data_5I4A
# 
_entry.id   5I4A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I4A         
WWPDB D_1000218241 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I4A 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doxzen, K.W.'    1 
'Kaya, E.'        2 
'Knoll, K.R.'     3 
'Wilson, R.C.'    4 
'Strutt, S.C.'    5 
'Kranzusch, P.J.' 6 
'Doudna, J.A.'    7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            113 
_citation.language                  ? 
_citation.page_first                4057 
_citation.page_last                 4062 
_citation.title                     'A bacterial Argonaute with noncanonical guide RNA specificity.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1524385113 
_citation.pdbx_database_id_PubMed   27035975 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kaya, E.'        1 ? 
primary 'Doxzen, K.W.'    2 ? 
primary 'Knoll, K.R.'     3 ? 
primary 'Wilson, R.C.'    4 ? 
primary 'Strutt, S.C.'    5 ? 
primary 'Kranzusch, P.J.' 6 ? 
primary 'Doudna, J.A.'    7 ? 
# 
_cell.entry_id           5I4A 
_cell.length_a           50.883 
_cell.length_b           75.420 
_cell.length_c           102.215 
_cell.angle_alpha        110.87 
_cell.angle_beta         90.55 
_cell.angle_gamma        90.09 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I4A 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Argonaute protein'                                        76190.242 2   ? ? ? ? 
2 polymer syn 
;RNA (5'-R(*UP*AP*UP*AP*CP*AP*AP*CP*CP*UP*AP*CP*UP*U)-3')
;
6538.916  2   ? ? ? ? 
3 water   nat water                                                      18.015    704 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        MpAgo 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;GANAYLNLYKIDIPKKIKRLYFYNPDMEPKLFARNLSRVNNFKFQDSNDLVWIEIPDIDFQITPKNVFQYKVEKEEIIKE
EEDKKLFVKTLYKYIKKLFLDNDFYFKKGNNFISNSEVFSLDSNENVNAHLTYKIKIHNISNEYYLSILPKFTFLSKEPA
LESAIKSGYLYNIKSGKSFPYISGLDGILKIDIGNNQIVEVAYPENYLFNFTTRDAEKYGFSKEVHEIYKNKVFEGFKKI
PKTLGFLNKITNLNENYQLKDGYKIFINVIYKFKNGESRYAKDVFKYSFYKNEQPLKAIFFFSSKKQFFEVQKSLKELFH
NKHSVFYRAAAELGFSKVEFLRDSKTKSSAFLYNPEEFTVKNTEFINQIEDNVMAIVLLDKYIGNIDPLVRNFPDNLILQ
PILKEKLEDIKPFIIKSYVYKMGNFIPECKPFILKKMEDKEKNLYIGIDLSHDTYARKTNLCIAAVDNTGDILYIGKHKN
LELNEKMNLDILEKEYIKAFEKYIEKFNVSPENVFILRDGRFIEDIEIIKNFISYNDTKYTLVEVNKNTNINSYDDLKEW
IIKLDENTYIYYPKTFLNQKGVEVKILENNTDYTIEEIIEQIYLLTRVAHSTPYTNYKLPYPLHIANKVALTDYEWKLYI
PY
;
;GANAYLNLYKIDIPKKIKRLYFYNPDMEPKLFARNLSRVNNFKFQDSNDLVWIEIPDIDFQITPKNVFQYKVEKEEIIKE
EEDKKLFVKTLYKYIKKLFLDNDFYFKKGNNFISNSEVFSLDSNENVNAHLTYKIKIHNISNEYYLSILPKFTFLSKEPA
LESAIKSGYLYNIKSGKSFPYISGLDGILKIDIGNNQIVEVAYPENYLFNFTTRDAEKYGFSKEVHEIYKNKVFEGFKKI
PKTLGFLNKITNLNENYQLKDGYKIFINVIYKFKNGESRYAKDVFKYSFYKNEQPLKAIFFFSSKKQFFEVQKSLKELFH
NKHSVFYRAAAELGFSKVEFLRDSKTKSSAFLYNPEEFTVKNTEFINQIEDNVMAIVLLDKYIGNIDPLVRNFPDNLILQ
PILKEKLEDIKPFIIKSYVYKMGNFIPECKPFILKKMEDKEKNLYIGIDLSHDTYARKTNLCIAAVDNTGDILYIGKHKN
LELNEKMNLDILEKEYIKAFEKYIEKFNVSPENVFILRDGRFIEDIEIIKNFISYNDTKYTLVEVNKNTNINSYDDLKEW
IIKLDENTYIYYPKTFLNQKGVEVKILENNTDYTIEEIIEQIYLLTRVAHSTPYTNYKLPYPLHIANKVALTDYEWKLYI
PY
;
A,C ? 
2 polyribonucleotide no no UAUACAACCUACUACCUCAUU UAUACAACCUACUACCUCAUU B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   ASN n 
1 4   ALA n 
1 5   TYR n 
1 6   LEU n 
1 7   ASN n 
1 8   LEU n 
1 9   TYR n 
1 10  LYS n 
1 11  ILE n 
1 12  ASP n 
1 13  ILE n 
1 14  PRO n 
1 15  LYS n 
1 16  LYS n 
1 17  ILE n 
1 18  LYS n 
1 19  ARG n 
1 20  LEU n 
1 21  TYR n 
1 22  PHE n 
1 23  TYR n 
1 24  ASN n 
1 25  PRO n 
1 26  ASP n 
1 27  MET n 
1 28  GLU n 
1 29  PRO n 
1 30  LYS n 
1 31  LEU n 
1 32  PHE n 
1 33  ALA n 
1 34  ARG n 
1 35  ASN n 
1 36  LEU n 
1 37  SER n 
1 38  ARG n 
1 39  VAL n 
1 40  ASN n 
1 41  ASN n 
1 42  PHE n 
1 43  LYS n 
1 44  PHE n 
1 45  GLN n 
1 46  ASP n 
1 47  SER n 
1 48  ASN n 
1 49  ASP n 
1 50  LEU n 
1 51  VAL n 
1 52  TRP n 
1 53  ILE n 
1 54  GLU n 
1 55  ILE n 
1 56  PRO n 
1 57  ASP n 
1 58  ILE n 
1 59  ASP n 
1 60  PHE n 
1 61  GLN n 
1 62  ILE n 
1 63  THR n 
1 64  PRO n 
1 65  LYS n 
1 66  ASN n 
1 67  VAL n 
1 68  PHE n 
1 69  GLN n 
1 70  TYR n 
1 71  LYS n 
1 72  VAL n 
1 73  GLU n 
1 74  LYS n 
1 75  GLU n 
1 76  GLU n 
1 77  ILE n 
1 78  ILE n 
1 79  LYS n 
1 80  GLU n 
1 81  GLU n 
1 82  GLU n 
1 83  ASP n 
1 84  LYS n 
1 85  LYS n 
1 86  LEU n 
1 87  PHE n 
1 88  VAL n 
1 89  LYS n 
1 90  THR n 
1 91  LEU n 
1 92  TYR n 
1 93  LYS n 
1 94  TYR n 
1 95  ILE n 
1 96  LYS n 
1 97  LYS n 
1 98  LEU n 
1 99  PHE n 
1 100 LEU n 
1 101 ASP n 
1 102 ASN n 
1 103 ASP n 
1 104 PHE n 
1 105 TYR n 
1 106 PHE n 
1 107 LYS n 
1 108 LYS n 
1 109 GLY n 
1 110 ASN n 
1 111 ASN n 
1 112 PHE n 
1 113 ILE n 
1 114 SER n 
1 115 ASN n 
1 116 SER n 
1 117 GLU n 
1 118 VAL n 
1 119 PHE n 
1 120 SER n 
1 121 LEU n 
1 122 ASP n 
1 123 SER n 
1 124 ASN n 
1 125 GLU n 
1 126 ASN n 
1 127 VAL n 
1 128 ASN n 
1 129 ALA n 
1 130 HIS n 
1 131 LEU n 
1 132 THR n 
1 133 TYR n 
1 134 LYS n 
1 135 ILE n 
1 136 LYS n 
1 137 ILE n 
1 138 HIS n 
1 139 ASN n 
1 140 ILE n 
1 141 SER n 
1 142 ASN n 
1 143 GLU n 
1 144 TYR n 
1 145 TYR n 
1 146 LEU n 
1 147 SER n 
1 148 ILE n 
1 149 LEU n 
1 150 PRO n 
1 151 LYS n 
1 152 PHE n 
1 153 THR n 
1 154 PHE n 
1 155 LEU n 
1 156 SER n 
1 157 LYS n 
1 158 GLU n 
1 159 PRO n 
1 160 ALA n 
1 161 LEU n 
1 162 GLU n 
1 163 SER n 
1 164 ALA n 
1 165 ILE n 
1 166 LYS n 
1 167 SER n 
1 168 GLY n 
1 169 TYR n 
1 170 LEU n 
1 171 TYR n 
1 172 ASN n 
1 173 ILE n 
1 174 LYS n 
1 175 SER n 
1 176 GLY n 
1 177 LYS n 
1 178 SER n 
1 179 PHE n 
1 180 PRO n 
1 181 TYR n 
1 182 ILE n 
1 183 SER n 
1 184 GLY n 
1 185 LEU n 
1 186 ASP n 
1 187 GLY n 
1 188 ILE n 
1 189 LEU n 
1 190 LYS n 
1 191 ILE n 
1 192 ASP n 
1 193 ILE n 
1 194 GLY n 
1 195 ASN n 
1 196 ASN n 
1 197 GLN n 
1 198 ILE n 
1 199 VAL n 
1 200 GLU n 
1 201 VAL n 
1 202 ALA n 
1 203 TYR n 
1 204 PRO n 
1 205 GLU n 
1 206 ASN n 
1 207 TYR n 
1 208 LEU n 
1 209 PHE n 
1 210 ASN n 
1 211 PHE n 
1 212 THR n 
1 213 THR n 
1 214 ARG n 
1 215 ASP n 
1 216 ALA n 
1 217 GLU n 
1 218 LYS n 
1 219 TYR n 
1 220 GLY n 
1 221 PHE n 
1 222 SER n 
1 223 LYS n 
1 224 GLU n 
1 225 VAL n 
1 226 HIS n 
1 227 GLU n 
1 228 ILE n 
1 229 TYR n 
1 230 LYS n 
1 231 ASN n 
1 232 LYS n 
1 233 VAL n 
1 234 PHE n 
1 235 GLU n 
1 236 GLY n 
1 237 PHE n 
1 238 LYS n 
1 239 LYS n 
1 240 ILE n 
1 241 PRO n 
1 242 LYS n 
1 243 THR n 
1 244 LEU n 
1 245 GLY n 
1 246 PHE n 
1 247 LEU n 
1 248 ASN n 
1 249 LYS n 
1 250 ILE n 
1 251 THR n 
1 252 ASN n 
1 253 LEU n 
1 254 ASN n 
1 255 GLU n 
1 256 ASN n 
1 257 TYR n 
1 258 GLN n 
1 259 LEU n 
1 260 LYS n 
1 261 ASP n 
1 262 GLY n 
1 263 TYR n 
1 264 LYS n 
1 265 ILE n 
1 266 PHE n 
1 267 ILE n 
1 268 ASN n 
1 269 VAL n 
1 270 ILE n 
1 271 TYR n 
1 272 LYS n 
1 273 PHE n 
1 274 LYS n 
1 275 ASN n 
1 276 GLY n 
1 277 GLU n 
1 278 SER n 
1 279 ARG n 
1 280 TYR n 
1 281 ALA n 
1 282 LYS n 
1 283 ASP n 
1 284 VAL n 
1 285 PHE n 
1 286 LYS n 
1 287 TYR n 
1 288 SER n 
1 289 PHE n 
1 290 TYR n 
1 291 LYS n 
1 292 ASN n 
1 293 GLU n 
1 294 GLN n 
1 295 PRO n 
1 296 LEU n 
1 297 LYS n 
1 298 ALA n 
1 299 ILE n 
1 300 PHE n 
1 301 PHE n 
1 302 PHE n 
1 303 SER n 
1 304 SER n 
1 305 LYS n 
1 306 LYS n 
1 307 GLN n 
1 308 PHE n 
1 309 PHE n 
1 310 GLU n 
1 311 VAL n 
1 312 GLN n 
1 313 LYS n 
1 314 SER n 
1 315 LEU n 
1 316 LYS n 
1 317 GLU n 
1 318 LEU n 
1 319 PHE n 
1 320 HIS n 
1 321 ASN n 
1 322 LYS n 
1 323 HIS n 
1 324 SER n 
1 325 VAL n 
1 326 PHE n 
1 327 TYR n 
1 328 ARG n 
1 329 ALA n 
1 330 ALA n 
1 331 ALA n 
1 332 GLU n 
1 333 LEU n 
1 334 GLY n 
1 335 PHE n 
1 336 SER n 
1 337 LYS n 
1 338 VAL n 
1 339 GLU n 
1 340 PHE n 
1 341 LEU n 
1 342 ARG n 
1 343 ASP n 
1 344 SER n 
1 345 LYS n 
1 346 THR n 
1 347 LYS n 
1 348 SER n 
1 349 SER n 
1 350 ALA n 
1 351 PHE n 
1 352 LEU n 
1 353 TYR n 
1 354 ASN n 
1 355 PRO n 
1 356 GLU n 
1 357 GLU n 
1 358 PHE n 
1 359 THR n 
1 360 VAL n 
1 361 LYS n 
1 362 ASN n 
1 363 THR n 
1 364 GLU n 
1 365 PHE n 
1 366 ILE n 
1 367 ASN n 
1 368 GLN n 
1 369 ILE n 
1 370 GLU n 
1 371 ASP n 
1 372 ASN n 
1 373 VAL n 
1 374 MET n 
1 375 ALA n 
1 376 ILE n 
1 377 VAL n 
1 378 LEU n 
1 379 LEU n 
1 380 ASP n 
1 381 LYS n 
1 382 TYR n 
1 383 ILE n 
1 384 GLY n 
1 385 ASN n 
1 386 ILE n 
1 387 ASP n 
1 388 PRO n 
1 389 LEU n 
1 390 VAL n 
1 391 ARG n 
1 392 ASN n 
1 393 PHE n 
1 394 PRO n 
1 395 ASP n 
1 396 ASN n 
1 397 LEU n 
1 398 ILE n 
1 399 LEU n 
1 400 GLN n 
1 401 PRO n 
1 402 ILE n 
1 403 LEU n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 LEU n 
1 408 GLU n 
1 409 ASP n 
1 410 ILE n 
1 411 LYS n 
1 412 PRO n 
1 413 PHE n 
1 414 ILE n 
1 415 ILE n 
1 416 LYS n 
1 417 SER n 
1 418 TYR n 
1 419 VAL n 
1 420 TYR n 
1 421 LYS n 
1 422 MET n 
1 423 GLY n 
1 424 ASN n 
1 425 PHE n 
1 426 ILE n 
1 427 PRO n 
1 428 GLU n 
1 429 CYS n 
1 430 LYS n 
1 431 PRO n 
1 432 PHE n 
1 433 ILE n 
1 434 LEU n 
1 435 LYS n 
1 436 LYS n 
1 437 MET n 
1 438 GLU n 
1 439 ASP n 
1 440 LYS n 
1 441 GLU n 
1 442 LYS n 
1 443 ASN n 
1 444 LEU n 
1 445 TYR n 
1 446 ILE n 
1 447 GLY n 
1 448 ILE n 
1 449 ASP n 
1 450 LEU n 
1 451 SER n 
1 452 HIS n 
1 453 ASP n 
1 454 THR n 
1 455 TYR n 
1 456 ALA n 
1 457 ARG n 
1 458 LYS n 
1 459 THR n 
1 460 ASN n 
1 461 LEU n 
1 462 CYS n 
1 463 ILE n 
1 464 ALA n 
1 465 ALA n 
1 466 VAL n 
1 467 ASP n 
1 468 ASN n 
1 469 THR n 
1 470 GLY n 
1 471 ASP n 
1 472 ILE n 
1 473 LEU n 
1 474 TYR n 
1 475 ILE n 
1 476 GLY n 
1 477 LYS n 
1 478 HIS n 
1 479 LYS n 
1 480 ASN n 
1 481 LEU n 
1 482 GLU n 
1 483 LEU n 
1 484 ASN n 
1 485 GLU n 
1 486 LYS n 
1 487 MET n 
1 488 ASN n 
1 489 LEU n 
1 490 ASP n 
1 491 ILE n 
1 492 LEU n 
1 493 GLU n 
1 494 LYS n 
1 495 GLU n 
1 496 TYR n 
1 497 ILE n 
1 498 LYS n 
1 499 ALA n 
1 500 PHE n 
1 501 GLU n 
1 502 LYS n 
1 503 TYR n 
1 504 ILE n 
1 505 GLU n 
1 506 LYS n 
1 507 PHE n 
1 508 ASN n 
1 509 VAL n 
1 510 SER n 
1 511 PRO n 
1 512 GLU n 
1 513 ASN n 
1 514 VAL n 
1 515 PHE n 
1 516 ILE n 
1 517 LEU n 
1 518 ARG n 
1 519 ASP n 
1 520 GLY n 
1 521 ARG n 
1 522 PHE n 
1 523 ILE n 
1 524 GLU n 
1 525 ASP n 
1 526 ILE n 
1 527 GLU n 
1 528 ILE n 
1 529 ILE n 
1 530 LYS n 
1 531 ASN n 
1 532 PHE n 
1 533 ILE n 
1 534 SER n 
1 535 TYR n 
1 536 ASN n 
1 537 ASP n 
1 538 THR n 
1 539 LYS n 
1 540 TYR n 
1 541 THR n 
1 542 LEU n 
1 543 VAL n 
1 544 GLU n 
1 545 VAL n 
1 546 ASN n 
1 547 LYS n 
1 548 ASN n 
1 549 THR n 
1 550 ASN n 
1 551 ILE n 
1 552 ASN n 
1 553 SER n 
1 554 TYR n 
1 555 ASP n 
1 556 ASP n 
1 557 LEU n 
1 558 LYS n 
1 559 GLU n 
1 560 TRP n 
1 561 ILE n 
1 562 ILE n 
1 563 LYS n 
1 564 LEU n 
1 565 ASP n 
1 566 GLU n 
1 567 ASN n 
1 568 THR n 
1 569 TYR n 
1 570 ILE n 
1 571 TYR n 
1 572 TYR n 
1 573 PRO n 
1 574 LYS n 
1 575 THR n 
1 576 PHE n 
1 577 LEU n 
1 578 ASN n 
1 579 GLN n 
1 580 LYS n 
1 581 GLY n 
1 582 VAL n 
1 583 GLU n 
1 584 VAL n 
1 585 LYS n 
1 586 ILE n 
1 587 LEU n 
1 588 GLU n 
1 589 ASN n 
1 590 ASN n 
1 591 THR n 
1 592 ASP n 
1 593 TYR n 
1 594 THR n 
1 595 ILE n 
1 596 GLU n 
1 597 GLU n 
1 598 ILE n 
1 599 ILE n 
1 600 GLU n 
1 601 GLN n 
1 602 ILE n 
1 603 TYR n 
1 604 LEU n 
1 605 LEU n 
1 606 THR n 
1 607 ARG n 
1 608 VAL n 
1 609 ALA n 
1 610 HIS n 
1 611 SER n 
1 612 THR n 
1 613 PRO n 
1 614 TYR n 
1 615 THR n 
1 616 ASN n 
1 617 TYR n 
1 618 LYS n 
1 619 LEU n 
1 620 PRO n 
1 621 TYR n 
1 622 PRO n 
1 623 LEU n 
1 624 HIS n 
1 625 ILE n 
1 626 ALA n 
1 627 ASN n 
1 628 LYS n 
1 629 VAL n 
1 630 ALA n 
1 631 LEU n 
1 632 THR n 
1 633 ASP n 
1 634 TYR n 
1 635 GLU n 
1 636 TRP n 
1 637 LYS n 
1 638 LEU n 
1 639 TYR n 
1 640 ILE n 
1 641 PRO n 
1 642 TYR n 
2 1   U   n 
2 2   A   n 
2 3   U   n 
2 4   A   n 
2 5   C   n 
2 6   A   n 
2 7   A   n 
2 8   C   n 
2 9   C   n 
2 10  U   n 
2 11  A   n 
2 12  C   n 
2 13  U   n 
2 14  A   n 
2 15  C   n 
2 16  C   n 
2 17  U   n 
2 18  C   n 
2 19  A   n 
2 20  U   n 
2 21  U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   642 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Marpi_0405 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'DSM 14283 / JCM 11233 / KA3' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Marinitoga piezophila (strain DSM 14283 / JCM 11233 / KA3)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     443254 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       21 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H2J4R4_MARPK H2J4R4 ? 1 
;YLNLYKIDIPKKIKRLYFYNPDMEPKLFARNLSRVNNFKFQDSNDLVWIEIPDIDFQITPKNVFQYKVEKEEIIKEEEDK
KLFVKTLYKYIKKLFLDNDFYFKKGNNFISNSEVFSLDSNENVNAHLTYKIKIHNISNEYYLSILPKFTFLSKEPALESA
IKSGYLYNIKSGKSFPYISGLDGILKIDIGNNQIVEVAYPENYLFNFTTRDAEKYGFSKEVHEIYKNKVFEGFKKIPKTL
GFLNKITNLNENYQLKDGYKIFINVIYKFKNGESRYAKDVFKYSFYKNEQPLKAIFFFSSKKQFFEVQKSLKELFHNKHS
VFYRAAAELGFSKVEFLRDSKTKSSAFLYNPEEFTVKNTEFINQIEDNVMAIVLLDKYIGNIDPLVRNFPDNLILQPILK
EKLEDIKPFIIKSYVYKMGNFIPECKPFILKKMEDKEKNLYIGIDLSHDTYARKTNLCIAAVDNTGDILYIGKHKNLELN
EKMNLDILEKEYIKAFEKYIEKFNVSPENVFILRDGRFIEDIEIIKNFISYNDTKYTLVEVNKNTNINSYDDLKEWIIKL
DENTYIYYPKTFLNQKGVEVKILENNTDYTIEEIIEQIYLLTRVAHSTPYTNYKLPYPLHIANKVALTDYEWKLYIPY
;
2 
2 PDB 5I4A         5I4A   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5I4A A 5 ? 642 ? H2J4R4 2 ? 639 ? 2 639 
2 2 5I4A B 1 ? 21  ? 5I4A   1 ? 21  ? 1 21  
3 1 5I4A C 5 ? 642 ? H2J4R4 2 ? 639 ? 2 639 
4 2 5I4A D 1 ? 21  ? 5I4A   1 ? 21  ? 1 21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I4A GLY A 1 ? UNP H2J4R4 ? ? 'expression tag' -2 1 
1 5I4A ALA A 2 ? UNP H2J4R4 ? ? 'expression tag' -1 2 
1 5I4A ASN A 3 ? UNP H2J4R4 ? ? 'expression tag' 0  3 
1 5I4A ALA A 4 ? UNP H2J4R4 ? ? 'expression tag' 1  4 
3 5I4A GLY C 1 ? UNP H2J4R4 ? ? 'expression tag' -2 5 
3 5I4A ALA C 2 ? UNP H2J4R4 ? ? 'expression tag' -1 6 
3 5I4A ASN C 3 ? UNP H2J4R4 ? ? 'expression tag' 0  7 
3 5I4A ALA C 4 ? UNP H2J4R4 ? ? 'expression tag' 1  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I4A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.47 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '27% PEG 2,000, 0.1M HEPES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-09-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Double flat crystal, Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.11587 1.0 
2 0.97964 1.0 
3 0.97197 1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.11587,0.97964,0.97197 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5I4A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.949 
_reflns.d_resolution_low                 48.33 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       100295 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.9 
_reflns.pdbx_Rmerge_I_obs                0.082 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.949 
_reflns_shell.d_res_low                   1.98 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        82.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.136 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I4A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     198823 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.327 
_refine.ls_d_res_high                            1.949 
_refine.ls_percent_reflns_obs                    95.85 
_refine.ls_R_factor_obs                          0.2161 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2157 
_refine.ls_R_factor_R_free                       0.2387 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.01 
_refine.ls_number_reflns_R_free                  4003 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.26 
_refine.pdbx_overall_phase_error                 26.18 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10664 
_refine_hist.pdbx_number_atoms_nucleic_acid   437 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             704 
_refine_hist.number_atoms_total               11805 
_refine_hist.d_res_high                       1.949 
_refine_hist.d_res_low                        48.327 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 11399 'X-RAY DIFFRACTION' ? 
f_angle_d          0.578  ? ? 15459 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.936 ? ? 6863  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.045  ? ? 1702  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1870  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.9487 1.9716  4955 0.3530 71.00 0.3112 . . 114 . . . . 
'X-RAY DIFFRACTION' . 1.9716 1.9956  6534 0.3413 95.00 0.3690 . . 130 . . . . 
'X-RAY DIFFRACTION' . 1.9956 2.0209  6806 0.3336 95.00 0.3390 . . 132 . . . . 
'X-RAY DIFFRACTION' . 2.0209 2.0475  6671 0.3150 95.00 0.3338 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.0475 2.0755  6599 0.3116 95.00 0.3294 . . 138 . . . . 
'X-RAY DIFFRACTION' . 2.0755 2.1052  6801 0.3017 96.00 0.2828 . . 136 . . . . 
'X-RAY DIFFRACTION' . 2.1052 2.1366  6606 0.2953 95.00 0.3087 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.1366 2.1700  6733 0.2836 96.00 0.2809 . . 154 . . . . 
'X-RAY DIFFRACTION' . 2.1700 2.2056  6759 0.2794 96.00 0.3048 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.2056 2.2436  6651 0.2726 96.00 0.3108 . . 127 . . . . 
'X-RAY DIFFRACTION' . 2.2436 2.2844  6775 0.2663 96.00 0.2701 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.2844 2.3283  6756 0.2569 96.00 0.2787 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.3283 2.3759  6645 0.2568 96.00 0.2819 . . 134 . . . . 
'X-RAY DIFFRACTION' . 2.3759 2.4275  6796 0.2576 96.00 0.2809 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.4275 2.4840  6715 0.2572 96.00 0.2970 . . 138 . . . . 
'X-RAY DIFFRACTION' . 2.4840 2.5461  6847 0.2512 97.00 0.3113 . . 133 . . . . 
'X-RAY DIFFRACTION' . 2.5461 2.6149  6703 0.2355 97.00 0.2480 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.6149 2.6919  6887 0.2303 97.00 0.2388 . . 133 . . . . 
'X-RAY DIFFRACTION' . 2.6919 2.7788  6716 0.2403 97.00 0.2452 . . 129 . . . . 
'X-RAY DIFFRACTION' . 2.7788 2.8781  6791 0.2286 97.00 0.2563 . . 138 . . . . 
'X-RAY DIFFRACTION' . 2.8781 2.9933  6865 0.2272 97.00 0.2323 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.9933 3.1295  6764 0.2081 97.00 0.2784 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.1295 3.2944  6813 0.2043 98.00 0.2478 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.2944 3.5008  6886 0.1963 98.00 0.2118 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.5008 3.7710  6899 0.1796 99.00 0.2079 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.7710 4.1503  6969 0.1726 99.00 0.1922 . . 136 . . . . 
'X-RAY DIFFRACTION' . 4.1503 4.7504  6954 0.1616 99.00 0.1955 . . 134 . . . . 
'X-RAY DIFFRACTION' . 4.7504 5.9832  6973 0.1712 99.00 0.2010 . . 140 . . . . 
'X-RAY DIFFRACTION' . 5.9832 48.3415 6951 0.1842 99.00 0.1842 . . 152 . . . . 
# 
_struct.entry_id                     5I4A 
_struct.title                        
;X-ray crystal structure of Marinitoga piezophila Argonaute in complex with 5' OH guide RNA
;
_struct.pdbx_descriptor              'Argonaute protein/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I4A 
_struct_keywords.text            
;Argonaute, 5' OH, Guide RNA, RNA BINDING PROTEIN-RNA complex
;
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN/RNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 28  ? ASN A 41  ? GLU A 25  ASN A 38  1 ? 14 
HELX_P HELX_P2  AA2 PRO A 64  ? GLN A 69  ? PRO A 61  GLN A 66  5 ? 6  
HELX_P HELX_P3  AA3 ASP A 83  ? ASN A 102 ? ASP A 80  ASN A 99  1 ? 20 
HELX_P HELX_P4  AA4 PRO A 159 ? SER A 163 ? PRO A 156 SER A 160 5 ? 5  
HELX_P HELX_P5  AA5 TYR A 203 ? GLU A 205 ? TYR A 200 GLU A 202 5 ? 3  
HELX_P HELX_P6  AA6 THR A 212 ? TYR A 219 ? THR A 209 TYR A 216 1 ? 8  
HELX_P HELX_P7  AA7 PHE A 221 ? LYS A 232 ? PHE A 218 LYS A 229 1 ? 12 
HELX_P HELX_P8  AA8 VAL A 233 ? LYS A 239 ? VAL A 230 LYS A 236 1 ? 7  
HELX_P HELX_P9  AA9 LYS A 239 ? LEU A 244 ? LYS A 236 LEU A 241 1 ? 6  
HELX_P HELX_P10 AB1 GLY A 245 ? ILE A 250 ? GLY A 242 ILE A 247 5 ? 6  
HELX_P HELX_P11 AB2 TYR A 280 ? LYS A 282 ? TYR A 277 LYS A 279 5 ? 3  
HELX_P HELX_P12 AB3 ASP A 283 ? SER A 288 ? ASP A 280 SER A 285 1 ? 6  
HELX_P HELX_P13 AB4 SER A 304 ? VAL A 311 ? SER A 301 VAL A 308 1 ? 8  
HELX_P HELX_P14 AB5 VAL A 311 ? HIS A 320 ? VAL A 308 HIS A 317 1 ? 10 
HELX_P HELX_P15 AB6 SER A 324 ? GLY A 334 ? SER A 321 GLY A 331 1 ? 11 
HELX_P HELX_P16 AB7 THR A 363 ? GLN A 368 ? THR A 360 GLN A 365 1 ? 6  
HELX_P HELX_P17 AB8 ILE A 386 ? PHE A 393 ? ILE A 383 PHE A 390 1 ? 8  
HELX_P HELX_P18 AB9 LYS A 404 ? ILE A 410 ? LYS A 401 ILE A 407 1 ? 7  
HELX_P HELX_P19 AC1 LYS A 411 ? PHE A 425 ? LYS A 408 PHE A 422 1 ? 15 
HELX_P HELX_P20 AC2 LYS A 436 ? GLU A 438 ? LYS A 433 GLU A 435 5 ? 3  
HELX_P HELX_P21 AC3 ASN A 484 ? ASN A 508 ? ASN A 481 ASN A 505 1 ? 25 
HELX_P HELX_P22 AC4 ASP A 525 ? ILE A 533 ? ASP A 522 ILE A 530 1 ? 9  
HELX_P HELX_P23 AC5 THR A 594 ? THR A 606 ? THR A 591 THR A 603 1 ? 13 
HELX_P HELX_P24 AC6 PRO A 620 ? THR A 632 ? PRO A 617 THR A 629 1 ? 13 
HELX_P HELX_P25 AC7 TYR A 634 ? TYR A 639 ? TYR A 631 TYR A 636 5 ? 6  
HELX_P HELX_P26 AC8 GLU C 28  ? ASN C 41  ? GLU C 25  ASN C 38  1 ? 14 
HELX_P HELX_P27 AC9 PRO C 64  ? GLN C 69  ? PRO C 61  GLN C 66  5 ? 6  
HELX_P HELX_P28 AD1 ASP C 83  ? ASN C 102 ? ASP C 80  ASN C 99  1 ? 20 
HELX_P HELX_P29 AD2 PRO C 159 ? SER C 163 ? PRO C 156 SER C 160 5 ? 5  
HELX_P HELX_P30 AD3 TYR C 203 ? GLU C 205 ? TYR C 200 GLU C 202 5 ? 3  
HELX_P HELX_P31 AD4 THR C 212 ? TYR C 219 ? THR C 209 TYR C 216 1 ? 8  
HELX_P HELX_P32 AD5 PHE C 221 ? LYS C 232 ? PHE C 218 LYS C 229 1 ? 12 
HELX_P HELX_P33 AD6 VAL C 233 ? LEU C 244 ? VAL C 230 LEU C 241 1 ? 12 
HELX_P HELX_P34 AD7 GLY C 245 ? ILE C 250 ? GLY C 242 ILE C 247 5 ? 6  
HELX_P HELX_P35 AD8 TYR C 280 ? LYS C 282 ? TYR C 277 LYS C 279 5 ? 3  
HELX_P HELX_P36 AD9 ASP C 283 ? SER C 288 ? ASP C 280 SER C 285 1 ? 6  
HELX_P HELX_P37 AE1 SER C 304 ? HIS C 320 ? SER C 301 HIS C 317 1 ? 17 
HELX_P HELX_P38 AE2 SER C 324 ? GLY C 334 ? SER C 321 GLY C 331 1 ? 11 
HELX_P HELX_P39 AE3 THR C 363 ? ILE C 369 ? THR C 360 ILE C 366 1 ? 7  
HELX_P HELX_P40 AE4 ILE C 386 ? PHE C 393 ? ILE C 383 PHE C 390 1 ? 8  
HELX_P HELX_P41 AE5 LYS C 404 ? ASP C 409 ? LYS C 401 ASP C 406 1 ? 6  
HELX_P HELX_P42 AE6 LYS C 411 ? PHE C 425 ? LYS C 408 PHE C 422 1 ? 15 
HELX_P HELX_P43 AE7 LYS C 436 ? GLU C 438 ? LYS C 433 GLU C 435 5 ? 3  
HELX_P HELX_P44 AE8 ASN C 484 ? ASN C 508 ? ASN C 481 ASN C 505 1 ? 25 
HELX_P HELX_P45 AE9 ASP C 525 ? SER C 534 ? ASP C 522 SER C 531 1 ? 10 
HELX_P HELX_P46 AF1 THR C 594 ? THR C 606 ? THR C 591 THR C 603 1 ? 13 
HELX_P HELX_P47 AF2 PRO C 620 ? THR C 632 ? PRO C 617 THR C 629 1 ? 13 
HELX_P HELX_P48 AF3 TYR C 634 ? TYR C 639 ? TYR C 631 TYR C 636 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 63 A . ? THR 60 A PRO 64 A ? PRO 61 A 1 -0.15 
2 THR 63 C . ? THR 60 C PRO 64 C ? PRO 61 C 1 1.16  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 7 ? 
AA3 ? 4 ? 
AA4 ? 9 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 5 ? 
AB1 ? 7 ? 
AB2 ? 3 ? 
AB3 ? 9 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? parallel      
AA4 6 7 ? parallel      
AA4 7 8 ? anti-parallel 
AA4 8 9 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB1 6 7 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? parallel      
AB3 6 7 ? parallel      
AB3 7 8 ? anti-parallel 
AB3 8 9 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? parallel      
AB6 1 2 ? parallel      
AB6 2 3 ? parallel      
AB6 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 8   ? LYS A 10  ? LEU A 5   LYS A 7   
AA1 2 GLU A 143 ? SER A 156 ? GLU A 140 SER A 153 
AA1 3 VAL A 127 ? ILE A 140 ? VAL A 124 ILE A 137 
AA1 4 ASN A 111 ? SER A 120 ? ASN A 108 SER A 117 
AA1 5 TYR A 105 ? LYS A 107 ? TYR A 102 LYS A 104 
AA2 1 LEU A 8   ? LYS A 10  ? LEU A 5   LYS A 7   
AA2 2 GLU A 143 ? SER A 156 ? GLU A 140 SER A 153 
AA2 3 TYR A 207 ? PHE A 211 ? TYR A 204 PHE A 208 
AA2 4 TYR A 169 ? ASN A 172 ? TYR A 166 ASN A 169 
AA2 5 SER A 178 ? LEU A 185 ? SER A 175 LEU A 182 
AA2 6 ILE A 188 ? ASP A 192 ? ILE A 185 ASP A 189 
AA2 7 ILE A 198 ? GLU A 200 ? ILE A 195 GLU A 197 
AA3 1 GLN A 45  ? ASP A 46  ? GLN A 42  ASP A 43  
AA3 2 VAL A 51  ? PRO A 56  ? VAL A 48  PRO A 53  
AA3 3 LYS A 16  ? PHE A 22  ? LYS A 13  PHE A 19  
AA3 4 LYS A 71  ? LYS A 79  ? LYS A 68  LYS A 76  
AA4 1 LYS A 264 ? PHE A 266 ? LYS A 261 PHE A 263 
AA4 2 TRP A 560 ? ASP A 565 ? TRP A 557 ASP A 562 
AA4 3 THR A 568 ? TYR A 571 ? THR A 565 TYR A 568 
AA4 4 VAL A 582 ? ASN A 589 ? VAL A 579 ASN A 586 
AA4 5 LYS A 539 ? ASN A 546 ? LYS A 536 ASN A 543 
AA4 6 ASN A 513 ? ASP A 519 ? ASN A 510 ASP A 516 
AA4 7 ASN A 443 ? ASP A 453 ? ASN A 440 ASP A 450 
AA4 8 LYS A 458 ? VAL A 466 ? LYS A 455 VAL A 463 
AA4 9 ILE A 472 ? GLU A 482 ? ILE A 469 GLU A 479 
AA5 1 GLU A 277 ? SER A 278 ? GLU A 274 SER A 275 
AA5 2 TYR A 271 ? LYS A 272 ? TYR A 268 LYS A 269 
AA5 3 ILE A 433 ? LEU A 434 ? ILE A 430 LEU A 431 
AA6 1 LYS A 337 ? PHE A 340 ? LYS A 334 PHE A 337 
AA6 2 PRO A 295 ? PHE A 302 ? PRO A 292 PHE A 299 
AA6 3 ALA A 350 ? LEU A 352 ? ALA A 347 LEU A 349 
AA7 1 LYS A 337 ? PHE A 340 ? LYS A 334 PHE A 337 
AA7 2 PRO A 295 ? PHE A 302 ? PRO A 292 PHE A 299 
AA7 3 MET A 374 ? LEU A 379 ? MET A 371 LEU A 376 
AA7 4 ILE A 398 ? LEU A 403 ? ILE A 395 LEU A 400 
AA8 1 TYR C 5   ? LEU C 6   ? TYR C 2   LEU C 3   
AA8 2 TYR C 257 ? GLN C 258 ? TYR C 254 GLN C 255 
AA9 1 LEU C 8   ? LYS C 10  ? LEU C 5   LYS C 7   
AA9 2 GLU C 143 ? SER C 156 ? GLU C 140 SER C 153 
AA9 3 VAL C 127 ? ILE C 140 ? VAL C 124 ILE C 137 
AA9 4 ASN C 111 ? SER C 120 ? ASN C 108 SER C 117 
AA9 5 TYR C 105 ? LYS C 107 ? TYR C 102 LYS C 104 
AB1 1 LEU C 8   ? LYS C 10  ? LEU C 5   LYS C 7   
AB1 2 GLU C 143 ? SER C 156 ? GLU C 140 SER C 153 
AB1 3 TYR C 207 ? PHE C 211 ? TYR C 204 PHE C 208 
AB1 4 TYR C 169 ? ASN C 172 ? TYR C 166 ASN C 169 
AB1 5 SER C 178 ? LEU C 185 ? SER C 175 LEU C 182 
AB1 6 ILE C 188 ? ASP C 192 ? ILE C 185 ASP C 189 
AB1 7 ILE C 198 ? GLU C 200 ? ILE C 195 GLU C 197 
AB2 1 VAL C 51  ? PRO C 56  ? VAL C 48  PRO C 53  
AB2 2 LYS C 16  ? PHE C 22  ? LYS C 13  PHE C 19  
AB2 3 LYS C 71  ? LYS C 79  ? LYS C 68  LYS C 76  
AB3 1 LYS C 264 ? PHE C 266 ? LYS C 261 PHE C 263 
AB3 2 TRP C 560 ? ASP C 565 ? TRP C 557 ASP C 562 
AB3 3 THR C 568 ? TYR C 571 ? THR C 565 TYR C 568 
AB3 4 VAL C 582 ? ASN C 589 ? VAL C 579 ASN C 586 
AB3 5 LYS C 539 ? ASN C 546 ? LYS C 536 ASN C 543 
AB3 6 ASN C 513 ? ASP C 519 ? ASN C 510 ASP C 516 
AB3 7 ASN C 443 ? ASP C 453 ? ASN C 440 ASP C 450 
AB3 8 LYS C 458 ? VAL C 466 ? LYS C 455 VAL C 463 
AB3 9 ILE C 472 ? GLU C 482 ? ILE C 469 GLU C 479 
AB4 1 GLU C 277 ? SER C 278 ? GLU C 274 SER C 275 
AB4 2 TYR C 271 ? LYS C 272 ? TYR C 268 LYS C 269 
AB4 3 ILE C 433 ? LEU C 434 ? ILE C 430 LEU C 431 
AB5 1 LYS C 337 ? PHE C 340 ? LYS C 334 PHE C 337 
AB5 2 PRO C 295 ? PHE C 302 ? PRO C 292 PHE C 299 
AB5 3 ALA C 350 ? LEU C 352 ? ALA C 347 LEU C 349 
AB6 1 LYS C 337 ? PHE C 340 ? LYS C 334 PHE C 337 
AB6 2 PRO C 295 ? PHE C 302 ? PRO C 292 PHE C 299 
AB6 3 VAL C 373 ? LEU C 379 ? VAL C 370 LEU C 376 
AB6 4 ILE C 398 ? LEU C 403 ? ILE C 395 LEU C 400 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 9   ? N TYR A 6   O LEU A 146 ? O LEU A 143 
AA1 2 3 O LEU A 155 ? O LEU A 152 N ASN A 128 ? N ASN A 125 
AA1 3 4 O LEU A 131 ? O LEU A 128 N SER A 114 ? N SER A 111 
AA1 4 5 O ILE A 113 ? O ILE A 110 N TYR A 105 ? N TYR A 102 
AA2 1 2 N TYR A 9   ? N TYR A 6   O LEU A 146 ? O LEU A 143 
AA2 2 3 N PHE A 154 ? N PHE A 151 O PHE A 211 ? O PHE A 208 
AA2 3 4 O LEU A 208 ? O LEU A 205 N TYR A 171 ? N TYR A 168 
AA2 4 5 N LEU A 170 ? N LEU A 167 O PHE A 179 ? O PHE A 176 
AA2 5 6 N SER A 183 ? N SER A 180 O LYS A 190 ? O LYS A 187 
AA2 6 7 N ILE A 191 ? N ILE A 188 O VAL A 199 ? O VAL A 196 
AA3 1 2 N GLN A 45  ? N GLN A 42  O TRP A 52  ? O TRP A 49  
AA3 2 3 O ILE A 55  ? O ILE A 52  N LYS A 18  ? N LYS A 15  
AA3 3 4 N ILE A 17  ? N ILE A 14  O ILE A 78  ? O ILE A 75  
AA4 1 2 N ILE A 265 ? N ILE A 262 O ILE A 561 ? O ILE A 558 
AA4 2 3 N ILE A 562 ? N ILE A 559 O ILE A 570 ? O ILE A 567 
AA4 3 4 N TYR A 569 ? N TYR A 566 O VAL A 584 ? O VAL A 581 
AA4 4 5 O LYS A 585 ? O LYS A 582 N GLU A 544 ? N GLU A 541 
AA4 5 6 O VAL A 545 ? O VAL A 542 N ARG A 518 ? N ARG A 515 
AA4 6 7 O PHE A 515 ? O PHE A 512 N ILE A 446 ? N ILE A 443 
AA4 7 8 N GLY A 447 ? N GLY A 444 O ALA A 464 ? O ALA A 461 
AA4 8 9 N THR A 459 ? N THR A 456 O LEU A 481 ? O LEU A 478 
AA5 1 2 O SER A 278 ? O SER A 275 N TYR A 271 ? N TYR A 268 
AA5 2 3 N LYS A 272 ? N LYS A 269 O ILE A 433 ? O ILE A 430 
AA6 1 2 O LYS A 337 ? O LYS A 334 N LEU A 296 ? N LEU A 293 
AA6 2 3 N PHE A 302 ? N PHE A 299 O PHE A 351 ? O PHE A 348 
AA7 1 2 O LYS A 337 ? O LYS A 334 N LEU A 296 ? N LEU A 293 
AA7 2 3 N PHE A 301 ? N PHE A 298 O ILE A 376 ? O ILE A 373 
AA7 3 4 N ALA A 375 ? N ALA A 372 O ILE A 398 ? O ILE A 395 
AA8 1 2 N LEU C 6   ? N LEU C 3   O TYR C 257 ? O TYR C 254 
AA9 1 2 N TYR C 9   ? N TYR C 6   O LEU C 146 ? O LEU C 143 
AA9 2 3 O LEU C 155 ? O LEU C 152 N ASN C 128 ? N ASN C 125 
AA9 3 4 O LEU C 131 ? O LEU C 128 N GLU C 117 ? N GLU C 114 
AA9 4 5 O ILE C 113 ? O ILE C 110 N TYR C 105 ? N TYR C 102 
AB1 1 2 N TYR C 9   ? N TYR C 6   O LEU C 146 ? O LEU C 143 
AB1 2 3 N PHE C 154 ? N PHE C 151 O PHE C 211 ? O PHE C 208 
AB1 3 4 O LEU C 208 ? O LEU C 205 N TYR C 171 ? N TYR C 168 
AB1 4 5 N LEU C 170 ? N LEU C 167 O PHE C 179 ? O PHE C 176 
AB1 5 6 N SER C 183 ? N SER C 180 O LYS C 190 ? O LYS C 187 
AB1 6 7 N ILE C 191 ? N ILE C 188 O VAL C 199 ? O VAL C 196 
AB2 1 2 O VAL C 51  ? O VAL C 48  N PHE C 22  ? N PHE C 19  
AB2 2 3 N ILE C 17  ? N ILE C 14  O ILE C 78  ? O ILE C 75  
AB3 1 2 N ILE C 265 ? N ILE C 262 O ILE C 561 ? O ILE C 558 
AB3 2 3 N ILE C 562 ? N ILE C 559 O ILE C 570 ? O ILE C 567 
AB3 3 4 N TYR C 569 ? N TYR C 566 O VAL C 584 ? O VAL C 581 
AB3 4 5 O LYS C 585 ? O LYS C 582 N GLU C 544 ? N GLU C 541 
AB3 5 6 O VAL C 543 ? O VAL C 540 N ILE C 516 ? N ILE C 513 
AB3 6 7 O PHE C 515 ? O PHE C 512 N LEU C 444 ? N LEU C 441 
AB3 7 8 N ASP C 453 ? N ASP C 450 O LYS C 458 ? O LYS C 455 
AB3 8 9 N LEU C 461 ? N LEU C 458 O HIS C 478 ? O HIS C 475 
AB4 1 2 O SER C 278 ? O SER C 275 N TYR C 271 ? N TYR C 268 
AB4 2 3 N LYS C 272 ? N LYS C 269 O ILE C 433 ? O ILE C 430 
AB5 1 2 O LYS C 337 ? O LYS C 334 N LEU C 296 ? N LEU C 293 
AB5 2 3 N PHE C 302 ? N PHE C 299 O PHE C 351 ? O PHE C 348 
AB6 1 2 O LYS C 337 ? O LYS C 334 N LEU C 296 ? N LEU C 293 
AB6 2 3 N PHE C 301 ? N PHE C 298 O ILE C 376 ? O ILE C 373 
AB6 3 4 N ALA C 375 ? N ALA C 372 O ILE C 398 ? O ILE C 395 
# 
_atom_sites.entry_id                    5I4A 
_atom_sites.fract_transf_matrix[1][1]   0.019653 
_atom_sites.fract_transf_matrix[1][2]   0.000031 
_atom_sites.fract_transf_matrix[1][3]   0.000212 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013259 
_atom_sites.fract_transf_matrix[2][3]   0.005055 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010471 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ALA A 1 4   ? 10.116  31.527  44.139  1.00 48.25  ?  1    ALA A N     1 
ATOM   2     C CA    . ALA A 1 4   ? 9.882   31.458  45.577  1.00 48.81  ?  1    ALA A CA    1 
ATOM   3     C C     . ALA A 1 4   ? 10.547  32.628  46.297  1.00 48.79  ?  1    ALA A C     1 
ATOM   4     O O     . ALA A 1 4   ? 11.702  32.962  46.031  1.00 51.02  ?  1    ALA A O     1 
ATOM   5     C CB    . ALA A 1 4   ? 10.384  30.134  46.135  1.00 51.85  ?  1    ALA A CB    1 
ATOM   6     N N     . TYR A 1 5   ? 9.805   33.242  47.212  1.00 53.04  ?  2    TYR A N     1 
ATOM   7     C CA    . TYR A 1 5   ? 10.281  34.394  47.964  1.00 53.63  ?  2    TYR A CA    1 
ATOM   8     C C     . TYR A 1 5   ? 11.026  33.944  49.213  1.00 46.77  ?  2    TYR A C     1 
ATOM   9     O O     . TYR A 1 5   ? 10.625  32.985  49.877  1.00 50.70  ?  2    TYR A O     1 
ATOM   10    C CB    . TYR A 1 5   ? 9.102   35.295  48.347  1.00 49.39  ?  2    TYR A CB    1 
ATOM   11    C CG    . TYR A 1 5   ? 9.359   36.260  49.490  1.00 53.82  ?  2    TYR A CG    1 
ATOM   12    C CD1   . TYR A 1 5   ? 9.169   35.870  50.813  1.00 55.89  ?  2    TYR A CD1   1 
ATOM   13    C CD2   . TYR A 1 5   ? 9.763   37.568  49.248  1.00 43.59  ?  2    TYR A CD2   1 
ATOM   14    C CE1   . TYR A 1 5   ? 9.392   36.743  51.858  1.00 52.90  ?  2    TYR A CE1   1 
ATOM   15    C CE2   . TYR A 1 5   ? 9.984   38.453  50.291  1.00 49.24  ?  2    TYR A CE2   1 
ATOM   16    C CZ    . TYR A 1 5   ? 9.799   38.033  51.594  1.00 46.26  ?  2    TYR A CZ    1 
ATOM   17    O OH    . TYR A 1 5   ? 10.018  38.902  52.639  1.00 40.14  ?  2    TYR A OH    1 
ATOM   18    N N     . LEU A 1 6   ? 12.113  34.642  49.527  1.00 39.02  ?  3    LEU A N     1 
ATOM   19    C CA    . LEU A 1 6   ? 12.772  34.524  50.818  1.00 35.82  ?  3    LEU A CA    1 
ATOM   20    C C     . LEU A 1 6   ? 12.784  35.889  51.490  1.00 37.06  ?  3    LEU A C     1 
ATOM   21    O O     . LEU A 1 6   ? 12.844  36.925  50.822  1.00 46.67  ?  3    LEU A O     1 
ATOM   22    C CB    . LEU A 1 6   ? 14.207  33.990  50.689  1.00 37.45  ?  3    LEU A CB    1 
ATOM   23    C CG    . LEU A 1 6   ? 14.382  32.533  50.256  1.00 40.39  ?  3    LEU A CG    1 
ATOM   24    C CD1   . LEU A 1 6   ? 15.841  32.109  50.384  1.00 30.10  ?  3    LEU A CD1   1 
ATOM   25    C CD2   . LEU A 1 6   ? 13.472  31.613  51.061  1.00 34.86  ?  3    LEU A CD2   1 
ATOM   26    N N     . ASN A 1 7   ? 12.726  35.887  52.819  1.00 34.56  ?  4    ASN A N     1 
ATOM   27    C CA    . ASN A 1 7   ? 12.708  37.133  53.584  1.00 33.80  ?  4    ASN A CA    1 
ATOM   28    C C     . ASN A 1 7   ? 14.086  37.777  53.695  1.00 34.46  ?  4    ASN A C     1 
ATOM   29    O O     . ASN A 1 7   ? 14.420  38.373  54.721  1.00 37.64  ?  4    ASN A O     1 
ATOM   30    C CB    . ASN A 1 7   ? 12.113  36.872  54.967  1.00 31.28  ?  4    ASN A CB    1 
ATOM   31    C CG    . ASN A 1 7   ? 12.979  35.962  55.820  1.00 27.55  ?  4    ASN A CG    1 
ATOM   32    O OD1   . ASN A 1 7   ? 13.808  35.214  55.307  1.00 31.65  ?  4    ASN A OD1   1 
ATOM   33    N ND2   . ASN A 1 7   ? 12.786  36.025  57.134  1.00 27.35  ?  4    ASN A ND2   1 
ATOM   34    N N     . LEU A 1 8   ? 14.900  37.674  52.650  1.00 33.33  ?  5    LEU A N     1 
ATOM   35    C CA    . LEU A 1 8   ? 16.250  38.214  52.641  1.00 35.04  ?  5    LEU A CA    1 
ATOM   36    C C     . LEU A 1 8   ? 16.275  39.540  51.895  1.00 32.36  ?  5    LEU A C     1 
ATOM   37    O O     . LEU A 1 8   ? 15.601  39.704  50.872  1.00 31.13  ?  5    LEU A O     1 
ATOM   38    C CB    . LEU A 1 8   ? 17.223  37.226  51.996  1.00 34.63  ?  5    LEU A CB    1 
ATOM   39    C CG    . LEU A 1 8   ? 17.418  35.933  52.787  1.00 38.26  ?  5    LEU A CG    1 
ATOM   40    C CD1   . LEU A 1 8   ? 18.217  34.916  51.988  1.00 36.51  ?  5    LEU A CD1   1 
ATOM   41    C CD2   . LEU A 1 8   ? 18.104  36.244  54.105  1.00 37.38  ?  5    LEU A CD2   1 
ATOM   42    N N     . TYR A 1 9   ? 17.052  40.487  52.413  1.00 32.74  ?  6    TYR A N     1 
ATOM   43    C CA    . TYR A 1 9   ? 17.139  41.821  51.840  1.00 37.77  ?  6    TYR A CA    1 
ATOM   44    C C     . TYR A 1 9   ? 18.599  42.229  51.733  1.00 36.00  ?  6    TYR A C     1 
ATOM   45    O O     . TYR A 1 9   ? 19.339  42.175  52.721  1.00 29.61  ?  6    TYR A O     1 
ATOM   46    C CB    . TYR A 1 9   ? 16.346  42.828  52.676  1.00 35.43  ?  6    TYR A CB    1 
ATOM   47    C CG    . TYR A 1 9   ? 14.860  42.550  52.660  1.00 40.92  ?  6    TYR A CG    1 
ATOM   48    C CD1   . TYR A 1 9   ? 14.057  43.035  51.635  1.00 41.67  ?  6    TYR A CD1   1 
ATOM   49    C CD2   . TYR A 1 9   ? 14.264  41.786  53.653  1.00 37.23  ?  6    TYR A CD2   1 
ATOM   50    C CE1   . TYR A 1 9   ? 12.700  42.777  51.607  1.00 37.92  ?  6    TYR A CE1   1 
ATOM   51    C CE2   . TYR A 1 9   ? 12.906  41.524  53.635  1.00 41.26  ?  6    TYR A CE2   1 
ATOM   52    C CZ    . TYR A 1 9   ? 12.130  42.022  52.610  1.00 41.65  ?  6    TYR A CZ    1 
ATOM   53    O OH    . TYR A 1 9   ? 10.779  41.765  52.582  1.00 47.92  ?  6    TYR A OH    1 
ATOM   54    N N     . LYS A 1 10  ? 19.003  42.637  50.534  1.00 36.28  ?  7    LYS A N     1 
ATOM   55    C CA    . LYS A 1 10  ? 20.401  42.943  50.270  1.00 39.39  ?  7    LYS A CA    1 
ATOM   56    C C     . LYS A 1 10  ? 20.800  44.247  50.948  1.00 39.83  ?  7    LYS A C     1 
ATOM   57    O O     . LYS A 1 10  ? 20.097  45.257  50.845  1.00 40.84  ?  7    LYS A O     1 
ATOM   58    C CB    . LYS A 1 10  ? 20.639  43.030  48.764  1.00 38.00  ?  7    LYS A CB    1 
ATOM   59    C CG    . LYS A 1 10  ? 22.098  43.054  48.355  1.00 44.31  ?  7    LYS A CG    1 
ATOM   60    C CD    . LYS A 1 10  ? 22.230  42.956  46.841  1.00 46.37  ?  7    LYS A CD    1 
ATOM   61    C CE    . LYS A 1 10  ? 23.678  43.082  46.400  1.00 51.29  ?  7    LYS A CE    1 
ATOM   62    N NZ    . LYS A 1 10  ? 24.524  42.000  46.971  1.00 58.59  1  7    LYS A NZ    1 
ATOM   63    N N     . ILE A 1 11  ? 21.931  44.222  51.642  1.00 34.89  ?  8    ILE A N     1 
ATOM   64    C CA    . ILE A 1 11  ? 22.459  45.396  52.325  1.00 40.39  ?  8    ILE A CA    1 
ATOM   65    C C     . ILE A 1 11  ? 23.362  46.146  51.357  1.00 42.00  ?  8    ILE A C     1 
ATOM   66    O O     . ILE A 1 11  ? 24.335  45.586  50.840  1.00 42.60  ?  8    ILE A O     1 
ATOM   67    C CB    . ILE A 1 11  ? 23.216  44.998  53.600  1.00 36.65  ?  8    ILE A CB    1 
ATOM   68    C CG1   . ILE A 1 11  ? 22.224  44.503  54.657  1.00 43.96  ?  8    ILE A CG1   1 
ATOM   69    C CG2   . ILE A 1 11  ? 24.047  46.165  54.119  1.00 35.64  ?  8    ILE A CG2   1 
ATOM   70    C CD1   . ILE A 1 11  ? 22.826  43.568  55.677  1.00 50.15  ?  8    ILE A CD1   1 
ATOM   71    N N     . ASP A 1 12  ? 23.041  47.413  51.108  1.00 37.74  ?  9    ASP A N     1 
ATOM   72    C CA    . ASP A 1 12  ? 23.768  48.254  50.157  1.00 41.48  ?  9    ASP A CA    1 
ATOM   73    C C     . ASP A 1 12  ? 24.385  49.428  50.913  1.00 40.79  ?  9    ASP A C     1 
ATOM   74    O O     . ASP A 1 12  ? 23.835  50.531  50.937  1.00 49.90  ?  9    ASP A O     1 
ATOM   75    C CB    . ASP A 1 12  ? 22.845  48.729  49.030  1.00 52.31  ?  9    ASP A CB    1 
ATOM   76    C CG    . ASP A 1 12  ? 23.568  49.584  48.006  1.00 73.15  ?  9    ASP A CG    1 
ATOM   77    O OD1   . ASP A 1 12  ? 24.275  49.014  47.149  1.00 85.34  ?  9    ASP A OD1   1 
ATOM   78    O OD2   . ASP A 1 12  ? 23.433  50.825  48.057  1.00 74.42  -1 9    ASP A OD2   1 
ATOM   79    N N     . ILE A 1 13  ? 25.531  49.179  51.539  1.00 38.18  ?  10   ILE A N     1 
ATOM   80    C CA    . ILE A 1 13  ? 26.310  50.215  52.218  1.00 36.96  ?  10   ILE A CA    1 
ATOM   81    C C     . ILE A 1 13  ? 27.784  49.954  51.958  1.00 32.75  ?  10   ILE A C     1 
ATOM   82    O O     . ILE A 1 13  ? 28.172  48.843  51.575  1.00 36.01  ?  10   ILE A O     1 
ATOM   83    C CB    . ILE A 1 13  ? 26.041  50.244  53.738  1.00 43.45  ?  10   ILE A CB    1 
ATOM   84    C CG1   . ILE A 1 13  ? 26.547  48.961  54.397  1.00 33.45  ?  10   ILE A CG1   1 
ATOM   85    C CG2   . ILE A 1 13  ? 24.566  50.474  54.043  1.00 52.75  ?  10   ILE A CG2   1 
ATOM   86    C CD1   . ILE A 1 13  ? 26.561  49.024  55.908  1.00 40.00  ?  10   ILE A CD1   1 
ATOM   87    N N     . PRO A 1 14  ? 28.632  50.968  52.140  1.00 36.89  ?  11   PRO A N     1 
ATOM   88    C CA    . PRO A 1 14  ? 30.078  50.735  52.035  1.00 35.35  ?  11   PRO A CA    1 
ATOM   89    C C     . PRO A 1 14  ? 30.535  49.642  52.989  1.00 39.78  ?  11   PRO A C     1 
ATOM   90    O O     . PRO A 1 14  ? 30.139  49.606  54.156  1.00 42.98  ?  11   PRO A O     1 
ATOM   91    C CB    . PRO A 1 14  ? 30.681  52.094  52.403  1.00 39.11  ?  11   PRO A CB    1 
ATOM   92    C CG    . PRO A 1 14  ? 29.634  53.080  52.009  1.00 43.20  ?  11   PRO A CG    1 
ATOM   93    C CD    . PRO A 1 14  ? 28.313  52.404  52.264  1.00 40.77  ?  11   PRO A CD    1 
ATOM   94    N N     . LYS A 1 15  ? 31.378  48.743  52.480  1.00 38.76  ?  12   LYS A N     1 
ATOM   95    C CA    . LYS A 1 15  ? 31.906  47.636  53.280  1.00 45.23  ?  12   LYS A CA    1 
ATOM   96    C C     . LYS A 1 15  ? 33.091  48.111  54.123  1.00 45.28  ?  12   LYS A C     1 
ATOM   97    O O     . LYS A 1 15  ? 34.221  47.639  53.996  1.00 42.15  ?  12   LYS A O     1 
ATOM   98    C CB    . LYS A 1 15  ? 32.307  46.462  52.394  1.00 44.18  ?  12   LYS A CB    1 
ATOM   99    C CG    . LYS A 1 15  ? 31.166  45.778  51.649  1.00 47.70  ?  12   LYS A CG    1 
ATOM   100   C CD    . LYS A 1 15  ? 29.827  45.941  52.353  1.00 53.22  ?  12   LYS A CD    1 
ATOM   101   C CE    . LYS A 1 15  ? 28.707  45.314  51.537  1.00 56.02  ?  12   LYS A CE    1 
ATOM   102   N NZ    . LYS A 1 15  ? 27.362  45.829  51.921  1.00 52.08  1  12   LYS A NZ    1 
ATOM   103   N N     . LYS A 1 16  ? 32.806  49.066  55.004  1.00 42.66  ?  13   LYS A N     1 
ATOM   104   C CA    . LYS A 1 16  ? 33.840  49.649  55.844  1.00 45.80  ?  13   LYS A CA    1 
ATOM   105   C C     . LYS A 1 16  ? 33.201  50.210  57.106  1.00 43.97  ?  13   LYS A C     1 
ATOM   106   O O     . LYS A 1 16  ? 32.026  50.585  57.112  1.00 35.69  ?  13   LYS A O     1 
ATOM   107   C CB    . LYS A 1 16  ? 34.610  50.744  55.098  1.00 39.95  ?  13   LYS A CB    1 
ATOM   108   C CG    . LYS A 1 16  ? 33.736  51.891  54.628  1.00 50.60  ?  13   LYS A CG    1 
ATOM   109   C CD    . LYS A 1 16  ? 34.544  52.969  53.927  1.00 54.22  ?  13   LYS A CD    1 
ATOM   110   C CE    . LYS A 1 16  ? 34.925  52.549  52.520  1.00 52.88  ?  13   LYS A CE    1 
ATOM   111   N NZ    . LYS A 1 16  ? 35.694  53.617  51.824  1.00 51.03  1  13   LYS A NZ    1 
ATOM   112   N N     . ILE A 1 17  ? 33.997  50.264  58.170  1.00 41.61  ?  14   ILE A N     1 
ATOM   113   C CA    . ILE A 1 17  ? 33.573  50.785  59.463  1.00 36.28  ?  14   ILE A CA    1 
ATOM   114   C C     . ILE A 1 17  ? 34.419  52.006  59.788  1.00 34.21  ?  14   ILE A C     1 
ATOM   115   O O     . ILE A 1 17  ? 35.639  51.996  59.589  1.00 34.09  ?  14   ILE A O     1 
ATOM   116   C CB    . ILE A 1 17  ? 33.701  49.718  60.572  1.00 36.29  ?  14   ILE A CB    1 
ATOM   117   C CG1   . ILE A 1 17  ? 32.801  48.520  60.263  1.00 36.60  ?  14   ILE A CG1   1 
ATOM   118   C CG2   . ILE A 1 17  ? 33.375  50.304  61.940  1.00 37.75  ?  14   ILE A CG2   1 
ATOM   119   C CD1   . ILE A 1 17  ? 31.367  48.895  59.958  1.00 37.89  ?  14   ILE A CD1   1 
ATOM   120   N N     . LYS A 1 18  ? 33.769  53.058  60.275  1.00 30.22  ?  15   LYS A N     1 
ATOM   121   C CA    . LYS A 1 18  ? 34.444  54.276  60.702  1.00 28.93  ?  15   LYS A CA    1 
ATOM   122   C C     . LYS A 1 18  ? 34.422  54.353  62.222  1.00 37.06  ?  15   LYS A C     1 
ATOM   123   O O     . LYS A 1 18  ? 33.382  54.113  62.844  1.00 34.32  ?  15   LYS A O     1 
ATOM   124   C CB    . LYS A 1 18  ? 33.787  55.519  60.096  1.00 34.91  ?  15   LYS A CB    1 
ATOM   125   C CG    . LYS A 1 18  ? 34.470  56.822  60.493  1.00 44.02  ?  15   LYS A CG    1 
ATOM   126   C CD    . LYS A 1 18  ? 34.471  57.838  59.361  1.00 53.13  ?  15   LYS A CD    1 
ATOM   127   C CE    . LYS A 1 18  ? 33.325  58.830  59.483  1.00 56.44  ?  15   LYS A CE    1 
ATOM   128   N NZ    . LYS A 1 18  ? 33.394  59.871  58.418  1.00 52.81  1  15   LYS A NZ    1 
ATOM   129   N N     . ARG A 1 19  ? 35.567  54.683  62.816  1.00 25.89  ?  16   ARG A N     1 
ATOM   130   C CA    . ARG A 1 19  ? 35.684  54.838  64.260  1.00 29.96  ?  16   ARG A CA    1 
ATOM   131   C C     . ARG A 1 19  ? 36.032  56.285  64.577  1.00 36.65  ?  16   ARG A C     1 
ATOM   132   O O     . ARG A 1 19  ? 37.103  56.770  64.192  1.00 31.62  ?  16   ARG A O     1 
ATOM   133   C CB    . ARG A 1 19  ? 36.732  53.884  64.838  1.00 31.38  ?  16   ARG A CB    1 
ATOM   134   C CG    . ARG A 1 19  ? 36.884  53.995  66.348  1.00 32.81  ?  16   ARG A CG    1 
ATOM   135   C CD    . ARG A 1 19  ? 37.443  52.727  66.979  1.00 40.84  ?  16   ARG A CD    1 
ATOM   136   N NE    . ARG A 1 19  ? 38.659  52.250  66.330  1.00 57.71  ?  16   ARG A NE    1 
ATOM   137   C CZ    . ARG A 1 19  ? 38.829  51.011  65.881  1.00 50.17  ?  16   ARG A CZ    1 
ATOM   138   N NH1   . ARG A 1 19  ? 37.864  50.114  66.018  1.00 38.79  1  16   ARG A NH1   1 
ATOM   139   N NH2   . ARG A 1 19  ? 39.972  50.665  65.304  1.00 54.84  ?  16   ARG A NH2   1 
ATOM   140   N N     . LEU A 1 20  ? 35.129  56.967  65.275  1.00 31.17  ?  17   LEU A N     1 
ATOM   141   C CA    . LEU A 1 20  ? 35.298  58.359  65.665  1.00 27.38  ?  17   LEU A CA    1 
ATOM   142   C C     . LEU A 1 20  ? 35.638  58.441  67.147  1.00 32.08  ?  17   LEU A C     1 
ATOM   143   O O     . LEU A 1 20  ? 35.229  57.590  67.938  1.00 25.56  ?  17   LEU A O     1 
ATOM   144   C CB    . LEU A 1 20  ? 34.028  59.166  65.381  1.00 37.33  ?  17   LEU A CB    1 
ATOM   145   C CG    . LEU A 1 20  ? 33.439  59.037  63.975  1.00 39.77  ?  17   LEU A CG    1 
ATOM   146   C CD1   . LEU A 1 20  ? 32.162  59.848  63.861  1.00 38.20  ?  17   LEU A CD1   1 
ATOM   147   C CD2   . LEU A 1 20  ? 34.449  59.480  62.938  1.00 42.21  ?  17   LEU A CD2   1 
ATOM   148   N N     . TYR A 1 21  ? 36.381  59.481  67.519  1.00 27.83  ?  18   TYR A N     1 
ATOM   149   C CA    . TYR A 1 21  ? 36.863  59.649  68.881  1.00 27.97  ?  18   TYR A CA    1 
ATOM   150   C C     . TYR A 1 21  ? 36.380  60.969  69.464  1.00 26.99  ?  18   TYR A C     1 
ATOM   151   O O     . TYR A 1 21  ? 36.199  61.958  68.747  1.00 32.72  ?  18   TYR A O     1 
ATOM   152   C CB    . TYR A 1 21  ? 38.393  59.592  68.938  1.00 32.21  ?  18   TYR A CB    1 
ATOM   153   C CG    . TYR A 1 21  ? 38.963  58.218  68.670  1.00 37.57  ?  18   TYR A CG    1 
ATOM   154   C CD1   . TYR A 1 21  ? 39.185  57.777  67.373  1.00 32.93  ?  18   TYR A CD1   1 
ATOM   155   C CD2   . TYR A 1 21  ? 39.281  57.363  69.717  1.00 35.21  ?  18   TYR A CD2   1 
ATOM   156   C CE1   . TYR A 1 21  ? 39.706  56.522  67.125  1.00 30.82  ?  18   TYR A CE1   1 
ATOM   157   C CE2   . TYR A 1 21  ? 39.804  56.106  69.479  1.00 36.76  ?  18   TYR A CE2   1 
ATOM   158   C CZ    . TYR A 1 21  ? 40.016  55.693  68.181  1.00 31.80  ?  18   TYR A CZ    1 
ATOM   159   O OH    . TYR A 1 21  ? 40.537  54.444  67.937  1.00 38.44  ?  18   TYR A OH    1 
ATOM   160   N N     . PHE A 1 22  ? 36.181  60.972  70.781  1.00 26.60  ?  19   PHE A N     1 
ATOM   161   C CA    . PHE A 1 22  ? 35.738  62.147  71.515  1.00 30.74  ?  19   PHE A CA    1 
ATOM   162   C C     . PHE A 1 22  ? 36.479  62.205  72.841  1.00 27.84  ?  19   PHE A C     1 
ATOM   163   O O     . PHE A 1 22  ? 36.850  61.171  73.404  1.00 27.41  ?  19   PHE A O     1 
ATOM   164   C CB    . PHE A 1 22  ? 34.220  62.121  71.761  1.00 32.53  ?  19   PHE A CB    1 
ATOM   165   C CG    . PHE A 1 22  ? 33.406  61.991  70.505  1.00 25.97  ?  19   PHE A CG    1 
ATOM   166   C CD1   . PHE A 1 22  ? 33.130  60.745  69.968  1.00 27.98  ?  19   PHE A CD1   1 
ATOM   167   C CD2   . PHE A 1 22  ? 32.922  63.117  69.858  1.00 31.14  ?  19   PHE A CD2   1 
ATOM   168   C CE1   . PHE A 1 22  ? 32.388  60.622  68.810  1.00 32.16  ?  19   PHE A CE1   1 
ATOM   169   C CE2   . PHE A 1 22  ? 32.176  63.001  68.699  1.00 30.33  ?  19   PHE A CE2   1 
ATOM   170   C CZ    . PHE A 1 22  ? 31.909  61.753  68.176  1.00 37.37  ?  19   PHE A CZ    1 
ATOM   171   N N     . TYR A 1 23  ? 36.696  63.421  73.339  1.00 32.25  ?  20   TYR A N     1 
ATOM   172   C CA    . TYR A 1 23  ? 37.355  63.606  74.625  1.00 34.56  ?  20   TYR A CA    1 
ATOM   173   C C     . TYR A 1 23  ? 36.627  64.666  75.437  1.00 33.16  ?  20   TYR A C     1 
ATOM   174   O O     . TYR A 1 23  ? 36.315  65.744  74.921  1.00 32.22  ?  20   TYR A O     1 
ATOM   175   C CB    . TYR A 1 23  ? 38.827  63.999  74.461  1.00 35.58  ?  20   TYR A CB    1 
ATOM   176   C CG    . TYR A 1 23  ? 39.493  64.250  75.792  1.00 35.86  ?  20   TYR A CG    1 
ATOM   177   C CD1   . TYR A 1 23  ? 39.879  63.193  76.602  1.00 29.83  ?  20   TYR A CD1   1 
ATOM   178   C CD2   . TYR A 1 23  ? 39.708  65.542  76.251  1.00 25.38  ?  20   TYR A CD2   1 
ATOM   179   C CE1   . TYR A 1 23  ? 40.473  63.411  77.827  1.00 35.44  ?  20   TYR A CE1   1 
ATOM   180   C CE2   . TYR A 1 23  ? 40.301  65.772  77.476  1.00 34.76  ?  20   TYR A CE2   1 
ATOM   181   C CZ    . TYR A 1 23  ? 40.681  64.703  78.260  1.00 31.78  ?  20   TYR A CZ    1 
ATOM   182   O OH    . TYR A 1 23  ? 41.271  64.926  79.480  1.00 33.39  ?  20   TYR A OH    1 
ATOM   183   N N     . ASN A 1 24  ? 36.380  64.360  76.710  1.00 27.30  ?  21   ASN A N     1 
ATOM   184   C CA    . ASN A 1 24  ? 35.699  65.270  77.627  1.00 30.00  ?  21   ASN A CA    1 
ATOM   185   C C     . ASN A 1 24  ? 36.536  65.382  78.894  1.00 31.33  ?  21   ASN A C     1 
ATOM   186   O O     . ASN A 1 24  ? 36.695  64.378  79.621  1.00 39.26  ?  21   ASN A O     1 
ATOM   187   C CB    . ASN A 1 24  ? 34.286  64.771  77.939  1.00 44.49  ?  21   ASN A CB    1 
ATOM   188   C CG    . ASN A 1 24  ? 33.454  65.785  78.708  1.00 42.39  ?  21   ASN A CG    1 
ATOM   189   O OD1   . ASN A 1 24  ? 33.982  66.609  79.456  1.00 41.66  ?  21   ASN A OD1   1 
ATOM   190   N ND2   . ASN A 1 24  ? 32.140  65.721  78.530  1.00 35.46  ?  21   ASN A ND2   1 
ATOM   191   N N     . PRO A 1 25  ? 37.080  66.563  79.211  1.00 32.96  ?  22   PRO A N     1 
ATOM   192   C CA    . PRO A 1 25  ? 37.892  66.695  80.430  1.00 40.17  ?  22   PRO A CA    1 
ATOM   193   C C     . PRO A 1 25  ? 37.081  66.776  81.711  1.00 43.55  ?  22   PRO A C     1 
ATOM   194   O O     . PRO A 1 25  ? 37.617  66.451  82.779  1.00 45.29  ?  22   PRO A O     1 
ATOM   195   C CB    . PRO A 1 25  ? 38.663  68.000  80.192  1.00 35.57  ?  22   PRO A CB    1 
ATOM   196   C CG    . PRO A 1 25  ? 37.744  68.804  79.328  1.00 28.53  ?  22   PRO A CG    1 
ATOM   197   C CD    . PRO A 1 25  ? 37.045  67.811  78.429  1.00 25.99  ?  22   PRO A CD    1 
ATOM   198   N N     . ASP A 1 26  ? 35.818  67.195  81.646  1.00 44.38  ?  23   ASP A N     1 
ATOM   199   C CA    . ASP A 1 26  ? 35.013  67.400  82.844  1.00 50.02  ?  23   ASP A CA    1 
ATOM   200   C C     . ASP A 1 26  ? 34.382  66.121  83.373  1.00 44.82  ?  23   ASP A C     1 
ATOM   201   O O     . ASP A 1 26  ? 33.757  66.156  84.439  1.00 50.42  ?  23   ASP A O     1 
ATOM   202   C CB    . ASP A 1 26  ? 33.903  68.415  82.563  1.00 55.02  ?  23   ASP A CB    1 
ATOM   203   C CG    . ASP A 1 26  ? 34.430  69.712  81.986  1.00 60.10  ?  23   ASP A CG    1 
ATOM   204   O OD1   . ASP A 1 26  ? 35.365  70.292  82.577  1.00 46.69  ?  23   ASP A OD1   1 
ATOM   205   O OD2   . ASP A 1 26  ? 33.912  70.148  80.937  1.00 72.16  -1 23   ASP A OD2   1 
ATOM   206   N N     . MET A 1 27  ? 34.526  65.004  82.668  1.00 38.23  ?  24   MET A N     1 
ATOM   207   C CA    . MET A 1 27  ? 33.764  63.805  82.973  1.00 42.58  ?  24   MET A CA    1 
ATOM   208   C C     . MET A 1 27  ? 34.647  62.577  82.824  1.00 46.18  ?  24   MET A C     1 
ATOM   209   O O     . MET A 1 27  ? 35.553  62.539  81.987  1.00 48.25  ?  24   MET A O     1 
ATOM   210   C CB    . MET A 1 27  ? 32.544  63.693  82.052  1.00 39.83  ?  24   MET A CB    1 
ATOM   211   C CG    . MET A 1 27  ? 31.546  62.619  82.425  1.00 46.45  ?  24   MET A CG    1 
ATOM   212   S SD    . MET A 1 27  ? 30.058  62.759  81.420  1.00 47.58  ?  24   MET A SD    1 
ATOM   213   C CE    . MET A 1 27  ? 29.709  64.508  81.575  1.00 33.66  ?  24   MET A CE    1 
ATOM   214   N N     . GLU A 1 28  ? 34.370  61.575  83.646  1.00 47.49  ?  25   GLU A N     1 
ATOM   215   C CA    . GLU A 1 28  ? 35.056  60.303  83.516  1.00 45.79  ?  25   GLU A CA    1 
ATOM   216   C C     . GLU A 1 28  ? 34.680  59.645  82.191  1.00 45.82  ?  25   GLU A C     1 
ATOM   217   O O     . GLU A 1 28  ? 33.523  59.722  81.766  1.00 46.01  ?  25   GLU A O     1 
ATOM   218   C CB    . GLU A 1 28  ? 34.709  59.388  84.689  1.00 51.25  ?  25   GLU A CB    1 
ATOM   219   C CG    . GLU A 1 28  ? 35.190  59.926  86.026  1.00 65.31  ?  25   GLU A CG    1 
ATOM   220   C CD    . GLU A 1 28  ? 36.693  60.060  86.079  1.00 70.05  ?  25   GLU A CD    1 
ATOM   221   O OE1   . GLU A 1 28  ? 37.370  59.008  86.063  1.00 70.55  ?  25   GLU A OE1   1 
ATOM   222   O OE2   . GLU A 1 28  ? 37.195  61.204  86.122  1.00 71.95  -1 25   GLU A OE2   1 
ATOM   223   N N     . PRO A 1 29  ? 35.640  59.017  81.507  1.00 36.46  ?  26   PRO A N     1 
ATOM   224   C CA    . PRO A 1 29  ? 35.340  58.448  80.182  1.00 35.60  ?  26   PRO A CA    1 
ATOM   225   C C     . PRO A 1 29  ? 34.211  57.431  80.193  1.00 40.71  ?  26   PRO A C     1 
ATOM   226   O O     . PRO A 1 29  ? 33.406  57.401  79.254  1.00 45.86  ?  26   PRO A O     1 
ATOM   227   C CB    . PRO A 1 29  ? 36.677  57.816  79.771  1.00 32.89  ?  26   PRO A CB    1 
ATOM   228   C CG    . PRO A 1 29  ? 37.709  58.609  80.516  1.00 37.43  ?  26   PRO A CG    1 
ATOM   229   C CD    . PRO A 1 29  ? 37.075  58.958  81.832  1.00 32.74  ?  26   PRO A CD    1 
ATOM   230   N N     . LYS A 1 30  ? 34.122  56.596  81.231  1.00 34.66  ?  27   LYS A N     1 
ATOM   231   C CA    . LYS A 1 30  ? 33.052  55.604  81.281  1.00 31.95  ?  27   LYS A CA    1 
ATOM   232   C C     . LYS A 1 30  ? 31.685  56.272  81.376  1.00 33.53  ?  27   LYS A C     1 
ATOM   233   O O     . LYS A 1 30  ? 30.728  55.842  80.719  1.00 39.89  ?  27   LYS A O     1 
ATOM   234   C CB    . LYS A 1 30  ? 33.270  54.652  82.457  1.00 39.27  ?  27   LYS A CB    1 
ATOM   235   C CG    . LYS A 1 30  ? 32.262  53.514  82.524  1.00 41.83  ?  27   LYS A CG    1 
ATOM   236   C CD    . LYS A 1 30  ? 32.718  52.426  83.483  1.00 42.88  ?  27   LYS A CD    1 
ATOM   237   C CE    . LYS A 1 30  ? 34.044  51.822  83.041  1.00 49.85  ?  27   LYS A CE    1 
ATOM   238   N NZ    . LYS A 1 30  ? 33.971  51.244  81.667  1.00 51.96  1  27   LYS A NZ    1 
ATOM   239   N N     . LEU A 1 31  ? 31.576  57.332  82.180  1.00 35.27  ?  28   LEU A N     1 
ATOM   240   C CA    . LEU A 1 31  ? 30.309  58.046  82.302  1.00 36.79  ?  28   LEU A CA    1 
ATOM   241   C C     . LEU A 1 31  ? 29.978  58.812  81.027  1.00 38.90  ?  28   LEU A C     1 
ATOM   242   O O     . LEU A 1 31  ? 28.820  58.836  80.594  1.00 42.62  ?  28   LEU A O     1 
ATOM   243   C CB    . LEU A 1 31  ? 30.357  58.991  83.502  1.00 28.65  ?  28   LEU A CB    1 
ATOM   244   C CG    . LEU A 1 31  ? 29.151  59.908  83.719  1.00 36.13  ?  28   LEU A CG    1 
ATOM   245   C CD1   . LEU A 1 31  ? 27.864  59.102  83.801  1.00 30.68  ?  28   LEU A CD1   1 
ATOM   246   C CD2   . LEU A 1 31  ? 29.343  60.751  84.971  1.00 33.78  ?  28   LEU A CD2   1 
ATOM   247   N N     . PHE A 1 32  ? 30.979  59.457  80.422  1.00 34.84  ?  29   PHE A N     1 
ATOM   248   C CA    . PHE A 1 32  ? 30.770  60.143  79.149  1.00 32.66  ?  29   PHE A CA    1 
ATOM   249   C C     . PHE A 1 32  ? 30.261  59.171  78.091  1.00 34.01  ?  29   PHE A C     1 
ATOM   250   O O     . PHE A 1 32  ? 29.295  59.459  77.375  1.00 31.44  ?  29   PHE A O     1 
ATOM   251   C CB    . PHE A 1 32  ? 32.075  60.814  78.710  1.00 29.29  ?  29   PHE A CB    1 
ATOM   252   C CG    . PHE A 1 32  ? 31.937  61.712  77.507  1.00 35.94  ?  29   PHE A CG    1 
ATOM   253   C CD1   . PHE A 1 32  ? 30.875  62.594  77.394  1.00 35.83  ?  29   PHE A CD1   1 
ATOM   254   C CD2   . PHE A 1 32  ? 32.895  61.697  76.504  1.00 35.08  ?  29   PHE A CD2   1 
ATOM   255   C CE1   . PHE A 1 32  ? 30.755  63.425  76.291  1.00 25.83  ?  29   PHE A CE1   1 
ATOM   256   C CE2   . PHE A 1 32  ? 32.782  62.527  75.402  1.00 30.69  ?  29   PHE A CE2   1 
ATOM   257   C CZ    . PHE A 1 32  ? 31.711  63.391  75.296  1.00 28.45  ?  29   PHE A CZ    1 
ATOM   258   N N     . ALA A 1 33  ? 30.885  57.994  78.003  1.00 32.66  ?  30   ALA A N     1 
ATOM   259   C CA    . ALA A 1 33  ? 30.451  56.992  77.034  1.00 27.61  ?  30   ALA A CA    1 
ATOM   260   C C     . ALA A 1 33  ? 29.039  56.501  77.332  1.00 31.15  ?  30   ALA A C     1 
ATOM   261   O O     . ALA A 1 33  ? 28.250  56.261  76.411  1.00 29.12  ?  30   ALA A O     1 
ATOM   262   C CB    . ALA A 1 33  ? 31.435  55.823  77.017  1.00 26.25  ?  30   ALA A CB    1 
ATOM   263   N N     . ARG A 1 34  ? 28.698  56.349  78.615  1.00 29.56  ?  31   ARG A N     1 
ATOM   264   C CA    . ARG A 1 34  ? 27.374  55.847  78.970  1.00 31.56  ?  31   ARG A CA    1 
ATOM   265   C C     . ARG A 1 34  ? 26.282  56.838  78.586  1.00 27.21  ?  31   ARG A C     1 
ATOM   266   O O     . ARG A 1 34  ? 25.242  56.447  78.042  1.00 34.54  ?  31   ARG A O     1 
ATOM   267   C CB    . ARG A 1 34  ? 27.310  55.538  80.464  1.00 32.91  ?  31   ARG A CB    1 
ATOM   268   C CG    . ARG A 1 34  ? 25.921  55.159  80.953  1.00 52.71  ?  31   ARG A CG    1 
ATOM   269   C CD    . ARG A 1 34  ? 25.808  53.667  81.218  1.00 62.32  ?  31   ARG A CD    1 
ATOM   270   N NE    . ARG A 1 34  ? 25.486  53.387  82.615  1.00 63.34  ?  31   ARG A NE    1 
ATOM   271   C CZ    . ARG A 1 34  ? 24.361  52.809  83.024  1.00 67.80  ?  31   ARG A CZ    1 
ATOM   272   N NH1   . ARG A 1 34  ? 23.446  52.430  82.142  1.00 60.48  1  31   ARG A NH1   1 
ATOM   273   N NH2   . ARG A 1 34  ? 24.157  52.597  84.318  1.00 68.96  ?  31   ARG A NH2   1 
ATOM   274   N N     . ASN A 1 35  ? 26.496  58.126  78.861  1.00 33.38  ?  32   ASN A N     1 
ATOM   275   C CA    . ASN A 1 35  ? 25.505  59.130  78.487  1.00 35.02  ?  32   ASN A CA    1 
ATOM   276   C C     . ASN A 1 35  ? 25.376  59.238  76.973  1.00 30.00  ?  32   ASN A C     1 
ATOM   277   O O     . ASN A 1 35  ? 24.270  59.416  76.450  1.00 36.18  ?  32   ASN A O     1 
ATOM   278   C CB    . ASN A 1 35  ? 25.868  60.484  79.096  1.00 26.90  ?  32   ASN A CB    1 
ATOM   279   C CG    . ASN A 1 35  ? 25.954  60.437  80.610  1.00 40.35  ?  32   ASN A CG    1 
ATOM   280   O OD1   . ASN A 1 35  ? 25.538  59.460  81.236  1.00 41.51  ?  32   ASN A OD1   1 
ATOM   281   N ND2   . ASN A 1 35  ? 26.490  61.495  81.206  1.00 44.36  ?  32   ASN A ND2   1 
ATOM   282   N N     . LEU A 1 36  ? 26.494  59.128  76.252  1.00 30.24  ?  33   LEU A N     1 
ATOM   283   C CA    . LEU A 1 36  ? 26.437  59.161  74.794  1.00 28.39  ?  33   LEU A CA    1 
ATOM   284   C C     . LEU A 1 36  ? 25.689  57.953  74.244  1.00 28.40  ?  33   LEU A C     1 
ATOM   285   O O     . LEU A 1 36  ? 24.929  58.073  73.276  1.00 37.60  ?  33   LEU A O     1 
ATOM   286   C CB    . LEU A 1 36  ? 27.848  59.231  74.215  1.00 28.74  ?  33   LEU A CB    1 
ATOM   287   C CG    . LEU A 1 36  ? 28.567  60.559  74.450  1.00 29.89  ?  33   LEU A CG    1 
ATOM   288   C CD1   . LEU A 1 36  ? 29.986  60.510  73.913  1.00 25.34  ?  33   LEU A CD1   1 
ATOM   289   C CD2   . LEU A 1 36  ? 27.782  61.696  73.813  1.00 30.68  ?  33   LEU A CD2   1 
ATOM   290   N N     . SER A 1 37  ? 25.893  56.780  74.849  1.00 28.37  ?  34   SER A N     1 
ATOM   291   C CA    . SER A 1 37  ? 25.171  55.588  74.418  1.00 27.86  ?  34   SER A CA    1 
ATOM   292   C C     . SER A 1 37  ? 23.671  55.750  74.629  1.00 32.51  ?  34   SER A C     1 
ATOM   293   O O     . SER A 1 37  ? 22.869  55.375  73.766  1.00 33.29  ?  34   SER A O     1 
ATOM   294   C CB    . SER A 1 37  ? 25.685  54.363  75.175  1.00 33.06  ?  34   SER A CB    1 
ATOM   295   O OG    . SER A 1 37  ? 27.099  54.281  75.138  1.00 32.65  ?  34   SER A OG    1 
ATOM   296   N N     . ARG A 1 38  ? 23.279  56.320  75.770  1.00 34.40  ?  35   ARG A N     1 
ATOM   297   C CA    . ARG A 1 38  ? 21.865  56.421  76.116  1.00 40.71  ?  35   ARG A CA    1 
ATOM   298   C C     . ARG A 1 38  ? 21.112  57.316  75.140  1.00 43.81  ?  35   ARG A C     1 
ATOM   299   O O     . ARG A 1 38  ? 20.005  56.978  74.704  1.00 47.62  ?  35   ARG A O     1 
ATOM   300   C CB    . ARG A 1 38  ? 21.726  56.949  77.544  1.00 43.59  ?  35   ARG A CB    1 
ATOM   301   C CG    . ARG A 1 38  ? 20.377  56.697  78.187  1.00 51.53  ?  35   ARG A CG    1 
ATOM   302   C CD    . ARG A 1 38  ? 20.262  57.442  79.507  1.00 56.38  ?  35   ARG A CD    1 
ATOM   303   N NE    . ARG A 1 38  ? 19.697  58.774  79.318  1.00 62.79  ?  35   ARG A NE    1 
ATOM   304   C CZ    . ARG A 1 38  ? 20.409  59.866  79.061  1.00 68.38  ?  35   ARG A CZ    1 
ATOM   305   N NH1   . ARG A 1 38  ? 21.730  59.804  78.964  1.00 75.76  1  35   ARG A NH1   1 
ATOM   306   N NH2   . ARG A 1 38  ? 19.796  61.023  78.898  1.00 70.67  ?  35   ARG A NH2   1 
ATOM   307   N N     . VAL A 1 39  ? 21.694  58.462  74.782  1.00 36.69  ?  36   VAL A N     1 
ATOM   308   C CA    . VAL A 1 39  ? 20.985  59.419  73.938  1.00 41.43  ?  36   VAL A CA    1 
ATOM   309   C C     . VAL A 1 39  ? 21.045  59.058  72.459  1.00 39.44  ?  36   VAL A C     1 
ATOM   310   O O     . VAL A 1 39  ? 20.215  59.542  71.679  1.00 42.96  ?  36   VAL A O     1 
ATOM   311   C CB    . VAL A 1 39  ? 21.533  60.840  74.149  1.00 40.18  ?  36   VAL A CB    1 
ATOM   312   C CG1   . VAL A 1 39  ? 21.319  61.280  75.590  1.00 41.87  ?  36   VAL A CG1   1 
ATOM   313   C CG2   . VAL A 1 39  ? 23.005  60.898  73.787  1.00 26.81  ?  36   VAL A CG2   1 
ATOM   314   N N     . ASN A 1 40  ? 21.997  58.226  72.043  1.00 34.60  ?  37   ASN A N     1 
ATOM   315   C CA    . ASN A 1 40  ? 22.108  57.819  70.650  1.00 32.81  ?  37   ASN A CA    1 
ATOM   316   C C     . ASN A 1 40  ? 21.567  56.420  70.391  1.00 30.96  ?  37   ASN A C     1 
ATOM   317   O O     . ASN A 1 40  ? 21.556  55.986  69.235  1.00 30.11  ?  37   ASN A O     1 
ATOM   318   C CB    . ASN A 1 40  ? 23.568  57.894  70.188  1.00 25.83  ?  37   ASN A CB    1 
ATOM   319   C CG    . ASN A 1 40  ? 24.053  59.319  70.003  1.00 29.06  ?  37   ASN A CG    1 
ATOM   320   O OD1   . ASN A 1 40  ? 23.927  59.892  68.921  1.00 28.26  ?  37   ASN A OD1   1 
ATOM   321   N ND2   . ASN A 1 40  ? 24.617  59.895  71.058  1.00 24.86  ?  37   ASN A ND2   1 
ATOM   322   N N     . ASN A 1 41  ? 21.121  55.711  71.431  1.00 30.18  ?  38   ASN A N     1 
ATOM   323   C CA    . ASN A 1 41  ? 20.667  54.323  71.307  1.00 36.71  ?  38   ASN A CA    1 
ATOM   324   C C     . ASN A 1 41  ? 21.731  53.459  70.635  1.00 38.04  ?  38   ASN A C     1 
ATOM   325   O O     . ASN A 1 41  ? 21.429  52.565  69.843  1.00 35.91  ?  38   ASN A O     1 
ATOM   326   C CB    . ASN A 1 41  ? 19.339  54.237  70.550  1.00 32.35  ?  38   ASN A CB    1 
ATOM   327   C CG    . ASN A 1 41  ? 18.155  54.643  71.402  1.00 26.70  ?  38   ASN A CG    1 
ATOM   328   O OD1   . ASN A 1 41  ? 18.069  54.281  72.574  1.00 31.21  ?  38   ASN A OD1   1 
ATOM   329   N ND2   . ASN A 1 41  ? 17.235  55.402  70.816  1.00 30.68  ?  38   ASN A ND2   1 
ATOM   330   N N     . PHE A 1 42  ? 22.991  53.734  70.960  1.00 34.16  ?  39   PHE A N     1 
ATOM   331   C CA    . PHE A 1 42  ? 24.117  53.111  70.270  1.00 27.75  ?  39   PHE A CA    1 
ATOM   332   C C     . PHE A 1 42  ? 25.310  53.143  71.208  1.00 27.84  ?  39   PHE A C     1 
ATOM   333   O O     . PHE A 1 42  ? 25.737  54.226  71.621  1.00 31.71  ?  39   PHE A O     1 
ATOM   334   C CB    . PHE A 1 42  ? 24.425  53.850  68.966  1.00 27.28  ?  39   PHE A CB    1 
ATOM   335   C CG    . PHE A 1 42  ? 25.344  53.104  68.045  1.00 28.02  ?  39   PHE A CG    1 
ATOM   336   C CD1   . PHE A 1 42  ? 26.699  53.015  68.317  1.00 28.73  ?  39   PHE A CD1   1 
ATOM   337   C CD2   . PHE A 1 42  ? 24.855  52.503  66.896  1.00 28.00  ?  39   PHE A CD2   1 
ATOM   338   C CE1   . PHE A 1 42  ? 27.546  52.333  67.469  1.00 29.41  ?  39   PHE A CE1   1 
ATOM   339   C CE2   . PHE A 1 42  ? 25.700  51.820  66.042  1.00 29.27  ?  39   PHE A CE2   1 
ATOM   340   C CZ    . PHE A 1 42  ? 27.047  51.735  66.329  1.00 29.39  ?  39   PHE A CZ    1 
ATOM   341   N N     . LYS A 1 43  ? 25.855  51.973  71.529  1.00 27.81  ?  40   LYS A N     1 
ATOM   342   C CA    . LYS A 1 43  ? 26.854  51.879  72.584  1.00 28.13  ?  40   LYS A CA    1 
ATOM   343   C C     . LYS A 1 43  ? 28.164  52.537  72.164  1.00 36.37  ?  40   LYS A C     1 
ATOM   344   O O     . LYS A 1 43  ? 28.727  52.217  71.112  1.00 29.43  ?  40   LYS A O     1 
ATOM   345   C CB    . LYS A 1 43  ? 27.096  50.417  72.955  1.00 36.59  ?  40   LYS A CB    1 
ATOM   346   C CG    . LYS A 1 43  ? 27.876  50.229  74.248  1.00 37.82  ?  40   LYS A CG    1 
ATOM   347   C CD    . LYS A 1 43  ? 27.669  48.837  74.825  1.00 44.09  ?  40   LYS A CD    1 
ATOM   348   C CE    . LYS A 1 43  ? 28.049  48.787  76.298  1.00 49.86  ?  40   LYS A CE    1 
ATOM   349   N NZ    . LYS A 1 43  ? 27.586  47.522  76.937  1.00 45.27  1  40   LYS A NZ    1 
ATOM   350   N N     . PHE A 1 44  ? 28.636  53.467  72.991  1.00 28.94  ?  41   PHE A N     1 
ATOM   351   C CA    . PHE A 1 44  ? 29.985  54.004  72.908  1.00 33.89  ?  41   PHE A CA    1 
ATOM   352   C C     . PHE A 1 44  ? 30.909  53.193  73.808  1.00 33.61  ?  41   PHE A C     1 
ATOM   353   O O     . PHE A 1 44  ? 30.497  52.688  74.855  1.00 34.00  ?  41   PHE A O     1 
ATOM   354   C CB    . PHE A 1 44  ? 30.025  55.472  73.345  1.00 29.52  ?  41   PHE A CB    1 
ATOM   355   C CG    . PHE A 1 44  ? 29.472  56.440  72.334  1.00 30.38  ?  41   PHE A CG    1 
ATOM   356   C CD1   . PHE A 1 44  ? 28.132  56.414  71.984  1.00 28.62  ?  41   PHE A CD1   1 
ATOM   357   C CD2   . PHE A 1 44  ? 30.290  57.403  71.763  1.00 29.80  ?  41   PHE A CD2   1 
ATOM   358   C CE1   . PHE A 1 44  ? 27.623  57.312  71.063  1.00 32.75  ?  41   PHE A CE1   1 
ATOM   359   C CE2   . PHE A 1 44  ? 29.786  58.306  70.841  1.00 29.62  ?  41   PHE A CE2   1 
ATOM   360   C CZ    . PHE A 1 44  ? 28.452  58.263  70.492  1.00 30.65  ?  41   PHE A CZ    1 
ATOM   361   N N     . GLN A 1 45  ? 32.168  53.079  73.400  1.00 36.14  ?  42   GLN A N     1 
ATOM   362   C CA    . GLN A 1 45  ? 33.194  52.473  74.234  1.00 37.71  ?  42   GLN A CA    1 
ATOM   363   C C     . GLN A 1 45  ? 34.116  53.560  74.774  1.00 31.76  ?  42   GLN A C     1 
ATOM   364   O O     . GLN A 1 45  ? 34.180  54.672  74.244  1.00 37.51  ?  42   GLN A O     1 
ATOM   365   C CB    . GLN A 1 45  ? 33.991  51.420  73.453  1.00 43.46  ?  42   GLN A CB    1 
ATOM   366   C CG    . GLN A 1 45  ? 34.875  50.523  74.317  1.00 60.04  ?  42   GLN A CG    1 
ATOM   367   C CD    . GLN A 1 45  ? 34.124  49.875  75.462  1.00 68.53  ?  42   GLN A CD    1 
ATOM   368   O OE1   . GLN A 1 45  ? 33.037  49.327  75.277  1.00 74.16  ?  42   GLN A OE1   1 
ATOM   369   N NE2   . GLN A 1 45  ? 34.700  49.939  76.658  1.00 62.66  ?  42   GLN A NE2   1 
ATOM   370   N N     . ASP A 1 46  ? 34.824  53.231  75.852  1.00 43.19  ?  43   ASP A N     1 
ATOM   371   C CA    . ASP A 1 46  ? 35.691  54.177  76.535  1.00 48.56  ?  43   ASP A CA    1 
ATOM   372   C C     . ASP A 1 46  ? 37.076  53.578  76.735  1.00 47.15  ?  43   ASP A C     1 
ATOM   373   O O     . ASP A 1 46  ? 37.255  52.358  76.767  1.00 49.97  ?  43   ASP A O     1 
ATOM   374   C CB    . ASP A 1 46  ? 35.111  54.588  77.895  1.00 52.55  ?  43   ASP A CB    1 
ATOM   375   C CG    . ASP A 1 46  ? 35.034  53.427  78.869  1.00 58.03  ?  43   ASP A CG    1 
ATOM   376   O OD1   . ASP A 1 46  ? 36.017  53.200  79.605  1.00 59.68  -1 43   ASP A OD1   1 
ATOM   377   O OD2   . ASP A 1 46  ? 33.990  52.741  78.898  1.00 59.32  ?  43   ASP A OD2   1 
ATOM   378   N N     . SER A 1 47  ? 38.059  54.468  76.865  1.00 47.02  ?  44   SER A N     1 
ATOM   379   C CA    . SER A 1 47  ? 39.413  54.093  77.250  1.00 54.37  ?  44   SER A CA    1 
ATOM   380   C C     . SER A 1 47  ? 39.752  54.734  78.588  1.00 64.07  ?  44   SER A C     1 
ATOM   381   O O     . SER A 1 47  ? 38.856  55.128  79.342  1.00 69.37  ?  44   SER A O     1 
ATOM   382   C CB    . SER A 1 47  ? 40.426  54.519  76.184  1.00 46.68  ?  44   SER A CB    1 
ATOM   383   O OG    . SER A 1 47  ? 41.756  54.413  76.674  1.00 45.06  ?  44   SER A OG    1 
ATOM   384   N N     . ASN A 1 48  ? 41.045  54.841  78.890  1.00 63.60  ?  45   ASN A N     1 
ATOM   385   C CA    . ASN A 1 48  ? 41.469  55.574  80.074  1.00 65.74  ?  45   ASN A CA    1 
ATOM   386   C C     . ASN A 1 48  ? 41.258  57.074  79.926  1.00 67.34  ?  45   ASN A C     1 
ATOM   387   O O     . ASN A 1 48  ? 41.173  57.778  80.937  1.00 67.22  ?  45   ASN A O     1 
ATOM   388   C CB    . ASN A 1 48  ? 42.936  55.269  80.377  1.00 67.18  ?  45   ASN A CB    1 
ATOM   389   C CG    . ASN A 1 48  ? 43.126  53.903  81.000  1.00 69.40  ?  45   ASN A CG    1 
ATOM   390   O OD1   . ASN A 1 48  ? 42.380  53.513  81.898  1.00 76.26  ?  45   ASN A OD1   1 
ATOM   391   N ND2   . ASN A 1 48  ? 44.121  53.165  80.523  1.00 63.37  ?  45   ASN A ND2   1 
ATOM   392   N N     . ASP A 1 49  ? 41.168  57.579  78.694  1.00 57.05  ?  46   ASP A N     1 
ATOM   393   C CA    . ASP A 1 49  ? 40.893  58.996  78.468  1.00 56.42  ?  46   ASP A CA    1 
ATOM   394   C C     . ASP A 1 49  ? 39.986  59.278  77.277  1.00 47.48  ?  46   ASP A C     1 
ATOM   395   O O     . ASP A 1 49  ? 39.295  60.301  77.293  1.00 47.69  ?  46   ASP A O     1 
ATOM   396   C CB    . ASP A 1 49  ? 42.204  59.779  78.287  1.00 61.31  ?  46   ASP A CB    1 
ATOM   397   C CG    . ASP A 1 49  ? 43.009  59.883  79.572  1.00 65.47  ?  46   ASP A CG    1 
ATOM   398   O OD1   . ASP A 1 49  ? 43.673  58.891  79.942  1.00 62.22  ?  46   ASP A OD1   1 
ATOM   399   O OD2   . ASP A 1 49  ? 42.988  60.960  80.207  1.00 67.74  -1 46   ASP A OD2   1 
ATOM   400   N N     . LEU A 1 50  ? 39.940  58.424  76.259  1.00 47.24  ?  47   LEU A N     1 
ATOM   401   C CA    . LEU A 1 50  ? 39.168  58.682  75.053  1.00 41.89  ?  47   LEU A CA    1 
ATOM   402   C C     . LEU A 1 50  ? 37.914  57.815  74.998  1.00 36.76  ?  47   LEU A C     1 
ATOM   403   O O     . LEU A 1 50  ? 37.911  56.657  75.429  1.00 33.60  ?  47   LEU A O     1 
ATOM   404   C CB    . LEU A 1 50  ? 40.011  58.436  73.799  1.00 34.95  ?  47   LEU A CB    1 
ATOM   405   C CG    . LEU A 1 50  ? 41.138  59.434  73.525  1.00 40.67  ?  47   LEU A CG    1 
ATOM   406   C CD1   . LEU A 1 50  ? 41.979  58.974  72.345  1.00 37.77  ?  47   LEU A CD1   1 
ATOM   407   C CD2   . LEU A 1 50  ? 40.570  60.823  73.273  1.00 35.19  ?  47   LEU A CD2   1 
ATOM   408   N N     . VAL A 1 51  ? 36.849  58.392  74.449  1.00 33.01  ?  48   VAL A N     1 
ATOM   409   C CA    . VAL A 1 51  ? 35.598  57.693  74.179  1.00 32.39  ?  48   VAL A CA    1 
ATOM   410   C C     . VAL A 1 51  ? 35.421  57.626  72.669  1.00 37.35  ?  48   VAL A C     1 
ATOM   411   O O     . VAL A 1 51  ? 35.631  58.626  71.972  1.00 32.72  ?  48   VAL A O     1 
ATOM   412   C CB    . VAL A 1 51  ? 34.406  58.400  74.846  1.00 31.54  ?  48   VAL A CB    1 
ATOM   413   C CG1   . VAL A 1 51  ? 33.088  57.892  74.279  1.00 30.92  ?  48   VAL A CG1   1 
ATOM   414   C CG2   . VAL A 1 51  ? 34.453  58.208  76.352  1.00 31.33  ?  48   VAL A CG2   1 
ATOM   415   N N     . TRP A 1 52  ? 35.044  56.454  72.159  1.00 38.24  ?  49   TRP A N     1 
ATOM   416   C CA    . TRP A 1 52  ? 34.942  56.267  70.720  1.00 35.64  ?  49   TRP A CA    1 
ATOM   417   C C     . TRP A 1 52  ? 33.669  55.514  70.357  1.00 32.11  ?  49   TRP A C     1 
ATOM   418   O O     . TRP A 1 52  ? 33.002  54.912  71.204  1.00 31.63  ?  49   TRP A O     1 
ATOM   419   C CB    . TRP A 1 52  ? 36.173  55.543  70.154  1.00 33.58  ?  49   TRP A CB    1 
ATOM   420   C CG    . TRP A 1 52  ? 36.712  54.432  71.002  1.00 40.20  ?  49   TRP A CG    1 
ATOM   421   C CD1   . TRP A 1 52  ? 37.557  54.551  72.069  1.00 47.94  ?  49   TRP A CD1   1 
ATOM   422   C CD2   . TRP A 1 52  ? 36.478  53.028  70.833  1.00 41.07  ?  49   TRP A CD2   1 
ATOM   423   N NE1   . TRP A 1 52  ? 37.849  53.311  72.583  1.00 40.02  ?  49   TRP A NE1   1 
ATOM   424   C CE2   . TRP A 1 52  ? 37.199  52.360  71.842  1.00 42.92  ?  49   TRP A CE2   1 
ATOM   425   C CE3   . TRP A 1 52  ? 35.719  52.272  69.934  1.00 38.52  ?  49   TRP A CE3   1 
ATOM   426   C CZ2   . TRP A 1 52  ? 37.191  50.973  71.972  1.00 47.89  ?  49   TRP A CZ2   1 
ATOM   427   C CZ3   . TRP A 1 52  ? 35.709  50.895  70.068  1.00 44.16  ?  49   TRP A CZ3   1 
ATOM   428   C CH2   . TRP A 1 52  ? 36.438  50.261  71.080  1.00 44.44  ?  49   TRP A CH2   1 
ATOM   429   N N     . ILE A 1 53  ? 33.341  55.563  69.067  1.00 32.15  ?  50   ILE A N     1 
ATOM   430   C CA    . ILE A 1 53  ? 32.170  54.896  68.514  1.00 31.63  ?  50   ILE A CA    1 
ATOM   431   C C     . ILE A 1 53  ? 32.534  54.348  67.141  1.00 33.52  ?  50   ILE A C     1 
ATOM   432   O O     . ILE A 1 53  ? 33.209  55.017  66.351  1.00 32.61  ?  50   ILE A O     1 
ATOM   433   C CB    . ILE A 1 53  ? 30.955  55.847  68.435  1.00 30.89  ?  50   ILE A CB    1 
ATOM   434   C CG1   . ILE A 1 53  ? 29.713  55.098  67.945  1.00 32.16  ?  50   ILE A CG1   1 
ATOM   435   C CG2   . ILE A 1 53  ? 31.252  57.055  67.545  1.00 31.13  ?  50   ILE A CG2   1 
ATOM   436   C CD1   . ILE A 1 53  ? 28.484  55.973  67.828  1.00 29.60  ?  50   ILE A CD1   1 
ATOM   437   N N     . GLU A 1 54  ? 32.103  53.121  66.865  1.00 32.03  ?  51   GLU A N     1 
ATOM   438   C CA    . GLU A 1 54  ? 32.317  52.473  65.577  1.00 32.44  ?  51   GLU A CA    1 
ATOM   439   C C     . GLU A 1 54  ? 30.984  52.421  64.842  1.00 41.32  ?  51   GLU A C     1 
ATOM   440   O O     . GLU A 1 54  ? 30.015  51.844  65.348  1.00 31.24  ?  51   GLU A O     1 
ATOM   441   C CB    . GLU A 1 54  ? 32.906  51.076  65.764  1.00 34.25  ?  51   GLU A CB    1 
ATOM   442   C CG    . GLU A 1 54  ? 34.337  51.096  66.280  1.00 40.41  ?  51   GLU A CG    1 
ATOM   443   C CD    . GLU A 1 54  ? 34.722  49.833  67.026  1.00 46.75  ?  51   GLU A CD    1 
ATOM   444   O OE1   . GLU A 1 54  ? 33.830  49.007  67.311  1.00 44.80  ?  51   GLU A OE1   1 
ATOM   445   O OE2   . GLU A 1 54  ? 35.921  49.671  67.335  1.00 48.41  -1 51   GLU A OE2   1 
ATOM   446   N N     . ILE A 1 55  ? 30.936  53.031  63.661  1.00 32.85  ?  52   ILE A N     1 
ATOM   447   C CA    . ILE A 1 55  ? 29.683  53.208  62.930  1.00 31.40  ?  52   ILE A CA    1 
ATOM   448   C C     . ILE A 1 55  ? 29.883  52.755  61.490  1.00 34.09  ?  52   ILE A C     1 
ATOM   449   O O     . ILE A 1 55  ? 31.021  52.660  61.003  1.00 32.57  ?  52   ILE A O     1 
ATOM   450   C CB    . ILE A 1 55  ? 29.200  54.678  62.971  1.00 32.06  ?  52   ILE A CB    1 
ATOM   451   C CG1   . ILE A 1 55  ? 30.262  55.604  62.375  1.00 31.65  ?  52   ILE A CG1   1 
ATOM   452   C CG2   . ILE A 1 55  ? 28.836  55.086  64.385  1.00 30.51  ?  52   ILE A CG2   1 
ATOM   453   C CD1   . ILE A 1 55  ? 29.735  56.971  61.992  1.00 36.89  ?  52   ILE A CD1   1 
ATOM   454   N N     . PRO A 1 56  ? 28.794  52.468  60.779  1.00 31.38  ?  53   PRO A N     1 
ATOM   455   C CA    . PRO A 1 56  ? 28.902  52.270  59.332  1.00 35.11  ?  53   PRO A CA    1 
ATOM   456   C C     . PRO A 1 56  ? 29.286  53.574  58.654  1.00 38.01  ?  53   PRO A C     1 
ATOM   457   O O     . PRO A 1 56  ? 29.073  54.667  59.183  1.00 31.68  ?  53   PRO A O     1 
ATOM   458   C CB    . PRO A 1 56  ? 27.495  51.822  58.915  1.00 35.48  ?  53   PRO A CB    1 
ATOM   459   C CG    . PRO A 1 56  ? 26.792  51.451  60.189  1.00 39.21  ?  53   PRO A CG    1 
ATOM   460   C CD    . PRO A 1 56  ? 27.413  52.290  61.259  1.00 34.48  ?  53   PRO A CD    1 
ATOM   461   N N     . ASP A 1 57  ? 29.864  53.449  57.459  1.00 37.32  ?  54   ASP A N     1 
ATOM   462   C CA    . ASP A 1 57  ? 30.295  54.618  56.694  1.00 43.68  ?  54   ASP A CA    1 
ATOM   463   C C     . ASP A 1 57  ? 29.099  55.264  55.992  1.00 49.05  ?  54   ASP A C     1 
ATOM   464   O O     . ASP A 1 57  ? 29.006  55.331  54.766  1.00 51.62  ?  54   ASP A O     1 
ATOM   465   C CB    . ASP A 1 57  ? 31.381  54.234  55.700  1.00 49.29  ?  54   ASP A CB    1 
ATOM   466   C CG    . ASP A 1 57  ? 31.995  55.439  55.017  1.00 55.81  ?  54   ASP A CG    1 
ATOM   467   O OD1   . ASP A 1 57  ? 31.932  56.543  55.599  1.00 59.38  ?  54   ASP A OD1   1 
ATOM   468   O OD2   . ASP A 1 57  ? 32.538  55.285  53.903  1.00 59.68  -1 54   ASP A OD2   1 
ATOM   469   N N     . ILE A 1 58  ? 28.165  55.743  56.811  1.00 40.87  ?  55   ILE A N     1 
ATOM   470   C CA    . ILE A 1 58  ? 26.960  56.409  56.342  1.00 42.74  ?  55   ILE A CA    1 
ATOM   471   C C     . ILE A 1 58  ? 26.760  57.669  57.171  1.00 48.81  ?  55   ILE A C     1 
ATOM   472   O O     . ILE A 1 58  ? 27.453  57.903  58.162  1.00 47.83  ?  55   ILE A O     1 
ATOM   473   C CB    . ILE A 1 58  ? 25.717  55.494  56.417  1.00 44.83  ?  55   ILE A CB    1 
ATOM   474   C CG1   . ILE A 1 58  ? 25.677  54.730  57.745  1.00 48.05  ?  55   ILE A CG1   1 
ATOM   475   C CG2   . ILE A 1 58  ? 25.702  54.524  55.244  1.00 48.26  ?  55   ILE A CG2   1 
ATOM   476   C CD1   . ILE A 1 58  ? 24.964  55.453  58.874  1.00 48.06  ?  55   ILE A CD1   1 
ATOM   477   N N     . ASP A 1 59  ? 25.801  58.488  56.748  1.00 47.73  ?  56   ASP A N     1 
ATOM   478   C CA    . ASP A 1 59  ? 25.480  59.690  57.503  1.00 45.68  ?  56   ASP A CA    1 
ATOM   479   C C     . ASP A 1 59  ? 24.919  59.302  58.863  1.00 47.04  ?  56   ASP A C     1 
ATOM   480   O O     . ASP A 1 59  ? 23.923  58.577  58.955  1.00 54.10  ?  56   ASP A O     1 
ATOM   481   C CB    . ASP A 1 59  ? 24.486  60.559  56.740  1.00 47.24  ?  56   ASP A CB    1 
ATOM   482   C CG    . ASP A 1 59  ? 24.518  62.005  57.193  1.00 64.91  ?  56   ASP A CG    1 
ATOM   483   O OD1   . ASP A 1 59  ? 25.600  62.627  57.122  1.00 67.48  ?  56   ASP A OD1   1 
ATOM   484   O OD2   . ASP A 1 59  ? 23.467  62.515  57.635  1.00 76.72  -1 56   ASP A OD2   1 
ATOM   485   N N     . PHE A 1 60  ? 25.571  59.781  59.919  1.00 42.06  ?  57   PHE A N     1 
ATOM   486   C CA    . PHE A 1 60  ? 25.263  59.384  61.291  1.00 43.29  ?  57   PHE A CA    1 
ATOM   487   C C     . PHE A 1 60  ? 25.360  60.646  62.143  1.00 53.72  ?  57   PHE A C     1 
ATOM   488   O O     . PHE A 1 60  ? 26.462  61.084  62.488  1.00 58.11  ?  57   PHE A O     1 
ATOM   489   C CB    . PHE A 1 60  ? 26.224  58.300  61.769  1.00 37.95  ?  57   PHE A CB    1 
ATOM   490   C CG    . PHE A 1 60  ? 25.817  57.638  63.058  1.00 34.18  ?  57   PHE A CG    1 
ATOM   491   C CD1   . PHE A 1 60  ? 25.785  58.351  64.245  1.00 34.71  ?  57   PHE A CD1   1 
ATOM   492   C CD2   . PHE A 1 60  ? 25.497  56.291  63.087  1.00 38.33  ?  57   PHE A CD2   1 
ATOM   493   C CE1   . PHE A 1 60  ? 25.420  57.742  65.429  1.00 30.16  ?  57   PHE A CE1   1 
ATOM   494   C CE2   . PHE A 1 60  ? 25.135  55.676  64.271  1.00 36.73  ?  57   PHE A CE2   1 
ATOM   495   C CZ    . PHE A 1 60  ? 25.097  56.406  65.444  1.00 29.55  ?  57   PHE A CZ    1 
ATOM   496   N N     . GLN A 1 61  ? 24.210  61.223  62.481  1.00 48.42  ?  58   GLN A N     1 
ATOM   497   C CA    . GLN A 1 61  ? 24.157  62.461  63.251  1.00 48.19  ?  58   GLN A CA    1 
ATOM   498   C C     . GLN A 1 61  ? 24.121  62.112  64.736  1.00 41.38  ?  58   GLN A C     1 
ATOM   499   O O     . GLN A 1 61  ? 23.134  61.556  65.229  1.00 41.93  ?  58   GLN A O     1 
ATOM   500   C CB    . GLN A 1 61  ? 22.945  63.292  62.843  1.00 47.65  ?  58   GLN A CB    1 
ATOM   501   C CG    . GLN A 1 61  ? 22.915  63.664  61.364  1.00 56.41  ?  58   GLN A CG    1 
ATOM   502   C CD    . GLN A 1 61  ? 23.887  64.777  61.012  1.00 64.13  ?  58   GLN A CD    1 
ATOM   503   O OE1   . GLN A 1 61  ? 25.078  64.540  60.809  1.00 67.65  ?  58   GLN A OE1   1 
ATOM   504   N NE2   . GLN A 1 61  ? 23.377  66.002  60.935  1.00 65.56  ?  58   GLN A NE2   1 
ATOM   505   N N     . ILE A 1 62  ? 25.194  62.445  65.448  1.00 39.75  ?  59   ILE A N     1 
ATOM   506   C CA    . ILE A 1 62  ? 25.320  62.097  66.859  1.00 36.24  ?  59   ILE A CA    1 
ATOM   507   C C     . ILE A 1 62  ? 24.610  63.138  67.717  1.00 33.61  ?  59   ILE A C     1 
ATOM   508   O O     . ILE A 1 62  ? 24.586  64.333  67.404  1.00 35.28  ?  59   ILE A O     1 
ATOM   509   C CB    . ILE A 1 62  ? 26.807  61.952  67.242  1.00 32.43  ?  59   ILE A CB    1 
ATOM   510   C CG1   . ILE A 1 62  ? 27.454  60.838  66.417  1.00 34.70  ?  59   ILE A CG1   1 
ATOM   511   C CG2   . ILE A 1 62  ? 26.971  61.661  68.729  1.00 28.19  ?  59   ILE A CG2   1 
ATOM   512   C CD1   . ILE A 1 62  ? 28.931  60.652  66.688  1.00 37.64  ?  59   ILE A CD1   1 
ATOM   513   N N     . THR A 1 63  ? 24.017  62.668  68.809  1.00 33.02  ?  60   THR A N     1 
ATOM   514   C CA    . THR A 1 63  ? 23.307  63.498  69.777  1.00 34.86  ?  60   THR A CA    1 
ATOM   515   C C     . THR A 1 63  ? 24.110  63.531  71.086  1.00 31.82  ?  60   THR A C     1 
ATOM   516   O O     . THR A 1 63  ? 24.670  62.513  71.482  1.00 32.18  ?  60   THR A O     1 
ATOM   517   C CB    . THR A 1 63  ? 21.874  62.939  70.013  1.00 43.19  ?  60   THR A CB    1 
ATOM   518   O OG1   . THR A 1 63  ? 21.080  63.143  68.837  1.00 47.91  ?  60   THR A OG1   1 
ATOM   519   C CG2   . THR A 1 63  ? 21.184  63.581  71.208  1.00 39.70  ?  60   THR A CG2   1 
ATOM   520   N N     . PRO A 1 64  ? 24.188  64.697  71.756  1.00 34.37  ?  61   PRO A N     1 
ATOM   521   C CA    . PRO A 1 64  ? 23.596  65.994  71.402  1.00 32.87  ?  61   PRO A CA    1 
ATOM   522   C C     . PRO A 1 64  ? 24.287  66.687  70.236  1.00 35.72  ?  61   PRO A C     1 
ATOM   523   O O     . PRO A 1 64  ? 25.359  66.262  69.805  1.00 29.96  ?  61   PRO A O     1 
ATOM   524   C CB    . PRO A 1 64  ? 23.757  66.813  72.685  1.00 34.74  ?  61   PRO A CB    1 
ATOM   525   C CG    . PRO A 1 64  ? 24.929  66.215  73.365  1.00 36.58  ?  61   PRO A CG    1 
ATOM   526   C CD    . PRO A 1 64  ? 24.869  64.748  73.062  1.00 32.97  ?  61   PRO A CD    1 
ATOM   527   N N     . LYS A 1 65  ? 23.659  67.752  69.735  1.00 26.80  ?  62   LYS A N     1 
ATOM   528   C CA    . LYS A 1 65  ? 24.225  68.485  68.608  1.00 27.10  ?  62   LYS A CA    1 
ATOM   529   C C     . LYS A 1 65  ? 25.620  69.004  68.933  1.00 29.03  ?  62   LYS A C     1 
ATOM   530   O O     . LYS A 1 65  ? 26.564  68.797  68.165  1.00 37.85  ?  62   LYS A O     1 
ATOM   531   C CB    . LYS A 1 65  ? 23.301  69.635  68.214  1.00 36.05  ?  62   LYS A CB    1 
ATOM   532   C CG    . LYS A 1 65  ? 23.698  70.332  66.922  1.00 44.78  ?  62   LYS A CG    1 
ATOM   533   C CD    . LYS A 1 65  ? 23.459  71.826  67.022  1.00 50.94  ?  62   LYS A CD    1 
ATOM   534   C CE    . LYS A 1 65  ? 22.404  72.291  66.041  1.00 51.47  ?  62   LYS A CE    1 
ATOM   535   N NZ    . LYS A 1 65  ? 21.571  73.382  66.627  1.00 40.29  1  62   LYS A NZ    1 
ATOM   536   N N     . ASN A 1 66  ? 25.777  69.667  70.083  1.00 34.87  ?  63   ASN A N     1 
ATOM   537   C CA    . ASN A 1 66  ? 27.075  70.277  70.379  1.00 38.32  ?  63   ASN A CA    1 
ATOM   538   C C     . ASN A 1 66  ? 28.158  69.261  70.743  1.00 33.42  ?  63   ASN A C     1 
ATOM   539   O O     . ASN A 1 66  ? 29.234  69.684  71.189  1.00 32.44  ?  63   ASN A O     1 
ATOM   540   C CB    . ASN A 1 66  ? 26.939  71.322  71.494  1.00 39.57  ?  63   ASN A CB    1 
ATOM   541   C CG    . ASN A 1 66  ? 26.518  70.726  72.848  1.00 44.98  ?  63   ASN A CG    1 
ATOM   542   O OD1   . ASN A 1 66  ? 26.763  69.560  73.150  1.00 33.23  ?  63   ASN A OD1   1 
ATOM   543   N ND2   . ASN A 1 66  ? 25.898  71.557  73.676  1.00 52.52  ?  63   ASN A ND2   1 
ATOM   544   N N     . VAL A 1 67  ? 27.928  67.957  70.567  1.00 38.10  ?  64   VAL A N     1 
ATOM   545   C CA    . VAL A 1 67  ? 28.946  66.969  70.901  1.00 29.46  ?  64   VAL A CA    1 
ATOM   546   C C     . VAL A 1 67  ? 30.199  67.153  70.057  1.00 29.41  ?  64   VAL A C     1 
ATOM   547   O O     . VAL A 1 67  ? 31.262  66.634  70.412  1.00 29.98  ?  64   VAL A O     1 
ATOM   548   C CB    . VAL A 1 67  ? 28.386  65.536  70.751  1.00 31.51  ?  64   VAL A CB    1 
ATOM   549   C CG1   . VAL A 1 67  ? 28.332  65.122  69.286  1.00 31.96  ?  64   VAL A CG1   1 
ATOM   550   C CG2   . VAL A 1 67  ? 29.214  64.547  71.564  1.00 30.92  ?  64   VAL A CG2   1 
ATOM   551   N N     . PHE A 1 68  ? 30.107  67.893  68.945  1.00 30.11  ?  65   PHE A N     1 
ATOM   552   C CA    . PHE A 1 68  ? 31.298  68.169  68.150  1.00 36.28  ?  65   PHE A CA    1 
ATOM   553   C C     . PHE A 1 68  ? 32.348  68.938  68.941  1.00 30.72  ?  65   PHE A C     1 
ATOM   554   O O     . PHE A 1 68  ? 33.522  68.934  68.556  1.00 34.61  ?  65   PHE A O     1 
ATOM   555   C CB    . PHE A 1 68  ? 30.934  68.931  66.865  1.00 38.18  ?  65   PHE A CB    1 
ATOM   556   C CG    . PHE A 1 68  ? 30.091  70.166  67.087  1.00 41.88  ?  65   PHE A CG    1 
ATOM   557   C CD1   . PHE A 1 68  ? 30.637  71.314  67.641  1.00 35.81  ?  65   PHE A CD1   1 
ATOM   558   C CD2   . PHE A 1 68  ? 28.762  70.190  66.701  1.00 42.52  ?  65   PHE A CD2   1 
ATOM   559   C CE1   . PHE A 1 68  ? 29.865  72.448  67.833  1.00 35.33  ?  65   PHE A CE1   1 
ATOM   560   C CE2   . PHE A 1 68  ? 27.984  71.322  66.891  1.00 29.78  ?  65   PHE A CE2   1 
ATOM   561   C CZ    . PHE A 1 68  ? 28.536  72.449  67.456  1.00 31.90  ?  65   PHE A CZ    1 
ATOM   562   N N     . GLN A 1 69  ? 31.956  69.587  70.043  1.00 31.71  ?  66   GLN A N     1 
ATOM   563   C CA    . GLN A 1 69  ? 32.921  70.290  70.881  1.00 35.06  ?  66   GLN A CA    1 
ATOM   564   C C     . GLN A 1 69  ? 33.889  69.337  71.568  1.00 31.09  ?  66   GLN A C     1 
ATOM   565   O O     . GLN A 1 69  ? 34.942  69.776  72.038  1.00 31.88  ?  66   GLN A O     1 
ATOM   566   C CB    . GLN A 1 69  ? 32.201  71.133  71.934  1.00 33.80  ?  66   GLN A CB    1 
ATOM   567   C CG    . GLN A 1 69  ? 31.712  70.335  73.130  1.00 43.37  ?  66   GLN A CG    1 
ATOM   568   C CD    . GLN A 1 69  ? 30.906  71.170  74.101  1.00 49.06  ?  66   GLN A CD    1 
ATOM   569   O OE1   . GLN A 1 69  ? 31.461  71.924  74.901  1.00 50.96  ?  66   GLN A OE1   1 
ATOM   570   N NE2   . GLN A 1 69  ? 29.586  71.040  74.037  1.00 44.43  ?  66   GLN A NE2   1 
ATOM   571   N N     . TYR A 1 70  ? 33.555  68.051  71.641  1.00 30.97  ?  67   TYR A N     1 
ATOM   572   C CA    . TYR A 1 70  ? 34.444  67.045  72.203  1.00 31.43  ?  67   TYR A CA    1 
ATOM   573   C C     . TYR A 1 70  ? 35.108  66.186  71.138  1.00 32.05  ?  67   TYR A C     1 
ATOM   574   O O     . TYR A 1 70  ? 35.915  65.316  71.481  1.00 32.50  ?  67   TYR A O     1 
ATOM   575   C CB    . TYR A 1 70  ? 33.679  66.146  73.180  1.00 31.18  ?  67   TYR A CB    1 
ATOM   576   C CG    . TYR A 1 70  ? 33.015  66.895  74.312  1.00 35.56  ?  67   TYR A CG    1 
ATOM   577   C CD1   . TYR A 1 70  ? 33.767  67.626  75.222  1.00 33.78  ?  67   TYR A CD1   1 
ATOM   578   C CD2   . TYR A 1 70  ? 31.636  66.866  74.475  1.00 33.91  ?  67   TYR A CD2   1 
ATOM   579   C CE1   . TYR A 1 70  ? 33.165  68.311  76.257  1.00 35.50  ?  67   TYR A CE1   1 
ATOM   580   C CE2   . TYR A 1 70  ? 31.025  67.547  75.507  1.00 35.35  ?  67   TYR A CE2   1 
ATOM   581   C CZ    . TYR A 1 70  ? 31.794  68.268  76.396  1.00 39.84  ?  67   TYR A CZ    1 
ATOM   582   O OH    . TYR A 1 70  ? 31.189  68.948  77.427  1.00 45.26  ?  67   TYR A OH    1 
ATOM   583   N N     . LYS A 1 71  ? 34.797  66.410  69.862  1.00 32.08  ?  68   LYS A N     1 
ATOM   584   C CA    . LYS A 1 71  ? 35.331  65.563  68.804  1.00 32.63  ?  68   LYS A CA    1 
ATOM   585   C C     . LYS A 1 71  ? 36.846  65.695  68.711  1.00 33.50  ?  68   LYS A C     1 
ATOM   586   O O     . LYS A 1 71  ? 37.400  66.794  68.792  1.00 33.73  ?  68   LYS A O     1 
ATOM   587   C CB    . LYS A 1 71  ? 34.698  65.908  67.457  1.00 32.49  ?  68   LYS A CB    1 
ATOM   588   C CG    . LYS A 1 71  ? 35.220  65.034  66.324  1.00 43.60  ?  68   LYS A CG    1 
ATOM   589   C CD    . LYS A 1 71  ? 34.388  65.147  65.065  1.00 44.58  ?  68   LYS A CD    1 
ATOM   590   C CE    . LYS A 1 71  ? 34.533  63.891  64.214  1.00 43.95  ?  68   LYS A CE    1 
ATOM   591   N NZ    . LYS A 1 71  ? 35.959  63.565  63.914  1.00 43.12  1  68   LYS A NZ    1 
ATOM   592   N N     . VAL A 1 72  ? 37.509  64.558  68.531  1.00 33.98  ?  69   VAL A N     1 
ATOM   593   C CA    . VAL A 1 72  ? 38.961  64.474  68.455  1.00 39.98  ?  69   VAL A CA    1 
ATOM   594   C C     . VAL A 1 72  ? 39.362  64.227  67.005  1.00 44.84  ?  69   VAL A C     1 
ATOM   595   O O     . VAL A 1 72  ? 38.623  63.606  66.232  1.00 35.09  ?  69   VAL A O     1 
ATOM   596   C CB    . VAL A 1 72  ? 39.477  63.369  69.408  1.00 44.66  ?  69   VAL A CB    1 
ATOM   597   C CG1   . VAL A 1 72  ? 40.827  62.815  68.975  1.00 45.34  ?  69   VAL A CG1   1 
ATOM   598   C CG2   . VAL A 1 72  ? 39.560  63.908  70.831  1.00 46.22  ?  69   VAL A CG2   1 
ATOM   599   N N     . GLU A 1 73  ? 40.536  64.753  66.632  1.00 45.37  ?  70   GLU A N     1 
ATOM   600   C CA    . GLU A 1 73  ? 41.048  64.607  65.271  1.00 46.64  ?  70   GLU A CA    1 
ATOM   601   C C     . GLU A 1 73  ? 41.087  63.153  64.811  1.00 47.91  ?  70   GLU A C     1 
ATOM   602   O O     . GLU A 1 73  ? 40.858  62.869  63.628  1.00 57.19  ?  70   GLU A O     1 
ATOM   603   C CB    . GLU A 1 73  ? 42.449  65.221  65.190  1.00 45.48  ?  70   GLU A CB    1 
ATOM   604   C CG    . GLU A 1 73  ? 43.249  64.854  63.948  1.00 63.61  ?  70   GLU A CG    1 
ATOM   605   C CD    . GLU A 1 73  ? 44.653  64.377  64.281  1.00 77.07  ?  70   GLU A CD    1 
ATOM   606   O OE1   . GLU A 1 73  ? 44.929  63.168  64.124  1.00 82.75  ?  70   GLU A OE1   1 
ATOM   607   O OE2   . GLU A 1 73  ? 45.479  65.208  64.712  1.00 72.12  -1 70   GLU A OE2   1 
ATOM   608   N N     . LYS A 1 74  ? 41.360  62.225  65.724  1.00 43.82  ?  71   LYS A N     1 
ATOM   609   C CA    . LYS A 1 74  ? 41.620  60.840  65.349  1.00 37.17  ?  71   LYS A CA    1 
ATOM   610   C C     . LYS A 1 74  ? 40.399  60.199  64.696  1.00 42.76  ?  71   LYS A C     1 
ATOM   611   O O     . LYS A 1 74  ? 39.280  60.285  65.211  1.00 35.89  ?  71   LYS A O     1 
ATOM   612   C CB    . LYS A 1 74  ? 42.039  60.043  66.584  1.00 37.25  ?  71   LYS A CB    1 
ATOM   613   C CG    . LYS A 1 74  ? 42.621  58.672  66.289  1.00 39.68  ?  71   LYS A CG    1 
ATOM   614   C CD    . LYS A 1 74  ? 42.899  57.918  67.581  1.00 40.47  ?  71   LYS A CD    1 
ATOM   615   C CE    . LYS A 1 74  ? 43.860  56.761  67.362  1.00 49.01  ?  71   LYS A CE    1 
ATOM   616   N NZ    . LYS A 1 74  ? 44.175  56.063  68.641  1.00 47.70  1  71   LYS A NZ    1 
ATOM   617   N N     . GLU A 1 75  ? 40.625  59.560  63.550  1.00 45.08  ?  72   GLU A N     1 
ATOM   618   C CA    . GLU A 1 75  ? 39.604  58.788  62.858  1.00 41.81  ?  72   GLU A CA    1 
ATOM   619   C C     . GLU A 1 75  ? 40.249  57.563  62.234  1.00 41.07  ?  72   GLU A C     1 
ATOM   620   O O     . GLU A 1 75  ? 41.413  57.596  61.827  1.00 45.39  ?  72   GLU A O     1 
ATOM   621   C CB    . GLU A 1 75  ? 38.894  59.603  61.771  1.00 44.25  ?  72   GLU A CB    1 
ATOM   622   C CG    . GLU A 1 75  ? 37.835  60.553  62.290  1.00 43.66  ?  72   GLU A CG    1 
ATOM   623   C CD    . GLU A 1 75  ? 37.018  61.168  61.174  1.00 47.59  ?  72   GLU A CD    1 
ATOM   624   O OE1   . GLU A 1 75  ? 37.169  60.727  60.016  1.00 54.55  ?  72   GLU A OE1   1 
ATOM   625   O OE2   . GLU A 1 75  ? 36.226  62.093  61.455  1.00 52.61  -1 72   GLU A OE2   1 
ATOM   626   N N     . GLU A 1 76  ? 39.480  56.481  62.158  1.00 36.85  ?  73   GLU A N     1 
ATOM   627   C CA    . GLU A 1 76  ? 39.977  55.223  61.627  1.00 37.78  ?  73   GLU A CA    1 
ATOM   628   C C     . GLU A 1 76  ? 38.916  54.592  60.738  1.00 42.12  ?  73   GLU A C     1 
ATOM   629   O O     . GLU A 1 76  ? 37.715  54.692  61.005  1.00 37.19  ?  73   GLU A O     1 
ATOM   630   C CB    . GLU A 1 76  ? 40.377  54.265  62.755  1.00 37.43  ?  73   GLU A CB    1 
ATOM   631   C CG    . GLU A 1 76  ? 41.559  54.760  63.574  1.00 49.42  ?  73   GLU A CG    1 
ATOM   632   C CD    . GLU A 1 76  ? 41.623  54.137  64.950  1.00 53.25  ?  73   GLU A CD    1 
ATOM   633   O OE1   . GLU A 1 76  ? 40.552  53.846  65.522  1.00 51.94  ?  73   GLU A OE1   1 
ATOM   634   O OE2   . GLU A 1 76  ? 42.745  53.937  65.461  1.00 66.86  -1 73   GLU A OE2   1 
ATOM   635   N N     . ILE A 1 77  ? 39.377  53.944  59.673  1.00 39.81  ?  74   ILE A N     1 
ATOM   636   C CA    . ILE A 1 77  ? 38.513  53.272  58.712  1.00 37.21  ?  74   ILE A CA    1 
ATOM   637   C C     . ILE A 1 77  ? 38.965  51.824  58.618  1.00 43.86  ?  74   ILE A C     1 
ATOM   638   O O     . ILE A 1 77  ? 40.118  51.552  58.262  1.00 44.74  ?  74   ILE A O     1 
ATOM   639   C CB    . ILE A 1 77  ? 38.549  53.958  57.337  1.00 41.96  ?  74   ILE A CB    1 
ATOM   640   C CG1   . ILE A 1 77  ? 37.792  55.287  57.400  1.00 38.89  ?  74   ILE A CG1   1 
ATOM   641   C CG2   . ILE A 1 77  ? 37.966  53.043  56.270  1.00 37.40  ?  74   ILE A CG2   1 
ATOM   642   C CD1   . ILE A 1 77  ? 38.444  56.408  56.625  1.00 45.85  ?  74   ILE A CD1   1 
ATOM   643   N N     . ILE A 1 78  ? 38.069  50.901  58.953  1.00 37.11  ?  75   ILE A N     1 
ATOM   644   C CA    . ILE A 1 78  ? 38.355  49.472  58.929  1.00 37.40  ?  75   ILE A CA    1 
ATOM   645   C C     . ILE A 1 78  ? 37.494  48.847  57.844  1.00 50.08  ?  75   ILE A C     1 
ATOM   646   O O     . ILE A 1 78  ? 36.260  48.889  57.921  1.00 51.41  ?  75   ILE A O     1 
ATOM   647   C CB    . ILE A 1 78  ? 38.086  48.813  60.290  1.00 37.04  ?  75   ILE A CB    1 
ATOM   648   C CG1   . ILE A 1 78  ? 38.577  49.709  61.430  1.00 41.68  ?  75   ILE A CG1   1 
ATOM   649   C CG2   . ILE A 1 78  ? 38.745  47.443  60.361  1.00 37.53  ?  75   ILE A CG2   1 
ATOM   650   C CD1   . ILE A 1 78  ? 40.074  49.949  61.428  1.00 44.85  ?  75   ILE A CD1   1 
ATOM   651   N N     . LYS A 1 79  ? 38.139  48.276  56.833  1.00 43.75  ?  76   LYS A N     1 
ATOM   652   C CA    . LYS A 1 79  ? 37.405  47.599  55.775  1.00 42.33  ?  76   LYS A CA    1 
ATOM   653   C C     . LYS A 1 79  ? 36.838  46.280  56.284  1.00 37.33  ?  76   LYS A C     1 
ATOM   654   O O     . LYS A 1 79  ? 37.427  45.616  57.143  1.00 41.51  ?  76   LYS A O     1 
ATOM   655   C CB    . LYS A 1 79  ? 38.315  47.339  54.579  1.00 42.99  ?  76   LYS A CB    1 
ATOM   656   C CG    . LYS A 1 79  ? 38.943  48.586  54.012  1.00 38.78  ?  76   LYS A CG    1 
ATOM   657   C CD    . LYS A 1 79  ? 40.091  48.226  53.104  1.00 54.07  ?  76   LYS A CD    1 
ATOM   658   C CE    . LYS A 1 79  ? 40.543  49.417  52.295  1.00 58.14  ?  76   LYS A CE    1 
ATOM   659   N NZ    . LYS A 1 79  ? 41.307  48.943  51.121  1.00 64.47  1  76   LYS A NZ    1 
ATOM   660   N N     . GLU A 1 80  ? 35.678  45.902  55.743  1.00 42.23  ?  77   GLU A N     1 
ATOM   661   C CA    . GLU A 1 80  ? 35.101  44.602  56.066  1.00 37.17  ?  77   GLU A CA    1 
ATOM   662   C C     . GLU A 1 80  ? 36.080  43.476  55.768  1.00 37.71  ?  77   GLU A C     1 
ATOM   663   O O     . GLU A 1 80  ? 36.075  42.452  56.460  1.00 49.29  ?  77   GLU A O     1 
ATOM   664   C CB    . GLU A 1 80  ? 33.796  44.407  55.292  1.00 38.77  ?  77   GLU A CB    1 
ATOM   665   C CG    . GLU A 1 80  ? 33.002  43.167  55.678  1.00 38.74  ?  77   GLU A CG    1 
ATOM   666   C CD    . GLU A 1 80  ? 33.426  41.934  54.902  1.00 45.67  ?  77   GLU A CD    1 
ATOM   667   O OE1   . GLU A 1 80  ? 34.117  42.087  53.873  1.00 44.79  ?  77   GLU A OE1   1 
ATOM   668   O OE2   . GLU A 1 80  ? 33.070  40.813  55.321  1.00 49.52  -1 77   GLU A OE2   1 
ATOM   669   N N     . GLU A 1 81  ? 36.929  43.652  54.752  1.00 40.88  ?  78   GLU A N     1 
ATOM   670   C CA    . GLU A 1 81  ? 37.986  42.685  54.470  1.00 46.22  ?  78   GLU A CA    1 
ATOM   671   C C     . GLU A 1 81  ? 38.852  42.437  55.700  1.00 47.56  ?  78   GLU A C     1 
ATOM   672   O O     . GLU A 1 81  ? 39.108  41.289  56.076  1.00 50.60  ?  78   GLU A O     1 
ATOM   673   C CB    . GLU A 1 81  ? 38.863  43.182  53.321  1.00 49.54  ?  78   GLU A CB    1 
ATOM   674   C CG    . GLU A 1 81  ? 38.304  42.969  51.931  1.00 51.89  ?  78   GLU A CG    1 
ATOM   675   C CD    . GLU A 1 81  ? 39.300  43.375  50.858  1.00 60.84  ?  78   GLU A CD    1 
ATOM   676   O OE1   . GLU A 1 81  ? 39.500  44.592  50.657  1.00 58.26  ?  78   GLU A OE1   1 
ATOM   677   O OE2   . GLU A 1 81  ? 39.896  42.476  50.228  1.00 68.85  -1 78   GLU A OE2   1 
ATOM   678   N N     . GLU A 1 82  ? 39.321  43.514  56.334  1.00 44.78  ?  79   GLU A N     1 
ATOM   679   C CA    . GLU A 1 82  ? 40.284  43.388  57.418  1.00 52.63  ?  79   GLU A CA    1 
ATOM   680   C C     . GLU A 1 82  ? 39.650  42.863  58.704  1.00 52.17  ?  79   GLU A C     1 
ATOM   681   O O     . GLU A 1 82  ? 40.379  42.416  59.598  1.00 56.02  ?  79   GLU A O     1 
ATOM   682   C CB    . GLU A 1 82  ? 40.943  44.738  57.687  1.00 56.74  ?  79   GLU A CB    1 
ATOM   683   C CG    . GLU A 1 82  ? 41.013  45.638  56.460  1.00 62.35  ?  79   GLU A CG    1 
ATOM   684   C CD    . GLU A 1 82  ? 41.661  46.981  56.751  1.00 64.37  ?  79   GLU A CD    1 
ATOM   685   O OE1   . GLU A 1 82  ? 42.846  46.999  57.146  1.00 68.82  ?  79   GLU A OE1   1 
ATOM   686   O OE2   . GLU A 1 82  ? 40.983  48.018  56.590  1.00 58.33  -1 79   GLU A OE2   1 
ATOM   687   N N     . ASP A 1 83  ? 38.319  42.904  58.817  1.00 45.93  ?  80   ASP A N     1 
ATOM   688   C CA    . ASP A 1 83  ? 37.664  42.530  60.066  1.00 46.18  ?  80   ASP A CA    1 
ATOM   689   C C     . ASP A 1 83  ? 36.173  42.337  59.755  1.00 48.91  ?  80   ASP A C     1 
ATOM   690   O O     . ASP A 1 83  ? 35.388  43.285  59.818  1.00 51.37  ?  80   ASP A O     1 
ATOM   691   C CB    . ASP A 1 83  ? 37.880  43.574  61.144  1.00 48.85  ?  80   ASP A CB    1 
ATOM   692   C CG    . ASP A 1 83  ? 37.485  43.086  62.528  1.00 39.85  ?  80   ASP A CG    1 
ATOM   693   O OD1   . ASP A 1 83  ? 36.686  42.137  62.628  1.00 45.16  ?  80   ASP A OD1   1 
ATOM   694   O OD2   . ASP A 1 83  ? 37.969  43.669  63.519  1.00 46.35  -1 80   ASP A OD2   1 
ATOM   695   N N     . LYS A 1 84  ? 35.799  41.092  59.442  1.00 39.84  ?  81   LYS A N     1 
ATOM   696   C CA    . LYS A 1 84  ? 34.404  40.791  59.127  1.00 36.30  ?  81   LYS A CA    1 
ATOM   697   C C     . LYS A 1 84  ? 33.514  40.928  60.355  1.00 38.78  ?  81   LYS A C     1 
ATOM   698   O O     . LYS A 1 84  ? 32.402  41.455  60.263  1.00 44.15  ?  81   LYS A O     1 
ATOM   699   C CB    . LYS A 1 84  ? 34.303  39.384  58.544  1.00 37.47  ?  81   LYS A CB    1 
ATOM   700   C CG    . LYS A 1 84  ? 34.865  39.245  57.141  1.00 50.06  ?  81   LYS A CG    1 
ATOM   701   C CD    . LYS A 1 84  ? 34.941  37.785  56.728  1.00 51.09  ?  81   LYS A CD    1 
ATOM   702   C CE    . LYS A 1 84  ? 34.496  37.587  55.289  1.00 55.40  ?  81   LYS A CE    1 
ATOM   703   N NZ    . LYS A 1 84  ? 33.012  37.626  55.164  1.00 54.12  1  81   LYS A NZ    1 
ATOM   704   N N     . LYS A 1 85  ? 33.983  40.455  61.513  1.00 39.83  ?  82   LYS A N     1 
ATOM   705   C CA    . LYS A 1 85  ? 33.140  40.464  62.702  1.00 39.32  ?  82   LYS A CA    1 
ATOM   706   C C     . LYS A 1 85  ? 32.837  41.885  63.156  1.00 37.69  ?  82   LYS A C     1 
ATOM   707   O O     . LYS A 1 85  ? 31.726  42.172  63.616  1.00 36.34  ?  82   LYS A O     1 
ATOM   708   C CB    . LYS A 1 85  ? 33.803  39.663  63.820  1.00 40.09  ?  82   LYS A CB    1 
ATOM   709   C CG    . LYS A 1 85  ? 34.025  38.205  63.458  1.00 55.22  ?  82   LYS A CG    1 
ATOM   710   C CD    . LYS A 1 85  ? 34.189  37.326  64.684  1.00 62.64  ?  82   LYS A CD    1 
ATOM   711   C CE    . LYS A 1 85  ? 33.659  35.927  64.407  1.00 67.69  ?  82   LYS A CE    1 
ATOM   712   N NZ    . LYS A 1 85  ? 34.182  35.378  63.122  1.00 65.45  1  82   LYS A NZ    1 
ATOM   713   N N     . LEU A 1 86  ? 33.810  42.792  63.030  1.00 35.70  ?  83   LEU A N     1 
ATOM   714   C CA    . LEU A 1 86  ? 33.572  44.183  63.401  1.00 31.05  ?  83   LEU A CA    1 
ATOM   715   C C     . LEU A 1 86  ? 32.489  44.805  62.531  1.00 32.03  ?  83   LEU A C     1 
ATOM   716   O O     . LEU A 1 86  ? 31.631  45.546  63.027  1.00 32.50  ?  83   LEU A O     1 
ATOM   717   C CB    . LEU A 1 86  ? 34.867  44.986  63.298  1.00 29.14  ?  83   LEU A CB    1 
ATOM   718   C CG    . LEU A 1 86  ? 34.799  46.482  63.615  1.00 35.59  ?  83   LEU A CG    1 
ATOM   719   C CD1   . LEU A 1 86  ? 34.190  46.712  64.987  1.00 32.34  ?  83   LEU A CD1   1 
ATOM   720   C CD2   . LEU A 1 86  ? 36.183  47.106  63.531  1.00 44.58  ?  83   LEU A CD2   1 
ATOM   721   N N     . PHE A 1 87  ? 32.511  44.515  61.227  1.00 28.57  ?  84   PHE A N     1 
ATOM   722   C CA    . PHE A 1 87  ? 31.474  45.035  60.343  1.00 28.78  ?  84   PHE A CA    1 
ATOM   723   C C     . PHE A 1 87  ? 30.100  44.511  60.740  1.00 34.59  ?  84   PHE A C     1 
ATOM   724   O O     . PHE A 1 87  ? 29.126  45.272  60.782  1.00 32.22  ?  84   PHE A O     1 
ATOM   725   C CB    . PHE A 1 87  ? 31.792  44.671  58.891  1.00 35.77  ?  84   PHE A CB    1 
ATOM   726   C CG    . PHE A 1 87  ? 30.753  45.133  57.906  1.00 34.24  ?  84   PHE A CG    1 
ATOM   727   C CD1   . PHE A 1 87  ? 30.796  46.416  57.390  1.00 30.32  ?  84   PHE A CD1   1 
ATOM   728   C CD2   . PHE A 1 87  ? 29.733  44.287  57.500  1.00 35.29  ?  84   PHE A CD2   1 
ATOM   729   C CE1   . PHE A 1 87  ? 29.841  46.846  56.489  1.00 34.54  ?  84   PHE A CE1   1 
ATOM   730   C CE2   . PHE A 1 87  ? 28.776  44.712  56.598  1.00 25.23  ?  84   PHE A CE2   1 
ATOM   731   C CZ    . PHE A 1 87  ? 28.830  45.992  56.095  1.00 32.82  ?  84   PHE A CZ    1 
ATOM   732   N N     . VAL A 1 88  ? 30.005  43.214  61.041  1.00 30.00  ?  85   VAL A N     1 
ATOM   733   C CA    . VAL A 1 88  ? 28.722  42.618  61.405  1.00 31.77  ?  85   VAL A CA    1 
ATOM   734   C C     . VAL A 1 88  ? 28.248  43.153  62.751  1.00 32.83  ?  85   VAL A C     1 
ATOM   735   O O     . VAL A 1 88  ? 27.074  43.503  62.922  1.00 31.71  ?  85   VAL A O     1 
ATOM   736   C CB    . VAL A 1 88  ? 28.831  41.082  61.413  1.00 35.50  ?  85   VAL A CB    1 
ATOM   737   C CG1   . VAL A 1 88  ? 27.559  40.455  61.972  1.00 34.66  ?  85   VAL A CG1   1 
ATOM   738   C CG2   . VAL A 1 88  ? 29.111  40.562  60.012  1.00 31.13  ?  85   VAL A CG2   1 
ATOM   739   N N     . LYS A 1 89  ? 29.154  43.216  63.728  1.00 26.12  ?  86   LYS A N     1 
ATOM   740   C CA    . LYS A 1 89  ? 28.808  43.775  65.030  1.00 30.23  ?  86   LYS A CA    1 
ATOM   741   C C     . LYS A 1 89  ? 28.303  45.206  64.890  1.00 35.01  ?  86   LYS A C     1 
ATOM   742   O O     . LYS A 1 89  ? 27.278  45.579  65.473  1.00 36.09  ?  86   LYS A O     1 
ATOM   743   C CB    . LYS A 1 89  ? 30.022  43.719  65.955  1.00 32.73  ?  86   LYS A CB    1 
ATOM   744   C CG    . LYS A 1 89  ? 29.892  44.551  67.217  1.00 33.22  ?  86   LYS A CG    1 
ATOM   745   C CD    . LYS A 1 89  ? 31.213  44.604  67.965  1.00 36.23  ?  86   LYS A CD    1 
ATOM   746   C CE    . LYS A 1 89  ? 31.110  45.455  69.220  1.00 46.32  ?  86   LYS A CE    1 
ATOM   747   N NZ    . LYS A 1 89  ? 32.400  45.487  69.961  1.00 50.41  1  86   LYS A NZ    1 
ATOM   748   N N     . THR A 1 90  ? 29.010  46.017  64.100  1.00 33.23  ?  87   THR A N     1 
ATOM   749   C CA    . THR A 1 90  ? 28.615  47.409  63.907  1.00 30.56  ?  87   THR A CA    1 
ATOM   750   C C     . THR A 1 90  ? 27.258  47.510  63.224  1.00 32.21  ?  87   THR A C     1 
ATOM   751   O O     . THR A 1 90  ? 26.419  48.333  63.609  1.00 27.43  ?  87   THR A O     1 
ATOM   752   C CB    . THR A 1 90  ? 29.677  48.138  63.089  1.00 29.55  ?  87   THR A CB    1 
ATOM   753   O OG1   . THR A 1 90  ? 30.961  47.955  63.701  1.00 32.98  ?  87   THR A OG1   1 
ATOM   754   C CG2   . THR A 1 90  ? 29.363  49.623  63.008  1.00 30.10  ?  87   THR A CG2   1 
ATOM   755   N N     . LEU A 1 91  ? 27.025  46.682  62.204  1.00 28.49  ?  88   LEU A N     1 
ATOM   756   C CA    . LEU A 1 91  ? 25.752  46.721  61.492  1.00 32.70  ?  88   LEU A CA    1 
ATOM   757   C C     . LEU A 1 91  ? 24.600  46.297  62.398  1.00 35.33  ?  88   LEU A C     1 
ATOM   758   O O     . LEU A 1 91  ? 23.510  46.879  62.343  1.00 32.14  ?  88   LEU A O     1 
ATOM   759   C CB    . LEU A 1 91  ? 25.829  45.829  60.255  1.00 28.74  ?  88   LEU A CB    1 
ATOM   760   C CG    . LEU A 1 91  ? 24.724  45.931  59.206  1.00 35.60  ?  88   LEU A CG    1 
ATOM   761   C CD1   . LEU A 1 91  ? 24.557  47.362  58.734  1.00 33.01  ?  88   LEU A CD1   1 
ATOM   762   C CD2   . LEU A 1 91  ? 25.052  45.021  58.038  1.00 31.80  ?  88   LEU A CD2   1 
ATOM   763   N N     . TYR A 1 92  ? 24.827  45.286  63.243  1.00 30.62  ?  89   TYR A N     1 
ATOM   764   C CA    . TYR A 1 92  ? 23.809  44.868  64.204  1.00 32.55  ?  89   TYR A CA    1 
ATOM   765   C C     . TYR A 1 92  ? 23.443  46.005  65.149  1.00 32.74  ?  89   TYR A C     1 
ATOM   766   O O     . TYR A 1 92  ? 22.260  46.271  65.395  1.00 28.16  ?  89   TYR A O     1 
ATOM   767   C CB    . TYR A 1 92  ? 24.303  43.655  64.992  1.00 32.11  ?  89   TYR A CB    1 
ATOM   768   C CG    . TYR A 1 92  ? 23.827  42.325  64.453  1.00 30.90  ?  89   TYR A CG    1 
ATOM   769   C CD1   . TYR A 1 92  ? 22.475  42.073  64.260  1.00 29.58  ?  89   TYR A CD1   1 
ATOM   770   C CD2   . TYR A 1 92  ? 24.732  41.322  64.136  1.00 27.46  ?  89   TYR A CD2   1 
ATOM   771   C CE1   . TYR A 1 92  ? 22.038  40.856  63.768  1.00 26.58  ?  89   TYR A CE1   1 
ATOM   772   C CE2   . TYR A 1 92  ? 24.306  40.104  63.645  1.00 29.57  ?  89   TYR A CE2   1 
ATOM   773   C CZ    . TYR A 1 92  ? 22.959  39.874  63.464  1.00 32.87  ?  89   TYR A CZ    1 
ATOM   774   O OH    . TYR A 1 92  ? 22.536  38.661  62.972  1.00 32.46  ?  89   TYR A OH    1 
ATOM   775   N N     . LYS A 1 93  ? 24.452  46.686  65.697  1.00 24.22  ?  90   LYS A N     1 
ATOM   776   C CA    . LYS A 1 93  ? 24.184  47.807  66.590  1.00 32.64  ?  90   LYS A CA    1 
ATOM   777   C C     . LYS A 1 93  ? 23.496  48.947  65.857  1.00 28.82  ?  90   LYS A C     1 
ATOM   778   O O     . LYS A 1 93  ? 22.654  49.643  66.438  1.00 29.36  ?  90   LYS A O     1 
ATOM   779   C CB    . LYS A 1 93  ? 25.486  48.291  67.229  1.00 33.38  ?  90   LYS A CB    1 
ATOM   780   C CG    . LYS A 1 93  ? 26.170  47.251  68.105  1.00 32.10  ?  90   LYS A CG    1 
ATOM   781   C CD    . LYS A 1 93  ? 27.544  47.722  68.553  1.00 31.26  ?  90   LYS A CD    1 
ATOM   782   C CE    . LYS A 1 93  ? 27.455  48.999  69.370  1.00 43.05  ?  90   LYS A CE    1 
ATOM   783   N NZ    . LYS A 1 93  ? 28.806  49.482  69.769  1.00 50.19  1  90   LYS A NZ    1 
ATOM   784   N N     . TYR A 1 94  ? 23.829  49.146  64.582  1.00 36.41  ?  91   TYR A N     1 
ATOM   785   C CA    . TYR A 1 94  ? 23.204  50.221  63.821  1.00 30.43  ?  91   TYR A CA    1 
ATOM   786   C C     . TYR A 1 94  ? 21.735  49.923  63.550  1.00 35.27  ?  91   TYR A C     1 
ATOM   787   O O     . TYR A 1 94  ? 20.895  50.830  63.587  1.00 34.72  ?  91   TYR A O     1 
ATOM   788   C CB    . TYR A 1 94  ? 23.954  50.450  62.512  1.00 33.86  ?  91   TYR A CB    1 
ATOM   789   C CG    . TYR A 1 94  ? 23.369  51.578  61.705  1.00 43.02  ?  91   TYR A CG    1 
ATOM   790   C CD1   . TYR A 1 94  ? 23.292  52.857  62.235  1.00 48.80  ?  91   TYR A CD1   1 
ATOM   791   C CD2   . TYR A 1 94  ? 22.885  51.367  60.423  1.00 47.92  ?  91   TYR A CD2   1 
ATOM   792   C CE1   . TYR A 1 94  ? 22.753  53.896  61.511  1.00 50.94  ?  91   TYR A CE1   1 
ATOM   793   C CE2   . TYR A 1 94  ? 22.343  52.404  59.689  1.00 50.21  ?  91   TYR A CE2   1 
ATOM   794   C CZ    . TYR A 1 94  ? 22.280  53.666  60.240  1.00 52.31  ?  91   TYR A CZ    1 
ATOM   795   O OH    . TYR A 1 94  ? 21.745  54.707  59.522  1.00 63.31  ?  91   TYR A OH    1 
ATOM   796   N N     . ILE A 1 95  ? 21.408  48.659  63.271  1.00 32.73  ?  92   ILE A N     1 
ATOM   797   C CA    . ILE A 1 95  ? 20.013  48.278  63.069  1.00 33.51  ?  92   ILE A CA    1 
ATOM   798   C C     . ILE A 1 95  ? 19.225  48.462  64.356  1.00 31.93  ?  92   ILE A C     1 
ATOM   799   O O     . ILE A 1 95  ? 18.098  48.974  64.347  1.00 39.14  ?  92   ILE A O     1 
ATOM   800   C CB    . ILE A 1 95  ? 19.931  46.829  62.553  1.00 28.50  ?  92   ILE A CB    1 
ATOM   801   C CG1   . ILE A 1 95  ? 20.395  46.767  61.097  1.00 35.57  ?  92   ILE A CG1   1 
ATOM   802   C CG2   . ILE A 1 95  ? 18.517  46.271  62.708  1.00 22.84  ?  92   ILE A CG2   1 
ATOM   803   C CD1   . ILE A 1 95  ? 21.020  45.449  60.724  1.00 42.39  ?  92   ILE A CD1   1 
ATOM   804   N N     . LYS A 1 96  ? 19.809  48.053  65.483  1.00 25.69  ?  93   LYS A N     1 
ATOM   805   C CA    . LYS A 1 96  ? 19.158  48.229  66.776  1.00 29.02  ?  93   LYS A CA    1 
ATOM   806   C C     . LYS A 1 96  ? 18.844  49.696  67.040  1.00 34.86  ?  93   LYS A C     1 
ATOM   807   O O     . LYS A 1 96  ? 17.739  50.037  67.480  1.00 30.81  ?  93   LYS A O     1 
ATOM   808   C CB    . LYS A 1 96  ? 20.048  47.659  67.879  1.00 25.92  ?  93   LYS A CB    1 
ATOM   809   C CG    . LYS A 1 96  ? 19.492  47.799  69.282  1.00 34.24  ?  93   LYS A CG    1 
ATOM   810   C CD    . LYS A 1 96  ? 20.470  47.229  70.295  1.00 35.53  ?  93   LYS A CD    1 
ATOM   811   C CE    . LYS A 1 96  ? 19.879  47.211  71.688  1.00 36.86  ?  93   LYS A CE    1 
ATOM   812   N NZ    . LYS A 1 96  ? 20.794  46.542  72.648  1.00 47.85  1  93   LYS A NZ    1 
ATOM   813   N N     . LYS A 1 97  ? 19.808  50.581  66.775  1.00 26.22  ?  94   LYS A N     1 
ATOM   814   C CA    . LYS A 1 97  ? 19.590  52.007  67.002  1.00 29.05  ?  94   LYS A CA    1 
ATOM   815   C C     . LYS A 1 97  ? 18.409  52.520  66.191  1.00 25.60  ?  94   LYS A C     1 
ATOM   816   O O     . LYS A 1 97  ? 17.560  53.255  66.708  1.00 34.75  ?  94   LYS A O     1 
ATOM   817   C CB    . LYS A 1 97  ? 20.850  52.802  66.656  1.00 31.73  ?  94   LYS A CB    1 
ATOM   818   C CG    . LYS A 1 97  ? 20.571  54.284  66.462  1.00 30.77  ?  94   LYS A CG    1 
ATOM   819   C CD    . LYS A 1 97  ? 21.812  55.063  66.072  1.00 37.24  ?  94   LYS A CD    1 
