C  CB  . VAL A 188 ? 0.7496 0.7121 0.9080 -0.0035 -0.0310 0.0206  442 VAL A CB  
1454 C  CG1 . VAL A 188 ? 0.6729 0.6373 0.8298 -0.0011 -0.0339 0.0117  442 VAL A CG1 
1455 C  CG2 . VAL A 188 ? 0.8111 0.7718 0.9674 -0.0044 -0.0306 0.0297  442 VAL A CG2 
1456 N  N   . LEU A 189 ? 0.7523 0.7224 0.8919 -0.0024 -0.0235 0.0061  443 LEU A N   
1457 C  CA  . LEU A 189 ? 0.7486 0.7207 0.8887 -0.0008 -0.0241 -0.0018 443 LEU A CA  
1458 C  C   . LEU A 189 ? 0.7093 0.6836 0.8496 0.0015  -0.0270 -0.0095 443 LEU A C   
1459 O  O   . LEU A 189 ? 0.6553 0.6315 0.7857 0.0014  -0.0244 -0.0105 443 LEU A O   
1460 C  CB  . LEU A 189 ? 0.7277 0.7020 0.8553 -0.0015 -0.0182 -0.0021 443 LEU A CB  
1461 C  CG  . LEU A 189 ? 0.8408 0.8168 0.9701 0.0004  -0.0191 -0.0091 443 LEU A CG  
1462 C  CD1 . LEU A 189 ? 0.8212 0.7956 0.9616 0.0002  -0.0215 -0.0076 443 LEU A CD1 
1463 C  CD2 . LEU A 189 ? 0.9441 0.9221 1.0600 0.0003  -0.0137 -0.0105 443 LEU A CD2 
1464 N  N   . THR A 190 ? 0.6731 0.6474 0.8248 0.0035  -0.0324 -0.0151 444 THR A N   
1465 C  CA  . THR A 190 ? 0.6485 0.6257 0.8015 0.0060  -0.0356 -0.0231 444 THR A CA  
1466 C  C   . THR A 190 ? 0.6270 0.6083 0.7784 0.0084  -0.0357 -0.0319 444 THR A C   
1467 O  O   . THR A 190 ? 0.6862 0.6674 0.8458 0.0097  -0.0385 -0.0345 444 THR A O   
1468 C  CB  . THR A 190 ? 0.6342 0.6088 0.8010 0.0071  -0.0422 -0.0233 444 THR A CB  
1469 O  OG1 . THR A 190 ? 0.6638 0.6351 0.8292 0.0052  -0.0416 -0.0150 444 THR A OG1 
1470 C  CG2 . THR A 190 ? 0.6032 0.5809 0.7723 0.0097  -0.0457 -0.0315 444 THR A CG2 
1471 N  N   . THR A 191 ? 0.6349 0.6201 0.7757 0.0091  -0.0324 -0.0361 445 THR A N   
1472 C  CA  . THR A 191 ? 0.7218 0.7117 0.8600 0.0117  -0.0322 -0.0443 445 THR A CA  
1473 C  C   . THR A 191 ? 0.7460 0.7400 0.8855 0.0138  -0.0344 -0.0515 445 THR A C   
1474 O  O   . THR A 191 ? 0.7586 0.7524 0.8966 0.0128  -0.0342 -0.0502 445 THR A O   
1475 C  CB  . THR A 191 ? 0.7647 0.7561 0.8886 0.0108  -0.0255 -0.0433 445 THR A CB  
1476 O  OG1 . THR A 191 ? 0.8397 0.8310 0.9542 0.0086  -0.0211 -0.0400 445 THR A OG1 
1477 C  CG2 . THR A 191 ? 0.7631 0.7513 0.8861 0.0093  -0.0235 -0.0377 445 THR A CG2 
1478 N  N   . GLU A 192 ? 0.7898 0.7881 0.9330 0.0169  -0.0371 -0.0595 446 GLU A N   
1479 C  CA  . GLU A 192 ? 0.8336 0.8378 0.9737 0.0190  -0.0369 -0.0669 446 GLU A CA  
1480 C  C   . GLU A 192 ? 0.7306 0.7365 0.8574 0.0168  -0.0303 -0.0649 446 GLU A C   
1481 O  O   . GLU A 192 ? 0.8000 0.8051 0.9164 0.0152  -0.0247 -0.0613 446 GLU A O   
1482 C  CB  . GLU A 192 ? 0.8832 0.8927 1.0217 0.0222  -0.0371 -0.0740 446 GLU A CB  
1483 C  CG  . GLU A 192 ? 1.0155 1.0266 1.1678 0.0257  -0.0443 -0.0803 446 GLU A CG  
1484 C  CD  . GLU A 192 ? 1.1311 1.1483 1.2795 0.0293  -0.0440 -0.0875 446 GLU A CD  
1485 O  OE1 . GLU A 192 ? 0.9779 0.9956 1.1151 0.0289  -0.0389 -0.0851 446 GLU A OE1 
1486 O  OE2 . GLU A 192 ? 1.1404 1.1623 1.2975 0.0329  -0.0492 -0.0957 446 GLU A OE2 
1487 N  N   . LEU A 193 ? 0.6678 0.6761 0.7957 0.0170  -0.0311 -0.0680 447 LEU A N   
1488 C  CA  . LEU A 193 ? 0.7290 0.7399 0.8466 0.0153  -0.0255 -0.0677 447 LEU A CA  
1489 C  C   . LEU A 193 ? 0.7436 0.7597 0.8529 0.0165  -0.0211 -0.0722 447 LEU A C   
1490 O  O   . LEU A 193 ? 0.6834 0.7038 0.7968 0.0196  -0.0239 -0.0786 447 LEU A O   
1491 C  CB  . LEU A 193 ? 0.7140 0.7274 0.8374 0.0160  -0.0287 -0.0717 447 LEU A CB  
1492 C  CG  . LEU A 193 ? 0.8195 0.8348 0.9351 0.0139  -0.0240 -0.0711 447 LEU A CG  
1493 C  CD1 . LEU A 193 ? 0.8504 0.8602 0.9627 0.0111  -0.0225 -0.0628 447 LEU A CD1 
1494 C  CD2 . LEU A 193 ? 0.7847 0.8051 0.9061 0.0156  -0.0268 -0.0780 447 LEU A CD2 
1495 N  N   . VAL A 194 ? 0.8388 0.8547 0.9368 0.0141  -0.0144 -0.0688 448 VAL A N   
1496 C  CA  . VAL A 194 ? 0.8820 0.9028 0.9714 0.0151  -0.0097 -0.0724 448 VAL A CA  
1497 C  C   . VAL A 194 ? 0.8889 0.9140 0.9737 0.0137  -0.0055 -0.0748 448 VAL A C   
1498 O  O   . VAL A 194 ? 0.8600 0.8828 0.9432 0.0109  -0.0035 -0.0715 448 VAL A O   
1499 C  CB  . VAL A 194 ? 0.8629 0.8807 0.9424 0.0140  -0.0048 -0.0673 448 VAL A CB  
1500 C  CG1 . VAL A 194 ? 0.9153 0.9288 0.9993 0.0149  -0.0083 -0.0643 448 VAL A CG1 
1501 C  CG2 . VAL A 194 ? 0.8990 0.9135 0.9711 0.0103  0.0005  -0.0616 448 VAL A CG2 
1502 N  N   . SER A 195 ? 0.8973 0.9289 0.9800 0.0157  -0.0039 -0.0807 449 SER A N   
1503 C  CA  . SER A 195 ? 0.9732 1.0100 1.0514 0.0145  0.0011  -0.0834 449 SER A CA  
1504 C  C   . SER A 195 ? 0.9296 0.9641 0.9965 0.0115  0.0087  -0.0781 449 SER A C   
1505 O  O   . SER A 195 ? 0.9708 1.0003 1.0326 0.0109  0.0102  -0.0730 449 SER A O   
1506 C  CB  . SER A 195 ? 1.0334 1.0783 1.1117 0.0179  0.0010  -0.0906 449 SER A CB  
1507 O  OG  . SER A 195 ? 1.0620 1.1066 1.1327 0.0192  0.0036  -0.0887 449 SER A OG  
1508 N  N   . GLY A 196 ? 0.9494 0.9878 1.0131 0.0098  0.0134  -0.0799 450 GLY A N   
1509 C  CA  . GLY A 196 ? 0.8780 0.9151 0.9320 0.0072  0.0208  -0.0759 450 GLY A CA  
1510 C  C   . GLY A 196 ? 0.8321 0.8636 0.8853 0.0037  0.0223  -0.0709 450 GLY A C   
1511 O  O   . GLY A 196 ? 0.8932 0.9226 0.9527 0.0036  0.0176  -0.0706 450 GLY A O   
1512 N  N   . PHE A 197 ? 0.8320 0.8609 0.8775 0.0011  0.0284  -0.0668 451 PHE A N   
1513 C  CA  . PHE A 197 ? 0.8738 0.8979 0.9179 -0.0021 0.0301  -0.0624 451 PHE A CA  
1514 C  C   . PHE A 197 ? 0.9203 0.9382 0.9571 -0.0029 0.0327  -0.0562 451 PHE A C   
1515 O  O   . PHE A 197 ? 0.9237 0.9416 0.9550 -0.0017 0.0351  -0.0553 451 PHE A O   
1516 C  CB  . PHE A 197 ? 0.8869 0.9144 0.9303 -0.0048 0.0352  -0.0645 451 PHE A CB  
1517 C  CG  . PHE A 197 ? 0.9063 0.9377 0.9446 -0.0048 0.0409  -0.0657 451 PHE A CG  
1518 C  CD1 . PHE A 197 ? 1.0331 1.0721 1.0745 -0.0029 0.0406  -0.0716 451 PHE A CD1 
1519 C  CD2 . PHE A 197 ? 0.9009 0.9286 0.9313 -0.0066 0.0467  -0.0611 451 PHE A CD2 
1520 C  CE1 . PHE A 197 ? 0.9852 1.0283 1.0212 -0.0029 0.0463  -0.0723 451 PHE A CE1 
1521 C  CE2 . PHE A 197 ? 0.8816 0.9126 0.9069 -0.0066 0.0521  -0.0614 451 PHE A CE2 
1522 C  CZ  . PHE A 197 ? 0.9254 0.9643 0.9532 -0.0048 0.0522  -0.0667 451 PHE A CZ  
1523 N  N   . PRO A 198 ? 0.8873 0.9004 0.9237 -0.0048 0.0324  -0.0520 452 PRO A N   
1524 C  CA  . PRO A 198 ? 0.9090 0.9167 0.9387 -0.0057 0.0352  -0.0465 452 PRO A CA  
1525 C  C   . PRO A 198 ? 0.9180 0.9250 0.9409 -0.0076 0.0420  -0.0452 452 PRO A C   
1526 O  O   . PRO A 198 ? 0.8932 0.9025 0.9172 -0.0097 0.0449  -0.0472 452 PRO A O   
1527 C  CB  . PRO A 198 ? 0.9367 0.9410 0.9682 -0.0072 0.0336  -0.0434 452 PRO A CB  
1528 C  CG  . PRO A 198 ? 0.9235 0.9314 0.9601 -0.0082 0.0325  -0.0471 452 PRO A CG  
1529 C  CD  . PRO A 198 ? 0.8893 0.9022 0.9307 -0.0060 0.0298  -0.0523 452 PRO A CD  
1530 N  N   . LEU A 199 ? 0.8715 0.8748 0.8879 -0.0072 0.0443  -0.0415 453 LEU A N   
1531 C  CA  . LEU A 199 ? 0.8317 0.8338 0.8418 -0.0088 0.0506  -0.0397 453 LEU A CA  
1532 C  C   . LEU A 199 ? 0.8712 0.8710 0.8815 -0.0122 0.0540  -0.0384 453 LEU A C   
1533 O  O   . LEU A 199 ? 0.9676 0.9673 0.9749 -0.0140 0.0593  -0.0377 453 LEU A O   
1534 C  CB  . LEU A 199 ? 0.8112 0.8093 0.8143 -0.0072 0.0519  -0.0359 453 LEU A CB  
1535 C  CG  . LEU A 199 ? 0.8552 0.8563 0.8575 -0.0034 0.0491  -0.0379 453 LEU A CG  
1536 C  CD1 . LEU A 199 ? 0.8433 0.8406 0.8387 -0.0014 0.0500  -0.0344 453 LEU A CD1 
1537 C  CD2 . LEU A 199 ? 0.8203 0.8278 0.8226 -0.0026 0.0511  -0.0421 453 LEU A CD2 
1538 N  N   . ASP A 200 ? 0.9363 0.9348 0.9504 -0.0131 0.0510  -0.0379 454 ASP A N   
1539 C  CA  . ASP A 200 ? 1.0205 1.0188 1.0368 -0.0159 0.0528  -0.0385 454 ASP A CA  
1540 C  C   . ASP A 200 ? 0.9333 0.9361 0.9530 -0.0176 0.0556  -0.0427 454 ASP A C   
1541 O  O   . ASP A 200 ? 0.9652 0.9671 0.9850 -0.0201 0.0593  -0.0427 454 ASP A O   
1542 C  CB  . ASP A 200 ? 0.9604 0.9597 0.9818 -0.0156 0.0479  -0.0395 454 ASP A CB  
1543 C  CG  . ASP A 200 ? 1.0161 1.0118 1.0359 -0.0147 0.0453  -0.0355 454 ASP A CG  
1544 O  OD1 . ASP A 200 ? 1.2190 1.2108 1.2343 -0.0155 0.0480  -0.0324 454 ASP A OD1 
1545 O  OD2 . ASP A 200 ? 1.0186 1.0152 1.0420 -0.0131 0.0405  -0.0355 454 ASP A OD2 
1546 N  N   . GLN A 201 ? 0.9248 0.9326 0.9483 -0.0161 0.0531  -0.0465 455 GLN A N   
1547 C  CA  . GLN A 201 ? 0.9871 1.0007 1.0152 -0.0172 0.0550  -0.0514 455 GLN A CA  
1548 C  C   . GLN A 201 ? 1.0102 1.0264 1.0350 -0.0173 0.0598  -0.0520 455 GLN A C   
1549 O  O   . GLN A 201 ? 1.0106 1.0328 1.0393 -0.0175 0.0607  -0.0564 455 GLN A O   
1550 C  CB  . GLN A 201 ? 1.0307 1.0488 1.0652 -0.0152 0.0493  -0.0558 455 GLN A CB  
1551 C  CG  . GLN A 201 ? 1.0621 1.0789 1.1008 -0.0150 0.0445  -0.0558 455 GLN A CG  
1552 C  CD  . GLN A 201 ? 1.0717 1.0917 1.1165 -0.0124 0.0382  -0.0590 455 GLN A CD  
1553 O  OE1 . GLN A 201 ? 1.0280 1.0533 1.0764 -0.0112 0.0375  -0.0638 455 GLN A OE1 
1554 N  NE2 . GLN A 201 ? 1.0341 1.0510 1.0802 -0.0113 0.0334  -0.0565 455 GLN A NE2 
1555 N  N   . ALA A 202 ? 1.1216 1.1338 1.1393 -0.0170 0.0629  -0.0476 456 ALA A N   
1556 C  CA  . ALA A 202 ? 1.1018 1.1165 1.1147 -0.0159 0.0666  -0.0473 456 ALA A CA  
1557 C  C   . ALA A 202 ? 1.1268 1.1388 1.1347 -0.0183 0.0738  -0.0436 456 ALA A C   
1558 O  O   . ALA A 202 ? 1.0928 1.1068 1.0958 -0.0171 0.0771  -0.0426 456 ALA A O   
1559 C  CB  . ALA A 202 ? 1.1132 1.1267 1.1219 -0.0121 0.0631  -0.0458 456 ALA A CB  
1560 N  N   . GLU A 203 ? 1.1604 1.1680 1.1695 -0.0214 0.0762  -0.0416 457 GLU A N   
1561 C  CA  . GLU A 203 ? 1.1849 1.1901 1.1913 -0.0242 0.0832  -0.0385 457 GLU A CA  
1562 C  C   . GLU A 203 ? 1.1733 1.1853 1.1826 -0.0257 0.0877  -0.0415 457 GLU A C   
1563 O  O   . GLU A 203 ? 1.1552 1.1667 1.1605 -0.0268 0.0936  -0.0384 457 GLU A O   
1564 C  CB  . GLU A 203 ? 1.2027 1.2031 1.2123 -0.0275 0.0845  -0.0375 457 GLU A CB  
1565 C  CG  . GLU A 203 ? 1.2214 1.2153 1.2278 -0.0264 0.0815  -0.0342 457 GLU A CG  
1566 C  CD  . GLU A 203 ? 1.2811 1.2727 1.2924 -0.0290 0.0813  -0.0352 457 GLU A CD  
1567 O  OE1 . GLU A 203 ? 1.2364 1.2298 1.2514 -0.0283 0.0766  -0.0378 457 GLU A OE1 
1568 O  OE2 . GLU A 203 ? 1.3738 1.3620 1.3854 -0.0316 0.0859  -0.0335 457 GLU A OE2 
1569 N  N   . GLY A 204 ? 1.1854 1.2040 1.2017 -0.0256 0.0850  -0.0474 458 GLY A N   
1570 C  CA  . GLY A 204 ? 1.1731 1.1994 1.1932 -0.0268 0.0889  -0.0511 458 GLY A CA  
1571 C  C   . GLY A 204 ? 1.2266 1.2579 1.2413 -0.0240 0.0906  -0.0511 458 GLY A C   
1572 O  O   . GLY A 204 ? 1.1029 1.1406 1.1193 -0.0253 0.0955  -0.0530 458 GLY A O   
1573 N  N   . LEU A 205 ? 1.1716 1.2007 1.1801 -0.0201 0.0868  -0.0492 459 LEU A N   
1574 C  CA  . LEU A 205 ? 1.0778 1.1113 1.0799 -0.0169 0.0884  -0.0487 459 LEU A CA  
1575 C  C   . LEU A 205 ? 0.9742 1.0053 0.9685 -0.0182 0.0960  -0.0429 459 LEU A C   
1576 O  O   . LEU A 205 ? 1.0488 1.0738 1.0430 -0.0216 0.0998  -0.0387 459 LEU A O   
1577 C  CB  . LEU A 205 ? 1.0888 1.1202 1.0870 -0.0124 0.0821  -0.0485 459 LEU A CB  
1578 C  CG  . LEU A 205 ? 1.0793 1.1132 1.0850 -0.0107 0.0746  -0.0538 459 LEU A CG  
1579 C  CD1 . LEU A 205 ? 1.0628 1.0938 1.0650 -0.0067 0.0691  -0.0526 459 LEU A CD1 
1580 C  CD2 . LEU A 205 ? 1.0307 1.0743 1.0423 -0.0098 0.0739  -0.0606 459 LEU A CD2 
1581 N  N   . SER A 206 ? 0.9922 1.0286 0.9806 -0.0153 0.0981  -0.0426 460 SER A N   
1582 C  CA  . SER A 206 ? 0.9689 1.0041 0.9497 -0.0162 0.1056  -0.0369 460 SER A CA  
1583 C  C   . SER A 206 ? 1.0187 1.0451 0.9907 -0.0144 0.1051  -0.0304 460 SER A C   
1584 O  O   . SER A 206 ? 0.9716 0.9948 0.9424 -0.0115 0.0988  -0.0311 460 SER A O   
1585 C  CB  . SER A 206 ? 0.9369 0.9817 0.9134 -0.0130 0.1078  -0.0391 460 SER A CB  
1586 O  OG  . SER A 206 ? 0.9569 1.0025 0.9278 -0.0074 0.1021  -0.0403 460 SER A OG  
1587 N  N   . GLN A 207 ? 0.9883 1.0108 0.9545 -0.0162 0.1118  -0.0240 461 GLN A N   
1588 C  CA  . GLN A 207 ? 1.0298 1.0436 0.9874 -0.0145 0.1120  -0.0174 461 GLN A CA  
1589 C  C   . GLN A 207 ? 1.0036 1.0199 0.9525 -0.0083 0.1081  -0.0176 461 GLN A C   
1590 O  O   . GLN A 207 ? 1.0308 1.0409 0.9753 -0.0060 0.1046  -0.0150 461 GLN A O   
1591 C  CB  . GLN A 207 ? 1.0324 1.0423 0.9858 -0.0174 0.1202  -0.0105 461 GLN A CB  
1592 C  CG  . GLN A 207 ? 1.0138 1.0131 0.9603 -0.0166 0.1205  -0.0036 461 GLN A CG  
1593 C  CD  . GLN A 207 ? 1.0386 1.0302 0.9915 -0.0192 0.1170  -0.0040 461 GLN A CD  
1594 O  OE1 . GLN A 207 ? 1.0583 1.0501 1.0203 -0.0235 0.1181  -0.0067 461 GLN A OE1 
1595 N  NE2 . GLN A 207 ? 1.0760 1.0613 1.0241 -0.0164 0.1126  -0.0019 461 GLN A NE2 
1596 N  N   . GLU A 208 ? 0.9708 0.9967 0.9179 -0.0056 0.1087  -0.0212 462 GLU A N   
1597 C  CA  . GLU A 208 ? 1.0017 1.0313 0.9408 0.0007  0.1051  -0.0222 462 GLU A CA  
1598 C  C   . GLU A 208 ? 0.9178 0.9472 0.8619 0.0035  0.0960  -0.0275 462 GLU A C   
1599 O  O   . GLU A 208 ? 0.9105 0.9377 0.8493 0.0077  0.0920  -0.0267 462 GLU A O   
1600 C  CB  . GLU A 208 ? 1.0061 1.0474 0.9426 0.0032  0.1081  -0.0254 462 GLU A CB  
1601 C  CG  . GLU A 208 ? 1.1067 1.1494 1.0365 0.0014  0.1174  -0.0194 462 GLU A CG  
1602 C  CD  . GLU A 208 ? 1.1344 1.1749 1.0718 -0.0056 0.1237  -0.0174 462 GLU A CD  
1603 O  OE1 . GLU A 208 ? 1.1549 1.2021 1.1016 -0.0081 0.1240  -0.0232 462 GLU A OE1 
1604 O  OE2 . GLU A 208 ? 1.0749 1.1068 1.0097 -0.0086 0.1280  -0.0103 462 GLU A OE2 
1605 N  N   . ILE A 209 ? 0.9307 0.9626 0.8853 0.0012  0.0930  -0.0329 463 ILE A N   
1606 C  CA  . ILE A 209 ? 0.9193 0.9521 0.8805 0.0033  0.0846  -0.0383 463 ILE A CA  
1607 C  C   . ILE A 209 ? 0.9213 0.9442 0.8833 0.0020  0.0816  -0.0347 463 ILE A C   
1608 O  O   . ILE A 209 ? 0.9090 0.9299 0.8712 0.0050  0.0758  -0.0357 463 ILE A O   
1609 C  CB  . ILE A 209 ? 0.9051 0.9433 0.8772 0.0008  0.0830  -0.0444 463 ILE A CB  
1610 C  CG1 . ILE A 209 ? 0.9857 1.0349 0.9580 0.0025  0.0855  -0.0491 463 ILE A CG1 
1611 C  CG2 . ILE A 209 ? 0.8854 0.9221 0.8651 0.0021  0.0747  -0.0485 463 ILE A CG2 
1612 C  CD1 . ILE A 209 ? 0.9834 1.0395 0.9554 0.0082  0.0799  -0.0548 463 ILE A CD1 
1613 N  N   . ARG A 210 ? 0.8820 0.8993 0.8456 -0.0027 0.0857  -0.0310 464 ARG A N   
1614 C  CA  . ARG A 210 ? 0.8829 0.8912 0.8471 -0.0044 0.0839  -0.0275 464 ARG A CA  
1615 C  C   . ARG A 210 ? 0.8654 0.8687 0.8204 -0.0012 0.0838  -0.0227 464 ARG A C   
1616 O  O   . ARG A 210 ? 0.8726 0.8720 0.8280 0.0006  0.0788  -0.0224 464 ARG A O   
1617 C  CB  . ARG A 210 ? 0.8777 0.8820 0.8460 -0.0098 0.0884  -0.0254 464 ARG A CB  
1618 C  CG  . ARG A 210 ? 0.9589 0.9659 0.9376 -0.0122 0.0852  -0.0304 464 ARG A CG  
1619 C  CD  . ARG A 210 ? 1.0079 1.0150 0.9924 -0.0172 0.0899  -0.0309 464 ARG A CD  
1620 N  NE  . ARG A 210 ? 1.0812 1.0812 1.0625 -0.0199 0.0948  -0.0254 464 ARG A NE  
1621 C  CZ  . ARG A 210 ? 1.0963 1.0961 1.0752 -0.0220 0.1016  -0.0222 464 ARG A CZ  
1622 N  NH1 . ARG A 210 ? 1.1464 1.1532 1.1255 -0.0222 0.1054  -0.0239 464 ARG A NH1 
1623 N  NH2 . ARG A 210 ? 1.1868 1.1788 1.1632 -0.0239 0.1049  -0.0171 464 ARG A NH2 
1624 N  N   . ASN A 211 ? 0.8715 0.8755 0.8184 -0.0001 0.0890  -0.0191 465 ASN A N   
1625 C  CA  . ASN A 211 ? 0.8682 0.8679 0.8055 0.0037  0.0886  -0.0146 465 ASN A CA  
1626 C  C   . ASN A 211 ? 0.8539 0.8572 0.7902 0.0090  0.0820  -0.0185 465 ASN A C   
1627 O  O   . ASN A 211 ? 0.8530 0.8515 0.7869 0.0112  0.0784  -0.0169 465 ASN A O   
1628 C  CB  . ASN A 211 ? 0.8674 0.8686 0.7957 0.0045  0.0952  -0.0103 465 ASN A CB  
1629 C  CG  . ASN A 211 ? 0.9591 0.9547 0.8883 -0.0007 0.1020  -0.0052 465 ASN A CG  
1630 O  OD1 . ASN A 211 ? 0.9127 0.9023 0.8480 -0.0044 0.1012  -0.0046 465 ASN A OD1 
1631 N  ND2 . ASN A 211 ? 0.9361 0.9340 0.8598 -0.0012 0.1086  -0.0015 465 ASN A ND2 
1632 N  N   . GLU A 212 ? 0.7915 0.8036 0.7306 0.0109  0.0801  -0.0241 466 GLU A N   
1633 C  CA  . GLU A 212 ? 0.8758 0.8921 0.8150 0.0160  0.0740  -0.0286 466 GLU A CA  
1634 C  C   . GLU A 212 ? 0.8144 0.8278 0.7624 0.0157  0.0671  -0.0315 466 GLU A C   
1635 O  O   . GLU A 212 ? 0.7717 0.7847 0.7194 0.0195  0.0619  -0.0330 466 GLU A O   
1636 C  CB  . GLU A 212 ? 0.9808 1.0077 0.9215 0.0178  0.0745  -0.0341 466 GLU A CB  
1637 C  CG  . GLU A 212 ? 1.0692 1.1026 1.0075 0.0242  0.0694  -0.0389 466 GLU A CG  
1638 C  CD  . GLU A 212 ? 1.2319 1.2766 1.1712 0.0261  0.0707  -0.0445 466 GLU A CD  
1639 O  OE1 . GLU A 212 ? 1.1145 1.1620 1.0558 0.0222  0.0761  -0.0442 466 GLU A OE1 
1640 O  OE2 . GLU A 212 ? 1.2964 1.3475 1.2351 0.0316  0.0659  -0.0498 466 GLU A OE2 
1641 N  N   . ILE A 213 ? 0.8049 0.8169 0.7611 0.0113  0.0670  -0.0325 467 ILE A N   
1642 C  CA  . ILE A 213 ? 0.7760 0.7851 0.7401 0.0107  0.0611  -0.0343 467 ILE A CA  
1643 C  C   . ILE A 213 ? 0.7529 0.7539 0.7135 0.0106  0.0606  -0.0293 467 ILE A C   
1644 O  O   . ILE A 213 ? 0.8333 0.8329 0.7954 0.0131  0.0557  -0.0300 467 ILE A O   
1645 C  CB  . ILE A 213 ? 0.8057 0.8152 0.7782 0.0062  0.0614  -0.0360 467 ILE A CB  
1646 C  CG1 . ILE A 213 ? 0.8799 0.8980 0.8575 0.0073  0.0601  -0.0422 467 ILE A CG1 
1647 C  CG2 . ILE A 213 ? 0.7664 0.7718 0.7457 0.0053  0.0562  -0.0361 467 ILE A CG2 
1648 C  CD1 . ILE A 213 ? 0.9280 0.9477 0.9121 0.0030  0.0621  -0.0439 467 ILE A CD1 
1649 N  N   . CYS A 214 ? 0.7459 0.7417 0.7024 0.0076  0.0658  -0.0244 468 CYS A N   
1650 C  CA  . CYS A 214 ? 0.7322 0.7204 0.6854 0.0074  0.0657  -0.0198 468 CYS A CA  
1651 C  C   . CYS A 214 ? 0.7061 0.6930 0.6512 0.0123  0.0644  -0.0180 468 CYS A C   
1652 O  O   . CYS A 214 ? 0.7049 0.6878 0.6501 0.0136  0.0612  -0.0167 468 CYS A O   
1653 C  CB  . CYS A 214 ? 0.7415 0.7250 0.6931 0.0031  0.0716  -0.0157 468 CYS A CB  
1654 S  SG  . CYS A 214 ? 0.8054 0.7892 0.7672 -0.0023 0.0718  -0.0181 468 CYS A SG  
1655 N  N   . TYR A 215 ? 0.6892 0.6800 0.6272 0.0150  0.0670  -0.0178 469 TYR A N   
1656 C  CA  . TYR A 215 ? 0.6495 0.6405 0.5796 0.0203  0.0654  -0.0169 469 TYR A CA  
1657 C  C   . TYR A 215 ? 0.7159 0.7099 0.6520 0.0236  0.0579  -0.0220 469 TYR A C   
1658 O  O   . TYR A 215 ? 0.6599 0.6503 0.5950 0.0258  0.0547  -0.0209 469 TYR A O   
1659 C  CB  . TYR A 215 ? 0.6858 0.6832 0.6084 0.0233  0.0686  -0.0173 469 TYR A CB  
1660 C  CG  . TYR A 215 ? 0.6999 0.6975 0.6128 0.0294  0.0670  -0.0160 469 TYR A CG  
1661 C  CD1 . TYR A 215 ? 0.7120 0.7152 0.6264 0.0345  0.0609  -0.0215 469 TYR A CD1 
1662 C  CD2 . TYR A 215 ? 0.7730 0.7652 0.6758 0.0302  0.0713  -0.0093 469 TYR A CD2 
1663 C  CE1 . TYR A 215 ? 0.7901 0.7941 0.6963 0.0404  0.0588  -0.0210 469 TYR A CE1 
1664 C  CE2 . TYR A 215 ? 0.7833 0.7760 0.6767 0.0365  0.0694  -0.0082 469 TYR A CE2 
1665 C  CZ  . TYR A 215 ? 0.8030 0.8018 0.6982 0.0416  0.0629  -0.0143 469 TYR A CZ  
1666 O  OH  . TYR A 215 ? 0.8934 0.8937 0.7804 0.0484  0.0599  -0.0145 469 TYR A OH  
1667 N  N   . ASN A 216 ? 0.6899 0.6902 0.6333 0.0236  0.0550  -0.0275 470 ASN A N   
1668 C  CA  . ASN A 216 ? 0.7374 0.7401 0.6880 0.0263  0.0479  -0.0323 470 ASN A CA  
1669 C  C   . ASN A 216 ? 0.7411 0.7380 0.6986 0.0239  0.0448  -0.0307 470 ASN A C   
1670 O  O   . ASN A 216 ? 0.7770 0.7736 0.7376 0.0266  0.0399  -0.0324 470 ASN A O   
1671 C  CB  . ASN A 216 ? 0.7475 0.7577 0.7054 0.0266  0.0454  -0.0385 470 ASN A CB  
1672 C  CG  . ASN A 216 ? 0.7808 0.7988 0.7326 0.0310  0.0464  -0.0417 470 ASN A CG  
1673 O  OD1 . ASN A 216 ? 0.8043 0.8245 0.7523 0.0360  0.0435  -0.0435 470 ASN A OD1 
1674 N  ND2 . ASN A 216 ? 0.8465 0.8692 0.7979 0.0293  0.0503  -0.0430 470 ASN A ND2 
1675 N  N   . ILE A 217 ? 0.6947 0.6875 0.6547 0.0188  0.0478  -0.0278 471 ILE A N   
1676 C  CA  . ILE A 217 ? 0.6646 0.6526 0.6304 0.0164  0.0456  -0.0260 471 ILE A CA  
1677 C  C   . ILE A 217 ? 0.6852 0.6679 0.6455 0.0180  0.0458  -0.0222 471 ILE A C   
1678 O  O   . ILE A 217 ? 0.6625 0.6440 0.6269 0.0193  0.0416  -0.0228 471 ILE A O   
1679 C  CB  . ILE A 217 ? 0.6653 0.6511 0.6345 0.0111  0.0488  -0.0243 471 ILE A CB  
1680 C  CG1 . ILE A 217 ? 0.7076 0.6985 0.6848 0.0100  0.0465  -0.0287 471 ILE A CG1 
1681 C  CG2 . ILE A 217 ? 0.7035 0.6842 0.6764 0.0088  0.0475  -0.0215 471 ILE A CG2 
1682 C  CD1 . ILE A 217 ? 0.7191 0.7088 0.7001 0.0054  0.0488  -0.0278 471 ILE A CD1 
1683 N  N   . LEU A 218 ? 0.6923 0.6721 0.6436 0.0182  0.0505  -0.0186 472 LEU A N   
1684 C  CA  . LEU A 218 ? 0.7308 0.7052 0.6772 0.0199  0.0504  -0.0151 472 LEU A CA  
1685 C  C   . LEU A 218 ? 0.7698 0.7466 0.7141 0.0256  0.0458  -0.0175 472 LEU A C   
1686 O  O   . LEU A 218 ? 0.6812 0.6551 0.6270 0.0271  0.0428  -0.0168 472 LEU A O   
1687 C  CB  . LEU A 218 ? 0.7757 0.7457 0.7138 0.0185  0.0564  -0.0103 472 LEU A CB  
1688 C  CG  . LEU A 218 ? 0.8086 0.7718 0.7428 0.0192  0.0568  -0.0062 472 LEU A CG  
1689 C  CD1 . LEU A 218 ? 0.8203 0.7807 0.7619 0.0162  0.0548  -0.0062 472 LEU A CD1 
1690 C  CD2 . LEU A 218 ? 0.8277 0.7864 0.7552 0.0173  0.0629  -0.0015 472 LEU A CD2 
1691 N  N   . VAL A 219 ? 0.7805 0.7633 0.7222 0.0290  0.0449  -0.0208 473 VAL A N   
1692 C  CA  . VAL A 219 ? 0.7525 0.7389 0.6936 0.0347  0.0398  -0.0244 473 VAL A CA  
1693 C  C   . VAL A 219 ? 0.7303 0.7174 0.6832 0.0345  0.0338  -0.0279 473 VAL A C   
1694 O  O   . VAL A 219 ? 0.6807 0.6664 0.6350 0.0371  0.0302  -0.0285 473 VAL A O   
1695 C  CB  . VAL A 219 ? 0.7511 0.7450 0.6885 0.0385  0.0396  -0.0283 473 VAL A CB  
1696 C  CG1 . VAL A 219 ? 0.7761 0.7744 0.7144 0.0447  0.0334  -0.0332 473 VAL A CG1 
1697 C  CG2 . VAL A 219 ? 0.8282 0.8213 0.7531 0.0395  0.0455  -0.0239 473 VAL A CG2 
1698 N  N   . LEU A 220 ? 0.6748 0.6640 0.6361 0.0312  0.0330  -0.0300 474 LEU A N   
1699 C  CA  . LEU A 220 ? 0.7258 0.7158 0.6985 0.0306  0.0278  -0.0328 474 LEU A CA  
1700 C  C   . LEU A 220 ? 0.6609 0.6450 0.6355 0.0284  0.0279  -0.0288 474 LEU A C   
1701 O  O   . LEU A 220 ? 0.6489 0.6329 0.6291 0.0301  0.0237  -0.0302 474 LEU A O   
1702 C  CB  . LEU A 220 ? 0.7175 0.7100 0.6980 0.0272  0.0275  -0.0348 474 LEU A CB  
1703 C  CG  . LEU A 220 ? 0.6608 0.6534 0.6536 0.0261  0.0224  -0.0366 474 LEU A CG  
1704 C  CD1 . LEU A 220 ? 0.7008 0.6978 0.6989 0.0308  0.0166  -0.0421 474 LEU A CD1 
1705 C  CD2 . LEU A 220 ? 0.6959 0.6897 0.6952 0.0226  0.0225  -0.0374 474 LEU A CD2 
1706 N  N   . CYS A 221 ? 0.6486 0.6282 0.6186 0.0249  0.0328  -0.0241 475 CYS A N   
1707 C  CA  . CYS A 221 ? 0.6678 0.6422 0.6384 0.0231  0.0334  -0.0205 475 CYS A CA  
1708 C  C   . CYS A 221 ? 0.6875 0.6604 0.6542 0.0272  0.0314  -0.0202 475 CYS A C   
1709 O  O   . CYS A 221 ? 0.6162 0.5883 0.5888 0.0276  0.0283  -0.0205 475 CYS A O   
1710 C  CB  . CYS A 221 ? 0.6858 0.6560 0.6516 0.0192  0.0389  -0.0163 475 CYS A CB  
1711 S  SG  . CYS A 221 ? 0.7543 0.7184 0.7193 0.0174  0.0404  -0.0120 475 CYS A SG  
1712 N  N   . LEU A 222 ? 0.7017 0.6745 0.6588 0.0306  0.0331  -0.0197 476 LEU A N   
1713 C  CA  . LEU A 222 ? 0.6803 0.6520 0.6337 0.0351  0.0307  -0.0198 476 LEU A CA  
1714 C  C   . LEU A 222 ? 0.6643 0.6405 0.6255 0.0385  0.0244  -0.0250 476 LEU A C   
1715 O  O   . LEU A 222 ? 0.7109 0.6858 0.6749 0.0403  0.0216  -0.0253 476 LEU A O   
1716 C  CB  . LEU A 222 ? 0.7663 0.7377 0.7078 0.0386  0.0332  -0.0184 476 LEU A CB  
1717 C  CG  . LEU A 222 ? 0.7194 0.6851 0.6538 0.0355  0.0393  -0.0127 476 LEU A CG  
1718 C  CD1 . LEU A 222 ? 0.7317 0.6981 0.6547 0.0394  0.0415  -0.0112 476 LEU A CD1 
1719 C  CD2 . LEU A 222 ? 0.7588 0.7187 0.6938 0.0345  0.0393  -0.0097 476 LEU A CD2 
1720 N  N   . ARG A 223 ? 0.7317 0.7134 0.6979 0.0392  0.0220  -0.0294 477 ARG A N   
1721 C  CA  . ARG A 223 ? 0.7545 0.7407 0.7303 0.0421  0.0156  -0.0350 477 ARG A CA  
1722 C  C   . ARG A 223 ? 0.7341 0.7186 0.7219 0.0387  0.0134  -0.0345 477 ARG A C   
1723 O  O   . ARG A 223 ? 0.6898 0.6754 0.6843 0.0410  0.0090  -0.0369 477 ARG A O   
1724 C  CB  . ARG A 223 ? 0.7665 0.7589 0.7457 0.0435  0.0137  -0.0400 477 ARG A CB  
1725 C  CG  . ARG A 223 ? 0.8284 0.8236 0.7954 0.0468  0.0166  -0.0403 477 ARG A CG  
1726 C  CD  . ARG A 223 ? 0.7543 0.7569 0.7239 0.0495  0.0139  -0.0464 477 ARG A CD  
1727 N  NE  . ARG A 223 ? 0.8359 0.8427 0.8140 0.0539  0.0069  -0.0527 477 ARG A NE  
1728 C  CZ  . ARG A 223 ? 0.8064 0.8191 0.7932 0.0555  0.0026  -0.0591 477 ARG A CZ  
1729 N  NH1 . ARG A 223 ? 0.7930 0.8084 0.7812 0.0533  0.0043  -0.0602 477 ARG A NH1 
1730 N  NH2 . ARG A 223 ? 0.8179 0.8338 0.8131 0.0593  -0.0039 -0.0647 477 ARG A NH2 
1731 N  N   . GLU A 224 ? 0.7166 0.6990 0.7073 0.0335  0.0163  -0.0314 478 GLU A N   
1732 C  CA  . GLU A 224 ? 0.7698 0.7505 0.7703 0.0298  0.0151  -0.0297 478 GLU A CA  
1733 C  C   . GLU A 224 ? 0.7363 0.7135 0.7353 0.0299  0.0158  -0.0267 478 GLU A C   
1734 O  O   . GLU A 224 ? 0.6976 0.6754 0.7051 0.0300  0.0128  -0.0275 478 GLU A O   
1735 C  CB  . GLU A 224 ? 0.7238 0.7030 0.7256 0.0248  0.0184  -0.0268 478 GLU A CB  
1736 C  CG  . GLU A 224 ? 0.7761 0.7590 0.7837 0.0240  0.0166  -0.0299 478 GLU A CG  
1737 C  CD  . GLU A 224 ? 0.8683 0.8494 0.8752 0.0192  0.0203  -0.0267 478 GLU A CD  
1738 O  OE1 . GLU A 224 ? 0.8759 0.8557 0.8892 0.0163  0.0198  -0.0245 478 GLU A OE1 
1739 O  OE2 . GLU A 224 ? 0.9521 0.9328 0.9512 0.0184  0.0244  -0.0258 478 GLU A OE2 
1740 N  N   . LEU A 225 ? 0.7445 0.7181 0.7329 0.0303  0.0197  -0.0236 479 LEU A N   
1741 C  CA  . LEU A 225 ? 0.7522 0.7225 0.7390 0.0308  0.0202  -0.0212 479 LEU A CA  
1742 C  C   . LEU A 225 ? 0.7720 0.7442 0.7598 0.0360  0.0158  -0.0246 479 LEU A C   
1743 O  O   . LEU A 225 ? 0.8138 0.7861 0.8084 0.0361  0.0136  -0.0250 479 LEU A O   
1744 C  CB  . LEU A 225 ? 0.7198 0.6854 0.6955 0.0301  0.0251  -0.0172 479 LEU A CB  
1745 C  CG  . LEU A 225 ? 0.7026 0.6664 0.6783 0.0250  0.0292  -0.0143 479 LEU A CG  
1746 C  CD1 . LEU A 225 ? 0.7142 0.6739 0.6796 0.0246  0.0338  -0.0111 479 LEU A CD1 
1747 C  CD2 . LEU A 225 ? 0.7049 0.6677 0.6871 0.0217  0.0294  -0.0123 479 LEU A CD2 
1748 N  N   . PHE A 226 ? 0.7672 0.7414 0.7481 0.0404  0.0148  -0.0271 480 PHE A N   
1749 C  CA  . PHE A 226 ? 0.7653 0.7405 0.7435 0.0462  0.0113  -0.0298 480 PHE A CA  
1750 C  C   . PHE A 226 ? 0.7475 0.7288 0.7317 0.0507  0.0055  -0.0364 480 PHE A C   
1751 O  O   . PHE A 226 ? 0.8195 0.8022 0.8022 0.0558  0.0021  -0.0391 480 PHE A O   
1752 C  CB  . PHE A 226 ? 0.7714 0.7434 0.7350 0.0487  0.0148  -0.0267 480 PHE A CB  
1753 C  CG  . PHE A 226 ? 0.7746 0.7404 0.7337 0.0447  0.0198  -0.0209 480 PHE A CG  
1754 C  CD1 . PHE A 226 ? 0.7539 0.7175 0.7187 0.0426  0.0196  -0.0195 480 PHE A CD1 
1755 C  CD2 . PHE A 226 ? 0.7610 0.7238 0.7107 0.0431  0.0248  -0.0171 480 PHE A CD2 
1756 C  CE1 . PHE A 226 ? 0.8024 0.7609 0.7637 0.0391  0.0239  -0.0150 480 PHE A CE1 
1757 C  CE2 . PHE A 226 ? 0.7896 0.7470 0.7365 0.0395  0.0291  -0.0125 480 PHE A CE2 
1758 C  CZ  . PHE A 226 ? 0.7942 0.7494 0.7466 0.0377  0.0284  -0.0116 480 PHE A CZ  
1759 N  N   . GLU A 227 ? 0.7398 0.7247 0.7313 0.0492  0.0039  -0.0392 481 GLU A N   
1760 C  CA  . GLU A 227 ? 0.7431 0.7339 0.7414 0.0534  -0.0019 -0.0461 481 GLU A CA  
1761 C  C   . GLU A 227 ? 0.7638 0.7562 0.7782 0.0500  -0.0049 -0.0481 481 GLU A C   
1762 O  O   . GLU A 227 ? 0.7741 0.7691 0.7988 0.0521  -0.0099 -0.0523 481 GLU A O   
1763 C  CB  . GLU A 227 ? 0.7544 0.7489 0.7443 0.0562  -0.0010 -0.0483 481 GLU A CB  
1764 C  CG  . GLU A 227 ? 0.7926 0.7941 0.7893 0.0605  -0.0067 -0.0561 481 GLU A CG  
1765 C  CD  . GLU A 227 ? 0.7961 0.8015 0.7879 0.0609  -0.0050 -0.0579 481 GLU A CD  
1766 O  OE1 . GLU A 227 ? 0.8347 0.8389 0.8138 0.0607  0.0002  -0.0540 481 GLU A OE1 
1767 O  OE2 . GLU A 227 ? 0.7547 0.7648 0.7563 0.0613  -0.0087 -0.0632 481 GLU A OE2 
1768 N  N   . PHE A 228 ? 0.8152 0.8060 0.8325 0.0448  -0.0021 -0.0451 482 PHE A N   
1769 C  CA  . PHE A 228 ? 0.7825 0.7746 0.8149 0.0420  -0.0053 -0.0466 482 PHE A CA  
1770 C  C   . PHE A 228 ? 0.8143 0.8037 0.8546 0.0389  -0.0052 -0.0433 482 PHE A C   
1771 O  O   . PHE A 228 ? 0.8623 0.8483 0.8961 0.0377  -0.0017 -0.0391 482 PHE A O   
1772 C  CB  . PHE A 228 ? 0.7779 0.7695 0.8112 0.0378  -0.0028 -0.0447 482 PHE A CB  
1773 C  CG  . PHE A 228 ? 0.7159 0.7107 0.7430 0.0399  -0.0024 -0.0478 482 PHE A CG  
1774 C  CD1 . PHE A 228 ? 0.7942 0.7940 0.8201 0.0456  -0.0061 -0.0539 482 PHE A CD1 
1775 C  CD2 . PHE A 228 ? 0.7434 0.7371 0.7664 0.0363  0.0017  -0.0449 482 PHE A CD2 
1776 C  CE1 . PHE A 228 ? 0.8157 0.8194 0.8361 0.0475  -0.0055 -0.0569 482 PHE A CE1 
1777 C  CE2 . PHE A 228 ? 0.7915 0.7888 0.8098 0.0379  0.0023  -0.0480 482 PHE A CE2 
1778 C  CZ  . PHE A 228 ? 0.8794 0.8819 0.8962 0.0435  -0.0011 -0.0539 482 PHE A CZ  
1779 N  N   . HIS A 229 ? 0.8910 0.8820 0.9461 0.0374  -0.0088 -0.0450 483 HIS A N   
1780 C  CA  . HIS A 229 ? 1.1459 1.1346 1.2083 0.0338  -0.0077 -0.0409 483 HIS A CA  
1781 C  C   . HIS A 229 ? 1.0886 1.0743 1.1498 0.0281  -0.0032 -0.0346 483 HIS A C   
1782 O  O   . HIS A 229 ? 1.0226 1.0072 1.0895 0.0249  -0.0019 -0.0309 483 HIS A O   
1783 C  CB  . HIS A 229 ? 1.2033 1.1946 1.2829 0.0342  -0.0131 -0.0443 483 HIS A CB  
1784 C  CG  . HIS A 229 ? 1.3850 1.3792 1.4671 0.0395  -0.0174 -0.0501 483 HIS A CG  
1785 N  ND1 . HIS A 229 ? 1.4458 1.4393 1.5270 0.0404  -0.0168 -0.0491 483 HIS A ND1 
1786 C  CD2 . HIS A 229 ? 1.4346 1.4328 1.5200 0.0444  -0.0226 -0.0573 483 HIS A CD2 
1787 C  CE1 . HIS A 229 ? 1.4461 1.4429 1.5300 0.0457  -0.0215 -0.0553 483 HIS A CE1 
1788 N  NE2 . HIS A 229 ? 1.3996 1.3993 1.4860 0.0483  -0.0251 -0.0605 483 HIS A NE2 
1789 N  N   . PHE A 230 ? 1.0034 0.9885 1.0571 0.0271  -0.0009 -0.0339 484 PHE A N   
1790 C  CA  . PHE A 230 ? 0.9620 0.9458 1.0175 0.0226  0.0015  -0.0301 484 PHE A CA  
1791 C  C   . PHE A 230 ? 0.9335 0.9154 0.9757 0.0214  0.0064  -0.0278 484 PHE A C   
1792 O  O   . PHE A 230 ? 1.0015 0.9846 1.0362 0.0243  0.0066  -0.0307 484 PHE A O   
1793 C  CB  . PHE A 230 ? 0.9657 0.9519 1.0319 0.0227  -0.0028 -0.0336 484 PHE A CB  
1794 C  CG  . PHE A 230 ? 1.1237 1.1106 1.2050 0.0218  -0.0066 -0.0339 484 PHE A CG  
1795 C  CD1 . PHE A 230 ? 1.1568 1.1418 1.2441 0.0173  -0.0049 -0.0283 484 PHE A CD1 
1796 C  CD2 . PHE A 230 ? 1.2450 1.2346 1.3351 0.0254  -0.0119 -0.0396 484 PHE A CD2 
1797 C  CE1 . PHE A 230 ? 1.2829 1.2685 1.3850 0.0162  -0.0081 -0.0279 484 PHE A CE1 
1798 C  CE2 . PHE A 230 ? 1.3145 1.3046 1.4203 0.0243  -0.0154 -0.0399 484 PHE A CE2 
1799 C  CZ  . PHE A 230 ? 1.3115 1.2994 1.4234 0.0195  -0.0133 -0.0336 484 PHE A CZ  
1800 N  N   . MSE A 231 ? 0.8467 0.8263 0.8865 0.0174  0.0102  -0.0230 485 MSE A N   
1801 C  CA  . MSE A 231 ? 0.8250 0.8030 0.8541 0.0160  0.0147  -0.0212 485 MSE A CA  
1802 C  C   . MSE A 231 ? 0.8047 0.7820 0.8360 0.0119  0.0165  -0.0182 485 MSE A C   
1803 O  O   . MSE A 231 ? 0.8671 0.8440 0.9043 0.0096  0.0163  -0.0152 485 MSE A O   
1804 C  CB  . MSE A 231 ? 0.8070 0.7821 0.8263 0.0165  0.0183  -0.0188 485 MSE A CB  
1805 C  CG  . MSE A 231 ? 0.9001 0.8734 0.9213 0.0135  0.0204  -0.0145 485 MSE A CG  
1806 SE SE  . MSE A 231 ? 0.9957 0.9651 1.0057 0.0141  0.0248  -0.0118 485 MSE A SE  
1807 C  CE  . MSE A 231 ? 0.9163 0.8874 0.9289 0.0195  0.0200  -0.0159 485 MSE A CE  
1808 N  N   . GLN A 232 ? 0.8190 0.7966 0.8453 0.0111  0.0185  -0.0189 486 GLN A N   
1809 C  CA  . GLN A 232 ? 0.8932 0.8702 0.9195 0.0075  0.0208  -0.0163 486 GLN A CA  
1810 C  C   . GLN A 232 ? 0.8870 0.8612 0.9052 0.0059  0.0254  -0.0128 486 GLN A C   
1811 O  O   . GLN A 232 ? 0.8632 0.8361 0.8731 0.0067  0.0282  -0.0133 486 GLN A O   
1812 C  CB  . GLN A 232 ? 0.9155 0.8941 0.9392 0.0074  0.0215  -0.0189 486 GLN A CB  
1813 C  CG  . GLN A 232 ? 1.0832 1.0650 1.1142 0.0093  0.0170  -0.0232 486 GLN A CG  
1814 C  CD  . GLN A 232 ? 1.2401 1.2228 1.2777 0.0070  0.0155  -0.0229 486 GLN A CD  
1815 O  OE1 . GLN A 232 ? 1.3413 1.3258 1.3777 0.0068  0.0159  -0.0253 486 GLN A OE1 
1816 N  NE2 . GLN A 232 ? 1.2566 1.2380 1.3010 0.0053  0.0139  -0.0196 486 GLN A NE2 
1817 N  N   . THR A 233 ? 0.7855 0.7590 0.8062 0.0036  0.0263  -0.0093 487 THR A N   
1818 C  CA  . THR A 233 ? 0.8133 0.7848 0.8276 0.0019  0.0303  -0.0064 487 THR A CA  
1819 C  C   . THR A 233 ? 0.7622 0.7338 0.7737 -0.0006 0.0329  -0.0059 487 THR A C   
1820 O  O   . THR A 233 ? 0.8551 0.8284 0.8700 -0.0013 0.0314  -0.0070 487 THR A O   
1821 C  CB  . THR A 233 ? 0.7655 0.7374 0.7840 0.0011  0.0301  -0.0035 487 THR A CB  
1822 O  OG1 . THR A 233 ? 0.8432 0.8170 0.8692 -0.0005 0.0281  -0.0020 487 THR A OG1 
1823 C  CG2 . THR A 233 ? 0.7800 0.7520 0.8014 0.0035  0.0279  -0.0045 487 THR A CG2 
1824 N  N   . ASP A 234 ? 0.9007 0.8705 0.9060 -0.0017 0.0365  -0.0046 488 ASP A N   
1825 C  CA  . ASP A 234 ? 0.9315 0.9017 0.9346 -0.0038 0.0387  -0.0049 488 ASP A CA  
1826 C  C   . ASP A 234 ? 0.9183 0.8895 0.9213 -0.0036 0.0383  -0.0079 488 ASP A C   
1827 O  O   . ASP A 234 ? 1.0456 1.0190 1.0522 -0.0048 0.0373  -0.0088 488 ASP A O   
1828 C  CB  . ASP A 234 ? 0.9716 0.9437 0.9788 -0.0056 0.0379  -0.0027 488 ASP A CB  
1829 C  CG  . ASP A 234 ? 1.0990 1.0708 1.1049 -0.0059 0.0394  0.0001  488 ASP A CG  
1830 O  OD1 . ASP A 234 ? 1.0919 1.0614 1.0924 -0.0056 0.0421  -0.0001 488 ASP A OD1 
1831 O  OD2 . ASP A 234 ? 1.1085 1.0824 1.1189 -0.0063 0.0381  0.0026  488 ASP A OD2 
1832 N  N   . PRO A 235 ? 0.8672 0.8375 0.8663 -0.0018 0.0391  -0.0095 489 PRO A N   
1833 C  CA  . PRO A 235 ? 0.8577 0.8299 0.8564 -0.0014 0.0392  -0.0126 489 PRO A CA  
1834 C  C   . PRO A 235 ? 0.8891 0.8620 0.8870 -0.0041 0.0418  -0.0131 489 PRO A C   
1835 O  O   . PRO A 235 ? 0.8462 0.8168 0.8403 -0.0057 0.0452  -0.0115 489 PRO A O   
1836 C  CB  . PRO A 235 ? 0.8839 0.8547 0.8761 0.0007  0.0411  -0.0130 489 PRO A CB  
1837 C  CG  . PRO A 235 ? 0.9406 0.9075 0.9287 0.0006  0.0430  -0.0101 489 PRO A CG  
1838 C  CD  . PRO A 235 ? 0.8589 0.8264 0.8526 -0.0001 0.0406  -0.0085 489 PRO A CD  
1839 N  N   . ASN A 236 ? 0.8515 0.8275 0.8538 -0.0045 0.0401  -0.0156 490 ASN A N   
1840 C  CA  . ASN A 236 ? 0.8995 0.8768 0.9024 -0.0069 0.0419  -0.0165 490 ASN A CA  
1841 C  C   . ASN A 236 ? 0.8426 0.8231 0.8469 -0.0066 0.0419  -0.0203 490 ASN A C   
1842 O  O   . ASN A 236 ? 0.7363 0.7195 0.7455 -0.0052 0.0382  -0.0225 490 ASN A O   
1843 C  CB  . ASN A 236 ? 0.9815 0.9596 0.9890 -0.0080 0.0396  -0.0152 490 ASN A CB  
1844 C  CG  . ASN A 236 ? 1.1819 1.1622 1.1910 -0.0099 0.0403  -0.0171 490 ASN A CG  
1845 O  OD1 . ASN A 236 ? 1.0521 1.0323 1.0584 -0.0112 0.0438  -0.0186 490 ASN A OD1 
1846 N  ND2 . ASN A 236 ? 1.3224 1.3047 1.3367 -0.0098 0.0369  -0.0171 490 ASN A ND2 
1847 N  N   . TRP A 237 ? 0.8280 0.8084 0.8288 -0.0081 0.0460  -0.0211 491 TRP A N   
1848 C  CA  . TRP A 237 ? 0.8544 0.8384 0.8563 -0.0081 0.0469  -0.0247 491 TRP A CA  
1849 C  C   . TRP A 237 ? 0.8275 0.8154 0.8363 -0.0083 0.0434  -0.0278 491 TRP A C   
1850 O  O   . TRP A 237 ? 0.9030 0.8947 0.9141 -0.0072 0.0425  -0.0313 491 TRP A O   
1851 C  CB  . TRP A 237 ? 0.8723 0.8553 0.8702 -0.0103 0.0525  -0.0245 491 TRP A CB  
1852 C  CG  . TRP A 237 ? 0.7755 0.7581 0.7752 -0.0132 0.0545  -0.0247 491 TRP A CG  
1853 C  CD1 . TRP A 237 ? 0.8245 0.8060 0.8262 -0.0141 0.0529  -0.0236 491 TRP A CD1 
1854 C  CD2 . TRP A 237 ? 0.8408 0.8242 0.8404 -0.0155 0.0589  -0.0263 491 TRP A CD2 
1855 N  NE1 . TRP A 237 ? 0.8081 0.7898 0.8109 -0.0166 0.0555  -0.0249 491 TRP A NE1 
1856 C  CE2 . TRP A 237 ? 0.8540 0.8367 0.8561 -0.0176 0.0593  -0.0265 491 TRP A CE2 
1857 C  CE3 . TRP A 237 ? 0.8412 0.8265 0.8391 -0.0160 0.0627  -0.0275 491 TRP A CE3 
1858 C  CZ2 . TRP A 237 ? 0.8746 0.8581 0.8786 -0.0203 0.0629  -0.0285 491 TRP A CZ2 
1859 C  CZ3 . TRP A 237 ? 0.8932 0.8789 0.8927 -0.0189 0.0669  -0.0286 491 TRP A CZ3 
1860 C  CH2 . TRP A 237 ? 0.8486 0.8334 0.8516 -0.0211 0.0669  -0.0293 491 TRP A CH2 
1861 N  N   . SER A 238 ? 0.9012 0.8886 0.9135 -0.0093 0.0413  -0.0266 492 SER A N   
1862 C  CA  . SER A 238 ? 1.0122 1.0026 1.0312 -0.0089 0.0370  -0.0288 492 SER A CA  
1863 C  C   . SER A 238 ? 1.0078 0.9989 1.0314 -0.0065 0.0322  -0.0293 492 SER A C   
1864 O  O   . SER A 238 ? 0.9247 0.9184 0.9544 -0.0059 0.0286  -0.0318 492 SER A O   
1865 C  CB  . SER A 238 ? 0.9702 0.9599 0.9908 -0.0104 0.0361  -0.0268 492 SER A CB  
1866 O  OG  . SER A 238 ? 1.0842 1.0726 1.1004 -0.0123 0.0406  -0.0263 492 SER A OG  
1867 N  N   . ASN A 239 ? 0.9697 0.9587 0.9913 -0.0050 0.0317  -0.0274 493 ASN A N   
1868 C  CA  . ASN A 239 ? 0.9090 0.8990 0.9363 -0.0026 0.0268  -0.0287 493 ASN A CA  
1869 C  C   . ASN A 239 ? 0.8590 0.8515 0.8855 0.0000  0.0264  -0.0325 493 ASN A C   
1870 O  O   . ASN A 239 ? 0.8715 0.8647 0.9025 0.0023  0.0224  -0.0338 493 ASN A O   
1871 C  CB  . ASN A 239 ? 0.8722 0.8590 0.9006 -0.0024 0.0253  -0.0246 493 ASN A CB  
1872 C  CG  . ASN A 239 ? 1.0344 1.0200 1.0646 -0.0044 0.0250  -0.0210 493 ASN A CG  
1873 O  OD1 . ASN A 239 ? 1.0441 1.0274 1.0712 -0.0052 0.0268  -0.0173 493 ASN A OD1 
1874 N  ND2 . ASN A 239 ? 0.9876 0.9752 1.0226 -0.0049 0.0227  -0.0224 493 ASN A ND2 
1875 N  N   . PHE A 240 ? 0.7610 0.7554 0.7822 -0.0004 0.0304  -0.0344 494 PHE A N   
1876 C  CA  . PHE A 240 ? 0.7763 0.7743 0.7957 0.0021  0.0307  -0.0381 494 PHE A CA  
1877 C  C   . PHE A 240 ? 0.8369 0.8397 0.8600 0.0015  0.0307  -0.0425 494 PHE A C   
1878 O  O   . PHE A 240 ? 0.7937 0.7967 0.8146 -0.0011 0.0345  -0.0421 494 PHE A O   
1879 C  CB  . PHE A 240 ? 0.8985 0.8948 0.9083 0.0020  0.0361  -0.0359 494 PHE A CB  
1880 C  CG  . PHE A 240 ? 0.8624 0.8542 0.8684 0.0030  0.0359  -0.0321 494 PHE A CG  
1881 C  CD1 . PHE A 240 ? 0.8699 0.8571 0.8741 0.0007  0.0376  -0.0277 494 PHE A CD1 
1882 C  CD2 . PHE A 240 ? 0.9002 0.8930 0.9044 0.0066  0.0340  -0.0333 494 PHE A CD2 
1883 C  CE1 . PHE A 240 ? 0.9150 0.8987 0.9163 0.0018  0.0375  -0.0247 494 PHE A CE1 
1884 C  CE2 . PHE A 240 ? 0.8546 0.8436 0.8556 0.0077  0.0337  -0.0302 494 PHE A CE2 
1885 C  CZ  . PHE A 240 ? 0.8862 0.8707 0.8860 0.0052  0.0355  -0.0259 494 PHE A CZ  
1886 N  N   . PHE A 241 ? 0.8118 0.8186 0.8412 0.0039  0.0261  -0.0471 495 PHE A N   
1887 C  CA  . PHE A 241 ? 0.8156 0.8279 0.8491 0.0040  0.0257  -0.0522 495 PHE A CA  
1888 C  C   . PHE A 241 ? 0.8195 0.8374 0.8499 0.0065  0.0273  -0.0565 495 PHE A C   
1889 O  O   . PHE A 241 ? 0.8422 0.8624 0.8746 0.0099  0.0238  -0.0593 495 PHE A O   
1890 C  CB  . PHE A 241 ? 0.8670 0.8804 0.9108 0.0051  0.0192  -0.0549 495 PHE A CB  
1891 C  CG  . PHE A 241 ? 0.8746 0.8846 0.9214 0.0025  0.0183  -0.0516 495 PHE A CG  
1892 C  CD1 . PHE A 241 ? 0.9012 0.9059 0.9441 0.0006  0.0200  -0.0457 495 PHE A CD1 
1893 C  CD2 . PHE A 241 ? 1.0398 1.0524 1.0932 0.0022  0.0155  -0.0547 495 PHE A CD2 
1894 C  CE1 . PHE A 241 ? 1.0401 1.0426 1.0850 -0.0014 0.0193  -0.0428 495 PHE A CE1 
1895 C  CE2 . PHE A 241 ? 1.0625 1.0723 1.1178 0.0002  0.0146  -0.0516 495 PHE A CE2 
1896 C  CZ  . PHE A 241 ? 1.1087 1.1137 1.1595 -0.0015 0.0165  -0.0456 495 PHE A CZ  
1897 N  N   . TYR A 242 ? 0.7869 0.8073 0.8124 0.0049  0.0329  -0.0569 496 TYR A N   
1898 C  CA  . TYR A 242 ? 0.8526 0.8788 0.8742 0.0069  0.0355  -0.0602 496 TYR A CA  
1899 C  C   . TYR A 242 ? 0.9801 1.0136 1.0089 0.0078  0.0334  -0.0669 496 TYR A C   
1900 O  O   . TYR A 242 ? 0.9540 0.9878 0.9864 0.0051  0.0343  -0.0676 496 TYR A O   
1901 C  CB  . TYR A 242 ? 0.8253 0.8504 0.8389 0.0042  0.0431  -0.0568 496 TYR A CB  
1902 C  CG  . TYR A 242 ? 0.8353 0.8669 0.8443 0.0061  0.0467  -0.0594 496 TYR A CG  
1903 C  CD1 . TYR A 242 ? 0.8134 0.8472 0.8180 0.0103  0.0453  -0.0604 496 TYR A CD1 
1904 C  CD2 . TYR A 242 ? 0.8887 0.9249 0.8979 0.0039  0.0516  -0.0612 496 TYR A CD2 
1905 C  CE1 . TYR A 242 ? 0.8740 0.9146 0.8734 0.0125  0.0487  -0.0627 496 TYR A CE1 
1906 C  CE2 . TYR A 242 ? 0.9144 0.9575 0.9192 0.0057  0.0553  -0.0635 496 TYR A CE2 
1907 C  CZ  . TYR A 242 ? 0.8254 0.8707 0.8249 0.0100  0.0539  -0.0640 496 TYR A CZ  
1908 O  OH  . TYR A 242 ? 0.8433 0.8956 0.8377 0.0121  0.0576  -0.0660 496 TYR A OH  
1909 N  N   . ASP A 243 ? 0.9193 0.9586 0.9500 0.0118  0.0303  -0.0721 497 ASP A N   
1910 C  CA  . ASP A 243 ? 0.9039 0.9512 0.9407 0.0133  0.0285  -0.0793 497 ASP A CA  
1911 C  C   . ASP A 243 ? 0.9652 1.0201 0.9954 0.0145  0.0342  -0.0817 497 ASP A C   
1912 O  O   . ASP A 243 ? 1.0228 1.0808 1.0488 0.0183  0.0335  -0.0833 497 ASP A O   
1913 C  CB  . ASP A 243 ? 0.9467 0.9957 0.9916 0.0174  0.0205  -0.0840 497 ASP A CB  
1914 C  CG  . ASP A 243 ? 0.9870 1.0449 1.0393 0.0199  0.0174  -0.0924 497 ASP A CG  
1915 O  OD1 . ASP A 243 ? 0.9849 1.0476 1.0371 0.0183  0.0211  -0.0947 497 ASP A OD1 
1916 O  OD2 . ASP A 243 ? 0.9946 1.0548 1.0533 0.0237  0.0111  -0.0972 497 ASP A OD2 
1917 N  N   . PRO A 244 ? 1.0281 1.0861 1.0572 0.0114  0.0399  -0.0819 498 PRO A N   
1918 C  CA  . PRO A 244 ? 1.0063 1.0723 1.0303 0.0122  0.0456  -0.0841 498 PRO A CA  
1919 C  C   . PRO A 244 ? 1.0423 1.1172 1.0682 0.0173  0.0422  -0.0912 498 PRO A C   
1920 O  O   . PRO A 244 ? 1.0442 1.1238 1.0625 0.0199  0.0454  -0.0913 498 PRO A O   
1921 C  CB  . PRO A 244 ? 1.0521 1.1213 1.0815 0.0085  0.0487  -0.0863 498 PRO A CB  
1922 C  CG  . PRO A 244 ? 1.0557 1.1163 1.0873 0.0048  0.0480  -0.0818 498 PRO A CG  
1923 C  CD  . PRO A 244 ? 1.0438 1.0978 1.0762 0.0068  0.0417  -0.0795 498 PRO A CD  
1924 N  N   . GLN A 245 ? 0.9983 1.0756 1.0346 0.0190  0.0353  -0.0972 499 GLN A N   
1925 C  CA  . GLN A 245 ? 1.1402 1.2270 1.1804 0.0237  0.0317  -0.1052 499 GLN A CA  
1926 C  C   . GLN A 245 ? 1.1312 1.2178 1.1656 0.0282  0.0295  -0.1048 499 GLN A C   
1927 O  O   . GLN A 245 ? 1.1241 1.2180 1.1520 0.0313  0.0324  -0.1070 499 GLN A O   
1928 C  CB  . GLN A 245 ? 1.1135 1.2018 1.1670 0.0248  0.0240  -0.1115 499 GLN A CB  