ATOM   820   C CE    . LYS A 1 97  ? 21.460  56.520  65.792  1.00 33.63  ?  94   LYS A CE    1 
ATOM   821   N NZ    . LYS A 1 97  ? 20.671  57.117  66.910  1.00 31.61  1  94   LYS A NZ    1 
ATOM   822   N N     . LEU A 1 98  ? 18.340  52.145  64.912  1.00 25.10  ?  95   LEU A N     1 
ATOM   823   C CA    . LEU A 1 98  ? 17.257  52.621  64.057  1.00 32.83  ?  95   LEU A CA    1 
ATOM   824   C C     . LEU A 1 98  ? 15.900  52.167  64.583  1.00 36.98  ?  95   LEU A C     1 
ATOM   825   O O     . LEU A 1 98  ? 14.948  52.955  64.637  1.00 39.20  ?  95   LEU A O     1 
ATOM   826   C CB    . LEU A 1 98  ? 17.474  52.141  62.624  1.00 27.30  ?  95   LEU A CB    1 
ATOM   827   C CG    . LEU A 1 98  ? 18.625  52.803  61.866  1.00 32.02  ?  95   LEU A CG    1 
ATOM   828   C CD1   . LEU A 1 98  ? 18.741  52.232  60.462  1.00 33.76  ?  95   LEU A CD1   1 
ATOM   829   C CD2   . LEU A 1 98  ? 18.436  54.311  61.821  1.00 34.59  ?  95   LEU A CD2   1 
ATOM   830   N N     . PHE A 1 99  ? 15.792  50.893  64.971  1.00 34.75  ?  96   PHE A N     1 
ATOM   831   C CA    . PHE A 1 99  ? 14.552  50.398  65.561  1.00 38.12  ?  96   PHE A CA    1 
ATOM   832   C C     . PHE A 1 99  ? 14.219  51.150  66.845  1.00 41.56  ?  96   PHE A C     1 
ATOM   833   O O     . PHE A 1 99  ? 13.083  51.596  67.040  1.00 50.10  ?  96   PHE A O     1 
ATOM   834   C CB    . PHE A 1 99  ? 14.661  48.897  65.836  1.00 34.10  ?  96   PHE A CB    1 
ATOM   835   C CG    . PHE A 1 99  ? 14.312  48.029  64.657  1.00 33.67  ?  96   PHE A CG    1 
ATOM   836   C CD1   . PHE A 1 99  ? 12.992  47.705  64.386  1.00 27.66  ?  96   PHE A CD1   1 
ATOM   837   C CD2   . PHE A 1 99  ? 15.304  47.524  63.833  1.00 28.45  ?  96   PHE A CD2   1 
ATOM   838   C CE1   . PHE A 1 99  ? 12.667  46.900  63.310  1.00 28.49  ?  96   PHE A CE1   1 
ATOM   839   C CE2   . PHE A 1 99  ? 14.985  46.719  62.754  1.00 30.73  ?  96   PHE A CE2   1 
ATOM   840   C CZ    . PHE A 1 99  ? 13.664  46.407  62.492  1.00 30.63  ?  96   PHE A CZ    1 
ATOM   841   N N     . LEU A 1 100 ? 15.203  51.295  67.737  1.00 41.29  ?  97   LEU A N     1 
ATOM   842   C CA    . LEU A 1 100 ? 14.967  52.014  68.985  1.00 36.26  ?  97   LEU A CA    1 
ATOM   843   C C     . LEU A 1 100 ? 14.639  53.479  68.722  1.00 38.98  ?  97   LEU A C     1 
ATOM   844   O O     . LEU A 1 100 ? 13.810  54.071  69.423  1.00 37.97  ?  97   LEU A O     1 
ATOM   845   C CB    . LEU A 1 100 ? 16.181  51.891  69.906  1.00 38.77  ?  97   LEU A CB    1 
ATOM   846   C CG    . LEU A 1 100 ? 16.469  50.519  70.525  1.00 46.53  ?  97   LEU A CG    1 
ATOM   847   C CD1   . LEU A 1 100 ? 17.709  50.580  71.404  1.00 37.51  ?  97   LEU A CD1   1 
ATOM   848   C CD2   . LEU A 1 100 ? 15.276  50.019  71.322  1.00 46.11  ?  97   LEU A CD2   1 
ATOM   849   N N     . ASP A 1 101 ? 15.280  54.083  67.716  1.00 42.31  ?  98   ASP A N     1 
ATOM   850   C CA    . ASP A 1 101 ? 14.968  55.463  67.357  1.00 36.85  ?  98   ASP A CA    1 
ATOM   851   C C     . ASP A 1 101 ? 13.544  55.614  66.843  1.00 44.55  ?  98   ASP A C     1 
ATOM   852   O O     . ASP A 1 101 ? 12.983  56.712  66.917  1.00 42.10  ?  98   ASP A O     1 
ATOM   853   C CB    . ASP A 1 101 ? 15.947  55.983  66.302  1.00 32.63  ?  98   ASP A CB    1 
ATOM   854   C CG    . ASP A 1 101 ? 17.309  56.317  66.881  1.00 35.57  ?  98   ASP A CG    1 
ATOM   855   O OD1   . ASP A 1 101 ? 17.451  56.311  68.120  1.00 29.59  ?  98   ASP A OD1   1 
ATOM   856   O OD2   . ASP A 1 101 ? 18.234  56.600  66.092  1.00 40.26  -1 98   ASP A OD2   1 
ATOM   857   N N     . ASN A 1 102 ? 12.953  54.546  66.312  1.00 37.22  ?  99   ASN A N     1 
ATOM   858   C CA    . ASN A 1 102 ? 11.560  54.558  65.896  1.00 37.55  ?  99   ASN A CA    1 
ATOM   859   C C     . ASN A 1 102 ? 10.647  53.935  66.944  1.00 36.35  ?  99   ASN A C     1 
ATOM   860   O O     . ASN A 1 102 ? 9.550   53.473  66.614  1.00 38.25  ?  99   ASN A O     1 
ATOM   861   C CB    . ASN A 1 102 ? 11.407  53.862  64.544  1.00 36.37  ?  99   ASN A CB    1 
ATOM   862   C CG    . ASN A 1 102 ? 12.042  54.653  63.413  1.00 44.96  ?  99   ASN A CG    1 
ATOM   863   O OD1   . ASN A 1 102 ? 11.379  55.449  62.746  1.00 51.58  ?  99   ASN A OD1   1 
ATOM   864   N ND2   . ASN A 1 102 ? 13.336  54.446  63.200  1.00 37.96  ?  99   ASN A ND2   1 
ATOM   865   N N     . ASP A 1 103 ? 11.094  53.911  68.201  1.00 52.11  ?  100  ASP A N     1 
ATOM   866   C CA    . ASP A 1 103 ? 10.306  53.534  69.371  1.00 63.42  ?  100  ASP A CA    1 
ATOM   867   C C     . ASP A 1 103 ? 9.898   52.066  69.376  1.00 64.77  ?  100  ASP A C     1 
ATOM   868   O O     . ASP A 1 103 ? 8.911   51.699  70.023  1.00 64.11  ?  100  ASP A O     1 
ATOM   869   C CB    . ASP A 1 103 ? 9.070   54.427  69.521  1.00 71.66  ?  100  ASP A CB    1 
ATOM   870   C CG    . ASP A 1 103 ? 8.939   55.003  70.918  1.00 78.86  ?  100  ASP A CG    1 
ATOM   871   O OD1   . ASP A 1 103 ? 9.750   55.881  71.282  1.00 74.88  ?  100  ASP A OD1   1 
ATOM   872   O OD2   . ASP A 1 103 ? 8.027   54.575  71.654  1.00 86.73  -1 100  ASP A OD2   1 
ATOM   873   N N     . PHE A 1 104 ? 10.634  51.211  68.673  1.00 54.15  ?  101  PHE A N     1 
ATOM   874   C CA    . PHE A 1 104 ? 10.481  49.777  68.860  1.00 45.60  ?  101  PHE A CA    1 
ATOM   875   C C     . PHE A 1 104 ? 11.133  49.358  70.171  1.00 42.38  ?  101  PHE A C     1 
ATOM   876   O O     . PHE A 1 104 ? 12.135  49.934  70.602  1.00 40.50  ?  101  PHE A O     1 
ATOM   877   C CB    . PHE A 1 104 ? 11.119  49.005  67.705  1.00 45.60  ?  101  PHE A CB    1 
ATOM   878   C CG    . PHE A 1 104 ? 10.298  48.991  66.446  1.00 47.48  ?  101  PHE A CG    1 
ATOM   879   C CD1   . PHE A 1 104 ? 10.090  50.154  65.723  1.00 36.38  ?  101  PHE A CD1   1 
ATOM   880   C CD2   . PHE A 1 104 ? 9.755   47.807  65.973  1.00 48.37  ?  101  PHE A CD2   1 
ATOM   881   C CE1   . PHE A 1 104 ? 9.340   50.141  64.560  1.00 37.91  ?  101  PHE A CE1   1 
ATOM   882   C CE2   . PHE A 1 104 ? 9.005   47.786  64.809  1.00 53.13  ?  101  PHE A CE2   1 
ATOM   883   C CZ    . PHE A 1 104 ? 8.797   48.955  64.102  1.00 52.28  ?  101  PHE A CZ    1 
ATOM   884   N N     . TYR A 1 105 ? 10.549  48.351  70.814  1.00 38.89  ?  102  TYR A N     1 
ATOM   885   C CA    . TYR A 1 105 ? 11.198  47.717  71.949  1.00 39.97  ?  102  TYR A CA    1 
ATOM   886   C C     . TYR A 1 105 ? 12.164  46.655  71.450  1.00 42.56  ?  102  TYR A C     1 
ATOM   887   O O     . TYR A 1 105 ? 11.885  45.951  70.476  1.00 41.64  ?  102  TYR A O     1 
ATOM   888   C CB    . TYR A 1 105 ? 10.171  47.083  72.888  1.00 45.59  ?  102  TYR A CB    1 
ATOM   889   C CG    . TYR A 1 105 ? 9.375   48.073  73.705  1.00 52.35  ?  102  TYR A CG    1 
ATOM   890   C CD1   . TYR A 1 105 ? 9.772   49.400  73.805  1.00 53.12  ?  102  TYR A CD1   1 
ATOM   891   C CD2   . TYR A 1 105 ? 8.228   47.678  74.382  1.00 53.25  ?  102  TYR A CD2   1 
ATOM   892   C CE1   . TYR A 1 105 ? 9.041   50.310  74.549  1.00 58.23  ?  102  TYR A CE1   1 
ATOM   893   C CE2   . TYR A 1 105 ? 7.495   48.577  75.131  1.00 55.04  ?  102  TYR A CE2   1 
ATOM   894   C CZ    . TYR A 1 105 ? 7.903   49.892  75.211  1.00 59.96  ?  102  TYR A CZ    1 
ATOM   895   O OH    . TYR A 1 105 ? 7.173   50.785  75.961  1.00 61.63  ?  102  TYR A OH    1 
ATOM   896   N N     . PHE A 1 106 ? 13.309  46.550  72.113  1.00 40.56  ?  103  PHE A N     1 
ATOM   897   C CA    . PHE A 1 106 ? 14.270  45.499  71.821  1.00 37.11  ?  103  PHE A CA    1 
ATOM   898   C C     . PHE A 1 106 ? 14.063  44.334  72.778  1.00 41.93  ?  103  PHE A C     1 
ATOM   899   O O     . PHE A 1 106 ? 13.839  44.529  73.976  1.00 41.04  ?  103  PHE A O     1 
ATOM   900   C CB    . PHE A 1 106 ? 15.709  46.009  71.924  1.00 40.68  ?  103  PHE A CB    1 
ATOM   901   C CG    . PHE A 1 106 ? 16.739  44.914  71.888  1.00 42.14  ?  103  PHE A CG    1 
ATOM   902   C CD1   . PHE A 1 106 ? 17.113  44.336  70.686  1.00 39.50  ?  103  PHE A CD1   1 
ATOM   903   C CD2   . PHE A 1 106 ? 17.326  44.455  73.058  1.00 40.98  ?  103  PHE A CD2   1 
ATOM   904   C CE1   . PHE A 1 106 ? 18.056  43.323  70.651  1.00 42.54  ?  103  PHE A CE1   1 
ATOM   905   C CE2   . PHE A 1 106 ? 18.269  43.442  73.030  1.00 36.75  ?  103  PHE A CE2   1 
ATOM   906   C CZ    . PHE A 1 106 ? 18.635  42.876  71.825  1.00 42.11  ?  103  PHE A CZ    1 
ATOM   907   N N     . LYS A 1 107 ? 14.133  43.124  72.235  1.00 35.80  ?  104  LYS A N     1 
ATOM   908   C CA    . LYS A 1 107 ? 14.055  41.898  73.012  1.00 30.19  ?  104  LYS A CA    1 
ATOM   909   C C     . LYS A 1 107 ? 15.186  40.983  72.569  1.00 41.36  ?  104  LYS A C     1 
ATOM   910   O O     . LYS A 1 107 ? 15.556  40.973  71.390  1.00 37.44  ?  104  LYS A O     1 
ATOM   911   C CB    . LYS A 1 107 ? 12.690  41.216  72.832  1.00 32.58  ?  104  LYS A CB    1 
ATOM   912   C CG    . LYS A 1 107 ? 12.437  40.023  73.743  1.00 37.72  ?  104  LYS A CG    1 
ATOM   913   C CD    . LYS A 1 107 ? 10.950  39.697  73.798  1.00 39.44  ?  104  LYS A CD    1 
ATOM   914   C CE    . LYS A 1 107 ? 10.680  38.376  74.499  1.00 43.09  ?  104  LYS A CE    1 
ATOM   915   N NZ    . LYS A 1 107 ? 10.493  37.258  73.529  1.00 48.25  1  104  LYS A NZ    1 
ATOM   916   N N     . LYS A 1 108 ? 15.736  40.228  73.522  1.00 44.64  ?  105  LYS A N     1 
ATOM   917   C CA    . LYS A 1 108 ? 16.911  39.403  73.266  1.00 44.02  ?  105  LYS A CA    1 
ATOM   918   C C     . LYS A 1 108 ? 16.695  38.512  72.047  1.00 38.78  ?  105  LYS A C     1 
ATOM   919   O O     . LYS A 1 108 ? 15.595  38.004  71.814  1.00 41.82  ?  105  LYS A O     1 
ATOM   920   C CB    . LYS A 1 108 ? 17.230  38.555  74.501  1.00 52.51  ?  105  LYS A CB    1 
ATOM   921   C CG    . LYS A 1 108 ? 18.637  37.971  74.528  1.00 53.64  ?  105  LYS A CG    1 
ATOM   922   C CD    . LYS A 1 108 ? 18.910  37.265  75.851  1.00 58.57  ?  105  LYS A CD    1 
ATOM   923   C CE    . LYS A 1 108 ? 20.296  36.642  75.882  1.00 57.94  ?  105  LYS A CE    1 
ATOM   924   N NZ    . LYS A 1 108 ? 20.577  35.987  77.190  1.00 56.36  1  105  LYS A NZ    1 
ATOM   925   N N     . GLY A 1 109 ? 17.754  38.342  71.261  1.00 43.05  ?  106  GLY A N     1 
ATOM   926   C CA    . GLY A 1 109 ? 17.650  37.668  69.983  1.00 48.25  ?  106  GLY A CA    1 
ATOM   927   C C     . GLY A 1 109 ? 17.354  38.574  68.811  1.00 46.82  ?  106  GLY A C     1 
ATOM   928   O O     . GLY A 1 109 ? 16.938  38.080  67.757  1.00 52.35  ?  106  GLY A O     1 
ATOM   929   N N     . ASN A 1 110 ? 17.552  39.885  68.964  1.00 38.57  ?  107  ASN A N     1 
ATOM   930   C CA    . ASN A 1 110 ? 17.296  40.872  67.914  1.00 35.80  ?  107  ASN A CA    1 
ATOM   931   C C     . ASN A 1 110 ? 15.835  40.869  67.475  1.00 35.50  ?  107  ASN A C     1 
ATOM   932   O O     . ASN A 1 110 ? 15.526  41.080  66.299  1.00 43.32  ?  107  ASN A O     1 
ATOM   933   C CB    . ASN A 1 110 ? 18.225  40.667  66.713  1.00 35.63  ?  107  ASN A CB    1 
ATOM   934   C CG    . ASN A 1 110 ? 19.653  41.088  67.005  1.00 40.44  ?  107  ASN A CG    1 
ATOM   935   O OD1   . ASN A 1 110 ? 19.892  42.128  67.618  1.00 35.54  ?  107  ASN A OD1   1 
ATOM   936   N ND2   . ASN A 1 110 ? 20.611  40.275  66.575  1.00 44.03  ?  107  ASN A ND2   1 
ATOM   937   N N     . ASN A 1 111 ? 14.931  40.626  68.420  1.00 33.16  ?  108  ASN A N     1 
ATOM   938   C CA    . ASN A 1 111 ? 13.504  40.803  68.200  1.00 30.78  ?  108  ASN A CA    1 
ATOM   939   C C     . ASN A 1 111 ? 13.138  42.248  68.506  1.00 39.33  ?  108  ASN A C     1 
ATOM   940   O O     . ASN A 1 111 ? 13.529  42.784  69.549  1.00 35.34  ?  108  ASN A O     1 
ATOM   941   C CB    . ASN A 1 111 ? 12.692  39.852  69.079  1.00 40.15  ?  108  ASN A CB    1 
ATOM   942   C CG    . ASN A 1 111 ? 12.875  38.401  68.692  1.00 39.50  ?  108  ASN A CG    1 
ATOM   943   O OD1   . ASN A 1 111 ? 12.199  37.898  67.798  1.00 45.33  ?  108  ASN A OD1   1 
ATOM   944   N ND2   . ASN A 1 111 ? 13.792  37.718  69.366  1.00 34.35  ?  108  ASN A ND2   1 
ATOM   945   N N     . PHE A 1 112 ? 12.397  42.877  67.598  1.00 29.94  ?  109  PHE A N     1 
ATOM   946   C CA    . PHE A 1 112 ? 12.037  44.284  67.730  1.00 38.94  ?  109  PHE A CA    1 
ATOM   947   C C     . PHE A 1 112 ? 10.521  44.398  67.800  1.00 35.21  ?  109  PHE A C     1 
ATOM   948   O O     . PHE A 1 112 ? 9.819   44.107  66.825  1.00 43.92  ?  109  PHE A O     1 
ATOM   949   C CB    . PHE A 1 112 ? 12.622  45.106  66.587  1.00 34.93  ?  109  PHE A CB    1 
ATOM   950   C CG    . PHE A 1 112 ? 14.121  45.192  66.625  1.00 37.63  ?  109  PHE A CG    1 
ATOM   951   C CD1   . PHE A 1 112 ? 14.757  45.962  67.586  1.00 37.29  ?  109  PHE A CD1   1 
ATOM   952   C CD2   . PHE A 1 112 ? 14.896  44.491  65.718  1.00 37.51  ?  109  PHE A CD2   1 
ATOM   953   C CE1   . PHE A 1 112 ? 16.135  46.040  67.633  1.00 29.82  ?  109  PHE A CE1   1 
ATOM   954   C CE2   . PHE A 1 112 ? 16.275  44.564  65.762  1.00 29.86  ?  109  PHE A CE2   1 
ATOM   955   C CZ    . PHE A 1 112 ? 16.894  45.338  66.720  1.00 29.85  ?  109  PHE A CZ    1 
ATOM   956   N N     . ILE A 1 113 ? 10.030  44.824  68.956  1.00 32.86  ?  110  ILE A N     1 
ATOM   957   C CA    . ILE A 1 113 ? 8.603   44.881  69.241  1.00 36.20  ?  110  ILE A CA    1 
ATOM   958   C C     . ILE A 1 113 ? 8.083   46.247  68.817  1.00 33.78  ?  110  ILE A C     1 
ATOM   959   O O     . ILE A 1 113 ? 8.532   47.275  69.334  1.00 33.96  ?  110  ILE A O     1 
ATOM   960   C CB    . ILE A 1 113 ? 8.340   44.630  70.733  1.00 36.45  ?  110  ILE A CB    1 
ATOM   961   C CG1   . ILE A 1 113 ? 8.802   43.228  71.132  1.00 31.38  ?  110  ILE A CG1   1 
ATOM   962   C CG2   . ILE A 1 113 ? 6.884   44.841  71.070  1.00 33.78  ?  110  ILE A CG2   1 
ATOM   963   C CD1   . ILE A 1 113 ? 8.796   42.995  72.630  1.00 30.01  ?  110  ILE A CD1   1 
ATOM   964   N N     . SER A 1 114 ? 7.141   46.264  67.879  1.00 52.58  ?  111  SER A N     1 
ATOM   965   C CA    . SER A 1 114 ? 6.532   47.523  67.475  1.00 52.63  ?  111  SER A CA    1 
ATOM   966   C C     . SER A 1 114 ? 5.620   48.052  68.575  1.00 52.76  ?  111  SER A C     1 
ATOM   967   O O     . SER A 1 114 ? 4.973   47.290  69.299  1.00 52.88  ?  111  SER A O     1 
ATOM   968   C CB    . SER A 1 114 ? 5.737   47.351  66.181  1.00 52.74  ?  111  SER A CB    1 
ATOM   969   O OG    . SER A 1 114 ? 5.054   48.546  65.841  1.00 52.81  ?  111  SER A OG    1 
ATOM   970   N N     . ASN A 1 115 ? 5.576   49.379  68.698  1.00 52.73  ?  112  ASN A N     1 
ATOM   971   C CA    . ASN A 1 115 ? 4.694   50.034  69.652  1.00 52.85  ?  112  ASN A CA    1 
ATOM   972   C C     . ASN A 1 115 ? 3.610   50.876  68.995  1.00 52.98  ?  112  ASN A C     1 
ATOM   973   O O     . ASN A 1 115 ? 2.826   51.513  69.707  1.00 53.08  ?  112  ASN A O     1 
ATOM   974   C CB    . ASN A 1 115 ? 5.503   50.899  70.626  1.00 52.71  ?  112  ASN A CB    1 
ATOM   975   C CG    . ASN A 1 115 ? 6.154   50.082  71.724  1.00 52.65  ?  112  ASN A CG    1 
ATOM   976   O OD1   . ASN A 1 115 ? 5.472   49.544  72.598  1.00 52.77  ?  112  ASN A OD1   1 
ATOM   977   N ND2   . ASN A 1 115 ? 7.476   49.987  71.689  1.00 52.45  ?  112  ASN A ND2   1 
ATOM   978   N N     . SER A 1 116 ? 3.544   50.901  67.664  1.00 52.98  ?  113  SER A N     1 
ATOM   979   C CA    . SER A 1 116 ? 2.419   51.487  66.946  1.00 53.66  ?  113  SER A CA    1 
ATOM   980   C C     . SER A 1 116 ? 1.498   50.447  66.333  1.00 55.14  ?  113  SER A C     1 
ATOM   981   O O     . SER A 1 116 ? 0.290   50.677  66.258  1.00 53.46  ?  113  SER A O     1 
ATOM   982   C CB    . SER A 1 116 ? 2.914   52.425  65.837  1.00 57.70  ?  113  SER A CB    1 
ATOM   983   O OG    . SER A 1 116 ? 3.298   51.696  64.683  1.00 63.22  ?  113  SER A OG    1 
ATOM   984   N N     . GLU A 1 117 ? 2.041   49.310  65.902  1.00 56.13  ?  114  GLU A N     1 
ATOM   985   C CA    . GLU A 1 117 ? 1.240   48.218  65.352  1.00 54.00  ?  114  GLU A CA    1 
ATOM   986   C C     . GLU A 1 117 ? 0.852   47.263  66.481  1.00 55.82  ?  114  GLU A C     1 
ATOM   987   O O     . GLU A 1 117 ? 1.294   46.117  66.564  1.00 54.08  ?  114  GLU A O     1 
ATOM   988   C CB    . GLU A 1 117 ? 2.004   47.505  64.244  1.00 58.58  ?  114  GLU A CB    1 
ATOM   989   C CG    . GLU A 1 117 ? 2.453   48.429  63.131  1.00 64.71  ?  114  GLU A CG    1 
ATOM   990   C CD    . GLU A 1 117 ? 1.291   49.149  62.481  1.00 72.87  ?  114  GLU A CD    1 
ATOM   991   O OE1   . GLU A 1 117 ? 0.335   48.466  62.056  1.00 64.65  ?  114  GLU A OE1   1 
ATOM   992   O OE2   . GLU A 1 117 ? 1.326   50.396  62.411  1.00 80.81  -1 114  GLU A OE2   1 
ATOM   993   N N     . VAL A 1 118 ? 0.008   47.777  67.371  1.00 58.12  ?  115  VAL A N     1 
ATOM   994   C CA    . VAL A 1 118 ? -0.445  47.053  68.552  1.00 54.32  ?  115  VAL A CA    1 
ATOM   995   C C     . VAL A 1 118 ? -1.967  47.050  68.564  1.00 59.63  ?  115  VAL A C     1 
ATOM   996   O O     . VAL A 1 118 ? -2.600  48.063  68.246  1.00 66.43  ?  115  VAL A O     1 
ATOM   997   C CB    . VAL A 1 118 ? 0.102   47.687  69.849  1.00 56.19  ?  115  VAL A CB    1 
ATOM   998   C CG1   . VAL A 1 118 ? -0.119  46.763  71.038  1.00 53.66  ?  115  VAL A CG1   1 
ATOM   999   C CG2   . VAL A 1 118 ? 1.574   48.048  69.697  1.00 53.37  ?  115  VAL A CG2   1 
ATOM   1000  N N     . PHE A 1 119 ? -2.555  45.915  68.932  1.00 57.16  ?  116  PHE A N     1 
ATOM   1001  C CA    . PHE A 1 119 ? -3.994  45.839  69.134  1.00 58.84  ?  116  PHE A CA    1 
ATOM   1002  C C     . PHE A 1 119 ? -4.293  44.933  70.317  1.00 56.45  ?  116  PHE A C     1 
ATOM   1003  O O     . PHE A 1 119 ? -3.652  43.894  70.495  1.00 54.27  ?  116  PHE A O     1 
ATOM   1004  C CB    . PHE A 1 119 ? -4.730  45.347  67.873  1.00 54.36  ?  116  PHE A CB    1 
ATOM   1005  C CG    . PHE A 1 119 ? -4.295  43.988  67.390  1.00 54.33  ?  116  PHE A CG    1 
ATOM   1006  C CD1   . PHE A 1 119 ? -4.906  42.837  67.866  1.00 56.11  ?  116  PHE A CD1   1 
ATOM   1007  C CD2   . PHE A 1 119 ? -3.301  43.865  66.433  1.00 54.18  ?  116  PHE A CD2   1 
ATOM   1008  C CE1   . PHE A 1 119 ? -4.517  41.590  67.414  1.00 54.44  ?  116  PHE A CE1   1 
ATOM   1009  C CE2   . PHE A 1 119 ? -2.909  42.620  65.976  1.00 54.16  ?  116  PHE A CE2   1 
ATOM   1010  C CZ    . PHE A 1 119 ? -3.517  41.482  66.467  1.00 54.28  ?  116  PHE A CZ    1 
ATOM   1011  N N     . SER A 1 120 ? -5.256  45.348  71.136  1.00 62.95  ?  117  SER A N     1 
ATOM   1012  C CA    . SER A 1 120 ? -5.701  44.523  72.247  1.00 60.14  ?  117  SER A CA    1 
ATOM   1013  C C     . SER A 1 120 ? -6.483  43.326  71.723  1.00 56.70  ?  117  SER A C     1 
ATOM   1014  O O     . SER A 1 120 ? -7.233  43.429  70.748  1.00 59.00  ?  117  SER A O     1 
ATOM   1015  C CB    . SER A 1 120 ? -6.565  45.344  73.204  1.00 57.98  ?  117  SER A CB    1 
ATOM   1016  O OG    . SER A 1 120 ? -6.964  44.576  74.328  1.00 62.07  ?  117  SER A OG    1 
ATOM   1017  N N     . LEU A 1 121 ? -6.298  42.182  72.373  1.00 58.30  ?  118  LEU A N     1 
ATOM   1018  C CA    . LEU A 1 121 ? -6.979  40.966  71.955  1.00 56.22  ?  118  LEU A CA    1 
ATOM   1019  C C     . LEU A 1 121 ? -8.463  41.049  72.286  1.00 60.28  ?  118  LEU A C     1 
ATOM   1020  O O     . LEU A 1 121 ? -8.839  41.415  73.404  1.00 62.75  ?  118  LEU A O     1 
ATOM   1021  C CB    . LEU A 1 121 ? -6.356  39.750  72.638  1.00 54.81  ?  118  LEU A CB    1 
ATOM   1022  C CG    . LEU A 1 121 ? -4.983  39.297  72.134  1.00 54.61  ?  118  LEU A CG    1 
ATOM   1023  C CD1   . LEU A 1 121 ? -4.455  38.161  72.979  1.00 59.81  ?  118  LEU A CD1   1 
ATOM   1024  C CD2   . LEU A 1 121 ? -5.070  38.868  70.690  1.00 54.63  ?  118  LEU A CD2   1 
ATOM   1025  N N     . ASP A 1 122 ? -9.307  40.714  71.306  1.00 58.13  ?  119  ASP A N     1 
ATOM   1026  C CA    . ASP A 1 122 ? -10.739 40.611  71.570  1.00 58.73  ?  119  ASP A CA    1 
ATOM   1027  C C     . ASP A 1 122 ? -11.013 39.624  72.697  1.00 61.97  ?  119  ASP A C     1 
ATOM   1028  O O     . ASP A 1 122 ? -11.895 39.850  73.534  1.00 63.76  ?  119  ASP A O     1 
ATOM   1029  C CB    . ASP A 1 122 ? -11.478 40.180  70.302  1.00 55.54  ?  119  ASP A CB    1 
ATOM   1030  C CG    . ASP A 1 122 ? -11.171 41.068  69.111  1.00 58.96  ?  119  ASP A CG    1 
ATOM   1031  O OD1   . ASP A 1 122 ? -11.113 42.306  69.278  1.00 62.36  ?  119  ASP A OD1   1 
ATOM   1032  O OD2   . ASP A 1 122 ? -10.990 40.524  68.001  1.00 62.41  -1 119  ASP A OD2   1 
ATOM   1033  N N     . SER A 1 123 ? -10.250 38.529  72.741  1.00 63.64  ?  120  SER A N     1 
ATOM   1034  C CA    . SER A 1 123 ? -10.522 37.470  73.705  1.00 55.60  ?  120  SER A CA    1 
ATOM   1035  C C     . SER A 1 123 ? -10.160 37.894  75.124  1.00 61.42  ?  120  SER A C     1 
ATOM   1036  O O     . SER A 1 123 ? -10.854 37.529  76.081  1.00 64.01  ?  120  SER A O     1 
ATOM   1037  C CB    . SER A 1 123 ? -9.762  36.201  73.311  1.00 55.43  ?  120  SER A CB    1 
ATOM   1038  O OG    . SER A 1 123 ? -9.813  35.232  74.344  1.00 66.26  ?  120  SER A OG    1 
ATOM   1039  N N     . ASN A 1 124 ? -9.080  38.657  75.288  1.00 65.53  ?  121  ASN A N     1 
ATOM   1040  C CA    . ASN A 1 124 ? -8.636  39.086  76.611  1.00 61.80  ?  121  ASN A CA    1 
ATOM   1041  C C     . ASN A 1 124 ? -8.238  40.552  76.528  1.00 63.66  ?  121  ASN A C     1 
ATOM   1042  O O     . ASN A 1 124 ? -7.258  40.900  75.860  1.00 60.85  ?  121  ASN A O     1 
ATOM   1043  C CB    . ASN A 1 124 ? -7.483  38.227  77.116  1.00 58.36  ?  121  ASN A CB    1 
ATOM   1044  C CG    . ASN A 1 124 ? -7.321  38.305  78.616  1.00 57.53  ?  121  ASN A CG    1 
ATOM   1045  O OD1   . ASN A 1 124 ? -7.212  39.390  79.185  1.00 61.95  ?  121  ASN A OD1   1 
ATOM   1046  N ND2   . ASN A 1 124 ? -7.319  37.152  79.270  1.00 60.40  ?  121  ASN A ND2   1 
ATOM   1047  N N     . GLU A 1 125 ? -8.994  41.406  77.223  1.00 63.05  ?  122  GLU A N     1 
ATOM   1048  C CA    . GLU A 1 125 ? -8.802  42.847  77.103  1.00 61.12  ?  122  GLU A CA    1 
ATOM   1049  C C     . GLU A 1 125 ? -7.450  43.290  77.648  1.00 57.70  ?  122  GLU A C     1 
ATOM   1050  O O     . GLU A 1 125 ? -6.912  44.316  77.215  1.00 57.74  ?  122  GLU A O     1 
ATOM   1051  C CB    . GLU A 1 125 ? -9.937  43.576  77.824  1.00 59.80  ?  122  GLU A CB    1 
ATOM   1052  C CG    . GLU A 1 125 ? -10.039 45.057  77.511  1.00 61.96  ?  122  GLU A CG    1 
ATOM   1053  C CD    . GLU A 1 125 ? -10.459 45.336  76.078  1.00 70.02  ?  122  GLU A CD    1 
ATOM   1054  O OE1   . GLU A 1 125 ? -10.813 44.383  75.350  1.00 73.21  ?  122  GLU A OE1   1 
ATOM   1055  O OE2   . GLU A 1 125 ? -10.439 46.519  75.680  1.00 75.98  -1 122  GLU A OE2   1 
ATOM   1056  N N     . ASN A 1 126 ? -6.880  42.532  78.580  1.00 54.86  ?  123  ASN A N     1 
ATOM   1057  C CA    . ASN A 1 126 ? -5.654  42.928  79.258  1.00 56.39  ?  123  ASN A CA    1 
ATOM   1058  C C     . ASN A 1 126 ? -4.388  42.475  78.536  1.00 61.52  ?  123  ASN A C     1 
ATOM   1059  O O     . ASN A 1 126 ? -3.294  42.614  79.092  1.00 54.33  ?  123  ASN A O     1 
ATOM   1060  C CB    . ASN A 1 126 ? -5.651  42.389  80.691  1.00 57.73  ?  123  ASN A CB    1 
ATOM   1061  C CG    . ASN A 1 126 ? -6.824  42.896  81.509  1.00 59.79  ?  123  ASN A CG    1 
ATOM   1062  O OD1   . ASN A 1 126 ? -6.773  43.982  82.085  1.00 62.01  ?  123  ASN A OD1   1 
ATOM   1063  N ND2   . ASN A 1 126 ? -7.889  42.104  81.567  1.00 58.03  ?  123  ASN A ND2   1 
ATOM   1064  N N     . VAL A 1 127 ? -4.500  41.951  77.317  1.00 50.14  ?  124  VAL A N     1 
ATOM   1065  C CA    . VAL A 1 127 ? -3.351  41.446  76.573  1.00 56.14  ?  124  VAL A CA    1 
ATOM   1066  C C     . VAL A 1 127 ? -3.192  42.260  75.296  1.00 62.31  ?  124  VAL A C     1 
ATOM   1067  O O     . VAL A 1 127 ? -4.167  42.481  74.568  1.00 66.30  ?  124  VAL A O     1 
ATOM   1068  C CB    . VAL A 1 127 ? -3.493  39.947  76.252  1.00 49.95  ?  124  VAL A CB    1 
ATOM   1069  C CG1   . VAL A 1 127 ? -2.274  39.456  75.490  1.00 53.05  ?  124  VAL A CG1   1 
ATOM   1070  C CG2   . VAL A 1 127 ? -3.679  39.146  77.532  1.00 47.78  ?  124  VAL A CG2   1 
ATOM   1071  N N     . ASN A 1 128 ? -1.964  42.700  75.028  1.00 58.49  ?  125  ASN A N     1 
ATOM   1072  C CA    . ASN A 1 128 ? -1.630  43.437  73.817  1.00 52.54  ?  125  ASN A CA    1 
ATOM   1073  C C     . ASN A 1 128 ? -0.878  42.529  72.852  1.00 51.84  ?  125  ASN A C     1 
ATOM   1074  O O     . ASN A 1 128 ? 0.054   41.824  73.253  1.00 41.80  ?  125  ASN A O     1 
ATOM   1075  C CB    . ASN A 1 128 ? -0.781  44.669  74.136  1.00 55.76  ?  125  ASN A CB    1 
ATOM   1076  C CG    . ASN A 1 128 ? -1.617  45.900  74.418  1.00 63.61  ?  125  ASN A CG    1 
ATOM   1077  O OD1   . ASN A 1 128 ? -1.293  46.696  75.298  1.00 64.99  ?  125  ASN A OD1   1 
ATOM   1078  N ND2   . ASN A 1 128 ? -2.699  46.065  73.666  1.00 61.67  ?  125  ASN A ND2   1 
ATOM   1079  N N     . ALA A 1 129 ? -1.284  42.554  71.585  1.00 52.26  ?  126  ALA A N     1 
ATOM   1080  C CA    . ALA A 1 129 ? -0.604  41.822  70.520  1.00 49.60  ?  126  ALA A CA    1 
ATOM   1081  C C     . ALA A 1 129 ? 0.264   42.817  69.758  1.00 55.37  ?  126  ALA A C     1 
ATOM   1082  O O     . ALA A 1 129 ? -0.240  43.625  68.973  1.00 53.65  ?  126  ALA A O     1 
ATOM   1083  C CB    . ALA A 1 129 ? -1.607  41.130  69.603  1.00 49.34  ?  126  ALA A CB    1 
ATOM   1084  N N     . HIS A 1 130 ? 1.571   42.759  69.997  1.00 48.88  ?  127  HIS A N     1 
ATOM   1085  C CA    . HIS A 1 130 ? 2.521   43.658  69.356  1.00 39.11  ?  127  HIS A CA    1 
ATOM   1086  C C     . HIS A 1 130 ? 3.102   42.991  68.115  1.00 40.98  ?  127  HIS A C     1 
ATOM   1087  O O     . HIS A 1 130 ? 3.715   41.922  68.209  1.00 38.66  ?  127  HIS A O     1 
ATOM   1088  C CB    . HIS A 1 130 ? 3.644   44.031  70.320  1.00 43.26  ?  127  HIS A CB    1 
ATOM   1089  C CG    . HIS A 1 130 ? 3.187   44.759  71.546  1.00 36.61  ?  127  HIS A CG    1 
ATOM   1090  N ND1   . HIS A 1 130 ? 3.352   46.117  71.710  1.00 37.09  ?  127  HIS A ND1   1 
ATOM   1091  C CD2   . HIS A 1 130 ? 2.589   44.314  72.677  1.00 38.17  ?  127  HIS A CD2   1 
ATOM   1092  C CE1   . HIS A 1 130 ? 2.867   46.480  72.884  1.00 40.97  ?  127  HIS A CE1   1 
ATOM   1093  N NE2   . HIS A 1 130 ? 2.399   45.405  73.491  1.00 40.82  ?  127  HIS A NE2   1 
ATOM   1094  N N     . LEU A 1 131 ? 2.908   43.619  66.957  1.00 42.47  ?  128  LEU A N     1 
ATOM   1095  C CA    . LEU A 1 131 ? 3.612   43.186  65.759  1.00 44.36  ?  128  LEU A CA    1 
ATOM   1096  C C     . LEU A 1 131 ? 5.112   43.273  66.001  1.00 44.04  ?  128  LEU A C     1 
ATOM   1097  O O     . LEU A 1 131 ? 5.619   44.293  66.472  1.00 33.53  ?  128  LEU A O     1 
ATOM   1098  C CB    . LEU A 1 131 ? 3.204   44.046  64.561  1.00 39.96  ?  128  LEU A CB    1 
ATOM   1099  C CG    . LEU A 1 131 ? 3.968   43.900  63.241  1.00 36.03  ?  128  LEU A CG    1 
ATOM   1100  C CD1   . LEU A 1 131 ? 4.015   42.456  62.768  1.00 35.53  ?  128  LEU A CD1   1 
ATOM   1101  C CD2   . LEU A 1 131 ? 3.338   44.785  62.176  1.00 46.15  ?  128  LEU A CD2   1 
ATOM   1102  N N     . THR A 1 132 ? 5.820   42.189  65.703  1.00 46.98  ?  129  THR A N     1 
ATOM   1103  C CA    . THR A 1 132 ? 7.235   42.076  66.017  1.00 35.42  ?  129  THR A CA    1 
ATOM   1104  C C     . THR A 1 132 ? 8.001   41.643  64.776  1.00 33.92  ?  129  THR A C     1 
ATOM   1105  O O     . THR A 1 132 ? 7.484   40.910  63.929  1.00 32.31  ?  129  THR A O     1 
ATOM   1106  C CB    . THR A 1 132 ? 7.462   41.077  67.174  1.00 32.44  ?  129  THR A CB    1 
ATOM   1107  O OG1   . THR A 1 132 ? 6.684   41.479  68.308  1.00 28.94  ?  129  THR A OG1   1 
ATOM   1108  C CG2   . THR A 1 132 ? 8.927   41.017  67.581  1.00 29.88  ?  129  THR A CG2   1 
ATOM   1109  N N     . TYR A 1 133 ? 9.239   42.122  64.669  1.00 29.47  ?  130  TYR A N     1 
ATOM   1110  C CA    . TYR A 1 133 ? 10.146  41.734  63.597  1.00 34.44  ?  130  TYR A CA    1 
ATOM   1111  C C     . TYR A 1 133 ? 11.465  41.279  64.200  1.00 29.91  ?  130  TYR A C     1 
ATOM   1112  O O     . TYR A 1 133 ? 12.087  42.018  64.972  1.00 31.45  ?  130  TYR A O     1 
ATOM   1113  C CB    . TYR A 1 133 ? 10.388  42.892  62.621  1.00 35.97  ?  130  TYR A CB    1 
ATOM   1114  C CG    . TYR A 1 133 ? 9.218   43.195  61.712  1.00 37.95  ?  130  TYR A CG    1 
ATOM   1115  C CD1   . TYR A 1 133 ? 8.951   42.397  60.608  1.00 39.51  ?  130  TYR A CD1   1 
ATOM   1116  C CD2   . TYR A 1 133 ? 8.392   44.288  61.946  1.00 39.21  ?  130  TYR A CD2   1 
ATOM   1117  C CE1   . TYR A 1 133 ? 7.891   42.670  59.767  1.00 35.95  ?  130  TYR A CE1   1 
ATOM   1118  C CE2   . TYR A 1 133 ? 7.328   44.570  61.109  1.00 41.79  ?  130  TYR A CE2   1 
ATOM   1119  C CZ    . TYR A 1 133 ? 7.083   43.758  60.021  1.00 46.32  ?  130  TYR A CZ    1 
ATOM   1120  O OH    . TYR A 1 133 ? 6.025   44.036  59.186  1.00 54.38  ?  130  TYR A OH    1 
ATOM   1121  N N     . LYS A 1 134 ? 11.881  40.063  63.860  1.00 35.83  ?  131  LYS A N     1 
ATOM   1122  C CA    . LYS A 1 134 ? 13.186  39.543  64.240  1.00 29.61  ?  131  LYS A CA    1 
ATOM   1123  C C     . LYS A 1 134 ? 14.135  39.682  63.058  1.00 30.53  ?  131  LYS A C     1 
ATOM   1124  O O     . LYS A 1 134 ? 13.801  39.283  61.936  1.00 37.53  ?  131  LYS A O     1 
ATOM   1125  C CB    . LYS A 1 134 ? 13.097  38.082  64.682  1.00 28.39  ?  131  LYS A CB    1 
ATOM   1126  C CG    . LYS A 1 134 ? 14.454  37.444  64.908  1.00 41.87  ?  131  LYS A CG    1 
ATOM   1127  C CD    . LYS A 1 134 ? 14.368  36.232  65.818  1.00 42.40  ?  131  LYS A CD    1 
ATOM   1128  C CE    . LYS A 1 134 ? 15.734  35.579  65.967  1.00 35.55  ?  131  LYS A CE    1 
ATOM   1129  N NZ    . LYS A 1 134 ? 15.774  34.600  67.083  1.00 42.82  1  131  LYS A NZ    1 
ATOM   1130  N N     . ILE A 1 135 ? 15.316  40.238  63.316  1.00 29.09  ?  132  ILE A N     1 
ATOM   1131  C CA    . ILE A 1 135 ? 16.250  40.645  62.275  1.00 43.06  ?  132  ILE A CA    1 
ATOM   1132  C C     . ILE A 1 135 ? 17.571  39.920  62.491  1.00 39.35  ?  132  ILE A C     1 
ATOM   1133  O O     . ILE A 1 135 ? 18.086  39.884  63.614  1.00 36.70  ?  132  ILE A O     1 
ATOM   1134  C CB    . ILE A 1 135 ? 16.459  42.171  62.281  1.00 37.73  ?  132  ILE A CB    1 
ATOM   1135  C CG1   . ILE A 1 135 ? 15.114  42.900  62.322  1.00 39.30  ?  132  ILE A CG1   1 
ATOM   1136  C CG2   . ILE A 1 135 ? 17.233  42.598  61.067  1.00 39.74  ?  132  ILE A CG2   1 
ATOM   1137  C CD1   . ILE A 1 135 ? 14.318  42.794  61.046  1.00 37.97  ?  132  ILE A CD1   1 
ATOM   1138  N N     . LYS A 1 136 ? 18.120  39.352  61.418  1.00 40.23  ?  133  LYS A N     1 
ATOM   1139  C CA    . LYS A 1 136 ? 19.412  38.682  61.462  1.00 32.74  ?  133  LYS A CA    1 
ATOM   1140  C C     . LYS A 1 136 ? 20.209  39.034  60.213  1.00 34.65  ?  133  LYS A C     1 
ATOM   1141  O O     . LYS A 1 136 ? 19.643  39.362  59.168  1.00 36.58  ?  133  LYS A O     1 
ATOM   1142  C CB    . LYS A 1 136 ? 19.255  37.160  61.578  1.00 29.39  ?  133  LYS A CB    1 
ATOM   1143  C CG    . LYS A 1 136 ? 18.767  36.695  62.940  1.00 49.20  ?  133  LYS A CG    1 
ATOM   1144  C CD    . LYS A 1 136 ? 19.736  37.115  64.028  1.00 58.37  ?  133  LYS A CD    1 
ATOM   1145  C CE    . LYS A 1 136 ? 19.409  36.450  65.351  1.00 60.36  ?  133  LYS A CE    1 
ATOM   1146  N NZ    . LYS A 1 136 ? 20.578  36.487  66.273  1.00 62.44  1  133  LYS A NZ    1 
ATOM   1147  N N     . ILE A 1 137 ? 21.532  38.958  60.334  1.00 32.08  ?  134  ILE A N     1 
ATOM   1148  C CA    . ILE A 1 137 ? 22.459  39.336  59.272  1.00 28.86  ?  134  ILE A CA    1 
ATOM   1149  C C     . ILE A 1 137 ? 23.084  38.071  58.702  1.00 31.59  ?  134  ILE A C     1 
ATOM   1150  O O     . ILE A 1 137 ? 23.551  37.208  59.455  1.00 32.89  ?  134  ILE A O     1 
ATOM   1151  C CB    . ILE A 1 137 ? 23.541  40.300  59.790  1.00 30.65  ?  134  ILE A CB    1 
ATOM   1152  C CG1   . ILE A 1 137 ? 22.911  41.624  60.227  1.00 27.50  ?  134  ILE A CG1   1 
ATOM   1153  C CG2   . ILE A 1 137 ? 24.609  40.533  58.732  1.00 29.66  ?  134  ILE A CG2   1 
ATOM   1154  C CD1   . ILE A 1 137 ? 23.902  42.599  60.824  1.00 28.41  ?  134  ILE A CD1   1 
ATOM   1155  N N     . HIS A 1 138 ? 23.105  37.969  57.375  1.00 31.10  ?  135  HIS A N     1 
ATOM   1156  C CA    . HIS A 1 138 ? 23.589  36.781  56.691  1.00 33.54  ?  135  HIS A CA    1 
ATOM   1157  C C     . HIS A 1 138 ? 24.607  37.171  55.632  1.00 40.68  ?  135  HIS A C     1 
ATOM   1158  O O     . HIS A 1 138 ? 24.431  38.166  54.923  1.00 41.85  ?  135  HIS A O     1 
ATOM   1159  C CB    . HIS A 1 138 ? 22.430  36.012  56.055  1.00 28.93  ?  135  HIS A CB    1 
ATOM   1160  C CG    . HIS A 1 138 ? 21.287  35.779  56.990  1.00 42.92  ?  135  HIS A CG    1 
ATOM   1161  N ND1   . HIS A 1 138 ? 21.240  34.708  57.856  1.00 33.70  ?  135  HIS A ND1   1 
ATOM   1162  C CD2   . HIS A 1 138 ? 20.156  36.491  57.210  1.00 39.00  ?  135  HIS A CD2   1 
ATOM   1163  C CE1   . HIS A 1 138 ? 20.125  34.765  58.562  1.00 35.86  ?  135  HIS A CE1   1 
ATOM   1164  N NE2   . HIS A 1 138 ? 19.451  35.838  58.191  1.00 36.09  ?  135  HIS A NE2   1 
ATOM   1165  N N     . ASN A 1 139 ? 25.673  36.385  55.536  1.00 43.27  ?  136  ASN A N     1 
ATOM   1166  C CA    . ASN A 1 139 ? 26.733  36.587  54.552  1.00 41.73  ?  136  ASN A CA    1 
ATOM   1167  C C     . ASN A 1 139 ? 26.611  35.474  53.513  1.00 45.34  ?  136  ASN A C     1 
ATOM   1168  O O     . ASN A 1 139 ? 27.114  34.365  53.713  1.00 44.14  ?  136  ASN A O     1 
ATOM   1169  C CB    . ASN A 1 139 ? 28.102  36.594  55.227  1.00 36.22  ?  136  ASN A CB    1 
ATOM   1170  C CG    . ASN A 1 139 ? 29.188  37.180  54.345  1.00 50.61  ?  136  ASN A CG    1 
ATOM   1171  O OD1   . ASN A 1 139 ? 30.367  36.862  54.499  1.00 55.09  ?  136  ASN A OD1   1 
ATOM   1172  N ND2   . ASN A 1 139 ? 28.795  38.041  53.414  1.00 47.57  ?  136  ASN A ND2   1 
ATOM   1173  N N     . ILE A 1 140 ? 25.925  35.770  52.410  1.00 40.34  ?  137  ILE A N     1 
ATOM   1174  C CA    . ILE A 1 140 ? 25.661  34.803  51.351  1.00 40.27  ?  137  ILE A CA    1 
ATOM   1175  C C     . ILE A 1 140 ? 26.344  35.280  50.077  1.00 47.12  ?  137  ILE A C     1 
ATOM   1176  O O     . ILE A 1 140 ? 26.123  36.415  49.638  1.00 51.48  ?  137  ILE A O     1 
ATOM   1177  C CB    . ILE A 1 140 ? 24.152  34.622  51.105  1.00 36.72  ?  137  ILE A CB    1 
ATOM   1178  C CG1   . ILE A 1 140 ? 23.397  34.419  52.420  1.00 35.61  ?  137  ILE A CG1   1 
ATOM   1179  C CG2   . ILE A 1 140 ? 23.902  33.452  50.158  1.00 36.13  ?  137  ILE A CG2   1 
ATOM   1180  C CD1   . ILE A 1 140 ? 21.892  34.326  52.237  1.00 41.49  ?  137  ILE A CD1   1 
ATOM   1181  N N     . SER A 1 141 ? 27.159  34.407  49.479  1.00 49.52  ?  138  SER A N     1 
ATOM   1182  C CA    . SER A 1 141 ? 27.779  34.666  48.176  1.00 48.76  ?  138  SER A CA    1 
ATOM   1183  C C     . SER A 1 141 ? 28.540  35.990  48.156  1.00 54.64  ?  138  SER A C     1 
ATOM   1184  O O     . SER A 1 141 ? 28.394  36.793  47.232  1.00 63.85  ?  138  SER A O     1 
ATOM   1185  C CB    . SER A 1 141 ? 26.738  34.631  47.053  1.00 42.66  ?  138  SER A CB    1 
ATOM   1186  O OG    . SER A 1 141 ? 26.504  33.309  46.603  1.00 56.90  ?  138  SER A OG    1 
ATOM   1187  N N     . ASN A 1 142 ? 29.351  36.225  49.187  1.00 54.23  ?  139  ASN A N     1 
ATOM   1188  C CA    . ASN A 1 142 ? 30.194  37.409  49.352  1.00 56.18  ?  139  ASN A CA    1 
ATOM   1189  C C     . ASN A 1 142 ? 29.401  38.695  49.548  1.00 52.54  ?  139  ASN A C     1 
ATOM   1190  O O     . ASN A 1 142 ? 30.006  39.773  49.595  1.00 52.87  ?  139  ASN A O     1 
ATOM   1191  C CB    . ASN A 1 142 ? 31.160  37.611  48.175  1.00 56.59  ?  139  ASN A CB    1 
ATOM   1192  C CG    . ASN A 1 142 ? 32.570  37.166  48.492  1.00 67.52  ?  139  ASN A CG    1 
ATOM   1193  O OD1   . ASN A 1 142 ? 32.854  36.700  49.596  1.00 75.07  ?  139  ASN A OD1   1 
ATOM   1194  N ND2   . ASN A 1 142 ? 33.464  37.303  47.520  1.00 65.82  ?  139  ASN A ND2   1 
ATOM   1195  N N     . GLU A 1 143 ? 28.079  38.628  49.658  1.00 41.29  ?  140  GLU A N     1 
ATOM   1196  C CA    . GLU A 1 143 ? 27.251  39.799  49.899  1.00 41.30  ?  140  GLU A CA    1 
ATOM   1197  C C     . GLU A 1 143 ? 26.534  39.645  51.232  1.00 41.18  ?  140  GLU A C     1 
ATOM   1198  O O     . GLU A 1 143 ? 26.359  38.536  51.744  1.00 39.42  ?  140  GLU A O     1 
ATOM   1199  C CB    . GLU A 1 143 ? 26.237  40.003  48.765  1.00 41.61  ?  140  GLU A CB    1 
ATOM   1200  C CG    . GLU A 1 143 ? 26.874  40.226  47.401  1.00 46.22  ?  140  GLU A CG    1 
ATOM   1201  C CD    . GLU A 1 143 ? 27.411  41.637  47.227  1.00 70.78  ?  140  GLU A CD    1 
ATOM   1202  O OE1   . GLU A 1 143 ? 26.751  42.589  47.695  1.00 68.34  ?  140  GLU A OE1   1 
ATOM   1203  O OE2   . GLU A 1 143 ? 28.493  41.794  46.623  1.00 80.58  -1 140  GLU A OE2   1 
ATOM   1204  N N     . TYR A 1 144 ? 26.125  40.776  51.798  1.00 42.04  ?  141  TYR A N     1 
ATOM   1205  C CA    . TYR A 1 144 ? 25.475  40.805  53.101  1.00 38.85  ?  141  TYR A CA    1 
ATOM   1206  C C     . TYR A 1 144 ? 23.975  40.995  52.933  1.00 38.00  ?  141  TYR A C     1 
ATOM   1207  O O     . TYR A 1 144 ? 23.531  41.844  52.152  1.00 43.92  ?  141  TYR A O     1 
ATOM   1208  C CB    . TYR A 1 144 ? 26.054  41.915  53.976  1.00 36.09  ?  141  TYR A CB    1 
ATOM   1209  C CG    . TYR A 1 144 ? 27.364  41.533  54.617  1.00 34.05  ?  141  TYR A CG    1 
ATOM   1210  C CD1   . TYR A 1 144 ? 27.391  40.877  55.840  1.00 33.90  ?  141  TYR A CD1   1 
ATOM   1211  C CD2   . TYR A 1 144 ? 28.573  41.814  53.996  1.00 36.11  ?  141  TYR A CD2   1 
ATOM   1212  C CE1   . TYR A 1 144 ? 28.585  40.516  56.432  1.00 36.74  ?  141  TYR A CE1   1 
ATOM   1213  C CE2   . TYR A 1 144 ? 29.775  41.458  54.581  1.00 36.34  ?  141  TYR A CE2   1 
ATOM   1214  C CZ    . TYR A 1 144 ? 29.773  40.810  55.799  1.00 34.94  ?  141  TYR A CZ    1 
ATOM   1215  O OH    . TYR A 1 144 ? 30.963  40.451  56.389  1.00 38.01  ?  141  TYR A OH    1 
ATOM   1216  N N     . TYR A 1 145 ? 23.201  40.203  53.670  1.00 29.15  ?  142  TYR A N     1 
ATOM   1217  C CA    . TYR A 1 145 ? 21.750  40.233  53.595  1.00 35.71  ?  142  TYR A CA    1 
ATOM   1218  C C     . TYR A 1 145 ? 21.166  40.389  54.991  1.00 38.41  ?  142  TYR A C     1 
ATOM   1219  O O     . TYR A 1 145 ? 21.849  40.236  56.008  1.00 42.04  ?  142  TYR A O     1 
ATOM   1220  C CB    . TYR A 1 145 ? 21.196  38.969  52.925  1.00 35.09  ?  142  TYR A CB    1 
ATOM   1221  C CG    . TYR A 1 145 ? 21.590  38.832  51.473  1.00 33.75  ?  142  TYR A CG    1 
ATOM   1222  C CD1   . TYR A 1 145 ? 22.794  38.241  51.112  1.00 34.17  ?  142  TYR A CD1   1 
ATOM   1223  C CD2   . TYR A 1 145 ? 20.758  39.296  50.462  1.00 42.47  ?  142  TYR A CD2   1 
ATOM   1224  C CE1   . TYR A 1 145 ? 23.158  38.116  49.784  1.00 42.21  ?  142  TYR A CE1   1 
ATOM   1225  C CE2   . TYR A 1 145 ? 21.113  39.174  49.131  1.00 38.79  ?  142  TYR A CE2   1 
ATOM   1226  C CZ    . TYR A 1 145 ? 22.314  38.584  48.798  1.00 48.20  ?  142  TYR A CZ    1 
ATOM   1227  O OH    . TYR A 1 145 ? 22.672  38.460  47.475  1.00 51.46  ?  142  TYR A OH    1 
ATOM   1228  N N     . LEU A 1 146 ? 19.871  40.686  55.020  1.00 43.00  ?  143  LEU A N     1 
ATOM   1229  C CA    . LEU A 1 146 ? 19.137  40.953  56.250  1.00 40.39  ?  143  LEU A CA    1 
ATOM   1230  C C     . LEU A 1 146 ? 17.826  40.186  56.187  1.00 41.79  ?  143  LEU A C     1 
ATOM   1231  O O     . LEU A 1 146 ? 16.962  40.507  55.364  1.00 54.93  ?  143  LEU A O     1 
ATOM   1232  C CB    . LEU A 1 146 ? 18.882  42.450  56.407  1.00 48.33  ?  143  LEU A CB    1 
ATOM   1233  C CG    . LEU A 1 146 ? 18.571  42.949  57.811  1.00 56.10  ?  143  LEU A CG    1 
ATOM   1234  C CD1   . LEU A 1 146 ? 19.828  42.863  58.655  1.00 65.66  ?  143  LEU A CD1   1 
ATOM   1235  C CD2   . LEU A 1 146 ? 18.018  44.368  57.784  1.00 48.33  ?  143  LEU A CD2   1 
ATOM   1236  N N     . SER A 1 147 ? 17.672  39.177  57.041  1.00 31.91  ?  144  SER A N     1 
ATOM   1237  C CA    . SER A 1 147 ? 16.412  38.456  57.126  1.00 31.15  ?  144  SER A CA    1 
ATOM   1238  C C     . SER A 1 147 ? 15.481  39.197  58.076  1.00 31.06  ?  144  SER A C     1 
ATOM   1239  O O     . SER A 1 147 ? 15.896  39.624  59.158  1.00 31.81  ?  144  SER A O     1 
ATOM   1240  C CB    . SER A 1 147 ? 16.615  37.009  57.582  1.00 36.98  ?  144  SER A CB    1 
ATOM   1241  O OG    . SER A 1 147 ? 17.358  36.928  58.787  1.00 30.69  ?  144  SER A OG    1 
ATOM   1242  N N     . ILE A 1 148 ? 14.234  39.371  57.650  1.00 29.73  ?  145  ILE A N     1 
ATOM   1243  C CA    . ILE A 1 148 ? 13.223  40.098  58.406  1.00 34.49  ?  145  ILE A CA    1 
ATOM   1244  C C     . ILE A 1 148 ? 12.059  39.139  58.599  1.00 36.47  ?  145  ILE A C     1 
ATOM   1245  O O     . ILE A 1 148 ? 11.290  38.887  57.662  1.00 38.16  ?  145  ILE A O     1 
ATOM   1246  C CB    . ILE A 1 148 ? 12.772  41.378  57.695  1.00 36.11  ?  145  ILE A CB    1 
ATOM   1247  C CG1   . ILE A 1 148 ? 13.966  42.298  57.422  1.00 34.71  ?  145  ILE A CG1   1 
ATOM   1248  C CG2   . ILE A 1 148 ? 11.733  42.108  58.527  1.00 35.36  ?  145  ILE A CG2   1 
ATOM   1249  C CD1   . ILE A 1 148 ? 13.588  43.584  56.696  1.00 31.46  ?  145  ILE A CD1   1 
ATOM   1250  N N     . LEU A 1 149 ? 11.925  38.596  59.808  1.00 38.12  ?  146  LEU A N     1 
ATOM   1251  C CA    . LEU A 1 149 ? 10.883  37.624  60.091  1.00 39.51  ?  146  LEU A CA    1 
ATOM   1252  C C     . LEU A 1 149 ? 9.754   38.296  60.854  1.00 43.62  ?  146  LEU A C     1 
ATOM   1253  O O     . LEU A 1 149 ? 9.920   38.599  62.047  1.00 40.27  ?  146  LEU A O     1 
ATOM   1254  C CB    . LEU A 1 149 ? 11.441  36.457  60.899  1.00 39.33  ?  146  LEU A CB    1 
ATOM   1255  C CG    . LEU A 1 149 ? 10.407  35.383  61.242  1.00 36.05  ?  146  LEU A CG    1 
ATOM   1256  C CD1   . LEU A 1 149 ? 10.046  34.590  59.997  1.00 32.23  ?  146  LEU A CD1   1 
ATOM   1257  C CD2   . LEU A 1 149 ? 10.912  34.470  62.347  1.00 44.04  ?  146  LEU A CD2   1 
ATOM   1258  N N     . PRO A 1 150 ? 8.611   38.560  60.228  1.00 42.45  ?  147  PRO A N     1 
ATOM   1259  C CA    . PRO A 1 150 ? 7.458   39.042  60.990  1.00 42.60  ?  147  PRO A CA    1 
ATOM   1260  C C     . PRO A 1 150 ? 6.979   37.979  61.967  1.00 44.06  ?  147  PRO A C     1 
ATOM   1261  O O     . PRO A 1 150 ? 6.937   36.787  61.651  1.00 42.43  ?  147  PRO A O     1 
ATOM   1262  C CB    . PRO A 1 150 ? 6.413   39.335  59.908  1.00 43.27  ?  147  PRO A CB    1 
ATOM   1263  C CG    . PRO A 1 150 ? 6.838   38.521  58.731  1.00 47.52  ?  147  PRO A CG    1 
ATOM   1264  C CD    . PRO A 1 150 ? 8.332   38.489  58.785  1.00 41.77  ?  147  PRO A CD    1 
ATOM   1265  N N     . LYS A 1 151 ? 6.637   38.421  63.171  1.00 50.41  ?  148  LYS A N     1 
ATOM   1266  C CA    . LYS A 1 151 ? 6.087   37.543  64.197  1.00 47.53  ?  148  LYS A CA    1 
ATOM   1267  C C     . LYS A 1 151 ? 5.252   38.400  65.142  1.00 45.00  ?  148  LYS A C     1 
ATOM   1268  O O     . LYS A 1 151 ? 4.927   39.553  64.836  1.00 49.60  ?  148  LYS A O     1 
ATOM   1269  C CB    . LYS A 1 151 ? 7.197   36.778  64.929  1.00 41.09  ?  148  LYS A CB    1 
ATOM   1270  C CG    . LYS A 1 151 ? 8.027   37.627  65.881  1.00 40.92  ?  148  LYS A CG    1 
ATOM   1271  C CD    . LYS A 1 151 ? 8.789   36.769  66.880  1.00 46.46  ?  148  LYS A CD    1 
ATOM   1272  C CE    . LYS A 1 151 ? 10.036  36.161  66.264  1.00 45.48  ?  148  LYS A CE    1 
ATOM   1273  N NZ    . LYS A 1 151 ? 10.952  35.632  67.313  1.00 39.98  1  148  LYS A NZ    1 
ATOM   1274  N N     . PHE A 1 152 ? 4.907   37.841  66.299  1.00 35.50  ?  149  PHE A N     1 
ATOM   1275  C CA    . PHE A 1 152 ? 4.066   38.543  67.253  1.00 31.97  ?  149  PHE A CA    1 
ATOM   1276  C C     . PHE A 1 152 ? 4.580   38.334  68.668  1.00 36.30  ?  149  PHE A C     1 
ATOM   1277  O O     . PHE A 1 152 ? 5.107   37.272  69.010  1.00 46.57  ?  149  PHE A O     1 
ATOM   1278  C CB    . PHE A 1 152 ? 2.607   38.092  67.152  1.00 39.47  ?  149  PHE A CB    1 
ATOM   1279  C CG    . PHE A 1 152 ? 1.833   38.819  66.100  1.00 41.76  ?  149  PHE A CG    1 
ATOM   1280  C CD1   . PHE A 1 152 ? 1.214   40.021  66.391  1.00 46.16  ?  149  PHE A CD1   1 
ATOM   1281  C CD2   . PHE A 1 152 ? 1.742   38.317  64.813  1.00 41.41  ?  149  PHE A CD2   1 
ATOM   1282  C CE1   . PHE A 1 152 ? 0.506   40.706  65.423  1.00 45.55  ?  149  PHE A CE1   1 
ATOM   1283  C CE2   . PHE A 1 152 ? 1.038   39.000  63.838  1.00 44.07  ?  149  PHE A CE2   1 
ATOM   1284  C CZ    . PHE A 1 152 ? 0.417   40.195  64.146  1.00 36.60  ?  149  PHE A CZ    1 
ATOM   1285  N N     . THR A 1 153 ? 4.420   39.373  69.482  1.00 42.25  ?  150  THR A N     1 
ATOM   1286  C CA    . THR A 1 153 ? 4.722   39.334  70.903  1.00 42.44  ?  150  THR A CA    1 
ATOM   1287  C C     . THR A 1 153 ? 3.472   39.749  71.659  1.00 51.60  ?  150  THR A C     1 
ATOM   1288  O O     . THR A 1 153 ? 2.890   40.801  71.371  1.00 53.54  ?  150  THR A O     1 
ATOM   1289  C CB    . THR A 1 153 ? 5.886   40.261  71.258  1.00 41.27  ?  150  THR A CB    1 
ATOM   1290  O OG1   . THR A 1 153 ? 6.942   40.093  70.305  1.00 36.20  ?  150  THR A OG1   1 
ATOM   1291  C CG2   . THR A 1 153 ? 6.416   39.941  72.646  1.00 40.98  ?  150  THR A CG2   1 
ATOM   1292  N N     . PHE A 1 154 ? 3.054   38.921  72.607  1.00 45.38  ?  151  PHE A N     1 
ATOM   1293  C CA    . PHE A 1 154 ? 1.857   39.172  73.396  1.00 47.48  ?  151  PHE A CA    1 
ATOM   1294  C C     . PHE A 1 154 ? 2.282   39.595  74.794  1.00 38.70  ?  151  PHE A C     1 
ATOM   1295  O O     . PHE A 1 154 ? 2.894   38.810  75.528  1.00 44.82  ?  151  PHE A O     1 
ATOM   1296  C CB    . PHE A 1 154 ? 0.962   37.934  73.422  1.00 45.67  ?  151  PHE A CB    1 
ATOM   1297  C CG    . PHE A 1 154 ? 0.594   37.441  72.051  1.00 40.70  ?  151  PHE A CG    1 
ATOM   1298  C CD1   . PHE A 1 154 ? -0.467  38.004  71.361  1.00 34.25  ?  151  PHE A CD1   1 
ATOM   1299  C CD2   . PHE A 1 154 ? 1.327   36.439  71.439  1.00 39.24  ?  151  PHE A CD2   1 
ATOM   1300  C CE1   . PHE A 1 154 ? -0.799  37.563  70.094  1.00 35.10  ?  151  PHE A CE1   1 
ATOM   1301  C CE2   . PHE A 1 154 ? 1.000   35.996  70.172  1.00 39.27  ?  151  PHE A CE2   1 
ATOM   1302  C CZ    . PHE A 1 154 ? -0.063  36.559  69.498  1.00 37.46  ?  151  PHE A CZ    1 
ATOM   1303  N N     . LEU A 1 155 ? 1.975   40.840  75.147  1.00 38.18  ?  152  LEU A N     1 
ATOM   1304  C CA    . LEU A 1 155 ? 2.406   41.435  76.400  1.00 44.12  ?  152  LEU A CA    1 
ATOM   1305  C C     . LEU A 1 155 ? 1.206   42.005  77.139  1.00 45.78  ?  152  LEU A C     1 
ATOM   1306  O O     . LEU A 1 155 ? 0.191   42.359  76.531  1.00 40.74  ?  152  LEU A O     1 
ATOM   1307  C CB    . LEU A 1 155 ? 3.437   42.550  76.169  1.00 43.25  ?  152  LEU A CB    1 
ATOM   1308  C CG    . LEU A 1 155 ? 4.720   42.202  75.413  1.00 39.96  ?  152  LEU A CG    1 
ATOM   1309  C CD1   . LEU A 1 155 ? 5.463   43.473  75.037  1.00 35.80  ?  152  LEU A CD1   1 
ATOM   1310  C CD2   . LEU A 1 155 ? 5.608   41.291  76.244  1.00 34.27  ?  152  LEU A CD2   1 
ATOM   1311  N N     . SER A 1 156 ? 1.333   42.093  78.460  1.00 41.76  ?  153  SER A N     1 
ATOM   1312  C CA    . SER A 1 156 ? 0.302   42.737  79.258  1.00 41.99  ?  153  SER A CA    1 
ATOM   1313  C C     . SER A 1 156 ? 0.219   44.215  78.903  1.00 46.25  ?  153  SER A C     1 
ATOM   1314  O O     . SER A 1 156 ? 1.238   44.882  78.702  1.00 47.34  ?  153  SER A O     1 
ATOM   1315  C CB    . SER A 1 156 ? 0.594   42.568  80.750  1.00 42.11  ?  153  SER A CB    1 
ATOM   1316  O OG    . SER A 1 156 ? 1.774   43.258  81.120  1.00 42.73  ?  153  SER A OG    1 
ATOM   1317  N N     . LYS A 1 157 ? -1.012  44.722  78.815  1.00 61.36  ?  154  LYS A N     1 
ATOM   1318  C CA    . LYS A 1 157 ? -1.216  46.127  78.479  1.00 56.70  ?  154  LYS A CA    1 
ATOM   1319  C C     . LYS A 1 157 ? -0.692  47.048  79.574  1.00 56.12  ?  154  LYS A C     1 
ATOM   1320  O O     . LYS A 1 157 ? -0.253  48.167  79.284  1.00 56.19  ?  154  LYS A O     1 
ATOM   1321  C CB    . LYS A 1 157 ? -2.702  46.380  78.224  1.00 58.45  ?  154  LYS A CB    1 
ATOM   1322  C CG    . LYS A 1 157 ? -3.058  47.806  77.846  1.00 59.50  ?  154  LYS A CG    1 
ATOM   1323  C CD    . LYS A 1 157 ? -4.553  47.928  77.607  1.00 59.62  ?  154  LYS A CD    1 
ATOM   1324  C CE    . LYS A 1 157 ? -4.951  49.354  77.272  1.00 60.21  ?  154  LYS A CE    1 
ATOM   1325  N NZ    . LYS A 1 157 ? -6.410  49.450  76.991  1.00 64.65  1  154  LYS A NZ    1 
ATOM   1326  N N     . GLU A 1 158 ? -0.720  46.596  80.821  1.00 54.43  ?  155  GLU A N     1 
ATOM   1327  C CA    . GLU A 1 158 ? -0.294  47.370  81.971  1.00 54.14  ?  155  GLU A CA    1 
ATOM   1328  C C     . GLU A 1 158 ? 0.945   46.739  82.593  1.00 59.13  ?  155  GLU A C     1 
ATOM   1329  O O     . GLU A 1 158 ? 1.194   45.540  82.421  1.00 55.05  ?  155  GLU A O     1 
ATOM   1330  C CB    . GLU A 1 158 ? -1.418  47.445  83.014  1.00 56.58  ?  155  GLU A CB    1 
ATOM   1331  C CG    . GLU A 1 158 ? -2.780  47.812  82.437  1.00 66.36  ?  155  GLU A CG    1 
ATOM   1332  C CD    . GLU A 1 158 ? -2.933  49.302  82.182  1.00 74.34  ?  155  GLU A CD    1 
ATOM   1333  O OE1   . GLU A 1 158 ? -2.956  50.074  83.165  1.00 75.10  ?  155  GLU A OE1   1 
ATOM   1334  O OE2   . GLU A 1 158 ? -3.032  49.702  81.002  1.00 77.55  -1 155  GLU A OE2   1 
ATOM   1335  N N     . PRO A 1 159 ? 1.756   47.522  83.306  1.00 60.40  ?  156  PRO A N     1 
ATOM   1336  C CA    . PRO A 1 159 ? 2.896   46.945  84.026  1.00 55.72  ?  156  PRO A CA    1 
ATOM   1337  C C     . PRO A 1 159 ? 2.452   45.859  84.998  1.00 53.34  ?  156  PRO A C     1 
ATOM   1338  O O     . PRO A 1 159 ? 1.291   45.789  85.409  1.00 56.20  ?  156  PRO A O     1 
ATOM   1339  C CB    . PRO A 1 159 ? 3.492   48.146  84.765  1.00 53.56  ?  156  PRO A CB    1 
ATOM   1340  C CG    . PRO A 1 159 ? 3.150   49.303  83.893  1.00 51.74  ?  156  PRO A CG    1 
ATOM   1341  C CD    . PRO A 1 159 ? 1.780   48.994  83.337  1.00 57.82  ?  156  PRO A CD    1 
ATOM   1342  N N     . ALA A 1 160 ? 3.418   45.012  85.371  1.00 52.01  ?  157  ALA A N     1 
ATOM   1343  C CA    . ALA A 1 160 ? 3.130   43.784  86.109  1.00 59.78  ?  157  ALA A CA    1 
ATOM   1344  C C     . ALA A 1 160 ? 2.294   44.044  87.357  1.00 62.68  ?  157  ALA A C     1 
ATOM   1345  O O     . ALA A 1 160 ? 1.309   43.343  87.616  1.00 63.99  ?  157  ALA A O     1 
ATOM   1346  C CB    . ALA A 1 160 ? 4.441   43.087  86.479  1.00 60.58  ?  157  ALA A CB    1 
ATOM   1347  N N     . LEU A 1 161 ? 2.669   45.054  88.144  1.00 60.01  ?  158  LEU A N     1 
ATOM   1348  C CA    . LEU A 1 161 ? 1.946   45.320  89.383  1.00 60.06  ?  158  LEU A CA    1 
ATOM   1349  C C     . LEU A 1 161 ? 0.551   45.875  89.123  1.00 60.90  ?  158  LEU A C     1 
ATOM   1350  O O     . LEU A 1 161 ? -0.339  45.721  89.967  1.00 58.03  ?  158  LEU A O     1 
ATOM   1351  C CB    . LEU A 1 161 ? 2.746   46.279  90.262  1.00 52.56  ?  158  LEU A CB    1 
ATOM   1352  C CG    . LEU A 1 161 ? 3.958   45.663  90.961  1.00 52.55  ?  158  LEU A CG    1 
ATOM   1353  C CD1   . LEU A 1 161 ? 4.654   46.690  91.837  1.00 55.02  ?  158  LEU A CD1   1 
ATOM   1354  C CD2   . LEU A 1 161 ? 3.532   44.455  91.781  1.00 52.68  ?  158  LEU A CD2   1 
ATOM   1355  N N     . GLU A 1 162 ? 0.334   46.512  87.970  1.00 62.83  ?  159  GLU A N     1 
ATOM   1356  C CA    . GLU A 1 162 ? -0.956  47.103  87.638  1.00 60.58  ?  159  GLU A CA    1 
ATOM   1357  C C     . GLU A 1 162 ? -1.720  46.290  86.598  1.00 61.84  ?  159  GLU A C     1 
ATOM   1358  O O     . GLU A 1 162 ? -2.633  46.819  85.954  1.00 72.31  ?  159  GLU A O     1 
ATOM   1359  C CB    . GLU A 1 162 ? -0.775  48.535  87.136  1.00 62.80  ?  159  GLU A CB    1 
ATOM   1360  C CG    . GLU A 1 162 ? 0.240   49.360  87.900  1.00 66.30  ?  159  GLU A CG    1 
ATOM   1361  C CD    . GLU A 1 162 ? 0.413   50.743  87.303  1.00 76.16  ?  159  GLU A CD    1 
ATOM   1362  O OE1   . GLU A 1 162 ? -0.047  50.956  86.160  1.00 72.56  ?  159  GLU A OE1   1 
ATOM   1363  O OE2   . GLU A 1 162 ? 1.001   51.617  87.975  1.00 84.84  -1 159  GLU A OE2   1 
ATOM   1364  N N     . SER A 1 163 ? -1.368  45.021  86.412  1.00 52.39  ?  160  SER A N     1 
ATOM   1365  C CA    . SER A 1 163 ? -1.968  44.179  85.384  1.00 53.68  ?  160  SER A CA    1 
ATOM   1366  C C     . SER A 1 163 ? -2.893  43.162  86.038  1.00 62.22  ?  160  SER A C     1 
ATOM   1367  O O     . SER A 1 163 ? -2.460  42.387  86.899  1.00 53.32  ?  160  SER A O     1 
ATOM   1368  C CB    . SER A 1 163 ? -0.891  43.475  84.559  1.00 52.09  ?  160  SER A CB    1 
ATOM   1369  O OG    . SER A 1 163 ? -1.471  42.675  83.542  1.00 52.32  ?  160  SER A OG    1 
ATOM   1370  N N     . ALA A 1 164 ? -4.162  43.164  85.620  1.00 68.20  ?  161  ALA A N     1 
ATOM   1371  C CA    . ALA A 1 164 ? -5.128  42.218  86.169  1.00 66.91  ?  161  ALA A CA    1 
ATOM   1372  C C     . ALA A 1 164 ? -4.708  40.779  85.896  1.00 68.41  ?  161  ALA A C     1 
ATOM   1373  O O     . ALA A 1 164 ? -4.788  39.921  86.783  1.00 73.90  ?  161  ALA A O     1 
ATOM   1374  C CB    . ALA A 1 164 ? -6.516  42.491  85.591  1.00 62.56  ?  161  ALA A CB    1 
ATOM   1375  N N     . ILE A 1 165 ? -4.258  40.498  84.679  1.00 62.36  ?  162  ILE A N     1 
ATOM   1376  C CA    . ILE A 1 165 ? -3.796  39.169  84.298  1.00 60.74  ?  162  ILE A CA    1 
ATOM   1377  C C     . ILE A 1 165 ? -2.303  39.074  84.580  1.00 64.34  ?  162  ILE A C     1 
ATOM   1378  O O     . ILE A 1 165 ? -1.582  40.078  84.587  1.00 68.90  ?  162  ILE A O     1 
ATOM   1379  C CB    . ILE A 1 165 ? -4.120  38.879  82.816  1.00 60.24  ?  162  ILE A CB    1 
ATOM   1380  C CG1   . ILE A 1 165 ? -3.837  37.414  82.468  1.00 57.08  ?  162  ILE A CG1   1 
ATOM   1381  C CG2   . ILE A 1 165 ? -3.345  39.820  81.902  1.00 58.88  ?  162  ILE A CG2   1 
ATOM   1382  C CD1   . ILE A 1 165 ? -3.989  37.089  80.996  1.00 52.39  ?  162  ILE A CD1   1 
ATOM   1383  N N     . LYS A 1 166 ? -1.832  37.855  84.828  1.00 58.16  ?  163  LYS A N     1 
ATOM   1384  C CA    . LYS A 1 166 ? -0.436  37.600  85.140  1.00 62.80  ?  163  LYS A CA    1 
ATOM   1385  C C     . LYS A 1 166 ? 0.052   36.381  84.369  1.00 75.07  ?  163  LYS A C     1 
ATOM   1386  O O     . LYS A 1 166 ? -0.733  35.619  83.796  1.00 76.25  ?  163  LYS A O     1 
ATOM   1387  C CB    . LYS A 1 166 ? -0.233  37.408  86.649  1.00 57.60  ?  163  LYS A CB    1 
ATOM   1388  C CG    . LYS A 1 166 ? -0.262  38.715  87.421  1.00 59.66  ?  163  LYS A CG    1 
ATOM   1389  C CD    . LYS A 1 166 ? -0.873  38.575  88.799  1.00 52.60  ?  163  LYS A CD    1 
ATOM   1390  C CE    . LYS A 1 166 ? -0.815  39.907  89.526  1.00 55.88  ?  163  LYS A CE    1 
ATOM   1391  N NZ    . LYS A 1 166 ? -1.126  41.037  88.605  1.00 52.61  1  163  LYS A NZ    1 
ATOM   1392  N N     . SER A 1 167 ? 1.371   36.212  84.353  1.00 75.34  ?  164  SER A N     1 
ATOM   1393  C CA    . SER A 1 167 ? 2.015   35.091  83.681  1.00 64.69  ?  164  SER A CA    1 
ATOM   1394  C C     . SER A 1 167 ? 3.251   34.705  84.487  1.00 55.47  ?  164  SER A C     1 
ATOM   1395  O O     . SER A 1 167 ? 3.498   35.241  85.571  1.00 51.80  ?  164  SER A O     1 
ATOM   1396  C CB    . SER A 1 167 ? 2.360   35.447  82.228  1.00 60.16  ?  164  SER A CB    1 
ATOM   1397  O OG    . SER A 1 167 ? 3.644   36.040  82.135  1.00 57.09  ?  164  SER A OG    1 
ATOM   1398  N N     . GLY A 1 168 ? 4.033   33.775  83.950  1.00 51.54  ?  165  GLY A N     1 
ATOM   1399  C CA    . GLY A 1 168 ? 5.225   33.300  84.615  1.00 51.54  ?  165  GLY A CA    1 
ATOM   1400  C C     . GLY A 1 168 ? 6.516   33.981  84.227  1.00 54.84  ?  165  GLY A C     1 
ATOM   1401  O O     . GLY A 1 168 ? 7.565   33.661  84.796  1.00 55.92  ?  165  GLY A O     1 
ATOM   1402  N N     . TYR A 1 169 ? 6.486   34.916  83.278  1.00 55.02  ?  166  TYR A N     1 
ATOM   1403  C CA    . TYR A 1 169 ? 7.703   35.566  82.809  1.00 55.29  ?  166  TYR A CA    1 
ATOM   1404  C C     . TYR A 1 169 ? 7.448   37.042  82.558  1.00 54.74  ?  166  TYR A C     1 
ATOM   1405  O O     . TYR A 1 169 ? 6.441   37.410  81.945  1.00 51.53  ?  166  TYR A O     1 
ATOM   1406  C CB    . TYR A 1 169 ? 8.231   34.895  81.536  1.00 54.68  ?  166  TYR A CB    1 
ATOM   1407  C CG    . TYR A 1 169 ? 8.865   33.550  81.799  1.00 59.64  ?  166  TYR A CG    1 
ATOM   1408  C CD1   . TYR A 1 169 ? 8.105   32.387  81.792  1.00 62.10  ?  166  TYR A CD1   1 
ATOM   1409  C CD2   . TYR A 1 169 ? 10.223  33.445  82.070  1.00 59.66  ?  166  TYR A CD2   1 
ATOM   1410  C CE1   . TYR A 1 169 ? 8.680   31.157  82.041  1.00 62.94  ?  166  TYR A CE1   1 
ATOM   1411  C CE2   . TYR A 1 169 ? 10.807  32.219  82.319  1.00 64.06  ?  166  TYR A CE2   1 
ATOM   1412  C CZ    . TYR A 1 169 ? 10.031  31.078  82.303  1.00 68.90  ?  166  TYR A CZ    1 
ATOM   1413  O OH    . TYR A 1 169 ? 10.608  29.854  82.551  1.00 80.25  ?  166  TYR A OH    1 
ATOM   1414  N N     . LEU A 1 170 ? 8.372   37.875  83.029  1.00 51.24  ?  167  LEU A N     1 
ATOM   1415  C CA    . LEU A 1 170 ? 8.312   39.318  82.857  1.00 51.10  ?  167  LEU A CA    1 
ATOM   1416  C C     . LEU A 1 170 ? 9.326   39.751  81.808  1.00 51.37  ?  167  LEU A C     1 
ATOM   1417  O O     . LEU A 1 170 ? 10.477  39.303  81.824  1.00 52.63  ?  167  LEU A O     1 
ATOM   1418  C CB    . LEU A 1 170 ? 8.605   40.039  84.174  1.00 51.26  ?  167  LEU A CB    1 
ATOM   1419  C CG    . LEU A 1 170 ? 7.736   39.672  85.374  1.00 51.47  ?  167  LEU A CG    1 
ATOM   1420  C CD1   . LEU A 1 170 ? 8.356   40.188  86.651  1.00 53.95  ?  167  LEU A CD1   1 
ATOM   1421  C CD2   . LEU A 1 170 ? 6.347   40.240  85.206  1.00 53.10  ?  167  LEU A CD2   1 
ATOM   1422  N N     . TYR A 1 171 ? 8.896   40.620  80.901  1.00 51.04  ?  168  TYR A N     1 
ATOM   1423  C CA    . TYR A 1 171 ? 9.774   41.209  79.901  1.00 52.39  ?  168  TYR A CA    1 
ATOM   1424  C C     . TYR A 1 171 ? 10.126  42.630  80.320  1.00 54.64  ?  168  TYR A C     1 
ATOM   1425  O O     . TYR A 1 171 ? 9.234   43.439  80.594  1.00 50.78  ?  168  TYR A O     1 
ATOM   1426  C CB    . TYR A 1 171 ? 9.114   41.208  78.520  1.00 50.51  ?  168  TYR A CB    1 
ATOM   1427  C CG    . TYR A 1 171 ? 9.743   42.181  77.549  1.00 50.35  ?  168  TYR A CG    1 
ATOM   1428  C CD1   . TYR A 1 171 ? 11.057  42.023  77.131  1.00 50.19  ?  168  TYR A CD1   1 
ATOM   1429  C CD2   . TYR A 1 171 ? 9.020   43.256  77.048  1.00 50.61  ?  168  TYR A CD2   1 
ATOM   1430  C CE1   . TYR A 1 171 ? 11.634  42.910  76.244  1.00 50.05  ?  168  TYR A CE1   1 
ATOM   1431  C CE2   . TYR A 1 171 ? 9.590   44.148  76.159  1.00 50.20  ?  168  TYR A CE2   1 
ATOM   1432  C CZ    . TYR A 1 171 ? 10.898  43.971  75.762  1.00 50.05  ?  168  TYR A CZ    1 
ATOM   1433  O OH    . TYR A 1 171 ? 11.471  44.856  74.879  1.00 49.91  ?  168  TYR A OH    1 
ATOM   1434  N N     . ASN A 1 172 ? 11.423  42.926  80.377  1.00 51.99  ?  169  ASN A N     1 
ATOM   1435  C CA    . ASN A 1 172 ? 11.895  44.249  80.764  1.00 53.15  ?  169  ASN A CA    1 
ATOM   1436  C C     . ASN A 1 172 ? 11.978  45.135  79.528  1.00 54.23  ?  169  ASN A C     1 
ATOM   1437  O O     . ASN A 1 172 ? 12.648  44.787  78.549  1.00 54.28  ?  169  ASN A O     1 
ATOM   1438  C CB    . ASN A 1 172 ? 13.255  44.167  81.454  1.00 57.93  ?  169  ASN A CB    1 
ATOM   1439  C CG    . ASN A 1 172 ? 13.724  45.513  81.973  1.00 62.50  ?  169  ASN A CG    1 
ATOM   1440  O OD1   . ASN A 1 172 ? 14.246  46.335  81.220  1.00 66.97  ?  169  ASN A OD1   1 
ATOM   1441  N ND2   . ASN A 1 172 ? 13.537  45.746  83.267  1.00 59.78  ?  169  ASN A ND2   1 
ATOM   1442  N N     . ILE A 1 173 ? 11.305  46.287  79.583  1.00 56.84  ?  170  ILE A N     1 
ATOM   1443  C CA    . ILE A 1 173 ? 11.259  47.191  78.438  1.00 57.15  ?  170  ILE A CA    1 
ATOM   1444  C C     . ILE A 1 173 ? 12.642  47.739  78.112  1.00 59.79  ?  170  ILE A C     1 
ATOM   1445  O O     . ILE A 1 173 ? 12.974  47.945  76.938  1.00 56.77  ?  170  ILE A O     1 
ATOM   1446  C CB    . ILE A 1 173 ? 10.235  48.316  78.701  1.00 53.84  ?  170  ILE A CB    1 
ATOM   1447  C CG1   . ILE A 1 173 ? 10.151  49.277  77.515  1.00 62.18  ?  170  ILE A CG1   1 
ATOM   1448  C CG2   . ILE A 1 173 ? 10.577  49.079  79.962  1.00 54.56  ?  170  ILE A CG2   1 
ATOM   1449  C CD1   . ILE A 1 173 ? 10.999  50.543  77.640  1.00 66.18  ?  170  ILE A CD1   1 
ATOM   1450  N N     . LYS A 1 174 ? 13.473  47.973  79.129  1.00 63.66  ?  171  LYS A N     1 
ATOM   1451  C CA    . LYS A 1 174 ? 14.763  48.618  78.898  1.00 57.56  ?  171  LYS A CA    1 
ATOM   1452  C C     . LYS A 1 174 ? 15.815  47.628  78.409  1.00 52.17  ?  171  LYS A C     1 
ATOM   1453  O O     . LYS A 1 174 ? 16.428  47.834  77.356  1.00 49.88  ?  171  LYS A O     1 
ATOM   1454  C CB    . LYS A 1 174 ? 15.244  49.314  80.174  1.00 54.37  ?  171  LYS A CB    1 
ATOM   1455  C CG    . LYS A 1 174 ? 14.925  50.804  80.248  1.00 56.66  ?  171  LYS A CG    1 
ATOM   1456  C CD    . LYS A 1 174 ? 13.445  51.049  80.470  1.00 53.20  ?  171  LYS A CD    1 
ATOM   1457  C CE    . LYS A 1 174 ? 13.097  52.520  80.331  1.00 50.55  ?  171  LYS A CE    1 
ATOM   1458  N NZ    . LYS A 1 174 ? 11.717  52.705  79.801  1.00 54.30  1  171  LYS A NZ    1 
ATOM   1459  N N     . SER A 1 175 ? 16.041  46.551  79.161  1.00 53.10  ?  172  SER A N     1 
ATOM   1460  C CA    . SER A 1 175 ? 17.130  45.636  78.835  1.00 51.23  ?  172  SER A CA    1 
ATOM   1461  C C     . SER A 1 175 ? 16.760  44.655  77.731  1.00 57.56  ?  172  SER A C     1 
ATOM   1462  O O     . SER A 1 175 ? 17.645  44.174  77.014  1.00 51.47  ?  172  SER A O     1 
ATOM   1463  C CB    . SER A 1 175 ? 17.553  44.860  80.081  1.00 52.08  ?  172  SER A CB    1 
ATOM   1464  O OG    . SER A 1 175 ? 16.506  44.015  80.526  1.00 50.58  ?  172  SER A OG    1 
ATOM   1465  N N     . GLY A 1 176 ? 15.477  44.340  77.583  1.00 61.38  ?  173  GLY A N     1 
ATOM   1466  C CA    . GLY A 1 176 ? 15.064  43.306  76.663  1.00 55.82  ?  173  GLY A CA    1 
ATOM   1467  C C     . GLY A 1 176 ? 15.219  41.895  77.184  1.00 53.67  ?  173  GLY A C     1 
ATOM   1468  O O     . GLY A 1 176 ? 14.942  40.945  76.441  1.00 53.74  ?  173  GLY A O     1 
ATOM   1469  N N     . LYS A 1 177 ? 15.653  41.726  78.427  1.00 55.97  ?  174  LYS A N     1 
ATOM   1470  C CA    . LYS A 1 177 ? 15.786  40.410  79.029  1.00 52.11  ?  174  LYS A CA    1 
ATOM   1471  C C     . LYS A 1 177 ? 14.475  40.000  79.692  1.00 51.51  ?  174  LYS A C     1 
ATOM   1472  O O     . LYS A 1 177 ? 13.622  40.832  80.011  1.00 50.35  ?  174  LYS A O     1 
ATOM   1473  C CB    . LYS A 1 177 ? 16.926  40.400  80.049  1.00 50.61  ?  174  LYS A CB    1 
ATOM   1474  C CG    . LYS A 1 177 ? 18.085  41.319  79.683  1.00 50.99  ?  174  LYS A CG    1 
ATOM   1475  C CD    . LYS A 1 177 ? 19.326  41.037  80.518  1.00 60.46  ?  174  LYS A CD    1 
ATOM   1476  C CE    . LYS A 1 177 ? 20.246  42.249  80.555  1.00 59.76  ?  174  LYS A CE    1 
ATOM   1477  N NZ    . LYS A 1 177 ? 21.621  41.901  81.006  1.00 58.27  1  174  LYS A NZ    1 
ATOM   1478  N N     . SER A 1 178 ? 14.321  38.694  79.891  1.00 52.16  ?  175  SER A N     1 
ATOM   1479  C CA    . SER A 1 178 ? 13.142  38.128  80.528  1.00 55.00  ?  175  SER A CA    1 
ATOM   1480  C C     . SER A 1 178 ? 13.549  37.383  81.790  1.00 52.91  ?  175  SER A C     1 
ATOM   1481  O O     . SER A 1 178 ? 14.563  36.678  81.809  1.00 53.64  ?  175  SER A O     1 
ATOM   1482  C CB    . SER A 1 178 ? 12.393  37.189  79.579  1.00 50.37  ?  175  SER A CB    1 
ATOM   1483  O OG    . SER A 1 178 ? 11.784  37.913  78.524  1.00 50.92  ?  175  SER A OG    1 
ATOM   1484  N N     . PHE A 1 179 ? 12.751  37.543  82.843  1.00 50.76  ?  176  PHE A N     1 
ATOM   1485  C CA    . PHE A 1 179 ? 13.032  36.948  84.137  1.00 51.68  ?  176  PHE A CA    1 
ATOM   1486  C C     . PHE A 1 179 ? 11.781  36.260  84.662  1.00 55.15  ?  176  PHE A C     1 
ATOM   1487  O O     . PHE A 1 179 ? 10.665  36.749  84.446  1.00 53.14  ?  176  PHE A O     1 
ATOM   1488  C CB    . PHE A 1 179 ? 13.496  38.008  85.149  1.00 51.00  ?  176  PHE A CB    1 
ATOM   1489  C CG    . PHE A 1 179 ? 14.467  39.007  84.583  1.00 64.75  ?  176  PHE A CG    1 
ATOM   1490  C CD1   . PHE A 1 179 ? 14.011  40.143  83.932  1.00 60.71  ?  176  PHE A CD1   1 
ATOM   1491  C CD2   . PHE A 1 179 ? 15.833  38.815  84.705  1.00 67.82  ?  176  PHE A CD2   1 
ATOM   1492  C CE1   . PHE A 1 179 ? 14.898  41.065  83.408  1.00 61.32  ?  176  PHE A CE1   1 
ATOM   1493  C CE2   . PHE A 1 179 ? 16.728  39.736  84.183  1.00 66.47  ?  176  PHE A CE2   1 
ATOM   1494  C CZ    . PHE A 1 179 ? 16.258  40.862  83.535  1.00 62.82  ?  176  PHE A CZ    1 
ATOM   1495  N N     . PRO A 1 180 ? 11.931  35.120  85.333  1.00 58.99  ?  177  PRO A N     1 
ATOM   1496  C CA    . PRO A 1 180 ? 10.773  34.492  85.979  1.00 55.41  ?  177  PRO A CA    1 
ATOM   1497  C C     . PRO A 1 180 ? 10.137  35.438  86.986  1.00 54.82  ?  177  PRO A C     1 
ATOM   1498  O O     . PRO A 1 180 ? 10.824  36.188  87.683  1.00 54.07  ?  177  PRO A O     1 
ATOM   1499  C CB    . PRO A 1 180 ? 11.372  33.257  86.659  1.00 51.33  ?  177  PRO A CB    1 
ATOM   1500  C CG    . PRO A 1 180 ? 12.604  32.955  85.866  1.00 57.47  ?  177  PRO A CG    1 
ATOM   1501  C CD    . PRO A 1 180 ? 13.142  34.286  85.427  1.00 57.38  ?  177  PRO A CD    1 
ATOM   1502  N N     . TYR A 1 181 ? 8.809   35.401  87.047  1.00 57.19  ?  178  TYR A N     1 
ATOM   1503  C CA    . TYR A 1 181 ? 8.034   36.281  87.915  1.00 55.30  ?  178  TYR A CA    1 
ATOM   1504  C C     . TYR A 1 181 ? 7.801   35.573  89.246  1.00 58.95  ?  178  TYR A C     1 
ATOM   1505  O O     . TYR A 1 181 ? 7.023   34.617  89.323  1.00 60.82  ?  178  TYR A O     1 
ATOM   1506  C CB    . TYR A 1 181 ? 6.720   36.661  87.236  1.00 51.78  ?  178  TYR A CB    1 
ATOM   1507  C CG    . TYR A 1 181 ? 5.642   37.184  88.159  1.00 52.04  ?  178  TYR A CG    1 
ATOM   1508  C CD1   . TYR A 1 181 ? 5.816   38.363  88.872  1.00 52.07  ?  178  TYR A CD1   1 
ATOM   1509  C CD2   . TYR A 1 181 ? 4.436   36.508  88.297  1.00 54.66  ?  178  TYR A CD2   1 
ATOM   1510  C CE1   . TYR A 1 181 ? 4.825   38.844  89.709  1.00 52.26  ?  178  TYR A CE1   1 
ATOM   1511  C CE2   . TYR A 1 181 ? 3.440   36.981  89.129  1.00 52.65  ?  178  TYR A CE2   1 
ATOM   1512  C CZ    . TYR A 1 181 ? 3.639   38.149  89.832  1.00 54.08  ?  178  TYR A CZ    1 
ATOM   1513  O OH    . TYR A 1 181 ? 2.648   38.621  90.662  1.00 59.28  ?  178  TYR A OH    1 
ATOM   1514  N N     . ILE A 1 182 ? 8.486   36.036  90.291  1.00 62.42  ?  179  ILE A N     1 
ATOM   1515  C CA    . ILE A 1 182 ? 8.353   35.417  91.607  1.00 65.17  ?  179  ILE A CA    1 
ATOM   1516  C C     . ILE A 1 182 ? 7.071   35.875  92.288  1.00 64.94  ?  179  ILE A C     1 
ATOM   1517  O O     . ILE A 1 182 ? 6.169   35.074  92.560  1.00 67.75  ?  179  ILE A O     1 
ATOM   1518  C CB    . ILE A 1 182 ? 9.586   35.722  92.477  1.00 62.78  ?  179  ILE A CB    1 
ATOM   1519  C CG1   . ILE A 1 182 ? 10.854  35.180  91.817  1.00 66.80  ?  179  ILE A CG1   1 
ATOM   1520  C CG2   . ILE A 1 182 ? 9.414   35.128  93.869  1.00 62.97  ?  179  ILE A CG2   1 
ATOM   1521  C CD1   . ILE A 1 182 ? 10.884  33.670  91.698  1.00 64.02  ?  179  ILE A CD1   1 
ATOM   1522  N N     . SER A 1 183 ? 6.969   37.170  92.574  1.00 60.96  ?  180  SER A N     1 
ATOM   1523  C CA    . SER A 1 183 ? 5.808   37.672  93.290  1.00 60.83  ?  180  SER A CA    1 
ATOM   1524  C C     . SER A 1 183 ? 5.629   39.155  93.005  1.00 61.60  ?  180  SER A C     1 
ATOM   1525  O O     . SER A 1 183 ? 6.595   39.876  92.740  1.00 63.76  ?  180  SER A O     1 
ATOM   1526  C CB    . SER A 1 183 ? 5.938   37.437  94.799  1.00 52.83  ?  180  SER A CB    1 
ATOM   1527  O OG    . SER A 1 183 ? 6.980   38.224  95.348  1.00 52.83  ?  180  SER A OG    1 
ATOM   1528  N N     . GLY A 1 184 ? 4.374   39.590  93.058  1.00 52.74  ?  181  GLY A N     1 
ATOM   1529  C CA    . GLY A 1 184 ? 4.026   40.994  92.995  1.00 53.68  ?  181  GLY A CA    1 
ATOM   1530  C C     . GLY A 1 184 ? 2.936   41.303  94.000  1.00 59.51  ?  181  GLY A C     1 
ATOM   1531  O O     . GLY A 1 184 ? 1.754   41.070  93.731  1.00 71.30  ?  181  GLY A O     1 
ATOM   1532  N N     . LEU A 1 185 ? 3.323   41.803  95.172  1.00 59.12  ?  182  LEU A N     1 
ATOM   1533  C CA    . LEU A 1 185 ? 2.386   42.039  96.261  1.00 60.59  ?  182  LEU A CA    1 
ATOM   1534  C C     . LEU A 1 185 ? 2.816   43.284  97.021  1.00 60.98  ?  182  LEU A C     1 
ATOM   1535  O O     . LEU A 1 185 ? 4.011   43.510  97.217  1.00 67.72  ?  182  LEU A O     1 
ATOM   1536  C CB    . LEU A 1 185 ? 2.326   40.842  97.220  1.00 59.65  ?  182  LEU A CB    1 
ATOM   1537  C CG    . LEU A 1 185 ? 1.837   39.494  96.687  1.00 59.43  ?  182  LEU A CG    1 
ATOM   1538  C CD1   . LEU A 1 185 ? 2.097   38.399  97.708  1.00 59.45  ?  182  LEU A CD1   1 
ATOM   1539  C CD2   . LEU A 1 185 ? 0.360   39.561  96.336  1.00 55.93  ?  182  LEU A CD2   1 
ATOM   1540  N N     . ASP A 1 186 ? 1.836   44.083  97.446  1.00 54.88  ?  183  ASP A N     1 
ATOM   1541  C CA    . ASP A 1 186 ? 2.082   45.273  98.263  1.00 55.62  ?  183  ASP A CA    1 
ATOM   1542  C C     . ASP A 1 186 ? 3.003   46.268  97.558  1.00 57.37  ?  183  ASP A C     1 
ATOM   1543  O O     . ASP A 1 186 ? 3.784   46.971  98.203  1.00 54.35  ?  183  ASP A O     1 
ATOM   1544  C CB    . ASP A 1 186 ? 2.659   44.896  99.630  1.00 56.86  ?  183  ASP A CB    1 
ATOM   1545  C CG    . ASP A 1 186 ? 2.071   43.612  100.178 1.00 62.87  ?  183  ASP A CG    1 
ATOM   1546  O OD1   . ASP A 1 186 ? 0.827   43.492  100.220 1.00 64.39  ?  183  ASP A OD1   1 
ATOM   1547  O OD2   . ASP A 1 186 ? 2.854   42.715  100.555 1.00 68.23  -1 183  ASP A OD2   1 
ATOM   1548  N N     . GLY A 1 187 ? 2.927   46.322  96.230  1.00 54.30  ?  184  GLY A N     1 
ATOM   1549  C CA    . GLY A 1 187 ? 3.695   47.279  95.464  1.00 53.17  ?  184  GLY A CA    1 
ATOM   1550  C C     . GLY A 1 187 ? 5.158   46.948  95.268  1.00 56.85  ?  184  GLY A C     1 
ATOM   1551  O O     . GLY A 1 187 ? 5.888   47.777  94.711  1.00 57.83  ?  184  GLY A O     1 
ATOM   1552  N N     . ILE A 1 188 ? 5.618   45.777  95.702  1.00 55.30  ?  185  ILE A N     1 
ATOM   1553  C CA    . ILE A 1 188 ? 6.999   45.354  95.497  1.00 56.67  ?  185  ILE A CA    1 
ATOM   1554  C C     . ILE A 1 188 ? 6.996   44.160  94.549  1.00 56.23  ?  185  ILE A C     1 
ATOM   1555  O O     . ILE A 1 188 ? 6.333   43.146  94.806  1.00 52.84  ?  185  ILE A O     1 
ATOM   1556  C CB    . ILE A 1 188 ? 7.713   45.035  96.822  1.00 61.27  ?  185  ILE A CB    1 
ATOM   1557  C CG1   . ILE A 1 188 ? 6.999   43.931  97.604  1.00 61.64  ?  185  ILE A CG1   1 
ATOM   1558  C CG2   . ILE A 1 188 ? 7.819   46.290  97.679  1.00 57.66  ?  185  ILE A CG2   1 
ATOM   1559  C CD1   . ILE A 1 188 ? 7.912   43.121  98.499  1.00 60.65  ?  185  ILE A CD1   1 
ATOM   1560  N N     . LEU A 1 189 ? 7.717   44.294  93.441  1.00 60.74  ?  186  LEU A N     1 
ATOM   1561  C CA    . LEU A 1 189 ? 7.793   43.272  92.408  1.00 52.41  ?  186  LEU A CA    1 
ATOM   1562  C C     . LEU A 1 189 ? 9.112   42.523  92.550  1.00 52.32  ?  186  LEU A C     1 
ATOM   1563  O O     . LEU A 1 189 ? 10.172  43.145  92.675  1.00 52.25  ?  186  LEU A O     1 
ATOM   1564  C CB    . LEU A 1 189 ? 7.679   43.906  91.021  1.00 52.24  ?  186  LEU A CB    1 
ATOM   1565  C CG    . LEU A 1 189 ? 7.612   42.995  89.795  1.00 52.08  ?  186  LEU A CG    1 
ATOM   1566  C CD1   . LEU A 1 189 ? 6.333   42.172  89.811  1.00 52.18  ?  186  LEU A CD1   1 
ATOM   1567  C CD2   . LEU A 1 189 ? 7.712   43.820  88.519  1.00 51.91  ?  186  LEU A CD2   1 
ATOM   1568  N N     . LYS A 1 190 ? 9.045   41.195  92.538  1.00 52.31  ?  187  LYS A N     1 
ATOM   1569  C CA    . LYS A 1 190 ? 10.215  40.356  92.754  1.00 61.88  ?  187  LYS A CA    1 
ATOM   1570  C C     . LYS A 1 190 ? 10.434  39.455  91.547  1.00 66.50  ?  187  LYS A C     1 
ATOM   1571  O O     . LYS A 1 190 ? 9.496   38.814  91.061  1.00 61.42  ?  187  LYS A O     1 
ATOM   1572  C CB    . LYS A 1 190 ? 10.070  39.531  94.037  1.00 56.50  ?  187  LYS A CB    1 
ATOM   1573  C CG    . LYS A 1 190 ? 9.963   40.400  95.284  1.00 59.69  ?  187  LYS A CG    1 
ATOM   1574  C CD    . LYS A 1 190 ? 10.603  39.753  96.503  1.00 65.45  ?  187  LYS A CD    1 
ATOM   1575  C CE    . LYS A 1 190 ? 9.729   38.656  97.083  1.00 64.16  ?  187  LYS A CE    1 
ATOM   1576  N NZ    . LYS A 1 190 ? 10.114  38.337  98.485  1.00 56.70  1  187  LYS A NZ    1 
ATOM   1577  N N     . ILE A 1 191 ? 11.678  39.414  91.071  1.00 67.54  ?  188  ILE A N     1 
ATOM   1578  C CA    . ILE A 1 191 ? 12.052  38.686  89.869  1.00 68.78  ?  188  ILE A CA    1 
ATOM   1579  C C     . ILE A 1 191 ? 13.163  37.703  90.213  1.00 68.20  ?  188  ILE A C     1 
ATOM   1580  O O     . ILE A 1 191 ? 13.842  37.823  91.236  1.00 63.97  ?  188  ILE A O     1 
ATOM   1581  C CB    . ILE A 1 191 ? 12.502  39.637  88.741  1.00 60.57  ?  188  ILE A CB    1 
ATOM   1582  C CG1   . ILE A 1 191 ? 13.735  40.431  89.178  1.00 56.40  ?  188  ILE A CG1   1 
ATOM   1583  C CG2   . ILE A 1 191 ? 11.388  40.593  88.374  1.00 55.07  ?  188  ILE A CG2   1 
ATOM   1584  C CD1   . ILE A 1 191 ? 14.178  41.473  88.172  1.00 51.36  ?  188  ILE A CD1   1 
ATOM   1585  N N     . ASP A 1 192 ? 13.347  36.723  89.334  1.00 66.44  ?  189  ASP A N     1 
ATOM   1586  C CA    . ASP A 1 192 ? 14.411  35.736  89.467  1.00 67.49  ?  189  ASP A CA    1 
ATOM   1587  C C     . ASP A 1 192 ? 15.583  36.145  88.585  1.00 67.81  ?  189  ASP A C     1 
ATOM   1588  O O     . ASP A 1 192 ? 15.402  36.434  87.397  1.00 61.57  ?  189  ASP A O     1 
ATOM   1589  C CB    . ASP A 1 192 ? 13.914  34.340  89.082  1.00 68.23  ?  189  ASP A CB    1 
ATOM   1590  C CG    . ASP A 1 192 ? 14.875  33.233  89.495  1.00 66.20  ?  189  ASP A CG    1 
ATOM   1591  O OD1   . ASP A 1 192 ? 16.094  33.490  89.606  1.00 66.60  ?  189  ASP A OD1   1 
ATOM   1592  O OD2   . ASP A 1 192 ? 14.407  32.095  89.707  1.00 64.55  -1 189  ASP A OD2   1 
ATOM   1593  N N     . ILE A 1 193 ? 16.777  36.168  89.167  1.00 71.59  ?  190  ILE A N     1 
ATOM   1594  C CA    . ILE A 1 193 ? 17.986  36.507  88.427  1.00 67.07  ?  190  ILE A CA    1 
ATOM   1595  C C     . ILE A 1 193 ? 18.850  35.265  88.250  1.00 67.90  ?  190  ILE A C     1 
ATOM   1596  O O     . ILE A 1 193 ? 19.267  34.644  89.229  1.00 72.41  ?  190  ILE A O     1 
ATOM   1597  C CB    . ILE A 1 193 ? 18.776  37.626  89.129  1.00 57.88  ?  190  ILE A CB    1 
ATOM   1598  C CG1   . ILE A 1 193 ? 17.924  38.891  89.251  1.00 54.45  ?  190  ILE A CG1   1 
ATOM   1599  C CG2   . ILE A 1 193 ? 20.064  37.918  88.375  1.00 55.26  ?  190  ILE A CG2   1 
ATOM   1600  C CD1   . ILE A 1 193 ? 17.790  39.673  87.963  1.00 57.63  ?  190  ILE A CD1   1 
ATOM   1601  N N     . ASN A 1 196 ? 20.294  31.485  91.521  1.00 65.42  ?  193  ASN A N     1 
ATOM   1602  C CA    . ASN A 1 196 ? 18.914  31.600  91.978  1.00 66.67  ?  193  ASN A CA    1 
ATOM   1603  C C     . ASN A 1 196 ? 18.780  32.729  92.997  1.00 72.87  ?  193  ASN A C     1 
ATOM   1604  O O     . ASN A 1 196 ? 18.603  32.491  94.193  1.00 77.77  ?  193  ASN A O     1 
ATOM   1605  C CB    . ASN A 1 196 ? 18.435  30.272  92.571  1.00 66.39  ?  193  ASN A CB    1 
ATOM   1606  C CG    . ASN A 1 196 ? 16.997  30.331  93.052  1.00 68.78  ?  193  ASN A CG    1 
ATOM   1607  O OD1   . ASN A 1 196 ? 16.077  30.576  92.272  1.00 71.75  ?  193  ASN A OD1   1 
ATOM   1608  N ND2   . ASN A 1 196 ? 16.798  30.095  94.344  1.00 65.23  ?  193  ASN A ND2   1 
ATOM   1609  N N     . GLN A 1 197 ? 18.869  33.963  92.510  1.00 72.67  ?  194  GLN A N     1 
ATOM   1610  C CA    . GLN A 1 197 ? 18.804  35.152  93.347  1.00 70.17  ?  194  GLN A CA    1 
ATOM   1611  C C     . GLN A 1 197 ? 17.476  35.864  93.126  1.00 72.83  ?  194  GLN A C     1 
ATOM   1612  O O     . GLN A 1 197 ? 17.076  36.102  91.981  1.00 76.85  ?  194  GLN A O     1 
ATOM   1613  C CB    . GLN A 1 197 ? 19.969  36.100  93.047  1.00 64.32  ?  194  GLN A CB    1 
ATOM   1614  C CG    . GLN A 1 197 ? 21.329  35.627  93.556  1.00 72.13  ?  194  GLN A CG    1 
ATOM   1615  C CD    . GLN A 1 197 ? 21.873  34.431  92.792  1.00 74.18  ?  194  GLN A CD    1 
ATOM   1616  O OE1   . GLN A 1 197 ? 21.325  34.033  91.763  1.00 78.86  ?  194  GLN A OE1   1 
ATOM   1617  N NE2   . GLN A 1 197 ? 22.957  33.852  93.294  1.00 71.67  ?  194  GLN A NE2   1 
ATOM   1618  N N     . ILE A 1 198 ? 16.801  36.199  94.221  1.00 69.58  ?  195  ILE A N     1 
ATOM   1619  C CA    . ILE A 1 198 ? 15.557  36.958  94.192  1.00 63.94  ?  195  ILE A CA    1 
ATOM   1620  C C     . ILE A 1 198 ? 15.885  38.425  94.422  1.00 66.41  ?  195  ILE A C     1 
ATOM   1621  O O     . ILE A 1 198 ? 16.727  38.760  95.266  1.00 71.15  ?  195  ILE A O     1 
ATOM   1622  C CB    . ILE A 1 198 ? 14.560  36.436  95.245  1.00 63.96  ?  195  ILE A CB    1 
ATOM   1623  C CG1   . ILE A 1 198 ? 15.245  36.302  96.607  1.00 65.47  ?  195  ILE A CG1   1 
ATOM   1624  C CG2   . ILE A 1 198 ? 13.977  35.102  94.807  1.00 63.97  ?  195  ILE A CG2   1 
ATOM   1625  C CD1   . ILE A 1 198 ? 14.321  35.862  97.721  1.00 64.74  ?  195  ILE A CD1   1 
ATOM   1626  N N     . VAL A 1 199 ? 15.239  39.306  93.661  1.00 65.56  ?  196  VAL A N     1 
ATOM   1627  C CA    . VAL A 1 199 ? 15.554  40.730  93.680  1.00 63.47  ?  196  VAL A CA    1 
ATOM   1628  C C     . VAL A 1 199 ? 14.261  41.533  93.638  1.00 64.75  ?  196  VAL A C     1 
ATOM   1629  O O     . VAL A 1 199 ? 13.403  41.294  92.782  1.00 62.20  ?  196  VAL A O     1 
ATOM   1630  C CB    . VAL A 1 199 ? 16.465  41.133  92.502  1.00 62.67  ?  196  VAL A CB    1 
ATOM   1631  C CG1   . VAL A 1 199 ? 16.723  42.627  92.514  1.00 62.47  ?  196  VAL A CG1   1 
ATOM   1632  C CG2   . VAL A 1 199 ? 17.780  40.373  92.547  1.00 63.05  ?  196  VAL A CG2   1 
ATOM   1633  N N     . GLU A 1 200 ? 14.124  42.483  94.562  1.00 65.80  ?  197  GLU A N     1 
ATOM   1634  C CA    . GLU A 1 200 ? 13.091  43.502  94.461  1.00 63.59  ?  197  GLU A CA    1 
ATOM   1635  C C     . GLU A 1 200 ? 13.527  44.560  93.460  1.00 68.17  ?  197  GLU A C     1 
ATOM   1636  O O     . GLU A 1 200 ? 14.706  44.920  93.390  1.00 72.35  ?  197  GLU A O     1 
ATOM   1637  C CB    . GLU A 1 200 ? 12.826  44.152  95.819  1.00 62.49  ?  197  GLU A CB    1 
ATOM   1638  C CG    . GLU A 1 200 ? 12.197  43.231  96.847  1.00 62.84  ?  197  GLU A CG    1 
ATOM   1639  C CD    . GLU A 1 200 ? 12.076  43.881  98.213  1.00 68.38  ?  197  GLU A CD    1 
ATOM   1640  O OE1   . GLU A 1 200 ? 11.703  45.072  98.279  1.00 72.10  ?  197  GLU A OE1   1 
ATOM   1641  O OE2   . GLU A 1 200 ? 12.364  43.204  99.223  1.00 69.88  -1 197  GLU A OE2   1 
ATOM   1642  N N     . VAL A 1 201 ? 12.572  45.064  92.697  1.00 67.20  ?  198  VAL A N     1 
ATOM   1643  C CA    . VAL A 1 201 ? 12.846  45.978  91.596  1.00 66.47  ?  198  VAL A CA    1 
ATOM   1644  C C     . VAL A 1 201 ? 12.553  47.407  92.032  1.00 68.36  ?  198  VAL A C     1 
ATOM   1645  O O     . VAL A 1 201 ? 11.647  47.660  92.838  1.00 70.46  ?  198  VAL A O     1 
ATOM   1646  C CB    . VAL A 1 201 ? 12.009  45.586  90.362  1.00 66.36  ?  198  VAL A CB    1 
ATOM   1647  C CG1   . VAL A 1 201 ? 12.282  46.529  89.217  1.00 70.07  ?  198  VAL A CG1   1 
ATOM   1648  C CG2   . VAL A 1 201 ? 12.299  44.140  89.966  1.00 60.71  ?  198  VAL A CG2   1 
ATOM   1649  N N     . ALA A 1 202 ? 13.325  48.361  91.491  1.00 67.89  ?  199  ALA A N     1 
ATOM   1650  C CA    . ALA A 1 202 ? 13.070  49.777  91.759  1.00 60.43  ?  199  ALA A CA    1 
ATOM   1651  C C     . ALA A 1 202 ? 12.072  50.419  90.792  1.00 62.84  ?  199  ALA A C     1 
ATOM   1652  O O     . ALA A 1 202 ? 11.218  51.186  91.235  1.00 64.97  ?  199  ALA A O     1 
ATOM   1653  C CB    . ALA A 1 202 ? 14.377  50.570  91.761  1.00 60.52  ?  199  ALA A CB    1 
ATOM   1654  N N     . TYR A 1 203 ? 12.134  50.136  89.490  1.00 63.43  ?  200  TYR A N     1 
ATOM   1655  C CA    . TYR A 1 203 ? 11.016  50.522  88.638  1.00 65.03  ?  200  TYR A CA    1 
ATOM   1656  C C     . TYR A 1 203 ? 10.251  49.289  88.175  1.00 61.85  ?  200  TYR A C     1 
ATOM   1657  O O     . TYR A 1 203 ? 10.543  48.734  87.105  1.00 58.83  ?  200  TYR A O     1 
ATOM   1658  C CB    . TYR A 1 203 ? 11.503  51.300  87.422  1.00 69.97  ?  200  TYR A CB    1 
ATOM   1659  C CG    . TYR A 1 203 ? 12.136  52.634  87.727  1.00 71.74  ?  200  TYR A CG    1 
ATOM   1660  C CD1   . TYR A 1 203 ? 11.369  53.782  87.843  1.00 74.94  ?  200  TYR A CD1   1 
ATOM   1661  C CD2   . TYR A 1 203 ? 13.527  52.781  87.762  1.00 71.52  ?  200  TYR A CD2   1 
ATOM   1662  C CE1   . TYR A 1 203 ? 11.992  55.020  88.073  1.00 76.72  ?  200  TYR A CE1   1 
ATOM   1663  C CE2   . TYR A 1 203 ? 14.120  54.005  88.041  1.00 74.55  ?  200  TYR A CE2   1 
ATOM   1664  C CZ    . TYR A 1 203 ? 13.354  55.107  88.178  1.00 78.22  ?  200  TYR A CZ    1 
ATOM   1665  O OH    . TYR A 1 203 ? 13.997  56.329  88.404  1.00 78.39  ?  200  TYR A OH    1 
ATOM   1666  N N     . PRO A 1 204 ? 9.279   48.822  88.963  1.00 59.13  ?  201  PRO A N     1 
ATOM   1667  C CA    . PRO A 1 204 ? 8.414   47.729  88.502  1.00 59.04  ?  201  PRO A CA    1 
ATOM   1668  C C     . PRO A 1 204 ? 7.588   48.113  87.295  1.00 58.49  ?  201  PRO A C     1 
ATOM   1669  O O     . PRO A 1 204 ? 7.006   47.224  86.663  1.00 58.36  ?  201  PRO A O     1 
ATOM   1670  C CB    . PRO A 1 204 ? 7.524   47.445  89.723  1.00 59.28  ?  201  PRO A CB    1 
ATOM   1671  C CG    . PRO A 1 204 ? 8.221   48.075  90.884  1.00 60.13  ?  201  PRO A CG    1 
ATOM   1672  C CD    . PRO A 1 204 ? 8.935   49.262  90.322  1.00 59.39  ?  201  PRO A CD    1 
ATOM   1673  N N     . GLU A 1 205 ? 7.518   49.405  86.959  1.00 58.17  ?  202  GLU A N     1 
ATOM   1674  C CA    . GLU A 1 205 ? 6.778   49.859  85.789  1.00 58.02  ?  202  GLU A CA    1 
ATOM   1675  C C     . GLU A 1 205 ? 7.474   49.516  84.479  1.00 57.44  ?  202  GLU A C     1 
ATOM   1676  O O     . GLU A 1 205 ? 6.834   49.565  83.424  1.00 57.50  ?  202  GLU A O     1 
ATOM   1677  C CB    . GLU A 1 205 ? 6.547   51.372  85.863  1.00 61.81  ?  202  GLU A CB    1 
ATOM   1678  C CG    . GLU A 1 205 ? 7.778   52.222  85.568  1.00 68.26  ?  202  GLU A CG    1 
ATOM   1679  C CD    . GLU A 1 205 ? 8.536   52.627  86.819  1.00 71.76  ?  202  GLU A CD    1 
ATOM   1680  O OE1   . GLU A 1 205 ? 8.255   52.064  87.898  1.00 70.95  ?  202  GLU A OE1   1 
ATOM   1681  O OE2   . GLU A 1 205 ? 9.418   53.509  86.722  1.00 71.30  -1 202  GLU A OE2   1 
ATOM   1682  N N     . ASN A 1 206 ? 8.759   49.171  84.519  1.00 57.73  ?  203  ASN A N     1 
ATOM   1683  C CA    . ASN A 1 206 ? 9.492   48.764  83.328  1.00 57.58  ?  203  ASN A CA    1 
ATOM   1684  C C     . ASN A 1 206 ? 9.290   47.294  82.983  1.00 57.70  ?  203  ASN A C     1 
ATOM   1685  O O     . ASN A 1 206 ? 9.943   46.790  82.062  1.00 57.63  ?  203  ASN A O     1 
ATOM   1686  C CB    . ASN A 1 206 ? 10.987  49.052  83.499  1.00 57.84  ?  203  ASN A CB    1 
ATOM   1687  C CG    . ASN A 1 206 ? 11.310  50.530  83.401  1.00 57.62  ?  203  ASN A CG    1 
ATOM   1688  O OD1   . ASN A 1 206 ? 10.478  51.331  82.980  1.00 57.23  ?  203  ASN A OD1   1 
ATOM   1689  N ND2   . ASN A 1 206 ? 12.529  50.896  83.780  1.00 57.88  ?  203  ASN A ND2   1 
ATOM   1690  N N     . TYR A 1 207 ? 8.405   46.600  83.689  1.00 57.86  ?  204  TYR A N     1 
ATOM   1691  C CA    . TYR A 1 207 ? 8.208   45.169  83.511  1.00 58.02  ?  204  TYR A CA    1 
ATOM   1692  C C     . TYR A 1 207 ? 6.796   44.900  83.013  1.00 57.70  ?  204  TYR A C     1 
ATOM   1693  O O     . TYR A 1 207 ? 5.821   45.379  83.601  1.00 57.62  ?  204  TYR A O     1 
ATOM   1694  C CB    . TYR A 1 207 ? 8.469   44.416  84.817  1.00 58.56  ?  204  TYR A CB    1 
ATOM   1695  C CG    . TYR A 1 207 ? 9.923   44.434  85.224  1.00 58.92  ?  204  TYR A CG    1 
ATOM   1696  C CD1   . TYR A 1 207 ? 10.503  45.587  85.730  1.00 58.96  ?  204  TYR A CD1   1 
ATOM   1697  C CD2   . TYR A 1 207 ? 10.719  43.303  85.092  1.00 59.21  ?  204  TYR A CD2   1 
ATOM   1698  C CE1   . TYR A 1 207 ? 11.828  45.617  86.087  1.00 59.28  ?  204  TYR A CE1   1 
ATOM   1699  C CE2   . TYR A 1 207 ? 12.052  43.324  85.459  1.00 59.53  ?  204  TYR A CE2   1 
ATOM   1700  C CZ    . TYR A 1 207 ? 12.598  44.485  85.960  1.00 59.57  ?  204  TYR A CZ    1 
ATOM   1701  O OH    . TYR A 1 207 ? 13.922  44.526  86.328  1.00 59.89  ?  204  TYR A OH    1 
ATOM   1702  N N     . LEU A 1 208 ? 6.698   44.140  81.928  1.00 57.51  ?  205  LEU A N     1 
ATOM   1703  C CA    . LEU A 1 208 ? 5.431   43.686  81.385  1.00 57.23  ?  205  LEU A CA    1 
ATOM   1704  C C     . LEU A 1 208 ? 5.404   42.165  81.393  1.00 57.49  ?  205  LEU A C     1 
ATOM   1705  O O     . LEU A 1 208 ? 6.450   41.511  81.358  1.00 57.76  ?  205  LEU A O     1 
ATOM   1706  C CB    . LEU A 1 208 ? 5.214   44.201  79.957  1.00 56.71  ?  205  LEU A CB    1 
ATOM   1707  C CG    . LEU A 1 208 ? 5.174   45.718  79.771  1.00 56.39  ?  205  LEU A CG    1 
ATOM   1708  C CD1   . LEU A 1 208 ? 4.952   46.069  78.309  1.00 55.89  ?  205  LEU A CD1   1 
ATOM   1709  C CD2   . LEU A 1 208 ? 4.091   46.330  80.642  1.00 56.35  ?  205  LEU A CD2   1 
ATOM   1710  N N     . PHE A 1 209 ? 4.201   41.605  81.446  1.00 57.40  ?  206  PHE A N     1 
ATOM   1711  C CA    . PHE A 1 209 ? 4.044   40.160  81.373  1.00 57.61  ?  206  PHE A CA    1 
ATOM   1712  C C     . PHE A 1 209 ? 4.118   39.704  79.923  1.00 57.31  ?  206  PHE A C     1 
ATOM   1713  O O     . PHE A 1 209 ? 3.476   40.289  79.046  1.00 56.86  ?  206  PHE A O     1 
ATOM   1714  C CB    . PHE A 1 209 ? 2.719   39.729  82.000  1.00 57.65  ?  206  PHE A CB    1 
ATOM   1715  C CG    . PHE A 1 209 ? 2.774   39.603  83.492  1.00 58.10  ?  206  PHE A CG    1 
ATOM   1716  C CD1   . PHE A 1 209 ? 3.435   38.539  84.080  1.00 58.56  ?  206  PHE A CD1   1 
ATOM   1717  C CD2   . PHE A 1 209 ? 2.169   40.543  84.307  1.00 58.06  ?  206  PHE A CD2   1 
ATOM   1718  C CE1   . PHE A 1 209 ? 3.489   38.413  85.453  1.00 58.97  ?  206  PHE A CE1   1 
ATOM   1719  C CE2   . PHE A 1 209 ? 2.223   40.423  85.681  1.00 58.48  ?  206  PHE A CE2   1 
ATOM   1720  C CZ    . PHE A 1 209 ? 2.888   39.358  86.254  1.00 58.93  ?  206  PHE A CZ    1 
ATOM   1721  N N     . ASN A 1 210 ? 4.905   38.663  79.674  1.00 57.55  ?  207  ASN A N     1 
ATOM   1722  C CA    . ASN A 1 210 ? 5.051   38.088  78.344  1.00 57.31  ?  207  ASN A CA    1 
ATOM   1723  C C     . ASN A 1 210 ? 4.266   36.784  78.280  1.00 57.40  ?  207  ASN A C     1 
ATOM   1724  O O     . ASN A 1 210 ? 4.435   35.908  79.136  1.00 57.82  ?  207  ASN A O     1 
ATOM   1725  C CB    . ASN A 1 210 ? 6.524   37.842  78.019  1.00 57.50  ?  207  ASN A CB    1 
ATOM   1726  C CG    . ASN A 1 210 ? 6.738   37.382  76.593  1.00 57.23  ?  207  ASN A CG    1 
ATOM   1727  O OD1   . ASN A 1 210 ? 5.994   37.761  75.688  1.00 56.79  ?  207  ASN A OD1   1 
ATOM   1728  N ND2   . ASN A 1 210 ? 7.756   36.555  76.385  1.00 59.37  ?  207  ASN A ND2   1 
ATOM   1729  N N     . PHE A 1 211 ? 3.406   36.660  77.274  1.00 57.01  ?  208  PHE A N     1 
ATOM   1730  C CA    . PHE A 1 211 ? 2.506   35.521  77.146  1.00 57.04  ?  208  PHE A CA    1 
ATOM   1731  C C     . PHE A 1 211 ? 2.950   34.652  75.979  1.00 56.95  ?  208  PHE A C     1 
ATOM   1732  O O     . PHE A 1 211 ? 2.986   35.112  74.832  1.00 62.45  ?  208  PHE A O     1 
ATOM   1733  C CB    . PHE A 1 211 ? 1.063   35.987  76.960  1.00 56.68  ?  208  PHE A CB    1 
ATOM   1734  C CG    . PHE A 1 211 ? 0.536   36.770  78.121  1.00 56.77  ?  208  PHE A CG    1 
ATOM   1735  C CD1   . PHE A 1 211 ? 0.094   36.124  79.262  1.00 57.13  ?  208  PHE A CD1   1 
ATOM   1736  C CD2   . PHE A 1 211 ? 0.492   38.152  78.079  1.00 56.50  ?  208  PHE A CD2   1 
ATOM   1737  C CE1   . PHE A 1 211 ? -0.388  36.841  80.339  1.00 57.22  ?  208  PHE A CE1   1 
ATOM   1738  C CE2   . PHE A 1 211 ? 0.011   38.876  79.153  1.00 56.59  ?  208  PHE A CE2   1 
ATOM   1739  C CZ    . PHE A 1 211 ? -0.430  38.219  80.284  1.00 56.95  ?  208  PHE A CZ    1 
ATOM   1740  N N     . THR A 1 212 ? 3.278   33.400  76.277  1.00 57.32  ?  209  THR A N     1 
ATOM   1741  C CA    . THR A 1 212 ? 3.728   32.454  75.273  1.00 58.82  ?  209  THR A CA    1 
ATOM   1742  C C     . THR A 1 212 ? 2.537   31.679  74.714  1.00 58.36  ?  209  THR A C     1 
ATOM   1743  O O     . THR A 1 212 ? 1.383   31.902  75.087  1.00 59.94  ?  209  THR A O     1 
ATOM   1744  C CB    . THR A 1 212 ? 4.766   31.508  75.870  1.00 57.80  ?  209  THR A CB    1 
ATOM   1745  O OG1   . THR A 1 212 ? 4.102   30.485  76.623  1.00 58.09  ?  209  THR A OG1   1 
ATOM   1746  C CG2   . THR A 1 212 ? 5.700   32.271  76.793  1.00 58.06  ?  209  THR A CG2   1 
ATOM   1747  N N     . THR A 1 213 ? 2.825   30.750  73.799  1.00 57.07  ?  210  THR A N     1 
ATOM   1748  C CA    . THR A 1 213 ? 1.772   29.917  73.230  1.00 57.14  ?  210  THR A CA    1 
ATOM   1749  C C     . THR A 1 213 ? 1.066   29.092  74.298  1.00 58.05  ?  210  THR A C     1 
ATOM   1750  O O     . THR A 1 213 ? -0.138  28.832  74.188  1.00 60.57  ?  210  THR A O     1 
ATOM   1751  C CB    . THR A 1 213 ? 2.354   29.000  72.154  1.00 60.46  ?  210  THR A CB    1 
ATOM   1752  O OG1   . THR A 1 213 ? 3.651   28.547  72.564  1.00 61.42  ?  210  THR A OG1   1 
ATOM   1753  C CG2   . THR A 1 213 ? 2.469   29.738  70.829  1.00 58.41  ?  210  THR A CG2   1 
ATOM   1754  N N     . ARG A 1 214 ? 1.789   28.680  75.340  1.00 57.93  ?  211  ARG A N     1 
ATOM   1755  C CA    . ARG A 1 214 ? 1.188   27.843  76.371  1.00 63.03  ?  211  ARG A CA    1 
ATOM   1756  C C     . ARG A 1 214 ? 0.324   28.663  77.324  1.00 58.12  ?  211  ARG A C     1 
ATOM   1757  O O     . ARG A 1 214 ? -0.730  28.193  77.767  1.00 58.08  ?  211  ARG A O     1 
ATOM   1758  C CB    . ARG A 1 214 ? 2.280   27.092  77.134  1.00 69.41  ?  211  ARG A CB    1 
ATOM   1759  C CG    . ARG A 1 214 ? 1.839   25.752  77.706  1.00 63.02  ?  211  ARG A CG    1 
ATOM   1760  C CD    . ARG A 1 214 ? 3.006   25.016  78.351  1.00 62.52  ?  211  ARG A CD    1 
ATOM   1761  N NE    . ARG A 1 214 ? 3.394   23.821  77.602  1.00 64.47  ?  211  ARG A NE    1 
ATOM   1762  C CZ    . ARG A 1 214 ? 4.356   22.983  77.978  1.00 67.44  ?  211  ARG A CZ    1 
ATOM   1763  N NH1   . ARG A 1 214 ? 4.640   21.921  77.236  1.00 63.76  1  211  ARG A NH1   1 
ATOM   1764  N NH2   . ARG A 1 214 ? 5.036   23.205  79.095  1.00 73.96  ?  211  ARG A NH2   1 
ATOM   1765  N N     . ASP A 1 215 ? 0.753   29.886  77.648  1.00 57.96  ?  212  ASP A N     1 
ATOM   1766  C CA    . ASP A 1 215 ? -0.053  30.754  78.503  1.00 57.90  ?  212  ASP A CA    1 
ATOM   1767  C C     . ASP A 1 215 ? -1.384  31.084  77.840  1.00 57.45  ?  212  ASP A C     1 
ATOM   1768  O O     . ASP A 1 215 ? -2.439  31.046  78.483  1.00 57.47  ?  212  ASP A O     1 
ATOM   1769  C CB    . ASP A 1 215 ? 0.718   32.034  78.827  1.00 57.87  ?  212  ASP A CB    1 
ATOM   1770  C CG    . ASP A 1 215 ? 2.101   31.757  79.386  1.00 67.65  ?  212  ASP A CG    1 
ATOM   1771  O OD1   . ASP A 1 215 ? 2.247   30.799  80.172  1.00 67.34  ?  212  ASP A OD1   1 
ATOM   1772  O OD2   . ASP A 1 215 ? 3.043   32.498  79.032  1.00 71.02  -1 212  ASP A OD2   1 
ATOM   1773  N N     . ALA A 1 216 ? -1.350  31.411  76.545  1.00 60.02  ?  213  ALA A N     1 
ATOM   1774  C CA    . ALA A 1 216 ? -2.581  31.675  75.806  1.00 62.72  ?  213  ALA A CA    1 
ATOM   1775  C C     . ALA A 1 216 ? -3.544  30.499  75.901  1.00 60.54  ?  213  ALA A C     1 
ATOM   1776  O O     . ALA A 1 216 ? -4.753  30.687  76.081  1.00 56.53  ?  213  ALA A O     1 
ATOM   1777  C CB    . ALA A 1 216 ? -2.254  31.990  74.347  1.00 65.54  ?  213  ALA A CB    1 
ATOM   1778  N N     . GLU A 1 217 ? -3.024  29.273  75.784  1.00 56.98  ?  214  GLU A N     1 
ATOM   1779  C CA    . GLU A 1 217 ? -3.841  28.099  76.073  1.00 58.25  ?  214  GLU A CA    1 
ATOM   1780  C C     . GLU A 1 217 ? -4.279  28.089  77.530  1.00 57.62  ?  214  GLU A C     1 
ATOM   1781  O O     . GLU A 1 217 ? -5.437  27.786  77.839  1.00 57.48  ?  214  GLU A O     1 
ATOM   1782  C CB    . GLU A 1 217 ? -3.070  26.819  75.754  1.00 63.06  ?  214  GLU A CB    1 
ATOM   1783  C CG    . GLU A 1 217 ? -2.772  26.589  74.285  1.00 62.52  ?  214  GLU A CG    1 
ATOM   1784  C CD    . GLU A 1 217 ? -1.981  25.315  74.056  1.00 59.00  ?  214  GLU A CD    1 
ATOM   1785  O OE1   . GLU A 1 217 ? -1.847  24.892  72.888  1.00 59.40  ?  214  GLU A OE1   1 
ATOM   1786  O OE2   . GLU A 1 217 ? -1.494  24.735  75.050  1.00 57.90  -1 214  GLU A OE2   1 
ATOM   1787  N N     . LYS A 1 218 ? -3.362  28.422  78.439  1.00 57.82  ?  215  LYS A N     1 
ATOM   1788  C CA    . LYS A 1 218 ? -3.658  28.341  79.864  1.00 58.18  ?  215  LYS A CA    1 
ATOM   1789  C C     . LYS A 1 218 ? -4.711  29.365  80.270  1.00 57.93  ?  215  LYS A C     1 
ATOM   1790  O O     . LYS A 1 218 ? -5.656  29.043  80.999  1.00 58.05  ?  215  LYS A O     1 
ATOM   1791  C CB    . LYS A 1 218 ? -2.372  28.534  80.668  1.00 58.56  ?  215  LYS A CB    1 
ATOM   1792  C CG    . LYS A 1 218 ? -2.527  28.324  82.158  1.00 58.98  ?  215  LYS A CG    1 
ATOM   1793  C CD    . LYS A 1 218 ? -1.210  28.550  82.877  1.00 59.34  ?  215  LYS A CD    1 
ATOM   1794  C CE    . LYS A 1 218 ? -1.400  28.452  84.375  1.00 59.75  ?  215  LYS A CE    1 
ATOM   1795  N NZ    . LYS A 1 218 ? -2.575  29.258  84.806  1.00 60.79  1  215  LYS A NZ    1 
ATOM   1796  N N     . TYR A 1 219 ? -4.569  30.604  79.805  1.00 57.59  ?  216  TYR A N     1 
ATOM   1797  C CA    . TYR A 1 219 ? -5.486  31.677  80.166  1.00 57.98  ?  216  TYR A CA    1 
ATOM   1798  C C     . TYR A 1 219 ? -6.609  31.863  79.153  1.00 56.86  ?  216  TYR A C     1 
ATOM   1799  O O     . TYR A 1 219 ? -7.340  32.855  79.231  1.00 56.59  ?  216  TYR A O     1 
ATOM   1800  C CB    . TYR A 1 219 ? -4.710  32.983  80.355  1.00 61.00  ?  216  TYR A CB    1 
ATOM   1801  C CG    . TYR A 1 219 ? -3.565  32.830  81.329  1.00 63.31  ?  216  TYR A CG    1 
ATOM   1802  C CD1   . TYR A 1 219 ? -3.801  32.676  82.689  1.00 59.13  ?  216  TYR A CD1   1 
ATOM   1803  C CD2   . TYR A 1 219 ? -2.249  32.821  80.889  1.00 65.03  ?  216  TYR A CD2   1 
ATOM   1804  C CE1   . TYR A 1 219 ? -2.757  32.525  83.582  1.00 61.53  ?  216  TYR A CE1   1 
ATOM   1805  C CE2   . TYR A 1 219 ? -1.200  32.669  81.773  1.00 63.11  ?  216  TYR A CE2   1 
ATOM   1806  C CZ    . TYR A 1 219 ? -1.459  32.523  83.118  1.00 64.50  ?  216  TYR A CZ    1 
ATOM   1807  O OH    . TYR A 1 219 ? -0.413  32.374  83.999  1.00 66.06  ?  216  TYR A OH    1 
ATOM   1808  N N     . GLY A 1 220 ? -6.756  30.941  78.205  1.00 56.76  ?  217  GLY A N     1 
ATOM   1809  C CA    . GLY A 1 220 ? -7.967  30.871  77.411  1.00 57.85  ?  217  GLY A CA    1 
ATOM   1810  C C     . GLY A 1 220 ? -8.094  31.864  76.279  1.00 59.99  ?  217  GLY A C     1 
ATOM   1811  O O     . GLY A 1 220 ? -9.216  32.240  75.924  1.00 66.24  ?  217  GLY A O     1 
ATOM   1812  N N     . PHE A 1 221 ? -6.979  32.300  75.688  1.00 58.84  ?  218  PHE A N     1 
ATOM   1813  C CA    . PHE A 1 221 ? -7.049  33.146  74.501  1.00 55.29  ?  218  PHE A CA    1 
ATOM   1814  C C     . PHE A 1 221 ? -6.163  32.627  73.373  1.00 55.22  ?  218  PHE A C     1 
ATOM   1815  O O     . PHE A 1 221 ? -5.807  33.391  72.470  1.00 54.89  ?  218  PHE A O     1 
ATOM   1816  C CB    . PHE A 1 221 ? -6.707  34.603  74.839  1.00 55.16  ?  218  PHE A CB    1 
ATOM   1817  C CG    . PHE A 1 221 ? -5.326  34.805  75.402  1.00 55.48  ?  218  PHE A CG    1 
ATOM   1818  C CD1   . PHE A 1 221 ? -5.096  34.711  76.764  1.00 55.90  ?  218  PHE A CD1   1 
ATOM   1819  C CD2   . PHE A 1 221 ? -4.266  35.129  74.571  1.00 56.83  ?  218  PHE A CD2   1 
ATOM   1820  C CE1   . PHE A 1 221 ? -3.829  34.915  77.283  1.00 56.20  ?  218  PHE A CE1   1 
ATOM   1821  C CE2   . PHE A 1 221 ? -2.998  35.337  75.083  1.00 55.65  ?  218  PHE A CE2   1 
ATOM   1822  C CZ    . PHE A 1 221 ? -2.779  35.228  76.441  1.00 56.08  ?  218  PHE A CZ    1 
ATOM   1823  N N     . SER A 1 222 ? -5.823  31.335  73.389  1.00 60.28  ?  219  SER A N     1 
ATOM   1824  C CA    . SER A 1 222 ? -5.000  30.754  72.333  1.00 60.31  ?  219  SER A CA    1 
ATOM   1825  C C     . SER A 1 222 ? -5.704  30.720  70.982  1.00 60.38  ?  219  SER A C     1 
ATOM   1826  O O     . SER A 1 222 ? -5.026  30.667  69.950  1.00 61.56  ?  219  SER A O     1 
ATOM   1827  C CB    . SER A 1 222 ? -4.568  29.340  72.723  1.00 60.28  ?  219  SER A CB    1 
ATOM   1828  O OG    . SER A 1 222 ? -5.684  28.554  73.105  1.00 60.27  ?  219  SER A OG    1 
ATOM   1829  N N     . LYS A 1 223 ? -7.039  30.739  70.960  1.00 60.39  ?  220  LYS A N     1 
ATOM   1830  C CA    . LYS A 1 223 ? -7.753  30.744  69.685  1.00 66.08  ?  220  LYS A CA    1 
ATOM   1831  C C     . LYS A 1 223 ? -7.423  31.994  68.881  1.00 66.53  ?  220  LYS A C     1 
ATOM   1832  O O     . LYS A 1 223 ? -7.089  31.913  67.693  1.00 60.54  ?  220  LYS A O     1 
ATOM   1833  C CB    . LYS A 1 223 ? -9.260  30.632  69.919  1.00 60.46  ?  220  LYS A CB    1 
ATOM   1834  C CG    . LYS A 1 223 ? -10.105 31.115  68.747  1.00 60.52  ?  220  LYS A CG    1 
ATOM   1835  C CD    . LYS A 1 223 ? -11.558 30.698  68.898  1.00 60.53  ?  220  LYS A CD    1 
ATOM   1836  C CE    . LYS A 1 223 ? -12.444 31.365  67.858  1.00 60.59  ?  220  LYS A CE    1 
ATOM   1837  N NZ    . LYS A 1 223 ? -12.866 32.728  68.279  1.00 60.59  1  220  LYS A NZ    1 
ATOM   1838  N N     . GLU A 1 224 ? -7.504  33.165  69.516  1.00 72.77  ?  221  GLU A N     1 
ATOM   1839  C CA    . GLU A 1 224 ? -7.147  34.393  68.817  1.00 75.93  ?  221  GLU A CA    1 
ATOM   1840  C C     . GLU A 1 224 ? -5.654  34.445  68.518  1.00 78.86  ?  221  GLU A C     1 
ATOM   1841  O O     . GLU A 1 224 ? -5.249  35.003  67.492  1.00 77.35  ?  221  GLU A O     1 
ATOM   1842  C CB    . GLU A 1 224 ? -7.578  35.612  69.632  1.00 69.83  ?  221  GLU A CB    1 
ATOM   1843  C CG    . GLU A 1 224 ? -7.670  36.894  68.821  1.00 60.74  ?  221  GLU A CG    1 
ATOM   1844  C CD    . GLU A 1 224 ? -8.191  38.064  69.631  1.00 60.54  ?  221  GLU A CD    1 
ATOM   1845  O OE1   . GLU A 1 224 ? -8.524  37.868  70.818  1.00 60.49  ?  221  GLU A OE1   1 
ATOM   1846  O OE2   . GLU A 1 224 ? -8.262  39.184  69.081  1.00 61.90  -1 221  GLU A OE2   1 
ATOM   1847  N N     . VAL A 1 225 ? -4.825  33.864  69.391  1.00 77.45  ?  222  VAL A N     1 
ATOM   1848  C CA    . VAL A 1 225 ? -3.390  33.797  69.126  1.00 73.00  ?  222  VAL A CA    1 
ATOM   1849  C C     . VAL A 1 225 ? -3.119  32.963  67.880  1.00 80.08  ?  222  VAL A C     1 
ATOM   1850  O O     . VAL A 1 225 ? -2.266  33.312  67.053  1.00 81.42  ?  222  VAL A O     1 
ATOM   1851  C CB    . VAL A 1 225 ? -2.646  33.242  70.356  1.00 60.56  ?  222  VAL A CB    1 
ATOM   1852  C CG1   . VAL A 1 225 ? -1.179  32.990  70.033  1.00 60.39  ?  222  VAL A CG1   1 
ATOM   1853  C CG2   . VAL A 1 225 ? -2.772  34.203  71.524  1.00 60.36  ?  222  VAL A CG2   1 
ATOM   1854  N N     . HIS A 1 226 ? -3.847  31.854  67.719  1.00 74.23  ?  223  HIS A N     1 
ATOM   1855  C CA    . HIS A 1 226 ? -3.673  31.022  66.532  1.00 71.87  ?  223  HIS A CA    1 
ATOM   1856  C C     . HIS A 1 226 ? -4.188  31.723  65.280  1.00 75.02  ?  223  HIS A C     1 
ATOM   1857  O O     . HIS A 1 226 ? -3.537  31.683  64.230  1.00 75.66  ?  223  HIS A O     1 
ATOM   1858  C CB    . HIS A 1 226 ? -4.375  29.678  66.726  1.00 63.68  ?  223  HIS A CB    1 
ATOM   1859  C CG    . HIS A 1 226 ? -3.696  28.777  67.710  1.00 60.47  ?  223  HIS A CG    1 
ATOM   1860  N ND1   . HIS A 1 226 ? -2.327  28.740  67.864  1.00 60.45  ?  223  HIS A ND1   1 
ATOM   1861  C CD2   . HIS A 1 226 ? -4.198  27.880  68.592  1.00 60.43  ?  223  HIS A CD2   1 
ATOM   1862  C CE1   . HIS A 1 226 ? -2.013  27.859  68.797  1.00 60.40  ?  223  HIS A CE1   1 
ATOM   1863  N NE2   . HIS A 1 226 ? -3.131  27.323  69.255  1.00 60.39  ?  223  HIS A NE2   1 
ATOM   1864  N N     . GLU A 1 227 ? -5.357  32.365  65.369  1.00 73.91  ?  224  GLU A N     1 
ATOM   1865  C CA    . GLU A 1 227 ? -5.909  33.077  64.219  1.00 76.34  ?  224  GLU A CA    1 
ATOM   1866  C C     . GLU A 1 227 ? -4.939  34.138  63.714  1.00 77.92  ?  224  GLU A C     1 
ATOM   1867  O O     . GLU A 1 227 ? -4.663  34.226  62.511  1.00 74.26  ?  224  GLU A O     1 
ATOM   1868  C CB    . GLU A 1 227 ? -7.248  33.714  64.588  1.00 68.26  ?  224  GLU A CB    1 
ATOM   1869  C CG    . GLU A 1 227 ? -8.425  32.757  64.545  1.00 60.70  ?  224  GLU A CG    1 
ATOM   1870  C CD    . GLU A 1 227 ? -9.587  33.224  65.398  1.00 60.68  ?  224  GLU A CD    1 
ATOM   1871  O OE1   . GLU A 1 227 ? -9.485  34.314  66.004  1.00 60.67  ?  224  GLU A OE1   1 
ATOM   1872  O OE2   . GLU A 1 227 ? -10.600 32.497  65.469  1.00 61.27  -1 224  GLU A OE2   1 
ATOM   1873  N N     . ILE A 1 228 ? -4.409  34.952  64.629  1.00 78.12  ?  225  ILE A N     1 
ATOM   1874  C CA    . ILE A 1 228 ? -3.475  36.011  64.254  1.00 73.20  ?  225  ILE A CA    1 
ATOM   1875  C C     . ILE A 1 228 ? -2.273  35.434  63.520  1.00 70.88  ?  225  ILE A C     1 
ATOM   1876  O O     . ILE A 1 228 ? -1.817  35.983  62.510  1.00 76.82  ?  225  ILE A O     1 
ATOM   1877  C CB    . ILE A 1 228 ? -3.050  36.803  65.504  1.00 63.76  ?  225  ILE A CB    1 
ATOM   1878  C CG1   . ILE A 1 228 ? -4.227  37.624  66.024  1.00 60.65  ?  225  ILE A CG1   1 
ATOM   1879  C CG2   . ILE A 1 228 ? -1.856  37.691  65.207  1.00 60.66  ?  225  ILE A CG2   1 
ATOM   1880  C CD1   . ILE A 1 228 ? -4.061  38.065  67.443  1.00 60.59  ?  225  ILE A CD1   1 
ATOM   1881  N N     . TYR A 1 229 ? -1.749  34.308  64.003  1.00 60.67  ?  226  TYR A N     1 
ATOM   1882  C CA    . TYR A 1 229 ? -0.579  33.715  63.368  1.00 60.68  ?  226  TYR A CA    1 
ATOM   1883  C C     . TYR A 1 229 ? -0.887  33.140  61.990  1.00 61.12  ?  226  TYR A C     1 
ATOM   1884  O O     . TYR A 1 229 ? 0.029   33.021  61.168  1.00 61.75  ?  226  TYR A O     1 
ATOM   1885  C CB    . TYR A 1 229 ? 0.010   32.623  64.262  1.00 60.62  ?  226  TYR A CB    1 
ATOM   1886  C CG    . TYR A 1 229 ? 1.211   33.065  65.066  1.00 60.58  ?  226  TYR A CG    1 
ATOM   1887  C CD1   . TYR A 1 229 ? 2.424   33.333  64.444  1.00 60.60  ?  226  TYR A CD1   1 
ATOM   1888  C CD2   . TYR A 1 229 ? 1.138   33.205  66.448  1.00 60.52  ?  226  TYR A CD2   1 
ATOM   1889  C CE1   . TYR A 1 229 ? 3.530   33.734  65.172  1.00 60.56  ?  226  TYR A CE1   1 
ATOM   1890  C CE2   . TYR A 1 229 ? 2.242   33.605  67.186  1.00 60.49  ?  226  TYR A CE2   1 
ATOM   1891  C CZ    . TYR A 1 229 ? 3.435   33.868  66.541  1.00 62.87  ?  226  TYR A CZ    1 
ATOM   1892  O OH    . TYR A 1 229 ? 4.536   34.267  67.264  1.00 60.47  ?  226  TYR A OH    1 
ATOM   1893  N N     . LYS A 1 230 ? -2.149  32.801  61.709  1.00 60.91  ?  227  LYS A N     1 
ATOM   1894  C CA    . LYS A 1 230 ? -2.464  32.045  60.499  1.00 60.80  ?  227  LYS A CA    1 
ATOM   1895  C C     . LYS A 1 230 ? -2.514  32.939  59.258  1.00 60.87  ?  227  LYS A C     1 
ATOM   1896  O O     . LYS A 1 230 ? -1.800  32.694  58.277  1.00 66.73  ?  227  LYS A O     1 
ATOM   1897  C CB    . LYS A 1 230 ? -3.784  31.287  60.678  1.00 60.80  ?  227  LYS A CB    1 
ATOM   1898  C CG    . LYS A 1 230 ? -4.078  30.328  59.534  1.00 60.84  ?  227  LYS A CG    1 
ATOM   1899  C CD    . LYS A 1 230 ? -5.514  29.838  59.568  1.00 61.54  ?  227  LYS A CD    1 
ATOM   1900  C CE    . LYS A 1 230 ? -5.761  28.763  58.517  1.00 60.89  ?  227  LYS A CE    1 
ATOM   1901  N NZ    . LYS A 1 230 ? -5.398  29.205  57.140  1.00 60.95  1  227  LYS A NZ    1 
ATOM   1902  N N     . ASN A 1 231 ? -3.352  33.979  59.277  1.00 60.89  ?  228  ASN A N     1 
ATOM   1903  C CA    . ASN A 1 231 ? -3.514  34.830  58.104  1.00 66.43  ?  228  ASN A CA    1 
ATOM   1904  C C     . ASN A 1 231 ? -3.319  36.298  58.469  1.00 70.85  ?  228  ASN A C     1 
ATOM   1905  O O     . ASN A 1 231 ? -3.948  37.181  57.873  1.00 74.27  ?  228  ASN A O     1 
ATOM   1906  C CB    . ASN A 1 231 ? -4.880  34.616  57.451  1.00 70.11  ?  228  ASN A CB    1 
ATOM   1907  C CG    . ASN A 1 231 ? -5.161  33.146  57.173  1.00 77.55  ?  228  ASN A CG    1 
ATOM   1908  O OD1   . ASN A 1 231 ? -5.944  32.499  57.879  1.00 84.69  ?  228  ASN A OD1   1 
ATOM   1909  N ND2   . ASN A 1 231 ? -4.520  32.610  56.144  1.00 72.30  ?  228  ASN A ND2   1 
ATOM   1910  N N     . LYS A 1 232 ? -2.465  36.585  59.460  1.00 58.85  ?  229  LYS A N     1 
ATOM   1911  C CA    . LYS A 1 232 ? -2.086  37.956  59.786  1.00 60.40  ?  229  LYS A CA    1 
ATOM   1912  C C     . LYS A 1 232 ? -0.574  38.103  59.934  1.00 63.91  ?  229  LYS A C     1 
ATOM   1913  O O     . LYS A 1 232 ? -0.104  39.186  60.307  1.00 58.20  ?  229  LYS A O     1 
ATOM   1914  C CB    . LYS A 1 232 ? -2.791  38.441  61.059  1.00 53.39  ?  229  LYS A CB    1 
ATOM   1915  C CG    . LYS A 1 232 ? -3.041  39.943  61.131  1.00 53.48  ?  229  LYS A CG    1 
ATOM   1916  C CD    . LYS A 1 232 ? -3.875  40.263  62.354  1.00 54.47  ?  229  LYS A CD    1 
ATOM   1917  C CE    . LYS A 1 232 ? -4.435  41.664  62.275  1.00 55.25  ?  229  LYS A CE    1 
ATOM   1918  N NZ    . LYS A 1 232 ? -5.520  41.880  63.267  1.00 56.59  1  229  LYS A NZ    1 
ATOM   1919  N N     . VAL A 1 233 ? 0.196   37.043  59.666  1.00 62.97  ?  230  VAL A N     1 
ATOM   1920  C CA    . VAL A 1 233 ? 1.649   37.161  59.559  1.00 59.10  ?  230  VAL A CA    1 
ATOM   1921  C C     . VAL A 1 233 ? 2.057   37.493  58.123  1.00 66.53  ?  230  VAL A C     1 
ATOM   1922  O O     . VAL A 1 233 ? 3.043   38.206  57.907  1.00 65.39  ?  230  VAL A O     1 
ATOM   1923  C CB    . VAL A 1 233 ? 2.327   35.865  60.039  1.00 59.82  ?  230  VAL A CB    1 
ATOM   1924  C CG1   . VAL A 1 233 ? 3.828   35.877  59.746  1.00 62.30  ?  230  VAL A CG1   1 
ATOM   1925  C CG2   . VAL A 1 233 ? 2.080   35.654  61.528  1.00 46.92  ?  230  VAL A CG2   1 
ATOM   1926  N N     . PHE A 1 234 ? 1.303   36.999  57.130  1.00 63.35  ?  231  PHE A N     1 
ATOM   1927  C CA    . PHE A 1 234 ? 1.560   37.374  55.742  1.00 53.79  ?  231  PHE A CA    1 
ATOM   1928  C C     . PHE A 1 234 ? 1.441   38.878  55.553  1.00 57.37  ?  231  PHE A C     1 
ATOM   1929  O O     . PHE A 1 234 ? 2.199   39.474  54.781  1.00 59.89  ?  231  PHE A O     1 
ATOM   1930  C CB    . PHE A 1 234 ? 0.602   36.641  54.807  1.00 55.23  ?  231  PHE A CB    1 
ATOM   1931  C CG    . PHE A 1 234 ? 0.610   37.168  53.396  1.00 60.69  ?  231  PHE A CG    1 
ATOM   1932  C CD1   . PHE A 1 234 ? 1.627   36.825  52.519  1.00 63.16  ?  231  PHE A CD1   1 
ATOM   1933  C CD2   . PHE A 1 234 ? -0.396  38.011  52.948  1.00 61.10  ?  231  PHE A CD2   1 
ATOM   1934  C CE1   . PHE A 1 234 ? 1.641   37.312  51.224  1.00 59.95  ?  231  PHE A CE1   1 
ATOM   1935  C CE2   . PHE A 1 234 ? -0.387  38.501  51.653  1.00 58.27  ?  231  PHE A CE2   1 
ATOM   1936  C CZ    . PHE A 1 234 ? 0.633   38.150  50.792  1.00 57.56  ?  231  PHE A CZ    1 
ATOM   1937  N N     . GLU A 1 235 ? 0.489   39.511  56.245  1.00 57.29  ?  232  GLU A N     1 
ATOM   1938  C CA    . GLU A 1 235 ? 0.433   40.968  56.234  1.00 55.51  ?  232  GLU A CA    1 
ATOM   1939  C C     . GLU A 1 235 ? 1.685   41.568  56.859  1.00 58.01  ?  232  GLU A C     1 
ATOM   1940  O O     . GLU A 1 235 ? 2.077   42.688  56.510  1.00 51.41  ?  232  GLU A O     1 
ATOM   1941  C CB    . GLU A 1 235 ? -0.816  41.456  56.967  1.00 55.18  ?  232  GLU A CB    1 
ATOM   1942  C CG    . GLU A 1 235 ? -1.150  42.915  56.693  1.00 60.83  ?  232  GLU A CG    1 
ATOM   1943  C CD    . GLU A 1 235 ? -2.233  43.453  57.604  1.00 70.57  ?  232  GLU A CD    1 
ATOM   1944  O OE1   . GLU A 1 235 ? -2.417  42.894  58.706  1.00 73.98  ?  232  GLU A OE1   1 
ATOM   1945  O OE2   . GLU A 1 235 ? -2.899  44.437  57.215  1.00 72.98  -1 232  GLU A OE2   1 
ATOM   1946  N N     . GLY A 1 236 ? 2.327   40.837  57.775  1.00 58.66  ?  233  GLY A N     1 
ATOM   1947  C CA    . GLY A 1 236 ? 3.591   41.301  58.324  1.00 58.35  ?  233  GLY A CA    1 
ATOM   1948  C C     . GLY A 1 236 ? 4.709   41.286  57.301  1.00 53.57  ?  233  GLY A C     1 
ATOM   1949  O O     . GLY A 1 236 ? 5.507   42.224  57.229  1.00 54.94  ?  233  GLY A O     1 
ATOM   1950  N N     . PHE A 1 237 ? 4.788   40.217  56.500  1.00 51.52  ?  234  PHE A N     1 
ATOM   1951  C CA    . PHE A 1 237 ? 5.729   40.201  55.383  1.00 47.51  ?  234  PHE A CA    1 
ATOM   1952  C C     . PHE A 1 237 ? 5.449   41.347  54.420  1.00 52.49  ?  234  PHE A C     1 
ATOM   1953  O O     . PHE A 1 237 ? 6.380   41.964  53.888  1.00 47.84  ?  234  PHE A O     1 
ATOM   1954  C CB    . PHE A 1 237 ? 5.661   38.864  54.640  1.00 47.57  ?  234  PHE A CB    1 
ATOM   1955  C CG    . PHE A 1 237 ? 6.433   37.748  55.297  1.00 52.82  ?  234  PHE A CG    1 
ATOM   1956  C CD1   . PHE A 1 237 ? 7.819   37.729  55.261  1.00 46.41  ?  234  PHE A CD1   1 
ATOM   1957  C CD2   . PHE A 1 237 ? 5.770   36.701  55.920  1.00 46.95  ?  234  PHE A CD2   1 
ATOM   1958  C CE1   . PHE A 1 237 ? 8.530   36.698  55.852  1.00 45.85  ?  234  PHE A CE1   1 
ATOM   1959  C CE2   . PHE A 1 237 ? 6.476   35.668  56.514  1.00 46.39  ?  234  PHE A CE2   1 
ATOM   1960  C CZ    . PHE A 1 237 ? 7.857   35.668  56.481  1.00 47.72  ?  234  PHE A CZ    1 
ATOM   1961  N N     . LYS A 1 238 ? 4.168   41.652  54.192  1.00 58.28  ?  235  LYS A N     1 
ATOM   1962  C CA    . LYS A 1 238 ? 3.780   42.691  53.247  1.00 59.81  ?  235  LYS A CA    1 
ATOM   1963  C C     . LYS A 1 238 ? 3.847   44.094  53.845  1.00 57.43  ?  235  LYS A C     1 
ATOM   1964  O O     . LYS A 1 238 ? 3.975   45.066  53.093  1.00 56.15  ?  235  LYS A O     1 
ATOM   1965  C CB    . LYS A 1 238 ? 2.370   42.408  52.714  1.00 60.56  ?  235  LYS A CB    1 
ATOM   1966  C CG    . LYS A 1 238 ? 1.880   43.400  51.669  1.00 55.24  ?  235  LYS A CG    1 
ATOM   1967  C CD    . LYS A 1 238 ? 1.040   42.736  50.593  1.00 56.79  ?  235  LYS A CD    1 
ATOM   1968  C CE    . LYS A 1 238 ? 0.659   43.738  49.513  1.00 53.44  ?  235  LYS A CE    1 
ATOM   1969  N NZ    . LYS A 1 238 ? 1.003   43.241  48.152  1.00 51.65  1  235  LYS A NZ    1 
ATOM   1970  N N     . LYS A 1 239 ? 3.775   44.228  55.168  1.00 52.51  ?  236  LYS A N     1 
ATOM   1971  C CA    . LYS A 1 239 ? 3.918   45.535  55.799  1.00 57.29  ?  236  LYS A CA    1 
ATOM   1972  C C     . LYS A 1 239 ? 5.371   45.964  55.964  1.00 48.19  ?  236  LYS A C     1 
ATOM   1973  O O     . LYS A 1 239 ? 5.617   47.072  56.448  1.00 48.10  ?  236  LYS A O     1 
ATOM   1974  C CB    . LYS A 1 239 ? 3.230   45.544  57.167  1.00 60.60  ?  236  LYS A CB    1 
ATOM   1975  C CG    . LYS A 1 239 ? 1.799   46.061  57.148  1.00 60.76  ?  236  LYS A CG    1 
ATOM   1976  C CD    . LYS A 1 239 ? 1.113   45.816  58.483  1.00 58.65  ?  236  LYS A CD    1 
ATOM   1977  C CE    . LYS A 1 239 ? 0.644   47.112  59.118  1.00 53.67  ?  236  LYS A CE    1 
ATOM   1978  N NZ    . LYS A 1 239 ? 0.200   46.894  60.522  1.00 55.93  1  236  LYS A NZ    1 
ATOM   1979  N N     . ILE A 1 240 ? 6.329   45.119  55.571  1.00 47.80  ?  237  ILE A N     1 
ATOM   1980  C CA    . ILE A 1 240 ? 7.743   45.441  55.786  1.00 47.22  ?  237  ILE A CA    1 
ATOM   1981  C C     . ILE A 1 240 ? 8.150   46.763  55.147  1.00 54.22  ?  237  ILE A C     1 
ATOM   1982  O O     . ILE A 1 240 ? 8.776   47.588  55.837  1.00 47.05  ?  237  ILE A O     1 
ATOM   1983  C CB    . ILE A 1 240 ? 8.626   44.269  55.321  1.00 50.86  ?  237  ILE A CB    1 
ATOM   1984  C CG1   . ILE A 1 240 ? 8.432   43.056  56.230  1.00 46.54  ?  237  ILE A CG1   1 
ATOM   1985  C CG2   . ILE A 1 240 ? 10.090  44.685  55.277  1.00 46.31  ?  237  ILE A CG2   1 
ATOM   1986  C CD1   . ILE A 1 240 ? 9.297   41.872  55.856  1.00 46.14  ?  237  ILE A CD1   1 
ATOM   1987  N N     . PRO A 1 241 ? 7.858   47.038  53.865  1.00 51.07  ?  238  PRO A N     1 
ATOM   1988  C CA    . PRO A 1 241 ? 8.367   48.285  53.266  1.00 49.75  ?  238  PRO A CA    1 
ATOM   1989  C C     . PRO A 1 241 ? 7.898   49.543  53.976  1.00 49.38  ?  238  PRO A C     1 
ATOM   1990  O O     . PRO A 1 241 ? 8.695   50.469  54.171  1.00 47.86  ?  238  PRO A O     1 
ATOM   1991  C CB    . PRO A 1 241 ? 7.843   48.217  51.825  1.00 48.53  ?  238  PRO A CB    1 
ATOM   1992  C CG    . PRO A 1 241 ? 7.626   46.770  51.567  1.00 49.24  ?  238  PRO A CG    1 
ATOM   1993  C CD    . PRO A 1 241 ? 7.143   46.217  52.868  1.00 48.30  ?  238  PRO A CD    1 
ATOM   1994  N N     . LYS A 1 242 ? 6.628   49.606  54.375  1.00 50.24  ?  239  LYS A N     1 
ATOM   1995  C CA    . LYS A 1 242 ? 6.121   50.812  55.021  1.00 56.39  ?  239  LYS A CA    1 
ATOM   1996  C C     . LYS A 1 242 ? 6.487   50.855  56.502  1.00 54.29  ?  239  LYS A C     1 
ATOM   1997  O O     . LYS A 1 242 ? 7.019   51.859  56.987  1.00 57.87  ?  239  LYS A O     1 
ATOM   1998  C CB    . LYS A 1 242 ? 4.606   50.905  54.840  1.00 60.02  ?  239  LYS A CB    1 
ATOM   1999  C CG    . LYS A 1 242 ? 3.991   52.128  55.489  1.00 57.43  ?  239  LYS A CG    1 
ATOM   2000  C CD    . LYS A 1 242 ? 2.576   52.371  54.996  1.00 59.25  ?  239  LYS A CD    1 
ATOM   2001  C CE    . LYS A 1 242 ? 2.047   53.691  55.526  1.00 59.28  ?  239  LYS A CE    1 
ATOM   2002  N NZ    . LYS A 1 242 ? 3.030   54.789  55.303  1.00 57.85  1  239  LYS A NZ    1 
ATOM   2003  N N     . THR A 1 243 ? 6.209   49.772  57.233  1.00 51.34  ?  240  THR A N     1 
ATOM   2004  C CA    . THR A 1 243 ? 6.429   49.774  58.677  1.00 47.54  ?  240  THR A CA    1 
ATOM   2005  C C     . THR A 1 243 ? 7.909   49.917  59.016  1.00 46.88  ?  240  THR A C     1 
ATOM   2006  O O     . THR A 1 243 ? 8.269   50.591  59.988  1.00 46.57  ?  240  THR A O     1 
ATOM   2007  C CB    . THR A 1 243 ? 5.852   48.497  59.294  1.00 49.97  ?  240  THR A CB    1 
ATOM   2008  O OG1   . THR A 1 243 ? 4.449   48.426  59.013  1.00 56.34  ?  240  THR A OG1   1 
ATOM   2009  C CG2   . THR A 1 243 ? 6.058   48.479  60.803  1.00 51.28  ?  240  THR A CG2   1 
ATOM   2010  N N     . LEU A 1 244 ? 8.784   49.300  58.223  1.00 46.65  ?  241  LEU A N     1 
ATOM   2011  C CA    . LEU A 1 244 ? 10.223  49.362  58.449  1.00 46.02  ?  241  LEU A CA    1 
ATOM   2012  C C     . LEU A 1 244 ? 10.918  50.329  57.497  1.00 46.76  ?  241  LEU A C     1 
ATOM   2013  O O     . LEU A 1 244 ? 12.091  50.133  57.167  1.00 45.70  ?  241  LEU A O     1 
ATOM   2014  C CB    . LEU A 1 244 ? 10.835  47.967  58.330  1.00 45.64  ?  241  LEU A CB    1 
ATOM   2015  C CG    . LEU A 1 244 ? 10.252  46.894  59.247  1.00 45.51  ?  241  LEU A CG    1 
ATOM   2016  C CD1   . LEU A 1 244 ? 11.011  45.590  59.085  1.00 45.08  ?  241  LEU A CD1   1 
ATOM   2017  C CD2   . LEU A 1 244 ? 10.273  47.358  60.697  1.00 45.19  ?  241  LEU A CD2   1 
ATOM   2018  N N     . GLY A 1 245 ? 10.214  51.380  57.064  1.00 49.70  ?  242  GLY A N     1 
ATOM   2019  C CA    . GLY A 1 245 ? 10.766  52.276  56.061  1.00 49.39  ?  242  GLY A CA    1 
ATOM   2020  C C     . GLY A 1 245 ? 12.100  52.879  56.457  1.00 46.22  ?  242  GLY A C     1 
ATOM   2021  O O     . GLY A 1 245 ? 12.970  53.094  55.609  1.00 50.50  ?  242  GLY A O     1 
ATOM   2022  N N     . PHE A 1 246 ? 12.285  53.151  57.751  1.00 45.85  ?  243  PHE A N     1 
ATOM   2023  C CA    . PHE A 1 246 ? 13.548  53.707  58.227  1.00 45.30  ?  243  PHE A CA    1 
ATOM   2024  C C     . PHE A 1 246 ? 14.744  52.833  57.863  1.00 45.27  ?  243  PHE A C     1 
ATOM   2025  O O     . PHE A 1 246 ? 15.879  53.322  57.863  1.00 44.42  ?  243  PHE A O     1 
ATOM   2026  C CB    . PHE A 1 246 ? 13.497  53.915  59.742  1.00 44.97  ?  243  PHE A CB    1 
ATOM   2027  C CG    . PHE A 1 246 ? 13.117  52.681  60.513  1.00 44.77  ?  243  PHE A CG    1 
ATOM   2028  C CD1   . PHE A 1 246 ? 14.079  51.758  60.891  1.00 44.17  ?  243  PHE A CD1   1 
ATOM   2029  C CD2   . PHE A 1 246 ? 11.798  52.449  60.865  1.00 45.17  ?  243  PHE A CD2   1 
ATOM   2030  C CE1   . PHE A 1 246 ? 13.731  50.625  61.600  1.00 43.99  ?  243  PHE A CE1   1 
ATOM   2031  C CE2   . PHE A 1 246 ? 11.444  51.318  61.576  1.00 44.99  ?  243  PHE A CE2   1 
ATOM   2032  C CZ    . PHE A 1 246 ? 12.411  50.406  61.943  1.00 44.40  ?  243  PHE A CZ    1 
ATOM   2033  N N     . LEU A 1 247 ? 14.517  51.555  57.552  1.00 50.82  ?  244  LEU A N     1 
ATOM   2034  C CA    . LEU A 1 247 ? 15.594  50.692  57.082  1.00 44.40  ?  244  LEU A CA    1 
ATOM   2035  C C     . LEU A 1 247 ? 16.012  50.995  55.649  1.00 44.64  ?  244  LEU A C     1 
ATOM   2036  O O     . LEU A 1 247 ? 16.964  50.376  55.163  1.00 44.31  ?  244  LEU A O     1 
ATOM   2037  C CB    . LEU A 1 247 ? 15.187  49.221  57.190  1.00 44.35  ?  244  LEU A CB    1 
ATOM   2038  C CG    . LEU A 1 247 ? 15.015  48.630  58.592  1.00 45.09  ?  244  LEU A CG    1 
ATOM   2039  C CD1   . LEU A 1 247 ? 14.822  47.125  58.504  1.00 43.90  ?  244  LEU A CD1   1 
ATOM   2040  C CD2   . LEU A 1 247 ? 16.204  48.971  59.477  1.00 43.33  ?  244  LEU A CD2   1 
ATOM   2041  N N     . ASN A 1 248 ? 15.335  51.924  54.965  1.00 45.20  ?  245  ASN A N     1 
ATOM   2042  C CA    . ASN A 1 248 ? 15.767  52.322  53.629  1.00 47.67  ?  245  ASN A CA    1 
ATOM   2043  C C     . ASN A 1 248 ? 17.203  52.824  53.626  1.00 46.18  ?  245  ASN A C     1 
ATOM   2044  O O     . ASN A 1 248 ? 17.840  52.852  52.567  1.00 44.94  ?  245  ASN A O     1 
ATOM   2045  C CB    . ASN A 1 248 ? 14.839  53.403  53.062  1.00 53.46  ?  245  ASN A CB    1 
ATOM   2046  C CG    . ASN A 1 248 ? 15.178  54.801  53.567  1.00 55.19  ?  245  ASN A CG    1 
ATOM   2047  O OD1   . ASN A 1 248 ? 15.584  54.985  54.716  1.00 57.09  ?  245  ASN A OD1   1 
ATOM   2048  N ND2   . ASN A 1 248 ? 15.011  55.795  52.702  1.00 65.83  ?  245  ASN A ND2   1 
ATOM   2049  N N     . LYS A 1 249 ? 17.720  53.218  54.791  1.00 54.73  ?  246  LYS A N     1 
ATOM   2050  C CA    . LYS A 1 249 ? 19.100  53.674  54.890  1.00 63.91  ?  246  LYS A CA    1 
ATOM   2051  C C     . LYS A 1 249 ? 20.079  52.612  54.401  1.00 62.99  ?  246  LYS A C     1 
ATOM   2052  O O     . LYS A 1 249 ? 21.080  52.937  53.751  1.00 57.44  ?  246  LYS A O     1 
ATOM   2053  C CB    . LYS A 1 249 ? 19.411  54.071  56.336  1.00 66.08  ?  246  LYS A CB    1 
ATOM   2054  C CG    . LYS A 1 249 ? 18.794  55.400  56.760  1.00 63.67  ?  246  LYS A CG    1 
ATOM   2055  C CD    . LYS A 1 249 ? 19.011  55.696  58.239  1.00 57.59  ?  246  LYS A CD    1 
ATOM   2056  C CE    . LYS A 1 249 ? 18.803  57.177  58.526  1.00 49.93  ?  246  LYS A CE    1 
ATOM   2057  N NZ    . LYS A 1 249 ? 18.586  57.455  59.972  1.00 44.60  1  246  LYS A NZ    1 
ATOM   2058  N N     . ILE A 1 250 ? 19.809  51.341  54.690  1.00 54.46  ?  247  ILE A N     1 
ATOM   2059  C CA    . ILE A 1 250 ? 20.762  50.273  54.404  1.00 45.59  ?  247  ILE A CA    1 
ATOM   2060  C C     . ILE A 1 250 ? 20.259  49.259  53.386  1.00 43.95  ?  247  ILE A C     1 
ATOM   2061  O O     . ILE A 1 250 ? 21.060  48.433  52.922  1.00 43.02  ?  247  ILE A O     1 
ATOM   2062  C CB    . ILE A 1 250 ? 21.205  49.546  55.693  1.00 46.55  ?  247  ILE A CB    1 
ATOM   2063  C CG1   . ILE A 1 250 ? 20.012  48.881  56.382  1.00 42.60  ?  247  ILE A CG1   1 
ATOM   2064  C CG2   . ILE A 1 250 ? 21.908  50.511  56.639  1.00 45.06  ?  247  ILE A CG2   1 
ATOM   2065  C CD1   . ILE A 1 250 ? 20.400  48.041  57.585  1.00 43.83  ?  247  ILE A CD1   1 
ATOM   2066  N N     . THR A 1 251 ? 18.982  49.279  53.009  1.00 43.92  ?  248  THR A N     1 
ATOM   2067  C CA    . THR A 1 251 ? 18.492  48.278  52.070  1.00 48.24  ?  248  THR A CA    1 
ATOM   2068  C C     . THR A 1 251 ? 17.238  48.791  51.376  1.00 48.27  ?  248  THR A C     1 
ATOM   2069  O O     . THR A 1 251 ? 16.570  49.710  51.856  1.00 47.82  ?  248  THR A O     1 
ATOM   2070  C CB    . THR A 1 251 ? 18.208  46.942  52.773  1.00 49.50  ?  248  THR A CB    1 
ATOM   2071  O OG1   . THR A 1 251 ? 17.998  45.916  51.794  1.00 53.38  ?  248  THR A OG1   1 
ATOM   2072  C CG2   . THR A 1 251 ? 16.976  47.051  53.658  1.00 44.27  ?  248  THR A CG2   1 
ATOM   2073  N N     . ASN A 1 252 ? 16.929  48.179  50.231  1.00 45.31  ?  249  ASN A N     1 
ATOM   2074  C CA    . ASN A 1 252 ? 15.710  48.470  49.478  1.00 51.22  ?  249  ASN A CA    1 
ATOM   2075  C C     . ASN A 1 252 ? 14.686  47.398  49.834  1.00 46.21  ?  249  ASN A C     1 
ATOM   2076  O O     . ASN A 1 252 ? 14.740  46.276  49.322  1.00 46.42  ?  249  ASN A O     1 
ATOM   2077  C CB    . ASN A 1 252 ? 15.983  48.504  47.976  1.00 46.31  ?  249  ASN A CB    1 
ATOM   2078  C CG    . ASN A 1 252 ? 14.767  48.937  47.164  1.00 51.12  ?  249  ASN A CG    1 
ATOM   2079  O OD1   . ASN A 1 252 ? 13.647  48.995  47.673  1.00 52.89  ?  249  ASN A OD1   1 
ATOM   2080  N ND2   . ASN A 1 252 ? 14.988  49.238  45.890  1.00 48.50  ?  249  ASN A ND2   1 
ATOM   2081  N N     . LEU A 1 253 ? 13.736  47.757  50.700  1.00 46.40  ?  250  LEU A N     1 
ATOM   2082  C CA    . LEU A 1 253 ? 12.710  46.823  51.146  1.00 46.58  ?  250  LEU A CA    1 
ATOM   2083  C C     . LEU A 1 253 ? 11.757  46.400  50.037  1.00 51.61  ?  250  LEU A C     1 
ATOM   2084  O O     . LEU A 1 253 ? 10.922  45.519  50.268  1.00 53.17  ?  250  LEU A O     1 
ATOM   2085  C CB    . LEU A 1 253 ? 11.915  47.443  52.293  1.00 50.65  ?  250  LEU A CB    1 
ATOM   2086  C CG    . LEU A 1 253 ? 12.732  47.785  53.535  1.00 46.08  ?  250  LEU A CG    1 
ATOM   2087  C CD1   . LEU A 1 253 ? 11.853  48.457  54.568  1.00 52.35  ?  250  LEU A CD1   1 
ATOM   2088  C CD2   . LEU A 1 253 ? 13.373  46.530  54.106  1.00 47.42  ?  250  LEU A CD2   1 
ATOM   2089  N N     . ASN A 1 254 ? 11.855  46.998  48.852  1.00 47.54  ?  251  ASN A N     1 
ATOM   2090  C CA    . ASN A 1 254 ? 10.983  46.670  47.733  1.00 48.14  ?  251  ASN A CA    1 
ATOM   2091  C C     . ASN A 1 254 ? 11.630  45.729  46.728  1.00 48.03  ?  251  ASN A C     1 
ATOM   2092  O O     . ASN A 1 254 ? 10.971  45.324  45.767  1.00 48.49  ?  251  ASN A O     1 
ATOM   2093  C CB    . ASN A 1 254 ? 10.535  47.953  47.024  1.00 53.99  ?  251  ASN A CB    1 
ATOM   2094  C CG    . ASN A 1 254 ? 9.557   48.763  47.852  1.00 58.66  ?  251  ASN A CG    1 
ATOM   2095  O OD1   . ASN A 1 254 ? 8.509   48.262  48.260  1.00 60.66  ?  251  ASN A OD1   1 
ATOM   2096  N ND2   . ASN A 1 254 ? 9.900   50.020  48.111  1.00 55.83  ?  251  ASN A ND2   1 
ATOM   2097  N N     . GLU A 1 255 ? 12.896  45.374  46.920  1.00 47.43  ?  252  GLU A N     1 
ATOM   2098  C CA    . GLU A 1 255 ? 13.601  44.440  46.045  1.00 47.26  ?  252  GLU A CA    1 
ATOM   2099  C C     . GLU A 1 255 ? 13.723  43.115  46.793  1.00 50.39  ?  252  GLU A C     1 
ATOM   2100  O O     . GLU A 1 255 ? 14.655  42.903  47.571  1.00 53.34  ?  252  GLU A O     1 
ATOM   2101  C CB    . GLU A 1 255 ? 14.957  44.998  45.628  1.00 51.75  ?  252  GLU A CB    1 
ATOM   2102  C CG    . GLU A 1 255 ? 14.837  46.202  44.708  1.00 66.55  ?  252  GLU A CG    1 
ATOM   2103  C CD    . GLU A 1 255 ? 16.174  46.721  44.224  1.00 71.56  ?  252  GLU A CD    1 
ATOM   2104  O OE1   . GLU A 1 255 ? 17.212  46.361  44.819  1.00 77.17  ?  252  GLU A OE1   1 
ATOM   2105  O OE2   . GLU A 1 255 ? 16.185  47.492  43.241  1.00 68.71  -1 252  GLU A OE2   1 
ATOM   2106  N N     . ASN A 1 256 ? 12.765  42.225  46.551  1.00 56.98  ?  253  ASN A N     1 
ATOM   2107  C CA    . ASN A 1 256 ? 12.703  40.966  47.271  1.00 56.81  ?  253  ASN A CA    1 
ATOM   2108  C C     . ASN A 1 256 ? 13.768  39.995  46.761  1.00 50.05  ?  253  ASN A C     1 
ATOM   2109  O O     . ASN A 1 256 ? 14.377  40.180  45.702  1.00 53.88  ?  253  ASN A O     1 
ATOM   2110  C CB    . ASN A 1 256 ? 11.313  40.342  47.143  1.00 59.97  ?  253  ASN A CB    1 
ATOM   2111  C CG    . ASN A 1 256 ? 10.239  41.154  47.845  1.00 64.71  ?  253  ASN A CG    1 
ATOM   2112  O OD1   . ASN A 1 256 ? 10.515  41.883  48.797  1.00 75.49  ?  253  ASN A OD1   1 
ATOM   2113  N ND2   . ASN A 1 256 ? 9.001   41.024  47.379  1.00 59.96  ?  253  ASN A ND2   1 
ATOM   2114  N N     . TYR A 1 257 ? 13.984  38.942  47.543  1.00 46.06  ?  254  TYR A N     1 
ATOM   2115  C CA    . TYR A 1 257 ? 14.911  37.868  47.200  1.00 48.16  ?  254  TYR A CA    1 
ATOM   2116  C C     . TYR A 1 257 ? 14.123  36.781  46.479  1.00 52.50  ?  254  TYR A C     1 
ATOM   2117  O O     . TYR A 1 257 ? 13.288  36.107  47.089  1.00 55.11  ?  254  TYR A O     1 
ATOM   2118  C CB    . TYR A 1 257 ? 15.576  37.327  48.464  1.00 44.99  ?  254  TYR A CB    1 
ATOM   2119  C CG    . TYR A 1 257 ? 16.769  36.419  48.244  1.00 44.46  ?  254  TYR A CG    1 
ATOM   2120  C CD1   . TYR A 1 257 ? 16.602  35.093  47.867  1.00 44.47  ?  254  TYR A CD1   1 
ATOM   2121  C CD2   . TYR A 1 257 ? 18.063  36.882  48.452  1.00 43.94  ?  254  TYR A CD2   1 
ATOM   2122  C CE1   . TYR A 1 257 ? 17.690  34.261  47.679  1.00 43.98  ?  254  TYR A CE1   1 
ATOM   2123  C CE2   . TYR A 1 257 ? 19.158  36.055  48.268  1.00 43.45  ?  254  TYR A CE2   1 
ATOM   2124  C CZ    . TYR A 1 257 ? 18.965  34.747  47.882  1.00 43.47  ?  254  TYR A CZ    1 
ATOM   2125  O OH    . TYR A 1 257 ? 20.050  33.920  47.698  1.00 47.61  ?  254  TYR A OH    1 
ATOM   2126  N N     . GLN A 1 258 ? 14.374  36.617  45.185  1.00 55.99  ?  255  GLN A N     1 
ATOM   2127  C CA    . GLN A 1 258 ? 13.713  35.559  44.429  1.00 62.87  ?  255  GLN A CA    1 
ATOM   2128  C C     . GLN A 1 258 ? 14.721  34.502  43.987  1.00 56.64  ?  255  GLN A C     1 
ATOM   2129  O O     . GLN A 1 258 ? 15.927  34.752  43.954  1.00 49.01  ?  255  GLN A O     1 
ATOM   2130  C CB    . GLN A 1 258 ? 12.977  36.128  43.213  1.00 67.46  ?  255  GLN A CB    1 
ATOM   2131  C CG    . GLN A 1 258 ? 11.760  35.306  42.811  1.00 72.39  ?  255  GLN A CG    1 
ATOM   2132  C CD    . GLN A 1 258 ? 11.191  35.702  41.464  1.00 73.14  ?  255  GLN A CD    1 
ATOM   2133  O OE1   . GLN A 1 258 ? 10.979  36.883  41.186  1.00 76.09  ?  255  GLN A OE1   1 
ATOM   2134  N NE2   . GLN A 1 258 ? 10.944  34.711  40.616  1.00 68.97  ?  255  GLN A NE2   1 
ATOM   2135  N N     . ASP A 1 261 ? 15.728  29.108  39.566  1.00 61.17  ?  258  ASP A N     1 
ATOM   2136  C CA    . ASP A 1 261 ? 14.755  28.060  39.278  1.00 63.90  ?  258  ASP A CA    1 
ATOM   2137  C C     . ASP A 1 261 ? 15.130  26.764  39.983  1.00 54.43  ?  258  ASP A C     1 
ATOM   2138  O O     . ASP A 1 261 ? 14.274  26.078  40.543  1.00 61.79  ?  258  ASP A O     1 
ATOM   2139  C CB    . ASP A 1 261 ? 14.651  27.822  37.772  1.00 65.20  ?  258  ASP A CB    1 
ATOM   2140  C CG    . ASP A 1 261 ? 14.891  29.082  36.967  1.00 72.67  ?  258  ASP A CG    1 
ATOM   2141  O OD1   . ASP A 1 261 ? 16.067  29.475  36.823  1.00 76.57  ?  258  ASP A OD1   1 
ATOM   2142  O OD2   . ASP A 1 261 ? 13.909  29.676  36.476  1.00 76.80  -1 258  ASP A OD2   1 
ATOM   2143  N N     . GLY A 1 262 ? 16.419  26.438  39.951  1.00 49.77  ?  259  GLY A N     1 
ATOM   2144  C CA    . GLY A 1 262 ? 16.897  25.192  40.513  1.00 48.18  ?  259  GLY A CA    1 
ATOM   2145  C C     . GLY A 1 262 ? 17.662  25.357  41.810  1.00 49.46  ?  259  GLY A C     1 
ATOM   2146  O O     . GLY A 1 262 ? 18.608  24.609  42.075  1.00 50.02  ?  259  GLY A O     1 
ATOM   2147  N N     . TYR A 1 263 ? 17.271  26.335  42.625  1.00 43.04  ?  260  TYR A N     1 
ATOM   2148  C CA    . TYR A 1 263 ? 17.879  26.549  43.930  1.00 42.04  ?  260  TYR A CA    1 
ATOM   2149  C C     . TYR A 1 263 ? 17.011  26.031  45.069  1.00 44.64  ?  260  TYR A C     1 
ATOM   2150  O O     . TYR A 1 263 ? 17.306  26.301  46.238  1.00 38.01  ?  260  TYR A O     1 
ATOM   2151  C CB    . TYR A 1 263 ? 18.197  28.030  44.131  1.00 39.15  ?  260  TYR A CB    1 
ATOM   2152  C CG    . TYR A 1 263 ? 19.564  28.402  43.611  1.00 41.69  ?  260  TYR A CG    1 
ATOM   2153  C CD1   . TYR A 1 263 ? 19.844  28.366  42.252  1.00 34.20  ?  260  TYR A CD1   1 
ATOM   2154  C CD2   . TYR A 1 263 ? 20.581  28.773  44.480  1.00 49.14  ?  260  TYR A CD2   1 
ATOM   2155  C CE1   . TYR A 1 263 ? 21.094  28.696  41.773  1.00 51.78  ?  260  TYR A CE1   1 
ATOM   2156  C CE2   . TYR A 1 263 ? 21.835  29.105  44.010  1.00 52.80  ?  260  TYR A CE2   1 
ATOM   2157  C CZ    . TYR A 1 263 ? 22.087  29.065  42.656  1.00 55.08  ?  260  TYR A CZ    1 
ATOM   2158  O OH    . TYR A 1 263 ? 23.336  29.397  42.184  1.00 66.10  ?  260  TYR A OH    1 
ATOM   2159  N N     . LYS A 1 264 ? 15.953  25.295  44.754  1.00 40.40  ?  261  LYS A N     1 
ATOM   2160  C CA    . LYS A 1 264 ? 15.145  24.619  45.759  1.00 48.63  ?  261  LYS A CA    1 
ATOM   2161  C C     . LYS A 1 264 ? 14.819  23.239  45.210  1.00 47.51  ?  261  LYS A C     1 
ATOM   2162  O O     . LYS A 1 264 ? 14.137  23.121  44.187  1.00 50.62  ?  261  LYS A O     1 
ATOM   2163  C CB    . LYS A 1 264 ? 13.877  25.409  46.085  1.00 51.29  ?  261  LYS A CB    1 
ATOM   2164  C CG    . LYS A 1 264 ? 13.131  25.960  44.871  1.00 55.96  ?  261  LYS A CG    1 
ATOM   2165  C CD    . LYS A 1 264 ? 11.759  26.501  45.255  1.00 58.89  ?  261  LYS A CD    1 
ATOM   2166  C CE    . LYS A 1 264 ? 11.033  25.528  46.170  1.00 54.13  ?  261  LYS A CE    1 
ATOM   2167  N NZ    . LYS A 1 264 ? 9.559   25.712  46.168  1.00 58.30  1  261  LYS A NZ    1 
ATOM   2168  N N     . ILE A 1 265 ? 15.310  22.197  45.878  1.00 32.20  ?  262  ILE A N     1 
ATOM   2169  C CA    . ILE A 1 265 ? 15.078  20.820  45.462  1.00 35.58  ?  262  ILE A CA    1 
ATOM   2170  C C     . ILE A 1 265 ? 14.285  20.101  46.546  1.00 48.49  ?  262  ILE A C     1 
ATOM   2171  O O     . ILE A 1 265 ? 14.513  20.306  47.745  1.00 47.03  ?  262  ILE A O     1 
ATOM   2172  C CB    . ILE A 1 265 ? 16.400  20.088  45.142  1.00 43.01  ?  262  ILE A CB    1 
ATOM   2173  C CG1   . ILE A 1 265 ? 16.109  18.744  44.470  1.00 55.38  ?  262  ILE A CG1   1 
ATOM   2174  C CG2   . ILE A 1 265 ? 17.250  19.887  46.395  1.00 45.42  ?  262  ILE A CG2   1 
ATOM   2175  C CD1   . ILE A 1 265 ? 17.287  18.151  43.723  1.00 54.39  ?  262  ILE A CD1   1 
ATOM   2176  N N     . PHE A 1 266 ? 13.322  19.289  46.118  1.00 40.87  ?  263  PHE A N     1 
ATOM   2177  C CA    . PHE A 1 266 ? 12.517  18.482  47.023  1.00 32.97  ?  263  PHE A CA    1 
ATOM   2178  C C     . PHE A 1 266 ? 13.161  17.110  47.166  1.00 35.09  ?  263  PHE A C     1 
ATOM   2179  O O     . PHE A 1 266 ? 13.411  16.428  46.167  1.00 40.35  ?  263  PHE A O     1 
ATOM   2180  C CB    . PHE A 1 266 ? 11.086  18.362  46.496  1.00 43.49  ?  263  PHE A CB    1 
ATOM   2181  C CG    . PHE A 1 266 ? 10.215  17.428  47.288  1.00 52.53  ?  263  PHE A CG    1 
ATOM   2182  C CD1   . PHE A 1 266 ? 9.509   17.886  48.387  1.00 56.51  ?  263  PHE A CD1   1 
ATOM   2183  C CD2   . PHE A 1 266 ? 10.090  16.096  46.923  1.00 53.57  ?  263  PHE A CD2   1 
ATOM   2184  C CE1   . PHE A 1 266 ? 8.703   17.033  49.115  1.00 50.37  ?  263  PHE A CE1   1 
ATOM   2185  C CE2   . PHE A 1 266 ? 9.287   15.238  47.649  1.00 54.20  ?  263  PHE A CE2   1 
ATOM   2186  C CZ    . PHE A 1 266 ? 8.592   15.708  48.746  1.00 54.18  ?  263  PHE A CZ    1 
ATOM   2187  N N     . ILE A 1 267 ? 13.434  16.708  48.404  1.00 39.89  ?  264  ILE A N     1 
ATOM   2188  C CA    . ILE A 1 267 ? 14.109  15.447  48.682  1.00 35.73  ?  264  ILE A CA    1 
ATOM   2189  C C     . ILE A 1 267 ? 13.066  14.382  48.985  1.00 38.73  ?  264  ILE A C     1 
ATOM   2190  O O     . ILE A 1 267 ? 12.230  14.550  49.883  1.00 29.75  ?  264  ILE A O     1 
ATOM   2191  C CB    . ILE A 1 267 ? 15.108  15.587  49.842  1.00 44.60  ?  264  ILE A CB    1 
ATOM   2192  C CG1   . ILE A 1 267 ? 16.206  16.581  49.473  1.00 49.12  ?  264  ILE A CG1   1 
ATOM   2193  C CG2   . ILE A 1 267 ? 15.710  14.234  50.181  1.00 29.74  ?  264  ILE A CG2   1 
ATOM   2194  C CD1   . ILE A 1 267 ? 17.059  16.149  48.304  1.00 53.22  ?  264  ILE A CD1   1 
ATOM   2195  N N     . ASN A 1 268 ? 13.128  13.282  48.244  1.00 51.88  ?  265  ASN A N     1 
ATOM   2196  C CA    . ASN A 1 268 ? 12.174  12.189  48.354  1.00 50.36  ?  265  ASN A CA    1 
ATOM   2197  C C     . ASN A 1 268 ? 12.767  11.114  49.261  1.00 30.01  ?  265  ASN A C     1 
ATOM   2198  O O     . ASN A 1 268 ? 13.789  10.508  48.923  1.00 39.97  ?  265  ASN A O     1 
ATOM   2199  C CB    . ASN A 1 268 ? 11.862  11.632  46.965  1.00 54.04  ?  265  ASN A CB    1 
ATOM   2200  C CG    . ASN A 1 268 ? 10.563  10.860  46.917  1.00 49.07  ?  265  ASN A CG    1 
ATOM   2201  O OD1   . ASN A 1 268 ? 9.479   11.442  46.928  1.00 51.10  ?  265  ASN A OD1   1 
ATOM   2202  N ND2   . ASN A 1 268 ? 10.667  9.541   46.838  1.00 39.51  ?  265  ASN A ND2   1 
ATOM   2203  N N     . VAL A 1 269 ? 12.133  10.883  50.409  1.00 31.53  ?  266  VAL A N     1 
ATOM   2204  C CA    . VAL A 1 269 ? 12.611  9.924   51.403  1.00 30.87  ?  266  VAL A CA    1 
ATOM   2205  C C     . VAL A 1 269 ? 11.709  8.698   51.364  1.00 41.76  ?  266  VAL A C     1 
ATOM   2206  O O     . VAL A 1 269 ? 10.517  8.781   51.685  1.00 39.14  ?  266  VAL A O     1 
ATOM   2207  C CB    . VAL A 1 269 ? 12.650  10.536  52.812  1.00 38.36  ?  266  VAL A CB    1 
ATOM   2208  C CG1   . VAL A 1 269 ? 13.234  9.540   53.806  1.00 27.93  ?  266  VAL A CG1   1 
ATOM   2209  C CG2   . VAL A 1 269 ? 13.452  11.829  52.813  1.00 39.45  ?  266  VAL A CG2   1 
ATOM   2210  N N     . ILE A 1 270 ? 12.280  7.558   50.984  1.00 40.21  ?  267  ILE A N     1 
ATOM   2211  C CA    . ILE A 1 270 ? 11.565  6.289   50.914  1.00 32.66  ?  267  ILE A CA    1 
ATOM   2212  C C     . ILE A 1 270 ? 12.099  5.380   52.011  1.00 38.13  ?  267  ILE A C     1 
ATOM   2213  O O     . ILE A 1 270 ? 13.316  5.188   52.130  1.00 27.94  ?  267  ILE A O     1 
ATOM   2214  C CB    . ILE A 1 270 ? 11.719  5.627   49.534  1.00 31.80  ?  267  ILE A CB    1 
ATOM   2215  C CG1   . ILE A 1 270 ? 11.208  6.552   48.429  1.00 43.24  ?  267  ILE A CG1   1 
ATOM   2216  C CG2   . ILE A 1 270 ? 10.978  4.296   49.497  1.00 30.15  ?  267  ILE A CG2   1 
ATOM   2217  C CD1   . ILE A 1 270 ? 9.707   6.744   48.432  1.00 44.77  ?  267  ILE A CD1   1 
ATOM   2218  N N     . TYR A 1 271 ? 11.191  4.822   52.805  1.00 60.67  ?  268  TYR A N     1 
ATOM   2219  C CA    . TYR A 1 271 ? 11.549  3.877   53.853  1.00 56.95  ?  268  TYR A CA    1 
ATOM   2220  C C     . TYR A 1 271 ? 11.479  2.453   53.314  1.00 58.85  ?  268  TYR A C     1 
ATOM   2221  O O     . TYR A 1 271 ? 10.525  2.086   52.623  1.00 63.10  ?  268  TYR A O     1 
ATOM   2222  C CB    . TYR A 1 271 ? 10.613  4.023   55.054  1.00 34.66  ?  268  TYR A CB    1 
ATOM   2223  C CG    . TYR A 1 271 ? 10.642  5.379   55.730  1.00 25.99  ?  268  TYR A CG    1 
ATOM   2224  C CD1   . TYR A 1 271 ? 9.901   6.444   55.230  1.00 26.92  ?  268  TYR A CD1   1 
ATOM   2225  C CD2   . TYR A 1 271 ? 11.394  5.587   56.879  1.00 29.22  ?  268  TYR A CD2   1 
ATOM   2226  C CE1   . TYR A 1 271 ? 9.918   7.679   55.849  1.00 29.48  ?  268  TYR A CE1   1 
ATOM   2227  C CE2   . TYR A 1 271 ? 11.417  6.820   57.506  1.00 28.27  ?  268  TYR A CE2   1 
ATOM   2228  C CZ    . TYR A 1 271 ? 10.678  7.862   56.986  1.00 31.28  ?  268  TYR A CZ    1 
ATOM   2229  O OH    . TYR A 1 271 ? 10.699  9.088   57.608  1.00 28.89  ?  268  TYR A OH    1 
ATOM   2230  N N     . LYS A 1 272 ? 12.498  1.654   53.632  1.00 40.64  ?  269  LYS A N     1 
ATOM   2231  C CA    . LYS A 1 272 ? 12.543  0.242   53.261  1.00 36.88  ?  269  LYS A CA    1 
ATOM   2232  C C     . LYS A 1 272 ? 12.177  -0.601  54.478  1.00 37.03  ?  269  LYS A C     1 
ATOM   2233  O O     . LYS A 1 272 ? 12.933  -0.655  55.453  1.00 29.43  ?  269  LYS A O     1 
ATOM   2234  C CB    . LYS A 1 272 ? 13.922  -0.152  52.734  1.00 41.92  ?  269  LYS A CB    1 
ATOM   2235  C CG    . LYS A 1 272 ? 14.134  0.089   51.247  1.00 50.93  ?  269  LYS A CG    1 
ATOM   2236  C CD    . LYS A 1 272 ? 15.476  -0.475  50.787  1.00 52.54  ?  269  LYS A CD    1 
ATOM   2237  C CE    . LYS A 1 272 ? 15.341  -1.883  50.212  1.00 51.31  ?  269  LYS A CE    1 
ATOM   2238  N NZ    . LYS A 1 272 ? 14.707  -2.843  51.158  1.00 51.60  1  269  LYS A NZ    1 
ATOM   2239  N N     . PHE A 1 273 ? 11.029  -1.263  54.416  1.00 35.18  ?  270  PHE A N     1 
ATOM   2240  C CA    . PHE A 1 273 ? 10.607  -2.200  55.442  1.00 30.58  ?  270  PHE A CA    1 
ATOM   2241  C C     . PHE A 1 273 ? 10.909  -3.624  54.970  1.00 39.49  ?  270  PHE A C     1 
ATOM   2242  O O     . PHE A 1 273 ? 11.619  -3.835  53.981  1.00 34.98  ?  270  PHE A O     1 
ATOM   2243  C CB    . PHE A 1 273 ? 9.128   -1.975  55.761  1.00 32.61  ?  270  PHE A CB    1 
ATOM   2244  C CG    . PHE A 1 273 ? 8.800   -0.551  56.116  1.00 33.52  ?  270  PHE A CG    1 
ATOM   2245  C CD1   . PHE A 1 273 ? 9.258   0.002   57.302  1.00 21.47  ?  270  PHE A CD1   1 
ATOM   2246  C CD2   . PHE A 1 273 ? 8.042   0.236   55.264  1.00 39.79  ?  270  PHE A CD2   1 
ATOM   2247  C CE1   . PHE A 1 273 ? 8.967   1.316   57.630  1.00 22.76  ?  270  PHE A CE1   1 
ATOM   2248  C CE2   . PHE A 1 273 ? 7.743   1.549   55.588  1.00 31.57  ?  270  PHE A CE2   1 
ATOM   2249  C CZ    . PHE A 1 273 ? 8.207   2.090   56.774  1.00 28.62  ?  270  PHE A CZ    1 
ATOM   2250  N N     . LYS A 1 274 ? 10.373  -4.622  55.677  1.00 30.85  ?  271  LYS A N     1 
ATOM   2251  C CA    . LYS A 1 274 ? 10.664  -6.004  55.307  1.00 28.17  ?  271  LYS A CA    1 
ATOM   2252  C C     . LYS A 1 274 ? 9.946   -6.399  54.022  1.00 27.46  ?  271  LYS A C     1 
ATOM   2253  O O     . LYS A 1 274 ? 10.558  -6.963  53.108  1.00 30.19  ?  271  LYS A O     1 
ATOM   2254  C CB    . LYS A 1 274 ? 10.285  -6.955  56.442  1.00 30.76  ?  271  LYS A CB    1 
ATOM   2255  C CG    . LYS A 1 274 ? 10.486  -8.431  56.108  1.00 35.64  ?  271  LYS A CG    1 
ATOM   2256  C CD    . LYS A 1 274 ? 10.744  -9.265  57.353  1.00 40.76  ?  271  LYS A CD    1 
ATOM   2257  C CE    . LYS A 1 274 ? 10.307  -10.711 57.158  1.00 46.37  ?  271  LYS A CE    1 
ATOM   2258  N NZ    . LYS A 1 274 ? 8.833   -10.859 57.327  1.00 44.65  1  271  LYS A NZ    1 
ATOM   2259  N N     . ASN A 1 275 ? 8.647   -6.115  53.929  1.00 29.66  ?  272  ASN A N     1 
ATOM   2260  C CA    . ASN A 1 275 ? 7.839   -6.608  52.822  1.00 41.30  ?  272  ASN A CA    1 
ATOM   2261  C C     . ASN A 1 275 ? 7.307   -5.487  51.933  1.00 45.43  ?  272  ASN A C     1 
ATOM   2262  O O     . ASN A 1 275 ? 6.355   -5.704  51.176  1.00 46.92  ?  272  ASN A O     1 
ATOM   2263  C CB    . ASN A 1 275 ? 6.689   -7.458  53.359  1.00 44.21  ?  272  ASN A CB    1 
ATOM   2264  C CG    . ASN A 1 275 ? 7.159   -8.523  54.332  1.00 44.21  ?  272  ASN A CG    1 
ATOM   2265  O OD1   . ASN A 1 275 ? 8.124   -9.243  54.068  1.00 35.49  ?  272  ASN A OD1   1 
ATOM   2266  N ND2   . ASN A 1 275 ? 6.488   -8.615  55.474  1.00 29.95  ?  272  ASN A ND2   1 
ATOM   2267  N N     . GLY A 1 276 ? 7.903   -4.303  51.997  1.00 36.25  ?  273  GLY A N     1 
ATOM   2268  C CA    . GLY A 1 276 ? 7.451   -3.218  51.147  1.00 33.02  ?  273  GLY A CA    1 
ATOM   2269  C C     . GLY A 1 276 ? 8.218   -1.948  51.434  1.00 28.98  ?  273  GLY A C     1 
ATOM   2270  O O     . GLY A 1 276 ? 9.094   -1.900  52.305  1.00 29.37  ?  273  GLY A O     1 
ATOM   2271  N N     . GLU A 1 277 ? 7.872   -0.913  50.676  1.00 29.54  ?  274  GLU A N     1 
ATOM   2272  C CA    . GLU A 1 277 ? 8.468   0.406   50.814  1.00 41.94  ?  274  GLU A CA    1 
ATOM   2273  C C     . GLU A 1 277 ? 7.364   1.450   50.874  1.00 44.98  ?  274  GLU A C     1 
ATOM   2274  O O     . GLU A 1 277 ? 6.231   1.211   50.446  1.00 42.21  ?  274  GLU A O     1 
ATOM   2275  C CB    . GLU A 1 277 ? 9.423   0.720   49.655  1.00 38.47  ?  274  GLU A CB    1 
ATOM   2276  C CG    . GLU A 1 277 ? 10.688  -0.121  49.645  1.00 59.15  ?  274  GLU A CG    1 
ATOM   2277  C CD    . GLU A 1 277 ? 11.536  0.123   48.411  1.00 63.41  ?  274  GLU A CD    1 
ATOM   2278  O OE1   . GLU A 1 277 ? 11.086  0.877   47.524  1.00 59.15  ?  274  GLU A OE1   1 
ATOM   2279  O OE2   . GLU A 1 277 ? 12.650  -0.437  48.326  1.00 70.54  -1 274  GLU A OE2   1 
ATOM   2280  N N     . SER A 1 278 ? 7.709   2.619   51.406  1.00 33.87  ?  275  SER A N     1 
ATOM   2281  C CA    . SER A 1 278 ? 6.741   3.701   51.518  1.00 36.92  ?  275  SER A CA    1 
ATOM   2282  C C     . SER A 1 278 ? 7.463   4.992   51.866  1.00 31.12  ?  275  SER A C     1 
ATOM   2283  O O     . SER A 1 278 ? 8.586   4.982   52.379  1.00 28.37  ?  275  SER A O     1 
ATOM   2284  C CB    . SER A 1 278 ? 5.675   3.394   52.576  1.00 34.30  ?  275  SER A CB    1 
ATOM   2285  O OG    . SER A 1 278 ? 4.761   4.471   52.704  1.00 38.25  ?  275  SER A OG    1 
ATOM   2286  N N     . ARG A 1 279 ? 6.797   6.104   51.570  1.00 32.87  ?  276  ARG A N     1 
ATOM   2287  C CA    . ARG A 1 279 ? 7.210   7.415   52.048  1.00 34.05  ?  276  ARG A CA    1 
ATOM   2288  C C     . ARG A 1 279 ? 6.630   7.740   53.416  1.00 33.78  ?  276  ARG A C     1 
ATOM   2289  O O     . ARG A 1 279 ? 6.996   8.766   53.999  1.00 36.86  ?  276  ARG A O     1 
ATOM   2290  C CB    . ARG A 1 279 ? 6.780   8.497   51.058  1.00 31.45  ?  276  ARG A CB    1 
ATOM   2291  C CG    . ARG A 1 279 ? 5.272   8.690   51.011  1.00 31.73  ?  276  ARG A CG    1 
ATOM   2292  C CD    . ARG A 1 279 ? 4.866   9.856   50.125  1.00 47.35  ?  276  ARG A CD    1 
ATOM   2293  N NE    . ARG A 1 279 ? 5.114   9.582   48.713  1.00 35.73  ?  276  ARG A NE    1 
ATOM   2294  C CZ    . ARG A 1 279 ? 6.234   9.906   48.077  1.00 44.54  ?  276  ARG A CZ    1 
ATOM   2295  N NH1   . ARG A 1 279 ? 7.210   10.521  48.731  1.00 33.24  1  276  ARG A NH1   1 
ATOM   2296  N NH2   . ARG A 1 279 ? 6.378   9.615   46.790  1.00 48.14  ?  276  ARG A NH2   1 
ATOM   2297  N N     . TYR A 1 280 ? 5.727   6.904   53.922  1.00 27.81  ?  277  TYR A N     1 
ATOM   2298  C CA    . TYR A 1 280 ? 5.077   7.103   55.210  1.00 41.89  ?  277  TYR A CA    1 
ATOM   2299  C C     . TYR A 1 280 ? 5.669   6.118   56.207  1.00 38.73  ?  277  TYR A C     1 
ATOM   2300  O O     . TYR A 1 280 ? 5.558   4.901   56.022  1.00 27.15  ?  277  TYR A O     1 
ATOM   2301  C CB    . TYR A 1 280 ? 3.563   6.909   55.100  1.00 49.14  ?  277  TYR A CB    1 
ATOM   2302  C CG    . TYR A 1 280 ? 2.906   7.722   54.004  1.00 48.42  ?  277  TYR A CG    1 
ATOM   2303  C CD1   . TYR A 1 280 ? 2.549   9.046   54.217  1.00 46.38  ?  277  TYR A CD1   1 
ATOM   2304  C CD2   . TYR A 1 280 ? 2.637   7.163   52.760  1.00 46.54  ?  277  TYR A CD2   1 
ATOM   2305  C CE1   . TYR A 1 280 ? 1.950   9.793   53.222  1.00 49.43  ?  277  TYR A CE1   1 
ATOM   2306  C CE2   . TYR A 1 280 ? 2.033   7.904   51.757  1.00 46.23  ?  277  TYR A CE2   1 
ATOM   2307  C CZ    . TYR A 1 280 ? 1.695   9.220   51.994  1.00 53.44  ?  277  TYR A CZ    1 
ATOM   2308  O OH    . TYR A 1 280 ? 1.098   9.969   51.005  1.00 56.85  ?  277  TYR A OH    1 
ATOM   2309  N N     . ALA A 1 281 ? 6.291   6.646   57.264  1.00 41.64  ?  278  ALA A N     1 
ATOM   2310  C CA    . ALA A 1 281 ? 6.859   5.780   58.292  1.00 39.40  ?  278  ALA A CA    1 
ATOM   2311  C C     . ALA A 1 281 ? 5.806   4.859   58.896  1.00 36.27  ?  278  ALA A C     1 
ATOM   2312  O O     . ALA A 1 281 ? 6.119   3.724   59.272  1.00 36.10  ?  278  ALA A O     1 
ATOM   2313  C CB    . ALA A 1 281 ? 7.523   6.625   59.382  1.00 35.23  ?  278  ALA A CB    1 
ATOM   2314  N N     . LYS A 1 282 ? 4.554   5.318   58.976  1.00 26.53  ?  279  LYS A N     1 
ATOM   2315  C CA    . LYS A 1 282 ? 3.477   4.527   59.560  1.00 33.62  ?  279  LYS A CA    1 
ATOM   2316  C C     . LYS A 1 282 ? 3.158   3.275   58.756  1.00 32.91  ?  279  LYS A C     1 
ATOM   2317  O O     . LYS A 1 282 ? 2.524   2.359   59.294  1.00 31.96  ?  279  LYS A O     1 
ATOM   2318  C CB    . LYS A 1 282 ? 2.222   5.390   59.707  1.00 40.29  ?  279  LYS A CB    1 
ATOM   2319  C CG    . LYS A 1 282 ? 1.669   5.884   58.390  1.00 41.47  ?  279  LYS A CG    1 
ATOM   2320  C CD    . LYS A 1 282 ? 0.324   6.557   58.565  1.00 47.23  ?  279  LYS A CD    1 
ATOM   2321  C CE    . LYS A 1 282 ? -0.199  7.054   57.230  1.00 44.83  ?  279  LYS A CE    1 
ATOM   2322  N NZ    . LYS A 1 282 ? -1.618  7.487   57.311  1.00 60.91  1  279  LYS A NZ    1 
ATOM   2323  N N     . ASP A 1 283 ? 3.579   3.202   57.495  1.00 26.31  ?  280  ASP A N     1 
ATOM   2324  C CA    . ASP A 1 283 ? 3.448   1.949   56.758  1.00 28.13  ?  280  ASP A CA    1 
ATOM   2325  C C     . ASP A 1 283 ? 4.332   0.841   57.303  1.00 34.48  ?  280  ASP A C     1 
ATOM   2326  O O     . ASP A 1 283 ? 4.282   -0.270  56.776  1.00 30.89  ?  280  ASP A O     1 
ATOM   2327  C CB    . ASP A 1 283 ? 3.769   2.168   55.273  1.00 23.58  ?  280  ASP A CB    1 
ATOM   2328  C CG    . ASP A 1 283 ? 2.576   2.645   54.493  1.00 38.05  ?  280  ASP A CG    1 
ATOM   2329  O OD1   . ASP A 1 283 ? 1.446   2.543   55.030  1.00 29.60  ?  280  ASP A OD1   1 
ATOM   2330  O OD2   . ASP A 1 283 ? 2.762   3.106   53.345  1.00 45.13  -1 280  ASP A OD2   1 
ATOM   2331  N N     . VAL A 1 284 ? 5.127   1.114   58.337  1.00 33.41  ?  281  VAL A N     1 
ATOM   2332  C CA    . VAL A 1 284 ? 5.888   0.053   58.989  1.00 30.23  ?  281  VAL A CA    1 
ATOM   2333  C C     . VAL A 1 284 ? 4.960   -1.049  59.485  1.00 24.36  ?  281  VAL A C     1 
ATOM   2334  O O     . VAL A 1 284 ? 5.346   -2.224  59.530  1.00 30.30  ?  281  VAL A O     1 
ATOM   2335  C CB    . VAL A 1 284 ? 6.753   0.637   60.135  1.00 28.43  ?  281  VAL A CB    1 
ATOM   2336  C CG1   . VAL A 1 284 ? 5.877   1.143   61.277  1.00 21.82  ?  281  VAL A CG1   1 
ATOM   2337  C CG2   . VAL A 1 284 ? 7.784   -0.379  60.627  1.00 30.47  ?  281  VAL A CG2   1 
ATOM   2338  N N     . PHE A 1 285 ? 3.726   -0.699  59.855  1.00 30.38  ?  282  PHE A N     1 
ATOM   2339  C CA    . PHE A 1 285 ? 2.746   -1.691  60.280  1.00 24.32  ?  282  PHE A CA    1 
ATOM   2340  C C     . PHE A 1 285 ? 2.147   -2.469  59.118  1.00 30.37  ?  282  PHE A C     1 
ATOM   2341  O O     . PHE A 1 285 ? 1.511   -3.503  59.349  1.00 26.99  ?  282  PHE A O     1 
ATOM   2342  C CB    . PHE A 1 285 ? 1.627   -1.020  61.080  1.00 34.05  ?  282  PHE A CB    1 
ATOM   2343  C CG    . PHE A 1 285 ? 2.087   -0.414  62.372  1.00 34.47  ?  282  PHE A CG    1 
ATOM   2344  C CD1   . PHE A 1 285 ? 2.339   -1.213  63.477  1.00 32.26  ?  282  PHE A CD1   1 
ATOM   2345  C CD2   . PHE A 1 285 ? 2.268   0.953   62.486  1.00 25.64  ?  282  PHE A CD2   1 
ATOM   2346  C CE1   . PHE A 1 285 ? 2.764   -0.660  64.670  1.00 29.61  ?  282  PHE A CE1   1 
ATOM   2347  C CE2   . PHE A 1 285 ? 2.691   1.511   63.677  1.00 28.06  ?  282  PHE A CE2   1 
ATOM   2348  C CZ    . PHE A 1 285 ? 2.940   0.702   64.771  1.00 26.48  ?  282  PHE A CZ    1 
ATOM   2349  N N     . LYS A 1 286 ? 2.322   -1.997  57.884  1.00 37.23  ?  283  LYS A N     1 
ATOM   2350  C CA    . LYS A 1 286 ? 1.915   -2.758  56.708  1.00 40.54  ?  283  LYS A CA    1 
ATOM   2351  C C     . LYS A 1 286 ? 2.967   -3.770  56.279  1.00 32.66  ?  283  LYS A C     1 
ATOM   2352  O O     . LYS A 1 286 ? 2.621   -4.877  55.855  1.00 33.83  ?  283  LYS A O     1 
ATOM   2353  C CB    . LYS A 1 286 ? 1.628   -1.822  55.529  1.00 36.93  ?  283  LYS A CB    1 
ATOM   2354  C CG    . LYS A 1 286 ? 0.276   -1.136  55.550  1.00 41.26  ?  283  LYS A CG    1 
ATOM   2355  C CD    . LYS A 1 286 ? 0.031   -0.428  54.228  1.00 50.90  ?  283  LYS A CD    1 
ATOM   2356  C CE    . LYS A 1 286 ? -1.194  0.464   54.285  1.00 61.59  ?  283  LYS A CE    1 
ATOM   2357  N NZ    . LYS A 1 286 ? -1.175  1.459   53.175  1.00 66.96  1  283  LYS A NZ    1 
ATOM   2358  N N     . TYR A 1 287 ? 4.247   -3.412  56.382  1.00 26.47  ?  284  TYR A N     1 
ATOM   2359  C CA    . TYR A 1 287 ? 5.319   -4.183  55.766  1.00 26.74  ?  284  TYR A CA    1 
ATOM   2360  C C     . TYR A 1 287 ? 6.359   -4.667  56.767  1.00 37.13  ?  284  TYR A C     1 
ATOM   2361  O O     . TYR A 1 287 ? 7.389   -5.215  56.350  1.00 32.61  ?  284  TYR A O     1 
ATOM   2362  C CB    . TYR A 1 287 ? 5.984   -3.352  54.665  1.00 43.16  ?  284  TYR A CB    1 
ATOM   2363  C CG    . TYR A 1 287 ? 4.989   -2.742  53.702  1.00 46.25  ?  284  TYR A CG    1 
ATOM   2364  C CD1   . TYR A 1 287 ? 4.321   -3.530  52.773  1.00 49.11  ?  284  TYR A CD1   1 
ATOM   2365  C CD2   . TYR A 1 287 ? 4.716   -1.378  53.723  1.00 42.68  ?  284  TYR A CD2   1 
ATOM   2366  C CE1   . TYR A 1 287 ? 3.408   -2.979  51.890  1.00 48.39  ?  284  TYR A CE1   1 
ATOM   2367  C CE2   . TYR A 1 287 ? 3.804   -0.817  52.843  1.00 42.43  ?  284  TYR A CE2   1 
ATOM   2368  C CZ    . TYR A 1 287 ? 3.153   -1.624  51.929  1.00 51.22  ?  284  TYR A CZ    1 
ATOM   2369  O OH    . TYR A 1 287 ? 2.245   -1.078  51.049  1.00 56.71  ?  284  TYR A OH    1 
ATOM   2370  N N     . SER A 1 288 ? 6.121   -4.461  58.067  1.00 31.09  ?  285  SER A N     1 
ATOM   2371  C CA    . SER A 1 288 ? 6.901   -5.030  59.163  1.00 34.00  ?  285  SER A CA    1 
ATOM   2372  C C     . SER A 1 288 ? 8.292   -4.414  59.270  1.00 33.64  ?  285  SER A C     1 
ATOM   2373  O O     . SER A 1 288 ? 8.769   -3.778  58.324  1.00 27.31  ?  285  SER A O     1 
ATOM   2374  C CB    . SER A 1 288 ? 6.997   -6.553  59.013  1.00 26.27  ?  285  SER A CB    1 
ATOM   2375  O OG    . SER A 1 288 ? 7.477   -7.157  60.206  1.00 27.90  ?  285  SER A OG    1 
ATOM   2376  N N     . PHE A 1 289 ? 8.934   -4.580  60.430  1.00 23.45  ?  286  PHE A N     1 
ATOM   2377  C CA    . PHE A 1 289 ? 10.310  -4.131  60.613  1.00 23.15  ?  286  PHE A CA    1 
ATOM   2378  C C     . PHE A 1 289 ? 11.201  -4.690  59.513  1.00 27.44  ?  286  PHE A C     1 
ATOM   2379  O O     . PHE A 1 289 ? 11.070  -5.851  59.121  1.00 34.29  ?  286  PHE A O     1 
ATOM   2380  C CB    . PHE A 1 289 ? 10.861  -4.584  61.969  1.00 31.13  ?  286  PHE A CB    1 
ATOM   2381  C CG    . PHE A 1 289 ? 10.594  -3.633  63.104  1.00 26.94  ?  286  PHE A CG    1 
ATOM   2382  C CD1   . PHE A 1 289 ? 9.573   -2.698  63.036  1.00 25.52  ?  286  PHE A CD1   1 
ATOM   2383  C CD2   . PHE A 1 289 ? 11.378  -3.677  64.246  1.00 25.81  ?  286  PHE A CD2   1 
ATOM   2384  C CE1   . PHE A 1 289 ? 9.339   -1.830  64.090  1.00 27.36  ?  286  PHE A CE1   1 
ATOM   2385  C CE2   . PHE A 1 289 ? 11.152  -2.812  65.301  1.00 23.98  ?  286  PHE A CE2   1 
ATOM   2386  C CZ    . PHE A 1 289 ? 10.132  -1.887  65.223  1.00 24.74  ?  286  PHE A CZ    1 
ATOM   2387  N N     . TYR A 1 290 ? 12.118  -3.852  59.022  1.00 27.70  ?  287  TYR A N     1 
ATOM   2388  C CA    . TYR A 1 290 ? 13.145  -4.325  58.099  1.00 31.91  ?  287  TYR A CA    1 
ATOM   2389  C C     . TYR A 1 290 ? 13.867  -5.545  58.662  1.00 31.08  ?  287  TYR A C     1 
ATOM   2390  O O     . TYR A 1 290 ? 14.131  -6.514  57.941  1.00 24.67  ?  287  TYR A O     1 
ATOM   2391  C CB    . TYR A 1 290 ? 14.135  -3.196  57.810  1.00 33.09  ?  287  TYR A CB    1 
ATOM   2392  C CG    . TYR A 1 290 ? 15.261  -3.560  56.866  1.00 40.20  ?  287  TYR A CG    1 
ATOM   2393  C CD1   . TYR A 1 290 ? 15.020  -3.770  55.514  1.00 41.77  ?  287  TYR A CD1   1 
ATOM   2394  C CD2   . TYR A 1 290 ? 16.568  -3.670  57.325  1.00 37.07  ?  287  TYR A CD2   1 
ATOM   2395  C CE1   . TYR A 1 290 ? 16.047  -4.094  54.647  1.00 38.41  ?  287  TYR A CE1   1 
ATOM   2396  C CE2   . TYR A 1 290 ? 17.603  -3.992  56.465  1.00 34.52  ?  287  TYR A CE2   1 
ATOM   2397  C CZ    . TYR A 1 290 ? 17.335  -4.204  55.128  1.00 37.78  ?  287  TYR A CZ    1 
ATOM   2398  O OH    . TYR A 1 290 ? 18.359  -4.526  54.267  1.00 40.44  ?  287  TYR A OH    1 
ATOM   2399  N N     . LYS A 1 291 ? 14.171  -5.522  59.955  1.00 26.79  ?  288  LYS A N     1 
ATOM   2400  C CA    . LYS A 1 291 ? 14.807  -6.641  60.634  1.00 37.59  ?  288  LYS A CA    1 
ATOM   2401  C C     . LYS A 1 291 ? 14.191  -6.789  62.014  1.00 33.86  ?  288  LYS A C     1 
ATOM   2402  O O     . LYS A 1 291 ? 14.162  -5.828  62.789  1.00 36.21  ?  288  LYS A O     1 
ATOM   2403  C CB    . LYS A 1 291 ? 16.320  -6.431  60.750  1.00 41.40  ?  288  LYS A CB    1 
ATOM   2404  C CG    . LYS A 1 291 ? 17.059  -7.562  61.441  1.00 48.62  ?  288  LYS A CG    1 
ATOM   2405  C CD    . LYS A 1 291 ? 18.308  -7.035  62.125  1.00 64.65  ?  288  LYS A CD    1 
ATOM   2406  C CE    . LYS A 1 291 ? 19.460  -8.018  62.035  1.00 72.36  ?  288  LYS A CE    1 
ATOM   2407  N NZ    . LYS A 1 291 ? 20.536  -7.504  61.141  1.00 76.08  1  288  LYS A NZ    1 
ATOM   2408  N N     . ASN A 1 292 ? 13.689  -7.984  62.310  1.00 31.84  ?  289  ASN A N     1 
ATOM   2409  C CA    . ASN A 1 292 ? 13.172  -8.281  63.639  1.00 31.04  ?  289  ASN A CA    1 
ATOM   2410  C C     . ASN A 1 292 ? 13.414  -9.751  63.957  1.00 26.53  ?  289  ASN A C     1 
ATOM   2411  O O     . ASN A 1 292 ? 14.552  -10.145 64.236  1.00 33.87  ?  289  ASN A O     1 
ATOM   2412  C CB    . ASN A 1 292 ? 11.684  -7.930  63.736  1.00 25.11  ?  289  ASN A CB    1 
ATOM   2413  C CG    . ASN A 1 292 ? 11.213  -7.764  65.174  1.00 30.00  ?  289  ASN A CG    1 
ATOM   2414  O OD1   . ASN A 1 292 ? 11.688  -8.451  66.079  1.00 31.54  ?  289  ASN A OD1   1 
ATOM   2415  N ND2   . ASN A 1 292 ? 10.274  -6.848  65.388  1.00 23.44  ?  289  ASN A ND2   1 
ATOM   2416  N N     . GLU A 1 293 ? 12.358  -10.567 63.895  1.00 21.41  ?  290  GLU A N     1 
ATOM   2417  C CA    . GLU A 1 293 ? 12.417  -11.982 64.270  1.00 34.30  ?  290  GLU A CA    1 
ATOM   2418  C C     . GLU A 1 293 ? 12.903  -12.159 65.705  1.00 34.91  ?  290  GLU A C     1 
ATOM   2419  O O     . GLU A 1 293 ? 13.476  -13.194 66.056  1.00 44.48  ?  290  GLU A O     1 
ATOM   2420  C CB    . GLU A 1 293 ? 13.296  -12.797 63.311  1.00 37.56  ?  290  GLU A CB    1 
ATOM   2421  C CG    . GLU A 1 293 ? 13.012  -12.587 61.828  1.00 50.13  ?  290  GLU A CG    1 
ATOM   2422  C CD    . GLU A 1 293 ? 13.880  -11.503 61.214  1.00 59.94  ?  290  GLU A CD    1 
ATOM   2423  O OE1   . GLU A 1 293 ? 13.324  -10.477 60.771  1.00 39.40  ?  290  GLU A OE1   1 
ATOM   2424  O OE2   . GLU A 1 293 ? 15.120  -11.677 61.183  1.00 62.43  -1 290  GLU A OE2   1 
ATOM   2425  N N     . GLN A 1 294 ? 12.681  -11.146 66.543  1.00 36.71  ?  291  GLN A N     1 
ATOM   2426  C CA    . GLN A 1 294 ? 13.116  -11.135 67.929  1.00 31.20  ?  291  GLN A CA    1 
ATOM   2427  C C     . GLN A 1 294 ? 11.915  -11.232 68.863  1.00 32.89  ?  291  GLN A C     1 
ATOM   2428  O O     . GLN A 1 294 ? 10.810  -10.808 68.510  1.00 36.34  ?  291  GLN A O     1 
ATOM   2429  C CB    . GLN A 1 294 ? 13.899  -9.856  68.253  1.00 37.04  ?  291  GLN A CB    1 
ATOM   2430  C CG    . GLN A 1 294 ? 15.050  -9.566  67.299  1.00 40.04  ?  291  GLN A CG    1 
ATOM   2431  C CD    . GLN A 1 294 ? 16.180  -10.572 67.422  1.00 44.05  ?  291  GLN A CD    1 
ATOM   2432  O OE1   . GLN A 1 294 ? 16.653  -11.126 66.427  1.00 43.89  ?  291  GLN A OE1   1 
ATOM   2433  N NE2   . GLN A 1 294 ? 16.623  -10.807 68.650  1.00 34.87  ?  291  GLN A NE2   1 
ATOM   2434  N N     . PRO A 1 295 ? 12.093  -11.793 70.057  1.00 35.81  ?  292  PRO A N     1 
ATOM   2435  C CA    . PRO A 1 295 ? 10.990  -11.821 71.021  1.00 34.72  ?  292  PRO A CA    1 
ATOM   2436  C C     . PRO A 1 295 ? 10.826  -10.477 71.714  1.00 26.73  ?  292  PRO A C     1 
ATOM   2437  O O     . PRO A 1 295 ? 11.798  -9.765  71.980  1.00 24.62  ?  292  PRO A O     1 
ATOM   2438  C CB    . PRO A 1 295 ? 11.419  -12.908 72.013  1.00 40.52  ?  292  PRO A CB    1 
ATOM   2439  C CG    . PRO A 1 295 ? 12.912  -12.866 71.971  1.00 44.01  ?  292  PRO A CG    1 
ATOM   2440  C CD    . PRO A 1 295 ? 13.280  -12.515 70.550  1.00 31.62  ?  292  PRO A CD    1 
ATOM   2441  N N     . LEU A 1 296 ? 9.572   -10.130 71.989  1.00 24.02  ?  293  LEU A N     1 
ATOM   2442  C CA    . LEU A 1 296 ? 9.230   -8.969  72.801  1.00 20.55  ?  293  LEU A CA    1 
ATOM   2443  C C     . LEU A 1 296 ? 8.873   -9.468  74.196  1.00 21.65  ?  293  LEU A C     1 
ATOM   2444  O O     . LEU A 1 296 ? 7.830   -10.101 74.388  1.00 26.12  ?  293  LEU A O     1 
ATOM   2445  C CB    . LEU A 1 296 ? 8.075   -8.188  72.179  1.00 30.65  ?  293  LEU A CB    1 
ATOM   2446  C CG    . LEU A 1 296 ? 7.603   -6.950  72.948  1.00 30.52  ?  293  LEU A CG    1 
ATOM   2447  C CD1   . LEU A 1 296 ? 8.742   -5.959  73.128  1.00 26.60  ?  293  LEU A CD1   1 
ATOM   2448  C CD2   . LEU A 1 296 ? 6.424   -6.295  72.243  1.00 27.96  ?  293  LEU A CD2   1 
ATOM   2449  N N     . LYS A 1 297 ? 9.748   -9.198  75.159  1.00 21.07  ?  294  LYS A N     1 
ATOM   2450  C CA    . LYS A 1 297 ? 9.577   -9.637  76.537  1.00 21.38  ?  294  LYS A CA    1 
ATOM   2451  C C     . LYS A 1 297 ? 9.341   -8.426  77.430  1.00 19.28  ?  294  LYS A C     1 
ATOM   2452  O O     . LYS A 1 297 ? 9.938   -7.366  77.219  1.00 23.24  ?  294  LYS A O     1 
ATOM   2453  C CB    . LYS A 1 297 ? 10.803  -10.425 77.012  1.00 21.17  ?  294  LYS A CB    1 
ATOM   2454  C CG    . LYS A 1 297 ? 11.039  -11.712 76.224  1.00 30.90  ?  294  LYS A CG    1 
ATOM   2455  C CD    . LYS A 1 297 ? 12.299  -12.436 76.674  1.00 35.12  ?  294  LYS A CD    1 
ATOM   2456  C CE    . LYS A 1 297 ? 13.545  -11.624 76.366  1.00 46.88  ?  294  LYS A CE    1 
ATOM   2457  N NZ    . LYS A 1 297 ? 14.793  -12.384 76.657  1.00 53.28  1  294  LYS A NZ    1 
ATOM   2458  N N     . ALA A 1 298 ? 8.469   -8.581  78.427  1.00 19.91  ?  295  ALA A N     1 
ATOM   2459  C CA    . ALA A 1 298 ? 8.079   -7.430  79.228  1.00 20.60  ?  295  ALA A CA    1 
ATOM   2460  C C     . ALA A 1 298 ? 7.570   -7.866  80.594  1.00 22.03  ?  295  ALA A C     1 
ATOM   2461  O O     . ALA A 1 298 ? 7.093   -8.990  80.768  1.00 24.90  ?  295  ALA A O     1 
ATOM   2462  C CB    . ALA A 1 298 ? 7.005   -6.604  78.508  1.00 23.31  ?  295  ALA A CB    1 
ATOM   2463  N N     . ILE A 1 299 ? 7.690   -6.954  81.560  1.00 19.89  ?  296  ILE A N     1 
ATOM   2464  C CA    . ILE A 1 299 ? 7.054   -7.069  82.866  1.00 17.35  ?  296  ILE A CA    1 
ATOM   2465  C C     . ILE A 1 299 ? 6.433   -5.717  83.201  1.00 24.44  ?  296  ILE A C     1 
ATOM   2466  O O     . ILE A 1 299 ? 6.718   -4.704  82.560  1.00 23.96  ?  296  ILE A O     1 
ATOM   2467  C CB    . ILE A 1 299 ? 8.031   -7.510  83.979  1.00 21.75  ?  296  ILE A CB    1 
ATOM   2468  C CG1   . ILE A 1 299 ? 9.227   -6.558  84.061  1.00 24.90  ?  296  ILE A CG1   1 
ATOM   2469  C CG2   . ILE A 1 299 ? 8.484   -8.951  83.764  1.00 16.39  ?  296  ILE A CG2   1 
ATOM   2470  C CD1   . ILE A 1 299 ? 10.182  -6.884  85.191  1.00 24.27  ?  296  ILE A CD1   1 
ATOM   2471  N N     . PHE A 1 300 ? 5.580   -5.708  84.224  1.00 17.18  ?  297  PHE A N     1 
ATOM   2472  C CA    . PHE A 1 300 ? 4.779   -4.543  84.578  1.00 15.95  ?  297  PHE A CA    1 
ATOM   2473  C C     . PHE A 1 300 ? 5.162   -4.014  85.955  1.00 19.04  ?  297  PHE A C     1 
ATOM   2474  O O     . PHE A 1 300 ? 5.410   -4.791  86.885  1.00 17.50  ?  297  PHE A O     1 
ATOM   2475  C CB    . PHE A 1 300 ? 3.276   -4.875  84.570  1.00 15.64  ?  297  PHE A CB    1 
ATOM   2476  C CG    . PHE A 1 300 ? 2.751   -5.325  83.235  1.00 18.87  ?  297  PHE A CG    1 
ATOM   2477  C CD1   . PHE A 1 300 ? 2.779   -6.663  82.879  1.00 18.33  ?  297  PHE A CD1   1 
ATOM   2478  C CD2   . PHE A 1 300 ? 2.210   -4.409  82.345  1.00 17.95  ?  297  PHE A CD2   1 
ATOM   2479  C CE1   . PHE A 1 300 ? 2.287   -7.077  81.653  1.00 22.37  ?  297  PHE A CE1   1 
ATOM   2480  C CE2   . PHE A 1 300 ? 1.720   -4.819  81.120  1.00 16.31  ?  297  PHE A CE2   1 
ATOM   2481  C CZ    . PHE A 1 300 ? 1.759   -6.153  80.775  1.00 21.27  ?  297  PHE A CZ    1 
ATOM   2482  N N     . PHE A 1 301 ? 5.190   -2.688  86.085  1.00 15.03  ?  298  PHE A N     1 
ATOM   2483  C CA    . PHE A 1 301 ? 5.406   -2.021  87.365  1.00 16.34  ?  298  PHE A CA    1 
ATOM   2484  C C     . PHE A 1 301 ? 4.264   -1.046  87.611  1.00 19.91  ?  298  PHE A C     1 
ATOM   2485  O O     . PHE A 1 301 ? 4.007   -0.164  86.785  1.00 17.52  ?  298  PHE A O     1 
ATOM   2486  C CB    . PHE A 1 301 ? 6.749   -1.285  87.398  1.00 22.43  ?  298  PHE A CB    1 
ATOM   2487  C CG    . PHE A 1 301 ? 7.941   -2.196  87.498  1.00 17.23  ?  298  PHE A CG    1 
ATOM   2488  C CD1   . PHE A 1 301 ? 8.539   -2.703  86.357  1.00 21.44  ?  298  PHE A CD1   1 
ATOM   2489  C CD2   . PHE A 1 301 ? 8.461   -2.543  88.734  1.00 17.75  ?  298  PHE A CD2   1 
ATOM   2490  C CE1   . PHE A 1 301 ? 9.638   -3.544  86.448  1.00 25.57  ?  298  PHE A CE1   1 
ATOM   2491  C CE2   . PHE A 1 301 ? 9.555   -3.381  88.830  1.00 15.67  ?  298  PHE A CE2   1 
ATOM   2492  C CZ    . PHE A 1 301 ? 10.142  -3.884  87.688  1.00 19.75  ?  298  PHE A CZ    1 
ATOM   2493  N N     . PHE A 1 302 ? 3.590   -1.199  88.745  1.00 25.75  ?  299  PHE A N     1 
ATOM   2494  C CA    . PHE A 1 302 ? 2.492   -0.327  89.126  1.00 25.62  ?  299  PHE A CA    1 
ATOM   2495  C C     . PHE A 1 302 ? 2.871   0.457   90.375  1.00 24.91  ?  299  PHE A C     1 
ATOM   2496  O O     . PHE A 1 302 ? 3.634   -0.020  91.220  1.00 23.72  ?  299  PHE A O     1 
ATOM   2497  C CB    . PHE A 1 302 ? 1.208   -1.122  89.379  1.00 17.87  ?  299  PHE A CB    1 
ATOM   2498  C CG    . PHE A 1 302 ? 0.762   -1.941  88.201  1.00 21.43  ?  299  PHE A CG    1 
ATOM   2499  C CD1   . PHE A 1 302 ? 1.241   -3.227  88.013  1.00 16.57  ?  299  PHE A CD1   1 
ATOM   2500  C CD2   . PHE A 1 302 ? -0.145  -1.434  87.289  1.00 27.10  ?  299  PHE A CD2   1 
ATOM   2501  C CE1   . PHE A 1 302 ? 0.832   -3.981  86.937  1.00 21.18  ?  299  PHE A CE1   1 
ATOM   2502  C CE2   . PHE A 1 302 ? -0.558  -2.186  86.211  1.00 29.32  ?  299  PHE A CE2   1 
ATOM   2503  C CZ    . PHE A 1 302 ? -0.066  -3.461  86.035  1.00 28.43  ?  299  PHE A CZ    1 
ATOM   2504  N N     . SER A 1 303 ? 2.328   1.671   90.489  1.00 29.23  ?  300  SER A N     1 
ATOM   2505  C CA    . SER A 1 303 ? 2.641   2.509   91.639  1.00 24.10  ?  300  SER A CA    1 
ATOM   2506  C C     . SER A 1 303 ? 1.916   2.054   92.900  1.00 28.67  ?  300  SER A C     1 
ATOM   2507  O O     . SER A 1 303 ? 2.305   2.459   94.002  1.00 24.68  ?  300  SER A O     1 
ATOM   2508  C CB    . SER A 1 303 ? 2.302   3.968   91.332  1.00 22.35  ?  300  SER A CB    1 
ATOM   2509  O OG    . SER A 1 303 ? 0.912   4.139   91.122  1.00 31.21  ?  300  SER A OG    1 
ATOM   2510  N N     . SER A 1 304 ? 0.884   1.222   92.767  1.00 27.90  ?  301  SER A N     1 
ATOM   2511  C CA    . SER A 1 304 ? 0.117   0.729   93.905  1.00 32.58  ?  301  SER A CA    1 
ATOM   2512  C C     . SER A 1 304 ? -0.818  -0.367  93.420  1.00 33.48  ?  301  SER A C     1 
ATOM   2513  O O     . SER A 1 304 ? -1.075  -0.503  92.220  1.00 32.29  ?  301  SER A O     1 
ATOM   2514  C CB    . SER A 1 304 ? -0.686  1.848   94.577  1.00 28.70  ?  301  SER A CB    1 
ATOM   2515  O OG    . SER A 1 304 ? -1.635  2.401   93.679  1.00 35.44  ?  301  SER A OG    1 
ATOM   2516  N N     . LYS A 1 305 ? -1.319  -1.155  94.375  1.00 32.76  ?  302  LYS A N     1 
ATOM   2517  C CA    . LYS A 1 305 ? -2.401  -2.083  94.065  1.00 28.63  ?  302  LYS A CA    1 
ATOM   2518  C C     . LYS A 1 305 ? -3.612  -1.338  93.519  1.00 26.15  ?  302  LYS A C     1 
ATOM   2519  O O     . LYS A 1 305 ? -4.272  -1.809  92.585  1.00 29.02  ?  302  LYS A O     1 
ATOM   2520  C CB    . LYS A 1 305 ? -2.783  -2.888  95.309  1.00 30.49  ?  302  LYS A CB    1 
ATOM   2521  C CG    . LYS A 1 305 ? -1.759  -3.931  95.728  1.00 35.76  ?  302  LYS A CG    1 
ATOM   2522  C CD    . LYS A 1 305 ? -1.666  -5.061  94.715  1.00 39.33  ?  302  LYS A CD    1 
ATOM   2523  C CE    . LYS A 1 305 ? -0.774  -6.187  95.221  1.00 36.86  ?  302  LYS A CE    1 
ATOM   2524  N NZ    . LYS A 1 305 ? -0.773  -7.355  94.294  1.00 42.44  1  302  LYS A NZ    1 
ATOM   2525  N N     . LYS A 1 306 ? -3.908  -0.162  94.079  1.00 22.48  ?  303  LYS A N     1 
ATOM   2526  C CA    . LYS A 1 306 ? -5.060  0.610   93.621  1.00 30.68  ?  303  LYS A CA    1 
ATOM   2527  C C     . LYS A 1 306 ? -4.932  0.964   92.146  1.00 31.11  ?  303  LYS A C     1 
ATOM   2528  O O     . LYS A 1 306 ? -5.878  0.786   91.370  1.00 26.91  ?  303  LYS A O     1 
ATOM   2529  C CB    . LYS A 1 306 ? -5.219  1.880   94.459  1.00 29.19  ?  303  LYS A CB    1 
ATOM   2530  C CG    . LYS A 1 306 ? -6.472  2.673   94.115  1.00 41.31  ?  303  LYS A CG    1 
ATOM   2531  C CD    . LYS A 1 306 ? -6.226  4.171   94.184  1.00 49.95  ?  303  LYS A CD    1 
ATOM   2532  C CE    . LYS A 1 306 ? -6.740  4.767   95.482  1.00 55.92  ?  303  LYS A CE    1 
ATOM   2533  N NZ    . LYS A 1 306 ? -6.564  6.247   95.513  1.00 64.29  1  303  LYS A NZ    1 
ATOM   2534  N N     . GLN A 1 307 ? -3.762  1.463   91.740  1.00 29.58  ?  304  GLN A N     1 
ATOM   2535  C CA    . GLN A 1 307 ? -3.560  1.826   90.341  1.00 27.34  ?  304  GLN A CA    1 
ATOM   2536  C C     . GLN A 1 307 ? -3.782  0.629   89.426  1.00 24.15  ?  304  GLN A C     1 
ATOM   2537  O O     . GLN A 1 307 ? -4.362  0.766   88.343  1.00 26.99  ?  304  GLN A O     1 
ATOM   2538  C CB    . GLN A 1 307 ? -2.158  2.396   90.141  1.00 32.02  ?  304  GLN A CB    1 
ATOM   2539  C CG    . GLN A 1 307 ? -1.881  2.833   88.714  1.00 25.76  ?  304  GLN A CG    1 
ATOM   2540  C CD    . GLN A 1 307 ? -0.404  2.873   88.403  1.00 22.00  ?  304  GLN A CD    1 
ATOM   2541  O OE1   . GLN A 1 307 ? 0.285   1.860   88.490  1.00 24.72  ?  304  GLN A OE1   1 
ATOM   2542  N NE2   . GLN A 1 307 ? 0.092   4.047   88.033  1.00 23.24  ?  304  GLN A NE2   1 
ATOM   2543  N N     . PHE A 1 308 ? -3.327  -0.555  89.848  1.00 28.97  ?  305  PHE A N     1 
ATOM   2544  C CA    . PHE A 1 308 ? -3.568  -1.763  89.065  1.00 26.54  ?  305  PHE A CA    1 
ATOM   2545  C C     . PHE A 1 308 ? -5.059  -1.983  88.851  1.00 27.88  ?  305  PHE A C     1 
ATOM   2546  O O     . PHE A 1 308 ? -5.510  -2.223  87.724  1.00 24.20  ?  305  PHE A O     1 
ATOM   2547  C CB    . PHE A 1 308 ? -2.945  -2.978  89.755  1.00 25.62  ?  305  PHE A CB    1 
ATOM   2548  C CG    . PHE A 1 308 ? -3.345  -4.291  89.139  1.00 29.72  ?  305  PHE A CG    1 
ATOM   2549  C CD1   . PHE A 1 308 ? -2.640  -4.809  88.065  1.00 35.51  ?  305  PHE A CD1   1 
ATOM   2550  C CD2   . PHE A 1 308 ? -4.433  -5.002  89.626  1.00 37.11  ?  305  PHE A CD2   1 
ATOM   2551  C CE1   . PHE A 1 308 ? -3.009  -6.011  87.490  1.00 38.19  ?  305  PHE A CE1   1 
ATOM   2552  C CE2   . PHE A 1 308 ? -4.808  -6.202  89.054  1.00 36.02  ?  305  PHE A CE2   1 
ATOM   2553  C CZ    . PHE A 1 308 ? -4.094  -6.709  87.985  1.00 43.15  ?  305  PHE A CZ    1 
ATOM   2554  N N     . PHE A 1 309 ? -5.843  -1.910  89.928  1.00 28.44  ?  306  PHE A N     1 
ATOM   2555  C CA    . PHE A 1 309 ? -7.275  -2.158  89.807  1.00 32.25  ?  306  PHE A CA    1 
ATOM   2556  C C     . PHE A 1 309 ? -7.969  -1.064  89.003  1.00 33.59  ?  306  PHE A C     1 
ATOM   2557  O O     . PHE A 1 309 ? -8.970  -1.335  88.330  1.00 31.40  ?  306  PHE A O     1 
ATOM   2558  C CB    . PHE A 1 309 ? -7.900  -2.303  91.195  1.00 23.65  ?  306  PHE A CB    1 
ATOM   2559  C CG    . PHE A 1 309 ? -7.516  -3.577  91.898  1.00 27.16  ?  306  PHE A CG    1 
ATOM   2560  C CD1   . PHE A 1 309 ? -7.910  -4.806  91.393  1.00 23.99  ?  306  PHE A CD1   1 
ATOM   2561  C CD2   . PHE A 1 309 ? -6.767  -3.548  93.061  1.00 28.31  ?  306  PHE A CD2   1 
ATOM   2562  C CE1   . PHE A 1 309 ? -7.561  -5.981  92.033  1.00 33.37  ?  306  PHE A CE1   1 
ATOM   2563  C CE2   . PHE A 1 309 ? -6.415  -4.719  93.709  1.00 31.90  ?  306  PHE A CE2   1 
ATOM   2564  C CZ    . PHE A 1 309 ? -6.812  -5.937  93.194  1.00 34.83  ?  306  PHE A CZ    1 
ATOM   2565  N N     . GLU A 1 310 ? -7.444  0.164   89.041  1.00 41.73  ?  307  GLU A N     1 
ATOM   2566  C CA    . GLU A 1 310 ? -8.016  1.240   88.237  1.00 41.46  ?  307  GLU A CA    1 
ATOM   2567  C C     . GLU A 1 310 ? -7.927  0.942   86.746  1.00 37.87  ?  307  GLU A C     1 
ATOM   2568  O O     . GLU A 1 310 ? -8.777  1.395   85.971  1.00 42.65  ?  307  GLU A O     1 
ATOM   2569  C CB    . GLU A 1 310 ? -7.311  2.562   88.540  1.00 47.19  ?  307  GLU A CB    1 
ATOM   2570  C CG    . GLU A 1 310 ? -7.515  3.097   89.945  1.00 62.74  ?  307  GLU A CG    1 
ATOM   2571  C CD    . GLU A 1 310 ? -6.725  4.370   90.191  1.00 77.55  ?  307  GLU A CD    1 
ATOM   2572  O OE1   . GLU A 1 310 ? -6.103  4.877   89.233  1.00 80.04  ?  307  GLU A OE1   1 
ATOM   2573  O OE2   . GLU A 1 310 ? -6.721  4.862   91.339  1.00 78.42  -1 307  GLU A OE2   1 
ATOM   2574  N N     . VAL A 1 311 ? -6.913  0.187   86.324  1.00 27.68  ?  308  VAL A N     1 
ATOM   2575  C CA    . VAL A 1 311 ? -6.647  -0.064  84.915  1.00 35.07  ?  308  VAL A CA    1 
ATOM   2576  C C     . VAL A 1 311 ? -6.787  -1.538  84.555  1.00 30.85  ?  308  VAL A C     1 
ATOM   2577  O O     . VAL A 1 311 ? -6.399  -1.942  83.459  1.00 28.36  ?  308  VAL A O     1 
ATOM   2578  C CB    . VAL A 1 311 ? -5.255  0.461   84.512  1.00 43.04  ?  308  VAL A CB    1 
ATOM   2579  C CG1   . VAL A 1 311 ? -5.139  1.947   84.814  1.00 38.70  ?  308  VAL A CG1   1 
ATOM   2580  C CG2   . VAL A 1 311 ? -4.166  -0.322  85.232  1.00 48.74  ?  308  VAL A CG2   1 
ATOM   2581  N N     . GLN A 1 312 ? -7.345  -2.350  85.456  1.00 25.72  ?  309  GLN A N     1 
ATOM   2582  C CA    . GLN A 1 312 ? -7.366  -3.795  85.243  1.00 26.00  ?  309  GLN A CA    1 
ATOM   2583  C C     . GLN A 1 312 ? -8.174  -4.172  84.005  1.00 24.65  ?  309  GLN A C     1 
ATOM   2584  O O     . GLN A 1 312 ? -7.781  -5.070  83.250  1.00 29.35  ?  309  GLN A O     1 
ATOM   2585  C CB    . GLN A 1 312 ? -7.924  -4.495  86.481  1.00 24.43  ?  309  GLN A CB    1 
ATOM   2586  C CG    . GLN A 1 312 ? -7.875  -6.009  86.410  1.00 30.68  ?  309  GLN A CG    1 
ATOM   2587  C CD    . GLN A 1 312 ? -8.495  -6.662  87.627  1.00 36.22  ?  309  GLN A CD    1 
ATOM   2588  O OE1   . GLN A 1 312 ? -9.265  -6.035  88.354  1.00 40.26  ?  309  GLN A OE1   1 
ATOM   2589  N NE2   . GLN A 1 312 ? -8.159  -7.926  87.858  1.00 33.58  ?  309  GLN A NE2   1 
ATOM   2590  N N     . LYS A 1 313 ? -9.303  -3.496  83.777  1.00 22.73  ?  310  LYS A N     1 
ATOM   2591  C CA    . LYS A 1 313 ? -10.115 -3.789  82.599  1.00 30.99  ?  310  LYS A CA    1 
ATOM   2592  C C     . LYS A 1 313 ? -9.324  -3.552  81.318  1.00 29.38  ?  310  LYS A C     1 
ATOM   2593  O O     . LYS A 1 313 ? -9.321  -4.392  80.410  1.00 33.01  ?  310  LYS A O     1 
ATOM   2594  C CB    . LYS A 1 313 ? -11.387 -2.943  82.611  1.00 33.01  ?  310  LYS A CB    1 
ATOM   2595  C CG    . LYS A 1 313 ? -12.303 -3.202  81.428  1.00 36.77  ?  310  LYS A CG    1 
ATOM   2596  C CD    . LYS A 1 313 ? -13.609 -2.435  81.542  1.00 39.38  ?  310  LYS A CD    1 
ATOM   2597  C CE    . LYS A 1 313 ? -14.533 -2.749  80.373  1.00 50.02  ?  310  LYS A CE    1 
ATOM   2598  N NZ    . LYS A 1 313 ? -13.948 -2.333  79.067  1.00 53.49  1  310  LYS A NZ    1 
ATOM   2599  N N     . SER A 1 314 ? -8.637  -2.411  81.233  1.00 31.98  ?  311  SER A N     1 
ATOM   2600  C CA    . SER A 1 314 ? -7.815  -2.126  80.062  1.00 29.23  ?  311  SER A CA    1 
ATOM   2601  C C     . SER A 1 314 ? -6.644  -3.096  79.961  1.00 23.82  ?  311  SER A C     1 
ATOM   2602  O O     . SER A 1 314 ? -6.303  -3.553  78.863  1.00 24.99  ?  311  SER A O     1 
ATOM   2603  C CB    . SER A 1 314 ? -7.317  -0.684  80.116  1.00 32.42  ?  311  SER A CB    1 
ATOM   2604  O OG    . SER A 1 314 ? -8.399  0.229   80.092  1.00 35.97  ?  311  SER A OG    1 
ATOM   2605  N N     . LEU A 1 315 ? -6.012  -3.415  81.094  1.00 22.40  ?  312  LEU A N     1 
ATOM   2606  C CA    . LEU A 1 315 ? -4.945  -4.413  81.093  1.00 28.14  ?  312  LEU A CA    1 
ATOM   2607  C C     . LEU A 1 315 ? -5.429  -5.738  80.518  1.00 25.96  ?  312  LEU A C     1 
ATOM   2608  O O     . LEU A 1 315 ? -4.719  -6.382  79.736  1.00 33.28  ?  312  LEU A O     1 
ATOM   2609  C CB    . LEU A 1 315 ? -4.413  -4.615  82.509  1.00 32.07  ?  312  LEU A CB    1 
ATOM   2610  C CG    . LEU A 1 315 ? -3.554  -3.508  83.118  1.00 29.57  ?  312  LEU A CG    1 
ATOM   2611  C CD1   . LEU A 1 315 ? -3.177  -3.875  84.544  1.00 24.68  ?  312  LEU A CD1   1 
ATOM   2612  C CD2   . LEU A 1 315 ? -2.312  -3.266  82.279  1.00 30.54  ?  312  LEU A CD2   1 
ATOM   2613  N N     . LYS A 1 316 ? -6.636  -6.164  80.898  1.00 27.06  ?  313  LYS A N     1 
ATOM   2614  C CA    . LYS A 1 316 ? -7.195  -7.391  80.341  1.00 22.23  ?  313  LYS A CA    1 
ATOM   2615  C C     . LYS A 1 316 ? -7.441  -7.250  78.845  1.00 22.60  ?  313  LYS A C     1 
ATOM   2616  O O     . LYS A 1 316 ? -7.071  -8.131  78.061  1.00 26.97  ?  313  LYS A O     1 
ATOM   2617  C CB    . LYS A 1 316 ? -8.494  -7.755  81.059  1.00 32.55  ?  313  LYS A CB    1 
ATOM   2618  C CG    . LYS A 1 316 ? -8.317  -8.216  82.490  1.00 34.98  ?  313  LYS A CG    1 
ATOM   2619  C CD    . LYS A 1 316 ? -9.625  -8.764  83.030  1.00 38.13  ?  313  LYS A CD    1 
ATOM   2620  C CE    . LYS A 1 316 ? -9.418  -9.531  84.322  1.00 43.30  ?  313  LYS A CE    1 
ATOM   2621  N NZ    . LYS A 1 316 ? -10.570 -10.431 84.588  1.00 48.49  1  313  LYS A NZ    1 
ATOM   2622  N N     . GLU A 1 317 ? -8.071  -6.145  78.432  1.00 27.38  ?  314  GLU A N     1 
ATOM   2623  C CA    . GLU A 1 317 ? -8.349  -5.934  77.014  1.00 28.51  ?  314  GLU A CA    1 
ATOM   2624  C C     . GLU A 1 317 ? -7.064  -5.915  76.194  1.00 27.29  ?  314  GLU A C     1 
ATOM   2625  O O     . GLU A 1 317 ? -7.043  -6.381  75.051  1.00 28.93  ?  314  GLU A O     1 
ATOM   2626  C CB    . GLU A 1 317 ? -9.114  -4.623  76.813  1.00 29.74  ?  314  GLU A CB    1 
ATOM   2627  C CG    . GLU A 1 317 ? -10.533 -4.640  77.351  1.00 45.13  ?  314  GLU A CG    1 
ATOM   2628  C CD    . GLU A 1 317 ? -11.216 -3.291  77.226  1.00 53.98  ?  314  GLU A CD    1 
ATOM   2629  O OE1   . GLU A 1 317 ? -10.511 -2.290  76.988  1.00 56.26  ?  314  GLU A OE1   1 
ATOM   2630  O OE2   . GLU A 1 317 ? -12.458 -3.233  77.363  1.00 64.21  -1 314  GLU A OE2   1 
ATOM   2631  N N     . LEU A 1 318 ? -5.979  -5.382  76.759  1.00 28.48  ?  315  LEU A N     1 
ATOM   2632  C CA    . LEU A 1 318 ? -4.744  -5.252  75.999  1.00 29.05  ?  315  LEU A CA    1 
ATOM   2633  C C     . LEU A 1 318 ? -3.922  -6.535  76.015  1.00 30.12  ?  315  LEU A C     1 
ATOM   2634  O O     . LEU A 1 318 ? -3.363  -6.927  74.983  1.00 28.09  ?  315  LEU A O     1 
ATOM   2635  C CB    . LEU A 1 318 ? -3.916  -4.087  76.546  1.00 26.41  ?  315  LEU A CB    1 
ATOM   2636  C CG    . LEU A 1 318 ? -4.324  -2.693  76.057  1.00 31.62  ?  315  LEU A CG    1 
ATOM   2637  C CD1   . LEU A 1 318 ? -3.577  -1.622  76.824  1.00 30.92  ?  315  LEU A CD1   1 
ATOM   2638  C CD2   . LEU A 1 318 ? -4.057  -2.570  74.565  1.00 32.53  ?  315  LEU A CD2   1 
ATOM   2639  N N     . PHE A 1 319 ? -3.831  -7.203  77.166  1.00 30.00  ?  316  PHE A N     1 
ATOM   2640  C CA    . PHE A 1 319 ? -2.853  -8.265  77.341  1.00 33.50  ?  316  PHE A CA    1 
ATOM   2641  C C     . PHE A 1 319 ? -3.439  -9.637  77.646  1.00 38.15  ?  316  PHE A C     1 
ATOM   2642  O O     . PHE A 1 319 ? -2.718  -10.633 77.507  1.00 35.38  ?  316  PHE A O     1 
ATOM   2643  C CB    . PHE A 1 319 ? -1.865  -7.877  78.450  1.00 39.69  ?  316  PHE A CB    1 
ATOM   2644  C CG    . PHE A 1 319 ? -1.238  -6.530  78.244  1.00 33.35  ?  316  PHE A CG    1 
ATOM   2645  C CD1   . PHE A 1 319 ? -0.323  -6.328  77.227  1.00 24.65  ?  316  PHE A CD1   1 
ATOM   2646  C CD2   . PHE A 1 319 ? -1.580  -5.460  79.052  1.00 32.00  ?  316  PHE A CD2   1 
ATOM   2647  C CE1   . PHE A 1 319 ? 0.257   -5.084  77.028  1.00 32.31  ?  316  PHE A CE1   1 
ATOM   2648  C CE2   . PHE A 1 319 ? -1.008  -4.215  78.859  1.00 28.80  ?  316  PHE A CE2   1 
ATOM   2649  C CZ    . PHE A 1 319 ? -0.088  -4.027  77.844  1.00 25.98  ?  316  PHE A CZ    1 
ATOM   2650  N N     . HIS A 1 320 ? -4.708  -9.730  78.045  1.00 31.17  ?  317  HIS A N     1 
ATOM   2651  C CA    . HIS A 1 320 ? -5.343  -11.033 78.196  1.00 33.35  ?  317  HIS A CA    1 
ATOM   2652  C C     . HIS A 1 320 ? -5.993  -11.520 76.912  1.00 41.56  ?  317  HIS A C     1 
ATOM   2653  O O     . HIS A 1 320 ? -6.170  -12.731 76.742  1.00 50.83  ?  317  HIS A O     1 
ATOM   2654  C CB    . HIS A 1 320 ? -6.384  -10.998 79.318  1.00 37.57  ?  317  HIS A CB    1 
ATOM   2655  C CG    . HIS A 1 320 ? -5.800  -11.142 80.688  1.00 46.31  ?  317  HIS A CG    1 
ATOM   2656  N ND1   . HIS A 1 320 ? -6.549  -11.516 81.783  1.00 55.29  ?  317  HIS A ND1   1 
ATOM   2657  C CD2   . HIS A 1 320 ? -4.536  -10.966 81.139  1.00 45.50  ?  317  HIS A CD2   1 
ATOM   2658  C CE1   . HIS A 1 320 ? -5.771  -11.562 82.850  1.00 49.46  ?  317  HIS A CE1   1 
ATOM   2659  N NE2   . HIS A 1 320 ? -4.545  -11.233 82.486  1.00 45.27  ?  317  HIS A NE2   1 
ATOM   2660  N N     . ASN A 1 321 ? -6.355  -10.606 76.016  1.00 41.39  ?  318  ASN A N     1 
ATOM   2661  C CA    . ASN A 1 321 ? -6.773  -10.950 74.661  1.00 36.63  ?  318  ASN A CA    1 
ATOM   2662  C C     . ASN A 1 321 ? -5.518  -11.039 73.802  1.00 27.24  ?  318  ASN A C     1 
ATOM   2663  O O     . ASN A 1 321 ? -4.930  -10.014 73.442  1.00 26.51  ?  318  ASN A O     1 
ATOM   2664  C CB    . ASN A 1 321 ? -7.752  -9.910  74.120  1.00 33.24  ?  318  ASN A CB    1 
ATOM   2665  C CG    . ASN A 1 321 ? -8.064  -10.093 72.639  1.00 34.22  ?  318  ASN A CG    1 
ATOM   2666  O OD1   . ASN A 1 321 ? -7.811  -11.152 72.059  1.00 58.73  ?  318  ASN A OD1   1 
ATOM   2667  N ND2   . ASN A 1 321 ? -8.624  -9.059  72.024  1.00 32.57  ?  318  ASN A ND2   1 
ATOM   2668  N N     . LYS A 1 322 ? -5.104  -12.266 73.471  1.00 27.36  ?  319  LYS A N     1 
ATOM   2669  C CA    . LYS A 1 322 ? -3.901  -12.481 72.662  1.00 35.23  ?  319  LYS A CA    1 
ATOM   2670  C C     . LYS A 1 322 ? -4.045  -11.977 71.223  1.00 30.25  ?  319  LYS A C     1 
ATOM   2671  O O     . LYS A 1 322 ? -3.128  -12.194 70.415  1.00 27.76  ?  319  LYS A O     1 
ATOM   2672  C CB    . LYS A 1 322 ? -3.526  -13.966 72.650  1.00 43.05  ?  319  LYS A CB    1 
ATOM   2673  C CG    . LYS A 1 322 ? -3.262  -14.575 74.025  1.00 48.42  ?  319  LYS A CG    1 
ATOM   2674  C CD    . LYS A 1 322 ? -2.095  -13.915 74.745  1.00 53.29  ?  319  LYS A CD    1 
ATOM   2675  C CE    . LYS A 1 322 ? -1.874  -14.533 76.122  1.00 64.35  ?  319  LYS A CE    1 
ATOM   2676  N NZ    . LYS A 1 322 ? -1.497  -15.974 76.045  1.00 71.83  1  319  LYS A NZ    1 
ATOM   2677  N N     . HIS A 1 323 ? -5.163  -11.325 70.890  1.00 34.35  ?  320  HIS A N     1 
ATOM   2678  C CA    . HIS A 1 323 ? -5.361  -10.713 69.581  1.00 40.20  ?  320  HIS A CA    1 
ATOM   2679  C C     . HIS A 1 323 ? -5.735  -9.240  69.701  1.00 27.24  ?  320  HIS A C     1 
ATOM   2680  O O     . HIS A 1 323 ? -6.318  -8.674  68.771  1.00 28.74  ?  320  HIS A O     1 
ATOM   2681  C CB    . HIS A 1 323 ? -6.423  -11.478 68.788  1.00 40.13  ?  320  HIS A CB    1 
ATOM   2682  C CG    . HIS A 1 323 ? -6.069  -12.911 68.544  1.00 39.13  ?  320  HIS A CG    1 
ATOM   2683  N ND1   . HIS A 1 323 ? -5.062  -13.290 67.683  1.00 48.86  ?  320  HIS A ND1   1 
ATOM   2684  C CD2   . HIS A 1 323 ? -6.578  -14.056 69.057  1.00 44.93  ?  320  HIS A CD2   1 
ATOM   2685  C CE1   . HIS A 1 323 ? -4.971  -14.608 67.671  1.00 49.55  ?  320  HIS A CE1   1 
ATOM   2686  N NE2   . HIS A 1 323 ? -5.878  -15.096 68.497  1.00 49.76  ?  320  HIS A NE2   1 
ATOM   2687  N N     . SER A 1 324 ? -5.403  -8.609  70.828  1.00 30.14  ?  321  SER A N     1 
ATOM   2688  C CA    . SER A 1 324 ? -5.639  -7.187  71.025  1.00 35.40  ?  321  SER A CA    1 
ATOM   2689  C C     . SER A 1 324 ? -4.799  -6.354  70.067  1.00 25.48  ?  321  SER A C     1 
ATOM   2690  O O     . SER A 1 324 ? -3.972  -6.888  69.325  1.00 29.11  ?  321  SER A O     1 
ATOM   2691  C CB    . SER A 1 324 ? -5.320  -6.786  72.463  1.00 32.98  ?  321  SER A CB    1 
ATOM   2692  O OG    . SER A 1 324 ? -3.920  -6.808  72.698  1.00 31.04  ?  321  SER A OG    1 
ATOM   2693  N N     . VAL A 1 325 ? -5.007  -5.038  70.083  1.00 20.58  ?  322  VAL A N     1 
ATOM   2694  C CA    . VAL A 1 325 ? -4.210  -4.139  69.253  1.00 26.56  ?  322  VAL A CA    1 
ATOM   2695  C C     . VAL A 1 325 ? -2.735  -4.224  69.629  1.00 27.44  ?  322  VAL A C     1 
ATOM   2696  O O     . VAL A 1 325 ? -1.856  -4.072  68.770  1.00 27.55  ?  322  VAL A O     1 
ATOM   2697  C CB    . VAL A 1 325 ? -4.754  -2.699  69.362  1.00 30.43  ?  322  VAL A CB    1 
ATOM   2698  C CG1   . VAL A 1 325 ? -4.812  -2.258  70.818  1.00 36.59  ?  322  VAL A CG1   1 
ATOM   2699  C CG2   . VAL A 1 325 ? -3.929  -1.732  68.528  1.00 37.54  ?  322  VAL A CG2   1 
ATOM   2700  N N     . PHE A 1 326 ? -2.433  -4.484  70.905  1.00 24.14  ?  323  PHE A N     1 
ATOM   2701  C CA    . PHE A 1 326 ? -1.041  -4.627  71.324  1.00 29.28  ?  323  PHE A CA    1 
ATOM   2702  C C     . PHE A 1 326 ? -0.382  -5.823  70.645  1.00 29.34  ?  323  PHE A C     1 
ATOM   2703  O O     . PHE A 1 326 ? 0.748   -5.726  70.149  1.00 26.23  ?  323  PHE A O     1 
ATOM   2704  C CB    . PHE A 1 326 ? -0.961  -4.760  72.849  1.00 29.09  ?  323  PHE A CB    1 
ATOM   2705  C CG    . PHE A 1 326 ? 0.443   -4.884  73.376  1.00 18.87  ?  323  PHE A CG    1 
ATOM   2706  C CD1   . PHE A 1 326 ? 1.168   -3.757  73.724  1.00 27.19  ?  323  PHE A CD1   1 
ATOM   2707  C CD2   . PHE A 1 326 ? 1.035   -6.128  73.526  1.00 22.69  ?  323  PHE A CD2   1 
ATOM   2708  C CE1   . PHE A 1 326 ? 2.461   -3.869  74.205  1.00 25.63  ?  323  PHE A CE1   1 
ATOM   2709  C CE2   . PHE A 1 326 ? 2.327   -6.244  74.004  1.00 25.44  ?  323  PHE A CE2   1 
ATOM   2710  C CZ    . PHE A 1 326 ? 3.039   -5.115  74.346  1.00 21.90  ?  323  PHE A CZ    1 
ATOM   2711  N N     . TYR A 1 327 ? -1.072  -6.968  70.622  1.00 25.96  ?  324  TYR A N     1 
ATOM   2712  C CA    . TYR A 1 327 ? -0.499  -8.164  70.010  1.00 19.97  ?  324  TYR A CA    1 
ATOM   2713  C C     . TYR A 1 327 ? -0.486  -8.070  68.490  1.00 15.64  ?  324  TYR A C     1 
ATOM   2714  O O     . TYR A 1 327 ? 0.424   -8.600  67.847  1.00 23.08  ?  324  TYR A O     1 
ATOM   2715  C CB    . TYR A 1 327 ? -1.268  -9.410  70.448  1.00 18.92  ?  324  TYR A CB    1 
ATOM   2716  C CG    . TYR A 1 327 ? -1.046  -9.795  71.892  1.00 22.70  ?  324  TYR A CG    1 
ATOM   2717  C CD1   . TYR A 1 327 ? 0.047   -10.569 72.263  1.00 32.50  ?  324  TYR A CD1   1 
ATOM   2718  C CD2   . TYR A 1 327 ? -1.932  -9.391  72.883  1.00 23.98  ?  324  TYR A CD2   1 
ATOM   2719  C CE1   . TYR A 1 327 ? 0.253   -10.925 73.583  1.00 34.20  ?  324  TYR A CE1   1 
ATOM   2720  C CE2   . TYR A 1 327 ? -1.733  -9.743  74.204  1.00 33.20  ?  324  TYR A CE2   1 
ATOM   2721  C CZ    . TYR A 1 327 ? -0.638  -10.511 74.548  1.00 35.19  ?  324  TYR A CZ    1 
ATOM   2722  O OH    . TYR A 1 327 ? -0.435  -10.868 75.862  1.00 33.17  ?  324  TYR A OH    1 
ATOM   2723  N N     . ARG A 1 328 ? -1.487  -7.420  67.898  1.00 24.39  ?  325  ARG A N     1 
ATOM   2724  C CA    . ARG A 1 328 ? -1.478  -7.237  66.450  1.00 27.83  ?  325  ARG A CA    1 
ATOM   2725  C C     . ARG A 1 328 ? -0.360  -6.294  66.028  1.00 28.51  ?  325  ARG A C     1 
ATOM   2726  O O     . ARG A 1 328 ? 0.274   -6.503  64.988  1.00 29.36  ?  325  ARG A O     1 
ATOM   2727  C CB    . ARG A 1 328 ? -2.835  -6.720  65.970  1.00 29.22  ?  325  ARG A CB    1 
ATOM   2728  C CG    . ARG A 1 328 ? -3.991  -7.676  66.242  1.00 38.75  ?  325  ARG A CG    1 
ATOM   2729  C CD    . ARG A 1 328 ? -5.202  -7.370  65.371  1.00 47.76  ?  325  ARG A CD    1 
ATOM   2730  N NE    . ARG A 1 328 ? -5.648  -5.987  65.493  1.00 48.50  ?  325  ARG A NE    1 
ATOM   2731  C CZ    . ARG A 1 328 ? -6.438  -5.542  66.464  1.00 48.55  ?  325  ARG A CZ    1 
ATOM   2732  N NH1   . ARG A 1 328 ? -6.865  -6.371  67.405  1.00 42.40  1  325  ARG A NH1   1 
ATOM   2733  N NH2   . ARG A 1 328 ? -6.796  -4.266  66.495  1.00 50.80  ?  325  ARG A NH2   1 
ATOM   2734  N N     . ALA A 1 329 ? -0.096  -5.258  66.829  1.00 29.51  ?  326  ALA A N     1 
ATOM   2735  C CA    . ALA A 1 329 ? 1.008   -4.351  66.529  1.00 25.46  ?  326  ALA A CA    1 
ATOM   2736  C C     . ALA A 1 329 ? 2.345   -5.080  66.569  1.00 25.29  ?  326  ALA A C     1 
ATOM   2737  O O     . ALA A 1 329 ? 3.194   -4.886  65.692  1.00 24.59  ?  326  ALA A O     1 
ATOM   2738  C CB    . ALA A 1 329 ? 1.009   -3.179  67.508  1.00 29.56  ?  326  ALA A CB    1 
ATOM   2739  N N     . ALA A 1 330 ? 2.550   -5.931  67.578  1.00 27.39  ?  327  ALA A N     1 
ATOM   2740  C CA    . ALA A 1 330 ? 3.807   -6.665  67.678  1.00 16.82  ?  327  ALA A CA    1 
ATOM   2741  C C     . ALA A 1 330 ? 3.953   -7.666  66.539  1.00 24.25  ?  327  ALA A C     1 
ATOM   2742  O O     . ALA A 1 330 ? 5.052   -7.854  66.006  1.00 20.40  ?  327  ALA A O     1 
ATOM   2743  C CB    . ALA A 1 330 ? 3.897   -7.370  69.032  1.00 15.02  ?  327  ALA A CB    1 
ATOM   2744  N N     . ALA A 1 331 ? 2.856   -8.323  66.157  1.00 23.37  ?  328  ALA A N     1 
ATOM   2745  C CA    . ALA A 1 331 ? 2.893   -9.208  64.998  1.00 27.55  ?  328  ALA A CA    1 
ATOM   2746  C C     . ALA A 1 331 ? 3.165   -8.423  63.720  1.00 20.74  ?  328  ALA A C     1 
ATOM   2747  O O     . ALA A 1 331 ? 4.007   -8.815  62.903  1.00 23.54  ?  328  ALA A O     1 
ATOM   2748  C CB    . ALA A 1 331 ? 1.581   -9.985  64.891  1.00 30.68  ?  328  ALA A CB    1 
ATOM   2749  N N     . GLU A 1 332 ? 2.467   -7.298  63.539  1.00 25.61  ?  329  GLU A N     1 
ATOM   2750  C CA    . GLU A 1 332 ? 2.657   -6.489  62.338  1.00 21.44  ?  329  GLU A CA    1 
ATOM   2751  C C     . GLU A 1 332 ? 4.082   -5.970  62.226  1.00 24.83  ?  329  GLU A C     1 
ATOM   2752  O O     . GLU A 1 332 ? 4.602   -5.822  61.116  1.00 25.39  ?  329  GLU A O     1 
ATOM   2753  C CB    . GLU A 1 332 ? 1.668   -5.322  62.327  1.00 22.28  ?  329  GLU A CB    1 
ATOM   2754  C CG    . GLU A 1 332 ? 0.249   -5.712  61.939  1.00 30.47  ?  329  GLU A CG    1 
ATOM   2755  C CD    . GLU A 1 332 ? -0.767  -4.632  62.261  1.00 39.78  ?  329  GLU A CD    1 
ATOM   2756  O OE1   . GLU A 1 332 ? -1.977  -4.942  62.278  1.00 42.41  ?  329  GLU A OE1   1 
ATOM   2757  O OE2   . GLU A 1 332 ? -0.360  -3.475  62.505  1.00 39.10  -1 329  GLU A OE2   1 
ATOM   2758  N N     . LEU A 1 333 ? 4.731   -5.693  63.356  1.00 21.92  ?  330  LEU A N     1 
ATOM   2759  C CA    . LEU A 1 333 ? 6.093   -5.181  63.332  1.00 25.52  ?  330  LEU A CA    1 
ATOM   2760  C C     . LEU A 1 333 ? 7.139   -6.279  63.202  1.00 18.69  ?  330  LEU A C     1 
ATOM   2761  O O     . LEU A 1 333 ? 8.318   -5.966  63.014  1.00 20.57  ?  330  LEU A O     1 
ATOM   2762  C CB    . LEU A 1 333 ? 6.359   -4.343  64.585  1.00 24.80  ?  330  LEU A CB    1 
ATOM   2763  C CG    . LEU A 1 333 ? 5.555   -3.043  64.649  1.00 27.71  ?  330  LEU A CG    1 
ATOM   2764  C CD1   . LEU A 1 333 ? 5.902   -2.261  65.900  1.00 21.09  ?  330  LEU A CD1   1 
ATOM   2765  C CD2   . LEU A 1 333 ? 5.779   -2.196  63.396  1.00 22.03  ?  330  LEU A CD2   1 
ATOM   2766  N N     . GLY A 1 334 ? 6.748   -7.545  63.291  1.00 24.53  ?  331  GLY A N     1 
ATOM   2767  C CA    . GLY A 1 334 ? 7.660   -8.639  63.039  1.00 20.75  ?  331  GLY A CA    1 
ATOM   2768  C C     . GLY A 1 334 ? 8.275   -9.301  64.253  1.00 32.30  ?  331  GLY A C     1 
ATOM   2769  O O     . GLY A 1 334 ? 9.282   -10.005 64.102  1.00 21.02  ?  331  GLY A O     1 
ATOM   2770  N N     . PHE A 1 335 ? 7.715   -9.102  65.444  1.00 27.66  ?  332  PHE A N     1 
ATOM   2771  C CA    . PHE A 1 335 ? 8.222   -9.793  66.622  1.00 29.51  ?  332  PHE A CA    1 
ATOM   2772  C C     . PHE A 1 335 ? 7.880   -11.276 66.542  1.00 27.74  ?  332  PHE A C     1 
ATOM   2773  O O     . PHE A 1 335 ? 6.756   -11.650 66.199  1.00 23.77  ?  332  PHE A O     1 
ATOM   2774  C CB    . PHE A 1 335 ? 7.638   -9.187  67.899  1.00 16.21  ?  332  PHE A CB    1 
ATOM   2775  C CG    . PHE A 1 335 ? 8.163   -7.818  68.220  1.00 16.83  ?  332  PHE A CG    1 
ATOM   2776  C CD1   . PHE A 1 335 ? 9.435   -7.656  68.743  1.00 31.53  ?  332  PHE A CD1   1 
ATOM   2777  C CD2   . PHE A 1 335 ? 7.382   -6.694  68.011  1.00 20.22  ?  332  PHE A CD2   1 
ATOM   2778  C CE1   . PHE A 1 335 ? 9.922   -6.398  69.042  1.00 30.84  ?  332  PHE A CE1   1 
ATOM   2779  C CE2   . PHE A 1 335 ? 7.864   -5.435  68.306  1.00 26.71  ?  332  PHE A CE2   1 
ATOM   2780  C CZ    . PHE A 1 335 ? 9.136   -5.288  68.824  1.00 31.96  ?  332  PHE A CZ    1 
ATOM   2781  N N     . SER A 1 336 ? 8.866   -12.122 66.849  1.00 25.10  ?  333  SER A N     1 
ATOM   2782  C CA    . SER A 1 336 ? 8.629   -13.562 66.839  1.00 37.55  ?  333  SER A CA    1 
ATOM   2783  C C     . SER A 1 336 ? 7.537   -13.943 67.829  1.00 38.78  ?  333  SER A C     1 
ATOM   2784  O O     . SER A 1 336 ? 6.666   -14.764 67.519  1.00 31.37  ?  333  SER A O     1 
ATOM   2785  C CB    . SER A 1 336 ? 9.925   -14.313 67.147  1.00 32.33  ?  333  SER A CB    1 
ATOM   2786  O OG    . SER A 1 336 ? 10.393  -14.020 68.452  1.00 41.44  ?  333  SER A OG    1 
ATOM   2787  N N     . LYS A 1 337 ? 7.551   -13.340 69.015  1.00 34.48  ?  334  LYS A N     1 
ATOM   2788  C CA    . LYS A 1 337 ? 6.519   -13.618 70.003  1.00 33.93  ?  334  LYS A CA    1 
ATOM   2789  C C     . LYS A 1 337 ? 6.522   -12.531 71.069  1.00 34.62  ?  334  LYS A C     1 
ATOM   2790  O O     . LYS A 1 337 ? 7.476   -11.758 71.204  1.00 36.70  ?  334  LYS A O     1 
ATOM   2791  C CB    . LYS A 1 337 ? 6.720   -14.994 70.643  1.00 32.30  ?  334  LYS A CB    1 
ATOM   2792  C CG    . LYS A 1 337 ? 8.013   -15.084 71.412  1.00 29.68  ?  334  LYS A CG    1 
ATOM   2793  C CD    . LYS A 1 337 ? 8.243   -16.468 71.987  1.00 36.45  ?  334  LYS A CD    1 
ATOM   2794  C CE    . LYS A 1 337 ? 9.211   -16.405 73.122  1.00 35.36  ?  334  LYS A CE    1 
ATOM   2795  N NZ    . LYS A 1 337 ? 9.633   -17.775 73.544  1.00 43.66  1  334  LYS A NZ    1 
ATOM   2796  N N     . VAL A 1 338 ? 5.427   -12.488 71.824  1.00 28.69  ?  335  VAL A N     1 
ATOM   2797  C CA    . VAL A 1 338 ? 5.273   -11.604 72.972  1.00 23.84  ?  335  VAL A CA    1 
ATOM   2798  C C     . VAL A 1 338 ? 5.239   -12.471 74.221  1.00 29.39  ?  335  VAL A C     1 
ATOM   2799  O O     . VAL A 1 338 ? 4.479   -13.445 74.287  1.00 30.58  ?  335  VAL A O     1 
ATOM   2800  C CB    . VAL A 1 338 ? 4.001   -10.746 72.859  1.00 29.22  ?  335  VAL A CB    1 
ATOM   2801  C CG1   . VAL A 1 338 ? 3.899   -9.784  74.037  1.00 26.17  ?  335  VAL A CG1   1 
ATOM   2802  C CG2   . VAL A 1 338 ? 3.991   -9.989  71.540  1.00 26.82  ?  335  VAL A CG2   1 
ATOM   2803  N N     . GLU A 1 339 ? 6.062   -12.122 75.206  1.00 28.50  ?  336  GLU A N     1 
ATOM   2804  C CA    . GLU A 1 339 ? 6.207   -12.935 76.405  1.00 30.24  ?  336  GLU A CA    1 
ATOM   2805  C C     . GLU A 1 339 ? 6.267   -12.026 77.621  1.00 26.03  ?  336  GLU A C     1 
ATOM   2806  O O     . GLU A 1 339 ? 7.144   -11.164 77.715  1.00 30.68  ?  336  GLU A O     1 
ATOM   2807  C CB    . GLU A 1 339 ? 7.461   -13.807 76.327  1.00 44.17  ?  336  GLU A CB    1 
ATOM   2808  C CG    . GLU A 1 339 ? 7.713   -14.643 77.566  1.00 51.49  ?  336  GLU A CG    1 
ATOM   2809  C CD    . GLU A 1 339 ? 8.929   -15.534 77.424  1.00 57.87  ?  336  GLU A CD    1 
ATOM   2810  O OE1   . GLU A 1 339 ? 9.138   -16.403 78.297  1.00 64.63  ?  336  GLU A OE1   1 
ATOM   2811  O OE2   . GLU A 1 339 ? 9.675   -15.368 76.436  1.00 54.68  -1 336  GLU A OE2   1 
ATOM   2812  N N     . PHE A 1 340 ? 5.343   -12.222 78.551  1.00 28.65  ?  337  PHE A N     1 
ATOM   2813  C CA    . PHE A 1 340 ? 5.356   -11.513 79.822  1.00 32.32  ?  337  PHE A CA    1 
ATOM   2814  C C     . PHE A 1 340 ? 5.958   -12.445 80.864  1.00 27.65  ?  337  PHE A C     1 
ATOM   2815  O O     . PHE A 1 340 ? 5.342   -13.445 81.245  1.00 23.04  ?  337  PHE A O     1 
ATOM   2816  C CB    . PHE A 1 340 ? 3.953   -11.048 80.196  1.00 29.06  ?  337  PHE A CB    1 
ATOM   2817  C CG    . PHE A 1 340 ? 3.388   -10.053 79.228  1.00 27.78  ?  337  PHE A CG    1 
ATOM   2818  C CD1   . PHE A 1 340 ? 3.869   -8.756  79.196  1.00 31.02  ?  337  PHE A CD1   1 
ATOM   2819  C CD2   . PHE A 1 340 ? 2.405   -10.419 78.327  1.00 42.34  ?  337  PHE A CD2   1 
ATOM   2820  C CE1   . PHE A 1 340 ? 3.369   -7.835  78.296  1.00 36.63  ?  337  PHE A CE1   1 
ATOM   2821  C CE2   . PHE A 1 340 ? 1.899   -9.500  77.424  1.00 40.29  ?  337  PHE A CE2   1 
ATOM   2822  C CZ    . PHE A 1 340 ? 2.384   -8.209  77.410  1.00 37.00  ?  337  PHE A CZ    1 
ATOM   2823  N N     . LEU A 1 341 ? 7.180   -12.133 81.290  1.00 25.52  ?  338  LEU A N     1 
ATOM   2824  C CA    . LEU A 1 341 ? 7.888   -12.975 82.241  1.00 25.37  ?  338  LEU A CA    1 
ATOM   2825  C C     . LEU A 1 341 ? 7.207   -12.923 83.599  1.00 31.45  ?  338  LEU A C     1 
ATOM   2826  O O     . LEU A 1 341 ? 6.789   -11.859 84.060  1.00 25.89  ?  338  LEU A O     1 
ATOM   2827  C CB    . LEU A 1 341 ? 9.339   -12.517 82.376  1.00 30.72  ?  338  LEU A CB    1 
ATOM   2828  C CG    . LEU A 1 341 ? 10.109  -12.193 81.095  1.00 29.86  ?  338  LEU A CG    1 
ATOM   2829  C CD1   . LEU A 1 341 ? 11.511  -11.727 81.444  1.00 30.11  ?  338  LEU A CD1   1 
ATOM   2830  C CD2   . LEU A 1 341 ? 10.157  -13.397 80.170  1.00 35.39  ?  338  LEU A CD2   1 
ATOM   2831  N N     . ARG A 1 342 ? 7.102   -14.076 84.251  1.00 33.57  ?  339  ARG A N     1 
ATOM   2832  C CA    . ARG A 1 342 ? 6.485   -14.147 85.565  1.00 43.47  ?  339  ARG A CA    1 
ATOM   2833  C C     . ARG A 1 342 ? 7.457   -14.740 86.574  1.00 40.47  ?  339  ARG A C     1 
ATOM   2834  O O     . ARG A 1 342 ? 8.182   -15.695 86.275  1.00 39.98  ?  339  ARG A O     1 
ATOM   2835  C CB    . ARG A 1 342 ? 5.183   -14.957 85.529  1.00 48.21  ?  339  ARG A CB    1 
ATOM   2836  C CG    . ARG A 1 342 ? 5.183   -16.114 84.555  1.00 61.32  ?  339  ARG A CG    1 
ATOM   2837  C CD    . ARG A 1 342 ? 3.761   -16.537 84.215  1.00 65.54  ?  339  ARG A CD    1 
ATOM   2838  N NE    . ARG A 1 342 ? 3.001   -16.928 85.399  1.00 70.96  ?  339  ARG A NE    1 
ATOM   2839  C CZ    . ARG A 1 342 ? 3.176   -18.074 86.050  1.00 67.51  ?  339  ARG A CZ    1 
ATOM   2840  N NH1   . ARG A 1 342 ? 4.095   -18.937 85.637  1.00 62.82  1  339  ARG A NH1   1 
ATOM   2841  N NH2   . ARG A 1 342 ? 2.440   -18.355 87.117  1.00 60.49  ?  339  ARG A NH2   1 
ATOM   2842  N N     . ASP A 1 343 ? 7.474   -14.142 87.760  1.00 39.43  ?  340  ASP A N     1 
ATOM   2843  C CA    . ASP A 1 343 ? 8.282   -14.630 88.869  1.00 43.54  ?  340  ASP A CA    1 
ATOM   2844  C C     . ASP A 1 343 ? 7.687   -15.930 89.393  1.00 43.40  ?  340  ASP A C     1 
ATOM   2845  O O     . ASP A 1 343 ? 6.524   -15.962 89.803  1.00 48.73  ?  340  ASP A O     1 
ATOM   2846  C CB    . ASP A 1 343 ? 8.336   -13.561 89.962  1.00 48.65  ?  340  ASP A CB    1 
ATOM   2847  C CG    . ASP A 1 343 ? 8.820   -14.094 91.298  1.00 56.54  ?  340  ASP A CG    1 
ATOM   2848  O OD1   . ASP A 1 343 ? 9.613   -15.059 91.325  1.00 69.63  ?  340  ASP A OD1   1 
ATOM   2849  O OD2   . ASP A 1 343 ? 8.412   -13.525 92.333  1.00 64.65  -1 340  ASP A OD2   1 
ATOM   2850  N N     . SER A 1 344 ? 8.486   -17.001 89.382  1.00 50.69  ?  341  SER A N     1 
ATOM   2851  C CA    . SER A 1 344 ? 7.996   -18.293 89.854  1.00 54.39  ?  341  SER A CA    1 
ATOM   2852  C C     . SER A 1 344 ? 7.521   -18.217 91.300  1.00 46.33  ?  341  SER A C     1 
ATOM   2853  O O     . SER A 1 344 ? 6.603   -18.946 91.691  1.00 48.89  ?  341  SER A O     1 
ATOM   2854  C CB    . SER A 1 344 ? 9.088   -19.354 89.702  1.00 53.70  ?  341  SER A CB    1 
ATOM   2855  O OG    . SER A 1 344 ? 8.548   -20.662 89.795  1.00 60.18  ?  341  SER A OG    1 
ATOM   2856  N N     . LYS A 1 345 ? 8.120   -17.333 92.098  1.00 51.18  ?  342  LYS A N     1 
ATOM   2857  C CA    . LYS A 1 345 ? 7.706   -17.136 93.482  1.00 45.61  ?  342  LYS A CA    1 
ATOM   2858  C C     . LYS A 1 345 ? 6.289   -16.577 93.547  1.00 50.85  ?  342  LYS A C     1 
ATOM   2859  O O     . LYS A 1 345 ? 5.375   -17.243 94.042  1.00 55.98  ?  342  LYS A O     1 
ATOM   2860  C CB    . LYS A 1 345 ? 8.690   -16.206 94.199  1.00 45.77  ?  342  LYS A CB    1 
ATOM   2861  C CG    . LYS A 1 345 ? 8.505   -16.126 95.703  1.00 50.57  ?  342  LYS A CG    1 
ATOM   2862  C CD    . LYS A 1 345 ? 9.748   -15.569 96.390  1.00 56.07  ?  342  LYS A CD    1 
ATOM   2863  C CE    . LYS A 1 345 ? 9.738   -14.051 96.444  1.00 59.06  ?  342  LYS A CE    1 
ATOM   2864  N NZ    . LYS A 1 345 ? 10.058  -13.570 97.818  1.00 60.24  1  342  LYS A NZ    1 
ATOM   2865  N N     . THR A 1 346 ? 6.093   -15.360 93.038  1.00 51.38  ?  343  THR A N     1 
ATOM   2866  C CA    . THR A 1 346 ? 4.789   -14.709 93.090  1.00 46.07  ?  343  THR A CA    1 
ATOM   2867  C C     . THR A 1 346 ? 3.845   -15.159 91.980  1.00 37.65  ?  343  THR A C     1 
ATOM   2868  O O     . THR A 1 346 ? 2.667   -14.786 92.009  1.00 43.75  ?  343  THR A O     1 
ATOM   2869  C CB    . THR A 1 346 ? 4.956   -13.187 93.025  1.00 49.81  ?  343  THR A CB    1 
ATOM   2870  O OG1   . THR A 1 346 ? 5.584   -12.824 91.789  1.00 47.91  ?  343  THR A OG1   1 
ATOM   2871  C CG2   . THR A 1 346 ? 5.808   -12.692 94.185  1.00 46.12  ?  343  THR A CG2   1 
ATOM   2872  N N     . LYS A 1 347 ? 4.326   -15.936 91.008  1.00 34.18  ?  344  LYS A N     1 
ATOM   2873  C CA    . LYS A 1 347 ? 3.538   -16.410 89.869  1.00 42.94  ?  344  LYS A CA    1 
ATOM   2874  C C     . LYS A 1 347 ? 2.921   -15.269 89.065  1.00 51.03  ?  344  LYS A C     1 
ATOM   2875  O O     . LYS A 1 347 ? 1.988   -15.489 88.287  1.00 50.52  ?  344  LYS A O     1 
ATOM   2876  C CB    . LYS A 1 347 ? 2.449   -17.396 90.310  1.00 53.33  ?  344  LYS A CB    1 
ATOM   2877  C CG    . LYS A 1 347 ? 2.991   -18.699 90.876  1.00 54.21  ?  344  LYS A CG    1 
ATOM   2878  C CD    . LYS A 1 347 ? 1.925   -19.785 90.902  1.00 56.31  ?  344  LYS A CD    1 
ATOM   2879  C CE    . LYS A 1 347 ? 2.258   -20.902 89.923  1.00 55.57  ?  344  LYS A CE    1 
ATOM   2880  N NZ    . LYS A 1 347 ? 1.281   -22.024 89.995  1.00 57.33  1  344  LYS A NZ    1 
ATOM   2881  N N     . SER A 1 348 ? 3.441   -14.054 89.222  1.00 39.33  ?  345  SER A N     1 
ATOM   2882  C CA    . SER A 1 348 ? 2.898   -12.869 88.580  1.00 37.47  ?  345  SER A CA    1 
ATOM   2883  C C     . SER A 1 348 ? 3.950   -12.213 87.697  1.00 34.26  ?  345  SER A C     1 
ATOM   2884  O O     . SER A 1 348 ? 5.156   -12.343 87.931  1.00 32.06  ?  345  SER A O     1 
ATOM   2885  C CB    . SER A 1 348 ? 2.400   -11.859 89.622  1.00 40.91  ?  345  SER A CB    1 
ATOM   2886  O OG    . SER A 1 348 ? 2.016   -10.636 89.018  1.00 33.32  ?  345  SER A OG    1 
ATOM   2887  N N     . SER A 1 349 ? 3.477   -11.509 86.672  1.00 26.90  ?  346  SER A N     1 
ATOM   2888  C CA    . SER A 1 349 ? 4.321   -10.664 85.840  1.00 27.11  ?  346  SER A CA    1 
ATOM   2889  C C     . SER A 1 349 ? 4.224   -9.198  86.240  1.00 30.14  ?  346  SER A C     1 
ATOM   2890  O O     . SER A 1 349 ? 4.723   -8.331  85.517  1.00 24.55  ?  346  SER A O     1 
ATOM   2891  C CB    . SER A 1 349 ? 3.948   -10.829 84.363  1.00 25.31  ?  346  SER A CB    1 
ATOM   2892  O OG    . SER A 1 349 ? 2.774   -10.106 84.039  1.00 34.60  ?  346  SER A OG    1 
ATOM   2893  N N     . ALA A 1 350 ? 3.590   -8.906  87.374  1.00 28.45  ?  347  ALA A N     1 
ATOM   2894  C CA    . ALA A 1 350 ? 3.319   -7.544  87.807  1.00 27.79  ?  347  ALA A CA    1 
ATOM   2895  C C     . ALA A 1 350 ? 4.007   -7.274  89.137  1.00 32.02  ?  347  ALA A C     1 
ATOM   2896  O O     . ALA A 1 350 ? 4.041   -8.138  90.019  1.00 28.06  ?  347  ALA A O     1 
ATOM   2897  C CB    . ALA A 1 350 ? 1.812   -7.298  87.935  1.00 31.47  ?  347  ALA A CB    1 
ATOM   2898  N N     . PHE A 1 351 ? 4.555   -6.069  89.273  1.00 17.03  ?  348  PHE A N     1 
ATOM   2899  C CA    . PHE A 1 351 ? 5.333   -5.699  90.442  1.00 19.20  ?  348  PHE A CA    1 
ATOM   2900  C C     . PHE A 1 351 ? 5.015   -4.257  90.801  1.00 21.73  ?  348  PHE A C     1 
ATOM   2901  O O     . PHE A 1 351 ? 4.435   -3.509  90.012  1.00 17.85  ?  348  PHE A O     1 
ATOM   2902  C CB    . PHE A 1 351 ? 6.836   -5.883  90.192  1.00 32.69  ?  348  PHE A CB    1 
ATOM   2903  C CG    . PHE A 1 351 ? 7.188   -7.228  89.629  1.00 28.47  ?  348  PHE A CG    1 
ATOM   2904  C CD1   . PHE A 1 351 ? 7.171   -7.443  88.262  1.00 27.51  ?  348  PHE A CD1   1 
ATOM   2905  C CD2   . PHE A 1 351 ? 7.515   -8.282  90.466  1.00 42.65  ?  348  PHE A CD2   1 
ATOM   2906  C CE1   . PHE A 1 351 ? 7.481   -8.681  87.738  1.00 30.58  ?  348  PHE A CE1   1 
ATOM   2907  C CE2   . PHE A 1 351 ? 7.829   -9.524  89.948  1.00 40.08  ?  348  PHE A CE2   1 
ATOM   2908  C CZ    . PHE A 1 351 ? 7.809   -9.723  88.582  1.00 33.35  ?  348  PHE A CZ    1 
ATOM   2909  N N     . LEU A 1 352 ? 5.399   -3.868  92.009  1.00 25.05  ?  349  LEU A N     1 
ATOM   2910  C CA    . LEU A 1 352 ? 5.162   -2.520  92.495  1.00 27.28  ?  349  LEU A CA    1 
ATOM   2911  C C     . LEU A 1 352 ? 6.455   -1.717  92.485  1.00 23.90  ?  349  LEU A C     1 
ATOM   2912  O O     . LEU A 1 352 ? 7.555   -2.270  92.572  1.00 26.70  ?  349  LEU A O     1 
ATOM   2913  C CB    . LEU A 1 352 ? 4.579   -2.541  93.911  1.00 38.66  ?  349  LEU A CB    1 
ATOM   2914  C CG    . LEU A 1 352 ? 3.172   -3.117  94.089  1.00 36.70  ?  349  LEU A CG    1 
ATOM   2915  C CD1   . LEU A 1 352 ? 2.777   -3.110  95.555  1.00 38.64  ?  349  LEU A CD1   1 
ATOM   2916  C CD2   . LEU A 1 352 ? 2.159   -2.346  93.254  1.00 29.69  ?  349  LEU A CD2   1 
ATOM   2917  N N     . TYR A 1 353 ? 6.312   -0.403  92.348  1.00 26.54  ?  350  TYR A N     1 
ATOM   2918  C CA    . TYR A 1 353 ? 7.407   0.517   92.598  1.00 27.94  ?  350  TYR A CA    1 
ATOM   2919  C C     . TYR A 1 353 ? 6.908   1.600   93.538  1.00 25.97  ?  350  TYR A C     1 
ATOM   2920  O O     . TYR A 1 353 ? 5.707   1.860   93.636  1.00 25.75  ?  350  TYR A O     1 
ATOM   2921  C CB    . TYR A 1 353 ? 7.970   1.131   91.304  1.00 20.83  ?  350  TYR A CB    1 
ATOM   2922  C CG    . TYR A 1 353 ? 7.071   2.138   90.618  1.00 27.94  ?  350  TYR A CG    1 
ATOM   2923  C CD1   . TYR A 1 353 ? 6.117   1.733   89.696  1.00 21.82  ?  350  TYR A CD1   1 
ATOM   2924  C CD2   . TYR A 1 353 ? 7.197   3.497   90.875  1.00 25.53  ?  350  TYR A CD2   1 
ATOM   2925  C CE1   . TYR A 1 353 ? 5.303   2.650   89.060  1.00 15.34  ?  350  TYR A CE1   1 
ATOM   2926  C CE2   . TYR A 1 353 ? 6.388   4.420   90.244  1.00 26.14  ?  350  TYR A CE2   1 
ATOM   2927  C CZ    . TYR A 1 353 ? 5.442   3.991   89.338  1.00 21.20  ?  350  TYR A CZ    1 
ATOM   2928  O OH    . TYR A 1 353 ? 4.634   4.909   88.704  1.00 24.80  ?  350  TYR A OH    1 
ATOM   2929  N N     . ASN A 1 354 ? 7.842   2.208   94.248  1.00 22.42  ?  351  ASN A N     1 
ATOM   2930  C CA    . ASN A 1 354 ? 7.507   3.276   95.177  1.00 24.11  ?  351  ASN A CA    1 
ATOM   2931  C C     . ASN A 1 354 ? 7.387   4.577   94.395  1.00 24.18  ?  351  ASN A C     1 
ATOM   2932  O O     . ASN A 1 354 ? 8.403   5.124   93.955  1.00 23.30  ?  351  ASN A O     1 
ATOM   2933  C CB    . ASN A 1 354 ? 8.573   3.373   96.274  1.00 25.38  ?  351  ASN A CB    1 
ATOM   2934  C CG    . ASN A 1 354 ? 8.232   4.393   97.344  1.00 33.29  ?  351  ASN A CG    1 
ATOM   2935  O OD1   . ASN A 1 354 ? 7.792   5.503   97.049  1.00 35.10  ?  351  ASN A OD1   1 
ATOM   2936  N ND2   . ASN A 1 354 ? 8.446   4.021   98.599  1.00 32.92  ?  351  ASN A ND2   1 
ATOM   2937  N N     . PRO A 1 355 ? 6.174   5.107   94.205  1.00 24.90  ?  352  PRO A N     1 
ATOM   2938  C CA    . PRO A 1 355 ? 6.031   6.343   93.419  1.00 37.98  ?  352  PRO A CA    1 
ATOM   2939  C C     . PRO A 1 355 ? 6.555   7.571   94.133  1.00 43.01  ?  352  PRO A C     1 
ATOM   2940  O O     . PRO A 1 355 ? 6.791   8.595   93.481  1.00 48.08  ?  352  PRO A O     1 
ATOM   2941  C CB    . PRO A 1 355 ? 4.520   6.437   93.190  1.00 35.58  ?  352  PRO A CB    1 
ATOM   2942  C CG    . PRO A 1 355 ? 3.939   5.786   94.402  1.00 28.62  ?  352  PRO A CG    1 
ATOM   2943  C CD    . PRO A 1 355 ? 4.890   4.674   94.785  1.00 26.47  ?  352  PRO A CD    1 
ATOM   2944  N N     . GLU A 1 356 ? 6.732   7.501   95.452  1.00 44.04  ?  353  GLU A N     1 
ATOM   2945  C CA    . GLU A 1 356 ? 7.272   8.615   96.219  1.00 41.55  ?  353  GLU A CA    1 
ATOM   2946  C C     . GLU A 1 356 ? 8.775   8.748   96.002  1.00 43.53  ?  353  GLU A C     1 
ATOM   2947  O O     . GLU A 1 356 ? 9.281   9.845   95.739  1.00 43.20  ?  353  GLU A O     1 
ATOM   2948  C CB    . GLU A 1 356 ? 6.949   8.407   97.701  1.00 52.15  ?  353  GLU A CB    1 
ATOM   2949  C CG    . GLU A 1 356 ? 6.866   9.656   98.546  1.00 62.79  ?  353  GLU A CG    1 
ATOM   2950  C CD    . GLU A 1 356 ? 6.564   9.329   99.997  1.00 72.25  ?  353  GLU A CD    1 
ATOM   2951  O OE1   . GLU A 1 356 ? 5.978   8.255   100.253 1.00 71.22  ?  353  GLU A OE1   1 
ATOM   2952  O OE2   . GLU A 1 356 ? 6.924   10.133  100.881 1.00 76.87  -1 353  GLU A OE2   1 
ATOM   2953  N N     . GLU A 1 357 ? 9.500   7.633   96.093  1.00 39.85  ?  354  GLU A N     1 
ATOM   2954  C CA    . GLU A 1 357 ? 10.945  7.613   95.922  1.00 34.40  ?  354  GLU A CA    1 
ATOM   2955  C C     . GLU A 1 357 ? 11.381  7.212   94.521  1.00 34.93  ?  354  GLU A C     1 
ATOM   2956  O O     . GLU A 1 357 ? 12.556  7.398   94.182  1.00 39.15  ?  354  GLU A O     1 
ATOM   2957  C CB    . GLU A 1 357 ? 11.580  6.654   96.936  1.00 44.50  ?  354  GLU A CB    1 
ATOM   2958  C CG    . GLU A 1 357 ? 11.231  6.964   98.378  1.00 57.86  ?  354  GLU A CG    1 
ATOM   2959  C CD    . GLU A 1 357 ? 11.743  8.318   98.817  1.00 70.19  ?  354  GLU A CD    1 
ATOM   2960  O OE1   . GLU A 1 357 ? 12.973  8.530   98.775  1.00 79.49  ?  354  GLU A OE1   1 
ATOM   2961  O OE2   . GLU A 1 357 ? 10.915  9.175   99.193  1.00 68.58  -1 354  GLU A OE2   1 
ATOM   2962  N N     . PHE A 1 358 ? 10.471  6.667   93.710  1.00 32.42  ?  355  PHE A N     1 
ATOM   2963  C CA    . PHE A 1 358 ? 10.801  6.131   92.387  1.00 33.37  ?  355  PHE A CA    1 
ATOM   2964  C C     . PHE A 1 358 ? 11.864  5.040   92.498  1.00 35.43  ?  355  PHE A C     1 
ATOM   2965  O O     . PHE A 1 358 ? 12.885  5.053   91.807  1.00 36.77  ?  355  PHE A O     1 
ATOM   2966  C CB    . PHE A 1 358 ? 11.228  7.246   91.430  1.00 36.28  ?  355  PHE A CB    1 
ATOM   2967  C CG    . PHE A 1 358 ? 10.169  8.288   91.223  1.00 37.71  ?  355  PHE A CG    1 
ATOM   2968  C CD1   . PHE A 1 358 ? 9.086   8.035   90.398  1.00 45.77  ?  355  PHE A CD1   1 
ATOM   2969  C CD2   . PHE A 1 358 ? 10.242  9.511   91.868  1.00 42.13  ?  355  PHE A CD2   1 
ATOM   2970  C CE1   . PHE A 1 358 ? 8.102   8.986   90.214  1.00 49.88  ?  355  PHE A CE1   1 
ATOM   2971  C CE2   . PHE A 1 358 ? 9.261   10.468  91.687  1.00 47.56  ?  355  PHE A CE2   1 
ATOM   2972  C CZ    . PHE A 1 358 ? 8.190   10.205  90.857  1.00 51.21  ?  355  PHE A CZ    1 
ATOM   2973  N N     . THR A 1 359 ? 11.604  4.082   93.385  1.00 29.99  ?  356  THR A N     1 
ATOM   2974  C CA    . THR A 1 359 ? 12.512  2.987   93.676  1.00 24.36  ?  356  THR A CA    1 
ATOM   2975  C C     . THR A 1 359 ? 11.804  1.655   93.467  1.00 27.19  ?  356  THR A C     1 
ATOM   2976  O O     . THR A 1 359 ? 10.575  1.563   93.513  1.00 24.45  ?  356  THR A O     1 
ATOM   2977  C CB    . THR A 1 359 ? 13.039  3.066   95.115  1.00 31.90  ?  356  THR A CB    1 
ATOM   2978  O OG1   . THR A 1 359 ? 11.932  3.113   96.025  1.00 33.06  ?  356  THR A OG1   1 
ATOM   2979  C CG2   . THR A 1 359 ? 13.901  4.305   95.303  1.00 40.57  ?  356  THR A CG2   1 
ATOM   2980  N N     . VAL A 1 360 ? 12.604  0.618   93.242  1.00 24.24  ?  357  VAL A N     1 
ATOM   2981  C CA    . VAL A 1 360 ? 12.118  -0.743  93.060  1.00 36.91  ?  357  VAL A CA    1 
ATOM   2982  C C     . VAL A 1 360 ? 12.899  -1.650  93.997  1.00 37.01  ?  357  VAL A C     1 
ATOM   2983  O O     . VAL A 1 360 ? 14.120  -1.509  94.134  1.00 36.87  ?  357  VAL A O     1 
ATOM   2984  C CB    . VAL A 1 360 ? 12.268  -1.213  91.596  1.00 29.98  ?  357  VAL A CB    1 
ATOM   2985  C CG1   . VAL A 1 360 ? 11.847  -2.665  91.448  1.00 31.45  ?  357  VAL A CG1   1 
ATOM   2986  C CG2   . VAL A 1 360 ? 11.461  -0.320  90.664  1.00 31.76  ?  357  VAL A CG2   1 
ATOM   2987  N N     . LYS A 1 361 ? 12.200  -2.572  94.653  1.00 41.12  ?  358  LYS A N     1 
ATOM   2988  C CA    . LYS A 1 361 ? 12.867  -3.530  95.523  1.00 36.19  ?  358  LYS A CA    1 
ATOM   2989  C C     . LYS A 1 361 ? 13.574  -4.565  94.654  1.00 38.85  ?  358  LYS A C     1 
ATOM   2990  O O     . LYS A 1 361 ? 12.961  -5.170  93.767  1.00 46.27  ?  358  LYS A O     1 
ATOM   2991  C CB    . LYS A 1 361 ? 11.873  -4.180  96.488  1.00 40.40  ?  358  LYS A CB    1 
ATOM   2992  C CG    . LYS A 1 361 ? 10.894  -5.173  95.877  1.00 53.96  ?  358  LYS A CG    1 
ATOM   2993  C CD    . LYS A 1 361 ? 9.622   -5.285  96.700  1.00 60.93  ?  358  LYS A CD    1 
ATOM   2994  C CE    . LYS A 1 361 ? 9.388   -6.710  97.177  1.00 59.59  ?  358  LYS A CE    1 
ATOM   2995  N NZ    . LYS A 1 361 ? 7.957   -6.947  97.521  1.00 59.84  1  358  LYS A NZ    1 
ATOM   2996  N N     . ASN A 1 362 ? 14.875  -4.726  94.868  1.00 37.44  ?  359  ASN A N     1 
ATOM   2997  C CA    . ASN A 1 362 ? 15.622  -5.735  94.134  1.00 36.49  ?  359  ASN A CA    1 
ATOM   2998  C C     . ASN A 1 362 ? 15.224  -7.118  94.632  1.00 34.29  ?  359  ASN A C     1 
ATOM   2999  O O     . ASN A 1 362 ? 15.154  -7.359  95.841  1.00 36.22  ?  359  ASN A O     1 
ATOM   3000  C CB    . ASN A 1 362 ? 17.126  -5.516  94.297  1.00 41.59  ?  359  ASN A CB    1 
ATOM   3001  C CG    . ASN A 1 362 ? 17.905  -5.844  93.035  1.00 58.26  ?  359  ASN A CG    1 
ATOM   3002  O OD1   . ASN A 1 362 ? 17.354  -6.369  92.067  1.00 55.46  ?  359  ASN A OD1   1 
ATOM   3003  N ND2   . ASN A 1 362 ? 19.199  -5.540  93.044  1.00 73.41  ?  359  ASN A ND2   1 
ATOM   3004  N N     . THR A 1 363 ? 14.932  -8.020  93.699  1.00 38.95  ?  360  THR A N     1 
ATOM   3005  C CA    . THR A 1 363 ? 14.548  -9.385  94.023  1.00 37.62  ?  360  THR A CA    1 
ATOM   3006  C C     . THR A 1 363 ? 15.398  -10.340 93.201  1.00 27.45  ?  360  THR A C     1 
ATOM   3007  O O     . THR A 1 363 ? 16.085  -9.938  92.259  1.00 40.40  ?  360  THR A O     1 
ATOM   3008  C CB    . THR A 1 363 ? 13.060  -9.645  93.751  1.00 33.03  ?  360  THR A CB    1 
ATOM   3009  O OG1   . THR A 1 363 ? 12.838  -9.715  92.338  1.00 29.69  ?  360  THR A OG1   1 
ATOM   3010  C CG2   . THR A 1 363 ? 12.205  -8.535  94.333  1.00 36.51  ?  360  THR A CG2   1 
ATOM   3011  N N     . GLU A 1 364 ? 15.348  -11.621 93.567  1.00 34.21  ?  361  GLU A N     1 
ATOM   3012  C CA    . GLU A 1 364 ? 16.042  -12.632 92.777  1.00 36.72  ?  361  GLU A CA    1 
ATOM   3013  C C     . GLU A 1 364 ? 15.548  -12.624 91.339  1.00 27.81  ?  361  GLU A C     1 
ATOM   3014  O O     . GLU A 1 364 ? 16.347  -12.591 90.398  1.00 30.07  ?  361  GLU A O     1 
ATOM   3015  C CB    . GLU A 1 364 ? 15.856  -14.014 93.402  1.00 42.46  ?  361  GLU A CB    1 
ATOM   3016  C CG    . GLU A 1 364 ? 16.521  -15.135 92.614  1.00 51.57  ?  361  GLU A CG    1 
ATOM   3017  C CD    . GLU A 1 364 ? 16.284  -16.501 93.228  1.00 63.42  ?  361  GLU A CD    1 
ATOM   3018  O OE1   . GLU A 1 364 ? 16.341  -17.507 92.489  1.00 69.28  ?  361  GLU A OE1   1 
ATOM   3019  O OE2   . GLU A 1 364 ? 16.036  -16.569 94.450  1.00 72.30  -1 361  GLU A OE2   1 
ATOM   3020  N N     . PHE A 1 365 ? 14.226  -12.631 91.154  1.00 41.29  ?  362  PHE A N     1 
ATOM   3021  C CA    . PHE A 1 365 ? 13.653  -12.671 89.811  1.00 38.92  ?  362  PHE A CA    1 
ATOM   3022  C C     . PHE A 1 365 ? 14.079  -11.463 88.987  1.00 28.50  ?  362  PHE A C     1 
ATOM   3023  O O     . PHE A 1 365 ? 14.507  -11.601 87.835  1.00 28.43  ?  362  PHE A O     1 
ATOM   3024  C CB    . PHE A 1 365 ? 12.129  -12.741 89.891  1.00 36.41  ?  362  PHE A CB    1 
ATOM   3025  C CG    . PHE A 1 365 ? 11.450  -12.546 88.567  1.00 38.79  ?  362  PHE A CG    1 
ATOM   3026  C CD1   . PHE A 1 365 ? 11.335  -13.598 87.676  1.00 40.83  ?  362  PHE A CD1   1 
ATOM   3027  C CD2   . PHE A 1 365 ? 10.942  -11.309 88.205  1.00 29.83  ?  362  PHE A CD2   1 
ATOM   3028  C CE1   . PHE A 1 365 ? 10.717  -13.426 86.452  1.00 37.53  ?  362  PHE A CE1   1 
ATOM   3029  C CE2   . PHE A 1 365 ? 10.329  -11.130 86.978  1.00 31.93  ?  362  PHE A CE2   1 
ATOM   3030  C CZ    . PHE A 1 365 ? 10.213  -12.190 86.104  1.00 24.98  ?  362  PHE A CZ    1 
ATOM   3031  N N     . ILE A 1 366 ? 13.945  -10.264 89.555  1.00 30.38  ?  363  ILE A N     1 
ATOM   3032  C CA    . ILE A 1 366 ? 14.322  -9.054  88.830  1.00 37.62  ?  363  ILE A CA    1 
ATOM   3033  C C     . ILE A 1 366 ? 15.815  -9.052  88.537  1.00 33.88  ?  363  ILE A C     1 
ATOM   3034  O O     . ILE A 1 366 ? 16.247  -8.711  87.428  1.00 35.20  ?  363  ILE A O     1 
ATOM   3035  C CB    . ILE A 1 366 ? 13.897  -7.806  89.627  1.00 38.58  ?  363  ILE A CB    1 
ATOM   3036  C CG1   . ILE A 1 366 ? 12.371  -7.732  89.721  1.00 40.53  ?  363  ILE A CG1   1 
ATOM   3037  C CG2   . ILE A 1 366 ? 14.473  -6.544  88.999  1.00 40.73  ?  363  ILE A CG2   1 
ATOM   3038  C CD1   . ILE A 1 366 ? 11.870  -6.706  90.716  1.00 42.22  ?  363  ILE A CD1   1 
ATOM   3039  N N     . ASN A 1 367 ? 16.628  -9.450  89.518  1.00 37.54  ?  364  ASN A N     1 
ATOM   3040  C CA    . ASN A 1 367 ? 18.076  -9.405  89.342  1.00 35.60  ?  364  ASN A CA    1 
ATOM   3041  C C     . ASN A 1 367 ? 18.545  -10.400 88.286  1.00 33.87  ?  364  ASN A C     1 
ATOM   3042  O O     . ASN A 1 367 ? 19.493  -10.119 87.542  1.00 39.86  ?  364  ASN A O     1 
ATOM   3043  C CB    . ASN A 1 367 ? 18.771  -9.663  90.678  1.00 44.69  ?  364  ASN A CB    1 
ATOM   3044  C CG    . ASN A 1 367 ? 20.279  -9.700  90.554  1.00 50.43  ?  364  ASN A CG    1 
ATOM   3045  O OD1   . ASN A 1 367 ? 20.945  -8.666  90.622  1.00 46.33  ?  364  ASN A OD1   1 
ATOM   3046  N ND2   . ASN A 1 367 ? 20.828  -10.896 90.374  1.00 44.24  ?  364  ASN A ND2   1 
ATOM   3047  N N     . GLN A 1 368 ? 17.900  -11.565 88.198  1.00 38.95  ?  365  GLN A N     1 
ATOM   3048  C CA    . GLN A 1 368 ? 18.312  -12.574 87.228  1.00 38.92  ?  365  GLN A CA    1 
ATOM   3049  C C     . GLN A 1 368 ? 17.808  -12.290 85.821  1.00 46.38  ?  365  GLN A C     1 
ATOM   3050  O O     . GLN A 1 368 ? 18.150  -13.041 84.901  1.00 44.99  ?  365  GLN A O     1 
ATOM   3051  C CB    . GLN A 1 368 ? 17.852  -13.973 87.666  1.00 43.86  ?  365  GLN A CB    1 
ATOM   3052  C CG    . GLN A 1 368 ? 16.347  -14.155 87.863  1.00 48.18  ?  365  GLN A CG    1 
ATOM   3053  C CD    . GLN A 1 368 ? 15.580  -14.383 86.574  1.00 58.67  ?  365  GLN A CD    1 
ATOM   3054  O OE1   . GLN A 1 368 ? 15.747  -15.405 85.910  1.00 59.44  ?  365  GLN A OE1   1 
ATOM   3055  N NE2   . GLN A 1 368 ? 14.725  -13.429 86.219  1.00 53.58  ?  365  GLN A NE2   1 
ATOM   3056  N N     . ILE A 1 369 ? 17.007  -11.240 85.628  1.00 44.11  ?  366  ILE A N     1 
ATOM   3057  C CA    . ILE A 1 369 ? 16.513  -10.923 84.293  1.00 32.88  ?  366  ILE A CA    1 
ATOM   3058  C C     . ILE A 1 369 ? 17.689  -10.561 83.401  1.00 39.13  ?  366  ILE A C     1 
ATOM   3059  O O     . ILE A 1 369 ? 18.477  -9.660  83.715  1.00 36.68  ?  366  ILE A O     1 
ATOM   3060  C CB    . ILE A 1 369 ? 15.482  -9.793  84.344  1.00 29.02  ?  366  ILE A CB    1 
ATOM   3061  C CG1   . ILE A 1 369 ? 14.132  -10.328 84.829  1.00 35.02  ?  366  ILE A CG1   1 
ATOM   3062  C CG2   . ILE A 1 369 ? 15.345  -9.137  82.972  1.00 33.90  ?  366  ILE A CG2   1 
ATOM   3063  C CD1   . ILE A 1 369 ? 13.086  -9.254  85.040  1.00 35.02  ?  366  ILE A CD1   1 
ATOM   3064  N N     . GLU A 1 370 ? 17.813  -11.265 82.287  1.00 34.36  ?  367  GLU A N     1 
ATOM   3065  C CA    . GLU A 1 370 ? 18.832  -10.998 81.288  1.00 44.07  ?  367  GLU A CA    1 
ATOM   3066  C C     . GLU A 1 370 ? 18.152  -10.596 79.982  1.00 48.20  ?  367  GLU A C     1 
ATOM   3067  O O     . GLU A 1 370 ? 16.923  -10.555 79.883  1.00 45.63  ?  367  GLU A O     1 
ATOM   3068  C CB    . GLU A 1 370 ? 19.731  -12.220 81.091  1.00 52.40  ?  367  GLU A CB    1 
ATOM   3069  C CG    . GLU A 1 370 ? 20.140  -12.921 82.379  1.00 66.71  ?  367  GLU A CG    1 
ATOM   3070  C CD    . GLU A 1 370 ? 21.637  -12.895 82.601  1.00 75.21  ?  367  GLU A CD    1 
ATOM   3071  O OE1   . GLU A 1 370 ? 22.303  -12.003 82.035  1.00 82.37  ?  367  GLU A OE1   1 
ATOM   3072  O OE2   . GLU A 1 370 ? 22.150  -13.766 83.336  1.00 71.39  -1 367  GLU A OE2   1 
ATOM   3073  N N     . ASP A 1 371 ? 18.976  -10.291 78.978  1.00 44.09  ?  368  ASP A N     1 
ATOM   3074  C CA    . ASP A 1 371 ? 18.512  -9.933  77.640  1.00 47.57  ?  368  ASP A CA    1 
ATOM   3075  C C     . ASP A 1 371 ? 17.659  -8.669  77.655  1.00 40.04  ?  368  ASP A C     1 
ATOM   3076  O O     . ASP A 1 371 ? 17.674  -7.908  78.628  1.00 42.91  ?  368  ASP A O     1 
ATOM   3077  C CB    . ASP A 1 371 ? 17.727  -11.087 77.013  1.00 55.35  ?  368  ASP A CB    1 
ATOM   3078  C CG    . ASP A 1 371 ? 18.367  -12.432 77.274  1.00 75.87  ?  368  ASP A CG    1 
ATOM   3079  O OD1   . ASP A 1 371 ? 19.529  -12.455 77.731  1.00 84.85  ?  368  ASP A OD1   1 
ATOM   3080  O OD2   . ASP A 1 371 ? 17.712  -13.466 77.028  1.00 85.36  -1 368  ASP A OD2   1 
ATOM   3081  N N     . ASN A 1 372 ? 16.912  -8.441  76.574  1.00 33.30  ?  369  ASN A N     1 
ATOM   3082  C CA    . ASN A 1 372 ? 16.088  -7.246  76.421  1.00 28.53  ?  369  ASN A CA    1 
ATOM   3083  C C     . ASN A 1 372 ? 14.714  -7.520  77.018  1.00 33.50  ?  369  ASN A C     1 
ATOM   3084  O O     . ASN A 1 372 ? 13.950  -8.332  76.487  1.00 47.67  ?  369  ASN A O     1 
ATOM   3085  C CB    . ASN A 1 372 ? 15.969  -6.858  74.951  1.00 22.34  ?  369  ASN A CB    1 
ATOM   3086  C CG    . ASN A 1 372 ? 17.311  -6.819  74.250  1.00 27.83  ?  369  ASN A CG    1 
ATOM   3087  O OD1   . ASN A 1 372 ? 18.248  -6.176  74.716  1.00 32.98  ?  369  ASN A OD1   1 
ATOM   3088  N ND2   . ASN A 1 372 ? 17.413  -7.527  73.126  1.00 32.80  ?  369  ASN A ND2   1 
ATOM   3089  N N     . VAL A 1 373 ? 14.395  -6.843  78.118  1.00 20.37  ?  370  VAL A N     1 
ATOM   3090  C CA    . VAL A 1 373 ? 13.093  -6.970  78.762  1.00 19.49  ?  370  VAL A CA    1 
ATOM   3091  C C     . VAL A 1 373 ? 12.576  -5.570  79.046  1.00 24.38  ?  370  VAL A C     1 
ATOM   3092  O O     . VAL A 1 373 ? 13.250  -4.776  79.717  1.00 17.03  ?  370  VAL A O     1 
ATOM   3093  C CB    . VAL A 1 373 ? 13.158  -7.802  80.056  1.00 15.07  ?  370  VAL A CB    1 
ATOM   3094  C CG1   . VAL A 1 373 ? 11.808  -7.776  80.771  1.00 15.89  ?  370  VAL A CG1   1 
ATOM   3095  C CG2   . VAL A 1 373 ? 13.559  -9.234  79.741  1.00 22.32  ?  370  VAL A CG2   1 
ATOM   3096  N N     . MET A 1 374 ? 11.389  -5.270  78.533  1.00 30.37  ?  371  MET A N     1 
ATOM   3097  C CA    . MET A 1 374 ? 10.770  -3.970  78.733  1.00 17.11  ?  371  MET A CA    1 