1929 C  CG  . GLN A 245 ? 1.1395 1.2271 1.1991 0.0207  0.0252  -0.1118 499 GLN A CG  
1930 C  CD  . GLN A 245 ? 1.2862 1.3782 1.3585 0.0230  0.0178  -0.1198 499 GLN A CD  
1931 O  OE1 . GLN A 245 ? 1.2997 1.3883 1.3788 0.0255  0.0103  -0.1213 499 GLN A OE1 
1932 N  NE2 . GLN A 245 ? 1.2557 1.3555 1.3319 0.0223  0.0200  -0.1250 499 GLN A NE2 
1933 N  N   . GLN A 246 ? 1.0310 1.1093 1.0669 0.0283  0.0250  -0.1012 500 GLN A N   
1934 C  CA  . GLN A 246 ? 1.0047 1.0829 1.0372 0.0327  0.0219  -0.1018 500 GLN A CA  
1935 C  C   . GLN A 246 ? 0.9917 1.0654 1.0115 0.0321  0.0273  -0.0946 500 GLN A C   
1936 O  O   . GLN A 246 ? 0.9636 1.0390 0.9786 0.0364  0.0257  -0.0954 500 GLN A O   
1937 C  CB  . GLN A 246 ? 1.0917 1.1641 1.1336 0.0337  0.0139  -0.1025 500 GLN A CB  
1938 C  CG  . GLN A 246 ? 1.1902 1.2670 1.2451 0.0354  0.0073  -0.1101 500 GLN A CG  
1939 C  CD  . GLN A 246 ? 1.3230 1.3948 1.3874 0.0372  -0.0008 -0.1110 500 GLN A CD  
1940 O  OE1 . GLN A 246 ? 1.3674 1.4304 1.4311 0.0347  -0.0011 -0.1045 500 GLN A OE1 
1941 N  NE2 . GLN A 246 ? 1.3191 1.3965 1.3929 0.0414  -0.0074 -0.1192 500 GLN A NE2 
1942 N  N   . HIS A 247 ? 0.8801 0.9485 0.8951 0.0272  0.0335  -0.0880 501 HIS A N   
1943 C  CA  . HIS A 247 ? 0.9784 1.0412 0.9822 0.0261  0.0387  -0.0806 501 HIS A CA  
1944 C  C   . HIS A 247 ? 1.0026 1.0578 1.0067 0.0275  0.0340  -0.0775 501 HIS A C   
1945 O  O   . HIS A 247 ? 1.0107 1.0651 1.0068 0.0303  0.0348  -0.0753 501 HIS A O   
1946 C  CB  . HIS A 247 ? 0.9292 0.9987 0.9225 0.0291  0.0438  -0.0807 501 HIS A CB  
1947 C  CG  . HIS A 247 ? 0.9440 1.0074 0.9260 0.0274  0.0499  -0.0725 501 HIS A CG  
1948 N  ND1 . HIS A 247 ? 0.9863 1.0429 0.9672 0.0219  0.0548  -0.0664 501 HIS A ND1 
1949 C  CD2 . HIS A 247 ? 0.9070 0.9702 0.8787 0.0308  0.0515  -0.0696 501 HIS A CD2 
1950 C  CE1 . HIS A 247 ? 0.9910 1.0428 0.9617 0.0218  0.0592  -0.0600 501 HIS A CE1 
1951 N  NE2 . HIS A 247 ? 0.9967 1.0524 0.9615 0.0272  0.0573  -0.0616 501 HIS A NE2 
1952 N  N   . LYS A 248 ? 0.9249 0.9751 0.9383 0.0255  0.0292  -0.0774 502 LYS A N   
1953 C  CA  . LYS A 248 ? 0.9069 0.9503 0.9229 0.0260  0.0248  -0.0746 502 LYS A CA  
1954 C  C   . LYS A 248 ? 0.9060 0.9414 0.9245 0.0211  0.0257  -0.0690 502 LYS A C   
1955 O  O   . LYS A 248 ? 0.9100 0.9453 0.9319 0.0177  0.0274  -0.0689 502 LYS A O   
1956 C  CB  . LYS A 248 ? 0.9316 0.9782 0.9577 0.0297  0.0168  -0.0810 502 LYS A CB  
1957 C  CG  . LYS A 248 ? 0.9727 1.0279 0.9956 0.0352  0.0157  -0.0871 502 LYS A CG  
1958 C  CD  . LYS A 248 ? 1.0834 1.1421 1.1170 0.0395  0.0073  -0.0942 502 LYS A CD  
1959 C  CE  . LYS A 248 ? 1.1153 1.1681 1.1517 0.0407  0.0028  -0.0920 502 LYS A CE  
1960 N  NZ  . LYS A 248 ? 1.0923 1.1476 1.1415 0.0442  -0.0056 -0.0989 502 LYS A NZ  
1961 N  N   . VAL A 249 ? 0.8586 0.8876 0.8750 0.0208  0.0248  -0.0644 503 VAL A N   
1962 C  CA  . VAL A 249 ? 0.7658 0.7876 0.7840 0.0168  0.0254  -0.0591 503 VAL A CA  
1963 C  C   . VAL A 249 ? 0.7890 0.8081 0.8160 0.0179  0.0188  -0.0596 503 VAL A C   
1964 O  O   . VAL A 249 ? 0.7810 0.7998 0.8075 0.0210  0.0162  -0.0602 503 VAL A O   
1965 C  CB  . VAL A 249 ? 0.7374 0.7541 0.7458 0.0154  0.0306  -0.0530 503 VAL A CB  
1966 C  CG1 . VAL A 249 ? 0.7184 0.7282 0.7285 0.0118  0.0309  -0.0478 503 VAL A CG1 
1967 C  CG2 . VAL A 249 ? 0.8106 0.8297 0.8116 0.0139  0.0373  -0.0522 503 VAL A CG2 
1968 N  N   . ALA A 250 ? 0.7641 0.7815 0.7994 0.0156  0.0161  -0.0594 504 ALA A N   
1969 C  CA  . ALA A 250 ? 0.7081 0.7215 0.7518 0.0154  0.0109  -0.0577 504 ALA A CA  
1970 C  C   . ALA A 250 ? 0.7295 0.7362 0.7699 0.0124  0.0132  -0.0506 504 ALA A C   
1971 O  O   . ALA A 250 ? 0.6932 0.6978 0.7277 0.0095  0.0180  -0.0471 504 ALA A O   
1972 C  CB  . ALA A 250 ? 0.7433 0.7580 0.7968 0.0147  0.0068  -0.0603 504 ALA A CB  
1973 N  N   . LEU A 251 ? 0.7768 0.7807 0.8216 0.0134  0.0098  -0.0489 505 LEU A N   
1974 C  CA  . LEU A 251 ? 0.7973 0.7958 0.8395 0.0112  0.0116  -0.0428 505 LEU A CA  
1975 C  C   . LEU A 251 ? 0.8284 0.8245 0.8796 0.0092  0.0082  -0.0403 505 LEU A C   
1976 O  O   . LEU A 251 ? 0.7432 0.7399 0.8038 0.0108  0.0030  -0.0423 505 LEU A O   
1977 C  CB  . LEU A 251 ? 0.8007 0.7980 0.8419 0.0135  0.0103  -0.0423 505 LEU A CB  
1978 C  CG  . LEU A 251 ? 0.9233 0.9203 0.9535 0.0148  0.0145  -0.0414 505 LEU A CG  
1979 C  CD1 . LEU A 251 ? 0.9956 0.9973 1.0210 0.0164  0.0164  -0.0454 505 LEU A CD1 
1980 C  CD2 . LEU A 251 ? 0.9900 0.9868 1.0216 0.0180  0.0114  -0.0424 505 LEU A CD2 
1981 N  N   . LEU A 252 ? 0.8268 0.8203 0.8753 0.0060  0.0111  -0.0359 506 LEU A N   
1982 C  CA  . LEU A 252 ? 0.9230 0.9144 0.9788 0.0044  0.0083  -0.0327 506 LEU A CA  
1983 C  C   . LEU A 252 ? 0.9054 0.8932 0.9583 0.0027  0.0104  -0.0268 506 LEU A C   
1984 O  O   . LEU A 252 ? 0.9113 0.8979 0.9557 0.0020  0.0148  -0.0252 506 LEU A O   
1985 C  CB  . LEU A 252 ? 0.8880 0.8806 0.9444 0.0028  0.0087  -0.0333 506 LEU A CB  
1986 C  CG  . LEU A 252 ? 0.9238 0.9205 0.9854 0.0047  0.0056  -0.0395 506 LEU A CG  
1987 C  CD1 . LEU A 252 ? 0.9903 0.9885 1.0515 0.0031  0.0067  -0.0403 506 LEU A CD1 
1988 C  CD2 . LEU A 252 ? 0.9085 0.9049 0.9814 0.0065  -0.0008 -0.0408 506 LEU A CD2 
1989 N  N   . ASP A 253 ? 0.8890 0.8750 0.9494 0.0021  0.0073  -0.0237 507 ASP A N   
1990 C  CA  . ASP A 253 ? 0.9132 0.8967 0.9724 0.0001  0.0091  -0.0177 507 ASP A CA  
1991 C  C   . ASP A 253 ? 0.8243 0.8066 0.8835 0.0010  0.0094  -0.0165 507 ASP A C   
1992 O  O   . ASP A 253 ? 0.8426 0.8241 0.8941 0.0010  0.0129  -0.0158 507 ASP A O   
1993 C  CB  . ASP A 253 ? 0.9874 0.9704 1.0378 -0.0021 0.0139  -0.0152 507 ASP A CB  
1994 C  CG  . ASP A 253 ? 1.0979 1.0792 1.1473 -0.0039 0.0156  -0.0090 507 ASP A CG  
1995 O  OD1 . ASP A 253 ? 1.1319 1.1124 1.1883 -0.0040 0.0130  -0.0060 507 ASP A OD1 
1996 O  OD2 . ASP A 253 ? 0.9910 0.9719 1.0330 -0.0052 0.0195  -0.0073 507 ASP A OD2 
1997 N  N   . PHE A 254 ? 0.8760 0.8579 0.9448 0.0016  0.0055  -0.0159 508 PHE A N   
1998 C  CA  . PHE A 254 ? 0.9351 0.9163 1.0064 0.0025  0.0049  -0.0153 508 PHE A CA  
1999 C  C   . PHE A 254 ? 0.8835 0.8632 0.9576 0.0003  0.0061  -0.0092 508 PHE A C   
2000 O  O   . PHE A 254 ? 0.9438 0.9232 1.0237 0.0008  0.0046  -0.0086 508 PHE A O   
2001 C  CB  . PHE A 254 ? 0.9055 0.8881 0.9867 0.0051  -0.0004 -0.0202 508 PHE A CB  
2002 C  CG  . PHE A 254 ? 1.0320 1.0171 1.1086 0.0078  -0.0009 -0.0264 508 PHE A CG  
2003 C  CD1 . PHE A 254 ? 1.0165 1.0024 1.0846 0.0097  0.0015  -0.0284 508 PHE A CD1 
2004 C  CD2 . PHE A 254 ? 1.1208 1.1079 1.2003 0.0083  -0.0030 -0.0300 508 PHE A CD2 
2005 C  CE1 . PHE A 254 ? 1.0743 1.0630 1.1369 0.0121  0.0019  -0.0334 508 PHE A CE1 
2006 C  CE2 . PHE A 254 ? 1.1498 1.1401 1.2243 0.0107  -0.0027 -0.0356 508 PHE A CE2 
2007 C  CZ  . PHE A 254 ? 1.0797 1.0709 1.1456 0.0126  0.0000  -0.0370 508 PHE A CZ  
2008 N  N   . GLY A 255 ? 0.9255 0.9046 0.9955 -0.0020 0.0087  -0.0050 509 GLY A N   
2009 C  CA  . GLY A 255 ? 0.8797 0.8583 0.9493 -0.0040 0.0111  0.0011  509 GLY A CA  
2010 C  C   . GLY A 255 ? 0.8748 0.8532 0.9360 -0.0036 0.0148  0.0008  509 GLY A C   
2011 O  O   . GLY A 255 ? 0.8369 0.8152 0.8996 -0.0040 0.0158  0.0035  509 GLY A O   
2012 N  N   . ALA A 256 ? 0.8834 0.8617 0.9367 -0.0026 0.0165  -0.0029 510 ALA A N   
2013 C  CA  . ALA A 256 ? 0.9313 0.9087 0.9762 -0.0018 0.0197  -0.0038 510 ALA A CA  
2014 C  C   . ALA A 256 ? 0.9365 0.9137 0.9839 0.0004  0.0181  -0.0056 510 ALA A C   
2015 O  O   . ALA A 256 ? 0.9836 0.9599 1.0249 0.0009  0.0207  -0.0050 510 ALA A O   
2016 C  CB  . ALA A 256 ? 0.9550 0.9324 0.9922 -0.0013 0.0217  -0.0070 510 ALA A CB  
2017 N  N   . THR A 257 ? 0.8627 0.8409 0.9194 0.0018  0.0138  -0.0079 511 THR A N   
2018 C  CA  . THR A 257 ? 0.7920 0.7706 0.8512 0.0046  0.0116  -0.0110 511 THR A CA  
2019 C  C   . THR A 257 ? 0.8509 0.8292 0.9130 0.0041  0.0123  -0.0081 511 THR A C   
2020 O  O   . THR A 257 ? 0.8597 0.8383 0.9287 0.0018  0.0121  -0.0042 511 THR A O   
2021 C  CB  . THR A 257 ? 0.8083 0.7884 0.8783 0.0062  0.0063  -0.0147 511 THR A CB  
2022 O  OG1 . THR A 257 ? 0.7873 0.7684 0.8553 0.0069  0.0054  -0.0179 511 THR A OG1 
2023 C  CG2 . THR A 257 ? 0.7550 0.7363 0.8272 0.0096  0.0036  -0.0191 511 THR A CG2 
2024 N  N   . ARG A 258 ? 0.7975 0.7756 0.8546 0.0063  0.0131  -0.0099 512 ARG A N   
2025 C  CA  . ARG A 258 ? 0.7416 0.7199 0.8023 0.0064  0.0133  -0.0084 512 ARG A CA  
2026 C  C   . ARG A 258 ? 0.7801 0.7591 0.8418 0.0102  0.0105  -0.0129 512 ARG A C   
2027 O  O   . ARG A 258 ? 0.8649 0.8437 0.9197 0.0128  0.0102  -0.0163 512 ARG A O   
2028 C  CB  . ARG A 258 ? 0.7727 0.7500 0.8251 0.0052  0.0179  -0.0049 512 ARG A CB  
2029 C  CG  . ARG A 258 ? 0.8561 0.8330 0.9047 0.0020  0.0211  -0.0009 512 ARG A CG  
2030 C  CD  . ARG A 258 ? 0.8714 0.8500 0.9283 -0.0004 0.0210  0.0032  512 ARG A CD  
2031 N  NE  . ARG A 258 ? 0.7886 0.7676 0.8413 -0.0029 0.0240  0.0071  512 ARG A NE  
2032 C  CZ  . ARG A 258 ? 0.7853 0.7641 0.8378 -0.0040 0.0234  0.0076  512 ARG A CZ  
2033 N  NH1 . ARG A 258 ? 0.7629 0.7412 0.8187 -0.0030 0.0203  0.0045  512 ARG A NH1 
2034 N  NH2 . ARG A 258 ? 0.8061 0.7857 0.8547 -0.0059 0.0260  0.0110  512 ARG A NH2 
2035 N  N   . GLU A 259 ? 0.7793 0.7595 0.8491 0.0105  0.0089  -0.0127 513 GLU A N   
2036 C  CA  . GLU A 259 ? 0.8753 0.8567 0.9477 0.0141  0.0060  -0.0170 513 GLU A CA  
2037 C  C   . GLU A 259 ? 0.8446 0.8259 0.9159 0.0136  0.0083  -0.0146 513 GLU A C   
2038 O  O   . GLU A 259 ? 0.8244 0.8068 0.9035 0.0110  0.0090  -0.0114 513 GLU A O   
2039 C  CB  . GLU A 259 ? 0.9929 0.9764 1.0801 0.0146  0.0010  -0.0198 513 GLU A CB  
2040 C  CG  . GLU A 259 ? 1.1459 1.1314 1.2415 0.0168  -0.0020 -0.0228 513 GLU A CG  
2041 C  CD  . GLU A 259 ? 1.3189 1.3064 1.4284 0.0182  -0.0076 -0.0274 513 GLU A CD  
2042 O  OE1 . GLU A 259 ? 1.2082 1.1953 1.3258 0.0155  -0.0086 -0.0254 513 GLU A OE1 
2043 O  OE2 . GLU A 259 ? 1.3744 1.3639 1.4868 0.0223  -0.0114 -0.0331 513 GLU A OE2 
2044 N  N   . TYR A 260 ? 0.9222 0.9024 0.9843 0.0164  0.0093  -0.0162 514 TYR A N   
2045 C  CA  . TYR A 260 ? 0.9110 0.8910 0.9709 0.0162  0.0117  -0.0142 514 TYR A CA  
2046 C  C   . TYR A 260 ? 0.8598 0.8411 0.9226 0.0204  0.0083  -0.0185 514 TYR A C   
2047 O  O   . TYR A 260 ? 0.8104 0.7921 0.8723 0.0239  0.0050  -0.0228 514 TYR A O   
2048 C  CB  . TYR A 260 ? 0.9216 0.8984 0.9674 0.0158  0.0161  -0.0117 514 TYR A CB  
2049 C  CG  . TYR A 260 ? 0.8357 0.8117 0.8784 0.0118  0.0197  -0.0076 514 TYR A CG  
2050 C  CD1 . TYR A 260 ? 0.8257 0.8037 0.8755 0.0084  0.0208  -0.0041 514 TYR A CD1 
2051 C  CD2 . TYR A 260 ? 0.8235 0.7970 0.8561 0.0116  0.0220  -0.0073 514 TYR A CD2 
2052 C  CE1 . TYR A 260 ? 0.7981 0.7758 0.8445 0.0053  0.0238  -0.0006 514 TYR A CE1 
2053 C  CE2 . TYR A 260 ? 0.8014 0.7745 0.8316 0.0082  0.0250  -0.0043 514 TYR A CE2 
2054 C  CZ  . TYR A 260 ? 0.8707 0.8459 0.9075 0.0053  0.0256  -0.0011 514 TYR A CZ  
2055 O  OH  . TYR A 260 ? 0.8964 0.8717 0.9305 0.0025  0.0282  0.0018  514 TYR A OH  
2056 N  N   . ASP A 261 ? 0.8545 0.8368 0.9203 0.0202  0.0093  -0.0175 515 ASP A N   
2057 C  CA  . ASP A 261 ? 0.7976 0.7810 0.8649 0.0242  0.0065  -0.0214 515 ASP A CA  
2058 C  C   . ASP A 261 ? 0.8078 0.7887 0.8622 0.0283  0.0063  -0.0235 515 ASP A C   
2059 O  O   . ASP A 261 ? 0.8533 0.8308 0.8964 0.0276  0.0100  -0.0206 515 ASP A O   
2060 C  CB  . ASP A 261 ? 0.9146 0.8991 0.9838 0.0230  0.0090  -0.0192 515 ASP A CB  
2061 C  CG  . ASP A 261 ? 1.0220 1.0093 1.0991 0.0262  0.0055  -0.0233 515 ASP A CG  
2062 O  OD1 . ASP A 261 ? 1.0409 1.0278 1.1145 0.0310  0.0020  -0.0279 515 ASP A OD1 
2063 O  OD2 . ASP A 261 ? 1.2373 1.2277 1.3240 0.0239  0.0064  -0.0220 515 ASP A OD2 
2064 N  N   . ARG A 262 ? 0.8703 0.8526 0.9264 0.0328  0.0019  -0.0285 516 ARG A N   
2065 C  CA  . ARG A 262 ? 0.9100 0.8903 0.9537 0.0376  0.0012  -0.0305 516 ARG A CA  
2066 C  C   . ARG A 262 ? 0.9336 0.9106 0.9675 0.0389  0.0039  -0.0283 516 ARG A C   
2067 O  O   . ARG A 262 ? 0.8789 0.8528 0.9003 0.0416  0.0050  -0.0278 516 ARG A O   
2068 C  CB  . ARG A 262 ? 0.9767 0.9603 1.0254 0.0428  -0.0046 -0.0370 516 ARG A CB  
2069 C  CG  . ARG A 262 ? 1.0579 1.0450 1.1203 0.0436  -0.0081 -0.0401 516 ARG A CG  
2070 C  CD  . ARG A 262 ? 1.1484 1.1391 1.2153 0.0494  -0.0143 -0.0473 516 ARG A CD  
2071 N  NE  . ARG A 262 ? 1.2786 1.2676 1.3304 0.0548  -0.0147 -0.0486 516 ARG A NE  
2072 C  CZ  . ARG A 262 ? 1.2435 1.2328 1.2869 0.0580  -0.0159 -0.0506 516 ARG A CZ  
2073 N  NH1 . ARG A 262 ? 1.3430 1.3347 1.3922 0.0570  -0.0176 -0.0528 516 ARG A NH1 
2074 N  NH2 . ARG A 262 ? 1.1767 1.1641 1.2058 0.0627  -0.0155 -0.0505 516 ARG A NH2 
2075 N  N   . SER A 263 ? 0.8810 0.8591 0.9209 0.0372  0.0049  -0.0271 517 SER A N   
2076 C  CA  . SER A 263 ? 0.8706 0.8459 0.9030 0.0385  0.0071  -0.0255 517 SER A CA  
2077 C  C   . SER A 263 ? 0.8420 0.8127 0.8630 0.0362  0.0119  -0.0211 517 SER A C   
2078 O  O   . SER A 263 ? 0.9379 0.9051 0.9496 0.0387  0.0129  -0.0204 517 SER A O   
2079 C  CB  . SER A 263 ? 0.9275 0.9059 0.9697 0.0364  0.0078  -0.0250 517 SER A CB  
2080 O  OG  . SER A 263 ? 1.0001 0.9793 1.0461 0.0309  0.0114  -0.0209 517 SER A OG  
2081 N  N   . PHE A 264 ? 0.7886 0.7595 0.8111 0.0316  0.0147  -0.0181 518 PHE A N   
2082 C  CA  . PHE A 264 ? 0.7814 0.7483 0.7943 0.0293  0.0190  -0.0146 518 PHE A CA  
2083 C  C   . PHE A 264 ? 0.8029 0.7665 0.8052 0.0319  0.0190  -0.0151 518 PHE A C   
2084 O  O   . PHE A 264 ? 0.7407 0.6999 0.7330 0.0328  0.0215  -0.0132 518 PHE A O   
2085 C  CB  . PHE A 264 ? 0.8057 0.7743 0.8232 0.0242  0.0214  -0.0119 518 PHE A CB  
2086 C  CG  . PHE A 264 ? 0.8180 0.7895 0.8430 0.0213  0.0228  -0.0100 518 PHE A CG  
2087 C  CD1 . PHE A 264 ? 0.8661 0.8364 0.8868 0.0202  0.0261  -0.0080 518 PHE A CD1 
2088 C  CD2 . PHE A 264 ? 0.8727 0.8485 0.9095 0.0195  0.0211  -0.0102 518 PHE A CD2 
2089 C  CE1 . PHE A 264 ? 0.9031 0.8772 0.9302 0.0178  0.0277  -0.0064 518 PHE A CE1 
2090 C  CE2 . PHE A 264 ? 0.9187 0.8978 0.9623 0.0168  0.0229  -0.0080 518 PHE A CE2 
2091 C  CZ  . PHE A 264 ? 0.8826 0.8613 0.9211 0.0160  0.0263  -0.0061 518 PHE A CZ  
2092 N  N   . THR A 265 ? 0.7937 0.7597 0.7987 0.0333  0.0161  -0.0177 519 THR A N   
2093 C  CA  . THR A 265 ? 0.7797 0.7442 0.7760 0.0354  0.0163  -0.0183 519 THR A CA  
2094 C  C   . THR A 265 ? 0.7200 0.6827 0.7084 0.0409  0.0147  -0.0197 519 THR A C   
2095 O  O   . THR A 265 ? 0.7968 0.7563 0.7743 0.0424  0.0167  -0.0181 519 THR A O   
2096 C  CB  . THR A 265 ? 0.8255 0.7940 0.8281 0.0356  0.0133  -0.0214 519 THR A CB  
2097 O  OG1 . THR A 265 ? 0.8796 0.8516 0.8907 0.0386  0.0085  -0.0255 519 THR A OG1 
2098 C  CG2 . THR A 265 ? 0.8804 0.8502 0.8903 0.0306  0.0147  -0.0197 519 THR A CG2 
2099 N  N   . ASP A 266 ? 0.6985 0.6635 0.6926 0.0439  0.0110  -0.0226 520 ASP A N   
2100 C  CA  . ASP A 266 ? 0.7937 0.7571 0.7811 0.0496  0.0088  -0.0242 520 ASP A CA  
2101 C  C   . ASP A 266 ? 0.8654 0.8230 0.8436 0.0491  0.0126  -0.0199 520 ASP A C   
2102 O  O   . ASP A 266 ? 0.8235 0.7773 0.7908 0.0524  0.0133  -0.0185 520 ASP A O   
2103 C  CB  . ASP A 266 ? 0.9000 0.8674 0.8982 0.0519  0.0043  -0.0283 520 ASP A CB  
2104 C  CG  . ASP A 266 ? 1.0036 0.9766 1.0102 0.0545  -0.0010 -0.0339 520 ASP A CG  
2105 O  OD1 . ASP A 266 ? 1.0687 1.0427 1.0710 0.0559  -0.0016 -0.0351 520 ASP A OD1 
2106 O  OD2 . ASP A 266 ? 1.1379 1.1149 1.1564 0.0554  -0.0046 -0.0376 520 ASP A OD2 
2107 N  N   . LEU A 267 ? 0.8641 0.8208 0.8466 0.0450  0.0152  -0.0177 521 LEU A N   
2108 C  CA  . LEU A 267 ? 0.8298 0.7812 0.8050 0.0443  0.0187  -0.0143 521 LEU A CA  
2109 C  C   . LEU A 267 ? 0.8186 0.7660 0.7855 0.0416  0.0229  -0.0107 521 LEU A C   
2110 O  O   . LEU A 267 ? 0.7294 0.6716 0.6876 0.0429  0.0250  -0.0082 521 LEU A O   
2111 C  CB  . LEU A 267 ? 0.8302 0.7830 0.8129 0.0410  0.0201  -0.0137 521 LEU A CB  
2112 C  CG  . LEU A 267 ? 0.7939 0.7499 0.7840 0.0435  0.0168  -0.0167 521 LEU A CG  
2113 C  CD1 . LEU A 267 ? 0.8153 0.7746 0.8142 0.0393  0.0187  -0.0160 521 LEU A CD1 
2114 C  CD2 . LEU A 267 ? 0.7630 0.7151 0.7462 0.0483  0.0155  -0.0172 521 LEU A CD2 
2115 N  N   . TYR A 268 ? 0.7687 0.7187 0.7390 0.0381  0.0241  -0.0106 522 TYR A N   
2116 C  CA  . TYR A 268 ? 0.7063 0.6534 0.6703 0.0352  0.0282  -0.0077 522 TYR A CA  
2117 C  C   . TYR A 268 ? 0.7250 0.6699 0.6793 0.0388  0.0282  -0.0073 522 TYR A C   
2118 O  O   . TYR A 268 ? 0.7829 0.7234 0.7295 0.0380  0.0318  -0.0041 522 TYR A O   
2119 C  CB  . TYR A 268 ? 0.7234 0.6743 0.6943 0.0308  0.0288  -0.0082 522 TYR A CB  
2120 C  CG  . TYR A 268 ? 0.7039 0.6523 0.6703 0.0272  0.0332  -0.0055 522 TYR A CG  
2121 C  CD1 . TYR A 268 ? 0.7274 0.6731 0.6934 0.0242  0.0363  -0.0032 522 TYR A CD1 
2122 C  CD2 . TYR A 268 ? 0.6794 0.6283 0.6420 0.0270  0.0342  -0.0056 522 TYR A CD2 
2123 C  CE1 . TYR A 268 ? 0.7479 0.6911 0.7103 0.0211  0.0401  -0.0012 522 TYR A CE1 
2124 C  CE2 . TYR A 268 ? 0.7705 0.7170 0.7293 0.0236  0.0384  -0.0033 522 TYR A CE2 
2125 C  CZ  . TYR A 268 ? 0.7444 0.6880 0.7036 0.0206  0.0412  -0.0012 522 TYR A CZ  
2126 O  OH  . TYR A 268 ? 0.8573 0.7986 0.8138 0.0174  0.0451  0.0005  522 TYR A OH  
2127 N  N   . ILE A 269 ? 0.7656 0.7141 0.7204 0.0429  0.0244  -0.0105 523 ILE A N   
2128 C  CA  . ILE A 269 ? 0.7978 0.7451 0.7422 0.0474  0.0241  -0.0102 523 ILE A CA  
2129 C  C   . ILE A 269 ? 0.7378 0.6788 0.6731 0.0502  0.0255  -0.0070 523 ILE A C   
2130 O  O   . ILE A 269 ? 0.7083 0.6454 0.6342 0.0507  0.0287  -0.0035 523 ILE A O   
2131 C  CB  . ILE A 269 ? 0.8458 0.7989 0.7931 0.0521  0.0189  -0.0153 523 ILE A CB  
2132 C  CG1 . ILE A 269 ? 0.9552 0.9094 0.8928 0.0559  0.0191  -0.0154 523 ILE A CG1 
2133 C  CG2 . ILE A 269 ? 0.8492 0.8030 0.7980 0.0571  0.0145  -0.0179 523 ILE A CG2 
2134 C  CD1 . ILE A 269 ? 1.0337 0.9903 0.9716 0.0527  0.0216  -0.0154 523 ILE A CD1 
2135 N  N   . GLN A 270 ? 0.7516 0.6917 0.6905 0.0516  0.0234  -0.0078 524 GLN A N   
2136 C  CA  . GLN A 270 ? 0.7477 0.6818 0.6794 0.0544  0.0240  -0.0052 524 GLN A CA  
2137 C  C   . GLN A 270 ? 0.8424 0.7708 0.7710 0.0501  0.0291  -0.0007 524 GLN A C   
2138 O  O   . GLN A 270 ? 0.8360 0.7581 0.7555 0.0517  0.0313  0.0031  524 GLN A O   
2139 C  CB  . GLN A 270 ? 0.7997 0.7352 0.7384 0.0563  0.0204  -0.0080 524 GLN A CB  
2140 C  CG  . GLN A 270 ? 0.8628 0.8041 0.8058 0.0610  0.0149  -0.0131 524 GLN A CG  
2141 C  CD  . GLN A 270 ? 0.9193 0.8622 0.8696 0.0629  0.0115  -0.0160 524 GLN A CD  
2142 O  OE1 . GLN A 270 ? 0.9799 0.9189 0.9253 0.0663  0.0107  -0.0151 524 GLN A OE1 
2143 N  NE2 . GLN A 270 ? 0.9336 0.8824 0.8959 0.0611  0.0093  -0.0196 524 GLN A NE2 
2144 N  N   . ILE A 271 ? 0.7610 0.6912 0.6968 0.0446  0.0312  -0.0009 525 ILE A N   
2145 C  CA  . ILE A 271 ? 0.8301 0.7554 0.7637 0.0405  0.0359  0.0026  525 ILE A CA  
2146 C  C   . ILE A 271 ? 0.8046 0.7271 0.7302 0.0401  0.0392  0.0055  525 ILE A C   
2147 O  O   . ILE A 271 ? 0.7989 0.7152 0.7186 0.0398  0.0421  0.0092  525 ILE A O   
2148 C  CB  . ILE A 271 ? 0.8136 0.7420 0.7559 0.0349  0.0376  0.0017  525 ILE A CB  
2149 C  CG1 . ILE A 271 ? 0.7670 0.6974 0.7161 0.0354  0.0353  -0.0003 525 ILE A CG1 
2150 C  CG2 . ILE A 271 ? 0.7381 0.6621 0.6778 0.0309  0.0423  0.0047  525 ILE A CG2 
2151 C  CD1 . ILE A 271 ? 0.7910 0.7260 0.7486 0.0310  0.0361  -0.0013 525 ILE A CD1 
2152 N  N   . ILE A 272 ? 0.7896 0.7170 0.7158 0.0398  0.0387  0.0040  526 ILE A N   
2153 C  CA  . ILE A 272 ? 0.7738 0.7001 0.6936 0.0386  0.0423  0.0064  526 ILE A CA  
2154 C  C   . ILE A 272 ? 0.8116 0.7349 0.7207 0.0439  0.0421  0.0088  526 ILE A C   
2155 O  O   . ILE A 272 ? 0.7740 0.6927 0.6764 0.0431  0.0462  0.0130  526 ILE A O   
2156 C  CB  . ILE A 272 ? 0.7942 0.7270 0.7180 0.0371  0.0416  0.0035  526 ILE A CB  
2157 C  CG1 . ILE A 272 ? 0.8388 0.7748 0.7730 0.0325  0.0412  0.0015  526 ILE A CG1 
2158 C  CG2 . ILE A 272 ? 0.7767 0.7088 0.6945 0.0357  0.0458  0.0060  526 ILE A CG2 
2159 C  CD1 . ILE A 272 ? 0.8297 0.7625 0.7650 0.0274  0.0456  0.0039  526 ILE A CD1 
2160 N  N   . ARG A 273 ? 0.7851 0.7112 0.6929 0.0493  0.0375  0.0061  527 ARG A N   
2161 C  CA  . ARG A 273 ? 0.8845 0.8075 0.7818 0.0553  0.0366  0.0084  527 ARG A CA  
2162 C  C   . ARG A 273 ? 0.8264 0.7409 0.7191 0.0549  0.0393  0.0133  527 ARG A C   
2163 O  O   . ARG A 273 ? 0.8158 0.7261 0.6999 0.0556  0.0426  0.0179  527 ARG A O   
2164 C  CB  . ARG A 273 ? 0.8850 0.8115 0.7833 0.0614  0.0304  0.0042  527 ARG A CB  
2165 C  CG  . ARG A 273 ? 0.9361 0.8599 0.8231 0.0684  0.0288  0.0063  527 ARG A CG  
2166 C  CD  . ARG A 273 ? 0.9199 0.8475 0.7981 0.0717  0.0293  0.0067  527 ARG A CD  