ATOM   3098  C C     . MET A 1 374 ? 10.117  -3.899  80.106  1.00 16.92  ?  371  MET A C     1 
ATOM   3099  O O     . MET A 1 374 ? 9.442   -4.835  80.540  1.00 23.40  ?  371  MET A O     1 
ATOM   3100  C CB    . MET A 1 374 ? 9.722   -3.712  77.654  1.00 16.34  ?  371  MET A CB    1 
ATOM   3101  C CG    . MET A 1 374 ? 10.247  -3.867  76.242  1.00 36.48  ?  371  MET A CG    1 
ATOM   3102  S SD    . MET A 1 374 ? 11.483  -2.617  75.869  1.00 65.87  ?  371  MET A SD    1 
ATOM   3103  C CE    . MET A 1 374 ? 12.204  -3.306  74.392  1.00 43.81  ?  371  MET A CE    1 
ATOM   3104  N N     . ALA A 1 375 ? 10.314  -2.779  80.787  1.00 13.93  ?  372  ALA A N     1 
ATOM   3105  C CA    . ALA A 1 375 ? 9.625   -2.504  82.040  1.00 16.48  ?  372  ALA A CA    1 
ATOM   3106  C C     . ALA A 1 375 ? 8.496   -1.528  81.726  1.00 19.04  ?  372  ALA A C     1 
ATOM   3107  O O     . ALA A 1 375 ? 8.720   -0.326  81.569  1.00 18.05  ?  372  ALA A O     1 
ATOM   3108  C CB    . ALA A 1 375 ? 10.582  -1.951  83.086  1.00 16.35  ?  372  ALA A CB    1 
ATOM   3109  N N     . ILE A 1 376 ? 7.279   -2.058  81.617  1.00 14.11  ?  373  ILE A N     1 
ATOM   3110  C CA    . ILE A 1 376 ? 6.084   -1.238  81.420  1.00 14.23  ?  373  ILE A CA    1 
ATOM   3111  C C     . ILE A 1 376 ? 5.730   -0.628  82.773  1.00 20.25  ?  373  ILE A C     1 
ATOM   3112  O O     . ILE A 1 376 ? 5.155   -1.291  83.643  1.00 25.30  ?  373  ILE A O     1 
ATOM   3113  C CB    . ILE A 1 376 ? 4.926   -2.051  80.837  1.00 19.73  ?  373  ILE A CB    1 
ATOM   3114  C CG1   . ILE A 1 376 ? 5.300   -2.564  79.440  1.00 24.73  ?  373  ILE A CG1   1 
ATOM   3115  C CG2   . ILE A 1 376 ? 3.659   -1.207  80.775  1.00 19.94  ?  373  ILE A CG2   1 
ATOM   3116  C CD1   . ILE A 1 376 ? 4.406   -3.673  78.928  1.00 21.96  ?  373  ILE A CD1   1 
ATOM   3117  N N     . VAL A 1 377 ? 6.081   0.637   82.955  1.00 21.07  ?  374  VAL A N     1 
ATOM   3118  C CA    . VAL A 1 377 ? 5.951   1.324   84.233  1.00 11.81  ?  374  VAL A CA    1 
ATOM   3119  C C     . VAL A 1 377 ? 4.804   2.314   84.105  1.00 20.52  ?  374  VAL A C     1 
ATOM   3120  O O     . VAL A 1 377 ? 4.880   3.266   83.317  1.00 16.92  ?  374  VAL A O     1 
ATOM   3121  C CB    . VAL A 1 377 ? 7.253   2.033   84.626  1.00 18.93  ?  374  VAL A CB    1 
ATOM   3122  C CG1   . VAL A 1 377 ? 7.099   2.731   85.968  1.00 30.81  ?  374  VAL A CG1   1 
ATOM   3123  C CG2   . VAL A 1 377 ? 8.397   1.031   84.652  1.00 20.71  ?  374  VAL A CG2   1 
ATOM   3124  N N     . LEU A 1 378 ? 3.736   2.085   84.863  1.00 21.48  ?  375  LEU A N     1 
ATOM   3125  C CA    . LEU A 1 378 ? 2.554   2.930   84.784  1.00 21.27  ?  375  LEU A CA    1 
ATOM   3126  C C     . LEU A 1 378 ? 2.738   4.157   85.667  1.00 23.03  ?  375  LEU A C     1 
ATOM   3127  O O     . LEU A 1 378 ? 2.931   4.035   86.883  1.00 17.95  ?  375  LEU A O     1 
ATOM   3128  C CB    . LEU A 1 378 ? 1.307   2.149   85.196  1.00 18.29  ?  375  LEU A CB    1 
ATOM   3129  C CG    . LEU A 1 378 ? 0.718   1.192   84.159  1.00 27.15  ?  375  LEU A CG    1 
ATOM   3130  C CD1   . LEU A 1 378 ? 1.516   -0.104  84.070  1.00 29.50  ?  375  LEU A CD1   1 
ATOM   3131  C CD2   . LEU A 1 378 ? -0.745  0.913   84.476  1.00 35.29  ?  375  LEU A CD2   1 
ATOM   3132  N N     . LEU A 1 379 ? 2.688   5.335   85.052  1.00 21.48  ?  376  LEU A N     1 
ATOM   3133  C CA    . LEU A 1 379 ? 2.780   6.602   85.761  1.00 22.42  ?  376  LEU A CA    1 
ATOM   3134  C C     . LEU A 1 379 ? 1.380   7.127   86.046  1.00 26.30  ?  376  LEU A C     1 
ATOM   3135  O O     . LEU A 1 379 ? 0.512   7.108   85.170  1.00 28.33  ?  376  LEU A O     1 
ATOM   3136  C CB    . LEU A 1 379 ? 3.565   7.630   84.944  1.00 26.24  ?  376  LEU A CB    1 
ATOM   3137  C CG    . LEU A 1 379 ? 4.919   7.213   84.363  1.00 26.91  ?  376  LEU A CG    1 
ATOM   3138  C CD1   . LEU A 1 379 ? 5.498   8.328   83.510  1.00 28.87  ?  376  LEU A CD1   1 
ATOM   3139  C CD2   . LEU A 1 379 ? 5.897   6.816   85.462  1.00 27.53  ?  376  LEU A CD2   1 
ATOM   3140  N N     . ASP A 1 380 ? 1.165   7.595   87.277  1.00 27.13  ?  377  ASP A N     1 
ATOM   3141  C CA    . ASP A 1 380 ? -0.137  8.144   87.642  1.00 37.50  ?  377  ASP A CA    1 
ATOM   3142  C C     . ASP A 1 380 ? -0.415  9.461   86.930  1.00 32.45  ?  377  ASP A C     1 
ATOM   3143  O O     . ASP A 1 380 ? -1.570  9.763   86.611  1.00 53.62  ?  377  ASP A O     1 
ATOM   3144  C CB    . ASP A 1 380 ? -0.216  8.335   89.155  1.00 38.37  ?  377  ASP A CB    1 
ATOM   3145  C CG    . ASP A 1 380 ? -0.356  7.023   89.896  1.00 46.26  ?  377  ASP A CG    1 
ATOM   3146  O OD1   . ASP A 1 380 ? -1.231  6.218   89.515  1.00 41.23  ?  377  ASP A OD1   1 
ATOM   3147  O OD2   . ASP A 1 380 ? 0.416   6.794   90.851  1.00 47.10  -1 377  ASP A OD2   1 
ATOM   3148  N N     . LYS A 1 381 ? 0.625   10.244  86.665  1.00 31.50  ?  378  LYS A N     1 
ATOM   3149  C CA    . LYS A 1 381 ? 0.493   11.540  86.015  1.00 29.90  ?  378  LYS A CA    1 
ATOM   3150  C C     . LYS A 1 381 ? 1.837   11.882  85.393  1.00 26.97  ?  378  LYS A C     1 
ATOM   3151  O O     . LYS A 1 381 ? 2.850   11.234  85.668  1.00 28.28  ?  378  LYS A O     1 
ATOM   3152  C CB    . LYS A 1 381 ? 0.061   12.618  87.012  1.00 34.73  ?  378  LYS A CB    1 
ATOM   3153  C CG    . LYS A 1 381 ? 0.993   12.719  88.209  1.00 46.06  ?  378  LYS A CG    1 
ATOM   3154  C CD    . LYS A 1 381 ? 0.692   13.930  89.073  1.00 61.24  ?  378  LYS A CD    1 
ATOM   3155  C CE    . LYS A 1 381 ? 1.745   14.085  90.162  1.00 67.26  ?  378  LYS A CE    1 
ATOM   3156  N NZ    . LYS A 1 381 ? 3.117   14.205  89.589  1.00 65.34  1  378  LYS A NZ    1 
ATOM   3157  N N     . TYR A 1 382 ? 1.840   12.914  84.553  1.00 26.10  ?  379  TYR A N     1 
ATOM   3158  C CA    . TYR A 1 382 ? 3.096   13.389  83.990  1.00 35.78  ?  379  TYR A CA    1 
ATOM   3159  C C     . TYR A 1 382 ? 4.013   13.852  85.115  1.00 33.03  ?  379  TYR A C     1 
ATOM   3160  O O     . TYR A 1 382 ? 3.610   14.633  85.981  1.00 36.50  ?  379  TYR A O     1 
ATOM   3161  C CB    . TYR A 1 382 ? 2.850   14.524  82.997  1.00 29.81  ?  379  TYR A CB    1 
ATOM   3162  C CG    . TYR A 1 382 ? 4.040   14.822  82.109  1.00 35.18  ?  379  TYR A CG    1 
ATOM   3163  C CD1   . TYR A 1 382 ? 4.258   14.097  80.943  1.00 35.52  ?  379  TYR A CD1   1 
ATOM   3164  C CD2   . TYR A 1 382 ? 4.945   15.825  82.435  1.00 38.27  ?  379  TYR A CD2   1 
ATOM   3165  C CE1   . TYR A 1 382 ? 5.342   14.362  80.127  1.00 43.49  ?  379  TYR A CE1   1 
ATOM   3166  C CE2   . TYR A 1 382 ? 6.032   16.097  81.624  1.00 43.27  ?  379  TYR A CE2   1 
ATOM   3167  C CZ    . TYR A 1 382 ? 6.226   15.362  80.472  1.00 49.88  ?  379  TYR A CZ    1 
ATOM   3168  O OH    . TYR A 1 382 ? 7.306   15.628  79.661  1.00 62.28  ?  379  TYR A OH    1 
ATOM   3169  N N     . ILE A 1 383 ? 5.242   13.347  85.113  1.00 30.85  ?  380  ILE A N     1 
ATOM   3170  C CA    . ILE A 1 383 ? 6.191   13.586  86.192  1.00 35.18  ?  380  ILE A CA    1 
ATOM   3171  C C     . ILE A 1 383 ? 7.090   14.752  85.810  1.00 37.89  ?  380  ILE A C     1 
ATOM   3172  O O     . ILE A 1 383 ? 7.722   14.739  84.746  1.00 41.00  ?  380  ILE A O     1 
ATOM   3173  C CB    . ILE A 1 383 ? 7.015   12.323  86.491  1.00 33.18  ?  380  ILE A CB    1 
ATOM   3174  C CG1   . ILE A 1 383 ? 6.097   11.210  86.997  1.00 44.95  ?  380  ILE A CG1   1 
ATOM   3175  C CG2   . ILE A 1 383 ? 8.104   12.621  87.505  1.00 31.00  ?  380  ILE A CG2   1 
ATOM   3176  C CD1   . ILE A 1 383 ? 6.790   9.883   87.167  1.00 52.05  ?  380  ILE A CD1   1 
ATOM   3177  N N     . GLY A 1 384 ? 7.147   15.761  86.680  1.00 35.52  ?  381  GLY A N     1 
ATOM   3178  C CA    . GLY A 1 384 ? 7.970   16.924  86.394  1.00 30.96  ?  381  GLY A CA    1 
ATOM   3179  C C     . GLY A 1 384 ? 9.455   16.620  86.440  1.00 32.71  ?  381  GLY A C     1 
ATOM   3180  O O     . GLY A 1 384 ? 10.230  17.145  85.637  1.00 33.37  ?  381  GLY A O     1 
ATOM   3181  N N     . ASN A 1 385 ? 9.874   15.773  87.378  1.00 33.10  ?  382  ASN A N     1 
ATOM   3182  C CA    . ASN A 1 385 ? 11.273  15.370  87.513  1.00 29.06  ?  382  ASN A CA    1 
ATOM   3183  C C     . ASN A 1 385 ? 11.338  13.847  87.446  1.00 33.16  ?  382  ASN A C     1 
ATOM   3184  O O     . ASN A 1 385 ? 11.198  13.162  88.460  1.00 23.81  ?  382  ASN A O     1 
ATOM   3185  C CB    . ASN A 1 385 ? 11.885  15.898  88.804  1.00 31.69  ?  382  ASN A CB    1 
ATOM   3186  C CG    . ASN A 1 385 ? 13.339  15.494  88.963  1.00 37.73  ?  382  ASN A CG    1 
ATOM   3187  O OD1   . ASN A 1 385 ? 13.998  15.113  87.995  1.00 36.05  ?  382  ASN A OD1   1 
ATOM   3188  N ND2   . ASN A 1 385 ? 13.846  15.577  90.186  1.00 42.11  ?  382  ASN A ND2   1 
ATOM   3189  N N     . ILE A 1 386 ? 11.576  13.319  86.241  1.00 31.80  ?  383  ILE A N     1 
ATOM   3190  C CA    . ILE A 1 386 ? 11.621  11.875  86.044  1.00 23.94  ?  383  ILE A CA    1 
ATOM   3191  C C     . ILE A 1 386 ? 13.027  11.307  86.191  1.00 27.72  ?  383  ILE A C     1 
ATOM   3192  O O     . ILE A 1 386 ? 13.205  10.084  86.090  1.00 24.53  ?  383  ILE A O     1 
ATOM   3193  C CB    . ILE A 1 386 ? 11.026  11.512  84.666  1.00 26.62  ?  383  ILE A CB    1 
ATOM   3194  C CG1   . ILE A 1 386 ? 10.428  10.102  84.697  1.00 29.53  ?  383  ILE A CG1   1 
ATOM   3195  C CG2   . ILE A 1 386 ? 12.081  11.645  83.575  1.00 28.08  ?  383  ILE A CG2   1 
ATOM   3196  C CD1   . ILE A 1 386 ? 9.411   9.843   83.611  1.00 25.45  ?  383  ILE A CD1   1 
ATOM   3197  N N     . ASP A 1 387 ? 14.030  12.153  86.434  1.00 29.99  ?  384  ASP A N     1 
ATOM   3198  C CA    . ASP A 1 387 ? 15.399  11.673  86.625  1.00 23.26  ?  384  ASP A CA    1 
ATOM   3199  C C     . ASP A 1 387 ? 15.524  10.592  87.692  1.00 35.01  ?  384  ASP A C     1 
ATOM   3200  O O     . ASP A 1 387 ? 16.194  9.580   87.428  1.00 30.88  ?  384  ASP A O     1 
ATOM   3201  C CB    . ASP A 1 387 ? 16.323  12.858  86.942  1.00 38.02  ?  384  ASP A CB    1 
ATOM   3202  C CG    . ASP A 1 387 ? 16.743  13.621  85.701  1.00 58.11  ?  384  ASP A CG    1 
ATOM   3203  O OD1   . ASP A 1 387 ? 16.904  12.990  84.634  1.00 51.62  ?  384  ASP A OD1   1 
ATOM   3204  O OD2   . ASP A 1 387 ? 16.919  14.853  85.794  1.00 74.35  -1 384  ASP A OD2   1 
ATOM   3205  N N     . PRO A 1 388 ? 14.932  10.723  88.890  1.00 40.69  ?  385  PRO A N     1 
ATOM   3206  C CA    . PRO A 1 388 ? 15.068  9.637   89.878  1.00 39.31  ?  385  PRO A CA    1 
ATOM   3207  C C     . PRO A 1 388 ? 14.587  8.287   89.374  1.00 33.11  ?  385  PRO A C     1 
ATOM   3208  O O     . PRO A 1 388 ? 15.239  7.267   89.633  1.00 36.21  ?  385  PRO A O     1 
ATOM   3209  C CB    . PRO A 1 388 ? 14.221  10.135  91.057  1.00 44.73  ?  385  PRO A CB    1 
ATOM   3210  C CG    . PRO A 1 388 ? 14.222  11.608  90.928  1.00 44.46  ?  385  PRO A CG    1 
ATOM   3211  C CD    . PRO A 1 388 ? 14.214  11.882  89.457  1.00 40.51  ?  385  PRO A CD    1 
ATOM   3212  N N     . LEU A 1 389 ? 13.464  8.253   88.653  1.00 27.46  ?  386  LEU A N     1 
ATOM   3213  C CA    . LEU A 1 389 ? 12.947  6.988   88.141  1.00 31.10  ?  386  LEU A CA    1 
ATOM   3214  C C     . LEU A 1 389 ? 13.976  6.297   87.253  1.00 27.56  ?  386  LEU A C     1 
ATOM   3215  O O     . LEU A 1 389 ? 14.251  5.103   87.414  1.00 29.83  ?  386  LEU A O     1 
ATOM   3216  C CB    . LEU A 1 389 ? 11.644  7.231   87.378  1.00 28.43  ?  386  LEU A CB    1 
ATOM   3217  C CG    . LEU A 1 389 ? 11.014  6.024   86.681  1.00 31.55  ?  386  LEU A CG    1 
ATOM   3218  C CD1   . LEU A 1 389 ? 10.699  4.927   87.685  1.00 33.46  ?  386  LEU A CD1   1 
ATOM   3219  C CD2   . LEU A 1 389 ? 9.761   6.441   85.927  1.00 27.69  ?  386  LEU A CD2   1 
ATOM   3220  N N     . VAL A 1 390 ? 14.563  7.042   86.312  1.00 24.61  ?  387  VAL A N     1 
ATOM   3221  C CA    . VAL A 1 390 ? 15.611  6.481   85.464  1.00 23.54  ?  387  VAL A CA    1 
ATOM   3222  C C     . VAL A 1 390 ? 16.841  6.134   86.292  1.00 25.33  ?  387  VAL A C     1 
ATOM   3223  O O     . VAL A 1 390 ? 17.457  5.076   86.110  1.00 22.34  ?  387  VAL A O     1 
ATOM   3224  C CB    . VAL A 1 390 ? 15.956  7.471   84.336  1.00 30.46  ?  387  VAL A CB    1 
ATOM   3225  C CG1   . VAL A 1 390 ? 16.972  6.864   83.377  1.00 28.26  ?  387  VAL A CG1   1 
ATOM   3226  C CG2   . VAL A 1 390 ? 14.699  7.907   83.607  1.00 25.58  ?  387  VAL A CG2   1 
ATOM   3227  N N     . ARG A 1 391 ? 17.208  7.016   87.223  1.00 26.69  ?  388  ARG A N     1 
ATOM   3228  C CA    . ARG A 1 391 ? 18.446  6.864   87.982  1.00 27.21  ?  388  ARG A CA    1 
ATOM   3229  C C     . ARG A 1 391 ? 18.406  5.642   88.893  1.00 33.56  ?  388  ARG A C     1 
ATOM   3230  O O     . ARG A 1 391 ? 19.411  4.937   89.039  1.00 23.28  ?  388  ARG A O     1 
ATOM   3231  C CB    . ARG A 1 391 ? 18.689  8.143   88.783  1.00 36.15  ?  388  ARG A CB    1 
ATOM   3232  C CG    . ARG A 1 391 ? 19.876  8.169   89.724  1.00 37.46  ?  388  ARG A CG    1 
ATOM   3233  C CD    . ARG A 1 391 ? 20.123  9.622   90.117  1.00 40.68  ?  388  ARG A CD    1 
ATOM   3234  N NE    . ARG A 1 391 ? 20.832  9.791   91.379  1.00 60.64  ?  388  ARG A NE    1 
ATOM   3235  C CZ    . ARG A 1 391 ? 21.244  10.967  91.844  1.00 69.11  ?  388  ARG A CZ    1 
ATOM   3236  N NH1   . ARG A 1 391 ? 21.024  12.074  91.144  1.00 69.30  1  388  ARG A NH1   1 
ATOM   3237  N NH2   . ARG A 1 391 ? 21.880  11.039  93.005  1.00 65.28  ?  388  ARG A NH2   1 
ATOM   3238  N N     . ASN A 1 392 ? 17.254  5.367   89.504  1.00 29.90  ?  389  ASN A N     1 
ATOM   3239  C CA    . ASN A 1 392 ? 17.137  4.305   90.495  1.00 34.65  ?  389  ASN A CA    1 
ATOM   3240  C C     . ASN A 1 392 ? 16.639  2.990   89.915  1.00 34.18  ?  389  ASN A C     1 
ATOM   3241  O O     . ASN A 1 392 ? 16.674  1.970   90.613  1.00 34.45  ?  389  ASN A O     1 
ATOM   3242  C CB    . ASN A 1 392 ? 16.202  4.746   91.622  1.00 35.02  ?  389  ASN A CB    1 
ATOM   3243  C CG    . ASN A 1 392 ? 16.623  6.062   92.234  1.00 30.85  ?  389  ASN A CG    1 
ATOM   3244  O OD1   . ASN A 1 392 ? 17.814  6.345   92.357  1.00 33.40  ?  389  ASN A OD1   1 
ATOM   3245  N ND2   . ASN A 1 392 ? 15.647  6.881   92.610  1.00 29.35  ?  389  ASN A ND2   1 
ATOM   3246  N N     . PHE A 1 393 ? 16.184  2.985   88.667  1.00 33.96  ?  390  PHE A N     1 
ATOM   3247  C CA    . PHE A 1 393 ? 15.617  1.782   88.090  1.00 30.99  ?  390  PHE A CA    1 
ATOM   3248  C C     . PHE A 1 393 ? 16.708  0.743   87.837  1.00 32.18  ?  390  PHE A C     1 
ATOM   3249  O O     . PHE A 1 393 ? 17.856  1.096   87.551  1.00 36.06  ?  390  PHE A O     1 
ATOM   3250  C CB    . PHE A 1 393 ? 14.899  2.108   86.788  1.00 35.08  ?  390  PHE A CB    1 
ATOM   3251  C CG    . PHE A 1 393 ? 13.648  1.321   86.588  1.00 33.14  ?  390  PHE A CG    1 
ATOM   3252  C CD1   . PHE A 1 393 ? 12.525  1.577   87.357  1.00 24.37  ?  390  PHE A CD1   1 
ATOM   3253  C CD2   . PHE A 1 393 ? 13.593  0.319   85.639  1.00 31.58  ?  390  PHE A CD2   1 
ATOM   3254  C CE1   . PHE A 1 393 ? 11.371  0.849   87.179  1.00 25.78  ?  390  PHE A CE1   1 
ATOM   3255  C CE2   . PHE A 1 393 ? 12.447  -0.412  85.461  1.00 28.83  ?  390  PHE A CE2   1 
ATOM   3256  C CZ    . PHE A 1 393 ? 11.332  -0.147  86.229  1.00 26.67  ?  390  PHE A CZ    1 
ATOM   3257  N N     . PRO A 1 394 ? 16.378  -0.545  87.953  1.00 31.06  ?  391  PRO A N     1 
ATOM   3258  C CA    . PRO A 1 394 ? 17.370  -1.589  87.662  1.00 31.43  ?  391  PRO A CA    1 
ATOM   3259  C C     . PRO A 1 394 ? 17.904  -1.450  86.244  1.00 36.69  ?  391  PRO A C     1 
ATOM   3260  O O     . PRO A 1 394 ? 17.144  -1.271  85.289  1.00 29.10  ?  391  PRO A O     1 
ATOM   3261  C CB    . PRO A 1 394 ? 16.582  -2.891  87.852  1.00 32.89  ?  391  PRO A CB    1 
ATOM   3262  C CG    . PRO A 1 394 ? 15.457  -2.528  88.765  1.00 32.27  ?  391  PRO A CG    1 
ATOM   3263  C CD    . PRO A 1 394 ? 15.103  -1.109  88.432  1.00 29.52  ?  391  PRO A CD    1 
ATOM   3264  N N     . ASP A 1 395 ? 19.228  -1.530  86.113  1.00 32.63  ?  392  ASP A N     1 
ATOM   3265  C CA    . ASP A 1 395 ? 19.877  -1.262  84.838  1.00 31.86  ?  392  ASP A CA    1 
ATOM   3266  C C     . ASP A 1 395 ? 19.736  -2.405  83.844  1.00 23.00  ?  392  ASP A C     1 
ATOM   3267  O O     . ASP A 1 395 ? 19.990  -2.204  82.653  1.00 40.97  ?  392  ASP A O     1 
ATOM   3268  C CB    . ASP A 1 395 ? 21.359  -0.951  85.059  1.00 49.93  ?  392  ASP A CB    1 
ATOM   3269  C CG    . ASP A 1 395 ? 21.570  0.299   85.889  1.00 71.37  ?  392  ASP A CG    1 
ATOM   3270  O OD1   . ASP A 1 395 ? 20.773  1.251   85.749  1.00 79.84  ?  392  ASP A OD1   1 
ATOM   3271  O OD2   . ASP A 1 395 ? 22.529  0.328   86.688  1.00 77.78  -1 392  ASP A OD2   1 
ATOM   3272  N N     . ASN A 1 396 ? 19.339  -3.592  84.294  1.00 31.56  ?  393  ASN A N     1 
ATOM   3273  C CA    . ASN A 1 396 ? 19.129  -4.701  83.374  1.00 32.98  ?  393  ASN A CA    1 
ATOM   3274  C C     . ASN A 1 396 ? 17.751  -4.676  82.724  1.00 23.96  ?  393  ASN A C     1 
ATOM   3275  O O     . ASN A 1 396 ? 17.429  -5.587  81.955  1.00 33.90  ?  393  ASN A O     1 
ATOM   3276  C CB    . ASN A 1 396 ? 19.347  -6.035  84.096  1.00 29.72  ?  393  ASN A CB    1 
ATOM   3277  C CG    . ASN A 1 396 ? 18.465  -6.192  85.318  1.00 33.70  ?  393  ASN A CG    1 
ATOM   3278  O OD1   . ASN A 1 396 ? 18.136  -5.217  85.993  1.00 32.58  ?  393  ASN A OD1   1 
ATOM   3279  N ND2   . ASN A 1 396 ? 18.078  -7.429  85.611  1.00 32.58  ?  393  ASN A ND2   1 
ATOM   3280  N N     . LEU A 1 397 ? 16.939  -3.660  83.001  1.00 22.45  ?  394  LEU A N     1 
ATOM   3281  C CA    . LEU A 1 397 ? 15.623  -3.513  82.399  1.00 22.28  ?  394  LEU A CA    1 
ATOM   3282  C C     . LEU A 1 397 ? 15.588  -2.285  81.499  1.00 21.70  ?  394  LEU A C     1 
ATOM   3283  O O     . LEU A 1 397 ? 16.244  -1.276  81.769  1.00 27.28  ?  394  LEU A O     1 
ATOM   3284  C CB    . LEU A 1 397 ? 14.534  -3.388  83.469  1.00 22.83  ?  394  LEU A CB    1 
ATOM   3285  C CG    . LEU A 1 397 ? 14.402  -4.540  84.467  1.00 23.36  ?  394  LEU A CG    1 
ATOM   3286  C CD1   . LEU A 1 397 ? 13.371  -4.202  85.529  1.00 26.64  ?  394  LEU A CD1   1 
ATOM   3287  C CD2   . LEU A 1 397 ? 14.031  -5.827  83.751  1.00 22.38  ?  394  LEU A CD2   1 
ATOM   3288  N N     . ILE A 1 398 ? 14.808  -2.384  80.426  1.00 20.00  ?  395  ILE A N     1 
ATOM   3289  C CA    . ILE A 1 398 ? 14.613  -1.283  79.489  1.00 16.60  ?  395  ILE A CA    1 
ATOM   3290  C C     . ILE A 1 398 ? 13.388  -0.510  79.968  1.00 17.62  ?  395  ILE A C     1 
ATOM   3291  O O     . ILE A 1 398 ? 12.250  -0.954  79.798  1.00 14.05  ?  395  ILE A O     1 
ATOM   3292  C CB    . ILE A 1 398 ? 14.443  -1.785  78.053  1.00 17.08  ?  395  ILE A CB    1 
ATOM   3293  C CG1   . ILE A 1 398 ? 15.665  -2.602  77.626  1.00 25.77  ?  395  ILE A CG1   1 
ATOM   3294  C CG2   . ILE A 1 398 ? 14.230  -0.615  77.099  1.00 15.40  ?  395  ILE A CG2   1 
ATOM   3295  C CD1   . ILE A 1 398 ? 15.530  -3.238  76.256  1.00 27.58  ?  395  ILE A CD1   1 
ATOM   3296  N N     . LEU A 1 399 ? 13.626  0.651   80.568  1.00 16.30  ?  396  LEU A N     1 
ATOM   3297  C CA    . LEU A 1 399 ? 12.559  1.434   81.176  1.00 19.87  ?  396  LEU A CA    1 
ATOM   3298  C C     . LEU A 1 399 ? 11.620  1.972   80.101  1.00 31.99  ?  396  LEU A C     1 
ATOM   3299  O O     . LEU A 1 399 ? 12.051  2.682   79.185  1.00 22.70  ?  396  LEU A O     1 
ATOM   3300  C CB    . LEU A 1 399 ? 13.165  2.571   81.997  1.00 22.93  ?  396  LEU A CB    1 
ATOM   3301  C CG    . LEU A 1 399 ? 12.244  3.524   82.756  1.00 32.35  ?  396  LEU A CG    1 
ATOM   3302  C CD1   . LEU A 1 399 ? 11.242  2.744   83.569  1.00 32.37  ?  396  LEU A CD1   1 
ATOM   3303  C CD2   . LEU A 1 399 ? 13.068  4.427   83.655  1.00 20.86  ?  396  LEU A CD2   1 
ATOM   3304  N N     . GLN A 1 400 ? 10.334  1.632   80.210  1.00 24.85  ?  397  GLN A N     1 
ATOM   3305  C CA    . GLN A 1 400 ? 9.321   2.024   79.230  1.00 15.87  ?  397  GLN A CA    1 
ATOM   3306  C C     . GLN A 1 400 ? 8.097   2.566   79.955  1.00 16.57  ?  397  GLN A C     1 
ATOM   3307  O O     . GLN A 1 400 ? 7.072   1.879   80.068  1.00 18.03  ?  397  GLN A O     1 
ATOM   3308  C CB    . GLN A 1 400 ? 8.944   0.849   78.324  1.00 13.25  ?  397  GLN A CB    1 
ATOM   3309  C CG    . GLN A 1 400 ? 10.052  0.401   77.372  1.00 22.56  ?  397  GLN A CG    1 
ATOM   3310  C CD    . GLN A 1 400 ? 10.322  1.408   76.263  1.00 24.94  ?  397  GLN A CD    1 
ATOM   3311  O OE1   . GLN A 1 400 ? 9.599   2.393   76.115  1.00 25.17  ?  397  GLN A OE1   1 
ATOM   3312  N NE2   . GLN A 1 400 ? 11.365  1.161   75.479  1.00 21.91  ?  397  GLN A NE2   1 
ATOM   3313  N N     . PRO A 1 401 ? 8.156   3.805   80.436  1.00 18.07  ?  398  PRO A N     1 
ATOM   3314  C CA    . PRO A 1 401 ? 7.019   4.364   81.175  1.00 14.15  ?  398  PRO A CA    1 
ATOM   3315  C C     . PRO A 1 401 ? 5.874   4.738   80.246  1.00 22.15  ?  398  PRO A C     1 
ATOM   3316  O O     . PRO A 1 401 ? 6.062   5.018   79.061  1.00 24.94  ?  398  PRO A O     1 
ATOM   3317  C CB    . PRO A 1 401 ? 7.605   5.607   81.857  1.00 18.97  ?  398  PRO A CB    1 
ATOM   3318  C CG    . PRO A 1 401 ? 9.108   5.552   81.603  1.00 29.03  ?  398  PRO A CG    1 
ATOM   3319  C CD    . PRO A 1 401 ? 9.278   4.751   80.356  1.00 17.82  ?  398  PRO A CD    1 
ATOM   3320  N N     . ILE A 1 402 ? 4.668   4.742   80.810  1.00 23.50  ?  399  ILE A N     1 
ATOM   3321  C CA    . ILE A 1 402 ? 3.476   5.152   80.072  1.00 18.22  ?  399  ILE A CA    1 
ATOM   3322  C C     . ILE A 1 402 ? 2.454   5.695   81.063  1.00 17.86  ?  399  ILE A C     1 
ATOM   3323  O O     . ILE A 1 402 ? 2.304   5.172   82.171  1.00 23.52  ?  399  ILE A O     1 
ATOM   3324  C CB    . ILE A 1 402 ? 2.898   3.993   79.228  1.00 22.02  ?  399  ILE A CB    1 
ATOM   3325  C CG1   . ILE A 1 402 ? 1.670   4.463   78.440  1.00 23.41  ?  399  ILE A CG1   1 
ATOM   3326  C CG2   . ILE A 1 402 ? 2.564   2.789   80.105  1.00 20.34  ?  399  ILE A CG2   1 
ATOM   3327  C CD1   . ILE A 1 402 ? 1.180   3.473   77.408  1.00 30.89  ?  399  ILE A CD1   1 
ATOM   3328  N N     . LEU A 1 403 ? 1.765   6.760   80.661  1.00 18.71  ?  400  LEU A N     1 
ATOM   3329  C CA    . LEU A 1 403 ? 0.767   7.380   81.519  1.00 26.75  ?  400  LEU A CA    1 
ATOM   3330  C C     . LEU A 1 403 ? -0.422  6.450   81.727  1.00 26.71  ?  400  LEU A C     1 
ATOM   3331  O O     . LEU A 1 403 ? -0.936  5.853   80.775  1.00 26.08  ?  400  LEU A O     1 
ATOM   3332  C CB    . LEU A 1 403 ? 0.309   8.708   80.915  1.00 27.30  ?  400  LEU A CB    1 
ATOM   3333  C CG    . LEU A 1 403 ? 1.401   9.773   80.808  1.00 26.18  ?  400  LEU A CG    1 
ATOM   3334  C CD1   . LEU A 1 403 ? 0.873   11.030  80.134  1.00 25.57  ?  400  LEU A CD1   1 
ATOM   3335  C CD2   . LEU A 1 403 ? 1.953   10.094  82.188  1.00 31.47  ?  400  LEU A CD2   1 
ATOM   3336  N N     . LYS A 1 404 ? -0.853  6.330   82.986  1.00 23.53  ?  401  LYS A N     1 
ATOM   3337  C CA    . LYS A 1 404 ? -2.009  5.499   83.316  1.00 27.49  ?  401  LYS A CA    1 
ATOM   3338  C C     . LYS A 1 404 ? -3.230  5.890   82.494  1.00 25.29  ?  401  LYS A C     1 
ATOM   3339  O O     . LYS A 1 404 ? -3.987  5.022   82.044  1.00 28.60  ?  401  LYS A O     1 
ATOM   3340  C CB    . LYS A 1 404 ? -2.307  5.599   84.816  1.00 30.69  ?  401  LYS A CB    1 
ATOM   3341  C CG    . LYS A 1 404 ? -3.789  5.705   85.171  1.00 42.39  ?  401  LYS A CG    1 
ATOM   3342  C CD    . LYS A 1 404 ? -4.004  5.860   86.675  1.00 36.95  ?  401  LYS A CD    1 
ATOM   3343  C CE    . LYS A 1 404 ? -3.666  7.266   87.157  1.00 40.80  ?  401  LYS A CE    1 
ATOM   3344  N NZ    . LYS A 1 404 ? -3.737  7.377   88.643  1.00 44.92  1  401  LYS A NZ    1 
ATOM   3345  N N     . GLU A 1 405 ? -3.428  7.194   82.268  1.00 33.09  ?  402  GLU A N     1 
ATOM   3346  C CA    . GLU A 1 405 ? -4.601  7.643   81.522  1.00 31.44  ?  402  GLU A CA    1 
ATOM   3347  C C     . GLU A 1 405 ? -4.576  7.161   80.079  1.00 35.81  ?  402  GLU A C     1 
ATOM   3348  O O     . GLU A 1 405 ? -5.634  6.918   79.490  1.00 32.56  ?  402  GLU A O     1 
ATOM   3349  C CB    . GLU A 1 405 ? -4.720  9.169   81.560  1.00 44.49  ?  402  GLU A CB    1 
ATOM   3350  C CG    . GLU A 1 405 ? -3.411  9.929   81.448  1.00 56.27  ?  402  GLU A CG    1 
ATOM   3351  C CD    . GLU A 1 405 ? -2.807  10.227  82.802  1.00 64.17  ?  402  GLU A CD    1 
ATOM   3352  O OE1   . GLU A 1 405 ? -2.473  9.268   83.534  1.00 46.70  ?  402  GLU A OE1   1 
ATOM   3353  O OE2   . GLU A 1 405 ? -2.684  11.423  83.140  1.00 71.33  -1 402  GLU A OE2   1 
ATOM   3354  N N     . LYS A 1 406 ? -3.389  7.023   79.489  1.00 32.11  ?  403  LYS A N     1 
ATOM   3355  C CA    . LYS A 1 406 ? -3.308  6.540   78.117  1.00 27.50  ?  403  LYS A CA    1 
ATOM   3356  C C     . LYS A 1 406 ? -3.500  5.034   78.020  1.00 24.50  ?  403  LYS A C     1 
ATOM   3357  O O     . LYS A 1 406 ? -3.852  4.537   76.945  1.00 34.25  ?  403  LYS A O     1 
ATOM   3358  C CB    . LYS A 1 406 ? -1.975  6.954   77.493  1.00 32.12  ?  403  LYS A CB    1 
ATOM   3359  C CG    . LYS A 1 406 ? -1.831  8.463   77.364  1.00 25.39  ?  403  LYS A CG    1 
ATOM   3360  C CD    . LYS A 1 406 ? -0.508  8.863   76.733  1.00 22.93  ?  403  LYS A CD    1 
ATOM   3361  C CE    . LYS A 1 406 ? -0.380  10.379  76.661  1.00 21.90  ?  403  LYS A CE    1 
ATOM   3362  N NZ    . LYS A 1 406 ? 0.799   10.809  75.858  1.00 23.05  1  403  LYS A NZ    1 
ATOM   3363  N N     . LEU A 1 407 ? -3.284  4.298   79.111  1.00 31.60  ?  404  LEU A N     1 
ATOM   3364  C CA    . LEU A 1 407 ? -3.698  2.901   79.147  1.00 42.83  ?  404  LEU A CA    1 
ATOM   3365  C C     . LEU A 1 407 ? -5.186  2.764   79.433  1.00 46.36  ?  404  LEU A C     1 
ATOM   3366  O O     . LEU A 1 407 ? -5.797  1.766   79.041  1.00 48.88  ?  404  LEU A O     1 
ATOM   3367  C CB    . LEU A 1 407 ? -2.895  2.123   80.192  1.00 44.02  ?  404  LEU A CB    1 
ATOM   3368  C CG    . LEU A 1 407 ? -1.522  1.616   79.747  1.00 33.93  ?  404  LEU A CG    1 
ATOM   3369  C CD1   . LEU A 1 407 ? -0.982  0.587   80.728  1.00 40.22  ?  404  LEU A CD1   1 
ATOM   3370  C CD2   . LEU A 1 407 ? -1.605  1.034   78.347  1.00 30.16  ?  404  LEU A CD2   1 
ATOM   3371  N N     . GLU A 1 408 ? -5.786  3.755   80.094  1.00 50.63  ?  405  GLU A N     1 
ATOM   3372  C CA    . GLU A 1 408 ? -7.203  3.665   80.426  1.00 46.55  ?  405  GLU A CA    1 
ATOM   3373  C C     . GLU A 1 408 ? -8.081  3.800   79.185  1.00 49.01  ?  405  GLU A C     1 
ATOM   3374  O O     . GLU A 1 408 ? -9.096  3.105   79.060  1.00 47.76  ?  405  GLU A O     1 
ATOM   3375  C CB    . GLU A 1 408 ? -7.569  4.730   81.459  1.00 47.70  ?  405  GLU A CB    1 
ATOM   3376  C CG    . GLU A 1 408 ? -7.229  4.360   82.895  1.00 48.72  ?  405  GLU A CG    1 
ATOM   3377  C CD    . GLU A 1 408 ? -7.408  5.530   83.844  1.00 57.12  ?  405  GLU A CD    1 
ATOM   3378  O OE1   . GLU A 1 408 ? -7.476  6.680   83.362  1.00 50.79  ?  405  GLU A OE1   1 
ATOM   3379  O OE2   . GLU A 1 408 ? -7.486  5.301   85.070  1.00 59.55  -1 405  GLU A OE2   1 
ATOM   3380  N N     . ASP A 1 409 ? -7.710  4.682   78.253  1.00 45.36  ?  406  ASP A N     1 
ATOM   3381  C CA    . ASP A 1 409 ? -8.568  4.983   77.112  1.00 54.84  ?  406  ASP A CA    1 
ATOM   3382  C C     . ASP A 1 409 ? -8.215  4.203   75.853  1.00 54.07  ?  406  ASP A C     1 
ATOM   3383  O O     . ASP A 1 409 ? -9.082  4.040   74.987  1.00 64.68  ?  406  ASP A O     1 
ATOM   3384  C CB    . ASP A 1 409 ? -8.540  6.487   76.810  1.00 62.79  ?  406  ASP A CB    1 
ATOM   3385  C CG    . ASP A 1 409 ? -9.478  7.281   77.705  1.00 73.00  ?  406  ASP A CG    1 
ATOM   3386  O OD1   . ASP A 1 409 ? -9.046  7.706   78.798  1.00 76.28  -1 406  ASP A OD1   1 
ATOM   3387  O OD2   . ASP A 1 409 ? -10.651 7.475   77.319  1.00 72.26  ?  406  ASP A OD2   1 
ATOM   3388  N N     . ILE A 1 410 ? -6.976  3.729   75.730  1.00 51.66  ?  407  ILE A N     1 
ATOM   3389  C CA    . ILE A 1 410 ? -6.573  2.799   74.678  1.00 47.55  ?  407  ILE A CA    1 
ATOM   3390  C C     . ILE A 1 410 ? -6.865  3.374   73.296  1.00 44.07  ?  407  ILE A C     1 
ATOM   3391  O O     . ILE A 1 410 ? -7.758  2.897   72.586  1.00 46.42  ?  407  ILE A O     1 
ATOM   3392  C CB    . ILE A 1 410 ? -7.259  1.430   74.863  1.00 46.31  ?  407  ILE A CB    1 
ATOM   3393  C CG1   . ILE A 1 410 ? -7.167  0.974   76.318  1.00 51.64  ?  407  ILE A CG1   1 
ATOM   3394  C CG2   . ILE A 1 410 ? -6.624  0.366   73.975  1.00 49.86  ?  407  ILE A CG2   1 
ATOM   3395  C CD1   . ILE A 1 410 ? -7.704  -0.426  76.550  1.00 55.64  ?  407  ILE A CD1   1 
ATOM   3396  N N     . LYS A 1 411 ? -6.122  4.404   72.905  1.00 41.70  ?  408  LYS A N     1 
ATOM   3397  C CA    . LYS A 1 411 ? -6.163  4.867   71.523  1.00 40.53  ?  408  LYS A CA    1 
ATOM   3398  C C     . LYS A 1 411 ? -5.186  4.033   70.704  1.00 35.84  ?  408  LYS A C     1 
ATOM   3399  O O     . LYS A 1 411 ? -3.997  3.985   71.040  1.00 27.59  ?  408  LYS A O     1 
ATOM   3400  C CB    . LYS A 1 411 ? -5.818  6.347   71.432  1.00 37.64  ?  408  LYS A CB    1 
ATOM   3401  C CG    . LYS A 1 411 ? -6.736  7.237   72.255  1.00 35.51  ?  408  LYS A CG    1 
ATOM   3402  C CD    . LYS A 1 411 ? -6.386  8.706   72.102  1.00 39.04  ?  408  LYS A CD    1 
ATOM   3403  C CE    . LYS A 1 411 ? -7.271  9.571   72.985  1.00 42.06  ?  408  LYS A CE    1 
ATOM   3404  N NZ    . LYS A 1 411 ? -6.908  11.011  72.900  1.00 43.49  1  408  LYS A NZ    1 
ATOM   3405  N N     . PRO A 1 412 ? -5.641  3.350   69.649  1.00 37.21  ?  409  PRO A N     1 
ATOM   3406  C CA    . PRO A 1 412 ? -4.762  2.391   68.955  1.00 27.67  ?  409  PRO A CA    1 
ATOM   3407  C C     . PRO A 1 412 ? -3.437  2.970   68.481  1.00 31.03  ?  409  PRO A C     1 
ATOM   3408  O O     . PRO A 1 412 ? -2.408  2.299   68.620  1.00 31.91  ?  409  PRO A O     1 
ATOM   3409  C CB    . PRO A 1 412 ? -5.628  1.911   67.778  1.00 31.24  ?  409  PRO A CB    1 
ATOM   3410  C CG    . PRO A 1 412 ? -6.825  2.831   67.739  1.00 41.19  ?  409  PRO A CG    1 
ATOM   3411  C CD    . PRO A 1 412 ? -7.017  3.311   69.134  1.00 39.23  ?  409  PRO A CD    1 
ATOM   3412  N N     . PHE A 1 413 ? -3.421  4.190   67.935  1.00 26.18  ?  410  PHE A N     1 
ATOM   3413  C CA    . PHE A 1 413 ? -2.161  4.737   67.441  1.00 30.16  ?  410  PHE A CA    1 
ATOM   3414  C C     . PHE A 1 413 ? -1.156  4.930   68.569  1.00 27.10  ?  410  PHE A C     1 
ATOM   3415  O O     . PHE A 1 413 ? 0.057   4.871   68.337  1.00 24.24  ?  410  PHE A O     1 
ATOM   3416  C CB    . PHE A 1 413 ? -2.400  6.053   66.690  1.00 29.81  ?  410  PHE A CB    1 
ATOM   3417  C CG    . PHE A 1 413 ? -2.717  7.228   67.579  1.00 33.60  ?  410  PHE A CG    1 
ATOM   3418  C CD1   . PHE A 1 413 ? -4.012  7.458   68.012  1.00 41.15  ?  410  PHE A CD1   1 
ATOM   3419  C CD2   . PHE A 1 413 ? -1.723  8.120   67.956  1.00 38.33  ?  410  PHE A CD2   1 
ATOM   3420  C CE1   . PHE A 1 413 ? -4.309  8.541   68.819  1.00 37.07  ?  410  PHE A CE1   1 
ATOM   3421  C CE2   . PHE A 1 413 ? -2.013  9.206   68.763  1.00 36.06  ?  410  PHE A CE2   1 
ATOM   3422  C CZ    . PHE A 1 413 ? -3.309  9.416   69.195  1.00 41.37  ?  410  PHE A CZ    1 
ATOM   3423  N N     . ILE A 1 414 ? -1.637  5.134   69.796  1.00 33.78  ?  411  ILE A N     1 
ATOM   3424  C CA    . ILE A 1 414 ? -0.734  5.265   70.934  1.00 24.83  ?  411  ILE A CA    1 
ATOM   3425  C C     . ILE A 1 414 ? -0.132  3.911   71.299  1.00 20.95  ?  411  ILE A C     1 
ATOM   3426  O O     . ILE A 1 414 ? 1.082   3.791   71.506  1.00 20.06  ?  411  ILE A O     1 
ATOM   3427  C CB    . ILE A 1 414 ? -1.466  5.904   72.126  1.00 33.34  ?  411  ILE A CB    1 
ATOM   3428  C CG1   . ILE A 1 414 ? -1.810  7.362   71.814  1.00 30.85  ?  411  ILE A CG1   1 
ATOM   3429  C CG2   . ILE A 1 414 ? -0.625  5.807   73.391  1.00 26.63  ?  411  ILE A CG2   1 
ATOM   3430  C CD1   . ILE A 1 414 ? -2.573  8.064   72.909  1.00 34.80  ?  411  ILE A CD1   1 
ATOM   3431  N N     . ILE A 1 415 ? -0.966  2.871   71.379  1.00 18.55  ?  412  ILE A N     1 
ATOM   3432  C CA    . ILE A 1 415 ? -0.448  1.538   71.683  1.00 25.22  ?  412  ILE A CA    1 
ATOM   3433  C C     . ILE A 1 415 ? 0.471   1.059   70.567  1.00 26.82  ?  412  ILE A C     1 
ATOM   3434  O O     . ILE A 1 415 ? 1.519   0.453   70.828  1.00 22.16  ?  412  ILE A O     1 
ATOM   3435  C CB    . ILE A 1 415 ? -1.599  0.543   71.933  1.00 28.16  ?  412  ILE A CB    1 
ATOM   3436  C CG1   . ILE A 1 415 ? -2.306  0.855   73.250  1.00 37.89  ?  412  ILE A CG1   1 
ATOM   3437  C CG2   . ILE A 1 415 ? -1.080  -0.888  71.976  1.00 25.01  ?  412  ILE A CG2   1 
ATOM   3438  C CD1   . ILE A 1 415 ? -3.501  1.740   73.107  1.00 47.05  ?  412  ILE A CD1   1 
ATOM   3439  N N     . LYS A 1 416 ? 0.097   1.322   69.310  1.00 23.84  ?  413  LYS A N     1 
ATOM   3440  C CA    . LYS A 1 416 ? 0.970   0.995   68.186  1.00 23.01  ?  413  LYS A CA    1 
ATOM   3441  C C     . LYS A 1 416 ? 2.320   1.688   68.327  1.00 21.08  ?  413  LYS A C     1 
ATOM   3442  O O     . LYS A 1 416 ? 3.375   1.064   68.161  1.00 18.98  ?  413  LYS A O     1 
ATOM   3443  C CB    . LYS A 1 416 ? 0.298   1.391   66.866  1.00 26.62  ?  413  LYS A CB    1 
ATOM   3444  C CG    . LYS A 1 416 ? -0.908  0.541   66.494  1.00 40.62  ?  413  LYS A CG    1 
ATOM   3445  C CD    . LYS A 1 416 ? -1.658  1.105   65.290  1.00 52.69  ?  413  LYS A CD    1 
ATOM   3446  C CE    . LYS A 1 416 ? -0.917  0.850   63.985  1.00 60.11  ?  413  LYS A CE    1 
ATOM   3447  N NZ    . LYS A 1 416 ? -1.773  1.123   62.792  1.00 62.75  1  413  LYS A NZ    1 
ATOM   3448  N N     . SER A 1 417 ? 2.298   2.986   68.641  1.00 23.48  ?  414  SER A N     1 
ATOM   3449  C CA    . SER A 1 417 ? 3.533   3.744   68.824  1.00 18.28  ?  414  SER A CA    1 
ATOM   3450  C C     . SER A 1 417 ? 4.367   3.185   69.968  1.00 20.22  ?  414  SER A C     1 
ATOM   3451  O O     . SER A 1 417 ? 5.596   3.087   69.867  1.00 13.75  ?  414  SER A O     1 
ATOM   3452  C CB    . SER A 1 417 ? 3.193   5.206   69.090  1.00 23.27  ?  414  SER A CB    1 
ATOM   3453  O OG    . SER A 1 417 ? 2.614   5.802   67.944  1.00 33.71  ?  414  SER A OG    1 
ATOM   3454  N N     . TYR A 1 418 ? 3.708   2.837   71.072  1.00 20.41  ?  415  TYR A N     1 
ATOM   3455  C CA    . TYR A 1 418 ? 4.385   2.262   72.229  1.00 20.34  ?  415  TYR A CA    1 
ATOM   3456  C C     . TYR A 1 418 ? 5.137   0.989   71.848  1.00 14.13  ?  415  TYR A C     1 
ATOM   3457  O O     . TYR A 1 418 ? 6.298   0.800   72.232  1.00 19.56  ?  415  TYR A O     1 
ATOM   3458  C CB    . TYR A 1 418 ? 3.344   1.999   73.317  1.00 16.99  ?  415  TYR A CB    1 
ATOM   3459  C CG    . TYR A 1 418 ? 3.859   1.661   74.696  1.00 17.82  ?  415  TYR A CG    1 
ATOM   3460  C CD1   . TYR A 1 418 ? 4.929   2.347   75.261  1.00 18.85  ?  415  TYR A CD1   1 
ATOM   3461  C CD2   . TYR A 1 418 ? 3.236   0.681   75.455  1.00 17.87  ?  415  TYR A CD2   1 
ATOM   3462  C CE1   . TYR A 1 418 ? 5.379   2.039   76.537  1.00 14.98  ?  415  TYR A CE1   1 
ATOM   3463  C CE2   . TYR A 1 418 ? 3.673   0.373   76.725  1.00 24.78  ?  415  TYR A CE2   1 
ATOM   3464  C CZ    . TYR A 1 418 ? 4.745   1.050   77.263  1.00 19.44  ?  415  TYR A CZ    1 
ATOM   3465  O OH    . TYR A 1 418 ? 5.179   0.735   78.528  1.00 19.95  ?  415  TYR A OH    1 
ATOM   3466  N N     . VAL A 1 419 ? 4.499   0.114   71.065  1.00 13.93  ?  416  VAL A N     1 
ATOM   3467  C CA    . VAL A 1 419 ? 5.161   -1.115  70.636  1.00 22.22  ?  416  VAL A CA    1 
ATOM   3468  C C     . VAL A 1 419 ? 6.292   -0.804  69.664  1.00 14.01  ?  416  VAL A C     1 
ATOM   3469  O O     . VAL A 1 419 ? 7.336   -1.468  69.672  1.00 17.61  ?  416  VAL A O     1 
ATOM   3470  C CB    . VAL A 1 419 ? 4.142   -2.092  70.021  1.00 22.21  ?  416  VAL A CB    1 
ATOM   3471  C CG1   . VAL A 1 419 ? 4.835   -3.374  69.576  1.00 13.02  ?  416  VAL A CG1   1 
ATOM   3472  C CG2   . VAL A 1 419 ? 3.039   -2.408  71.017  1.00 22.29  ?  416  VAL A CG2   1 
ATOM   3473  N N     . TYR A 1 420 ? 6.101   0.201   68.805  1.00 17.72  ?  417  TYR A N     1 
ATOM   3474  C CA    . TYR A 1 420 ? 7.174   0.615   67.908  1.00 20.74  ?  417  TYR A CA    1 
ATOM   3475  C C     . TYR A 1 420 ? 8.398   1.065   68.695  1.00 17.70  ?  417  TYR A C     1 
ATOM   3476  O O     . TYR A 1 420 ? 9.530   0.678   68.381  1.00 19.24  ?  417  TYR A O     1 
ATOM   3477  C CB    . TYR A 1 420 ? 6.686   1.733   66.981  1.00 16.10  ?  417  TYR A CB    1 
ATOM   3478  C CG    . TYR A 1 420 ? 7.752   2.220   66.026  1.00 13.87  ?  417  TYR A CG    1 
ATOM   3479  C CD1   . TYR A 1 420 ? 8.669   3.195   66.409  1.00 22.33  ?  417  TYR A CD1   1 
ATOM   3480  C CD2   . TYR A 1 420 ? 7.850   1.698   64.743  1.00 24.17  ?  417  TYR A CD2   1 
ATOM   3481  C CE1   . TYR A 1 420 ? 9.653   3.632   65.543  1.00 19.45  ?  417  TYR A CE1   1 
ATOM   3482  C CE2   . TYR A 1 420 ? 8.827   2.132   63.868  1.00 18.59  ?  417  TYR A CE2   1 
ATOM   3483  C CZ    . TYR A 1 420 ? 9.725   3.101   64.274  1.00 27.17  ?  417  TYR A CZ    1 
ATOM   3484  O OH    . TYR A 1 420 ? 10.700  3.537   63.407  1.00 20.24  ?  417  TYR A OH    1 
ATOM   3485  N N     . LYS A 1 421 ? 8.186   1.904   69.714  1.00 19.59  ?  418  LYS A N     1 
ATOM   3486  C CA    . LYS A 1 421 ? 9.290   2.368   70.548  1.00 21.11  ?  418  LYS A CA    1 
ATOM   3487  C C     . LYS A 1 421 ? 10.040  1.198   71.174  1.00 15.41  ?  418  LYS A C     1 
ATOM   3488  O O     . LYS A 1 421 ? 11.276  1.191   71.220  1.00 28.47  ?  418  LYS A O     1 
ATOM   3489  C CB    . LYS A 1 421 ? 8.765   3.305   71.636  1.00 19.55  ?  418  LYS A CB    1 
ATOM   3490  C CG    . LYS A 1 421 ? 9.824   3.743   72.632  1.00 19.86  ?  418  LYS A CG    1 
ATOM   3491  C CD    . LYS A 1 421 ? 9.260   4.679   73.683  1.00 19.73  ?  418  LYS A CD    1 
ATOM   3492  C CE    . LYS A 1 421 ? 10.378  5.253   74.535  1.00 17.29  ?  418  LYS A CE    1 
ATOM   3493  N NZ    . LYS A 1 421 ? 9.901   6.263   75.529  1.00 14.24  1  418  LYS A NZ    1 
ATOM   3494  N N     . MET A 1 422 ? 9.303   0.197   71.660  1.00 13.66  ?  419  MET A N     1 
ATOM   3495  C CA    . MET A 1 422 ? 9.939   -0.988  72.229  1.00 21.95  ?  419  MET A CA    1 
ATOM   3496  C C     . MET A 1 422 ? 10.838  -1.671  71.208  1.00 21.63  ?  419  MET A C     1 
ATOM   3497  O O     . MET A 1 422 ? 11.984  -2.026  71.511  1.00 20.44  ?  419  MET A O     1 
ATOM   3498  C CB    . MET A 1 422 ? 8.875   -1.955  72.741  1.00 35.52  ?  419  MET A CB    1 
ATOM   3499  C CG    . MET A 1 422 ? 8.108   -1.452  73.943  1.00 82.25  ?  419  MET A CG    1 
ATOM   3500  S SD    . MET A 1 422 ? 6.870   -2.650  74.458  1.00 134.76 ?  419  MET A SD    1 
ATOM   3501  C CE    . MET A 1 422 ? 6.177   -1.819  75.877  1.00 111.63 ?  419  MET A CE    1 
ATOM   3502  N N     . GLY A 1 423 ? 10.335  -1.859  69.985  1.00 15.65  ?  420  GLY A N     1 
ATOM   3503  C CA    . GLY A 1 423 ? 11.178  -2.399  68.930  1.00 16.69  ?  420  GLY A CA    1 
ATOM   3504  C C     . GLY A 1 423 ? 12.390  -1.529  68.668  1.00 25.78  ?  420  GLY A C     1 
ATOM   3505  O O     . GLY A 1 423 ? 13.504  -2.030  68.498  1.00 22.36  ?  420  GLY A O     1 
ATOM   3506  N N     . ASN A 1 424 ? 12.187  -0.208  68.650  1.00 22.90  ?  421  ASN A N     1 
ATOM   3507  C CA    . ASN A 1 424 ? 13.288  0.732   68.484  1.00 26.19  ?  421  ASN A CA    1 
ATOM   3508  C C     . ASN A 1 424 ? 14.365  0.539   69.548  1.00 28.22  ?  421  ASN A C     1 
ATOM   3509  O O     . ASN A 1 424 ? 15.550  0.765   69.277  1.00 24.92  ?  421  ASN A O     1 
ATOM   3510  C CB    . ASN A 1 424 ? 12.741  2.162   68.526  1.00 30.76  ?  421  ASN A CB    1 
ATOM   3511  C CG    . ASN A 1 424 ? 13.475  3.105   67.593  1.00 29.72  ?  421  ASN A CG    1 
ATOM   3512  O OD1   . ASN A 1 424 ? 13.922  2.712   66.516  1.00 27.14  ?  421  ASN A OD1   1 
ATOM   3513  N ND2   . ASN A 1 424 ? 13.597  4.362   68.003  1.00 44.70  ?  421  ASN A ND2   1 
ATOM   3514  N N     . PHE A 1 425 ? 13.982  0.120   70.755  1.00 31.66  ?  422  PHE A N     1 
ATOM   3515  C CA    . PHE A 1 425 ? 14.915  -0.024  71.867  1.00 27.57  ?  422  PHE A CA    1 
ATOM   3516  C C     . PHE A 1 425 ? 15.545  -1.408  71.953  1.00 27.08  ?  422  PHE A C     1 
ATOM   3517  O O     . PHE A 1 425 ? 16.333  -1.655  72.871  1.00 44.39  ?  422  PHE A O     1 
ATOM   3518  C CB    . PHE A 1 425 ? 14.219  0.299   73.193  1.00 16.63  ?  422  PHE A CB    1 
ATOM   3519  C CG    . PHE A 1 425 ? 14.284  1.750   73.575  1.00 20.41  ?  422  PHE A CG    1 
ATOM   3520  C CD1   . PHE A 1 425 ? 13.549  2.698   72.883  1.00 15.28  ?  422  PHE A CD1   1 
ATOM   3521  C CD2   . PHE A 1 425 ? 15.075  2.166   74.634  1.00 18.05  ?  422  PHE A CD2   1 
ATOM   3522  C CE1   . PHE A 1 425 ? 13.606  4.033   73.236  1.00 21.43  ?  422  PHE A CE1   1 
ATOM   3523  C CE2   . PHE A 1 425 ? 15.135  3.498   74.993  1.00 22.92  ?  422  PHE A CE2   1 
ATOM   3524  C CZ    . PHE A 1 425 ? 14.400  4.433   74.293  1.00 14.13  ?  422  PHE A CZ    1 
ATOM   3525  N N     . ILE A 1 426 ? 15.224  -2.311  71.032  1.00 21.23  ?  423  ILE A N     1 
ATOM   3526  C CA    . ILE A 1 426 ? 15.863  -3.622  70.958  1.00 22.77  ?  423  ILE A CA    1 
ATOM   3527  C C     . ILE A 1 426 ? 16.979  -3.532  69.923  1.00 29.32  ?  423  ILE A C     1 
ATOM   3528  O O     . ILE A 1 426 ? 16.688  -3.356  68.727  1.00 26.56  ?  423  ILE A O     1 
ATOM   3529  C CB    . ILE A 1 426 ? 14.856  -4.723  70.606  1.00 23.17  ?  423  ILE A CB    1 
ATOM   3530  C CG1   . ILE A 1 426 ? 13.860  -4.901  71.753  1.00 24.55  ?  423  ILE A CG1   1 
ATOM   3531  C CG2   . ILE A 1 426 ? 15.577  -6.032  70.320  1.00 22.60  ?  423  ILE A CG2   1 
ATOM   3532  C CD1   . ILE A 1 426 ? 12.647  -5.740  71.401  1.00 23.46  ?  423  ILE A CD1   1 
ATOM   3533  N N     . PRO A 1 427 ? 18.251  -3.639  70.321  1.00 24.69  ?  424  PRO A N     1 
ATOM   3534  C CA    . PRO A 1 427 ? 19.343  -3.428  69.357  1.00 20.96  ?  424  PRO A CA    1 
ATOM   3535  C C     . PRO A 1 427 ? 19.380  -4.446  68.232  1.00 28.92  ?  424  PRO A C     1 
ATOM   3536  O O     . PRO A 1 427 ? 19.918  -4.138  67.165  1.00 26.34  ?  424  PRO A O     1 
ATOM   3537  C CB    . PRO A 1 427 ? 20.605  -3.501  70.228  1.00 24.56  ?  424  PRO A CB    1 
ATOM   3538  C CG    . PRO A 1 427 ? 20.184  -4.209  71.478  1.00 31.16  ?  424  PRO A CG    1 
ATOM   3539  C CD    . PRO A 1 427 ? 18.746  -3.853  71.692  1.00 26.31  ?  424  PRO A CD    1 
ATOM   3540  N N     . GLU A 1 428 ? 18.826  -5.640  68.417  1.00 27.83  ?  425  GLU A N     1 
ATOM   3541  C CA    . GLU A 1 428 ? 18.804  -6.603  67.324  1.00 28.86  ?  425  GLU A CA    1 
ATOM   3542  C C     . GLU A 1 428 ? 17.714  -6.311  66.304  1.00 33.89  ?  425  GLU A C     1 
ATOM   3543  O O     . GLU A 1 428 ? 17.619  -7.026  65.300  1.00 37.57  ?  425  GLU A O     1 
ATOM   3544  C CB    . GLU A 1 428 ? 18.640  -8.026  67.864  1.00 26.83  ?  425  GLU A CB    1 
ATOM   3545  C CG    . GLU A 1 428 ? 19.844  -8.539  68.645  1.00 28.88  ?  425  GLU A CG    1 
ATOM   3546  C CD    . GLU A 1 428 ? 19.939  -7.941  70.035  1.00 34.95  ?  425  GLU A CD    1 
ATOM   3547  O OE1   . GLU A 1 428 ? 18.880  -7.597  70.605  1.00 19.71  ?  425  GLU A OE1   1 
ATOM   3548  O OE2   . GLU A 1 428 ? 21.070  -7.808  70.553  1.00 26.76  -1 425  GLU A OE2   1 
ATOM   3549  N N     . CYS A 1 429 ? 16.896  -5.289  66.530  1.00 24.48  ?  426  CYS A N     1 
ATOM   3550  C CA    . CYS A 1 429 ? 15.859  -4.892  65.592  1.00 37.27  ?  426  CYS A CA    1 
ATOM   3551  C C     . CYS A 1 429 ? 16.310  -3.699  64.754  1.00 25.61  ?  426  CYS A C     1 
ATOM   3552  O O     . CYS A 1 429 ? 17.206  -2.940  65.139  1.00 26.85  ?  426  CYS A O     1 
ATOM   3553  C CB    . CYS A 1 429 ? 14.562  -4.544  66.327  1.00 48.29  ?  426  CYS A CB    1 
ATOM   3554  S SG    . CYS A 1 429 ? 13.727  -5.949  67.085  1.00 58.26  ?  426  CYS A SG    1 
ATOM   3555  N N     . LYS A 1 430 ? 15.676  -3.548  63.602  1.00 26.27  ?  427  LYS A N     1 
ATOM   3556  C CA    . LYS A 1 430 ? 15.869  -2.377  62.743  1.00 22.60  ?  427  LYS A CA    1 
ATOM   3557  C C     . LYS A 1 430 ? 14.530  -2.088  62.085  1.00 19.88  ?  427  LYS A C     1 
ATOM   3558  O O     . LYS A 1 430 ? 14.101  -2.817  61.177  1.00 25.67  ?  427  LYS A O     1 
ATOM   3559  C CB    . LYS A 1 430 ? 16.964  -2.594  61.704  1.00 19.86  ?  427  LYS A CB    1 
ATOM   3560  C CG    . LYS A 1 430 ? 17.162  -1.414  60.754  1.00 31.65  ?  427  LYS A CG    1 
ATOM   3561  C CD    . LYS A 1 430 ? 17.423  -0.114  61.507  1.00 30.28  ?  427  LYS A CD    1 
ATOM   3562  C CE    . LYS A 1 430 ? 18.745  -0.145  62.257  1.00 29.29  ?  427  LYS A CE    1 
ATOM   3563  N NZ    . LYS A 1 430 ? 18.954  1.117   63.021  1.00 26.78  1  427  LYS A NZ    1 
ATOM   3564  N N     . PRO A 1 431 ? 13.816  -1.057  62.545  1.00 22.02  ?  428  PRO A N     1 
ATOM   3565  C CA    . PRO A 1 431 ? 12.497  -0.761  61.963  1.00 20.82  ?  428  PRO A CA    1 
ATOM   3566  C C     . PRO A 1 431 ? 12.527  -0.520  60.463  1.00 24.06  ?  428  PRO A C     1 
ATOM   3567  O O     . PRO A 1 431 ? 11.577  -0.902  59.769  1.00 25.69  ?  428  PRO A O     1 
ATOM   3568  C CB    . PRO A 1 431 ? 12.059  0.491   62.731  1.00 17.42  ?  428  PRO A CB    1 
ATOM   3569  C CG    . PRO A 1 431 ? 12.746  0.357   64.063  1.00 17.17  ?  428  PRO A CG    1 
ATOM   3570  C CD    . PRO A 1 431 ? 14.091  -0.243  63.742  1.00 19.14  ?  428  PRO A CD    1 
ATOM   3571  N N     . PHE A 1 432 ? 13.590  0.086   59.942  1.00 26.80  ?  429  PHE A N     1 
ATOM   3572  C CA    . PHE A 1 432 ? 13.687  0.419   58.527  1.00 33.22  ?  429  PHE A CA    1 
ATOM   3573  C C     . PHE A 1 432 ? 15.105  0.886   58.238  1.00 24.76  ?  429  PHE A C     1 
ATOM   3574  O O     . PHE A 1 432 ? 15.835  1.304   59.141  1.00 25.18  ?  429  PHE A O     1 
ATOM   3575  C CB    . PHE A 1 432 ? 12.682  1.511   58.135  1.00 21.62  ?  429  PHE A CB    1 
ATOM   3576  C CG    . PHE A 1 432 ? 12.891  2.813   58.861  1.00 21.60  ?  429  PHE A CG    1 
ATOM   3577  C CD1   . PHE A 1 432 ? 13.852  3.718   58.435  1.00 29.39  ?  429  PHE A CD1   1 
ATOM   3578  C CD2   . PHE A 1 432 ? 12.125  3.135   59.969  1.00 18.63  ?  429  PHE A CD2   1 
ATOM   3579  C CE1   . PHE A 1 432 ? 14.053  4.908   59.105  1.00 27.76  ?  429  PHE A CE1   1 
ATOM   3580  C CE2   . PHE A 1 432 ? 12.317  4.332   60.640  1.00 20.74  ?  429  PHE A CE2   1 
ATOM   3581  C CZ    . PHE A 1 432 ? 13.282  5.218   60.206  1.00 21.78  ?  429  PHE A CZ    1 
ATOM   3582  N N     . ILE A 1 433 ? 15.478  0.832   56.964  1.00 32.41  ?  430  ILE A N     1 
ATOM   3583  C CA    . ILE A 1 433 ? 16.652  1.541   56.476  1.00 42.96  ?  430  ILE A CA    1 
ATOM   3584  C C     . ILE A 1 433 ? 16.200  2.457   55.350  1.00 34.61  ?  430  ILE A C     1 
ATOM   3585  O O     . ILE A 1 433 ? 15.213  2.183   54.660  1.00 43.67  ?  430  ILE A O     1 
ATOM   3586  C CB    . ILE A 1 433 ? 17.780  0.596   56.004  1.00 38.78  ?  430  ILE A CB    1 
ATOM   3587  C CG1   . ILE A 1 433 ? 17.376  -0.145  54.728  1.00 38.76  ?  430  ILE A CG1   1 
ATOM   3588  C CG2   . ILE A 1 433 ? 18.154  -0.380  57.108  1.00 40.34  ?  430  ILE A CG2   1 
ATOM   3589  C CD1   . ILE A 1 433 ? 18.456  -1.058  54.189  1.00 33.46  ?  430  ILE A CD1   1 
ATOM   3590  N N     . LEU A 1 434 ? 16.909  3.568   55.185  1.00 32.63  ?  431  LEU A N     1 
ATOM   3591  C CA    . LEU A 1 434 ? 16.575  4.513   54.131  1.00 27.14  ?  431  LEU A CA    1 
ATOM   3592  C C     . LEU A 1 434 ? 17.105  3.997   52.801  1.00 30.35  ?  431  LEU A C     1 
ATOM   3593  O O     . LEU A 1 434 ? 18.250  3.542   52.712  1.00 36.39  ?  431  LEU A O     1 
ATOM   3594  C CB    . LEU A 1 434 ? 17.146  5.896   54.438  1.00 26.84  ?  431  LEU A CB    1 
ATOM   3595  C CG    . LEU A 1 434 ? 16.611  6.578   55.699  1.00 23.39  ?  431  LEU A CG    1 
ATOM   3596  C CD1   . LEU A 1 434 ? 17.020  8.036   55.722  1.00 19.53  ?  431  LEU A CD1   1 
ATOM   3597  C CD2   . LEU A 1 434 ? 15.099  6.439   55.792  1.00 25.73  ?  431  LEU A CD2   1 
ATOM   3598  N N     . LYS A 1 435 ? 16.261  4.057   51.770  1.00 24.65  ?  432  LYS A N     1 
ATOM   3599  C CA    . LYS A 1 435 ? 16.654  3.557   50.457  1.00 25.92  ?  432  LYS A CA    1 
ATOM   3600  C C     . LYS A 1 435 ? 17.918  4.248   49.959  1.00 29.72  ?  432  LYS A C     1 
ATOM   3601  O O     . LYS A 1 435 ? 18.816  3.600   49.409  1.00 34.91  ?  432  LYS A O     1 
ATOM   3602  C CB    . LYS A 1 435 ? 15.507  3.750   49.467  1.00 40.13  ?  432  LYS A CB    1 
ATOM   3603  C CG    . LYS A 1 435 ? 15.529  2.793   48.294  1.00 55.86  ?  432  LYS A CG    1 
ATOM   3604  C CD    . LYS A 1 435 ? 14.394  3.085   47.326  1.00 61.32  ?  432  LYS A CD    1 
ATOM   3605  C CE    . LYS A 1 435 ? 14.302  2.006   46.263  1.00 63.84  ?  432  LYS A CE    1 
ATOM   3606  N NZ    . LYS A 1 435 ? 15.653  1.640   45.760  1.00 57.03  1  432  LYS A NZ    1 
ATOM   3607  N N     . LYS A 1 436 ? 18.014  5.563   50.163  1.00 30.91  ?  433  LYS A N     1 
ATOM   3608  C CA    . LYS A 1 436 ? 19.165  6.329   49.705  1.00 33.43  ?  433  LYS A CA    1 
ATOM   3609  C C     . LYS A 1 436 ? 20.364  6.227   50.638  1.00 28.61  ?  433  LYS A C     1 
ATOM   3610  O O     . LYS A 1 436 ? 21.466  6.631   50.249  1.00 35.76  ?  433  LYS A O     1 
ATOM   3611  C CB    . LYS A 1 436 ? 18.771  7.797   49.525  1.00 34.78  ?  433  LYS A CB    1 
ATOM   3612  C CG    . LYS A 1 436 ? 17.772  8.020   48.402  1.00 31.43  ?  433  LYS A CG    1 
ATOM   3613  C CD    . LYS A 1 436 ? 17.384  9.483   48.262  1.00 34.10  ?  433  LYS A CD    1 
ATOM   3614  C CE    . LYS A 1 436 ? 16.621  9.715   46.961  1.00 34.76  ?  433  LYS A CE    1 
ATOM   3615  N NZ    . LYS A 1 436 ? 16.180  11.131  46.806  1.00 44.65  1  433  LYS A NZ    1 
ATOM   3616  N N     . MET A 1 437 ? 20.183  5.705   51.851  1.00 27.81  ?  434  MET A N     1 
ATOM   3617  C CA    . MET A 1 437 ? 21.288  5.507   52.779  1.00 23.12  ?  434  MET A CA    1 
ATOM   3618  C C     . MET A 1 437 ? 21.877  4.104   52.729  1.00 28.80  ?  434  MET A C     1 
ATOM   3619  O O     . MET A 1 437 ? 22.879  3.849   53.408  1.00 43.58  ?  434  MET A O     1 
ATOM   3620  C CB    . MET A 1 437 ? 20.840  5.811   54.215  1.00 32.85  ?  434  MET A CB    1 
ATOM   3621  C CG    . MET A 1 437 ? 20.523  7.274   54.477  1.00 32.52  ?  434  MET A CG    1 
ATOM   3622  S SD    . MET A 1 437 ? 21.964  8.340   54.290  1.00 36.66  ?  434  MET A SD    1 
ATOM   3623  C CE    . MET A 1 437 ? 22.976  7.800   55.664  1.00 28.40  ?  434  MET A CE    1 
ATOM   3624  N N     . GLU A 1 438 ? 21.295  3.197   51.941  1.00 34.44  ?  435  GLU A N     1 
ATOM   3625  C CA    . GLU A 1 438 ? 21.725  1.801   51.969  1.00 36.02  ?  435  GLU A CA    1 
ATOM   3626  C C     . GLU A 1 438 ? 23.183  1.639   51.550  1.00 41.05  ?  435  GLU A C     1 
ATOM   3627  O O     . GLU A 1 438 ? 23.838  0.674   51.955  1.00 44.37  ?  435  GLU A O     1 
ATOM   3628  C CB    . GLU A 1 438 ? 20.804  0.963   51.078  1.00 41.87  ?  435  GLU A CB    1 
ATOM   3629  C CG    . GLU A 1 438 ? 21.054  -0.537  51.149  1.00 47.32  ?  435  GLU A CG    1 
ATOM   3630  C CD    . GLU A 1 438 ? 19.858  -1.358  50.698  1.00 54.18  ?  435  GLU A CD    1 
ATOM   3631  O OE1   . GLU A 1 438 ? 18.815  -0.754  50.374  1.00 57.82  ?  435  GLU A OE1   1 
ATOM   3632  O OE2   . GLU A 1 438 ? 19.959  -2.605  50.671  1.00 59.96  -1 435  GLU A OE2   1 
ATOM   3633  N N     . ASP A 1 439 ? 23.729  2.565   50.770  1.00 41.97  ?  436  ASP A N     1 
ATOM   3634  C CA    . ASP A 1 439 ? 25.112  2.428   50.334  1.00 40.17  ?  436  ASP A CA    1 
ATOM   3635  C C     . ASP A 1 439 ? 26.039  3.424   51.016  1.00 41.47  ?  436  ASP A C     1 
ATOM   3636  O O     . ASP A 1 439 ? 27.084  3.766   50.455  1.00 44.55  ?  436  ASP A O     1 
ATOM   3637  C CB    . ASP A 1 439 ? 25.194  2.586   48.805  1.00 44.78  ?  436  ASP A CB    1 
ATOM   3638  C CG    . ASP A 1 439 ? 24.709  3.962   48.304  1.00 49.12  ?  436  ASP A CG    1 
ATOM   3639  O OD1   . ASP A 1 439 ? 23.975  4.661   49.020  1.00 46.18  ?  436  ASP A OD1   1 
ATOM   3640  O OD2   . ASP A 1 439 ? 25.066  4.359   47.178  1.00 62.10  -1 436  ASP A OD2   1 
ATOM   3641  N N     . LYS A 1 440 ? 25.683  3.892   52.214  1.00 41.98  ?  437  LYS A N     1 
ATOM   3642  C CA    . LYS A 1 440 ? 26.466  4.896   52.930  1.00 36.97  ?  437  LYS A CA    1 
ATOM   3643  C C     . LYS A 1 440 ? 27.128  4.346   54.192  1.00 38.85  ?  437  LYS A C     1 
ATOM   3644  O O     . LYS A 1 440 ? 27.426  5.113   55.111  1.00 41.79  ?  437  LYS A O     1 
ATOM   3645  C CB    . LYS A 1 440 ? 25.599  6.107   53.288  1.00 39.82  ?  437  LYS A CB    1 
ATOM   3646  C CG    . LYS A 1 440 ? 24.878  6.740   52.109  1.00 36.30  ?  437  LYS A CG    1 
ATOM   3647  C CD    . LYS A 1 440 ? 25.854  7.135   51.017  1.00 39.50  ?  437  LYS A CD    1 
ATOM   3648  C CE    . LYS A 1 440 ? 25.191  8.024   49.979  1.00 38.91  ?  437  LYS A CE    1 
ATOM   3649  N NZ    . LYS A 1 440 ? 23.960  7.413   49.405  1.00 44.97  1  437  LYS A NZ    1 
ATOM   3650  N N     . GLU A 1 441 ? 27.373  3.033   54.253  1.00 38.58  ?  438  GLU A N     1 
ATOM   3651  C CA    . GLU A 1 441 ? 27.949  2.440   55.460  1.00 39.26  ?  438  GLU A CA    1 
ATOM   3652  C C     . GLU A 1 441 ? 29.368  2.935   55.718  1.00 37.77  ?  438  GLU A C     1 
ATOM   3653  O O     . GLU A 1 441 ? 29.837  2.912   56.862  1.00 31.35  ?  438  GLU A O     1 
ATOM   3654  C CB    . GLU A 1 441 ? 27.936  0.912   55.354  1.00 48.07  ?  438  GLU A CB    1 
ATOM   3655  C CG    . GLU A 1 441 ? 28.475  0.163   56.566  1.00 55.11  ?  438  GLU A CG    1 
ATOM   3656  C CD    . GLU A 1 441 ? 28.310  -1.342  56.442  1.00 65.05  ?  438  GLU A CD    1 
ATOM   3657  O OE1   . GLU A 1 441 ? 29.316  -2.042  56.197  1.00 69.94  ?  438  GLU A OE1   1 
ATOM   3658  O OE2   . GLU A 1 441 ? 27.166  -1.823  56.579  1.00 64.66  -1 438  GLU A OE2   1 
ATOM   3659  N N     . LYS A 1 442 ? 30.066  3.388   54.677  1.00 34.46  ?  439  LYS A N     1 
ATOM   3660  C CA    . LYS A 1 442 ? 31.464  3.780   54.812  1.00 37.34  ?  439  LYS A CA    1 
ATOM   3661  C C     . LYS A 1 442 ? 31.654  5.086   55.574  1.00 45.31  ?  439  LYS A C     1 
ATOM   3662  O O     . LYS A 1 442 ? 32.801  5.475   55.821  1.00 36.09  ?  439  LYS A O     1 
ATOM   3663  C CB    . LYS A 1 442 ? 32.100  3.899   53.430  1.00 37.44  ?  439  LYS A CB    1 
ATOM   3664  C CG    . LYS A 1 442 ? 31.416  4.902   52.515  1.00 44.06  ?  439  LYS A CG    1 
ATOM   3665  C CD    . LYS A 1 442 ? 32.000  4.834   51.111  1.00 52.03  ?  439  LYS A CD    1 
ATOM   3666  C CE    . LYS A 1 442 ? 31.139  5.581   50.106  1.00 46.68  ?  439  LYS A CE    1 
ATOM   3667  N NZ    . LYS A 1 442 ? 31.642  5.402   48.716  1.00 45.38  1  439  LYS A NZ    1 
ATOM   3668  N N     . ASN A 1 443 ? 30.576  5.761   55.960  1.00 42.00  ?  440  ASN A N     1 
ATOM   3669  C CA    . ASN A 1 443 ? 30.656  7.078   56.569  1.00 41.92  ?  440  ASN A CA    1 
ATOM   3670  C C     . ASN A 1 443 ? 30.331  7.008   58.057  1.00 36.87  ?  440  ASN A C     1 
ATOM   3671  O O     . ASN A 1 443 ? 29.511  6.198   58.498  1.00 31.64  ?  440  ASN A O     1 
ATOM   3672  C CB    . ASN A 1 443 ? 29.704  8.051   55.871  1.00 40.93  ?  440  ASN A CB    1 
ATOM   3673  C CG    . ASN A 1 443 ? 29.920  8.095   54.371  1.00 34.10  ?  440  ASN A CG    1 
ATOM   3674  O OD1   . ASN A 1 443 ? 31.055  8.138   53.896  1.00 32.06  ?  440  ASN A OD1   1 
ATOM   3675  N ND2   . ASN A 1 443 ? 28.828  8.076   53.616  1.00 36.09  ?  440  ASN A ND2   1 
ATOM   3676  N N     . LEU A 1 444 ? 30.990  7.873   58.826  1.00 33.71  ?  441  LEU A N     1 
ATOM   3677  C CA    . LEU A 1 444 ? 30.788  7.980   60.266  1.00 36.87  ?  441  LEU A CA    1 
ATOM   3678  C C     . LEU A 1 444 ? 30.146  9.332   60.550  1.00 40.20  ?  441  LEU A C     1 
ATOM   3679  O O     . LEU A 1 444 ? 30.785  10.378  60.382  1.00 34.74  ?  441  LEU A O     1 
ATOM   3680  C CB    . LEU A 1 444 ? 32.108  7.820   61.017  1.00 38.36  ?  441  LEU A CB    1 
ATOM   3681  C CG    . LEU A 1 444 ? 32.081  8.066   62.528  1.00 43.15  ?  441  LEU A CG    1 
ATOM   3682  C CD1   . LEU A 1 444 ? 31.078  7.146   63.197  1.00 32.16  ?  441  LEU A CD1   1 
ATOM   3683  C CD2   . LEU A 1 444 ? 33.467  7.883   63.128  1.00 40.65  ?  441  LEU A CD2   1 
ATOM   3684  N N     . TYR A 1 445 ? 28.886  9.307   60.974  1.00 40.73  ?  442  TYR A N     1 
ATOM   3685  C CA    . TYR A 1 445 ? 28.116  10.518  61.220  1.00 32.80  ?  442  TYR A CA    1 
ATOM   3686  C C     . TYR A 1 445 ? 28.182  10.858  62.704  1.00 30.48  ?  442  TYR A C     1 
ATOM   3687  O O     . TYR A 1 445 ? 27.735  10.074  63.546  1.00 34.27  ?  442  TYR A O     1 
ATOM   3688  C CB    . TYR A 1 445 ? 26.671  10.336  60.756  1.00 28.14  ?  442  TYR A CB    1 
ATOM   3689  C CG    . TYR A 1 445 ? 26.575  9.935   59.299  1.00 25.40  ?  442  TYR A CG    1 
ATOM   3690  C CD1   . TYR A 1 445 ? 26.792  10.862  58.290  1.00 25.39  ?  442  TYR A CD1   1 
ATOM   3691  C CD2   . TYR A 1 445 ? 26.283  8.627   58.933  1.00 28.35  ?  442  TYR A CD2   1 
ATOM   3692  C CE1   . TYR A 1 445 ? 26.715  10.503  56.957  1.00 35.80  ?  442  TYR A CE1   1 
ATOM   3693  C CE2   . TYR A 1 445 ? 26.204  8.257   57.599  1.00 30.63  ?  442  TYR A CE2   1 
ATOM   3694  C CZ    . TYR A 1 445 ? 26.420  9.200   56.618  1.00 30.06  ?  442  TYR A CZ    1 
ATOM   3695  O OH    . TYR A 1 445 ? 26.345  8.843   55.291  1.00 31.90  ?  442  TYR A OH    1 
ATOM   3696  N N     . ILE A 1 446 ? 28.737  12.028  63.015  1.00 33.30  ?  443  ILE A N     1 
ATOM   3697  C CA    . ILE A 1 446 ? 29.003  12.455  64.382  1.00 35.81  ?  443  ILE A CA    1 
ATOM   3698  C C     . ILE A 1 446 ? 28.325  13.798  64.609  1.00 35.61  ?  443  ILE A C     1 
ATOM   3699  O O     . ILE A 1 446 ? 28.419  14.697  63.765  1.00 29.78  ?  443  ILE A O     1 
ATOM   3700  C CB    . ILE A 1 446 ? 30.518  12.552  64.647  1.00 46.46  ?  443  ILE A CB    1 
ATOM   3701  C CG1   . ILE A 1 446 ? 31.167  11.168  64.558  1.00 44.81  ?  443  ILE A CG1   1 
ATOM   3702  C CG2   . ILE A 1 446 ? 30.795  13.187  66.001  1.00 48.51  ?  443  ILE A CG2   1 
ATOM   3703  C CD1   . ILE A 1 446 ? 32.680  11.203  64.588  1.00 45.66  ?  443  ILE A CD1   1 
ATOM   3704  N N     . GLY A 1 447 ? 27.639  13.929  65.739  1.00 31.58  ?  444  GLY A N     1 
ATOM   3705  C CA    . GLY A 1 447 ? 27.026  15.187  66.146  1.00 30.64  ?  444  GLY A CA    1 
ATOM   3706  C C     . GLY A 1 447 ? 27.740  15.741  67.366  1.00 36.87  ?  444  GLY A C     1 
ATOM   3707  O O     . GLY A 1 447 ? 28.157  14.983  68.243  1.00 37.30  ?  444  GLY A O     1 
ATOM   3708  N N     . ILE A 1 448 ? 27.876  17.065  67.415  1.00 39.19  ?  445  ILE A N     1 
ATOM   3709  C CA    . ILE A 1 448 ? 28.633  17.743  68.464  1.00 41.11  ?  445  ILE A CA    1 
ATOM   3710  C C     . ILE A 1 448 ? 27.754  18.816  69.090  1.00 38.13  ?  445  ILE A C     1 
ATOM   3711  O O     . ILE A 1 448 ? 27.327  19.750  68.402  1.00 31.58  ?  445  ILE A O     1 
ATOM   3712  C CB    . ILE A 1 448 ? 29.929  18.375  67.928  1.00 43.85  ?  445  ILE A CB    1 
ATOM   3713  C CG1   . ILE A 1 448 ? 30.770  17.341  67.178  1.00 45.59  ?  445  ILE A CG1   1 
ATOM   3714  C CG2   . ILE A 1 448 ? 30.725  18.997  69.069  1.00 30.05  ?  445  ILE A CG2   1 
ATOM   3715  C CD1   . ILE A 1 448 ? 31.212  16.184  68.032  1.00 35.94  ?  445  ILE A CD1   1 
ATOM   3716  N N     . ASP A 1 449 ? 27.506  18.697  70.395  1.00 35.69  ?  446  ASP A N     1 
ATOM   3717  C CA    . ASP A 1 449 ? 26.831  19.727  71.181  1.00 42.64  ?  446  ASP A CA    1 
ATOM   3718  C C     . ASP A 1 449 ? 27.820  20.226  72.226  1.00 43.45  ?  446  ASP A C     1 
ATOM   3719  O O     . ASP A 1 449 ? 28.162  19.497  73.164  1.00 40.06  ?  446  ASP A O     1 
ATOM   3720  C CB    . ASP A 1 449 ? 25.558  19.186  71.837  1.00 47.34  ?  446  ASP A CB    1 
ATOM   3721  C CG    . ASP A 1 449 ? 24.714  20.280  72.490  1.00 52.74  ?  446  ASP A CG    1 
ATOM   3722  O OD1   . ASP A 1 449 ? 25.275  21.290  72.965  1.00 62.55  ?  446  ASP A OD1   1 
ATOM   3723  O OD2   . ASP A 1 449 ? 23.476  20.124  72.531  1.00 56.97  -1 446  ASP A OD2   1 
ATOM   3724  N N     . LEU A 1 450 ? 28.269  21.470  72.070  1.00 42.57  ?  447  LEU A N     1 
ATOM   3725  C CA    . LEU A 1 450 ? 29.279  22.048  72.948  1.00 41.63  ?  447  LEU A CA    1 
ATOM   3726  C C     . LEU A 1 450 ? 28.922  23.502  73.217  1.00 40.39  ?  447  LEU A C     1 
ATOM   3727  O O     . LEU A 1 450 ? 28.856  24.310  72.285  1.00 37.33  ?  447  LEU A O     1 
ATOM   3728  C CB    . LEU A 1 450 ? 30.674  21.928  72.327  1.00 35.41  ?  447  LEU A CB    1 
ATOM   3729  C CG    . LEU A 1 450 ? 31.852  22.537  73.088  1.00 50.60  ?  447  LEU A CG    1 
ATOM   3730  C CD1   . LEU A 1 450 ? 33.079  21.652  72.981  1.00 45.87  ?  447  LEU A CD1   1 
ATOM   3731  C CD2   . LEU A 1 450 ? 32.151  23.901  72.527  1.00 59.08  ?  447  LEU A CD2   1 
ATOM   3732  N N     . SER A 1 451 ? 28.708  23.836  74.488  1.00 35.96  ?  448  SER A N     1 
ATOM   3733  C CA    . SER A 1 451 ? 28.319  25.179  74.892  1.00 46.39  ?  448  SER A CA    1 
ATOM   3734  C C     . SER A 1 451 ? 29.242  25.682  75.996  1.00 48.73  ?  448  SER A C     1 
ATOM   3735  O O     . SER A 1 451 ? 29.864  24.902  76.723  1.00 40.36  ?  448  SER A O     1 
ATOM   3736  C CB    . SER A 1 451 ? 26.861  25.224  75.368  1.00 57.99  ?  448  SER A CB    1 
ATOM   3737  O OG    . SER A 1 451 ? 26.656  24.357  76.471  1.00 54.13  ?  448  SER A OG    1 
ATOM   3738  N N     . HIS A 1 452 ? 29.316  27.008  76.115  1.00 56.25  ?  449  HIS A N     1 
ATOM   3739  C CA    . HIS A 1 452 ? 30.154  27.677  77.105  1.00 60.39  ?  449  HIS A CA    1 
ATOM   3740  C C     . HIS A 1 452 ? 29.327  28.740  77.812  1.00 67.62  ?  449  HIS A C     1 
ATOM   3741  O O     . HIS A 1 452 ? 28.823  29.664  77.166  1.00 69.13  ?  449  HIS A O     1 
ATOM   3742  C CB    . HIS A 1 452 ? 31.381  28.324  76.456  1.00 54.13  ?  449  HIS A CB    1 
ATOM   3743  C CG    . HIS A 1 452 ? 32.220  27.381  75.653  1.00 58.29  ?  449  HIS A CG    1 
ATOM   3744  N ND1   . HIS A 1 452 ? 32.702  26.194  76.161  1.00 59.00  ?  449  HIS A ND1   1 
ATOM   3745  C CD2   . HIS A 1 452 ? 32.674  27.457  74.381  1.00 61.82  ?  449  HIS A CD2   1 
ATOM   3746  C CE1   . HIS A 1 452 ? 33.411  25.576  75.233  1.00 58.70  ?  449  HIS A CE1   1 
ATOM   3747  N NE2   . HIS A 1 452 ? 33.411  26.322  74.144  1.00 62.09  ?  449  HIS A NE2   1 
ATOM   3748  N N     . ASP A 1 453 ? 29.203  28.621  79.131  1.00 68.16  ?  450  ASP A N     1 
ATOM   3749  C CA    . ASP A 1 453 ? 28.485  29.618  79.923  1.00 66.01  ?  450  ASP A CA    1 
ATOM   3750  C C     . ASP A 1 453 ? 29.359  30.201  81.029  1.00 60.76  ?  450  ASP A C     1 
ATOM   3751  O O     . ASP A 1 453 ? 30.472  29.732  81.271  1.00 59.13  ?  450  ASP A O     1 
ATOM   3752  C CB    . ASP A 1 453 ? 27.217  29.015  80.530  1.00 77.17  ?  450  ASP A CB    1 
ATOM   3753  C CG    . ASP A 1 453 ? 25.979  29.322  79.712  1.00 85.94  ?  450  ASP A CG    1 
ATOM   3754  O OD1   . ASP A 1 453 ? 25.342  30.367  79.968  1.00 85.96  ?  450  ASP A OD1   1 
ATOM   3755  O OD2   . ASP A 1 453 ? 25.643  28.522  78.814  1.00 88.00  -1 450  ASP A OD2   1 
ATOM   3756  N N     . ALA A 1 456 ? 29.423  32.538  84.853  1.00 71.39  ?  453  ALA A N     1 
ATOM   3757  C CA    . ALA A 1 456 ? 30.187  31.328  85.128  1.00 65.32  ?  453  ALA A CA    1 
ATOM   3758  C C     . ALA A 1 456 ? 31.333  31.194  84.133  1.00 75.54  ?  453  ALA A C     1 
ATOM   3759  O O     . ALA A 1 456 ? 31.474  32.017  83.226  1.00 85.51  ?  453  ALA A O     1 
ATOM   3760  C CB    . ALA A 1 456 ? 29.280  30.108  85.083  1.00 52.40  ?  453  ALA A CB    1 
ATOM   3761  N N     . ARG A 1 457 ? 32.160  30.167  84.318  1.00 67.63  ?  454  ARG A N     1 
ATOM   3762  C CA    . ARG A 1 457 ? 33.310  29.905  83.451  1.00 63.14  ?  454  ARG A CA    1 
ATOM   3763  C C     . ARG A 1 457 ? 33.428  28.406  83.202  1.00 65.15  ?  454  ARG A C     1 
ATOM   3764  O O     . ARG A 1 457 ? 34.473  27.793  83.415  1.00 66.49  ?  454  ARG A O     1 
ATOM   3765  C CB    . ARG A 1 457 ? 34.601  30.454  84.058  1.00 58.96  ?  454  ARG A CB    1 
ATOM   3766  C CG    . ARG A 1 457 ? 34.650  31.971  84.171  1.00 63.50  ?  454  ARG A CG    1 
ATOM   3767  C CD    . ARG A 1 457 ? 34.544  32.625  82.804  1.00 72.33  ?  454  ARG A CD    1 
ATOM   3768  N NE    . ARG A 1 457 ? 35.764  32.458  82.020  1.00 84.22  ?  454  ARG A NE    1 
ATOM   3769  C CZ    . ARG A 1 457 ? 35.873  32.762  80.730  1.00 84.98  ?  454  ARG A CZ    1 
ATOM   3770  N NH1   . ARG A 1 457 ? 34.830  33.243  80.065  1.00 86.38  1  454  ARG A NH1   1 
ATOM   3771  N NH2   . ARG A 1 457 ? 37.027  32.580  80.103  1.00 80.88  ?  454  ARG A NH2   1 
ATOM   3772  N N     . LYS A 1 458 ? 32.349  27.800  82.723  1.00 62.44  ?  455  LYS A N     1 
ATOM   3773  C CA    . LYS A 1 458 ? 32.266  26.358  82.552  1.00 58.42  ?  455  LYS A CA    1 
ATOM   3774  C C     . LYS A 1 458 ? 31.962  26.012  81.096  1.00 55.97  ?  455  LYS A C     1 
ATOM   3775  O O     . LYS A 1 458 ? 31.532  26.857  80.304  1.00 46.56  ?  455  LYS A O     1 
ATOM   3776  C CB    . LYS A 1 458 ? 31.195  25.767  83.479  1.00 55.20  ?  455  LYS A CB    1 
ATOM   3777  C CG    . LYS A 1 458 ? 31.397  26.089  84.959  1.00 55.06  ?  455  LYS A CG    1 
ATOM   3778  C CD    . LYS A 1 458 ? 32.319  25.085  85.641  1.00 53.20  ?  455  LYS A CD    1 
ATOM   3779  C CE    . LYS A 1 458 ? 32.590  25.469  87.092  1.00 52.23  ?  455  LYS A CE    1 
ATOM   3780  N NZ    . LYS A 1 458 ? 33.726  26.424  87.216  1.00 55.72  1  455  LYS A NZ    1 
ATOM   3781  N N     . THR A 1 459 ? 32.174  24.736  80.757  1.00 55.53  ?  456  THR A N     1 
ATOM   3782  C CA    . THR A 1 459 ? 32.001  24.217  79.402  1.00 60.23  ?  456  THR A CA    1 
ATOM   3783  C C     . THR A 1 459 ? 31.228  22.904  79.442  1.00 51.91  ?  456  THR A C     1 
ATOM   3784  O O     . THR A 1 459 ? 31.470  22.065  80.314  1.00 57.06  ?  456  THR A O     1 
ATOM   3785  C CB    . THR A 1 459 ? 33.366  24.002  78.720  1.00 62.45  ?  456  THR A CB    1 
ATOM   3786  O OG1   . THR A 1 459 ? 33.897  25.264  78.301  1.00 60.42  ?  456  THR A OG1   1 
ATOM   3787  C CG2   . THR A 1 459 ? 33.254  23.073  77.516  1.00 60.11  ?  456  THR A CG2   1 
ATOM   3788  N N     . ASN A 1 460 ? 30.305  22.723  78.498  1.00 44.57  ?  457  ASN A N     1 
ATOM   3789  C CA    . ASN A 1 460 ? 29.443  21.548  78.456  1.00 50.13  ?  457  ASN A CA    1 
ATOM   3790  C C     . ASN A 1 460 ? 29.558  20.901  77.078  1.00 49.77  ?  457  ASN A C     1 
ATOM   3791  O O     . ASN A 1 460 ? 29.356  21.564  76.050  1.00 43.37  ?  457  ASN A O     1 
ATOM   3792  C CB    . ASN A 1 460 ? 27.996  21.922  78.748  1.00 44.63  ?  457  ASN A CB    1 
ATOM   3793  C CG    . ASN A 1 460 ? 27.796  22.371  80.174  1.00 52.73  ?  457  ASN A CG    1 
ATOM   3794  O OD1   . ASN A 1 460 ? 28.343  21.768  81.101  1.00 40.53  ?  457  ASN A OD1   1 
ATOM   3795  N ND2   . ASN A 1 460 ? 27.039  23.443  80.364  1.00 60.00  ?  457  ASN A ND2   1 
ATOM   3796  N N     . LEU A 1 461 ? 29.864  19.600  77.059  1.00 44.74  ?  458  LEU A N     1 
ATOM   3797  C CA    . LEU A 1 461 ? 30.189  18.872  75.837  1.00 42.71  ?  458  LEU A CA    1 
ATOM   3798  C C     . LEU A 1 461 ? 29.423  17.557  75.778  1.00 40.44  ?  458  LEU A C     1 
ATOM   3799  O O     . LEU A 1 461 ? 29.285  16.864  76.790  1.00 44.31  ?  458  LEU A O     1 
ATOM   3800  C CB    . LEU A 1 461 ? 31.697  18.588  75.758  1.00 36.36  ?  458  LEU A CB    1 
ATOM   3801  C CG    . LEU A 1 461 ? 32.138  17.532  74.739  1.00 35.58  ?  458  LEU A CG    1 
ATOM   3802  C CD1   . LEU A 1 461 ? 31.936  18.037  73.317  1.00 44.12  ?  458  LEU A CD1   1 
ATOM   3803  C CD2   . LEU A 1 461 ? 33.581  17.123  74.971  1.00 47.90  ?  458  LEU A CD2   1 
ATOM   3804  N N     . CYS A 1 462 ? 28.932  17.216  74.586  1.00 34.50  ?  459  CYS A N     1 
ATOM   3805  C CA    . CYS A 1 462 ? 28.321  15.917  74.325  1.00 33.16  ?  459  CYS A CA    1 
ATOM   3806  C C     . CYS A 1 462 ? 28.461  15.600  72.842  1.00 42.77  ?  459  CYS A C     1 
ATOM   3807  O O     . CYS A 1 462 ? 28.217  16.469  71.999  1.00 37.97  ?  459  CYS A O     1 
ATOM   3808  C CB    . CYS A 1 462 ? 26.846  15.895  74.740  1.00 37.97  ?  459  CYS A CB    1 
ATOM   3809  S SG    . CYS A 1 462 ? 25.992  14.353  74.311  1.00 35.42  ?  459  CYS A SG    1 
ATOM   3810  N N     . ILE A 1 463 ? 28.868  14.368  72.530  1.00 31.90  ?  460  ILE A N     1 
ATOM   3811  C CA    . ILE A 1 463 ? 29.024  13.919  71.153  1.00 31.17  ?  460  ILE A CA    1 
ATOM   3812  C C     . ILE A 1 463 ? 28.245  12.623  70.958  1.00 30.29  ?  460  ILE A C     1 
ATOM   3813  O O     . ILE A 1 463 ? 28.033  11.852  71.899  1.00 30.33  ?  460  ILE A O     1 
ATOM   3814  C CB    . ILE A 1 463 ? 30.511  13.728  70.762  1.00 44.09  ?  460  ILE A CB    1 
ATOM   3815  C CG1   . ILE A 1 463 ? 31.047  12.379  71.247  1.00 45.53  ?  460  ILE A CG1   1 
ATOM   3816  C CG2   . ILE A 1 463 ? 31.365  14.855  71.326  1.00 48.78  ?  460  ILE A CG2   1 
ATOM   3817  C CD1   . ILE A 1 463 ? 31.306  11.385  70.128  1.00 45.53  ?  460  ILE A CD1   1 
ATOM   3818  N N     . ALA A 1 464 ? 27.822  12.385  69.717  1.00 29.51  ?  461  ALA A N     1 
ATOM   3819  C CA    . ALA A 1 464 ? 27.056  11.197  69.369  1.00 28.65  ?  461  ALA A CA    1 
ATOM   3820  C C     . ALA A 1 464 ? 27.418  10.772  67.954  1.00 34.92  ?  461  ALA A C     1 
ATOM   3821  O O     . ALA A 1 464 ? 27.438  11.604  67.042  1.00 32.40  ?  461  ALA A O     1 
ATOM   3822  C CB    . ALA A 1 464 ? 25.549  11.458  69.472  1.00 28.26  ?  461  ALA A CB    1 
ATOM   3823  N N     . ALA A 1 465 ? 27.695  9.481   67.775  1.00 35.59  ?  462  ALA A N     1 
ATOM   3824  C CA    . ALA A 1 465 ? 28.057  8.922   66.479  1.00 35.81  ?  462  ALA A CA    1 
ATOM   3825  C C     . ALA A 1 465 ? 27.074  7.825   66.094  1.00 30.03  ?  462  ALA A C     1 
ATOM   3826  O O     . ALA A 1 465 ? 26.663  7.022   66.939  1.00 26.17  ?  462  ALA A O     1 
ATOM   3827  C CB    . ALA A 1 465 ? 29.485  8.365   66.498  1.00 27.48  ?  462  ALA A CB    1 
ATOM   3828  N N     . VAL A 1 466 ? 26.690  7.799   64.814  1.00 29.91  ?  463  VAL A N     1 
ATOM   3829  C CA    . VAL A 1 466 ? 25.766  6.801   64.287  1.00 25.52  ?  463  VAL A CA    1 
ATOM   3830  C C     . VAL A 1 466 ? 26.260  6.335   62.923  1.00 37.12  ?  463  VAL A C     1 
ATOM   3831  O O     . VAL A 1 466 ? 27.097  6.978   62.285  1.00 38.61  ?  463  VAL A O     1 
ATOM   3832  C CB    . VAL A 1 466 ? 24.315  7.327   64.157  1.00 27.35  ?  463  VAL A CB    1 
ATOM   3833  C CG1   . VAL A 1 466 ? 23.843  7.986   65.451  1.00 27.49  ?  463  VAL A CG1   1 
ATOM   3834  C CG2   . VAL A 1 466 ? 24.197  8.285   62.982  1.00 32.35  ?  463  VAL A CG2   1 
ATOM   3835  N N     . ASP A 1 467 ? 25.716  5.205   62.470  1.00 30.39  ?  464  ASP A N     1 
ATOM   3836  C CA    . ASP A 1 467 ? 26.039  4.671   61.157  1.00 30.21  ?  464  ASP A CA    1 
ATOM   3837  C C     . ASP A 1 467 ? 24.912  4.989   60.174  1.00 36.36  ?  464  ASP A C     1 
ATOM   3838  O O     . ASP A 1 467 ? 23.955  5.702   60.494  1.00 38.01  ?  464  ASP A O     1 
ATOM   3839  C CB    . ASP A 1 467 ? 26.340  3.165   61.243  1.00 29.18  ?  464  ASP A CB    1 
ATOM   3840  C CG    . ASP A 1 467 ? 25.129  2.318   61.638  1.00 28.60  ?  464  ASP A CG    1 
ATOM   3841  O OD1   . ASP A 1 467 ? 23.971  2.767   61.515  1.00 36.70  ?  464  ASP A OD1   1 
ATOM   3842  O OD2   . ASP A 1 467 ? 25.347  1.162   62.061  1.00 37.49  -1 464  ASP A OD2   1 
ATOM   3843  N N     . ASN A 1 468 ? 25.017  4.437   58.962  1.00 33.09  ?  465  ASN A N     1 
ATOM   3844  C CA    . ASN A 1 468 ? 24.057  4.732   57.904  1.00 33.95  ?  465  ASN A CA    1 
ATOM   3845  C C     . ASN A 1 468 ? 22.668  4.180   58.197  1.00 30.65  ?  465  ASN A C     1 
ATOM   3846  O O     . ASN A 1 468 ? 21.697  4.622   57.574  1.00 28.09  ?  465  ASN A O     1 
ATOM   3847  C CB    . ASN A 1 468 ? 24.561  4.168   56.576  1.00 39.43  ?  465  ASN A CB    1 
ATOM   3848  C CG    . ASN A 1 468 ? 24.493  2.655   56.525  1.00 29.78  ?  465  ASN A CG    1 
ATOM   3849  O OD1   . ASN A 1 468 ? 25.140  1.965   57.313  1.00 30.66  ?  465  ASN A OD1   1 
ATOM   3850  N ND2   . ASN A 1 468 ? 23.708  2.130   55.594  1.00 29.70  ?  465  ASN A ND2   1 
ATOM   3851  N N     . THR A 1 469 ? 22.552  3.225   59.118  1.00 35.08  ?  466  THR A N     1 
ATOM   3852  C CA    . THR A 1 469 ? 21.274  2.618   59.460  1.00 27.52  ?  466  THR A CA    1 
ATOM   3853  C C     . THR A 1 469 ? 20.594  3.286   60.645  1.00 32.34  ?  466  THR A C     1 
ATOM   3854  O O     . THR A 1 469 ? 19.460  2.923   60.975  1.00 37.36  ?  466  THR A O     1 
ATOM   3855  C CB    . THR A 1 469 ? 21.461  1.131   59.778  1.00 39.27  ?  466  THR A CB    1 
ATOM   3856  O OG1   . THR A 1 469 ? 22.221  0.995   60.985  1.00 33.96  ?  466  THR A OG1   1 
ATOM   3857  C CG2   . THR A 1 469 ? 22.197  0.433   58.648  1.00 28.71  ?  466  THR A CG2   1 
ATOM   3858  N N     . GLY A 1 470 ? 21.251  4.241   61.293  1.00 28.77  ?  467  GLY A N     1 
ATOM   3859  C CA    . GLY A 1 470 ? 20.712  4.849   62.487  1.00 29.79  ?  467  GLY A CA    1 
ATOM   3860  C C     . GLY A 1 470 ? 21.127  4.188   63.783  1.00 28.86  ?  467  GLY A C     1 
ATOM   3861  O O     . GLY A 1 470 ? 20.720  4.657   64.853  1.00 26.92  ?  467  GLY A O     1 
ATOM   3862  N N     . ASP A 1 471 ? 21.909  3.111   63.727  1.00 30.77  ?  468  ASP A N     1 
ATOM   3863  C CA    . ASP A 1 471 ? 22.458  2.533   64.946  1.00 30.67  ?  468  ASP A CA    1 
ATOM   3864  C C     . ASP A 1 471 ? 23.383  3.536   65.617  1.00 31.28  ?  468  ASP A C     1 
ATOM   3865  O O     . ASP A 1 471 ? 24.224  4.156   64.961  1.00 28.57  ?  468  ASP A O     1 
ATOM   3866  C CB    . ASP A 1 471 ? 23.221  1.243   64.641  1.00 32.21  ?  468  ASP A CB    1 
ATOM   3867  C CG    . ASP A 1 471 ? 22.306  0.049   64.461  1.00 42.95  ?  468  ASP A CG    1 
ATOM   3868  O OD1   . ASP A 1 471 ? 21.094  0.177   64.737  1.00 39.17  ?  468  ASP A OD1   1 
ATOM   3869  O OD2   . ASP A 1 471 ? 22.804  -1.021  64.054  1.00 63.43  -1 468  ASP A OD2   1 
ATOM   3870  N N     . ILE A 1 472 ? 23.226  3.697   66.926  1.00 27.57  ?  469  ILE A N     1 
ATOM   3871  C CA    . ILE A 1 472 ? 24.075  4.611   67.680  1.00 24.89  ?  469  ILE A CA    1 
ATOM   3872  C C     . ILE A 1 472 ? 25.373  3.892   68.020  1.00 34.03  ?  469  ILE A C     1 
ATOM   3873  O O     . ILE A 1 472 ? 25.367  2.875   68.722  1.00 36.56  ?  469  ILE A O     1 
ATOM   3874  C CB    . ILE A 1 472 ? 23.365  5.111   68.943  1.00 29.94  ?  469  ILE A CB    1 
ATOM   3875  C CG1   . ILE A 1 472 ? 22.072  5.826   68.557  1.00 24.96  ?  469  ILE A CG1   1 
ATOM   3876  C CG2   . ILE A 1 472 ? 24.273  6.040   69.731  1.00 30.74  ?  469  ILE A CG2   1 
ATOM   3877  C CD1   . ILE A 1 472 ? 21.278  6.305   69.734  1.00 28.53  ?  469  ILE A CD1   1 
ATOM   3878  N N     . LEU A 1 473 ? 26.489  4.417   67.514  1.00 29.10  ?  470  LEU A N     1 
ATOM   3879  C CA    . LEU A 1 473 ? 27.786  3.794   67.740  1.00 26.21  ?  470  LEU A CA    1 
ATOM   3880  C C     . LEU A 1 473 ? 28.387  4.188   69.078  1.00 34.75  ?  470  LEU A C     1 
ATOM   3881  O O     . LEU A 1 473 ? 29.067  3.372   69.711  1.00 46.52  ?  470  LEU A O     1 
ATOM   3882  C CB    . LEU A 1 473 ? 28.748  4.170   66.613  1.00 28.93  ?  470  LEU A CB    1 
ATOM   3883  C CG    . LEU A 1 473 ? 28.386  3.577   65.257  1.00 33.68  ?  470  LEU A CG    1 
ATOM   3884  C CD1   . LEU A 1 473 ? 29.305  4.096   64.173  1.00 27.45  ?  470  LEU A CD1   1 
ATOM   3885  C CD2   . LEU A 1 473 ? 28.475  2.078   65.358  1.00 40.14  ?  470  LEU A CD2   1 
ATOM   3886  N N     . TYR A 1 474 ? 28.146  5.417   69.524  1.00 29.85  ?  471  TYR A N     1 
ATOM   3887  C CA    . TYR A 1 474 ? 28.799  5.929   70.718  1.00 40.33  ?  471  TYR A CA    1 
ATOM   3888  C C     . TYR A 1 474 ? 28.142  7.239   71.121  1.00 28.42  ?  471  TYR A C     1 
ATOM   3889  O O     . TYR A 1 474 ? 27.708  8.018   70.267  1.00 28.17  ?  471  TYR A O     1 
ATOM   3890  C CB    . TYR A 1 474 ? 30.302  6.140   70.483  1.00 38.04  ?  471  TYR A CB    1 
ATOM   3891  C CG    . TYR A 1 474 ? 31.022  6.807   71.633  1.00 42.01  ?  471  TYR A CG    1 
ATOM   3892  C CD1   . TYR A 1 474 ? 31.464  6.069   72.724  1.00 40.53  ?  471  TYR A CD1   1 
ATOM   3893  C CD2   . TYR A 1 474 ? 31.256  8.175   71.627  1.00 42.80  ?  471  TYR A CD2   1 
ATOM   3894  C CE1   . TYR A 1 474 ? 32.117  6.678   73.778  1.00 36.42  ?  471  TYR A CE1   1 
ATOM   3895  C CE2   . TYR A 1 474 ? 31.908  8.792   72.675  1.00 42.02  ?  471  TYR A CE2   1 
ATOM   3896  C CZ    . TYR A 1 474 ? 32.336  8.039   73.747  1.00 49.88  ?  471  TYR A CZ    1 
ATOM   3897  O OH    . TYR A 1 474 ? 32.984  8.651   74.793  1.00 44.18  ?  471  TYR A OH    1 
ATOM   3898  N N     . ILE A 1 475 ? 28.079  7.466   72.430  1.00 29.00  ?  472  ILE A N     1 
ATOM   3899  C CA    . ILE A 1 475 ? 27.658  8.736   73.008  1.00 29.62  ?  472  ILE A CA    1 
ATOM   3900  C C     . ILE A 1 475 ? 28.642  9.093   74.112  1.00 33.28  ?  472  ILE A C     1 
ATOM   3901  O O     . ILE A 1 475 ? 28.931  8.264   74.982  1.00 35.71  ?  472  ILE A O     1 
ATOM   3902  C CB    . ILE A 1 475 ? 26.224  8.674   73.568  1.00 29.25  ?  472  ILE A CB    1 
ATOM   3903  C CG1   . ILE A 1 475 ? 25.228  8.295   72.473  1.00 28.33  ?  472  ILE A CG1   1 
ATOM   3904  C CG2   . ILE A 1 475 ? 25.836  10.008  74.195  1.00 31.50  ?  472  ILE A CG2   1 
ATOM   3905  C CD1   . ILE A 1 475 ? 23.804  8.155   72.971  1.00 28.04  ?  472  ILE A CD1   1 
ATOM   3906  N N     . GLY A 1 476 ? 29.155  10.310  74.075  1.00 32.14  ?  473  GLY A N     1 
ATOM   3907  C CA    . GLY A 1 476 ? 30.033  10.801  75.126  1.00 35.56  ?  473  GLY A CA    1 
ATOM   3908  C C     . GLY A 1 476 ? 29.521  12.114  75.672  1.00 37.11  ?  473  GLY A C     1 
ATOM   3909  O O     . GLY A 1 476 ? 29.032  12.959  74.926  1.00 36.75  ?  473  GLY A O     1 
ATOM   3910  N N     . LYS A 1 477 ? 29.635  12.274  76.991  1.00 34.26  ?  474  LYS A N     1 
ATOM   3911  C CA    . LYS A 1 477 ? 29.127  13.454  77.676  1.00 33.98  ?  474  LYS A CA    1 
ATOM   3912  C C     . LYS A 1 477 ? 30.075  13.837  78.800  1.00 40.30  ?  474  LYS A C     1 
ATOM   3913  O O     . LYS A 1 477 ? 30.583  12.970  79.516  1.00 49.18  ?  474  LYS A O     1 
ATOM   3914  C CB    . LYS A 1 477 ? 27.717  13.213  78.238  1.00 33.63  ?  474  LYS A CB    1 
ATOM   3915  C CG    . LYS A 1 477 ? 27.114  14.419  78.944  1.00 34.28  ?  474  LYS A CG    1 
ATOM   3916  C CD    . LYS A 1 477 ? 25.721  14.125  79.481  1.00 36.30  ?  474  LYS A CD    1 
ATOM   3917  C CE    . LYS A 1 477 ? 25.084  15.375  80.073  1.00 41.69  ?  474  LYS A CE    1 
ATOM   3918  N NZ    . LYS A 1 477 ? 23.696  15.128  80.561  1.00 34.30  1  474  LYS A NZ    1 
ATOM   3919  N N     . HIS A 1 478 ? 30.310  15.141  78.946  1.00 42.09  ?  475  HIS A N     1 
ATOM   3920  C CA    . HIS A 1 478 ? 31.147  15.684  80.007  1.00 36.85  ?  475  HIS A CA    1 
ATOM   3921  C C     . HIS A 1 478 ? 30.471  16.914  80.584  1.00 38.47  ?  475  HIS A C     1 
ATOM   3922  O O     . HIS A 1 478 ? 30.021  17.785  79.835  1.00 48.48  ?  475  HIS A O     1 
ATOM   3923  C CB    . HIS A 1 478 ? 32.539  16.039  79.490  1.00 46.26  ?  475  HIS A CB    1 
ATOM   3924  C CG    . HIS A 1 478 ? 33.313  14.857  79.006  1.00 49.28  ?  475  HIS A CG    1 
ATOM   3925  N ND1   . HIS A 1 478 ? 34.084  14.083  79.845  1.00 56.00  ?  475  HIS A ND1   1 
ATOM   3926  C CD2   . HIS A 1 478 ? 33.423  14.304  77.775  1.00 47.76  ?  475  HIS A CD2   1 
ATOM   3927  C CE1   . HIS A 1 478 ? 34.642  13.108  79.150  1.00 51.07  ?  475  HIS A CE1   1 
ATOM   3928  N NE2   . HIS A 1 478 ? 34.257  13.220  77.892  1.00 45.00  ?  475  HIS A NE2   1 
ATOM   3929  N N     . LYS A 1 479 ? 30.410  16.988  81.907  1.00 57.17  ?  476  LYS A N     1 
ATOM   3930  C CA    . LYS A 1 479 ? 29.698  18.049  82.598  1.00 59.54  ?  476  LYS A CA    1 
ATOM   3931  C C     . LYS A 1 479 ? 30.675  18.953  83.341  1.00 60.89  ?  476  LYS A C     1 
ATOM   3932  O O     . LYS A 1 479 ? 31.631  18.481  83.966  1.00 66.12  ?  476  LYS A O     1 
ATOM   3933  C CB    . LYS A 1 479 ? 28.668  17.472  83.571  1.00 54.21  ?  476  LYS A CB    1 
ATOM   3934  C CG    . LYS A 1 479 ? 27.631  16.555  82.929  1.00 55.87  ?  476  LYS A CG    1 
ATOM   3935  C CD    . LYS A 1 479 ? 26.370  16.477  83.785  1.00 52.46  ?  476  LYS A CD    1 
ATOM   3936  C CE    . LYS A 1 479 ? 25.688  17.839  83.893  1.00 52.49  ?  476  LYS A CE    1 
ATOM   3937  N NZ    . LYS A 1 479 ? 24.750  17.894  85.054  1.00 60.01  1  476  LYS A NZ    1 
ATOM   3938  N N     . ASN A 1 480 ? 30.430  20.257  83.245  1.00 59.82  ?  477  ASN A N     1 
ATOM   3939  C CA    . ASN A 1 480 ? 31.145  21.287  84.000  1.00 68.77  ?  477  ASN A CA    1 
ATOM   3940  C C     . ASN A 1 480 ? 32.663  21.160  83.842  1.00 74.54  ?  477  ASN A C     1 
ATOM   3941  O O     . ASN A 1 480 ? 33.400  20.908  84.792  1.00 78.17  ?  477  ASN A O     1 
ATOM   3942  C CB    . ASN A 1 480 ? 30.746  21.247  85.478  1.00 56.08  ?  477  ASN A CB    1 
ATOM   3943  C CG    . ASN A 1 480 ? 29.249  21.343  85.687  1.00 54.61  ?  477  ASN A CG    1 
ATOM   3944  O OD1   . ASN A 1 480 ? 28.663  22.417  85.557  1.00 55.24  ?  477  ASN A OD1   1 
ATOM   3945  N ND2   . ASN A 1 480 ? 28.627  20.224  86.035  1.00 53.09  ?  477  ASN A ND2   1 
ATOM   3946  N N     . LEU A 1 481 ? 33.103  21.336  82.600  1.00 67.84  ?  478  LEU A N     1 
ATOM   3947  C CA    . LEU A 1 481 ? 34.514  21.486  82.294  1.00 59.43  ?  478  LEU A CA    1 
ATOM   3948  C C     . LEU A 1 481 ? 34.907  22.951  82.434  1.00 54.73  ?  478  LEU A C     1 
ATOM   3949  O O     . LEU A 1 481 ? 34.121  23.850  82.128  1.00 57.07  ?  478  LEU A O     1 
ATOM   3950  C CB    . LEU A 1 481 ? 34.816  20.990  80.878  1.00 57.42  ?  478  LEU A CB    1 
ATOM   3951  C CG    . LEU A 1 481 ? 34.467  19.526  80.599  1.00 52.55  ?  478  LEU A CG    1 
ATOM   3952  C CD1   . LEU A 1 481 ? 34.454  19.247  79.104  1.00 53.33  ?  478  LEU A CD1   1 
ATOM   3953  C CD2   . LEU A 1 481 ? 35.442  18.601  81.311  1.00 52.55  ?  478  LEU A CD2   1 
ATOM   3954  N N     . GLU A 1 482 ? 36.127  23.188  82.918  1.00 59.12  ?  479  GLU A N     1 
ATOM   3955  C CA    . GLU A 1 482 ? 36.616  24.555  83.070  1.00 55.17  ?  479  GLU A CA    1 
ATOM   3956  C C     . GLU A 1 482 ? 36.772  25.209  81.703  1.00 57.47  ?  479  GLU A C     1 
ATOM   3957  O O     . GLU A 1 482 ? 37.399  24.643  80.800  1.00 57.07  ?  479  GLU A O     1 
ATOM   3958  C CB    . GLU A 1 482 ? 37.948  24.572  83.820  1.00 59.84  ?  479  GLU A CB    1 
ATOM   3959  C CG    . GLU A 1 482 ? 37.873  24.114  85.274  1.00 67.97  ?  479  GLU A CG    1 
ATOM   3960  C CD    . GLU A 1 482 ? 37.179  25.120  86.180  1.00 73.00  ?  479  GLU A CD    1 
ATOM   3961  O OE1   . GLU A 1 482 ? 37.875  25.862  86.909  1.00 70.97  ?  479  GLU A OE1   1 
ATOM   3962  O OE2   . GLU A 1 482 ? 35.931  25.172  86.158  1.00 78.15  -1 479  GLU A OE2   1 
ATOM   3963  N N     . LEU A 1 483 ? 36.198  26.402  81.549  1.00 53.39  ?  480  LEU A N     1 
ATOM   3964  C CA    . LEU A 1 483 ? 36.232  27.098  80.269  1.00 52.77  ?  480  LEU A CA    1 
ATOM   3965  C C     . LEU A 1 483 ? 37.660  27.458  79.881  1.00 52.79  ?  480  LEU A C     1 
ATOM   3966  O O     . LEU A 1 483 ? 38.235  28.423  80.393  1.00 52.83  ?  480  LEU A O     1 
ATOM   3967  C CB    . LEU A 1 483 ? 35.352  28.351  80.313  1.00 56.19  ?  480  LEU A CB    1 
ATOM   3968  C CG    . LEU A 1 483 ? 35.243  29.178  79.029  1.00 58.40  ?  480  LEU A CG    1 
ATOM   3969  C CD1   . LEU A 1 483 ? 35.124  28.288  77.800  1.00 53.58  ?  480  LEU A CD1   1 
ATOM   3970  C CD2   . LEU A 1 483 ? 34.051  30.119  79.115  1.00 63.24  ?  480  LEU A CD2   1 
ATOM   3971  N N     . ASN A 1 484 ? 38.233  26.674  78.974  1.00 52.75  ?  481  ASN A N     1 
ATOM   3972  C CA    . ASN A 1 484 ? 39.585  26.908  78.481  1.00 55.53  ?  481  ASN A CA    1 
ATOM   3973  C C     . ASN A 1 484 ? 39.686  26.244  77.119  1.00 62.15  ?  481  ASN A C     1 
ATOM   3974  O O     . ASN A 1 484 ? 39.544  25.020  77.021  1.00 62.41  ?  481  ASN A O     1 
ATOM   3975  C CB    . ASN A 1 484 ? 40.632  26.353  79.451  1.00 56.26  ?  481  ASN A CB    1 
ATOM   3976  C CG    . ASN A 1 484 ? 42.051  26.502  78.928  1.00 60.21  ?  481  ASN A CG    1 
ATOM   3977  O OD1   . ASN A 1 484 ? 42.526  25.672  78.152  1.00 56.79  ?  481  ASN A OD1   1 
ATOM   3978  N ND2   . ASN A 1 484 ? 42.739  27.553  79.363  1.00 52.84  ?  481  ASN A ND2   1 
ATOM   3979  N N     . GLU A 1 485 ? 39.901  27.053  76.079  1.00 63.21  ?  482  GLU A N     1 
ATOM   3980  C CA    . GLU A 1 485 ? 39.973  26.561  74.710  1.00 58.10  ?  482  GLU A CA    1 
ATOM   3981  C C     . GLU A 1 485 ? 40.855  25.325  74.605  1.00 52.44  ?  482  GLU A C     1 
ATOM   3982  O O     . GLU A 1 485 ? 40.448  24.295  74.055  1.00 50.72  ?  482  GLU A O     1 
ATOM   3983  C CB    . GLU A 1 485 ? 40.502  27.670  73.793  1.00 63.05  ?  482  GLU A CB    1 
ATOM   3984  C CG    . GLU A 1 485 ? 40.616  27.271  72.331  1.00 66.69  ?  482  GLU A CG    1 
ATOM   3985  C CD    . GLU A 1 485 ? 39.314  27.450  71.585  1.00 70.13  ?  482  GLU A CD    1 
ATOM   3986  O OE1   . GLU A 1 485 ? 38.954  28.610  71.293  1.00 72.77  ?  482  GLU A OE1   1 
ATOM   3987  O OE2   . GLU A 1 485 ? 38.643  26.435  71.309  1.00 72.12  -1 482  GLU A OE2   1 
ATOM   3988  N N     . LYS A 1 486 ? 42.064  25.403  75.158  1.00 51.56  ?  483  LYS A N     1 
ATOM   3989  C CA    . LYS A 1 486 ? 43.013  24.306  74.995  1.00 54.90  ?  483  LYS A CA    1 
ATOM   3990  C C     . LYS A 1 486 ? 42.546  23.049  75.714  1.00 53.70  ?  483  LYS A C     1 
ATOM   3991  O O     . LYS A 1 486 ? 42.689  21.939  75.190  1.00 52.03  ?  483  LYS A O     1 
ATOM   3992  C CB    . LYS A 1 486 ? 44.397  24.729  75.490  1.00 55.18  ?  483  LYS A CB    1 
ATOM   3993  C CG    . LYS A 1 486 ? 45.420  23.593  75.576  1.00 52.83  ?  483  LYS A CG    1 
ATOM   3994  C CD    . LYS A 1 486 ? 45.654  22.896  74.242  1.00 51.42  ?  483  LYS A CD    1 
ATOM   3995  C CE    . LYS A 1 486 ? 46.848  21.954  74.300  1.00 51.90  ?  483  LYS A CE    1 
ATOM   3996  N NZ    . LYS A 1 486 ? 46.962  21.319  75.640  1.00 56.63  1  483  LYS A NZ    1 
ATOM   3997  N N     . MET A 1 487 ? 42.012  23.189  76.930  1.00 53.70  ?  484  MET A N     1 
ATOM   3998  C CA    . MET A 1 487 ? 41.551  21.996  77.631  1.00 59.79  ?  484  MET A CA    1 
ATOM   3999  C C     . MET A 1 487 ? 40.321  21.417  76.949  1.00 71.57  ?  484  MET A C     1 
ATOM   4000  O O     . MET A 1 487 ? 40.222  20.201  76.763  1.00 77.40  ?  484  MET A O     1 
ATOM   4001  C CB    . MET A 1 487 ? 41.277  22.288  79.106  1.00 56.88  ?  484  MET A CB    1 
ATOM   4002  C CG    . MET A 1 487 ? 42.520  22.664  79.863  1.00 67.08  ?  484  MET A CG    1 
ATOM   4003  S SD    . MET A 1 487 ? 42.217  22.704  81.626  1.00 78.97  ?  484  MET A SD    1 
ATOM   4004  C CE    . MET A 1 487 ? 40.692  23.632  81.652  1.00 69.27  ?  484  MET A CE    1 
ATOM   4005  N N     . ASN A 1 488 ? 39.415  22.283  76.485  1.00 72.21  ?  485  ASN A N     1 
ATOM   4006  C CA    . ASN A 1 488 ? 38.169  21.806  75.888  1.00 66.13  ?  485  ASN A CA    1 
ATOM   4007  C C     . ASN A 1 488 ? 38.411  21.045  74.586  1.00 72.02  ?  485  ASN A C     1 
ATOM   4008  O O     . ASN A 1 488 ? 37.723  20.066  74.292  1.00 72.02  ?  485  ASN A O     1 
ATOM   4009  C CB    . ASN A 1 488 ? 37.220  22.980  75.656  1.00 50.40  ?  485  ASN A CB    1 
ATOM   4010  C CG    . ASN A 1 488 ? 36.779  23.637  76.951  1.00 52.26  ?  485  ASN A CG    1 
ATOM   4011  O OD1   . ASN A 1 488 ? 36.851  23.038  78.025  1.00 50.65  ?  485  ASN A OD1   1 
ATOM   4012  N ND2   . ASN A 1 488 ? 36.311  24.876  76.853  1.00 47.48  ?  485  ASN A ND2   1 
ATOM   4013  N N     . LEU A 1 489 ? 39.373  21.482  73.788  1.00 66.51  ?  486  LEU A N     1 
ATOM   4014  C CA    . LEU A 1 489 ? 39.668  20.808  72.527  1.00 63.02  ?  486  LEU A CA    1 
ATOM   4015  C C     . LEU A 1 489 ? 40.429  19.508  72.724  1.00 60.33  ?  486  LEU A C     1 
ATOM   4016  O O     . LEU A 1 489 ? 40.350  18.615  71.871  1.00 45.24  ?  486  LEU A O     1 
ATOM   4017  C CB    . LEU A 1 489 ? 40.460  21.754  71.628  1.00 61.77  ?  486  LEU A CB    1 
ATOM   4018  C CG    . LEU A 1 489 ? 39.808  22.691  70.591  1.00 62.90  ?  486  LEU A CG    1 
ATOM   4019  C CD1   . LEU A 1 489 ? 40.768  23.774  70.314  1.00 53.46  ?  486  LEU A CD1   1 
ATOM   4020  C CD2   . LEU A 1 489 ? 39.547  21.923  69.345  1.00 68.25  ?  486  LEU A CD2   1 
ATOM   4021  N N     . ASP A 1 490 ? 41.142  19.372  73.839  1.00 57.29  ?  487  ASP A N     1 
ATOM   4022  C CA    . ASP A 1 490 ? 41.734  18.078  74.164  1.00 57.68  ?  487  ASP A CA    1 
ATOM   4023  C C     . ASP A 1 490 ? 40.649  17.030  74.380  1.00 62.13  ?  487  ASP A C     1 
ATOM   4024  O O     . ASP A 1 490 ? 40.659  15.959  73.755  1.00 60.69  ?  487  ASP A O     1 
ATOM   4025  C CB    . ASP A 1 490 ? 42.623  18.180  75.407  1.00 51.78  ?  487  ASP A CB    1 
ATOM   4026  C CG    . ASP A 1 490 ? 43.919  18.930  75.149  1.00 55.17  ?  487  ASP A CG    1 
ATOM   4027  O OD1   . ASP A 1 490 ? 44.355  19.013  73.975  1.00 52.41  ?  487  ASP A OD1   1 
ATOM   4028  O OD2   . ASP A 1 490 ? 44.515  19.425  76.125  1.00 59.88  -1 487  ASP A OD2   1 
ATOM   4029  N N     . ILE A 1 491 ? 39.668  17.354  75.223  1.00 54.74  ?  488  ILE A N     1 
ATOM   4030  C CA    . ILE A 1 491 ? 38.584  16.423  75.510  1.00 63.19  ?  488  ILE A CA    1 
ATOM   4031  C C     . ILE A 1 491 ? 37.782  16.130  74.249  1.00 62.16  ?  488  ILE A C     1 
ATOM   4032  O O     . ILE A 1 491 ? 37.374  14.987  74.010  1.00 60.53  ?  488  ILE A O     1 
ATOM   4033  C CB    . ILE A 1 491 ? 37.691  16.971  76.639  1.00 59.21  ?  488  ILE A CB    1 
ATOM   4034  C CG1   . ILE A 1 491 ? 38.485  17.095  77.940  1.00 58.96  ?  488  ILE A CG1   1 
ATOM   4035  C CG2   . ILE A 1 491 ? 36.483  16.068  76.856  1.00 61.06  ?  488  ILE A CG2   1 
ATOM   4036  C CD1   . ILE A 1 491 ? 38.880  15.762  78.541  1.00 51.75  ?  488  ILE A CD1   1 
ATOM   4037  N N     . LEU A 1 492 ? 37.540  17.156  73.427  1.00 62.93  ?  489  LEU A N     1 
ATOM   4038  C CA    . LEU A 1 492 ? 36.862  16.953  72.148  1.00 55.75  ?  489  LEU A CA    1 
ATOM   4039  C C     . LEU A 1 492 ? 37.573  15.888  71.326  1.00 53.31  ?  489  LEU A C     1 
ATOM   4040  O O     . LEU A 1 492 ? 36.947  14.946  70.825  1.00 52.76  ?  489  LEU A O     1 
ATOM   4041  C CB    . LEU A 1 492 ? 36.798  18.273  71.373  1.00 51.81  ?  489  LEU A CB    1 
ATOM   4042  C CG    . LEU A 1 492 ? 35.823  18.498  70.205  1.00 53.03  ?  489  LEU A CG    1 
ATOM   4043  C CD1   . LEU A 1 492 ? 35.946  19.933  69.713  1.00 56.97  ?  489  LEU A CD1   1 
ATOM   4044  C CD2   . LEU A 1 492 ? 36.013  17.533  69.035  1.00 50.21  ?  489  LEU A CD2   1 
ATOM   4045  N N     . GLU A 1 493 ? 38.890  16.031  71.173  1.00 50.99  ?  490  GLU A N     1 
ATOM   4046  C CA    . GLU A 1 493 ? 39.665  15.040  70.437  1.00 52.94  ?  490  GLU A CA    1 
ATOM   4047  C C     . GLU A 1 493 ? 39.515  13.655  71.053  1.00 46.11  ?  490  GLU A C     1 
ATOM   4048  O O     . GLU A 1 493 ? 39.356  12.663  70.335  1.00 46.03  ?  490  GLU A O     1 
ATOM   4049  C CB    . GLU A 1 493 ? 41.134  15.458  70.399  1.00 44.86  ?  490  GLU A CB    1 
ATOM   4050  C CG    . GLU A 1 493 ? 42.083  14.379  69.913  1.00 44.98  ?  490  GLU A CG    1 
ATOM   4051  C CD    . GLU A 1 493 ? 43.512  14.876  69.808  1.00 49.71  ?  490  GLU A CD    1 
ATOM   4052  O OE1   . GLU A 1 493 ? 44.403  14.071  69.462  1.00 46.38  ?  490  GLU A OE1   1 
ATOM   4053  O OE2   . GLU A 1 493 ? 43.743  16.076  70.069  1.00 49.28  -1 490  GLU A OE2   1 
ATOM   4054  N N     . LYS A 1 494 ? 39.545  13.574  72.386  1.00 44.25  ?  491  LYS A N     1 
ATOM   4055  C CA    . LYS A 1 494 ? 39.484  12.280  73.060  1.00 48.96  ?  491  LYS A CA    1 
ATOM   4056  C C     . LYS A 1 494 ? 38.160  11.579  72.777  1.00 43.55  ?  491  LYS A C     1 
ATOM   4057  O O     . LYS A 1 494 ? 38.135  10.407  72.387  1.00 43.34  ?  491  LYS A O     1 
ATOM   4058  C CB    . LYS A 1 494 ? 39.695  12.466  74.566  1.00 53.46  ?  491  LYS A CB    1 
ATOM   4059  C CG    . LYS A 1 494 ? 41.162  12.471  75.029  1.00 62.27  ?  491  LYS A CG    1 
ATOM   4060  C CD    . LYS A 1 494 ? 42.082  13.215  74.067  1.00 64.87  ?  491  LYS A CD    1 
ATOM   4061  C CE    . LYS A 1 494 ? 43.055  14.129  74.793  1.00 60.67  ?  491  LYS A CE    1 
ATOM   4062  N NZ    . LYS A 1 494 ? 43.581  15.176  73.873  1.00 52.12  1  491  LYS A NZ    1 
ATOM   4063  N N     . GLU A 1 495 ? 37.046  12.293  72.954  1.00 43.29  ?  492  GLU A N     1 
ATOM   4064  C CA    . GLU A 1 495 ? 35.741  11.712  72.654  1.00 50.94  ?  492  GLU A CA    1 
ATOM   4065  C C     . GLU A 1 495 ? 35.619  11.357  71.178  1.00 54.75  ?  492  GLU A C     1 
ATOM   4066  O O     . GLU A 1 495 ? 35.048  10.316  70.828  1.00 46.68  ?  492  GLU A O     1 
ATOM   4067  C CB    . GLU A 1 495 ? 34.631  12.676  73.069  1.00 42.55  ?  492  GLU A CB    1 
ATOM   4068  C CG    . GLU A 1 495 ? 34.555  12.915  74.567  1.00 51.15  ?  492  GLU A CG    1 
ATOM   4069  C CD    . GLU A 1 495 ? 34.248  11.648  75.348  1.00 58.20  ?  492  GLU A CD    1 
ATOM   4070  O OE1   . GLU A 1 495 ? 33.675  10.705  74.763  1.00 61.46  ?  492  GLU A OE1   1 
ATOM   4071  O OE2   . GLU A 1 495 ? 34.579  11.597  76.553  1.00 43.58  -1 492  GLU A OE2   1 
ATOM   4072  N N     . TYR A 1 496 ? 36.155  12.208  70.298  1.00 53.06  ?  493  TYR A N     1 
ATOM   4073  C CA    . TYR A 1 496 ? 36.118  11.915  68.869  1.00 55.02  ?  493  TYR A CA    1 
ATOM   4074  C C     . TYR A 1 496 ? 36.862  10.625  68.553  1.00 54.49  ?  493  TYR A C     1 
ATOM   4075  O O     . TYR A 1 496 ? 36.380  9.796   67.771  1.00 49.75  ?  493  TYR A O     1 
ATOM   4076  C CB    . TYR A 1 496 ? 36.707  13.080  68.074  1.00 57.63  ?  493  TYR A CB    1 
ATOM   4077  C CG    . TYR A 1 496 ? 36.939  12.748  66.619  1.00 58.04  ?  493  TYR A CG    1 
ATOM   4078  C CD1   . TYR A 1 496 ? 35.878  12.413  65.788  1.00 52.71  ?  493  TYR A CD1   1 
ATOM   4079  C CD2   . TYR A 1 496 ? 38.215  12.764  66.076  1.00 54.20  ?  493  TYR A CD2   1 
ATOM   4080  C CE1   . TYR A 1 496 ? 36.083  12.104  64.458  1.00 42.07  ?  493  TYR A CE1   1 
ATOM   4081  C CE2   . TYR A 1 496 ? 38.428  12.456  64.746  1.00 48.48  ?  493  TYR A CE2   1 
ATOM   4082  C CZ    . TYR A 1 496 ? 37.357  12.128  63.943  1.00 43.03  ?  493  TYR A CZ    1 
ATOM   4083  O OH    . TYR A 1 496 ? 37.559  11.821  62.617  1.00 49.41  ?  493  TYR A OH    1 
ATOM   4084  N N     . ILE A 1 497 ? 38.042  10.437  69.152  1.00 53.82  ?  494  ILE A N     1 
ATOM   4085  C CA    . ILE A 1 497 ? 38.797  9.204   68.940  1.00 48.38  ?  494  ILE A CA    1 
ATOM   4086  C C     . ILE A 1 497 ? 38.007  8.004   69.444  1.00 45.86  ?  494  ILE A C     1 
ATOM   4087  O O     . ILE A 1 497 ? 38.047  6.920   68.848  1.00 50.14  ?  494  ILE A O     1 
ATOM   4088  C CB    . ILE A 1 497 ? 40.178  9.301   69.614  1.00 45.21  ?  494  ILE A CB    1 
ATOM   4089  C CG1   . ILE A 1 497 ? 41.013  10.401  68.959  1.00 53.53  ?  494  ILE A CG1   1 
ATOM   4090  C CG2   . ILE A 1 497 ? 40.917  7.967   69.543  1.00 43.93  ?  494  ILE A CG2   1 
ATOM   4091  C CD1   . ILE A 1 497 ? 42.427  10.491  69.492  1.00 50.13  ?  494  ILE A CD1   1 
ATOM   4092  N N     . LYS A 1 498 ? 37.269  8.180   70.542  1.00 46.42  ?  495  LYS A N     1 
ATOM   4093  C CA    . LYS A 1 498 ? 36.458  7.091   71.076  1.00 55.98  ?  495  LYS A CA    1 
ATOM   4094  C C     . LYS A 1 498 ? 35.376  6.675   70.084  1.00 49.49  ?  495  LYS A C     1 
ATOM   4095  O O     . LYS A 1 498 ? 35.200  5.484   69.802  1.00 45.60  ?  495  LYS A O     1 
ATOM   4096  C CB    . LYS A 1 498 ? 35.846  7.501   72.418  1.00 50.97  ?  495  LYS A CB    1 
ATOM   4097  C CG    . LYS A 1 498 ? 36.885  7.812   73.486  1.00 51.90  ?  495  LYS A CG    1 
ATOM   4098  C CD    . LYS A 1 498 ? 36.566  7.131   74.801  1.00 49.78  ?  495  LYS A CD    1 
ATOM   4099  C CE    . LYS A 1 498 ? 35.898  8.079   75.778  1.00 52.54  ?  495  LYS A CE    1 
ATOM   4100  N NZ    . LYS A 1 498 ? 35.438  7.360   77.000  1.00 56.43  1  495  LYS A NZ    1 
ATOM   4101  N N     . ALA A 1 499 ? 34.648  7.649   69.535  1.00 41.52  ?  496  ALA A N     1 
ATOM   4102  C CA    . ALA A 1 499 ? 33.635  7.341   68.530  1.00 44.72  ?  496  ALA A CA    1 
ATOM   4103  C C     . ALA A 1 499 ? 34.258  6.688   67.304  1.00 56.03  ?  496  ALA A C     1 
ATOM   4104  O O     . ALA A 1 499 ? 33.705  5.729   66.750  1.00 47.03  ?  496  ALA A O     1 
ATOM   4105  C CB    . ALA A 1 499 ? 32.884  8.611   68.136  1.00 42.42  ?  496  ALA A CB    1 
ATOM   4106  N N     . PHE A 1 500 ? 35.409  7.203   66.864  1.00 41.46  ?  497  PHE A N     1 
ATOM   4107  C CA    . PHE A 1 500 ? 36.143  6.601   65.756  1.00 44.83  ?  497  PHE A CA    1 
ATOM   4108  C C     . PHE A 1 500 ? 36.415  5.125   66.019  1.00 42.39  ?  497  PHE A C     1 
ATOM   4109  O O     . PHE A 1 500 ? 36.173  4.269   65.160  1.00 42.28  ?  497  PHE A O     1 
ATOM   4110  C CB    . PHE A 1 500 ? 37.455  7.360   65.544  1.00 53.39  ?  497  PHE A CB    1 
ATOM   4111  C CG    . PHE A 1 500 ? 37.940  7.368   64.123  1.00 57.09  ?  497  PHE A CG    1 
ATOM   4112  C CD1   . PHE A 1 500 ? 38.553  6.254   63.577  1.00 57.16  ?  497  PHE A CD1   1 
ATOM   4113  C CD2   . PHE A 1 500 ? 37.804  8.504   63.341  1.00 55.37  ?  497  PHE A CD2   1 
ATOM   4114  C CE1   . PHE A 1 500 ? 39.008  6.265   62.272  1.00 53.30  ?  497  PHE A CE1   1 
ATOM   4115  C CE2   . PHE A 1 500 ? 38.256  8.521   62.035  1.00 55.41  ?  497  PHE A CE2   1 
ATOM   4116  C CZ    . PHE A 1 500 ? 38.859  7.400   61.501  1.00 52.14  ?  497  PHE A CZ    1 
ATOM   4117  N N     . GLU A 1 501 ? 36.910  4.809   67.219  1.00 41.72  ?  498  GLU A N     1 
ATOM   4118  C CA    . GLU A 1 501 ? 37.243  3.427   67.542  1.00 41.71  ?  498  GLU A CA    1 
ATOM   4119  C C     . GLU A 1 501 ? 36.000  2.545   67.541  1.00 51.87  ?  498  GLU A C     1 
ATOM   4120  O O     . GLU A 1 501 ? 36.058  1.382   67.125  1.00 48.09  ?  498  GLU A O     1 
ATOM   4121  C CB    . GLU A 1 501 ? 37.951  3.363   68.895  1.00 54.39  ?  498  GLU A CB    1 
ATOM   4122  C CG    . GLU A 1 501 ? 39.056  2.322   68.961  1.00 63.15  ?  498  GLU A CG    1 
ATOM   4123  C CD    . GLU A 1 501 ? 40.151  2.583   67.946  1.00 63.74  ?  498  GLU A CD    1 
ATOM   4124  O OE1   . GLU A 1 501 ? 40.581  3.749   67.821  1.00 64.70  ?  498  GLU A OE1   1 
ATOM   4125  O OE2   . GLU A 1 501 ? 40.569  1.626   67.263  1.00 64.35  -1 498  GLU A OE2   1 
ATOM   4126  N N     . LYS A 1 502 ? 34.865  3.086   68.000  1.00 43.83  ?  499  LYS A N     1 
ATOM   4127  C CA    . LYS A 1 502 ? 33.612  2.335   67.986  1.00 46.59  ?  499  LYS A CA    1 
ATOM   4128  C C     . LYS A 1 502 ? 33.238  1.901   66.575  1.00 47.64  ?  499  LYS A C     1 
ATOM   4129  O O     . LYS A 1 502 ? 32.817  0.757   66.361  1.00 49.56  ?  499  LYS A O     1 
ATOM   4130  C CB    . LYS A 1 502 ? 32.494  3.178   68.598  1.00 53.36  ?  499  LYS A CB    1 
ATOM   4131  C CG    . LYS A 1 502 ? 32.708  3.525   70.061  1.00 50.97  ?  499  LYS A CG    1 
ATOM   4132  C CD    . LYS A 1 502 ? 32.600  2.291   70.930  1.00 53.47  ?  499  LYS A CD    1 
ATOM   4133  C CE    . LYS A 1 502 ? 32.947  2.587   72.377  1.00 48.42  ?  499  LYS A CE    1 
ATOM   4134  N NZ    . LYS A 1 502 ? 32.939  1.342   73.187  1.00 51.06  1  499  LYS A NZ    1 
ATOM   4135  N N     . TYR A 1 503 ? 33.368  2.806   65.602  1.00 40.20  ?  500  TYR A N     1 
ATOM   4136  C CA    . TYR A 1 503 ? 33.113  2.447   64.210  1.00 39.96  ?  500  TYR A CA    1 
ATOM   4137  C C     . TYR A 1 503 ? 34.015  1.298   63.777  1.00 40.11  ?  500  TYR A C     1 
ATOM   4138  O O     . TYR A 1 503 ? 33.540  0.269   63.285  1.00 39.82  ?  500  TYR A O     1 
ATOM   4139  C CB    . TYR A 1 503 ? 33.317  3.667   63.305  1.00 40.07  ?  500  TYR A CB    1 
ATOM   4140  C CG    . TYR A 1 503 ? 32.990  3.424   61.844  1.00 39.82  ?  500  TYR A CG    1 
ATOM   4141  C CD1   . TYR A 1 503 ? 33.882  2.759   61.008  1.00 43.96  ?  500  TYR A CD1   1 
ATOM   4142  C CD2   . TYR A 1 503 ? 31.793  3.871   61.296  1.00 39.42  ?  500  TYR A CD2   1 
ATOM   4143  C CE1   . TYR A 1 503 ? 33.587  2.536   59.677  1.00 39.77  ?  500  TYR A CE1   1 
ATOM   4144  C CE2   . TYR A 1 503 ? 31.492  3.655   59.960  1.00 39.52  ?  500  TYR A CE2   1 
ATOM   4145  C CZ    . TYR A 1 503 ? 32.395  2.987   59.157  1.00 46.76  ?  500  TYR A CZ    1 
ATOM   4146  O OH    . TYR A 1 503 ? 32.106  2.766   57.830  1.00 47.10  ?  500  TYR A OH    1 
ATOM   4147  N N     . ILE A 1 504 ? 35.329  1.470   63.943  1.00 40.57  ?  501  ILE A N     1 
ATOM   4148  C CA    . ILE A 1 504 ? 36.272  0.389   63.666  1.00 50.13  ?  501  ILE A CA    1 
ATOM   4149  C C     . ILE A 1 504 ? 35.870  -0.862  64.435  1.00 55.02  ?  501  ILE A C     1 
ATOM   4150  O O     . ILE A 1 504 ? 35.852  -1.972  63.892  1.00 55.00  ?  501  ILE A O     1 
ATOM   4151  C CB    . ILE A 1 504 ? 37.704  0.825   64.022  1.00 49.54  ?  501  ILE A CB    1 
ATOM   4152  C CG1   . ILE A 1 504 ? 38.056  2.145   63.335  1.00 50.77  ?  501  ILE A CG1   1 
ATOM   4153  C CG2   . ILE A 1 504 ? 38.701  -0.269  63.659  1.00 42.27  ?  501  ILE A CG2   1 
ATOM   4154  C CD1   . ILE A 1 504 ? 39.248  2.841   63.949  1.00 48.48  ?  501  ILE A CD1   1 
ATOM   4155  N N     . GLU A 1 505 ? 35.532  -0.688  65.715  1.00 44.73  ?  502  GLU A N     1 
ATOM   4156  C CA    . GLU A 1 505 ? 35.090  -1.806  66.539  1.00 42.95  ?  502  GLU A CA    1 
ATOM   4157  C C     . GLU A 1 505 ? 33.885  -2.507  65.923  1.00 51.03  ?  502  GLU A C     1 
ATOM   4158  O O     . GLU A 1 505 ? 33.767  -3.735  66.000  1.00 54.26  ?  502  GLU A O     1 
ATOM   4159  C CB    . GLU A 1 505 ? 34.775  -1.301  67.946  1.00 49.63  ?  502  GLU A CB    1 
ATOM   4160  C CG    . GLU A 1 505 ? 34.243  -2.334  68.896  1.00 42.58  ?  502  GLU A CG    1 
ATOM   4161  C CD    . GLU A 1 505 ? 34.237  -1.825  70.317  1.00 48.47  ?  502  GLU A CD    1 
ATOM   4162  O OE1   . GLU A 1 505 ? 35.313  -1.831  70.950  1.00 60.03  ?  502  GLU A OE1   1 
ATOM   4163  O OE2   . GLU A 1 505 ? 33.166  -1.399  70.797  1.00 62.96  -1 502  GLU A OE2   1 
ATOM   4164  N N     . LYS A 1 506 ? 32.994  -1.753  65.289  1.00 43.02  ?  503  LYS A N     1 
ATOM   4165  C CA    . LYS A 1 506 ? 31.836  -2.373  64.659  1.00 45.22  ?  503  LYS A CA    1 
ATOM   4166  C C     . LYS A 1 506 ? 32.111  -2.849  63.240  1.00 51.95  ?  503  LYS A C     1 
ATOM   4167  O O     . LYS A 1 506 ? 31.530  -3.851  62.809  1.00 45.31  ?  503  LYS A O     1 
ATOM   4168  C CB    . LYS A 1 506 ? 30.654  -1.398  64.639  1.00 42.41  ?  503  LYS A CB    1 
ATOM   4169  C CG    . LYS A 1 506 ? 29.398  -1.990  63.997  1.00 38.35  ?  503  LYS A CG    1 
ATOM   4170  C CD    . LYS A 1 506 ? 28.179  -1.106  64.118  1.00 39.44  ?  503  LYS A CD    1 
ATOM   4171  C CE    . LYS A 1 506 ? 26.921  -1.847  63.720  1.00 37.55  ?  503  LYS A CE    1 
ATOM   4172  N NZ    . LYS A 1 506 ? 25.714  -0.997  63.834  1.00 37.24  1  503  LYS A NZ    1 
ATOM   4173  N N     . PHE A 1 507 ? 32.941  -2.135  62.480  1.00 44.30  ?  504  PHE A N     1 
ATOM   4174  C CA    . PHE A 1 507 ? 33.091  -2.432  61.060  1.00 49.81  ?  504  PHE A CA    1 
ATOM   4175  C C     . PHE A 1 507 ? 34.472  -2.944  60.678  1.00 49.17  ?  504  PHE A C     1 
ATOM   4176  O O     . PHE A 1 507 ? 34.686  -3.267  59.504  1.00 56.07  ?  504  PHE A O     1 
ATOM   4177  C CB    . PHE A 1 507 ? 32.734  -1.198  60.215  1.00 39.20  ?  504  PHE A CB    1 
ATOM   4178  C CG    . PHE A 1 507 ? 31.293  -0.801  60.321  1.00 40.04  ?  504  PHE A CG    1 
ATOM   4179  C CD1   . PHE A 1 507 ? 30.301  -1.647  59.855  1.00 38.34  ?  504  PHE A CD1   1 
ATOM   4180  C CD2   . PHE A 1 507 ? 30.926  0.394   60.913  1.00 38.79  ?  504  PHE A CD2   1 
ATOM   4181  C CE1   . PHE A 1 507 ? 28.977  -1.306  59.968  1.00 37.95  ?  504  PHE A CE1   1 
ATOM   4182  C CE2   . PHE A 1 507 ? 29.603  0.741   61.028  1.00 42.32  ?  504  PHE A CE2   1 
ATOM   4183  C CZ    . PHE A 1 507 ? 28.624  -0.111  60.554  1.00 42.10  ?  504  PHE A CZ    1 
ATOM   4184  N N     . ASN A 1 508 ? 35.409  -3.029  61.623  1.00 52.43  ?  505  ASN A N     1 
ATOM   4185  C CA    . ASN A 1 508 ? 36.747  -3.588  61.401  1.00 58.16  ?  505  ASN A CA    1 
ATOM   4186  C C     . ASN A 1 508 ? 37.505  -2.881  60.277  1.00 64.30  ?  505  ASN A C     1 
ATOM   4187  O O     . ASN A 1 508 ? 38.479  -3.421  59.737  1.00 66.63  ?  505  ASN A O     1 
ATOM   4188  C CB    . ASN A 1 508 ? 36.683  -5.095  61.134  1.00 62.66  ?  505  ASN A CB    1 
ATOM   4189  C CG    . ASN A 1 508 ? 37.981  -5.802  61.487  1.00 69.46  ?  505  ASN A CG    1 
ATOM   4190  O OD1   . ASN A 1 508 ? 38.568  -5.557  62.541  1.00 72.75  ?  505  ASN A OD1   1 
ATOM   4191  N ND2   . ASN A 1 508 ? 38.449  -6.667  60.592  1.00 72.98  ?  505  ASN A ND2   1 
ATOM   4192  N N     . VAL A 1 509 ? 37.068  -1.674  59.921  1.00 64.15  ?  506  VAL A N     1 
ATOM   4193  C CA    . VAL A 1 509 ? 37.785  -0.798  59.003  1.00 54.11  ?  506  VAL A CA    1 
ATOM   4194  C C     . VAL A 1 509 ? 37.548  0.633   59.462  1.00 53.68  ?  506  VAL A C     1 
ATOM   4195  O O     . VAL A 1 509 ? 36.527  0.943   60.085  1.00 53.20  ?  506  VAL A O     1 
ATOM   4196  C CB    . VAL A 1 509 ? 37.330  -0.977  57.534  1.00 53.20  ?  506  VAL A CB    1 
ATOM   4197  C CG1   . VAL A 1 509 ? 38.012  -2.176  56.896  1.00 53.32  ?  506  VAL A CG1   1 
ATOM   4198  C CG2   . VAL A 1 509 ? 35.820  -1.113  57.457  1.00 55.24  ?  506  VAL A CG2   1 
ATOM   4199  N N     . SER A 1 510 ? 38.500  1.510   59.161  1.00 54.27  ?  507  SER A N     1 
ATOM   4200  C CA    . SER A 1 510 ? 38.280  2.921   59.411  1.00 55.45  ?  507  SER A CA    1 
ATOM   4201  C C     . SER A 1 510 ? 37.136  3.423   58.533  1.00 58.19  ?  507  SER A C     1 
ATOM   4202  O O     . SER A 1 510 ? 36.912  2.906   57.434  1.00 58.87  ?  507  SER A O     1 
ATOM   4203  C CB    . SER A 1 510 ? 39.545  3.731   59.126  1.00 55.09  ?  507  SER A CB    1 
ATOM   4204  O OG    . SER A 1 510 ? 40.195  4.105   60.328  1.00 55.69  ?  507  SER A OG    1 
ATOM   4205  N N     . PRO A 1 511 ? 36.382  4.415   59.001  1.00 53.26  ?  508  PRO A N     1 
ATOM   4206  C CA    . PRO A 1 511 ? 35.417  5.069   58.115  1.00 52.62  ?  508  PRO A CA    1 
ATOM   4207  C C     . PRO A 1 511 ? 36.150  5.804   57.010  1.00 52.95  ?  508  PRO A C     1 
ATOM   4208  O O     . PRO A 1 511 ? 37.149  6.484   57.251  1.00 53.64  ?  508  PRO A O     1 
ATOM   4209  C CB    . PRO A 1 511 ? 34.677  6.037   59.042  1.00 52.41  ?  508  PRO A CB    1 
ATOM   4210  C CG    . PRO A 1 511 ? 35.642  6.302   60.152  1.00 53.18  ?  508  PRO A CG    1 
ATOM   4211  C CD    . PRO A 1 511 ? 36.410  5.025   60.341  1.00 53.54  ?  508  PRO A CD    1 
ATOM   4212  N N     . GLU A 1 512 ? 35.660  5.645   55.782  1.00 52.46  ?  509  GLU A N     1 
ATOM   4213  C CA    . GLU A 1 512 ? 36.285  6.362   54.679  1.00 52.73  ?  509  GLU A CA    1 
ATOM   4214  C C     . GLU A 1 512 ? 36.013  7.856   54.774  1.00 52.72  ?  509  GLU A C     1 
ATOM   4215  O O     . GLU A 1 512 ? 36.871  8.668   54.414  1.00 53.25  ?  509  GLU A O     1 
ATOM   4216  C CB    . GLU A 1 512 ? 35.800  5.809   53.342  1.00 52.19  ?  509  GLU A CB    1 
ATOM   4217  C CG    . GLU A 1 512 ? 36.798  6.028   52.227  1.00 67.59  ?  509  GLU A CG    1 
ATOM   4218  C CD    . GLU A 1 512 ? 38.196  5.574   52.618  1.00 73.10  ?  509  GLU A CD    1 
ATOM   4219  O OE1   . GLU A 1 512 ? 38.446  4.351   52.624  1.00 76.75  ?  509  GLU A OE1   1 
ATOM   4220  O OE2   . GLU A 1 512 ? 39.038  6.439   52.942  1.00 67.10  -1 509  GLU A OE2   1 
ATOM   4221  N N     . ASN A 1 513 ? 34.845  8.237   55.282  1.00 52.15  ?  510  ASN A N     1 
ATOM   4222  C CA    . ASN A 1 513 ? 34.483  9.634   55.456  1.00 52.09  ?  510  ASN A CA    1 
ATOM   4223  C C     . ASN A 1 513 ? 33.889  9.835   56.842  1.00 51.98  ?  510  ASN A C     1 
ATOM   4224  O O     . ASN A 1 513 ? 33.264  8.931   57.403  1.00 51.61  ?  510  ASN A O     1 
ATOM   4225  C CB    . ASN A 1 513 ? 33.492  10.087  54.381  1.00 51.39  ?  510  ASN A CB    1 
ATOM   4226  C CG    . ASN A 1 513 ? 33.920  9.668   52.987  1.00 51.39  ?  510  ASN A CG    1 
ATOM   4227  O OD1   . ASN A 1 513 ? 34.788  10.294  52.380  1.00 51.87  ?  510  ASN A OD1   1 
ATOM   4228  N ND2   . ASN A 1 513 ? 33.309  8.606   52.473  1.00 50.85  ?  510  ASN A ND2   1 
ATOM   4229  N N     . VAL A 1 514 ? 34.090  11.031  57.392  1.00 52.30  ?  511  VAL A N     1 
ATOM   4230  C CA    . VAL A 1 514 ? 33.621  11.373  58.730  1.00 52.26  ?  511  VAL A CA    1 
ATOM   4231  C C     . VAL A 1 514 ? 32.874  12.698  58.654  1.00 51.95  ?  511  VAL A C     1 
ATOM   4232  O O     . VAL A 1 514 ? 33.458  13.726  58.290  1.00 52.34  ?  511  VAL A O     1 
ATOM   4233  C CB    . VAL A 1 514 ? 34.775  11.458  59.744  1.00 53.11  ?  511  VAL A CB    1 
ATOM   4234  C CG1   . VAL A 1 514 ? 34.248  11.849  61.113  1.00 53.05  ?  511  VAL A CG1   1 
ATOM   4235  C CG2   . VAL A 1 514 ? 35.510  10.129  59.827  1.00 53.80  ?  511  VAL A CG2   1 
ATOM   4236  N N     . PHE A 1 515 ? 31.590  12.673  58.997  1.00 51.24  ?  512  PHE A N     1 
ATOM   4237  C CA    . PHE A 1 515 ? 30.746  13.860  59.003  1.00 50.87  ?  512  PHE A CA    1 
ATOM   4238  C C     . PHE A 1 515 ? 30.688  14.406  60.424  1.00 52.86  ?  512  PHE A C     1 
ATOM   4239  O O     . PHE A 1 515 ? 30.215  13.719  61.336  1.00 50.91  ?  512  PHE A O     1 
ATOM   4240  C CB    . PHE A 1 515 ? 29.339  13.536  58.501  1.00 49.93  ?  512  PHE A CB    1 
ATOM   4241  C CG    . PHE A 1 515 ? 29.276  13.163  57.044  1.00 49.63  ?  512  PHE A CG    1 
ATOM   4242  C CD1   . PHE A 1 515 ? 29.852  11.989  56.586  1.00 49.78  ?  512  PHE A CD1   1 
ATOM   4243  C CD2   . PHE A 1 515 ? 28.617  13.974  56.136  1.00 49.19  ?  512  PHE A CD2   1 
ATOM   4244  C CE1   . PHE A 1 515 ? 29.791  11.643  55.250  1.00 49.50  ?  512  PHE A CE1   1 
ATOM   4245  C CE2   . PHE A 1 515 ? 28.550  13.629  54.798  1.00 48.91  ?  512  PHE A CE2   1 
ATOM   4246  C CZ    . PHE A 1 515 ? 29.139  12.462  54.356  1.00 49.06  ?  512  PHE A CZ    1 
ATOM   4247  N N     . ILE A 1 516 ? 31.167  15.631  60.611  1.00 51.55  ?  513  ILE A N     1 
ATOM   4248  C CA    . ILE A 1 516 ? 31.141  16.297  61.908  1.00 51.81  ?  513  ILE A CA    1 
ATOM   4249  C C     . ILE A 1 516 ? 30.096  17.400  61.815  1.00 51.30  ?  513  ILE A C     1 
ATOM   4250  O O     . ILE A 1 516 ? 30.324  18.443  61.190  1.00 51.45  ?  513  ILE A O     1 
ATOM   4251  C CB    . ILE A 1 516 ? 32.513  16.852  62.310  1.00 52.93  ?  513  ILE A CB    1 
ATOM   4252  C CG1   . ILE A 1 516 ? 33.531  15.720  62.460  1.00 53.24  ?  513  ILE A CG1   1 
ATOM   4253  C CG2   . ILE A 1 516 ? 32.411  17.637  63.608  1.00 52.97  ?  513  ILE A CG2   1 
ATOM   4254  C CD1   . ILE A 1 516 ? 34.305  15.421  61.190  1.00 53.46  ?  513  ILE A CD1   1 
ATOM   4255  N N     . LEU A 1 517 ? 28.943  17.167  62.432  1.00 50.70  ?  514  LEU A N     1 
ATOM   4256  C CA    . LEU A 1 517 ? 27.850  18.126  62.443  1.00 50.17  ?  514  LEU A CA    1 
ATOM   4257  C C     . LEU A 1 517 ? 27.848  18.846  63.786  1.00 50.46  ?  514  LEU A C     1 
ATOM   4258  O O     . LEU A 1 517 ? 27.821  18.204  64.841  1.00 50.54  ?  514  LEU A O     1 
ATOM   4259  C CB    . LEU A 1 517 ? 26.513  17.427  62.201  1.00 49.27  ?  514  LEU A CB    1 
ATOM   4260  C CG    . LEU A 1 517 ? 26.545  16.219  61.257  1.00 49.01  ?  514  LEU A CG    1 
ATOM   4261  C CD1   . LEU A 1 517 ? 25.169  15.582  61.163  1.00 48.13  ?  514  LEU A CD1   1 
ATOM   4262  C CD2   . LEU A 1 517 ? 27.058  16.594  59.873  1.00 49.13  ?  514  LEU A CD2   1 
ATOM   4263  N N     . ARG A 1 518 ? 27.888  20.173  63.742  1.00 50.62  ?  515  ARG A N     1 
ATOM   4264  C CA    . ARG A 1 518 ? 28.029  21.000  64.930  1.00 50.99  ?  515  ARG A CA    1 
ATOM   4265  C C     . ARG A 1 518 ? 26.744  21.776  65.183  1.00 50.37  ?  515  ARG A C     1 
ATOM   4266  O O     . ARG A 1 518 ? 26.181  22.377  64.262  1.00 49.96  ?  515  ARG A O     1 
ATOM   4267  C CB    . ARG A 1 518 ? 29.209  21.963  64.772  1.00 51.76  ?  515  ARG A CB    1 
ATOM   4268  C CG    . ARG A 1 518 ? 29.353  22.996  65.875  1.00 52.14  ?  515  ARG A CG    1 
ATOM   4269  C CD    . ARG A 1 518 ? 29.697  22.363  67.213  1.00 52.48  ?  515  ARG A CD    1 
ATOM   4270  N NE    . ARG A 1 518 ? 30.016  23.382  68.210  1.00 55.81  ?  515  ARG A NE    1 
ATOM   4271  C CZ    . ARG A 1 518 ? 31.251  23.749  68.535  1.00 53.76  ?  515  ARG A CZ    1 
ATOM   4272  N NH1   . ARG A 1 518 ? 32.293  23.173  67.951  1.00 54.20  1  515  ARG A NH1   1 
ATOM   4273  N NH2   . ARG A 1 518 ? 31.442  24.691  69.447  1.00 54.12  ?  515  ARG A NH2   1 
ATOM   4274  N N     . ASP A 1 519 ? 26.283  21.758  66.432  1.00 50.30  ?  516  ASP A N     1 
ATOM   4275  C CA    . ASP A 1 519 ? 25.148  22.574  66.857  1.00 49.80  ?  516  ASP A CA    1 
ATOM   4276  C C     . ASP A 1 519 ? 25.616  24.019  66.949  1.00 50.25  ?  516  ASP A C     1 
ATOM   4277  O O     . ASP A 1 519 ? 26.219  24.433  67.941  1.00 50.81  ?  516  ASP A O     1 
ATOM   4278  C CB    . ASP A 1 519 ? 24.603  22.074  68.190  1.00 49.65  ?  516  ASP A CB    1 
ATOM   4279  C CG    . ASP A 1 519 ? 23.445  22.913  68.707  1.00 49.16  ?  516  ASP A CG    1 
ATOM   4280  O OD1   . ASP A 1 519 ? 22.864  23.694  67.922  1.00 48.78  ?  516  ASP A OD1   1 
ATOM   4281  O OD2   . ASP A 1 519 ? 23.109  22.783  69.902  1.00 56.11  -1 516  ASP A OD2   1 
ATOM   4282  N N     . GLY A 1 520 ? 25.339  24.790  65.908  1.00 50.01  ?  517  GLY A N     1 
ATOM   4283  C CA    . GLY A 1 520 ? 25.846  26.139  65.805  1.00 50.45  ?  517  GLY A CA    1 
ATOM   4284  C C     . GLY A 1 520 ? 27.123  26.201  64.994  1.00 51.06  ?  517  GLY A C     1 
ATOM   4285  O O     . GLY A 1 520 ? 27.417  25.338  64.163  1.00 55.23  ?  517  GLY A O     1 
ATOM   4286  N N     . ARG A 1 521 ? 27.901  27.245  65.257  1.00 56.00  ?  518  ARG A N     1 
ATOM   4287  C CA    . ARG A 1 521 ? 29.120  27.507  64.511  1.00 55.01  ?  518  ARG A CA    1 
ATOM   4288  C C     . ARG A 1 521 ? 30.346  27.103  65.323  1.00 56.23  ?  518  ARG A C     1 
ATOM   4289  O O     . ARG A 1 521 ? 30.359  27.214  66.555  1.00 61.32  ?  518  ARG A O     1 
ATOM   4290  C CB    . ARG A 1 521 ? 29.209  28.981  64.117  1.00 52.79  ?  518  ARG A CB    1 
ATOM   4291  C CG    . ARG A 1 521 ? 28.991  29.968  65.253  1.00 56.26  ?  518  ARG A CG    1 
ATOM   4292  C CD    . ARG A 1 521 ? 28.739  31.368  64.703  1.00 61.85  ?  518  ARG A CD    1 
ATOM   4293  N NE    . ARG A 1 521 ? 28.945  32.414  65.703  1.00 67.59  ?  518  ARG A NE    1 
ATOM   4294  C CZ    . ARG A 1 521 ? 27.976  32.963  66.430  1.00 67.44  ?  518  ARG A CZ    1 
ATOM   4295  N NH1   . ARG A 1 521 ? 26.719  32.568  66.276  1.00 61.49  1  518  ARG A NH1   1 
ATOM   4296  N NH2   . ARG A 1 521 ? 28.265  33.909  67.313  1.00 65.31  ?  518  ARG A NH2   1 
ATOM   4297  N N     . PHE A 1 522 ? 31.370  26.615  64.621  1.00 53.52  ?  519  PHE A N     1 
ATOM   4298  C CA    . PHE A 1 522 ? 32.652  26.302  65.240  1.00 54.33  ?  519  PHE A CA    1 
ATOM   4299  C C     . PHE A 1 522 ? 33.301  27.596  65.716  1.00 55.70  ?  519  PHE A C     1 
ATOM   4300  O O     . PHE A 1 522 ? 33.716  28.427  64.901  1.00 58.90  ?  519  PHE A O     1 
ATOM   4301  C CB    . PHE A 1 522 ? 33.569  25.587  64.252  1.00 54.63  ?  519  PHE A CB    1 
ATOM   4302  C CG    . PHE A 1 522 ? 33.149  24.176  63.923  1.00 54.17  ?  519  PHE A CG    1 
ATOM   4303  C CD1   . PHE A 1 522 ? 32.227  23.926  62.919  1.00 53.44  ?  519  PHE A CD1   1 
ATOM   4304  C CD2   . PHE A 1 522 ? 33.705  23.097  64.591  1.00 54.48  ?  519  PHE A CD2   1 
ATOM   4305  C CE1   . PHE A 1 522 ? 31.854  22.633  62.599  1.00 53.03  ?  519  PHE A CE1   1 
ATOM   4306  C CE2   . PHE A 1 522 ? 33.335  21.797  64.280  1.00 55.29  ?  519  PHE A CE2   1 
ATOM   4307  C CZ    . PHE A 1 522 ? 32.407  21.566  63.281  1.00 53.34  ?  519  PHE A CZ    1 
ATOM   4308  N N     . ILE A 1 523 ? 33.391  27.774  67.032  1.00 55.22  ?  520  ILE A N     1 
ATOM   4309  C CA    . ILE A 1 523 ? 34.086  28.909  67.627  1.00 55.86  ?  520  ILE A CA    1 
ATOM   4310  C C     . ILE A 1 523 ? 35.408  28.496  68.259  1.00 56.68  ?  520  ILE A C     1 
ATOM   4311  O O     . ILE A 1 523 ? 36.178  29.359  68.704  1.00 57.30  ?  520  ILE A O     1 
ATOM   4312  C CB    . ILE A 1 523 ? 33.168  29.636  68.633  1.00 58.53  ?  520  ILE A CB    1 
ATOM   4313  C CG1   . ILE A 1 523 ? 31.899  30.084  67.910  1.00 61.39  ?  520  ILE A CG1   1 
ATOM   4314  C CG2   . ILE A 1 523 ? 33.806  30.890  69.218  1.00 60.40  ?  520  ILE A CG2   1 
ATOM   4315  C CD1   . ILE A 1 523 ? 32.186  30.941  66.681  1.00 62.26  ?  520  ILE A CD1   1 
ATOM   4316  N N     . GLU A 1 524 ? 35.726  27.206  68.251  1.00 57.41  ?  521  GLU A N     1 
ATOM   4317  C CA    . GLU A 1 524 ? 36.997  26.724  68.764  1.00 57.48  ?  521  GLU A CA    1 
ATOM   4318  C C     . GLU A 1 524 ? 38.099  26.973  67.736  1.00 58.58  ?  521  GLU A C     1 
ATOM   4319  O O     . GLU A 1 524 ? 37.858  27.464  66.629  1.00 57.73  ?  521  GLU A O     1 
ATOM   4320  C CB    . GLU A 1 524 ? 36.896  25.242  69.123  1.00 57.31  ?  521  GLU A CB    1 
ATOM   4321  C CG    . GLU A 1 524 ? 35.970  24.931  70.298  1.00 62.35  ?  521  GLU A CG    1 
ATOM   4322  C CD    . GLU A 1 524 ? 34.518  25.283  70.020  1.00 57.95  ?  521  GLU A CD    1 
ATOM   4323  O OE1   . GLU A 1 524 ? 34.098  25.201  68.846  1.00 58.46  ?  521  GLU A OE1   1 
ATOM   4324  O OE2   . GLU A 1 524 ? 33.803  25.666  70.968  1.00 58.33  -1 521  GLU A OE2   1 
ATOM   4325  N N     . ASP A 1 525 ? 39.331  26.637  68.107  1.00 61.68  ?  522  ASP A N     1 
ATOM   4326  C CA    . ASP A 1 525 ? 40.468  26.749  67.195  1.00 63.87  ?  522  ASP A CA    1 
ATOM   4327  C C     . ASP A 1 525 ? 40.269  25.752  66.061  1.00 60.22  ?  522  ASP A C     1 
ATOM   4328  O O     . ASP A 1 525 ? 40.526  24.557  66.219  1.00 58.89  ?  522  ASP A O     1 
ATOM   4329  C CB    . ASP A 1 525 ? 41.773  26.496  67.939  1.00 66.21  ?  522  ASP A CB    1 
ATOM   4330  C CG    . ASP A 1 525 ? 42.969  27.123  67.252  1.00 62.32  ?  522  ASP A CG    1 
ATOM   4331  O OD1   . ASP A 1 525 ? 42.959  27.227  66.007  1.00 62.02  ?  522  ASP A OD1   1 
ATOM   4332  O OD2   . ASP A 1 525 ? 43.919  27.516  67.962  1.00 61.50  -1 522  ASP A OD2   1 
ATOM   4333  N N     . ILE A 1 526 ? 39.814  26.243  64.905  1.00 58.90  ?  523  ILE A N     1 
ATOM   4334  C CA    . ILE A 1 526 ? 39.338  25.341  63.858  1.00 60.21  ?  523  ILE A CA    1 
ATOM   4335  C C     . ILE A 1 526 ? 40.489  24.536  63.264  1.00 58.70  ?  523  ILE A C     1 
ATOM   4336  O O     . ILE A 1 526 ? 40.322  23.361  62.914  1.00 58.12  ?  523  ILE A O     1 
ATOM   4337  C CB    . ILE A 1 526 ? 38.565  26.127  62.780  1.00 58.71  ?  523  ILE A CB    1 
ATOM   4338  C CG1   . ILE A 1 526 ? 37.807  25.164  61.865  1.00 56.69  ?  523  ILE A CG1   1 
ATOM   4339  C CG2   . ILE A 1 526 ? 39.493  27.023  61.967  1.00 58.49  ?  523  ILE A CG2   1 
ATOM   4340  C CD1   . ILE A 1 526 ? 36.836  24.267  62.601  1.00 56.13  ?  523  ILE A CD1   1 
ATOM   4341  N N     . GLU A 1 527 ? 41.678  25.140  63.159  1.00 59.16  ?  524  GLU A N     1 
ATOM   4342  C CA    . GLU A 1 527 ? 42.815  24.431  62.577  1.00 59.65  ?  524  GLU A CA    1 
ATOM   4343  C C     . GLU A 1 527 ? 43.231  23.254  63.448  1.00 59.90  ?  524  GLU A C     1 
ATOM   4344  O O     . GLU A 1 527 ? 43.541  22.171  62.936  1.00 59.89  ?  524  GLU A O     1 
ATOM   4345  C CB    . GLU A 1 527 ? 43.987  25.392  62.372  1.00 63.66  ?  524  GLU A CB    1 
ATOM   4346  C CG    . GLU A 1 527 ? 43.715  26.486  61.350  1.00 66.95  ?  524  GLU A CG    1 
ATOM   4347  C CD    . GLU A 1 527 ? 43.407  25.932  59.971  1.00 70.06  ?  524  GLU A CD    1 
ATOM   4348  O OE1   . GLU A 1 527 ? 44.115  25.002  59.527  1.00 68.54  ?  524  GLU A OE1   1 
ATOM   4349  O OE2   . GLU A 1 527 ? 42.452  26.422  59.333  1.00 72.06  -1 524  GLU A OE2   1 
ATOM   4350  N N     . ILE A 1 528 ? 43.243  23.449  64.770  1.00 60.14  ?  525  ILE A N     1 
ATOM   4351  C CA    . ILE A 1 528 ? 43.514  22.349  65.692  1.00 60.32  ?  525  ILE A CA    1 
ATOM   4352  C C     . ILE A 1 528 ? 42.535  21.207  65.452  1.00 59.58  ?  525  ILE A C     1 
ATOM   4353  O O     . ILE A 1 528 ? 42.930  20.042  65.325  1.00 59.67  ?  525  ILE A O     1 
ATOM   4354  C CB    . ILE A 1 528 ? 43.452  22.842  67.149  1.00 61.70  ?  525  ILE A CB    1 
ATOM   4355  C CG1   . ILE A 1 528 ? 44.565  23.854  67.429  1.00 61.38  ?  525  ILE A CG1   1 
ATOM   4356  C CG2   . ILE A 1 528 ? 43.528  21.666  68.112  1.00 60.63  ?  525  ILE A CG2   1 
ATOM   4357  C CD1   . ILE A 1 528 ? 45.940  23.234  67.565  1.00 62.14  ?  525  ILE A CD1   1 
ATOM   4358  N N     . ILE A 1 529 ? 41.239  21.529  65.389  1.00 58.85  ?  526  ILE A N     1 
ATOM   4359  C CA    . ILE A 1 529 ? 40.233  20.515  65.077  1.00 58.10  ?  526  ILE A CA    1 
ATOM   4360  C C     . ILE A 1 529 ? 40.545  19.868  63.738  1.00 60.65  ?  526  ILE A C     1 
ATOM   4361  O O     . ILE A 1 529 ? 40.639  18.640  63.629  1.00 57.90  ?  526  ILE A O     1 
ATOM   4362  C CB    . ILE A 1 529 ? 38.820  21.127  65.083  1.00 57.33  ?  526  ILE A CB    1 
ATOM   4363  C CG1   . ILE A 1 529 ? 38.645  22.065  66.264  1.00 57.60  ?  526  ILE A CG1   1 
ATOM   4364  C CG2   . ILE A 1 529 ? 37.767  20.042  65.159  1.00 56.61  ?  526  ILE A CG2   1 
ATOM   4365  C CD1   . ILE A 1 529 ? 37.221  22.501  66.523  1.00 56.78  ?  526  ILE A CD1   1 
ATOM   4366  N N     . LYS A 1 530 ? 40.746  20.698  62.708  1.00 58.05  ?  527  LYS A N     1 
ATOM   4367  C CA    . LYS A 1 530 ? 40.965  20.216  61.347  1.00 57.91  ?  527  LYS A CA    1 
ATOM   4368  C C     . LYS A 1 530 ? 42.010  19.107  61.295  1.00 60.15  ?  527  LYS A C     1 
ATOM   4369  O O     . LYS A 1 530 ? 41.835  18.108  60.588  1.00 58.08  ?  527  LYS A O     1 
ATOM   4370  C CB    . LYS A 1 530 ? 41.392  21.388  60.461  1.00 58.49  ?  527  LYS A CB    1 
ATOM   4371  C CG    . LYS A 1 530 ? 40.970  21.282  59.012  1.00 57.67  ?  527  LYS A CG    1 
ATOM   4372  C CD    . LYS A 1 530 ? 41.913  22.061  58.113  1.00 58.18  ?  527  LYS A CD    1 
ATOM   4373  C CE    . LYS A 1 530 ? 42.344  21.224  56.919  1.00 58.31  ?  527  LYS A CE    1 
ATOM   4374  N NZ    . LYS A 1 530 ? 42.808  19.869  57.343  1.00 58.35  1  527  LYS A NZ    1 
ATOM   4375  N N     . ASN A 1 531 ? 43.096  19.256  62.057  1.00 65.74  ?  528  ASN A N     1 
ATOM   4376  C CA    . ASN A 1 531 ? 44.203  18.310  61.962  1.00 63.11  ?  528  ASN A CA    1 
ATOM   4377  C C     . ASN A 1 531 ? 43.875  16.985  62.643  1.00 65.21  ?  528  ASN A C     1 
ATOM   4378  O O     . ASN A 1 531 ? 44.050  15.915  62.048  1.00 64.18  ?  528  ASN A O     1 
ATOM   4379  C CB    . ASN A 1 531 ? 45.470  18.924  62.557  1.00 68.15  ?  528  ASN A CB    1 
ATOM   4380  C CG    . ASN A 1 531 ? 46.594  17.916  62.694  1.00 75.85  ?  528  ASN A CG    1 
ATOM   4381  O OD1   . ASN A 1 531 ? 47.241  17.550  61.712  1.00 77.77  ?  528  ASN A OD1   1 
ATOM   4382  N ND2   . ASN A 1 531 ? 46.832  17.460  63.918  1.00 75.86  ?  528  ASN A ND2   1 
ATOM   4383  N N     . PHE A 1 532 ? 43.404  17.026  63.896  1.00 59.40  ?  529  PHE A N     1 
ATOM   4384  C CA    . PHE A 1 532 ? 43.209  15.767  64.610  1.00 59.27  ?  529  PHE A CA    1 
ATOM   4385  C C     . PHE A 1 532 ? 41.977  15.012  64.129  1.00 62.03  ?  529  PHE A C     1 
ATOM   4386  O O     . PHE A 1 532 ? 41.845  13.821  64.433  1.00 67.47  ?  529  PHE A O     1 
ATOM   4387  C CB    . PHE A 1 532 ? 43.159  15.985  66.137  1.00 60.01  ?  529  PHE A CB    1 
ATOM   4388  C CG    . PHE A 1 532 ? 41.879  16.612  66.664  1.00 58.90  ?  529  PHE A CG    1 
ATOM   4389  C CD1   . PHE A 1 532 ? 40.669  15.923  66.656  1.00 58.11  ?  529  PHE A CD1   1 
ATOM   4390  C CD2   . PHE A 1 532 ? 41.912  17.867  67.251  1.00 59.14  ?  529  PHE A CD2   1 
ATOM   4391  C CE1   . PHE A 1 532 ? 39.516  16.498  67.156  1.00 57.57  ?  529  PHE A CE1   1 
ATOM   4392  C CE2   . PHE A 1 532 ? 40.764  18.443  67.764  1.00 58.61  ?  529  PHE A CE2   1 
ATOM   4393  C CZ    . PHE A 1 532 ? 39.564  17.759  67.715  1.00 57.82  ?  529  PHE A CZ    1 
ATOM   4394  N N     . ILE A 1 533 ? 41.068  15.673  63.404  1.00 57.81  ?  530  ILE A N     1 
ATOM   4395  C CA    . ILE A 1 533 ? 39.938  14.961  62.810  1.00 60.93  ?  530  ILE A CA    1 
ATOM   4396  C C     . ILE A 1 533 ? 40.442  13.836  61.921  1.00 61.77  ?  530  ILE A C     1 
ATOM   4397  O O     . ILE A 1 533 ? 39.791  12.791  61.790  1.00 63.76  ?  530  ILE A O     1 
ATOM   4398  C CB    . ILE A 1 533 ? 39.032  15.935  62.031  1.00 65.27  ?  530  ILE A CB    1 
ATOM   4399  C CG1   . ILE A 1 533 ? 38.297  16.871  62.984  1.00 65.35  ?  530  ILE A CG1   1 
ATOM   4400  C CG2   . ILE A 1 533 ? 38.001  15.186  61.210  1.00 62.73  ?  530  ILE A CG2   1 
ATOM   4401  C CD1   . ILE A 1 533 ? 37.731  18.068  62.283  1.00 69.86  ?  530  ILE A CD1   1 
ATOM   4402  N N     . SER A 1 534 ? 41.617  14.018  61.326  1.00 64.45  ?  531  SER A N     1 
ATOM   4403  C CA    . SER A 1 534 ? 42.258  12.997  60.507  1.00 59.63  ?  531  SER A CA    1 
ATOM   4404  C C     . SER A 1 534 ? 42.610  11.754  61.321  1.00 58.62  ?  531  SER A C     1 
ATOM   4405  O O     . SER A 1 534 ? 42.514  11.750  62.549  1.00 58.13  ?  531  SER A O     1 
ATOM   4406  C CB    . SER A 1 534 ? 43.517  13.568  59.857  1.00 58.49  ?  531  SER A CB    1 
ATOM   4407  O OG    . SER A 1 534 ? 43.324  14.924  59.492  1.00 58.46  ?  531  SER A OG    1 
ATOM   4408  N N     . ASP A 1 537 ? 44.640  9.780   58.813  1.00 60.03  ?  534  ASP A N     1 
ATOM   4409  C CA    . ASP A 1 537 ? 44.450  9.964   57.378  1.00 62.51  ?  534  ASP A CA    1 
ATOM   4410  C C     . ASP A 1 537 ? 43.022  9.647   56.952  1.00 66.64  ?  534  ASP A C     1 
ATOM   4411  O O     . ASP A 1 537 ? 42.804  8.767   56.119  1.00 66.57  ?  534  ASP A O     1 
ATOM   4412  C CB    . ASP A 1 537 ? 45.424  9.085   56.586  1.00 65.60  ?  534  ASP A CB    1 
ATOM   4413  C CG    . ASP A 1 537 ? 46.816  9.680   56.505  1.00 70.28  ?  534  ASP A CG    1 
ATOM   4414  O OD1   . ASP A 1 537 ? 47.065  10.481  55.580  1.00 74.41  -1 534  ASP A OD1   1 
ATOM   4415  O OD2   . ASP A 1 537 ? 47.660  9.343   57.363  1.00 73.49  ?  534  ASP A OD2   1 
ATOM   4416  N N     . THR A 1 538 ? 42.048  10.357  57.515  1.00 70.21  ?  535  THR A N     1 
ATOM   4417  C CA    . THR A 1 538 ? 40.648  10.134  57.184  1.00 62.99  ?  535  THR A CA    1 
ATOM   4418  C C     . THR A 1 538 ? 40.056  11.385  56.546  1.00 56.97  ?  535  THR A C     1 
ATOM   4419  O O     . THR A 1 538 ? 40.351  12.512  56.961  1.00 51.31  ?  535  THR A O     1 
ATOM   4420  C CB    . THR A 1 538 ? 39.834  9.707   58.426  1.00 60.24  ?  535  THR A CB    1 
ATOM   4421  O OG1   . THR A 1 538 ? 38.550  9.217   58.017  1.00 59.43  ?  535  THR A OG1   1 
ATOM   4422  C CG2   . THR A 1 538 ? 39.638  10.851  59.393  1.00 60.69  ?  535  THR A CG2   1 
ATOM   4423  N N     . LYS A 1 539 ? 39.245  11.175  55.513  1.00 54.53  ?  536  LYS A N     1 
ATOM   4424  C CA    . LYS A 1 539 ? 38.562  12.269  54.841  1.00 56.92  ?  536  LYS A CA    1 
ATOM   4425  C C     . LYS A 1 539 ? 37.309  12.642  55.627  1.00 64.29  ?  536  LYS A C     1 
ATOM   4426  O O     . LYS A 1 539 ? 36.657  11.783  56.225  1.00 61.65  ?  536  LYS A O     1 
ATOM   4427  C CB    . LYS A 1 539 ? 38.241  11.864  53.401  1.00 58.56  ?  536  LYS A CB    1 
ATOM   4428  C CG    . LYS A 1 539 ? 39.525  11.609  52.594  1.00 60.46  ?  536  LYS A CG    1 
ATOM   4429  C CD    . LYS A 1 539 ? 39.320  10.750  51.348  1.00 58.14  ?  536  LYS A CD    1 
ATOM   4430  C CE    . LYS A 1 539 ? 38.772  9.373   51.619  1.00 61.85  ?  536  LYS A CE    1 
ATOM   4431  N NZ    . LYS A 1 539 ? 38.371  8.745   50.327  1.00 60.76  1  536  LYS A NZ    1 
ATOM   4432  N N     . TYR A 1 540 ? 37.001  13.937  55.667  1.00 64.32  ?  537  TYR A N     1 
ATOM   4433  C CA    . TYR A 1 540 ? 35.978  14.435  56.575  1.00 56.32  ?  537  TYR A CA    1 
ATOM   4434  C C     . TYR A 1 540 ? 35.295  15.654  55.970  1.00 46.62  ?  537  TYR A C     1 
ATOM   4435  O O     . TYR A 1 540 ? 35.667  16.141  54.898  1.00 41.80  ?  537  TYR A O     1 
ATOM   4436  C CB    . TYR A 1 540 ? 36.582  14.788  57.938  1.00 51.33  ?  537  TYR A CB    1 
ATOM   4437  C CG    . TYR A 1 540 ? 37.641  15.856  57.835  1.00 51.20  ?  537  TYR A CG    1 
ATOM   4438  C CD1   . TYR A 1 540 ? 38.966  15.518  57.611  1.00 42.79  ?  537  TYR A CD1   1 
ATOM   4439  C CD2   . TYR A 1 540 ? 37.313  17.204  57.938  1.00 50.14  ?  537  TYR A CD2   1 
ATOM   4440  C CE1   . TYR A 1 540 ? 39.936  16.481  57.502  1.00 49.32  ?  537  TYR A CE1   1 
ATOM   4441  C CE2   . TYR A 1 540 ? 38.284  18.180  57.828  1.00 52.63  ?  537  TYR A CE2   1 
ATOM   4442  C CZ    . TYR A 1 540 ? 39.594  17.806  57.611  1.00 54.88  ?  537  TYR A CZ    1 
ATOM   4443  O OH    . TYR A 1 540 ? 40.581  18.746  57.495  1.00 64.89  ?  537  TYR A OH    1 
ATOM   4444  N N     . THR A 1 541 ? 34.287  16.149  56.685  1.00 44.18  ?  538  THR A N     1 
ATOM   4445  C CA    . THR A 1 541 ? 33.625  17.403  56.362  1.00 43.84  ?  538  THR A CA    1 
ATOM   4446  C C     . THR A 1 541 ? 33.170  18.050  57.662  1.00 39.84  ?  538  THR A C     1 
ATOM   4447  O O     . THR A 1 541 ? 32.725  17.360  58.584  1.00 43.74  ?  538  THR A O     1 
ATOM   4448  C CB    . THR A 1 541 ? 32.432  17.195  55.420  1.00 37.55  ?  538  THR A CB    1 
ATOM   4449  O OG1   . THR A 1 541 ? 31.733  18.435  55.252  1.00 36.44  ?  538  THR A OG1   1 
ATOM   4450  C CG2   . THR A 1 541 ? 31.474  16.143  55.976  1.00 51.05  ?  538  THR A CG2   1 
ATOM   4451  N N     . LEU A 1 542 ? 33.299  19.370  57.735  1.00 39.16  ?  539  LEU A N     1 
ATOM   4452  C CA    . LEU A 1 542 ? 32.905  20.141  58.908  1.00 39.34  ?  539  LEU A CA    1 
ATOM   4453  C C     . LEU A 1 542 ? 31.641  20.917  58.574  1.00 42.29  ?  539  LEU A C     1 
ATOM   4454  O O     . LEU A 1 542 ? 31.626  21.707  57.624  1.00 35.50  ?  539  LEU A O     1 
ATOM   4455  C CB    . LEU A 1 542 ? 34.024  21.082  59.350  1.00 46.17  ?  539  LEU A CB    1 
ATOM   4456  C CG    . LEU A 1 542 ? 35.287  20.336  59.775  1.00 46.38  ?  539  LEU A CG    1 
ATOM   4457  C CD1   . LEU A 1 542 ? 36.280  21.272  60.449  1.00 44.67  ?  539  LEU A CD1   1 
ATOM   4458  C CD2   . LEU A 1 542 ? 34.904  19.184  60.687  1.00 42.72  ?  539  LEU A CD2   1 
ATOM   4459  N N     . VAL A 1 543 ? 30.587  20.690  59.354  1.00 38.33  ?  540  VAL A N     1 
ATOM   4460  C CA    . VAL A 1 543 ? 29.254  21.187  59.045  1.00 43.02  ?  540  VAL A CA    1 
ATOM   4461  C C     . VAL A 1 543 ? 28.728  21.970  60.238  1.00 39.50  ?  540  VAL A C     1 
ATOM   4462  O O     . VAL A 1 543 ? 28.758  21.480  61.373  1.00 34.92  ?  540  VAL A O     1 
ATOM   4463  C CB    . VAL A 1 543 ? 28.293  20.039  58.688  1.00 46.33  ?  540  VAL A CB    1 
ATOM   4464  C CG1   . VAL A 1 543 ? 26.925  20.589  58.355  1.00 43.69  ?  540  VAL A CG1   1 
ATOM   4465  C CG2   . VAL A 1 543 ? 28.845  19.215  57.533  1.00 34.48  ?  540  VAL A CG2   1 
ATOM   4466  N N     . GLU A 1 544 ? 28.244  23.183  59.981  1.00 39.41  ?  541  GLU A N     1 
ATOM   4467  C CA    . GLU A 1 544 ? 27.589  24.000  60.993  1.00 38.46  ?  541  GLU A CA    1 
ATOM   4468  C C     . GLU A 1 544 ? 26.086  23.950  60.755  1.00 38.70  ?  541  GLU A C     1 
ATOM   4469  O O     . GLU A 1 544 ? 25.617  24.250  59.651  1.00 36.15  ?  541  GLU A O     1 
ATOM   4470  C CB    . GLU A 1 544 ? 28.091  25.442  60.950  1.00 40.46  ?  541  GLU A CB    1 
ATOM   4471  C CG    . GLU A 1 544 ? 29.549  25.598  61.330  1.00 46.09  ?  541  GLU A CG    1 
ATOM   4472  C CD    . GLU A 1 544 ? 30.010  27.040  61.276  1.00 55.20  ?  541  GLU A CD    1 
ATOM   4473  O OE1   . GLU A 1 544 ? 29.324  27.861  60.630  1.00 47.61  ?  541  GLU A OE1   1 
ATOM   4474  O OE2   . GLU A 1 544 ? 31.054  27.353  61.888  1.00 52.80  -1 541  GLU A OE2   1 
ATOM   4475  N N     . VAL A 1 545 ? 25.340  23.567  61.787  1.00 38.26  ?  542  VAL A N     1 
ATOM   4476  C CA    . VAL A 1 545 ? 23.892  23.426  61.718  1.00 31.35  ?  542  VAL A CA    1 
ATOM   4477  C C     . VAL A 1 545 ? 23.263  24.458  62.643  1.00 35.24  ?  542  VAL A C     1 
ATOM   4478  O O     . VAL A 1 545 ? 23.606  24.530  63.829  1.00 40.99  ?  542  VAL A O     1 
ATOM   4479  C CB    . VAL A 1 545 ? 23.447  22.003  62.096  1.00 34.27  ?  542  VAL A CB    1 
ATOM   4480  C CG1   . VAL A 1 545 ? 21.940  21.879  62.017  1.00 33.95  ?  542  VAL A CG1   1 
ATOM   4481  C CG2   . VAL A 1 545 ? 24.117  20.978  61.192  1.00 36.92  ?  542  VAL A CG2   1 
ATOM   4482  N N     . ASN A 1 546 ? 22.344  25.252  62.103  1.00 35.66  ?  543  ASN A N     1 
ATOM   4483  C CA    . ASN A 1 546 ? 21.638  26.280  62.864  1.00 40.17  ?  543  ASN A CA    1 
ATOM   4484  C C     . ASN A 1 546 ? 20.152  25.940  62.841  1.00 40.23  ?  543  ASN A C     1 
ATOM   4485  O O     . ASN A 1 546 ? 19.456  26.222  61.861  1.00 40.22  ?  543  ASN A O     1 
ATOM   4486  C CB    . ASN A 1 546 ? 21.907  27.671  62.292  1.00 37.95  ?  543  ASN A CB    1 
ATOM   4487  C CG    . ASN A 1 546 ? 21.253  28.778  63.107  1.00 45.05  ?  543  ASN A CG    1 
ATOM   4488  O OD1   . ASN A 1 546 ? 20.680  28.532  64.168  1.00 44.86  ?  543  ASN A OD1   1 
ATOM   4489  N ND2   . ASN A 1 546 ? 21.344  30.008  62.614  1.00 51.53  ?  543  ASN A ND2   1 
ATOM   4490  N N     . LYS A 1 547 ? 19.666  25.339  63.928  1.00 31.21  ?  544  LYS A N     1 
ATOM   4491  C CA    . LYS A 1 547 ? 18.249  25.022  64.044  1.00 39.42  ?  544  LYS A CA    1 
ATOM   4492  C C     . LYS A 1 547 ? 17.387  26.263  64.222  1.00 41.25  ?  544  LYS A C     1 
ATOM   4493  O O     . LYS A 1 547 ? 16.158  26.158  64.160  1.00 50.62  ?  544  LYS A O     1 
ATOM   4494  C CB    . LYS A 1 547 ? 18.023  24.070  65.218  1.00 41.56  ?  544  LYS A CB    1 
ATOM   4495  C CG    . LYS A 1 547 ? 18.144  24.736  66.577  1.00 45.50  ?  544  LYS A CG    1 
ATOM   4496  C CD    . LYS A 1 547 ? 19.069  23.954  67.492  1.00 50.97  ?  544  LYS A CD    1 
ATOM   4497  C CE    . LYS A 1 547 ? 18.960  24.432  68.930  1.00 47.37  ?  544  LYS A CE    1 
ATOM   4498  N NZ    . LYS A 1 547 ? 19.783  23.589  69.837  1.00 55.90  1  544  LYS A NZ    1 
ATOM   4499  N N     . ASN A 1 548 ? 17.995  27.429  64.441  1.00 40.51  ?  545  ASN A N     1 
ATOM   4500  C CA    . ASN A 1 548 ? 17.273  28.666  64.706  1.00 44.55  ?  545  ASN A CA    1 
ATOM   4501  C C     . ASN A 1 548 ? 17.466  29.697  63.598  1.00 35.24  ?  545  ASN A C     1 
ATOM   4502  O O     . ASN A 1 548 ? 17.539  30.896  63.874  1.00 48.06  ?  545  ASN A O     1 
ATOM   4503  C CB    . ASN A 1 548 ? 17.709  29.257  66.047  1.00 52.91  ?  545  ASN A CB    1 
ATOM   4504  C CG    . ASN A 1 548 ? 17.458  28.319  67.210  1.00 64.49  ?  545  ASN A CG    1 
ATOM   4505  O OD1   . ASN A 1 548 ? 16.412  27.674  67.285  1.00 76.69  ?  545  ASN A OD1   1 
ATOM   4506  N ND2   . ASN A 1 548 ? 18.420  28.232  68.121  1.00 57.99  ?  545  ASN A ND2   1 
ATOM   4507  N N     . THR A 1 549 ? 17.554  29.256  62.345  1.00 41.46  ?  546  THR A N     1 
ATOM   4508  C CA    . THR A 1 549 ? 17.755  30.203  61.257  1.00 33.73  ?  546  THR A CA    1 
ATOM   4509  C C     . THR A 1 549 ? 16.532  31.101  61.108  1.00 37.39  ?  546  THR A C     1 
ATOM   4510  O O     . THR A 1 549 ? 15.389  30.668  61.300  1.00 34.11  ?  546  THR A O     1 
ATOM   4511  C CB    . THR A 1 549 ? 18.052  29.483  59.938  1.00 41.55  ?  546  THR A CB    1 
ATOM   4512  O OG1   . THR A 1 549 ? 18.353  30.449  58.923  1.00 39.86  ?  546  THR A OG1   1 
ATOM   4513  C CG2   . THR A 1 549 ? 16.868  28.657  59.488  1.00 38.84  ?  546  THR A CG2   1 
ATOM   4514  N N     . ASN A 1 550 ? 16.784  32.366  60.787  1.00 31.36  ?  547  ASN A N     1 
ATOM   4515  C CA    . ASN A 1 550 ? 15.739  33.369  60.643  1.00 32.64  ?  547  ASN A CA    1 
ATOM   4516  C C     . ASN A 1 550 ? 15.229  33.485  59.211  1.00 35.27  ?  547  ASN A C     1 
ATOM   4517  O O     . ASN A 1 550 ? 14.292  34.249  58.958  1.00 31.66  ?  547  ASN A O     1 
ATOM   4518  C CB    . ASN A 1 550 ? 16.264  34.729  61.116  1.00 31.20  ?  547  ASN A CB    1 
ATOM   4519  C CG    . ASN A 1 550 ? 15.157  35.681  61.505  1.00 31.17  ?  547  ASN A CG    1 
ATOM   4520  O OD1   . ASN A 1 550 ? 14.264  35.329  62.272  1.00 37.59  ?  547  ASN A OD1   1 
ATOM   4521  N ND2   . ASN A 1 550 ? 15.204  36.896  60.971  1.00 31.16  ?  547  ASN A ND2   1 
ATOM   4522  N N     . ILE A 1 551 ? 15.820  32.750  58.276  1.00 38.02  ?  548  ILE A N     1 
ATOM   4523  C CA    . ILE A 1 551 ? 15.420  32.820  56.875  1.00 35.20  ?  548  ILE A CA    1 
ATOM   4524  C C     . ILE A 1 551 ? 14.174  31.972  56.673  1.00 38.95  ?  548  ILE A C     1 
ATOM   4525  O O     . ILE A 1 551 ? 14.156  30.780  57.007  1.00 33.81  ?  548  ILE A O     1 
ATOM   4526  C CB    . ILE A 1 551 ? 16.564  32.356  55.962  1.00 32.01  ?  548  ILE A CB    1 
ATOM   4527  C CG1   . ILE A 1 551 ? 17.787  33.255  56.155  1.00 33.20  ?  548  ILE A CG1   1 
ATOM   4528  C CG2   . ILE A 1 551 ? 16.111  32.337  54.505  1.00 32.25  ?  548  ILE A CG2   1 
ATOM   4529  C CD1   . ILE A 1 551 ? 19.062  32.704  55.551  1.00 31.85  ?  548  ILE A CD1   1 
ATOM   4530  N N     . ASN A 1 552 ? 13.129  32.579  56.124  1.00 32.75  ?  549  ASN A N     1 
ATOM   4531  C CA    . ASN A 1 552 ? 11.855  31.888  55.990  1.00 39.07  ?  549  ASN A CA    1 
ATOM   4532  C C     . ASN A 1 552 ? 11.092  32.502  54.820  1.00 42.76  ?  549  ASN A C     1 
ATOM   4533  O O     . ASN A 1 552 ? 11.673  33.198  53.981  1.00 38.47  ?  549  ASN A O     1 
ATOM   4534  C CB    . ASN A 1 552 ? 11.083  31.950  57.319  1.00 32.32  ?  549  ASN A CB    1 
ATOM   4535  C CG    . ASN A 1 552 ? 10.314  30.680  57.602  1.00 32.44  ?  549  ASN A CG    1 
ATOM   4536  O OD1   . ASN A 1 552 ? 9.800   30.038  56.687  1.00 38.89  ?  549  ASN A OD1   1 
ATOM   4537  N ND2   . ASN A 1 552 ? 10.239  30.304  58.872  1.00 35.73  ?  549  ASN A ND2   1 
ATOM   4538  N N     . SER A 1 553 ? 9.786   32.250  54.770  1.00 37.84  ?  550  SER A N     1 
ATOM   4539  C CA    . SER A 1 553 ? 8.959   32.657  53.642  1.00 35.56  ?  550  SER A CA    1 
ATOM   4540  C C     . SER A 1 553 ? 7.495   32.459  53.999  1.00 39.54  ?  550  SER A C     1 
ATOM   4541  O O     . SER A 1 553 ? 7.153   31.653  54.869  1.00 39.52  ?  550  SER A O     1 
ATOM   4542  C CB    . SER A 1 553 ? 9.300   31.854  52.386  1.00 35.61  ?  550  SER A CB    1 
ATOM   4543  O OG    . SER A 1 553 ? 8.295   32.008  51.398  1.00 40.98  ?  550  SER A OG    1 
ATOM   4544  N N     . TYR A 1 554 ? 6.631   33.198  53.303  1.00 41.13  ?  551  TYR A N     1 
ATOM   4545  C CA    . TYR A 1 554 ? 5.203   32.913  53.353  1.00 41.21  ?  551  TYR A CA    1 
ATOM   4546  C C     . TYR A 1 554 ? 4.813   31.760  52.439  1.00 47.10  ?  551  TYR A C     1 
ATOM   4547  O O     . TYR A 1 554 ? 3.718   31.209  52.593  1.00 50.63  ?  551  TYR A O     1 
ATOM   4548  C CB    . TYR A 1 554 ? 4.384   34.163  53.004  1.00 40.97  ?  551  TYR A CB    1 
ATOM   4549  C CG    . TYR A 1 554 ? 4.833   34.907  51.763  1.00 50.03  ?  551  TYR A CG    1 
ATOM   4550  C CD1   . TYR A 1 554 ? 4.500   34.452  50.491  1.00 48.03  ?  551  TYR A CD1   1 
ATOM   4551  C CD2   . TYR A 1 554 ? 5.569   36.081  51.865  1.00 48.43  ?  551  TYR A CD2   1 
ATOM   4552  C CE1   . TYR A 1 554 ? 4.904   35.137  49.356  1.00 43.73  ?  551  TYR A CE1   1 
ATOM   4553  C CE2   . TYR A 1 554 ? 5.973   36.773  50.738  1.00 50.34  ?  551  TYR A CE2   1 
ATOM   4554  C CZ    . TYR A 1 554 ? 5.640   36.296  49.486  1.00 52.01  ?  551  TYR A CZ    1 
ATOM   4555  O OH    . TYR A 1 554 ? 6.043   36.980  48.362  1.00 54.21  ?  551  TYR A OH    1 
ATOM   4556  N N     . ASP A 1 555 ? 5.679   31.384  51.501  1.00 44.15  ?  552  ASP A N     1 
ATOM   4557  C CA    . ASP A 1 555 ? 5.470   30.178  50.717  1.00 39.06  ?  552  ASP A CA    1 
ATOM   4558  C C     . ASP A 1 555 ? 5.728   28.943  51.575  1.00 37.31  ?  552  ASP A C     1 
ATOM   4559  O O     . ASP A 1 555 ? 6.394   29.002  52.613  1.00 41.50  ?  552  ASP A O     1 
ATOM   4560  C CB    . ASP A 1 555 ? 6.388   30.165  49.495  1.00 47.11  ?  552  ASP A CB    1 
ATOM   4561  C CG    . ASP A 1 555 ? 6.112   31.312  48.545  1.00 53.00  ?  552  ASP A CG    1 
ATOM   4562  O OD1   . ASP A 1 555 ? 4.929   31.670  48.374  1.00 60.10  ?  552  ASP A OD1   1 
ATOM   4563  O OD2   . ASP A 1 555 ? 7.079   31.853  47.969  1.00 47.06  -1 552  ASP A OD2   1 
ATOM   4564  N N     . ASP A 1 556 ? 5.191   27.810  51.127  1.00 38.17  ?  553  ASP A N     1 
ATOM   4565  C CA    . ASP A 1 556 ? 5.383   26.537  51.815  1.00 40.07  ?  553  ASP A CA    1 
ATOM   4566  C C     . ASP A 1 556 ? 6.697   25.922  51.349  1.00 38.50  ?  553  ASP A C     1 
ATOM   4567  O O     . ASP A 1 556 ? 6.838   25.549  50.179  1.00 46.78  ?  553  ASP A O     1 
ATOM   4568  C CB    . ASP A 1 556 ? 4.219   25.586  51.554  1.00 43.79  ?  553  ASP A CB    1 
ATOM   4569  C CG    . ASP A 1 556 ? 4.425   24.229  52.199  1.00 47.84  ?  553  ASP A CG    1 
ATOM   4570  O OD1   . ASP A 1 556 ? 4.992   24.182  53.310  1.00 49.76  ?  553  ASP A OD1   1 
ATOM   4571  O OD2   . ASP A 1 556 ? 4.029   23.210  51.596  1.00 56.52  -1 553  ASP A OD2   1 
ATOM   4572  N N     . LEU A 1 557 ? 7.654   25.811  52.266  1.00 33.83  ?  554  LEU A N     1 
ATOM   4573  C CA    . LEU A 1 557 ? 8.959   25.234  51.980  1.00 37.44  ?  554  LEU A CA    1 
ATOM   4574  C C     . LEU A 1 557 ? 9.195   23.931  52.733  1.00 35.17  ?  554  LEU A C     1 
ATOM   4575  O O     . LEU A 1 557 ? 10.319  23.419  52.728  1.00 40.17  ?  554  LEU A O     1 
ATOM   4576  C CB    . LEU A 1 557 ? 10.060  26.243  52.317  1.00 33.56  ?  554  LEU A CB    1 
ATOM   4577  C CG    . LEU A 1 557 ? 9.937   27.601  51.623  1.00 35.07  ?  554  LEU A CG    1 
ATOM   4578  C CD1   . LEU A 1 557 ? 10.879  28.612  52.250  1.00 33.30  ?  554  LEU A CD1   1 
ATOM   4579  C CD2   . LEU A 1 557 ? 10.212  27.460  50.139  1.00 38.42  ?  554  LEU A CD2   1 
ATOM   4580  N N     . LYS A 1 558 ? 8.167   23.386  53.381  1.00 33.83  ?  555  LYS A N     1 
ATOM   4581  C CA    . LYS A 1 558 ? 8.339   22.165  54.155  1.00 44.11  ?  555  LYS A CA    1 
ATOM   4582  C C     . LYS A 1 558 ? 8.770   21.018  53.250  1.00 45.68  ?  555  LYS A C     1 
ATOM   4583  O O     . LYS A 1 558 ? 8.210   20.819  52.166  1.00 34.23  ?  555  LYS A O     1 
ATOM   4584  C CB    . LYS A 1 558 ? 7.045   21.809  54.889  1.00 42.67  ?  555  LYS A CB    1 
ATOM   4585  C CG    . LYS A 1 558 ? 6.539   22.891  55.836  1.00 36.98  ?  555  LYS A CG    1 
ATOM   4586  C CD    . LYS A 1 558 ? 5.784   22.273  57.004  1.00 43.52  ?  555  LYS A CD    1 
ATOM   4587  C CE    . LYS A 1 558 ? 4.910   23.292  57.717  1.00 50.45  ?  555  LYS A CE    1 
ATOM   4588  N NZ    . LYS A 1 558 ? 3.657   23.565  56.958  1.00 55.14  1  555  LYS A NZ    1 
ATOM   4589  N N     . GLU A 1 559 ? 9.783   20.276  53.702  1.00 40.82  ?  556  GLU A N     1 
ATOM   4590  C CA    . GLU A 1 559 ? 10.425  19.169  52.996  1.00 38.10  ?  556  GLU A CA    1 
ATOM   4591  C C     . GLU A 1 559 ? 11.240  19.627  51.792  1.00 38.91  ?  556  GLU A C     1 
ATOM   4592  O O     . GLU A 1 559 ? 11.638  18.795  50.968  1.00 38.71  ?  556  GLU A O     1 
ATOM   4593  C CB    . GLU A 1 559 ? 9.409   18.102  52.567  1.00 41.70  ?  556  GLU A CB    1 
ATOM   4594  C CG    . GLU A 1 559 ? 8.602   17.541  53.734  1.00 41.45  ?  556  GLU A CG    1 
ATOM   4595  C CD    . GLU A 1 559 ? 7.603   16.484  53.308  1.00 55.93  ?  556  GLU A CD    1 
ATOM   4596  O OE1   . GLU A 1 559 ? 6.384   16.752  53.366  1.00 60.60  ?  556  GLU A OE1   1 
ATOM   4597  O OE2   . GLU A 1 559 ? 8.040   15.384  52.911  1.00 55.22  -1 556  GLU A OE2   1 
ATOM   4598  N N     . TRP A 1 560 ? 11.515  20.923  51.673  1.00 36.89  ?  557  TRP A N     1 
ATOM   4599  C CA    . TRP A 1 560 ? 12.345  21.461  50.608  1.00 36.62  ?  557  TRP A CA    1 
ATOM   4600  C C     . TRP A 1 560 ? 13.727  21.822  51.136  1.00 33.76  ?  557  TRP A C     1 
ATOM   4601  O O     . TRP A 1 560 ? 13.883  22.247  52.283  1.00 33.53  ?  557  TRP A O     1 
ATOM   4602  C CB    . TRP A 1 560 ? 11.703  22.701  49.981  1.00 40.09  ?  557  TRP A CB    1 
ATOM   4603  C CG    . TRP A 1 560 ? 10.602  22.384  49.033  1.00 38.43  ?  557  TRP A CG    1 
ATOM   4604  C CD1   . TRP A 1 560 ? 9.282   22.205  49.332  1.00 34.42  ?  557  TRP A CD1   1 
ATOM   4605  C CD2   . TRP A 1 560 ? 10.722  22.202  47.619  1.00 40.44  ?  557  TRP A CD2   1 
ATOM   4606  N NE1   . TRP A 1 560 ? 8.573   21.924  48.189  1.00 36.74  ?  557  TRP A NE1   1 
ATOM   4607  C CE2   . TRP A 1 560 ? 9.435   21.917  47.123  1.00 39.25  ?  557  TRP A CE2   1 
ATOM   4608  C CE3   . TRP A 1 560 ? 11.794  22.253  46.723  1.00 35.87  ?  557  TRP A CE3   1 
ATOM   4609  C CZ2   . TRP A 1 560 ? 9.191   21.684  45.772  1.00 40.66  ?  557  TRP A CZ2   1 
ATOM   4610  C CZ3   . TRP A 1 560 ? 11.550  22.021  45.382  1.00 42.07  ?  557  TRP A CZ3   1 
ATOM   4611  C CH2   . TRP A 1 560 ? 10.260  21.741  44.919  1.00 43.57  ?  557  TRP A CH2   1 
ATOM   4612  N N     . ILE A 1 561 ? 14.730  21.647  50.280  1.00 33.81  ?  558  ILE A N     1 
ATOM   4613  C CA    . ILE A 1 561 ? 16.097  22.078  50.551  1.00 33.60  ?  558  ILE A CA    1 
ATOM   4614  C C     . ILE A 1 561 ? 16.410  23.240  49.618  1.00 42.15  ?  558  ILE A C     1 
ATOM   4615  O O     . ILE A 1 561 ? 16.312  23.105  48.392  1.00 46.13  ?  558  ILE A O     1 
ATOM   4616  C CB    . ILE A 1 561 ? 17.107  20.934  50.368  1.00 34.40  ?  558  ILE A CB    1 
ATOM   4617  C CG1   . ILE A 1 561 ? 16.876  19.840  51.411  1.00 37.21  ?  558  ILE A CG1   1 
ATOM   4618  C CG2   . ILE A 1 561 ? 18.531  21.462  50.461  1.00 33.45  ?  558  ILE A CG2   1 
ATOM   4619  C CD1   . ILE A 1 561 ? 17.997  18.819  51.476  1.00 38.97  ?  558  ILE A CD1   1 
ATOM   4620  N N     . ILE A 1 562 ? 16.785  24.376  50.197  1.00 33.42  ?  559  ILE A N     1 
ATOM   4621  C CA    . ILE A 1 562 ? 17.047  25.600  49.450  1.00 33.41  ?  559  ILE A CA    1 
ATOM   4622  C C     . ILE A 1 562 ? 18.535  25.905  49.525  1.00 36.08  ?  559  ILE A C     1 
ATOM   4623  O O     . ILE A 1 562 ? 19.132  25.855  50.606  1.00 43.52  ?  559  ILE A O     1 
ATOM   4624  C CB    . ILE A 1 562 ? 16.214  26.773  49.991  1.00 41.77  ?  559  ILE A CB    1 
ATOM   4625  C CG1   . ILE A 1 562 ? 14.725  26.501  49.772  1.00 40.67  ?  559  ILE A CG1   1 
ATOM   4626  C CG2   . ILE A 1 562 ? 16.629  28.084  49.337  1.00 55.96  ?  559  ILE A CG2   1 
ATOM   4627  C CD1   . ILE A 1 562 ? 13.825  27.543  50.387  1.00 48.62  ?  559  ILE A CD1   1 
ATOM   4628  N N     . LYS A 1 563 ? 19.130  26.219  48.379  1.00 39.72  ?  560  LYS A N     1 
ATOM   4629  C CA    . LYS A 1 563 ? 20.533  26.602  48.310  1.00 37.46  ?  560  LYS A CA    1 
ATOM   4630  C C     . LYS A 1 563 ? 20.648  28.116  48.410  1.00 36.80  ?  560  LYS A C     1 
ATOM   4631  O O     . LYS A 1 563 ? 20.059  28.842  47.603  1.00 46.65  ?  560  LYS A O     1 
ATOM   4632  C CB    . LYS A 1 563 ? 21.167  26.101  47.014  1.00 43.03  ?  560  LYS A CB    1 
ATOM   4633  C CG    . LYS A 1 563 ? 22.517  26.722  46.702  1.00 51.58  ?  560  LYS A CG    1 
ATOM   4634  C CD    . LYS A 1 563 ? 23.379  25.750  45.920  1.00 54.58  ?  560  LYS A CD    1 
ATOM   4635  C CE    . LYS A 1 563 ? 24.270  26.458  44.920  1.00 45.62  ?  560  LYS A CE    1 
ATOM   4636  N NZ    . LYS A 1 563 ? 25.145  25.491  44.202  1.00 54.89  1  560  LYS A NZ    1 
ATOM   4637  N N     . LEU A 1 564 ? 21.400  28.589  49.402  1.00 36.53  ?  561  LEU A N     1 
ATOM   4638  C CA    . LEU A 1 564 ? 21.718  30.007  49.514  1.00 37.14  ?  561  LEU A CA    1 
ATOM   4639  C C     . LEU A 1 564 ? 22.935  30.372  48.673  1.00 47.13  ?  561  LEU A C     1 
ATOM   4640  O O     . LEU A 1 564 ? 22.862  31.263  47.820  1.00 46.47  ?  561  LEU A O     1 
ATOM   4641  C CB    . LEU A 1 564 ? 21.957  30.378  50.978  1.00 32.45  ?  561  LEU A CB    1 
ATOM   4642  C CG    . LEU A 1 564 ? 20.780  30.139  51.916  1.00 36.76  ?  561  LEU A CG    1 
ATOM   4643  C CD1   . LEU A 1 564 ? 21.164  30.540  53.330  1.00 41.33  ?  561  LEU A CD1   1 
ATOM   4644  C CD2   . LEU A 1 564 ? 19.555  30.907  51.443  1.00 36.59  ?  561  LEU A CD2   1 
ATOM   4645  N N     . ASP A 1 565 ? 24.058  29.701  48.910  1.00 41.69  ?  562  ASP A N     1 
ATOM   4646  C CA    . ASP A 1 565 ? 25.244  29.846  48.078  1.00 41.13  ?  562  ASP A CA    1 
ATOM   4647  C C     . ASP A 1 565 ? 25.915  28.483  47.971  1.00 40.71  ?  562  ASP A C     1 
ATOM   4648  O O     . ASP A 1 565 ? 25.324  27.451  48.306  1.00 39.52  ?  562  ASP A O     1 
ATOM   4649  C CB    . ASP A 1 565 ? 26.188  30.924  48.631  1.00 47.73  ?  562  ASP A CB    1 
ATOM   4650  C CG    . ASP A 1 565 ? 26.669  30.631  50.044  1.00 54.02  ?  562  ASP A CG    1 
ATOM   4651  O OD1   . ASP A 1 565 ? 27.102  29.493  50.324  1.00 52.18  ?  562  ASP A OD1   1 
ATOM   4652  O OD2   . ASP A 1 565 ? 26.623  31.556  50.881  1.00 66.10  -1 562  ASP A OD2   1 
ATOM   4653  N N     . GLU A 1 566 ? 27.174  28.487  47.533  1.00 40.31  ?  563  GLU A N     1 
ATOM   4654  C CA    . GLU A 1 566 ? 27.848  27.239  47.201  1.00 45.58  ?  563  GLU A CA    1 
ATOM   4655  C C     . GLU A 1 566 ? 28.026  26.341  48.419  1.00 47.39  ?  563  GLU A C     1 
ATOM   4656  O O     . GLU A 1 566 ? 28.038  25.111  48.286  1.00 45.03  ?  563  GLU A O     1 
ATOM   4657  C CB    . GLU A 1 566 ? 29.200  27.541  46.553  1.00 56.05  ?  563  GLU A CB    1 
ATOM   4658  C CG    . GLU A 1 566 ? 29.776  26.397  45.732  1.00 61.62  ?  563  GLU A CG    1 
ATOM   4659  C CD    . GLU A 1 566 ? 28.923  26.037  44.523  1.00 59.46  ?  563  GLU A CD    1 
ATOM   4660  O OE1   . GLU A 1 566 ? 28.006  26.810  44.169  1.00 58.13  ?  563  GLU A OE1   1 
ATOM   4661  O OE2   . GLU A 1 566 ? 29.176  24.971  43.922  1.00 49.42  -1 563  GLU A OE2   1 
ATOM   4662  N N     . ASN A 1 567 ? 28.149  26.925  49.610  1.00 47.87  ?  564  ASN A N     1 
ATOM   4663  C CA    . ASN A 1 567 ? 28.446  26.162  50.816  1.00 40.83  ?  564  ASN A CA    1 
ATOM   4664  C C     . ASN A 1 567 ? 27.364  26.272  51.883  1.00 37.21  ?  564  ASN A C     1 
ATOM   4665  O O     . ASN A 1 567 ? 27.561  25.771  52.995  1.00 36.43  ?  564  ASN A O     1 
ATOM   4666  C CB    . ASN A 1 567 ? 29.791  26.604  51.399  1.00 43.42  ?  564  ASN A CB    1 
ATOM   4667  C CG    . ASN A 1 567 ? 30.971  26.008  50.659  1.00 58.56  ?  564  ASN A CG    1 
ATOM   4668  O OD1   . ASN A 1 567 ? 31.237  26.352  49.507  1.00 68.22  ?  564  ASN A OD1   1 
ATOM   4669  N ND2   . ASN A 1 567 ? 31.692  25.112  51.323  1.00 59.39  ?  564  ASN A ND2   1 
ATOM   4670  N N     . THR A 1 568 ? 26.230  26.904  51.588  1.00 35.22  ?  565  THR A N     1 
ATOM   4671  C CA    . THR A 1 568 ? 25.210  27.163  52.598  1.00 40.20  ?  565  THR A CA    1 
ATOM   4672  C C     . THR A 1 568 ? 23.845  26.768  52.058  1.00 33.99  ?  565  THR A C     1 
ATOM   4673  O O     . THR A 1 568 ? 23.414  27.279  51.019  1.00 31.95  ?  565  THR A O     1 
ATOM   4674  C CB    . THR A 1 568 ? 25.216  28.635  53.017  1.00 47.72  ?  565  THR A CB    1 
ATOM   4675  O OG1   . THR A 1 568 ? 26.570  29.098  53.084  1.00 49.93  ?  565  THR A OG1   1 
ATOM   4676  C CG2   . THR A 1 568 ? 24.582  28.797  54.388  1.00 52.56  ?  565  THR A CG2   1 
ATOM   4677  N N     . TYR A 1 569 ? 23.167  25.868  52.769  1.00 30.28  ?  566  TYR A N     1 
ATOM   4678  C CA    . TYR A 1 569 ? 21.830  25.417  52.413  1.00 30.76  ?  566  TYR A CA    1 
ATOM   4679  C C     . TYR A 1 569 ? 20.903  25.562  53.612  1.00 37.09  ?  566  TYR A C     1 
ATOM   4680  O O     . TYR A 1 569 ? 21.343  25.700  54.756  1.00 38.31  ?  566  TYR A O     1 
ATOM   4681  C CB    . TYR A 1 569 ? 21.819  23.952  51.948  1.00 38.46  ?  566  TYR A CB    1 
ATOM   4682  C CG    . TYR A 1 569 ? 22.492  23.689  50.619  1.00 36.19  ?  566  TYR A CG    1 
ATOM   4683  C CD1   . TYR A 1 569 ? 23.870  23.776  50.488  1.00 40.01  ?  566  TYR A CD1   1 
ATOM   4684  C CD2   . TYR A 1 569 ? 21.749  23.324  49.502  1.00 36.09  ?  566  TYR A CD2   1 
ATOM   4685  C CE1   . TYR A 1 569 ? 24.490  23.526  49.280  1.00 42.03  ?  566  TYR A CE1   1 
ATOM   4686  C CE2   . TYR A 1 569 ? 22.363  23.069  48.287  1.00 39.15  ?  566  TYR A CE2   1 
ATOM   4687  C CZ    . TYR A 1 569 ? 23.733  23.171  48.184  1.00 39.39  ?  566  TYR A CZ    1 
ATOM   4688  O OH    . TYR A 1 569 ? 24.348  22.918  46.980  1.00 39.85  ?  566  TYR A OH    1 
ATOM   4689  N N     . ILE A 1 570 ? 19.603  25.523  53.331  1.00 33.40  ?  567  ILE A N     1 
ATOM   4690  C CA    . ILE A 1 570 ? 18.566  25.500  54.355  1.00 31.39  ?  567  ILE A CA    1 
ATOM   4691  C C     . ILE A 1 570 ? 17.567  24.423  53.981  1.00 37.54  ?  567  ILE A C     1 
ATOM   4692  O O     . ILE A 1 570 ? 17.072  24.400  52.849  1.00 31.36  ?  567  ILE A O     1 
ATOM   4693  C CB    . ILE A 1 570 ? 17.840  26.852  54.490  1.00 40.04  ?  567  ILE A CB    1 
ATOM   4694  C CG1   . ILE A 1 570 ? 18.829  27.989  54.692  1.00 44.26  ?  567  ILE A CG1   1 
ATOM   4695  C CG2   . ILE A 1 570 ? 16.849  26.815  55.646  1.00 44.04  ?  567  ILE A CG2   1 
ATOM   4696  C CD1   . ILE A 1 570 ? 18.155  29.328  54.801  1.00 52.84  ?  567  ILE A CD1   1 
ATOM   4697  N N     . TYR A 1 571 ? 17.262  23.537  54.922  1.00 35.97  ?  568  TYR A N     1 
ATOM   4698  C CA    . TYR A 1 571 ? 16.157  22.612  54.742  1.00 26.98  ?  568  TYR A CA    1 
ATOM   4699  C C     . TYR A 1 571 ? 15.069  22.916  55.761  1.00 23.44  ?  568  TYR A C     1 
ATOM   4700  O O     . TYR A 1 571 ? 15.339  23.391  56.869  1.00 30.32  ?  568  TYR A O     1 
ATOM   4701  C CB    . TYR A 1 571 ? 16.610  21.146  54.835  1.00 33.45  ?  568  TYR A CB    1 
ATOM   4702  C CG    . TYR A 1 571 ? 16.944  20.622  56.216  1.00 23.42  ?  568  TYR A CG    1 
ATOM   4703  C CD1   . TYR A 1 571 ? 15.944  20.179  57.076  1.00 27.84  ?  568  TYR A CD1   1 
ATOM   4704  C CD2   . TYR A 1 571 ? 18.262  20.520  56.640  1.00 24.93  ?  568  TYR A CD2   1 
ATOM   4705  C CE1   . TYR A 1 571 ? 16.246  19.683  58.332  1.00 29.71  ?  568  TYR A CE1   1 
ATOM   4706  C CE2   . TYR A 1 571 ? 18.573  20.021  57.893  1.00 34.16  ?  568  TYR A CE2   1 
ATOM   4707  C CZ    . TYR A 1 571 ? 17.562  19.606  58.735  1.00 29.25  ?  568  TYR A CZ    1 
ATOM   4708  O OH    . TYR A 1 571 ? 17.865  19.110  59.983  1.00 28.18  ?  568  TYR A OH    1 
ATOM   4709  N N     . TYR A 1 572 ? 13.830  22.664  55.355  1.00 27.69  ?  569  TYR A N     1 
ATOM   4710  C CA    . TYR A 1 572 ? 12.661  22.862  56.208  1.00 24.79  ?  569  TYR A CA    1 
ATOM   4711  C C     . TYR A 1 572 ? 12.015  21.502  56.417  1.00 33.78  ?  569  TYR A C     1 
ATOM   4712  O O     . TYR A 1 572 ? 11.302  21.008  55.525  1.00 33.65  ?  569  TYR A O     1 
ATOM   4713  C CB    . TYR A 1 572 ? 11.680  23.848  55.574  1.00 34.79  ?  569  TYR A CB    1 
ATOM   4714  C CG    . TYR A 1 572 ? 12.248  25.246  55.420  1.00 31.52  ?  569  TYR A CG    1 
ATOM   4715  C CD1   . TYR A 1 572 ? 13.119  25.554  54.382  1.00 36.82  ?  569  TYR A CD1   1 
ATOM   4716  C CD2   . TYR A 1 572 ? 11.913  26.257  56.314  1.00 31.31  ?  569  TYR A CD2   1 
ATOM   4717  C CE1   . TYR A 1 572 ? 13.643  26.824  54.240  1.00 34.44  ?  569  TYR A CE1   1 
ATOM   4718  C CE2   . TYR A 1 572 ? 12.432  27.531  56.182  1.00 35.76  ?  569  TYR A CE2   1 
ATOM   4719  C CZ    . TYR A 1 572 ? 13.297  27.810  55.141  1.00 39.42  ?  569  TYR A CZ    1 
ATOM   4720  O OH    . TYR A 1 572 ? 13.818  29.076  54.999  1.00 39.90  ?  569  TYR A OH    1 
ATOM   4721  N N     . PRO A 1 573 ? 12.245  20.852  57.554  1.00 35.88  ?  570  PRO A N     1 
ATOM   4722  C CA    . PRO A 1 573 ? 11.742  19.488  57.741  1.00 35.82  ?  570  PRO A CA    1 
ATOM   4723  C C     . PRO A 1 573 ? 10.228  19.463  57.872  1.00 45.19  ?  570  PRO A C     1 
ATOM   4724  O O     . PRO A 1 573 ? 9.587   20.454  58.230  1.00 36.10  ?  570  PRO A O     1 
ATOM   4725  C CB    . PRO A 1 573 ? 12.418  19.036  59.040  1.00 35.97  ?  570  PRO A CB    1 
ATOM   4726  C CG    . PRO A 1 573 ? 12.661  20.313  59.788  1.00 35.63  ?  570  PRO A CG    1 
ATOM   4727  C CD    . PRO A 1 573 ? 12.958  21.352  58.743  1.00 35.75  ?  570  PRO A CD    1 
ATOM   4728  N N     . LYS A 1 574 ? 9.657   18.298  57.566  1.00 42.38  ?  571  LYS A N     1 
ATOM   4729  C CA    . LYS A 1 574 ? 8.214   18.135  57.670  1.00 39.11  ?  571  LYS A CA    1 
ATOM   4730  C C     . LYS A 1 574 ? 7.768   18.327  59.113  1.00 40.67  ?  571  LYS A C     1 
ATOM   4731  O O     . LYS A 1 574 ? 8.378   17.799  60.048  1.00 45.48  ?  571  LYS A O     1 
ATOM   4732  C CB    . LYS A 1 574 ? 7.785   16.758  57.164  1.00 36.11  ?  571  LYS A CB    1 
ATOM   4733  C CG    . LYS A 1 574 ? 6.275   16.557  57.180  1.00 36.28  ?  571  LYS A CG    1 
ATOM   4734  C CD    . LYS A 1 574 ? 5.841   15.335  56.382  1.00 43.64  ?  571  LYS A CD    1 
ATOM   4735  C CE    . LYS A 1 574 ? 5.982   14.049  57.184  1.00 55.08  ?  571  LYS A CE    1 
ATOM   4736  N NZ    . LYS A 1 574 ? 7.403   13.710  57.476  1.00 62.77  1  571  LYS A NZ    1 
ATOM   4737  N N     . THR A 1 575 ? 6.702   19.102  59.290  1.00 41.58  ?  572  THR A N     1 
ATOM   4738  C CA    . THR A 1 575 ? 6.211   19.447  60.615  1.00 43.48  ?  572  THR A CA    1 
ATOM   4739  C C     . THR A 1 575 ? 4.743   19.830  60.497  1.00 47.73  ?  572  THR A C     1 
ATOM   4740  O O     . THR A 1 575 ? 4.341   20.470  59.521  1.00 52.25  ?  572  THR A O     1 
ATOM   4741  C CB    . THR A 1 575 ? 7.022   20.603  61.222  1.00 49.73  ?  572  THR A CB    1 
ATOM   4742  O OG1   . THR A 1 575 ? 8.420   20.290  61.185  1.00 67.90  ?  572  THR A OG1   1 
ATOM   4743  C CG2   . THR A 1 575 ? 6.623   20.845  62.656  1.00 38.65  ?  572  THR A CG2   1 
ATOM   4744  N N     . PHE A 1 576 ? 3.945   19.420  61.479  1.00 49.41  ?  573  PHE A N     1 
ATOM   4745  C CA    . PHE A 1 576 ? 2.564   19.872  61.578  1.00 51.81  ?  573  PHE A CA    1 
ATOM   4746  C C     . PHE A 1 576 ? 2.435   21.171  62.365  1.00 43.75  ?  573  PHE A C     1 
ATOM   4747  O O     . PHE A 1 576 ? 1.313   21.636  62.587  1.00 51.94  ?  573  PHE A O     1 
ATOM   4748  C CB    . PHE A 1 576 ? 1.682   18.782  62.207  1.00 54.40  ?  573  PHE A CB    1 
ATOM   4749  C CG    . PHE A 1 576 ? 2.165   18.299  63.547  1.00 60.38  ?  573  PHE A CG    1 
ATOM   4750  C CD1   . PHE A 1 576 ? 3.072   17.255  63.636  1.00 60.91  ?  573  PHE A CD1   1 
ATOM   4751  C CD2   . PHE A 1 576 ? 1.703   18.879  64.718  1.00 61.30  ?  573  PHE A CD2   1 
ATOM   4752  C CE1   . PHE A 1 576 ? 3.516   16.805  64.865  1.00 63.19  ?  573  PHE A CE1   1 
ATOM   4753  C CE2   . PHE A 1 576 ? 2.142   18.431  65.952  1.00 59.57  ?  573  PHE A CE2   1 
ATOM   4754  C CZ    . PHE A 1 576 ? 3.054   17.396  66.023  1.00 58.65  ?  573  PHE A CZ    1 
ATOM   4755  N N     . LEU A 1 577 ? 3.550   21.763  62.785  1.00 45.88  ?  574  LEU A N     1 
ATOM   4756  C CA    . LEU A 1 577 ? 3.583   23.055  63.450  1.00 43.33  ?  574  LEU A CA    1 
ATOM   4757  C C     . LEU A 1 577 ? 3.989   24.135  62.444  1.00 43.53  ?  574  LEU A C     1 
ATOM   4758  O O     . LEU A 1 577 ? 3.840   23.960  61.229  1.00 43.14  ?  574  LEU A O     1 
ATOM   4759  C CB    . LEU A 1 577 ? 4.540   23.011  64.649  1.00 50.17  ?  574  LEU A CB    1 
ATOM   4760  C CG    . LEU A 1 577 ? 4.245   22.142  65.873  1.00 51.56  ?  574  LEU A CG    1 
ATOM   4761  C CD1   . LEU A 1 577 ? 4.673   20.706  65.644  1.00 53.26  ?  574  LEU A CD1   1 
ATOM   4762  C CD2   . LEU A 1 577 ? 4.942   22.715  67.099  1.00 50.61  ?  574  LEU A CD2   1 
ATOM   4763  N N     . ASN A 1 578 ? 4.519   25.248  62.943  1.00 50.42  ?  575  ASN A N     1 
ATOM   4764  C CA    . ASN A 1 578 ? 4.945   26.336  62.077  1.00 50.12  ?  575  ASN A CA    1 
ATOM   4765  C C     . ASN A 1 578 ? 6.178   25.941  61.273  1.00 45.75  ?  575  ASN A C     1 
ATOM   4766  O O     . ASN A 1 578 ? 7.006   25.138  61.709  1.00 44.96  ?  575  ASN A O     1 
ATOM   4767  C CB    . ASN A 1 578 ? 5.242   27.591  62.896  1.00 50.57  ?  575  ASN A CB    1 
ATOM   4768  C CG    . ASN A 1 578 ? 3.994   28.210  63.482  1.00 62.03  ?  575  ASN A CG    1 
ATOM   4769  O OD1   . ASN A 1 578 ? 3.017   28.449  62.772  1.00 66.20  ?  575  ASN A OD1   1 
ATOM   4770  N ND2   . ASN A 1 578 ? 4.011   28.460  64.786  1.00 67.49  ?  575  ASN A ND2   1 
ATOM   4771  N N     . GLN A 1 579 ? 6.289   26.524  60.084  1.00 43.37  ?  576  GLN A N     1 
ATOM   4772  C CA    . GLN A 1 579 ? 7.409   26.262  59.188  1.00 36.76  ?  576  GLN A CA    1 
ATOM   4773  C C     . GLN A 1 579 ? 8.685   26.852  59.779  1.00 36.61  ?  576  GLN A C     1 
ATOM   4774  O O     . GLN A 1 579 ? 8.809   28.073  59.914  1.00 36.69  ?  576  GLN A O     1 
ATOM   4775  C CB    . GLN A 1 579 ? 7.103   26.857  57.818  1.00 41.89  ?  576  GLN A CB    1 
ATOM   4776  C CG    . GLN A 1 579 ? 8.158   26.641  56.760  1.00 37.29  ?  576  GLN A CG    1 
ATOM   4777  C CD    . GLN A 1 579 ? 7.705   27.155  55.408  1.00 37.27  ?  576  GLN A CD    1 
ATOM   4778  O OE1   . GLN A 1 579 ? 7.275   26.382  54.552  1.00 45.28  ?  576  GLN A OE1   1 
ATOM   4779  N NE2   . GLN A 1 579 ? 7.787   28.467  55.214  1.00 37.25  ?  576  GLN A NE2   1 
ATOM   4780  N N     . LYS A 1 580 ? 9.634   25.989  60.140  1.00 36.40  ?  577  LYS A N     1 
ATOM   4781  C CA    . LYS A 1 580 ? 10.910  26.413  60.698  1.00 36.45  ?  577  LYS A CA    1 
ATOM   4782  C C     . LYS A 1 580 ? 12.042  25.799  59.890  1.00 36.12  ?  577  LYS A C     1 
ATOM   4783  O O     . LYS A 1 580 ? 11.948  24.652  59.444  1.00 41.71  ?  577  LYS A O     1 
ATOM   4784  C CB    . LYS A 1 580 ? 11.050  26.012  62.174  1.00 36.09  ?  577  LYS A CB    1 
ATOM   4785  C CG    . LYS A 1 580 ? 10.036  26.661  63.101  1.00 45.47  ?  577  LYS A CG    1 
ATOM   4786  C CD    . LYS A 1 580 ? 10.607  26.851  64.500  1.00 57.47  ?  577  LYS A CD    1 
ATOM   4787  C CE    . LYS A 1 580 ? 11.229  25.568  65.031  1.00 51.60  ?  577  LYS A CE    1 
ATOM   4788  N NZ    . LYS A 1 580 ? 11.761  25.735  66.413  1.00 47.08  1  577  LYS A NZ    1 
ATOM   4789  N N     . GLY A 1 581 ? 13.114  26.565  59.711  1.00 36.08  ?  578  GLY A N     1 
ATOM   4790  C CA    . GLY A 1 581 ? 14.227  26.144  58.895  1.00 35.98  ?  578  GLY A CA    1 
ATOM   4791  C C     . GLY A 1 581 ? 15.420  25.674  59.702  1.00 35.76  ?  578  GLY A C     1 
ATOM   4792  O O     . GLY A 1 581 ? 15.573  25.997  60.878  1.00 35.68  ?  578  GLY A O     1 
ATOM   4793  N N     . VAL A 1 582 ? 16.276  24.902  59.039  1.00 35.66  ?  579  VAL A N     1 
ATOM   4794  C CA    . VAL A 1 582 ? 17.532  24.430  59.607  1.00 35.45  ?  579  VAL A CA    1 
ATOM   4795  C C     . VAL A 1 582 ? 18.638  24.756  58.616  1.00 36.58  ?  579  VAL A C     1 
ATOM   4796  O O     . VAL A 1 582 ? 18.640  24.239  57.492  1.00 39.07  ?  579  VAL A O     1 
ATOM   4797  C CB    . VAL A 1 582 ? 17.506  22.922  59.912  1.00 35.31  ?  579  VAL A CB    1 
ATOM   4798  C CG1   . VAL A 1 582 ? 18.871  22.463  60.381  1.00 35.10  ?  579  VAL A CG1   1 
ATOM   4799  C CG2   . VAL A 1 582 ? 16.448  22.607  60.957  1.00 35.32  ?  579  VAL A CG2   1 
ATOM   4800  N N     . GLU A 1 583 ? 19.567  25.613  59.026  1.00 35.39  ?  580  GLU A N     1 
ATOM   4801  C CA    . GLU A 1 583 ? 20.667  26.030  58.168  1.00 38.55  ?  580  GLU A CA    1 
ATOM   4802  C C     . GLU A 1 583 ? 21.812  25.032  58.247  1.00 38.02  ?  580  GLU A C     1 
ATOM   4803  O O     . GLU A 1 583 ? 22.154  24.543  59.326  1.00 38.33  ?  580  GLU A O     1 
ATOM   4804  C CB    . GLU A 1 583 ? 21.164  27.420  58.564  1.00 35.42  ?  580  GLU A CB    1 
ATOM   4805  C CG    . GLU A 1 583 ? 21.015  28.458  57.477  1.00 41.64  ?  580  GLU A CG    1 
ATOM   4806  C CD    . GLU A 1 583 ? 21.608  29.794  57.865  1.00 41.92  ?  580  GLU A CD    1 
ATOM   4807  O OE1   . GLU A 1 583 ? 22.835  29.967  57.706  1.00 38.96  ?  580  GLU A OE1   1 
ATOM   4808  O OE2   . GLU A 1 583 ? 20.847  30.667  58.338  1.00 41.14  -1 580  GLU A OE2   1 
ATOM   4809  N N     . VAL A 1 584 ? 22.402  24.733  57.094  1.00 36.70  ?  581  VAL A N     1 
ATOM   4810  C CA    . VAL A 1 584 ? 23.506  23.788  56.982  1.00 35.03  ?  581  VAL A CA    1 
ATOM   4811  C C     . VAL A 1 584 ? 24.620  24.472  56.201  1.00 36.83  ?  581  VAL A C     1 
ATOM   4812  O O     . VAL A 1 584 ? 24.413  24.876  55.050  1.00 35.20  ?  581  VAL A O     1 
ATOM   4813  C CB    . VAL A 1 584 ? 23.078  22.484  56.286  1.00 35.02  ?  581  VAL A CB    1 
ATOM   4814  C CG1   . VAL A 1 584 ? 24.175  21.447  56.374  1.00 34.84  ?  581  VAL A CG1   1 
ATOM   4815  C CG2   . VAL A 1 584 ? 21.785  21.950  56.886  1.00 35.05  ?  581  VAL A CG2   1 
ATOM   4816  N N     . LYS A 1 585 ? 25.793  24.602  56.818  1.00 34.92  ?  582  LYS A N     1 
ATOM   4817  C CA    . LYS A 1 585 ? 26.927  25.286  56.204  1.00 39.25  ?  582  LYS A CA    1 
ATOM   4818  C C     . LYS A 1 585 ? 28.134  24.361  56.200  1.00 34.76  ?  582  LYS A C     1 
ATOM   4819  O O     . LYS A 1 585 ? 28.619  23.970  57.265  1.00 40.97  ?  582  LYS A O     1 
ATOM   4820  C CB    . LYS A 1 585 ? 27.261  26.582  56.946  1.00 34.95  ?  582  LYS A CB    1 
ATOM   4821  C CG    . LYS A 1 585 ? 28.487  27.298  56.399  1.00 38.20  ?  582  LYS A CG    1 
ATOM   4822  C CD    . LYS A 1 585 ? 28.902  28.471  57.269  1.00 45.89  ?  582  LYS A CD    1 
ATOM   4823  C CE    . LYS A 1 585 ? 30.036  29.235  56.621  1.00 60.09  ?  582  LYS A CE    1 
ATOM   4824  N NZ    . LYS A 1 585 ? 31.112  28.315  56.143  1.00 64.12  1  582  LYS A NZ    1 
ATOM   4825  N N     . ILE A 1 586 ? 28.630  24.033  55.009  1.00 34.80  ?  583  ILE A N     1 
ATOM   4826  C CA    . ILE A 1 586 ? 29.828  23.205  54.867  1.00 39.79  ?  583  ILE A CA    1 
ATOM   4827  C C     . ILE A 1 586 ? 31.035  24.100  55.133  1.00 35.06  ?  583  ILE A C     1 
ATOM   4828  O O     . ILE A 1 586 ? 31.492  24.821  54.246  1.00 45.56  ?  583  ILE A O     1 
ATOM   4829  C CB    . ILE A 1 586 ? 29.909  22.546  53.488  1.00 37.86  ?  583  ILE A CB    1 
ATOM   4830  C CG1   . ILE A 1 586 ? 28.575  21.891  53.122  1.00 34.79  ?  583  ILE A CG1   1 
ATOM   4831  C CG2   . ILE A 1 586 ? 31.028  21.512  53.464  1.00 42.17  ?  583  ILE A CG2   1 
ATOM   4832  C CD1   . ILE A 1 586 ? 28.218  20.702  53.988  1.00 44.07  ?  583  ILE A CD1   1 
ATOM   4833  N N     . LEU A 1 587 ? 31.555  24.061  56.359  1.00 44.00  ?  584  LEU A N     1 
ATOM   4834  C CA    . LEU A 1 587 ? 32.746  24.840  56.684  1.00 45.90  ?  584  LEU A CA    1 
ATOM   4835  C C     . LEU A 1 587 ? 33.960  24.327  55.923  1.00 44.62  ?  584  LEU A C     1 
ATOM   4836  O O     . LEU A 1 587 ? 34.703  25.107  55.315  1.00 43.96  ?  584  LEU A O     1 
ATOM   4837  C CB    . LEU A 1 587 ? 33.006  24.802  58.190  1.00 46.13  ?  584  LEU A CB    1 
ATOM   4838  C CG    . LEU A 1 587 ? 32.624  26.036  59.004  1.00 47.75  ?  584  LEU A CG    1 
ATOM   4839  C CD1   . LEU A 1 587 ? 33.260  25.967  60.379  1.00 60.19  ?  584  LEU A CD1   1 
ATOM   4840  C CD2   . LEU A 1 587 ? 33.046  27.306  58.288  1.00 43.25  ?  584  LEU A CD2   1 
ATOM   4841  N N     . GLU A 1 588 ? 34.176  23.017  55.950  1.00 43.36  ?  585  GLU A N     1 
ATOM   4842  C CA    . GLU A 1 588 ? 35.309  22.397  55.286  1.00 39.60  ?  585  GLU A CA    1 
ATOM   4843  C C     . GLU A 1 588 ? 34.827  21.103  54.648  1.00 51.71  ?  585  GLU A C     1 
ATOM   4844  O O     . GLU A 1 588 ? 33.822  20.519  55.065  1.00 55.46  ?  585  GLU A O     1 
ATOM   4845  C CB    . GLU A 1 588 ? 36.456  22.114  56.263  1.00 37.82  ?  585  GLU A CB    1 
ATOM   4846  C CG    . GLU A 1 588 ? 37.843  22.381  55.703  1.00 54.56  ?  585  GLU A CG    1 
ATOM   4847  C CD    . GLU A 1 588 ? 38.155  23.862  55.612  1.00 55.79  ?  585  GLU A CD    1 
ATOM   4848  O OE1   . GLU A 1 588 ? 38.202  24.529  56.667  1.00 57.26  ?  585  GLU A OE1   1 
ATOM   4849  O OE2   . GLU A 1 588 ? 38.343  24.360  54.484  1.00 66.86  -1 585  GLU A OE2   1 
ATOM   4850  N N     . ASN A 1 589 ? 35.548  20.658  53.623  1.00 43.26  ?  586  ASN A N     1 
ATOM   4851  C CA    . ASN A 1 589 ? 35.210  19.391  52.986  1.00 37.02  ?  586  ASN A CA    1 
ATOM   4852  C C     . ASN A 1 589 ? 36.409  18.873  52.216  1.00 42.68  ?  586  ASN A C     1 
ATOM   4853  O O     . ASN A 1 589 ? 36.908  19.546  51.312  1.00 42.85  ?  586  ASN A O     1 
ATOM   4854  C CB    . ASN A 1 589 ? 34.005  19.532  52.053  1.00 43.26  ?  586  ASN A CB    1 
ATOM   4855  C CG    . ASN A 1 589 ? 33.655  18.234  51.353  1.00 40.15  ?  586  ASN A CG    1 
ATOM   4856  O OD1   . ASN A 1 589 ? 33.930  17.150  51.865  1.00 40.98  ?  586  ASN A OD1   1 
ATOM   4857  N ND2   . ASN A 1 589 ? 33.068  18.337  50.165  1.00 35.81  ?  586  ASN A ND2   1 
ATOM   4858  N N     . ASN A 1 590 ? 36.857  17.667  52.565  1.00 36.95  ?  587  ASN A N     1 
ATOM   4859  C CA    . ASN A 1 590 ? 37.851  16.941  51.784  1.00 43.03  ?  587  ASN A CA    1 
ATOM   4860  C C     . ASN A 1 590 ? 37.382  15.520  51.484  1.00 41.61  ?  587  ASN A C     1 
ATOM   4861  O O     . ASN A 1 590 ? 38.203  14.652  51.167  1.00 37.12  ?  587  ASN A O     1 
ATOM   4862  C CB    . ASN A 1 590 ? 39.212  16.927  52.488  1.00 41.96  ?  587  ASN A CB    1 
ATOM   4863  C CG    . ASN A 1 590 ? 39.130  16.441  53.922  1.00 55.23  ?  587  ASN A CG    1 
ATOM   4864  O OD1   . ASN A 1 590 ? 39.633  15.368  54.249  1.00 61.55  ?  587  ASN A OD1   1 
ATOM   4865  N ND2   . ASN A 1 590 ? 38.511  17.237  54.788  1.00 55.45  ?  587  ASN A ND2   1 
ATOM   4866  N N     . THR A 1 591 ? 36.075  15.268  51.572  1.00 37.00  ?  588  THR A N     1 
ATOM   4867  C CA    . THR A 1 591 ? 35.535  13.992  51.134  1.00 37.02  ?  588  THR A CA    1 
ATOM   4868  C C     . THR A 1 591 ? 35.397  13.987  49.613  1.00 44.50  ?  588  THR A C     1 
ATOM   4869  O O     . THR A 1 591 ? 35.540  15.014  48.941  1.00 43.16  ?  588  THR A O     1 
ATOM   4870  C CB    . THR A 1 591 ? 34.169  13.712  51.773  1.00 41.65  ?  588  THR A CB    1 
ATOM   4871  O OG1   . THR A 1 591 ? 33.212  14.672  51.318  1.00 39.23  ?  588  THR A OG1   1 
ATOM   4872  C CG2   . THR A 1 591 ? 34.245  13.758  53.294  1.00 37.02  ?  588  THR A CG2   1 
ATOM   4873  N N     . ASP A 1 592 ? 35.120  12.808  49.066  1.00 38.37  ?  589  ASP A N     1 
ATOM   4874  C CA    . ASP A 1 592 ? 34.832  12.667  47.645  1.00 46.12  ?  589  ASP A CA    1 
ATOM   4875  C C     . ASP A 1 592 ? 33.383  12.996  47.305  1.00 49.40  ?  589  ASP A C     1 
ATOM   4876  O O     . ASP A 1 592 ? 32.988  12.883  46.140  1.00 51.06  ?  589  ASP A O     1 
ATOM   4877  C CB    . ASP A 1 592 ? 35.169  11.249  47.186  1.00 58.29  ?  589  ASP A CB    1 
ATOM   4878  C CG    . ASP A 1 592 ? 36.626  10.899  47.432  1.00 65.46  ?  589  ASP A CG    1 
ATOM   4879  O OD1   . ASP A 1 592 ? 37.471  11.823  47.430  1.00 54.26  ?  589  ASP A OD1   1 
ATOM   4880  O OD2   . ASP A 1 592 ? 36.929  9.701   47.616  1.00 71.80  -1 589  ASP A OD2   1 
ATOM   4881  N N     . TYR A 1 593 ? 32.592  13.402  48.293  1.00 40.57  ?  590  TYR A N     1 
ATOM   4882  C CA    . TYR A 1 593 ? 31.223  13.824  48.054  1.00 40.46  ?  590  TYR A CA    1 
ATOM   4883  C C     . TYR A 1 593 ? 31.185  15.293  47.665  1.00 43.14  ?  590  TYR A C     1 
ATOM   4884  O O     . TYR A 1 593 ? 31.971  16.105  48.163  1.00 39.36  ?  590  TYR A O     1 
ATOM   4885  C CB    . TYR A 1 593 ? 30.366  13.612  49.302  1.00 39.84  ?  590  TYR A CB    1 
ATOM   4886  C CG    . TYR A 1 593 ? 30.094  12.171  49.649  1.00 36.82  ?  590  TYR A CG    1 
ATOM   4887  C CD1   . TYR A 1 593 ? 29.312  11.377  48.822  1.00 36.80  ?  590  TYR A CD1   1 
ATOM   4888  C CD2   . TYR A 1 593 ? 30.590  11.612  50.818  1.00 37.44  ?  590  TYR A CD2   1 
ATOM   4889  C CE1   . TYR A 1 593 ? 29.048  10.061  49.141  1.00 36.86  ?  590  TYR A CE1   1 
ATOM   4890  C CE2   . TYR A 1 593 ? 30.330  10.296  51.146  1.00 38.51  ?  590  TYR A CE2   1 
ATOM   4891  C CZ    . TYR A 1 593 ? 29.558  9.525   50.305  1.00 36.93  ?  590  TYR A CZ    1 
ATOM   4892  O OH    . TYR A 1 593 ? 29.296  8.213   50.628  1.00 36.99  ?  590  TYR A OH    1 
ATOM   4893  N N     . THR A 1 594 ? 30.265  15.629  46.770  1.00 65.75  ?  591  THR A N     1 
ATOM   4894  C CA    . THR A 1 594 ? 29.992  17.026  46.487  1.00 59.15  ?  591  THR A CA    1 
ATOM   4895  C C     . THR A 1 594 ? 29.203  17.635  47.641  1.00 58.24  ?  591  THR A C     1 
ATOM   4896  O O     . THR A 1 594 ? 28.661  16.928  48.494  1.00 47.16  ?  591  THR A O     1 
ATOM   4897  C CB    . THR A 1 594 ? 29.206  17.178  45.184  1.00 49.72  ?  591  THR A CB    1 
ATOM   4898  O OG1   . THR A 1 594 ? 27.863  16.716  45.378  1.00 40.57  ?  591  THR A OG1   1 
ATOM   4899  C CG2   . THR A 1 594 ? 29.860  16.370  44.071  1.00 53.82  ?  591  THR A CG2   1 
ATOM   4900  N N     . ILE A 1 595 ? 29.154  18.968  47.664  1.00 46.38  ?  592  ILE A N     1 
ATOM   4901  C CA    . ILE A 1 595 ? 28.347  19.661  48.666  1.00 47.04  ?  592  ILE A CA    1 
ATOM   4902  C C     . ILE A 1 595 ? 26.905  19.179  48.596  1.00 37.94  ?  592  ILE A C     1 
ATOM   4903  O O     . ILE A 1 595 ? 26.301  18.819  49.612  1.00 41.10  ?  592  ILE A O     1 
ATOM   4904  C CB    . ILE A 1 595 ? 28.444  21.185  48.477  1.00 49.08  ?  592  ILE A CB    1 
ATOM   4905  C CG1   . ILE A 1 595 ? 29.898  21.650  48.586  1.00 51.83  ?  592  ILE A CG1   1 
ATOM   4906  C CG2   . ILE A 1 595 ? 27.576  21.909  49.495  1.00 33.37  ?  592  ILE A CG2   1 
ATOM   4907  C CD1   . ILE A 1 595 ? 30.582  21.213  49.858  1.00 51.32  ?  592  ILE A CD1   1 
ATOM   4908  N N     . GLU A 1 596 ? 26.346  19.133  47.382  1.00 26.70  ?  593  GLU A N     1 
ATOM   4909  C CA    . GLU A 1 596 ? 24.965  18.692  47.199  1.00 36.36  ?  593  GLU A CA    1 
ATOM   4910  C C     . GLU A 1 596 ? 24.731  17.307  47.792  1.00 34.57  ?  593  GLU A C     1 
ATOM   4911  O O     . GLU A 1 596 ? 23.689  17.054  48.408  1.00 27.68  ?  593  GLU A O     1 
ATOM   4912  C CB    . GLU A 1 596 ? 24.604  18.694  45.712  1.00 38.29  ?  593  GLU A CB    1 
ATOM   4913  C CG    . GLU A 1 596 ? 24.599  20.067  45.058  1.00 55.38  ?  593  GLU A CG    1 
ATOM   4914  C CD    . GLU A 1 596 ? 25.978  20.518  44.609  1.00 72.53  ?  593  GLU A CD    1 
ATOM   4915  O OE1   . GLU A 1 596 ? 26.949  19.755  44.792  1.00 76.60  ?  593  GLU A OE1   1 
ATOM   4916  O OE2   . GLU A 1 596 ? 26.088  21.637  44.066  1.00 81.47  -1 593  GLU A OE2   1 
ATOM   4917  N N     . GLU A 1 597 ? 25.688  16.395  47.611  1.00 31.96  ?  594  GLU A N     1 
ATOM   4918  C CA    . GLU A 1 597 ? 25.540  15.049  48.152  1.00 26.32  ?  594  GLU A CA    1 
ATOM   4919  C C     . GLU A 1 597 ? 25.631  15.049  49.672  1.00 27.71  ?  594  GLU A C     1 
ATOM   4920  O O     . GLU A 1 597 ? 24.880  14.332  50.343  1.00 28.33  ?  594  GLU A O     1 
ATOM   4921  C CB    . GLU A 1 597 ? 26.597  14.127  47.548  1.00 30.30  ?  594  GLU A CB    1 
ATOM   4922  C CG    . GLU A 1 597 ? 26.364  13.794  46.086  1.00 31.19  ?  594  GLU A CG    1 
ATOM   4923  C CD    . GLU A 1 597 ? 27.592  13.207  45.425  1.00 29.19  ?  594  GLU A CD    1 
ATOM   4924  O OE1   . GLU A 1 597 ? 28.711  13.477  45.908  1.00 31.43  ?  594  GLU A OE1   1 
ATOM   4925  O OE2   . GLU A 1 597 ? 27.439  12.478  44.424  1.00 39.20  -1 594  GLU A OE2   1 
ATOM   4926  N N     . ILE A 1 598 ? 26.542  15.848  50.230  1.00 24.87  ?  595  ILE A N     1 
ATOM   4927  C CA    . ILE A 1 598 ? 26.653  15.963  51.683  1.00 28.39  ?  595  ILE A CA    1 
ATOM   4928  C C     . ILE A 1 598 ? 25.365  16.526  52.270  1.00 25.41  ?  595  ILE A C     1 
ATOM   4929  O O     . ILE A 1 598 ? 24.863  16.043  53.291  1.00 33.44  ?  595  ILE A O     1 
ATOM   4930  C CB    . ILE A 1 598 ? 27.867  16.830  52.061  1.00 33.09  ?  595  ILE A CB    1 
ATOM   4931  C CG1   . ILE A 1 598 ? 29.161  16.176  51.575  1.00 36.23  ?  595  ILE A CG1   1 
ATOM   4932  C CG2   . ILE A 1 598 ? 27.920  17.049  53.565  1.00 37.24  ?  595  ILE A CG2   1 
ATOM   4933  C CD1   . ILE A 1 598 ? 30.401  17.012  51.839  1.00 25.96  ?  595  ILE A CD1   1 
ATOM   4934  N N     . ILE A 1 599 ? 24.811  17.560  51.633  1.00 28.80  ?  596  ILE A N     1 
ATOM   4935  C CA    . ILE A 1 599 ? 23.579  18.168  52.127  1.00 27.55  ?  596  ILE A CA    1 
ATOM   4936  C C     . ILE A 1 599 ? 22.444  17.153  52.122  1.00 26.34  ?  596  ILE A C     1 
ATOM   4937  O O     . ILE A 1 599 ? 21.632  17.100  53.054  1.00 19.71  ?  596  ILE A O     1 
ATOM   4938  C CB    . ILE A 1 599 ? 23.226  19.411  51.290  1.00 26.16  ?  596  ILE A CB    1 
ATOM   4939  C CG1   . ILE A 1 599 ? 24.360  20.437  51.345  1.00 30.30  ?  596  ILE A CG1   1 
ATOM   4940  C CG2   . ILE A 1 599 ? 21.922  20.023  51.764  1.00 17.76  ?  596  ILE A CG2   1 
ATOM   4941  C CD1   . ILE A 1 599 ? 24.711  20.902  52.734  1.00 29.65  ?  596  ILE A CD1   1 
ATOM   4942  N N     . GLU A 1 600 ? 22.371  16.328  51.075  1.00 26.31  ?  597  GLU A N     1 
ATOM   4943  C CA    . GLU A 1 600 ? 21.318  15.321  51.007  1.00 24.35  ?  597  GLU A CA    1 
ATOM   4944  C C     . GLU A 1 600 ? 21.484  14.276  52.103  1.00 21.25  ?  597  GLU A C     1 
ATOM   4945  O O     . GLU A 1 600 ? 20.493  13.813  52.679  1.00 16.44  ?  597  GLU A O     1 
ATOM   4946  C CB    . GLU A 1 600 ? 21.303  14.661  49.628  1.00 31.14  ?  597  GLU A CB    1 
ATOM   4947  C CG    . GLU A 1 600 ? 20.204  13.620  49.450  1.00 38.41  ?  597  GLU A CG    1 
ATOM   4948  C CD    . GLU A 1 600 ? 20.443  12.720  48.260  1.00 54.93  ?  597  GLU A CD    1 
ATOM   4949  O OE1   . GLU A 1 600 ? 19.470  12.436  47.527  1.00 55.16  ?  597  GLU A OE1   1 
ATOM   4950  O OE2   . GLU A 1 600 ? 21.604  12.299  48.063  1.00 66.66  -1 597  GLU A OE2   1 
ATOM   4951  N N     . GLN A 1 601 ? 22.728  13.895  52.413  1.00 20.29  ?  598  GLN A N     1 
ATOM   4952  C CA    . GLN A 1 601 ? 22.943  12.916  53.474  1.00 28.20  ?  598  GLN A CA    1 
ATOM   4953  C C     . GLN A 1 601 ? 22.584  13.495  54.835  1.00 29.37  ?  598  GLN A C     1 
ATOM   4954  O O     . GLN A 1 601 ? 22.053  12.786  55.695  1.00 28.75  ?  598  GLN A O     1 
ATOM   4955  C CB    . GLN A 1 601 ? 24.390  12.427  53.465  1.00 28.45  ?  598  GLN A CB    1 
ATOM   4956  C CG    . GLN A 1 601 ? 24.694  11.419  52.376  1.00 27.51  ?  598  GLN A CG    1 
ATOM   4957  C CD    . GLN A 1 601 ? 26.139  10.977  52.392  1.00 37.35  ?  598  GLN A CD    1 
ATOM   4958  O OE1   . GLN A 1 601 ? 26.700  10.691  53.448  1.00 36.98  ?  598  GLN A OE1   1 
ATOM   4959  N NE2   . GLN A 1 601 ? 26.757  10.931  51.219  1.00 41.61  ?  598  GLN A NE2   1 
ATOM   4960  N N     . ILE A 1 602 ? 22.864  14.783  55.047  1.00 28.92  ?  599  ILE A N     1 
ATOM   4961  C CA    . ILE A 1 602 ? 22.516  15.419  56.314  1.00 27.72  ?  599  ILE A CA    1 
ATOM   4962  C C     . ILE A 1 602 ? 21.004  15.456  56.487  1.00 30.80  ?  599  ILE A C     1 
ATOM   4963  O O     . ILE A 1 602 ? 20.482  15.224  57.585  1.00 31.17  ?  599  ILE A O     1 
ATOM   4964  C CB    . ILE A 1 602 ? 23.141  16.824  56.393  1.00 26.12  ?  599  ILE A CB    1 
ATOM   4965  C CG1   . ILE A 1 602 ? 24.665  16.715  56.510  1.00 23.03  ?  599  ILE A CG1   1 
ATOM   4966  C CG2   . ILE A 1 602 ? 22.560  17.613  57.559  1.00 30.45  ?  599  ILE A CG2   1 
ATOM   4967  C CD1   . ILE A 1 602 ? 25.379  18.020  56.352  1.00 31.43  ?  599  ILE A CD1   1 
ATOM   4968  N N     . TYR A 1 603 ? 20.275  15.731  55.404  1.00 24.71  ?  600  TYR A N     1 
ATOM   4969  C CA    . TYR A 1 603 ? 18.818  15.717  55.476  1.00 24.93  ?  600  TYR A CA    1 
ATOM   4970  C C     . TYR A 1 603 ? 18.291  14.310  55.728  1.00 20.15  ?  600  TYR A C     1 
ATOM   4971  O O     . TYR A 1 603 ? 17.379  14.118  56.541  1.00 24.05  ?  600  TYR A O     1 
ATOM   4972  C CB    . TYR A 1 603 ? 18.218  16.291  54.194  1.00 21.70  ?  600  TYR A CB    1 
ATOM   4973  C CG    . TYR A 1 603 ? 16.708  16.341  54.217  1.00 23.86  ?  600  TYR A CG    1 
ATOM   4974  C CD1   . TYR A 1 603 ? 16.041  17.346  54.904  1.00 21.90  ?  600  TYR A CD1   1 
ATOM   4975  C CD2   . TYR A 1 603 ? 15.951  15.383  53.561  1.00 23.15  ?  600  TYR A CD2   1 
ATOM   4976  C CE1   . TYR A 1 603 ? 14.663  17.397  54.934  1.00 30.07  ?  600  TYR A CE1   1 
ATOM   4977  C CE2   . TYR A 1 603 ? 14.570  15.425  53.585  1.00 23.74  ?  600  TYR A CE2   1 
ATOM   4978  C CZ    . TYR A 1 603 ? 13.932  16.435  54.271  1.00 29.48  ?  600  TYR A CZ    1 
ATOM   4979  O OH    . TYR A 1 603 ? 12.559  16.489  54.302  1.00 31.21  ?  600  TYR A OH    1 
ATOM   4980  N N     . LEU A 1 604 ? 18.846  13.314  55.034  1.00 28.90  ?  601  LEU A N     1 
ATOM   4981  C CA    . LEU A 1 604 ? 18.427  11.935  55.264  1.00 21.02  ?  601  LEU A CA    1 
ATOM   4982  C C     . LEU A 1 604 ? 18.692  11.509  56.700  1.00 22.79  ?  601  LEU A C     1 
ATOM   4983  O O     . LEU A 1 604 ? 17.958  10.677  57.244  1.00 20.85  ?  601  LEU A O     1 
ATOM   4984  C CB    . LEU A 1 604 ? 19.141  10.992  54.293  1.00 19.12  ?  601  LEU A CB    1 
ATOM   4985  C CG    . LEU A 1 604 ? 18.808  11.109  52.802  1.00 21.45  ?  601  LEU A CG    1 
ATOM   4986  C CD1   . LEU A 1 604 ? 19.855  10.400  51.966  1.00 20.36  ?  601  LEU A CD1   1 
ATOM   4987  C CD2   . LEU A 1 604 ? 17.422  10.552  52.503  1.00 16.77  ?  601  LEU A CD2   1 
ATOM   4988  N N     . LEU A 1 605 ? 19.720  12.078  57.335  1.00 19.24  ?  602  LEU A N     1 
ATOM   4989  C CA    . LEU A 1 605 ? 19.997  11.759  58.732  1.00 24.42  ?  602  LEU A CA    1 
ATOM   4990  C C     . LEU A 1 605 ? 18.842  12.141  59.650  1.00 14.98  ?  602  LEU A C     1 
ATOM   4991  O O     . LEU A 1 605 ? 18.708  11.573  60.741  1.00 16.63  ?  602  LEU A O     1 
ATOM   4992  C CB    . LEU A 1 605 ? 21.277  12.454  59.192  1.00 23.99  ?  602  LEU A CB    1 
ATOM   4993  C CG    . LEU A 1 605 ? 22.586  11.800  58.743  1.00 28.91  ?  602  LEU A CG    1 
ATOM   4994  C CD1   . LEU A 1 605 ? 23.773  12.607  59.237  1.00 22.22  ?  602  LEU A CD1   1 
ATOM   4995  C CD2   . LEU A 1 605 ? 22.650  10.367  59.249  1.00 28.27  ?  602  LEU A CD2   1 
ATOM   4996  N N     . THR A 1 606 ? 18.008  13.101  59.245  1.00 23.98  ?  603  THR A N     1 
ATOM   4997  C CA    . THR A 1 606 ? 16.837  13.439  60.047  1.00 22.87  ?  603  THR A CA    1 
ATOM   4998  C C     . THR A 1 606 ? 15.774  12.346  60.023  1.00 23.74  ?  603  THR A C     1 
ATOM   4999  O O     . THR A 1 606 ? 14.802  12.432  60.781  1.00 24.50  ?  603  THR A O     1 
ATOM   5000  C CB    . THR A 1 606 ? 16.218  14.758  59.569  1.00 29.46  ?  603  THR A CB    1 
ATOM   5001  O OG1   . THR A 1 606 ? 15.457  14.529  58.376  1.00 22.88  ?  603  THR A OG1   1 
ATOM   5002  C CG2   . THR A 1 606 ? 17.305  15.791  59.282  1.00 22.86  ?  603  THR A CG2   1 
ATOM   5003  N N     . ARG A 1 607 ? 15.935  11.325  59.179  1.00 25.91  ?  604  ARG A N     1 
ATOM   5004  C CA    . ARG A 1 607 ? 14.947  10.267  59.042  1.00 20.33  ?  604  ARG A CA    1 
ATOM   5005  C C     . ARG A 1 607 ? 15.502  8.868   59.263  1.00 20.58  ?  604  ARG A C     1 
ATOM   5006  O O     . ARG A 1 607 ? 14.744  7.901   59.141  1.00 20.55  ?  604  ARG A O     1 
ATOM   5007  C CB    . ARG A 1 607 ? 14.298  10.315  57.650  1.00 19.61  ?  604  ARG A CB    1 
ATOM   5008  C CG    . ARG A 1 607 ? 13.630  11.633  57.304  1.00 22.18  ?  604  ARG A CG    1 
ATOM   5009  C CD    . ARG A 1 607 ? 12.336  11.838  58.083  1.00 27.32  ?  604  ARG A CD    1 
ATOM   5010  N NE    . ARG A 1 607 ? 11.548  12.921  57.507  1.00 29.01  ?  604  ARG A NE    1 
ATOM   5011  C CZ    . ARG A 1 607 ? 10.680  12.761  56.513  1.00 33.48  ?  604  ARG A CZ    1 
ATOM   5012  N NH1   . ARG A 1 607 ? 10.481  11.556  55.993  1.00 38.72  1  604  ARG A NH1   1 
ATOM   5013  N NH2   . ARG A 1 607 ? 10.011  13.805  56.039  1.00 23.77  ?  604  ARG A NH2   1 
ATOM   5014  N N     . VAL A 1 608 ? 16.795  8.721   59.571  1.00 20.64  ?  605  VAL A N     1 
ATOM   5015  C CA    . VAL A 1 608 ? 17.359  7.390   59.777  1.00 22.54  ?  605  VAL A CA    1 
ATOM   5016  C C     . VAL A 1 608 ? 16.825  6.722   61.032  1.00 26.80  ?  605  VAL A C     1 
ATOM   5017  O O     . VAL A 1 608 ? 17.099  5.539   61.260  1.00 20.65  ?  605  VAL A O     1 
ATOM   5018  C CB    . VAL A 1 608 ? 18.900  7.435   59.836  1.00 22.00  ?  605  VAL A CB    1 
ATOM   5019  C CG1   . VAL A 1 608 ? 19.462  7.942   58.524  1.00 31.92  ?  605  VAL A CG1   1 
ATOM   5020  C CG2   . VAL A 1 608 ? 19.363  8.296   60.996  1.00 30.67  ?  605  VAL A CG2   1 
ATOM   5021  N N     . ALA A 1 609 ? 16.073  7.452   61.851  1.00 28.36  ?  606  ALA A N     1 
ATOM   5022  C CA    . ALA A 1 609 ? 15.373  6.872   62.985  1.00 28.03  ?  606  ALA A CA    1 
ATOM   5023  C C     . ALA A 1 609 ? 14.107  7.678   63.228  1.00 23.49  ?  606  ALA A C     1 
ATOM   5024  O O     . ALA A 1 609 ? 14.002  8.842   62.832  1.00 23.66  ?  606  ALA A O     1 
ATOM   5025  C CB    . ALA A 1 609 ? 16.246  6.846   64.245  1.00 19.29  ?  606  ALA A CB    1 
ATOM   5026  N N     . HIS A 1 610 ? 13.141  7.034   63.874  1.00 20.02  ?  607  HIS A N     1 
ATOM   5027  C CA    . HIS A 1 610 ? 11.907  7.669   64.306  1.00 19.53  ?  607  HIS A CA    1 
ATOM   5028  C C     . HIS A 1 610 ? 11.665  7.332   65.769  1.00 19.82  ?  607  HIS A C     1 
ATOM   5029  O O     . HIS A 1 610 ? 11.914  6.203   66.200  1.00 19.50  ?  607  HIS A O     1 
ATOM   5030  C CB    . HIS A 1 610 ? 10.697  7.207   63.468  1.00 16.00  ?  607  HIS A CB    1 
ATOM   5031  C CG    . HIS A 1 610 ? 10.530  7.946   62.175  1.00 20.81  ?  607  HIS A CG    1 
ATOM   5032  N ND1   . HIS A 1 610 ? 9.576   8.924   61.995  1.00 24.02  ?  607  HIS A ND1   1 
ATOM   5033  C CD2   . HIS A 1 610 ? 11.191  7.844   60.998  1.00 23.73  ?  607  HIS A CD2   1 
ATOM   5034  C CE1   . HIS A 1 610 ? 9.658   9.396   60.763  1.00 20.07  ?  607  HIS A CE1   1 
ATOM   5035  N NE2   . HIS A 1 610 ? 10.631  8.759   60.138  1.00 25.92  ?  607  HIS A NE2   1 
ATOM   5036  N N     . SER A 1 611 ? 11.193  8.319   66.532  1.00 19.45  ?  608  SER A N     1 
ATOM   5037  C CA    . SER A 1 611 ? 10.689  8.030   67.870  1.00 31.46  ?  608  SER A CA    1 
ATOM   5038  C C     . SER A 1 611 ? 9.371   7.270   67.787  1.00 29.25  ?  608  SER A C     1 
ATOM   5039  O O     . SER A 1 611 ? 9.174   6.261   68.475  1.00 28.52  ?  608  SER A O     1 
ATOM   5040  C CB    . SER A 1 611 ? 10.521  9.328   68.659  1.00 31.00  ?  608  SER A CB    1 
ATOM   5041  O OG    . SER A 1 611 ? 9.606   9.151   69.724  1.00 43.94  ?  608  SER A OG    1 
ATOM   5042  N N     . THR A 1 612 ? 8.493   7.714   66.901  1.00 13.63  ?  609  THR A N     1 
ATOM   5043  C CA    . THR A 1 612 ? 7.273   7.019   66.544  1.00 23.28  ?  609  THR A CA    1 
ATOM   5044  C C     . THR A 1 612 ? 7.108   7.219   65.035  1.00 38.06  ?  609  THR A C     1 
ATOM   5045  O O     . THR A 1 612 ? 7.681   8.104   64.497  1.00 66.99  ?  609  THR A O     1 
ATOM   5046  C CB    . THR A 1 612 ? 5.984   7.440   67.243  1.00 22.98  ?  609  THR A CB    1 
ATOM   5047  O OG1   . THR A 1 612 ? 5.511   8.647   66.676  1.00 50.71  ?  609  THR A OG1   1 
ATOM   5048  C CG2   . THR A 1 612 ? 6.170   7.582   68.739  1.00 19.34  ?  609  THR A CG2   1 
ATOM   5049  N N     . PRO A 1 613 ? 6.325   6.405   64.362  1.00 28.18  ?  610  PRO A N     1 
ATOM   5050  C CA    . PRO A 1 613 ? 6.113   6.604   62.917  1.00 24.63  ?  610  PRO A CA    1 
ATOM   5051  C C     . PRO A 1 613 ? 5.272   7.825   62.576  1.00 23.16  ?  610  PRO A C     1 
ATOM   5052  O O     . PRO A 1 613 ? 5.212   8.196   61.398  1.00 27.54  ?  610  PRO A O     1 
ATOM   5053  C CB    . PRO A 1 613 ? 5.407   5.314   62.478  1.00 18.31  ?  610  PRO A CB    1 
ATOM   5054  C CG    . PRO A 1 613 ? 5.709   4.318   63.542  1.00 24.60  ?  610  PRO A CG    1 
ATOM   5055  C CD    . PRO A 1 613 ? 5.817   5.097   64.813  1.00 20.35  ?  610  PRO A CD    1 
ATOM   5056  N N     . TYR A 1 614 ? 4.636   8.462   63.558  1.00 19.13  ?  611  TYR A N     1 
ATOM   5057  C CA    . TYR A 1 614 ? 3.686   9.538   63.318  1.00 29.73  ?  611  TYR A CA    1 
ATOM   5058  C C     . TYR A 1 614 ? 4.304   10.928  63.425  1.00 30.16  ?  611  TYR A C     1 
ATOM   5059  O O     . TYR A 1 614 ? 3.620   11.915  63.141  1.00 40.24  ?  611  TYR A O     1 
ATOM   5060  C CB    . TYR A 1 614 ? 2.504   9.408   64.286  1.00 28.71  ?  611  TYR A CB    1 
ATOM   5061  C CG    . TYR A 1 614 ? 1.812   8.064   64.182  1.00 28.47  ?  611  TYR A CG    1 
ATOM   5062  C CD1   . TYR A 1 614 ? 1.074   7.729   63.055  1.00 41.48  ?  611  TYR A CD1   1 
ATOM   5063  C CD2   . TYR A 1 614 ? 1.911   7.125   65.202  1.00 35.21  ?  611  TYR A CD2   1 
ATOM   5064  C CE1   . TYR A 1 614 ? 0.446   6.499   62.946  1.00 39.17  ?  611  TYR A CE1   1 
ATOM   5065  C CE2   . TYR A 1 614 ? 1.285   5.893   65.102  1.00 29.58  ?  611  TYR A CE2   1 
ATOM   5066  C CZ    . TYR A 1 614 ? 0.555   5.587   63.972  1.00 33.67  ?  611  TYR A CZ    1 
ATOM   5067  O OH    . TYR A 1 614 ? -0.067  4.362   63.871  1.00 37.99  ?  611  TYR A OH    1 
ATOM   5068  N N     . THR A 1 615 ? 5.568   11.031  63.838  1.00 27.18  ?  612  THR A N     1 
ATOM   5069  C CA    . THR A 1 615 ? 6.317   12.280  63.794  1.00 22.25  ?  612  THR A CA    1 
ATOM   5070  C C     . THR A 1 615 ? 7.730   11.973  63.323  1.00 23.22  ?  612  THR A C     1 
ATOM   5071  O O     . THR A 1 615 ? 8.199   10.838  63.412  1.00 24.24  ?  612  THR A O     1 
ATOM   5072  C CB    . THR A 1 615 ? 6.381   12.994  65.157  1.00 27.47  ?  612  THR A CB    1 
ATOM   5073  O OG1   . THR A 1 615 ? 7.190   12.231  66.062  1.00 26.47  ?  612  THR A OG1   1 
ATOM   5074  C CG2   . THR A 1 615 ? 4.987   13.186  65.754  1.00 31.55  ?  612  THR A CG2   1 
ATOM   5075  N N     . ASN A 1 616 ? 8.418   12.999  62.829  1.00 20.24  ?  613  ASN A N     1 
ATOM   5076  C CA    . ASN A 1 616 ? 9.790   12.834  62.374  1.00 23.95  ?  613  ASN A CA    1 
ATOM   5077  C C     . ASN A 1 616 ? 10.696  13.852  63.051  1.00 15.92  ?  613  ASN A C     1 
ATOM   5078  O O     . ASN A 1 616 ? 10.259  14.922  63.483  1.00 29.43  ?  613  ASN A O     1 
ATOM   5079  C CB    . ASN A 1 616 ? 9.904   12.958  60.848  1.00 29.73  ?  613  ASN A CB    1 
ATOM   5080  C CG    . ASN A 1 616 ? 9.256   14.216  60.313  1.00 28.61  ?  613  ASN A CG    1 
ATOM   5081  O OD1   . ASN A 1 616 ? 8.139   14.179  59.798  1.00 35.59  ?  613  ASN A OD1   1 
ATOM   5082  N ND2   . ASN A 1 616 ? 9.952   15.340  60.433  1.00 27.61  ?  613  ASN A ND2   1 
ATOM   5083  N N     . TYR A 1 617 ? 11.975  13.503  63.128  1.00 19.35  ?  614  TYR A N     1 
ATOM   5084  C CA    . TYR A 1 617 ? 12.970  14.391  63.706  1.00 18.62  ?  614  TYR A CA    1 
ATOM   5085  C C     . TYR A 1 617 ? 13.208  15.595  62.800  1.00 21.88  ?  614  TYR A C     1 
ATOM   5086  O O     . TYR A 1 617 ? 13.028  15.531  61.581  1.00 28.08  ?  614  TYR A O     1 
ATOM   5087  C CB    . TYR A 1 617 ? 14.278  13.638  63.935  1.00 23.94  ?  614  TYR A CB    1 
ATOM   5088  C CG    . TYR A 1 617 ? 14.173  12.551  64.983  1.00 27.25  ?  614  TYR A CG    1 
ATOM   5089  C CD1   . TYR A 1 617 ? 13.541  12.790  66.195  1.00 28.61  ?  614  TYR A CD1   1 
ATOM   5090  C CD2   . TYR A 1 617 ? 14.696  11.284  64.757  1.00 25.17  ?  614  TYR A CD2   1 
ATOM   5091  C CE1   . TYR A 1 617 ? 13.439  11.802  67.158  1.00 33.62  ?  614  TYR A CE1   1 
ATOM   5092  C CE2   . TYR A 1 617 ? 14.598  10.288  65.715  1.00 22.76  ?  614  TYR A CE2   1 
ATOM   5093  C CZ    . TYR A 1 617 ? 13.969  10.553  66.915  1.00 26.06  ?  614  TYR A CZ    1 
ATOM   5094  O OH    . TYR A 1 617 ? 13.867  9.571   67.873  1.00 26.07  ?  614  TYR A OH    1 
ATOM   5095  N N     . LYS A 1 618 ? 13.620  16.704  63.413  1.00 24.72  ?  615  LYS A N     1 
ATOM   5096  C CA    . LYS A 1 618 ? 13.923  17.931  62.687  1.00 25.26  ?  615  LYS A CA    1 
ATOM   5097  C C     . LYS A 1 618 ? 15.407  18.106  62.406  1.00 23.91  ?  615  LYS A C     1 
ATOM   5098  O O     . LYS A 1 618 ? 15.769  18.663  61.364  1.00 28.12  ?  615  LYS A O     1 
ATOM   5099  C CB    . LYS A 1 618 ? 13.409  19.145  63.469  1.00 30.18  ?  615  LYS A CB    1 
ATOM   5100  C CG    . LYS A 1 618 ? 11.894  19.233  63.517  1.00 41.63  ?  615  LYS A CG    1 
ATOM   5101  C CD    . LYS A 1 618 ? 11.407  19.938  64.768  1.00 47.34  ?  615  LYS A CD    1 
ATOM   5102  C CE    . LYS A 1 618 ? 9.888   19.914  64.833  1.00 53.62  ?  615  LYS A CE    1 
ATOM   5103  N NZ    . LYS A 1 618 ? 9.376   20.082  66.222  1.00 48.55  1  615  LYS A NZ    1 
ATOM   5104  N N     . LEU A 1 619 ? 16.263  17.632  63.294  1.00 19.41  ?  616  LEU A N     1 
ATOM   5105  C CA    . LEU A 1 619 ? 17.705  17.713  63.162  1.00 24.95  ?  616  LEU A CA    1 
ATOM   5106  C C     . LEU A 1 619 ? 18.277  16.358  62.766  1.00 26.01  ?  616  LEU A C     1 
ATOM   5107  O O     . LEU A 1 619 ? 17.641  15.320  62.978  1.00 23.51  ?  616  LEU A O     1 
ATOM   5108  C CB    . LEU A 1 619 ? 18.334  18.171  64.484  1.00 34.98  ?  616  LEU A CB    1 
ATOM   5109  C CG    . LEU A 1 619 ? 17.881  19.557  64.949  1.00 31.00  ?  616  LEU A CG    1 
ATOM   5110  C CD1   . LEU A 1 619 ? 18.360  19.851  66.363  1.00 33.03  ?  616  LEU A CD1   1 
ATOM   5111  C CD2   . LEU A 1 619 ? 18.373  20.617  63.980  1.00 34.11  ?  616  LEU A CD2   1 
ATOM   5112  N N     . PRO A 1 620 ? 19.474  16.327  62.175  1.00 25.27  ?  617  PRO A N     1 
ATOM   5113  C CA    . PRO A 1 620 ? 20.115  15.038  61.897  1.00 20.51  ?  617  PRO A CA    1 
ATOM   5114  C C     . PRO A 1 620 ? 20.254  14.239  63.181  1.00 17.86  ?  617  PRO A C     1 
ATOM   5115  O O     . PRO A 1 620 ? 20.546  14.791  64.243  1.00 24.93  ?  617  PRO A O     1 
ATOM   5116  C CB    . PRO A 1 620 ? 21.480  15.430  61.316  1.00 23.32  ?  617  PRO A CB    1 
ATOM   5117  C CG    . PRO A 1 620 ? 21.685  16.855  61.721  1.00 30.57  ?  617  PRO A CG    1 
ATOM   5118  C CD    . PRO A 1 620 ? 20.319  17.459  61.757  1.00 34.71  ?  617  PRO A CD    1 
ATOM   5119  N N     . TYR A 1 621 ? 20.013  12.934  63.073  1.00 26.62  ?  618  TYR A N     1 
ATOM   5120  C CA    . TYR A 1 621 ? 19.929  12.075  64.253  1.00 24.77  ?  618  TYR A CA    1 
ATOM   5121  C C     . TYR A 1 621 ? 21.124  12.200  65.194  1.00 23.02  ?  618  TYR A C     1 
ATOM   5122  O O     . TYR A 1 621 ? 20.899  12.321  66.410  1.00 21.54  ?  618  TYR A O     1 
ATOM   5123  C CB    . TYR A 1 621 ? 19.719  10.623  63.797  1.00 20.57  ?  618  TYR A CB    1 
ATOM   5124  C CG    . TYR A 1 621 ? 19.273  9.670   64.885  1.00 21.98  ?  618  TYR A CG    1 
ATOM   5125  C CD1   . TYR A 1 621 ? 18.303  10.038  65.812  1.00 21.99  ?  618  TYR A CD1   1 
ATOM   5126  C CD2   . TYR A 1 621 ? 19.807  8.392   64.970  1.00 21.57  ?  618  TYR A CD2   1 
ATOM   5127  C CE1   . TYR A 1 621 ? 17.894  9.161   66.802  1.00 26.75  ?  618  TYR A CE1   1 
ATOM   5128  C CE2   . TYR A 1 621 ? 19.404  7.511   65.949  1.00 27.84  ?  618  TYR A CE2   1 
ATOM   5129  C CZ    . TYR A 1 621 ? 18.447  7.897   66.863  1.00 26.69  ?  618  TYR A CZ    1 
ATOM   5130  O OH    . TYR A 1 621 ? 18.051  7.012   67.838  1.00 22.59  ?  618  TYR A OH    1 
ATOM   5131  N N     . PRO A 1 622 ? 22.384  12.204  64.733  1.00 26.59  ?  619  PRO A N     1 
ATOM   5132  C CA    . PRO A 1 622 ? 23.488  12.416  65.688  1.00 19.07  ?  619  PRO A CA    1 
ATOM   5133  C C     . PRO A 1 622 ? 23.382  13.724  66.456  1.00 20.14  ?  619  PRO A C     1 
ATOM   5134  O O     . PRO A 1 622 ? 23.678  13.755  67.657  1.00 28.38  ?  619  PRO A O     1 
ATOM   5135  C CB    . PRO A 1 622 ? 24.737  12.371  64.795  1.00 23.02  ?  619  PRO A CB    1 
ATOM   5136  C CG    . PRO A 1 622 ? 24.244  12.591  63.406  1.00 33.30  ?  619  PRO A CG    1 
ATOM   5137  C CD    . PRO A 1 622 ? 22.891  11.962  63.370  1.00 26.79  ?  619  PRO A CD    1 
ATOM   5138  N N     . LEU A 1 623 ? 22.964  14.808  65.798  1.00 25.17  ?  620  LEU A N     1 
ATOM   5139  C CA    . LEU A 1 623 ? 22.775  16.073  66.503  1.00 20.96  ?  620  LEU A CA    1 
ATOM   5140  C C     . LEU A 1 623 ? 21.567  16.017  67.423  1.00 23.28  ?  620  LEU A C     1 
ATOM   5141  O O     . LEU A 1 623 ? 21.594  16.575  68.527  1.00 25.34  ?  620  LEU A O     1 
ATOM   5142  C CB    . LEU A 1 623 ? 22.621  17.219  65.505  1.00 31.67  ?  620  LEU A CB    1 
ATOM   5143  C CG    . LEU A 1 623 ? 23.890  17.919  65.030  1.00 40.67  ?  620  LEU A CG    1 
ATOM   5144  C CD1   . LEU A 1 623 ? 23.509  19.202  64.327  1.00 42.08  ?  620  LEU A CD1   1 
ATOM   5145  C CD2   . LEU A 1 623 ? 24.816  18.200  66.199  1.00 33.74  ?  620  LEU A CD2   1 
ATOM   5146  N N     . HIS A 1 624 ? 20.488  15.372  66.974  1.00 24.24  ?  621  HIS A N     1 
ATOM   5147  C CA    . HIS A 1 624 ? 19.325  15.183  67.836  1.00 16.42  ?  621  HIS A CA    1 
ATOM   5148  C C     . HIS A 1 624 ? 19.711  14.470  69.125  1.00 18.76  ?  621  HIS A C     1 
ATOM   5149  O O     . HIS A 1 624 ? 19.284  14.863  70.218  1.00 23.42  ?  621  HIS A O     1 
ATOM   5150  C CB    . HIS A 1 624 ? 18.249  14.397  67.092  1.00 17.87  ?  621  HIS A CB    1 
ATOM   5151  C CG    . HIS A 1 624 ? 17.055  14.067  67.931  1.00 21.94  ?  621  HIS A CG    1 
ATOM   5152  N ND1   . HIS A 1 624 ? 15.984  14.923  68.071  1.00 30.66  ?  621  HIS A ND1   1 
ATOM   5153  C CD2   . HIS A 1 624 ? 16.770  12.980  68.686  1.00 23.09  ?  621  HIS A CD2   1 
ATOM   5154  C CE1   . HIS A 1 624 ? 15.087  14.376  68.871  1.00 31.94  ?  621  HIS A CE1   1 
ATOM   5155  N NE2   . HIS A 1 624 ? 15.540  13.196  69.258  1.00 26.99  ?  621  HIS A NE2   1 
ATOM   5156  N N     . ILE A 1 625 ? 20.530  13.425  69.017  1.00 18.91  ?  622  ILE A N     1 
ATOM   5157  C CA    . ILE A 1 625 ? 20.982  12.702  70.201  1.00 16.62  ?  622  ILE A CA    1 
ATOM   5158  C C     . ILE A 1 625 ? 21.845  13.600  71.078  1.00 29.07  ?  622  ILE A C     1 
ATOM   5159  O O     . ILE A 1 625 ? 21.653  13.677  72.298  1.00 27.99  ?  622  ILE A O     1 
ATOM   5160  C CB    . ILE A 1 625 ? 21.740  11.428  69.788  1.00 21.41  ?  622  ILE A CB    1 
ATOM   5161  C CG1   . ILE A 1 625 ? 20.843  10.511  68.953  1.00 22.86  ?  622  ILE A CG1   1 
ATOM   5162  C CG2   . ILE A 1 625 ? 22.258  10.707  71.013  1.00 19.91  ?  622  ILE A CG2   1 
ATOM   5163  C CD1   . ILE A 1 625 ? 21.613  9.552   68.066  1.00 27.89  ?  622  ILE A CD1   1 
ATOM   5164  N N     . ALA A 1 626 ? 22.808  14.295  70.466  1.00 25.45  ?  623  ALA A N     1 
ATOM   5165  C CA    . ALA A 1 626 ? 23.735  15.120  71.234  1.00 26.24  ?  623  ALA A CA    1 
ATOM   5166  C C     . ALA A 1 626 ? 23.002  16.210  72.006  1.00 25.82  ?  623  ALA A C     1 
ATOM   5167  O O     . ALA A 1 626 ? 23.301  16.455  73.181  1.00 25.97  ?  623  ALA A O     1 
ATOM   5168  C CB    . ALA A 1 626 ? 24.787  15.731  70.309  1.00 29.12  ?  623  ALA A CB    1 
ATOM   5169  N N     . ASN A 1 627 ? 22.038  16.876  71.365  1.00 21.10  ?  624  ASN A N     1 
ATOM   5170  C CA    . ASN A 1 627 ? 21.240  17.869  72.077  1.00 34.31  ?  624  ASN A CA    1 
ATOM   5171  C C     . ASN A 1 627 ? 20.465  17.232  73.225  1.00 36.17  ?  624  ASN A C     1 
ATOM   5172  O O     . ASN A 1 627 ? 20.434  17.771  74.338  1.00 37.15  ?  624  ASN A O     1 
ATOM   5173  C CB    . ASN A 1 627 ? 20.278  18.574  71.118  1.00 27.60  ?  624  ASN A CB    1 
ATOM   5174  C CG    . ASN A 1 627 ? 20.981  19.544  70.181  1.00 44.40  ?  624  ASN A CG    1 
ATOM   5175  O OD1   . ASN A 1 627 ? 22.166  19.840  70.344  1.00 46.21  ?  624  ASN A OD1   1 
ATOM   5176  N ND2   . ASN A 1 627 ? 20.245  20.056  69.204  1.00 47.38  ?  624  ASN A ND2   1 
ATOM   5177  N N     . LYS A 1 628 ? 19.839  16.078  72.974  1.00 28.62  ?  625  LYS A N     1 
ATOM   5178  C CA    . LYS A 1 628 ? 18.994  15.452  73.986  1.00 30.24  ?  625  LYS A CA    1 
ATOM   5179  C C     . LYS A 1 628 ? 19.810  14.953  75.173  1.00 22.56  ?  625  LYS A C     1 
ATOM   5180  O O     . LYS A 1 628 ? 19.421  15.156  76.329  1.00 29.35  ?  625  LYS A O     1 
ATOM   5181  C CB    . LYS A 1 628 ? 18.193  14.303  73.370  1.00 27.09  ?  625  LYS A CB    1 
ATOM   5182  C CG    . LYS A 1 628 ? 16.852  14.717  72.789  1.00 33.95  ?  625  LYS A CG    1 
ATOM   5183  C CD    . LYS A 1 628 ? 15.944  15.273  73.871  1.00 36.14  ?  625  LYS A CD    1 
ATOM   5184  C CE    . LYS A 1 628 ? 14.572  15.633  73.326  1.00 47.32  ?  625  LYS A CE    1 
ATOM   5185  N NZ    . LYS A 1 628 ? 13.696  14.440  73.172  1.00 52.63  1  625  LYS A NZ    1 
ATOM   5186  N N     . VAL A 1 629 ? 20.943  14.296  74.912  1.00 25.03  ?  626  VAL A N     1 
ATOM   5187  C CA    . VAL A 1 629 ? 21.748  13.753  76.004  1.00 30.50  ?  626  VAL A CA    1 
ATOM   5188  C C     . VAL A 1 629 ? 22.371  14.874  76.828  1.00 34.58  ?  626  VAL A C     1 
ATOM   5189  O O     . VAL A 1 629 ? 22.499  14.764  78.053  1.00 25.11  ?  626  VAL A O     1 
ATOM   5190  C CB    . VAL A 1 629 ? 22.811  12.784  75.455  1.00 23.86  ?  626  VAL A CB    1 
ATOM   5191  C CG1   . VAL A 1 629 ? 23.757  12.342  76.561  1.00 27.83  ?  626  VAL A CG1   1 
ATOM   5192  C CG2   . VAL A 1 629 ? 22.137  11.574  74.825  1.00 25.49  ?  626  VAL A CG2   1 
ATOM   5193  N N     . ALA A 1 630 ? 22.756  15.973  76.179  1.00 31.32  ?  627  ALA A N     1 
ATOM   5194  C CA    . ALA A 1 630 ? 23.313  17.104  76.912  1.00 40.65  ?  627  ALA A CA    1 
ATOM   5195  C C     . ALA A 1 630 ? 22.269  17.813  77.764  1.00 36.58  ?  627  ALA A C     1 
ATOM   5196  O O     . ALA A 1 630 ? 22.632  18.522  78.709  1.00 34.08  ?  627  ALA A O     1 
ATOM   5197  C CB    . ALA A 1 630 ? 23.948  18.101  75.941  1.00 37.72  ?  627  ALA A CB    1 
ATOM   5198  N N     . LEU A 1 631 ? 20.985  17.620  77.466  1.00 36.83  ?  628  LEU A N     1 
ATOM   5199  C CA    . LEU A 1 631 ? 19.937  18.392  78.119  1.00 36.60  ?  628  LEU A CA    1 
ATOM   5200  C C     . LEU A 1 631 ? 19.639  17.902  79.537  1.00 40.48  ?  628  LEU A C     1 
ATOM   5201  O O     . LEU A 1 631 ? 19.252  18.710  80.390  1.00 39.24  ?  628  LEU A O     1 
ATOM   5202  C CB    . LEU A 1 631 ? 18.673  18.360  77.254  1.00 47.97  ?  628  LEU A CB    1 
ATOM   5203  C CG    . LEU A 1 631 ? 17.744  19.575  77.281  1.00 54.15  ?  628  LEU A CG    1 
ATOM   5204  C CD1   . LEU A 1 631 ? 17.020  19.711  75.954  1.00 54.56  ?  628  LEU A CD1   1 
ATOM   5205  C CD2   . LEU A 1 631 ? 16.743  19.460  78.417  1.00 58.32  ?  628  LEU A CD2   1 
ATOM   5206  N N     . THR A 1 632 ? 19.810  16.608  79.816  1.00 36.37  ?  629  THR A N     1 
ATOM   5207  C CA    . THR A 1 632 ? 19.447  16.041  81.109  1.00 28.32  ?  629  THR A CA    1 
ATOM   5208  C C     . THR A 1 632 ? 20.500  15.034  81.554  1.00 28.00  ?  629  THR A C     1 
ATOM   5209  O O     . THR A 1 632 ? 21.321  14.564  80.762  1.00 28.34  ?  629  THR A O     1 
ATOM   5210  C CB    . THR A 1 632 ? 18.071  15.352  81.074  1.00 33.49  ?  629  THR A CB    1 
ATOM   5211  O OG1   . THR A 1 632 ? 18.084  14.313  80.086  1.00 24.51  ?  629  THR A OG1   1 
ATOM   5212  C CG2   . THR A 1 632 ? 16.963  16.348  80.741  1.00 34.45  ?  629  THR A CG2   1 
ATOM   5213  N N     . ASP A 1 633 ? 20.446  14.694  82.844  1.00 27.51  ?  630  ASP A N     1 
ATOM   5214  C CA    . ASP A 1 633 ? 21.366  13.722  83.423  1.00 24.55  ?  630  ASP A CA    1 
ATOM   5215  C C     . ASP A 1 633 ? 20.924  12.287  83.155  1.00 29.83  ?  630  ASP A C     1 
ATOM   5216  O O     . ASP A 1 633 ? 21.762  11.411  82.910  1.00 33.26  ?  630  ASP A O     1 
ATOM   5217  C CB    . ASP A 1 633 ? 21.484  13.964  84.925  1.00 35.38  ?  630  ASP A CB    1 
ATOM   5218  C CG    . ASP A 1 633 ? 22.232  15.236  85.253  1.00 48.68  ?  630  ASP A CG    1 
ATOM   5219  O OD1   . ASP A 1 633 ? 23.307  15.477  84.658  1.00 48.10  ?  630  ASP A OD1   1 
ATOM   5220  O OD2   . ASP A 1 633 ? 21.738  15.995  86.109  1.00 49.94  -1 630  ASP A OD2   1 
ATOM   5221  N N     . TYR A 1 634 ? 19.617  12.027  83.213  1.00 24.38  ?  631  TYR A N     1 
ATOM   5222  C CA    . TYR A 1 634 ? 19.088  10.677  83.021  1.00 23.46  ?  631  TYR A CA    1 
ATOM   5223  C C     . TYR A 1 634 ? 17.864  10.606  82.125  1.00 22.18  ?  631  TYR A C     1 
ATOM   5224  O O     . TYR A 1 634 ? 17.628  9.547   81.532  1.00 28.69  ?  631  TYR A O     1 
ATOM   5225  C CB    . TYR A 1 634 ? 18.730  10.043  84.370  1.00 36.07  ?  631  TYR A CB    1 
ATOM   5226  C CG    . TYR A 1 634 ? 19.898  9.849   85.303  1.00 40.55  ?  631  TYR A CG    1 
ATOM   5227  C CD1   . TYR A 1 634 ? 20.646  8.680   85.273  1.00 37.35  ?  631  TYR A CD1   1 
ATOM   5228  C CD2   . TYR A 1 634 ? 20.246  10.828  86.226  1.00 38.94  ?  631  TYR A CD2   1 
ATOM   5229  C CE1   . TYR A 1 634 ? 21.711  8.493   86.129  1.00 38.48  ?  631  TYR A CE1   1 
ATOM   5230  C CE2   . TYR A 1 634 ? 21.312  10.652  87.084  1.00 41.35  ?  631  TYR A CE2   1 
ATOM   5231  C CZ    . TYR A 1 634 ? 22.038  9.481   87.034  1.00 42.06  ?  631  TYR A CZ    1 
ATOM   5232  O OH    . TYR A 1 634 ? 23.099  9.303   87.891  1.00 48.42  ?  631  TYR A OH    1 
ATOM   5233  N N     . GLU A 1 635 ? 17.081  11.680  82.000  1.00 24.58  ?  632  GLU A N     1 
ATOM   5234  C CA    . GLU A 1 635 ? 15.816  11.617  81.280  1.00 22.20  ?  632  GLU A CA    1 
ATOM   5235  C C     . GLU A 1 635 ? 16.003  11.184  79.832  1.00 27.69  ?  632  GLU A C     1 
ATOM   5236  O O     . GLU A 1 635 ? 15.128  10.515  79.269  1.00 21.17  ?  632  GLU A O     1 
ATOM   5237  C CB    . GLU A 1 635 ? 15.122  12.976  81.346  1.00 23.44  ?  632  GLU A CB    1 
ATOM   5238  C CG    . GLU A 1 635 ? 13.778  13.042  80.649  1.00 31.10  ?  632  GLU A CG    1 
ATOM   5239  C CD    . GLU A 1 635 ? 13.231  14.454  80.597  1.00 37.44  ?  632  GLU A CD    1 
ATOM   5240  O OE1   . GLU A 1 635 ? 12.587  14.811  79.588  1.00 32.52  ?  632  GLU A OE1   1 
ATOM   5241  O OE2   . GLU A 1 635 ? 13.454  15.209  81.567  1.00 41.01  -1 632  GLU A OE2   1 
ATOM   5242  N N     . TRP A 1 636 ? 17.136  11.534  79.218  1.00 22.07  ?  633  TRP A N     1 
ATOM   5243  C CA    . TRP A 1 636 ? 17.355  11.203  77.814  1.00 24.78  ?  633  TRP A CA    1 
ATOM   5244  C C     . TRP A 1 636 ? 17.373  9.701   77.569  1.00 21.23  ?  633  TRP A C     1 
ATOM   5245  O O     . TRP A 1 636 ? 17.161  9.270   76.430  1.00 21.13  ?  633  TRP A O     1 
ATOM   5246  C CB    . TRP A 1 636 ? 18.661  11.828  77.317  1.00 22.85  ?  633  TRP A CB    1 
ATOM   5247  C CG    . TRP A 1 636 ? 19.899  11.307  77.995  1.00 32.60  ?  633  TRP A CG    1 
ATOM   5248  C CD1   . TRP A 1 636 ? 20.581  11.894  79.022  1.00 28.81  ?  633  TRP A CD1   1 
ATOM   5249  C CD2   . TRP A 1 636 ? 20.610  10.099  77.683  1.00 24.83  ?  633  TRP A CD2   1 
ATOM   5250  N NE1   . TRP A 1 636 ? 21.668  11.127  79.371  1.00 26.18  ?  633  TRP A NE1   1 
ATOM   5251  C CE2   . TRP A 1 636 ? 21.709  10.022  78.562  1.00 27.67  ?  633  TRP A CE2   1 
ATOM   5252  C CE3   . TRP A 1 636 ? 20.425  9.078   76.744  1.00 24.06  ?  633  TRP A CE3   1 
ATOM   5253  C CZ2   . TRP A 1 636 ? 22.615  8.963   78.534  1.00 30.01  ?  633  TRP A CZ2   1 
ATOM   5254  C CZ3   . TRP A 1 636 ? 21.326  8.028   76.718  1.00 23.66  ?  633  TRP A CZ3   1 
ATOM   5255  C CH2   . TRP A 1 636 ? 22.407  7.980   77.606  1.00 29.49  ?  633  TRP A CH2   1 
ATOM   5256  N N     . LYS A 1 637 ? 17.625  8.898   78.606  1.00 21.25  ?  634  LYS A N     1 
ATOM   5257  C CA    . LYS A 1 637 ? 17.607  7.449   78.447  1.00 21.16  ?  634  LYS A CA    1 
ATOM   5258  C C     . LYS A 1 637 ? 16.223  6.930   78.084  1.00 21.00  ?  634  LYS A C     1 
ATOM   5259  O O     . LYS A 1 637 ? 16.106  5.805   77.586  1.00 20.90  ?  634  LYS A O     1 
ATOM   5260  C CB    . LYS A 1 637 ? 18.096  6.767   79.727  1.00 34.55  ?  634  LYS A CB    1 
ATOM   5261  C CG    . LYS A 1 637 ? 19.609  6.637   79.853  1.00 47.47  ?  634  LYS A CG    1 
ATOM   5262  C CD    . LYS A 1 637 ? 19.967  5.670   80.978  1.00 49.65  ?  634  LYS A CD    1 
ATOM   5263  C CE    . LYS A 1 637 ? 21.396  5.157   80.857  1.00 60.44  ?  634  LYS A CE    1 
ATOM   5264  N NZ    . LYS A 1 637 ? 22.405  6.147   81.323  1.00 59.72  1  634  LYS A NZ    1 
ATOM   5265  N N     . LEU A 1 638 ? 15.177  7.719   78.329  1.00 20.97  ?  635  LEU A N     1 
ATOM   5266  C CA    . LEU A 1 638 ? 13.824  7.334   77.949  1.00 25.43  ?  635  LEU A CA    1 
ATOM   5267  C C     . LEU A 1 638 ? 13.572  7.472   76.456  1.00 20.74  ?  635  LEU A C     1 
ATOM   5268  O O     . LEU A 1 638 ? 12.623  6.873   75.943  1.00 20.61  ?  635  LEU A O     1 
ATOM   5269  C CB    . LEU A 1 638 ? 12.801  8.186   78.702  1.00 17.40  ?  635  LEU A CB    1 
ATOM   5270  C CG    . LEU A 1 638 ? 12.884  8.186   80.226  1.00 20.51  ?  635  LEU A CG    1 
ATOM   5271  C CD1   . LEU A 1 638 ? 11.844  9.129   80.813  1.00 24.85  ?  635  LEU A CD1   1 
ATOM   5272  C CD2   . LEU A 1 638 ? 12.708  6.775   80.764  1.00 22.21  ?  635  LEU A CD2   1 
ATOM   5273  N N     . TYR A 1 639 ? 14.389  8.252   75.754  1.00 15.12  ?  636  TYR A N     1 
ATOM   5274  C CA    . TYR A 1 639 ? 14.158  8.549   74.349  1.00 12.43  ?  636  TYR A CA    1 
ATOM   5275  C C     . TYR A 1 639 ? 15.218  7.976   73.427  1.00 12.44  ?  636  TYR A C     1 
ATOM   5276  O O     . TYR A 1 639 ? 14.907  7.639   72.279  1.00 23.13  ?  636  TYR A O     1 
ATOM   5277  C CB    . TYR A 1 639 ? 14.092  10.068  74.132  1.00 16.07  ?  636  TYR A CB    1 
ATOM   5278  C CG    . TYR A 1 639 ? 13.366  10.822  75.226  1.00 16.47  ?  636  TYR A CG    1 
ATOM   5279  C CD1   . TYR A 1 639 ? 12.038  10.543  75.528  1.00 20.25  ?  636  TYR A CD1   1 
ATOM   5280  C CD2   . TYR A 1 639 ? 14.000  11.834  75.940  1.00 22.57  ?  636  TYR A CD2   1 
ATOM   5281  C CE1   . TYR A 1 639 ? 11.368  11.236  76.520  1.00 25.88  ?  636  TYR A CE1   1 
ATOM   5282  C CE2   . TYR A 1 639 ? 13.338  12.533  76.936  1.00 28.77  ?  636  TYR A CE2   1 
ATOM   5283  C CZ    . TYR A 1 639 ? 12.019  12.228  77.220  1.00 34.93  ?  636  TYR A CZ    1 
ATOM   5284  O OH    . TYR A 1 639 ? 11.353  12.919  78.206  1.00 44.56  ?  636  TYR A OH    1 
ATOM   5285  N N     . ILE A 1 640 ? 16.453  7.862   73.899  1.00 21.77  ?  637  ILE A N     1 
ATOM   5286  C CA    . ILE A 1 640 ? 17.608  7.485   73.094  1.00 24.20  ?  637  ILE A CA    1 
ATOM   5287  C C     . ILE A 1 640 ? 17.992  6.057   73.477  1.00 22.97  ?  637  ILE A C     1 
ATOM   5288  O O     . ILE A 1 640 ? 18.407  5.817   74.620  1.00 25.31  ?  637  ILE A O     1 
ATOM   5289  C CB    . ILE A 1 640 ? 18.776  8.456   73.318  1.00 28.47  ?  637  ILE A CB    1 
ATOM   5290  C CG1   . ILE A 1 640 ? 18.336  9.900   73.057  1.00 23.24  ?  637  ILE A CG1   1 
ATOM   5291  C CG2   . ILE A 1 640 ? 19.968  8.088   72.454  1.00 24.21  ?  637  ILE A CG2   1 
ATOM   5292  C CD1   . ILE A 1 640 ? 17.740  10.134  71.689  1.00 24.79  ?  637  ILE A CD1   1 
ATOM   5293  N N     . PRO A 1 641 ? 17.867  5.082   72.572  1.00 24.06  ?  638  PRO A N     1 
ATOM   5294  C CA    . PRO A 1 641 ? 18.270  3.711   72.910  1.00 31.65  ?  638  PRO A CA    1 
ATOM   5295  C C     . PRO A 1 641 ? 19.780  3.528   72.871  1.00 48.62  ?  638  PRO A C     1 
ATOM   5296  O O     . PRO A 1 641 ? 20.353  3.240   71.816  1.00 57.33  ?  638  PRO A O     1 
ATOM   5297  C CB    . PRO A 1 641 ? 17.570  2.867   71.839  1.00 29.82  ?  638  PRO A CB    1 
ATOM   5298  C CG    . PRO A 1 641 ? 17.432  3.790   70.670  1.00 38.14  ?  638  PRO A CG    1 
ATOM   5299  C CD    . PRO A 1 641 ? 17.261  5.178   71.232  1.00 28.75  ?  638  PRO A CD    1 
ATOM   5300  N N     . TYR A 1 642 ? 20.430  3.696   74.019  1.00 53.70  ?  639  TYR A N     1 
ATOM   5301  C CA    . TYR A 1 642 ? 21.876  3.538   74.115  1.00 50.54  ?  639  TYR A CA    1 
ATOM   5302  C C     . TYR A 1 642 ? 22.263  2.854   75.419  1.00 48.16  ?  639  TYR A C     1 
ATOM   5303  O O     . TYR A 1 642 ? 22.513  1.649   75.446  1.00 54.48  ?  639  TYR A O     1 
ATOM   5304  C CB    . TYR A 1 642 ? 22.574  4.894   74.006  1.00 49.04  ?  639  TYR A CB    1 
ATOM   5305  C CG    . TYR A 1 642 ? 24.085  4.813   74.002  1.00 43.83  ?  639  TYR A CG    1 
ATOM   5306  C CD1   . TYR A 1 642 ? 24.771  4.351   72.886  1.00 36.75  ?  639  TYR A CD1   1 
ATOM   5307  C CD2   . TYR A 1 642 ? 24.826  5.209   75.108  1.00 45.16  ?  639  TYR A CD2   1 
ATOM   5308  C CE1   . TYR A 1 642 ? 26.152  4.280   72.874  1.00 32.39  ?  639  TYR A CE1   1 
ATOM   5309  C CE2   . TYR A 1 642 ? 26.209  5.142   75.105  1.00 48.57  ?  639  TYR A CE2   1 
ATOM   5310  C CZ    . TYR A 1 642 ? 26.865  4.677   73.984  1.00 40.01  ?  639  TYR A CZ    1 
ATOM   5311  O OH    . TYR A 1 642 ? 28.239  4.608   73.972  1.00 40.22  ?  639  TYR A OH    1 
ATOM   5312  O "O5'" . U   B 2 1   ? 8.549   9.627   77.626  1.00 35.88  ?  1    U   B "O5'" 1 
ATOM   5313  C "C5'" . U   B 2 1   ? 8.139   8.392   78.204  1.00 34.26  ?  1    U   B "C5'" 1 
ATOM   5314  C "C4'" . U   B 2 1   ? 6.917   8.556   79.076  1.00 35.16  ?  1    U   B "C4'" 1 
ATOM   5315  O "O4'" . U   B 2 1   ? 7.282   9.285   80.278  1.00 36.64  ?  1    U   B "O4'" 1 
ATOM   5316  C "C3'" . U   B 2 1   ? 5.754   9.316   78.442  1.00 35.12  ?  1    U   B "C3'" 1 
ATOM   5317  O "O3'" . U   B 2 1   ? 4.514   8.728   78.834  1.00 33.71  ?  1    U   B "O3'" 1 
ATOM   5318  C "C2'" . U   B 2 1   ? 5.877   10.714  79.042  1.00 37.25  ?  1    U   B "C2'" 1 
ATOM   5319  O "O2'" . U   B 2 1   ? 4.655   11.417  79.135  1.00 37.72  ?  1    U   B "O2'" 1 
ATOM   5320  C "C1'" . U   B 2 1   ? 6.459   10.426  80.424  1.00 36.13  ?  1    U   B "C1'" 1 
ATOM   5321  N N1    . U   B 2 1   ? 7.302   11.519  80.925  1.00 26.95  ?  1    U   B N1    1 
ATOM   5322  C C2    . U   B 2 1   ? 7.015   12.107  82.143  1.00 24.20  ?  1    U   B C2    1 
ATOM   5323  O O2    . U   B 2 1   ? 6.082   11.758  82.848  1.00 24.01  ?  1    U   B O2    1 
ATOM   5324  N N3    . U   B 2 1   ? 7.869   13.122  82.507  1.00 24.43  ?  1    U   B N3    1 
ATOM   5325  C C4    . U   B 2 1   ? 8.952   13.596  81.785  1.00 23.54  ?  1    U   B C4    1 
ATOM   5326  O O4    . U   B 2 1   ? 9.634   14.516  82.235  1.00 20.07  ?  1    U   B O4    1 
ATOM   5327  C C5    . U   B 2 1   ? 9.176   12.936  80.538  1.00 21.60  ?  1    U   B C5    1 
ATOM   5328  C C6    . U   B 2 1   ? 8.361   11.948  80.163  1.00 17.76  ?  1    U   B C6    1 
ATOM   5329  P P     . A   B 2 2   ? 3.301   8.662   77.783  1.00 33.24  ?  2    A   B P     1 
ATOM   5330  O OP1   . A   B 2 2   ? 2.929   10.054  77.439  1.00 32.44  -1 2    A   B OP1   1 
ATOM   5331  O OP2   . A   B 2 2   ? 2.268   7.726   78.291  1.00 34.42  ?  2    A   B OP2   1 
ATOM   5332  O "O5'" . A   B 2 2   ? 3.953   8.028   76.476  1.00 34.51  ?  2    A   B "O5'" 1 
ATOM   5333  C "C5'" . A   B 2 2   ? 4.517   6.724   76.483  1.00 32.82  ?  2    A   B "C5'" 1 
ATOM   5334  C "C4'" . A   B 2 2   ? 4.813   6.268   75.080  1.00 33.07  ?  2    A   B "C4'" 1 
ATOM   5335  O "O4'" . A   B 2 2   ? 3.560   6.035   74.383  1.00 33.65  ?  2    A   B "O4'" 1 
ATOM   5336  C "C3'" . A   B 2 2   ? 5.542   7.282   74.212  1.00 33.24  ?  2    A   B "C3'" 1 
ATOM   5337  O "O3'" . A   B 2 2   ? 6.946   7.271   74.400  1.00 32.25  ?  2    A   B "O3'" 1 
ATOM   5338  C "C2'" . A   B 2 2   ? 5.098   6.903   72.807  1.00 33.92  ?  2    A   B "C2'" 1 
ATOM   5339  O "O2'" . A   B 2 2   ? 5.798   5.759   72.343  1.00 33.14  ?  2    A   B "O2'" 1 
ATOM   5340  C "C1'" . A   B 2 2   ? 3.645   6.512   73.059  1.00 32.53  ?  2    A   B "C1'" 1 
ATOM   5341  N N9    . A   B 2 2   ? 2.743   7.673   72.943  1.00 13.84  ?  2    A   B N9    1 
ATOM   5342  C C8    . A   B 2 2   ? 2.124   8.356   73.959  1.00 19.60  ?  2    A   B C8    1 
ATOM   5343  N N7    . A   B 2 2   ? 1.375   9.354   73.553  1.00 16.46  ?  2    A   B N7    1 
ATOM   5344  C C5    . A   B 2 2   ? 1.517   9.324   72.170  1.00 21.91  ?  2    A   B C5    1 
ATOM   5345  C C6    . A   B 2 2   ? 0.980   10.122  71.145  1.00 24.10  ?  2    A   B C6    1 
ATOM   5346  N N6    . A   B 2 2   ? 0.155   11.152  71.362  1.00 25.36  ?  2    A   B N6    1 
ATOM   5347  N N1    . A   B 2 2   ? 1.327   9.825   69.873  1.00 23.42  ?  2    A   B N1    1 
ATOM   5348  C C2    . A   B 2 2   ? 2.151   8.795   69.654  1.00 22.75  ?  2    A   B C2    1 
ATOM   5349  N N3    . A   B 2 2   ? 2.718   7.976   70.539  1.00 22.17  ?  2    A   B N3    1 
ATOM   5350  C C4    . A   B 2 2   ? 2.355   8.297   71.787  1.00 14.12  ?  2    A   B C4    1 
ATOM   5351  P P     . U   B 2 3   ? 7.783   8.627   74.212  1.00 32.91  ?  3    U   B P     1 
ATOM   5352  O OP1   . U   B 2 3   ? 9.229   8.325   74.357  1.00 34.54  ?  3    U   B OP1   1 
ATOM   5353  O OP2   . U   B 2 3   ? 7.173   9.682   75.055  1.00 31.99  -1 3    U   B OP2   1 
ATOM   5354  O "O5'" . U   B 2 3   ? 7.521   9.005   72.692  1.00 34.88  ?  3    U   B "O5'" 1 
ATOM   5355  C "C5'" . U   B 2 3   ? 7.418   10.358  72.293  1.00 35.27  ?  3    U   B "C5'" 1 
ATOM   5356  C "C4'" . U   B 2 3   ? 6.887   10.476  70.890  1.00 35.59  ?  3    U   B "C4'" 1 
ATOM   5357  O "O4'" . U   B 2 3   ? 5.463   10.191  70.872  1.00 36.12  ?  3    U   B "O4'" 1 
ATOM   5358  C "C3'" . U   B 2 3   ? 7.004   11.858  70.274  1.00 36.08  ?  3    U   B "C3'" 1 
ATOM   5359  O "O3'" . U   B 2 3   ? 8.280   12.081  69.705  1.00 35.26  ?  3    U   B "O3'" 1 
ATOM   5360  C "C2'" . U   B 2 3   ? 5.881   11.873  69.250  1.00 37.51  ?  3    U   B "C2'" 1 
ATOM   5361  O "O2'" . U   B 2 3   ? 6.273   11.193  68.071  1.00 36.50  ?  3    U   B "O2'" 1 
ATOM   5362  C "C1'" . U   B 2 3   ? 4.809   11.047  69.961  1.00 35.32  ?  3    U   B "C1'" 1 
ATOM   5363  N N1    . U   B 2 3   ? 3.878   11.906  70.726  1.00 27.43  ?  3    U   B N1    1 
ATOM   5364  C C2    . U   B 2 3   ? 3.005   12.723  70.027  1.00 28.05  ?  3    U   B C2    1 
ATOM   5365  O O2    . U   B 2 3   ? 2.950   12.773  68.810  1.00 24.53  ?  3    U   B O2    1 
ATOM   5366  N N3    . U   B 2 3   ? 2.185   13.491  70.816  1.00 26.87  ?  3    U   B N3    1 
ATOM   5367  C C4    . U   B 2 3   ? 2.147   13.524  72.191  1.00 28.34  ?  3    U   B C4    1 
ATOM   5368  O O4    . U   B 2 3   ? 1.345   14.270  72.755  1.00 34.63  ?  3    U   B O4    1 
ATOM   5369  C C5    . U   B 2 3   ? 3.078   12.654  72.839  1.00 25.96  ?  3    U   B C5    1 
ATOM   5370  C C6    . U   B 2 3   ? 3.891   11.895  72.099  1.00 17.70  ?  3    U   B C6    1 
ATOM   5371  P P     . A   B 2 4   ? 9.192   13.292  70.223  1.00 35.96  ?  4    A   B P     1 
ATOM   5372  O OP1   . A   B 2 4   ? 10.364  13.392  69.316  1.00 37.85  ?  4    A   B OP1   1 
ATOM   5373  O OP2   . A   B 2 4   ? 9.394   13.108  71.683  1.00 34.27  -1 4    A   B OP2   1 
ATOM   5374  O "O5'" . A   B 2 4   ? 8.284   14.580  69.990  1.00 38.64  ?  4    A   B "O5'" 1 
ATOM   5375  C "C5'" . A   B 2 4   ? 7.823   14.914  68.690  1.00 42.19  ?  4    A   B "C5'" 1 
ATOM   5376  C "C4'" . A   B 2 4   ? 6.708   15.926  68.737  1.00 46.15  ?  4    A   B "C4'" 1 