2167 N  NE  . ARG A 273 ? 0.9665 0.8896 0.8368 0.0690  0.0356  0.0129  527 ARG A NE  
2168 C  CZ  . ARG A 273 ? 0.9466 0.8733 0.8109 0.0694  0.0382  0.0140  527 ARG A CZ  
2169 N  NH1 . ARG A 273 ? 0.9421 0.8770 0.8071 0.0725  0.0349  0.0089  527 ARG A NH1 
2170 N  NH2 . ARG A 273 ? 0.9858 0.9080 0.8442 0.0665  0.0442  0.0199  527 ARG A NH2 
2171 N  N   . ALA A 274 ? 0.8142 0.7263 0.7132 0.0534  0.0382  0.0124  528 ALA A N   
2172 C  CA  . ALA A 274 ? 0.8172 0.7211 0.7129 0.0537  0.0399  0.0162  528 ALA A CA  
2173 C  C   . ALA A 274 ? 0.8795 0.7786 0.7737 0.0488  0.0455  0.0204  528 ALA A C   
2174 O  O   . ALA A 274 ? 0.9198 0.8114 0.8080 0.0497  0.0477  0.0250  528 ALA A O   
2175 C  CB  . ALA A 274 ? 0.8282 0.7319 0.7320 0.0529  0.0375  0.0134  528 ALA A CB  
2176 N  N   . ALA A 275 ? 0.8513 0.7545 0.7516 0.0436  0.0476  0.0187  529 ALA A N   
2177 C  CA  . ALA A 275 ? 0.8296 0.7294 0.7295 0.0388  0.0529  0.0219  529 ALA A CA  
2178 C  C   . ALA A 275 ? 0.8571 0.7561 0.7485 0.0396  0.0562  0.0256  529 ALA A C   
2179 O  O   . ALA A 275 ? 0.8106 0.7043 0.6994 0.0370  0.0608  0.0299  529 ALA A O   
2180 C  CB  . ALA A 275 ? 0.7730 0.6779 0.6816 0.0335  0.0538  0.0187  529 ALA A CB  
2181 N  N   . ALA A 276 ? 0.9333 0.8382 0.8212 0.0429  0.0541  0.0237  530 ALA A N   
2182 C  CA  . ALA A 276 ? 0.9718 0.8772 0.8507 0.0447  0.0569  0.0270  530 ALA A CA  
2183 C  C   . ALA A 276 ? 1.0727 0.9707 0.9419 0.0490  0.0576  0.0325  530 ALA A C   
2184 O  O   . ALA A 276 ? 1.1374 1.0317 1.0002 0.0483  0.0622  0.0378  530 ALA A O   
2185 C  CB  . ALA A 276 ? 0.9408 0.8548 0.8184 0.0484  0.0534  0.0228  530 ALA A CB  
2186 N  N   . ASP A 277 ? 1.0096 0.9054 0.8789 0.0530  0.0531  0.0312  531 ASP A N   
2187 C  CA  . ASP A 277 ? 1.0218 0.9102 0.8831 0.0575  0.0526  0.0357  531 ASP A CA  
2188 C  C   . ASP A 277 ? 1.0232 0.9027 0.8877 0.0545  0.0548  0.0389  531 ASP A C   
2189 O  O   . ASP A 277 ? 1.1045 0.9776 0.9644 0.0583  0.0534  0.0418  531 ASP A O   
2190 C  CB  . ASP A 277 ? 0.9843 0.8755 0.8448 0.0639  0.0461  0.0318  531 ASP A CB  
2191 C  CG  . ASP A 277 ? 0.9983 0.8983 0.8560 0.0676  0.0432  0.0280  531 ASP A CG  
2192 O  OD1 . ASP A 277 ? 0.9113 0.8140 0.7643 0.0666  0.0466  0.0299  531 ASP A OD1 
2193 O  OD2 . ASP A 277 ? 1.0184 0.9231 0.8799 0.0712  0.0376  0.0227  531 ASP A OD2 
2194 N  N   . ARG A 278 ? 1.0069 0.8862 0.8797 0.0481  0.0578  0.0379  532 ARG A N   
2195 C  CA  . ARG A 278 ? 1.0131 0.8844 0.8894 0.0449  0.0603  0.0406  532 ARG A CA  
2196 C  C   . ARG A 278 ? 0.9906 0.8581 0.8696 0.0479  0.0561  0.0389  532 ARG A C   
2197 O  O   . ARG A 278 ? 1.0903 0.9498 0.9695 0.0475  0.0573  0.0420  532 ARG A O   
2198 C  CB  . ARG A 278 ? 1.1334 0.9974 1.0023 0.0447  0.0651  0.0480  532 ARG A CB  
2199 C  CG  . ARG A 278 ? 1.1267 0.9951 0.9903 0.0435  0.0690  0.0503  532 ARG A CG  
2200 C  CD  . ARG A 278 ? 1.1542 1.0297 1.0255 0.0380  0.0709  0.0461  532 ARG A CD  
2201 N  NE  . ARG A 278 ? 1.1924 1.0638 1.0710 0.0317  0.0751  0.0471  532 ARG A NE  
2202 C  CZ  . ARG A 278 ? 1.2132 1.0884 1.1016 0.0270  0.0750  0.0424  532 ARG A CZ  
2203 N  NH1 . ARG A 278 ? 1.1569 1.0398 1.0495 0.0274  0.0712  0.0367  532 ARG A NH1 
2204 N  NH2 . ARG A 278 ? 1.1600 1.0313 1.0545 0.0219  0.0786  0.0433  532 ARG A NH2 
2205 N  N   . ASP A 279 ? 0.9943 0.8679 0.8763 0.0507  0.0511  0.0337  533 ASP A N   
2206 C  CA  . ASP A 279 ? 1.0443 0.9162 0.9301 0.0536  0.0468  0.0309  533 ASP A CA  
2207 C  C   . ASP A 279 ? 1.0314 0.9071 0.9287 0.0491  0.0464  0.0261  533 ASP A C   
2208 O  O   . ASP A 279 ? 1.0638 0.9472 0.9665 0.0490  0.0437  0.0213  533 ASP A O   
2209 C  CB  . ASP A 279 ? 1.0146 0.8909 0.8963 0.0601  0.0417  0.0284  533 ASP A CB  
2210 C  CG  . ASP A 279 ? 1.0442 0.9212 0.9312 0.0630  0.0370  0.0244  533 ASP A CG  
2211 O  OD1 . ASP A 279 ? 1.0910 0.9649 0.9841 0.0606  0.0375  0.0236  533 ASP A OD1 
2212 O  OD2 . ASP A 279 ? 1.0061 0.8874 0.8917 0.0679  0.0325  0.0214  533 ASP A OD2 
2213 N  N   . ARG A 280 ? 0.9849 0.8551 0.8859 0.0458  0.0490  0.0274  534 ARG A N   
2214 C  CA  . ARG A 280 ? 0.9762 0.8495 0.8870 0.0414  0.0495  0.0234  534 ARG A CA  
2215 C  C   . ARG A 280 ? 0.9262 0.8039 0.8423 0.0439  0.0451  0.0188  534 ARG A C   
2216 O  O   . ARG A 280 ? 0.8379 0.7222 0.7612 0.0410  0.0447  0.0149  534 ARG A O   
2217 C  CB  . ARG A 280 ? 0.9695 0.8356 0.8831 0.0380  0.0528  0.0256  534 ARG A CB  
2218 C  CG  . ARG A 280 ? 1.0296 0.8978 0.9523 0.0357  0.0521  0.0212  534 ARG A CG  
2219 C  CD  . ARG A 280 ? 0.9842 0.8462 0.9109 0.0324  0.0549  0.0220  534 ARG A CD  
2220 N  NE  . ARG A 280 ? 0.9078 0.7705 0.8349 0.0278  0.0590  0.0236  534 ARG A NE  
2221 C  CZ  . ARG A 280 ? 0.9321 0.7981 0.8658 0.0231  0.0611  0.0209  534 ARG A CZ  
2222 N  NH1 . ARG A 280 ? 1.0286 0.8977 0.9692 0.0222  0.0597  0.0164  534 ARG A NH1 
2223 N  NH2 . ARG A 280 ? 0.9579 0.8244 0.8911 0.0195  0.0647  0.0228  534 ARG A NH2 
2224 N  N   . GLU A 281 ? 0.9336 0.8076 0.8461 0.0492  0.0419  0.0193  535 GLU A N   
2225 C  CA  . GLU A 281 ? 0.9972 0.8751 0.9146 0.0523  0.0375  0.0148  535 GLU A CA  
2226 C  C   . GLU A 281 ? 0.9144 0.8011 0.8338 0.0536  0.0348  0.0114  535 GLU A C   
2227 O  O   . GLU A 281 ? 0.9330 0.8258 0.8600 0.0529  0.0329  0.0072  535 GLU A O   
2228 C  CB  . GLU A 281 ? 1.0196 0.8909 0.9323 0.0583  0.0344  0.0161  535 GLU A CB  
2229 C  CG  . GLU A 281 ? 1.1471 1.0095 1.0602 0.0574  0.0362  0.0186  535 GLU A CG  
2230 C  CD  . GLU A 281 ? 1.2445 1.1099 1.1675 0.0539  0.0367  0.0143  535 GLU A CD  
2231 O  OE1 . GLU A 281 ? 1.1077 0.9783 1.0359 0.0560  0.0335  0.0097  535 GLU A OE1 
2232 O  OE2 . GLU A 281 ? 1.2558 1.1189 1.1816 0.0492  0.0404  0.0152  535 GLU A OE2 
2233 N  N   . THR A 282 ? 0.8569 0.7447 0.7700 0.0555  0.0345  0.0130  536 THR A N   
2234 C  CA  . THR A 282 ? 0.9007 0.7970 0.8173 0.0561  0.0319  0.0093  536 THR A CA  
2235 C  C   . THR A 282 ? 0.8130 0.7151 0.7369 0.0499  0.0344  0.0077  536 THR A C   
2236 O  O   . THR A 282 ? 0.7657 0.6746 0.6975 0.0489  0.0325  0.0039  536 THR A O   
2237 C  CB  . THR A 282 ? 0.9282 0.8249 0.8365 0.0606  0.0303  0.0106  536 THR A CB  
2238 O  OG1 . THR A 282 ? 0.9995 0.8913 0.9022 0.0665  0.0274  0.0117  536 THR A OG1 
2239 C  CG2 . THR A 282 ? 0.9133 0.8188 0.8265 0.0617  0.0269  0.0060  536 THR A CG2 
2240 N  N   . VAL A 283 ? 0.8511 0.7503 0.7732 0.0457  0.0388  0.0106  537 VAL A N   
2241 C  CA  . VAL A 283 ? 0.8145 0.7187 0.7427 0.0402  0.0411  0.0093  537 VAL A CA  
2242 C  C   . VAL A 283 ? 0.7894 0.6970 0.7260 0.0378  0.0407  0.0064  537 VAL A C   
2243 O  O   . VAL A 283 ? 0.8273 0.7417 0.7700 0.0360  0.0397  0.0039  537 VAL A O   
2244 C  CB  . VAL A 283 ? 0.8251 0.7251 0.7498 0.0366  0.0457  0.0127  537 VAL A CB  
2245 C  CG1 . VAL A 283 ? 0.8278 0.7323 0.7590 0.0312  0.0479  0.0111  537 VAL A CG1 
2246 C  CG2 . VAL A 283 ? 0.8065 0.7066 0.7239 0.0386  0.0461  0.0147  537 VAL A CG2 
2247 N  N   . ARG A 284 ? 0.7878 0.6909 0.7247 0.0385  0.0410  0.0067  538 ARG A N   
2248 C  CA  . ARG A 284 ? 0.6894 0.5955 0.6334 0.0370  0.0407  0.0039  538 ARG A CA  
2249 C  C   . ARG A 284 ? 0.7186 0.6308 0.6675 0.0395  0.0370  0.0006  538 ARG A C   
2250 O  O   . ARG A 284 ? 0.6962 0.6152 0.6524 0.0370  0.0371  -0.0017 538 ARG A O   
2251 C  CB  . ARG A 284 ? 0.8271 0.7259 0.7697 0.0380  0.0415  0.0049  538 ARG A CB  
2252 C  CG  . ARG A 284 ? 0.8597 0.7617 0.8091 0.0377  0.0407  0.0014  538 ARG A CG  
2253 C  CD  . ARG A 284 ? 0.9558 0.8510 0.9049 0.0385  0.0413  0.0017  538 ARG A CD  
2254 N  NE  . ARG A 284 ? 0.9609 0.8616 0.9172 0.0378  0.0406  -0.0025 538 ARG A NE  
2255 C  CZ  . ARG A 284 ? 0.8969 0.8011 0.8564 0.0410  0.0377  -0.0054 538 ARG A CZ  
2256 N  NH1 . ARG A 284 ? 0.8723 0.7746 0.8287 0.0454  0.0347  -0.0049 538 ARG A NH1 
2257 N  NH2 . ARG A 284 ? 0.9421 0.8525 0.9081 0.0398  0.0379  -0.0089 538 ARG A NH2 
2258 N  N   . ALA A 285 ? 0.7369 0.6472 0.6824 0.0446  0.0338  0.0004  539 ALA A N   
2259 C  CA  . ALA A 285 ? 0.7641 0.6800 0.7152 0.0476  0.0299  -0.0034 539 ALA A CA  
2260 C  C   . ALA A 285 ? 0.7597 0.6832 0.7160 0.0460  0.0289  -0.0051 539 ALA A C   
2261 O  O   . ALA A 285 ? 0.7999 0.7298 0.7645 0.0450  0.0278  -0.0078 539 ALA A O   
2262 C  CB  . ALA A 285 ? 0.7340 0.6461 0.6799 0.0537  0.0264  -0.0035 539 ALA A CB  
2263 N  N   . LYS A 286 ? 0.7433 0.6663 0.6952 0.0458  0.0293  -0.0036 540 LYS A N   
2264 C  CA  . LYS A 286 ? 0.7298 0.6594 0.6869 0.0441  0.0283  -0.0052 540 LYS A CA  
2265 C  C   . LYS A 286 ? 0.7501 0.6832 0.7128 0.0384  0.0312  -0.0048 540 LYS A C   
2266 O  O   . LYS A 286 ? 0.7272 0.6667 0.6980 0.0367  0.0301  -0.0066 540 LYS A O   
2267 C  CB  . LYS A 286 ? 0.8235 0.7519 0.7742 0.0461  0.0275  -0.0043 540 LYS A CB  
2268 C  CG  . LYS A 286 ? 0.8278 0.7554 0.7746 0.0525  0.0234  -0.0058 540 LYS A CG  
2269 C  CD  . LYS A 286 ? 0.9501 0.8838 0.9061 0.0542  0.0195  -0.0102 540 LYS A CD  
2270 C  CE  . LYS A 286 ? 1.0295 0.9658 0.9845 0.0597  0.0148  -0.0132 540 LYS A CE  
2271 N  NZ  . LYS A 286 ? 1.0010 0.9356 0.9540 0.0654  0.0113  -0.0150 540 LYS A NZ  
2272 N  N   . SER A 287 ? 0.7223 0.6516 0.6818 0.0354  0.0348  -0.0025 541 SER A N   
2273 C  CA  . SER A 287 ? 0.6677 0.6005 0.6322 0.0305  0.0375  -0.0023 541 SER A CA  
2274 C  C   . SER A 287 ? 0.6669 0.6047 0.6388 0.0299  0.0369  -0.0043 541 SER A C   
2275 O  O   . SER A 287 ? 0.6735 0.6169 0.6513 0.0267  0.0377  -0.0046 541 SER A O   
2276 C  CB  . SER A 287 ? 0.6482 0.5758 0.6081 0.0280  0.0411  -0.0002 541 SER A CB  
2277 O  OG  . SER A 287 ? 0.6816 0.6060 0.6358 0.0276  0.0424  0.0019  541 SER A OG  
2278 N  N   . ILE A 288 ? 0.6712 0.6071 0.6427 0.0331  0.0355  -0.0056 542 ILE A N   
2279 C  CA  . ILE A 288 ? 0.6284 0.5696 0.6071 0.0331  0.0348  -0.0079 542 ILE A CA  
2280 C  C   . ILE A 288 ? 0.6705 0.6176 0.6555 0.0344  0.0320  -0.0097 542 ILE A C   
2281 O  O   . ILE A 288 ? 0.6888 0.6424 0.6812 0.0319  0.0326  -0.0104 542 ILE A O   
2282 C  CB  . ILE A 288 ? 0.6668 0.6039 0.6433 0.0366  0.0339  -0.0092 542 ILE A CB  
2283 C  CG1 . ILE A 288 ? 0.6948 0.6267 0.6673 0.0348  0.0368  -0.0078 542 ILE A CG1 
2284 C  CG2 . ILE A 288 ? 0.5869 0.5302 0.5709 0.0378  0.0325  -0.0123 542 ILE A CG2 
2285 C  CD1 . ILE A 288 ? 0.7405 0.6652 0.7089 0.0387  0.0355  -0.0080 542 ILE A CD1 
2286 N  N   . GLU A 289 ? 0.7298 0.6747 0.7121 0.0381  0.0289  -0.0105 543 GLU A N   
2287 C  CA  . GLU A 289 ? 0.7678 0.7183 0.7573 0.0395  0.0258  -0.0129 543 GLU A CA  
2288 C  C   . GLU A 289 ? 0.7481 0.7034 0.7432 0.0354  0.0267  -0.0121 543 GLU A C   
2289 O  O   . GLU A 289 ? 0.7471 0.7084 0.7513 0.0343  0.0257  -0.0134 543 GLU A O   
2290 C  CB  . GLU A 289 ? 0.7918 0.7392 0.7763 0.0446  0.0222  -0.0141 543 GLU A CB  
2291 C  CG  . GLU A 289 ? 0.8531 0.8063 0.8460 0.0469  0.0182  -0.0178 543 GLU A CG  
2292 C  CD  . GLU A 289 ? 0.9459 0.8971 0.9340 0.0526  0.0140  -0.0197 543 GLU A CD  
2293 O  OE1 . GLU A 289 ? 0.8865 0.8314 0.8637 0.0553  0.0143  -0.0177 543 GLU A OE1 
2294 O  OE2 . GLU A 289 ? 0.8408 0.7972 0.8366 0.0543  0.0104  -0.0233 543 GLU A OE2 
2295 N  N   . MSE A 290 ? 0.7499 0.7025 0.7399 0.0330  0.0288  -0.0097 544 MSE A N   
2296 C  CA  . MSE A 290 ? 0.7658 0.7221 0.7604 0.0292  0.0297  -0.0087 544 MSE A CA  
2297 C  C   . MSE A 290 ? 0.7049 0.6653 0.7047 0.0251  0.0325  -0.0074 544 MSE A C   
2298 O  O   . MSE A 290 ? 0.7825 0.7468 0.7878 0.0222  0.0329  -0.0065 544 MSE A O   
2299 C  CB  . MSE A 290 ? 0.7969 0.7492 0.7842 0.0282  0.0311  -0.0070 544 MSE A CB  
2300 C  CG  . MSE A 290 ? 0.8224 0.7783 0.8145 0.0269  0.0295  -0.0075 544 MSE A CG  
2301 SE SE  . MSE A 290 ? 0.8273 0.7790 0.8103 0.0259  0.0315  -0.0058 544 MSE A SE  
2302 C  CE  . MSE A 290 ? 0.8202 0.7684 0.7986 0.0220  0.0367  -0.0029 544 MSE A CE  
2303 N  N   . LYS A 291 ? 0.7203 0.6797 0.7181 0.0251  0.0343  -0.0074 545 LYS A N   
2304 C  CA  . LYS A 291 ? 0.6732 0.6368 0.6745 0.0221  0.0370  -0.0066 545 LYS A CA  
2305 C  C   . LYS A 291 ? 0.6353 0.5977 0.6329 0.0188  0.0398  -0.0045 545 LYS A C   
2306 O  O   . LYS A 291 ? 0.6536 0.6205 0.6542 0.0162  0.0419  -0.0037 545 LYS A O   
2307 C  CB  . LYS A 291 ? 0.7288 0.7001 0.7398 0.0205  0.0368  -0.0066 545 LYS A CB  
2308 C  CG  . LYS A 291 ? 0.8450 0.8191 0.8621 0.0234  0.0341  -0.0092 545 LYS A CG  
2309 C  CD  . LYS A 291 ? 0.9260 0.9078 0.9538 0.0207  0.0345  -0.0084 545 LYS A CD  
2310 C  CE  . LYS A 291 ? 0.9736 0.9584 1.0099 0.0228  0.0312  -0.0109 545 LYS A CE  
2311 N  NZ  . LYS A 291 ? 0.9824 0.9670 1.0180 0.0264  0.0301  -0.0139 545 LYS A NZ  
2312 N  N   . PHE A 292 ? 0.6594 0.6160 0.6502 0.0191  0.0402  -0.0038 546 PHE A N   
2313 C  CA  . PHE A 292 ? 0.6952 0.6501 0.6823 0.0162  0.0431  -0.0024 546 PHE A CA  
2314 C  C   . PHE A 292 ? 0.6713 0.6249 0.6566 0.0164  0.0449  -0.0033 546 PHE A C   
2315 O  O   . PHE A 292 ? 0.7497 0.7064 0.7363 0.0141  0.0469  -0.0032 546 PHE A O   
2316 C  CB  . PHE A 292 ? 0.6902 0.6394 0.6711 0.0162  0.0436  -0.0015 546 PHE A CB  
2317 C  CG  . PHE A 292 ? 0.6755 0.6246 0.6549 0.0128  0.0461  -0.0005 546 PHE A CG  
2318 C  CD1 . PHE A 292 ? 0.7363 0.6902 0.7199 0.0102  0.0462  0.0002  546 PHE A CD1 
2319 C  CD2 . PHE A 292 ? 0.7096 0.6539 0.6843 0.0122  0.0483  -0.0002 546 PHE A CD2 
2320 C  CE1 . PHE A 292 ? 0.6802 0.6344 0.6627 0.0073  0.0481  0.0007  546 PHE A CE1 
2321 C  CE2 . PHE A 292 ? 0.6944 0.6390 0.6686 0.0091  0.0505  0.0002  546 PHE A CE2 
2322 C  CZ  . PHE A 292 ? 0.7409 0.6905 0.7187 0.0068  0.0502  0.0005  546 PHE A CZ  
2323 N  N   . LEU A 293 ? 0.7521 0.7006 0.7339 0.0195  0.0440  -0.0041 547 LEU A N   
2324 C  CA  . LEU A 293 ? 0.7472 0.6938 0.7282 0.0207  0.0447  -0.0056 547 LEU A CA  
2325 C  C   . LEU A 293 ? 0.6895 0.6409 0.6756 0.0229  0.0431  -0.0077 547 LEU A C   
2326 O  O   . LEU A 293 ? 0.7664 0.7192 0.7548 0.0248  0.0407  -0.0080 547 LEU A O   
2327 C  CB  . LEU A 293 ? 0.6937 0.6314 0.6683 0.0232  0.0444  -0.0050 547 LEU A CB  
2328 C  CG  . LEU A 293 ? 0.7101 0.6425 0.6798 0.0212  0.0465  -0.0030 547 LEU A CG  
2329 C  CD1 . LEU A 293 ? 0.7739 0.6978 0.7382 0.0237  0.0464  -0.0019 547 LEU A CD1 
2330 C  CD2 . LEU A 293 ? 0.7007 0.6353 0.6724 0.0178  0.0490  -0.0036 547 LEU A CD2 
2331 N  N   . THR A 294 ? 0.6863 0.6405 0.6745 0.0228  0.0443  -0.0094 548 THR A N   
2332 C  CA  . THR A 294 ? 0.7112 0.6702 0.7041 0.0249  0.0432  -0.0119 548 THR A CA  
2333 C  C   . THR A 294 ? 0.7373 0.6901 0.7276 0.0290  0.0412  -0.0137 548 THR A C   
2334 O  O   . THR A 294 ? 0.7476 0.7031 0.7415 0.0317  0.0392  -0.0157 548 THR A O   
2335 C  CB  . THR A 294 ? 0.6762 0.6416 0.6722 0.0233  0.0455  -0.0134 548 THR A CB  
2336 O  OG1 . THR A 294 ? 0.6925 0.6530 0.6848 0.0236  0.0464  -0.0147 548 THR A OG1 
2337 C  CG2 . THR A 294 ? 0.6691 0.6407 0.6671 0.0195  0.0476  -0.0113 548 THR A CG2 
2338 N  N   . GLY A 295 ? 0.7034 0.6478 0.6879 0.0296  0.0415  -0.0127 549 GLY A N   
2339 C  CA  . GLY A 295 ? 0.7234 0.6614 0.7053 0.0334  0.0397  -0.0138 549 GLY A CA  
2340 C  C   . GLY A 295 ? 0.7542 0.6923 0.7379 0.0332  0.0409  -0.0163 549 GLY A C   
2341 O  O   . GLY A 295 ? 0.7600 0.6924 0.7424 0.0362  0.0395  -0.0174 549 GLY A O   
2342 N  N   . TYR A 296 ? 0.6853 0.6300 0.6722 0.0302  0.0432  -0.0174 550 TYR A N   
2343 C  CA  . TYR A 296 ? 0.7283 0.6740 0.7172 0.0306  0.0440  -0.0206 550 TYR A CA  
2344 C  C   . TYR A 296 ? 0.6975 0.6439 0.6856 0.0272  0.0466  -0.0204 550 TYR A C   
2345 O  O   . TYR A 296 ? 0.7332 0.6844 0.7242 0.0269  0.0474  -0.0235 550 TYR A O   
2346 C  CB  . TYR A 296 ? 0.6545 0.6095 0.6492 0.0321  0.0435  -0.0243 550 TYR A CB  
2347 C  CG  . TYR A 296 ? 0.6800 0.6458 0.6787 0.0299  0.0451  -0.0239 550 TYR A CG  
2348 C  CD1 . TYR A 296 ? 0.6873 0.6601 0.6872 0.0273  0.0476  -0.0246 550 TYR A CD1 
2349 C  CD2 . TYR A 296 ? 0.7431 0.7125 0.7446 0.0304  0.0439  -0.0228 550 TYR A CD2 
2350 C  CE1 . TYR A 296 ? 0.6654 0.6483 0.6689 0.0254  0.0492  -0.0235 550 TYR A CE1 
2351 C  CE2 . TYR A 296 ? 0.6796 0.6585 0.6856 0.0282  0.0454  -0.0219 550 TYR A CE2 
2352 C  CZ  . TYR A 296 ? 0.6893 0.6745 0.6959 0.0257  0.0481  -0.0219 550 TYR A CZ  
2353 O  OH  . TYR A 296 ? 0.7539 0.7482 0.7650 0.0237  0.0496  -0.0202 550 TYR A OH  
2354 N  N   . GLU A 297 ? 0.7965 0.7389 0.7810 0.0247  0.0477  -0.0171 551 GLU A N   
2355 C  CA  . GLU A 297 ? 0.8235 0.7651 0.8072 0.0216  0.0499  -0.0170 551 GLU A CA  
2356 C  C   . GLU A 297 ? 0.7738 0.7082 0.7573 0.0228  0.0498  -0.0189 551 GLU A C   
2357 O  O   . GLU A 297 ? 0.7944 0.7218 0.7765 0.0256  0.0482  -0.0186 551 GLU A O   
2358 C  CB  . GLU A 297 ? 0.8188 0.7568 0.7988 0.0193  0.0508  -0.0132 551 GLU A CB  
2359 C  CG  . GLU A 297 ? 0.8341 0.7795 0.8155 0.0171  0.0513  -0.0117 551 GLU A CG  
2360 C  CD  . GLU A 297 ? 0.8708 0.8183 0.8529 0.0187  0.0494  -0.0103 551 GLU A CD  
2361 O  OE1 . GLU A 297 ? 0.8064 0.7483 0.7862 0.0214  0.0476  -0.0097 551 GLU A OE1 
2362 O  OE2 . GLU A 297 ? 0.8504 0.8054 0.8360 0.0173  0.0496  -0.0098 551 GLU A OE2 
2363 N  N   . VAL A 298 ? 0.7794 0.7154 0.7647 0.0208  0.0513  -0.0211 552 VAL A N   
2364 C  CA  . VAL A 298 ? 0.8737 0.8019 0.8597 0.0209  0.0516  -0.0225 552 VAL A CA  
2365 C  C   . VAL A 298 ? 0.8594 0.7773 0.8412 0.0203  0.0521  -0.0181 552 VAL A C   
2366 O  O   . VAL A 298 ? 0.8571 0.7751 0.8361 0.0180  0.0534  -0.0151 552 VAL A O   
2367 C  CB  . VAL A 298 ? 0.9166 0.8473 0.9048 0.0180  0.0533  -0.0249 552 VAL A CB  
2368 C  CG1 . VAL A 298 ? 0.9238 0.8475 0.9151 0.0188  0.0530  -0.0276 552 VAL A CG1 
2369 C  CG2 . VAL A 298 ? 0.9480 0.8908 0.9388 0.0177  0.0536  -0.0283 552 VAL A CG2 
2370 N  N   . LYS A 299 ? 0.8670 0.7763 0.8484 0.0226  0.0510  -0.0177 553 LYS A N   
2371 C  CA  . LYS A 299 ? 0.9784 0.8777 0.9555 0.0224  0.0517  -0.0132 553 LYS A CA  
2372 C  C   . LYS A 299 ? 0.9906 0.8886 0.9668 0.0182  0.0547  -0.0111 553 LYS A C   
2373 O  O   . LYS A 299 ? 0.9699 0.8656 0.9415 0.0173  0.0557  -0.0070 553 LYS A O   
2374 C  CB  . LYS A 299 ? 0.9818 0.8719 0.9601 0.0248  0.0506  -0.0135 553 LYS A CB  
2375 C  CG  . LYS A 299 ? 1.0352 0.9141 1.0086 0.0255  0.0513  -0.0081 553 LYS A CG  
2376 C  CD  . LYS A 299 ? 1.1240 1.0027 1.0909 0.0280  0.0499  -0.0045 553 LYS A CD  
2377 C  CE  . LYS A 299 ? 1.1410 1.0103 1.1043 0.0322  0.0480  -0.0016 553 LYS A CE  
2378 N  NZ  . LYS A 299 ? 1.1590 1.0178 1.1205 0.0309  0.0502  0.0026  553 LYS A NZ  
2379 N  N   . VAL A 300 ? 0.9190 0.8189 0.8997 0.0159  0.0559  -0.0143 554 VAL A N   
2380 C  CA  . VAL A 300 ? 0.9633 0.8605 0.9444 0.0123  0.0585  -0.0129 554 VAL A CA  
2381 C  C   . VAL A 300 ? 0.8640 0.7670 0.8419 0.0103  0.0595  -0.0108 554 VAL A C   
2382 O  O   . VAL A 300 ? 0.8726 0.7718 0.8475 0.0086  0.0612  -0.0073 554 VAL A O   
2383 C  CB  . VAL A 300 ? 1.0478 0.9469 1.0357 0.0105  0.0591  -0.0180 554 VAL A CB  
2384 C  CG1 . VAL A 300 ? 1.0913 0.9907 1.0805 0.0065  0.0616  -0.0176 554 VAL A CG1 
2385 C  CG2 . VAL A 300 ? 1.0245 0.9151 1.0158 0.0122  0.0583  -0.0192 554 VAL A CG2 
2386 N  N   . MSE A 301 ? 0.8702 0.7824 0.8489 0.0106  0.0584  -0.0128 555 MSE A N   
2387 C  CA  . MSE A 301 ? 0.9074 0.8250 0.8839 0.0090  0.0589  -0.0108 555 MSE A CA  
2388 C  C   . MSE A 301 ? 0.8412 0.7558 0.8129 0.0108  0.0580  -0.0070 555 MSE A C   
2389 O  O   . MSE A 301 ? 0.8863 0.8003 0.8552 0.0094  0.0589  -0.0043 555 MSE A O   
2390 C  CB  . MSE A 301 ? 0.9782 0.9060 0.9574 0.0088  0.0581  -0.0136 555 MSE A CB  
2391 C  CG  . MSE A 301 ? 1.1712 1.1043 1.1492 0.0068  0.0586  -0.0117 555 MSE A CG  
2392 SE SE  . MSE A 301 ? 1.4967 1.4356 1.4743 0.0092  0.0564  -0.0101 555 MSE A SE  
2393 C  CE  . MSE A 301 ? 1.2853 1.2356 1.2672 0.0084  0.0567  -0.0137 555 MSE A CE  
2394 N  N   . GLU A 302 ? 0.8128 0.7252 0.7836 0.0142  0.0560  -0.0069 556 GLU A N   
2395 C  CA  . GLU A 302 ? 0.8014 0.7111 0.7677 0.0164  0.0548  -0.0038 556 GLU A CA  
2396 C  C   . GLU A 302 ? 0.8133 0.7150 0.7751 0.0156  0.0566  -0.0001 556 GLU A C   
2397 O  O   . GLU A 302 ? 0.8300 0.7322 0.7882 0.0153  0.0569  0.0024  556 GLU A O   
2398 C  CB  . GLU A 302 ? 0.8494 0.7580 0.8158 0.0204  0.0522  -0.0048 556 GLU A CB  
2399 C  CG  . GLU A 302 ? 0.8689 0.7763 0.8311 0.0233  0.0502  -0.0024 556 GLU A CG  
2400 C  CD  . GLU A 302 ? 0.8978 0.8027 0.8601 0.0276  0.0475  -0.0035 556 GLU A CD  
2401 O  OE1 . GLU A 302 ? 0.9507 0.8623 0.9166 0.0289  0.0457  -0.0061 556 GLU A OE1 
2402 O  OE2 . GLU A 302 ? 0.9288 0.8250 0.8879 0.0297  0.0473  -0.0018 556 GLU A OE2 
2403 N  N   . ASP A 303 ? 0.7883 0.6832 0.7510 0.0153  0.0578  0.0001  557 ASP A N   
2404 C  CA  . ASP A 303 ? 0.8506 0.7373 0.8093 0.0147  0.0599  0.0042  557 ASP A CA  