ATOM   5377  O "O4'" . A   B 2 4   ? 5.549   15.364  69.406  1.00 44.02  ?  4    A   B "O4'" 1 
ATOM   5378  C "C3'" . A   B 2 4   ? 6.985   17.202  69.514  1.00 46.96  ?  4    A   B "C3'" 1 
ATOM   5379  O "O3'" . A   B 2 4   ? 7.774   18.134  68.794  1.00 40.63  ?  4    A   B "O3'" 1 
ATOM   5380  C "C2'" . A   B 2 4   ? 5.581   17.702  69.822  1.00 45.04  ?  4    A   B "C2'" 1 
ATOM   5381  O "O2'" . A   B 2 4   ? 5.010   18.334  68.687  1.00 41.50  ?  4    A   B "O2'" 1 
ATOM   5382  C "C1'" . A   B 2 4   ? 4.840   16.390  70.073  1.00 39.60  ?  4    A   B "C1'" 1 
ATOM   5383  N N9    . A   B 2 4   ? 4.765   16.073  71.510  1.00 30.34  ?  4    A   B N9    1 
ATOM   5384  C C8    . A   B 2 4   ? 5.570   15.231  72.237  1.00 28.63  ?  4    A   B C8    1 
ATOM   5385  N N7    . A   B 2 4   ? 5.244   15.161  73.506  1.00 37.96  ?  4    A   B N7    1 
ATOM   5386  C C5    . A   B 2 4   ? 4.155   16.017  73.623  1.00 23.43  ?  4    A   B C5    1 
ATOM   5387  C C6    . A   B 2 4   ? 3.356   16.387  74.718  1.00 31.18  ?  4    A   B C6    1 
ATOM   5388  N N6    . A   B 2 4   ? 3.534   15.914  75.955  1.00 37.47  ?  4    A   B N6    1 
ATOM   5389  N N1    . A   B 2 4   ? 2.352   17.266  74.499  1.00 30.58  ?  4    A   B N1    1 
ATOM   5390  C C2    . A   B 2 4   ? 2.171   17.736  73.257  1.00 24.05  ?  4    A   B C2    1 
ATOM   5391  N N3    . A   B 2 4   ? 2.860   17.465  72.149  1.00 39.77  ?  4    A   B N3    1 
ATOM   5392  C C4    . A   B 2 4   ? 3.852   16.590  72.402  1.00 32.64  ?  4    A   B C4    1 
ATOM   5393  P P     . C   B 2 5   ? 8.784   19.115  69.571  1.00 40.13  ?  5    C   B P     1 
ATOM   5394  O OP1   . C   B 2 5   ? 9.536   19.898  68.559  1.00 51.84  ?  5    C   B OP1   1 
ATOM   5395  O OP2   . C   B 2 5   ? 9.533   18.314  70.571  1.00 38.01  -1 5    C   B OP2   1 
ATOM   5396  O "O5'" . C   B 2 5   ? 7.825   20.116  70.361  1.00 53.48  ?  5    C   B "O5'" 1 
ATOM   5397  C "C5'" . C   B 2 5   ? 6.867   20.915  69.677  1.00 57.86  ?  5    C   B "C5'" 1 
ATOM   5398  C "C4'" . C   B 2 5   ? 5.805   21.427  70.620  1.00 54.30  ?  5    C   B "C4'" 1 
ATOM   5399  O "O4'" . C   B 2 5   ? 5.220   20.319  71.341  1.00 51.71  ?  5    C   B "O4'" 1 
ATOM   5400  C "C3'" . C   B 2 5   ? 6.292   22.380  71.700  1.00 55.59  ?  5    C   B "C3'" 1 
ATOM   5401  O "O3'" . C   B 2 5   ? 6.305   23.717  71.233  1.00 59.91  ?  5    C   B "O3'" 1 
ATOM   5402  C "C2'" . C   B 2 5   ? 5.304   22.167  72.848  1.00 56.34  ?  5    C   B "C2'" 1 
ATOM   5403  O "O2'" . C   B 2 5   ? 4.173   23.013  72.705  1.00 53.46  ?  5    C   B "O2'" 1 
ATOM   5404  C "C1'" . C   B 2 5   ? 4.861   20.714  72.643  1.00 52.68  ?  5    C   B "C1'" 1 
ATOM   5405  N N1    . C   B 2 5   ? 5.445   19.756  73.612  1.00 43.99  ?  5    C   B N1    1 
ATOM   5406  C C2    . C   B 2 5   ? 4.902   19.663  74.898  1.00 41.61  ?  5    C   B C2    1 
ATOM   5407  O O2    . C   B 2 5   ? 3.962   20.409  75.212  1.00 44.95  ?  5    C   B O2    1 
ATOM   5408  N N3    . C   B 2 5   ? 5.420   18.770  75.776  1.00 43.08  ?  5    C   B N3    1 
ATOM   5409  C C4    . C   B 2 5   ? 6.431   17.980  75.410  1.00 40.74  ?  5    C   B C4    1 
ATOM   5410  N N4    . C   B 2 5   ? 6.907   17.116  76.312  1.00 39.30  ?  5    C   B N4    1 
ATOM   5411  C C5    . C   B 2 5   ? 6.995   18.043  74.104  1.00 35.11  ?  5    C   B C5    1 
ATOM   5412  C C6    . C   B 2 5   ? 6.473   18.930  73.246  1.00 41.31  ?  5    C   B C6    1 
ATOM   5413  P P     . A   B 2 6   ? 7.675   24.545  71.138  1.00 71.79  ?  6    A   B P     1 
ATOM   5414  O OP1   . A   B 2 6   ? 7.314   25.976  71.295  1.00 80.80  -1 6    A   B OP1   1 
ATOM   5415  O OP2   . A   B 2 6   ? 8.466   24.112  69.957  1.00 74.35  ?  6    A   B OP2   1 
ATOM   5416  O "O5'" . A   B 2 6   ? 8.436   24.161  72.476  1.00 54.37  ?  6    A   B "O5'" 1 
ATOM   5417  C "C5'" . A   B 2 6   ? 8.653   25.159  73.457  1.00 62.97  ?  6    A   B "C5'" 1 
ATOM   5418  C "C4'" . A   B 2 6   ? 7.693   25.040  74.615  1.00 70.17  ?  6    A   B "C4'" 1 
ATOM   5419  O "O4'" . A   B 2 6   ? 7.841   23.744  75.233  1.00 71.68  ?  6    A   B "O4'" 1 
ATOM   5420  C "C3'" . A   B 2 6   ? 7.909   26.089  75.708  1.00 76.02  ?  6    A   B "C3'" 1 
ATOM   5421  O "O3'" . A   B 2 6   ? 6.754   26.894  75.898  1.00 82.41  ?  6    A   B "O3'" 1 
ATOM   5422  C "C2'" . A   B 2 6   ? 8.274   25.324  76.981  1.00 71.33  ?  6    A   B "C2'" 1 
ATOM   5423  O "O2'" . A   B 2 6   ? 7.404   25.656  78.053  1.00 67.91  ?  6    A   B "O2'" 1 
ATOM   5424  C "C1'" . A   B 2 6   ? 8.124   23.851  76.603  1.00 71.14  ?  6    A   B "C1'" 1 
ATOM   5425  P P     . A   B 2 7   ? 6.502   28.258  75.090  1.00 89.92  ?  7    A   B P     1 
ATOM   5426  O OP1   . A   B 2 7   ? 5.029   28.451  75.094  1.00 83.63  ?  7    A   B OP1   1 
ATOM   5427  O OP2   . A   B 2 7   ? 7.233   28.231  73.797  1.00 88.09  -1 7    A   B OP2   1 
ATOM   5428  O "O5'" . A   B 2 7   ? 7.130   29.381  76.030  1.00 87.75  ?  7    A   B "O5'" 1 
ATOM   5429  C "C5'" . A   B 2 7   ? 8.526   29.435  76.277  1.00 83.64  ?  7    A   B "C5'" 1 
ATOM   5430  C "C4'" . A   B 2 7   ? 8.996   30.854  76.441  1.00 83.51  ?  7    A   B "C4'" 1 
ATOM   5431  O "O4'" . A   B 2 7   ? 9.164   31.165  77.848  1.00 76.90  ?  7    A   B "O4'" 1 
ATOM   5432  C "C3'" . A   B 2 7   ? 10.346  31.173  75.831  1.00 84.74  ?  7    A   B "C3'" 1 
ATOM   5433  O "O3'" . A   B 2 7   ? 10.261  31.392  74.436  1.00 88.14  ?  7    A   B "O3'" 1 
ATOM   5434  C "C2'" . A   B 2 7   ? 10.787  32.394  76.628  1.00 83.86  ?  7    A   B "C2'" 1 
ATOM   5435  O "O2'" . A   B 2 7   ? 10.117  33.560  76.171  1.00 84.69  ?  7    A   B "O2'" 1 
ATOM   5436  C "C1'" . A   B 2 7   ? 10.253  32.047  78.018  1.00 75.44  ?  7    A   B "C1'" 1 
ATOM   5437  P P     . C   B 2 8   ? 11.460  30.926  73.471  1.00 86.20  ?  8    C   B P     1 
ATOM   5438  O OP1   . C   B 2 8   ? 10.882  30.534  72.159  1.00 84.74  ?  8    C   B OP1   1 
ATOM   5439  O OP2   . C   B 2 8   ? 12.314  29.965  74.223  1.00 82.76  -1 8    C   B OP2   1 
ATOM   5440  O "O5'" . C   B 2 8   ? 12.294  32.262  73.246  1.00 71.71  ?  8    C   B "O5'" 1 
ATOM   5441  C "C5'" . C   B 2 8   ? 11.628  33.514  73.117  1.00 72.23  ?  8    C   B "C5'" 1 
ATOM   5442  C "C4'" . C   B 2 8   ? 12.562  34.654  73.468  1.00 79.77  ?  8    C   B "C4'" 1 
ATOM   5443  O "O4'" . C   B 2 8   ? 12.772  34.706  74.900  1.00 79.99  ?  8    C   B "O4'" 1 
ATOM   5444  C "C3'" . C   B 2 8   ? 13.959  34.526  72.900  1.00 78.03  ?  8    C   B "C3'" 1 
ATOM   5445  O "O3'" . C   B 2 8   ? 14.029  34.929  71.541  1.00 74.31  ?  8    C   B "O3'" 1 
ATOM   5446  C "C2'" . C   B 2 8   ? 14.789  35.378  73.847  1.00 76.55  ?  8    C   B "C2'" 1 
ATOM   5447  O "O2'" . C   B 2 8   ? 14.646  36.758  73.534  1.00 75.28  ?  8    C   B "O2'" 1 
ATOM   5448  C "C1'" . C   B 2 8   ? 14.096  35.105  75.183  1.00 77.40  ?  8    C   B "C1'" 1 
ATOM   5449  P P     . C   B 2 9   ? 14.086  33.832  70.366  1.00 67.10  ?  9    C   B P     1 
ATOM   5450  O OP1   . C   B 2 9   ? 13.825  34.528  69.082  1.00 69.76  ?  9    C   B OP1   1 
ATOM   5451  O OP2   . C   B 2 9   ? 13.228  32.688  70.766  1.00 71.64  -1 9    C   B OP2   1 
ATOM   5452  O "O5'" . C   B 2 9   ? 15.604  33.347  70.366  1.00 64.61  ?  9    C   B "O5'" 1 
ATOM   5453  C "C5'" . C   B 2 9   ? 16.648  34.238  70.003  1.00 70.06  ?  9    C   B "C5'" 1 
ATOM   5454  C "C4'" . C   B 2 9   ? 17.779  34.219  70.999  1.00 72.06  ?  9    C   B "C4'" 1 
ATOM   5455  O "O4'" . C   B 2 9   ? 17.255  33.953  72.325  1.00 70.97  ?  9    C   B "O4'" 1 
ATOM   5456  C "C3'" . C   B 2 9   ? 18.835  33.144  70.792  1.00 72.13  ?  9    C   B "C3'" 1 
ATOM   5457  O "O3'" . C   B 2 9   ? 19.807  33.510  69.825  1.00 74.23  ?  9    C   B "O3'" 1 
ATOM   5458  C "C2'" . C   B 2 9   ? 19.412  32.973  72.191  1.00 70.05  ?  9    C   B "C2'" 1 
ATOM   5459  O "O2'" . C   B 2 9   ? 20.325  34.019  72.486  1.00 67.03  ?  9    C   B "O2'" 1 
ATOM   5460  C "C1'" . C   B 2 9   ? 18.168  33.164  73.057  1.00 71.35  ?  9    C   B "C1'" 1 
ATOM   5461  P P     . U   B 2 10  ? 19.743  32.920  68.330  1.00 71.61  ?  10   U   B P     1 
ATOM   5462  O OP1   . U   B 2 10  ? 18.573  33.541  67.667  1.00 65.95  ?  10   U   B OP1   1 
ATOM   5463  O OP2   . U   B 2 10  ? 19.800  31.443  68.451  1.00 74.81  -1 10   U   B OP2   1 
ATOM   5464  O "O5'" . U   B 2 10  ? 21.075  33.469  67.655  1.00 70.30  ?  10   U   B "O5'" 1 
ATOM   5465  O "O3'" . U   B 2 10  ? 24.664  34.818  65.434  1.00 85.69  ?  10   U   B "O3'" 1 
ATOM   5466  P P     . A   B 2 11  ? 24.591  36.399  65.165  1.00 83.25  ?  11   A   B P     1 
ATOM   5467  O OP1   . A   B 2 11  ? 23.322  36.905  65.743  1.00 87.55  -1 11   A   B OP1   1 
ATOM   5468  O OP2   . A   B 2 11  ? 24.902  36.641  63.733  1.00 78.26  ?  11   A   B OP2   1 
ATOM   5469  O "O5'" . A   B 2 11  ? 25.774  36.992  66.047  1.00 76.37  ?  11   A   B "O5'" 1 
ATOM   5470  C "C5'" . A   B 2 11  ? 27.121  36.935  65.606  1.00 73.83  ?  11   A   B "C5'" 1 
ATOM   5471  C "C4'" . A   B 2 11  ? 27.969  37.915  66.367  1.00 77.77  ?  11   A   B "C4'" 1 
ATOM   5472  O "O4'" . A   B 2 11  ? 27.587  39.263  65.985  1.00 76.15  ?  11   A   B "O4'" 1 
ATOM   5473  C "C3'" . A   B 2 11  ? 27.778  37.872  67.877  1.00 82.43  ?  11   A   B "C3'" 1 
ATOM   5474  O "O3'" . A   B 2 11  ? 28.573  36.891  68.535  1.00 87.17  ?  11   A   B "O3'" 1 
ATOM   5475  C "C2'" . A   B 2 11  ? 28.067  39.306  68.306  1.00 79.99  ?  11   A   B "C2'" 1 
ATOM   5476  O "O2'" . A   B 2 11  ? 29.463  39.553  68.398  1.00 78.23  ?  11   A   B "O2'" 1 
ATOM   5477  C "C1'" . A   B 2 11  ? 27.512  40.091  67.124  1.00 75.76  ?  11   A   B "C1'" 1 
ATOM   5478  N N9    . A   B 2 11  ? 26.100  40.458  67.331  1.00 62.06  ?  11   A   B N9    1 
ATOM   5479  C C8    . A   B 2 11  ? 24.961  39.731  67.067  1.00 51.09  ?  11   A   B C8    1 
ATOM   5480  N N7    . A   B 2 11  ? 23.851  40.363  67.371  1.00 50.51  ?  11   A   B N7    1 
ATOM   5481  C C5    . A   B 2 11  ? 24.301  41.584  67.868  1.00 52.43  ?  11   A   B C5    1 
ATOM   5482  C C6    . A   B 2 11  ? 23.640  42.719  68.367  1.00 53.98  ?  11   A   B C6    1 
ATOM   5483  N N6    . A   B 2 11  ? 22.307  42.826  68.457  1.00 53.84  ?  11   A   B N6    1 
ATOM   5484  N N1    . A   B 2 11  ? 24.402  43.754  68.774  1.00 55.73  ?  11   A   B N1    1 
ATOM   5485  C C2    . A   B 2 11  ? 25.736  43.669  68.690  1.00 55.93  ?  11   A   B C2    1 
ATOM   5486  N N3    . A   B 2 11  ? 26.472  42.659  68.243  1.00 54.59  ?  11   A   B N3    1 
ATOM   5487  C C4    . A   B 2 11  ? 25.681  41.647  67.847  1.00 57.78  ?  11   A   B C4    1 
ATOM   5488  P P     . C   B 2 12  ? 30.053  36.497  68.029  1.00 90.95  ?  12   C   B P     1 
ATOM   5489  O OP1   . C   B 2 12  ? 29.955  35.654  66.815  1.00 89.16  ?  12   C   B OP1   1 
ATOM   5490  O OP2   . C   B 2 12  ? 30.755  35.958  69.212  1.00 88.07  ?  12   C   B OP2   1 
ATOM   5491  O "O5'" . C   B 2 12  ? 30.760  37.888  67.672  1.00 88.07  ?  12   C   B "O5'" 1 
ATOM   5492  P P     . U   B 2 20  ? 22.090  48.691  80.917  1.00 94.30  ?  20   U   B P     1 
ATOM   5493  O OP1   . U   B 2 20  ? 22.843  48.228  82.112  1.00 95.05  ?  20   U   B OP1   1 
ATOM   5494  O OP2   . U   B 2 20  ? 21.105  47.778  80.278  1.00 89.13  -1 20   U   B OP2   1 
ATOM   5495  O "O5'" . U   B 2 20  ? 21.359  50.071  81.245  1.00 101.60 ?  20   U   B "O5'" 1 
ATOM   5496  C "C5'" . U   B 2 20  ? 20.875  50.367  82.549  1.00 106.14 ?  20   U   B "C5'" 1 
ATOM   5497  C "C4'" . U   B 2 20  ? 19.365  50.374  82.594  1.00 108.12 ?  20   U   B "C4'" 1 
ATOM   5498  O "O4'" . U   B 2 20  ? 18.871  49.114  82.080  1.00 105.57 ?  20   U   B "O4'" 1 
ATOM   5499  C "C3'" . U   B 2 20  ? 18.744  50.497  83.983  1.00 108.51 ?  20   U   B "C3'" 1 
ATOM   5500  O "O3'" . U   B 2 20  ? 18.590  51.847  84.397  1.00 117.83 ?  20   U   B "O3'" 1 
ATOM   5501  C "C2'" . U   B 2 20  ? 17.407  49.768  83.849  1.00 98.30  ?  20   U   B "C2'" 1 
ATOM   5502  O "O2'" . U   B 2 20  ? 16.394  50.641  83.370  1.00 94.72  ?  20   U   B "O2'" 1 
ATOM   5503  C "C1'" . U   B 2 20  ? 17.705  48.725  82.768  1.00 94.58  ?  20   U   B "C1'" 1 
ATOM   5504  N N1    . U   B 2 20  ? 17.868  47.340  83.278  1.00 76.95  ?  20   U   B N1    1 
ATOM   5505  C C2    . U   B 2 20  ? 19.026  46.934  83.929  1.00 71.94  ?  20   U   B C2    1 
ATOM   5506  O O2    . U   B 2 20  ? 19.985  47.651  84.148  1.00 76.21  ?  20   U   B O2    1 
ATOM   5507  N N3    . U   B 2 20  ? 19.034  45.619  84.327  1.00 60.83  ?  20   U   B N3    1 
ATOM   5508  C C4    . U   B 2 20  ? 18.039  44.682  84.154  1.00 59.24  ?  20   U   B C4    1 
ATOM   5509  O O4    . U   B 2 20  ? 18.208  43.538  84.578  1.00 57.66  ?  20   U   B O4    1 
ATOM   5510  C C5    . U   B 2 20  ? 16.880  45.172  83.476  1.00 62.54  ?  20   U   B C5    1 
ATOM   5511  C C6    . U   B 2 20  ? 16.843  46.447  83.074  1.00 63.32  ?  20   U   B C6    1 
ATOM   5512  P P     . U   B 2 21  ? 19.748  52.623  85.204  1.00 119.80 ?  21   U   B P     1 
ATOM   5513  O OP1   . U   B 2 21  ? 19.071  53.555  86.152  1.00 119.66 ?  21   U   B OP1   1 
ATOM   5514  O OP2   . U   B 2 21  ? 20.672  53.208  84.206  1.00 118.91 -1 21   U   B OP2   1 
ATOM   5515  O "O5'" . U   B 2 21  ? 20.576  51.479  85.958  1.00 112.96 ?  21   U   B "O5'" 1 
ATOM   5516  C "C5'" . U   B 2 21  ? 20.294  51.114  87.314  1.00 106.08 ?  21   U   B "C5'" 1 
ATOM   5517  C "C4'" . U   B 2 21  ? 18.831  50.769  87.484  1.00 102.73 ?  21   U   B "C4'" 1 
ATOM   5518  O "O4'" . U   B 2 21  ? 18.597  49.396  87.077  1.00 98.45  ?  21   U   B "O4'" 1 
ATOM   5519  C "C3'" . U   B 2 21  ? 18.198  50.933  88.878  1.00 105.17 ?  21   U   B "C3'" 1 
ATOM   5520  O "O3'" . U   B 2 21  ? 17.152  51.906  88.862  1.00 108.66 ?  21   U   B "O3'" 1 
ATOM   5521  C "C2'" . U   B 2 21  ? 17.569  49.563  89.179  1.00 102.40 ?  21   U   B "C2'" 1 
ATOM   5522  O "O2'" . U   B 2 21  ? 16.271  49.643  89.737  1.00 106.53 ?  21   U   B "O2'" 1 
ATOM   5523  C "C1'" . U   B 2 21  ? 17.522  48.878  87.815  1.00 90.23  ?  21   U   B "C1'" 1 
ATOM   5524  N N1    . U   B 2 21  ? 17.637  47.413  87.927  1.00 71.33  ?  21   U   B N1    1 
ATOM   5525  C C2    . U   B 2 21  ? 16.447  46.707  88.037  1.00 63.28  ?  21   U   B C2    1 
ATOM   5526  O O2    . U   B 2 21  ? 15.356  47.211  88.007  1.00 72.37  ?  21   U   B O2    1 
ATOM   5527  N N3    . U   B 2 21  ? 16.530  45.357  88.177  1.00 61.27  ?  21   U   B N3    1 
ATOM   5528  C C4    . U   B 2 21  ? 17.689  44.633  88.229  1.00 60.31  ?  21   U   B C4    1 
ATOM   5529  O O4    . U   B 2 21  ? 17.614  43.414  88.356  1.00 58.51  ?  21   U   B O4    1 
ATOM   5530  C C5    . U   B 2 21  ? 18.896  45.399  88.125  1.00 61.58  ?  21   U   B C5    1 
ATOM   5531  C C6    . U   B 2 21  ? 18.836  46.736  87.988  1.00 63.58  ?  21   U   B C6    1 
ATOM   5532  N N     . ALA C 1 4   ? 36.088  -11.499 48.328  1.00 53.23  ?  1    ALA C N     1 
ATOM   5533  C CA    . ALA C 1 4   ? 35.806  -11.327 46.907  1.00 58.10  ?  1    ALA C CA    1 
ATOM   5534  C C     . ALA C 1 4   ? 36.568  -12.360 46.080  1.00 52.05  ?  1    ALA C C     1 
ATOM   5535  O O     . ALA C 1 4   ? 37.679  -12.746 46.427  1.00 57.46  ?  1    ALA C O     1 
ATOM   5536  C CB    . ALA C 1 4   ? 36.157  -9.909  46.455  1.00 49.51  ?  1    ALA C CB    1 
ATOM   5537  N N     . TYR C 1 5   ? 35.966  -12.804 44.984  1.00 49.47  ?  2    TYR C N     1 
ATOM   5538  C CA    . TYR C 1 5   ? 36.527  -13.876 44.175  1.00 42.31  ?  2    TYR C CA    1 
ATOM   5539  C C     . TYR C 1 5   ? 37.395  -13.316 43.056  1.00 38.06  ?  2    TYR C C     1 
ATOM   5540  O O     . TYR C 1 5   ? 37.070  -12.289 42.455  1.00 40.22  ?  2    TYR C O     1 
ATOM   5541  C CB    . TYR C 1 5   ? 35.395  -14.730 43.594  1.00 47.58  ?  2    TYR C CB    1 
ATOM   5542  C CG    . TYR C 1 5   ? 35.775  -15.677 42.468  1.00 60.03  ?  2    TYR C CG    1 
ATOM   5543  C CD1   . TYR C 1 5   ? 35.829  -15.237 41.147  1.00 60.84  ?  2    TYR C CD1   1 
ATOM   5544  C CD2   . TYR C 1 5   ? 36.031  -17.020 42.718  1.00 57.93  ?  2    TYR C CD2   1 
ATOM   5545  C CE1   . TYR C 1 5   ? 36.157  -16.096 40.119  1.00 57.38  ?  2    TYR C CE1   1 
ATOM   5546  C CE2   . TYR C 1 5   ? 36.359  -17.889 41.693  1.00 56.18  ?  2    TYR C CE2   1 
ATOM   5547  C CZ    . TYR C 1 5   ? 36.421  -17.421 40.396  1.00 59.52  ?  2    TYR C CZ    1 
ATOM   5548  O OH    . TYR C 1 5   ? 36.747  -18.280 39.371  1.00 54.12  ?  2    TYR C OH    1 
ATOM   5549  N N     . LEU C 1 6   ? 38.511  -13.991 42.793  1.00 36.08  ?  3    LEU C N     1 
ATOM   5550  C CA    . LEU C 1 6   ? 39.259  -13.833 41.555  1.00 37.82  ?  3    LEU C CA    1 
ATOM   5551  C C     . LEU C 1 6   ? 39.353  -15.190 40.871  1.00 35.95  ?  3    LEU C C     1 
ATOM   5552  O O     . LEU C 1 6   ? 39.431  -16.228 41.533  1.00 37.69  ?  3    LEU C O     1 
ATOM   5553  C CB    . LEU C 1 6   ? 40.669  -13.271 41.789  1.00 41.52  ?  3    LEU C CB    1 
ATOM   5554  C CG    . LEU C 1 6   ? 40.821  -11.786 42.126  1.00 37.34  ?  3    LEU C CG    1 
ATOM   5555  C CD1   . LEU C 1 6   ? 42.274  -11.369 41.974  1.00 35.74  ?  3    LEU C CD1   1 
ATOM   5556  C CD2   . LEU C 1 6   ? 39.916  -10.931 41.254  1.00 33.22  ?  3    LEU C CD2   1 
ATOM   5557  N N     . ASN C 1 7   ? 39.345  -15.178 39.540  1.00 30.46  ?  4    ASN C N     1 
ATOM   5558  C CA    . ASN C 1 7   ? 39.346  -16.414 38.758  1.00 27.62  ?  4    ASN C CA    1 
ATOM   5559  C C     . ASN C 1 7   ? 40.724  -17.055 38.655  1.00 31.23  ?  4    ASN C C     1 
ATOM   5560  O O     . ASN C 1 7   ? 41.070  -17.627 37.620  1.00 34.35  ?  4    ASN C O     1 
ATOM   5561  C CB    . ASN C 1 7   ? 38.774  -16.138 37.370  1.00 29.93  ?  4    ASN C CB    1 
ATOM   5562  C CG    . ASN C 1 7   ? 39.647  -15.207 36.553  1.00 27.53  ?  4    ASN C CG    1 
ATOM   5563  O OD1   . ASN C 1 7   ? 40.401  -14.405 37.102  1.00 33.14  ?  4    ASN C OD1   1 
ATOM   5564  N ND2   . ASN C 1 7   ? 39.550  -15.311 35.232  1.00 27.48  ?  4    ASN C ND2   1 
ATOM   5565  N N     . LEU C 1 8   ? 41.523  -16.986 39.713  1.00 39.98  ?  5    LEU C N     1 
ATOM   5566  C CA    . LEU C 1 8   ? 42.865  -17.545 39.718  1.00 34.44  ?  5    LEU C CA    1 
ATOM   5567  C C     . LEU C 1 8   ? 42.876  -18.879 40.448  1.00 30.79  ?  5    LEU C C     1 
ATOM   5568  O O     . LEU C 1 8   ? 42.232  -19.037 41.489  1.00 28.82  ?  5    LEU C O     1 
ATOM   5569  C CB    . LEU C 1 8   ? 43.849  -16.576 40.375  1.00 31.68  ?  5    LEU C CB    1 
ATOM   5570  C CG    . LEU C 1 8   ? 44.023  -15.264 39.610  1.00 32.29  ?  5    LEU C CG    1 
ATOM   5571  C CD1   . LEU C 1 8   ? 44.854  -14.272 40.403  1.00 30.49  ?  5    LEU C CD1   1 
ATOM   5572  C CD2   . LEU C 1 8   ? 44.658  -15.538 38.257  1.00 37.99  ?  5    LEU C CD2   1 
ATOM   5573  N N     . TYR C 1 9   ? 43.608  -19.842 39.893  1.00 32.23  ?  6    TYR C N     1 
ATOM   5574  C CA    . TYR C 1 9   ? 43.723  -21.167 40.486  1.00 36.36  ?  6    TYR C CA    1 
ATOM   5575  C C     . TYR C 1 9   ? 45.191  -21.552 40.570  1.00 40.10  ?  6    TYR C C     1 
ATOM   5576  O O     . TYR C 1 9   ? 45.902  -21.534 39.560  1.00 44.76  ?  6    TYR C O     1 
ATOM   5577  C CB    . TYR C 1 9   ? 42.929  -22.200 39.683  1.00 32.23  ?  6    TYR C CB    1 
ATOM   5578  C CG    . TYR C 1 9   ? 41.446  -21.910 39.672  1.00 36.00  ?  6    TYR C CG    1 
ATOM   5579  C CD1   . TYR C 1 9   ? 40.899  -21.044 38.738  1.00 40.24  ?  6    TYR C CD1   1 
ATOM   5580  C CD2   . TYR C 1 9   ? 40.597  -22.482 40.610  1.00 40.42  ?  6    TYR C CD2   1 
ATOM   5581  C CE1   . TYR C 1 9   ? 39.549  -20.766 38.722  1.00 40.15  ?  6    TYR C CE1   1 
ATOM   5582  C CE2   . TYR C 1 9   ? 39.239  -22.209 40.604  1.00 45.10  ?  6    TYR C CE2   1 
ATOM   5583  C CZ    . TYR C 1 9   ? 38.723  -21.349 39.656  1.00 37.42  ?  6    TYR C CZ    1 
ATOM   5584  O OH    . TYR C 1 9   ? 37.377  -21.067 39.637  1.00 38.43  ?  6    TYR C OH    1 
ATOM   5585  N N     . LYS C 1 10  ? 45.634  -21.899 41.774  1.00 32.33  ?  7    LYS C N     1 
ATOM   5586  C CA    . LYS C 1 10  ? 47.043  -22.169 42.014  1.00 35.00  ?  7    LYS C CA    1 
ATOM   5587  C C     . LYS C 1 10  ? 47.463  -23.471 41.348  1.00 36.20  ?  7    LYS C C     1 
ATOM   5588  O O     . LYS C 1 10  ? 46.804  -24.503 41.498  1.00 47.13  ?  7    LYS C O     1 
ATOM   5589  C CB    . LYS C 1 10  ? 47.315  -22.234 43.514  1.00 35.73  ?  7    LYS C CB    1 
ATOM   5590  C CG    . LYS C 1 10  ? 48.785  -22.288 43.874  1.00 39.52  ?  7    LYS C CG    1 
ATOM   5591  C CD    . LYS C 1 10  ? 48.966  -22.364 45.379  1.00 47.72  ?  7    LYS C CD    1 
ATOM   5592  C CE    . LYS C 1 10  ? 50.436  -22.355 45.760  1.00 56.86  ?  7    LYS C CE    1 
ATOM   5593  N NZ    . LYS C 1 10  ? 51.197  -23.437 45.072  1.00 66.06  1  7    LYS C NZ    1 
ATOM   5594  N N     . ILE C 1 11  ? 48.574  -23.424 40.626  1.00 32.98  ?  8    ILE C N     1 
ATOM   5595  C CA    . ILE C 1 11  ? 49.109  -24.596 39.947  1.00 37.41  ?  8    ILE C CA    1 
ATOM   5596  C C     . ILE C 1 11  ? 50.052  -25.317 40.900  1.00 43.54  ?  8    ILE C C     1 
ATOM   5597  O O     . ILE C 1 11  ? 51.052  -24.745 41.349  1.00 42.86  ?  8    ILE C O     1 
ATOM   5598  C CB    . ILE C 1 11  ? 49.820  -24.202 38.645  1.00 41.93  ?  8    ILE C CB    1 
ATOM   5599  C CG1   . ILE C 1 11  ? 48.792  -23.682 37.639  1.00 42.56  ?  8    ILE C CG1   1 
ATOM   5600  C CG2   . ILE C 1 11  ? 50.585  -25.379 38.077  1.00 32.72  ?  8    ILE C CG2   1 
ATOM   5601  C CD1   . ILE C 1 11  ? 49.393  -23.035 36.417  1.00 47.23  ?  8    ILE C CD1   1 
ATOM   5602  N N     . ASP C 1 12  ? 49.728  -26.569 41.218  1.00 47.71  ?  9    ASP C N     1 
ATOM   5603  C CA    . ASP C 1 12  ? 50.498  -27.384 42.156  1.00 43.23  ?  9    ASP C CA    1 
ATOM   5604  C C     . ASP C 1 12  ? 51.061  -28.584 41.402  1.00 46.34  ?  9    ASP C C     1 
ATOM   5605  O O     . ASP C 1 12  ? 50.428  -29.642 41.331  1.00 53.69  ?  9    ASP C O     1 
ATOM   5606  C CB    . ASP C 1 12  ? 49.640  -27.825 43.341  1.00 55.81  ?  9    ASP C CB    1 
ATOM   5607  C CG    . ASP C 1 12  ? 50.391  -28.738 44.295  1.00 64.10  ?  9    ASP C CG    1 
ATOM   5608  O OD1   . ASP C 1 12  ? 51.638  -28.669 44.332  1.00 58.98  ?  9    ASP C OD1   1 
ATOM   5609  O OD2   . ASP C 1 12  ? 49.735  -29.526 45.007  1.00 77.96  -1 9    ASP C OD2   1 
ATOM   5610  N N     . ILE C 1 13  ? 52.257  -28.412 40.849  1.00 36.49  ?  10   ILE C N     1 
ATOM   5611  C CA    . ILE C 1 13  ? 52.978  -29.460 40.130  1.00 38.64  ?  10   ILE C CA    1 
ATOM   5612  C C     . ILE C 1 13  ? 54.467  -29.243 40.384  1.00 38.00  ?  10   ILE C C     1 
ATOM   5613  O O     . ILE C 1 13  ? 54.864  -28.136 40.778  1.00 37.71  ?  10   ILE C O     1 
ATOM   5614  C CB    . ILE C 1 13  ? 52.651  -29.435 38.626  1.00 51.04  ?  10   ILE C CB    1 
ATOM   5615  C CG1   . ILE C 1 13  ? 52.863  -28.040 38.055  1.00 46.52  ?  10   ILE C CG1   1 
ATOM   5616  C CG2   . ILE C 1 13  ? 51.225  -29.851 38.366  1.00 51.71  ?  10   ILE C CG2   1 
ATOM   5617  C CD1   . ILE C 1 13  ? 54.156  -27.886 37.354  1.00 54.41  ?  10   ILE C CD1   1 
ATOM   5618  N N     . PRO C 1 14  ? 55.320  -30.251 40.192  1.00 36.02  ?  11   PRO C N     1 
ATOM   5619  C CA    . PRO C 1 14  ? 56.764  -30.031 40.353  1.00 35.54  ?  11   PRO C CA    1 
ATOM   5620  C C     . PRO C 1 14  ? 57.269  -28.943 39.416  1.00 42.15  ?  11   PRO C C     1 
ATOM   5621  O O     . PRO C 1 14  ? 56.963  -28.936 38.222  1.00 48.13  ?  11   PRO C O     1 
ATOM   5622  C CB    . PRO C 1 14  ? 57.369  -31.397 40.010  1.00 39.72  ?  11   PRO C CB    1 
ATOM   5623  C CG    . PRO C 1 14  ? 56.283  -32.376 40.312  1.00 33.57  ?  11   PRO C CG    1 
ATOM   5624  C CD    . PRO C 1 14  ? 55.000  -31.672 39.966  1.00 38.06  ?  11   PRO C CD    1 
ATOM   5625  N N     . LYS C 1 15  ? 58.062  -28.025 39.967  1.00 39.39  ?  12   LYS C N     1 
ATOM   5626  C CA    . LYS C 1 15  ? 58.568  -26.881 39.208  1.00 44.17  ?  12   LYS C CA    1 
ATOM   5627  C C     . LYS C 1 15  ? 59.740  -27.295 38.314  1.00 45.25  ?  12   LYS C C     1 
ATOM   5628  O O     . LYS C 1 15  ? 60.862  -26.798 38.422  1.00 40.33  ?  12   LYS C O     1 
ATOM   5629  C CB    . LYS C 1 15  ? 58.960  -25.756 40.159  1.00 49.69  ?  12   LYS C CB    1 
ATOM   5630  C CG    . LYS C 1 15  ? 57.789  -25.188 40.952  1.00 49.00  ?  12   LYS C CG    1 
ATOM   5631  C CD    . LYS C 1 15  ? 56.567  -25.048 40.056  1.00 45.95  ?  12   LYS C CD    1 
ATOM   5632  C CE    . LYS C 1 15  ? 55.678  -23.886 40.466  1.00 46.25  ?  12   LYS C CE    1 
ATOM   5633  N NZ    . LYS C 1 15  ? 54.617  -24.273 41.434  1.00 49.23  1  12   LYS C NZ    1 
ATOM   5634  N N     . LYS C 1 16  ? 59.452  -28.219 37.400  1.00 41.86  ?  13   LYS C N     1 
ATOM   5635  C CA    . LYS C 1 16  ? 60.476  -28.726 36.499  1.00 36.85  ?  13   LYS C CA    1 
ATOM   5636  C C     . LYS C 1 16  ? 59.816  -29.360 35.283  1.00 37.54  ?  13   LYS C C     1 
ATOM   5637  O O     . LYS C 1 16  ? 58.648  -29.757 35.319  1.00 41.08  ?  13   LYS C O     1 
ATOM   5638  C CB    . LYS C 1 16  ? 61.395  -29.731 37.204  1.00 31.29  ?  13   LYS C CB    1 
ATOM   5639  C CG    . LYS C 1 16  ? 60.668  -30.884 37.885  1.00 47.05  ?  13   LYS C CG    1 
ATOM   5640  C CD    . LYS C 1 16  ? 61.656  -31.805 38.590  1.00 51.92  ?  13   LYS C CD    1 
ATOM   5641  C CE    . LYS C 1 16  ? 61.566  -31.687 40.104  1.00 52.25  ?  13   LYS C CE    1 
ATOM   5642  N NZ    . LYS C 1 16  ? 60.707  -32.755 40.689  1.00 57.56  1  13   LYS C NZ    1 
ATOM   5643  N N     . ILE C 1 17  ? 60.590  -29.447 34.205  1.00 38.12  ?  14   ILE C N     1 
ATOM   5644  C CA    . ILE C 1 17  ? 60.162  -30.049 32.949  1.00 36.66  ?  14   ILE C CA    1 
ATOM   5645  C C     . ILE C 1 17  ? 61.079  -31.227 32.652  1.00 30.14  ?  14   ILE C C     1 
ATOM   5646  O O     . ILE C 1 17  ? 62.282  -31.175 32.933  1.00 29.47  ?  14   ILE C O     1 
ATOM   5647  C CB    . ILE C 1 17  ? 60.185  -29.018 31.797  1.00 33.21  ?  14   ILE C CB    1 
ATOM   5648  C CG1   . ILE C 1 17  ? 59.218  -27.870 32.093  1.00 31.76  ?  14   ILE C CG1   1 
ATOM   5649  C CG2   . ILE C 1 17  ? 59.851  -29.665 30.461  1.00 23.78  ?  14   ILE C CG2   1 
ATOM   5650  C CD1   . ILE C 1 17  ? 57.827  -28.323 32.477  1.00 33.33  ?  14   ILE C CD1   1 
ATOM   5651  N N     . LYS C 1 18  ? 60.506  -32.297 32.110  1.00 27.57  ?  15   LYS C N     1 
ATOM   5652  C CA    . LYS C 1 18  ? 61.251  -33.491 31.735  1.00 31.44  ?  15   LYS C CA    1 
ATOM   5653  C C     . LYS C 1 18  ? 61.209  -33.650 30.221  1.00 28.45  ?  15   LYS C C     1 
ATOM   5654  O O     . LYS C 1 18  ? 60.139  -33.548 29.614  1.00 26.18  ?  15   LYS C O     1 
ATOM   5655  C CB    . LYS C 1 18  ? 60.676  -34.734 32.421  1.00 35.36  ?  15   LYS C CB    1 
ATOM   5656  C CG    . LYS C 1 18  ? 61.397  -36.033 32.081  1.00 52.67  ?  15   LYS C CG    1 
ATOM   5657  C CD    . LYS C 1 18  ? 60.868  -37.195 32.912  1.00 59.11  ?  15   LYS C CD    1 
ATOM   5658  C CE    . LYS C 1 18  ? 61.737  -37.446 34.135  1.00 65.58  ?  15   LYS C CE    1 
ATOM   5659  N NZ    . LYS C 1 18  ? 61.132  -38.450 35.058  1.00 68.78  1  15   LYS C NZ    1 
ATOM   5660  N N     . ARG C 1 19  ? 62.369  -33.890 29.615  1.00 28.99  ?  16   ARG C N     1 
ATOM   5661  C CA    . ARG C 1 19  ? 62.474  -34.090 28.176  1.00 31.65  ?  16   ARG C CA    1 
ATOM   5662  C C     . ARG C 1 19  ? 62.791  -35.553 27.893  1.00 34.11  ?  16   ARG C C     1 
ATOM   5663  O O     . ARG C 1 19  ? 63.841  -36.059 28.306  1.00 33.38  ?  16   ARG C O     1 
ATOM   5664  C CB    . ARG C 1 19  ? 63.538  -33.179 27.566  1.00 26.12  ?  16   ARG C CB    1 
ATOM   5665  C CG    . ARG C 1 19  ? 63.659  -33.315 26.055  1.00 30.29  ?  16   ARG C CG    1 
ATOM   5666  C CD    . ARG C 1 19  ? 64.358  -32.119 25.424  1.00 37.92  ?  16   ARG C CD    1 
ATOM   5667  N NE    . ARG C 1 19  ? 65.497  -31.663 26.214  1.00 54.63  ?  16   ARG C NE    1 
ATOM   5668  C CZ    . ARG C 1 19  ? 65.610  -30.441 26.724  1.00 44.83  ?  16   ARG C CZ    1 
ATOM   5669  N NH1   . ARG C 1 19  ? 64.659  -29.542 26.515  1.00 40.03  1  16   ARG C NH1   1 
ATOM   5670  N NH2   . ARG C 1 19  ? 66.681  -30.116 27.433  1.00 46.73  ?  16   ARG C NH2   1 
ATOM   5671  N N     . LEU C 1 20  ? 61.886  -36.223 27.190  1.00 27.28  ?  17   LEU C N     1 
ATOM   5672  C CA    . LEU C 1 20  ? 62.056  -37.610 26.788  1.00 34.62  ?  17   LEU C CA    1 
ATOM   5673  C C     . LEU C 1 20  ? 62.417  -37.677 25.311  1.00 32.32  ?  17   LEU C C     1 
ATOM   5674  O O     . LEU C 1 20  ? 61.968  -36.854 24.512  1.00 34.04  ?  17   LEU C O     1 
ATOM   5675  C CB    . LEU C 1 20  ? 60.781  -38.414 27.046  1.00 29.29  ?  17   LEU C CB    1 
ATOM   5676  C CG    . LEU C 1 20  ? 60.237  -38.359 28.472  1.00 33.89  ?  17   LEU C CG    1 
ATOM   5677  C CD1   . LEU C 1 20  ? 58.959  -39.170 28.585  1.00 33.59  ?  17   LEU C CD1   1 
ATOM   5678  C CD2   . LEU C 1 20  ? 61.278  -38.858 29.453  1.00 37.03  ?  17   LEU C CD2   1 
ATOM   5679  N N     . TYR C 1 21  ? 63.226  -38.670 24.952  1.00 28.14  ?  18   TYR C N     1 
ATOM   5680  C CA    . TYR C 1 21  ? 63.718  -38.823 23.592  1.00 26.54  ?  18   TYR C CA    1 
ATOM   5681  C C     . TYR C 1 21  ? 63.225  -40.130 22.990  1.00 22.40  ?  18   TYR C C     1 
ATOM   5682  O O     . TYR C 1 21  ? 63.029  -41.126 23.694  1.00 29.58  ?  18   TYR C O     1 
ATOM   5683  C CB    . TYR C 1 21  ? 65.248  -38.783 23.544  1.00 25.54  ?  18   TYR C CB    1 
ATOM   5684  C CG    . TYR C 1 21  ? 65.836  -37.421 23.822  1.00 32.60  ?  18   TYR C CG    1 
ATOM   5685  C CD1   . TYR C 1 21  ? 65.956  -36.947 25.121  1.00 32.62  ?  18   TYR C CD1   1 
ATOM   5686  C CD2   . TYR C 1 21  ? 66.278  -36.610 22.785  1.00 30.60  ?  18   TYR C CD2   1 
ATOM   5687  C CE1   . TYR C 1 21  ? 66.495  -35.701 25.380  1.00 35.27  ?  18   TYR C CE1   1 
ATOM   5688  C CE2   . TYR C 1 21  ? 66.821  -35.363 23.034  1.00 29.25  ?  18   TYR C CE2   1 
ATOM   5689  C CZ    . TYR C 1 21  ? 66.925  -34.913 24.332  1.00 34.00  ?  18   TYR C CZ    1 
ATOM   5690  O OH    . TYR C 1 21  ? 67.467  -33.672 24.586  1.00 38.75  ?  18   TYR C OH    1 
ATOM   5691  N N     . PHE C 1 22  ? 63.034  -40.115 21.673  1.00 22.89  ?  19   PHE C N     1 
ATOM   5692  C CA    . PHE C 1 22  ? 62.590  -41.283 20.932  1.00 25.38  ?  19   PHE C CA    1 
ATOM   5693  C C     . PHE C 1 22  ? 63.350  -41.350 19.617  1.00 29.76  ?  19   PHE C C     1 
ATOM   5694  O O     . PHE C 1 22  ? 63.808  -40.331 19.092  1.00 25.83  ?  19   PHE C O     1 
ATOM   5695  C CB    . PHE C 1 22  ? 61.076  -41.245 20.669  1.00 29.01  ?  19   PHE C CB    1 
ATOM   5696  C CG    . PHE C 1 22  ? 60.249  -41.209 21.920  1.00 26.21  ?  19   PHE C CG    1 
ATOM   5697  C CD1   . PHE C 1 22  ? 59.986  -40.008 22.561  1.00 29.06  ?  19   PHE C CD1   1 
ATOM   5698  C CD2   . PHE C 1 22  ? 59.737  -42.377 22.459  1.00 22.29  ?  19   PHE C CD2   1 
ATOM   5699  C CE1   . PHE C 1 22  ? 59.231  -39.975 23.716  1.00 31.82  ?  19   PHE C CE1   1 
ATOM   5700  C CE2   . PHE C 1 22  ? 58.978  -42.350 23.611  1.00 28.79  ?  19   PHE C CE2   1 
ATOM   5701  C CZ    . PHE C 1 22  ? 58.724  -41.149 24.241  1.00 30.69  ?  19   PHE C CZ    1 
ATOM   5702  N N     . TYR C 1 23  ? 63.489  -42.564 19.093  1.00 31.54  ?  20   TYR C N     1 
ATOM   5703  C CA    . TYR C 1 23  ? 64.165  -42.775 17.822  1.00 24.73  ?  20   TYR C CA    1 
ATOM   5704  C C     . TYR C 1 23  ? 63.449  -43.866 17.046  1.00 21.73  ?  20   TYR C C     1 
ATOM   5705  O O     . TYR C 1 23  ? 63.210  -44.956 17.576  1.00 31.11  ?  20   TYR C O     1 
ATOM   5706  C CB    . TYR C 1 23  ? 65.637  -43.151 18.018  1.00 28.79  ?  20   TYR C CB    1 
ATOM   5707  C CG    . TYR C 1 23  ? 66.345  -43.398 16.711  1.00 31.69  ?  20   TYR C CG    1 
ATOM   5708  C CD1   . TYR C 1 23  ? 66.664  -42.342 15.870  1.00 27.66  ?  20   TYR C CD1   1 
ATOM   5709  C CD2   . TYR C 1 23  ? 66.674  -44.685 16.306  1.00 30.26  ?  20   TYR C CD2   1 
ATOM   5710  C CE1   . TYR C 1 23  ? 67.298  -42.554 14.667  1.00 28.29  ?  20   TYR C CE1   1 
ATOM   5711  C CE2   . TYR C 1 23  ? 67.310  -44.909 15.100  1.00 31.79  ?  20   TYR C CE2   1 
ATOM   5712  C CZ    . TYR C 1 23  ? 67.618  -43.838 14.287  1.00 32.39  ?  20   TYR C CZ    1 
ATOM   5713  O OH    . TYR C 1 23  ? 68.250  -44.046 13.086  1.00 34.76  ?  20   TYR C OH    1 
ATOM   5714  N N     . ASN C 1 24  ? 63.111  -43.568 15.795  1.00 27.68  ?  21   ASN C N     1 
ATOM   5715  C CA    . ASN C 1 24  ? 62.491  -44.527 14.890  1.00 27.72  ?  21   ASN C CA    1 
ATOM   5716  C C     . ASN C 1 24  ? 63.362  -44.665 13.651  1.00 27.80  ?  21   ASN C C     1 
ATOM   5717  O O     . ASN C 1 24  ? 63.515  -43.689 12.896  1.00 27.85  ?  21   ASN C O     1 
ATOM   5718  C CB    . ASN C 1 24  ? 61.073  -44.086 14.510  1.00 34.62  ?  21   ASN C CB    1 
ATOM   5719  C CG    . ASN C 1 24  ? 60.298  -45.165 13.772  1.00 30.22  ?  21   ASN C CG    1 
ATOM   5720  O OD1   . ASN C 1 24  ? 60.870  -45.995 13.067  1.00 31.67  ?  21   ASN C OD1   1 
ATOM   5721  N ND2   . ASN C 1 24  ? 58.980  -45.153 13.931  1.00 27.77  ?  21   ASN C ND2   1 
ATOM   5722  N N     . PRO C 1 25  ? 63.944  -45.840 13.396  1.00 27.81  ?  22   PRO C N     1 
ATOM   5723  C CA    . PRO C 1 25  ? 64.774  -46.002 12.194  1.00 36.72  ?  22   PRO C CA    1 
ATOM   5724  C C     . PRO C 1 25  ? 63.984  -46.087 10.902  1.00 38.29  ?  22   PRO C C     1 
ATOM   5725  O O     . PRO C 1 25  ? 64.575  -45.909 9.829   1.00 42.65  ?  22   PRO C O     1 
ATOM   5726  C CB    . PRO C 1 25  ? 65.518  -47.318 12.461  1.00 33.81  ?  22   PRO C CB    1 
ATOM   5727  C CG    . PRO C 1 25  ? 64.575  -48.092 13.328  1.00 27.80  ?  22   PRO C CG    1 
ATOM   5728  C CD    . PRO C 1 25  ? 63.894  -47.070 14.207  1.00 27.75  ?  22   PRO C CD    1 
ATOM   5729  N N     . ASP C 1 26  ? 62.678  -46.341 10.963  1.00 34.69  ?  23   ASP C N     1 
ATOM   5730  C CA    . ASP C 1 26  ? 61.903  -46.653 9.771   1.00 40.53  ?  23   ASP C CA    1 
ATOM   5731  C C     . ASP C 1 26  ? 61.346  -45.427 9.059   1.00 41.04  ?  23   ASP C C     1 
ATOM   5732  O O     . ASP C 1 26  ? 60.865  -45.560 7.929   1.00 52.41  ?  23   ASP C O     1 
ATOM   5733  C CB    . ASP C 1 26  ? 60.741  -47.588 10.122  1.00 44.03  ?  23   ASP C CB    1 
ATOM   5734  C CG    . ASP C 1 26  ? 61.206  -48.895 10.731  1.00 53.73  ?  23   ASP C CG    1 
ATOM   5735  O OD1   . ASP C 1 26  ? 61.902  -49.664 10.034  1.00 46.80  ?  23   ASP C OD1   1 
ATOM   5736  O OD2   . ASP C 1 26  ? 60.865  -49.161 11.902  1.00 70.48  -1 23   ASP C OD2   1 
ATOM   5737  N N     . MET C 1 27  ? 61.391  -44.248 9.673   1.00 35.03  ?  24   MET C N     1 
ATOM   5738  C CA    . MET C 1 27  ? 60.788  -43.076 9.055   1.00 30.88  ?  24   MET C CA    1 
ATOM   5739  C C     . MET C 1 27  ? 61.574  -41.828 9.428   1.00 31.86  ?  24   MET C C     1 
ATOM   5740  O O     . MET C 1 27  ? 62.376  -41.827 10.367  1.00 37.20  ?  24   MET C O     1 
ATOM   5741  C CB    . MET C 1 27  ? 59.320  -42.928 9.464   1.00 33.85  ?  24   MET C CB    1 
ATOM   5742  C CG    . MET C 1 27  ? 59.078  -43.077 10.950  1.00 36.15  ?  24   MET C CG    1 
ATOM   5743  S SD    . MET C 1 27  ? 57.322  -43.122 11.341  1.00 58.63  ?  24   MET C SD    1 
ATOM   5744  C CE    . MET C 1 27  ? 56.793  -41.600 10.587  1.00 27.99  ?  24   MET C CE    1 
ATOM   5745  N N     . GLU C 1 28  ? 61.327  -40.761 8.672   1.00 28.13  ?  25   GLU C N     1 
ATOM   5746  C CA    . GLU C 1 28  ? 62.001  -39.494 8.916   1.00 34.93  ?  25   GLU C CA    1 
ATOM   5747  C C     . GLU C 1 28  ? 61.575  -38.920 10.264  1.00 28.04  ?  25   GLU C C     1 
ATOM   5748  O O     . GLU C 1 28  ? 60.409  -39.046 10.654  1.00 28.01  ?  25   GLU C O     1 
ATOM   5749  C CB    . GLU C 1 28  ? 61.690  -38.493 7.803   1.00 36.05  ?  25   GLU C CB    1 
ATOM   5750  C CG    . GLU C 1 28  ? 62.166  -38.928 6.428   1.00 46.38  ?  25   GLU C CG    1 
ATOM   5751  C CD    . GLU C 1 28  ? 63.666  -39.128 6.369   1.00 52.17  ?  25   GLU C CD    1 
ATOM   5752  O OE1   . GLU C 1 28  ? 64.409  -38.133 6.506   1.00 57.35  ?  25   GLU C OE1   1 
ATOM   5753  O OE2   . GLU C 1 28  ? 64.102  -40.285 6.199   1.00 58.68  -1 25   GLU C OE2   1 
ATOM   5754  N N     . PRO C 1 29  ? 62.494  -38.293 10.999  1.00 29.98  ?  26   PRO C N     1 
ATOM   5755  C CA    . PRO C 1 29  ? 62.133  -37.750 12.318  1.00 28.21  ?  26   PRO C CA    1 
ATOM   5756  C C     . PRO C 1 29  ? 61.033  -36.703 12.280  1.00 33.92  ?  26   PRO C C     1 
ATOM   5757  O O     . PRO C 1 29  ? 60.245  -36.622 13.231  1.00 26.11  ?  26   PRO C O     1 
ATOM   5758  C CB    . PRO C 1 29  ? 63.457  -37.160 12.821  1.00 22.98  ?  26   PRO C CB    1 
ATOM   5759  C CG    . PRO C 1 29  ? 64.508  -37.960 12.117  1.00 30.29  ?  26   PRO C CG    1 
ATOM   5760  C CD    . PRO C 1 29  ? 63.947  -38.256 10.757  1.00 29.79  ?  26   PRO C CD    1 
ATOM   5761  N N     . LYS C 1 30  ? 60.948  -35.896 11.218  1.00 32.15  ?  27   LYS C N     1 
ATOM   5762  C CA    . LYS C 1 30  ? 59.910  -34.870 11.161  1.00 28.65  ?  27   LYS C CA    1 
ATOM   5763  C C     . LYS C 1 30  ? 58.524  -35.492 11.063  1.00 29.34  ?  27   LYS C C     1 
ATOM   5764  O O     . LYS C 1 30  ? 57.585  -35.043 11.732  1.00 30.71  ?  27   LYS C O     1 
ATOM   5765  C CB    . LYS C 1 30  ? 60.156  -33.925 9.987   1.00 32.35  ?  27   LYS C CB    1 
ATOM   5766  C CG    . LYS C 1 30  ? 59.064  -32.880 9.819   1.00 42.56  ?  27   LYS C CG    1 
ATOM   5767  C CD    . LYS C 1 30  ? 59.500  -31.753 8.900   1.00 39.65  ?  27   LYS C CD    1 
ATOM   5768  C CE    . LYS C 1 30  ? 58.452  -30.652 8.838   1.00 46.43  ?  27   LYS C CE    1 
ATOM   5769  N NZ    . LYS C 1 30  ? 57.180  -31.115 8.212   1.00 49.51  1  27   LYS C NZ    1 
ATOM   5770  N N     . LEU C 1 31  ? 58.374  -36.529 10.236  1.00 31.86  ?  28   LEU C N     1 
ATOM   5771  C CA    . LEU C 1 31  ? 57.082  -37.197 10.121  1.00 31.83  ?  28   LEU C CA    1 
ATOM   5772  C C     . LEU C 1 31  ? 56.774  -38.016 11.369  1.00 31.67  ?  28   LEU C C     1 
ATOM   5773  O O     . LEU C 1 31  ? 55.616  -38.099 11.793  1.00 25.89  ?  28   LEU C O     1 
ATOM   5774  C CB    . LEU C 1 31  ? 57.056  -38.076 8.872   1.00 33.50  ?  28   LEU C CB    1 
ATOM   5775  C CG    . LEU C 1 31  ? 55.814  -38.937 8.635   1.00 36.18  ?  28   LEU C CG    1 
ATOM   5776  C CD1   . LEU C 1 31  ? 54.555  -38.095 8.598   1.00 40.15  ?  28   LEU C CD1   1 
ATOM   5777  C CD2   . LEU C 1 31  ? 55.958  -39.765 7.361   1.00 33.45  ?  28   LEU C CD2   1 
ATOM   5778  N N     . PHE C 1 32  ? 57.798  -38.636 11.961  1.00 29.74  ?  29   PHE C N     1 
ATOM   5779  C CA    . PHE C 1 32  ? 57.618  -39.345 13.225  1.00 23.47  ?  29   PHE C CA    1 
ATOM   5780  C C     . PHE C 1 32  ? 57.114  -38.400 14.308  1.00 29.33  ?  29   PHE C C     1 
ATOM   5781  O O     . PHE C 1 32  ? 56.133  -38.695 15.003  1.00 31.82  ?  29   PHE C O     1 
ATOM   5782  C CB    . PHE C 1 32  ? 58.939  -40.005 13.632  1.00 23.27  ?  29   PHE C CB    1 
ATOM   5783  C CG    . PHE C 1 32  ? 58.844  -40.868 14.860  1.00 26.81  ?  29   PHE C CG    1 
ATOM   5784  C CD1   . PHE C 1 32  ? 57.792  -41.755 15.027  1.00 28.94  ?  29   PHE C CD1   1 
ATOM   5785  C CD2   . PHE C 1 32  ? 59.828  -40.814 15.836  1.00 32.05  ?  29   PHE C CD2   1 
ATOM   5786  C CE1   . PHE C 1 32  ? 57.711  -42.555 16.154  1.00 24.41  ?  29   PHE C CE1   1 
ATOM   5787  C CE2   . PHE C 1 32  ? 59.756  -41.613 16.964  1.00 34.71  ?  29   PHE C CE2   1 
ATOM   5788  C CZ    . PHE C 1 32  ? 58.696  -42.485 17.123  1.00 32.44  ?  29   PHE C CZ    1 
ATOM   5789  N N     . ALA C 1 33  ? 57.762  -37.241 14.448  1.00 23.90  ?  30   ALA C N     1 
ATOM   5790  C CA    . ALA C 1 33  ? 57.306  -36.241 15.409  1.00 23.48  ?  30   ALA C CA    1 
ATOM   5791  C C     . ALA C 1 33  ? 55.897  -35.762 15.084  1.00 31.47  ?  30   ALA C C     1 
ATOM   5792  O O     . ALA C 1 33  ? 55.082  -35.547 15.990  1.00 25.21  ?  30   ALA C O     1 
ATOM   5793  C CB    . ALA C 1 33  ? 58.281  -35.063 15.443  1.00 23.09  ?  30   ALA C CB    1 
ATOM   5794  N N     . ARG C 1 34  ? 55.587  -35.597 13.795  1.00 33.52  ?  31   ARG C N     1 
ATOM   5795  C CA    . ARG C 1 34  ? 54.256  -35.142 13.403  1.00 34.70  ?  31   ARG C CA    1 
ATOM   5796  C C     . ARG C 1 34  ? 53.185  -36.134 13.837  1.00 32.75  ?  31   ARG C C     1 
ATOM   5797  O O     . ARG C 1 34  ? 52.166  -35.750 14.424  1.00 35.14  ?  31   ARG C O     1 
ATOM   5798  C CB    . ARG C 1 34  ? 54.199  -34.923 11.891  1.00 30.72  ?  31   ARG C CB    1 
ATOM   5799  C CG    . ARG C 1 34  ? 52.790  -34.731 11.350  1.00 45.74  ?  31   ARG C CG    1 
ATOM   5800  C CD    . ARG C 1 34  ? 52.798  -34.532 9.841   1.00 62.49  ?  31   ARG C CD    1 
ATOM   5801  N NE    . ARG C 1 34  ? 52.176  -35.644 9.128   1.00 69.24  ?  31   ARG C NE    1 
ATOM   5802  C CZ    . ARG C 1 34  ? 52.240  -35.811 7.811   1.00 70.36  ?  31   ARG C CZ    1 
ATOM   5803  N NH1   . ARG C 1 34  ? 52.909  -34.944 7.063   1.00 67.38  1  31   ARG C NH1   1 
ATOM   5804  N NH2   . ARG C 1 34  ? 51.646  -36.852 7.242   1.00 71.14  ?  31   ARG C NH2   1 
ATOM   5805  N N     . ASN C 1 35  ? 53.399  -37.421 13.552  1.00 32.03  ?  32   ASN C N     1 
ATOM   5806  C CA    . ASN C 1 35  ? 52.423  -38.437 13.933  1.00 31.03  ?  32   ASN C CA    1 
ATOM   5807  C C     . ASN C 1 35  ? 52.249  -38.496 15.445  1.00 23.66  ?  32   ASN C C     1 
ATOM   5808  O O     . ASN C 1 35  ? 51.121  -38.590 15.944  1.00 38.08  ?  32   ASN C O     1 
ATOM   5809  C CB    . ASN C 1 35  ? 52.845  -39.802 13.390  1.00 28.98  ?  32   ASN C CB    1 
ATOM   5810  C CG    . ASN C 1 35  ? 52.898  -39.837 11.875  1.00 45.07  ?  32   ASN C CG    1 
ATOM   5811  O OD1   . ASN C 1 35  ? 52.597  -38.846 11.208  1.00 45.92  ?  32   ASN C OD1   1 
ATOM   5812  N ND2   . ASN C 1 35  ? 53.295  -40.978 11.323  1.00 42.48  ?  32   ASN C ND2   1 
ATOM   5813  N N     . LEU C 1 36  ? 53.355  -38.436 16.190  1.00 27.94  ?  33   LEU C N     1 
ATOM   5814  C CA    . LEU C 1 36  ? 53.270  -38.466 17.647  1.00 29.36  ?  33   LEU C CA    1 
ATOM   5815  C C     . LEU C 1 36  ? 52.549  -37.242 18.193  1.00 31.61  ?  33   LEU C C     1 
ATOM   5816  O O     . LEU C 1 36  ? 51.836  -37.340 19.198  1.00 33.43  ?  33   LEU C O     1 
ATOM   5817  C CB    . LEU C 1 36  ? 54.669  -38.572 18.251  1.00 22.97  ?  33   LEU C CB    1 
ATOM   5818  C CG    . LEU C 1 36  ? 55.449  -39.852 17.951  1.00 27.32  ?  33   LEU C CG    1 
ATOM   5819  C CD1   . LEU C 1 36  ? 56.836  -39.786 18.574  1.00 22.69  ?  33   LEU C CD1   1 
ATOM   5820  C CD2   . LEU C 1 36  ? 54.692  -41.073 18.448  1.00 25.48  ?  33   LEU C CD2   1 
ATOM   5821  N N     . SER C 1 37  ? 52.724  -36.084 17.551  1.00 30.51  ?  34   SER C N     1 
ATOM   5822  C CA    . SER C 1 37  ? 52.003  -34.891 17.979  1.00 30.18  ?  34   SER C CA    1 
ATOM   5823  C C     . SER C 1 37  ? 50.505  -35.046 17.756  1.00 23.50  ?  34   SER C C     1 
ATOM   5824  O O     . SER C 1 37  ? 49.697  -34.617 18.588  1.00 29.46  ?  34   SER C O     1 
ATOM   5825  C CB    . SER C 1 37  ? 52.528  -33.662 17.234  1.00 29.49  ?  34   SER C CB    1 
ATOM   5826  O OG    . SER C 1 37  ? 53.926  -33.504 17.413  1.00 29.03  ?  34   SER C OG    1 
ATOM   5827  N N     . ARG C 1 38  ? 50.118  -35.676 16.647  1.00 31.49  ?  35   ARG C N     1 
ATOM   5828  C CA    . ARG C 1 38  ? 48.707  -35.766 16.289  1.00 38.27  ?  35   ARG C CA    1 
ATOM   5829  C C     . ARG C 1 38  ? 47.941  -36.651 17.267  1.00 36.54  ?  35   ARG C C     1 
ATOM   5830  O O     . ARG C 1 38  ? 46.864  -36.276 17.745  1.00 44.26  ?  35   ARG C O     1 
ATOM   5831  C CB    . ARG C 1 38  ? 48.572  -36.293 14.861  1.00 36.53  ?  35   ARG C CB    1 
ATOM   5832  C CG    . ARG C 1 38  ? 47.247  -35.979 14.188  1.00 48.23  ?  35   ARG C CG    1 
ATOM   5833  C CD    . ARG C 1 38  ? 47.065  -36.822 12.937  1.00 52.51  ?  35   ARG C CD    1 
ATOM   5834  N NE    . ARG C 1 38  ? 46.612  -38.164 13.282  1.00 61.71  ?  35   ARG C NE    1 
ATOM   5835  C CZ    . ARG C 1 38  ? 47.420  -39.164 13.623  1.00 70.16  ?  35   ARG C CZ    1 
ATOM   5836  N NH1   . ARG C 1 38  ? 48.733  -38.988 13.653  1.00 75.68  1  35   ARG C NH1   1 
ATOM   5837  N NH2   . ARG C 1 38  ? 46.911  -40.343 13.926  1.00 77.74  ?  35   ARG C NH2   1 
ATOM   5838  N N     . VAL C 1 39  ? 48.483  -37.830 17.581  1.00 32.18  ?  36   VAL C N     1 
ATOM   5839  C CA    . VAL C 1 39  ? 47.772  -38.765 18.449  1.00 27.74  ?  36   VAL C CA    1 
ATOM   5840  C C     . VAL C 1 39  ? 47.819  -38.357 19.914  1.00 33.65  ?  36   VAL C C     1 
ATOM   5841  O O     . VAL C 1 39  ? 46.982  -38.815 20.701  1.00 44.52  ?  36   VAL C O     1 
ATOM   5842  C CB    . VAL C 1 39  ? 48.332  -40.190 18.305  1.00 31.69  ?  36   VAL C CB    1 
ATOM   5843  C CG1   . VAL C 1 39  ? 48.145  -40.680 16.897  1.00 28.21  ?  36   VAL C CG1   1 
ATOM   5844  C CG2   . VAL C 1 39  ? 49.801  -40.228 18.679  1.00 29.02  ?  36   VAL C CG2   1 
ATOM   5845  N N     . ASN C 1 40  ? 48.771  -37.519 20.311  1.00 35.38  ?  37   ASN C N     1 
ATOM   5846  C CA    . ASN C 1 40  ? 48.898  -37.105 21.700  1.00 27.68  ?  37   ASN C CA    1 
ATOM   5847  C C     . ASN C 1 40  ? 48.341  -35.713 21.963  1.00 23.03  ?  37   ASN C C     1 
ATOM   5848  O O     . ASN C 1 40  ? 48.334  -35.278 23.119  1.00 24.82  ?  37   ASN C O     1 
ATOM   5849  C CB    . ASN C 1 40  ? 50.367  -37.161 22.137  1.00 23.24  ?  37   ASN C CB    1 
ATOM   5850  C CG    . ASN C 1 40  ? 50.871  -38.583 22.319  1.00 28.98  ?  37   ASN C CG    1 
ATOM   5851  O OD1   . ASN C 1 40  ? 50.686  -39.186 23.376  1.00 26.87  ?  37   ASN C OD1   1 
ATOM   5852  N ND2   . ASN C 1 40  ? 51.514  -39.122 21.289  1.00 22.79  ?  37   ASN C ND2   1 
ATOM   5853  N N     . ASN C 1 41  ? 47.875  -35.009 20.927  1.00 23.47  ?  38   ASN C N     1 
ATOM   5854  C CA    . ASN C 1 41  ? 47.416  -33.623 21.060  1.00 30.00  ?  38   ASN C CA    1 
ATOM   5855  C C     . ASN C 1 41  ? 48.470  -32.769 21.759  1.00 31.13  ?  38   ASN C C     1 
ATOM   5856  O O     . ASN C 1 41  ? 48.161  -31.912 22.589  1.00 30.53  ?  38   ASN C O     1 
ATOM   5857  C CB    . ASN C 1 41  ? 46.075  -33.552 21.796  1.00 33.80  ?  38   ASN C CB    1 
ATOM   5858  C CG    . ASN C 1 41  ? 44.906  -33.973 20.926  1.00 29.16  ?  38   ASN C CG    1 
ATOM   5859  O OD1   . ASN C 1 41  ? 44.803  -33.569 19.769  1.00 33.95  ?  38   ASN C OD1   1 
ATOM   5860  N ND2   . ASN C 1 41  ? 44.020  -34.794 21.480  1.00 24.83  ?  38   ASN C ND2   1 
ATOM   5861  N N     . PHE C 1 42  ? 49.734  -33.019 21.422  1.00 33.80  ?  39   PHE C N     1 
ATOM   5862  C CA    . PHE C 1 42  ? 50.857  -32.393 22.114  1.00 32.82  ?  39   PHE C CA    1 
ATOM   5863  C C     . PHE C 1 42  ? 52.057  -32.437 21.183  1.00 29.00  ?  39   PHE C C     1 
ATOM   5864  O O     . PHE C 1 42  ? 52.476  -33.522 20.771  1.00 32.25  ?  39   PHE C O     1 
ATOM   5865  C CB    . PHE C 1 42  ? 51.156  -33.121 23.427  1.00 21.33  ?  39   PHE C CB    1 
ATOM   5866  C CG    . PHE C 1 42  ? 52.056  -32.359 24.352  1.00 22.68  ?  39   PHE C CG    1 
ATOM   5867  C CD1   . PHE C 1 42  ? 53.418  -32.292 24.118  1.00 25.29  ?  39   PHE C CD1   1 
ATOM   5868  C CD2   . PHE C 1 42  ? 51.538  -31.711 25.462  1.00 22.74  ?  39   PHE C CD2   1 
ATOM   5869  C CE1   . PHE C 1 42  ? 54.247  -31.590 24.968  1.00 29.95  ?  39   PHE C CE1   1 
ATOM   5870  C CE2   . PHE C 1 42  ? 52.363  -31.009 26.318  1.00 27.19  ?  39   PHE C CE2   1 
ATOM   5871  C CZ    . PHE C 1 42  ? 53.720  -30.947 26.071  1.00 24.72  ?  39   PHE C CZ    1 
ATOM   5872  N N     . LYS C 1 43  ? 52.618  -31.274 20.868  1.00 30.15  ?  40   LYS C N     1 
ATOM   5873  C CA    . LYS C 1 43  ? 53.619  -31.194 19.811  1.00 30.32  ?  40   LYS C CA    1 
ATOM   5874  C C     . LYS C 1 43  ? 54.934  -31.832 20.248  1.00 32.43  ?  40   LYS C C     1 
ATOM   5875  O O     . LYS C 1 43  ? 55.520  -31.442 21.264  1.00 36.41  ?  40   LYS C O     1 
ATOM   5876  C CB    . LYS C 1 43  ? 53.841  -29.742 19.399  1.00 31.67  ?  40   LYS C CB    1 
ATOM   5877  C CG    . LYS C 1 43  ? 54.999  -29.553 18.433  1.00 33.48  ?  40   LYS C CG    1 
ATOM   5878  C CD    . LYS C 1 43  ? 54.974  -28.186 17.768  1.00 44.99  ?  40   LYS C CD    1 
ATOM   5879  C CE    . LYS C 1 43  ? 56.374  -27.782 17.327  1.00 55.01  ?  40   LYS C CE    1 
ATOM   5880  N NZ    . LYS C 1 43  ? 56.362  -26.676 16.329  1.00 53.10  1  40   LYS C NZ    1 
ATOM   5881  N N     . PHE C 1 44  ? 55.384  -32.819 19.478  1.00 27.66  ?  41   PHE C N     1 
ATOM   5882  C CA    . PHE C 1 44  ? 56.737  -33.347 19.559  1.00 22.80  ?  41   PHE C CA    1 
ATOM   5883  C C     . PHE C 1 44  ? 57.646  -32.533 18.647  1.00 34.14  ?  41   PHE C C     1 
ATOM   5884  O O     . PHE C 1 44  ? 57.217  -32.030 17.606  1.00 32.24  ?  41   PHE C O     1 
ATOM   5885  C CB    . PHE C 1 44  ? 56.785  -34.817 19.129  1.00 24.05  ?  41   PHE C CB    1 
ATOM   5886  C CG    . PHE C 1 44  ? 56.223  -35.781 20.138  1.00 27.02  ?  41   PHE C CG    1 
ATOM   5887  C CD1   . PHE C 1 44  ? 54.882  -35.746 20.490  1.00 28.91  ?  41   PHE C CD1   1 
ATOM   5888  C CD2   . PHE C 1 44  ? 57.031  -36.754 20.706  1.00 22.45  ?  41   PHE C CD2   1 
ATOM   5889  C CE1   . PHE C 1 44  ? 54.367  -36.647 21.410  1.00 26.56  ?  41   PHE C CE1   1 
ATOM   5890  C CE2   . PHE C 1 44  ? 56.522  -37.656 21.623  1.00 29.87  ?  41   PHE C CE2   1 
ATOM   5891  C CZ    . PHE C 1 44  ? 55.186  -37.604 21.974  1.00 26.14  ?  41   PHE C CZ    1 
ATOM   5892  N N     . GLN C 1 45  ? 58.911  -32.414 19.039  1.00 39.65  ?  42   GLN C N     1 
ATOM   5893  C CA    . GLN C 1 45  ? 59.913  -31.734 18.232  1.00 35.98  ?  42   GLN C CA    1 
ATOM   5894  C C     . GLN C 1 45  ? 60.936  -32.741 17.718  1.00 34.71  ?  42   GLN C C     1 
ATOM   5895  O O     . GLN C 1 45  ? 61.188  -33.775 18.343  1.00 39.32  ?  42   GLN C O     1 
ATOM   5896  C CB    . GLN C 1 45  ? 60.604  -30.621 19.031  1.00 37.20  ?  42   GLN C CB    1 
ATOM   5897  C CG    . GLN C 1 45  ? 61.691  -29.851 18.274  1.00 50.94  ?  42   GLN C CG    1 
ATOM   5898  C CD    . GLN C 1 45  ? 61.249  -29.361 16.907  1.00 58.77  ?  42   GLN C CD    1 
ATOM   5899  O OE1   . GLN C 1 45  ? 60.142  -28.850 16.742  1.00 69.83  ?  42   GLN C OE1   1 
ATOM   5900  N NE2   . GLN C 1 45  ? 62.121  -29.517 15.916  1.00 44.04  ?  42   GLN C NE2   1 
ATOM   5901  N N     . ASP C 1 46  ? 61.505  -32.438 16.556  1.00 34.23  ?  43   ASP C N     1 
ATOM   5902  C CA    . ASP C 1 46  ? 62.494  -33.302 15.922  1.00 35.53  ?  43   ASP C CA    1 
ATOM   5903  C C     . ASP C 1 46  ? 63.863  -32.629 15.862  1.00 40.89  ?  43   ASP C C     1 
ATOM   5904  O O     . ASP C 1 46  ? 63.987  -31.492 15.408  1.00 46.68  ?  43   ASP C O     1 
ATOM   5905  C CB    . ASP C 1 46  ? 62.032  -33.681 14.516  1.00 37.19  ?  43   ASP C CB    1 
ATOM   5906  C CG    . ASP C 1 46  ? 61.633  -32.471 13.692  1.00 42.34  ?  43   ASP C CG    1 
ATOM   5907  O OD1   . ASP C 1 46  ? 60.585  -31.862 13.995  1.00 38.65  ?  43   ASP C OD1   1 
ATOM   5908  O OD2   . ASP C 1 46  ? 62.363  -32.130 12.740  1.00 60.38  -1 43   ASP C OD2   1 
ATOM   5909  N N     . ASP C 1 49  ? 68.203  -36.150 14.475  1.00 40.81  ?  46   ASP C N     1 
ATOM   5910  C CA    . ASP C 1 49  ? 67.869  -37.549 14.223  1.00 47.97  ?  46   ASP C CA    1 
ATOM   5911  C C     . ASP C 1 49  ? 66.901  -38.098 15.264  1.00 43.10  ?  46   ASP C C     1 
ATOM   5912  O O     . ASP C 1 49  ? 66.173  -39.058 15.004  1.00 40.25  ?  46   ASP C O     1 
ATOM   5913  C CB    . ASP C 1 49  ? 69.138  -38.402 14.190  1.00 53.83  ?  46   ASP C CB    1 
ATOM   5914  C CG    . ASP C 1 49  ? 69.738  -38.500 12.800  1.00 65.86  ?  46   ASP C CG    1 
ATOM   5915  O OD1   . ASP C 1 49  ? 69.279  -37.769 11.897  1.00 64.82  ?  46   ASP C OD1   1 
ATOM   5916  O OD2   . ASP C 1 49  ? 70.666  -39.310 12.610  1.00 72.17  -1 46   ASP C OD2   1 
ATOM   5917  N N     . LEU C 1 50  ? 66.893  -37.488 16.442  1.00 41.33  ?  47   LEU C N     1 
ATOM   5918  C CA    . LEU C 1 50  ? 65.997  -37.911 17.504  1.00 32.42  ?  47   LEU C CA    1 
ATOM   5919  C C     . LEU C 1 50  ? 64.720  -37.079 17.493  1.00 34.42  ?  47   LEU C C     1 
ATOM   5920  O O     . LEU C 1 50  ? 64.658  -35.986 16.924  1.00 47.25  ?  47   LEU C O     1 
ATOM   5921  C CB    . LEU C 1 50  ? 66.679  -37.796 18.868  1.00 32.89  ?  47   LEU C CB    1 
ATOM   5922  C CG    . LEU C 1 50  ? 67.858  -38.725 19.163  1.00 33.30  ?  47   LEU C CG    1 
ATOM   5923  C CD1   . LEU C 1 50  ? 68.581  -38.264 20.416  1.00 33.25  ?  47   LEU C CD1   1 
ATOM   5924  C CD2   . LEU C 1 50  ? 67.387  -40.161 19.318  1.00 31.70  ?  47   LEU C CD2   1 
ATOM   5925  N N     . VAL C 1 51  ? 63.690  -37.628 18.127  1.00 28.46  ?  48   VAL C N     1 
ATOM   5926  C CA    . VAL C 1 51  ? 62.424  -36.944 18.356  1.00 27.41  ?  48   VAL C CA    1 
ATOM   5927  C C     . VAL C 1 51  ? 62.212  -36.868 19.860  1.00 29.63  ?  48   VAL C C     1 
ATOM   5928  O O     . VAL C 1 51  ? 62.367  -37.875 20.562  1.00 36.25  ?  48   VAL C O     1 
ATOM   5929  C CB    . VAL C 1 51  ? 61.256  -37.670 17.666  1.00 25.27  ?  48   VAL C CB    1 
ATOM   5930  C CG1   . VAL C 1 51  ? 59.922  -37.163 18.187  1.00 26.72  ?  48   VAL C CG1   1 
ATOM   5931  C CG2   . VAL C 1 51  ? 61.345  -37.495 16.157  1.00 23.37  ?  48   VAL C CG2   1 
ATOM   5932  N N     . TRP C 1 52  ? 61.872  -35.682 20.358  1.00 28.92  ?  49   TRP C N     1 
ATOM   5933  C CA    . TRP C 1 52  ? 61.728  -35.493 21.792  1.00 28.74  ?  49   TRP C CA    1 
ATOM   5934  C C     . TRP C 1 52  ? 60.444  -34.744 22.120  1.00 29.08  ?  49   TRP C C     1 
ATOM   5935  O O     . TRP C 1 52  ? 59.789  -34.155 21.255  1.00 29.67  ?  49   TRP C O     1 
ATOM   5936  C CB    . TRP C 1 52  ? 62.937  -34.760 22.396  1.00 27.41  ?  49   TRP C CB    1 
ATOM   5937  C CG    . TRP C 1 52  ? 63.535  -33.677 21.551  1.00 36.50  ?  49   TRP C CG    1 
ATOM   5938  C CD1   . TRP C 1 52  ? 64.440  -33.833 20.542  1.00 44.29  ?  49   TRP C CD1   1 
ATOM   5939  C CD2   . TRP C 1 52  ? 63.307  -32.268 21.671  1.00 38.83  ?  49   TRP C CD2   1 
ATOM   5940  N NE1   . TRP C 1 52  ? 64.776  -32.611 20.014  1.00 50.67  ?  49   TRP C NE1   1 
ATOM   5941  C CE2   . TRP C 1 52  ? 64.095  -31.634 20.690  1.00 47.48  ?  49   TRP C CE2   1 
ATOM   5942  C CE3   . TRP C 1 52  ? 62.506  -31.481 22.505  1.00 34.73  ?  49   TRP C CE3   1 
ATOM   5943  C CZ2   . TRP C 1 52  ? 64.109  -30.251 20.524  1.00 49.12  ?  49   TRP C CZ2   1 
ATOM   5944  C CZ3   . TRP C 1 52  ? 62.518  -30.108 22.334  1.00 44.55  ?  49   TRP C CZ3   1 
ATOM   5945  C CH2   . TRP C 1 52  ? 63.314  -29.507 21.351  1.00 48.46  ?  49   TRP C CH2   1 
ATOM   5946  N N     . ILE C 1 53  ? 60.096  -34.785 23.405  1.00 27.90  ?  50   ILE C N     1 
ATOM   5947  C CA    . ILE C 1 53  ? 58.918  -34.116 23.940  1.00 27.29  ?  50   ILE C CA    1 
ATOM   5948  C C     . ILE C 1 53  ? 59.260  -33.587 25.326  1.00 27.68  ?  50   ILE C C     1 
ATOM   5949  O O     . ILE C 1 53  ? 59.912  -34.271 26.123  1.00 27.12  ?  50   ILE C O     1 
ATOM   5950  C CB    . ILE C 1 53  ? 57.697  -35.061 23.988  1.00 27.01  ?  50   ILE C CB    1 
ATOM   5951  C CG1   . ILE C 1 53  ? 56.466  -34.330 24.529  1.00 25.62  ?  50   ILE C CG1   1 
ATOM   5952  C CG2   . ILE C 1 53  ? 57.996  -36.304 24.818  1.00 30.27  ?  50   ILE C CG2   1 
ATOM   5953  C CD1   . ILE C 1 53  ? 55.232  -35.199 24.600  1.00 25.12  ?  50   ILE C CD1   1 
ATOM   5954  N N     . GLU C 1 54  ? 58.833  -32.361 25.606  1.00 29.67  ?  51   GLU C N     1 
ATOM   5955  C CA    . GLU C 1 54  ? 59.022  -31.733 26.906  1.00 27.71  ?  51   GLU C CA    1 
ATOM   5956  C C     . GLU C 1 54  ? 57.678  -31.719 27.621  1.00 34.06  ?  51   GLU C C     1 
ATOM   5957  O O     . GLU C 1 54  ? 56.701  -31.173 27.099  1.00 28.77  ?  51   GLU C O     1 
ATOM   5958  C CB    . GLU C 1 54  ? 59.588  -30.321 26.749  1.00 30.04  ?  51   GLU C CB    1 
ATOM   5959  C CG    . GLU C 1 54  ? 60.952  -30.300 26.067  1.00 35.28  ?  51   GLU C CG    1 
ATOM   5960  C CD    . GLU C 1 54  ? 61.298  -28.953 25.456  1.00 44.18  ?  51   GLU C CD    1 
ATOM   5961  O OE1   . GLU C 1 54  ? 62.502  -28.680 25.272  1.00 45.18  ?  51   GLU C OE1   1 
ATOM   5962  O OE2   . GLU C 1 54  ? 60.371  -28.173 25.155  1.00 38.66  -1 51   GLU C OE2   1 
ATOM   5963  N N     . ILE C 1 55  ? 57.628  -32.337 28.797  1.00 29.31  ?  52   ILE C N     1 
ATOM   5964  C CA    . ILE C 1 55  ? 56.369  -32.519 29.518  1.00 27.73  ?  52   ILE C CA    1 
ATOM   5965  C C     . ILE C 1 55  ? 56.559  -32.067 30.958  1.00 28.39  ?  52   ILE C C     1 
ATOM   5966  O O     . ILE C 1 55  ? 57.692  -31.979 31.456  1.00 28.88  ?  52   ILE C O     1 
ATOM   5967  C CB    . ILE C 1 55  ? 55.891  -33.990 29.472  1.00 27.26  ?  52   ILE C CB    1 
ATOM   5968  C CG1   . ILE C 1 55  ? 56.936  -34.907 30.111  1.00 32.03  ?  52   ILE C CG1   1 
ATOM   5969  C CG2   . ILE C 1 55  ? 55.587  -34.410 28.047  1.00 26.58  ?  52   ILE C CG2   1 
ATOM   5970  C CD1   . ILE C 1 55  ? 56.422  -36.300 30.415  1.00 27.21  ?  52   ILE C CD1   1 
ATOM   5971  N N     . PRO C 1 56  ? 55.466  -31.770 31.657  1.00 28.41  ?  53   PRO C N     1 
ATOM   5972  C CA    . PRO C 1 56  ? 55.558  -31.573 33.105  1.00 28.99  ?  53   PRO C CA    1 
ATOM   5973  C C     . PRO C 1 56  ? 55.922  -32.878 33.791  1.00 37.74  ?  53   PRO C C     1 
ATOM   5974  O O     . PRO C 1 56  ? 55.733  -33.970 33.251  1.00 28.55  ?  53   PRO C O     1 
ATOM   5975  C CB    . PRO C 1 56  ? 54.149  -31.110 33.501  1.00 33.99  ?  53   PRO C CB    1 
ATOM   5976  C CG    . PRO C 1 56  ? 53.495  -30.683 32.223  1.00 38.82  ?  53   PRO C CG    1 
ATOM   5977  C CD    . PRO C 1 56  ? 54.098  -31.543 31.157  1.00 27.93  ?  53   PRO C CD    1 
ATOM   5978  N N     . ASP C 1 57  ? 56.441  -32.756 35.010  1.00 39.13  ?  54   ASP C N     1 
ATOM   5979  C CA    . ASP C 1 57  ? 56.881  -33.936 35.747  1.00 42.61  ?  54   ASP C CA    1 
ATOM   5980  C C     . ASP C 1 57  ? 55.695  -34.663 36.374  1.00 46.20  ?  54   ASP C C     1 
ATOM   5981  O O     . ASP C 1 57  ? 55.678  -34.917 37.582  1.00 55.44  ?  54   ASP C O     1 
ATOM   5982  C CB    . ASP C 1 57  ? 57.902  -33.540 36.817  1.00 54.66  ?  54   ASP C CB    1 
ATOM   5983  C CG    . ASP C 1 57  ? 58.749  -34.708 37.274  1.00 66.52  ?  54   ASP C CG    1 
ATOM   5984  O OD1   . ASP C 1 57  ? 58.816  -35.716 36.540  1.00 63.65  ?  54   ASP C OD1   1 
ATOM   5985  O OD2   . ASP C 1 57  ? 59.349  -34.620 38.366  1.00 72.97  -1 54   ASP C OD2   1 
ATOM   5986  N N     . ILE C 1 58  ? 54.707  -35.016 35.554  1.00 37.13  ?  55   ILE C N     1 
ATOM   5987  C CA    . ILE C 1 58  ? 53.508  -35.721 35.987  1.00 43.88  ?  55   ILE C CA    1 
ATOM   5988  C C     . ILE C 1 58  ? 53.422  -37.021 35.196  1.00 43.69  ?  55   ILE C C     1 
ATOM   5989  O O     . ILE C 1 58  ? 54.082  -37.192 34.167  1.00 40.30  ?  55   ILE C O     1 
ATOM   5990  C CB    . ILE C 1 58  ? 52.233  -34.866 35.787  1.00 50.15  ?  55   ILE C CB    1 
ATOM   5991  C CG1   . ILE C 1 58  ? 52.401  -33.488 36.423  1.00 60.48  ?  55   ILE C CG1   1 
ATOM   5992  C CG2   . ILE C 1 58  ? 50.988  -35.531 36.380  1.00 54.83  ?  55   ILE C CG2   1 
ATOM   5993  C CD1   . ILE C 1 58  ? 51.122  -32.687 36.417  1.00 64.23  ?  55   ILE C CD1   1 
ATOM   5994  N N     . ASP C 1 59  ? 52.611  -37.953 35.697  1.00 44.71  ?  56   ASP C N     1 
ATOM   5995  C CA    . ASP C 1 59  ? 52.276  -39.137 34.918  1.00 51.06  ?  56   ASP C CA    1 
ATOM   5996  C C     . ASP C 1 59  ? 51.714  -38.710 33.569  1.00 41.93  ?  56   ASP C C     1 
ATOM   5997  O O     . ASP C 1 59  ? 50.702  -38.006 33.499  1.00 49.41  ?  56   ASP C O     1 
ATOM   5998  C CB    . ASP C 1 59  ? 51.274  -40.011 35.670  1.00 56.12  ?  56   ASP C CB    1 
ATOM   5999  C CG    . ASP C 1 59  ? 51.217  -41.431 35.128  1.00 64.98  ?  56   ASP C CG    1 
ATOM   6000  O OD1   . ASP C 1 59  ? 51.185  -41.605 33.890  1.00 63.66  ?  56   ASP C OD1   1 
ATOM   6001  O OD2   . ASP C 1 59  ? 51.212  -42.378 35.944  1.00 70.52  -1 56   ASP C OD2   1 
ATOM   6002  N N     . PHE C 1 60  ? 52.388  -39.131 32.500  1.00 38.98  ?  57   PHE C N     1 
ATOM   6003  C CA    . PHE C 1 60  ? 52.087  -38.691 31.138  1.00 37.63  ?  57   PHE C CA    1 
ATOM   6004  C C     . PHE C 1 60  ? 52.190  -39.928 30.251  1.00 35.52  ?  57   PHE C C     1 
ATOM   6005  O O     . PHE C 1 60  ? 53.291  -40.317 29.851  1.00 39.03  ?  57   PHE C O     1 
ATOM   6006  C CB    . PHE C 1 60  ? 53.053  -37.593 30.697  1.00 43.16  ?  57   PHE C CB    1 
ATOM   6007  C CG    . PHE C 1 60  ? 52.649  -36.877 29.433  1.00 33.71  ?  57   PHE C CG    1 
ATOM   6008  C CD1   . PHE C 1 60  ? 52.586  -37.548 28.223  1.00 34.40  ?  57   PHE C CD1   1 
ATOM   6009  C CD2   . PHE C 1 60  ? 52.372  -35.518 29.452  1.00 34.10  ?  57   PHE C CD2   1 
ATOM   6010  C CE1   . PHE C 1 60  ? 52.230  -36.890 27.061  1.00 33.83  ?  57   PHE C CE1   1 
ATOM   6011  C CE2   . PHE C 1 60  ? 52.018  -34.851 28.289  1.00 33.29  ?  57   PHE C CE2   1 
ATOM   6012  C CZ    . PHE C 1 60  ? 51.948  -35.540 27.093  1.00 28.36  ?  57   PHE C CZ    1 
ATOM   6013  N N     . GLN C 1 61  ? 51.048  -40.542 29.954  1.00 35.89  ?  58   GLN C N     1 
ATOM   6014  C CA    . GLN C 1 61  ? 51.001  -41.766 29.160  1.00 35.60  ?  58   GLN C CA    1 
ATOM   6015  C C     . GLN C 1 61  ? 50.956  -41.389 27.682  1.00 35.81  ?  58   GLN C C     1 
ATOM   6016  O O     . GLN C 1 61  ? 49.974  -40.805 27.210  1.00 41.59  ?  58   GLN C O     1 
ATOM   6017  C CB    . GLN C 1 61  ? 49.793  -42.612 29.555  1.00 35.14  ?  58   GLN C CB    1 
ATOM   6018  C CG    . GLN C 1 61  ? 49.703  -42.909 31.047  1.00 43.45  ?  58   GLN C CG    1 
ATOM   6019  C CD    . GLN C 1 61  ? 50.751  -43.901 31.517  1.00 49.74  ?  58   GLN C CD    1 
ATOM   6020  O OE1   . GLN C 1 61  ? 51.273  -44.692 30.730  1.00 56.49  ?  58   GLN C OE1   1 
ATOM   6021  N NE2   . GLN C 1 61  ? 51.061  -43.866 32.807  1.00 47.53  ?  58   GLN C NE2   1 
ATOM   6022  N N     . ILE C 1 62  ? 52.016  -41.727 26.954  1.00 36.46  ?  59   ILE C N     1 
ATOM   6023  C CA    . ILE C 1 62  ? 52.158  -41.354 25.552  1.00 36.00  ?  59   ILE C CA    1 
ATOM   6024  C C     . ILE C 1 62  ? 51.482  -42.396 24.671  1.00 34.74  ?  59   ILE C C     1 
ATOM   6025  O O     . ILE C 1 62  ? 51.559  -43.603 24.929  1.00 33.37  ?  59   ILE C O     1 
ATOM   6026  C CB    . ILE C 1 62  ? 53.647  -41.185 25.191  1.00 35.46  ?  59   ILE C CB    1 
ATOM   6027  C CG1   . ILE C 1 62  ? 54.255  -40.028 25.986  1.00 30.75  ?  59   ILE C CG1   1 
ATOM   6028  C CG2   . ILE C 1 62  ? 53.830  -40.956 23.688  1.00 23.16  ?  59   ILE C CG2   1 
ATOM   6029  C CD1   . ILE C 1 62  ? 55.725  -39.783 25.701  1.00 36.56  ?  59   ILE C CD1   1 
ATOM   6030  N N     . THR C 1 63  ? 50.806  -41.918 23.631  1.00 30.33  ?  60   THR C N     1 
ATOM   6031  C CA    . THR C 1 63  ? 50.128  -42.751 22.644  1.00 25.31  ?  60   THR C CA    1 
ATOM   6032  C C     . THR C 1 63  ? 50.978  -42.801 21.369  1.00 30.96  ?  60   THR C C     1 
ATOM   6033  O O     . THR C 1 63  ? 51.551  -41.788 20.973  1.00 39.53  ?  60   THR C O     1 
ATOM   6034  C CB    . THR C 1 63  ? 48.705  -42.189 22.348  1.00 27.53  ?  60   THR C CB    1 
ATOM   6035  O OG1   . THR C 1 63  ? 47.882  -42.344 23.509  1.00 29.76  ?  60   THR C OG1   1 
ATOM   6036  C CG2   . THR C 1 63  ? 48.034  -42.882 21.165  1.00 30.52  ?  60   THR C CG2   1 
ATOM   6037  N N     . PRO C 1 64  ? 51.077  -43.978 20.726  1.00 26.24  ?  61   PRO C N     1 
ATOM   6038  C CA    . PRO C 1 64  ? 50.440  -45.249 21.086  1.00 33.09  ?  61   PRO C CA    1 
ATOM   6039  C C     . PRO C 1 64  ? 51.160  -46.023 22.181  1.00 32.14  ?  61   PRO C C     1 
ATOM   6040  O O     . PRO C 1 64  ? 52.277  -45.670 22.561  1.00 33.41  ?  61   PRO C O     1 
ATOM   6041  C CB    . PRO C 1 64  ? 50.466  -46.031 19.774  1.00 31.07  ?  61   PRO C CB    1 
ATOM   6042  C CG    . PRO C 1 64  ? 51.676  -45.532 19.081  1.00 39.77  ?  61   PRO C CG    1 
ATOM   6043  C CD    . PRO C 1 64  ? 51.780  -44.071 19.434  1.00 36.57  ?  61   PRO C CD    1 
ATOM   6044  N N     . LYS C 1 65  ? 50.495  -47.071 22.671  1.00 34.03  ?  62   LYS C N     1 
ATOM   6045  C CA    . LYS C 1 65  ? 51.037  -47.886 23.753  1.00 20.96  ?  62   LYS C CA    1 
ATOM   6046  C C     . LYS C 1 65  ? 52.468  -48.324 23.465  1.00 24.77  ?  62   LYS C C     1 
ATOM   6047  O O     . LYS C 1 65  ? 53.374  -48.101 24.278  1.00 33.04  ?  62   LYS C O     1 
ATOM   6048  C CB    . LYS C 1 65  ? 50.140  -49.102 23.982  1.00 30.71  ?  62   LYS C CB    1 
ATOM   6049  C CG    . LYS C 1 65  ? 50.605  -50.027 25.098  1.00 28.77  ?  62   LYS C CG    1 
ATOM   6050  C CD    . LYS C 1 65  ? 50.462  -49.367 26.454  1.00 30.35  ?  62   LYS C CD    1 
ATOM   6051  C CE    . LYS C 1 65  ? 50.770  -50.346 27.576  1.00 36.70  ?  62   LYS C CE    1 
ATOM   6052  N NZ    . LYS C 1 65  ? 50.534  -49.750 28.922  1.00 29.15  1  62   LYS C NZ    1 
ATOM   6053  N N     . ASN C 1 66  ? 52.696  -48.933 22.297  1.00 20.79  ?  63   ASN C N     1 
ATOM   6054  C CA    . ASN C 1 66  ? 54.000  -49.517 22.009  1.00 20.78  ?  63   ASN C CA    1 
ATOM   6055  C C     . ASN C 1 66  ? 55.055  -48.487 21.626  1.00 29.95  ?  63   ASN C C     1 
ATOM   6056  O O     . ASN C 1 66  ? 56.114  -48.881 21.118  1.00 24.25  ?  63   ASN C O     1 
ATOM   6057  C CB    . ASN C 1 66  ? 53.874  -50.589 20.918  1.00 26.84  ?  63   ASN C CB    1 
ATOM   6058  C CG    . ASN C 1 66  ? 53.419  -50.029 19.573  1.00 34.84  ?  63   ASN C CG    1 
ATOM   6059  O OD1   . ASN C 1 66  ? 53.346  -48.815 19.371  1.00 39.10  ?  63   ASN C OD1   1 
ATOM   6060  N ND2   . ASN C 1 66  ? 53.119  -50.926 18.640  1.00 36.28  ?  63   ASN C ND2   1 
ATOM   6061  N N     . VAL C 1 67  ? 54.808  -47.192 21.853  1.00 28.96  ?  64   VAL C N     1 
ATOM   6062  C CA    . VAL C 1 67  ? 55.820  -46.187 21.557  1.00 21.81  ?  64   VAL C CA    1 
ATOM   6063  C C     . VAL C 1 67  ? 57.081  -46.414 22.379  1.00 26.27  ?  64   VAL C C     1 
ATOM   6064  O O     . VAL C 1 67  ? 58.156  -45.927 22.009  1.00 22.64  ?  64   VAL C O     1 
ATOM   6065  C CB    . VAL C 1 67  ? 55.262  -44.766 21.777  1.00 29.29  ?  64   VAL C CB    1 
ATOM   6066  C CG1   . VAL C 1 67  ? 55.181  -44.439 23.263  1.00 26.57  ?  64   VAL C CG1   1 
ATOM   6067  C CG2   . VAL C 1 67  ? 56.112  -43.737 21.041  1.00 28.57  ?  64   VAL C CG2   1 
ATOM   6068  N N     . PHE C 1 68  ? 56.983  -47.165 23.483  1.00 28.92  ?  65   PHE C N     1 
ATOM   6069  C CA    . PHE C 1 68  ? 58.168  -47.488 24.269  1.00 33.20  ?  65   PHE C CA    1 
ATOM   6070  C C     . PHE C 1 68  ? 59.223  -48.217 23.447  1.00 24.62  ?  65   PHE C C     1 
ATOM   6071  O O     . PHE C 1 68  ? 60.402  -48.194 23.817  1.00 26.91  ?  65   PHE C O     1 
ATOM   6072  C CB    . PHE C 1 68  ? 57.797  -48.321 25.505  1.00 28.96  ?  65   PHE C CB    1 
ATOM   6073  C CG    . PHE C 1 68  ? 57.000  -49.568 25.202  1.00 27.84  ?  65   PHE C CG    1 
ATOM   6074  C CD1   . PHE C 1 68  ? 57.596  -50.671 24.612  1.00 25.07  ?  65   PHE C CD1   1 
ATOM   6075  C CD2   . PHE C 1 68  ? 55.661  -49.647 25.543  1.00 33.70  ?  65   PHE C CD2   1 
ATOM   6076  C CE1   . PHE C 1 68  ? 56.864  -51.812 24.342  1.00 27.11  ?  65   PHE C CE1   1 
ATOM   6077  C CE2   . PHE C 1 68  ? 54.927  -50.789 25.278  1.00 21.89  ?  65   PHE C CE2   1 
ATOM   6078  C CZ    . PHE C 1 68  ? 55.529  -51.870 24.679  1.00 28.59  ?  65   PHE C CZ    1 
ATOM   6079  N N     . GLN C 1 69  ? 58.831  -48.857 22.341  1.00 29.45  ?  66   GLN C N     1 
ATOM   6080  C CA    . GLN C 1 69  ? 59.806  -49.519 21.482  1.00 32.79  ?  66   GLN C CA    1 
ATOM   6081  C C     . GLN C 1 69  ? 60.795  -48.533 20.880  1.00 31.42  ?  66   GLN C C     1 
ATOM   6082  O O     . GLN C 1 69  ? 61.906  -48.930 20.512  1.00 30.47  ?  66   GLN C O     1 
ATOM   6083  C CB    . GLN C 1 69  ? 59.095  -50.291 20.367  1.00 33.54  ?  66   GLN C CB    1 
ATOM   6084  C CG    . GLN C 1 69  ? 58.520  -49.414 19.268  1.00 39.52  ?  66   GLN C CG    1 
ATOM   6085  C CD    . GLN C 1 69  ? 57.655  -50.188 18.290  1.00 40.01  ?  66   GLN C CD    1 
ATOM   6086  O OE1   . GLN C 1 69  ? 56.466  -49.910 18.140  1.00 39.90  ?  66   GLN C OE1   1 
ATOM   6087  N NE2   . GLN C 1 69  ? 58.254  -51.159 17.614  1.00 36.58  ?  66   GLN C NE2   1 
ATOM   6088  N N     . TYR C 1 70  ? 60.422  -47.260 20.778  1.00 22.53  ?  67   TYR C N     1 
ATOM   6089  C CA    . TYR C 1 70  ? 61.292  -46.228 20.239  1.00 29.49  ?  67   TYR C CA    1 
ATOM   6090  C C     . TYR C 1 70  ? 61.951  -45.384 21.321  1.00 23.53  ?  67   TYR C C     1 
ATOM   6091  O O     . TYR C 1 70  ? 62.750  -44.501 20.994  1.00 23.83  ?  67   TYR C O     1 
ATOM   6092  C CB    . TYR C 1 70  ? 60.504  -45.322 19.286  1.00 33.51  ?  67   TYR C CB    1 
ATOM   6093  C CG    . TYR C 1 70  ? 59.809  -46.068 18.169  1.00 30.88  ?  67   TYR C CG    1 
ATOM   6094  C CD1   . TYR C 1 70  ? 60.538  -46.773 17.220  1.00 30.45  ?  67   TYR C CD1   1 
ATOM   6095  C CD2   . TYR C 1 70  ? 58.423  -46.063 18.059  1.00 31.94  ?  67   TYR C CD2   1 
ATOM   6096  C CE1   . TYR C 1 70  ? 59.908  -47.458 16.196  1.00 34.12  ?  67   TYR C CE1   1 
ATOM   6097  C CE2   . TYR C 1 70  ? 57.784  -46.743 17.036  1.00 29.71  ?  67   TYR C CE2   1 
ATOM   6098  C CZ    . TYR C 1 70  ? 58.531  -47.438 16.109  1.00 33.77  ?  67   TYR C CZ    1 
ATOM   6099  O OH    . TYR C 1 70  ? 57.898  -48.115 15.091  1.00 41.92  ?  67   TYR C OH    1 
ATOM   6100  N N     . LYS C 1 71  ? 61.644  -45.634 22.594  1.00 23.83  ?  68   LYS C N     1 
ATOM   6101  C CA    . LYS C 1 71  ? 62.175  -44.801 23.664  1.00 24.53  ?  68   LYS C CA    1 
ATOM   6102  C C     . LYS C 1 71  ? 63.694  -44.897 23.719  1.00 28.97  ?  68   LYS C C     1 
ATOM   6103  O O     . LYS C 1 71  ? 64.268  -45.988 23.653  1.00 36.86  ?  68   LYS C O     1 
ATOM   6104  C CB    . LYS C 1 71  ? 61.573  -45.202 25.010  1.00 25.65  ?  68   LYS C CB    1 
ATOM   6105  C CG    . LYS C 1 71  ? 61.997  -44.279 26.148  1.00 41.14  ?  68   LYS C CG    1 
ATOM   6106  C CD    . LYS C 1 71  ? 61.174  -44.502 27.404  1.00 50.53  ?  68   LYS C CD    1 
ATOM   6107  C CE    . LYS C 1 71  ? 61.232  -43.287 28.322  1.00 57.63  ?  68   LYS C CE    1 
ATOM   6108  N NZ    . LYS C 1 71  ? 62.621  -42.968 28.760  1.00 62.54  1  68   LYS C NZ    1 
ATOM   6109  N N     . VAL C 1 72  ? 64.338  -43.744 23.837  1.00 32.31  ?  69   VAL C N     1 
ATOM   6110  C CA    . VAL C 1 72  ? 65.791  -43.628 23.866  1.00 37.86  ?  69   VAL C CA    1 
ATOM   6111  C C     . VAL C 1 72  ? 66.242  -43.481 25.311  1.00 43.47  ?  69   VAL C C     1 
ATOM   6112  O O     . VAL C 1 72  ? 65.601  -42.785 26.108  1.00 26.74  ?  69   VAL C O     1 
ATOM   6113  C CB    . VAL C 1 72  ? 66.254  -42.434 23.008  1.00 30.61  ?  69   VAL C CB    1 
ATOM   6114  C CG1   . VAL C 1 72  ? 67.711  -42.089 23.276  1.00 32.05  ?  69   VAL C CG1   1 
ATOM   6115  C CG2   . VAL C 1 72  ? 66.039  -42.736 21.538  1.00 32.55  ?  69   VAL C CG2   1 
ATOM   6116  N N     . GLU C 1 73  ? 67.344  -44.146 25.657  1.00 39.12  ?  70   GLU C N     1 
ATOM   6117  C CA    . GLU C 1 73  ? 67.907  -44.023 26.995  1.00 41.82  ?  70   GLU C CA    1 
ATOM   6118  C C     . GLU C 1 73  ? 68.555  -42.651 27.158  1.00 47.71  ?  70   GLU C C     1 
ATOM   6119  O O     . GLU C 1 73  ? 69.780  -42.535 27.267  1.00 39.21  ?  70   GLU C O     1 
ATOM   6120  C CB    . GLU C 1 73  ? 68.910  -45.143 27.264  1.00 41.31  ?  70   GLU C CB    1 
ATOM   6121  C CG    . GLU C 1 73  ? 69.377  -45.227 28.710  1.00 55.52  ?  70   GLU C CG    1 
ATOM   6122  C CD    . GLU C 1 73  ? 69.782  -46.630 29.118  1.00 72.91  ?  70   GLU C CD    1 
ATOM   6123  O OE1   . GLU C 1 73  ? 69.429  -47.589 28.400  1.00 76.64  ?  70   GLU C OE1   1 
ATOM   6124  O OE2   . GLU C 1 73  ? 70.453  -46.776 30.161  1.00 81.83  -1 70   GLU C OE2   1 
ATOM   6125  N N     . LYS C 1 74  ? 67.731  -41.607 27.159  1.00 40.83  ?  71   LYS C N     1 
ATOM   6126  C CA    . LYS C 1 74  ? 68.209  -40.240 27.325  1.00 35.02  ?  71   LYS C CA    1 
ATOM   6127  C C     . LYS C 1 74  ? 67.067  -39.407 27.877  1.00 36.88  ?  71   LYS C C     1 
ATOM   6128  O O     . LYS C 1 74  ? 65.991  -39.356 27.272  1.00 29.49  ?  71   LYS C O     1 
ATOM   6129  C CB    . LYS C 1 74  ? 68.710  -39.661 26.004  1.00 43.71  ?  71   LYS C CB    1 
ATOM   6130  C CG    . LYS C 1 74  ? 69.172  -38.215 26.109  1.00 42.05  ?  71   LYS C CG    1 
ATOM   6131  C CD    . LYS C 1 74  ? 69.486  -37.616 24.748  1.00 43.91  ?  71   LYS C CD    1 
ATOM   6132  C CE    . LYS C 1 74  ? 70.013  -36.197 24.892  1.00 45.68  ?  71   LYS C CE    1 
ATOM   6133  N NZ    . LYS C 1 74  ? 71.264  -35.965 24.125  1.00 43.62  1  71   LYS C NZ    1 
ATOM   6134  N N     . GLU C 1 75  ? 67.294  -38.767 29.024  1.00 33.46  ?  72   GLU C N     1 
ATOM   6135  C CA    . GLU C 1 75  ? 66.293  -37.915 29.648  1.00 31.35  ?  72   GLU C CA    1 
ATOM   6136  C C     . GLU C 1 75  ? 66.981  -36.711 30.269  1.00 36.39  ?  72   GLU C C     1 
ATOM   6137  O O     . GLU C 1 75  ? 68.124  -36.796 30.729  1.00 37.30  ?  72   GLU C O     1 
ATOM   6138  C CB    . GLU C 1 75  ? 65.489  -38.667 30.718  1.00 36.30  ?  72   GLU C CB    1 
ATOM   6139  C CG    . GLU C 1 75  ? 64.670  -39.830 30.183  1.00 53.54  ?  72   GLU C CG    1 
ATOM   6140  C CD    . GLU C 1 75  ? 63.815  -40.488 31.249  1.00 62.41  ?  72   GLU C CD    1 
ATOM   6141  O OE1   . GLU C 1 75  ? 63.814  -40.001 32.399  1.00 58.76  ?  72   GLU C OE1   1 
ATOM   6142  O OE2   . GLU C 1 75  ? 63.143  -41.493 30.934  1.00 68.30  -1 72   GLU C OE2   1 
ATOM   6143  N N     . GLU C 1 76  ? 66.271  -35.588 30.278  1.00 34.19  ?  73   GLU C N     1 
ATOM   6144  C CA    . GLU C 1 76  ? 66.751  -34.365 30.901  1.00 34.36  ?  73   GLU C CA    1 
ATOM   6145  C C     . GLU C 1 76  ? 65.668  -33.792 31.801  1.00 38.91  ?  73   GLU C C     1 
ATOM   6146  O O     . GLU C 1 76  ? 64.472  -33.924 31.527  1.00 36.85  ?  73   GLU C O     1 
ATOM   6147  C CB    . GLU C 1 76  ? 67.166  -33.320 29.860  1.00 34.90  ?  73   GLU C CB    1 
ATOM   6148  C CG    . GLU C 1 76  ? 68.488  -33.621 29.191  1.00 41.24  ?  73   GLU C CG    1 
ATOM   6149  C CD    . GLU C 1 76  ? 68.371  -33.693 27.685  1.00 42.20  ?  73   GLU C CD    1 
ATOM   6150  O OE1   . GLU C 1 76  ? 67.770  -32.779 27.085  1.00 37.40  ?  73   GLU C OE1   1 
ATOM   6151  O OE2   . GLU C 1 76  ? 68.873  -34.674 27.102  1.00 53.66  -1 73   GLU C OE2   1 
ATOM   6152  N N     . ILE C 1 77  ? 66.107  -33.157 32.882  1.00 31.38  ?  74   ILE C N     1 
ATOM   6153  C CA    . ILE C 1 77  ? 65.225  -32.490 33.829  1.00 38.48  ?  74   ILE C CA    1 
ATOM   6154  C C     . ILE C 1 77  ? 65.660  -31.037 33.906  1.00 42.23  ?  74   ILE C C     1 
ATOM   6155  O O     . ILE C 1 77  ? 66.807  -30.745 34.266  1.00 45.78  ?  74   ILE C O     1 
ATOM   6156  C CB    . ILE C 1 77  ? 65.264  -33.154 35.214  1.00 38.17  ?  74   ILE C CB    1 
ATOM   6157  C CG1   . ILE C 1 77  ? 64.683  -34.568 35.131  1.00 35.87  ?  74   ILE C CG1   1 
ATOM   6158  C CG2   . ILE C 1 77  ? 64.517  -32.307 36.235  1.00 32.32  ?  74   ILE C CG2   1 
ATOM   6159  C CD1   . ILE C 1 77  ? 65.017  -35.441 36.318  1.00 41.76  ?  74   ILE C CD1   1 
ATOM   6160  N N     . ILE C 1 78  ? 64.755  -30.131 33.553  1.00 35.83  ?  75   ILE C N     1 
ATOM   6161  C CA    . ILE C 1 78  ? 65.031  -28.700 33.543  1.00 32.34  ?  75   ILE C CA    1 
ATOM   6162  C C     . ILE C 1 78  ? 64.192  -28.059 34.638  1.00 33.59  ?  75   ILE C C     1 
ATOM   6163  O O     . ILE C 1 78  ? 62.956  -28.071 34.570  1.00 34.00  ?  75   ILE C O     1 
ATOM   6164  C CB    . ILE C 1 78  ? 64.726  -28.072 32.175  1.00 34.32  ?  75   ILE C CB    1 
ATOM   6165  C CG1   . ILE C 1 78  ? 65.128  -29.024 31.045  1.00 39.12  ?  75   ILE C CG1   1 
ATOM   6166  C CG2   . ILE C 1 78  ? 65.446  -26.739 32.031  1.00 41.85  ?  75   ILE C CG2   1 
ATOM   6167  C CD1   . ILE C 1 78  ? 66.615  -29.310 30.974  1.00 51.26  ?  75   ILE C CD1   1 
ATOM   6168  N N     . LYS C 1 79  ? 64.858  -27.509 35.647  1.00 33.53  ?  76   LYS C N     1 
ATOM   6169  C CA    . LYS C 1 79  ? 64.149  -26.824 36.716  1.00 40.89  ?  76   LYS C CA    1 
ATOM   6170  C C     . LYS C 1 79  ? 63.540  -25.528 36.198  1.00 35.62  ?  76   LYS C C     1 
ATOM   6171  O O     . LYS C 1 79  ? 64.125  -24.840 35.356  1.00 33.63  ?  76   LYS C O     1 
ATOM   6172  C CB    . LYS C 1 79  ? 65.098  -26.539 37.880  1.00 41.35  ?  76   LYS C CB    1 
ATOM   6173  C CG    . LYS C 1 79  ? 65.631  -27.795 38.552  1.00 40.07  ?  76   LYS C CG    1 
ATOM   6174  C CD    . LYS C 1 79  ? 67.081  -27.627 38.969  1.00 48.90  ?  76   LYS C CD    1 
ATOM   6175  C CE    . LYS C 1 79  ? 67.245  -26.509 39.980  1.00 49.40  ?  76   LYS C CE    1 
ATOM   6176  N NZ    . LYS C 1 79  ? 68.682  -26.233 40.256  1.00 59.85  1  76   LYS C NZ    1 
ATOM   6177  N N     . GLU C 1 80  ? 62.343  -25.207 36.695  1.00 39.64  ?  77   GLU C N     1 
ATOM   6178  C CA    . GLU C 1 80  ? 61.710  -23.939 36.345  1.00 40.60  ?  77   GLU C CA    1 
ATOM   6179  C C     . GLU C 1 80  ? 62.632  -22.766 36.654  1.00 42.12  ?  77   GLU C C     1 
ATOM   6180  O O     . GLU C 1 80  ? 62.674  -21.783 35.904  1.00 45.70  ?  77   GLU C O     1 
ATOM   6181  C CB    . GLU C 1 80  ? 60.378  -23.799 37.087  1.00 42.82  ?  77   GLU C CB    1 
ATOM   6182  C CG    . GLU C 1 80  ? 59.657  -22.476 36.862  1.00 53.20  ?  77   GLU C CG    1 
ATOM   6183  C CD    . GLU C 1 80  ? 60.061  -21.406 37.862  1.00 61.45  ?  77   GLU C CD    1 
ATOM   6184  O OE1   . GLU C 1 80  ? 60.520  -21.765 38.967  1.00 70.51  ?  77   GLU C OE1   1 
ATOM   6185  O OE2   . GLU C 1 80  ? 59.925  -20.208 37.541  1.00 60.73  -1 77   GLU C OE2   1 
ATOM   6186  N N     . GLU C 1 81  ? 63.388  -22.859 37.753  1.00 45.56  ?  78   GLU C N     1 
ATOM   6187  C CA    . GLU C 1 81  ? 64.372  -21.829 38.068  1.00 48.64  ?  78   GLU C CA    1 
ATOM   6188  C C     . GLU C 1 81  ? 65.427  -21.713 36.978  1.00 49.61  ?  78   GLU C C     1 
ATOM   6189  O O     . GLU C 1 81  ? 65.942  -20.618 36.728  1.00 52.38  ?  78   GLU C O     1 
ATOM   6190  C CB    . GLU C 1 81  ? 65.040  -22.120 39.414  1.00 47.72  ?  78   GLU C CB    1 
ATOM   6191  C CG    . GLU C 1 81  ? 64.131  -21.958 40.627  1.00 57.05  ?  78   GLU C CG    1 
ATOM   6192  C CD    . GLU C 1 81  ? 63.118  -23.077 40.756  1.00 63.52  ?  78   GLU C CD    1 
ATOM   6193  O OE1   . GLU C 1 81  ? 63.437  -24.214 40.352  1.00 62.51  ?  78   GLU C OE1   1 
ATOM   6194  O OE2   . GLU C 1 81  ? 61.999  -22.817 41.246  1.00 65.59  -1 78   GLU C OE2   1 
ATOM   6195  N N     . GLU C 1 82  ? 65.755  -22.822 36.312  1.00 49.66  ?  79   GLU C N     1 
ATOM   6196  C CA    . GLU C 1 82  ? 66.761  -22.788 35.258  1.00 52.58  ?  79   GLU C CA    1 
ATOM   6197  C C     . GLU C 1 82  ? 66.208  -22.247 33.947  1.00 51.90  ?  79   GLU C C     1 
ATOM   6198  O O     . GLU C 1 82  ? 66.975  -21.722 33.132  1.00 48.54  ?  79   GLU C O     1 
ATOM   6199  C CB    . GLU C 1 82  ? 67.339  -24.186 35.018  1.00 55.00  ?  79   GLU C CB    1 
ATOM   6200  C CG    . GLU C 1 82  ? 67.951  -24.850 36.235  1.00 60.79  ?  79   GLU C CG    1 
ATOM   6201  C CD    . GLU C 1 82  ? 68.555  -26.202 35.900  1.00 69.00  ?  79   GLU C CD    1 
ATOM   6202  O OE1   . GLU C 1 82  ? 69.726  -26.241 35.466  1.00 77.22  ?  79   GLU C OE1   1 
ATOM   6203  O OE2   . GLU C 1 82  ? 67.854  -27.225 36.052  1.00 63.51  -1 79   GLU C OE2   1 
ATOM   6204  N N     . ASP C 1 83  ? 64.899  -22.376 33.713  1.00 49.20  ?  80   ASP C N     1 
ATOM   6205  C CA    . ASP C 1 83  ? 64.317  -21.959 32.436  1.00 50.85  ?  80   ASP C CA    1 
ATOM   6206  C C     . ASP C 1 83  ? 62.831  -21.681 32.660  1.00 51.49  ?  80   ASP C C     1 
ATOM   6207  O O     . ASP C 1 83  ? 62.015  -22.605 32.627  1.00 45.76  ?  80   ASP C O     1 
ATOM   6208  C CB    . ASP C 1 83  ? 64.535  -23.018 31.371  1.00 46.64  ?  80   ASP C CB    1 
ATOM   6209  C CG    . ASP C 1 83  ? 64.328  -22.488 29.969  1.00 41.73  ?  80   ASP C CG    1 
ATOM   6210  O OD1   . ASP C 1 83  ? 63.656  -21.446 29.815  1.00 39.83  ?  80   ASP C OD1   1 
ATOM   6211  O OD2   . ASP C 1 83  ? 64.832  -23.120 29.019  1.00 47.96  -1 80   ASP C OD2   1 
ATOM   6212  N N     . LYS C 1 84  ? 62.500  -20.406 32.870  1.00 36.45  ?  81   LYS C N     1 
ATOM   6213  C CA    . LYS C 1 84  ? 61.117  -20.031 33.145  1.00 36.64  ?  81   LYS C CA    1 
ATOM   6214  C C     . LYS C 1 84  ? 60.248  -20.173 31.900  1.00 34.90  ?  81   LYS C C     1 
ATOM   6215  O O     . LYS C 1 84  ? 59.166  -20.771 31.950  1.00 42.69  ?  81   LYS C O     1 
ATOM   6216  C CB    . LYS C 1 84  ? 61.065  -18.600 33.675  1.00 33.85  ?  81   LYS C CB    1 
ATOM   6217  C CG    . LYS C 1 84  ? 60.352  -18.462 35.002  1.00 49.72  ?  81   LYS C CG    1 
ATOM   6218  C CD    . LYS C 1 84  ? 60.986  -17.377 35.852  1.00 51.81  ?  81   LYS C CD    1 
ATOM   6219  C CE    . LYS C 1 84  ? 60.290  -17.262 37.193  1.00 50.75  ?  81   LYS C CE    1 
ATOM   6220  N NZ    . LYS C 1 84  ? 61.180  -16.668 38.228  1.00 53.89  1  81   LYS C NZ    1 
ATOM   6221  N N     . LYS C 1 85  ? 60.706  -19.620 30.773  1.00 33.71  ?  82   LYS C N     1 
ATOM   6222  C CA    . LYS C 1 85  ? 59.932  -19.683 29.536  1.00 35.65  ?  82   LYS C CA    1 
ATOM   6223  C C     . LYS C 1 85  ? 59.602  -21.122 29.155  1.00 34.86  ?  82   LYS C C     1 
ATOM   6224  O O     . LYS C 1 85  ? 58.466  -21.425 28.770  1.00 33.05  ?  82   LYS C O     1 
ATOM   6225  C CB    . LYS C 1 85  ? 60.698  -18.992 28.406  1.00 38.03  ?  82   LYS C CB    1 
ATOM   6226  C CG    . LYS C 1 85  ? 61.023  -17.527 28.669  1.00 50.38  ?  82   LYS C CG    1 
ATOM   6227  C CD    . LYS C 1 85  ? 61.701  -16.887 27.462  1.00 55.09  ?  82   LYS C CD    1 
ATOM   6228  C CE    . LYS C 1 85  ? 63.109  -17.430 27.246  1.00 59.43  ?  82   LYS C CE    1 
ATOM   6229  N NZ    . LYS C 1 85  ? 64.150  -16.532 27.820  1.00 57.26  1  82   LYS C NZ    1 
ATOM   6230  N N     . LEU C 1 86  ? 60.584  -22.022 29.259  1.00 30.33  ?  83   LEU C N     1 
ATOM   6231  C CA    . LEU C 1 86  ? 60.347  -23.428 28.944  1.00 30.25  ?  83   LEU C CA    1 
ATOM   6232  C C     . LEU C 1 86  ? 59.220  -24.003 29.790  1.00 27.69  ?  83   LEU C C     1 
ATOM   6233  O O     . LEU C 1 86  ? 58.353  -24.723 29.282  1.00 30.22  ?  83   LEU C O     1 
ATOM   6234  C CB    . LEU C 1 86  ? 61.625  -24.237 29.158  1.00 24.18  ?  83   LEU C CB    1 
ATOM   6235  C CG    . LEU C 1 86  ? 61.454  -25.757 29.116  1.00 25.97  ?  83   LEU C CG    1 
ATOM   6236  C CD1   . LEU C 1 86  ? 61.106  -26.223 27.711  1.00 25.76  ?  83   LEU C CD1   1 
ATOM   6237  C CD2   . LEU C 1 86  ? 62.701  -26.455 29.624  1.00 34.37  ?  83   LEU C CD2   1 
ATOM   6238  N N     . PHE C 1 87  ? 59.215  -23.689 31.085  1.00 27.14  ?  84   PHE C N     1 
ATOM   6239  C CA    . PHE C 1 87  ? 58.192  -24.219 31.979  1.00 30.43  ?  84   PHE C CA    1 
ATOM   6240  C C     . PHE C 1 87  ? 56.805  -23.727 31.582  1.00 27.92  ?  84   PHE C C     1 
ATOM   6241  O O     . PHE C 1 87  ? 55.852  -24.512 31.499  1.00 28.58  ?  84   PHE C O     1 
ATOM   6242  C CB    . PHE C 1 87  ? 58.523  -23.824 33.418  1.00 34.76  ?  84   PHE C CB    1 
ATOM   6243  C CG    . PHE C 1 87  ? 57.521  -24.299 34.421  1.00 30.67  ?  84   PHE C CG    1 
ATOM   6244  C CD1   . PHE C 1 87  ? 57.546  -25.605 34.873  1.00 37.73  ?  84   PHE C CD1   1 
ATOM   6245  C CD2   . PHE C 1 87  ? 56.561  -23.437 34.920  1.00 32.60  ?  84   PHE C CD2   1 
ATOM   6246  C CE1   . PHE C 1 87  ? 56.626  -26.041 35.797  1.00 38.70  ?  84   PHE C CE1   1 
ATOM   6247  C CE2   . PHE C 1 87  ? 55.639  -23.870 35.845  1.00 31.09  ?  84   PHE C CE2   1 
ATOM   6248  C CZ    . PHE C 1 87  ? 55.674  -25.169 36.284  1.00 38.75  ?  84   PHE C CZ    1 
ATOM   6249  N N     . VAL C 1 88  ? 56.675  -22.422 31.328  1.00 27.76  ?  85   VAL C N     1 
ATOM   6250  C CA    . VAL C 1 88  ? 55.379  -21.857 30.964  1.00 22.15  ?  85   VAL C CA    1 
ATOM   6251  C C     . VAL C 1 88  ? 54.913  -22.401 29.619  1.00 26.65  ?  85   VAL C C     1 
ATOM   6252  O O     . VAL C 1 88  ? 53.738  -22.753 29.448  1.00 21.40  ?  85   VAL C O     1 
ATOM   6253  C CB    . VAL C 1 88  ? 55.457  -20.320 30.963  1.00 27.35  ?  85   VAL C CB    1 
ATOM   6254  C CG1   . VAL C 1 88  ? 54.124  -19.716 30.553  1.00 25.96  ?  85   VAL C CG1   1 
ATOM   6255  C CG2   . VAL C 1 88  ? 55.884  -19.812 32.334  1.00 35.84  ?  85   VAL C CG2   1 
ATOM   6256  N N     . LYS C 1 89  ? 55.822  -22.482 28.647  1.00 19.09  ?  86   LYS C N     1 
ATOM   6257  C CA    . LYS C 1 89  ? 55.472  -23.037 27.341  1.00 23.31  ?  86   LYS C CA    1 
ATOM   6258  C C     . LYS C 1 89  ? 54.979  -24.474 27.467  1.00 29.43  ?  86   LYS C C     1 
ATOM   6259  O O     . LYS C 1 89  ? 53.964  -24.852 26.869  1.00 30.66  ?  86   LYS C O     1 
ATOM   6260  C CB    . LYS C 1 89  ? 56.677  -22.968 26.402  1.00 27.99  ?  86   LYS C CB    1 
ATOM   6261  C CG    . LYS C 1 89  ? 56.553  -23.846 25.164  1.00 31.30  ?  86   LYS C CG    1 
ATOM   6262  C CD    . LYS C 1 89  ? 57.870  -23.921 24.401  1.00 32.12  ?  86   LYS C CD    1 
ATOM   6263  C CE    . LYS C 1 89  ? 57.747  -24.824 23.185  1.00 32.96  ?  86   LYS C CE    1 
ATOM   6264  N NZ    . LYS C 1 89  ? 59.047  -24.996 22.483  1.00 46.92  1  86   LYS C NZ    1 
ATOM   6265  N N     . THR C 1 90  ? 55.694  -25.292 28.243  1.00 24.37  ?  87   THR C N     1 
ATOM   6266  C CA    . THR C 1 90  ? 55.285  -26.682 28.432  1.00 30.00  ?  87   THR C CA    1 
ATOM   6267  C C     . THR C 1 90  ? 53.921  -26.769 29.105  1.00 31.50  ?  87   THR C C     1 
ATOM   6268  O O     . THR C 1 90  ? 53.078  -27.584 28.715  1.00 29.73  ?  87   THR C O     1 
ATOM   6269  C CB    . THR C 1 90  ? 56.334  -27.426 29.257  1.00 30.50  ?  87   THR C CB    1 
ATOM   6270  O OG1   . THR C 1 90  ? 57.613  -27.317 28.619  1.00 37.39  ?  87   THR C OG1   1 
ATOM   6271  C CG2   . THR C 1 90  ? 55.959  -28.895 29.403  1.00 34.07  ?  87   THR C CG2   1 
ATOM   6272  N N     . LEU C 1 91  ? 53.687  -25.932 30.116  1.00 29.76  ?  88   LEU C N     1 
ATOM   6273  C CA    . LEU C 1 91  ? 52.418  -25.962 30.833  1.00 27.19  ?  88   LEU C CA    1 
ATOM   6274  C C     . LEU C 1 91  ? 51.259  -25.572 29.922  1.00 26.48  ?  88   LEU C C     1 
ATOM   6275  O O     . LEU C 1 91  ? 50.177  -26.167 29.993  1.00 25.60  ?  88   LEU C O     1 
ATOM   6276  C CB    . LEU C 1 91  ? 52.496  -25.036 32.044  1.00 33.73  ?  88   LEU C CB    1 
ATOM   6277  C CG    . LEU C 1 91  ? 51.442  -25.177 33.140  1.00 45.84  ?  88   LEU C CG    1 
ATOM   6278  C CD1   . LEU C 1 91  ? 51.210  -26.636 33.480  1.00 39.56  ?  88   LEU C CD1   1 
ATOM   6279  C CD2   . LEU C 1 91  ? 51.912  -24.416 34.363  1.00 44.28  ?  88   LEU C CD2   1 
ATOM   6280  N N     . TYR C 1 92  ? 51.468  -24.573 29.060  1.00 32.98  ?  89   TYR C N     1 
ATOM   6281  C CA    . TYR C 1 92  ? 50.444  -24.184 28.094  1.00 37.77  ?  89   TYR C CA    1 
ATOM   6282  C C     . TYR C 1 92  ? 50.089  -25.340 27.168  1.00 37.02  ?  89   TYR C C     1 
ATOM   6283  O O     . TYR C 1 92  ? 48.908  -25.625 26.934  1.00 26.36  ?  89   TYR C O     1 
ATOM   6284  C CB    . TYR C 1 92  ? 50.925  -22.982 27.284  1.00 32.61  ?  89   TYR C CB    1 
ATOM   6285  C CG    . TYR C 1 92  ? 50.475  -21.645 27.822  1.00 29.36  ?  89   TYR C CG    1 
ATOM   6286  C CD1   . TYR C 1 92  ? 49.133  -21.393 28.079  1.00 29.39  ?  89   TYR C CD1   1 
ATOM   6287  C CD2   . TYR C 1 92  ? 51.392  -20.635 28.073  1.00 29.08  ?  89   TYR C CD2   1 
ATOM   6288  C CE1   . TYR C 1 92  ? 48.718  -20.170 28.569  1.00 26.31  ?  89   TYR C CE1   1 
ATOM   6289  C CE2   . TYR C 1 92  ? 50.986  -19.407 28.561  1.00 26.13  ?  89   TYR C CE2   1 
ATOM   6290  C CZ    . TYR C 1 92  ? 49.650  -19.181 28.809  1.00 26.90  ?  89   TYR C CZ    1 
ATOM   6291  O OH    . TYR C 1 92  ? 49.251  -17.960 29.297  1.00 29.63  ?  89   TYR C OH    1 
ATOM   6292  N N     . LYS C 1 93  ? 51.103  -26.013 26.623  1.00 29.40  ?  90   LYS C N     1 
ATOM   6293  C CA    . LYS C 1 93  ? 50.843  -27.138 25.732  1.00 28.78  ?  90   LYS C CA    1 
ATOM   6294  C C     . LYS C 1 93  ? 50.137  -28.269 26.468  1.00 30.29  ?  90   LYS C C     1 
ATOM   6295  O O     . LYS C 1 93  ? 49.291  -28.963 25.892  1.00 29.67  ?  90   LYS C O     1 
ATOM   6296  C CB    . LYS C 1 93  ? 52.151  -27.626 25.109  1.00 29.49  ?  90   LYS C CB    1 
ATOM   6297  C CG    . LYS C 1 93  ? 52.832  -26.598 24.218  1.00 23.20  ?  90   LYS C CG    1 
ATOM   6298  C CD    . LYS C 1 93  ? 54.245  -27.025 23.851  1.00 29.84  ?  90   LYS C CD    1 
ATOM   6299  C CE    . LYS C 1 93  ? 54.255  -28.313 23.039  1.00 30.66  ?  90   LYS C CE    1 
ATOM   6300  N NZ    . LYS C 1 93  ? 55.647  -28.776 22.775  1.00 35.72  1  90   LYS C NZ    1 
ATOM   6301  N N     . TYR C 1 94  ? 50.454  -28.457 27.750  1.00 31.93  ?  91   TYR C N     1 
ATOM   6302  C CA    . TYR C 1 94  ? 49.831  -29.535 28.510  1.00 31.33  ?  91   TYR C CA    1 
ATOM   6303  C C     . TYR C 1 94  ? 48.370  -29.225 28.816  1.00 24.40  ?  91   TYR C C     1 
ATOM   6304  O O     . TYR C 1 94  ? 47.523  -30.126 28.800  1.00 26.40  ?  91   TYR C O     1 
ATOM   6305  C CB    . TYR C 1 94  ? 50.609  -29.790 29.798  1.00 34.56  ?  91   TYR C CB    1 
ATOM   6306  C CG    . TYR C 1 94  ? 50.050  -30.932 30.608  1.00 42.95  ?  91   TYR C CG    1 
ATOM   6307  C CD1   . TYR C 1 94  ? 50.033  -32.221 30.095  1.00 45.52  ?  91   TYR C CD1   1 
ATOM   6308  C CD2   . TYR C 1 94  ? 49.537  -30.724 31.880  1.00 40.93  ?  91   TYR C CD2   1 
ATOM   6309  C CE1   . TYR C 1 94  ? 49.522  -33.272 30.825  1.00 47.93  ?  91   TYR C CE1   1 
ATOM   6310  C CE2   . TYR C 1 94  ? 49.023  -31.771 32.620  1.00 47.25  ?  91   TYR C CE2   1 
ATOM   6311  C CZ    . TYR C 1 94  ? 49.020  -33.042 32.085  1.00 47.99  ?  91   TYR C CZ    1 
ATOM   6312  O OH    . TYR C 1 94  ? 48.514  -34.095 32.808  1.00 58.34  ?  91   TYR C OH    1 
ATOM   6313  N N     . ILE C 1 95  ? 48.060  -27.961 29.108  1.00 30.83  ?  92   ILE C N     1 
ATOM   6314  C CA    . ILE C 1 95  ? 46.667  -27.555 29.278  1.00 33.08  ?  92   ILE C CA    1 
ATOM   6315  C C     . ILE C 1 95  ? 45.900  -27.755 27.979  1.00 31.18  ?  92   ILE C C     1 
ATOM   6316  O O     . ILE C 1 95  ? 44.776  -28.269 27.971  1.00 33.16  ?  92   ILE C O     1 
ATOM   6317  C CB    . ILE C 1 95  ? 46.591  -26.094 29.754  1.00 35.41  ?  92   ILE C CB    1 
ATOM   6318  C CG1   . ILE C 1 95  ? 47.239  -25.948 31.129  1.00 37.16  ?  92   ILE C CG1   1 
ATOM   6319  C CG2   . ILE C 1 95  ? 45.145  -25.610 29.783  1.00 23.22  ?  92   ILE C CG2   1 
ATOM   6320  C CD1   . ILE C 1 95  ? 47.638  -24.537 31.447  1.00 43.21  ?  92   ILE C CD1   1 
ATOM   6321  N N     . LYS C 1 96  ? 46.501  -27.345 26.859  1.00 26.36  ?  93   LYS C N     1 
ATOM   6322  C CA    . LYS C 1 96  ? 45.879  -27.553 25.557  1.00 29.66  ?  93   LYS C CA    1 
ATOM   6323  C C     . LYS C 1 96  ? 45.596  -29.029 25.310  1.00 36.94  ?  93   LYS C C     1 
ATOM   6324  O O     . LYS C 1 96  ? 44.519  -29.388 24.819  1.00 31.25  ?  93   LYS C O     1 
ATOM   6325  C CB    . LYS C 1 96  ? 46.775  -26.986 24.459  1.00 23.87  ?  93   LYS C CB    1 
ATOM   6326  C CG    . LYS C 1 96  ? 46.182  -27.047 23.068  1.00 25.33  ?  93   LYS C CG    1 
ATOM   6327  C CD    . LYS C 1 96  ? 47.144  -26.466 22.047  1.00 28.03  ?  93   LYS C CD    1 
ATOM   6328  C CE    . LYS C 1 96  ? 46.577  -26.560 20.644  1.00 39.36  ?  93   LYS C CE    1 
ATOM   6329  N NZ    . LYS C 1 96  ? 47.558  -26.098 19.625  1.00 54.80  1  93   LYS C NZ    1 
ATOM   6330  N N     . LYS C 1 97  ? 46.547  -29.900 25.656  1.00 29.99  ?  94   LYS C N     1 
ATOM   6331  C CA    . LYS C 1 97  ? 46.356  -31.332 25.443  1.00 29.61  ?  94   LYS C CA    1 
ATOM   6332  C C     . LYS C 1 97  ? 45.172  -31.859 26.243  1.00 24.63  ?  94   LYS C C     1 
ATOM   6333  O O     . LYS C 1 97  ? 44.347  -32.619 25.725  1.00 33.60  ?  94   LYS C O     1 
ATOM   6334  C CB    . LYS C 1 97  ? 47.627  -32.099 25.810  1.00 33.78  ?  94   LYS C CB    1 
ATOM   6335  C CG    . LYS C 1 97  ? 47.381  -33.583 26.031  1.00 33.27  ?  94   LYS C CG    1 
ATOM   6336  C CD    . LYS C 1 97  ? 48.662  -34.342 26.318  1.00 30.65  ?  94   LYS C CD    1 
ATOM   6337  C CE    . LYS C 1 97  ? 48.361  -35.793 26.664  1.00 29.07  ?  94   LYS C CE    1 
ATOM   6338  N NZ    . LYS C 1 97  ? 47.580  -36.469 25.592  1.00 24.30  1  94   LYS C NZ    1 
ATOM   6339  N N     . LEU C 1 98  ? 45.074  -31.467 27.515  1.00 22.68  ?  95   LEU C N     1 
ATOM   6340  C CA    . LEU C 1 98  ? 43.971  -31.933 28.352  1.00 29.33  ?  95   LEU C CA    1 
ATOM   6341  C C     . LEU C 1 98  ? 42.627  -31.493 27.784  1.00 28.95  ?  95   LEU C C     1 
ATOM   6342  O O     . LEU C 1 98  ? 41.679  -32.285 27.711  1.00 32.09  ?  95   LEU C O     1 
ATOM   6343  C CB    . LEU C 1 98  ? 44.147  -31.423 29.782  1.00 27.63  ?  95   LEU C CB    1 
ATOM   6344  C CG    . LEU C 1 98  ? 45.273  -32.058 30.599  1.00 40.73  ?  95   LEU C CG    1 
ATOM   6345  C CD1   . LEU C 1 98  ? 45.405  -31.375 31.956  1.00 31.49  ?  95   LEU C CD1   1 
ATOM   6346  C CD2   . LEU C 1 98  ? 45.034  -33.553 30.765  1.00 35.72  ?  95   LEU C CD2   1 
ATOM   6347  N N     . PHE C 1 99  ? 42.525  -30.224 27.379  1.00 28.57  ?  96   PHE C N     1 
ATOM   6348  C CA    . PHE C 1 99  ? 41.287  -29.735 26.780  1.00 31.25  ?  96   PHE C CA    1 
ATOM   6349  C C     . PHE C 1 99  ? 40.965  -30.477 25.489  1.00 26.65  ?  96   PHE C C     1 
ATOM   6350  O O     . PHE C 1 99  ? 39.811  -30.854 25.252  1.00 31.39  ?  96   PHE C O     1 
ATOM   6351  C CB    . PHE C 1 99  ? 41.390  -28.235 26.520  1.00 32.20  ?  96   PHE C CB    1 
ATOM   6352  C CG    . PHE C 1 99  ? 40.998  -27.382 27.693  1.00 33.06  ?  96   PHE C CG    1 
ATOM   6353  C CD1   . PHE C 1 99  ? 39.664  -27.086 27.930  1.00 26.22  ?  96   PHE C CD1   1 
ATOM   6354  C CD2   . PHE C 1 99  ? 41.957  -26.866 28.549  1.00 35.64  ?  96   PHE C CD2   1 
ATOM   6355  C CE1   . PHE C 1 99  ? 39.294  -26.297 29.002  1.00 30.83  ?  96   PHE C CE1   1 
ATOM   6356  C CE2   . PHE C 1 99  ? 41.593  -26.077 29.624  1.00 35.05  ?  96   PHE C CE2   1 
ATOM   6357  C CZ    . PHE C 1 99  ? 40.258  -25.791 29.850  1.00 31.57  ?  96   PHE C CZ    1 
ATOM   6358  N N     . LEU C 1 100 ? 41.972  -30.695 24.642  1.00 29.15  ?  97   LEU C N     1 
ATOM   6359  C CA    . LEU C 1 100 ? 41.739  -31.414 23.394  1.00 36.05  ?  97   LEU C CA    1 
ATOM   6360  C C     . LEU C 1 100 ? 41.395  -32.876 23.652  1.00 27.96  ?  97   LEU C C     1 
ATOM   6361  O O     . LEU C 1 100 ? 40.540  -33.447 22.964  1.00 30.65  ?  97   LEU C O     1 
ATOM   6362  C CB    . LEU C 1 100 ? 42.961  -31.299 22.481  1.00 33.59  ?  97   LEU C CB    1 
ATOM   6363  C CG    . LEU C 1 100 ? 43.176  -29.962 21.767  1.00 43.51  ?  97   LEU C CG    1 
ATOM   6364  C CD1   . LEU C 1 100 ? 44.524  -29.948 21.062  1.00 39.23  ?  97   LEU C CD1   1 
ATOM   6365  C CD2   . LEU C 1 100 ? 42.054  -29.696 20.774  1.00 32.37  ?  97   LEU C CD2   1 
ATOM   6366  N N     . ASP C 1 101 ? 42.052  -33.500 24.636  1.00 40.52  ?  98   ASP C N     1 
ATOM   6367  C CA    . ASP C 1 101 ? 41.721  -34.877 24.994  1.00 35.75  ?  98   ASP C CA    1 
ATOM   6368  C C     . ASP C 1 101 ? 40.294  -35.011 25.502  1.00 37.37  ?  98   ASP C C     1 
ATOM   6369  O O     . ASP C 1 101 ? 39.716  -36.099 25.413  1.00 34.22  ?  98   ASP C O     1 
ATOM   6370  C CB    . ASP C 1 101 ? 42.690  -35.405 26.052  1.00 33.07  ?  98   ASP C CB    1 
ATOM   6371  C CG    . ASP C 1 101 ? 44.063  -35.716 25.487  1.00 38.70  ?  98   ASP C CG    1 
ATOM   6372  O OD1   . ASP C 1 101 ? 44.241  -35.595 24.255  1.00 41.23  ?  98   ASP C OD1   1 
ATOM   6373  O OD2   . ASP C 1 101 ? 44.959  -36.097 26.271  1.00 35.60  -1 98   ASP C OD2   1 
ATOM   6374  N N     . ASN C 1 102 ? 39.717  -33.938 26.040  1.00 40.60  ?  99   ASN C N     1 
ATOM   6375  C CA    . ASN C 1 102 ? 38.331  -33.934 26.486  1.00 38.44  ?  99   ASN C CA    1 
ATOM   6376  C C     . ASN C 1 102 ? 37.398  -33.310 25.457  1.00 37.60  ?  99   ASN C C     1 
ATOM   6377  O O     . ASN C 1 102 ? 36.299  -32.872 25.811  1.00 41.70  ?  99   ASN C O     1 
ATOM   6378  C CB    . ASN C 1 102 ? 38.209  -33.221 27.833  1.00 39.02  ?  99   ASN C CB    1 
ATOM   6379  C CG    . ASN C 1 102 ? 38.824  -34.019 28.967  1.00 34.09  ?  99   ASN C CG    1 
ATOM   6380  O OD1   . ASN C 1 102 ? 38.131  -34.752 29.674  1.00 40.94  ?  99   ASN C OD1   1 
ATOM   6381  N ND2   . ASN C 1 102 ? 40.133  -33.887 29.141  1.00 32.33  ?  99   ASN C ND2   1 
ATOM   6382  N N     . ASP C 1 103 ? 37.835  -33.243 24.197  1.00 35.94  ?  100  ASP C N     1 
ATOM   6383  C CA    . ASP C 1 103 ? 37.001  -32.893 23.048  1.00 38.31  ?  100  ASP C CA    1 
ATOM   6384  C C     . ASP C 1 103 ? 36.593  -31.421 23.037  1.00 48.11  ?  100  ASP C C     1 
ATOM   6385  O O     . ASP C 1 103 ? 35.536  -31.068 22.507  1.00 50.31  ?  100  ASP C O     1 
ATOM   6386  C CB    . ASP C 1 103 ? 35.758  -33.787 22.961  1.00 52.70  ?  100  ASP C CB    1 
ATOM   6387  C CG    . ASP C 1 103 ? 35.278  -33.977 21.534  1.00 69.89  ?  100  ASP C CG    1 
ATOM   6388  O OD1   . ASP C 1 103 ? 35.823  -33.312 20.628  1.00 81.96  ?  100  ASP C OD1   1 
ATOM   6389  O OD2   . ASP C 1 103 ? 34.351  -34.785 21.318  1.00 73.07  -1 100  ASP C OD2   1 
ATOM   6390  N N     . PHE C 1 104 ? 37.420  -30.549 23.605  1.00 41.05  ?  101  PHE C N     1 
ATOM   6391  C CA    . PHE C 1 104 ? 37.236  -29.116 23.425  1.00 31.65  ?  101  PHE C CA    1 
ATOM   6392  C C     . PHE C 1 104 ? 37.849  -28.676 22.102  1.00 35.92  ?  101  PHE C C     1 
ATOM   6393  O O     . PHE C 1 104 ? 38.839  -29.243 21.634  1.00 30.33  ?  101  PHE C O     1 
ATOM   6394  C CB    . PHE C 1 104 ? 37.882  -28.331 24.568  1.00 30.23  ?  101  PHE C CB    1 
ATOM   6395  C CG    . PHE C 1 104 ? 37.059  -28.283 25.825  1.00 40.05  ?  101  PHE C CG    1 
ATOM   6396  C CD1   . PHE C 1 104 ? 36.869  -29.422 26.591  1.00 37.42  ?  101  PHE C CD1   1 
ATOM   6397  C CD2   . PHE C 1 104 ? 36.499  -27.090 26.256  1.00 37.01  ?  101  PHE C CD2   1 
ATOM   6398  C CE1   . PHE C 1 104 ? 36.121  -29.377 27.755  1.00 35.92  ?  101  PHE C CE1   1 
ATOM   6399  C CE2   . PHE C 1 104 ? 35.750  -27.038 27.420  1.00 39.44  ?  101  PHE C CE2   1 
ATOM   6400  C CZ    . PHE C 1 104 ? 35.560  -28.182 28.169  1.00 40.19  ?  101  PHE C CZ    1 
ATOM   6401  N N     . TYR C 1 105 ? 37.245  -27.659 21.496  1.00 32.55  ?  102  TYR C N     1 
ATOM   6402  C CA    . TYR C 1 105 ? 37.855  -26.992 20.357  1.00 33.35  ?  102  TYR C CA    1 
ATOM   6403  C C     . TYR C 1 105 ? 38.853  -25.953 20.846  1.00 38.29  ?  102  TYR C C     1 
ATOM   6404  O O     . TYR C 1 105 ? 38.607  -25.250 21.830  1.00 29.01  ?  102  TYR C O     1 
ATOM   6405  C CB    . TYR C 1 105 ? 36.794  -26.319 19.486  1.00 38.25  ?  102  TYR C CB    1 
ATOM   6406  C CG    . TYR C 1 105 ? 36.063  -27.242 18.537  1.00 46.83  ?  102  TYR C CG    1 
ATOM   6407  C CD1   . TYR C 1 105 ? 36.550  -28.512 18.253  1.00 48.90  ?  102  TYR C CD1   1 
ATOM   6408  C CD2   . TYR C 1 105 ? 34.889  -26.836 17.915  1.00 48.15  ?  102  TYR C CD2   1 
ATOM   6409  C CE1   . TYR C 1 105 ? 35.881  -29.355 17.380  1.00 54.56  ?  102  TYR C CE1   1 
ATOM   6410  C CE2   . TYR C 1 105 ? 34.215  -27.670 17.044  1.00 52.54  ?  102  TYR C CE2   1 
ATOM   6411  C CZ    . TYR C 1 105 ? 34.714  -28.927 16.778  1.00 60.39  ?  102  TYR C CZ    1 
ATOM   6412  O OH    . TYR C 1 105 ? 34.041  -29.756 15.909  1.00 66.37  ?  102  TYR C OH    1 
ATOM   6413  N N     . PHE C 1 106 ? 39.987  -25.862 20.162  1.00 36.30  ?  103  PHE C N     1 
ATOM   6414  C CA    . PHE C 1 106 ? 40.960  -24.816 20.440  1.00 33.31  ?  103  PHE C CA    1 
ATOM   6415  C C     . PHE C 1 106 ? 40.706  -23.632 19.516  1.00 38.53  ?  103  PHE C C     1 
ATOM   6416  O O     . PHE C 1 106 ? 40.498  -23.809 18.311  1.00 41.12  ?  103  PHE C O     1 
ATOM   6417  C CB    . PHE C 1 106 ? 42.391  -25.324 20.261  1.00 37.93  ?  103  PHE C CB    1 
ATOM   6418  C CG    . PHE C 1 106 ? 43.430  -24.244 20.363  1.00 32.70  ?  103  PHE C CG    1 
ATOM   6419  C CD1   . PHE C 1 106 ? 43.838  -23.771 21.600  1.00 34.55  ?  103  PHE C CD1   1 
ATOM   6420  C CD2   . PHE C 1 106 ? 43.996  -23.697 19.224  1.00 35.11  ?  103  PHE C CD2   1 
ATOM   6421  C CE1   . PHE C 1 106 ? 44.790  -22.773 21.698  1.00 33.76  ?  103  PHE C CE1   1 
ATOM   6422  C CE2   . PHE C 1 106 ? 44.948  -22.699 19.315  1.00 39.79  ?  103  PHE C CE2   1 
ATOM   6423  C CZ    . PHE C 1 106 ? 45.345  -22.236 20.553  1.00 32.42  ?  103  PHE C CZ    1 
ATOM   6424  N N     . LYS C 1 107 ? 40.713  -22.431 20.089  1.00 40.15  ?  104  LYS C N     1 
ATOM   6425  C CA    . LYS C 1 107 ? 40.582  -21.191 19.338  1.00 36.18  ?  104  LYS C CA    1 
ATOM   6426  C C     . LYS C 1 107 ? 41.668  -20.236 19.804  1.00 38.12  ?  104  LYS C C     1 
ATOM   6427  O O     . LYS C 1 107 ? 41.962  -20.162 21.001  1.00 38.82  ?  104  LYS C O     1 
ATOM   6428  C CB    . LYS C 1 107 ? 39.187  -20.568 19.522  1.00 35.51  ?  104  LYS C CB    1 
ATOM   6429  C CG    . LYS C 1 107 ? 38.948  -19.284 18.732  1.00 39.63  ?  104  LYS C CG    1 
ATOM   6430  C CD    . LYS C 1 107 ? 37.485  -19.160 18.320  1.00 35.58  ?  104  LYS C CD    1 
ATOM   6431  C CE    . LYS C 1 107 ? 37.171  -17.800 17.709  1.00 45.75  ?  104  LYS C CE    1 
ATOM   6432  N NZ    . LYS C 1 107 ? 36.818  -16.786 18.747  1.00 47.67  1  104  LYS C NZ    1 
ATOM   6433  N N     . LYS C 1 108 ? 42.263  -19.517 18.849  1.00 43.12  ?  105  LYS C N     1 
ATOM   6434  C CA    . LYS C 1 108 ? 43.411  -18.659 19.124  1.00 46.93  ?  105  LYS C CA    1 
ATOM   6435  C C     . LYS C 1 108 ? 43.137  -17.743 20.311  1.00 42.37  ?  105  LYS C C     1 
ATOM   6436  O O     . LYS C 1 108 ? 42.035  -17.209 20.467  1.00 45.31  ?  105  LYS C O     1 
ATOM   6437  C CB    . LYS C 1 108 ? 43.751  -17.828 17.884  1.00 52.13  ?  105  LYS C CB    1 
ATOM   6438  C CG    . LYS C 1 108 ? 45.234  -17.533 17.710  1.00 51.14  ?  105  LYS C CG    1 
ATOM   6439  C CD    . LYS C 1 108 ? 45.432  -16.327 16.811  1.00 54.35  ?  105  LYS C CD    1 
ATOM   6440  C CE    . LYS C 1 108 ? 46.831  -16.283 16.223  1.00 54.27  ?  105  LYS C CE    1 
ATOM   6441  N NZ    . LYS C 1 108 ? 47.010  -15.095 15.342  1.00 54.44  1  105  LYS C NZ    1 
ATOM   6442  N N     . GLY C 1 109 ? 44.149  -17.571 21.151  1.00 39.39  ?  106  GLY C N     1 
ATOM   6443  C CA    . GLY C 1 109 ? 43.982  -16.919 22.428  1.00 44.05  ?  106  GLY C CA    1 
ATOM   6444  C C     . GLY C 1 109 ? 43.703  -17.852 23.586  1.00 40.11  ?  106  GLY C C     1 
ATOM   6445  O O     . GLY C 1 109 ? 43.199  -17.390 24.617  1.00 44.23  ?  106  GLY C O     1 
ATOM   6446  N N     . ASN C 1 110 ? 44.006  -19.145 23.444  1.00 36.68  ?  107  ASN C N     1 
ATOM   6447  C CA    . ASN C 1 110 ? 43.761  -20.154 24.475  1.00 39.85  ?  107  ASN C CA    1 
ATOM   6448  C C     . ASN C 1 110 ? 42.295  -20.199 24.892  1.00 38.79  ?  107  ASN C C     1 
ATOM   6449  O O     . ASN C 1 110 ? 41.974  -20.467 26.053  1.00 40.26  ?  107  ASN C O     1 
ATOM   6450  C CB    . ASN C 1 110 ? 44.662  -19.940 25.693  1.00 36.73  ?  107  ASN C CB    1 
ATOM   6451  C CG    . ASN C 1 110 ? 46.076  -20.438 25.460  1.00 45.68  ?  107  ASN C CG    1 
ATOM   6452  O OD1   . ASN C 1 110 ? 46.279  -21.526 24.920  1.00 40.68  ?  107  ASN C OD1   1 
ATOM   6453  N ND2   . ASN C 1 110 ? 47.062  -19.638 25.853  1.00 42.68  ?  107  ASN C ND2   1 
ATOM   6454  N N     . ASN C 1 111 ? 41.396  -19.933 23.948  1.00 29.01  ?  108  ASN C N     1 
ATOM   6455  C CA    . ASN C 1 111 ? 39.974  -20.156 24.163  1.00 29.02  ?  108  ASN C CA    1 
ATOM   6456  C C     . ASN C 1 111 ? 39.648  -21.605 23.844  1.00 33.21  ?  108  ASN C C     1 
ATOM   6457  O O     . ASN C 1 111 ? 40.018  -22.114 22.782  1.00 36.72  ?  108  ASN C O     1 
ATOM   6458  C CB    . ASN C 1 111 ? 39.138  -19.222 23.289  1.00 38.89  ?  108  ASN C CB    1 
ATOM   6459  C CG    . ASN C 1 111 ? 39.429  -17.763 23.552  1.00 35.03  ?  108  ASN C CG    1 
ATOM   6460  O OD1   . ASN C 1 111 ? 38.977  -17.201 24.549  1.00 42.76  ?  108  ASN C OD1   1 
ATOM   6461  N ND2   . ASN C 1 111 ? 40.182  -17.137 22.655  1.00 37.46  ?  108  ASN C ND2   1 
ATOM   6462  N N     . PHE C 1 112 ? 38.966  -22.273 24.769  1.00 29.01  ?  109  PHE C N     1 
ATOM   6463  C CA    . PHE C 1 112 ? 38.607  -23.674 24.606  1.00 32.57  ?  109  PHE C CA    1 
ATOM   6464  C C     . PHE C 1 112 ? 37.094  -23.794 24.546  1.00 30.69  ?  109  PHE C C     1 
ATOM   6465  O O     . PHE C 1 112 ? 36.395  -23.474 25.512  1.00 32.04  ?  109  PHE C O     1 
ATOM   6466  C CB    . PHE C 1 112 ? 39.206  -24.522 25.723  1.00 34.78  ?  109  PHE C CB    1 
ATOM   6467  C CG    . PHE C 1 112 ? 40.705  -24.550 25.699  1.00 32.24  ?  109  PHE C CG    1 
ATOM   6468  C CD1   . PHE C 1 112 ? 41.376  -25.350 24.789  1.00 28.96  ?  109  PHE C CD1   1 
ATOM   6469  C CD2   . PHE C 1 112 ? 41.444  -23.749 26.553  1.00 34.50  ?  109  PHE C CD2   1 
ATOM   6470  C CE1   . PHE C 1 112 ? 42.756  -25.373 24.751  1.00 30.63  ?  109  PHE C CE1   1 
ATOM   6471  C CE2   . PHE C 1 112 ? 42.826  -23.765 26.519  1.00 33.65  ?  109  PHE C CE2   1 
ATOM   6472  C CZ    . PHE C 1 112 ? 43.482  -24.578 25.617  1.00 35.31  ?  109  PHE C CZ    1 
ATOM   6473  N N     . ILE C 1 113 ? 36.606  -24.254 23.405  1.00 32.19  ?  110  ILE C N     1 
ATOM   6474  C CA    . ILE C 1 113 ? 35.192  -24.249 23.064  1.00 33.33  ?  110  ILE C CA    1 
ATOM   6475  C C     . ILE C 1 113 ? 34.642  -25.630 23.389  1.00 31.81  ?  110  ILE C C     1 
ATOM   6476  O O     . ILE C 1 113 ? 34.974  -26.611 22.715  1.00 36.55  ?  110  ILE C O     1 
ATOM   6477  C CB    . ILE C 1 113 ? 34.992  -23.892 21.585  1.00 35.36  ?  110  ILE C CB    1 
ATOM   6478  C CG1   . ILE C 1 113 ? 35.619  -22.530 21.279  1.00 29.07  ?  110  ILE C CG1   1 
ATOM   6479  C CG2   . ILE C 1 113 ? 33.534  -23.909 21.209  1.00 29.08  ?  110  ILE C CG2   1 
ATOM   6480  C CD1   . ILE C 1 113 ? 35.856  -22.298 19.803  1.00 29.08  ?  110  ILE C CD1   1 
ATOM   6481  N N     . SER C 1 114 ? 33.811  -25.715 24.423  1.00 40.84  ?  111  SER C N     1 
ATOM   6482  C CA    . SER C 1 114 ? 33.218  -26.991 24.798  1.00 40.89  ?  111  SER C CA    1 
ATOM   6483  C C     . SER C 1 114 ? 32.271  -27.484 23.713  1.00 41.22  ?  111  SER C C     1 
ATOM   6484  O O     . SER C 1 114 ? 31.565  -26.699 23.073  1.00 41.55  ?  111  SER C O     1 
ATOM   6485  C CB    . SER C 1 114 ? 32.470  -26.865 26.124  1.00 41.00  ?  111  SER C CB    1 
ATOM   6486  O OG    . SER C 1 114 ? 31.645  -27.994 26.356  1.00 41.14  ?  111  SER C OG    1 
ATOM   6487  N N     . ASN C 1 115 ? 32.265  -28.799 23.503  1.00 41.14  ?  112  ASN C N     1 
ATOM   6488  C CA    . ASN C 1 115 ? 31.342  -29.436 22.577  1.00 41.44  ?  112  ASN C CA    1 
ATOM   6489  C C     . ASN C 1 115 ? 30.309  -30.303 23.281  1.00 41.62  ?  112  ASN C C     1 
ATOM   6490  O O     . ASN C 1 115 ? 29.461  -30.901 22.614  1.00 41.88  ?  112  ASN C O     1 
ATOM   6491  C CB    . ASN C 1 115 ? 32.112  -30.260 21.538  1.00 41.23  ?  112  ASN C CB    1 
ATOM   6492  C CG    . ASN C 1 115 ? 32.717  -29.396 20.447  1.00 41.22  ?  112  ASN C CG    1 
ATOM   6493  O OD1   . ASN C 1 115 ? 32.012  -28.922 19.555  1.00 41.54  ?  112  ASN C OD1   1 
ATOM   6494  N ND2   . ASN C 1 115 ? 34.027  -29.184 20.513  1.00 40.84  ?  112  ASN C ND2   1 
ATOM   6495  N N     . SER C 1 116 ? 30.361  -30.390 24.609  1.00 44.79  ?  113  SER C N     1 
ATOM   6496  C CA    . SER C 1 116 ? 29.288  -30.974 25.406  1.00 44.66  ?  113  SER C CA    1 
ATOM   6497  C C     . SER C 1 116 ? 28.349  -29.926 25.977  1.00 45.91  ?  113  SER C C     1 
ATOM   6498  O O     . SER C 1 116 ? 27.143  -30.163 26.061  1.00 42.33  ?  113  SER C O     1 
ATOM   6499  C CB    . SER C 1 116 ? 29.868  -31.803 26.558  1.00 48.92  ?  113  SER C CB    1 
ATOM   6500  O OG    . SER C 1 116 ? 30.401  -30.955 27.560  1.00 65.15  ?  113  SER C OG    1 
ATOM   6501  N N     . GLU C 1 117 ? 28.877  -28.768 26.353  1.00 46.97  ?  114  GLU C N     1 
ATOM   6502  C CA    . GLU C 1 117 ? 28.078  -27.685 26.932  1.00 42.17  ?  114  GLU C CA    1 
ATOM   6503  C C     . GLU C 1 117 ? 27.670  -26.713 25.828  1.00 47.85  ?  114  GLU C C     1 
ATOM   6504  O O     . GLU C 1 117 ? 28.157  -25.587 25.724  1.00 42.42  ?  114  GLU C O     1 
ATOM   6505  C CB    . GLU C 1 117 ? 28.857  -26.988 28.049  1.00 43.85  ?  114  GLU C CB    1 
ATOM   6506  C CG    . GLU C 1 117 ? 29.361  -27.938 29.102  1.00 51.00  ?  114  GLU C CG    1 
ATOM   6507  C CD    . GLU C 1 117 ? 28.228  -28.593 29.862  1.00 61.71  ?  114  GLU C CD    1 
ATOM   6508  O OE1   . GLU C 1 117 ? 27.209  -27.910 30.100  1.00 59.71  ?  114  GLU C OE1   1 
ATOM   6509  O OE2   . GLU C 1 117 ? 28.353  -29.790 30.212  1.00 67.88  -1 114  GLU C OE2   1 
ATOM   6510  N N     . VAL C 1 118 ? 26.768  -27.196 24.979  1.00 46.92  ?  115  VAL C N     1 
ATOM   6511  C CA    . VAL C 1 118 ? 26.300  -26.463 23.811  1.00 43.06  ?  115  VAL C CA    1 
ATOM   6512  C C     . VAL C 1 118 ? 24.779  -26.518 23.775  1.00 47.57  ?  115  VAL C C     1 
ATOM   6513  O O     . VAL C 1 118 ? 24.174  -27.532 24.139  1.00 43.58  ?  115  VAL C O     1 
ATOM   6514  C CB    . VAL C 1 118 ? 26.888  -27.042 22.505  1.00 42.95  ?  115  VAL C CB    1 
ATOM   6515  C CG1   . VAL C 1 118 ? 26.732  -26.057 21.354  1.00 43.18  ?  115  VAL C CG1   1 