2405 C  C   . ASP A 303 ? 0.8667 0.7562 0.8254 0.0109  0.0625  0.0051  557 ASP A C   
2406 O  O   . ASP A 303 ? 0.8554 0.7423 0.8092 0.0109  0.0638  0.0087  557 ASP A O   
2407 C  CB  . ASP A 303 ? 0.9076 0.7860 0.8687 0.0148  0.0608  0.0044  557 ASP A CB  
2408 C  CG  . ASP A 303 ? 0.9527 0.8256 0.9117 0.0193  0.0582  0.0053  557 ASP A CG  
2409 O  OD1 . ASP A 303 ? 0.9624 0.8354 0.9159 0.0222  0.0566  0.0076  557 ASP A OD1 
2410 O  OD2 . ASP A 303 ? 0.9969 0.8657 0.9600 0.0201  0.0574  0.0033  557 ASP A OD2 
2411 N  N   . ALA A 304 ? 0.8292 0.7247 0.7928 0.0081  0.0631  0.0016  558 ALA A N   
2412 C  CA  . ALA A 304 ? 0.8712 0.7697 0.8352 0.0045  0.0654  0.0021  558 ALA A CA  
2413 C  C   . ALA A 304 ? 0.7920 0.6951 0.7522 0.0050  0.0646  0.0039  558 ALA A C   
2414 O  O   . ALA A 304 ? 0.9353 0.8378 0.8932 0.0034  0.0664  0.0058  558 ALA A O   
2415 C  CB  . ALA A 304 ? 0.8569 0.7614 0.8268 0.0019  0.0657  -0.0022 558 ALA A CB  
2416 N  N   . HIS A 305 ? 0.7551 0.6630 0.7153 0.0072  0.0618  0.0028  559 HIS A N   
2417 C  CA  . HIS A 305 ? 0.7606 0.6727 0.7187 0.0082  0.0603  0.0037  559 HIS A CA  
2418 C  C   . HIS A 305 ? 0.7893 0.6965 0.7413 0.0111  0.0598  0.0068  559 HIS A C   
2419 O  O   . HIS A 305 ? 0.8151 0.7238 0.7644 0.0109  0.0602  0.0082  559 HIS A O   
2420 C  CB  . HIS A 305 ? 0.7891 0.7079 0.7506 0.0095  0.0577  0.0015  559 HIS A CB  
2421 C  CG  . HIS A 305 ? 0.7905 0.7130 0.7511 0.0111  0.0555  0.0022  559 HIS A CG  
2422 N  ND1 . HIS A 305 ? 0.7798 0.7069 0.7417 0.0092  0.0554  0.0023  559 HIS A ND1 
2423 C  CD2 . HIS A 305 ? 0.7691 0.6914 0.7285 0.0145  0.0530  0.0024  559 HIS A CD2 
2424 C  CE1 . HIS A 305 ? 0.7384 0.6678 0.7002 0.0114  0.0530  0.0025  559 HIS A CE1 
2425 N  NE2 . HIS A 305 ? 0.7351 0.6619 0.6954 0.0146  0.0515  0.0025  559 HIS A NE2 
2426 N  N   . LEU A 306 ? 0.8152 0.7167 0.7648 0.0140  0.0590  0.0079  560 LEU A N   
2427 C  CA  . LEU A 306 ? 0.8174 0.7137 0.7603 0.0172  0.0586  0.0113  560 LEU A CA  
2428 C  C   . LEU A 306 ? 0.8734 0.7654 0.8129 0.0151  0.0623  0.0145  560 LEU A C   
2429 O  O   . LEU A 306 ? 0.8677 0.7600 0.8021 0.0164  0.0625  0.0166  560 LEU A O   
2430 C  CB  . LEU A 306 ? 0.8000 0.6908 0.7414 0.0208  0.0569  0.0118  560 LEU A CB  
2431 C  CG  . LEU A 306 ? 0.8866 0.7825 0.8317 0.0231  0.0534  0.0084  560 LEU A CG  
2432 C  CD1 . LEU A 306 ? 0.8787 0.7693 0.8238 0.0262  0.0518  0.0082  560 LEU A CD1 
2433 C  CD2 . LEU A 306 ? 0.9180 0.8184 0.8611 0.0258  0.0507  0.0082  560 LEU A CD2 
2434 N  N   . ASP A 307 ? 0.8622 0.7510 0.8050 0.0118  0.0651  0.0144  561 ASP A N   
2435 C  CA  . ASP A 307 ? 0.8196 0.7048 0.7605 0.0092  0.0691  0.0174  561 ASP A CA  
2436 C  C   . ASP A 307 ? 0.8170 0.7087 0.7573 0.0074  0.0698  0.0168  561 ASP A C   
2437 O  O   . ASP A 307 ? 0.7982 0.6887 0.7336 0.0078  0.0717  0.0197  561 ASP A O   
2438 C  CB  . ASP A 307 ? 0.8741 0.7562 0.8210 0.0055  0.0717  0.0163  561 ASP A CB  
2439 C  CG  . ASP A 307 ? 0.9463 0.8208 0.8944 0.0072  0.0711  0.0170  561 ASP A CG  
2440 O  OD1 . ASP A 307 ? 0.8674 0.7373 0.8099 0.0110  0.0697  0.0200  561 ASP A OD1 
2441 O  OD2 . ASP A 307 ? 1.0287 0.9024 0.9833 0.0052  0.0715  0.0142  561 ASP A OD2 
2442 N  N   . ALA A 308 ? 0.8083 0.7071 0.7535 0.0058  0.0683  0.0131  562 ALA A N   
2443 C  CA  . ALA A 308 ? 0.7614 0.6662 0.7071 0.0041  0.0686  0.0121  562 ALA A CA  
2444 C  C   . ALA A 308 ? 0.8091 0.7160 0.7498 0.0074  0.0666  0.0132  562 ALA A C   
2445 O  O   . ALA A 308 ? 0.8227 0.7313 0.7607 0.0070  0.0679  0.0142  562 ALA A O   
2446 C  CB  . ALA A 308 ? 0.8097 0.7210 0.7615 0.0021  0.0671  0.0084  562 ALA A CB  
2447 N  N   . ILE A 309 ? 0.8231 0.7302 0.7627 0.0109  0.0633  0.0128  563 ILE A N   
2448 C  CA  . ILE A 309 ? 0.7887 0.6981 0.7242 0.0144  0.0609  0.0131  563 ILE A CA  
2449 C  C   . ILE A 309 ? 0.8239 0.7284 0.7517 0.0163  0.0631  0.0169  563 ILE A C   
2450 O  O   . ILE A 309 ? 0.7682 0.6758 0.6927 0.0174  0.0630  0.0171  563 ILE A O   
2451 C  CB  . ILE A 309 ? 0.7942 0.7051 0.7309 0.0180  0.0568  0.0116  563 ILE A CB  
2452 C  CG1 . ILE A 309 ? 0.8486 0.7659 0.7927 0.0161  0.0549  0.0084  563 ILE A CG1 
2453 C  CG2 . ILE A 309 ? 0.8029 0.7160 0.7356 0.0220  0.0540  0.0115  563 ILE A CG2 
2454 C  CD1 . ILE A 309 ? 0.8207 0.7392 0.7674 0.0188  0.0518  0.0069  563 ILE A CD1 
2455 N  N   . LEU A 310 ? 0.8105 0.7077 0.7356 0.0167  0.0650  0.0198  564 LEU A N   
2456 C  CA  . LEU A 310 ? 0.8566 0.7486 0.7738 0.0186  0.0673  0.0244  564 LEU A CA  
2457 C  C   . LEU A 310 ? 0.8907 0.7836 0.8070 0.0153  0.0718  0.0262  564 LEU A C   
2458 O  O   . LEU A 310 ? 0.8527 0.7445 0.7618 0.0173  0.0734  0.0295  564 LEU A O   
2459 C  CB  . LEU A 310 ? 0.9224 0.8057 0.8378 0.0199  0.0680  0.0275  564 LEU A CB  
2460 C  CG  . LEU A 310 ? 0.9874 0.8701 0.9021 0.0245  0.0633  0.0260  564 LEU A CG  
2461 C  CD1 . LEU A 310 ? 1.0219 0.8979 0.9394 0.0245  0.0633  0.0265  564 LEU A CD1 
2462 C  CD2 . LEU A 310 ? 0.9811 0.8627 0.8870 0.0298  0.0616  0.0285  564 LEU A CD2 
2463 N  N   . ILE A 311 ? 0.8176 0.7128 0.7407 0.0105  0.0737  0.0240  565 ILE A N   
2464 C  CA  . ILE A 311 ? 0.8666 0.7647 0.7896 0.0075  0.0773  0.0245  565 ILE A CA  
2465 C  C   . ILE A 311 ? 0.8424 0.7475 0.7624 0.0097  0.0755  0.0229  565 ILE A C   
2466 O  O   . ILE A 311 ? 0.8490 0.7552 0.7641 0.0102  0.0780  0.0250  565 ILE A O   
2467 C  CB  . ILE A 311 ? 0.8992 0.7995 0.8306 0.0024  0.0790  0.0216  565 ILE A CB  
2468 C  CG1 . ILE A 311 ? 0.9015 0.7945 0.8356 0.0003  0.0817  0.0235  565 ILE A CG1 
2469 C  CG2 . ILE A 311 ? 0.8830 0.7884 0.8155 -0.0002 0.0816  0.0207  565 ILE A CG2 
2470 C  CD1 . ILE A 311 ? 0.9253 0.8201 0.8681 -0.0039 0.0823  0.0197  565 ILE A CD1 
2471 N  N   . LEU A 312 ? 0.8581 0.7682 0.7811 0.0112  0.0711  0.0192  566 LEU A N   
2472 C  CA  . LEU A 312 ? 0.8422 0.7584 0.7629 0.0139  0.0686  0.0174  566 LEU A CA  
2473 C  C   . LEU A 312 ? 0.8764 0.7905 0.7883 0.0191  0.0677  0.0200  566 LEU A C   
2474 O  O   . LEU A 312 ? 0.8205 0.7385 0.7280 0.0213  0.0677  0.0198  566 LEU A O   
2475 C  CB  . LEU A 312 ? 0.8065 0.7280 0.7331 0.0146  0.0639  0.0132  566 LEU A CB  
2476 C  CG  . LEU A 312 ? 0.7746 0.6984 0.7094 0.0108  0.0632  0.0107  566 LEU A CG  
2477 C  CD1 . LEU A 312 ? 0.7773 0.7057 0.7166 0.0126  0.0585  0.0077  566 LEU A CD1 
2478 C  CD2 . LEU A 312 ? 0.8838 0.8108 0.8213 0.0072  0.0658  0.0097  566 LEU A CD2 
2479 N  N   . GLY A 313 ? 0.8703 0.7786 0.7794 0.0215  0.0667  0.0221  567 GLY A N   
2480 C  CA  . GLY A 313 ? 0.8492 0.7547 0.7493 0.0266  0.0660  0.0252  567 GLY A CA  
2481 C  C   . GLY A 313 ? 0.9385 0.8412 0.8313 0.0263  0.0710  0.0301  567 GLY A C   
2482 O  O   . GLY A 313 ? 1.0245 0.9291 0.9096 0.0305  0.0705  0.0315  567 GLY A O   
2483 N  N   . GLU A 314 ? 0.8860 0.7847 0.7817 0.0215  0.0757  0.0325  568 GLU A N   
2484 C  CA  . GLU A 314 ? 0.9443 0.8402 0.8348 0.0202  0.0813  0.0376  568 GLU A CA  
2485 C  C   . GLU A 314 ? 0.9278 0.8321 0.8156 0.0209  0.0820  0.0358  568 GLU A C   
2486 O  O   . GLU A 314 ? 0.8684 0.7732 0.7475 0.0242  0.0835  0.0390  568 GLU A O   
2487 C  CB  . GLU A 314 ? 0.9908 0.8835 0.8884 0.0139  0.0859  0.0385  568 GLU A CB  
2488 C  CG  . GLU A 314 ? 1.0964 0.9794 0.9945 0.0122  0.0889  0.0431  568 GLU A CG  
2489 C  CD  . GLU A 314 ? 1.1811 1.0634 1.0894 0.0061  0.0915  0.0409  568 GLU A CD  
2490 O  OE1 . GLU A 314 ? 1.2425 1.1271 1.1530 0.0024  0.0959  0.0415  568 GLU A OE1 
2491 O  OE2 . GLU A 314 ? 1.1727 1.0531 1.0872 0.0052  0.0890  0.0379  568 GLU A OE2 
2492 N  N   . ALA A 315 ? 0.8269 0.7377 0.7221 0.0180  0.0809  0.0307  569 ALA A N   
2493 C  CA  . ALA A 315 ? 0.8308 0.7499 0.7244 0.0188  0.0810  0.0281  569 ALA A CA  
2494 C  C   . ALA A 315 ? 0.8911 0.8135 0.7772 0.0254  0.0771  0.0274  569 ALA A C   
2495 O  O   . ALA A 315 ? 0.8689 0.7951 0.7478 0.0279  0.0791  0.0288  569 ALA A O   
2496 C  CB  . ALA A 315 ? 0.8386 0.7638 0.7417 0.0157  0.0787  0.0223  569 ALA A CB  
2497 N  N   . PHE A 316 ? 0.8113 0.7329 0.6989 0.0284  0.0718  0.0251  570 PHE A N   
2498 C  CA  . PHE A 316 ? 0.8061 0.7319 0.6883 0.0346  0.0674  0.0231  570 PHE A CA  
2499 C  C   . PHE A 316 ? 0.8020 0.7229 0.6729 0.0394  0.0685  0.0285  570 PHE A C   
2500 O  O   . PHE A 316 ? 0.8039 0.7288 0.6685 0.0447  0.0661  0.0274  570 PHE A O   
2501 C  CB  . PHE A 316 ? 0.8069 0.7346 0.6956 0.0363  0.0612  0.0183  570 PHE A CB  
2502 C  CG  . PHE A 316 ? 0.8065 0.7401 0.7052 0.0329  0.0594  0.0132  570 PHE A CG  
2503 C  CD1 . PHE A 316 ? 0.8214 0.7619 0.7209 0.0329  0.0595  0.0103  570 PHE A CD1 
2504 C  CD2 . PHE A 316 ? 0.8004 0.7327 0.7077 0.0300  0.0575  0.0114  570 PHE A CD2 
2505 C  CE1 . PHE A 316 ? 0.8244 0.7699 0.7333 0.0300  0.0575  0.0059  570 PHE A CE1 
2506 C  CE2 . PHE A 316 ? 0.7944 0.7319 0.7106 0.0270  0.0558  0.0074  570 PHE A CE2 
2507 C  CZ  . PHE A 316 ? 0.8057 0.7493 0.7228 0.0270  0.0557  0.0047  570 PHE A CZ  
2508 N  N   . ALA A 317 ? 0.8514 0.7635 0.7201 0.0377  0.0719  0.0339  571 ALA A N   
2509 C  CA  . ALA A 317 ? 0.9343 0.8405 0.7923 0.0416  0.0737  0.0403  571 ALA A CA  
2510 C  C   . ALA A 317 ? 1.0169 0.9239 0.8670 0.0414  0.0795  0.0453  571 ALA A C   
2511 O  O   . ALA A 317 ? 1.0410 0.9459 0.8804 0.0463  0.0801  0.0499  571 ALA A O   
2512 C  CB  . ALA A 317 ? 0.9474 0.8437 0.8075 0.0394  0.0752  0.0442  571 ALA A CB  
2513 N  N   . SER A 318 ? 1.0178 0.9277 0.8731 0.0358  0.0839  0.0447  572 SER A N   
2514 C  CA  . SER A 318 ? 1.0660 0.9762 0.9161 0.0340  0.0906  0.0499  572 SER A CA  
2515 C  C   . SER A 318 ? 1.0474 0.9678 0.8923 0.0366  0.0914  0.0477  572 SER A C   
2516 O  O   . SER A 318 ? 0.9831 0.9116 0.8335 0.0363  0.0885  0.0410  572 SER A O   
2517 C  CB  . SER A 318 ? 1.0483 0.9561 0.9078 0.0264  0.0955  0.0504  572 SER A CB  
2518 O  OG  . SER A 318 ? 1.0809 0.9887 0.9358 0.0245  0.1023  0.0558  572 SER A OG  
2519 N  N   . ASP A 319 ? 1.1118 1.0319 0.9464 0.0390  0.0958  0.0536  573 ASP A N   
2520 C  CA  . ASP A 319 ? 1.2655 1.1960 1.0959 0.0406  0.0976  0.0516  573 ASP A CA  
2521 C  C   . ASP A 319 ? 1.2132 1.1459 1.0490 0.0341  0.1044  0.0527  573 ASP A C   
2522 O  O   . ASP A 319 ? 1.2394 1.1815 1.0747 0.0342  0.1059  0.0496  573 ASP A O   
2523 C  CB  . ASP A 319 ? 1.3725 1.3054 1.1886 0.0479  0.0977  0.0554  573 ASP A CB  
2524 C  CG  . ASP A 319 ? 1.5777 1.5232 1.3909 0.0523  0.0947  0.0489  573 ASP A CG  
2525 O  OD1 . ASP A 319 ? 1.4952 1.4460 1.3168 0.0523  0.0892  0.0406  573 ASP A OD1 
2526 O  OD2 . ASP A 319 ? 1.9007 1.8511 1.7033 0.0559  0.0981  0.0521  573 ASP A OD2 
2527 N  N   . GLU A 320 ? 1.2269 1.1517 1.0694 0.0282  0.1080  0.0561  574 GLU A N   
2528 C  CA  . GLU A 320 ? 1.2230 1.1502 1.0725 0.0217  0.1139  0.0562  574 GLU A CA  
2529 C  C   . GLU A 320 ? 1.1580 1.0912 1.0187 0.0189  0.1100  0.0474  574 GLU A C   
2530 O  O   . GLU A 320 ? 1.1235 1.0557 0.9878 0.0205  0.1037  0.0430  574 GLU A O   
2531 C  CB  . GLU A 320 ? 1.2758 1.1926 1.1293 0.0165  0.1191  0.0625  574 GLU A CB  
2532 C  CG  . GLU A 320 ? 1.3420 1.2504 1.1853 0.0198  0.1213  0.0715  574 GLU A CG  
2533 C  CD  . GLU A 320 ? 1.4300 1.3353 1.2716 0.0161  0.1300  0.0794  574 GLU A CD  
2534 O  OE1 . GLU A 320 ? 1.5121 1.4069 1.3561 0.0135  0.1326  0.0851  574 GLU A OE1 
2535 O  OE2 . GLU A 320 ? 1.4211 1.3348 1.2594 0.0159  0.1342  0.0796  574 GLU A OE2 
2536 N  N   . PRO A 321 ? 1.0571 0.9964 0.9235 0.0147  0.1138  0.0450  575 PRO A N   
2537 C  CA  . PRO A 321 ? 0.9380 0.8813 0.8158 0.0116  0.1101  0.0374  575 PRO A CA  
2538 C  C   . PRO A 321 ? 0.9607 0.8958 0.8472 0.0069  0.1097  0.0377  575 PRO A C   
2539 O  O   . PRO A 321 ? 1.0288 0.9573 0.9163 0.0036  0.1144  0.0427  575 PRO A O   
2540 C  CB  . PRO A 321 ? 0.9572 0.9083 0.8388 0.0082  0.1147  0.0352  575 PRO A CB  
2541 C  CG  . PRO A 321 ? 1.0255 0.9779 0.8973 0.0098  0.1209  0.0417  575 PRO A CG  
2542 C  CD  . PRO A 321 ? 0.9921 0.9345 0.8560 0.0122  0.1215  0.0490  575 PRO A CD  
2543 N  N   . PHE A 322 ? 0.9223 0.8584 0.8154 0.0068  0.1038  0.0320  576 PHE A N   
2544 C  CA  . PHE A 322 ? 0.9155 0.8460 0.8168 0.0033  0.1023  0.0309  576 PHE A CA  
2545 C  C   . PHE A 322 ? 0.9400 0.8744 0.8518 -0.0022 0.1039  0.0266  576 PHE A C   
2546 O  O   . PHE A 322 ? 0.8498 0.7921 0.7647 -0.0019 0.1017  0.0215  576 PHE A O   
2547 C  CB  . PHE A 322 ? 0.9073 0.8381 0.8091 0.0068  0.0951  0.0272  576 PHE A CB  
2548 C  CG  . PHE A 322 ? 0.9120 0.8369 0.8201 0.0046  0.0930  0.0266  576 PHE A CG  
2549 C  CD1 . PHE A 322 ? 0.8526 0.7687 0.7578 0.0051  0.0942  0.0313  576 PHE A CD1 
2550 C  CD2 . PHE A 322 ? 0.9398 0.8682 0.8565 0.0025  0.0895  0.0212  576 PHE A CD2 
2551 C  CE1 . PHE A 322 ? 0.8609 0.7724 0.7720 0.0035  0.0919  0.0300  576 PHE A CE1 
2552 C  CE2 . PHE A 322 ? 0.8657 0.7896 0.7875 0.0010  0.0874  0.0204  576 PHE A CE2 
2553 C  CZ  . PHE A 322 ? 0.8425 0.7583 0.7615 0.0015  0.0886  0.0245  576 PHE A CZ  
2554 N  N   . ASP A 323 ? 0.9664 0.8955 0.8839 -0.0069 0.1075  0.0285  577 ASP A N   
2555 C  CA  . ASP A 323 ? 0.9675 0.9002 0.8949 -0.0119 0.1091  0.0244  577 ASP A CA  
2556 C  C   . ASP A 323 ? 0.9459 0.8777 0.8798 -0.0124 0.1036  0.0200  577 ASP A C   
2557 O  O   . ASP A 323 ? 0.9395 0.8651 0.8771 -0.0144 0.1038  0.0209  577 ASP A O   
2558 C  CB  . ASP A 323 ? 1.0511 0.9792 0.9823 -0.0166 0.1158  0.0282  577 ASP A CB  
2559 C  CG  . ASP A 323 ? 1.0637 0.9975 1.0049 -0.0215 0.1181  0.0236  577 ASP A CG  
2560 O  OD1 . ASP A 323 ? 1.1850 1.1259 1.1257 -0.0219 0.1206  0.0223  577 ASP A OD1 
2561 O  OD2 . ASP A 323 ? 1.0041 0.9353 0.9538 -0.0249 0.1174  0.0210  577 ASP A OD2 
2562 N  N   . PHE A 324 ? 0.9448 0.8829 0.8799 -0.0104 0.0987  0.0152  578 PHE A N   
2563 C  CA  . PHE A 324 ? 0.8665 0.8050 0.8077 -0.0107 0.0935  0.0112  578 PHE A CA  
2564 C  C   . PHE A 324 ? 0.8821 0.8202 0.8322 -0.0155 0.0950  0.0088  578 PHE A C   
2565 O  O   . PHE A 324 ? 0.7943 0.7297 0.7480 -0.0161 0.0924  0.0076  578 PHE A O   
2566 C  CB  . PHE A 324 ? 0.7824 0.7284 0.7251 -0.0085 0.0887  0.0066  578 PHE A CB  
2567 C  CG  . PHE A 324 ? 0.7606 0.7075 0.6963 -0.0034 0.0857  0.0074  578 PHE A CG  
2568 C  CD1 . PHE A 324 ? 0.7902 0.7349 0.7255 -0.0009 0.0810  0.0071  578 PHE A CD1 
2569 C  CD2 . PHE A 324 ? 0.7899 0.7407 0.7197 -0.0010 0.0876  0.0082  578 PHE A CD2 
2570 C  CE1 . PHE A 324 ? 0.7606 0.7066 0.6904 0.0040  0.0779  0.0072  578 PHE A CE1 
2571 C  CE2 . PHE A 324 ? 0.8114 0.7635 0.7348 0.0041  0.0845  0.0084  578 PHE A CE2 
2572 C  CZ  . PHE A 324 ? 0.7976 0.7473 0.7214 0.0066  0.0794  0.0077  578 PHE A CZ  
2573 N  N   . GLY A 325 ? 0.9376 0.8790 0.8913 -0.0186 0.0990  0.0078  579 GLY A N   
2574 C  CA  . GLY A 325 ? 0.8916 0.8337 0.8543 -0.0231 0.1005  0.0048  579 GLY A CA  
2575 C  C   . GLY A 325 ? 0.9255 0.8603 0.8913 -0.0255 0.1026  0.0068  579 GLY A C   
2576 O  O   . GLY A 325 ? 0.9438 0.8791 0.9169 -0.0279 0.1017  0.0033  579 GLY A O   
2577 N  N   . THR A 326 ? 0.9914 0.9195 0.9518 -0.0245 0.1053  0.0122  580 THR A N   
2578 C  CA  . THR A 326 ? 1.0681 0.9881 1.0315 -0.0263 0.1069  0.0145  580 THR A CA  
2579 C  C   . THR A 326 ? 1.0781 0.9916 1.0358 -0.0228 0.1042  0.0176  580 THR A C   
2580 O  O   . THR A 326 ? 0.9879 0.8957 0.9492 -0.0238 0.1038  0.0177  580 THR A O   
2581 C  CB  . THR A 326 ? 1.0593 0.9752 1.0236 -0.0292 0.1136  0.0189  580 THR A CB  
2582 O  OG1 . THR A 326 ? 1.0766 0.9893 1.0309 -0.0261 0.1154  0.0249  580 THR A OG1 
2583 C  CG2 . THR A 326 ? 1.0979 1.0206 1.0676 -0.0327 0.1174  0.0164  580 THR A CG2 
2584 N  N   . GLN A 327 ? 1.0532 0.9674 1.0022 -0.0186 0.1022  0.0198  581 GLN A N   
2585 C  CA  . GLN A 327 ? 1.0637 0.9725 1.0074 -0.0148 0.0992  0.0223  581 GLN A CA  
2586 C  C   . GLN A 327 ? 1.0471 0.9595 0.9922 -0.0126 0.0931  0.0181  581 GLN A C   
2587 O  O   . GLN A 327 ? 1.0451 0.9536 0.9889 -0.0105 0.0905  0.0188  581 GLN A O   
2588 C  CB  . GLN A 327 ? 1.0447 0.9517 0.9783 -0.0111 0.1004  0.0274  581 GLN A CB  
2589 C  CG  . GLN A 327 ? 1.1218 1.0231 1.0526 -0.0126 0.1064  0.0334  581 GLN A CG  
2590 C  CD  . GLN A 327 ? 1.1936 1.0950 1.1133 -0.0084 0.1076  0.0382  581 GLN A CD  
2591 O  OE1 . GLN A 327 ? 1.1248 1.0319 1.0414 -0.0084 0.1105  0.0388  581 GLN A OE1 
2592 N  NE2 . GLN A 327 ? 1.1671 1.0630 1.0806 -0.0043 0.1050  0.0411  581 GLN A NE2 
2593 N  N   . SER A 328 ? 1.0163 0.9360 0.9651 -0.0135 0.0911  0.0138  582 SER A N   
2594 C  CA  . SER A 328 ? 1.0194 0.9433 0.9691 -0.0113 0.0858  0.0106  582 SER A CA  
2595 C  C   . SER A 328 ? 0.9997 0.9285 0.9572 -0.0140 0.0839  0.0059  582 SER A C   
2596 O  O   . SER A 328 ? 1.0580 0.9923 1.0170 -0.0128 0.0803  0.0033  582 SER A O   
2597 C  CB  . SER A 328 ? 1.0068 0.9355 0.9517 -0.0083 0.0843  0.0105  582 SER A CB  
2598 O  OG  . SER A 328 ? 0.9899 0.9194 0.9329 -0.0049 0.0797  0.0098  582 SER A OG  
2599 N  N   . THR A 329 ? 1.0286 0.9557 0.9916 -0.0174 0.0863  0.0048  583 THR A N   
2600 C  CA  . THR A 329 ? 0.9682 0.8998 0.9382 -0.0195 0.0844  0.0003  583 THR A CA  
2601 C  C   . THR A 329 ? 0.9517 0.8832 0.9224 -0.0178 0.0805  -0.0008 583 THR A C   
2602 O  O   . THR A 329 ? 0.9263 0.8532 0.8937 -0.0158 0.0800  0.0016  583 THR A O   
2603 C  CB  . THR A 329 ? 0.9506 0.8802 0.9266 -0.0231 0.0875  -0.0011 583 THR A CB  
2604 O  OG1 . THR A 329 ? 0.9557 0.8780 0.9303 -0.0228 0.0891  0.0017  583 THR A OG1 
2605 C  CG2 . THR A 329 ? 0.9452 0.8767 0.9230 -0.0256 0.0915  -0.0012 583 THR A CG2 
2606 N  N   . THR A 330 ? 0.9754 0.9122 0.9505 -0.0186 0.0780  -0.0042 584 THR A N   
2607 C  CA  . THR A 330 ? 0.9720 0.9099 0.9485 -0.0174 0.0748  -0.0053 584 THR A CA  
2608 C  C   . THR A 330 ? 0.9275 0.8600 0.9044 -0.0176 0.0761  -0.0048 584 THR A C   
2609 O  O   . THR A 330 ? 1.0017 0.9326 0.9765 -0.0154 0.0742  -0.0038 584 THR A O   
2610 C  CB  . THR A 330 ? 0.9845 0.9283 0.9660 -0.0188 0.0728  -0.0090 584 THR A CB  
2611 O  OG1 . THR A 330 ? 0.9901 0.9341 0.9761 -0.0216 0.0753  -0.0114 584 THR A OG1 
2612 C  CG2 . THR A 330 ? 0.9858 0.9346 0.9675 -0.0181 0.0706  -0.0095 584 THR A CG2 
2613 N  N   . GLU A 331 ? 0.9964 0.9260 0.9764 -0.0201 0.0793  -0.0055 585 GLU A N   
2614 C  CA  . GLU A 331 ? 1.0067 0.9307 0.9884 -0.0204 0.0806  -0.0052 585 GLU A CA  
2615 C  C   . GLU A 331 ? 0.9925 0.9103 0.9682 -0.0179 0.0810  -0.0008 585 GLU A C   
2616 O  O   . GLU A 331 ? 0.9148 0.8301 0.8897 -0.0160 0.0793  -0.0007 585 GLU A O   
2617 C  CB  . GLU A 331 ? 1.1759 1.0977 1.1630 -0.0239 0.0843  -0.0065 585 GLU A CB  
2618 C  CG  . GLU A 331 ? 1.2901 1.2089 1.2827 -0.0247 0.0843  -0.0091 585 GLU A CG  
2619 C  CD  . GLU A 331 ? 1.3300 1.2419 1.3261 -0.0270 0.0883  -0.0076 585 GLU A CD  
2620 O  OE1 . GLU A 331 ? 1.3501 1.2616 1.3472 -0.0293 0.0917  -0.0061 585 GLU A OE1 
2621 O  OE2 . GLU A 331 ? 1.4318 1.3389 1.4303 -0.0265 0.0880  -0.0079 585 GLU A OE2 
2622 N  N   . LYS A 332 ? 0.9718 0.8878 0.9431 -0.0176 0.0830  0.0025  586 LYS A N   
2623 C  CA  . LYS A 332 ? 1.0476 0.9582 1.0124 -0.0146 0.0830  0.0067  586 LYS A CA  
2624 C  C   . LYS A 332 ? 0.9479 0.8601 0.9092 -0.0109 0.0788  0.0067  586 LYS A C   
2625 O  O   . LYS A 332 ? 0.8430 0.7503 0.8013 -0.0086 0.0781  0.0088  586 LYS A O   
2626 C  CB  . LYS A 332 ? 1.1165 1.0264 1.0762 -0.0143 0.0857  0.0101  586 LYS A CB  
2627 C  CG  . LYS A 332 ? 1.1664 1.0729 1.1285 -0.0176 0.0906  0.0118  586 LYS A CG  
2628 C  CD  . LYS A 332 ? 1.1107 1.0084 1.0719 -0.0173 0.0927  0.0154  586 LYS A CD  
2629 C  CE  . LYS A 332 ? 1.0778 0.9725 1.0415 -0.0208 0.0981  0.0179  586 LYS A CE  
2630 N  NZ  . LYS A 332 ? 1.1408 1.0291 1.1109 -0.0228 0.0994  0.0176  586 LYS A NZ  
2631 N  N   . ILE A 333 ? 0.9229 0.8418 0.8852 -0.0105 0.0761  0.0045  587 ILE A N   
2632 C  CA  . ILE A 333 ? 0.9155 0.8367 0.8750 -0.0072 0.0724  0.0048  587 ILE A CA  
2633 C  C   . ILE A 333 ? 0.9122 0.8388 0.8758 -0.0072 0.0693  0.0021  587 ILE A C   
2634 O  O   . ILE A 333 ? 0.9791 0.9083 0.9417 -0.0050 0.0665  0.0023  587 ILE A O   
2635 C  CB  . ILE A 333 ? 0.8605 0.7847 0.8165 -0.0057 0.0716  0.0057  587 ILE A CB  
2636 C  CG1 . ILE A 333 ? 0.8488 0.7793 0.8086 -0.0076 0.0710  0.0031  587 ILE A CG1 
2637 C  CG2 . ILE A 333 ? 0.8943 0.8145 0.8451 -0.0051 0.0747  0.0088  587 ILE A CG2 
2638 C  CD1 . ILE A 333 ? 0.8430 0.7769 0.8003 -0.0057 0.0695  0.0033  587 ILE A CD1 
2639 N  N   . HIS A 334 ? 0.9430 0.8715 0.9112 -0.0094 0.0698  -0.0004 588 HIS A N   
2640 C  CA  . HIS A 334 ? 0.9624 0.8966 0.9337 -0.0092 0.0671  -0.0024 588 HIS A CA  
2641 C  C   . HIS A 334 ? 0.9599 0.8932 0.9302 -0.0066 0.0653  -0.0019 588 HIS A C   
2642 O  O   . HIS A 334 ? 0.9559 0.8940 0.9275 -0.0057 0.0629  -0.0022 588 HIS A O   
2643 C  CB  . HIS A 334 ? 0.9971 0.9342 0.9730 -0.0115 0.0678  -0.0055 588 HIS A CB  
2644 C  CG  . HIS A 334 ? 1.0814 1.0155 1.0590 -0.0116 0.0687  -0.0069 588 HIS A CG  
2645 N  ND1 . HIS A 334 ? 1.0495 0.9779 1.0280 -0.0130 0.0714  -0.0070 588 HIS A ND1 
2646 C  CD2 . HIS A 334 ? 1.0953 1.0314 1.0742 -0.0103 0.0672  -0.0085 588 HIS A CD2 
2647 C  CE1 . HIS A 334 ? 1.0881 1.0150 1.0690 -0.0125 0.0711  -0.0089 588 HIS A CE1 
2648 N  NE2 . HIS A 334 ? 1.1219 1.0537 1.1028 -0.0108 0.0686  -0.0100 588 HIS A NE2 
2649 N  N   . ASN A 335 ? 0.8431 0.7705 0.8116 -0.0056 0.0664  -0.0009 589 ASN A N   
2650 C  CA  . ASN A 335 ? 0.8758 0.8019 0.8431 -0.0027 0.0646  -0.0005 589 ASN A CA  
2651 C  C   . ASN A 335 ? 0.9212 0.8481 0.8855 0.0000  0.0623  0.0013  589 ASN A C   
2652 O  O   . ASN A 335 ? 0.9271 0.8540 0.8915 0.0024  0.0606  0.0012  589 ASN A O   
2653 C  CB  . ASN A 335 ? 0.8916 0.8107 0.8582 -0.0021 0.0659  -0.0001 589 ASN A CB  
2654 C  CG  . ASN A 335 ? 0.9462 0.8662 0.9177 -0.0040 0.0669  -0.0033 589 ASN A CG  
2655 O  OD1 . ASN A 335 ? 0.9042 0.8304 0.8785 -0.0041 0.0655  -0.0059 589 ASN A OD1 
2656 N  ND2 . ASN A 335 ? 0.8762 0.7902 0.8488 -0.0054 0.0692  -0.0032 589 ASN A ND2 
2657 N  N   . LEU A 336 ? 0.7990 0.7271 0.7615 0.0000  0.0621  0.0024  590 LEU A N   
2658 C  CA  . LEU A 336 ? 0.8477 0.7788 0.8097 0.0024  0.0592  0.0028  590 LEU A CA  
2659 C  C   . LEU A 336 ? 0.8570 0.7937 0.8237 0.0024  0.0571  0.0015  590 LEU A C   
2660 O  O   . LEU A 336 ? 0.8728 0.8108 0.8401 0.0046  0.0549  0.0017  590 LEU A O   
2661 C  CB  . LEU A 336 ? 0.8794 0.8132 0.8410 0.0019  0.0588  0.0029  590 LEU A CB  
2662 C  CG  . LEU A 336 ? 0.9089 0.8392 0.8652 0.0035  0.0597  0.0046  590 LEU A CG  
2663 C  CD1 . LEU A 336 ? 0.9174 0.8522 0.8745 0.0033  0.0586  0.0036  590 LEU A CD1 
2664 C  CD2 . LEU A 336 ? 0.9503 0.8776 0.9028 0.0074  0.0580  0.0057  590 LEU A CD2 
2665 N  N   . ILE A 337 ? 0.8145 0.7547 0.7844 -0.0001 0.0578  0.0003  591 ILE A N   
2666 C  CA  . ILE A 337 ? 0.8763 0.8222 0.8501 -0.0003 0.0564  -0.0004 591 ILE A CA  
2667 C  C   . ILE A 337 ? 0.8613 0.8079 0.8363 -0.0013 0.0579  -0.0021 591 ILE A C   
2668 O  O   . ILE A 337 ? 0.9248 0.8736 0.9012 -0.0034 0.0589  -0.0034 591 ILE A O   
2669 C  CB  . ILE A 337 ? 0.9308 0.8819 0.9076 -0.0020 0.0555  -0.0003 591 ILE A CB  
2670 C  CG1 . ILE A 337 ? 0.9685 0.9191 0.9448 -0.0014 0.0541  0.0004  591 ILE A CG1 
2671 C  CG2 . ILE A 337 ? 1.0015 0.9582 0.9820 -0.0019 0.0542  0.0000  591 ILE A CG2 
2672 C  CD1 . ILE A 337 ? 0.9807 0.9318 0.9579 0.0010  0.0517  0.0010  591 ILE A CD1 
2673 N  N   . PRO A 338 ? 0.8148 0.7596 0.7894 0.0004  0.0578  -0.0027 592 PRO A N   
2674 C  CA  . PRO A 338 ? 0.8962 0.8431 0.8726 -0.0002 0.0587  -0.0050 592 PRO A CA  
2675 C  C   . PRO A 338 ? 1.0051 0.9601 0.9842 -0.0007 0.0578  -0.0051 592 PRO A C   
2676 O  O   . PRO A 338 ? 0.9375 0.8953 0.9178 0.0005  0.0564  -0.0037 592 PRO A O   
2677 C  CB  . PRO A 338 ? 0.9614 0.9050 0.9371 0.0022  0.0583  -0.0056 592 PRO A CB  
2678 C  CG  . PRO A 338 ? 0.9189 0.8565 0.8913 0.0038  0.0578  -0.0033 592 PRO A CG  
2679 C  CD  . PRO A 338 ? 0.8854 0.8266 0.8581 0.0032  0.0567  -0.0018 592 PRO A CD  
2680 N  N   . VAL A 339 ? 1.1405 1.0993 1.1209 -0.0024 0.0585  -0.0065 593 VAL A N   
2681 C  CA  . VAL A 339 ? 1.2834 1.2497 1.2657 -0.0029 0.0577  -0.0057 593 VAL A CA  
2682 C  C   . VAL A 339 ? 1.2690 1.2403 1.2524 -0.0014 0.0578  -0.0068 593 VAL A C   
2683 O  O   . VAL A 339 ? 1.2178 1.1953 1.2027 -0.0014 0.0573  -0.0051 593 VAL A O   
2684 C  CB  . VAL A 339 ? 1.3739 1.3430 1.3568 -0.0048 0.0579  -0.0064 593 VAL A CB  
2685 C  CG1 . VAL A 339 ? 1.3260 1.2984 1.3092 -0.0049 0.0587  -0.0097 593 VAL A CG1 
2686 C  CG2 . VAL A 339 ? 1.2706 1.2446 1.2550 -0.0054 0.0566  -0.0037 593 VAL A CG2 
2687 N  N   . MSE A 340 ? 1.3301 1.2989 1.3130 -0.0002 0.0584  -0.0094 594 MSE A N   
2688 C  CA  . MSE A 340 ? 1.3804 1.3535 1.3645 0.0018  0.0583  -0.0107 594 MSE A CA  
2689 C  C   . MSE A 340 ? 1.4058 1.3765 1.3902 0.0033  0.0573  -0.0089 594 MSE A C   
2690 O  O   . MSE A 340 ? 1.4134 1.3788 1.3971 0.0049  0.0570  -0.0101 594 MSE A O   
2691 C  CB  . MSE A 340 ? 1.5213 1.4933 1.5057 0.0028  0.0588  -0.0149 594 MSE A CB  
2692 C  CG  . MSE A 340 ? 1.6433 1.6216 1.6284 0.0022  0.0593  -0.0178 594 MSE A CG  
2693 SE SE  . MSE A 340 ? 1.8068 1.7971 1.7916 0.0018  0.0594  -0.0155 594 MSE A SE  
2694 C  CE  . MSE A 340 ? 1.6789 1.6670 1.6630 -0.0007 0.0592  -0.0156 594 MSE A CE  
2695 N  N   . LEU A 341 ? 1.1915 1.1660 1.1774 0.0029  0.0566  -0.0060 595 LEU A N   
2696 C  CA  . LEU A 341 ? 1.0551 1.0293 1.0429 0.0044  0.0554  -0.0046 595 LEU A CA  
2697 C  C   . LEU A 341 ? 0.9670 0.9484 0.9584 0.0034  0.0552  -0.0020 595 LEU A C   
2698 O  O   . LEU A 341 ? 0.8928 0.8785 0.8873 0.0045  0.0551  -0.0017 595 LEU A O   
2699 C  CB  . LEU A 341 ? 1.0317 0.9986 1.0178 0.0049  0.0541  -0.0034 595 LEU A CB  
2700 C  CG  . LEU A 341 ? 1.0422 1.0010 1.0248 0.0065  0.0540  -0.0044 595 LEU A CG  
2701 C  CD1 . LEU A 341 ? 1.0431 0.9983 1.0248 0.0077  0.0523  -0.0028 595 LEU A CD1 
2702 C  CD2 . LEU A 341 ? 1.0810 1.0388 1.0639 0.0089  0.0538  -0.0066 595 LEU A CD2 
2703 N  N   . ARG A 342 ? 0.9061 0.8890 0.8976 0.0014  0.0552  -0.0001 596 ARG A N   
2704 C  CA  . ARG A 342 ? 1.0641 1.0537 1.0590 0.0003  0.0553  0.0029  596 ARG A CA  
2705 C  C   . ARG A 342 ? 1.0872 1.0846 1.0828 0.0009  0.0570  0.0025  596 ARG A C   
2706 O  O   . ARG A 342 ? 1.0997 1.1030 1.0986 0.0002  0.0574  0.0055  596 ARG A O   
2707 C  CB  . ARG A 342 ? 1.2048 1.1950 1.1992 -0.0017 0.0550  0.0046  596 ARG A CB  
2708 C  CG  . ARG A 342 ? 1.3128 1.2964 1.3054 -0.0023 0.0541  0.0039  596 ARG A CG  
2709 C  CD  . ARG A 342 ? 1.4512 1.4360 1.4435 -0.0041 0.0538  0.0048  596 ARG A CD  
2710 N  NE  . ARG A 342 ? 1.3451 1.3262 1.3389 -0.0047 0.0521  0.0057  596 ARG A NE  
2711 C  CZ  . ARG A 342 ? 1.2322 1.2141 1.2303 -0.0046 0.0504  0.0079  596 ARG A CZ  
2712 N  NH1 . ARG A 342 ? 1.0127 0.9987 1.0143 -0.0042 0.0506  0.0097  596 ARG A NH1 
2713 N  NH2 . ARG A 342 ? 1.1901 1.1689 1.1896 -0.0048 0.0487  0.0079  596 ARG A NH2 
2714 N  N   . HIS A 343 ? 0.9672 0.9648 0.9601 0.0021  0.0579  -0.0010 597 HIS A N   
2715 C  CA  . HIS A 343 ? 1.1085 1.1141 1.1015 0.0031  0.0594  -0.0022 597 HIS A CA  
2716 C  C   . HIS A 343 ? 1.1474 1.1520 1.1416 0.0053  0.0593  -0.0050 597 HIS A C   
2717 O  O   . HIS A 343 ? 1.2838 1.2858 1.2761 0.0066  0.0592  -0.0089 597 HIS A O   
2718 C  CB  . HIS A 343 ? 1.1456 1.1527 1.1351 0.0031  0.0600  -0.0051 597 HIS A CB  
2719 C  CG  . HIS A 343 ? 1.3266 1.3338 1.3148 0.0013  0.0597  -0.0030 597 HIS A CG  
2720 N  ND1 . HIS A 343 ? 1.4059 1.4065 1.3927 0.0003  0.0589  -0.0043 597 HIS A ND1 
2721 C  CD2 . HIS A 343 ? 1.4332 1.4462 1.4217 0.0004  0.0600  0.0005  597 HIS A CD2 
2722 C  CE1 . HIS A 343 ? 1.4637 1.4662 1.4501 -0.0011 0.0585  -0.0022 597 HIS A CE1 
2723 N  NE2 . HIS A 343 ? 1.4743 1.4841 1.4616 -0.0010 0.0590  0.0008  597 HIS A NE2 
2724 N  N   . ARG A 344 ? 0.9912 0.9973 0.9891 0.0056  0.0589  -0.0032 598 ARG A N   
2725 C  CA  . ARG A 344 ? 0.9737 0.9800 0.9735 0.0079  0.0586  -0.0058 598 ARG A CA  
2726 C  C   . ARG A 344 ? 0.9126 0.9255 0.9178 0.0076  0.0591  -0.0032 598 ARG A C   
2727 O  O   . ARG A 344 ? 0.8345 0.8487 0.8418 0.0056  0.0591  0.0007  598 ARG A O   
2728 C  CB  . ARG A 344 ? 0.8921 0.8885 0.8905 0.0093  0.0566  -0.0076 598 ARG A CB  
2729 C  CG  . ARG A 344 ? 0.8673 0.8601 0.8681 0.0092  0.0549  -0.0053 598 ARG A CG  
2730 C  CD  . ARG A 344 ? 0.7947 0.7783 0.7929 0.0111  0.0530  -0.0067 598 ARG A CD  
2731 N  NE  . ARG A 344 ? 0.6868 0.6685 0.6873 0.0114  0.0511  -0.0049 598 ARG A NE  
2732 C  CZ  . ARG A 344 ? 0.7072 0.6816 0.7048 0.0123  0.0494  -0.0047 598 ARG A CZ  
2733 N  NH1 . ARG A 344 ? 0.8178 0.7855 0.8100 0.0126  0.0498  -0.0054 598 ARG A NH1 
2734 N  NH2 . ARG A 344 ? 0.6869 0.6610 0.6873 0.0128  0.0475  -0.0037 598 ARG A NH2 
2735 N  N   . LEU A 345 ? 0.9834 1.0005 0.9914 0.0095  0.0595  -0.0054 599 LEU A N   
2736 C  CA  . LEU A 345 ? 1.0343 1.0586 1.0485 0.0089  0.0605  -0.0030 599 LEU A CA  
2737 C  C   . LEU A 345 ? 0.9690 0.9900 0.9872 0.0072  0.0590  0.0005  599 LEU A C   
2738 O  O   . LEU A 345 ? 0.8922 0.9185 0.9144 0.0051  0.0602  0.0046  599 LEU A O   
2739 C  CB  . LEU A 345 ? 1.0417 1.0687 1.0593 0.0115  0.0602  -0.0066 599 LEU A CB  
2740 C  CG  . LEU A 345 ? 1.0356 1.0722 1.0604 0.0108  0.0620  -0.0047 599 LEU A CG  
2741 C  CD1 . LEU A 345 ? 1.0028 1.0493 1.0265 0.0097  0.0654  -0.0027 599 LEU A CD1 
2742 C  CD2 . LEU A 345 ? 0.9978 1.0367 1.0268 0.0135  0.0613  -0.0087 599 LEU A CD2 
2743 N  N   . VAL A 346 ? 0.9084 0.9209 0.9256 0.0084  0.0564  -0.0010 600 VAL A N   
2744 C  CA  . VAL A 346 ? 0.8422 0.8514 0.8634 0.0076  0.0543  0.0011  600 VAL A CA  
2745 C  C   . VAL A 346 ? 0.8627 0.8633 0.8786 0.0073  0.0527  0.0011  600 VAL A C   
2746 O  O   . VAL A 346 ? 0.7260 0.7200 0.7388 0.0094  0.0510  -0.0012 600 VAL A O   
2747 C  CB  . VAL A 346 ? 0.8971 0.9061 0.9234 0.0097  0.0525  -0.0011 600 VAL A CB  
2748 C  CG1 . VAL A 346 ? 0.8755 0.8802 0.9052 0.0097  0.0497  -0.0002 600 VAL A CG1 
2749 C  CG2 . VAL A 346 ? 0.9564 0.9750 0.9894 0.0092  0.0546  -0.0004 600 VAL A CG2 
2750 N  N   . PRO A 347 ? 0.8750 0.8760 0.8901 0.0049  0.0532  0.0040  601 PRO A N   
2751 C  CA  . PRO A 347 ? 0.8697 0.8635 0.8798 0.0047  0.0521  0.0036  601 PRO A CA  
2752 C  C   . PRO A 347 ? 0.7694 0.7580 0.7812 0.0056  0.0493  0.0033  601 PRO A C   
2753 O  O   . PRO A 347 ? 0.7711 0.7623 0.7892 0.0059  0.0481  0.0039  601 PRO A O   
2754 C  CB  . PRO A 347 ? 0.8800 0.8766 0.8897 0.0021  0.0532  0.0065  601 PRO A CB  
2755 C  CG  . PRO A 347 ? 0.8813 0.8856 0.8966 0.0009  0.0543  0.0094  601 PRO A CG  
2756 C  CD  . PRO A 347 ? 0.9339 0.9407 0.9537 0.0025  0.0542  0.0080  601 PRO A CD  
2757 N  N   . PRO A 348 ? 0.7527 0.7345 0.7592 0.0062  0.0485  0.0023  602 PRO A N   
2758 C  CA  . PRO A 348 ? 0.7920 0.7692 0.7986 0.0074  0.0459  0.0019  602 PRO A CA  
2759 C  C   . PRO A 348 ? 0.7284 0.7087 0.7414 0.0059  0.0446  0.0038  602 PRO A C   
2760 O  O   . PRO A 348 ? 0.7587 0.7419 0.7729 0.0035  0.0458  0.0060  602 PRO A O   
2761 C  CB  . PRO A 348 ? 0.8113 0.7827 0.8110 0.0071  0.0465  0.0016  602 PRO A CB  
2762 C  CG  . PRO A 348 ? 0.7859 0.7575 0.7819 0.0064  0.0490  0.0009  602 PRO A CG  
2763 C  CD  . PRO A 348 ? 0.7487 0.7275 0.7489 0.0057  0.0501  0.0014  602 PRO A CD  
2764 N  N   . PRO A 349 ? 0.6703 0.6505 0.6881 0.0074  0.0420  0.0028  603 PRO A N   
2765 C  CA  . PRO A 349 ? 0.7285 0.7104 0.7531 0.0062  0.0399  0.0040  603 PRO A CA  
2766 C  C   . PRO A 349 ? 0.7879 0.7667 0.8084 0.0050  0.0399  0.0047  603 PRO A C   
2767 O  O   . PRO A 349 ? 0.7314 0.7054 0.7444 0.0062  0.0401  0.0032  603 PRO A O   
2768 C  CB  . PRO A 349 ? 0.7200 0.7001 0.7472 0.0093  0.0366  0.0012  603 PRO A CB  
2769 C  CG  . PRO A 349 ? 0.6964 0.6752 0.7199 0.0119  0.0371  -0.0008 603 PRO A CG  
2770 C  CD  . PRO A 349 ? 0.6749 0.6519 0.6908 0.0109  0.0402  0.0001  603 PRO A CD  
2771 N  N   . GLU A 350 ? 0.7639 0.7453 0.7888 0.0025  0.0398  0.0070  604 GLU A N   
2772 C  CA  . GLU A 350 ? 0.8274 0.8062 0.8488 0.0014  0.0396  0.0073  604 GLU A CA  
2773 C  C   . GLU A 350 ? 0.7875 0.7625 0.8072 0.0033  0.0371  0.0046  604 GLU A C   
2774 O  O   . GLU A 350 ? 0.8338 0.8061 0.8481 0.0031  0.0377  0.0040  604 GLU A O   
2775 C  CB  . GLU A 350 ? 0.8640 0.8462 0.8907 -0.0013 0.0396  0.0104  604 GLU A CB  
2776 C  CG  . GLU A 350 ? 0.9655 0.9511 0.9896 -0.0031 0.0426  0.0130  604 GLU A CG  
2777 C  CD  . GLU A 350 ? 1.0725 1.0560 1.0879 -0.0033 0.0446  0.0117  604 GLU A CD  
2778 O  OE1 . GLU A 350 ? 0.9234 0.9041 0.9365 -0.0037 0.0438  0.0107  604 GLU A OE1 
2779 O  OE2 . GLU A 350 ? 0.9582 0.9432 0.9697 -0.0031 0.0470  0.0114  604 GLU A OE2 
2780 N  N   . GLU A 351 ? 0.7250 0.7001 0.7490 0.0055  0.0345  0.0028  605 GLU A N   
2781 C  CA  . GLU A 351 ? 0.8458 0.8181 0.8674 0.0080  0.0321  0.0000  605 GLU A CA  
2782 C  C   . GLU A 351 ? 0.8141 0.7819 0.8249 0.0095  0.0339  -0.0009 605 GLU A C   
2783 O  O   . GLU A 351 ? 0.7694 0.7349 0.7758 0.0103  0.0336  -0.0019 605 GLU A O   
2784 C  CB  . GLU A 351 ? 0.8634 0.8372 0.8915 0.0106  0.0287  -0.0023 605 GLU A CB  
2785 C  CG  . GLU A 351 ? 0.8795 0.8572 0.9197 0.0089  0.0267  -0.0015 605 GLU A CG  
2786 C  CD  . GLU A 351 ? 0.8773 0.8586 0.9234 0.0074  0.0283  0.0007  605 GLU A CD  
2787 O  OE1 . GLU A 351 ? 0.8723 0.8539 0.9134 0.0061  0.0317  0.0028  605 GLU A OE1 
2788 O  OE2 . GLU A 351 ? 0.9473 0.9312 1.0031 0.0077  0.0261  -0.0001 605 GLU A OE2 
2789 N  N   . THR A 352 ? 0.7409 0.7078 0.7481 0.0098  0.0361  -0.0002 606 THR A N   
2790 C  CA  . THR A 352 ? 0.6916 0.6537 0.6899 0.0111  0.0377  -0.0007 606 THR A CA  
2791 C  C   . THR A 352 ? 0.6610 0.6214 0.6549 0.0088  0.0402  0.0003  606 THR A C   
2792 O  O   . THR A 352 ? 0.7101 0.6670 0.6983 0.0096  0.0408  -0.0002 606 THR A O   
2793 C  CB  . THR A 352 ? 0.6280 0.5890 0.6243 0.0126  0.0388  -0.0009 606 THR A CB  
2794 O  OG1 . THR A 352 ? 0.6711 0.6348 0.6691 0.0102  0.0411  0.0003  606 THR A OG1 
2795 C  CG2 . THR A 352 ? 0.6451 0.6080 0.6462 0.0152  0.0359  -0.0024 606 THR A CG2 
2796 N  N   . TYR A 353 ? 0.7014 0.6647 0.6980 0.0059  0.0417  0.0017  607 TYR A N   
2797 C  CA  . TYR A 353 ? 0.7237 0.6865 0.7177 0.0036  0.0436  0.0022  607 TYR A CA  
2798 C  C   . TYR A 353 ? 0.7221 0.6844 0.7162 0.0034  0.0423  0.0015  607 TYR A C   
2799 O  O   . TYR A 353 ? 0.7660 0.7255 0.7551 0.0031  0.0438  0.0008  607 TYR A O   
2800 C  CB  . TYR A 353 ? 0.7732 0.7406 0.7715 0.0012  0.0443  0.0039  607 TYR A CB  
2801 C  CG  . TYR A 353 ? 0.7448 0.7129 0.7406 0.0008  0.0467  0.0041  607 TYR A CG  
2802 C  CD1 . TYR A 353 ? 0.8767 0.8421 0.8674 0.0001  0.0488  0.0031  607 TYR A CD1 
2803 C  CD2 . TYR A 353 ? 0.8115 0.7837 0.8110 0.0009  0.0468  0.0050  607 TYR A CD2 
2804 C  CE1 . TYR A 353 ? 0.9203 0.8867 0.9095 0.0000  0.0506  0.0026  607 TYR A CE1 
2805 C  CE2 . TYR A 353 ? 0.8221 0.7958 0.8195 0.0009  0.0489  0.0046  607 TYR A CE2 
2806 C  CZ  . TYR A 353 ? 0.8822 0.8529 0.8745 0.0006  0.0506  0.0031  607 TYR A CZ  
2807 O  OH  . TYR A 353 ? 0.9142 0.8866 0.9050 0.0008  0.0523  0.0020  607 TYR A OH  
2808 N  N   . SER A 354 ? 0.7401 0.7051 0.7404 0.0036  0.0395  0.0013  608 SER A N   
2809 C  CA  . SER A 354 ? 0.7382 0.7031 0.7393 0.0042  0.0376  -0.0002 608 SER A CA  
2810 C  C   . SER A 354 ? 0.7323 0.6940 0.7270 0.0066  0.0378  -0.0020 608 SER A C   
2811 O  O   . SER A 354 ? 0.7167 0.6779 0.7088 0.0063  0.0384  -0.0028 608 SER A O   
2812 C  CB  . SER A 354 ? 0.7763 0.7440 0.7857 0.0051  0.0340  -0.0010 608 SER A CB  
2813 O  OG  . SER A 354 ? 0.7493 0.7198 0.7648 0.0027  0.0337  0.0010  608 SER A OG  
2814 N  N   . LEU A 355 ? 0.7592 0.7193 0.7518 0.0094  0.0371  -0.0025 609 LEU A N   
2815 C  CA  . LEU A 355 ? 0.7187 0.6764 0.7052 0.0124  0.0367  -0.0038 609 LEU A CA  
2816 C  C   . LEU A 355 ? 0.6808 0.6347 0.6595 0.0114  0.0404  -0.0025 609 LEU A C   
2817 O  O   . LEU A 355 ? 0.6718 0.6249 0.6464 0.0119  0.0413  -0.0031 609 LEU A O   
2818 C  CB  . LEU A 355 ? 0.7755 0.7325 0.7617 0.0158  0.0347  -0.0046 609 LEU A CB  
2819 C  CG  . LEU A 355 ? 0.7563 0.7171 0.7511 0.0172  0.0306  -0.0066 609 LEU A CG  
2820 C  CD1 . LEU A 355 ? 0.7797 0.7397 0.7735 0.0208  0.0289  -0.0077 609 LEU A CD1 
2821 C  CD2 . LEU A 355 ? 0.7835 0.7463 0.7800 0.0187  0.0279  -0.0092 609 LEU A CD2 
2822 N  N   . HIS A 356 ? 0.7030 0.6549 0.6803 0.0098  0.0429  -0.0009 610 HIS A N   
2823 C  CA  . HIS A 356 ? 0.6712 0.6195 0.6431 0.0082  0.0465  0.0001  610 HIS A CA  
2824 C  C   . HIS A 356 ? 0.6962 0.6462 0.6694 0.0052  0.0479  -0.0002 610 HIS A C   
2825 O  O   . HIS A 356 ? 0.7063 0.6540 0.6752 0.0045  0.0504  0.0000  610 HIS A O   
2826 C  CB  . HIS A 356 ? 0.6513 0.5975 0.6225 0.0074  0.0483  0.0011  610 HIS A CB  
2827 C  CG  . HIS A 356 ? 0.6972 0.6398 0.6649 0.0105  0.0478  0.0015  610 HIS A CG  
2828 N  ND1 . HIS A 356 ? 0.7292 0.6675 0.6905 0.0129  0.0483  0.0022  610 HIS A ND1 
2829 C  CD2 . HIS A 356 ? 0.7219 0.6646 0.6914 0.0117  0.0469  0.0013  610 HIS A CD2 
2830 C  CE1 . HIS A 356 ? 0.7146 0.6501 0.6739 0.0155  0.0474  0.0025  610 HIS A CE1 
2831 N  NE2 . HIS A 356 ? 0.6878 0.6261 0.6523 0.0149  0.0465  0.0017  610 HIS A NE2 
2832 N  N   . LYS A 357 ? 0.7497 0.7038 0.7289 0.0034  0.0465  -0.0006 611 LYS A N   
2833 C  CA  . LYS A 357 ? 0.7844 0.7406 0.7654 0.0008  0.0474  -0.0012 611 LYS A CA  
2834 C  C   . LYS A 357 ? 0.7222 0.6793 0.7028 0.0020  0.0461  -0.0027 611 LYS A C   
2835 O  O   . LYS A 357 ? 0.7414 0.6986 0.7202 0.0008  0.0478  -0.0035 611 LYS A O   
2836 C  CB  . LYS A 357 ? 0.8968 0.8570 0.8841 -0.0009 0.0457  -0.0008 611 LYS A CB  
2837 C  CG  . LYS A 357 ? 1.1688 1.1298 1.1567 -0.0023 0.0471  0.0005  611 LYS A CG  
2838 C  CD  . LYS A 357 ? 1.3067 1.2721 1.3008 -0.0030 0.0451  0.0018  611 LYS A CD  
2839 C  CE  . LYS A 357 ? 1.3233 1.2903 1.3177 -0.0034 0.0463  0.0032  611 LYS A CE  
2840 N  NZ  . LYS A 357 ? 1.3261 1.2946 1.3187 -0.0050 0.0484  0.0032  611 LYS A NZ  
2841 N  N   . LYS A 358 ? 0.6644 0.6227 0.6468 0.0046  0.0430  -0.0036 612 LYS A N   
2842 C  CA  . LYS A 358 ? 0.6645 0.6246 0.6468 0.0062  0.0414  -0.0058 612 LYS A CA  
2843 C  C   . LYS A 358 ? 0.7118 0.6693 0.6860 0.0072  0.0444  -0.0056 612 LYS A C   
2844 O  O   . LYS A 358 ? 0.7908 0.7498 0.7640 0.0065  0.0456  -0.0068 612 LYS A O   
2845 C  CB  . LYS A 358 ? 0.6688 0.6309 0.6550 0.0093  0.0373  -0.0074 612 LYS A CB  
2846 C  CG  . LYS A 358 ? 0.6503 0.6146 0.6354 0.0118  0.0356  -0.0103 612 LYS A CG  
2847 C  CD  . LYS A 358 ? 0.6445 0.6123 0.6361 0.0101  0.0338  -0.0122 612 LYS A CD  
2848 C  CE  . LYS A 358 ? 0.6876 0.6583 0.6786 0.0124  0.0323  -0.0156 612 LYS A CE  
2849 N  NZ  . LYS A 358 ? 0.7626 0.7365 0.7608 0.0108  0.0303  -0.0176 612 LYS A NZ  
2850 N  N   . MSE A 359 ? 0.7137 0.6675 0.6825 0.0090  0.0456  -0.0040 613 MSE A N   
2851 C  CA  . MSE A 359 ? 0.6794 0.6301 0.6401 0.0103  0.0485  -0.0029 613 MSE A CA  
2852 C  C   . MSE A 359 ? 0.7701 0.7187 0.7294 0.0068  0.0528  -0.0015 613 MSE A C   
2853 O  O   . MSE A 359 ? 0.7906 0.7397 0.7471 0.0061  0.0552  -0.0017 613 MSE A O   
2854 C  CB  . MSE A 359 ? 0.6924 0.6389 0.6480 0.0131  0.0487  -0.0010 613 MSE A CB  
2855 C  CG  . MSE A 359 ? 0.7232 0.6662 0.6698 0.0152  0.0512  0.0009  613 MSE A CG  
2856 SE SE  . MSE A 359 ? 0.8447 0.7930 0.7885 0.0197  0.0484  -0.0019 613 MSE A SE  
2857 C  CE  . MSE A 359 ? 0.7456 0.6912 0.6865 0.0247  0.0450  -0.0014 613 MSE A CE  
2858 N  N   . GLY A 360 ? 0.7008 0.6478 0.6627 0.0045  0.0537  -0.0006 614 GLY A N   
2859 C  CA  . GLY A 360 ? 0.6907 0.6358 0.6523 0.0011  0.0574  0.0000  614 GLY A CA  
2860 C  C   . GLY A 360 ? 0.6491 0.5979 0.6140 -0.0013 0.0580  -0.0018 614 GLY A C   
2861 O  O   . GLY A 360 ? 0.7161 0.6641 0.6793 -0.0030 0.0613  -0.0018 614 GLY A O   
2862 N  N   . GLY A 361 ? 0.6570 0.6100 0.6270 -0.0012 0.0548  -0.0034 615 GLY A N   
2863 C  CA  . GLY A 361 ? 0.6648 0.6216 0.6387 -0.0031 0.0544  -0.0054 615 GLY A CA  
2864 C  C   . GLY A 361 ? 0.6937 0.6522 0.6655 -0.0021 0.0552  -0.0068 615 GLY A C   
2865 O  O   . GLY A 361 ? 0.7265 0.6870 0.6998 -0.0042 0.0568  -0.0082 615 GLY A O   
2866 N  N   . SER A 362 ? 0.6998 0.6582 0.6682 0.0012  0.0538  -0.0067 616 SER A N   
2867 C  CA  . SER A 362 ? 0.6724 0.6334 0.6381 0.0027  0.0543  -0.0083 616 SER A CA  
2868 C  C   . SER A 362 ? 0.7516 0.7097 0.7115 0.0014  0.0596  -0.0062 616 SER A C   
2869 O  O   . SER A 362 ? 0.7177 0.6785 0.6777 0.0002  0.0619  -0.0075 616 SER A O   
2870 C  CB  . SER A 362 ? 0.6958 0.6579 0.6591 0.0071  0.0514  -0.0091 616 SER A CB  
2871 O  OG  . SER A 362 ? 0.6624 0.6272 0.6325 0.0078  0.0467  -0.0111 616 SER A OG  
2872 N  N   . PHE A 363 ? 0.6919 0.6446 0.6479 0.0015  0.0615  -0.0031 617 PHE A N   
2873 C  CA  . PHE A 363 ? 0.7931 0.7420 0.7451 -0.0002 0.0664  -0.0007 617 PHE A CA  
2874 C  C   . PHE A 363 ? 0.7893 0.7395 0.7462 -0.0045 0.0690  -0.0021 617 PHE A C   
2875 O  O   . PHE A 363 ? 0.7656 0.7157 0.7210 -0.0060 0.0729  -0.0014 617 PHE A O   
2876 C  CB  . PHE A 363 ? 0.7558 0.6982 0.7041 0.0005  0.0675  0.0026  617 PHE A CB  
2877 C  CG  . PHE A 363 ? 0.7684 0.7084 0.7092 0.0045  0.0674  0.0049  617 PHE A CG  
2878 C  CD1 . PHE A 363 ? 0.6952 0.6380 0.6352 0.0083  0.0631  0.0034  617 PHE A CD1 
2879 C  CD2 . PHE A 363 ? 0.7592 0.6942 0.6939 0.0046  0.0715  0.0086  617 PHE A CD2 
2880 C  CE1 . PHE A 363 ? 0.7273 0.6685 0.6604 0.0125  0.0625  0.0050  617 PHE A CE1 
2881 C  CE2 . PHE A 363 ? 0.7243 0.6572 0.6516 0.0087  0.0711  0.0110  617 PHE A CE2 