ATOM   6516  C CG2   . VAL C 1 118 ? 28.349  -27.436 22.693  1.00 45.21  ?  115  VAL C CG2   1 
ATOM   6517  N N     . PHE C 1 119 ? 24.160  -25.428 23.329  1.00 51.90  ?  116  PHE C N     1 
ATOM   6518  C CA    . PHE C 1 119 ? 22.723  -25.424 23.103  1.00 54.36  ?  116  PHE C CA    1 
ATOM   6519  C C     . PHE C 1 119 ? 22.404  -24.528 21.917  1.00 48.02  ?  116  PHE C C     1 
ATOM   6520  O O     . PHE C 1 119 ? 23.004  -23.462 21.752  1.00 44.45  ?  116  PHE C O     1 
ATOM   6521  C CB    . PHE C 1 119 ? 21.950  -24.968 24.350  1.00 54.31  ?  116  PHE C CB    1 
ATOM   6522  C CG    . PHE C 1 119 ? 22.311  -23.587 24.830  1.00 51.33  ?  116  PHE C CG    1 
ATOM   6523  C CD1   . PHE C 1 119 ? 21.631  -22.472 24.363  1.00 48.82  ?  116  PHE C CD1   1 
ATOM   6524  C CD2   . PHE C 1 119 ? 23.316  -23.407 25.765  1.00 44.02  ?  116  PHE C CD2   1 
ATOM   6525  C CE1   . PHE C 1 119 ? 21.959  -21.203 24.808  1.00 44.68  ?  116  PHE C CE1   1 
ATOM   6526  C CE2   . PHE C 1 119 ? 23.647  -22.142 26.214  1.00 47.34  ?  116  PHE C CE2   1 
ATOM   6527  C CZ    . PHE C 1 119 ? 22.968  -21.040 25.736  1.00 44.32  ?  116  PHE C CZ    1 
ATOM   6528  N N     . SER C 1 120 ? 21.467  -24.977 21.087  1.00 51.26  ?  117  SER C N     1 
ATOM   6529  C CA    . SER C 1 120 ? 20.993  -24.155 19.985  1.00 55.86  ?  117  SER C CA    1 
ATOM   6530  C C     . SER C 1 120 ? 20.167  -22.997 20.529  1.00 50.50  ?  117  SER C C     1 
ATOM   6531  O O     . SER C 1 120 ? 19.392  -23.160 21.475  1.00 53.23  ?  117  SER C O     1 
ATOM   6532  C CB    . SER C 1 120 ? 20.159  -24.992 19.014  1.00 59.81  ?  117  SER C CB    1 
ATOM   6533  O OG    . SER C 1 120 ? 19.814  -24.248 17.858  1.00 65.52  ?  117  SER C OG    1 
ATOM   6534  N N     . LEU C 1 121 ? 20.347  -21.820 19.936  1.00 48.88  ?  118  LEU C N     1 
ATOM   6535  C CA    . LEU C 1 121 ? 19.598  -20.649 20.366  1.00 47.49  ?  118  LEU C CA    1 
ATOM   6536  C C     . LEU C 1 121 ? 18.116  -20.824 20.056  1.00 46.26  ?  118  LEU C C     1 
ATOM   6537  O O     . LEU C 1 121 ? 17.743  -21.279 18.971  1.00 52.92  ?  118  LEU C O     1 
ATOM   6538  C CB    . LEU C 1 121 ? 20.125  -19.391 19.674  1.00 45.81  ?  118  LEU C CB    1 
ATOM   6539  C CG    . LEU C 1 121 ? 21.581  -18.981 19.907  1.00 47.66  ?  118  LEU C CG    1 
ATOM   6540  C CD1   . LEU C 1 121 ? 21.942  -17.806 19.017  1.00 52.48  ?  118  LEU C CD1   1 
ATOM   6541  C CD2   . LEU C 1 121 ? 21.823  -18.634 21.364  1.00 45.22  ?  118  LEU C CD2   1 
ATOM   6542  N N     . ASP C 1 122 ? 17.267  -20.468 21.024  1.00 46.45  ?  119  ASP C N     1 
ATOM   6543  C CA    . ASP C 1 122 ? 15.832  -20.432 20.761  1.00 52.45  ?  119  ASP C CA    1 
ATOM   6544  C C     . ASP C 1 122 ? 15.498  -19.419 19.676  1.00 54.21  ?  119  ASP C C     1 
ATOM   6545  O O     . ASP C 1 122 ? 14.567  -19.631 18.890  1.00 54.71  ?  119  ASP C O     1 
ATOM   6546  C CB    . ASP C 1 122 ? 15.067  -20.100 22.044  1.00 58.07  ?  119  ASP C CB    1 
ATOM   6547  C CG    . ASP C 1 122 ? 15.349  -21.081 23.165  1.00 70.27  ?  119  ASP C CG    1 
ATOM   6548  O OD1   . ASP C 1 122 ? 15.248  -22.304 22.930  1.00 75.97  ?  119  ASP C OD1   1 
ATOM   6549  O OD2   . ASP C 1 122 ? 15.676  -20.626 24.282  1.00 76.23  -1 119  ASP C OD2   1 
ATOM   6550  N N     . SER C 1 123 ? 16.253  -18.321 19.612  1.00 55.25  ?  120  SER C N     1 
ATOM   6551  C CA    . SER C 1 123 ? 15.992  -17.253 18.656  1.00 51.31  ?  120  SER C CA    1 
ATOM   6552  C C     . SER C 1 123 ? 16.438  -17.597 17.241  1.00 56.08  ?  120  SER C C     1 
ATOM   6553  O O     . SER C 1 123 ? 15.916  -17.015 16.284  1.00 62.63  ?  120  SER C O     1 
ATOM   6554  C CB    . SER C 1 123 ? 16.686  -15.968 19.116  1.00 47.15  ?  120  SER C CB    1 
ATOM   6555  O OG    . SER C 1 123 ? 16.757  -15.019 18.068  1.00 55.70  ?  120  SER C OG    1 
ATOM   6556  N N     . ASN C 1 124 ? 17.389  -18.517 17.084  1.00 55.66  ?  121  ASN C N     1 
ATOM   6557  C CA    . ASN C 1 124 ? 17.875  -18.897 15.758  1.00 49.75  ?  121  ASN C CA    1 
ATOM   6558  C C     . ASN C 1 124 ? 18.426  -20.315 15.874  1.00 56.16  ?  121  ASN C C     1 
ATOM   6559  O O     . ASN C 1 124 ? 19.523  -20.517 16.403  1.00 54.93  ?  121  ASN C O     1 
ATOM   6560  C CB    . ASN C 1 124 ? 18.930  -17.919 15.257  1.00 46.66  ?  121  ASN C CB    1 
ATOM   6561  C CG    . ASN C 1 124 ? 19.162  -18.024 13.761  1.00 46.90  ?  121  ASN C CG    1 
ATOM   6562  O OD1   . ASN C 1 124 ? 19.127  -19.112 13.187  1.00 54.05  ?  121  ASN C OD1   1 
ATOM   6563  N ND2   . ASN C 1 124 ? 19.397  -16.885 13.121  1.00 47.87  ?  121  ASN C ND2   1 
ATOM   6564  N N     . GLU C 1 125 ? 17.659  -21.287 15.375  1.00 58.85  ?  122  GLU C N     1 
ATOM   6565  C CA    . GLU C 1 125 ? 18.032  -22.688 15.527  1.00 61.23  ?  122  GLU C CA    1 
ATOM   6566  C C     . GLU C 1 125 ? 19.314  -23.033 14.780  1.00 58.00  ?  122  GLU C C     1 
ATOM   6567  O O     . GLU C 1 125 ? 19.934  -24.060 15.078  1.00 58.21  ?  122  GLU C O     1 
ATOM   6568  C CB    . GLU C 1 125 ? 16.880  -23.583 15.055  1.00 61.82  ?  122  GLU C CB    1 
ATOM   6569  C CG    . GLU C 1 125 ? 16.988  -25.047 15.473  1.00 70.42  ?  122  GLU C CG    1 
ATOM   6570  C CD    . GLU C 1 125 ? 16.798  -25.263 16.968  1.00 76.67  ?  122  GLU C CD    1 
ATOM   6571  O OE1   . GLU C 1 125 ? 16.454  -24.295 17.681  1.00 77.97  ?  122  GLU C OE1   1 
ATOM   6572  O OE2   . GLU C 1 125 ? 16.990  -26.408 17.431  1.00 73.91  -1 122  GLU C OE2   1 
ATOM   6573  N N     . ASN C 1 126 ? 19.736  -22.197 13.834  1.00 53.25  ?  123  ASN C N     1 
ATOM   6574  C CA    . ASN C 1 126 ? 20.942  -22.455 13.057  1.00 56.35  ?  123  ASN C CA    1 
ATOM   6575  C C     . ASN C 1 126 ? 22.223  -22.044 13.774  1.00 61.31  ?  123  ASN C C     1 
ATOM   6576  O O     . ASN C 1 126 ? 23.313  -22.274 13.237  1.00 45.19  ?  123  ASN C O     1 
ATOM   6577  C CB    . ASN C 1 126 ? 20.857  -21.732 11.711  1.00 55.64  ?  123  ASN C CB    1 
ATOM   6578  C CG    . ASN C 1 126 ? 19.739  -22.259 10.837  1.00 54.63  ?  123  ASN C CG    1 
ATOM   6579  O OD1   . ASN C 1 126 ? 19.528  -23.468 10.739  1.00 46.43  ?  123  ASN C OD1   1 
ATOM   6580  N ND2   . ASN C 1 126 ? 19.014  -21.351 10.195  1.00 58.44  ?  123  ASN C ND2   1 
ATOM   6581  N N     . VAL C 1 127 ? 22.132  -21.450 14.961  1.00 49.32  ?  124  VAL C N     1 
ATOM   6582  C CA    . VAL C 1 127 ? 23.297  -20.959 15.687  1.00 48.93  ?  124  VAL C CA    1 
ATOM   6583  C C     . VAL C 1 127 ? 23.429  -21.739 16.987  1.00 45.68  ?  124  VAL C C     1 
ATOM   6584  O O     . VAL C 1 127 ? 22.459  -21.866 17.743  1.00 41.74  ?  124  VAL C O     1 
ATOM   6585  C CB    . VAL C 1 127 ? 23.199  -19.447 15.964  1.00 47.03  ?  124  VAL C CB    1 
ATOM   6586  C CG1   . VAL C 1 127 ? 24.484  -18.940 16.609  1.00 48.47  ?  124  VAL C CG1   1 
ATOM   6587  C CG2   . VAL C 1 127 ? 22.904  -18.690 14.680  1.00 37.75  ?  124  VAL C CG2   1 
ATOM   6588  N N     . ASN C 1 128 ? 24.622  -22.233 17.253  1.00 42.52  ?  125  ASN C N     1 
ATOM   6589  C CA    . ASN C 1 128 ? 24.908  -22.930 18.484  1.00 46.27  ?  125  ASN C CA    1 
ATOM   6590  C C     . ASN C 1 128 ? 25.662  -22.022 19.458  1.00 39.40  ?  125  ASN C C     1 
ATOM   6591  O O     . ASN C 1 128 ? 26.507  -21.255 19.066  1.00 39.10  ?  125  ASN C O     1 
ATOM   6592  C CB    . ASN C 1 128 ? 25.777  -24.177 18.204  1.00 49.81  ?  125  ASN C CB    1 
ATOM   6593  C CG    . ASN C 1 128 ? 24.971  -25.389 17.800  1.00 51.72  ?  125  ASN C CG    1 
ATOM   6594  O OD1   . ASN C 1 128 ? 25.452  -26.262 17.113  1.00 57.21  ?  125  ASN C OD1   1 
ATOM   6595  N ND2   . ASN C 1 128 ? 23.761  -25.449 18.254  1.00 43.41  ?  125  ASN C ND2   1 
ATOM   6596  N N     . ALA C 1 129 ? 25.347  -22.146 20.728  1.00 44.83  ?  126  ALA C N     1 
ATOM   6597  C CA    . ALA C 1 129 ? 26.019  -21.411 21.793  1.00 41.46  ?  126  ALA C CA    1 
ATOM   6598  C C     . ALA C 1 129 ? 26.889  -22.397 22.561  1.00 43.52  ?  126  ALA C C     1 
ATOM   6599  O O     . ALA C 1 129 ? 26.371  -23.278 23.256  1.00 49.85  ?  126  ALA C O     1 
ATOM   6600  C CB    . ALA C 1 129 ? 25.012  -20.729 22.714  1.00 43.87  ?  126  ALA C CB    1 
ATOM   6601  N N     . HIS C 1 130 ? 28.204  -22.253 22.431  1.00 40.06  ?  127  HIS C N     1 
ATOM   6602  C CA    . HIS C 1 130 ? 29.160  -23.135 23.085  1.00 35.80  ?  127  HIS C CA    1 
ATOM   6603  C C     . HIS C 1 130 ? 29.714  -22.452 24.328  1.00 35.81  ?  127  HIS C C     1 
ATOM   6604  O O     . HIS C 1 130 ? 30.274  -21.354 24.237  1.00 30.22  ?  127  HIS C O     1 
ATOM   6605  C CB    . HIS C 1 130 ? 30.313  -23.491 22.150  1.00 39.87  ?  127  HIS C CB    1 
ATOM   6606  C CG    . HIS C 1 130 ? 29.900  -24.192 20.894  1.00 31.31  ?  127  HIS C CG    1 
ATOM   6607  N ND1   . HIS C 1 130 ? 30.198  -25.515 20.652  1.00 35.23  ?  127  HIS C ND1   1 
ATOM   6608  C CD2   . HIS C 1 130 ? 29.245  -23.747 19.796  1.00 38.21  ?  127  HIS C CD2   1 
ATOM   6609  C CE1   . HIS C 1 130 ? 29.731  -25.861 19.465  1.00 36.20  ?  127  HIS C CE1   1 
ATOM   6610  N NE2   . HIS C 1 130 ? 29.147  -24.806 18.925  1.00 42.73  ?  127  HIS C NE2   1 
ATOM   6611  N N     . LEU C 1 131 ? 29.570  -23.103 25.479  1.00 37.65  ?  128  LEU C N     1 
ATOM   6612  C CA    . LEU C 1 131 ? 30.308  -22.667 26.654  1.00 39.11  ?  128  LEU C CA    1 
ATOM   6613  C C     . LEU C 1 131 ? 31.799  -22.730 26.357  1.00 33.79  ?  128  LEU C C     1 
ATOM   6614  O O     . LEU C 1 131 ? 32.301  -23.734 25.845  1.00 30.69  ?  128  LEU C O     1 
ATOM   6615  C CB    . LEU C 1 131 ? 29.967  -23.537 27.864  1.00 40.77  ?  128  LEU C CB    1 
ATOM   6616  C CG    . LEU C 1 131 ? 30.750  -23.230 29.143  1.00 33.22  ?  128  LEU C CG    1 
ATOM   6617  C CD1   . LEU C 1 131 ? 30.622  -21.761 29.527  1.00 32.42  ?  128  LEU C CD1   1 
ATOM   6618  C CD2   . LEU C 1 131 ? 30.287  -24.127 30.281  1.00 39.73  ?  128  LEU C CD2   1 
ATOM   6619  N N     . THR C 1 132 ? 32.503  -21.646 26.662  1.00 37.32  ?  129  THR C N     1 
ATOM   6620  C CA    . THR C 1 132 ? 33.910  -21.506 26.327  1.00 38.81  ?  129  THR C CA    1 
ATOM   6621  C C     . THR C 1 132 ? 34.667  -21.019 27.552  1.00 26.59  ?  129  THR C C     1 
ATOM   6622  O O     . THR C 1 132 ? 34.116  -20.309 28.398  1.00 41.98  ?  129  THR C O     1 
ATOM   6623  C CB    . THR C 1 132 ? 34.096  -20.535 25.141  1.00 35.11  ?  129  THR C CB    1 
ATOM   6624  O OG1   . THR C 1 132 ? 33.350  -21.017 24.017  1.00 34.66  ?  129  THR C OG1   1 
ATOM   6625  C CG2   . THR C 1 132 ? 35.559  -20.409 24.737  1.00 31.79  ?  129  THR C CG2   1 
ATOM   6626  N N     . TYR C 1 133 ? 35.930  -21.426 27.652  1.00 26.48  ?  130  TYR C N     1 
ATOM   6627  C CA    . TYR C 1 133 ? 36.816  -20.989 28.724  1.00 36.47  ?  130  TYR C CA    1 
ATOM   6628  C C     . TYR C 1 133 ? 38.131  -20.521 28.122  1.00 30.99  ?  130  TYR C C     1 
ATOM   6629  O O     . TYR C 1 133 ? 38.798  -21.282 27.412  1.00 27.30  ?  130  TYR C O     1 
ATOM   6630  C CB    . TYR C 1 133 ? 37.064  -22.112 29.734  1.00 29.83  ?  130  TYR C CB    1 
ATOM   6631  C CG    . TYR C 1 133 ? 35.864  -22.440 30.589  1.00 30.00  ?  130  TYR C CG    1 
ATOM   6632  C CD1   . TYR C 1 133 ? 35.550  -21.672 31.703  1.00 35.02  ?  130  TYR C CD1   1 
ATOM   6633  C CD2   . TYR C 1 133 ? 35.045  -23.519 30.285  1.00 34.46  ?  130  TYR C CD2   1 
ATOM   6634  C CE1   . TYR C 1 133 ? 34.454  -21.970 32.491  1.00 30.23  ?  130  TYR C CE1   1 
ATOM   6635  C CE2   . TYR C 1 133 ? 33.948  -23.825 31.066  1.00 32.78  ?  130  TYR C CE2   1 
ATOM   6636  C CZ    . TYR C 1 133 ? 33.657  -23.048 32.167  1.00 36.11  ?  130  TYR C CZ    1 
ATOM   6637  O OH    . TYR C 1 133 ? 32.564  -23.350 32.947  1.00 46.51  ?  130  TYR C OH    1 
ATOM   6638  N N     . LYS C 1 134 ? 38.498  -19.276 28.404  1.00 31.24  ?  131  LYS C N     1 
ATOM   6639  C CA    . LYS C 1 134 ? 39.813  -18.760 28.059  1.00 30.47  ?  131  LYS C CA    1 
ATOM   6640  C C     . LYS C 1 134 ? 40.750  -18.985 29.238  1.00 31.30  ?  131  LYS C C     1 
ATOM   6641  O O     . LYS C 1 134 ? 40.408  -18.665 30.381  1.00 35.06  ?  131  LYS C O     1 
ATOM   6642  C CB    . LYS C 1 134 ? 39.741  -17.275 27.704  1.00 28.09  ?  131  LYS C CB    1 
ATOM   6643  C CG    . LYS C 1 134 ? 41.068  -16.690 27.261  1.00 29.81  ?  131  LYS C CG    1 
ATOM   6644  C CD    . LYS C 1 134 ? 40.911  -15.275 26.722  1.00 29.22  ?  131  LYS C CD    1 
ATOM   6645  C CE    . LYS C 1 134 ? 42.272  -14.653 26.475  1.00 32.04  ?  131  LYS C CE    1 
ATOM   6646  N NZ    . LYS C 1 134 ? 42.396  -14.103 25.103  1.00 45.52  1  131  LYS C NZ    1 
ATOM   6647  N N     . ILE C 1 135 ? 41.926  -19.538 28.957  1.00 28.94  ?  132  ILE C N     1 
ATOM   6648  C CA    . ILE C 1 135 ? 42.861  -19.987 29.981  1.00 37.37  ?  132  ILE C CA    1 
ATOM   6649  C C     . ILE C 1 135 ? 44.171  -19.233 29.805  1.00 36.45  ?  132  ILE C C     1 
ATOM   6650  O O     . ILE C 1 135 ? 44.687  -19.130 28.688  1.00 32.92  ?  132  ILE C O     1 
ATOM   6651  C CB    . ILE C 1 135 ? 43.097  -21.506 29.897  1.00 35.22  ?  132  ILE C CB    1 
ATOM   6652  C CG1   . ILE C 1 135 ? 41.767  -22.261 29.862  1.00 39.74  ?  132  ILE C CG1   1 
ATOM   6653  C CG2   . ILE C 1 135 ? 43.943  -21.972 31.059  1.00 34.73  ?  132  ILE C CG2   1 
ATOM   6654  C CD1   . ILE C 1 135 ? 40.995  -22.181 31.139  1.00 39.47  ?  132  ILE C CD1   1 
ATOM   6655  N N     . LYS C 1 136 ? 44.709  -18.711 30.905  1.00 32.49  ?  133  LYS C N     1 
ATOM   6656  C CA    . LYS C 1 136 ? 45.992  -18.022 30.881  1.00 33.69  ?  133  LYS C CA    1 
ATOM   6657  C C     . LYS C 1 136 ? 46.790  -18.394 32.123  1.00 31.30  ?  133  LYS C C     1 
ATOM   6658  O O     . LYS C 1 136 ? 46.229  -18.792 33.147  1.00 25.08  ?  133  LYS C O     1 
ATOM   6659  C CB    . LYS C 1 136 ? 45.822  -16.497 30.790  1.00 27.88  ?  133  LYS C CB    1 
ATOM   6660  C CG    . LYS C 1 136 ? 45.251  -16.025 29.466  1.00 43.10  ?  133  LYS C CG    1 
ATOM   6661  C CD    . LYS C 1 136 ? 46.233  -16.294 28.351  1.00 50.57  ?  133  LYS C CD    1 
ATOM   6662  C CE    . LYS C 1 136 ? 45.593  -16.046 27.002  1.00 56.91  ?  133  LYS C CE    1 
ATOM   6663  N NZ    . LYS C 1 136 ? 46.627  -15.771 25.974  1.00 60.84  1  133  LYS C NZ    1 
ATOM   6664  N N     . ILE C 1 137 ? 48.110  -18.265 32.015  1.00 30.28  ?  134  ILE C N     1 
ATOM   6665  C CA    . ILE C 1 137 ? 49.045  -18.650 33.065  1.00 29.94  ?  134  ILE C CA    1 
ATOM   6666  C C     . ILE C 1 137 ? 49.676  -17.386 33.628  1.00 34.70  ?  134  ILE C C     1 
ATOM   6667  O O     . ILE C 1 137 ? 50.100  -16.505 32.868  1.00 35.17  ?  134  ILE C O     1 
ATOM   6668  C CB    . ILE C 1 137 ? 50.116  -19.617 32.532  1.00 35.01  ?  134  ILE C CB    1 
ATOM   6669  C CG1   . ILE C 1 137 ? 49.471  -20.927 32.073  1.00 32.82  ?  134  ILE C CG1   1 
ATOM   6670  C CG2   . ILE C 1 137 ? 51.181  -19.877 33.588  1.00 38.08  ?  134  ILE C CG2   1 
ATOM   6671  C CD1   . ILE C 1 137 ? 50.446  -21.911 31.471  1.00 29.85  ?  134  ILE C CD1   1 
ATOM   6672  N N     . HIS C 1 138 ? 49.732  -17.292 34.955  1.00 30.78  ?  135  HIS C N     1 
ATOM   6673  C CA    . HIS C 1 138 ? 50.254  -16.116 35.636  1.00 32.75  ?  135  HIS C CA    1 
ATOM   6674  C C     . HIS C 1 138 ? 51.263  -16.525 36.697  1.00 34.98  ?  135  HIS C C     1 
ATOM   6675  O O     . HIS C 1 138 ? 51.066  -17.514 37.409  1.00 33.05  ?  135  HIS C O     1 
ATOM   6676  C CB    . HIS C 1 138 ? 49.123  -15.307 36.277  1.00 34.67  ?  135  HIS C CB    1 
ATOM   6677  C CG    . HIS C 1 138 ? 47.965  -15.073 35.360  1.00 30.37  ?  135  HIS C CG    1 
ATOM   6678  N ND1   . HIS C 1 138 ? 47.886  -13.981 34.523  1.00 33.07  ?  135  HIS C ND1   1 
ATOM   6679  C CD2   . HIS C 1 138 ? 46.847  -15.802 35.133  1.00 32.25  ?  135  HIS C CD2   1 
ATOM   6680  C CE1   . HIS C 1 138 ? 46.765  -14.042 33.827  1.00 31.78  ?  135  HIS C CE1   1 
ATOM   6681  N NE2   . HIS C 1 138 ? 46.118  -15.139 34.177  1.00 32.71  ?  135  HIS C NE2   1 
ATOM   6682  N N     . ASN C 1 139 ? 52.339  -15.751 36.802  1.00 41.85  ?  136  ASN C N     1 
ATOM   6683  C CA    . ASN C 1 139 ? 53.378  -15.950 37.809  1.00 38.48  ?  136  ASN C CA    1 
ATOM   6684  C C     . ASN C 1 139 ? 53.214  -14.843 38.848  1.00 43.99  ?  136  ASN C C     1 
ATOM   6685  O O     . ASN C 1 139 ? 53.668  -13.713 38.643  1.00 37.99  ?  136  ASN C O     1 
ATOM   6686  C CB    . ASN C 1 139 ? 54.762  -15.938 37.165  1.00 37.59  ?  136  ASN C CB    1 
ATOM   6687  C CG    . ASN C 1 139 ? 55.830  -16.552 38.051  1.00 47.28  ?  136  ASN C CG    1 
ATOM   6688  O OD1   . ASN C 1 139 ? 57.023  -16.327 37.847  1.00 45.98  ?  136  ASN C OD1   1 
ATOM   6689  N ND2   . ASN C 1 139 ? 55.408  -17.337 39.037  1.00 43.09  ?  136  ASN C ND2   1 
ATOM   6690  N N     . ILE C 1 140 ? 52.553  -15.168 39.957  1.00 48.54  ?  137  ILE C N     1 
ATOM   6691  C CA    . ILE C 1 140 ? 52.229  -14.205 41.007  1.00 40.68  ?  137  ILE C CA    1 
ATOM   6692  C C     . ILE C 1 140 ? 52.929  -14.635 42.288  1.00 39.80  ?  137  ILE C C     1 
ATOM   6693  O O     . ILE C 1 140 ? 52.687  -15.741 42.789  1.00 38.09  ?  137  ILE C O     1 
ATOM   6694  C CB    . ILE C 1 140 ? 50.714  -14.099 41.238  1.00 43.48  ?  137  ILE C CB    1 
ATOM   6695  C CG1   . ILE C 1 140 ? 49.987  -13.727 39.946  1.00 43.99  ?  137  ILE C CG1   1 
ATOM   6696  C CG2   . ILE C 1 140 ? 50.416  -13.092 42.341  1.00 49.81  ?  137  ILE C CG2   1 
ATOM   6697  C CD1   . ILE C 1 140 ? 48.478  -13.833 40.055  1.00 44.31  ?  137  ILE C CD1   1 
ATOM   6698  N N     . SER C 1 141 ? 53.775  -13.756 42.825  1.00 36.73  ?  138  SER C N     1 
ATOM   6699  C CA    . SER C 1 141 ? 54.451  -13.980 44.104  1.00 44.31  ?  138  SER C CA    1 
ATOM   6700  C C     . SER C 1 141 ? 55.156  -15.335 44.135  1.00 49.39  ?  138  SER C C     1 
ATOM   6701  O O     . SER C 1 141 ? 54.947  -16.152 45.034  1.00 45.37  ?  138  SER C O     1 
ATOM   6702  C CB    . SER C 1 141 ? 53.471  -13.851 45.272  1.00 41.27  ?  138  SER C CB    1 
ATOM   6703  O OG    . SER C 1 141 ? 53.219  -12.496 45.588  1.00 50.83  ?  138  SER C OG    1 
ATOM   6704  N N     . ASN C 1 142 ? 55.985  -15.575 43.121  1.00 49.65  ?  139  ASN C N     1 
ATOM   6705  C CA    . ASN C 1 142 ? 56.826  -16.764 43.003  1.00 48.75  ?  139  ASN C CA    1 
ATOM   6706  C C     . ASN C 1 142 ? 56.023  -18.052 42.854  1.00 43.92  ?  139  ASN C C     1 
ATOM   6707  O O     . ASN C 1 142 ? 56.599  -19.145 42.906  1.00 42.26  ?  139  ASN C O     1 
ATOM   6708  C CB    . ASN C 1 142 ? 57.790  -16.883 44.192  1.00 55.40  ?  139  ASN C CB    1 
ATOM   6709  C CG    . ASN C 1 142 ? 59.200  -17.242 43.768  1.00 64.47  ?  139  ASN C CG    1 
ATOM   6710  O OD1   . ASN C 1 142 ? 59.516  -17.270 42.577  1.00 65.06  ?  139  ASN C OD1   1 
ATOM   6711  N ND2   . ASN C 1 142 ? 60.060  -17.509 44.744  1.00 60.93  ?  139  ASN C ND2   1 
ATOM   6712  N N     . GLU C 1 143 ? 54.710  -17.959 42.671  1.00 43.40  ?  140  GLU C N     1 
ATOM   6713  C CA    . GLU C 1 143 ? 53.868  -19.109 42.380  1.00 42.33  ?  140  GLU C CA    1 
ATOM   6714  C C     . GLU C 1 143 ? 53.301  -18.987 40.973  1.00 37.93  ?  140  GLU C C     1 
ATOM   6715  O O     . GLU C 1 143 ? 53.440  -17.959 40.305  1.00 37.65  ?  140  GLU C O     1 
ATOM   6716  C CB    . GLU C 1 143 ? 52.736  -19.240 43.405  1.00 46.34  ?  140  GLU C CB    1 
ATOM   6717  C CG    . GLU C 1 143 ? 53.192  -19.774 44.750  1.00 64.04  ?  140  GLU C CG    1 
ATOM   6718  C CD    . GLU C 1 143 ? 53.949  -21.082 44.626  1.00 80.80  ?  140  GLU C CD    1 
ATOM   6719  O OE1   . GLU C 1 143 ? 53.300  -22.138 44.476  1.00 79.37  ?  140  GLU C OE1   1 
ATOM   6720  O OE2   . GLU C 1 143 ? 55.198  -21.053 44.669  1.00 90.99  -1 140  GLU C OE2   1 
ATOM   6721  N N     . TYR C 1 144 ? 52.659  -20.058 40.520  1.00 33.65  ?  141  TYR C N     1 
ATOM   6722  C CA    . TYR C 1 144 ? 52.010  -20.083 39.219  1.00 40.81  ?  141  TYR C CA    1 
ATOM   6723  C C     . TYR C 1 144 ? 50.518  -20.301 39.400  1.00 41.68  ?  141  TYR C C     1 
ATOM   6724  O O     . TYR C 1 144 ? 50.094  -21.146 40.195  1.00 40.41  ?  141  TYR C O     1 
ATOM   6725  C CB    . TYR C 1 144 ? 52.597  -21.168 38.313  1.00 33.93  ?  141  TYR C CB    1 
ATOM   6726  C CG    . TYR C 1 144 ? 53.918  -20.768 37.703  1.00 31.62  ?  141  TYR C CG    1 
ATOM   6727  C CD1   . TYR C 1 144 ? 53.965  -20.050 36.516  1.00 31.60  ?  141  TYR C CD1   1 
ATOM   6728  C CD2   . TYR C 1 144 ? 55.117  -21.094 38.322  1.00 27.42  ?  141  TYR C CD2   1 
ATOM   6729  C CE1   . TYR C 1 144 ? 55.169  -19.675 35.957  1.00 28.82  ?  141  TYR C CE1   1 
ATOM   6730  C CE2   . TYR C 1 144 ? 56.326  -20.724 37.772  1.00 32.03  ?  141  TYR C CE2   1 
ATOM   6731  C CZ    . TYR C 1 144 ? 56.346  -20.015 36.589  1.00 33.70  ?  141  TYR C CZ    1 
ATOM   6732  O OH    . TYR C 1 144 ? 57.549  -19.643 36.036  1.00 34.77  ?  141  TYR C OH    1 
ATOM   6733  N N     . TYR C 1 145 ? 49.731  -19.527 38.660  1.00 31.15  ?  142  TYR C N     1 
ATOM   6734  C CA    . TYR C 1 145 ? 48.283  -19.578 38.741  1.00 35.28  ?  142  TYR C CA    1 
ATOM   6735  C C     . TYR C 1 145 ? 47.694  -19.760 37.352  1.00 39.97  ?  142  TYR C C     1 
ATOM   6736  O O     . TYR C 1 145 ? 48.357  -19.554 36.331  1.00 37.77  ?  142  TYR C O     1 
ATOM   6737  C CB    . TYR C 1 145 ? 47.705  -18.311 39.381  1.00 39.58  ?  142  TYR C CB    1 
ATOM   6738  C CG    . TYR C 1 145 ? 48.024  -18.167 40.849  1.00 36.78  ?  142  TYR C CG    1 
ATOM   6739  C CD1   . TYR C 1 145 ? 49.223  -17.605 41.267  1.00 37.13  ?  142  TYR C CD1   1 
ATOM   6740  C CD2   . TYR C 1 145 ? 47.123  -18.589 41.819  1.00 36.66  ?  142  TYR C CD2   1 
ATOM   6741  C CE1   . TYR C 1 145 ? 49.517  -17.470 42.609  1.00 39.64  ?  142  TYR C CE1   1 
ATOM   6742  C CE2   . TYR C 1 145 ? 47.409  -18.460 43.162  1.00 33.14  ?  142  TYR C CE2   1 
ATOM   6743  C CZ    . TYR C 1 145 ? 48.606  -17.899 43.553  1.00 43.71  ?  142  TYR C CZ    1 
ATOM   6744  O OH    . TYR C 1 145 ? 48.895  -17.766 44.892  1.00 49.14  ?  142  TYR C OH    1 
ATOM   6745  N N     . LEU C 1 146 ? 46.424  -20.145 37.337  1.00 32.43  ?  143  LEU C N     1 
ATOM   6746  C CA    . LEU C 1 146 ? 45.659  -20.335 36.115  1.00 39.21  ?  143  LEU C CA    1 
ATOM   6747  C C     . LEU C 1 146 ? 44.407  -19.478 36.210  1.00 42.69  ?  143  LEU C C     1 
ATOM   6748  O O     . LEU C 1 146 ? 43.606  -19.652 37.134  1.00 44.77  ?  143  LEU C O     1 
ATOM   6749  C CB    . LEU C 1 146 ? 45.291  -21.808 35.935  1.00 48.19  ?  143  LEU C CB    1 
ATOM   6750  C CG    . LEU C 1 146 ? 45.064  -22.321 34.518  1.00 43.38  ?  143  LEU C CG    1 
ATOM   6751  C CD1   . LEU C 1 146 ? 46.339  -22.165 33.719  1.00 47.33  ?  143  LEU C CD1   1 
ATOM   6752  C CD2   . LEU C 1 146 ? 44.610  -23.773 34.541  1.00 33.61  ?  143  LEU C CD2   1 
ATOM   6753  N N     . SER C 1 147 ? 44.247  -18.545 35.275  1.00 30.17  ?  144  SER C N     1 
ATOM   6754  C CA    . SER C 1 147 ? 43.007  -17.791 35.169  1.00 38.66  ?  144  SER C CA    1 
ATOM   6755  C C     . SER C 1 147 ? 42.075  -18.526 34.216  1.00 34.24  ?  144  SER C C     1 
ATOM   6756  O O     . SER C 1 147 ? 42.495  -18.964 33.139  1.00 35.65  ?  144  SER C O     1 
ATOM   6757  C CB    . SER C 1 147 ? 43.253  -16.359 34.692  1.00 35.54  ?  144  SER C CB    1 
ATOM   6758  O OG    . SER C 1 147 ? 44.009  -16.320 33.494  1.00 30.88  ?  144  SER C OG    1 
ATOM   6759  N N     . ILE C 1 148 ? 40.825  -18.689 34.632  1.00 28.65  ?  145  ILE C N     1 
ATOM   6760  C CA    . ILE C 1 148 ? 39.827  -19.446 33.889  1.00 32.17  ?  145  ILE C CA    1 
ATOM   6761  C C     . ILE C 1 148 ? 38.643  -18.510 33.692  1.00 36.47  ?  145  ILE C C     1 
ATOM   6762  O O     . ILE C 1 148 ? 37.890  -18.240 34.636  1.00 37.32  ?  145  ILE C O     1 
ATOM   6763  C CB    . ILE C 1 148 ? 39.411  -20.736 34.613  1.00 32.83  ?  145  ILE C CB    1 
ATOM   6764  C CG1   . ILE C 1 148 ? 40.516  -21.798 34.543  1.00 35.99  ?  145  ILE C CG1   1 
ATOM   6765  C CG2   . ILE C 1 148 ? 38.162  -21.318 33.989  1.00 29.87  ?  145  ILE C CG2   1 
ATOM   6766  C CD1   . ILE C 1 148 ? 41.646  -21.623 35.516  1.00 39.34  ?  145  ILE C CD1   1 
ATOM   6767  N N     . LEU C 1 149 ? 38.476  -17.998 32.475  1.00 43.59  ?  146  LEU C N     1 
ATOM   6768  C CA    . LEU C 1 149 ? 37.423  -17.030 32.212  1.00 33.06  ?  146  LEU C CA    1 
ATOM   6769  C C     . LEU C 1 149 ? 36.287  -17.690 31.451  1.00 37.92  ?  146  LEU C C     1 
ATOM   6770  O O     . LEU C 1 149 ? 36.460  -18.027 30.268  1.00 30.00  ?  146  LEU C O     1 
ATOM   6771  C CB    . LEU C 1 149 ? 37.959  -15.841 31.423  1.00 34.44  ?  146  LEU C CB    1 
ATOM   6772  C CG    . LEU C 1 149 ? 36.846  -14.840 31.105  1.00 38.27  ?  146  LEU C CG    1 
ATOM   6773  C CD1   . LEU C 1 149 ? 36.386  -14.146 32.382  1.00 34.91  ?  146  LEU C CD1   1 
ATOM   6774  C CD2   . LEU C 1 149 ? 37.275  -13.836 30.051  1.00 43.15  ?  146  LEU C CD2   1 
ATOM   6775  N N     . PRO C 1 150 ? 35.125  -17.892 32.062  1.00 34.68  ?  147  PRO C N     1 
ATOM   6776  C CA    . PRO C 1 150 ? 33.981  -18.399 31.302  1.00 36.27  ?  147  PRO C CA    1 
ATOM   6777  C C     . PRO C 1 150 ? 33.464  -17.354 30.328  1.00 42.82  ?  147  PRO C C     1 
ATOM   6778  O O     . PRO C 1 150 ? 33.393  -16.162 30.639  1.00 32.10  ?  147  PRO C O     1 
ATOM   6779  C CB    . PRO C 1 150 ? 32.945  -18.724 32.385  1.00 39.39  ?  147  PRO C CB    1 
ATOM   6780  C CG    . PRO C 1 150 ? 33.353  -17.911 33.561  1.00 41.36  ?  147  PRO C CG    1 
ATOM   6781  C CD    . PRO C 1 150 ? 34.845  -17.816 33.505  1.00 41.93  ?  147  PRO C CD    1 
ATOM   6782  N N     . LYS C 1 151 ? 33.117  -17.815 29.133  1.00 38.20  ?  148  LYS C N     1 
ATOM   6783  C CA    . LYS C 1 151 ? 32.572  -16.964 28.085  1.00 33.83  ?  148  LYS C CA    1 
ATOM   6784  C C     . LYS C 1 151 ? 31.788  -17.858 27.132  1.00 39.30  ?  148  LYS C C     1 
ATOM   6785  O O     . LYS C 1 151 ? 31.509  -19.022 27.439  1.00 36.65  ?  148  LYS C O     1 
ATOM   6786  C CB    . LYS C 1 151 ? 33.682  -16.186 27.370  1.00 33.97  ?  148  LYS C CB    1 
ATOM   6787  C CG    . LYS C 1 151 ? 34.755  -17.073 26.766  1.00 31.71  ?  148  LYS C CG    1 
ATOM   6788  C CD    . LYS C 1 151 ? 35.439  -16.410 25.581  1.00 40.84  ?  148  LYS C CD    1 
ATOM   6789  C CE    . LYS C 1 151 ? 36.484  -15.397 26.012  1.00 44.24  ?  148  LYS C CE    1 
ATOM   6790  N NZ    . LYS C 1 151 ? 37.199  -14.832 24.831  1.00 48.34  1  148  LYS C NZ    1 
ATOM   6791  N N     . PHE C 1 152 ? 31.440  -17.322 25.965  1.00 41.00  ?  149  PHE C N     1 
ATOM   6792  C CA    . PHE C 1 152 ? 30.640  -18.067 25.007  1.00 36.99  ?  149  PHE C CA    1 
ATOM   6793  C C     . PHE C 1 152 ? 31.134  -17.813 23.594  1.00 38.85  ?  149  PHE C C     1 
ATOM   6794  O O     . PHE C 1 152 ? 31.617  -16.726 23.266  1.00 41.97  ?  149  PHE C O     1 
ATOM   6795  C CB    . PHE C 1 152 ? 29.154  -17.709 25.113  1.00 36.81  ?  149  PHE C CB    1 
ATOM   6796  C CG    . PHE C 1 152 ? 28.451  -18.403 26.238  1.00 38.60  ?  149  PHE C CG    1 
ATOM   6797  C CD1   . PHE C 1 152 ? 27.884  -19.651 26.049  1.00 42.34  ?  149  PHE C CD1   1 
ATOM   6798  C CD2   . PHE C 1 152 ? 28.369  -17.818 27.490  1.00 43.82  ?  149  PHE C CD2   1 
ATOM   6799  C CE1   . PHE C 1 152 ? 27.241  -20.300 27.083  1.00 43.56  ?  149  PHE C CE1   1 
ATOM   6800  C CE2   . PHE C 1 152 ? 27.727  -18.464 28.531  1.00 41.44  ?  149  PHE C CE2   1 
ATOM   6801  C CZ    . PHE C 1 152 ? 27.162  -19.706 28.326  1.00 43.26  ?  149  PHE C CZ    1 
ATOM   6802  N N     . THR C 1 153 ? 31.007  -18.841 22.761  1.00 34.85  ?  150  THR C N     1 
ATOM   6803  C CA    . THR C 1 153 ? 31.306  -18.758 21.341  1.00 37.86  ?  150  THR C CA    1 
ATOM   6804  C C     . THR C 1 153 ? 30.069  -19.186 20.572  1.00 37.05  ?  150  THR C C     1 
ATOM   6805  O O     . THR C 1 153 ? 29.523  -20.266 20.819  1.00 42.04  ?  150  THR C O     1 
ATOM   6806  C CB    . THR C 1 153 ? 32.496  -19.640 20.963  1.00 35.61  ?  150  THR C CB    1 
ATOM   6807  O OG1   . THR C 1 153 ? 33.563  -19.423 21.894  1.00 32.29  ?  150  THR C OG1   1 
ATOM   6808  C CG2   . THR C 1 153 ? 32.984  -19.303 19.562  1.00 40.95  ?  150  THR C CG2   1 
ATOM   6809  N N     . PHE C 1 154 ? 29.623  -18.335 19.656  1.00 38.93  ?  151  PHE C N     1 
ATOM   6810  C CA    . PHE C 1 154 ? 28.447  -18.603 18.845  1.00 36.32  ?  151  PHE C CA    1 
ATOM   6811  C C     . PHE C 1 154 ? 28.902  -19.019 17.453  1.00 31.22  ?  151  PHE C C     1 
ATOM   6812  O O     . PHE C 1 154 ? 29.528  -18.232 16.734  1.00 32.89  ?  151  PHE C O     1 
ATOM   6813  C CB    . PHE C 1 154 ? 27.534  -17.379 18.803  1.00 43.00  ?  151  PHE C CB    1 
ATOM   6814  C CG    . PHE C 1 154 ? 27.107  -16.914 20.165  1.00 39.14  ?  151  PHE C CG    1 
ATOM   6815  C CD1   . PHE C 1 154 ? 26.056  -17.530 20.823  1.00 42.30  ?  151  PHE C CD1   1 
ATOM   6816  C CD2   . PHE C 1 154 ? 27.776  -15.884 20.803  1.00 43.35  ?  151  PHE C CD2   1 
ATOM   6817  C CE1   . PHE C 1 154 ? 25.670  -17.115 22.084  1.00 43.03  ?  151  PHE C CE1   1 
ATOM   6818  C CE2   . PHE C 1 154 ? 27.393  -15.465 22.066  1.00 38.42  ?  151  PHE C CE2   1 
ATOM   6819  C CZ    . PHE C 1 154 ? 26.339  -16.082 22.704  1.00 36.68  ?  151  PHE C CZ    1 
ATOM   6820  N N     . LEU C 1 155 ? 28.604  -20.262 17.091  1.00 35.00  ?  152  LEU C N     1 
ATOM   6821  C CA    . LEU C 1 155 ? 29.055  -20.850 15.843  1.00 36.38  ?  152  LEU C CA    1 
ATOM   6822  C C     . LEU C 1 155 ? 27.863  -21.392 15.071  1.00 44.95  ?  152  LEU C C     1 
ATOM   6823  O O     . LEU C 1 155 ? 26.824  -21.724 15.650  1.00 54.15  ?  152  LEU C O     1 
ATOM   6824  C CB    . LEU C 1 155 ? 30.066  -21.976 16.094  1.00 32.01  ?  152  LEU C CB    1 
ATOM   6825  C CG    . LEU C 1 155 ? 31.338  -21.589 16.848  1.00 36.43  ?  152  LEU C CG    1 
ATOM   6826  C CD1   . LEU C 1 155 ? 32.065  -22.831 17.335  1.00 41.91  ?  152  LEU C CD1   1 
ATOM   6827  C CD2   . LEU C 1 155 ? 32.242  -20.752 15.957  1.00 37.77  ?  152  LEU C CD2   1 
ATOM   6828  N N     . SER C 1 156 ? 28.023  -21.476 13.753  1.00 31.22  ?  153  SER C N     1 
ATOM   6829  C CA    . SER C 1 156 ? 27.001  -22.102 12.930  1.00 31.15  ?  153  SER C CA    1 
ATOM   6830  C C     . SER C 1 156 ? 26.869  -23.569 13.311  1.00 33.26  ?  153  SER C C     1 
ATOM   6831  O O     . SER C 1 156 ? 27.870  -24.265 13.507  1.00 41.15  ?  153  SER C O     1 
ATOM   6832  C CB    . SER C 1 156 ? 27.345  -21.964 11.446  1.00 32.32  ?  153  SER C CB    1 
ATOM   6833  O OG    . SER C 1 156 ? 28.510  -22.701 11.119  1.00 37.57  ?  153  SER C OG    1 
ATOM   6834  N N     . LYS C 1 157 ? 25.625  -24.031 13.437  1.00 50.86  ?  154  LYS C N     1 
ATOM   6835  C CA    . LYS C 1 157 ? 25.388  -25.423 13.801  1.00 50.80  ?  154  LYS C CA    1 
ATOM   6836  C C     . LYS C 1 157 ? 25.905  -26.373 12.729  1.00 50.75  ?  154  LYS C C     1 
ATOM   6837  O O     . LYS C 1 157 ? 26.232  -27.529 13.029  1.00 48.46  ?  154  LYS C O     1 
ATOM   6838  C CB    . LYS C 1 157 ? 23.893  -25.641 14.049  1.00 57.52  ?  154  LYS C CB    1 
ATOM   6839  C CG    . LYS C 1 157 ? 23.544  -26.931 14.773  1.00 59.60  ?  154  LYS C CG    1 
ATOM   6840  C CD    . LYS C 1 157 ? 22.114  -26.881 15.290  1.00 56.33  ?  154  LYS C CD    1 
ATOM   6841  C CE    . LYS C 1 157 ? 21.119  -26.761 14.147  1.00 53.44  ?  154  LYS C CE    1 
ATOM   6842  N NZ    . LYS C 1 157 ? 21.106  -27.978 13.294  1.00 57.15  1  154  LYS C NZ    1 
ATOM   6843  N N     . GLU C 1 158 ? 25.998  -25.904 11.489  1.00 48.71  ?  155  GLU C N     1 
ATOM   6844  C CA    . GLU C 1 158 ? 26.410  -26.692 10.342  1.00 48.86  ?  155  GLU C CA    1 
ATOM   6845  C C     . GLU C 1 158 ? 27.692  -26.128 9.745   1.00 49.67  ?  155  GLU C C     1 
ATOM   6846  O O     . GLU C 1 158 ? 28.017  -24.952 9.949   1.00 48.92  ?  155  GLU C O     1 
ATOM   6847  C CB    . GLU C 1 158 ? 25.308  -26.699 9.274   1.00 50.37  ?  155  GLU C CB    1 
ATOM   6848  C CG    . GLU C 1 158 ? 23.966  -27.206 9.771   1.00 60.73  ?  155  GLU C CG    1 
ATOM   6849  C CD    . GLU C 1 158 ? 23.845  -28.714 9.688   1.00 64.98  ?  155  GLU C CD    1 
ATOM   6850  O OE1   . GLU C 1 158 ? 23.936  -29.253 8.565   1.00 71.29  ?  155  GLU C OE1   1 
ATOM   6851  O OE2   . GLU C 1 158 ? 23.668  -29.360 10.742  1.00 64.29  -1 155  GLU C OE2   1 
ATOM   6852  N N     . PRO C 1 159 ? 28.451  -26.945 9.001   1.00 54.37  ?  156  PRO C N     1 
ATOM   6853  C CA    . PRO C 1 159 ? 29.590  -26.412 8.242   1.00 51.26  ?  156  PRO C CA    1 
ATOM   6854  C C     . PRO C 1 159 ? 29.192  -25.258 7.334   1.00 52.75  ?  156  PRO C C     1 
ATOM   6855  O O     . PRO C 1 159 ? 28.010  -25.085 7.021   1.00 53.73  ?  156  PRO C O     1 
ATOM   6856  C CB    . PRO C 1 159 ? 30.067  -27.625 7.435   1.00 49.22  ?  156  PRO C CB    1 
ATOM   6857  C CG    . PRO C 1 159 ? 29.688  -28.790 8.281   1.00 50.97  ?  156  PRO C CG    1 
ATOM   6858  C CD    . PRO C 1 159 ? 28.390  -28.416 8.946   1.00 51.34  ?  156  PRO C CD    1 
ATOM   6859  N N     . ALA C 1 160 ? 30.186  -24.480 6.897   1.00 51.66  ?  157  ALA C N     1 
ATOM   6860  C CA    . ALA C 1 160 ? 29.920  -23.222 6.204   1.00 50.52  ?  157  ALA C CA    1 
ATOM   6861  C C     . ALA C 1 160 ? 29.046  -23.427 4.973   1.00 55.75  ?  157  ALA C C     1 
ATOM   6862  O O     . ALA C 1 160 ? 28.057  -22.712 4.775   1.00 65.00  ?  157  ALA C O     1 
ATOM   6863  C CB    . ALA C 1 160 ? 31.240  -22.551 5.821   1.00 49.54  ?  157  ALA C CB    1 
ATOM   6864  N N     . LEU C 1 161 ? 29.395  -24.402 4.133   1.00 54.49  ?  158  LEU C N     1 
ATOM   6865  C CA    . LEU C 1 161 ? 28.645  -24.624 2.902   1.00 51.78  ?  158  LEU C CA    1 
ATOM   6866  C C     . LEU C 1 161 ? 27.268  -25.224 3.155   1.00 49.92  ?  158  LEU C C     1 
ATOM   6867  O O     . LEU C 1 161 ? 26.380  -25.082 2.309   1.00 50.07  ?  158  LEU C O     1 
ATOM   6868  C CB    . LEU C 1 161 ? 29.441  -25.527 1.962   1.00 50.59  ?  158  LEU C CB    1 
ATOM   6869  C CG    . LEU C 1 161 ? 30.748  -24.938 1.431   1.00 50.14  ?  158  LEU C CG    1 
ATOM   6870  C CD1   . LEU C 1 161 ? 31.506  -25.970 0.614   1.00 50.23  ?  158  LEU C CD1   1 
ATOM   6871  C CD2   . LEU C 1 161 ? 30.467  -23.695 0.602   1.00 51.73  ?  158  LEU C CD2   1 
ATOM   6872  N N     . GLU C 1 162 ? 27.070  -25.887 4.293   1.00 50.41  ?  159  GLU C N     1 
ATOM   6873  C CA    . GLU C 1 162 ? 25.802  -26.521 4.624   1.00 54.50  ?  159  GLU C CA    1 
ATOM   6874  C C     . GLU C 1 162 ? 25.024  -25.743 5.678   1.00 55.37  ?  159  GLU C C     1 
ATOM   6875  O O     . GLU C 1 162 ? 24.145  -26.308 6.337   1.00 62.51  ?  159  GLU C O     1 
ATOM   6876  C CB    . GLU C 1 162 ? 26.045  -27.956 5.090   1.00 58.96  ?  159  GLU C CB    1 
ATOM   6877  C CG    . GLU C 1 162 ? 26.857  -28.780 4.106   1.00 66.34  ?  159  GLU C CG    1 
ATOM   6878  C CD    . GLU C 1 162 ? 27.486  -30.000 4.746   1.00 74.37  ?  159  GLU C CD    1 
ATOM   6879  O OE1   . GLU C 1 162 ? 27.106  -30.338 5.887   1.00 70.91  ?  159  GLU C OE1   1 
ATOM   6880  O OE2   . GLU C 1 162 ? 28.368  -30.614 4.109   1.00 79.82  -1 159  GLU C OE2   1 
ATOM   6881  N N     . SER C 1 163 ? 25.329  -24.460 5.846   1.00 54.35  ?  160  SER C N     1 
ATOM   6882  C CA    . SER C 1 163 ? 24.690  -23.613 6.844   1.00 54.85  ?  160  SER C CA    1 
ATOM   6883  C C     . SER C 1 163 ? 23.802  -22.590 6.151   1.00 56.35  ?  160  SER C C     1 
ATOM   6884  O O     . SER C 1 163 ? 24.260  -21.864 5.262   1.00 52.91  ?  160  SER C O     1 
ATOM   6885  C CB    . SER C 1 163 ? 25.736  -22.900 7.705   1.00 51.95  ?  160  SER C CB    1 
ATOM   6886  O OG    . SER C 1 163 ? 25.138  -21.932 8.550   1.00 51.87  ?  160  SER C OG    1 
ATOM   6887  N N     . ALA C 1 164 ? 22.534  -22.532 6.567   1.00 58.06  ?  161  ALA C N     1 
ATOM   6888  C CA    . ALA C 1 164 ? 21.622  -21.533 6.020   1.00 57.97  ?  161  ALA C CA    1 
ATOM   6889  C C     . ALA C 1 164 ? 22.068  -20.124 6.389   1.00 58.36  ?  161  ALA C C     1 
ATOM   6890  O O     . ALA C 1 164 ? 22.045  -19.217 5.550   1.00 63.93  ?  161  ALA C O     1 
ATOM   6891  C CB    . ALA C 1 164 ? 20.199  -21.791 6.514   1.00 54.79  ?  161  ALA C CB    1 
ATOM   6892  N N     . ILE C 1 165 ? 22.480  -19.924 7.635   1.00 52.43  ?  162  ILE C N     1 
ATOM   6893  C CA    . ILE C 1 165 ? 22.924  -18.621 8.111   1.00 54.46  ?  162  ILE C CA    1 
ATOM   6894  C C     . ILE C 1 165 ? 24.414  -18.478 7.834   1.00 57.73  ?  162  ILE C C     1 
ATOM   6895  O O     . ILE C 1 165 ? 25.178  -19.448 7.917   1.00 55.71  ?  162  ILE C O     1 
ATOM   6896  C CB    . ILE C 1 165 ? 22.601  -18.447 9.608   1.00 55.57  ?  162  ILE C CB    1 
ATOM   6897  C CG1   . ILE C 1 165 ? 22.866  -17.008 10.056  1.00 49.65  ?  162  ILE C CG1   1 
ATOM   6898  C CG2   . ILE C 1 165 ? 23.390  -19.437 10.458  1.00 63.30  ?  162  ILE C CG2   1 
ATOM   6899  C CD1   . ILE C 1 165 ? 22.334  -16.695 11.440  1.00 56.23  ?  162  ILE C CD1   1 
ATOM   6900  N N     . LYS C 1 166 ? 24.829  -17.265 7.483   1.00 55.46  ?  163  LYS C N     1 
ATOM   6901  C CA    . LYS C 1 166 ? 26.209  -16.989 7.122   1.00 56.20  ?  163  LYS C CA    1 
ATOM   6902  C C     . LYS C 1 166 ? 26.716  -15.784 7.901   1.00 66.30  ?  163  LYS C C     1 
ATOM   6903  O O     . LYS C 1 166 ? 25.959  -15.078 8.574   1.00 62.28  ?  163  LYS C O     1 
ATOM   6904  C CB    . LYS C 1 166 ? 26.350  -16.760 5.610   1.00 57.60  ?  163  LYS C CB    1 
ATOM   6905  C CG    . LYS C 1 166 ? 26.406  -18.051 4.807   1.00 59.65  ?  163  LYS C CG    1 
ATOM   6906  C CD    . LYS C 1 166 ? 25.938  -17.867 3.376   1.00 54.11  ?  163  LYS C CD    1 
ATOM   6907  C CE    . LYS C 1 166 ? 26.233  -19.115 2.561   1.00 54.04  ?  163  LYS C CE    1 
ATOM   6908  N NZ    . LYS C 1 166 ? 25.932  -20.356 3.328   1.00 52.12  1  163  LYS C NZ    1 
ATOM   6909  N N     . SER C 1 167 ? 28.022  -15.560 7.801   1.00 64.90  ?  164  SER C N     1 
ATOM   6910  C CA    . SER C 1 167 ? 28.686  -14.469 8.493   1.00 56.83  ?  164  SER C CA    1 
ATOM   6911  C C     . SER C 1 167 ? 29.904  -14.067 7.673   1.00 54.98  ?  164  SER C C     1 
ATOM   6912  O O     . SER C 1 167 ? 30.152  -14.605 6.590   1.00 59.29  ?  164  SER C O     1 
ATOM   6913  C CB    . SER C 1 167 ? 29.068  -14.877 9.920   1.00 55.75  ?  164  SER C CB    1 
ATOM   6914  O OG    . SER C 1 167 ? 29.367  -13.747 10.722  1.00 56.72  ?  164  SER C OG    1 
ATOM   6915  N N     . GLY C 1 168 ? 30.669  -13.115 8.197   1.00 49.42  ?  165  GLY C N     1 
ATOM   6916  C CA    . GLY C 1 168 ? 31.859  -12.658 7.509   1.00 56.70  ?  165  GLY C CA    1 
ATOM   6917  C C     . GLY C 1 168 ? 33.130  -13.398 7.848   1.00 49.60  ?  165  GLY C C     1 
ATOM   6918  O O     . GLY C 1 168 ? 34.133  -13.240 7.146   1.00 56.75  ?  165  GLY C O     1 
ATOM   6919  N N     . TYR C 1 169 ? 33.117  -14.213 8.899   1.00 50.35  ?  166  TYR C N     1 
ATOM   6920  C CA    . TYR C 1 169 ? 34.316  -14.882 9.379   1.00 49.17  ?  166  TYR C CA    1 
ATOM   6921  C C     . TYR C 1 169 ? 34.051  -16.365 9.591   1.00 53.18  ?  166  TYR C C     1 
ATOM   6922  O O     . TYR C 1 169 ? 32.957  -16.761 10.006  1.00 53.31  ?  166  TYR C O     1 
ATOM   6923  C CB    . TYR C 1 169 ? 34.817  -14.244 10.680  1.00 49.00  ?  166  TYR C CB    1 
ATOM   6924  C CG    . TYR C 1 169 ? 35.591  -12.968 10.448  1.00 56.21  ?  166  TYR C CG    1 
ATOM   6925  C CD1   . TYR C 1 169 ? 34.939  -11.747 10.324  1.00 59.21  ?  166  TYR C CD1   1 
ATOM   6926  C CD2   . TYR C 1 169 ? 36.975  -12.988 10.334  1.00 57.11  ?  166  TYR C CD2   1 
ATOM   6927  C CE1   . TYR C 1 169 ? 35.646  -10.579 10.103  1.00 58.93  ?  166  TYR C CE1   1 
ATOM   6928  C CE2   . TYR C 1 169 ? 37.691  -11.826 10.114  1.00 61.27  ?  166  TYR C CE2   1 
ATOM   6929  C CZ    . TYR C 1 169 ? 37.022  -10.625 10.000  1.00 63.05  ?  166  TYR C CZ    1 
ATOM   6930  O OH    . TYR C 1 169 ? 37.732  -9.466  9.781   1.00 66.55  ?  166  TYR C OH    1 
ATOM   6931  N N     . LEU C 1 170 ? 35.065  -17.176 9.302   1.00 49.12  ?  167  LEU C N     1 
ATOM   6932  C CA    . LEU C 1 170 ? 35.004  -18.622 9.445   1.00 49.07  ?  167  LEU C CA    1 
ATOM   6933  C C     . LEU C 1 170 ? 36.011  -19.068 10.493  1.00 49.14  ?  167  LEU C C     1 
ATOM   6934  O O     . LEU C 1 170 ? 37.107  -18.510 10.589  1.00 48.89  ?  167  LEU C O     1 
ATOM   6935  C CB    . LEU C 1 170 ? 35.301  -19.323 8.118   1.00 49.24  ?  167  LEU C CB    1 
ATOM   6936  C CG    . LEU C 1 170 ? 34.298  -19.092 6.991   1.00 49.42  ?  167  LEU C CG    1 
ATOM   6937  C CD1   . LEU C 1 170 ? 34.829  -19.649 5.685   1.00 53.87  ?  167  LEU C CD1   1 
ATOM   6938  C CD2   . LEU C 1 170 ? 32.974  -19.733 7.341   1.00 49.36  ?  167  LEU C CD2   1 
ATOM   6939  N N     . TYR C 1 171 ? 35.637  -20.079 11.272  1.00 48.76  ?  168  TYR C N     1 
ATOM   6940  C CA    . TYR C 1 171 ? 36.500  -20.649 12.299  1.00 48.60  ?  168  TYR C CA    1 
ATOM   6941  C C     . TYR C 1 171 ? 36.827  -22.087 11.922  1.00 49.34  ?  168  TYR C C     1 
ATOM   6942  O O     . TYR C 1 171 ? 35.919  -22.904 11.732  1.00 48.63  ?  168  TYR C O     1 
ATOM   6943  C CB    . TYR C 1 171 ? 35.834  -20.586 13.676  1.00 48.41  ?  168  TYR C CB    1 
ATOM   6944  C CG    . TYR C 1 171 ? 36.429  -21.536 14.688  1.00 48.24  ?  168  TYR C CG    1 
ATOM   6945  C CD1   . TYR C 1 171 ? 37.735  -21.380 15.134  1.00 48.17  ?  168  TYR C CD1   1 
ATOM   6946  C CD2   . TYR C 1 171 ? 35.683  -22.587 15.204  1.00 48.15  ?  168  TYR C CD2   1 
ATOM   6947  C CE1   . TYR C 1 171 ? 38.281  -22.247 16.060  1.00 48.02  ?  168  TYR C CE1   1 
ATOM   6948  C CE2   . TYR C 1 171 ? 36.220  -23.458 16.131  1.00 48.00  ?  168  TYR C CE2   1 
ATOM   6949  C CZ    . TYR C 1 171 ? 37.520  -23.284 16.555  1.00 47.93  ?  168  TYR C CZ    1 
ATOM   6950  O OH    . TYR C 1 171 ? 38.059  -24.151 17.477  1.00 47.78  ?  168  TYR C OH    1 
ATOM   6951  N N     . ASN C 1 172 ? 38.117  -22.389 11.805  1.00 48.62  ?  169  ASN C N     1 
ATOM   6952  C CA    . ASN C 1 172 ? 38.572  -23.740 11.503  1.00 48.63  ?  169  ASN C CA    1 
ATOM   6953  C C     . ASN C 1 172 ? 38.676  -24.526 12.805  1.00 52.43  ?  169  ASN C C     1 
ATOM   6954  O O     . ASN C 1 172 ? 39.382  -24.112 13.732  1.00 55.23  ?  169  ASN C O     1 
ATOM   6955  C CB    . ASN C 1 172 ? 39.915  -23.718 10.776  1.00 49.31  ?  169  ASN C CB    1 
ATOM   6956  C CG    . ASN C 1 172 ? 40.365  -25.101 10.342  1.00 48.76  ?  169  ASN C CG    1 
ATOM   6957  O OD1   . ASN C 1 172 ? 40.875  -25.881 11.146  1.00 48.63  ?  169  ASN C OD1   1 
ATOM   6958  N ND2   . ASN C 1 172 ? 40.182  -25.410 9.063   1.00 48.94  ?  169  ASN C ND2   1 
ATOM   6959  N N     . ILE C 1 173 ? 37.978  -25.661 12.869  1.00 48.91  ?  170  ILE C N     1 
ATOM   6960  C CA    . ILE C 1 173 ? 37.915  -26.419 14.114  1.00 52.98  ?  170  ILE C CA    1 
ATOM   6961  C C     . ILE C 1 173 ? 39.220  -27.162 14.374  1.00 58.61  ?  170  ILE C C     1 
ATOM   6962  O O     . ILE C 1 173 ? 39.560  -27.442 15.530  1.00 66.91  ?  170  ILE C O     1 
ATOM   6963  C CB    . ILE C 1 173 ? 36.713  -27.379 14.088  1.00 48.21  ?  170  ILE C CB    1 
ATOM   6964  C CG1   . ILE C 1 173 ? 36.886  -28.429 12.990  1.00 48.34  ?  170  ILE C CG1   1 
ATOM   6965  C CG2   . ILE C 1 173 ? 35.424  -26.603 13.874  1.00 48.26  ?  170  ILE C CG2   1 
ATOM   6966  C CD1   . ILE C 1 173 ? 35.748  -29.425 12.910  1.00 48.35  ?  170  ILE C CD1   1 
ATOM   6967  N N     . LYS C 1 174 ? 39.972  -27.492 13.324  1.00 58.21  ?  171  LYS C N     1 
ATOM   6968  C CA    . LYS C 1 174 ? 41.209  -28.247 13.494  1.00 52.83  ?  171  LYS C CA    1 
ATOM   6969  C C     . LYS C 1 174 ? 42.410  -27.361 13.795  1.00 51.87  ?  171  LYS C C     1 
ATOM   6970  O O     . LYS C 1 174 ? 43.319  -27.792 14.513  1.00 56.89  ?  171  LYS C O     1 
ATOM   6971  C CB    . LYS C 1 174 ? 41.495  -29.087 12.245  1.00 55.18  ?  171  LYS C CB    1 
ATOM   6972  C CG    . LYS C 1 174 ? 41.075  -30.547 12.363  1.00 53.47  ?  171  LYS C CG    1 
ATOM   6973  C CD    . LYS C 1 174 ? 39.565  -30.696 12.448  1.00 53.70  ?  171  LYS C CD    1 
ATOM   6974  C CE    . LYS C 1 174 ? 39.159  -32.148 12.654  1.00 56.47  ?  171  LYS C CE    1 
ATOM   6975  N NZ    . LYS C 1 174 ? 39.620  -33.026 11.542  1.00 56.83  1  171  LYS C NZ    1 
ATOM   6976  N N     . SER C 1 175 ? 42.441  -26.137 13.271  1.00 48.32  ?  172  SER C N     1 
ATOM   6977  C CA    . SER C 1 175 ? 43.582  -25.253 13.476  1.00 48.30  ?  172  SER C CA    1 
ATOM   6978  C C     . SER C 1 175 ? 43.350  -24.199 14.546  1.00 52.25  ?  172  SER C C     1 
ATOM   6979  O O     . SER C 1 175 ? 44.315  -23.741 15.166  1.00 48.10  ?  172  SER C O     1 
ATOM   6980  C CB    . SER C 1 175 ? 43.954  -24.545 12.170  1.00 52.60  ?  172  SER C CB    1 
ATOM   6981  O OG    . SER C 1 175 ? 43.059  -23.480 11.896  1.00 53.58  ?  172  SER C OG    1 
ATOM   6982  N N     . GLY C 1 176 ? 42.102  -23.798 14.775  1.00 48.69  ?  173  GLY C N     1 
ATOM   6983  C CA    . GLY C 1 176 ? 41.817  -22.716 15.690  1.00 48.05  ?  173  GLY C CA    1 
ATOM   6984  C C     . GLY C 1 176 ? 41.981  -21.331 15.108  1.00 48.16  ?  173  GLY C C     1 
ATOM   6985  O O     . GLY C 1 176 ? 41.784  -20.347 15.832  1.00 48.08  ?  173  GLY C O     1 
ATOM   6986  N N     . LYS C 1 177 ? 42.335  -21.220 13.832  1.00 48.34  ?  174  LYS C N     1 
ATOM   6987  C CA    . LYS C 1 177 ? 42.484  -19.940 13.162  1.00 48.47  ?  174  LYS C CA    1 
ATOM   6988  C C     . LYS C 1 177 ? 41.164  -19.515 12.523  1.00 50.78  ?  174  LYS C C     1 
ATOM   6989  O O     . LYS C 1 177 ? 40.299  -20.339 12.217  1.00 48.60  ?  174  LYS C O     1 
ATOM   6990  C CB    . LYS C 1 177 ? 43.579  -20.018 12.099  1.00 52.06  ?  174  LYS C CB    1 
ATOM   6991  C CG    . LYS C 1 177 ? 44.829  -20.765 12.540  1.00 54.40  ?  174  LYS C CG    1 
ATOM   6992  C CD    . LYS C 1 177 ? 45.863  -20.806 11.427  1.00 53.92  ?  174  LYS C CD    1 
ATOM   6993  C CE    . LYS C 1 177 ? 47.225  -21.222 11.957  1.00 53.38  ?  174  LYS C CE    1 
ATOM   6994  N NZ    . LYS C 1 177 ? 48.319  -20.800 11.037  1.00 51.60  1  174  LYS C NZ    1 
ATOM   6995  N N     . SER C 1 178 ? 41.021  -18.207 12.317  1.00 52.87  ?  175  SER C N     1 
ATOM   6996  C CA    . SER C 1 178 ? 39.835  -17.635 11.696  1.00 52.69  ?  175  SER C CA    1 
ATOM   6997  C C     . SER C 1 178 ? 40.221  -16.832 10.463  1.00 50.76  ?  175  SER C C     1 
ATOM   6998  O O     . SER C 1 178 ? 41.281  -16.197 10.429  1.00 48.95  ?  175  SER C O     1 
ATOM   6999  C CB    . SER C 1 178 ? 39.067  -16.739 12.669  1.00 50.29  ?  175  SER C CB    1 
ATOM   7000  O OG    . SER C 1 178 ? 38.444  -17.505 13.684  1.00 52.13  ?  175  SER C OG    1 
ATOM   7001  N N     . PHE C 1 179 ? 39.344  -16.854 9.460   1.00 49.08  ?  176  PHE C N     1 
ATOM   7002  C CA    . PHE C 1 179 ? 39.576  -16.185 8.191   1.00 54.14  ?  176  PHE C CA    1 
ATOM   7003  C C     . PHE C 1 179 ? 38.296  -15.534 7.698   1.00 54.89  ?  176  PHE C C     1 
ATOM   7004  O O     . PHE C 1 179 ? 37.198  -16.050 7.931   1.00 49.34  ?  176  PHE C O     1 
ATOM   7005  C CB    . PHE C 1 179 ? 40.091  -17.165 7.134   1.00 49.41  ?  176  PHE C CB    1 
ATOM   7006  C CG    . PHE C 1 179 ? 41.079  -18.160 7.663   1.00 51.87  ?  176  PHE C CG    1 
ATOM   7007  C CD1   . PHE C 1 179 ? 42.395  -17.800 7.890   1.00 54.39  ?  176  PHE C CD1   1 
ATOM   7008  C CD2   . PHE C 1 179 ? 40.687  -19.457 7.944   1.00 58.66  ?  176  PHE C CD2   1 
ATOM   7009  C CE1   . PHE C 1 179 ? 43.309  -18.730 8.382   1.00 59.48  ?  176  PHE C CE1   1 
ATOM   7010  C CE2   . PHE C 1 179 ? 41.586  -20.394 8.434   1.00 61.81  ?  176  PHE C CE2   1 
ATOM   7011  C CZ    . PHE C 1 179 ? 42.897  -20.028 8.660   1.00 60.84  ?  176  PHE C CZ    1 
ATOM   7012  N N     . PRO C 1 180 ? 38.414  -14.390 7.027   1.00 56.23  ?  177  PRO C N     1 
ATOM   7013  C CA    . PRO C 1 180 ? 37.248  -13.787 6.377   1.00 53.66  ?  177  PRO C CA    1 
ATOM   7014  C C     . PRO C 1 180 ? 36.646  -14.739 5.356   1.00 49.75  ?  177  PRO C C     1 
ATOM   7015  O O     . PRO C 1 180 ? 37.359  -15.432 4.626   1.00 49.84  ?  177  PRO C O     1 
ATOM   7016  C CB    . PRO C 1 180 ? 37.826  -12.532 5.705   1.00 51.44  ?  177  PRO C CB    1 
ATOM   7017  C CG    . PRO C 1 180 ? 39.066  -12.215 6.505   1.00 50.39  ?  177  PRO C CG    1 
ATOM   7018  C CD    . PRO C 1 180 ? 39.621  -13.554 6.899   1.00 52.77  ?  177  PRO C CD    1 
ATOM   7019  N N     . TYR C 1 181 ? 35.318  -14.779 5.329   1.00 49.76  ?  178  TYR C N     1 
ATOM   7020  C CA    . TYR C 1 181 ? 34.573  -15.631 4.412   1.00 51.54  ?  178  TYR C CA    1 
ATOM   7021  C C     . TYR C 1 181 ? 34.320  -14.849 3.129   1.00 54.56  ?  178  TYR C C     1 
ATOM   7022  O O     . TYR C 1 181 ? 33.562  -13.874 3.125   1.00 61.60  ?  178  TYR C O     1 
ATOM   7023  C CB    . TYR C 1 181 ? 33.268  -16.088 5.059   1.00 49.78  ?  178  TYR C CB    1 
ATOM   7024  C CG    . TYR C 1 181 ? 32.230  -16.604 4.093   1.00 49.92  ?  178  TYR C CG    1 
ATOM   7025  C CD1   . TYR C 1 181 ? 32.398  -17.820 3.447   1.00 49.99  ?  178  TYR C CD1   1 
ATOM   7026  C CD2   . TYR C 1 181 ? 31.071  -15.882 3.841   1.00 49.99  ?  178  TYR C CD2   1 
ATOM   7027  C CE1   . TYR C 1 181 ? 31.447  -18.296 2.570   1.00 50.12  ?  178  TYR C CE1   1 
ATOM   7028  C CE2   . TYR C 1 181 ? 30.114  -16.351 2.966   1.00 50.12  ?  178  TYR C CE2   1 
ATOM   7029  C CZ    . TYR C 1 181 ? 30.308  -17.558 2.333   1.00 50.18  ?  178  TYR C CZ    1 
ATOM   7030  O OH    . TYR C 1 181 ? 29.359  -18.031 1.459   1.00 50.31  ?  178  TYR C OH    1 
ATOM   7031  N N     . ILE C 1 182 ? 34.964  -15.266 2.045   1.00 54.39  ?  179  ILE C N     1 
ATOM   7032  C CA    . ILE C 1 182 ? 34.835  -14.565 0.773   1.00 55.36  ?  179  ILE C CA    1 
ATOM   7033  C C     . ILE C 1 182 ? 33.669  -15.098 -0.037  1.00 57.92  ?  179  ILE C C     1 
ATOM   7034  O O     . ILE C 1 182 ? 32.807  -14.335 -0.481  1.00 64.12  ?  179  ILE C O     1 
ATOM   7035  C CB    . ILE C 1 182 ? 36.155  -14.660 -0.014  1.00 55.90  ?  179  ILE C CB    1 
ATOM   7036  C CG1   . ILE C 1 182 ? 37.160  -13.676 0.564   1.00 54.19  ?  179  ILE C CG1   1 
ATOM   7037  C CG2   . ILE C 1 182 ? 35.930  -14.393 -1.496  1.00 55.64  ?  179  ILE C CG2   1 
ATOM   7038  C CD1   . ILE C 1 182 ? 38.520  -14.237 0.629   1.00 59.19  ?  179  ILE C CD1   1 
ATOM   7039  N N     . SER C 1 183 ? 33.620  -16.409 -0.246  1.00 50.56  ?  180  SER C N     1 
ATOM   7040  C CA    . SER C 1 183 ? 32.537  -16.962 -1.038  1.00 53.85  ?  180  SER C CA    1 
ATOM   7041  C C     . SER C 1 183 ? 32.341  -18.429 -0.696  1.00 60.72  ?  180  SER C C     1 
ATOM   7042  O O     . SER C 1 183 ? 33.291  -19.144 -0.363  1.00 58.36  ?  180  SER C O     1 
ATOM   7043  C CB    . SER C 1 183 ? 32.798  -16.802 -2.540  1.00 51.30  ?  180  SER C CB    1 
ATOM   7044  O OG    . SER C 1 183 ? 33.645  -17.828 -3.026  1.00 53.42  ?  180  SER C OG    1 
ATOM   7045  N N     . GLY C 1 184 ? 31.084  -18.850 -0.775  1.00 55.65  ?  181  GLY C N     1 
ATOM   7046  C CA    . GLY C 1 184 ? 30.695  -20.243 -0.761  1.00 57.71  ?  181  GLY C CA    1 
ATOM   7047  C C     . GLY C 1 184 ? 29.618  -20.442 -1.807  1.00 66.95  ?  181  GLY C C     1 
ATOM   7048  O O     . GLY C 1 184 ? 28.464  -20.064 -1.586  1.00 73.63  ?  181  GLY C O     1 
ATOM   7049  N N     . LEU C 1 185 ? 29.986  -20.990 -2.964  1.00 61.31  ?  182  LEU C N     1 
ATOM   7050  C CA    . LEU C 1 185 ? 29.045  -21.175 -4.058  1.00 55.21  ?  182  LEU C CA    1 
ATOM   7051  C C     . LEU C 1 185 ? 29.394  -22.461 -4.788  1.00 57.45  ?  182  LEU C C     1 
ATOM   7052  O O     . LEU C 1 185 ? 30.572  -22.748 -5.019  1.00 57.30  ?  182  LEU C O     1 
ATOM   7053  C CB    . LEU C 1 185 ? 29.068  -19.994 -5.041  1.00 57.24  ?  182  LEU C CB    1 
ATOM   7054  C CG    . LEU C 1 185 ? 28.536  -18.633 -4.583  1.00 57.60  ?  182  LEU C CG    1 
ATOM   7055  C CD1   . LEU C 1 185 ? 28.943  -17.546 -5.567  1.00 56.71  ?  182  LEU C CD1   1 
ATOM   7056  C CD2   . LEU C 1 185 ? 27.023  -18.666 -4.419  1.00 53.84  ?  182  LEU C CD2   1 
ATOM   7057  N N     . ASP C 1 186 ? 28.363  -23.233 -5.131  1.00 54.14  ?  183  ASP C N     1 
ATOM   7058  C CA    . ASP C 1 186 ? 28.516  -24.441 -5.941  1.00 55.20  ?  183  ASP C CA    1 
ATOM   7059  C C     . ASP C 1 186 ? 29.455  -25.443 -5.271  1.00 54.98  ?  183  ASP C C     1 
ATOM   7060  O O     . ASP C 1 186 ? 30.233  -26.136 -5.933  1.00 51.23  ?  183  ASP C O     1 
ATOM   7061  C CB    . ASP C 1 186 ? 29.002  -24.093 -7.349  1.00 55.13  ?  183  ASP C CB    1 
ATOM   7062  C CG    . ASP C 1 186 ? 28.297  -22.876 -7.924  1.00 57.04  ?  183  ASP C CG    1 
ATOM   7063  O OD1   . ASP C 1 186 ? 27.047  -22.854 -7.940  1.00 56.66  ?  183  ASP C OD1   1 
ATOM   7064  O OD2   . ASP C 1 186 ? 28.995  -21.933 -8.349  1.00 58.65  -1 183  ASP C OD2   1 
ATOM   7065  N N     . GLY C 1 187 ? 29.391  -25.508 -3.942  1.00 50.95  ?  184  GLY C N     1 
ATOM   7066  C CA    . GLY C 1 187 ? 30.183  -26.461 -3.190  1.00 50.81  ?  184  GLY C CA    1 
ATOM   7067  C C     . GLY C 1 187 ? 31.643  -26.112 -3.019  1.00 54.99  ?  184  GLY C C     1 
ATOM   7068  O O     . GLY C 1 187 ? 32.439  -26.996 -2.690  1.00 53.97  ?  184  GLY C O     1 
ATOM   7069  N N     . ILE C 1 188 ? 32.023  -24.853 -3.220  1.00 53.99  ?  185  ILE C N     1 
ATOM   7070  C CA    . ILE C 1 188 ? 33.413  -24.421 -3.127  1.00 52.21  ?  185  ILE C CA    1 
ATOM   7071  C C     . ILE C 1 188 ? 33.498  -23.296 -2.104  1.00 54.10  ?  185  ILE C C     1 
ATOM   7072  O O     . ILE C 1 188 ? 32.839  -22.259 -2.255  1.00 50.73  ?  185  ILE C O     1 
ATOM   7073  C CB    . ILE C 1 188 ? 33.963  -23.969 -4.489  1.00 53.56  ?  185  ILE C CB    1 
ATOM   7074  C CG1   . ILE C 1 188 ? 34.105  -25.168 -5.431  1.00 52.17  ?  185  ILE C CG1   1 
ATOM   7075  C CG2   . ILE C 1 188 ? 35.291  -23.255 -4.318  1.00 53.53  ?  185  ILE C CG2   1 
ATOM   7076  C CD1   . ILE C 1 188 ? 34.752  -24.832 -6.759  1.00 51.33  ?  185  ILE C CD1   1 
ATOM   7077  N N     . LEU C 1 189 ? 34.315  -23.498 -1.074  1.00 52.76  ?  186  LEU C N     1 
ATOM   7078  C CA    . LEU C 1 189 ? 34.479  -22.538 0.009   1.00 50.37  ?  186  LEU C CA    1 
ATOM   7079  C C     . LEU C 1 189 ? 35.785  -21.776 -0.185  1.00 50.40  ?  186  LEU C C     1 
ATOM   7080  O O     . LEU C 1 189 ? 36.850  -22.386 -0.329  1.00 51.79  ?  186  LEU C O     1 
ATOM   7081  C CB    . LEU C 1 189 ? 34.468  -23.256 1.360   1.00 53.42  ?  186  LEU C CB    1 
ATOM   7082  C CG    . LEU C 1 189 ? 34.385  -22.426 2.640   1.00 49.98  ?  186  LEU C CG    1 
ATOM   7083  C CD1   . LEU C 1 189 ? 33.116  -21.589 2.654   1.00 50.01  ?  186  LEU C CD1   1 
ATOM   7084  C CD2   . LEU C 1 189 ? 34.446  -23.336 3.859   1.00 49.78  ?  186  LEU C CD2   1 
ATOM   7085  N N     . LYS C 1 190 ? 35.699  -20.447 -0.194  1.00 50.43  ?  187  LYS C N     1 
ATOM   7086  C CA    . LYS C 1 190 ? 36.846  -19.578 -0.427  1.00 56.76  ?  187  LYS C CA    1 
ATOM   7087  C C     . LYS C 1 190 ? 37.088  -18.711 0.801   1.00 54.46  ?  187  LYS C C     1 
ATOM   7088  O O     . LYS C 1 190 ? 36.140  -18.155 1.368   1.00 51.38  ?  187  LYS C O     1 
ATOM   7089  C CB    . LYS C 1 190 ? 36.628  -18.702 -1.663  1.00 52.98  ?  187  LYS C CB    1 
ATOM   7090  C CG    . LYS C 1 190 ? 36.525  -19.484 -2.965  1.00 57.71  ?  187  LYS C CG    1 
ATOM   7091  C CD    . LYS C 1 190 ? 36.601  -18.561 -4.172  1.00 52.12  ?  187  LYS C CD    1 
ATOM   7092  C CE    . LYS C 1 190 ? 36.779  -19.352 -5.457  1.00 52.43  ?  187  LYS C CE    1 
ATOM   7093  N NZ    . LYS C 1 190 ? 37.002  -18.469 -6.635  1.00 51.45  1  187  LYS C NZ    1 
ATOM   7094  N N     . ILE C 1 191 ? 38.356  -18.593 1.207   1.00 59.29  ?  188  ILE C N     1 
ATOM   7095  C CA    . ILE C 1 191 ? 38.730  -17.880 2.423   1.00 66.16  ?  188  ILE C CA    1 
ATOM   7096  C C     . ILE C 1 191 ? 39.901  -16.947 2.136   1.00 69.29  ?  188  ILE C C     1 
ATOM   7097  O O     . ILE C 1 191 ? 40.666  -17.138 1.187   1.00 65.19  ?  188  ILE C O     1 
ATOM   7098  C CB    . ILE C 1 191 ? 39.090  -18.842 3.576   1.00 60.43  ?  188  ILE C CB    1 
ATOM   7099  C CG1   . ILE C 1 191 ? 40.327  -19.665 3.220   1.00 49.92  ?  188  ILE C CG1   1 
ATOM   7100  C CG2   . ILE C 1 191 ? 37.927  -19.765 3.892   1.00 58.14  ?  188  ILE C CG2   1 
ATOM   7101  C CD1   . ILE C 1 191 ? 40.794  -20.585 4.329   1.00 49.73  ?  188  ILE C CD1   1 
ATOM   7102  N N     . ASP C 1 192 ? 40.037  -15.928 2.989   1.00 69.90  ?  189  ASP C N     1 
ATOM   7103  C CA    . ASP C 1 192 ? 41.100  -14.934 2.878   1.00 70.28  ?  189  ASP C CA    1 
ATOM   7104  C C     . ASP C 1 192 ? 42.295  -15.359 3.717   1.00 64.57  ?  189  ASP C C     1 
ATOM   7105  O O     . ASP C 1 192 ? 42.157  -15.627 4.914   1.00 61.41  ?  189  ASP C O     1 
ATOM   7106  C CB    . ASP C 1 192 ? 40.607  -13.558 3.332   1.00 77.67  ?  189  ASP C CB    1 
ATOM   7107  C CG    . ASP C 1 192 ? 41.569  -12.432 2.970   1.00 77.24  ?  189  ASP C CG    1 
ATOM   7108  O OD1   . ASP C 1 192 ? 42.793  -12.677 2.866   1.00 73.78  ?  189  ASP C OD1   1 
ATOM   7109  O OD2   . ASP C 1 192 ? 41.097  -11.290 2.793   1.00 76.37  -1 189  ASP C OD2   1 
ATOM   7110  N N     . ILE C 1 193 ? 43.466  -15.399 3.090   1.00 63.64  ?  190  ILE C N     1 
ATOM   7111  C CA    . ILE C 1 193 ? 44.694  -15.743 3.791   1.00 62.08  ?  190  ILE C CA    1 
ATOM   7112  C C     . ILE C 1 193 ? 45.705  -14.609 3.661   1.00 66.26  ?  190  ILE C C     1 
ATOM   7113  O O     . ILE C 1 193 ? 45.457  -13.489 4.107   1.00 71.64  ?  190  ILE C O     1 
ATOM   7114  C CB    . ILE C 1 193 ? 45.281  -17.061 3.265   1.00 55.93  ?  190  ILE C CB    1 
ATOM   7115  C CG1   . ILE C 1 193 ? 44.243  -18.178 3.368   1.00 50.90  ?  190  ILE C CG1   1 
ATOM   7116  C CG2   . ILE C 1 193 ? 46.542  -17.427 4.035   1.00 51.02  ?  190  ILE C CG2   1 
ATOM   7117  C CD1   . ILE C 1 193 ? 43.751  -18.419 4.769   1.00 54.42  ?  190  ILE C CD1   1 
ATOM   7118  N N     . ASN C 1 196 ? 45.865  -10.153 1.235   1.00 55.04  ?  193  ASN C N     1 
ATOM   7119  C CA    . ASN C 1 196 ? 44.827  -10.136 0.211   1.00 63.75  ?  193  ASN C CA    1 
ATOM   7120  C C     . ASN C 1 196 ? 45.009  -11.303 -0.749  1.00 70.71  ?  193  ASN C C     1 
ATOM   7121  O O     . ASN C 1 196 ? 45.528  -11.133 -1.853  1.00 75.80  ?  193  ASN C O     1 
ATOM   7122  C CB    . ASN C 1 196 ? 44.846  -8.813  -0.556  1.00 59.83  ?  193  ASN C CB    1 
ATOM   7123  C CG    . ASN C 1 196 ? 43.730  -8.713  -1.579  1.00 69.79  ?  193  ASN C CG    1 
ATOM   7124  O OD1   . ASN C 1 196 ? 43.899  -9.085  -2.740  1.00 74.95  ?  193  ASN C OD1   1 
ATOM   7125  N ND2   . ASN C 1 196 ? 42.580  -8.207  -1.150  1.00 73.83  ?  193  ASN C ND2   1 
ATOM   7126  N N     . GLN C 1 197 ? 44.599  -12.497 -0.326  1.00 74.64  ?  194  GLN C N     1 
ATOM   7127  C CA    . GLN C 1 197 ? 44.736  -13.692 -1.155  1.00 72.27  ?  194  GLN C CA    1 
ATOM   7128  C C     . GLN C 1 197 ? 43.571  -14.625 -0.885  1.00 76.18  ?  194  GLN C C     1 
ATOM   7129  O O     . GLN C 1 197 ? 43.330  -14.996 0.266   1.00 83.19  ?  194  GLN C O     1 
ATOM   7130  C CB    . GLN C 1 197 ? 46.046  -14.433 -0.890  1.00 68.14  ?  194  GLN C CB    1 
ATOM   7131  C CG    . GLN C 1 197 ? 47.308  -13.664 -1.183  1.00 67.62  ?  194  GLN C CG    1 
ATOM   7132  C CD    . GLN C 1 197 ? 48.115  -13.381 0.070   1.00 69.21  ?  194  GLN C CD    1 
ATOM   7133  O OE1   . GLN C 1 197 ? 47.630  -12.722 0.991   1.00 76.37  ?  194  GLN C OE1   1 
ATOM   7134  N NE2   . GLN C 1 197 ? 49.339  -13.887 0.094   1.00 67.41  ?  194  GLN C NE2   1 
ATOM   7135  N N     . ILE C 1 198 ? 42.889  -15.028 -1.948  1.00 68.61  ?  195  ILE C N     1 
ATOM   7136  C CA    . ILE C 1 198 ? 41.795  -15.987 -1.878  1.00 56.74  ?  195  ILE C CA    1 
ATOM   7137  C C     . ILE C 1 198 ? 42.373  -17.382 -2.042  1.00 59.24  ?  195  ILE C C     1 
ATOM   7138  O O     . ILE C 1 198 ? 43.312  -17.587 -2.819  1.00 66.54  ?  195  ILE C O     1 
ATOM   7139  C CB    . ILE C 1 198 ? 40.742  -15.704 -2.967  1.00 61.81  ?  195  ILE C CB    1 
ATOM   7140  C CG1   . ILE C 1 198 ? 40.701  -14.213 -3.339  1.00 60.30  ?  195  ILE C CG1   1 
ATOM   7141  C CG2   . ILE C 1 198 ? 39.370  -16.225 -2.535  1.00 60.89  ?  195  ILE C CG2   1 
ATOM   7142  C CD1   . ILE C 1 198 ? 40.146  -13.298 -2.260  1.00 49.36  ?  195  ILE C CD1   1 
ATOM   7143  N N     . VAL C 1 199 ? 41.812  -18.353 -1.325  1.00 56.03  ?  196  VAL C N     1 
ATOM   7144  C CA    . VAL C 1 199 ? 42.197  -19.749 -1.505  1.00 52.05  ?  196  VAL C CA    1 
ATOM   7145  C C     . VAL C 1 199 ? 40.959  -20.625 -1.361  1.00 53.59  ?  196  VAL C C     1 
ATOM   7146  O O     . VAL C 1 199 ? 40.138  -20.418 -0.460  1.00 52.01  ?  196  VAL C O     1 
ATOM   7147  C CB    . VAL C 1 199 ? 43.311  -20.184 -0.526  1.00 46.13  ?  196  VAL C CB    1 
ATOM   7148  C CG1   . VAL C 1 199 ? 42.820  -20.225 0.903   1.00 50.13  ?  196  VAL C CG1   1 
ATOM   7149  C CG2   . VAL C 1 199 ? 43.887  -21.537 -0.932  1.00 50.86  ?  196  VAL C CG2   1 
ATOM   7150  N N     . GLU C 1 200 ? 40.805  -21.575 -2.280  1.00 50.76  ?  197  GLU C N     1 
ATOM   7151  C CA    . GLU C 1 200 ? 39.775  -22.596 -2.165  1.00 57.94  ?  197  GLU C CA    1 
ATOM   7152  C C     . GLU C 1 200 ? 40.263  -23.681 -1.220  1.00 63.72  ?  197  GLU C C     1 
ATOM   7153  O O     . GLU C 1 200 ? 41.412  -24.125 -1.312  1.00 66.71  ?  197  GLU C O     1 
ATOM   7154  C CB    . GLU C 1 200 ? 39.446  -23.186 -3.536  1.00 61.67  ?  197  GLU C CB    1 
ATOM   7155  C CG    . GLU C 1 200 ? 38.750  -22.207 -4.462  1.00 60.67  ?  197  GLU C CG    1 
ATOM   7156  C CD    . GLU C 1 200 ? 38.728  -22.664 -5.907  1.00 70.92  ?  197  GLU C CD    1 
ATOM   7157  O OE1   . GLU C 1 200 ? 38.952  -23.867 -6.161  1.00 74.17  ?  197  GLU C OE1   1 
ATOM   7158  O OE2   . GLU C 1 200 ? 38.492  -21.814 -6.792  1.00 70.40  -1 197  GLU C OE2   1 
ATOM   7159  N N     . VAL C 1 201 ? 39.401  -24.100 -0.306  1.00 65.65  ?  198  VAL C N     1 
ATOM   7160  C CA    . VAL C 1 201 ? 39.794  -25.036 0.738   1.00 61.28  ?  198  VAL C CA    1 
ATOM   7161  C C     . VAL C 1 201 ? 39.435  -26.449 0.305   1.00 53.36  ?  198  VAL C C     1 
ATOM   7162  O O     . VAL C 1 201 ? 38.461  -26.678 -0.423  1.00 57.74  ?  198  VAL C O     1 
ATOM   7163  C CB    . VAL C 1 201 ? 39.147  -24.674 2.095   1.00 53.47  ?  198  VAL C CB    1 
ATOM   7164  C CG1   . VAL C 1 201 ? 39.210  -23.170 2.325   1.00 49.70  ?  198  VAL C CG1   1 
ATOM   7165  C CG2   . VAL C 1 201 ? 37.716  -25.175 2.177   1.00 57.10  ?  198  VAL C CG2   1 
ATOM   7166  N N     . ALA C 1 202 ? 40.248  -27.410 0.744   1.00 58.98  ?  199  ALA C N     1 
ATOM   7167  C CA    . ALA C 1 202 ? 40.042  -28.812 0.400   1.00 55.36  ?  199  ALA C CA    1 
ATOM   7168  C C     . ALA C 1 202 ? 39.129  -29.530 1.381   1.00 51.47  ?  199  ALA C C     1 
ATOM   7169  O O     . ALA C 1 202 ? 38.387  -30.432 0.978   1.00 52.26  ?  199  ALA C O     1 
ATOM   7170  C CB    . ALA C 1 202 ? 41.386  -29.543 0.331   1.00 49.06  ?  199  ALA C CB    1 
ATOM   7171  N N     . TYR C 1 203 ? 39.164  -29.149 2.657   1.00 55.74  ?  200  TYR C N     1 
ATOM   7172  C CA    . TYR C 1 203 ? 38.299  -29.744 3.667   1.00 57.43  ?  200  TYR C CA    1 
ATOM   7173  C C     . TYR C 1 203 ? 37.349  -28.659 4.165   1.00 62.55  ?  200  TYR C C     1 
ATOM   7174  O O     . TYR C 1 203 ? 37.582  -28.071 5.230   1.00 63.50  ?  200  TYR C O     1 
ATOM   7175  C CB    . TYR C 1 203 ? 39.104  -30.341 4.834   1.00 59.98  ?  200  TYR C CB    1 
ATOM   7176  C CG    . TYR C 1 203 ? 40.275  -31.250 4.457   1.00 64.72  ?  200  TYR C CG    1 
ATOM   7177  C CD1   . TYR C 1 203 ? 41.370  -30.746 3.785   1.00 66.04  ?  200  TYR C CD1   1 
ATOM   7178  C CD2   . TYR C 1 203 ? 40.301  -32.597 4.810   1.00 69.00  ?  200  TYR C CD2   1 
ATOM   7179  C CE1   . TYR C 1 203 ? 42.446  -31.525 3.444   1.00 69.80  ?  200  TYR C CE1   1 
ATOM   7180  C CE2   . TYR C 1 203 ? 41.392  -33.403 4.467   1.00 74.19  ?  200  TYR C CE2   1 
ATOM   7181  C CZ    . TYR C 1 203 ? 42.461  -32.850 3.781   1.00 76.19  ?  200  TYR C CZ    1 
ATOM   7182  O OH    . TYR C 1 203 ? 43.559  -33.602 3.421   1.00 77.20  ?  200  TYR C OH    1 
ATOM   7183  N N     . PRO C 1 204 ? 36.279  -28.353 3.420   1.00 53.85  ?  201  PRO C N     1 
ATOM   7184  C CA    . PRO C 1 204 ? 35.339  -27.321 3.883   1.00 54.51  ?  201  PRO C CA    1 
ATOM   7185  C C     . PRO C 1 204 ? 34.531  -27.746 5.092   1.00 57.53  ?  201  PRO C C     1 
ATOM   7186  O O     . PRO C 1 204 ? 33.978  -26.880 5.780   1.00 60.31  ?  201  PRO C O     1 
ATOM   7187  C CB    . PRO C 1 204 ? 34.440  -27.094 2.663   1.00 44.44  ?  201  PRO C CB    1 
ATOM   7188  C CG    . PRO C 1 204 ? 34.462  -28.404 1.947   1.00 45.00  ?  201  PRO C CG    1 
ATOM   7189  C CD    . PRO C 1 204 ? 35.855  -28.951 2.142   1.00 49.18  ?  201  PRO C CD    1 
ATOM   7190  N N     . GLU C 1 205 ? 34.450  -29.049 5.373   1.00 53.31  ?  202  GLU C N     1 
ATOM   7191  C CA    . GLU C 1 205 ? 33.748  -29.528 6.557   1.00 49.75  ?  202  GLU C CA    1 
ATOM   7192  C C     . GLU C 1 205 ? 34.407  -29.068 7.852   1.00 44.04  ?  202  GLU C C     1 
ATOM   7193  O O     . GLU C 1 205 ? 33.762  -29.102 8.904   1.00 50.44  ?  202  GLU C O     1 
ATOM   7194  C CB    . GLU C 1 205 ? 33.661  -31.056 6.534   1.00 55.47  ?  202  GLU C CB    1 
ATOM   7195  C CG    . GLU C 1 205 ? 35.000  -31.778 6.681   1.00 67.76  ?  202  GLU C CG    1 
ATOM   7196  C CD    . GLU C 1 205 ? 35.803  -31.820 5.391   1.00 77.06  ?  202  GLU C CD    1 
ATOM   7197  O OE1   . GLU C 1 205 ? 35.377  -31.192 4.399   1.00 75.83  ?  202  GLU C OE1   1 
ATOM   7198  O OE2   . GLU C 1 205 ? 36.859  -32.488 5.368   1.00 80.09  -1 202  GLU C OE2   1 
ATOM   7199  N N     . ASN C 1 206 ? 35.669  -28.641 7.802   1.00 44.65  ?  203  ASN C N     1 
ATOM   7200  C CA    . ASN C 1 206 ? 36.380  -28.163 8.982   1.00 49.62  ?  203  ASN C CA    1 
ATOM   7201  C C     . ASN C 1 206 ? 36.121  -26.692 9.281   1.00 50.17  ?  203  ASN C C     1 
ATOM   7202  O O     . ASN C 1 206 ? 36.806  -26.123 10.138  1.00 53.87  ?  203  ASN C O     1 
ATOM   7203  C CB    . ASN C 1 206 ? 37.888  -28.387 8.824   1.00 43.36  ?  203  ASN C CB    1 
ATOM   7204  C CG    . ASN C 1 206 ? 38.278  -29.848 8.924   1.00 55.78  ?  203  ASN C CG    1 
ATOM   7205  O OD1   . ASN C 1 206 ? 37.479  -30.690 9.337   1.00 57.39  ?  203  ASN C OD1   1 
ATOM   7206  N ND2   . ASN C 1 206 ? 39.518  -30.155 8.559   1.00 59.04  ?  203  ASN C ND2   1 
ATOM   7207  N N     . TYR C 1 207 ? 35.159  -26.064 8.609   1.00 47.76  ?  204  TYR C N     1 
ATOM   7208  C CA    . TYR C 1 207 ? 34.931  -24.630 8.726   1.00 43.81  ?  204  TYR C CA    1 
ATOM   7209  C C     . TYR C 1 207 ? 33.505  -24.355 9.184   1.00 42.24  ?  204  TYR C C     1 
ATOM   7210  O O     . TYR C 1 207 ? 32.545  -24.823 8.563   1.00 41.19  ?  204  TYR C O     1 
ATOM   7211  C CB    . TYR C 1 207 ? 35.203  -23.925 7.394   1.00 48.93  ?  204  TYR C CB    1 
ATOM   7212  C CG    . TYR C 1 207 ? 36.664  -23.916 6.999   1.00 52.29  ?  204  TYR C CG    1 
ATOM   7213  C CD1   . TYR C 1 207 ? 37.242  -25.016 6.377   1.00 49.91  ?  204  TYR C CD1   1 
ATOM   7214  C CD2   . TYR C 1 207 ? 37.465  -22.810 7.250   1.00 47.35  ?  204  TYR C CD2   1 
ATOM   7215  C CE1   . TYR C 1 207 ? 38.576  -25.014 6.017   1.00 48.40  ?  204  TYR C CE1   1 
ATOM   7216  C CE2   . TYR C 1 207 ? 38.800  -22.799 6.892   1.00 45.57  ?  204  TYR C CE2   1 
ATOM   7217  C CZ    . TYR C 1 207 ? 39.350  -23.903 6.276   1.00 47.82  ?  204  TYR C CZ    1 
ATOM   7218  O OH    . TYR C 1 207 ? 40.679  -23.897 5.918   1.00 48.43  ?  204  TYR C OH    1 
ATOM   7219  N N     . LEU C 1 208 ? 33.377  -23.590 10.264  1.00 40.51  ?  205  LEU C N     1 
ATOM   7220  C CA    . LEU C 1 208 ? 32.099  -23.120 10.772  1.00 42.50  ?  205  LEU C CA    1 
ATOM   7221  C C     . LEU C 1 208 ? 32.075  -21.598 10.747  1.00 38.57  ?  205  LEU C C     1 
ATOM   7222  O O     . LEU C 1 208 ? 33.120  -20.943 10.739  1.00 39.84  ?  205  LEU C O     1 
ATOM   7223  C CB    . LEU C 1 208 ? 31.847  -23.612 12.204  1.00 33.83  ?  205  LEU C CB    1 
ATOM   7224  C CG    . LEU C 1 208 ? 31.808  -25.119 12.468  1.00 36.90  ?  205  LEU C CG    1 
ATOM   7225  C CD1   . LEU C 1 208 ? 31.802  -25.394 13.964  1.00 34.56  ?  205  LEU C CD1   1 
ATOM   7226  C CD2   . LEU C 1 208 ? 30.596  -25.750 11.805  1.00 40.79  ?  205  LEU C CD2   1 
ATOM   7227  N N     . PHE C 1 209 ? 30.868  -21.038 10.741  1.00 35.57  ?  206  PHE C N     1 
ATOM   7228  C CA    . PHE C 1 209 ? 30.689  -19.595 10.836  1.00 38.11  ?  206  PHE C CA    1 
ATOM   7229  C C     . PHE C 1 209 ? 30.711  -19.177 12.299  1.00 38.78  ?  206  PHE C C     1 
ATOM   7230  O O     . PHE C 1 209 ? 30.043  -19.791 13.135  1.00 35.60  ?  206  PHE C O     1 
ATOM   7231  C CB    . PHE C 1 209 ? 29.376  -19.158 10.185  1.00 40.13  ?  206  PHE C CB    1 
ATOM   7232  C CG    . PHE C 1 209 ? 29.450  -19.035 8.692   1.00 40.05  ?  206  PHE C CG    1 
ATOM   7233  C CD1   . PHE C 1 209 ? 30.038  -17.928 8.109   1.00 40.35  ?  206  PHE C CD1   1 
ATOM   7234  C CD2   . PHE C 1 209 ? 28.928  -20.022 7.871   1.00 36.58  ?  206  PHE C CD2   1 
ATOM   7235  C CE1   . PHE C 1 209 ? 30.109  -17.805 6.736   1.00 43.20  ?  206  PHE C CE1   1 
ATOM   7236  C CE2   . PHE C 1 209 ? 28.995  -19.902 6.494   1.00 33.15  ?  206  PHE C CE2   1 
ATOM   7237  C CZ    . PHE C 1 209 ? 29.589  -18.796 5.929   1.00 35.36  ?  206  PHE C CZ    1 
ATOM   7238  N N     . ASN C 1 210 ? 31.478  -18.134 12.602  1.00 40.23  ?  207  ASN C N     1 
ATOM   7239  C CA    . ASN C 1 210 ? 31.579  -17.588 13.948  1.00 38.49  ?  207  ASN C CA    1 
ATOM   7240  C C     . ASN C 1 210 ? 30.787  -16.288 14.015  1.00 41.04  ?  207  ASN C C     1 
ATOM   7241  O O     . ASN C 1 210 ? 30.946  -15.416 13.154  1.00 49.37  ?  207  ASN C O     1 
ATOM   7242  C CB    . ASN C 1 210 ? 33.041  -17.348 14.330  1.00 45.01  ?  207  ASN C CB    1 
ATOM   7243  C CG    . ASN C 1 210 ? 33.210  -16.964 15.788  1.00 54.28  ?  207  ASN C CG    1 
ATOM   7244  O OD1   . ASN C 1 210 ? 32.417  -17.357 16.645  1.00 44.52  ?  207  ASN C OD1   1 
ATOM   7245  N ND2   . ASN C 1 210 ? 34.250  -16.189 16.077  1.00 61.84  ?  207  ASN C ND2   1 
ATOM   7246  N N     . PHE C 1 211 ? 29.936  -16.164 15.029  1.00 34.31  ?  208  PHE C N     1 
ATOM   7247  C CA    . PHE C 1 211 ? 29.028  -15.032 15.162  1.00 39.93  ?  208  PHE C CA    1 
ATOM   7248  C C     . PHE C 1 211 ? 29.422  -14.197 16.372  1.00 46.00  ?  208  PHE C C     1 
ATOM   7249  O O     . PHE C 1 211 ? 29.462  -14.704 17.498  1.00 43.60  ?  208  PHE C O     1 
ATOM   7250  C CB    . PHE C 1 211 ? 27.580  -15.504 15.288  1.00 35.28  ?  208  PHE C CB    1 
ATOM   7251  C CG    . PHE C 1 211 ? 27.092  -16.273 14.098  1.00 45.06  ?  208  PHE C CG    1 
ATOM   7252  C CD1   . PHE C 1 211 ? 26.678  -15.612 12.953  1.00 39.84  ?  208  PHE C CD1   1 
ATOM   7253  C CD2   . PHE C 1 211 ? 27.048  -17.656 14.120  1.00 42.30  ?  208  PHE C CD2   1 
ATOM   7254  C CE1   . PHE C 1 211 ? 26.230  -16.316 11.853  1.00 42.60  ?  208  PHE C CE1   1 
ATOM   7255  C CE2   . PHE C 1 211 ? 26.598  -18.366 13.023  1.00 52.18  ?  208  PHE C CE2   1 
ATOM   7256  C CZ    . PHE C 1 211 ? 26.189  -17.694 11.888  1.00 46.10  ?  208  PHE C CZ    1 
ATOM   7257  N N     . THR C 1 212 ? 29.703  -12.922 16.134  1.00 48.50  ?  209  THR C N     1 
ATOM   7258  C CA    . THR C 1 212 ? 29.960  -11.975 17.204  1.00 55.89  ?  209  THR C CA    1 
ATOM   7259  C C     . THR C 1 212 ? 28.653  -11.313 17.632  1.00 52.86  ?  209  THR C C     1 
ATOM   7260  O O     . THR C 1 212 ? 27.603  -11.490 17.008  1.00 45.73  ?  209  THR C O     1 
ATOM   7261  C CB    . THR C 1 212 ? 30.971  -10.920 16.756  1.00 52.44  ?  209  THR C CB    1 
ATOM   7262  O OG1   . THR C 1 212 ? 30.323  -9.972  15.899  1.00 45.73  ?  209  THR C OG1   1 
ATOM   7263  C CG2   . THR C 1 212 ? 32.114  -11.574 15.994  1.00 50.01  ?  209  THR C CG2   1 
ATOM   7264  N N     . THR C 1 213 ? 28.724  -10.543 18.722  1.00 47.04  ?  210  THR C N     1 
ATOM   7265  C CA    . THR C 1 213 ? 27.558  -9.778  19.150  1.00 51.88  ?  210  THR C CA    1 
ATOM   7266  C C     . THR C 1 213 ? 27.120  -8.796  18.071  1.00 51.88  ?  210  THR C C     1 
ATOM   7267  O O     . THR C 1 213 ? 25.930  -8.481  17.960  1.00 52.67  ?  210  THR C O     1 
ATOM   7268  C CB    . THR C 1 213 ? 27.857  -9.040  20.458  1.00 50.22  ?  210  THR C CB    1 
ATOM   7269  O OG1   . THR C 1 213 ? 28.510  -9.928  21.373  1.00 49.60  ?  210  THR C OG1   1 
ATOM   7270  C CG2   . THR C 1 213 ? 26.570  -8.541  21.095  1.00 47.10  ?  210  THR C CG2   1 
ATOM   7271  N N     . ARG C 1 214 ? 28.065  -8.319  17.258  1.00 49.43  ?  211  ARG C N     1 
ATOM   7272  C CA    . ARG C 1 214 ? 27.719  -7.438  16.149  1.00 48.22  ?  211  ARG C CA    1 
ATOM   7273  C C     . ARG C 1 214 ? 26.893  -8.173  15.101  1.00 47.64  ?  211  ARG C C     1 
ATOM   7274  O O     . ARG C 1 214 ? 25.855  -7.672  14.650  1.00 51.10  ?  211  ARG C O     1 
ATOM   7275  C CB    . ARG C 1 214 ? 28.991  -6.858  15.532  1.00 56.23  ?  211  ARG C CB    1 
ATOM   7276  C CG    . ARG C 1 214 ? 28.766  -6.076  14.252  1.00 63.45  ?  211  ARG C CG    1 
ATOM   7277  C CD    . ARG C 1 214 ? 27.882  -4.856  14.474  1.00 70.20  ?  211  ARG C CD    1 
ATOM   7278  N NE    . ARG C 1 214 ? 28.565  -3.793  15.205  1.00 74.25  ?  211  ARG C NE    1 
ATOM   7279  C CZ    . ARG C 1 214 ? 29.608  -3.116  14.735  1.00 71.97  ?  211  ARG C CZ    1 
ATOM   7280  N NH1   . ARG C 1 214 ? 30.103  -3.406  13.539  1.00 69.14  1  211  ARG C NH1   1 
ATOM   7281  N NH2   . ARG C 1 214 ? 30.164  -2.158  15.463  1.00 69.71  ?  211  ARG C NH2   1 
ATOM   7282  N N     . ASP C 1 215 ? 27.339  -9.366  14.697  1.00 51.96  ?  212  ASP C N     1 
ATOM   7283  C CA    . ASP C 1 215 ? 26.551  -10.173 13.772  1.00 41.31  ?  212  ASP C CA    1 
ATOM   7284  C C     . ASP C 1 215 ? 25.196  -10.537 14.367  1.00 48.95  ?  212  ASP C C     1 
ATOM   7285  O O     . ASP C 1 215 ? 24.200  -10.618 13.640  1.00 52.19  ?  212  ASP C O     1 
ATOM   7286  C CB    . ASP C 1 215 ? 27.317  -11.441 13.396  1.00 43.41  ?  212  ASP C CB    1 
ATOM   7287  C CG    . ASP C 1 215 ? 28.692  -11.147 12.831  1.00 55.79  ?  212  ASP C CG    1 
ATOM   7288  O OD1   . ASP C 1 215 ? 28.791  -10.334 11.888  1.00 60.11  ?  212  ASP C OD1   1 
ATOM   7289  O OD2   . ASP C 1 215 ? 29.677  -11.727 13.335  1.00 62.71  -1 212  ASP C OD2   1 
ATOM   7290  N N     . ALA C 1 216 ? 25.141  -10.757 15.682  1.00 51.39  ?  213  ALA C N     1 
ATOM   7291  C CA    . ALA C 1 216 ? 23.872  -11.069 16.330  1.00 57.90  ?  213  ALA C CA    1 
ATOM   7292  C C     . ALA C 1 216 ? 22.889  -9.911  16.204  1.00 51.87  ?  213  ALA C C     1 
ATOM   7293  O O     . ALA C 1 216 ? 21.686  -10.126 16.011  1.00 43.98  ?  213  ALA C O     1 
ATOM   7294  C CB    . ALA C 1 216 ? 24.110  -11.425 17.797  1.00 56.44  ?  213  ALA C CB    1 
ATOM   7295  N N     . GLU C 1 217 ? 23.382  -8.674  16.309  1.00 45.29  ?  214  GLU C N     1 
ATOM   7296  C CA    . GLU C 1 217 ? 22.537  -7.518  16.024  1.00 47.03  ?  214  GLU C CA    1 
ATOM   7297  C C     . GLU C 1 217 ? 22.073  -7.528  14.575  1.00 40.96  ?  214  GLU C C     1 
ATOM   7298  O O     . GLU C 1 217 ? 20.899  -7.266  14.286  1.00 39.27  ?  214  GLU C O     1 
ATOM   7299  C CB    . GLU C 1 217 ? 23.291  -6.221  16.323  1.00 50.21  ?  214  GLU C CB    1 
ATOM   7300  C CG    . GLU C 1 217 ? 23.744  -6.057  17.761  1.00 55.49  ?  214  GLU C CG    1 
ATOM   7301  C CD    . GLU C 1 217 ? 24.495  -4.756  17.981  1.00 59.33  ?  214  GLU C CD    1 
ATOM   7302  O OE1   . GLU C 1 217 ? 25.147  -4.275  17.030  1.00 68.59  ?  214  GLU C OE1   1 
ATOM   7303  O OE2   . GLU C 1 217 ? 24.428  -4.210  19.102  1.00 59.62  -1 214  GLU C OE2   1 
ATOM   7304  N N     . LYS C 1 218 ? 22.983  -7.836  13.650  1.00 44.32  ?  215  LYS C N     1 
ATOM   7305  C CA    . LYS C 1 218 ? 22.653  -7.795  12.229  1.00 43.75  ?  215  LYS C CA    1 
ATOM   7306  C C     . LYS C 1 218 ? 21.630  -8.864  11.867  1.00 44.13  ?  215  LYS C C     1 
ATOM   7307  O O     . LYS C 1 218 ? 20.649  -8.586  11.167  1.00 48.16  ?  215  LYS C O     1 
ATOM   7308  C CB    . LYS C 1 218 ? 23.925  -7.961  11.399  1.00 46.57  ?  215  LYS C CB    1 
ATOM   7309  C CG    . LYS C 1 218 ? 23.697  -8.163  9.909   1.00 54.88  ?  215  LYS C CG    1 
ATOM   7310  C CD    . LYS C 1 218 ? 25.028  -8.329  9.193   1.00 58.01  ?  215  LYS C CD    1 
ATOM   7311  C CE    . LYS C 1 218 ? 25.930  -7.136  9.460   1.00 58.25  ?  215  LYS C CE    1 
ATOM   7312  N NZ    . LYS C 1 218 ? 27.365  -7.466  9.253   1.00 61.69  1  215  LYS C NZ    1 
ATOM   7313  N N     . TYR C 1 219 ? 21.839  -10.092 12.332  1.00 43.64  ?  216  TYR C N     1 
ATOM   7314  C CA    . TYR C 1 219 ? 20.956  -11.199 11.994  1.00 43.11  ?  216  TYR C CA    1 
ATOM   7315  C C     . TYR C 1 219 ? 19.843  -11.403 13.015  1.00 44.96  ?  216  TYR C C     1 
ATOM   7316  O O     . TYR C 1 219 ? 19.055  -12.344 12.871  1.00 46.30  ?  216  TYR C O     1 
ATOM   7317  C CB    . TYR C 1 219 ? 21.775  -12.481 11.818  1.00 45.98  ?  216  TYR C CB    1 
ATOM   7318  C CG    . TYR C 1 219 ? 22.852  -12.336 10.762  1.00 56.66  ?  216  TYR C CG    1 
ATOM   7319  C CD1   . TYR C 1 219 ? 22.528  -12.294 9.412   1.00 60.41  ?  216  TYR C CD1   1 
ATOM   7320  C CD2   . TYR C 1 219 ? 24.191  -12.226 11.115  1.00 64.35  ?  216  TYR C CD2   1 
ATOM   7321  C CE1   . TYR C 1 219 ? 23.509  -12.153 8.443   1.00 64.25  ?  216  TYR C CE1   1 
ATOM   7322  C CE2   . TYR C 1 219 ? 25.177  -12.083 10.155  1.00 68.60  ?  216  TYR C CE2   1 
ATOM   7323  C CZ    . TYR C 1 219 ? 24.832  -12.048 8.822   1.00 67.98  ?  216  TYR C CZ    1 
ATOM   7324  O OH    . TYR C 1 219 ? 25.814  -11.908 7.867   1.00 71.15  ?  216  TYR C OH    1 
ATOM   7325  N N     . GLY C 1 220 ? 19.762  -10.555 14.037  1.00 52.86  ?  217  GLY C N     1 
ATOM   7326  C CA    . GLY C 1 220 ? 18.549  -10.425 14.817  1.00 55.53  ?  217  GLY C CA    1 
ATOM   7327  C C     . GLY C 1 220 ? 18.424  -11.288 16.052  1.00 55.94  ?  217  GLY C C     1 
ATOM   7328  O O     . GLY C 1 220 ? 17.322  -11.377 16.606  1.00 62.78  ?  217  GLY C O     1 
ATOM   7329  N N     . PHE C 1 221 ? 19.502  -11.923 16.510  1.00 49.70  ?  218  PHE C N     1 
ATOM   7330  C CA    . PHE C 1 221 ? 19.457  -12.696 17.746  1.00 48.94  ?  218  PHE C CA    1 
ATOM   7331  C C     . PHE C 1 221 ? 20.347  -12.100 18.833  1.00 47.97  ?  218  PHE C C     1 
ATOM   7332  O O     . PHE C 1 221 ? 20.770  -12.815 19.747  1.00 50.74  ?  218  PHE C O     1 
ATOM   7333  C CB    . PHE C 1 221 ? 19.822  -14.161 17.484  1.00 53.13  ?  218  PHE C CB    1 
ATOM   7334  C CG    . PHE C 1 221 ? 21.135  -14.358 16.776  1.00 46.71  ?  218  PHE C CG    1 
ATOM   7335  C CD1   . PHE C 1 221 ? 21.200  -14.352 15.393  1.00 47.90  ?  218  PHE C CD1   1 
ATOM   7336  C CD2   . PHE C 1 221 ? 22.297  -14.584 17.494  1.00 49.38  ?  218  PHE C CD2   1 
ATOM   7337  C CE1   . PHE C 1 221 ? 22.404  -14.546 14.740  1.00 47.40  ?  218  PHE C CE1   1 
ATOM   7338  C CE2   . PHE C 1 221 ? 23.504  -14.781 16.845  1.00 46.71  ?  218  PHE C CE2   1 
ATOM   7339  C CZ    . PHE C 1 221 ? 23.556  -14.761 15.467  1.00 44.78  ?  218  PHE C CZ    1 
ATOM   7340  N N     . SER C 1 222 ? 20.621  -10.795 18.760  1.00 43.84  ?  219  SER C N     1 
ATOM   7341  C CA    . SER C 1 222 ? 21.432  -10.135 19.777  1.00 44.03  ?  219  SER C CA    1 
ATOM   7342  C C     . SER C 1 222 ? 20.776  -10.152 21.150  1.00 51.65  ?  219  SER C C     1 
ATOM   7343  O O     . SER C 1 222 ? 21.480  -10.047 22.161  1.00 53.56  ?  219  SER C O     1 
ATOM   7344  C CB    . SER C 1 222 ? 21.716  -8.691  19.362  1.00 43.81  ?  219  SER C CB    1 
ATOM   7345  O OG    . SER C 1 222 ? 20.514  -8.016  19.033  1.00 48.71  ?  219  SER C OG    1 
ATOM   7346  N N     . LYS C 1 223 ? 19.449  -10.277 21.212  1.00 50.39  ?  220  LYS C N     1 
ATOM   7347  C CA    . LYS C 1 223 ? 18.765  -10.272 22.501  1.00 52.78  ?  220  LYS C CA    1 
ATOM   7348  C C     . LYS C 1 223 ? 19.107  -11.519 23.310  1.00 44.64  ?  220  LYS C C     1 
ATOM   7349  O O     . LYS C 1 223 ? 19.426  -11.429 24.501  1.00 41.88  ?  220  LYS C O     1 
ATOM   7350  C CB    . LYS C 1 223 ? 17.257  -10.153 22.285  1.00 58.44  ?  220  LYS C CB    1 
ATOM   7351  C CG    . LYS C 1 223 ? 16.416  -10.313 23.536  1.00 59.92  ?  220  LYS C CG    1 
ATOM   7352  C CD    . LYS C 1 223 ? 14.950  -10.060 23.221  1.00 57.02  ?  220  LYS C CD    1 
ATOM   7353  C CE    . LYS C 1 223 ? 14.038  -10.921 24.079  1.00 53.94  ?  220  LYS C CE    1 
ATOM   7354  N NZ    . LYS C 1 223 ? 14.194  -10.626 25.526  1.00 53.01  1  220  LYS C NZ    1 
ATOM   7355  N N     . GLU C 1 224 ? 19.049  -12.694 22.678  1.00 43.00  ?  221  GLU C N     1 
ATOM   7356  C CA    . GLU C 1 224 ? 19.412  -13.918 23.383  1.00 48.38  ?  221  GLU C CA    1 
ATOM   7357  C C     . GLU C 1 224 ? 20.895  -13.932 23.737  1.00 54.35  ?  221  GLU C C     1 
ATOM   7358  O O     . GLU C 1 224 ? 21.277  -14.478 24.779  1.00 49.28  ?  221  GLU C O     1 
ATOM   7359  C CB    . GLU C 1 224 ? 19.045  -15.142 22.542  1.00 46.91  ?  221  GLU C CB    1 
ATOM   7360  C CG    . GLU C 1 224 ? 18.884  -16.422 23.353  1.00 41.32  ?  221  GLU C CG    1 
ATOM   7361  C CD    . GLU C 1 224 ? 18.499  -17.618 22.503  1.00 45.92  ?  221  GLU C CD    1 
ATOM   7362  O OE1   . GLU C 1 224 ? 18.447  -18.742 23.045  1.00 54.71  ?  221  GLU C OE1   1 
ATOM   7363  O OE2   . GLU C 1 224 ? 18.251  -17.437 21.292  1.00 44.66  -1 221  GLU C OE2   1 
ATOM   7364  N N     . VAL C 1 225 ? 21.737  -13.322 22.896  1.00 66.04  ?  222  VAL C N     1 
ATOM   7365  C CA    . VAL C 1 225 ? 23.165  -13.227 23.196  1.00 65.21  ?  222  VAL C CA    1 
ATOM   7366  C C     . VAL C 1 225 ? 23.390  -12.421 24.470  1.00 70.29  ?  222  VAL C C     1 
ATOM   7367  O O     . VAL C 1 225 ? 24.176  -12.815 25.341  1.00 66.48  ?  222  VAL C O     1 
ATOM   7368  C CB    . VAL C 1 225 ? 23.921  -12.620 21.998  1.00 48.65  ?  222  VAL C CB    1 
ATOM   7369  C CG1   . VAL C 1 225 ? 25.331  -12.212 22.399  1.00 40.95  ?  222  VAL C CG1   1 
ATOM   7370  C CG2   . VAL C 1 225 ? 23.959  -13.607 20.838  1.00 36.96  ?  222  VAL C CG2   1 
ATOM   7371  N N     . HIS C 1 226 ? 22.695  -11.286 24.605  1.00 65.34  ?  223  HIS C N     1 
ATOM   7372  C CA    . HIS C 1 226 ? 22.848  -10.459 25.799  1.00 67.67  ?  223  HIS C CA    1 
ATOM   7373  C C     . HIS C 1 226 ? 22.352  -11.182 27.045  1.00 66.73  ?  223  HIS C C     1 
ATOM   7374  O O     . HIS C 1 226 ? 23.003  -11.140 28.095  1.00 67.20  ?  223  HIS C O     1 
ATOM   7375  C CB    . HIS C 1 226 ? 22.111  -9.133  25.620  1.00 64.38  ?  223  HIS C CB    1 
ATOM   7376  C CG    . HIS C 1 226 ? 22.655  -8.282  24.515  1.00 62.46  ?  223  HIS C CG    1 
ATOM   7377  N ND1   . HIS C 1 226 ? 21.891  -7.881  23.440  1.00 64.30  ?  223  HIS C ND1   1 
ATOM   7378  C CD2   . HIS C 1 226 ? 23.884  -7.750  24.321  1.00 61.22  ?  223  HIS C CD2   1 
ATOM   7379  C CE1   . HIS C 1 226 ? 22.628  -7.144  22.628  1.00 65.96  ?  223  HIS C CE1   1 
ATOM   7380  N NE2   . HIS C 1 226 ? 23.841  -7.048  23.140  1.00 63.90  ?  223  HIS C NE2   1 
ATOM   7381  N N     . GLU C 1 227 ? 21.199  -11.846 26.951  1.00 68.58  ?  224  GLU C N     1 
ATOM   7382  C CA    . GLU C 1 227 ? 20.684  -12.591 28.095  1.00 71.87  ?  224  GLU C CA    1 
ATOM   7383  C C     . GLU C 1 227 ? 21.657  -13.682 28.526  1.00 70.92  ?  224  GLU C C     1 
ATOM   7384  O O     . GLU C 1 227 ? 21.830  -13.937 29.725  1.00 72.83  ?  224  GLU C O     1 
ATOM   7385  C CB    . GLU C 1 227 ? 19.326  -13.195 27.752  1.00 72.88  ?  224  GLU C CB    1 
ATOM   7386  C CG    . GLU C 1 227 ? 18.232  -12.171 27.486  1.00 68.56  ?  224  GLU C CG    1 
ATOM   7387  C CD    . GLU C 1 227 ? 16.963  -12.802 26.940  1.00 70.45  ?  224  GLU C CD    1 
ATOM   7388  O OE1   . GLU C 1 227 ? 17.004  -13.987 26.537  1.00 63.17  ?  224  GLU C OE1   1 
ATOM   7389  O OE2   . GLU C 1 227 ? 15.922  -12.113 26.911  1.00 78.10  -1 224  GLU C OE2   1 
ATOM   7390  N N     . ILE C 1 228 ? 22.294  -14.343 27.557  1.00 70.85  ?  225  ILE C N     1 
ATOM   7391  C CA    . ILE C 1 228 ? 23.248  -15.402 27.877  1.00 71.79  ?  225  ILE C CA    1 
ATOM   7392  C C     . ILE C 1 228 ? 24.448  -14.829 28.621  1.00 72.21  ?  225  ILE C C     1 
ATOM   7393  O O     . ILE C 1 228 ? 24.890  -15.378 29.637  1.00 71.56  ?  225  ILE C O     1 
ATOM   7394  C CB    . ILE C 1 228 ? 23.673  -16.144 26.598  1.00 58.76  ?  225  ILE C CB    1 
ATOM   7395  C CG1   . ILE C 1 228 ? 22.532  -17.033 26.098  1.00 48.91  ?  225  ILE C CG1   1 
ATOM   7396  C CG2   . ILE C 1 228 ? 24.934  -16.965 26.840  1.00 55.86  ?  225  ILE C CG2   1 
ATOM   7397  C CD1   . ILE C 1 228 ? 22.731  -17.546 24.691  1.00 45.02  ?  225  ILE C CD1   1 
ATOM   7398  N N     . TYR C 1 229 ? 24.985  -13.706 28.135  1.00 68.36  ?  226  TYR C N     1 
ATOM   7399  C CA    . TYR C 1 229 ? 26.153  -13.113 28.781  1.00 70.51  ?  226  TYR C CA    1 
ATOM   7400  C C     . TYR C 1 229 ? 25.818  -12.533 30.149  1.00 77.60  ?  226  TYR C C     1 
ATOM   7401  O O     . TYR C 1 229 ? 26.689  -12.474 31.024  1.00 79.83  ?  226  TYR C O     1 
ATOM   7402  C CB    . TYR C 1 229 ? 26.765  -12.033 27.891  1.00 65.30  ?  226  TYR C CB    1 
ATOM   7403  C CG    . TYR C 1 229 ? 27.885  -12.540 27.017  1.00 60.54  ?  226  TYR C CG    1 
ATOM   7404  C CD1   . TYR C 1 229 ? 29.059  -13.021 27.577  1.00 60.13  ?  226  TYR C CD1   1 
ATOM   7405  C CD2   . TYR C 1 229 ? 27.771  -12.534 25.633  1.00 58.05  ?  226  TYR C CD2   1 
ATOM   7406  C CE1   . TYR C 1 229 ? 30.088  -13.487 26.786  1.00 62.51  ?  226  TYR C CE1   1 
ATOM   7407  C CE2   . TYR C 1 229 ? 28.794  -12.997 24.832  1.00 59.65  ?  226  TYR C CE2   1 
ATOM   7408  C CZ    . TYR C 1 229 ? 29.952  -13.473 25.413  1.00 65.35  ?  226  TYR C CZ    1 
ATOM   7409  O OH    . TYR C 1 229 ? 30.975  -13.935 24.619  1.00 68.46  ?  226  TYR C OH    1 
ATOM   7410  N N     . LYS C 1 230 ? 24.577  -12.099 30.353  1.00 72.60  ?  227  LYS C N     1 
ATOM   7411  C CA    . LYS C 1 230 ? 24.181  -11.524 31.630  1.00 69.63  ?  227  LYS C CA    1 
ATOM   7412  C C     . LYS C 1 230 ? 23.772  -12.577 32.650  1.00 69.33  ?  227  LYS C C     1 
ATOM   7413  O O     . LYS C 1 230 ? 23.983  -12.377 33.852  1.00 73.50  ?  227  LYS C O     1 
ATOM   7414  C CB    . LYS C 1 230 ? 23.031  -10.532 31.424  1.00 68.70  ?  227  LYS C CB    1 
ATOM   7415  C CG    . LYS C 1 230 ? 22.488  -9.914  32.704  1.00 64.44  ?  227  LYS C CG    1 
ATOM   7416  C CD    . LYS C 1 230 ? 21.385  -8.912  32.407  1.00 64.12  ?  227  LYS C CD    1 
ATOM   7417  C CE    . LYS C 1 230 ? 20.646  -8.507  33.674  1.00 59.77  ?  227  LYS C CE    1 
ATOM   7418  N NZ    . LYS C 1 230 ? 19.882  -9.649  34.255  1.00 58.10  1  227  LYS C NZ    1 
ATOM   7419  N N     . ASN C 1 231 ? 23.212  -13.700 32.206  1.00 66.00  ?  228  ASN C N     1 
ATOM   7420  C CA    . ASN C 1 231 ? 22.641  -14.690 33.112  1.00 60.27  ?  228  ASN C CA    1 
ATOM   7421  C C     . ASN C 1 231 ? 23.379  -16.021 33.124  1.00 61.66  ?  228  ASN C C     1 
ATOM   7422  O O     . ASN C 1 231 ? 23.534  -16.618 34.191  1.00 64.30  ?  228  ASN C O     1 
ATOM   7423  C CB    . ASN C 1 231 ? 21.170  -14.935 32.758  1.00 62.44  ?  228  ASN C CB    1 
ATOM   7424  C CG    . ASN C 1 231 ? 20.330  -13.673 32.859  1.00 67.04  ?  228  ASN C CG    1 
ATOM   7425  O OD1   . ASN C 1 231 ? 20.656  -12.756 33.614  1.00 73.95  ?  228  ASN C OD1   1 
ATOM   7426  N ND2   . ASN C 1 231 ? 19.243  -13.622 32.098  1.00 61.82  ?  228  ASN C ND2   1 
ATOM   7427  N N     . LYS C 1 232 ? 23.839  -16.509 31.973  1.00 64.29  ?  229  LYS C N     1 
ATOM   7428  C CA    . LYS C 1 232 ? 24.446  -17.831 31.882  1.00 61.58  ?  229  LYS C CA    1 
ATOM   7429  C C     . LYS C 1 232 ? 25.966  -17.804 31.983  1.00 68.82  ?  229  LYS C C     1 
ATOM   7430  O O     . LYS C 1 232 ? 26.610  -18.818 31.693  1.00 73.57  ?  229  LYS C O     1 
ATOM   7431  C CB    . LYS C 1 232 ? 24.022  -18.516 30.582  1.00 60.07  ?  229  LYS C CB    1 
ATOM   7432  C CG    . LYS C 1 232 ? 22.566  -18.948 30.564  1.00 63.95  ?  229  LYS C CG    1 
ATOM   7433  C CD    . LYS C 1 232 ? 22.219  -19.687 29.282  1.00 62.23  ?  229  LYS C CD    1 
ATOM   7434  C CE    . LYS C 1 232 ? 20.744  -20.050 29.243  1.00 62.64  ?  229  LYS C CE    1 
ATOM   7435  N NZ    . LYS C 1 232 ? 20.261  -20.223 27.845  1.00 62.90  1  229  LYS C NZ    1 
ATOM   7436  N N     . VAL C 1 233 ? 26.555  -16.681 32.385  1.00 62.52  ?  230  VAL C N     1 
ATOM   7437  C CA    . VAL C 1 233 ? 28.004  -16.619 32.567  1.00 60.80  ?  230  VAL C CA    1 
ATOM   7438  C C     . VAL C 1 233 ? 28.398  -16.958 34.000  1.00 65.26  ?  230  VAL C C     1 
ATOM   7439  O O     . VAL C 1 233 ? 29.404  -17.636 34.227  1.00 63.27  ?  230  VAL C O     1 
ATOM   7440  C CB    . VAL C 1 233 ? 28.534  -15.236 32.138  1.00 54.13  ?  230  VAL C CB    1 
ATOM   7441  C CG1   . VAL C 1 233 ? 29.940  -15.006 32.667  1.00 50.58  ?  230  VAL C CG1   1 
ATOM   7442  C CG2   . VAL C 1 233 ? 28.527  -15.126 30.625  1.00 47.59  ?  230  VAL C CG2   1 
ATOM   7443  N N     . PHE C 1 234 ? 27.612  -16.511 34.984  1.00 65.78  ?  231  PHE C N     1 
ATOM   7444  C CA    . PHE C 1 234 ? 27.891  -16.890 36.366  1.00 58.34  ?  231  PHE C CA    1 
ATOM   7445  C C     . PHE C 1 234 ? 27.767  -18.393 36.568  1.00 53.63  ?  231  PHE C C     1 
ATOM   7446  O O     . PHE C 1 234 ? 28.480  -18.969 37.398  1.00 55.46  ?  231  PHE C O     1 
ATOM   7447  C CB    . PHE C 1 234 ? 26.960  -16.152 37.326  1.00 57.17  ?  231  PHE C CB    1 
ATOM   7448  C CG    . PHE C 1 234 ? 27.097  -16.597 38.753  1.00 60.73  ?  231  PHE C CG    1 
ATOM   7449  C CD1   . PHE C 1 234 ? 28.224  -16.265 39.488  1.00 62.94  ?  231  PHE C CD1   1 
ATOM   7450  C CD2   . PHE C 1 234 ? 26.108  -17.355 39.357  1.00 54.18  ?  231  PHE C CD2   1 
ATOM   7451  C CE1   . PHE C 1 234 ? 28.359  -16.677 40.800  1.00 53.18  ?  231  PHE C CE1   1 
ATOM   7452  C CE2   . PHE C 1 234 ? 26.237  -17.769 40.670  1.00 56.25  ?  231  PHE C CE2   1 
ATOM   7453  C CZ    . PHE C 1 234 ? 27.364  -17.429 41.392  1.00 54.90  ?  231  PHE C CZ    1 
ATOM   7454  N N     . GLU C 1 235 ? 26.871  -19.045 35.824  1.00 55.53  ?  232  GLU C N     1 
ATOM   7455  C CA    . GLU C 1 235 ? 26.812  -20.501 35.849  1.00 61.61  ?  232  GLU C CA    1 
ATOM   7456  C C     . GLU C 1 235 ? 28.063  -21.127 35.246  1.00 64.66  ?  232  GLU C C     1 
ATOM   7457  O O     . GLU C 1 235 ? 28.379  -22.281 35.558  1.00 66.33  ?  232  GLU C O     1 
ATOM   7458  C CB    . GLU C 1 235 ? 25.568  -20.991 35.107  1.00 66.02  ?  232  GLU C CB    1 
ATOM   7459  C CG    . GLU C 1 235 ? 25.248  -22.460 35.333  1.00 75.87  ?  232  GLU C CG    1 
ATOM   7460  C CD    . GLU C 1 235 ? 24.284  -23.011 34.303  1.00 91.73  ?  232  GLU C CD    1 
ATOM   7461  O OE1   . GLU C 1 235 ? 23.790  -22.222 33.469  1.00 98.13  ?  232  GLU C OE1   1 
ATOM   7462  O OE2   . GLU C 1 235 ? 24.025  -24.233 34.323  1.00 96.42  -1 232  GLU C OE2   1 
ATOM   7463  N N     . GLY C 1 236 ? 28.776  -20.391 34.391  1.00 65.32  ?  233  GLY C N     1 
ATOM   7464  C CA    . GLY C 1 236 ? 30.047  -20.883 33.886  1.00 62.74  ?  233  GLY C CA    1 
ATOM   7465  C C     . GLY C 1 236 ? 31.138  -20.852 34.939  1.00 61.59  ?  233  GLY C C     1 
ATOM   7466  O O     . GLY C 1 236 ? 31.943  -21.782 35.038  1.00 63.15  ?  233  GLY C O     1 
ATOM   7467  N N     . PHE C 1 237 ? 31.184  -19.777 35.736  1.00 56.71  ?  234  PHE C N     1 
ATOM   7468  C CA    . PHE C 1 237 ? 32.111  -19.726 36.864  1.00 47.18  ?  234  PHE C CA    1 
ATOM   7469  C C     . PHE C 1 237 ? 31.884  -20.884 37.827  1.00 54.35  ?  234  PHE C C     1 
ATOM   7470  O O     . PHE C 1 237 ? 32.842  -21.397 38.417  1.00 57.04  ?  234  PHE C O     1 
ATOM   7471  C CB    . PHE C 1 237 ? 31.971  -18.399 37.614  1.00 49.59  ?  234  PHE C CB    1 
ATOM   7472  C CG    . PHE C 1 237 ? 32.752  -17.260 37.011  1.00 49.57  ?  234  PHE C CG    1 
ATOM   7473  C CD1   . PHE C 1 237 ? 34.135  -17.219 37.108  1.00 44.94  ?  234  PHE C CD1   1 
ATOM   7474  C CD2   . PHE C 1 237 ? 32.099  -16.214 36.378  1.00 40.35  ?  234  PHE C CD2   1 
ATOM   7475  C CE1   . PHE C 1 237 ? 34.854  -16.165 36.566  1.00 40.86  ?  234  PHE C CE1   1 
ATOM   7476  C CE2   . PHE C 1 237 ? 32.812  -15.158 35.833  1.00 39.15  ?  234  PHE C CE2   1 
ATOM   7477  C CZ    . PHE C 1 237 ? 34.190  -15.134 35.926  1.00 41.57  ?  234  PHE C CZ    1 
ATOM   7478  N N     . LYS C 1 238 ? 30.633  -21.310 37.995  1.00 56.48  ?  235  LYS C N     1 
ATOM   7479  C CA    . LYS C 1 238 ? 30.307  -22.373 38.936  1.00 56.03  ?  235  LYS C CA    1 
ATOM   7480  C C     . LYS C 1 238 ? 30.494  -23.764 38.348  1.00 59.40  ?  235  LYS C C     1 
ATOM   7481  O O     . LYS C 1 238 ? 30.736  -24.717 39.099  1.00 53.01  ?  235  LYS C O     1 
ATOM   7482  C CB    . LYS C 1 238 ? 28.865  -22.216 39.430  1.00 57.65  ?  235  LYS C CB    1 
ATOM   7483  C CG    . LYS C 1 238 ? 28.529  -23.042 40.664  1.00 61.14  ?  235  LYS C CG    1 
ATOM   7484  C CD    . LYS C 1 238 ? 29.525  -22.786 41.782  1.00 57.40  ?  235  LYS C CD    1 
ATOM   7485  C CE    . LYS C 1 238 ? 28.964  -23.191 43.132  1.00 55.06  ?  235  LYS C CE    1 
ATOM   7486  N NZ    . LYS C 1 238 ? 28.875  -22.016 44.046  1.00 53.25  1  235  LYS C NZ    1 
ATOM   7487  N N     . LYS C 1 239 ? 30.389  -23.911 37.027  1.00 56.92  ?  236  LYS C N     1 
ATOM   7488  C CA    . LYS C 1 239 ? 30.616  -25.212 36.413  1.00 53.51  ?  236  LYS C CA    1 
ATOM   7489  C C     . LYS C 1 239 ? 32.093  -25.572 36.318  1.00 49.37  ?  236  LYS C C     1 
ATOM   7490  O O     . LYS C 1 239 ? 32.409  -26.698 35.917  1.00 55.41  ?  236  LYS C O     1 
ATOM   7491  C CB    . LYS C 1 239 ? 29.994  -25.259 35.016  1.00 62.25  ?  236  LYS C CB    1 
ATOM   7492  C CG    . LYS C 1 239 ? 28.528  -25.658 34.984  1.00 68.41  ?  236  LYS C CG    1 
ATOM   7493  C CD    . LYS C 1 239 ? 28.235  -26.521 33.764  1.00 63.40  ?  236  LYS C CD    1 
ATOM   7494  C CE    . LYS C 1 239 ? 27.150  -25.922 32.889  1.00 60.08  ?  236  LYS C CE    1 
ATOM   7495  N NZ    . LYS C 1 239 ? 26.098  -26.937 32.612  1.00 58.28  1  236  LYS C NZ    1 
ATOM   7496  N N     . ILE C 1 240 ? 32.992  -24.661 36.681  1.00 42.99  ?  237  ILE C N     1 
ATOM   7497  C CA    . ILE C 1 240 ? 34.434  -24.854 36.524  1.00 46.01  ?  237  ILE C CA    1 
ATOM   7498  C C     . ILE C 1 240 ? 34.912  -26.146 37.188  1.00 52.15  ?  237  ILE C C     1 
ATOM   7499  O O     . ILE C 1 240 ? 35.508  -26.985 36.496  1.00 44.61  ?  237  ILE C O     1 
ATOM   7500  C CB    . ILE C 1 240 ? 35.214  -23.637 37.051  1.00 41.73  ?  237  ILE C CB    1 
ATOM   7501  C CG1   . ILE C 1 240 ? 34.986  -22.426 36.146  1.00 34.82  ?  237  ILE C CG1   1 
ATOM   7502  C CG2   . ILE C 1 240 ? 36.700  -23.953 37.164  1.00 48.32  ?  237  ILE C CG2   1 
ATOM   7503  C CD1   . ILE C 1 240 ? 35.703  -21.173 36.610  1.00 38.26  ?  237  ILE C CD1   1 
ATOM   7504  N N     . PRO C 1 241 ? 34.685  -26.370 38.491  1.00 52.57  ?  238  PRO C N     1 
ATOM   7505  C CA    . PRO C 1 241 ? 35.245  -27.581 39.118  1.00 51.34  ?  238  PRO C CA    1 
ATOM   7506  C C     . PRO C 1 241 ? 34.699  -28.879 38.547  1.00 54.28  ?  238  PRO C C     1 
ATOM   7507  O O     . PRO C 1 241 ? 35.370  -29.914 38.657  1.00 58.23  ?  238  PRO C O     1 
ATOM   7508  C CB    . PRO C 1 241 ? 34.874  -27.420 40.601  1.00 47.49  ?  238  PRO C CB    1 
ATOM   7509  C CG    . PRO C 1 241 ? 34.524  -25.981 40.771  1.00 47.08  ?  238  PRO C CG    1 
ATOM   7510  C CD    . PRO C 1 241 ? 33.916  -25.578 39.468  1.00 47.61  ?  238  PRO C CD    1 
ATOM   7511  N N     . LYS C 1 242 ? 33.516  -28.863 37.936  1.00 52.75  ?  239  LYS C N     1 
ATOM   7512  C CA    . LYS C 1 242 ? 32.931  -30.048 37.320  1.00 52.76  ?  239  LYS C CA    1 
ATOM   7513  C C     . LYS C 1 242 ? 33.263  -30.166 35.837  1.00 61.39  ?  239  LYS C C     1 
ATOM   7514  O O     . LYS C 1 242 ? 33.689  -31.232 35.385  1.00 63.77  ?  239  LYS C O     1 
ATOM   7515  C CB    . LYS C 1 242 ? 31.412  -30.034 37.513  1.00 57.47  ?  239  LYS C CB    1 
ATOM   7516  C CG    . LYS C 1 242 ? 30.689  -31.233 36.942  1.00 59.56  ?  239  LYS C CG    1 
ATOM   7517  C CD    . LYS C 1 242 ? 29.185  -31.036 37.040  1.00 62.02  ?  239  LYS C CD    1 
ATOM   7518  C CE    . LYS C 1 242 ? 28.429  -32.328 36.800  1.00 64.93  ?  239  LYS C CE    1 
ATOM   7519  N NZ    . LYS C 1 242 ? 28.758  -33.335 37.840  1.00 70.01  1  239  LYS C NZ    1 
ATOM   7520  N N     . THR C 1 243 ? 33.074  -29.088 35.069  1.00 62.64  ?  240  THR C N     1 
ATOM   7521  C CA    . THR C 1 243 ? 33.292  -29.165 33.627  1.00 57.47  ?  240  THR C CA    1 
ATOM   7522  C C     . THR C 1 243 ? 34.771  -29.316 33.295  1.00 48.53  ?  240  THR C C     1 
ATOM   7523  O O     . THR C 1 243 ? 35.135  -30.058 32.375  1.00 46.39  ?  240  THR C O     1 
ATOM   7524  C CB    . THR C 1 243 ? 32.716  -27.928 32.933  1.00 60.61  ?  240  THR C CB    1 
ATOM   7525  O OG1   . THR C 1 243 ? 31.354  -27.747 33.335  1.00 67.68  ?  240  THR C OG1   1 
ATOM   7526  C CG2   . THR C 1 243 ? 32.771  -28.089 31.415  1.00 56.06  ?  240  THR C CG2   1 
ATOM   7527  N N     . LEU C 1 244 ? 35.639  -28.624 34.032  1.00 43.71  ?  241  LEU C N     1 
ATOM   7528  C CA    . LEU C 1 244 ? 37.078  -28.682 33.814  1.00 49.65  ?  241  LEU C CA    1 
ATOM   7529  C C     . LEU C 1 244 ? 37.772  -29.621 34.794  1.00 58.10  ?  241  LEU C C     1 
ATOM   7530  O O     . LEU C 1 244 ? 38.946  -29.417 35.125  1.00 46.73  ?  241  LEU C O     1 
ATOM   7531  C CB    . LEU C 1 244 ? 37.678  -27.279 33.901  1.00 36.68  ?  241  LEU C CB    1 
ATOM   7532  C CG    . LEU C 1 244 ? 36.967  -26.224 33.049  1.00 36.08  ?  241  LEU C CG    1 
ATOM   7533  C CD1   . LEU C 1 244 ? 37.689  -24.889 33.122  1.00 34.58  ?  241  LEU C CD1   1 
ATOM   7534  C CD2   . LEU C 1 244 ? 36.836  -26.693 31.606  1.00 35.32  ?  241  LEU C CD2   1 
ATOM   7535  N N     . GLY C 1 245 ? 37.064  -30.659 35.254  1.00 66.84  ?  242  GLY C N     1 
ATOM   7536  C CA    . GLY C 1 245 ? 37.619  -31.553 36.257  1.00 60.81  ?  242  GLY C CA    1 
ATOM   7537  C C     . GLY C 1 245 ? 38.932  -32.191 35.849  1.00 53.03  ?  242  GLY C C     1 
ATOM   7538  O O     . GLY C 1 245 ? 39.773  -32.484 36.702  1.00 61.95  ?  242  GLY C O     1 
ATOM   7539  N N     . PHE C 1 246 ? 39.135  -32.400 34.545  1.00 51.63  ?  243  PHE C N     1 
ATOM   7540  C CA    . PHE C 1 246 ? 40.387  -32.981 34.070  1.00 47.55  ?  243  PHE C CA    1 
ATOM   7541  C C     . PHE C 1 246 ? 41.597  -32.131 34.435  1.00 48.62  ?  243  PHE C C     1 
ATOM   7542  O O     . PHE C 1 246 ? 42.727  -32.625 34.372  1.00 50.52  ?  243  PHE C O     1 
ATOM   7543  C CB    . PHE C 1 246 ? 40.333  -33.190 32.552  1.00 43.96  ?  243  PHE C CB    1 
ATOM   7544  C CG    . PHE C 1 246 ? 39.880  -31.977 31.783  1.00 47.14  ?  243  PHE C CG    1 
ATOM   7545  C CD1   . PHE C 1 246 ? 40.793  -31.026 31.356  1.00 46.18  ?  243  PHE C CD1   1 
ATOM   7546  C CD2   . PHE C 1 246 ? 38.541  -31.794 31.480  1.00 43.64  ?  243  PHE C CD2   1 
ATOM   7547  C CE1   . PHE C 1 246 ? 40.376  -29.911 30.645  1.00 43.71  ?  243  PHE C CE1   1 
ATOM   7548  C CE2   . PHE C 1 246 ? 38.120  -30.683 30.770  1.00 41.91  ?  243  PHE C CE2   1 
ATOM   7549  C CZ    . PHE C 1 246 ? 39.038  -29.741 30.352  1.00 36.23  ?  243  PHE C CZ    1 
ATOM   7550  N N     . LEU C 1 247 ? 41.391  -30.871 34.818  1.00 53.09  ?  244  LEU C N     1 
ATOM   7551  C CA    . LEU C 1 247 ? 42.481  -30.016 35.269  1.00 47.49  ?  244  LEU C CA    1 
ATOM   7552  C C     . LEU C 1 247 ? 42.913  -30.301 36.703  1.00 46.64  ?  244  LEU C C     1 
ATOM   7553  O O     . LEU C 1 247 ? 43.810  -29.615 37.205  1.00 44.86  ?  244  LEU C O     1 
ATOM   7554  C CB    . LEU C 1 247 ? 42.085  -28.541 35.146  1.00 43.13  ?  244  LEU C CB    1 
ATOM   7555  C CG    . LEU C 1 247 ? 41.795  -27.986 33.750  1.00 39.76  ?  244  LEU C CG    1 
ATOM   7556  C CD1   . LEU C 1 247 ? 41.482  -26.503 33.828  1.00 43.00  ?  244  LEU C CD1   1 
ATOM   7557  C CD2   . LEU C 1 247 ? 42.963  -28.238 32.810  1.00 39.60  ?  244  LEU C CD2   1 
ATOM   7558  N N     . ASN C 1 248 ? 42.313  -31.288 37.375  1.00 52.90  ?  245  ASN C N     1 
ATOM   7559  C CA    . ASN C 1 248 ? 42.686  -31.568 38.758  1.00 58.00  ?  245  ASN C CA    1 
ATOM   7560  C C     . ASN C 1 248 ? 44.118  -32.068 38.896  1.00 64.30  ?  245  ASN C C     1 
ATOM   7561  O O     . ASN C 1 248 ? 44.645  -32.087 40.013  1.00 67.09  ?  245  ASN C O     1 
ATOM   7562  C CB    . ASN C 1 248 ? 41.714  -32.575 39.391  1.00 59.80  ?  245  ASN C CB    1 
ATOM   7563  C CG    . ASN C 1 248 ? 41.741  -33.947 38.722  1.00 66.18  ?  245  ASN C CG    1 
ATOM   7564  O OD1   . ASN C 1 248 ? 42.680  -34.302 38.010  1.00 69.98  ?  245  ASN C OD1   1 
ATOM   7565  N ND2   . ASN C 1 248 ? 40.697  -34.731 38.965  1.00 65.58  ?  245  ASN C ND2   1 
ATOM   7566  N N     . LYS C 1 249 ? 44.755  -32.473 37.797  1.00 68.58  ?  246  LYS C N     1 
ATOM   7567  C CA    . LYS C 1 249 ? 46.133  -32.940 37.851  1.00 70.55  ?  246  LYS C CA    1 
ATOM   7568  C C     . LYS C 1 249 ? 47.138  -31.815 38.053  1.00 65.62  ?  246  LYS C C     1 
ATOM   7569  O O     . LYS C 1 249 ? 48.297  -32.100 38.367  1.00 58.07  ?  246  LYS C O     1 
ATOM   7570  C CB    . LYS C 1 249 ? 46.473  -33.712 36.573  1.00 73.66  ?  246  LYS C CB    1 
ATOM   7571  C CG    . LYS C 1 249 ? 45.523  -33.453 35.414  1.00 65.39  ?  246  LYS C CG    1 
ATOM   7572  C CD    . LYS C 1 249 ? 45.798  -34.387 34.245  1.00 63.06  ?  246  LYS C CD    1 
ATOM   7573  C CE    . LYS C 1 249 ? 45.964  -35.828 34.705  1.00 58.18  ?  246  LYS C CE    1 
ATOM   7574  N NZ    . LYS C 1 249 ? 45.913  -36.783 33.561  1.00 50.56  1  246  LYS C NZ    1 
ATOM   7575  N N     . ILE C 1 250 ? 46.735  -30.556 37.890  1.00 56.39  ?  247  ILE C N     1 
ATOM   7576  C CA    . ILE C 1 250 ? 47.674  -29.449 38.034  1.00 50.73  ?  247  ILE C CA    1 
ATOM   7577  C C     . ILE C 1 250 ? 47.162  -28.406 39.019  1.00 49.61  ?  247  ILE C C     1 
ATOM   7578  O O     . ILE C 1 250 ? 47.914  -27.511 39.416  1.00 50.67  ?  247  ILE C O     1 
ATOM   7579  C CB    . ILE C 1 250 ? 47.997  -28.799 36.672  1.00 49.24  ?  247  ILE C CB    1 
ATOM   7580  C CG1   . ILE C 1 250 ? 46.748  -28.168 36.055  1.00 45.44  ?  247  ILE C CG1   1 
ATOM   7581  C CG2   . ILE C 1 250 ? 48.605  -29.815 35.718  1.00 52.04  ?  247  ILE C CG2   1 
ATOM   7582  C CD1   . ILE C 1 250 ? 47.010  -27.513 34.716  1.00 51.28  ?  247  ILE C CD1   1 
ATOM   7583  N N     . THR C 1 251 ? 45.896  -28.504 39.425  1.00 48.90  ?  248  THR C N     1 
ATOM   7584  C CA    . THR C 1 251 ? 45.348  -27.510 40.340  1.00 49.93  ?  248  THR C CA    1 
ATOM   7585  C C     . THR C 1 251 ? 44.113  -28.070 41.030  1.00 54.15  ?  248  THR C C     1 
ATOM   7586  O O     . THR C 1 251 ? 43.482  -29.016 40.551  1.00 55.90  ?  248  THR C O     1 
ATOM   7587  C CB    . THR C 1 251 ? 45.001  -26.205 39.612  1.00 46.81  ?  248  THR C CB    1 
ATOM   7588  O OG1   . THR C 1 251 ? 44.791  -25.158 40.572  1.00 42.53  ?  248  THR C OG1   1 
ATOM   7589  C CG2   . THR C 1 251 ? 43.745  -26.371 38.771  1.00 45.18  ?  248  THR C CG2   1 
ATOM   7590  N N     . ASN C 1 252 ? 43.782  -27.466 42.174  1.00 48.16  ?  249  ASN C N     1 
ATOM   7591  C CA    . ASN C 1 252 ? 42.556  -27.766 42.913  1.00 55.92  ?  249  ASN C CA    1 
ATOM   7592  C C     . ASN C 1 252 ? 41.522  -26.718 42.522  1.00 44.15  ?  249  ASN C C     1 
ATOM   7593  O O     . ASN C 1 252 ? 41.596  -25.566 42.955  1.00 52.31  ?  249  ASN C O     1 
ATOM   7594  C CB    . ASN C 1 252 ? 42.812  -27.775 44.417  1.00 56.61  ?  249  ASN C CB    1 
ATOM   7595  C CG    . ASN C 1 252 ? 41.551  -28.044 45.232  1.00 57.35  ?  249  ASN C CG    1 
ATOM   7596  O OD1   . ASN C 1 252 ? 40.502  -28.389 44.688  1.00 60.65  ?  249  ASN C OD1   1 
ATOM   7597  N ND2   . ASN C 1 252 ? 41.656  -27.895 46.547  1.00 57.22  ?  249  ASN C ND2   1 
ATOM   7598  N N     . LEU C 1 253 ? 40.552  -27.123 41.702  1.00 44.29  ?  250  LEU C N     1 
ATOM   7599  C CA    . LEU C 1 253 ? 39.536  -26.201 41.204  1.00 48.67  ?  250  LEU C CA    1 
ATOM   7600  C C     . LEU C 1 253 ? 38.516  -25.806 42.257  1.00 54.64  ?  250  LEU C C     1 
ATOM   7601  O O     . LEU C 1 253 ? 37.596  -25.045 41.938  1.00 53.91  ?  250  LEU C O     1 
ATOM   7602  C CB    . LEU C 1 253 ? 38.816  -26.812 40.003  1.00 54.58  ?  250  LEU C CB    1 
ATOM   7603  C CG    . LEU C 1 253 ? 39.640  -26.946 38.723  1.00 52.16  ?  250  LEU C CG    1 
ATOM   7604  C CD1   . LEU C 1 253 ? 38.783  -27.534 37.622  1.00 54.37  ?  250  LEU C CD1   1 
ATOM   7605  C CD2   . LEU C 1 253 ? 40.203  -25.595 38.310  1.00 46.44  ?  250  LEU C CD2   1 
ATOM   7606  N N     . ASN C 1 254 ? 38.644  -26.293 43.489  1.00 56.88  ?  251  ASN C N     1 
ATOM   7607  C CA    . ASN C 1 254 ? 37.726  -25.929 44.557  1.00 57.66  ?  251  ASN C CA    1 
ATOM   7608  C C     . ASN C 1 254 ? 38.328  -24.946 45.552  1.00 55.84  ?  251  ASN C C     1 
ATOM   7609  O O     . ASN C 1 254 ? 37.612  -24.477 46.444  1.00 59.04  ?  251  ASN C O     1 
ATOM   7610  C CB    . ASN C 1 254 ? 37.246  -27.182 45.298  1.00 58.17  ?  251  ASN C CB    1 
ATOM   7611  C CG    . ASN C 1 254 ? 36.291  -28.015 44.466  1.00 59.39  ?  251  ASN C CG    1 
ATOM   7612  O OD1   . ASN C 1 254 ? 35.191  -27.570 44.137  1.00 63.23  ?  251  ASN C OD1   1 
ATOM   7613  N ND2   . ASN C 1 254 ? 36.704  -29.231 44.123  1.00 50.88  ?  251  ASN C ND2   1 
ATOM   7614  N N     . GLU C 1 255 ? 39.612  -24.621 45.423  1.00 55.31  ?  252  GLU C N     1 
ATOM   7615  C CA    . GLU C 1 255 ? 40.273  -23.635 46.279  1.00 50.25  ?  252  GLU C CA    1 
ATOM   7616  C C     . GLU C 1 255 ? 40.360  -22.332 45.491  1.00 65.53  ?  252  GLU C C     1 
ATOM   7617  O O     . GLU C 1 255 ? 41.285  -22.115 44.708  1.00 70.41  ?  252  GLU C O     1 
ATOM   7618  C CB    . GLU C 1 255 ? 41.646  -24.131 46.715  1.00 53.00  ?  252  GLU C CB    1 
ATOM   7619  C CG    . GLU C 1 255 ? 41.761  -24.403 48.204  1.00 66.29  ?  252  GLU C CG    1 
ATOM   7620  C CD    . GLU C 1 255 ? 42.518  -25.680 48.498  1.00 77.72  ?  252  GLU C CD    1 
ATOM   7621  O OE1   . GLU C 1 255 ? 42.083  -26.440 49.386  1.00 73.59  ?  252  GLU C OE1   1 
ATOM   7622  O OE2   . GLU C 1 255 ? 43.540  -25.932 47.827  1.00 80.46  -1 252  GLU C OE2   1 
ATOM   7623  N N     . ASN C 1 256 ? 39.379  -21.461 45.702  1.00 66.95  ?  253  ASN C N     1 
ATOM   7624  C CA    . ASN C 1 256 ? 39.319  -20.203 44.976  1.00 60.97  ?  253  ASN C CA    1 
ATOM   7625  C C     . ASN C 1 256 ? 40.369  -19.226 45.498  1.00 56.72  ?  253  ASN C C     1 
ATOM   7626  O O     . ASN C 1 256 ? 40.894  -19.367 46.607  1.00 59.58  ?  253  ASN C O     1 
ATOM   7627  C CB    . ASN C 1 256 ? 37.921  -19.594 45.088  1.00 62.31  ?  253  ASN C CB    1 
ATOM   7628  C CG    . ASN C 1 256 ? 36.839  -20.515 44.552  1.00 65.15  ?  253  ASN C CG    1 
ATOM   7629  O OD1   . ASN C 1 256 ? 37.116  -21.639 44.127  1.00 69.31  ?  253  ASN C OD1   1 
ATOM   7630  N ND2   . ASN C 1 256 ? 35.598  -20.046 44.576  1.00 63.50  ?  253  ASN C ND2   1 
ATOM   7631  N N     . TYR C 1 257 ? 40.675  -18.222 44.679  1.00 51.21  ?  254  TYR C N     1 
ATOM   7632  C CA    . TYR C 1 257 ? 41.670  -17.230 45.060  1.00 52.63  ?  254  TYR C CA    1 
ATOM   7633  C C     . TYR C 1 257 ? 41.119  -16.324 46.153  1.00 58.93  ?  254  TYR C C     1 
ATOM   7634  O O     . TYR C 1 257 ? 39.964  -15.891 46.105  1.00 61.38  ?  254  TYR C O     1 
ATOM   7635  C CB    . TYR C 1 257 ? 42.095  -16.397 43.851  1.00 44.80  ?  254  TYR C CB    1 
ATOM   7636  C CG    . TYR C 1 257 ? 43.273  -15.480 44.120  1.00 43.20  ?  254  TYR C CG    1 
ATOM   7637  C CD1   . TYR C 1 257 ? 44.579  -15.930 43.965  1.00 43.73  ?  254  TYR C CD1   1 
ATOM   7638  C CD2   . TYR C 1 257 ? 43.079  -14.163 44.521  1.00 41.60  ?  254  TYR C CD2   1 
ATOM   7639  C CE1   . TYR C 1 257 ? 45.659  -15.095 44.206  1.00 38.81  ?  254  TYR C CE1   1 
ATOM   7640  C CE2   . TYR C 1 257 ? 44.152  -13.322 44.765  1.00 42.31  ?  254  TYR C CE2   1 
ATOM   7641  C CZ    . TYR C 1 257 ? 45.439  -13.794 44.605  1.00 43.88  ?  254  TYR C CZ    1 
ATOM   7642  O OH    . TYR C 1 257 ? 46.508  -12.960 44.846  1.00 50.55  ?  254  TYR C OH    1 
ATOM   7643  N N     . GLN C 1 258 ? 41.962  -16.034 47.138  1.00 60.94  ?  255  GLN C N     1 
ATOM   7644  C CA    . GLN C 1 258 ? 41.573  -15.248 48.305  1.00 60.06  ?  255  GLN C CA    1 
ATOM   7645  C C     . GLN C 1 258 ? 41.898  -13.781 48.031  1.00 56.32  ?  255  GLN C C     1 
ATOM   7646  O O     . GLN C 1 258 ? 43.058  -13.365 48.064  1.00 60.18  ?  255  GLN C O     1 
ATOM   7647  C CB    . GLN C 1 258 ? 42.262  -15.790 49.560  1.00 62.01  ?  255  GLN C CB    1 
ATOM   7648  C CG    . GLN C 1 258 ? 43.803  -15.621 49.702  1.00 61.79  ?  255  GLN C CG    1 
ATOM   7649  C CD    . GLN C 1 258 ? 44.604  -15.863 48.423  1.00 62.08  ?  255  GLN C CD    1 
ATOM   7650  O OE1   . GLN C 1 258 ? 44.204  -16.637 47.552  1.00 62.43  ?  255  GLN C OE1   1 
ATOM   7651  N NE2   . GLN C 1 258 ? 45.745  -15.191 48.310  1.00 60.80  ?  255  GLN C NE2   1 
ATOM   7652  N N     . LEU C 1 259 ? 40.874  -12.985 47.721  1.00 49.47  ?  256  LEU C N     1 
ATOM   7653  C CA    . LEU C 1 259 ? 41.086  -11.546 47.586  1.00 43.96  ?  256  LEU C CA    1 
ATOM   7654  C C     . LEU C 1 259 ? 41.159  -10.977 48.997  1.00 60.99  ?  256  LEU C C     1 
ATOM   7655  O O     . LEU C 1 259 ? 40.189  -10.458 49.556  1.00 64.53  ?  256  LEU C O     1 