2882 C  CZ  . PHE A 363 ? 0.7508 0.6871 0.6770 0.0128  0.0665  0.0089  617 PHE A CZ  
2883 N  N   . LEU A 364 ? 0.7634 0.7150 0.7262 -0.0063 0.0668  -0.0038 618 LEU A N   
2884 C  CA  . LEU A 364 ? 0.7784 0.7317 0.7461 -0.0099 0.0686  -0.0056 618 LEU A CA  
2885 C  C   . LEU A 364 ? 0.7734 0.7320 0.7440 -0.0107 0.0687  -0.0085 618 LEU A C   
2886 O  O   . LEU A 364 ? 0.8537 0.8133 0.8267 -0.0135 0.0716  -0.0097 618 LEU A O   
2887 C  CB  . LEU A 364 ? 0.7992 0.7536 0.7718 -0.0108 0.0658  -0.0067 618 LEU A CB  
2888 C  CG  . LEU A 364 ? 0.8855 0.8355 0.8567 -0.0107 0.0661  -0.0048 618 LEU A CG  
2889 C  CD1 . LEU A 364 ? 0.9327 0.8851 0.9086 -0.0120 0.0641  -0.0062 618 LEU A CD1 
2890 C  CD2 . LEU A 364 ? 0.9116 0.8566 0.8802 -0.0121 0.0705  -0.0032 618 LEU A CD2 
2891 N  N   . ILE A 365 ? 0.7961 0.7586 0.7676 -0.0084 0.0651  -0.0101 619 ILE A N   
2892 C  CA  . ILE A 365 ? 0.7703 0.7382 0.7446 -0.0086 0.0647  -0.0133 619 ILE A CA  
2893 C  C   . ILE A 365 ? 0.7571 0.7252 0.7268 -0.0087 0.0692  -0.0125 619 ILE A C   
2894 O  O   . ILE A 365 ? 0.8086 0.7800 0.7808 -0.0106 0.0715  -0.0146 619 ILE A O   
2895 C  CB  . ILE A 365 ? 0.7496 0.7209 0.7257 -0.0055 0.0598  -0.0152 619 ILE A CB  
2896 C  CG1 . ILE A 365 ? 0.7523 0.7234 0.7336 -0.0059 0.0558  -0.0153 619 ILE A CG1 
2897 C  CG2 . ILE A 365 ? 0.7185 0.6956 0.6970 -0.0051 0.0593  -0.0190 619 ILE A CG2 
2898 C  CD1 . ILE A 365 ? 0.8392 0.8129 0.8238 -0.0032 0.0507  -0.0168 619 ILE A CD1 
2899 N  N   . CYS A 366 ? 0.7566 0.7210 0.7194 -0.0067 0.0709  -0.0093 620 CYS A N   
2900 C  CA  . CYS A 366 ? 0.7595 0.7240 0.7170 -0.0065 0.0756  -0.0076 620 CYS A CA  
2901 C  C   . CYS A 366 ? 0.7808 0.7419 0.7396 -0.0106 0.0808  -0.0057 620 CYS A C   
2902 O  O   . CYS A 366 ? 0.7541 0.7174 0.7127 -0.0122 0.0850  -0.0057 620 CYS A O   
2903 C  CB  . CYS A 366 ? 0.7590 0.7208 0.7083 -0.0027 0.0756  -0.0044 620 CYS A CB  
2904 S  SG  . CYS A 366 ? 0.8028 0.7688 0.7507 0.0027  0.0695  -0.0071 620 CYS A SG  
2905 N  N   . SER A 367 ? 0.7959 0.7522 0.7569 -0.0123 0.0805  -0.0046 621 SER A N   
2906 C  CA  . SER A 367 ? 0.8364 0.7892 0.8004 -0.0160 0.0845  -0.0036 621 SER A CA  
2907 C  C   . SER A 367 ? 0.8208 0.7788 0.7920 -0.0188 0.0847  -0.0078 621 SER A C   
2908 O  O   . SER A 367 ? 0.8113 0.7706 0.7842 -0.0212 0.0889  -0.0080 621 SER A O   
2909 C  CB  . SER A 367 ? 0.8375 0.7848 0.8024 -0.0164 0.0832  -0.0023 621 SER A CB  
2910 O  OG  . SER A 367 ? 0.9104 0.8534 0.8775 -0.0195 0.0873  -0.0010 621 SER A OG  
2911 N  N   . LYS A 368 ? 0.8702 0.8315 0.8456 -0.0184 0.0801  -0.0109 622 LYS A N   
2912 C  CA  . LYS A 368 ? 0.8871 0.8539 0.8694 -0.0204 0.0793  -0.0153 622 LYS A CA  
2913 C  C   . LYS A 368 ? 0.9137 0.8856 0.8965 -0.0209 0.0818  -0.0172 622 LYS A C   
2914 O  O   . LYS A 368 ? 0.9763 0.9506 0.9640 -0.0237 0.0844  -0.0195 622 LYS A O   
2915 C  CB  . LYS A 368 ? 0.8200 0.7898 0.8056 -0.0190 0.0735  -0.0176 622 LYS A CB  
2916 C  CG  . LYS A 368 ? 0.9256 0.8924 0.9128 -0.0197 0.0719  -0.0169 622 LYS A CG  
2917 C  CD  . LYS A 368 ? 1.0165 0.9858 1.0061 -0.0181 0.0666  -0.0178 622 LYS A CD  
2918 C  CE  . LYS A 368 ? 1.1246 1.0928 1.1165 -0.0193 0.0657  -0.0180 622 LYS A CE  
2919 N  NZ  . LYS A 368 ? 1.1485 1.1173 1.1406 -0.0175 0.0616  -0.0168 622 LYS A NZ  
2920 N  N   . LEU A 369 ? 0.8530 0.8269 0.8311 -0.0179 0.0811  -0.0165 623 LEU A N   
2921 C  CA  . LEU A 369 ? 0.8034 0.7833 0.7818 -0.0177 0.0831  -0.0188 623 LEU A CA  
2922 C  C   . LEU A 369 ? 0.9188 0.8974 0.8925 -0.0187 0.0896  -0.0155 623 LEU A C   
2923 O  O   . LEU A 369 ? 0.9219 0.9061 0.8948 -0.0183 0.0920  -0.0169 623 LEU A O   
2924 C  CB  . LEU A 369 ? 0.8208 0.8047 0.7972 -0.0137 0.0788  -0.0206 623 LEU A CB  
2925 C  CG  . LEU A 369 ? 0.8750 0.8622 0.8581 -0.0132 0.0731  -0.0247 623 LEU A CG  
2926 C  CD1 . LEU A 369 ? 0.8795 0.8689 0.8612 -0.0091 0.0683  -0.0259 623 LEU A CD1 
2927 C  CD2 . LEU A 369 ? 0.8316 0.8248 0.8211 -0.0152 0.0740  -0.0292 623 LEU A CD2 
2928 N  N   . LYS A 370 ? 0.8758 0.8473 0.8464 -0.0198 0.0923  -0.0110 624 LYS A N   
2929 C  CA  . LYS A 370 ? 0.9763 0.9449 0.9431 -0.0212 0.0987  -0.0067 624 LYS A CA  
2930 C  C   . LYS A 370 ? 0.9576 0.9282 0.9159 -0.0178 0.1002  -0.0042 624 LYS A C   
2931 O  O   . LYS A 370 ? 0.9281 0.9004 0.8840 -0.0189 0.1057  -0.0020 624 LYS A O   
2932 C  CB  . LYS A 370 ? 1.0646 1.0360 1.0385 -0.0257 0.1032  -0.0088 624 LYS A CB  
2933 C  CG  . LYS A 370 ? 1.1330 1.0985 1.1121 -0.0292 0.1046  -0.0079 624 LYS A CG  
2934 C  CD  . LYS A 370 ? 1.2284 1.1979 1.2176 -0.0326 0.1045  -0.0132 624 LYS A CD  
2935 C  CE  . LYS A 370 ? 1.2792 1.2437 1.2729 -0.0343 0.1027  -0.0139 624 LYS A CE  
2936 N  NZ  . LYS A 370 ? 1.3313 1.2971 1.3339 -0.0385 0.1061  -0.0166 624 LYS A NZ  
2937 N  N   . ALA A 371 ? 0.9539 0.9241 0.9075 -0.0136 0.0954  -0.0042 625 ALA A N   
2938 C  CA  . ALA A 371 ? 0.9455 0.9184 0.8909 -0.0093 0.0955  -0.0027 625 ALA A CA  
2939 C  C   . ALA A 371 ? 0.8472 0.8138 0.7842 -0.0083 0.0993  0.0039  625 ALA A C   
2940 O  O   . ALA A 371 ? 0.8684 0.8275 0.8057 -0.0098 0.1000  0.0070  625 ALA A O   
2941 C  CB  . ALA A 371 ? 0.9523 0.9275 0.8970 -0.0051 0.0885  -0.0057 625 ALA A CB  
2942 N  N   . ARG A 372 ? 0.8479 0.8177 0.7772 -0.0052 0.1014  0.0057  626 ARG A N   
2943 C  CA  . ARG A 372 ? 1.0323 0.9966 0.9526 -0.0036 0.1051  0.0124  626 ARG A CA  
2944 C  C   . ARG A 372 ? 1.0398 1.0089 0.9506 0.0024  0.1036  0.0126  626 ARG A C   
2945 O  O   . ARG A 372 ? 1.0763 1.0533 0.9854 0.0034  0.1054  0.0106  626 ARG A O   
2946 C  CB  . ARG A 372 ? 1.1043 1.0671 1.0259 -0.0081 0.1129  0.0163  626 ARG A CB  
2947 C  CG  . ARG A 372 ? 1.1834 1.1392 1.0969 -0.0073 0.1175  0.0242  626 ARG A CG  
2948 C  CD  . ARG A 372 ? 1.2956 1.2490 1.2136 -0.0129 0.1250  0.0278  626 ARG A CD  
2949 N  NE  . ARG A 372 ? 1.2906 1.2375 1.2002 -0.0119 0.1298  0.0361  626 ARG A NE  
2950 C  CZ  . ARG A 372 ? 1.3059 1.2564 1.2056 -0.0086 0.1331  0.0401  626 ARG A CZ  
2951 N  NH1 . ARG A 372 ? 1.2801 1.2411 1.1771 -0.0060 0.1323  0.0360  626 ARG A NH1 
2952 N  NH2 . ARG A 372 ? 1.2968 1.2402 1.1889 -0.0076 0.1369  0.0483  626 ARG A NH2 
2953 N  N   . PHE A 373 ? 1.0172 0.9819 0.9223 0.0065  0.0997  0.0144  627 PHE A N   
2954 C  CA  . PHE A 373 ? 0.9111 0.8799 0.8075 0.0128  0.0970  0.0141  627 PHE A CA  
2955 C  C   . PHE A 373 ? 0.8891 0.8507 0.7788 0.0165  0.0945  0.0180  627 PHE A C   
2956 O  O   . PHE A 373 ? 0.8192 0.7740 0.7128 0.0144  0.0931  0.0191  627 PHE A O   
2957 C  CB  . PHE A 373 ? 0.8741 0.8506 0.7753 0.0152  0.0909  0.0066  627 PHE A CB  
2958 C  CG  . PHE A 373 ? 0.8625 0.8362 0.7721 0.0141  0.0851  0.0032  627 PHE A CG  
2959 C  CD1 . PHE A 373 ? 0.7886 0.7586 0.6958 0.0176  0.0803  0.0035  627 PHE A CD1 
2960 C  CD2 . PHE A 373 ? 0.8742 0.8501 0.7936 0.0101  0.0841  -0.0008 627 PHE A CD2 
2961 C  CE1 . PHE A 373 ? 0.7539 0.7226 0.6687 0.0168  0.0752  0.0004  627 PHE A CE1 
2962 C  CE2 . PHE A 373 ? 0.8548 0.8290 0.7815 0.0094  0.0788  -0.0037 627 PHE A CE2 
2963 C  CZ  . PHE A 373 ? 0.8550 0.8254 0.7793 0.0126  0.0747  -0.0028 627 PHE A CZ  
2964 N  N   . PRO A 374 ? 0.9573 0.9209 0.8367 0.0222  0.0939  0.0199  628 PRO A N   
2965 C  CA  . PRO A 374 ? 0.9121 0.8690 0.7851 0.0262  0.0911  0.0233  628 PRO A CA  
2966 C  C   . PRO A 374 ? 0.8793 0.8375 0.7568 0.0290  0.0833  0.0177  628 PRO A C   
2967 O  O   . PRO A 374 ? 0.9674 0.9336 0.8481 0.0309  0.0798  0.0118  628 PRO A O   
2968 C  CB  . PRO A 374 ? 0.9395 0.9001 0.7999 0.0318  0.0929  0.0263  628 PRO A CB  
2969 C  CG  . PRO A 374 ? 0.9163 0.8838 0.7761 0.0296  0.0986  0.0264  628 PRO A CG  
2970 C  CD  . PRO A 374 ? 0.9473 0.9191 0.8195 0.0253  0.0966  0.0197  628 PRO A CD  
2971 N  N   . CYS A 375 ? 0.8319 0.7829 0.7100 0.0295  0.0807  0.0195  629 CYS A N   
2972 C  CA  . CYS A 375 ? 0.8129 0.7647 0.6966 0.0316  0.0736  0.0146  629 CYS A CA  
2973 C  C   . CYS A 375 ? 0.8075 0.7576 0.6841 0.0381  0.0695  0.0153  629 CYS A C   
2974 O  O   . CYS A 375 ? 0.8045 0.7566 0.6854 0.0406  0.0635  0.0109  629 CYS A O   
2975 C  CB  . CYS A 375 ? 0.7822 0.7284 0.6744 0.0268  0.0733  0.0148  629 CYS A CB  
2976 S  SG  . CYS A 375 ? 0.8705 0.8196 0.7718 0.0200  0.0767  0.0126  629 CYS A SG  
2977 N  N   . LYS A 376 ? 0.7909 0.7382 0.6567 0.0411  0.0725  0.0207  630 LYS A N   
2978 C  CA  . LYS A 376 ? 0.7785 0.7236 0.6372 0.0475  0.0685  0.0216  630 LYS A CA  
2979 C  C   . LYS A 376 ? 0.7933 0.7468 0.6509 0.0533  0.0629  0.0155  630 LYS A C   
2980 O  O   . LYS A 376 ? 0.8582 0.8116 0.7182 0.0569  0.0569  0.0123  630 LYS A O   
2981 C  CB  . LYS A 376 ? 0.7807 0.7211 0.6273 0.0499  0.0729  0.0290  630 LYS A CB  
2982 C  CG  . LYS A 376 ? 0.8408 0.7783 0.6800 0.0566  0.0687  0.0302  630 LYS A CG  
2983 C  CD  . LYS A 376 ? 0.9490 0.8815 0.7757 0.0590  0.0734  0.0385  630 LYS A CD  
2984 C  CE  . LYS A 376 ? 1.0764 1.0028 0.8975 0.0644  0.0693  0.0407  630 LYS A CE  
2985 N  NZ  . LYS A 376 ? 1.1834 1.1110 0.9902 0.0718  0.0692  0.0444  630 LYS A NZ  
2986 N  N   . ALA A 377 ? 0.7933 0.7546 0.6478 0.0546  0.0645  0.0137  631 ALA A N   
2987 C  CA  . ALA A 377 ? 0.8165 0.7864 0.6692 0.0609  0.0591  0.0076  631 ALA A CA  
2988 C  C   . ALA A 377 ? 0.8379 0.8113 0.7036 0.0598  0.0531  0.0001  631 ALA A C   
2989 O  O   . ALA A 377 ? 0.8116 0.7879 0.6785 0.0647  0.0470  -0.0044 631 ALA A O   
2990 C  CB  . ALA A 377 ? 0.8071 0.7853 0.6543 0.0624  0.0624  0.0066  631 ALA A CB  
2991 N  N   . MSE A 378 ? 0.8320 0.8050 0.7075 0.0533  0.0547  -0.0012 632 MSE A N   
2992 C  CA  . MSE A 378 ? 0.8029 0.7784 0.6911 0.0519  0.0492  -0.0073 632 MSE A CA  
2993 C  C   . MSE A 378 ? 0.8021 0.7721 0.6929 0.0532  0.0452  -0.0069 632 MSE A C   
2994 O  O   . MSE A 378 ? 0.7715 0.7450 0.6671 0.0567  0.0392  -0.0119 632 MSE A O   
2995 C  CB  . MSE A 378 ? 0.7454 0.7208 0.6433 0.0452  0.0512  -0.0083 632 MSE A CB  
2996 C  CG  . MSE A 378 ? 0.7640 0.7315 0.6623 0.0395  0.0563  -0.0026 632 MSE A CG  
2997 SE SE  . MSE A 378 ? 0.7825 0.7527 0.6944 0.0326  0.0565  -0.0063 632 MSE A SE  
2998 C  CE  . MSE A 378 ? 0.8202 0.7975 0.7276 0.0320  0.0617  -0.0069 632 MSE A CE  
2999 N  N   . PHE A 379 ? 0.8051 0.7669 0.6930 0.0508  0.0484  -0.0011 633 PHE A N   
3000 C  CA  . PHE A 379 ? 0.7829 0.7400 0.6737 0.0520  0.0447  -0.0011 633 PHE A CA  
3001 C  C   . PHE A 379 ? 0.7993 0.7577 0.6834 0.0594  0.0405  -0.0023 633 PHE A C   
3002 O  O   . PHE A 379 ? 0.8023 0.7625 0.6925 0.0618  0.0350  -0.0065 633 PHE A O   
3003 C  CB  . PHE A 379 ? 0.8055 0.7537 0.6952 0.0481  0.0486  0.0047  633 PHE A CB  
3004 C  CG  . PHE A 379 ? 0.7567 0.7013 0.6502 0.0494  0.0448  0.0041  633 PHE A CG  
3005 C  CD1 . PHE A 379 ? 0.7908 0.7379 0.6955 0.0473  0.0412  -0.0001 633 PHE A CD1 
3006 C  CD2 . PHE A 379 ? 0.7465 0.6861 0.6326 0.0533  0.0443  0.0072  633 PHE A CD2 
3007 C  CE1 . PHE A 379 ? 0.8327 0.7775 0.7415 0.0485  0.0378  -0.0010 633 PHE A CE1 
3008 C  CE2 . PHE A 379 ? 0.8312 0.7684 0.7213 0.0548  0.0405  0.0059  633 PHE A CE2 
3009 C  CZ  . PHE A 379 ? 0.8228 0.7630 0.7245 0.0524  0.0373  0.0016  633 PHE A CZ  
3010 N  N   . GLU A 380 ? 0.8291 0.7871 0.7010 0.0633  0.0430  0.0013  634 GLU A N   
3011 C  CA  . GLU A 380 ? 0.8755 0.8354 0.7402 0.0712  0.0385  -0.0003 634 GLU A CA  
3012 C  C   . GLU A 380 ? 0.8871 0.8566 0.7572 0.0754  0.0323  -0.0086 634 GLU A C   
3013 O  O   . GLU A 380 ? 0.8782 0.8490 0.7512 0.0798  0.0264  -0.0126 634 GLU A O   
3014 C  CB  . GLU A 380 ? 0.8860 0.8444 0.7357 0.0749  0.0426  0.0056  634 GLU A CB  
3015 C  CG  . GLU A 380 ? 0.8936 0.8415 0.7379 0.0720  0.0478  0.0140  634 GLU A CG  
3016 C  CD  . GLU A 380 ? 0.9337 0.8750 0.7790 0.0740  0.0443  0.0150  634 GLU A CD  
3017 O  OE1 . GLU A 380 ? 1.0141 0.9586 0.8596 0.0797  0.0382  0.0106  634 GLU A OE1 
3018 O  OE2 . GLU A 380 ? 0.9668 0.9000 0.8138 0.0697  0.0474  0.0196  634 GLU A OE2 
3019 N  N   . GLU A 381 ? 0.8974 0.8733 0.7703 0.0738  0.0335  -0.0117 635 GLU A N   
3020 C  CA  . GLU A 381 ? 0.9229 0.9075 0.8038 0.0766  0.0276  -0.0202 635 GLU A CA  
3021 C  C   . GLU A 381 ? 0.8784 0.8616 0.7736 0.0741  0.0228  -0.0240 635 GLU A C   
3022 O  O   . GLU A 381 ? 0.8607 0.8474 0.7606 0.0785  0.0166  -0.0294 635 GLU A O   
3023 C  CB  . GLU A 381 ? 0.9600 0.9509 0.8433 0.0742  0.0300  -0.0226 635 GLU A CB  
3024 C  CG  . GLU A 381 ? 1.1041 1.1028 0.9994 0.0753  0.0239  -0.0315 635 GLU A CG  
3025 C  CD  . GLU A 381 ? 1.1866 1.1952 1.0775 0.0817  0.0214  -0.0372 635 GLU A CD  
3026 O  OE1 . GLU A 381 ? 1.2603 1.2746 1.1552 0.0799  0.0224  -0.0405 635 GLU A OE1 
3027 O  OE2 . GLU A 381 ? 1.2764 1.2875 1.1599 0.0887  0.0182  -0.0388 635 GLU A OE2 
3028 N  N   . ALA A 382 ? 0.8287 0.8074 0.7312 0.0671  0.0256  -0.0214 636 ALA A N   
3029 C  CA  . ALA A 382 ? 0.8561 0.8339 0.7719 0.0645  0.0216  -0.0244 636 ALA A CA  
3030 C  C   . ALA A 382 ? 0.8038 0.7780 0.7193 0.0676  0.0184  -0.0240 636 ALA A C   
3031 O  O   . ALA A 382 ? 0.8774 0.8546 0.8019 0.0696  0.0129  -0.0289 636 ALA A O   
3032 C  CB  . ALA A 382 ? 0.7811 0.7549 0.7032 0.0569  0.0254  -0.0213 636 ALA A CB  
3033 N  N   . TYR A 383 ? 0.7887 0.7567 0.6945 0.0682  0.0218  -0.0183 637 TYR A N   
3034 C  CA  . TYR A 383 ? 0.8209 0.7853 0.7257 0.0715  0.0189  -0.0178 637 TYR A CA  
3035 C  C   . TYR A 383 ? 0.8837 0.8536 0.7857 0.0794  0.0132  -0.0228 637 TYR A C   
3036 O  O   . TYR A 383 ? 0.9087 0.8797 0.8170 0.0820  0.0082  -0.0266 637 TYR A O   
3037 C  CB  . TYR A 383 ? 0.8740 0.8306 0.7683 0.0712  0.0235  -0.0107 637 TYR A CB  
3038 C  CG  . TYR A 383 ? 0.8381 0.7904 0.7322 0.0740  0.0207  -0.0101 637 TYR A CG  
3039 C  CD1 . TYR A 383 ? 0.8781 0.8280 0.7823 0.0701  0.0199  -0.0107 637 TYR A CD1 
3040 C  CD2 . TYR A 383 ? 0.8327 0.7834 0.7162 0.0807  0.0190  -0.0087 637 TYR A CD2 
3041 C  CE1 . TYR A 383 ? 0.8650 0.8115 0.7698 0.0726  0.0174  -0.0105 637 TYR A CE1 
3042 C  CE2 . TYR A 383 ? 0.8238 0.7707 0.7078 0.0836  0.0160  -0.0086 637 TYR A CE2 
3043 C  CZ  . TYR A 383 ? 0.8341 0.7792 0.7294 0.0793  0.0152  -0.0098 637 TYR A CZ  
3044 O  OH  . TYR A 383 ? 0.9293 0.8714 0.8268 0.0813  0.0126  -0.0102 637 TYR A OH  
3045 N  N   . SER A 384 ? 0.9021 0.8760 0.7947 0.0834  0.0139  -0.0232 638 SER A N   
3046 C  CA  . SER A 384 ? 0.9800 0.9600 0.8691 0.0917  0.0081  -0.0286 638 SER A CA  
3047 C  C   . SER A 384 ? 0.9541 0.9414 0.8572 0.0927  0.0018  -0.0374 638 SER A C   
3048 O  O   . SER A 384 ? 0.8314 0.8213 0.7384 0.0978  -0.0042 -0.0423 638 SER A O   
3049 C  CB  . SER A 384 ? 0.9467 0.9304 0.8221 0.0960  0.0106  -0.0270 638 SER A CB  
3050 O  OG  . SER A 384 ? 1.1557 1.1476 1.0307 0.1032  0.0046  -0.0342 638 SER A OG  
3051 N  N   . ASN A 385 ? 0.8818 0.8722 0.7932 0.0881  0.0028  -0.0396 639 ASN A N   
3052 C  CA  . ASN A 385 ? 0.9013 0.8980 0.8273 0.0888  -0.0034 -0.0476 639 ASN A CA  
3053 C  C   . ASN A 385 ? 0.9770 0.9706 0.9162 0.0856  -0.0060 -0.0486 639 ASN A C   
3054 O  O   . ASN A 385 ? 0.9963 0.9943 0.9461 0.0882  -0.0121 -0.0550 639 ASN A O   
3055 C  CB  . ASN A 385 ? 0.9417 0.9428 0.8736 0.0854  -0.0024 -0.0502 639 ASN A CB  
3056 C  CG  . ASN A 385 ? 0.9621 0.9679 0.8820 0.0889  0.0001  -0.0503 639 ASN A CG  
3057 O  OD1 . ASN A 385 ? 1.0509 1.0591 0.9599 0.0955  -0.0010 -0.0507 639 ASN A OD1 
3058 N  ND2 . ASN A 385 ? 0.9173 0.9244 0.8388 0.0845  0.0037  -0.0494 639 ASN A ND2 
3059 N  N   . TYR A 386 ? 0.9802 0.9669 0.9194 0.0799  -0.0015 -0.0423 640 TYR A N   
3060 C  CA  . TYR A 386 ? 0.8752 0.8592 0.8250 0.0773  -0.0034 -0.0425 640 TYR A CA  
3061 C  C   . TYR A 386 ? 0.8560 0.8403 0.8038 0.0837  -0.0079 -0.0450 640 TYR A C   
3062 O  O   . TYR A 386 ? 0.8354 0.8218 0.7951 0.0841  -0.0123 -0.0492 640 TYR A O   
3063 C  CB  . TYR A 386 ? 0.8401 0.8168 0.7878 0.0709  0.0026  -0.0353 640 TYR A CB  
3064 C  CG  . TYR A 386 ? 0.8507 0.8249 0.8078 0.0684  0.0014  -0.0349 640 TYR A CG  
3065 C  CD1 . TYR A 386 ? 0.8536 0.8294 0.8245 0.0634  0.0007  -0.0361 640 TYR A CD1 
3066 C  CD2 . TYR A 386 ? 0.8462 0.8167 0.7985 0.0711  0.0010  -0.0331 640 TYR A CD2 
3067 C  CE1 . TYR A 386 ? 0.8315 0.8059 0.8106 0.0613  -0.0001 -0.0356 640 TYR A CE1 
3068 C  CE2 . TYR A 386 ? 0.8386 0.8076 0.7994 0.0689  0.0002  -0.0329 640 TYR A CE2 
3069 C  CZ  . TYR A 386 ? 0.8698 0.8411 0.8439 0.0641  -0.0002 -0.0343 640 TYR A CZ  
3070 O  OH  . TYR A 386 ? 0.9415 0.9122 0.9240 0.0621  -0.0009 -0.0341 640 TYR A OH  
3071 N  N   . CYS A 387 ? 0.9063 0.8882 0.8396 0.0883  -0.0066 -0.0421 641 CYS A N   
3072 C  CA  . CYS A 387 ? 0.9781 0.9603 0.9077 0.0951  -0.0109 -0.0442 641 CYS A CA  
3073 C  C   . CYS A 387 ? 0.9588 0.9493 0.8916 0.1020  -0.0177 -0.0526 641 CYS A C   
3074 O  O   . CYS A 387 ? 1.0495 1.0419 0.9878 0.1061  -0.0230 -0.0571 641 CYS A O   
3075 C  CB  . CYS A 387 ? 1.0393 1.0162 0.9516 0.0982  -0.0074 -0.0380 641 CYS A CB  
3076 S  SG  . CYS A 387 ? 1.0592 1.0257 0.9683 0.0920  -0.0010 -0.0293 641 CYS A SG  
3077 N  N   . LYS A 388 ? 1.0190 1.0148 0.9491 0.1036  -0.0179 -0.0553 642 LYS A N   
3078 C  CA  . LYS A 388 ? 1.0522 1.0569 0.9887 0.1096  -0.0249 -0.0646 642 LYS A CA  
3079 C  C   . LYS A 388 ? 1.0961 1.1028 1.0524 0.1063  -0.0291 -0.0699 642 LYS A C   
3080 O  O   . LYS A 388 ? 1.1701 1.1802 1.1338 0.1108  -0.0351 -0.0758 642 LYS A O   
3081 C  CB  . LYS A 388 ? 1.0057 1.0162 0.9371 0.1113  -0.0243 -0.0670 642 LYS A CB  
3082 C  CG  . LYS A 388 ? 1.0445 1.0546 0.9563 0.1156  -0.0205 -0.0622 642 LYS A CG  
3083 C  CD  . LYS A 388 ? 1.1577 1.1765 1.0653 0.1196  -0.0216 -0.0671 642 LYS A CD  
3084 C  CE  . LYS A 388 ? 1.1957 1.2137 1.0849 0.1209  -0.0153 -0.0605 642 LYS A CE  
3085 N  NZ  . LYS A 388 ? 1.1391 1.1559 1.0136 0.1282  -0.0162 -0.0579 642 LYS A NZ  
3086 N  N   . ARG A 389 ? 1.1019 1.1065 1.0670 0.0986  -0.0259 -0.0675 643 ARG A N   
3087 C  CA  . ARG A 389 ? 1.1216 1.1275 1.1060 0.0948  -0.0292 -0.0712 643 ARG A CA  
3088 C  C   . ARG A 389 ? 1.1526 1.1568 1.1449 0.0953  -0.0319 -0.0721 643 ARG A C   
3089 O  O   . ARG A 389 ? 1.1058 1.1129 1.1146 0.0939  -0.0358 -0.0767 643 ARG A O   
3090 C  CB  . ARG A 389 ? 1.1307 1.1335 1.1212 0.0863  -0.0245 -0.0668 643 ARG A CB  
3091 C  CG  . ARG A 389 ? 1.2120 1.2198 1.2156 0.0848  -0.0277 -0.0721 643 ARG A CG  
3092 C  CD  . ARG A 389 ? 1.2586 1.2631 1.2643 0.0772  -0.0226 -0.0669 643 ARG A CD  
3093 N  NE  . ARG A 389 ? 1.2623 1.2663 1.2537 0.0775  -0.0180 -0.0638 643 ARG A NE  
3094 C  CZ  . ARG A 389 ? 1.2254 1.2239 1.2066 0.0736  -0.0114 -0.0564 643 ARG A CZ  
3095 N  NH1 . ARG A 389 ? 1.1333 1.1258 1.1158 0.0688  -0.0082 -0.0509 643 ARG A NH1 
3096 N  NH2 . ARG A 389 ? 1.1867 1.1863 1.1564 0.0746  -0.0080 -0.0548 643 ARG A NH2 
3097 N  N   . GLN A 390 ? 1.2114 1.2110 1.1933 0.0972  -0.0299 -0.0679 644 GLN A N   
3098 C  CA  . GLN A 390 ? 1.3157 1.3164 1.3025 0.1015  -0.0347 -0.0716 644 GLN A CA  
3099 C  C   . GLN A 390 ? 1.2279 1.2294 1.2000 0.1101  -0.0370 -0.0728 644 GLN A C   
3100 O  O   . GLN A 390 ? 1.2663 1.2733 1.2423 0.1165  -0.0434 -0.0799 644 GLN A O   
3101 C  CB  . GLN A 390 ? 1.3943 1.3894 1.3851 0.0968  -0.0317 -0.0668 644 GLN A CB  
3102 C  CG  . GLN A 390 ? 1.4428 1.4357 1.4435 0.0880  -0.0275 -0.0630 644 GLN A CG  
3103 C  CD  . GLN A 390 ? 1.3811 1.3682 1.3702 0.0833  -0.0204 -0.0551 644 GLN A CD  
3104 O  OE1 . GLN A 390 ? 1.2408 1.2241 1.2150 0.0860  -0.0179 -0.0514 644 GLN A OE1 
3105 N  NE2 . GLN A 390 ? 1.2762 1.2625 1.2726 0.0765  -0.0173 -0.0525 644 GLN A NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   255 ?   ?   ?   A . n 
A 1 2   SER 2   256 ?   ?   ?   A . n 
A 1 3   GLU 3   257 ?   ?   ?   A . n 
A 1 4   ALA 4   258 ?   ?   ?   A . n 
A 1 5   ASN 5   259 ?   ?   ?   A . n 
A 1 6   ALA 6   260 ?   ?   ?   A . n 
A 1 7   GLU 7   261 261 GLU GLU A . n 
A 1 8   ARG 8   262 262 ARG ARG A . n 
A 1 9   ILE 9   263 263 ILE ILE A . n 
A 1 10  VAL 10  264 264 VAL VAL A . n 
A 1 11  ARG 11  265 265 ARG ARG A . n 
A 1 12  THR 12  266 266 THR THR A . n 
A 1 13  LEU 13  267 267 LEU LEU A . n 
A 1 14  CYS 14  268 268 CYS CYS A . n 
A 1 15  LYS 15  269 269 LYS LYS A . n 
A 1 16  VAL 16  270 270 VAL VAL A . n 
A 1 17  ARG 17  271 271 ARG ARG A . n 
A 1 18  GLY 18  272 272 GLY GLY A . n 
A 1 19  ALA 19  273 273 ALA ALA A . n 
A 1 20  ALA 20  274 274 ALA ALA A . n 
A 1 21  LEU 21  275 275 LEU LEU A . n 
A 1 22  LYS 22  276 276 LYS LYS A . n 
A 1 23  LEU 23  277 277 LEU LEU A . n 
A 1 24  GLY 24  278 278 GLY GLY A . n 
A 1 25  GLN 25  279 279 GLN GLN A . n 
A 1 26  MSE 26  280 280 MSE MSE A . n 
A 1 27  LEU 27  281 281 LEU LEU A . n 
A 1 28  SER 28  282 282 SER SER A . n 
A 1 29  ILE 29  283 283 ILE ALA A . n 
A 1 30  GLN 30  284 284 GLN GLN A . n 
A 1 31  ASP 31  285 285 ASP ASP A . n 
A 1 32  ASP 32  286 286 ASP ASP A . n 
A 1 33  ALA 33  287 287 ALA ALA A . n 
A 1 34  PHE 34  288 288 PHE PHE A . n 
A 1 35  ILE 35  289 289 ILE ILE A . n 
A 1 36  ASN 36  290 290 ASN ASN A . n 
A 1 37  PRO 37  291 291 PRO PRO A . n 
A 1 38  HIS 38  292 292 HIS HIS A . n 
A 1 39  LEU 39  293 293 LEU LEU A . n 
A 1 40  ALA 40  294 294 ALA ALA A . n 
A 1 41  LYS 41  295 295 LYS LYS A . n 
A 1 42  ILE 42  296 296 ILE ILE A . n 
A 1 43  PHE 43  297 297 PHE PHE A . n 
A 1 44  GLU 44  298 298 GLU GLU A . n 
A 1 45  ARG 45  299 299 ARG ARG A . n 
A 1 46  VAL 46  300 300 VAL VAL A . n 
A 1 47  ARG 47  301 301 ARG ARG A . n 
A 1 48  GLN 48  302 302 GLN GLN A . n 
A 1 49  SER 49  303 303 SER SER A . n 
A 1 50  ALA 50  304 304 ALA ALA A . n 
A 1 51  ASP 51  305 305 ASP ASP A . n 
A 1 52  PHE 52  306 306 PHE PHE A . n 
A 1 53  MSE 53  307 307 MSE MSE A . n 
A 1 54  PRO 54  308 308 PRO PRO A . n 
A 1 55  LEU 55  309 309 LEU LEU A . n 
A 1 56  LYS 56  310 310 LYS LYS A . n 
A 1 57  GLN 57  311 311 GLN GLN A . n 
A 1 58  MSE 58  312 312 MSE MSE A . n 
A 1 59  MSE 59  313 313 MSE MSE A . n 
A 1 60  LYS 60  314 314 LYS LYS A . n 
A 1 61  THR 61  315 315 THR THR A . n 
A 1 62  LEU 62  316 316 LEU LEU A . n 
A 1 63  ASN 63  317 317 ASN ASN A . n 
A 1 64  ASN 64  318 318 ASN ASN A . n 
A 1 65  ASP 65  319 319 ASP ASP A . n 
A 1 66  LEU 66  320 320 LEU LEU A . n 
A 1 67  GLY 67  321 321 GLY GLY A . n 
A 1 68  PRO 68  322 322 PRO PRO A . n 
A 1 69  ASN 69  323 323 ASN ASN A . n 
A 1 70  TRP 70  324 324 TRP TRP A . n 
A 1 71  ARG 71  325 325 ARG ARG A . n 
A 1 72  ASP 72  326 326 ASP ASP A . n 
A 1 73  LYS 73  327 327 LYS LYS A . n 
A 1 74  LEU 74  328 328 LEU LEU A . n 
A 1 75  GLU 75  329 329 GLU GLU A . n 
A 1 76  TYR 76  330 330 TYR TYR A . n 
A 1 77  PHE 77  331 331 PHE PHE A . n 
A 1 78  GLU 78  332 332 GLU GLU A . n 
A 1 79  GLU 79  333 333 GLU GLU A . n 
A 1 80  ARG 80  334 334 ARG ARG A . n 
A 1 81  PRO 81  335 335 PRO PRO A . n 
A 1 82  PHE 82  336 336 PHE PHE A . n 
A 1 83  ALA 83  337 337 ALA ALA A . n 
A 1 84  ALA 84  338 338 ALA ALA A . n 
A 1 85  ALA 85  339 339 ALA ALA A . n 
A 1 86  SER 86  340 340 SER SER A . n 
A 1 87  ILE 87  341 341 ILE ILE A . n 
A 1 88  GLY 88  342 342 GLY GLY A . n 
A 1 89  GLN 89  343 343 GLN GLN A . n 
A 1 90  VAL 90  344 344 VAL VAL A . n 
A 1 91  HIS 91  345 345 HIS HIS A . n 
A 1 92  LEU 92  346 346 LEU LEU A . n 
A 1 93  ALA 93  347 347 ALA ALA A . n 
A 1 94  ARG 94  348 348 ARG ARG A . n 
A 1 95  MSE 95  349 349 MSE MSE A . n 
A 1 96  LYS 96  350 350 LYS LYS A . n 
A 1 97  GLY 97  351 351 GLY GLY A . n 
A 1 98  GLY 98  352 352 GLY GLY A . n 
A 1 99  ARG 99  353 353 ARG ARG A . n 
A 1 100 GLU 100 354 354 GLU GLU A . n 
A 1 101 VAL 101 355 355 VAL VAL A . n 
A 1 102 ALA 102 356 356 ALA ALA A . n 
A 1 103 MSE 103 357 357 MSE MSE A . n 
A 1 104 LYS 104 358 358 LYS LYS A . n 
A 1 105 ILE 105 359 359 ILE ILE A . n 
A 1 106 GLN 106 360 360 GLN GLN A . n 
A 1 107 TYR 107 361 361 TYR TYR A . n 
A 1 108 PRO 108 362 362 PRO PRO A . n 
A 1 109 GLY 109 363 363 GLY GLY A . n 
A 1 110 VAL 110 364 364 VAL VAL A . n 
A 1 111 ALA 111 365 365 ALA ALA A . n 
A 1 112 GLN 112 366 366 GLN GLN A . n 
A 1 113 SER 113 367 367 SER SER A . n 
A 1 114 ILE 114 368 368 ILE ILE A . n 
A 1 115 ASN 115 369 369 ASN ASN A . n 
A 1 116 SER 116 370 370 SER SER A . n 
A 1 117 ASP 117 371 371 ASP ASP A . n 
A 1 118 VAL 118 372 372 VAL VAL A . n 
A 1 119 ASN 119 373 373 ASN ASN A . n 
A 1 120 ASN 120 374 374 ASN ASN A . n 
A 1 121 LEU 121 375 375 LEU LEU A . n 
A 1 122 MSE 122 376 376 MSE MSE A . n 
A 1 123 ALA 123 377 377 ALA ALA A . n 
A 1 124 VAL 124 378 378 VAL VAL A . n 
A 1 125 LEU 125 379 379 LEU LEU A . n 
A 1 126 ASN 126 380 380 ASN ASN A . n 
A 1 127 MSE 127 381 381 MSE MSE A . n 
A 1 128 SER 128 382 382 SER SER A . n 
A 1 129 ASN 129 383 383 ASN ASN A . n 
A 1 130 MSE 130 384 384 MSE MSE A . n 
A 1 131 LEU 131 385 385 LEU LEU A . n 
A 1 132 PRO 132 386 386 PRO PRO A . n 
A 1 133 GLU 133 387 387 GLU GLU A . n 
A 1 134 GLY 134 388 388 GLY GLY A . n 
A 1 135 LEU 135 389 389 LEU LEU A . n 
A 1 136 PHE 136 390 390 PHE PHE A . n 
A 1 137 PRO 137 391 391 PRO PRO A . n 
A 1 138 GLU 138 392 392 GLU GLU A . n 
A 1 139 HIS 139 393 393 HIS HIS A . n 
A 1 140 LEU 140 394 394 LEU LEU A . n 
A 1 141 ILE 141 395 395 ILE ILE A . n 
A 1 142 ASP 142 396 396 ASP ASP A . n 
A 1 143 VAL 143 397 397 VAL VAL A . n 
A 1 144 LEU 144 398 398 LEU LEU A . n 
A 1 145 ARG 145 399 399 ARG ARG A . n 
A 1 146 ARG 146 400 400 ARG ARG A . n 
A 1 147 GLU 147 401 401 GLU GLU A . n 
A 1 148 LEU 148 402 402 LEU LEU A . n 
A 1 149 ALA 149 403 403 ALA ALA A . n 
A 1 150 LEU 150 404 404 LEU LEU A . n 
A 1 151 GLU 151 405 405 GLU GLU A . n 
A 1 152 CYS 152 406 406 CYS CYS A . n 
A 1 153 ASP 153 407 407 ASP ASP A . n 
A 1 154 TYR 154 408 408 TYR TYR A . n 
A 1 155 GLN 155 409 409 GLN GLN A . n 
A 1 156 ARG 156 410 410 ARG ARG A . n 
A 1 157 GLU 157 411 411 GLU GLU A . n 
A 1 158 ALA 158 412 412 ALA ALA A . n 
A 1 159 ALA 159 413 413 ALA ALA A . n 
A 1 160 CYS 160 414 414 CYS CYS A . n 
A 1 161 ALA 161 415 415 ALA ALA A . n 
A 1 162 ARG 162 416 416 ARG ARG A . n 
A 1 163 LYS 163 417 417 LYS LYS A . n 
A 1 164 PHE 164 418 418 PHE PHE A . n 
A 1 165 ARG 165 419 419 ARG ARG A . n 
A 1 166 ASP 166 420 420 ASP ASP A . n 
A 1 167 LEU 167 421 421 LEU LEU A . n 
A 1 168 LEU 168 422 422 LEU LEU A . n 
A 1 169 LYS 169 423 423 LYS LYS A . n 
A 1 170 GLY 170 424 424 GLY GLY A . n 
A 1 171 HIS 171 425 425 HIS HIS A . n 
A 1 172 PRO 172 426 426 PRO PRO A . n 
A 1 173 PHE 173 427 427 PHE PHE A . n 
A 1 174 PHE 174 428 428 PHE PHE A . n 
A 1 175 TYR 175 429 429 TYR TYR A . n 
A 1 176 VAL 176 430 430 VAL VAL A . n 
A 1 177 PRO 177 431 431 PRO PRO A . n 
A 1 178 GLU 178 432 432 GLU GLU A . n 
A 1 179 ILE 179 433 433 ILE ILE A . n 
A 1 180 VAL 180 434 434 VAL VAL A . n 
A 1 181 ASP 181 435 435 ASP ASP A . n 
A 1 182 GLU 182 436 436 GLU GLU A . n 
A 1 183 LEU 183 437 437 LEU LEU A . n 
A 1 184 CYS 184 438 438 CYS CYS A . n 
A 1 185 SER 185 439 439 SER SER A . n 
A 1 186 PRO 186 440 440 PRO PRO A . n 
A 1 187 HIS 187 441 441 HIS HIS A . n 
A 1 188 VAL 188 442 442 VAL VAL A . n 
A 1 189 LEU 189 443 443 LEU LEU A . n 
A 1 190 THR 190 444 444 THR THR A . n 
A 1 191 THR 191 445 445 THR THR A . n 
A 1 192 GLU 192 446 446 GLU GLU A . n 
A 1 193 LEU 193 447 447 LEU LEU A . n 
A 1 194 VAL 194 448 448 VAL VAL A . n 
A 1 195 SER 195 449 449 SER SER A . n 
A 1 196 GLY 196 450 450 GLY GLY A . n 
A 1 197 PHE 197 451 451 PHE PHE A . n 
A 1 198 PRO 198 452 452 PRO PRO A . n 
A 1 199 LEU 199 453 453 LEU LEU A . n 
A 1 200 ASP 200 454 454 ASP ASP A . n 
A 1 201 GLN 201 455 455 GLN GLN A . n 
A 1 202 ALA 202 456 456 ALA ALA A . n 
A 1 203 GLU 203 457 457 GLU GLU A . n 
A 1 204 GLY 204 458 458 GLY GLY A . n 
A 1 205 LEU 205 459 459 LEU LEU A . n 
A 1 206 SER 206 460 460 SER SER A . n 
A 1 207 GLN 207 461 461 GLN GLN A . n 
A 1 208 GLU 208 462 462 GLU GLU A . n 
A 1 209 ILE 209 463 463 ILE ILE A . n 
A 1 210 ARG 210 464 464 ARG ARG A . n 
A 1 211 ASN 211 465 465 ASN ASN A . n 
A 1 212 GLU 212 466 466 GLU GLU A . n 
A 1 213 ILE 213 467 467 ILE ILE A . n 
A 1 214 CYS 214 468 468 CYS CYS A . n 
A 1 215 TYR 215 469 469 TYR TYR A . n 
A 1 216 ASN 216 470 470 ASN ASN A . n 
A 1 217 ILE 217 471 471 ILE ILE A . n 
A 1 218 LEU 218 472 472 LEU LEU A . n 
A 1 219 VAL 219 473 473 VAL VAL A . n 
A 1 220 LEU 220 474 474 LEU LEU A . n 
A 1 221 CYS 221 475 475 CYS CYS A . n 
A 1 222 LEU 222 476 476 LEU LEU A . n 
A 1 223 ARG 223 477 477 ARG ARG A . n 
A 1 224 GLU 224 478 478 GLU GLU A . n 
A 1 225 LEU 225 479 479 LEU LEU A . n 
A 1 226 PHE 226 480 480 PHE PHE A . n 
A 1 227 GLU 227 481 481 GLU GLU A . n 
A 1 228 PHE 228 482 482 PHE PHE A . n 
A 1 229 HIS 229 483 483 HIS HIS A . n 
A 1 230 PHE 230 484 484 PHE PHE A . n 
A 1 231 MSE 231 485 485 MSE MSE A . n 
A 1 232 GLN 232 486 486 GLN GLN A . n 
A 1 233 THR 233 487 487 THR THR A . n 
A 1 234 ASP 234 488 488 ASP ASP A . n 
A 1 235 PRO 235 489 489 PRO PRO A . n 
A 1 236 ASN 236 490 490 ASN ASN A . n 
A 1 237 TRP 237 491 491 TRP TRP A . n 
A 1 238 SER 238 492 492 SER SER A . n 
A 1 239 ASN 239 493 493 ASN ASN A . n 
A 1 240 PHE 240 494 494 PHE PHE A . n 
A 1 241 PHE 241 495 495 PHE PHE A . n 
A 1 242 TYR 242 496 496 TYR TYR A . n 
A 1 243 ASP 243 497 497 ASP ASP A . n 
A 1 244 PRO 244 498 498 PRO PRO A . n 
A 1 245 GLN 245 499 499 GLN GLN A . n 
A 1 246 GLN 246 500 500 GLN GLN A . n 
A 1 247 HIS 247 501 501 HIS HIS A . n 
A 1 248 LYS 248 502 502 LYS LYS A . n 
A 1 249 VAL 249 503 503 VAL VAL A . n 
A 1 250 ALA 250 504 504 ALA ALA A . n 
A 1 251 LEU 251 505 505 LEU LEU A . n 
A 1 252 LEU 252 506 506 LEU LEU A . n 
A 1 253 ASP 253 507 507 ASP ASP A . n 
A 1 254 PHE 254 508 508 PHE PHE A . n 
A 1 255 GLY 255 509 509 GLY GLY A . n 
A 1 256 ALA 256 510 510 ALA ALA A . n 
A 1 257 THR 257 511 511 THR THR A . n 
A 1 258 ARG 258 512 512 ARG ARG A . n 
A 1 259 GLU 259 513 513 GLU GLU A . n 
A 1 260 TYR 260 514 514 TYR TYR A . n 
A 1 261 ASP 261 515 515 ASP ASP A . n 
A 1 262 ARG 262 516 516 ARG ARG A . n 
A 1 263 SER 263 517 517 SER SER A . n 
A 1 264 PHE 264 518 518 PHE PHE A . n 
A 1 265 THR 265 519 519 THR THR A . n 
A 1 266 ASP 266 520 520 ASP ASP A . n 
A 1 267 LEU 267 521 521 LEU LEU A . n 
A 1 268 TYR 268 522 522 TYR TYR A . n 
A 1 269 ILE 269 523 523 ILE ILE A . n 
A 1 270 GLN 270 524 524 GLN GLN A . n 
A 1 271 ILE 271 525 525 ILE ILE A . n 
A 1 272 ILE 272 526 526 ILE ILE A . n 
A 1 273 ARG 273 527 527 ARG ARG A . n 
A 1 274 ALA 274 528 528 ALA ALA A . n 
A 1 275 ALA 275 529 529 ALA ALA A . n 
A 1 276 ALA 276 530 530 ALA ALA A . n 
A 1 277 ASP 277 531 531 ASP ASP A . n 
A 1 278 ARG 278 532 532 ARG ARG A . n 
A 1 279 ASP 279 533 533 ASP ASP A . n 
A 1 280 ARG 280 534 534 ARG ARG A . n 
A 1 281 GLU 281 535 535 GLU GLU A . n 
A 1 282 THR 282 536 536 THR THR A . n 
A 1 283 VAL 283 537 537 VAL VAL A . n 
A 1 284 ARG 284 538 538 ARG ARG A . n 
A 1 285 ALA 285 539 539 ALA ALA A . n 
A 1 286 LYS 286 540 540 LYS LYS A . n 
A 1 287 SER 287 541 541 SER SER A . n 
A 1 288 ILE 288 542 542 ILE ILE A . n 
A 1 289 GLU 289 543 543 GLU GLU A . n 
A 1 290 MSE 290 544 544 MSE MSE A . n 
A 1 291 LYS 291 545 545 LYS LYS A . n 
A 1 292 PHE 292 546 546 PHE PHE A . n 
A 1 293 LEU 293 547 547 LEU LEU A . n 
A 1 294 THR 294 548 548 THR THR A . n 
A 1 295 GLY 295 549 549 GLY GLY A . n 
A 1 296 TYR 296 550 550 TYR TYR A . n 
A 1 297 GLU 297 551 551 GLU GLU A . n 
A 1 298 VAL 298 552 552 VAL VAL A . n 
A 1 299 LYS 299 553 553 LYS LYS A . n 
A 1 300 VAL 300 554 554 VAL VAL A . n 
A 1 301 MSE 301 555 555 MSE MSE A . n 
A 1 302 GLU 302 556 556 GLU GLU A . n 
A 1 303 ASP 303 557 557 ASP ASP A . n 
A 1 304 ALA 304 558 558 ALA ALA A . n 
A 1 305 HIS 305 559 559 HIS HIS A . n 
A 1 306 LEU 306 560 560 LEU LEU A . n 
A 1 307 ASP 307 561 561 ASP ASP A . n 
A 1 308 ALA 308 562 562 ALA ALA A . n 
A 1 309 ILE 309 563 563 ILE ILE A . n 
A 1 310 LEU 310 564 564 LEU LEU A . n 
A 1 311 ILE 311 565 565 ILE ILE A . n 
A 1 312 LEU 312 566 566 LEU LEU A . n 
A 1 313 GLY 313 567 567 GLY GLY A . n 
A 1 314 GLU 314 568 568 GLU GLU A . n 
A 1 315 ALA 315 569 569 ALA ALA A . n 
A 1 316 PHE 316 570 570 PHE PHE A . n 
A 1 317 ALA 317 571 571 ALA ALA A . n 
A 1 318 SER 318 572 572 SER SER A . n 
A 1 319 ASP 319 573 573 ASP ASP A . n 
A 1 320 GLU 320 574 574 GLU GLU A . n 
A 1 321 PRO 321 575 575 PRO PRO A . n 
A 1 322 PHE 322 576 576 PHE PHE A . n 
A 1 323 ASP 323 577 577 ASP ASP A . n 
A 1 324 PHE 324 578 578 PHE PHE A . n 
A 1 325 GLY 325 579 579 GLY GLY A . n 
A 1 326 THR 326 580 580 THR THR A . n 
A 1 327 GLN 327 581 581 GLN GLN A . n 
A 1 328 SER 328 582 582 SER SER A . n 
A 1 329 THR 329 583 583 THR THR A . n 
A 1 330 THR 330 584 584 THR THR A . n 
A 1 331 GLU 331 585 585 GLU GLU A . n 
A 1 332 LYS 332 586 586 LYS LYS A . n 
A 1 333 ILE 333 587 587 ILE ILE A . n 
A 1 334 HIS 334 588 588 HIS HIS A . n 
A 1 335 ASN 335 589 589 ASN ASN A . n 
A 1 336 LEU 336 590 590 LEU LEU A . n 
A 1 337 ILE 337 591 591 ILE ILE A . n 
A 1 338 PRO 338 592 592 PRO PRO A . n 
A 1 339 VAL 339 593 593 VAL VAL A . n 
A 1 340 MSE 340 594 594 MSE MSE A . n 
A 1 341 LEU 341 595 595 LEU LEU A . n 
A 1 342 ARG 342 596 596 ARG ARG A . n 
A 1 343 HIS 343 597 597 HIS HIS A . n 
A 1 344 ARG 344 598 598 ARG ARG A . n 
A 1 345 LEU 345 599 599 LEU LEU A . n 
A 1 346 VAL 346 600 600 VAL VAL A . n 
A 1 347 PRO 347 601 601 PRO PRO A . n 
A 1 348 PRO 348 602 602 PRO PRO A . n 
A 1 349 PRO 349 603 603 PRO PRO A . n 
A 1 350 GLU 350 604 604 GLU GLU A . n 
A 1 351 GLU 351 605 605 GLU GLU A . n 
A 1 352 THR 352 606 606 THR THR A . n 
A 1 353 TYR 353 607 607 TYR TYR A . n 
A 1 354 SER 354 608 608 SER SER A . n 
A 1 355 LEU 355 609 609 LEU LEU A . n 
A 1 356 HIS 356 610 610 HIS HIS A . n 
A 1 357 LYS 357 611 611 LYS LYS A . n 
A 1 358 LYS 358 612 612 LYS LYS A . n 
A 1 359 MSE 359 613 613 MSE MSE A . n 
A 1 360 GLY 360 614 614 GLY GLY A . n 
A 1 361 GLY 361 615 615 GLY GLY A . n 
A 1 362 SER 362 616 616 SER SER A . n 
A 1 363 PHE 363 617 617 PHE PHE A . n 
A 1 364 LEU 364 618 618 LEU LEU A . n 
A 1 365 ILE 365 619 619 ILE ILE A . n 
A 1 366 CYS 366 620 620 CYS CYS A . n 
A 1 367 SER 367 621 621 SER SER A . n 
A 1 368 LYS 368 622 622 LYS LYS A . n 
A 1 369 LEU 369 623 623 LEU LEU A . n 
A 1 370 LYS 370 624 624 LYS LYS A . n 
A 1 371 ALA 371 625 625 ALA ALA A . n 
A 1 372 ARG 372 626 626 ARG ARG A . n 
A 1 373 PHE 373 627 627 PHE PHE A . n 
A 1 374 PRO 374 628 628 PRO PRO A . n 
A 1 375 CYS 375 629 629 CYS CYS A . n 
A 1 376 LYS 376 630 630 LYS LYS A . n 
A 1 377 ALA 377 631 631 ALA ALA A . n 
A 1 378 MSE 378 632 632 MSE MSE A . n 
A 1 379 PHE 379 633 633 PHE PHE A . n 
A 1 380 GLU 380 634 634 GLU GLU A . n 
A 1 381 GLU 381 635 635 GLU GLU A . n 
A 1 382 ALA 382 636 636 ALA ALA A . n 
A 1 383 TYR 383 637 637 TYR TYR A . n 
A 1 384 SER 384 638 638 SER SER A . n 
A 1 385 ASN 385 639 639 ASN ASN A . n 
A 1 386 TYR 386 640 640 TYR TYR A . n 
A 1 387 CYS 387 641 641 CYS CYS A . n 
A 1 388 LYS 388 642 642 LYS LYS A . n 
A 1 389 ARG 389 643 643 ARG ARG A . n 
A 1 390 GLN 390 644 644 GLN GLN A . n 
A 1 391 ALA 391 645 ?   ?   ?   A . n 
A 1 392 GLN 392 646 ?   ?   ?   A . n 
A 1 393 GLN 393 647 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Mitochondrial Protein Partnership' 
_pdbx_SG_project.initial_of_center     MPP 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ANP 1  700 700 ANP ANP A . 
C 3 HOH 1  801 2   HOH HOH A . 
C 3 HOH 2  802 23  HOH HOH A . 
C 3 HOH 3  803 8   HOH HOH A . 
C 3 HOH 4  804 12  HOH HOH A . 
C 3 HOH 5  805 1   HOH HOH A . 
C 3 HOH 6  806 5   HOH HOH A . 
C 3 HOH 7  807 4   HOH HOH A . 
C 3 HOH 8  808 21  HOH HOH A . 
C 3 HOH 9  809 22  HOH HOH A . 
C 3 HOH 10 810 3   HOH HOH A . 
C 3 HOH 11 811 20  HOH HOH A . 
C 3 HOH 12 812 7   HOH HOH A . 
C 3 HOH 13 813 11  HOH HOH A . 
C 3 HOH 14 814 19  HOH HOH A . 
C 3 HOH 15 815 9   HOH HOH A . 
C 3 HOH 16 816 15  HOH HOH A . 
C 3 HOH 17 817 27  HOH HOH A . 
C 3 HOH 18 818 6   HOH HOH A . 
C 3 HOH 19 819 18  HOH HOH A . 
C 3 HOH 20 820 13  HOH HOH A . 
C 3 HOH 21 821 24  HOH HOH A . 
C 3 HOH 22 822 14  HOH HOH A . 
C 3 HOH 23 823 26  HOH HOH A . 
C 3 HOH 24 824 16  HOH HOH A . 
C 3 HOH 25 825 10  HOH HOH A . 
C 3 HOH 26 826 25  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 26  A MSE 280 ? MET 'modified residue' 
2  A MSE 53  A MSE 307 ? MET 'modified residue' 
3  A MSE 58  A MSE 312 ? MET 'modified residue' 
4  A MSE 59  A MSE 313 ? MET 'modified residue' 
5  A MSE 95  A MSE 349 ? MET 'modified residue' 
6  A MSE 103 A MSE 357 ? MET 'modified residue' 
7  A MSE 122 A MSE 376 ? MET 'modified residue' 
8  A MSE 127 A MSE 381 ? MET 'modified residue' 
9  A MSE 130 A MSE 384 ? MET 'modified residue' 
10 A MSE 231 A MSE 485 ? MET 'modified residue' 
11 A MSE 290 A MSE 544 ? MET 'modified residue' 
12 A MSE 301 A MSE 555 ? MET 'modified residue' 
13 A MSE 340 A MSE 594 ? MET 'modified residue' 
14 A MSE 359 A MSE 613 ? MET 'modified residue' 
15 A MSE 378 A MSE 632 ? MET 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 850   ? 
1 MORE         -3    ? 
1 'SSA (A^2)'  18070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-17 
2 'Structure model' 1 1 2016-08-24 
3 'Structure model' 1 2 2016-08-31 
4 'Structure model' 1 3 2017-09-06 
5 'Structure model' 1 4 2017-11-01 
6 'Structure model' 1 5 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
7 6 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation                           
2 4 'Structure model' pdbx_audit_support                 
3 4 'Structure model' pdbx_struct_oper_list              
4 5 'Structure model' pdbx_struct_assembly_auth_evidence 
5 6 'Structure model' pdbx_audit_support                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 6 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         50.9469 
_pdbx_refine_tls.origin_y         36.1305 
_pdbx_refine_tls.origin_z         18.7924 
_pdbx_refine_tls.T[1][1]          0.0535 
_pdbx_refine_tls.T[2][2]          0.0274 
_pdbx_refine_tls.T[3][3]          0.0651 
_pdbx_refine_tls.T[1][2]          -0.0046 
_pdbx_refine_tls.T[1][3]          0.0347 
_pdbx_refine_tls.T[2][3]          -0.0064 
_pdbx_refine_tls.L[1][1]          0.7755 
_pdbx_refine_tls.L[2][2]          0.3956 
_pdbx_refine_tls.L[3][3]          0.2599 
_pdbx_refine_tls.L[1][2]          -0.2354 
_pdbx_refine_tls.L[1][3]          0.1214 
_pdbx_refine_tls.L[2][3]          0.2083 
_pdbx_refine_tls.S[1][1]          0.0787 
_pdbx_refine_tls.S[1][2]          0.0177 
_pdbx_refine_tls.S[1][3]          -0.1058 
_pdbx_refine_tls.S[2][1]          -0.0306 
_pdbx_refine_tls.S[2][2]          0.0022 
_pdbx_refine_tls.S[2][3]          0.0192 
_pdbx_refine_tls.S[3][1]          -0.0408 
_pdbx_refine_tls.S[3][2]          0.0210 
_pdbx_refine_tls.S[3][3]          -0.0809 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     261 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     644 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    520 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OH 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    640 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.01 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             406 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             406 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.714 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.098 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 348 ? ? CZ A ARG 348 ? ? NH2 A ARG 348 ? ? 116.53 120.30 -3.77 0.50 N 
2 1 NE A ARG 400 ? ? CZ A ARG 400 ? ? NH1 A ARG 400 ? ? 123.34 120.30 3.04  0.50 N 
3 1 NE A ARG 410 ? ? CZ A ARG 410 ? ? NH2 A ARG 410 ? ? 116.45 120.30 -3.85 0.50 N 
4 1 NE A ARG 419 ? ? CZ A ARG 419 ? ? NH2 A ARG 419 ? ? 117.07 120.30 -3.23 0.50 N 
5 1 CB A ASP 435 ? ? CG A ASP 435 ? ? OD1 A ASP 435 ? ? 123.88 118.30 5.58  0.90 N 
6 1 NE A ARG 464 ? ? CZ A ARG 464 ? ? NH1 A ARG 464 ? ? 123.43 120.30 3.13  0.50 N 
7 1 NE A ARG 534 ? ? CZ A ARG 534 ? ? NH1 A ARG 534 ? ? 123.49 120.30 3.19  0.50 N 
8 1 NE A ARG 643 ? ? CZ A ARG 643 ? ? NH1 A ARG 643 ? ? 123.46 120.30 3.16  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 282 ? ? 66.39   63.04  
2  1 GLN A 284 ? ? -144.63 40.05  
3  1 ASP A 285 ? ? 52.01   13.86  
4  1 PHE A 288 ? ? -172.38 -68.55 
5  1 ALA A 304 ? ? -60.43  81.40  
6  1 LYS A 310 ? ? -26.23  -62.50 
7  1 ASN A 383 ? ? 11.51   69.19  
8  1 PRO A 386 ? ? -94.86  36.63  
9  1 GLU A 446 ? ? -37.95  132.12 
10 1 ASP A 507 ? ? 91.99   89.54  
11 1 LEU A 595 ? ? -157.69 -43.82 
12 1 HIS A 597 ? ? -111.95 77.57  
13 1 ARG A 643 ? ? -49.40  -19.44 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 SER A 282 ? ? ILE A 283 ? ? 147.50 
2 1 LEU A 385 ? ? PRO A 386 ? ? -61.96 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ILE 283 ? CG1 ? A ILE 29 CG1 
2 1 Y 1 A ILE 283 ? CG2 ? A ILE 29 CG2 
3 1 Y 1 A ILE 283 ? CD1 ? A ILE 29 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 255 ? A SER 1   
2 1 Y 1 A SER 256 ? A SER 2   
3 1 Y 1 A GLU 257 ? A GLU 3   
4 1 Y 1 A ALA 258 ? A ALA 4   
5 1 Y 1 A ASN 259 ? A ASN 5   
6 1 Y 1 A ALA 260 ? A ALA 6   
7 1 Y 1 A ALA 645 ? A ALA 391 
8 1 Y 1 A GLN 646 ? A GLN 392 
9 1 Y 1 A GLN 647 ? A GLN 393 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' U01GM094622    1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM112057-02 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
3 water                                         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#