ATOM   7656  C CB    . LEU C 1 259 ? 39.997  -10.885 46.751  1.00 50.52  ?  256  LEU C CB    1 
ATOM   7657  C CG    . LEU C 1 259 ? 40.277  -9.430  46.358  1.00 54.22  ?  256  LEU C CG    1 
ATOM   7658  C CD1   . LEU C 1 259 ? 41.727  -9.258  45.934  1.00 53.24  ?  256  LEU C CD1   1 
ATOM   7659  C CD2   . LEU C 1 259 ? 39.352  -8.976  45.242  1.00 59.19  ?  256  LEU C CD2   1 
ATOM   7660  N N     . LYS C 1 260 ? 42.340  -11.131 49.592  1.00 61.82  ?  257  LYS C N     1 
ATOM   7661  C CA    . LYS C 1 260 ? 42.626  -10.558 50.897  1.00 60.77  ?  257  LYS C CA    1 
ATOM   7662  C C     . LYS C 1 260 ? 42.271  -9.078  50.911  1.00 68.33  ?  257  LYS C C     1 
ATOM   7663  O O     . LYS C 1 260 ? 42.499  -8.359  49.935  1.00 70.46  ?  257  LYS C O     1 
ATOM   7664  C CB    . LYS C 1 260 ? 44.107  -10.758 51.226  1.00 58.98  ?  257  LYS C CB    1 
ATOM   7665  C CG    . LYS C 1 260 ? 44.509  -10.344 52.622  1.00 68.82  ?  257  LYS C CG    1 
ATOM   7666  C CD    . LYS C 1 260 ? 43.779  -11.168 53.660  1.00 67.42  ?  257  LYS C CD    1 
ATOM   7667  C CE    . LYS C 1 260 ? 44.250  -10.818 55.055  1.00 62.53  ?  257  LYS C CE    1 
ATOM   7668  N NZ    . LYS C 1 260 ? 43.414  -11.486 56.084  1.00 59.62  1  257  LYS C NZ    1 
ATOM   7669  N N     . ASP C 1 261 ? 41.687  -8.626  52.015  1.00 77.32  ?  258  ASP C N     1 
ATOM   7670  C CA    . ASP C 1 261 ? 41.321  -7.224  52.127  1.00 74.36  ?  258  ASP C CA    1 
ATOM   7671  C C     . ASP C 1 261 ? 42.566  -6.372  52.334  1.00 64.09  ?  258  ASP C C     1 
ATOM   7672  O O     . ASP C 1 261 ? 43.551  -6.806  52.940  1.00 71.36  ?  258  ASP C O     1 
ATOM   7673  C CB    . ASP C 1 261 ? 40.333  -7.012  53.274  1.00 75.47  ?  258  ASP C CB    1 
ATOM   7674  C CG    . ASP C 1 261 ? 39.104  -6.235  52.842  1.00 70.56  ?  258  ASP C CG    1 
ATOM   7675  O OD1   . ASP C 1 261 ? 39.255  -5.276  52.057  1.00 62.49  ?  258  ASP C OD1   1 
ATOM   7676  O OD2   . ASP C 1 261 ? 37.989  -6.589  53.276  1.00 79.66  -1 258  ASP C OD2   1 
ATOM   7677  N N     . GLY C 1 262 ? 42.510  -5.142  51.832  1.00 54.36  ?  259  GLY C N     1 
ATOM   7678  C CA    . GLY C 1 262 ? 43.679  -4.301  51.764  1.00 54.04  ?  259  GLY C CA    1 
ATOM   7679  C C     . GLY C 1 262 ? 44.494  -4.472  50.502  1.00 50.55  ?  259  GLY C C     1 
ATOM   7680  O O     . GLY C 1 262 ? 45.339  -3.616  50.205  1.00 46.38  ?  259  GLY C O     1 
ATOM   7681  N N     . TYR C 1 263 ? 44.284  -5.558  49.764  1.00 41.44  ?  260  TYR C N     1 
ATOM   7682  C CA    . TYR C 1 263 ? 44.826  -5.722  48.424  1.00 46.92  ?  260  TYR C CA    1 
ATOM   7683  C C     . TYR C 1 263 ? 43.858  -5.230  47.364  1.00 48.41  ?  260  TYR C C     1 
ATOM   7684  O O     . TYR C 1 263 ? 44.102  -5.413  46.168  1.00 42.88  ?  260  TYR C O     1 
ATOM   7685  C CB    . TYR C 1 263 ? 45.189  -7.189  48.179  1.00 43.30  ?  260  TYR C CB    1 
ATOM   7686  C CG    . TYR C 1 263 ? 46.352  -7.661  49.025  1.00 54.89  ?  260  TYR C CG    1 
ATOM   7687  C CD1   . TYR C 1 263 ? 46.166  -8.041  50.349  1.00 59.73  ?  260  TYR C CD1   1 
ATOM   7688  C CD2   . TYR C 1 263 ? 47.639  -7.708  48.506  1.00 59.17  ?  260  TYR C CD2   1 
ATOM   7689  C CE1   . TYR C 1 263 ? 47.227  -8.463  51.127  1.00 62.50  ?  260  TYR C CE1   1 
ATOM   7690  C CE2   . TYR C 1 263 ? 48.706  -8.129  49.277  1.00 60.31  ?  260  TYR C CE2   1 
ATOM   7691  C CZ    . TYR C 1 263 ? 48.495  -8.504  50.587  1.00 61.88  ?  260  TYR C CZ    1 
ATOM   7692  O OH    . TYR C 1 263 ? 49.556  -8.923  51.358  1.00 63.01  ?  260  TYR C OH    1 
ATOM   7693  N N     . LYS C 1 264 ? 42.774  -4.596  47.790  1.00 51.67  ?  261  LYS C N     1 
ATOM   7694  C CA    . LYS C 1 264 ? 41.716  -4.120  46.916  1.00 46.71  ?  261  LYS C CA    1 
ATOM   7695  C C     . LYS C 1 264 ? 41.424  -2.677  47.300  1.00 47.56  ?  261  LYS C C     1 
ATOM   7696  O O     . LYS C 1 264 ? 41.058  -2.404  48.447  1.00 49.99  ?  261  LYS C O     1 
ATOM   7697  C CB    . LYS C 1 264 ? 40.481  -5.005  47.075  1.00 49.47  ?  261  LYS C CB    1 
ATOM   7698  C CG    . LYS C 1 264 ? 39.307  -4.585  46.269  1.00 56.27  ?  261  LYS C CG    1 
ATOM   7699  C CD    . LYS C 1 264 ? 38.058  -5.286  46.745  1.00 61.78  ?  261  LYS C CD    1 
ATOM   7700  C CE    . LYS C 1 264 ? 36.907  -4.905  45.865  1.00 61.69  ?  261  LYS C CE    1 
ATOM   7701  N NZ    . LYS C 1 264 ? 35.648  -5.591  46.269  1.00 66.40  1  261  LYS C NZ    1 
ATOM   7702  N N     . ILE C 1 265 ? 41.607  -1.754  46.358  1.00 38.39  ?  262  ILE C N     1 
ATOM   7703  C CA    . ILE C 1 265 ? 41.576  -0.324  46.649  1.00 45.92  ?  262  ILE C CA    1 
ATOM   7704  C C     . ILE C 1 265 ? 40.685  0.380   45.634  1.00 51.90  ?  262  ILE C C     1 
ATOM   7705  O O     . ILE C 1 265 ? 40.838  0.187   44.422  1.00 42.61  ?  262  ILE C O     1 
ATOM   7706  C CB    . ILE C 1 265 ? 42.993  0.282   46.643  1.00 53.84  ?  262  ILE C CB    1 
ATOM   7707  C CG1   . ILE C 1 265 ? 43.780  -0.209  47.860  1.00 65.44  ?  262  ILE C CG1   1 
ATOM   7708  C CG2   . ILE C 1 265 ? 42.933  1.801   46.616  1.00 51.57  ?  262  ILE C CG2   1 
ATOM   7709  C CD1   . ILE C 1 265 ? 45.185  -0.668  47.540  1.00 68.98  ?  262  ILE C CD1   1 
ATOM   7710  N N     . PHE C 1 266 ? 39.756  1.194   46.133  1.00 45.23  ?  263  PHE C N     1 
ATOM   7711  C CA    . PHE C 1 266 ? 38.885  2.014   45.303  1.00 45.98  ?  263  PHE C CA    1 
ATOM   7712  C C     . PHE C 1 266 ? 39.476  3.417   45.234  1.00 49.17  ?  263  PHE C C     1 
ATOM   7713  O O     . PHE C 1 266 ? 39.603  4.092   46.261  1.00 48.99  ?  263  PHE C O     1 
ATOM   7714  C CB    . PHE C 1 266 ? 37.466  2.047   45.874  1.00 42.13  ?  263  PHE C CB    1 
ATOM   7715  C CG    . PHE C 1 266 ? 36.462  2.749   44.995  1.00 55.64  ?  263  PHE C CG    1 
ATOM   7716  C CD1   . PHE C 1 266 ? 36.447  4.131   44.898  1.00 56.55  ?  263  PHE C CD1   1 
ATOM   7717  C CD2   . PHE C 1 266 ? 35.516  2.024   44.286  1.00 58.74  ?  263  PHE C CD2   1 
ATOM   7718  C CE1   . PHE C 1 266 ? 35.526  4.776   44.097  1.00 57.47  ?  263  PHE C CE1   1 
ATOM   7719  C CE2   . PHE C 1 266 ? 34.587  2.665   43.484  1.00 56.89  ?  263  PHE C CE2   1 
ATOM   7720  C CZ    . PHE C 1 266 ? 34.593  4.043   43.390  1.00 56.38  ?  263  PHE C CZ    1 
ATOM   7721  N N     . ILE C 1 267 ? 39.820  3.859   44.031  1.00 49.21  ?  264  ILE C N     1 
ATOM   7722  C CA    . ILE C 1 267 ? 40.451  5.157   43.825  1.00 49.93  ?  264  ILE C CA    1 
ATOM   7723  C C     . ILE C 1 267 ? 39.416  6.135   43.293  1.00 58.59  ?  264  ILE C C     1 
ATOM   7724  O O     . ILE C 1 267 ? 38.668  5.821   42.357  1.00 53.56  ?  264  ILE C O     1 
ATOM   7725  C CB    . ILE C 1 267 ? 41.652  5.046   42.872  1.00 57.81  ?  264  ILE C CB    1 
ATOM   7726  C CG1   . ILE C 1 267 ? 42.808  4.335   43.577  1.00 58.46  ?  264  ILE C CG1   1 
ATOM   7727  C CG2   . ILE C 1 267 ? 42.063  6.425   42.358  1.00 55.03  ?  264  ILE C CG2   1 
ATOM   7728  C CD1   . ILE C 1 267 ? 44.179  4.876   43.225  1.00 63.21  ?  264  ILE C CD1   1 
ATOM   7729  N N     . ASN C 1 268 ? 39.378  7.323   43.883  1.00 62.24  ?  265  ASN C N     1 
ATOM   7730  C CA    . ASN C 1 268 ? 38.479  8.386   43.464  1.00 60.96  ?  265  ASN C CA    1 
ATOM   7731  C C     . ASN C 1 268 ? 39.278  9.459   42.738  1.00 40.86  ?  265  ASN C C     1 
ATOM   7732  O O     . ASN C 1 268 ? 40.236  10.007  43.295  1.00 50.14  ?  265  ASN C O     1 
ATOM   7733  C CB    . ASN C 1 268 ? 37.754  8.984   44.667  1.00 74.39  ?  265  ASN C CB    1 
ATOM   7734  C CG    . ASN C 1 268 ? 36.986  10.224  44.311  1.00 91.05  ?  265  ASN C CG    1 
ATOM   7735  O OD1   . ASN C 1 268 ? 37.415  11.337  44.607  1.00 99.57  ?  265  ASN C OD1   1 
ATOM   7736  N ND2   . ASN C 1 268 ? 35.850  10.045  43.663  1.00 96.58  ?  265  ASN C ND2   1 
ATOM   7737  N N     . VAL C 1 269 ? 38.870  9.769   41.511  1.00 35.02  ?  266  VAL C N     1 
ATOM   7738  C CA    . VAL C 1 269 ? 39.552  10.745  40.668  1.00 30.83  ?  266  VAL C CA    1 
ATOM   7739  C C     . VAL C 1 269 ? 38.779  12.056  40.727  1.00 33.52  ?  266  VAL C C     1 
ATOM   7740  O O     . VAL C 1 269 ? 37.617  12.120  40.308  1.00 44.09  ?  266  VAL C O     1 
ATOM   7741  C CB    . VAL C 1 269 ? 39.676  10.239  39.221  1.00 27.19  ?  266  VAL C CB    1 
ATOM   7742  C CG1   . VAL C 1 269 ? 40.366  11.274  38.348  1.00 24.30  ?  266  VAL C CG1   1 
ATOM   7743  C CG2   . VAL C 1 269 ? 40.427  8.916   39.186  1.00 30.61  ?  266  VAL C CG2   1 
ATOM   7744  N N     . ILE C 1 270 ? 39.419  13.101  41.245  1.00 27.88  ?  267  ILE C N     1 
ATOM   7745  C CA    . ILE C 1 270 ? 38.802  14.412  41.407  1.00 27.78  ?  267  ILE C CA    1 
ATOM   7746  C C     . ILE C 1 270 ? 39.288  15.324  40.289  1.00 29.12  ?  267  ILE C C     1 
ATOM   7747  O O     . ILE C 1 270 ? 40.496  15.538  40.133  1.00 26.75  ?  267  ILE C O     1 
ATOM   7748  C CB    . ILE C 1 270 ? 39.121  15.017  42.784  1.00 27.08  ?  267  ILE C CB    1 
ATOM   7749  C CG1   . ILE C 1 270 ? 38.412  14.235  43.888  1.00 33.24  ?  267  ILE C CG1   1 
ATOM   7750  C CG2   . ILE C 1 270 ? 38.705  16.478  42.835  1.00 23.10  ?  267  ILE C CG2   1 
ATOM   7751  C CD1   . ILE C 1 270 ? 36.906  14.348  43.826  1.00 31.17  ?  267  ILE C CD1   1 
ATOM   7752  N N     . TYR C 1 271 ? 38.348  15.869  39.521  1.00 59.96  ?  268  TYR C N     1 
ATOM   7753  C CA    . TYR C 1 271 ? 38.655  16.808  38.449  1.00 56.42  ?  268  TYR C CA    1 
ATOM   7754  C C     . TYR C 1 271 ? 38.629  18.232  38.991  1.00 57.85  ?  268  TYR C C     1 
ATOM   7755  O O     . TYR C 1 271 ? 37.633  18.652  39.587  1.00 61.86  ?  268  TYR C O     1 
ATOM   7756  C CB    . TYR C 1 271 ? 37.648  16.676  37.308  1.00 26.17  ?  268  TYR C CB    1 
ATOM   7757  C CG    . TYR C 1 271 ? 37.550  15.308  36.670  1.00 21.44  ?  268  TYR C CG    1 
ATOM   7758  C CD1   . TYR C 1 271 ? 36.717  14.330  37.197  1.00 26.81  ?  268  TYR C CD1   1 
ATOM   7759  C CD2   . TYR C 1 271 ? 38.266  15.008  35.517  1.00 25.97  ?  268  TYR C CD2   1 
ATOM   7760  C CE1   . TYR C 1 271 ? 36.615  13.084  36.606  1.00 28.03  ?  268  TYR C CE1   1 
ATOM   7761  C CE2   . TYR C 1 271 ? 38.171  13.766  34.920  1.00 22.65  ?  268  TYR C CE2   1 
ATOM   7762  C CZ    . TYR C 1 271 ? 37.343  12.808  35.469  1.00 25.91  ?  268  TYR C CZ    1 
ATOM   7763  O OH    . TYR C 1 271 ? 37.250  11.572  34.871  1.00 23.48  ?  268  TYR C OH    1 
ATOM   7764  N N     . LYS C 1 272 ? 39.714  18.974  38.778  1.00 34.70  ?  269  LYS C N     1 
ATOM   7765  C CA    . LYS C 1 272 ? 39.778  20.379  39.168  1.00 30.11  ?  269  LYS C CA    1 
ATOM   7766  C C     . LYS C 1 272 ? 39.405  21.250  37.974  1.00 30.16  ?  269  LYS C C     1 
ATOM   7767  O O     . LYS C 1 272 ? 40.080  21.221  36.939  1.00 24.90  ?  269  LYS C O     1 
ATOM   7768  C CB    . LYS C 1 272 ? 41.168  20.755  39.687  1.00 31.23  ?  269  LYS C CB    1 
ATOM   7769  C CG    . LYS C 1 272 ? 41.389  20.435  41.159  1.00 41.43  ?  269  LYS C CG    1 
ATOM   7770  C CD    . LYS C 1 272 ? 42.679  21.048  41.691  1.00 44.19  ?  269  LYS C CD    1 
ATOM   7771  C CE    . LYS C 1 272 ? 42.572  22.562  41.826  1.00 52.35  ?  269  LYS C CE    1 
ATOM   7772  N NZ    . LYS C 1 272 ? 43.758  23.141  42.522  1.00 55.54  1  269  LYS C NZ    1 
ATOM   7773  N N     . PHE C 1 273 ? 38.331  22.017  38.118  1.00 33.62  ?  270  PHE C N     1 
ATOM   7774  C CA    . PHE C 1 273 ? 37.888  22.947  37.096  1.00 28.51  ?  270  PHE C CA    1 
ATOM   7775  C C     . PHE C 1 273 ? 38.240  24.372  37.522  1.00 29.10  ?  270  PHE C C     1 
ATOM   7776  O O     . PHE C 1 273 ? 39.004  24.592  38.467  1.00 35.32  ?  270  PHE C O     1 
ATOM   7777  C CB    . PHE C 1 273 ? 36.390  22.767  36.846  1.00 25.93  ?  270  PHE C CB    1 
ATOM   7778  C CG    . PHE C 1 273 ? 35.997  21.353  36.519  1.00 27.45  ?  270  PHE C CG    1 
ATOM   7779  C CD1   . PHE C 1 273 ? 36.363  20.779  35.310  1.00 27.11  ?  270  PHE C CD1   1 
ATOM   7780  C CD2   . PHE C 1 273 ? 35.261  20.598  37.418  1.00 30.97  ?  270  PHE C CD2   1 
ATOM   7781  C CE1   . PHE C 1 273 ? 36.008  19.473  35.007  1.00 26.25  ?  270  PHE C CE1   1 
ATOM   7782  C CE2   . PHE C 1 273 ? 34.898  19.295  37.120  1.00 27.62  ?  270  PHE C CE2   1 
ATOM   7783  C CZ    . PHE C 1 273 ? 35.270  18.734  35.910  1.00 27.88  ?  270  PHE C CZ    1 
ATOM   7784  N N     . LYS C 1 274 ? 37.681  25.360  36.820  1.00 25.37  ?  271  LYS C N     1 
ATOM   7785  C CA    . LYS C 1 274 ? 37.971  26.753  37.150  1.00 27.23  ?  271  LYS C CA    1 
ATOM   7786  C C     . LYS C 1 274 ? 37.321  27.154  38.468  1.00 29.45  ?  271  LYS C C     1 
ATOM   7787  O O     . LYS C 1 274 ? 37.970  27.745  39.339  1.00 30.79  ?  271  LYS C O     1 
ATOM   7788  C CB    . LYS C 1 274 ? 37.495  27.668  36.025  1.00 27.41  ?  271  LYS C CB    1 
ATOM   7789  C CG    . LYS C 1 274 ? 37.677  29.156  36.293  1.00 41.04  ?  271  LYS C CG    1 
ATOM   7790  C CD    . LYS C 1 274 ? 37.227  29.978  35.090  1.00 41.84  ?  271  LYS C CD    1 
ATOM   7791  C CE    . LYS C 1 274 ? 37.141  31.468  35.408  1.00 44.34  ?  271  LYS C CE    1 
ATOM   7792  N NZ    . LYS C 1 274 ? 38.475  32.107  35.580  1.00 46.98  1  271  LYS C NZ    1 
ATOM   7793  N N     . ASN C 1 275 ? 36.040  26.833  38.635  1.00 25.58  ?  272  ASN C N     1 
ATOM   7794  C CA    . ASN C 1 275 ? 35.252  27.333  39.751  1.00 28.48  ?  272  ASN C CA    1 
ATOM   7795  C C     . ASN C 1 275 ? 34.870  26.253  40.755  1.00 34.69  ?  272  ASN C C     1 
ATOM   7796  O O     . ASN C 1 275 ? 34.046  26.510  41.638  1.00 31.12  ?  272  ASN C O     1 
ATOM   7797  C CB    . ASN C 1 275 ? 33.999  28.029  39.217  1.00 25.84  ?  272  ASN C CB    1 
ATOM   7798  C CG    . ASN C 1 275 ? 34.327  29.225  38.348  1.00 32.43  ?  272  ASN C CG    1 
ATOM   7799  O OD1   . ASN C 1 275 ? 35.165  30.052  38.710  1.00 24.64  ?  272  ASN C OD1   1 
ATOM   7800  N ND2   . ASN C 1 275 ? 33.686  29.314  37.190  1.00 35.41  ?  272  ASN C ND2   1 
ATOM   7801  N N     . GLY C 1 276 ? 35.446  25.063  40.649  1.00 33.74  ?  273  GLY C N     1 
ATOM   7802  C CA    . GLY C 1 276 ? 35.146  24.007  41.597  1.00 35.36  ?  273  GLY C CA    1 
ATOM   7803  C C     . GLY C 1 276 ? 35.803  22.710  41.189  1.00 32.37  ?  273  GLY C C     1 
ATOM   7804  O O     . GLY C 1 276 ? 36.419  22.600  40.125  1.00 26.46  ?  273  GLY C O     1 
ATOM   7805  N N     . GLU C 1 277 ? 35.657  21.718  42.067  1.00 27.35  ?  274  GLU C N     1 
ATOM   7806  C CA    . GLU C 1 277 ? 36.209  20.385  41.877  1.00 33.50  ?  274  GLU C CA    1 
ATOM   7807  C C     . GLU C 1 277 ? 35.092  19.352  41.963  1.00 31.67  ?  274  GLU C C     1 
ATOM   7808  O O     . GLU C 1 277 ? 34.064  19.584  42.605  1.00 28.87  ?  274  GLU C O     1 
ATOM   7809  C CB    . GLU C 1 277 ? 37.284  20.065  42.925  1.00 49.19  ?  274  GLU C CB    1 
ATOM   7810  C CG    . GLU C 1 277 ? 38.367  21.119  43.079  1.00 61.49  ?  274  GLU C CG    1 
ATOM   7811  C CD    . GLU C 1 277 ? 39.320  20.807  44.220  1.00 57.24  ?  274  GLU C CD    1 
ATOM   7812  O OE1   . GLU C 1 277 ? 38.985  19.943  45.059  1.00 47.77  ?  274  GLU C OE1   1 
ATOM   7813  O OE2   . GLU C 1 277 ? 40.407  21.422  44.276  1.00 60.83  -1 274  GLU C OE2   1 
ATOM   7814  N N     . SER C 1 278 ? 35.305  18.204  41.324  1.00 34.32  ?  275  SER C N     1 
ATOM   7815  C CA    . SER C 1 278 ? 34.292  17.157  41.300  1.00 39.44  ?  275  SER C CA    1 
ATOM   7816  C C     . SER C 1 278 ? 34.903  15.859  40.787  1.00 35.45  ?  275  SER C C     1 
ATOM   7817  O O     . SER C 1 278 ? 35.870  15.871  40.018  1.00 27.83  ?  275  SER C O     1 
ATOM   7818  C CB    . SER C 1 278 ? 33.102  17.552  40.418  1.00 37.34  ?  275  SER C CB    1 
ATOM   7819  O OG    . SER C 1 278 ? 32.259  16.438  40.176  1.00 34.91  ?  275  SER C OG    1 
ATOM   7820  N N     . ARG C 1 279 ? 34.322  14.741  41.221  1.00 31.12  ?  276  ARG C N     1 
ATOM   7821  C CA    . ARG C 1 279 ? 34.662  13.430  40.682  1.00 32.18  ?  276  ARG C CA    1 
ATOM   7822  C C     . ARG C 1 279 ? 33.882  13.106  39.415  1.00 35.01  ?  276  ARG C C     1 
ATOM   7823  O O     . ARG C 1 279 ? 33.985  11.984  38.907  1.00 29.65  ?  276  ARG C O     1 
ATOM   7824  C CB    . ARG C 1 279 ? 34.423  12.342  41.734  1.00 28.04  ?  276  ARG C CB    1 
ATOM   7825  C CG    . ARG C 1 279 ? 32.960  11.960  41.943  1.00 30.52  ?  276  ARG C CG    1 
ATOM   7826  C CD    . ARG C 1 279 ? 32.832  10.850  42.990  1.00 32.55  ?  276  ARG C CD    1 
ATOM   7827  N NE    . ARG C 1 279 ? 31.475  10.319  43.070  1.00 31.20  ?  276  ARG C NE    1 
ATOM   7828  C CZ    . ARG C 1 279 ? 30.498  10.873  43.780  1.00 42.77  ?  276  ARG C CZ    1 
ATOM   7829  N NH1   . ARG C 1 279 ? 30.722  11.981  44.473  1.00 44.18  1  276  ARG C NH1   1 
ATOM   7830  N NH2   . ARG C 1 279 ? 29.292  10.324  43.789  1.00 49.85  ?  276  ARG C NH2   1 
ATOM   7831  N N     . TYR C 1 280 ? 33.110  14.063  38.902  1.00 28.72  ?  277  TYR C N     1 
ATOM   7832  C CA    . TYR C 1 280 ? 32.298  13.892  37.705  1.00 31.06  ?  277  TYR C CA    1 
ATOM   7833  C C     . TYR C 1 280 ? 32.884  14.743  36.586  1.00 33.34  ?  277  TYR C C     1 
ATOM   7834  O O     . TYR C 1 280 ? 32.976  15.969  36.720  1.00 29.30  ?  277  TYR C O     1 
ATOM   7835  C CB    . TYR C 1 280 ? 30.847  14.295  37.964  1.00 26.70  ?  277  TYR C CB    1 
ATOM   7836  C CG    . TYR C 1 280 ? 30.159  13.512  39.056  1.00 30.35  ?  277  TYR C CG    1 
ATOM   7837  C CD1   . TYR C 1 280 ? 29.830  12.176  38.875  1.00 41.59  ?  277  TYR C CD1   1 
ATOM   7838  C CD2   . TYR C 1 280 ? 29.819  14.115  40.262  1.00 28.52  ?  277  TYR C CD2   1 
ATOM   7839  C CE1   . TYR C 1 280 ? 29.192  11.457  39.865  1.00 40.45  ?  277  TYR C CE1   1 
ATOM   7840  C CE2   . TYR C 1 280 ? 29.178  13.402  41.261  1.00 41.20  ?  277  TYR C CE2   1 
ATOM   7841  C CZ    . TYR C 1 280 ? 28.868  12.072  41.055  1.00 45.86  ?  277  TYR C CZ    1 
ATOM   7842  O OH    . TYR C 1 280 ? 28.228  11.349  42.035  1.00 47.53  ?  277  TYR C OH    1 
ATOM   7843  N N     . ALA C 1 281 ? 33.261  14.096  35.482  1.00 39.66  ?  278  ALA C N     1 
ATOM   7844  C CA    . ALA C 1 281 ? 33.812  14.834  34.350  1.00 42.21  ?  278  ALA C CA    1 
ATOM   7845  C C     . ALA C 1 281 ? 32.798  15.822  33.787  1.00 38.86  ?  278  ALA C C     1 
ATOM   7846  O O     . ALA C 1 281 ? 33.161  16.939  33.396  1.00 38.59  ?  278  ALA C O     1 
ATOM   7847  C CB    . ALA C 1 281 ? 34.276  13.864  33.263  1.00 38.16  ?  278  ALA C CB    1 
ATOM   7848  N N     . LYS C 1 282 ? 31.521  15.436  33.749  1.00 27.57  ?  279  LYS C N     1 
ATOM   7849  C CA    . LYS C 1 282 ? 30.492  16.291  33.167  1.00 27.58  ?  279  LYS C CA    1 
ATOM   7850  C C     . LYS C 1 282 ? 30.243  17.560  33.972  1.00 27.61  ?  279  LYS C C     1 
ATOM   7851  O O     . LYS C 1 282 ? 29.572  18.466  33.469  1.00 27.55  ?  279  LYS C O     1 
ATOM   7852  C CB    . LYS C 1 282 ? 29.187  15.512  33.014  1.00 29.70  ?  279  LYS C CB    1 
ATOM   7853  C CG    . LYS C 1 282 ? 28.545  15.110  34.324  1.00 37.59  ?  279  LYS C CG    1 
ATOM   7854  C CD    . LYS C 1 282 ? 27.193  14.471  34.078  1.00 46.53  ?  279  LYS C CD    1 
ATOM   7855  C CE    . LYS C 1 282 ? 26.681  13.760  35.314  1.00 36.32  ?  279  LYS C CE    1 
ATOM   7856  N NZ    . LYS C 1 282 ? 25.435  13.007  35.011  1.00 41.86  1  279  LYS C NZ    1 
ATOM   7857  N N     . ASP C 1 283 ? 30.761  17.654  35.197  1.00 27.73  ?  280  ASP C N     1 
ATOM   7858  C CA    . ASP C 1 283 ? 30.664  18.902  35.944  1.00 31.16  ?  280  ASP C CA    1 
ATOM   7859  C C     . ASP C 1 283 ? 31.527  20.009  35.356  1.00 29.23  ?  280  ASP C C     1 
ATOM   7860  O O     . ASP C 1 283 ? 31.518  21.121  35.895  1.00 27.06  ?  280  ASP C O     1 
ATOM   7861  C CB    . ASP C 1 283 ? 31.041  18.681  37.409  1.00 21.73  ?  280  ASP C CB    1 
ATOM   7862  C CG    . ASP C 1 283 ? 29.889  18.143  38.232  1.00 33.80  ?  280  ASP C CG    1 
ATOM   7863  O OD1   . ASP C 1 283 ? 28.729  18.272  37.783  1.00 30.41  ?  280  ASP C OD1   1 
ATOM   7864  O OD2   . ASP C 1 283 ? 30.142  17.604  39.330  1.00 27.14  -1 280  ASP C OD2   1 
ATOM   7865  N N     . VAL C 1 284 ? 32.276  19.738  34.284  1.00 26.66  ?  281  VAL C N     1 
ATOM   7866  C CA    . VAL C 1 284 ? 32.986  20.809  33.593  1.00 28.03  ?  281  VAL C CA    1 
ATOM   7867  C C     . VAL C 1 284 ? 32.003  21.857  33.087  1.00 26.12  ?  281  VAL C C     1 
ATOM   7868  O O     . VAL C 1 284 ? 32.336  23.045  33.008  1.00 25.83  ?  281  VAL C O     1 
ATOM   7869  C CB    . VAL C 1 284 ? 33.848  20.235  32.448  1.00 19.53  ?  281  VAL C CB    1 
ATOM   7870  C CG1   . VAL C 1 284 ? 32.976  19.637  31.347  1.00 20.81  ?  281  VAL C CG1   1 
ATOM   7871  C CG2   . VAL C 1 284 ? 34.776  21.308  31.891  1.00 22.26  ?  281  VAL C CG2   1 
ATOM   7872  N N     . PHE C 1 285 ? 30.775  21.446  32.758  1.00 26.50  ?  282  PHE C N     1 
ATOM   7873  C CA    . PHE C 1 285 ? 29.758  22.403  32.340  1.00 29.21  ?  282  PHE C CA    1 
ATOM   7874  C C     . PHE C 1 285 ? 29.236  23.229  33.504  1.00 33.97  ?  282  PHE C C     1 
ATOM   7875  O O     . PHE C 1 285 ? 28.650  24.293  33.283  1.00 32.28  ?  282  PHE C O     1 
ATOM   7876  C CB    . PHE C 1 285 ? 28.605  21.675  31.651  1.00 24.48  ?  282  PHE C CB    1 
ATOM   7877  C CG    . PHE C 1 285 ? 28.985  21.073  30.332  1.00 22.84  ?  282  PHE C CG    1 
ATOM   7878  C CD1   . PHE C 1 285 ? 29.254  21.884  29.245  1.00 24.26  ?  282  PHE C CD1   1 
ATOM   7879  C CD2   . PHE C 1 285 ? 29.079  19.701  30.180  1.00 24.82  ?  282  PHE C CD2   1 
ATOM   7880  C CE1   . PHE C 1 285 ? 29.610  21.340  28.026  1.00 25.92  ?  282  PHE C CE1   1 
ATOM   7881  C CE2   . PHE C 1 285 ? 29.435  19.150  28.961  1.00 23.63  ?  282  PHE C CE2   1 
ATOM   7882  C CZ    . PHE C 1 285 ? 29.702  19.972  27.885  1.00 25.33  ?  282  PHE C CZ    1 
ATOM   7883  N N     . LYS C 1 286 ? 29.444  22.766  34.733  1.00 27.20  ?  283  LYS C N     1 
ATOM   7884  C CA    . LYS C 1 286 ? 29.037  23.499  35.922  1.00 27.53  ?  283  LYS C CA    1 
ATOM   7885  C C     . LYS C 1 286 ? 30.109  24.479  36.382  1.00 29.88  ?  283  LYS C C     1 
ATOM   7886  O O     . LYS C 1 286 ? 29.782  25.578  36.841  1.00 31.83  ?  283  LYS C O     1 
ATOM   7887  C CB    . LYS C 1 286 ? 28.706  22.509  37.042  1.00 25.21  ?  283  LYS C CB    1 
ATOM   7888  C CG    . LYS C 1 286 ? 28.097  23.109  38.293  1.00 36.43  ?  283  LYS C CG    1 
ATOM   7889  C CD    . LYS C 1 286 ? 27.723  21.999  39.267  1.00 39.64  ?  283  LYS C CD    1 
ATOM   7890  C CE    . LYS C 1 286 ? 27.338  22.540  40.635  1.00 44.19  ?  283  LYS C CE    1 
ATOM   7891  N NZ    . LYS C 1 286 ? 27.176  21.436  41.622  1.00 45.95  1  283  LYS C NZ    1 
ATOM   7892  N N     . TYR C 1 287 ? 31.387  24.116  36.247  1.00 26.74  ?  284  TYR C N     1 
ATOM   7893  C CA    . TYR C 1 287 ? 32.480  24.900  36.806  1.00 26.43  ?  284  TYR C CA    1 
ATOM   7894  C C     . TYR C 1 287 ? 33.431  25.476  35.763  1.00 33.70  ?  284  TYR C C     1 
ATOM   7895  O O     . TYR C 1 287 ? 34.396  26.151  36.145  1.00 25.82  ?  284  TYR C O     1 
ATOM   7896  C CB    . TYR C 1 287 ? 33.282  24.052  37.797  1.00 28.79  ?  284  TYR C CB    1 
ATOM   7897  C CG    . TYR C 1 287 ? 32.479  23.514  38.956  1.00 36.40  ?  284  TYR C CG    1 
ATOM   7898  C CD1   . TYR C 1 287 ? 31.925  24.369  39.899  1.00 33.89  ?  284  TYR C CD1   1 
ATOM   7899  C CD2   . TYR C 1 287 ? 32.294  22.145  39.121  1.00 30.37  ?  284  TYR C CD2   1 
ATOM   7900  C CE1   . TYR C 1 287 ? 31.195  23.878  40.967  1.00 38.31  ?  284  TYR C CE1   1 
ATOM   7901  C CE2   . TYR C 1 287 ? 31.568  21.644  40.185  1.00 35.28  ?  284  TYR C CE2   1 
ATOM   7902  C CZ    . TYR C 1 287 ? 31.020  22.515  41.104  1.00 41.33  ?  284  TYR C CZ    1 
ATOM   7903  O OH    . TYR C 1 287 ? 30.295  22.026  42.166  1.00 43.11  ?  284  TYR C OH    1 
ATOM   7904  N N     . SER C 1 288 ? 33.205  25.205  34.472  1.00 25.61  ?  285  SER C N     1 
ATOM   7905  C CA    . SER C 1 288 ? 33.966  25.772  33.356  1.00 25.05  ?  285  SER C CA    1 
ATOM   7906  C C     . SER C 1 288 ? 35.363  25.169  33.242  1.00 30.65  ?  285  SER C C     1 
ATOM   7907  O O     . SER C 1 288 ? 35.867  24.565  34.195  1.00 24.85  ?  285  SER C O     1 
ATOM   7908  C CB    . SER C 1 288 ? 34.053  27.301  33.479  1.00 18.59  ?  285  SER C CB    1 
ATOM   7909  O OG    . SER C 1 288 ? 34.521  27.890  32.272  1.00 20.17  ?  285  SER C OG    1 
ATOM   7910  N N     . PHE C 1 289 ? 35.979  25.309  32.065  1.00 21.00  ?  286  PHE C N     1 
ATOM   7911  C CA    . PHE C 1 289 ? 37.344  24.841  31.856  1.00 19.57  ?  286  PHE C CA    1 
ATOM   7912  C C     . PHE C 1 289 ? 38.277  25.424  32.908  1.00 23.29  ?  286  PHE C C     1 
ATOM   7913  O O     . PHE C 1 289 ? 38.186  26.605  33.252  1.00 26.38  ?  286  PHE C O     1 
ATOM   7914  C CB    . PHE C 1 289 ? 37.851  25.240  30.465  1.00 26.94  ?  286  PHE C CB    1 
ATOM   7915  C CG    . PHE C 1 289 ? 37.482  24.277  29.365  1.00 23.73  ?  286  PHE C CG    1 
ATOM   7916  C CD1   . PHE C 1 289 ? 36.452  23.367  29.521  1.00 22.41  ?  286  PHE C CD1   1 
ATOM   7917  C CD2   . PHE C 1 289 ? 38.184  24.285  28.169  1.00 23.64  ?  286  PHE C CD2   1 
ATOM   7918  C CE1   . PHE C 1 289 ? 36.122  22.490  28.502  1.00 22.37  ?  286  PHE C CE1   1 
ATOM   7919  C CE2   . PHE C 1 289 ? 37.861  23.408  27.147  1.00 26.12  ?  286  PHE C CE2   1 
ATOM   7920  C CZ    . PHE C 1 289 ? 36.827  22.509  27.315  1.00 22.64  ?  286  PHE C CZ    1 
ATOM   7921  N N     . TYR C 1 290 ? 39.181  24.580  33.414  1.00 20.82  ?  287  TYR C N     1 
ATOM   7922  C CA    . TYR C 1 290 ? 40.240  25.058  34.298  1.00 27.22  ?  287  TYR C CA    1 
ATOM   7923  C C     . TYR C 1 290 ? 40.953  26.263  33.696  1.00 24.51  ?  287  TYR C C     1 
ATOM   7924  O O     . TYR C 1 290 ? 41.229  27.246  34.392  1.00 27.27  ?  287  TYR C O     1 
ATOM   7925  C CB    . TYR C 1 290 ? 41.231  23.927  34.578  1.00 28.13  ?  287  TYR C CB    1 
ATOM   7926  C CG    . TYR C 1 290 ? 42.342  24.281  35.546  1.00 25.82  ?  287  TYR C CG    1 
ATOM   7927  C CD1   . TYR C 1 290 ? 42.089  24.426  36.904  1.00 29.82  ?  287  TYR C CD1   1 
ATOM   7928  C CD2   . TYR C 1 290 ? 43.648  24.444  35.102  1.00 27.63  ?  287  TYR C CD2   1 
ATOM   7929  C CE1   . TYR C 1 290 ? 43.103  24.741  37.793  1.00 30.91  ?  287  TYR C CE1   1 
ATOM   7930  C CE2   . TYR C 1 290 ? 44.669  24.757  35.983  1.00 24.48  ?  287  TYR C CE2   1 
ATOM   7931  C CZ    . TYR C 1 290 ? 44.389  24.905  37.326  1.00 31.57  ?  287  TYR C CZ    1 
ATOM   7932  O OH    . TYR C 1 290 ? 45.399  25.217  38.206  1.00 38.64  ?  287  TYR C OH    1 
ATOM   7933  N N     . LYS C 1 291 ? 41.249  26.206  32.400  1.00 22.87  ?  288  LYS C N     1 
ATOM   7934  C CA    . LYS C 1 291 ? 41.812  27.338  31.673  1.00 29.41  ?  288  LYS C CA    1 
ATOM   7935  C C     . LYS C 1 291 ? 41.098  27.448  30.337  1.00 28.45  ?  288  LYS C C     1 
ATOM   7936  O O     . LYS C 1 291 ? 41.121  26.507  29.537  1.00 22.28  ?  288  LYS C O     1 
ATOM   7937  C CB    . LYS C 1 291 ? 43.320  27.180  31.454  1.00 34.21  ?  288  LYS C CB    1 
ATOM   7938  C CG    . LYS C 1 291 ? 44.143  27.022  32.724  1.00 45.06  ?  288  LYS C CG    1 
ATOM   7939  C CD    . LYS C 1 291 ? 44.404  28.352  33.409  1.00 52.30  ?  288  LYS C CD    1 
ATOM   7940  C CE    . LYS C 1 291 ? 45.470  28.198  34.481  1.00 49.50  ?  288  LYS C CE    1 
ATOM   7941  N NZ    . LYS C 1 291 ? 46.667  27.483  33.949  1.00 45.68  1  288  LYS C NZ    1 
ATOM   7942  N N     . ASN C 1 292 ? 40.457  28.589  30.099  1.00 33.20  ?  289  ASN C N     1 
ATOM   7943  C CA    . ASN C 1 292 ? 39.894  28.871  28.786  1.00 27.53  ?  289  ASN C CA    1 
ATOM   7944  C C     . ASN C 1 292 ? 40.050  30.352  28.476  1.00 21.97  ?  289  ASN C C     1 
ATOM   7945  O O     . ASN C 1 292 ? 41.166  30.825  28.243  1.00 21.63  ?  289  ASN C O     1 
ATOM   7946  C CB    . ASN C 1 292 ? 38.423  28.453  28.710  1.00 20.05  ?  289  ASN C CB    1 
ATOM   7947  C CG    . ASN C 1 292 ? 37.918  28.358  27.275  1.00 21.50  ?  289  ASN C CG    1 
ATOM   7948  O OD1   . ASN C 1 292 ? 38.475  28.971  26.364  1.00 22.08  ?  289  ASN C OD1   1 
ATOM   7949  N ND2   . ASN C 1 292 ? 36.857  27.589  27.071  1.00 18.96  ?  289  ASN C ND2   1 
ATOM   7950  N N     . GLU C 1 293 ? 38.938  31.089  28.479  1.00 22.19  ?  290  GLU C N     1 
ATOM   7951  C CA    . GLU C 1 293 ? 38.937  32.521  28.183  1.00 33.47  ?  290  GLU C CA    1 
ATOM   7952  C C     . GLU C 1 293 ? 39.515  32.801  26.798  1.00 35.99  ?  290  GLU C C     1 
ATOM   7953  O O     . GLU C 1 293 ? 40.088  33.865  26.552  1.00 40.26  ?  290  GLU C O     1 
ATOM   7954  C CB    . GLU C 1 293 ? 39.685  33.316  29.261  1.00 33.37  ?  290  GLU C CB    1 
ATOM   7955  C CG    . GLU C 1 293 ? 39.047  33.262  30.655  1.00 41.80  ?  290  GLU C CG    1 
ATOM   7956  C CD    . GLU C 1 293 ? 39.243  31.925  31.365  1.00 51.90  ?  290  GLU C CD    1 
ATOM   7957  O OE1   . GLU C 1 293 ? 40.403  31.478  31.501  1.00 52.45  ?  290  GLU C OE1   1 
ATOM   7958  O OE2   . GLU C 1 293 ? 38.234  31.316  31.785  1.00 43.80  -1 290  GLU C OE2   1 
ATOM   7959  N N     . GLN C 1 294 ? 39.368  31.837  25.896  1.00 32.69  ?  291  GLN C N     1 
ATOM   7960  C CA    . GLN C 1 294 ? 39.817  31.885  24.515  1.00 23.61  ?  291  GLN C CA    1 
ATOM   7961  C C     . GLN C 1 294 ? 38.618  31.969  23.580  1.00 26.04  ?  291  GLN C C     1 
ATOM   7962  O O     . GLN C 1 294 ? 37.498  31.607  23.958  1.00 21.78  ?  291  GLN C O     1 
ATOM   7963  C CB    . GLN C 1 294 ? 40.641  30.634  24.171  1.00 31.66  ?  291  GLN C CB    1 
ATOM   7964  C CG    . GLN C 1 294 ? 41.809  30.369  25.109  1.00 39.11  ?  291  GLN C CG    1 
ATOM   7965  C CD    . GLN C 1 294 ? 42.952  31.345  24.908  1.00 41.03  ?  291  GLN C CD    1 
ATOM   7966  O OE1   . GLN C 1 294 ? 43.442  31.516  23.793  1.00 31.00  ?  291  GLN C OE1   1 
ATOM   7967  N NE2   . GLN C 1 294 ? 43.380  31.992  25.987  1.00 31.24  ?  291  GLN C NE2   1 
ATOM   7968  N N     . PRO C 1 295 ? 38.809  32.451  22.351  1.00 31.31  ?  292  PRO C N     1 
ATOM   7969  C CA    . PRO C 1 295 ? 37.694  32.493  21.398  1.00 30.37  ?  292  PRO C CA    1 
ATOM   7970  C C     . PRO C 1 295 ? 37.513  31.180  20.652  1.00 28.71  ?  292  PRO C C     1 
ATOM   7971  O O     . PRO C 1 295 ? 38.474  30.514  20.258  1.00 25.07  ?  292  PRO C O     1 
ATOM   7972  C CB    . PRO C 1 295 ? 38.111  33.613  20.435  1.00 31.63  ?  292  PRO C CB    1 
ATOM   7973  C CG    . PRO C 1 295 ? 39.599  33.552  20.435  1.00 35.76  ?  292  PRO C CG    1 
ATOM   7974  C CD    . PRO C 1 295 ? 40.007  33.138  21.830  1.00 21.33  ?  292  PRO C CD    1 
ATOM   7975  N N     . LEU C 1 296 ? 36.248  30.812  20.455  1.00 22.55  ?  293  LEU C N     1 
ATOM   7976  C CA    . LEU C 1 296 ? 35.877  29.648  19.659  1.00 20.21  ?  293  LEU C CA    1 
ATOM   7977  C C     . LEU C 1 296 ? 35.487  30.144  18.271  1.00 16.97  ?  293  LEU C C     1 
ATOM   7978  O O     . LEU C 1 296 ? 34.404  30.706  18.082  1.00 23.87  ?  293  LEU C O     1 
ATOM   7979  C CB    . LEU C 1 296 ? 34.736  28.875  20.316  1.00 27.98  ?  293  LEU C CB    1 
ATOM   7980  C CG    . LEU C 1 296 ? 34.266  27.630  19.558  1.00 18.53  ?  293  LEU C CG    1 
ATOM   7981  C CD1   . LEU C 1 296 ? 35.406  26.633  19.420  1.00 20.10  ?  293  LEU C CD1   1 
ATOM   7982  C CD2   . LEU C 1 296 ? 33.071  26.987  20.244  1.00 22.29  ?  293  LEU C CD2   1 
ATOM   7983  N N     . LYS C 1 297 ? 36.371  29.929  17.302  1.00 15.61  ?  294  LYS C N     1 
ATOM   7984  C CA    . LYS C 1 297 ? 36.168  30.361  15.927  1.00 20.85  ?  294  LYS C CA    1 
ATOM   7985  C C     . LYS C 1 297 ? 35.920  29.147  15.043  1.00 15.32  ?  294  LYS C C     1 
ATOM   7986  O O     . LYS C 1 297 ? 36.530  28.093  15.242  1.00 23.32  ?  294  LYS C O     1 
ATOM   7987  C CB    . LYS C 1 297 ? 37.380  31.146  15.420  1.00 24.20  ?  294  LYS C CB    1 
ATOM   7988  C CG    . LYS C 1 297 ? 37.704  32.375  16.256  1.00 32.87  ?  294  LYS C CG    1 
ATOM   7989  C CD    . LYS C 1 297 ? 38.925  33.110  15.726  1.00 37.38  ?  294  LYS C CD    1 
ATOM   7990  C CE    . LYS C 1 297 ? 39.112  34.442  16.436  1.00 45.04  ?  294  LYS C CE    1 
ATOM   7991  N NZ    . LYS C 1 297 ? 40.238  35.225  15.860  1.00 45.64  1  294  LYS C NZ    1 
ATOM   7992  N N     . ALA C 1 298 ? 35.034  29.296  14.059  1.00 24.78  ?  295  ALA C N     1 
ATOM   7993  C CA    . ALA C 1 298 ? 34.662  28.150  13.240  1.00 17.83  ?  295  ALA C CA    1 
ATOM   7994  C C     . ALA C 1 298 ? 34.132  28.609  11.892  1.00 17.03  ?  295  ALA C C     1 
ATOM   7995  O O     . ALA C 1 298 ? 33.654  29.736  11.738  1.00 21.35  ?  295  ALA C O     1 
ATOM   7996  C CB    . ALA C 1 298 ? 33.617  27.281  13.949  1.00 20.01  ?  295  ALA C CB    1 
ATOM   7997  N N     . ILE C 1 299 ? 34.228  27.707  10.914  1.00 15.13  ?  296  ILE C N     1 
ATOM   7998  C CA    . ILE C 1 299 ? 33.551  27.831  9.629   1.00 22.46  ?  296  ILE C CA    1 
ATOM   7999  C C     . ILE C 1 299 ? 32.918  26.481  9.309   1.00 21.35  ?  296  ILE C C     1 
ATOM   8000  O O     . ILE C 1 299 ? 33.176  25.478  9.975   1.00 21.96  ?  296  ILE C O     1 
ATOM   8001  C CB    . ILE C 1 299 ? 34.497  28.276  8.492   1.00 22.55  ?  296  ILE C CB    1 
ATOM   8002  C CG1   . ILE C 1 299 ? 35.650  27.286  8.323   1.00 31.91  ?  296  ILE C CG1   1 
ATOM   8003  C CG2   . ILE C 1 299 ? 35.024  29.679  8.749   1.00 25.53  ?  296  ILE C CG2   1 
ATOM   8004  C CD1   . ILE C 1 299 ? 36.611  27.653  7.202   1.00 32.22  ?  296  ILE C CD1   1 
ATOM   8005  N N     . PHE C 1 300 ? 32.090  26.463  8.266   1.00 17.30  ?  297  PHE C N     1 
ATOM   8006  C CA    . PHE C 1 300 ? 31.274  25.305  7.921   1.00 18.82  ?  297  PHE C CA    1 
ATOM   8007  C C     . PHE C 1 300 ? 31.622  24.795  6.530   1.00 25.65  ?  297  PHE C C     1 
ATOM   8008  O O     . PHE C 1 300 ? 31.796  25.583  5.595   1.00 20.69  ?  297  PHE C O     1 
ATOM   8009  C CB    . PHE C 1 300 ? 29.776  25.643  7.955   1.00 17.21  ?  297  PHE C CB    1 
ATOM   8010  C CG    . PHE C 1 300 ? 29.279  26.097  9.294   1.00 23.73  ?  297  PHE C CG    1 
ATOM   8011  C CD1   . PHE C 1 300 ? 29.317  27.439  9.638   1.00 26.77  ?  297  PHE C CD1   1 
ATOM   8012  C CD2   . PHE C 1 300 ? 28.755  25.188  10.199  1.00 20.36  ?  297  PHE C CD2   1 
ATOM   8013  C CE1   . PHE C 1 300 ? 28.852  27.863  10.866  1.00 26.23  ?  297  PHE C CE1   1 
ATOM   8014  C CE2   . PHE C 1 300 ? 28.291  25.607  11.431  1.00 17.14  ?  297  PHE C CE2   1 
ATOM   8015  C CZ    . PHE C 1 300 ? 28.340  26.946  11.764  1.00 22.46  ?  297  PHE C CZ    1 
ATOM   8016  N N     . PHE C 1 301 ? 31.695  23.473  6.390   1.00 15.90  ?  298  PHE C N     1 
ATOM   8017  C CA    . PHE C 1 301 ? 31.861  22.828  5.094   1.00 18.21  ?  298  PHE C CA    1 
ATOM   8018  C C     . PHE C 1 301 ? 30.706  21.870  4.855   1.00 25.80  ?  298  PHE C C     1 
ATOM   8019  O O     . PHE C 1 301 ? 30.409  21.023  5.705   1.00 21.15  ?  298  PHE C O     1 
ATOM   8020  C CB    . PHE C 1 301 ? 33.195  22.082  5.002   1.00 20.84  ?  298  PHE C CB    1 
ATOM   8021  C CG    . PHE C 1 301 ? 34.385  22.988  4.935   1.00 18.16  ?  298  PHE C CG    1 
ATOM   8022  C CD1   . PHE C 1 301 ? 34.966  23.480  6.093   1.00 19.49  ?  298  PHE C CD1   1 
ATOM   8023  C CD2   . PHE C 1 301 ? 34.920  23.357  3.713   1.00 24.33  ?  298  PHE C CD2   1 
ATOM   8024  C CE1   . PHE C 1 301 ? 36.061  24.324  6.034   1.00 17.73  ?  298  PHE C CE1   1 
ATOM   8025  C CE2   . PHE C 1 301 ? 36.017  24.199  3.649   1.00 24.42  ?  298  PHE C CE2   1 
ATOM   8026  C CZ    . PHE C 1 301 ? 36.586  24.680  4.810   1.00 22.53  ?  298  PHE C CZ    1 
ATOM   8027  N N     . PHE C 1 302 ? 30.062  22.007  3.701   1.00 20.12  ?  299  PHE C N     1 
ATOM   8028  C CA    . PHE C 1 302 ? 28.940  21.169  3.313   1.00 20.41  ?  299  PHE C CA    1 
ATOM   8029  C C     . PHE C 1 302 ? 29.297  20.390  2.057   1.00 24.18  ?  299  PHE C C     1 
ATOM   8030  O O     . PHE C 1 302 ? 30.030  20.878  1.194   1.00 19.80  ?  299  PHE C O     1 
ATOM   8031  C CB    . PHE C 1 302 ? 27.675  22.003  3.071   1.00 21.63  ?  299  PHE C CB    1 
ATOM   8032  C CG    . PHE C 1 302 ? 27.227  22.780  4.275   1.00 20.93  ?  299  PHE C CG    1 
ATOM   8033  C CD1   . PHE C 1 302 ? 26.353  22.222  5.190   1.00 30.82  ?  299  PHE C CD1   1 
ATOM   8034  C CD2   . PHE C 1 302 ? 27.693  24.060  4.498   1.00 17.96  ?  299  PHE C CD2   1 
ATOM   8035  C CE1   . PHE C 1 302 ? 25.950  22.934  6.302   1.00 28.02  ?  299  PHE C CE1   1 
ATOM   8036  C CE2   . PHE C 1 302 ? 27.292  24.775  5.604   1.00 23.33  ?  299  PHE C CE2   1 
ATOM   8037  C CZ    . PHE C 1 302 ? 26.421  24.212  6.507   1.00 28.02  ?  299  PHE C CZ    1 
ATOM   8038  N N     . SER C 1 303 ? 28.767  19.168  1.961   1.00 26.18  ?  300  SER C N     1 
ATOM   8039  C CA    . SER C 1 303 ? 29.061  18.325  0.809   1.00 26.49  ?  300  SER C CA    1 
ATOM   8040  C C     . SER C 1 303 ? 28.334  18.790  -0.448  1.00 29.63  ?  300  SER C C     1 
ATOM   8041  O O     . SER C 1 303 ? 28.764  18.455  -1.558  1.00 27.01  ?  300  SER C O     1 
ATOM   8042  C CB    . SER C 1 303 ? 28.701  16.872  1.124   1.00 17.35  ?  300  SER C CB    1 
ATOM   8043  O OG    . SER C 1 303 ? 27.313  16.723  1.354   1.00 28.95  ?  300  SER C OG    1 
ATOM   8044  N N     . SER C 1 304 ? 27.258  19.556  -0.299  1.00 31.62  ?  301  SER C N     1 
ATOM   8045  C CA    . SER C 1 304 ? 26.496  20.059  -1.434  1.00 35.57  ?  301  SER C CA    1 
ATOM   8046  C C     . SER C 1 304 ? 25.576  21.166  -0.943  1.00 34.02  ?  301  SER C C     1 
ATOM   8047  O O     . SER C 1 304 ? 25.346  21.317  0.261   1.00 24.12  ?  301  SER C O     1 
ATOM   8048  C CB    . SER C 1 304 ? 25.684  18.946  -2.106  1.00 35.22  ?  301  SER C CB    1 
ATOM   8049  O OG    . SER C 1 304 ? 24.795  18.335  -1.186  1.00 41.55  ?  301  SER C OG    1 
ATOM   8050  N N     . LYS C 1 305 ? 25.059  21.946  -1.895  1.00 24.25  ?  302  LYS C N     1 
ATOM   8051  C CA    . LYS C 1 305 ? 24.004  22.898  -1.567  1.00 26.47  ?  302  LYS C CA    1 
ATOM   8052  C C     . LYS C 1 305 ? 22.778  22.175  -1.030  1.00 26.63  ?  302  LYS C C     1 
ATOM   8053  O O     . LYS C 1 305 ? 22.110  22.665  -0.112  1.00 31.92  ?  302  LYS C O     1 
ATOM   8054  C CB    . LYS C 1 305 ? 23.639  23.732  -2.797  1.00 31.81  ?  302  LYS C CB    1 
ATOM   8055  C CG    . LYS C 1 305 ? 24.659  24.799  -3.168  1.00 39.09  ?  302  LYS C CG    1 
ATOM   8056  C CD    . LYS C 1 305 ? 24.616  25.968  -2.196  1.00 40.80  ?  302  LYS C CD    1 
ATOM   8057  C CE    . LYS C 1 305 ? 25.585  27.069  -2.607  1.00 42.78  ?  302  LYS C CE    1 
ATOM   8058  N NZ    . LYS C 1 305 ? 25.512  28.241  -1.688  1.00 40.73  1  302  LYS C NZ    1 
ATOM   8059  N N     . LYS C 1 306 ? 22.481  20.994  -1.580  1.00 24.15  ?  303  LYS C N     1 
ATOM   8060  C CA    . LYS C 1 306 ? 21.332  20.215  -1.128  1.00 34.05  ?  303  LYS C CA    1 
ATOM   8061  C C     . LYS C 1 306 ? 21.471  19.818  0.337   1.00 31.42  ?  303  LYS C C     1 
ATOM   8062  O O     . LYS C 1 306 ? 20.517  19.927  1.115   1.00 30.22  ?  303  LYS C O     1 
ATOM   8063  C CB    . LYS C 1 306 ? 21.171  18.975  -2.007  1.00 37.42  ?  303  LYS C CB    1 
ATOM   8064  C CG    . LYS C 1 306 ? 20.173  17.959  -1.487  1.00 39.67  ?  303  LYS C CG    1 
ATOM   8065  C CD    . LYS C 1 306 ? 20.470  16.581  -2.055  1.00 44.52  ?  303  LYS C CD    1 
ATOM   8066  C CE    . LYS C 1 306 ? 19.196  15.850  -2.421  1.00 42.61  ?  303  LYS C CE    1 
ATOM   8067  N NZ    . LYS C 1 306 ? 18.446  16.595  -3.468  1.00 54.40  1  303  LYS C NZ    1 
ATOM   8068  N N     . GLN C 1 307 ? 22.656  19.340  0.729   1.00 22.55  ?  304  GLN C N     1 
ATOM   8069  C CA    . GLN C 1 307 ? 22.879  18.974  2.124   1.00 23.36  ?  304  GLN C CA    1 
ATOM   8070  C C     . GLN C 1 307 ? 22.675  20.172  3.042   1.00 23.05  ?  304  GLN C C     1 
ATOM   8071  O O     . GLN C 1 307 ? 22.118  20.038  4.139   1.00 24.68  ?  304  GLN C O     1 
ATOM   8072  C CB    . GLN C 1 307 ? 24.286  18.398  2.300   1.00 25.66  ?  304  GLN C CB    1 
ATOM   8073  C CG    . GLN C 1 307 ? 24.557  17.852  3.694   1.00 25.46  ?  304  GLN C CG    1 
ATOM   8074  C CD    . GLN C 1 307 ? 26.034  17.849  4.047   1.00 24.24  ?  304  GLN C CD    1 
ATOM   8075  O OE1   . GLN C 1 307 ? 26.694  18.887  3.999   1.00 20.99  ?  304  GLN C OE1   1 
ATOM   8076  N NE2   . GLN C 1 307 ? 26.556  16.683  4.412   1.00 19.87  ?  304  GLN C NE2   1 
ATOM   8077  N N     . PHE C 1 308 ? 23.117  21.355  2.607   1.00 25.15  ?  305  PHE C N     1 
ATOM   8078  C CA    . PHE C 1 308 ? 22.897  22.565  3.393   1.00 25.94  ?  305  PHE C CA    1 
ATOM   8079  C C     . PHE C 1 308 ? 21.413  22.801  3.634   1.00 29.20  ?  305  PHE C C     1 
ATOM   8080  O O     . PHE C 1 308 ? 20.989  23.072  4.763   1.00 27.36  ?  305  PHE C O     1 
ATOM   8081  C CB    . PHE C 1 308 ? 23.514  23.775  2.692   1.00 26.17  ?  305  PHE C CB    1 
ATOM   8082  C CG    . PHE C 1 308 ? 23.067  25.088  3.264   1.00 31.15  ?  305  PHE C CG    1 
ATOM   8083  C CD1   . PHE C 1 308 ? 23.616  25.564  4.443   1.00 35.93  ?  305  PHE C CD1   1 
ATOM   8084  C CD2   . PHE C 1 308 ? 22.083  25.836  2.638   1.00 26.21  ?  305  PHE C CD2   1 
ATOM   8085  C CE1   . PHE C 1 308 ? 23.200  26.766  4.981   1.00 35.23  ?  305  PHE C CE1   1 
ATOM   8086  C CE2   . PHE C 1 308 ? 21.662  27.041  3.172   1.00 32.29  ?  305  PHE C CE2   1 
ATOM   8087  C CZ    . PHE C 1 308 ? 22.222  27.506  4.344   1.00 33.85  ?  305  PHE C CZ    1 
ATOM   8088  N N     . PHE C 1 309 ? 20.605  22.708  2.577   1.00 29.62  ?  306  PHE C N     1 
ATOM   8089  C CA    . PHE C 1 309 ? 19.180  22.981  2.722   1.00 27.91  ?  306  PHE C CA    1 
ATOM   8090  C C     . PHE C 1 309 ? 18.481  21.907  3.543   1.00 27.37  ?  306  PHE C C     1 
ATOM   8091  O O     . PHE C 1 309 ? 17.447  22.180  4.161   1.00 37.47  ?  306  PHE C O     1 
ATOM   8092  C CB    . PHE C 1 309 ? 18.528  23.123  1.348   1.00 23.84  ?  306  PHE C CB    1 
ATOM   8093  C CG    . PHE C 1 309 ? 18.874  24.407  0.650   1.00 29.28  ?  306  PHE C CG    1 
ATOM   8094  C CD1   . PHE C 1 309 ? 18.441  25.621  1.156   1.00 29.62  ?  306  PHE C CD1   1 
ATOM   8095  C CD2   . PHE C 1 309 ? 19.630  24.403  -0.508  1.00 22.11  ?  306  PHE C CD2   1 
ATOM   8096  C CE1   . PHE C 1 309 ? 18.759  26.806  0.523   1.00 27.87  ?  306  PHE C CE1   1 
ATOM   8097  C CE2   . PHE C 1 309 ? 19.949  25.585  -1.148  1.00 33.01  ?  306  PHE C CE2   1 
ATOM   8098  C CZ    . PHE C 1 309 ? 19.513  26.787  -0.634  1.00 29.24  ?  306  PHE C CZ    1 
ATOM   8099  N N     . GLU C 1 310 ? 19.029  20.691  3.573   1.00 32.19  ?  307  GLU C N     1 
ATOM   8100  C CA    . GLU C 1 310 ? 18.434  19.643  4.395   1.00 36.85  ?  307  GLU C CA    1 
ATOM   8101  C C     . GLU C 1 310 ? 18.533  19.967  5.881   1.00 42.12  ?  307  GLU C C     1 
ATOM   8102  O O     . GLU C 1 310 ? 17.643  19.596  6.654   1.00 44.87  ?  307  GLU C O     1 
ATOM   8103  C CB    . GLU C 1 310 ? 19.104  18.299  4.105   1.00 47.01  ?  307  GLU C CB    1 
ATOM   8104  C CG    . GLU C 1 310 ? 18.787  17.719  2.736   1.00 59.55  ?  307  GLU C CG    1 
ATOM   8105  C CD    . GLU C 1 310 ? 19.535  16.426  2.467   1.00 70.99  ?  307  GLU C CD    1 
ATOM   8106  O OE1   . GLU C 1 310 ? 20.139  15.880  3.415   1.00 73.11  ?  307  GLU C OE1   1 
ATOM   8107  O OE2   . GLU C 1 310 ? 19.523  15.959  1.309   1.00 72.97  -1 307  GLU C OE2   1 
ATOM   8108  N N     . VAL C 1 311 ? 19.590  20.661  6.297   1.00 30.63  ?  308  VAL C N     1 
ATOM   8109  C CA    . VAL C 1 311 ? 19.846  20.927  7.707   1.00 36.87  ?  308  VAL C CA    1 
ATOM   8110  C C     . VAL C 1 311 ? 19.739  22.410  8.034   1.00 28.50  ?  308  VAL C C     1 
ATOM   8111  O O     . VAL C 1 311 ? 20.113  22.823  9.137   1.00 24.96  ?  308  VAL C O     1 
ATOM   8112  C CB    . VAL C 1 311 ? 21.215  20.372  8.137   1.00 43.59  ?  308  VAL C CB    1 
ATOM   8113  C CG1   . VAL C 1 311 ? 21.325  18.897  7.781   1.00 45.78  ?  308  VAL C CG1   1 
ATOM   8114  C CG2   . VAL C 1 311 ? 22.344  21.167  7.493   1.00 31.19  ?  308  VAL C CG2   1 
ATOM   8115  N N     . GLN C 1 312 ? 19.222  23.224  7.107   1.00 28.36  ?  309  GLN C N     1 
ATOM   8116  C CA    . GLN C 1 312 ? 19.196  24.670  7.319   1.00 29.21  ?  309  GLN C CA    1 
ATOM   8117  C C     . GLN C 1 312 ? 18.423  25.040  8.580   1.00 29.39  ?  309  GLN C C     1 
ATOM   8118  O O     . GLN C 1 312 ? 18.821  25.954  9.312   1.00 23.65  ?  309  GLN C O     1 
ATOM   8119  C CB    . GLN C 1 312 ? 18.595  25.376  6.103   1.00 35.16  ?  309  GLN C CB    1 
ATOM   8120  C CG    . GLN C 1 312 ? 18.607  26.895  6.211   1.00 29.72  ?  309  GLN C CG    1 
ATOM   8121  C CD    . GLN C 1 312 ? 18.037  27.579  4.986   1.00 34.54  ?  309  GLN C CD    1 
ATOM   8122  O OE1   . GLN C 1 312 ? 17.284  26.977  4.222   1.00 36.63  ?  309  GLN C OE1   1 
ATOM   8123  N NE2   . GLN C 1 312 ? 18.397  28.842  4.791   1.00 32.21  ?  309  GLN C NE2   1 
ATOM   8124  N N     . LYS C 1 313 ? 17.324  24.334  8.856   1.00 23.40  ?  310  LYS C N     1 
ATOM   8125  C CA    . LYS C 1 313 ? 16.523  24.645  10.035  1.00 28.77  ?  310  LYS C CA    1 
ATOM   8126  C C     . LYS C 1 313 ? 17.309  24.383  11.313  1.00 20.90  ?  310  LYS C C     1 
ATOM   8127  O O     . LYS C 1 313 ? 17.371  25.237  12.205  1.00 28.45  ?  310  LYS C O     1 
ATOM   8128  C CB    . LYS C 1 313 ? 15.228  23.833  10.022  1.00 27.36  ?  310  LYS C CB    1 
ATOM   8129  C CG    . LYS C 1 313 ? 14.376  24.021  11.270  1.00 38.01  ?  310  LYS C CG    1 
ATOM   8130  C CD    . LYS C 1 313 ? 13.068  23.254  11.178  1.00 39.97  ?  310  LYS C CD    1 
ATOM   8131  C CE    . LYS C 1 313 ? 12.299  23.326  12.488  1.00 46.32  ?  310  LYS C CE    1 
ATOM   8132  N NZ    . LYS C 1 313 ? 11.014  22.572  12.426  1.00 53.28  1  310  LYS C NZ    1 
ATOM   8133  N N     . SER C 1 314 ? 17.924  23.204  11.416  1.00 27.01  ?  311  SER C N     1 
ATOM   8134  C CA    . SER C 1 314 ? 18.755  22.906  12.576  1.00 25.32  ?  311  SER C CA    1 
ATOM   8135  C C     . SER C 1 314 ? 19.930  23.870  12.673  1.00 25.07  ?  311  SER C C     1 
ATOM   8136  O O     . SER C 1 314 ? 20.334  24.258  13.776  1.00 24.89  ?  311  SER C O     1 
ATOM   8137  C CB    . SER C 1 314 ? 19.255  21.467  12.504  1.00 24.55  ?  311  SER C CB    1 
ATOM   8138  O OG    . SER C 1 314 ? 18.180  20.554  12.390  1.00 35.28  ?  311  SER C OG    1 
ATOM   8139  N N     . LEU C 1 315 ? 20.493  24.267  11.527  1.00 26.93  ?  312  LEU C N     1 
ATOM   8140  C CA    . LEU C 1 315 ? 21.597  25.224  11.533  1.00 28.41  ?  312  LEU C CA    1 
ATOM   8141  C C     . LEU C 1 315 ? 21.163  26.568  12.101  1.00 30.64  ?  312  LEU C C     1 
ATOM   8142  O O     . LEU C 1 315 ? 21.885  27.175  12.902  1.00 28.44  ?  312  LEU C O     1 
ATOM   8143  C CB    . LEU C 1 315 ? 22.149  25.402  10.120  1.00 25.27  ?  312  LEU C CB    1 
ATOM   8144  C CG    . LEU C 1 315 ? 23.004  24.297  9.507   1.00 28.39  ?  312  LEU C CG    1 
ATOM   8145  C CD1   . LEU C 1 315 ? 23.327  24.657  8.070   1.00 34.21  ?  312  LEU C CD1   1 
ATOM   8146  C CD2   . LEU C 1 315 ? 24.282  24.089  10.307  1.00 28.44  ?  312  LEU C CD2   1 
ATOM   8147  N N     . LYS C 1 316 ? 19.989  27.057  11.690  1.00 22.14  ?  313  LYS C N     1 
ATOM   8148  C CA    . LYS C 1 316 ? 19.493  28.321  12.225  1.00 26.23  ?  313  LYS C CA    1 
ATOM   8149  C C     . LYS C 1 316 ? 19.194  28.207  13.713  1.00 19.67  ?  313  LYS C C     1 
ATOM   8150  O O     . LYS C 1 316 ? 19.517  29.116  14.487  1.00 25.31  ?  313  LYS C O     1 
ATOM   8151  C CB    . LYS C 1 316 ? 18.248  28.772  11.458  1.00 30.84  ?  313  LYS C CB    1 
ATOM   8152  C CG    . LYS C 1 316 ? 18.503  29.053  9.985   1.00 28.93  ?  313  LYS C CG    1 
ATOM   8153  C CD    . LYS C 1 316 ? 17.215  29.298  9.215   1.00 24.60  ?  313  LYS C CD    1 
ATOM   8154  C CE    . LYS C 1 316 ? 16.865  30.775  9.144   1.00 32.56  ?  313  LYS C CE    1 
ATOM   8155  N NZ    . LYS C 1 316 ? 15.988  31.065  7.970   1.00 41.76  1  313  LYS C NZ    1 
ATOM   8156  N N     . GLU C 1 317 ? 18.587  27.093  14.133  1.00 24.17  ?  314  GLU C N     1 
ATOM   8157  C CA    . GLU C 1 317 ? 18.306  26.890  15.553  1.00 22.62  ?  314  GLU C CA    1 
ATOM   8158  C C     . GLU C 1 317 ? 19.586  26.900  16.376  1.00 26.66  ?  314  GLU C C     1 
ATOM   8159  O O     . GLU C 1 317 ? 19.632  27.490  17.462  1.00 27.05  ?  314  GLU C O     1 
ATOM   8160  C CB    . GLU C 1 317 ? 17.555  25.575  15.764  1.00 18.10  ?  314  GLU C CB    1 
ATOM   8161  C CG    . GLU C 1 317 ? 16.131  25.578  15.238  1.00 31.42  ?  314  GLU C CG    1 
ATOM   8162  C CD    . GLU C 1 317 ? 15.453  24.228  15.384  1.00 41.44  ?  314  GLU C CD    1 
ATOM   8163  O OE1   . GLU C 1 317 ? 16.138  23.252  15.757  1.00 53.05  ?  314  GLU C OE1   1 
ATOM   8164  O OE2   . GLU C 1 317 ? 14.234  24.143  15.128  1.00 44.51  -1 314  GLU C OE2   1 
ATOM   8165  N N     . LEU C 1 318 ? 20.641  26.261  15.873  1.00 26.05  ?  315  LEU C N     1 
ATOM   8166  C CA    . LEU C 1 318 ? 21.860  26.130  16.661  1.00 32.43  ?  315  LEU C CA    1 
ATOM   8167  C C     . LEU C 1 318 ? 22.733  27.378  16.584  1.00 29.42  ?  315  LEU C C     1 
ATOM   8168  O O     . LEU C 1 318 ? 23.330  27.777  17.590  1.00 26.12  ?  315  LEU C O     1 
ATOM   8169  C CB    . LEU C 1 318 ? 22.646  24.903  16.203  1.00 32.83  ?  315  LEU C CB    1 
ATOM   8170  C CG    . LEU C 1 318 ? 22.136  23.583  16.783  1.00 36.81  ?  315  LEU C CG    1 
ATOM   8171  C CD1   . LEU C 1 318 ? 22.744  22.407  16.061  1.00 36.92  ?  315  LEU C CD1   1 
ATOM   8172  C CD2   . LEU C 1 318 ? 22.443  23.509  18.270  1.00 21.66  ?  315  LEU C CD2   1 
ATOM   8173  N N     . PHE C 1 319 ? 22.811  28.018  15.416  1.00 25.94  ?  316  PHE C N     1 
ATOM   8174  C CA    . PHE C 1 319 ? 23.824  29.038  15.195  1.00 28.55  ?  316  PHE C CA    1 
ATOM   8175  C C     . PHE C 1 319 ? 23.277  30.433  14.924  1.00 33.85  ?  316  PHE C C     1 
ATOM   8176  O O     . PHE C 1 319 ? 24.034  31.402  15.038  1.00 36.33  ?  316  PHE C O     1 
ATOM   8177  C CB    . PHE C 1 319 ? 24.739  28.609  14.040  1.00 32.31  ?  316  PHE C CB    1 
ATOM   8178  C CG    . PHE C 1 319 ? 25.341  27.247  14.237  1.00 29.76  ?  316  PHE C CG    1 
ATOM   8179  C CD1   . PHE C 1 319 ? 26.198  27.000  15.298  1.00 27.65  ?  316  PHE C CD1   1 
ATOM   8180  C CD2   . PHE C 1 319 ? 25.039  26.209  13.374  1.00 22.39  ?  316  PHE C CD2   1 
ATOM   8181  C CE1   . PHE C 1 319 ? 26.749  25.742  15.490  1.00 19.32  ?  316  PHE C CE1   1 
ATOM   8182  C CE2   . PHE C 1 319 ? 25.584  24.948  13.561  1.00 26.82  ?  316  PHE C CE2   1 
ATOM   8183  C CZ    . PHE C 1 319 ? 26.442  24.716  14.620  1.00 14.56  ?  316  PHE C CZ    1 
ATOM   8184  N N     . HIS C 1 320 ? 21.996  30.571  14.580  1.00 32.50  ?  317  HIS C N     1 
ATOM   8185  C CA    . HIS C 1 320 ? 21.392  31.894  14.480  1.00 29.85  ?  317  HIS C CA    1 
ATOM   8186  C C     . HIS C 1 320 ? 20.751  32.347  15.783  1.00 37.07  ?  317  HIS C C     1 
ATOM   8187  O O     . HIS C 1 320 ? 20.585  33.554  15.989  1.00 46.32  ?  317  HIS C O     1 
ATOM   8188  C CB    . HIS C 1 320 ? 20.345  31.926  13.364  1.00 34.95  ?  317  HIS C CB    1 
ATOM   8189  C CG    . HIS C 1 320 ? 20.925  31.868  11.987  1.00 44.33  ?  317  HIS C CG    1 
ATOM   8190  N ND1   . HIS C 1 320 ? 20.283  32.395  10.887  1.00 47.74  ?  317  HIS C ND1   1 
ATOM   8191  C CD2   . HIS C 1 320 ? 22.088  31.346  11.530  1.00 49.40  ?  317  HIS C CD2   1 
ATOM   8192  C CE1   . HIS C 1 320 ? 21.026  32.202  9.812   1.00 51.45  ?  317  HIS C CE1   1 
ATOM   8193  N NE2   . HIS C 1 320 ? 22.126  31.567  10.175  1.00 50.07  ?  317  HIS C NE2   1 
ATOM   8194  N N     . ASN C 1 321 ? 20.385  31.413  16.658  1.00 31.22  ?  318  ASN C N     1 
ATOM   8195  C CA    . ASN C 1 321 ? 19.929  31.736  18.008  1.00 22.96  ?  318  ASN C CA    1 
ATOM   8196  C C     . ASN C 1 321 ? 21.166  31.809  18.893  1.00 25.95  ?  318  ASN C C     1 
ATOM   8197  O O     . ASN C 1 321 ? 21.722  30.782  19.289  1.00 29.54  ?  318  ASN C O     1 
ATOM   8198  C CB    . ASN C 1 321 ? 18.929  30.695  18.504  1.00 23.36  ?  318  ASN C CB    1 
ATOM   8199  C CG    . ASN C 1 321 ? 18.620  30.825  19.992  1.00 23.11  ?  318  ASN C CG    1 
ATOM   8200  O OD1   . ASN C 1 321 ? 18.893  31.849  20.623  1.00 32.23  ?  318  ASN C OD1   1 
ATOM   8201  N ND2   . ASN C 1 321 ? 18.031  29.777  20.557  1.00 29.58  ?  318  ASN C ND2   1 
ATOM   8202  N N     . LYS C 1 322 ? 21.593  33.029  19.213  1.00 28.75  ?  319  LYS C N     1 
ATOM   8203  C CA    . LYS C 1 322 ? 22.785  33.241  20.026  1.00 34.51  ?  319  LYS C CA    1 
ATOM   8204  C C     . LYS C 1 322 ? 22.650  32.687  21.439  1.00 28.74  ?  319  LYS C C     1 
ATOM   8205  O O     . LYS C 1 322 ? 23.586  32.831  22.231  1.00 25.17  ?  319  LYS C O     1 
ATOM   8206  C CB    . LYS C 1 322 ? 23.115  34.733  20.096  1.00 40.06  ?  319  LYS C CB    1 
ATOM   8207  C CG    . LYS C 1 322 ? 23.188  35.428  18.744  1.00 42.96  ?  319  LYS C CG    1 
ATOM   8208  C CD    . LYS C 1 322 ? 24.363  34.941  17.924  1.00 40.82  ?  319  LYS C CD    1 
ATOM   8209  C CE    . LYS C 1 322 ? 24.725  35.969  16.870  1.00 50.35  ?  319  LYS C CE    1 
ATOM   8210  N NZ    . LYS C 1 322 ? 24.898  37.319  17.485  1.00 51.27  1  319  LYS C NZ    1 
ATOM   8211  N N     . HIS C 1 323 ? 21.513  32.075  21.774  1.00 33.30  ?  320  HIS C N     1 
ATOM   8212  C CA    . HIS C 1 323 ? 21.304  31.453  23.076  1.00 30.69  ?  320  HIS C CA    1 
ATOM   8213  C C     . HIS C 1 323 ? 20.931  29.984  22.946  1.00 23.12  ?  320  HIS C C     1 
ATOM   8214  O O     . HIS C 1 323 ? 20.370  29.404  23.880  1.00 28.34  ?  320  HIS C O     1 
ATOM   8215  C CB    . HIS C 1 323 ? 20.243  32.217  23.869  1.00 35.39  ?  320  HIS C CB    1 
ATOM   8216  C CG    . HIS C 1 323 ? 20.596  33.652  24.087  1.00 40.29  ?  320  HIS C CG    1 
ATOM   8217  N ND1   . HIS C 1 323 ? 21.493  34.059  25.052  1.00 41.06  ?  320  HIS C ND1   1 
ATOM   8218  C CD2   . HIS C 1 323 ? 20.198  34.775  23.446  1.00 43.81  ?  320  HIS C CD2   1 
ATOM   8219  C CE1   . HIS C 1 323 ? 21.622  35.373  25.003  1.00 41.77  ?  320  HIS C CE1   1 
ATOM   8220  N NE2   . HIS C 1 323 ? 20.849  35.831  24.036  1.00 47.68  ?  320  HIS C NE2   1 
ATOM   8221  N N     . SER C 1 324 ? 21.244  29.373  21.806  1.00 28.08  ?  321  SER C N     1 
ATOM   8222  C CA    . SER C 1 324 ? 21.031  27.950  21.617  1.00 32.67  ?  321  SER C CA    1 
ATOM   8223  C C     . SER C 1 324 ? 21.932  27.150  22.556  1.00 27.20  ?  321  SER C C     1 
ATOM   8224  O O     . SER C 1 324 ? 22.800  27.692  23.247  1.00 31.82  ?  321  SER C O     1 
ATOM   8225  C CB    . SER C 1 324 ? 21.309  27.556  20.167  1.00 24.96  ?  321  SER C CB    1 
ATOM   8226  O OG    . SER C 1 324 ? 22.702  27.584  19.896  1.00 35.32  ?  321  SER C OG    1 
ATOM   8227  N N     . VAL C 1 325 ? 21.722  25.831  22.559  1.00 25.94  ?  322  VAL C N     1 
ATOM   8228  C CA    . VAL C 1 325 ? 22.547  24.938  23.367  1.00 21.65  ?  322  VAL C CA    1 
ATOM   8229  C C     . VAL C 1 325 ? 24.010  25.019  22.944  1.00 26.23  ?  322  VAL C C     1 
ATOM   8230  O O     . VAL C 1 325 ? 24.914  24.785  23.758  1.00 23.54  ?  322  VAL C O     1 
ATOM   8231  C CB    . VAL C 1 325 ? 21.994  23.500  23.278  1.00 28.75  ?  322  VAL C CB    1 
ATOM   8232  C CG1   . VAL C 1 325 ? 21.908  23.050  21.828  1.00 29.78  ?  322  VAL C CG1   1 
ATOM   8233  C CG2   . VAL C 1 325 ? 22.835  22.535  24.099  1.00 35.52  ?  322  VAL C CG2   1 
ATOM   8234  N N     . PHE C 1 326 ? 24.274  25.370  21.682  1.00 25.20  ?  323  PHE C N     1 
ATOM   8235  C CA    . PHE C 1 326 ? 25.657  25.506  21.231  1.00 18.30  ?  323  PHE C CA    1 
ATOM   8236  C C     . PHE C 1 326 ? 26.347  26.672  21.929  1.00 20.78  ?  323  PHE C C     1 
ATOM   8237  O O     . PHE C 1 326 ? 27.476  26.537  22.417  1.00 19.11  ?  323  PHE C O     1 
ATOM   8238  C CB    . PHE C 1 326 ? 25.704  25.684  19.711  1.00 16.48  ?  323  PHE C CB    1 
ATOM   8239  C CG    . PHE C 1 326 ? 27.100  25.678  19.143  1.00 20.76  ?  323  PHE C CG    1 
ATOM   8240  C CD1   . PHE C 1 326 ? 27.713  24.485  18.789  1.00 28.47  ?  323  PHE C CD1   1 
ATOM   8241  C CD2   . PHE C 1 326 ? 27.800  26.860  18.969  1.00 27.75  ?  323  PHE C CD2   1 
ATOM   8242  C CE1   . PHE C 1 326 ? 28.998  24.472  18.271  1.00 26.74  ?  323  PHE C CE1   1 
ATOM   8243  C CE2   . PHE C 1 326 ? 29.085  26.854  18.452  1.00 36.20  ?  323  PHE C CE2   1 
ATOM   8244  C CZ    . PHE C 1 326 ? 29.684  25.659  18.104  1.00 32.03  ?  323  PHE C CZ    1 
ATOM   8245  N N     . TYR C 1 327 ? 25.684  27.830  21.979  1.00 23.80  ?  324  TYR C N     1 
ATOM   8246  C CA    . TYR C 1 327 ? 26.275  28.998  22.621  1.00 25.88  ?  324  TYR C CA    1 
ATOM   8247  C C     . TYR C 1 327 ? 26.283  28.867  24.137  1.00 20.04  ?  324  TYR C C     1 
ATOM   8248  O O     . TYR C 1 327 ? 27.178  29.410  24.795  1.00 28.65  ?  324  TYR C O     1 
ATOM   8249  C CB    . TYR C 1 327 ? 25.527  30.268  22.216  1.00 22.76  ?  324  TYR C CB    1 
ATOM   8250  C CG    . TYR C 1 327 ? 25.665  30.631  20.758  1.00 28.34  ?  324  TYR C CG    1 
ATOM   8251  C CD1   . TYR C 1 327 ? 26.705  31.439  20.316  1.00 36.47  ?  324  TYR C CD1   1 
ATOM   8252  C CD2   . TYR C 1 327 ? 24.751  30.168  19.821  1.00 29.83  ?  324  TYR C CD2   1 
ATOM   8253  C CE1   . TYR C 1 327 ? 26.832  31.774  18.980  1.00 30.71  ?  324  TYR C CE1   1 
ATOM   8254  C CE2   . TYR C 1 327 ? 24.870  30.496  18.486  1.00 38.82  ?  324  TYR C CE2   1 
ATOM   8255  C CZ    . TYR C 1 327 ? 25.912  31.299  18.069  1.00 32.35  ?  324  TYR C CZ    1 
ATOM   8256  O OH    . TYR C 1 327 ? 26.031  31.625  16.740  1.00 27.78  ?  324  TYR C OH    1 
ATOM   8257  N N     . ARG C 1 328 ? 25.300  28.166  24.710  1.00 24.12  ?  325  ARG C N     1 
ATOM   8258  C CA    . ARG C 1 328 ? 25.285  27.976  26.158  1.00 26.12  ?  325  ARG C CA    1 
ATOM   8259  C C     . ARG C 1 328 ? 26.414  27.055  26.604  1.00 27.43  ?  325  ARG C C     1 
ATOM   8260  O O     . ARG C 1 328 ? 27.077  27.321  27.612  1.00 24.25  ?  325  ARG C O     1 
ATOM   8261  C CB    . ARG C 1 328 ? 23.930  27.426  26.608  1.00 24.98  ?  325  ARG C CB    1 
ATOM   8262  C CG    . ARG C 1 328 ? 22.763  28.363  26.321  1.00 38.42  ?  325  ARG C CG    1 
ATOM   8263  C CD    . ARG C 1 328 ? 21.557  28.068  27.201  1.00 47.69  ?  325  ARG C CD    1 
ATOM   8264  N NE    . ARG C 1 328 ? 21.119  26.677  27.124  1.00 50.21  ?  325  ARG C NE    1 
ATOM   8265  C CZ    . ARG C 1 328 ? 20.302  26.199  26.189  1.00 46.18  ?  325  ARG C CZ    1 
ATOM   8266  N NH1   . ARG C 1 328 ? 19.836  26.997  25.240  1.00 39.42  1  325  ARG C NH1   1 
ATOM   8267  N NH2   . ARG C 1 328 ? 19.956  24.918  26.202  1.00 48.27  ?  325  ARG C NH2   1 
ATOM   8268  N N     . ALA C 1 329 ? 26.650  25.969  25.864  1.00 18.94  ?  326  ALA C N     1 
ATOM   8269  C CA    . ALA C 1 329 ? 27.755  25.076  26.201  1.00 18.74  ?  326  ALA C CA    1 
ATOM   8270  C C     . ALA C 1 329 ? 29.099  25.780  26.057  1.00 21.75  ?  326  ALA C C     1 
ATOM   8271  O O     . ALA C 1 329 ? 30.018  25.543  26.848  1.00 22.20  ?  326  ALA C O     1 
ATOM   8272  C CB    . ALA C 1 329 ? 27.708  23.822  25.327  1.00 20.82  ?  326  ALA C CB    1 
ATOM   8273  N N     . ALA C 1 330 ? 29.234  26.649  25.052  1.00 21.58  ?  327  ALA C N     1 
ATOM   8274  C CA    . ALA C 1 330 ? 30.475  27.398  24.888  1.00 16.96  ?  327  ALA C CA    1 
ATOM   8275  C C     . ALA C 1 330 ? 30.682  28.380  26.034  1.00 19.88  ?  327  ALA C C     1 
ATOM   8276  O O     . ALA C 1 330 ? 31.806  28.545  26.525  1.00 19.77  ?  327  ALA C O     1 
ATOM   8277  C CB    . ALA C 1 330 ? 30.473  28.129  23.547  1.00 23.08  ?  327  ALA C CB    1 
ATOM   8278  N N     . ALA C 1 331 ? 29.611  29.045  26.472  1.00 18.80  ?  328  ALA C N     1 
ATOM   8279  C CA    . ALA C 1 331 ? 29.725  29.956  27.605  1.00 27.93  ?  328  ALA C CA    1 
ATOM   8280  C C     . ALA C 1 331 ? 30.032  29.197  28.889  1.00 20.01  ?  328  ALA C C     1 
ATOM   8281  O O     . ALA C 1 331 ? 30.875  29.625  29.686  1.00 25.58  ?  328  ALA C O     1 
ATOM   8282  C CB    . ALA C 1 331 ? 28.440  30.771  27.758  1.00 36.25  ?  328  ALA C CB    1 
ATOM   8283  N N     . GLU C 1 332 ? 29.367  28.061  29.098  1.00 27.11  ?  329  GLU C N     1 
ATOM   8284  C CA    . GLU C 1 332 ? 29.587  27.284  30.313  1.00 19.50  ?  329  GLU C CA    1 
ATOM   8285  C C     . GLU C 1 332 ? 31.011  26.750  30.394  1.00 28.68  ?  329  GLU C C     1 
ATOM   8286  O O     . GLU C 1 332 ? 31.548  26.586  31.495  1.00 25.99  ?  329  GLU C O     1 
ATOM   8287  C CB    . GLU C 1 332 ? 28.579  26.137  30.386  1.00 26.19  ?  329  GLU C CB    1 
ATOM   8288  C CG    . GLU C 1 332 ? 27.155  26.588  30.672  1.00 20.83  ?  329  GLU C CG    1 
ATOM   8289  C CD    . GLU C 1 332 ? 26.127  25.499  30.427  1.00 39.34  ?  329  GLU C CD    1 
ATOM   8290  O OE1   . GLU C 1 332 ? 24.921  25.782  30.572  1.00 48.44  ?  329  GLU C OE1   1 
ATOM   8291  O OE2   . GLU C 1 332 ? 26.521  24.362  30.086  1.00 39.73  -1 329  GLU C OE2   1 
ATOM   8292  N N     . LEU C 1 333 ? 31.640  26.479  29.252  1.00 18.04  ?  330  LEU C N     1 
ATOM   8293  C CA    . LEU C 1 333 ? 32.997  25.950  29.250  1.00 20.10  ?  330  LEU C CA    1 
ATOM   8294  C C     . LEU C 1 333 ? 34.063  27.033  29.340  1.00 14.70  ?  330  LEU C C     1 
ATOM   8295  O O     . LEU C 1 333 ? 35.244  26.703  29.489  1.00 23.34  ?  330  LEU C O     1 
ATOM   8296  C CB    . LEU C 1 333 ? 33.232  25.098  27.997  1.00 26.27  ?  330  LEU C CB    1 
ATOM   8297  C CG    . LEU C 1 333 ? 32.426  23.802  27.913  1.00 19.50  ?  330  LEU C CG    1 
ATOM   8298  C CD1   . LEU C 1 333 ? 32.761  23.053  26.635  1.00 17.88  ?  330  LEU C CD1   1 
ATOM   8299  C CD2   . LEU C 1 333 ? 32.666  22.928  29.137  1.00 19.74  ?  330  LEU C CD2   1 
ATOM   8300  N N     . GLY C 1 334 ? 33.686  28.305  29.254  1.00 14.73  ?  331  GLY C N     1 
ATOM   8301  C CA    . GLY C 1 334 ? 34.616  29.392  29.467  1.00 21.51  ?  331  GLY C CA    1 
ATOM   8302  C C     . GLY C 1 334 ? 35.142  30.071  28.226  1.00 22.86  ?  331  GLY C C     1 
ATOM   8303  O O     . GLY C 1 334 ? 36.121  30.823  28.325  1.00 18.27  ?  331  GLY C O     1 
ATOM   8304  N N     . PHE C 1 335 ? 34.536  29.836  27.065  1.00 26.84  ?  332  PHE C N     1 
ATOM   8305  C CA    . PHE C 1 335 ? 34.981  30.496  25.846  1.00 31.50  ?  332  PHE C CA    1 
ATOM   8306  C C     . PHE C 1 335 ? 34.664  31.984  25.905  1.00 30.57  ?  332  PHE C C     1 
ATOM   8307  O O     . PHE C 1 335 ? 33.539  32.380  26.230  1.00 27.03  ?  332  PHE C O     1 
ATOM   8308  C CB    . PHE C 1 335 ? 34.322  29.861  24.622  1.00 20.91  ?  332  PHE C CB    1 
ATOM   8309  C CG    . PHE C 1 335 ? 34.861  28.505  24.284  1.00 19.99  ?  332  PHE C CG    1 
ATOM   8310  C CD1   . PHE C 1 335 ? 36.141  28.365  23.773  1.00 24.41  ?  332  PHE C CD1   1 
ATOM   8311  C CD2   . PHE C 1 335 ? 34.091  27.369  24.476  1.00 19.25  ?  332  PHE C CD2   1 
ATOM   8312  C CE1   . PHE C 1 335 ? 36.646  27.116  23.462  1.00 26.70  ?  332  PHE C CE1   1 
ATOM   8313  C CE2   . PHE C 1 335 ? 34.591  26.117  24.168  1.00 26.53  ?  332  PHE C CE2   1 
ATOM   8314  C CZ    . PHE C 1 335 ? 35.872  25.993  23.659  1.00 30.71  ?  332  PHE C CZ    1 
ATOM   8315  N N     . SER C 1 336 ? 35.665  32.811  25.595  1.00 27.12  ?  333  SER C N     1 
ATOM   8316  C CA    . SER C 1 336 ? 35.462  34.255  25.642  1.00 28.54  ?  333  SER C CA    1 
ATOM   8317  C C     . SER C 1 336 ? 34.385  34.699  24.665  1.00 29.29  ?  333  SER C C     1 
ATOM   8318  O O     . SER C 1 336 ? 33.639  35.642  24.953  1.00 29.58  ?  333  SER C O     1 
ATOM   8319  C CB    . SER C 1 336 ? 36.773  34.984  25.352  1.00 31.58  ?  333  SER C CB    1 
ATOM   8320  O OG    . SER C 1 336 ? 37.196  34.763  24.020  1.00 27.32  ?  333  SER C OG    1 
ATOM   8321  N N     . LYS C 1 337 ? 34.279  34.033  23.516  1.00 27.55  ?  334  LYS C N     1 
ATOM   8322  C CA    . LYS C 1 337 ? 33.252  34.361  22.536  1.00 28.49  ?  334  LYS C CA    1 
ATOM   8323  C C     . LYS C 1 337 ? 33.165  33.241  21.509  1.00 27.38  ?  334  LYS C C     1 
ATOM   8324  O O     . LYS C 1 337 ? 34.017  32.353  21.449  1.00 26.90  ?  334  LYS C O     1 
ATOM   8325  C CB    . LYS C 1 337 ? 33.539  35.702  21.851  1.00 31.73  ?  334  LYS C CB    1 
ATOM   8326  C CG    . LYS C 1 337 ? 34.770  35.697  20.968  1.00 25.55  ?  334  LYS C CG    1 
ATOM   8327  C CD    . LYS C 1 337 ? 35.007  37.071  20.362  1.00 35.02  ?  334  LYS C CD    1 
ATOM   8328  C CE    . LYS C 1 337 ? 36.098  37.025  19.306  1.00 33.80  ?  334  LYS C CE    1 
ATOM   8329  N NZ    . LYS C 1 337 ? 36.275  38.347  18.650  1.00 37.79  1  334  LYS C NZ    1 
ATOM   8330  N N     . VAL C 1 338 ? 32.111  33.302  20.701  1.00 27.34  ?  335  VAL C N     1 
ATOM   8331  C CA    . VAL C 1 338 ? 31.924  32.430  19.548  1.00 21.54  ?  335  VAL C CA    1 
ATOM   8332  C C     . VAL C 1 338 ? 31.900  33.309  18.307  1.00 25.10  ?  335  VAL C C     1 
ATOM   8333  O O     . VAL C 1 338 ? 31.199  34.328  18.278  1.00 23.13  ?  335  VAL C O     1 
ATOM   8334  C CB    . VAL C 1 338 ? 30.631  31.602  19.664  1.00 27.32  ?  335  VAL C CB    1 
ATOM   8335  C CG1   . VAL C 1 338 ? 30.437  30.730  18.434  1.00 26.68  ?  335  VAL C CG1   1 
ATOM   8336  C CG2   . VAL C 1 338 ? 30.662  30.751  20.925  1.00 32.76  ?  335  VAL C CG2   1 
ATOM   8337  N N     . GLU C 1 339 ? 32.675  32.930  17.295  1.00 23.86  ?  336  GLU C N     1 
ATOM   8338  C CA    . GLU C 1 339 ? 32.788  33.729  16.081  1.00 28.26  ?  336  GLU C CA    1 
ATOM   8339  C C     . GLU C 1 339 ? 32.825  32.803  14.879  1.00 20.79  ?  336  GLU C C     1 
ATOM   8340  O O     . GLU C 1 339 ? 33.678  31.914  14.799  1.00 23.94  ?  336  GLU C O     1 
ATOM   8341  C CB    . GLU C 1 339 ? 34.036  34.614  16.113  1.00 28.84  ?  336  GLU C CB    1 
ATOM   8342  C CG    . GLU C 1 339 ? 34.184  35.514  14.902  1.00 46.28  ?  336  GLU C CG    1 
ATOM   8343  C CD    . GLU C 1 339 ? 35.433  36.367  14.965  1.00 53.97  ?  336  GLU C CD    1 
ATOM   8344  O OE1   . GLU C 1 339 ? 35.721  37.076  13.978  1.00 59.83  ?  336  GLU C OE1   1 
ATOM   8345  O OE2   . GLU C 1 339 ? 36.126  36.329  16.003  1.00 51.73  -1 336  GLU C OE2   1 
ATOM   8346  N N     . PHE C 1 340 ? 31.905  33.014  13.947  1.00 23.37  ?  337  PHE C N     1 
ATOM   8347  C CA    . PHE C 1 340 ? 31.878  32.278  12.691  1.00 24.37  ?  337  PHE C CA    1 
ATOM   8348  C C     . PHE C 1 340 ? 32.482  33.169  11.613  1.00 25.01  ?  337  PHE C C     1 
ATOM   8349  O O     . PHE C 1 340 ? 31.882  34.172  11.213  1.00 26.50  ?  337  PHE C O     1 
ATOM   8350  C CB    . PHE C 1 340 ? 30.455  31.839  12.357  1.00 27.93  ?  337  PHE C CB    1 
ATOM   8351  C CG    . PHE C 1 340 ? 29.899  30.849  13.339  1.00 24.04  ?  337  PHE C CG    1 
ATOM   8352  C CD1   . PHE C 1 340 ? 30.381  29.552  13.376  1.00 29.85  ?  337  PHE C CD1   1 
ATOM   8353  C CD2   . PHE C 1 340 ? 28.920  31.219  14.243  1.00 22.62  ?  337  PHE C CD2   1 
ATOM   8354  C CE1   . PHE C 1 340 ? 29.886  28.639  14.285  1.00 34.75  ?  337  PHE C CE1   1 
ATOM   8355  C CE2   . PHE C 1 340 ? 28.420  30.309  15.155  1.00 18.46  ?  337  PHE C CE2   1 
ATOM   8356  C CZ    . PHE C 1 340 ? 28.904  29.020  15.176  1.00 25.72  ?  337  PHE C CZ    1 
ATOM   8357  N N     . LEU C 1 341 ? 33.682  32.811  11.166  1.00 21.41  ?  338  LEU C N     1 
ATOM   8358  C CA    . LEU C 1 341 ? 34.415  33.646  10.229  1.00 22.12  ?  338  LEU C CA    1 
ATOM   8359  C C     . LEU C 1 341 ? 33.709  33.674  8.881   1.00 28.13  ?  338  LEU C C     1 
ATOM   8360  O O     . LEU C 1 341 ? 33.183  32.661  8.414   1.00 28.18  ?  338  LEU C O     1 
ATOM   8361  C CB    . LEU C 1 341 ? 35.843  33.132  10.066  1.00 25.63  ?  338  LEU C CB    1 
ATOM   8362  C CG    . LEU C 1 341 ? 36.623  32.910  11.365  1.00 27.66  ?  338  LEU C CG    1 
ATOM   8363  C CD1   . LEU C 1 341 ? 38.067  32.543  11.066  1.00 23.69  ?  338  LEU C CD1   1 
ATOM   8364  C CD2   . LEU C 1 341 ? 36.549  34.139  12.253  1.00 31.28  ?  338  LEU C CD2   1 
ATOM   8365  N N     . ARG C 1 342 ? 33.701  34.846  8.255   1.00 23.48  ?  339  ARG C N     1 
ATOM   8366  C CA    . ARG C 1 342 ? 32.995  35.070  7.003   1.00 31.74  ?  339  ARG C CA    1 
ATOM   8367  C C     . ARG C 1 342 ? 33.987  35.463  5.921   1.00 32.79  ?  339  ARG C C     1 
ATOM   8368  O O     . ARG C 1 342 ? 34.859  36.309  6.145   1.00 31.83  ?  339  ARG C O     1 
ATOM   8369  C CB    . ARG C 1 342 ? 31.930  36.160  7.149   1.00 38.25  ?  339  ARG C CB    1 
ATOM   8370  C CG    . ARG C 1 342 ? 30.847  35.843  8.160   1.00 48.39  ?  339  ARG C CG    1 
ATOM   8371  C CD    . ARG C 1 342 ? 30.019  37.080  8.495   1.00 59.93  ?  339  ARG C CD    1 
ATOM   8372  N NE    . ARG C 1 342 ? 28.902  37.289  7.577   1.00 68.34  ?  339  ARG C NE    1 
ATOM   8373  C CZ    . ARG C 1 342 ? 28.871  38.215  6.624   1.00 70.78  ?  339  ARG C CZ    1 
ATOM   8374  N NH1   . ARG C 1 342 ? 29.900  39.034  6.448   1.00 69.74  1  339  ARG C NH1   1 
ATOM   8375  N NH2   . ARG C 1 342 ? 27.802  38.324  5.847   1.00 68.16  ?  339  ARG C NH2   1 
ATOM   8376  N N     . ASP C 1 343 ? 33.854  34.842  4.756   1.00 28.55  ?  340  ASP C N     1 
ATOM   8377  C CA    . ASP C 1 343 ? 34.575  35.290  3.574   1.00 38.81  ?  340  ASP C CA    1 
ATOM   8378  C C     . ASP C 1 343 ? 33.971  36.613  3.126   1.00 39.52  ?  340  ASP C C     1 
ATOM   8379  O O     . ASP C 1 343 ? 32.814  36.659  2.697   1.00 37.65  ?  340  ASP C O     1 
ATOM   8380  C CB    . ASP C 1 343 ? 34.488  34.231  2.479   1.00 45.53  ?  340  ASP C CB    1 
ATOM   8381  C CG    . ASP C 1 343 ? 35.135  34.672  1.178   1.00 47.10  ?  340  ASP C CG    1 
ATOM   8382  O OD1   . ASP C 1 343 ? 35.952  35.616  1.195   1.00 55.88  ?  340  ASP C OD1   1 
ATOM   8383  O OD2   . ASP C 1 343 ? 34.829  34.059  0.135   1.00 48.99  -1 340  ASP C OD2   1 
ATOM   8384  N N     . SER C 1 344 ? 34.743  37.698  3.249   1.00 37.30  ?  341  SER C N     1 
ATOM   8385  C CA    . SER C 1 344 ? 34.256  39.002  2.808   1.00 51.26  ?  341  SER C CA    1 
ATOM   8386  C C     . SER C 1 344 ? 33.873  38.980  1.335   1.00 38.26  ?  341  SER C C     1 
ATOM   8387  O O     . SER C 1 344 ? 33.029  39.770  0.899   1.00 51.65  ?  341  SER C O     1 
ATOM   8388  C CB    . SER C 1 344 ? 35.312  40.078  3.067   1.00 59.30  ?  341  SER C CB    1 
ATOM   8389  O OG    . SER C 1 344 ? 36.469  39.863  2.276   1.00 57.75  ?  341  SER C OG    1 
ATOM   8390  N N     . LYS C 1 345 ? 34.471  38.072  0.563   1.00 40.65  ?  342  LYS C N     1 
ATOM   8391  C CA    . LYS C 1 345 ? 34.130  37.944  -0.848  1.00 42.11  ?  342  LYS C CA    1 
ATOM   8392  C C     . LYS C 1 345 ? 32.755  37.307  -1.027  1.00 46.11  ?  342  LYS C C     1 
ATOM   8393  O O     . LYS C 1 345 ? 31.896  37.853  -1.727  1.00 44.25  ?  342  LYS C O     1 
ATOM   8394  C CB    . LYS C 1 345 ? 35.213  37.132  -1.560  1.00 45.42  ?  342  LYS C CB    1 
ATOM   8395  C CG    . LYS C 1 345 ? 35.101  37.092  -3.068  1.00 40.71  ?  342  LYS C CG    1 
ATOM   8396  C CD    . LYS C 1 345 ? 36.314  36.405  -3.677  1.00 54.60  ?  342  LYS C CD    1 
ATOM   8397  C CE    . LYS C 1 345 ? 36.577  35.063  -3.012  1.00 62.83  ?  342  LYS C CE    1 
ATOM   8398  N NZ    . LYS C 1 345 ? 37.448  34.190  -3.843  1.00 59.85  1  342  LYS C NZ    1 
ATOM   8399  N N     . THR C 1 346 ? 32.519  36.157  -0.388  1.00 45.34  ?  343  THR C N     1 
ATOM   8400  C CA    . THR C 1 346 ? 31.258  35.442  -0.556  1.00 40.47  ?  343  THR C CA    1 
ATOM   8401  C C     . THR C 1 346 ? 30.213  35.785  0.498   1.00 44.23  ?  343  THR C C     1 
ATOM   8402  O O     . THR C 1 346 ? 29.080  35.303  0.385   1.00 56.68  ?  343  THR C O     1 
ATOM   8403  C CB    . THR C 1 346 ? 31.477  33.923  -0.540  1.00 45.59  ?  343  THR C CB    1 
ATOM   8404  O OG1   . THR C 1 346 ? 31.929  33.509  0.757   1.00 40.81  ?  343  THR C OG1   1 
ATOM   8405  C CG2   . THR C 1 346 ? 32.491  33.509  -1.595  1.00 43.65  ?  343  THR C CG2   1 
ATOM   8406  N N     . LYS C 1 347 ? 30.563  36.570  1.523   1.00 36.94  ?  344  LYS C N     1 
ATOM   8407  C CA    . LYS C 1 347 ? 29.637  37.052  2.547   1.00 43.85  ?  344  LYS C CA    1 
ATOM   8408  C C     . LYS C 1 347 ? 29.218  35.943  3.518   1.00 49.03  ?  344  LYS C C     1 
ATOM   8409  O O     . LYS C 1 347 ? 28.367  36.163  4.391   1.00 50.26  ?  344  LYS C O     1 
ATOM   8410  C CB    . LYS C 1 347 ? 28.428  37.721  1.866   1.00 49.59  ?  344  LYS C CB    1 
ATOM   8411  C CG    . LYS C 1 347 ? 27.223  38.107  2.694   1.00 55.20  ?  344  LYS C CG    1 
ATOM   8412  C CD    . LYS C 1 347 ? 25.954  37.613  2.017   1.00 57.35  ?  344  LYS C CD    1 
ATOM   8413  C CE    . LYS C 1 347 ? 24.725  38.098  2.752   1.00 59.12  ?  344  LYS C CE    1 
ATOM   8414  N NZ    . LYS C 1 347 ? 24.864  39.545  3.068   1.00 59.01  1  344  LYS C NZ    1 
ATOM   8415  N N     . SER C 1 348 ? 29.837  34.767  3.438   1.00 32.59  ?  345  SER C N     1 
ATOM   8416  C CA    . SER C 1 348 ? 29.327  33.587  4.118   1.00 33.16  ?  345  SER C CA    1 
ATOM   8417  C C     . SER C 1 348 ? 30.408  32.904  4.946   1.00 32.52  ?  345  SER C C     1 
ATOM   8418  O O     . SER C 1 348 ? 31.606  33.032  4.685   1.00 29.08  ?  345  SER C O     1 
ATOM   8419  C CB    . SER C 1 348 ? 28.750  32.580  3.119   1.00 38.61  ?  345  SER C CB    1 
ATOM   8420  O OG    . SER C 1 348 ? 28.443  31.356  3.752   1.00 38.03  ?  345  SER C OG    1 
ATOM   8421  N N     . SER C 1 349 ? 29.951  32.175  5.963   1.00 21.78  ?  346  SER C N     1 
ATOM   8422  C CA    . SER C 1 349 ? 30.779  31.270  6.746   1.00 23.91  ?  346  SER C CA    1 
ATOM   8423  C C     . SER C 1 349 ? 30.698  29.836  6.244   1.00 31.73  ?  346  SER C C     1 
ATOM   8424  O O     . SER C 1 349 ? 31.271  28.937  6.870   1.00 26.34  ?  346  SER C O     1 
ATOM   8425  C CB    . SER C 1 349 ? 30.366  31.318  8.218   1.00 28.91  ?  346  SER C CB    1 
ATOM   8426  O OG    . SER C 1 349 ? 30.493  32.626  8.742   1.00 29.98  ?  346  SER C OG    1 
ATOM   8427  N N     . ALA C 1 350 ? 29.992  29.605  5.140   1.00 24.10  ?  347  ALA C N     1 
ATOM   8428  C CA    . ALA C 1 350 ? 29.713  28.269  4.639   1.00 26.73  ?  347  ALA C CA    1 
ATOM   8429  C C     . ALA C 1 350 ? 30.455  28.031  3.331   1.00 33.80  ?  347  ALA C C     1 
ATOM   8430  O O     . ALA C 1 350 ? 30.518  28.912  2.469   1.00 31.58  ?  347  ALA C O     1 
ATOM   8431  C CB    . ALA C 1 350 ? 28.210  28.063  4.435   1.00 26.65  ?  347  ALA C CB    1 
ATOM   8432  N N     . PHE C 1 351 ? 31.015  26.832  3.193   1.00 23.58  ?  348  PHE C N     1 
ATOM   8433  C CA    . PHE C 1 351 ? 31.787  26.472  2.020   1.00 24.42  ?  348  PHE C CA    1 
ATOM   8434  C C     . PHE C 1 351 ? 31.449  25.041  1.638   1.00 32.48  ?  348  PHE C C     1 
ATOM   8435  O O     . PHE C 1 351 ? 30.858  24.291  2.418   1.00 23.63  ?  348  PHE C O     1 
ATOM   8436  C CB    . PHE C 1 351 ? 33.292  26.638  2.274   1.00 25.89  ?  348  PHE C CB    1 
ATOM   8437  C CG    . PHE C 1 351 ? 33.658  27.995  2.794   1.00 24.16  ?  348  PHE C CG    1 
ATOM   8438  C CD1   . PHE C 1 351 ? 33.671  28.252  4.154   1.00 22.17  ?  348  PHE C CD1   1 
ATOM   8439  C CD2   . PHE C 1 351 ? 33.958  29.027  1.918   1.00 30.59  ?  348  PHE C CD2   1 
ATOM   8440  C CE1   . PHE C 1 351 ? 33.990  29.506  4.634   1.00 21.26  ?  348  PHE C CE1   1 
ATOM   8441  C CE2   . PHE C 1 351 ? 34.280  30.283  2.393   1.00 30.96  ?  348  PHE C CE2   1 
ATOM   8442  C CZ    . PHE C 1 351 ? 34.294  30.522  3.750   1.00 26.47  ?  348  PHE C CZ    1 
ATOM   8443  N N     . LEU C 1 352 ? 31.817  24.673  0.421   1.00 27.87  ?  349  LEU C N     1 
ATOM   8444  C CA    . LEU C 1 352 ? 31.577  23.331  -0.080  1.00 23.29  ?  349  LEU C CA    1 
ATOM   8445  C C     . LEU C 1 352 ? 32.866  22.521  -0.071  1.00 23.63  ?  349  LEU C C     1 
ATOM   8446  O O     . LEU C 1 352 ? 33.970  23.067  -0.165  1.00 25.43  ?  349  LEU C O     1 
ATOM   8447  C CB    . LEU C 1 352 ? 31.000  23.367  -1.500  1.00 28.40  ?  349  LEU C CB    1 
ATOM   8448  C CG    . LEU C 1 352 ? 29.589  23.929  -1.676  1.00 34.74  ?  349  LEU C CG    1 
ATOM   8449  C CD1   . LEU C 1 352 ? 29.204  23.951  -3.146  1.00 38.95  ?  349  LEU C CD1   1 
ATOM   8450  C CD2   . LEU C 1 352 ? 28.585  23.115  -0.875  1.00 38.16  ?  349  LEU C CD2   1 
ATOM   8451  N N     . TYR C 1 353 ? 32.711  21.208  0.069   1.00 24.43  ?  350  TYR C N     1 
ATOM   8452  C CA    . TYR C 1 353 ? 33.789  20.267  -0.185  1.00 21.77  ?  350  TYR C CA    1 
ATOM   8453  C C     . TYR C 1 353 ? 33.260  19.182  -1.111  1.00 24.80  ?  350  TYR C C     1 
ATOM   8454  O O     . TYR C 1 353 ? 32.054  18.926  -1.174  1.00 26.64  ?  350  TYR C O     1 
ATOM   8455  C CB    . TYR C 1 353 ? 34.355  19.661  1.114   1.00 28.30  ?  350  TYR C CB    1 
ATOM   8456  C CG    . TYR C 1 353 ? 33.459  18.656  1.808   1.00 30.79  ?  350  TYR C CG    1 
ATOM   8457  C CD1   . TYR C 1 353 ? 32.502  19.066  2.728   1.00 24.35  ?  350  TYR C CD1   1 
ATOM   8458  C CD2   . TYR C 1 353 ? 33.590  17.294  1.563   1.00 30.09  ?  350  TYR C CD2   1 
ATOM   8459  C CE1   . TYR C 1 353 ? 31.692  18.148  3.372   1.00 21.38  ?  350  TYR C CE1   1 
ATOM   8460  C CE2   . TYR C 1 353 ? 32.784  16.371  2.201   1.00 31.73  ?  350  TYR C CE2   1 
ATOM   8461  C CZ    . TYR C 1 353 ? 31.836  16.801  3.104   1.00 25.15  ?  350  TYR C CZ    1 
ATOM   8462  O OH    . TYR C 1 353 ? 31.035  15.880  3.739   1.00 26.88  ?  350  TYR C OH    1 
ATOM   8463  N N     . ASN C 1 354 ? 34.176  18.557  -1.846  1.00 27.89  ?  351  ASN C N     1 
ATOM   8464  C CA    . ASN C 1 354 ? 33.810  17.508  -2.786  1.00 24.44  ?  351  ASN C CA    1 
ATOM   8465  C C     . ASN C 1 354 ? 33.711  16.186  -2.035  1.00 23.25  ?  351  ASN C C     1 
ATOM   8466  O O     . ASN C 1 354 ? 34.739  15.686  -1.548  1.00 23.73  ?  351  ASN C O     1 
ATOM   8467  C CB    . ASN C 1 354 ? 34.835  17.410  -3.905  1.00 25.67  ?  351  ASN C CB    1 
ATOM   8468  C CG    . ASN C 1 354 ? 34.462  16.380  -4.959  1.00 34.76  ?  351  ASN C CG    1 
ATOM   8469  O OD1   . ASN C 1 354 ? 34.182  15.224  -4.649  1.00 34.26  ?  351  ASN C OD1   1 
ATOM   8470  N ND2   . ASN C 1 354 ? 34.463  16.801  -6.217  1.00 39.16  ?  351  ASN C ND2   1 
ATOM   8471  N N     . PRO C 1 355 ? 32.525  15.578  -1.932  1.00 31.94  ?  352  PRO C N     1 
ATOM   8472  C CA    . PRO C 1 355 ? 32.403  14.338  -1.149  1.00 31.76  ?  352  PRO C CA    1 
ATOM   8473  C C     . PRO C 1 355 ? 33.052  13.136  -1.809  1.00 35.26  ?  352  PRO C C     1 
ATOM   8474  O O     . PRO C 1 355 ? 33.389  12.181  -1.102  1.00 43.88  ?  352  PRO C O     1 
ATOM   8475  C CB    . PRO C 1 355 ? 30.886  14.146  -1.021  1.00 33.39  ?  352  PRO C CB    1 
ATOM   8476  C CG    . PRO C 1 355 ? 30.249  15.378  -1.615  1.00 36.63  ?  352  PRO C CG    1 
ATOM   8477  C CD    . PRO C 1 355 ? 31.249  15.972  -2.546  1.00 26.95  ?  352  PRO C CD    1 
ATOM   8478  N N     . GLU C 1 356 ? 33.227  13.142  -3.132  1.00 37.36  ?  353  GLU C N     1 
ATOM   8479  C CA    . GLU C 1 356 ? 33.853  12.003  -3.800  1.00 45.56  ?  353  GLU C CA    1 
ATOM   8480  C C     . GLU C 1 356 ? 35.335  11.909  -3.455  1.00 43.45  ?  353  GLU C C     1 
ATOM   8481  O O     . GLU C 1 356 ? 35.809  10.868  -2.987  1.00 49.17  ?  353  GLU C O     1 
ATOM   8482  C CB    . GLU C 1 356 ? 33.652  12.109  -5.312  1.00 54.23  ?  353  GLU C CB    1 
ATOM   8483  C CG    . GLU C 1 356 ? 34.455  11.106  -6.121  1.00 70.51  ?  353  GLU C CG    1 
ATOM   8484  C CD    . GLU C 1 356 ? 35.552  11.764  -6.934  1.00 78.82  ?  353  GLU C CD    1 
ATOM   8485  O OE1   . GLU C 1 356 ? 35.645  13.010  -6.909  1.00 88.79  ?  353  GLU C OE1   1 
ATOM   8486  O OE2   . GLU C 1 356 ? 36.320  11.038  -7.601  1.00 68.73  -1 353  GLU C OE2   1 
ATOM   8487  N N     . GLU C 1 357 ? 36.080  12.992  -3.671  1.00 43.72  ?  354  GLU C N     1 
ATOM   8488  C CA    . GLU C 1 357 ? 37.511  13.013  -3.402  1.00 39.72  ?  354  GLU C CA    1 
ATOM   8489  C C     . GLU C 1 357 ? 37.858  13.540  -2.017  1.00 35.08  ?  354  GLU C C     1 
ATOM   8490  O O     . GLU C 1 357 ? 39.023  13.445  -1.614  1.00 40.82  ?  354  GLU C O     1 
ATOM   8491  C CB    . GLU C 1 357 ? 38.233  13.856  -4.458  1.00 45.71  ?  354  GLU C CB    1 
ATOM   8492  C CG    . GLU C 1 357 ? 38.590  13.085  -5.716  1.00 62.07  ?  354  GLU C CG    1 
ATOM   8493  C CD    . GLU C 1 357 ? 39.142  13.973  -6.810  1.00 74.62  ?  354  GLU C CD    1 
ATOM   8494  O OE1   . GLU C 1 357 ? 38.419  14.890  -7.254  1.00 77.84  ?  354  GLU C OE1   1 
ATOM   8495  O OE2   . GLU C 1 357 ? 40.302  13.760  -7.223  1.00 80.68  -1 354  GLU C OE2   1 
ATOM   8496  N N     . PHE C 1 358 ? 36.885  14.085  -1.285  1.00 29.50  ?  355  PHE C N     1 
ATOM   8497  C CA    . PHE C 1 358 ? 37.114  14.660  0.043   1.00 38.81  ?  355  PHE C CA    1 
ATOM   8498  C C     . PHE C 1 358 ? 38.148  15.782  -0.025  1.00 34.45  ?  355  PHE C C     1 
ATOM   8499  O O     . PHE C 1 358 ? 39.130  15.805  0.720   1.00 37.32  ?  355  PHE C O     1 
ATOM   8500  C CB    . PHE C 1 358 ? 37.518  13.582  1.050   1.00 42.83  ?  355  PHE C CB    1 
ATOM   8501  C CG    . PHE C 1 358 ? 36.505  12.484  1.187   1.00 49.81  ?  355  PHE C CG    1 
ATOM   8502  C CD1   . PHE C 1 358 ? 35.467  12.593  2.097   1.00 46.83  ?  355  PHE C CD1   1 
ATOM   8503  C CD2   . PHE C 1 358 ? 36.581  11.350  0.395   1.00 58.97  ?  355  PHE C CD2   1 
ATOM   8504  C CE1   . PHE C 1 358 ? 34.527  11.587  2.219   1.00 47.51  ?  355  PHE C CE1   1 
ATOM   8505  C CE2   . PHE C 1 358 ? 35.644  10.340  0.512   1.00 57.62  ?  355  PHE C CE2   1 
ATOM   8506  C CZ    . PHE C 1 358 ? 34.616  10.459  1.426   1.00 55.60  ?  355  PHE C CZ    1 
ATOM   8507  N N     . THR C 1 359 ? 37.909  16.726  -0.932  1.00 25.30  ?  356  THR C N     1 
ATOM   8508  C CA    . THR C 1 359 ? 38.831  17.818  -1.191  1.00 28.74  ?  356  THR C CA    1 
ATOM   8509  C C     . THR C 1 359 ? 38.117  19.151  -1.024  1.00 21.80  ?  356  THR C C     1 
ATOM   8510  O O     . THR C 1 359 ? 36.893  19.252  -1.144  1.00 23.61  ?  356  THR C O     1 
ATOM   8511  C CB    . THR C 1 359 ? 39.438  17.724  -2.599  1.00 38.35  ?  356  THR C CB    1 
ATOM   8512  O OG1   . THR C 1 359 ? 38.388  17.717  -3.575  1.00 36.01  ?  356  THR C OG1   1 
ATOM   8513  C CG2   . THR C 1 359 ? 40.267  16.453  -2.740  1.00 43.01  ?  356  THR C CG2   1 
ATOM   8514  N N     . VAL C 1 360 ? 38.911  20.178  -0.736  1.00 32.48  ?  357  VAL C N     1 
ATOM   8515  C CA    . VAL C 1 360 ? 38.437  21.548  -0.592  1.00 35.62  ?  357  VAL C CA    1 
ATOM   8516  C C     . VAL C 1 360 ? 39.238  22.426  -1.541  1.00 33.67  ?  357  VAL C C     1 
ATOM   8517  O O     . VAL C 1 360 ? 40.450  22.238  -1.700  1.00 29.02  ?  357  VAL C O     1 
ATOM   8518  C CB    . VAL C 1 360 ? 38.570  22.039  0.866   1.00 29.78  ?  357  VAL C CB    1 
ATOM   8519  C CG1   . VAL C 1 360 ? 38.230  23.518  0.978   1.00 36.64  ?  357  VAL C CG1   1 
ATOM   8520  C CG2   . VAL C 1 360 ? 37.676  21.217  1.781   1.00 28.79  ?  357  VAL C CG2   1 
ATOM   8521  N N     . LYS C 1 361 ? 38.561  23.369  -2.187  1.00 34.15  ?  358  LYS C N     1 
ATOM   8522  C CA    . LYS C 1 361 ? 39.238  24.304  -3.074  1.00 35.83  ?  358  LYS C CA    1 
ATOM   8523  C C     . LYS C 1 361 ? 39.912  25.381  -2.234  1.00 30.91  ?  358  LYS C C     1 
ATOM   8524  O O     . LYS C 1 361 ? 39.238  26.130  -1.519  1.00 33.99  ?  358  LYS C O     1 
ATOM   8525  C CB    . LYS C 1 361 ? 38.255  24.920  -4.065  1.00 39.22  ?  358  LYS C CB    1 
ATOM   8526  C CG    . LYS C 1 361 ? 38.926  25.555  -5.273  1.00 46.01  ?  358  LYS C CG    1 
ATOM   8527  C CD    . LYS C 1 361 ? 37.909  26.047  -6.286  1.00 46.83  ?  358  LYS C CD    1 
ATOM   8528  C CE    . LYS C 1 361 ? 38.598  26.530  -7.551  1.00 55.61  ?  358  LYS C CE    1 
ATOM   8529  N NZ    . LYS C 1 361 ? 37.709  26.402  -8.739  1.00 60.27  1  358  LYS C NZ    1 
ATOM   8530  N N     . ASN C 1 362 ? 41.238  25.448  -2.311  1.00 30.12  ?  359  ASN C N     1 
ATOM   8531  C CA    . ASN C 1 362 ? 41.978  26.463  -1.576  1.00 35.11  ?  359  ASN C CA    1 
ATOM   8532  C C     . ASN C 1 362 ? 41.607  27.851  -2.087  1.00 31.94  ?  359  ASN C C     1 
ATOM   8533  O O     . ASN C 1 362 ? 41.543  28.085  -3.297  1.00 33.71  ?  359  ASN C O     1 
ATOM   8534  C CB    . ASN C 1 362 ? 43.481  26.220  -1.720  1.00 44.27  ?  359  ASN C CB    1 
ATOM   8535  C CG    . ASN C 1 362 ? 44.254  26.572  -0.463  1.00 57.16  ?  359  ASN C CG    1 
ATOM   8536  O OD1   . ASN C 1 362 ? 43.693  26.630  0.631   1.00 54.52  ?  359  ASN C OD1   1 
ATOM   8537  N ND2   . ASN C 1 362 ? 45.553  26.804  -0.615  1.00 68.16  ?  359  ASN C ND2   1 
ATOM   8538  N N     . THR C 1 363 ? 41.335  28.765  -1.158  1.00 36.49  ?  360  THR C N     1 
ATOM   8539  C CA    . THR C 1 363 ? 40.945  30.129  -1.487  1.00 37.41  ?  360  THR C CA    1 
ATOM   8540  C C     . THR C 1 363 ? 41.790  31.100  -0.676  1.00 31.90  ?  360  THR C C     1 
ATOM   8541  O O     . THR C 1 363 ? 42.470  30.719  0.281   1.00 30.46  ?  360  THR C O     1 
ATOM   8542  C CB    . THR C 1 363 ? 39.459  30.397  -1.201  1.00 34.83  ?  360  THR C CB    1 
ATOM   8543  O OG1   . THR C 1 363 ? 39.261  30.529  0.213   1.00 37.89  ?  360  THR C OG1   1 
ATOM   8544  C CG2   . THR C 1 363 ? 38.588  29.267  -1.728  1.00 36.95  ?  360  THR C CG2   1 
ATOM   8545  N N     . GLU C 1 364 ? 41.728  32.375  -1.067  1.00 38.46  ?  361  GLU C N     1 
ATOM   8546  C CA    . GLU C 1 364 ? 42.395  33.424  -0.302  1.00 41.61  ?  361  GLU C CA    1 
ATOM   8547  C C     . GLU C 1 364 ? 41.920  33.418  1.144   1.00 32.90  ?  361  GLU C C     1 
ATOM   8548  O O     . GLU C 1 364 ? 42.731  33.434  2.076   1.00 31.35  ?  361  GLU C O     1 
ATOM   8549  C CB    . GLU C 1 364 ? 42.138  34.785  -0.957  1.00 49.27  ?  361  GLU C CB    1 
ATOM   8550  C CG    . GLU C 1 364 ? 43.300  35.771  -0.879  1.00 66.33  ?  361  GLU C CG    1 
ATOM   8551  C CD    . GLU C 1 364 ? 43.120  36.814  0.207   1.00 72.90  ?  361  GLU C CD    1 
ATOM   8552  O OE1   . GLU C 1 364 ? 43.521  36.550  1.361   1.00 66.21  ?  361  GLU C OE1   1 
ATOM   8553  O OE2   . GLU C 1 364 ? 42.574  37.897  -0.094  1.00 79.12  -1 361  GLU C OE2   1 
ATOM   8554  N N     . PHE C 1 365 ? 40.600  33.366  1.346   1.00 44.60  ?  362  PHE C N     1 
ATOM   8555  C CA    . PHE C 1 365 ? 40.044  33.388  2.696   1.00 37.60  ?  362  PHE C CA    1 
ATOM   8556  C C     . PHE C 1 365 ? 40.502  32.181  3.507   1.00 21.25  ?  362  PHE C C     1 
ATOM   8557  O O     . PHE C 1 365 ? 40.985  32.325  4.635   1.00 29.00  ?  362  PHE C O     1 
ATOM   8558  C CB    . PHE C 1 365 ? 38.517  33.441  2.633   1.00 35.68  ?  362  PHE C CB    1 
ATOM   8559  C CG    . PHE C 1 365 ? 37.852  33.228  3.963   1.00 37.96  ?  362  PHE C CG    1 
ATOM   8560  C CD1   . PHE C 1 365 ? 37.735  34.270  4.866   1.00 43.37  ?  362  PHE C CD1   1 
ATOM   8561  C CD2   . PHE C 1 365 ? 37.356  31.984  4.315   1.00 32.17  ?  362  PHE C CD2   1 
ATOM   8562  C CE1   . PHE C 1 365 ? 37.130  34.078  6.095   1.00 42.66  ?  362  PHE C CE1   1 
ATOM   8563  C CE2   . PHE C 1 365 ? 36.753  31.787  5.544   1.00 36.14  ?  362  PHE C CE2   1 
ATOM   8564  C CZ    . PHE C 1 365 ? 36.638  32.836  6.432   1.00 39.25  ?  362  PHE C CZ    1 
ATOM   8565  N N     . ILE C 1 366 ? 40.344  30.978  2.951   1.00 24.29  ?  363  ILE C N     1 
ATOM   8566  C CA    . ILE C 1 366 ? 40.742  29.768  3.665   1.00 36.14  ?  363  ILE C CA    1 
ATOM   8567  C C     . ILE C 1 366 ? 42.237  29.784  3.956   1.00 36.53  ?  363  ILE C C     1 
ATOM   8568  O O     . ILE C 1 366 ? 42.674  29.451  5.066   1.00 31.37  ?  363  ILE C O     1 
ATOM   8569  C CB    . ILE C 1 366 ? 40.333  28.520  2.860   1.00 42.79  ?  363  ILE C CB    1 
ATOM   8570  C CG1   . ILE C 1 366 ? 38.808  28.399  2.809   1.00 39.08  ?  363  ILE C CG1   1 
ATOM   8571  C CG2   . ILE C 1 366 ? 40.966  27.264  3.447   1.00 39.73  ?  363  ILE C CG2   1 
ATOM   8572  C CD1   . ILE C 1 366 ? 38.305  27.470  1.728   1.00 40.99  ?  363  ILE C CD1   1 
ATOM   8573  N N     . ASN C 1 367 ? 43.045  30.188  2.973   1.00 37.35  ?  364  ASN C N     1 
ATOM   8574  C CA    . ASN C 1 367 ? 44.493  30.167  3.152   1.00 39.49  ?  364  ASN C CA    1 
ATOM   8575  C C     . ASN C 1 367 ? 44.955  31.184  4.189   1.00 35.14  ?  364  ASN C C     1 
ATOM   8576  O O     . ASN C 1 367 ? 45.921  30.925  4.915   1.00 45.90  ?  364  ASN C O     1 
ATOM   8577  C CB    . ASN C 1 367 ? 45.192  30.414  1.814   1.00 45.52  ?  364  ASN C CB    1 
ATOM   8578  C CG    . ASN C 1 367 ? 46.704  30.402  1.933   1.00 52.25  ?  364  ASN C CG    1 
ATOM   8579  O OD1   . ASN C 1 367 ? 47.338  31.452  2.043   1.00 56.27  ?  364  ASN C OD1   1 
ATOM   8580  N ND2   . ASN C 1 367 ? 47.289  29.210  1.917   1.00 46.83  ?  364  ASN C ND2   1 
ATOM   8581  N N     . GLN C 1 368 ? 44.288  32.337  4.280   1.00 30.64  ?  365  GLN C N     1 
ATOM   8582  C CA    . GLN C 1 368 ? 44.712  33.372  5.216   1.00 37.52  ?  365  GLN C CA    1 
ATOM   8583  C C     . GLN C 1 368 ? 44.259  33.105  6.643   1.00 43.27  ?  365  GLN C C     1 
ATOM   8584  O O     . GLN C 1 368 ? 44.653  33.851  7.547   1.00 40.68  ?  365  GLN C O     1 
ATOM   8585  C CB    . GLN C 1 368 ? 44.202  34.750  4.770   1.00 40.55  ?  365  GLN C CB    1 
ATOM   8586  C CG    . GLN C 1 368 ? 42.684  34.916  4.745   1.00 47.84  ?  365  GLN C CG    1 
ATOM   8587  C CD    . GLN C 1 368 ? 42.088  35.323  6.082   1.00 53.14  ?  365  GLN C CD    1 
ATOM   8588  O OE1   . GLN C 1 368 ? 42.475  36.334  6.668   1.00 56.87  ?  365  GLN C OE1   1 
ATOM   8589  N NE2   . GLN C 1 368 ? 41.134  34.536  6.567   1.00 45.34  ?  365  GLN C NE2   1 
ATOM   8590  N N     . ILE C 1 369 ? 43.441  32.077  6.866   1.00 41.89  ?  366  ILE C N     1 
ATOM   8591  C CA    . ILE C 1 369 ? 42.998  31.765  8.219   1.00 36.00  ?  366  ILE C CA    1 
ATOM   8592  C C     . ILE C 1 369 ? 44.208  31.404  9.065   1.00 34.03  ?  366  ILE C C     1 
ATOM   8593  O O     . ILE C 1 369 ? 44.949  30.463  8.753   1.00 32.90  ?  366  ILE C O     1 
ATOM   8594  C CB    . ILE C 1 369 ? 41.966  30.633  8.205   1.00 31.68  ?  366  ILE C CB    1 
ATOM   8595  C CG1   . ILE C 1 369 ? 40.617  31.143  7.689   1.00 37.65  ?  366  ILE C CG1   1 
ATOM   8596  C CG2   . ILE C 1 369 ? 41.814  30.040  9.597   1.00 35.43  ?  366  ILE C CG2   1 
ATOM   8597  C CD1   . ILE C 1 369 ? 39.547  30.072  7.608   1.00 43.39  ?  366  ILE C CD1   1 
ATOM   8598  N N     . GLU C 1 370 ? 44.425  32.164  10.130  1.00 39.73  ?  367  GLU C N     1 
ATOM   8599  C CA    . GLU C 1 370 ? 45.454  31.875  11.113  1.00 51.24  ?  367  GLU C CA    1 
ATOM   8600  C C     . GLU C 1 370 ? 44.789  31.404  12.400  1.00 45.76  ?  367  GLU C C     1 
ATOM   8601  O O     . GLU C 1 370 ? 43.568  31.490  12.560  1.00 42.54  ?  367  GLU C O     1 
ATOM   8602  C CB    . GLU C 1 370 ? 46.328  33.112  11.363  1.00 66.73  ?  367  GLU C CB    1 
ATOM   8603  C CG    . GLU C 1 370 ? 47.786  32.812  11.690  1.00 79.80  ?  367  GLU C CG    1 
ATOM   8604  C CD    . GLU C 1 370 ? 48.652  34.062  11.711  1.00 92.00  ?  367  GLU C CD    1 
ATOM   8605  O OE1   . GLU C 1 370 ? 48.415  34.966  10.880  1.00 95.18  ?  367  GLU C OE1   1 
ATOM   8606  O OE2   . GLU C 1 370 ? 49.554  34.149  12.570  1.00 95.78  -1 367  GLU C OE2   1 
ATOM   8607  N N     . ASP C 1 371 ? 45.615  30.882  13.310  1.00 39.50  ?  368  ASP C N     1 
ATOM   8608  C CA    . ASP C 1 371 ? 45.205  30.504  14.662  1.00 46.34  ?  368  ASP C CA    1 
ATOM   8609  C C     . ASP C 1 371 ? 44.317  29.267  14.698  1.00 37.94  ?  368  ASP C C     1 
ATOM   8610  O O     . ASP C 1 371 ? 44.391  28.407  13.814  1.00 50.67  ?  368  ASP C O     1 
ATOM   8611  C CB    . ASP C 1 371 ? 44.480  31.661  15.353  1.00 52.62  ?  368  ASP C CB    1 
ATOM   8612  C CG    . ASP C 1 371 ? 45.170  32.973  15.137  1.00 74.63  ?  368  ASP C CG    1 
ATOM   8613  O OD1   . ASP C 1 371 ? 46.413  32.965  15.030  1.00 79.69  ?  368  ASP C OD1   1 
ATOM   8614  O OD2   . ASP C 1 371 ? 44.476  34.007  15.045  1.00 85.06  -1 368  ASP C OD2   1 
ATOM   8615  N N     . ASN C 1 372 ? 43.483  29.175  15.733  1.00 21.68  ?  369  ASN C N     1 
ATOM   8616  C CA    . ASN C 1 372 ? 42.657  28.000  15.992  1.00 28.74  ?  369  ASN C CA    1 
ATOM   8617  C C     . ASN C 1 372 ? 41.265  28.248  15.425  1.00 26.84  ?  369  ASN C C     1 
ATOM   8618  O O     . ASN C 1 372 ? 40.484  29.019  15.991  1.00 30.25  ?  369  ASN C O     1 
ATOM   8619  C CB    . ASN C 1 372 ? 42.589  27.707  17.490  1.00 15.94  ?  369  ASN C CB    1 
ATOM   8620  C CG    . ASN C 1 372 ? 43.959  27.595  18.126  1.00 20.96  ?  369  ASN C CG    1 
ATOM   8621  O OD1   . ASN C 1 372 ? 44.878  27.012  17.548  1.00 29.87  ?  369  ASN C OD1   1 
ATOM   8622  N ND2   . ASN C 1 372 ? 44.107  28.163  19.316  1.00 24.89  ?  369  ASN C ND2   1 
ATOM   8623  N N     . VAL C 1 373 ? 40.955  27.597  14.308  1.00 17.75  ?  370  VAL C N     1 
ATOM   8624  C CA    . VAL C 1 373 ? 39.654  27.727  13.668  1.00 16.82  ?  370  VAL C CA    1 
ATOM   8625  C C     . VAL C 1 373 ? 39.128  26.330  13.379  1.00 13.95  ?  370  VAL C C     1 
ATOM   8626  O O     . VAL C 1 373 ? 39.784  25.544  12.684  1.00 17.09  ?  370  VAL C O     1 
ATOM   8627  C CB    . VAL C 1 373 ? 39.724  28.564  12.380  1.00 23.99  ?  370  VAL C CB    1 
ATOM   8628  C CG1   . VAL C 1 373 ? 38.383  28.542  11.656  1.00 22.66  ?  370  VAL C CG1   1 
ATOM   8629  C CG2   . VAL C 1 373 ? 40.130  29.992  12.710  1.00 27.31  ?  370  VAL C CG2   1 
ATOM   8630  N N     . MET C 1 374 ? 37.953  26.022  13.915  1.00 18.78  ?  371  MET C N     1 
ATOM   8631  C CA    . MET C 1 374 ? 37.328  24.727  13.696  1.00 17.12  ?  371  MET C CA    1 
ATOM   8632  C C     . MET C 1 374 ? 36.681  24.673  12.320  1.00 20.80  ?  371  MET C C     1 
ATOM   8633  O O     . MET C 1 374 ? 36.069  25.642  11.865  1.00 22.01  ?  371  MET C O     1 
ATOM   8634  C CB    . MET C 1 374 ? 36.277  24.455  14.770  1.00 15.99  ?  371  MET C CB    1 
ATOM   8635  C CG    . MET C 1 374 ? 36.792  24.592  16.188  1.00 31.40  ?  371  MET C CG    1 
ATOM   8636  S SD    . MET C 1 374 ? 38.062  23.373  16.558  1.00 62.42  ?  371  MET C SD    1 
ATOM   8637  C CE    . MET C 1 374 ? 38.859  24.146  17.955  1.00 51.59  ?  371  MET C CE    1 
ATOM   8638  N N     . ALA C 1 375 ? 36.810  23.531  11.662  1.00 11.22  ?  372  ALA C N     1 
ATOM   8639  C CA    . ALA C 1 375 ? 36.126  23.276  10.402  1.00 19.19  ?  372  ALA C CA    1 
ATOM   8640  C C     . ALA C 1 375 ? 35.001  22.293  10.692  1.00 13.74  ?  372  ALA C C     1 
ATOM   8641  O O     . ALA C 1 375 ? 35.237  21.089  10.826  1.00 20.29  ?  372  ALA C O     1 
ATOM   8642  C CB    . ALA C 1 375 ? 37.085  22.737  9.348   1.00 15.86  ?  372  ALA C CB    1 
ATOM   8643  N N     . ILE C 1 376 ? 33.780  22.813  10.807  1.00 17.33  ?  373  ILE C N     1 
ATOM   8644  C CA    . ILE C 1 376 ? 32.593  21.984  11.004  1.00 16.90  ?  373  ILE C CA    1 
ATOM   8645  C C     . ILE C 1 376 ? 32.239  21.378  9.649   1.00 19.06  ?  373  ILE C C     1 
ATOM   8646  O O     . ILE C 1 376 ? 31.682  22.050  8.779   1.00 16.97  ?  373  ILE C O     1 
ATOM   8647  C CB    . ILE C 1 376 ? 31.431  22.785  11.592  1.00 20.49  ?  373  ILE C CB    1 
ATOM   8648  C CG1   . ILE C 1 376 ? 31.823  23.342  12.963  1.00 20.41  ?  373  ILE C CG1   1 
ATOM   8649  C CG2   . ILE C 1 376 ? 30.184  21.909  11.697  1.00 19.86  ?  373  ILE C CG2   1 
ATOM   8650  C CD1   . ILE C 1 376 ? 30.890  24.407  13.491  1.00 18.10  ?  373  ILE C CD1   1 
ATOM   8651  N N     . VAL C 1 377 ? 32.564  20.103  9.469   1.00 17.50  ?  374  VAL C N     1 
ATOM   8652  C CA    . VAL C 1 377 ? 32.417  19.418  8.189   1.00 16.08  ?  374  VAL C CA    1 
ATOM   8653  C C     . VAL C 1 377 ? 31.280  18.419  8.329   1.00 24.22  ?  374  VAL C C     1 
ATOM   8654  O O     . VAL C 1 377 ? 31.393  17.437  9.072   1.00 19.83  ?  374  VAL C O     1 
ATOM   8655  C CB    . VAL C 1 377 ? 33.720  18.728  7.765   1.00 19.11  ?  374  VAL C CB    1 
ATOM   8656  C CG1   . VAL C 1 377 ? 33.526  17.956  6.465   1.00 27.64  ?  374  VAL C CG1   1 
ATOM   8657  C CG2   . VAL C 1 377 ? 34.831  19.755  7.624   1.00 23.71  ?  374  VAL C CG2   1 
ATOM   8658  N N     . LEU C 1 378 ? 30.182  18.670  7.623   1.00 18.96  ?  375  LEU C N     1 
ATOM   8659  C CA    . LEU C 1 378 ? 29.003  17.822  7.731   1.00 18.09  ?  375  LEU C CA    1 
ATOM   8660  C C     . LEU C 1 378 ? 29.171  16.597  6.842   1.00 19.18  ?  375  LEU C C     1 
ATOM   8661  O O     . LEU C 1 378 ? 29.398  16.722  5.634   1.00 23.56  ?  375  LEU C O     1 
ATOM   8662  C CB    . LEU C 1 378 ? 27.746  18.599  7.350   1.00 19.14  ?  375  LEU C CB    1 
ATOM   8663  C CG    . LEU C 1 378 ? 27.105  19.449  8.450   1.00 36.49  ?  375  LEU C CG    1 
ATOM   8664  C CD1   . LEU C 1 378 ? 27.924  20.701  8.747   1.00 35.16  ?  375  LEU C CD1   1 
ATOM   8665  C CD2   . LEU C 1 378 ? 25.674  19.805  8.077   1.00 40.72  ?  375  LEU C CD2   1 
ATOM   8666  N N     . LEU C 1 379 ? 29.067  15.417  7.442   1.00 23.13  ?  376  LEU C N     1 
ATOM   8667  C CA    . LEU C 1 379 ? 29.160  14.152  6.726   1.00 22.33  ?  376  LEU C CA    1 
ATOM   8668  C C     . LEU C 1 379 ? 27.757  13.642  6.430   1.00 27.55  ?  376  LEU C C     1 
ATOM   8669  O O     . LEU C 1 379 ? 26.897  13.631  7.316   1.00 29.06  ?  376  LEU C O     1 
ATOM   8670  C CB    . LEU C 1 379 ? 29.933  13.117  7.545   1.00 16.74  ?  376  LEU C CB    1 
ATOM   8671  C CG    . LEU C 1 379 ? 31.288  13.548  8.113   1.00 24.03  ?  376  LEU C CG    1 
ATOM   8672  C CD1   . LEU C 1 379 ? 31.907  12.416  8.922   1.00 20.82  ?  376  LEU C CD1   1 
ATOM   8673  C CD2   . LEU C 1 379 ? 32.226  13.996  7.004   1.00 23.35  ?  376  LEU C CD2   1 
ATOM   8674  N N     . ASP C 1 380 ? 27.531  13.222  5.184   1.00 37.31  ?  377  ASP C N     1 
ATOM   8675  C CA    . ASP C 1 380 ? 26.231  12.670  4.820   1.00 41.17  ?  377  ASP C CA    1 
ATOM   8676  C C     . ASP C 1 380 ? 25.953  11.365  5.553   1.00 34.45  ?  377  ASP C C     1 
ATOM   8677  O O     . ASP C 1 380 ? 24.794  11.058  5.855   1.00 30.60  ?  377  ASP C O     1 
ATOM   8678  C CB    . ASP C 1 380 ? 26.159  12.463  3.308   1.00 43.90  ?  377  ASP C CB    1 
ATOM   8679  C CG    . ASP C 1 380 ? 26.157  13.771  2.544   1.00 50.39  ?  377  ASP C CG    1 
ATOM   8680  O OD1   . ASP C 1 380 ? 25.350  14.659  2.894   1.00 47.01  ?  377  ASP C OD1   1 
ATOM   8681  O OD2   . ASP C 1 380 ? 26.967  13.916  1.605   1.00 52.53  -1 377  ASP C OD2   1 
ATOM   8682  N N     . LYS C 1 381 ? 26.996  10.602  5.858   1.00 28.66  ?  378  LYS C N     1 
ATOM   8683  C CA    . LYS C 1 381 ? 26.864  9.341   6.573   1.00 29.18  ?  378  LYS C CA    1 
ATOM   8684  C C     . LYS C 1 381 ? 28.243  8.959   7.089   1.00 27.73  ?  378  LYS C C     1 
ATOM   8685  O O     . LYS C 1 381 ? 29.256  9.535   6.686   1.00 29.67  ?  378  LYS C O     1 
ATOM   8686  C CB    . LYS C 1 381 ? 26.287  8.243   5.676   1.00 36.82  ?  378  LYS C CB    1 
ATOM   8687  C CG    . LYS C 1 381 ? 27.144  7.943   4.458   1.00 38.45  ?  378  LYS C CG    1 
ATOM   8688  C CD    . LYS C 1 381 ? 26.631  6.738   3.690   1.00 55.05  ?  378  LYS C CD    1 
ATOM   8689  C CE    . LYS C 1 381 ? 27.788  5.920   3.135   1.00 62.27  ?  378  LYS C CE    1 
ATOM   8690  N NZ    . LYS C 1 381 ? 28.705  6.740   2.296   1.00 67.90  1  378  LYS C NZ    1 
ATOM   8691  N N     . TYR C 1 382 ? 28.270  7.979   7.990   1.00 27.73  ?  379  TYR C N     1 
ATOM   8692  C CA    . TYR C 1 382 ? 29.539  7.458   8.479   1.00 26.63  ?  379  TYR C CA    1 
ATOM   8693  C C     . TYR C 1 382 ? 30.386  6.990   7.302   1.00 32.13  ?  379  TYR C C     1 
ATOM   8694  O O     . TYR C 1 382 ? 29.898  6.301   6.401   1.00 36.81  ?  379  TYR C O     1 
ATOM   8695  C CB    . TYR C 1 382 ? 29.297  6.312   9.464   1.00 22.29  ?  379  TYR C CB    1 
ATOM   8696  C CG    . TYR C 1 382 ? 30.507  5.945   10.302  1.00 37.85  ?  379  TYR C CG    1 
ATOM   8697  C CD1   . TYR C 1 382 ? 31.427  5.001   9.861   1.00 34.30  ?  379  TYR C CD1   1 
ATOM   8698  C CD2   . TYR C 1 382 ? 30.725  6.541   11.540  1.00 37.63  ?  379  TYR C CD2   1 
ATOM   8699  C CE1   . TYR C 1 382 ? 32.531  4.663   10.627  1.00 33.85  ?  379  TYR C CE1   1 
ATOM   8700  C CE2   . TYR C 1 382 ? 31.825  6.208   12.314  1.00 37.71  ?  379  TYR C CE2   1 
ATOM   8701  C CZ    . TYR C 1 382 ? 32.725  5.270   11.852  1.00 41.27  ?  379  TYR C CZ    1 
ATOM   8702  O OH    . TYR C 1 382 ? 33.821  4.934   12.616  1.00 46.15  ?  379  TYR C OH    1 
ATOM   8703  N N     . ILE C 1 383 ? 31.655  7.390   7.298   1.00 31.08  ?  380  ILE C N     1 
ATOM   8704  C CA    . ILE C 1 383 ? 32.560  7.133   6.184   1.00 28.23  ?  380  ILE C CA    1 
ATOM   8705  C C     . ILE C 1 383 ? 33.493  5.992   6.560   1.00 33.59  ?  380  ILE C C     1 
ATOM   8706  O O     . ILE C 1 383 ? 34.151  6.036   7.609   1.00 37.71  ?  380  ILE C O     1 
ATOM   8707  C CB    . ILE C 1 383 ? 33.348  8.400   5.812   1.00 36.70  ?  380  ILE C CB    1 
ATOM   8708  C CG1   . ILE C 1 383 ? 32.386  9.494   5.351   1.00 47.22  ?  380  ILE C CG1   1 
ATOM   8709  C CG2   . ILE C 1 383 ? 34.379  8.095   4.737   1.00 33.98  ?  380  ILE C CG2   1 
ATOM   8710  C CD1   . ILE C 1 383 ? 33.013  10.864  5.264   1.00 48.78  ?  380  ILE C CD1   1 
ATOM   8711  N N     . GLY C 1 384 ? 33.554  4.972   5.702   1.00 29.80  ?  381  GLY C N     1 
ATOM   8712  C CA    . GLY C 1 384 ? 34.392  3.820   5.995   1.00 26.43  ?  381  GLY C CA    1 
ATOM   8713  C C     . GLY C 1 384 ? 35.872  4.148   5.997   1.00 28.30  ?  381  GLY C C     1 
ATOM   8714  O O     . GLY C 1 384 ? 36.616  3.698   6.873   1.00 31.32  ?  381  GLY C O     1 
ATOM   8715  N N     . ASN C 1 385 ? 36.324  4.929   5.018   1.00 35.40  ?  382  ASN C N     1 
ATOM   8716  C CA    . ASN C 1 385 ? 37.719  5.362   4.933   1.00 34.78  ?  382  ASN C CA    1 
ATOM   8717  C C     . ASN C 1 385 ? 37.746  6.888   4.953   1.00 38.14  ?  382  ASN C C     1 
ATOM   8718  O O     . ASN C 1 385 ? 37.549  7.535   3.920   1.00 32.93  ?  382  ASN C O     1 
ATOM   8719  C CB    . ASN C 1 385 ? 38.399  4.813   3.680   1.00 30.92  ?  382  ASN C CB    1 
ATOM   8720  C CG    . ASN C 1 385 ? 39.831  5.300   3.530   1.00 37.35  ?  382  ASN C CG    1 
ATOM   8721  O OD1   . ASN C 1 385 ? 40.474  5.685   4.507   1.00 26.80  ?  382  ASN C OD1   1 
ATOM   8722  N ND2   . ASN C 1 385 ? 40.333  5.289   2.301   1.00 44.08  ?  382  ASN C ND2   1 
ATOM   8723  N N     . ILE C 1 386 ? 38.002  7.463   6.132   1.00 31.46  ?  383  ILE C N     1 
ATOM   8724  C CA    . ILE C 1 386 ? 38.024  8.914   6.277   1.00 21.08  ?  383  ILE C CA    1 
ATOM   8725  C C     . ILE C 1 386 ? 39.425  9.496   6.130   1.00 24.89  ?  383  ILE C C     1 
ATOM   8726  O O     . ILE C 1 386 ? 39.589  10.721  6.211   1.00 27.69  ?  383  ILE C O     1 
ATOM   8727  C CB    . ILE C 1 386 ? 37.396  9.316   7.630   1.00 28.72  ?  383  ILE C CB    1 
ATOM   8728  C CG1   . ILE C 1 386 ? 36.835  10.741  7.567   1.00 30.00  ?  383  ILE C CG1   1 
ATOM   8729  C CG2   . ILE C 1 386 ? 38.405  9.164   8.759   1.00 24.96  ?  383  ILE C CG2   1 
ATOM   8730  C CD1   . ILE C 1 386 ? 35.775  11.033  8.609   1.00 28.30  ?  383  ILE C CD1   1 
ATOM   8731  N N     . ASP C 1 387 ? 40.439  8.658   5.903   1.00 34.89  ?  384  ASP C N     1 
ATOM   8732  C CA    . ASP C 1 387 ? 41.799  9.150   5.682   1.00 33.23  ?  384  ASP C CA    1 
ATOM   8733  C C     . ASP C 1 387 ? 41.897  10.213  4.592   1.00 40.14  ?  384  ASP C C     1 
ATOM   8734  O O     . ASP C 1 387 ? 42.587  11.221  4.814   1.00 44.20  ?  384  ASP C O     1 
ATOM   8735  C CB    . ASP C 1 387 ? 42.729  7.967   5.373   1.00 44.18  ?  384  ASP C CB    1 
ATOM   8736  C CG    . ASP C 1 387 ? 43.206  7.253   6.626   1.00 58.13  ?  384  ASP C CG    1 
ATOM   8737  O OD1   . ASP C 1 387 ? 43.416  7.926   7.657   1.00 60.97  ?  384  ASP C OD1   1 
ATOM   8738  O OD2   . ASP C 1 387 ? 43.375  6.017   6.581   1.00 63.86  -1 384  ASP C OD2   1 
ATOM   8739  N N     . PRO C 1 388 ? 41.266  10.067  3.415   1.00 34.03  ?  385  PRO C N     1 
ATOM   8740  C CA    . PRO C 1 388 ? 41.358  11.149  2.418   1.00 32.12  ?  385  PRO C CA    1 
ATOM   8741  C C     . PRO C 1 388 ? 40.884  12.498  2.934   1.00 29.47  ?  385  PRO C C     1 
ATOM   8742  O O     . PRO C 1 388 ? 41.505  13.522  2.626   1.00 31.91  ?  385  PRO C O     1 
ATOM   8743  C CB    . PRO C 1 388 ? 40.480  10.635  1.268   1.00 39.49  ?  385  PRO C CB    1 
ATOM   8744  C CG    . PRO C 1 388 ? 40.546  9.156   1.385   1.00 39.65  ?  385  PRO C CG    1 
ATOM   8745  C CD    . PRO C 1 388 ? 40.584  8.879   2.861   1.00 44.60  ?  385  PRO C CD    1 
ATOM   8746  N N     . LEU C 1 389 ? 39.804  12.531  3.719   1.00 28.90  ?  386  LEU C N     1 
ATOM   8747  C CA    . LEU C 1 389 ? 39.325  13.797  4.264   1.00 35.19  ?  386  LEU C CA    1 
ATOM   8748  C C     . LEU C 1 389 ? 40.381  14.456  5.143   1.00 28.79  ?  386  LEU C C     1 
ATOM   8749  O O     . LEU C 1 389 ? 40.619  15.665  5.043   1.00 26.58  ?  386  LEU C O     1 
ATOM   8750  C CB    . LEU C 1 389 ? 38.035  13.573  5.050   1.00 39.04  ?  386  LEU C CB    1 
ATOM   8751  C CG    . LEU C 1 389 ? 37.415  14.807  5.707   1.00 38.74  ?  386  LEU C CG    1 
ATOM   8752  C CD1   . LEU C 1 389 ? 37.000  15.829  4.658   1.00 38.76  ?  386  LEU C CD1   1 
ATOM   8753  C CD2   . LEU C 1 389 ? 36.233  14.415  6.576   1.00 39.81  ?  386  LEU C CD2   1 
ATOM   8754  N N     . VAL C 1 390 ? 41.029  13.672  6.006   1.00 19.73  ?  387  VAL C N     1 
ATOM   8755  C CA    . VAL C 1 390 ? 42.069  14.215  6.875   1.00 25.01  ?  387  VAL C CA    1 
ATOM   8756  C C     . VAL C 1 390 ? 43.306  14.585  6.067   1.00 17.36  ?  387  VAL C C     1 
ATOM   8757  O O     . VAL C 1 390 ? 43.920  15.634  6.292   1.00 21.92  ?  387  VAL C O     1 
ATOM   8758  C CB    . VAL C 1 390 ? 42.410  13.207  7.987   1.00 29.65  ?  387  VAL C CB    1 
ATOM   8759  C CG1   . VAL C 1 390 ? 43.347  13.836  9.013   1.00 33.91  ?  387  VAL C CG1   1 
ATOM   8760  C CG2   . VAL C 1 390 ? 41.139  12.693  8.640   1.00 30.59  ?  387  VAL C CG2   1 
ATOM   8761  N N     . ARG C 1 391 ? 43.687  13.736  5.109   1.00 23.30  ?  388  ARG C N     1 
ATOM   8762  C CA    . ARG C 1 391 ? 44.917  13.967  4.356   1.00 29.82  ?  388  ARG C CA    1 
ATOM   8763  C C     . ARG C 1 391 ? 44.804  15.194  3.459   1.00 32.54  ?  388  ARG C C     1 
ATOM   8764  O O     . ARG C 1 391 ? 45.768  15.956  3.317   1.00 33.46  ?  388  ARG C O     1 
ATOM   8765  C CB    . ARG C 1 391 ? 45.264  12.727  3.527   1.00 35.85  ?  388  ARG C CB    1 
ATOM   8766  C CG    . ARG C 1 391 ? 46.558  12.845  2.731   1.00 42.41  ?  388  ARG C CG    1 
ATOM   8767  C CD    . ARG C 1 391 ? 46.636  11.808  1.614   1.00 38.63  ?  388  ARG C CD    1 
ATOM   8768  N NE    . ARG C 1 391 ? 46.898  10.457  2.104   1.00 58.81  ?  388  ARG C NE    1 
ATOM   8769  C CZ    . ARG C 1 391 ? 47.131  9.410   1.316   1.00 67.39  ?  388  ARG C CZ    1 
ATOM   8770  N NH1   . ARG C 1 391 ? 47.136  9.557   -0.002  1.00 62.90  1  388  ARG C NH1   1 
ATOM   8771  N NH2   . ARG C 1 391 ? 47.363  8.216   1.845   1.00 64.47  ?  388  ARG C NH2   1 
ATOM   8772  N N     . ASN C 1 392 ? 43.639  15.407  2.850   1.00 31.20  ?  389  ASN C N     1 
ATOM   8773  C CA    . ASN C 1 392 ? 43.471  16.459  1.855   1.00 27.64  ?  389  ASN C CA    1 
ATOM   8774  C C     . ASN C 1 392 ? 43.024  17.788  2.447   1.00 34.12  ?  389  ASN C C     1 
ATOM   8775  O O     . ASN C 1 392 ? 43.009  18.794  1.730   1.00 26.46  ?  389  ASN C O     1 
ATOM   8776  C CB    . ASN C 1 392 ? 42.463  16.013  0.792   1.00 24.79  ?  389  ASN C CB    1 
ATOM   8777  C CG    . ASN C 1 392 ? 42.873  14.724  0.110   1.00 29.98  ?  389  ASN C CG    1 
ATOM   8778  O OD1   . ASN C 1 392 ? 44.061  14.444  -0.049  1.00 33.33  ?  389  ASN C OD1   1 
ATOM   8779  N ND2   . ASN C 1 392 ? 41.889  13.928  -0.293  1.00 36.93  ?  389  ASN C ND2   1 
ATOM   8780  N N     . PHE C 1 393 ? 42.676  17.819  3.726   1.00 37.57  ?  390  PHE C N     1 
ATOM   8781  C CA    . PHE C 1 393 ? 42.097  19.009  4.323   1.00 40.36  ?  390  PHE C CA    1 
ATOM   8782  C C     . PHE C 1 393 ? 43.176  20.053  4.611   1.00 34.80  ?  390  PHE C C     1 
ATOM   8783  O O     . PHE C 1 393 ? 44.316  19.705  4.930   1.00 32.24  ?  390  PHE C O     1 
ATOM   8784  C CB    . PHE C 1 393 ? 41.366  18.648  5.609   1.00 37.05  ?  390  PHE C CB    1 
ATOM   8785  C CG    . PHE C 1 393 ? 40.134  19.460  5.845   1.00 34.12  ?  390  PHE C CG    1 
ATOM   8786  C CD1   . PHE C 1 393 ? 39.015  19.293  5.047   1.00 26.72  ?  390  PHE C CD1   1 
ATOM   8787  C CD2   . PHE C 1 393 ? 40.097  20.398  6.857   1.00 40.02  ?  390  PHE C CD2   1 
ATOM   8788  C CE1   . PHE C 1 393 ? 37.879  20.048  5.258   1.00 23.50  ?  390  PHE C CE1   1 
ATOM   8789  C CE2   . PHE C 1 393 ? 38.971  21.152  7.070   1.00 40.55  ?  390  PHE C CE2   1 
ATOM   8790  C CZ    . PHE C 1 393 ? 37.859  20.979  6.272   1.00 32.96  ?  390  PHE C CZ    1 
ATOM   8791  N N     . PRO C 1 394 ? 42.839  21.340  4.494   1.00 34.49  ?  391  PRO C N     1 
ATOM   8792  C CA    . PRO C 1 394 ? 43.826  22.393  4.776   1.00 32.85  ?  391  PRO C CA    1 
ATOM   8793  C C     . PRO C 1 394 ? 44.349  22.289  6.202   1.00 39.68  ?  391  PRO C C     1 
ATOM   8794  O O     . PRO C 1 394 ? 43.578  22.170  7.158   1.00 27.04  ?  391  PRO C O     1 
ATOM   8795  C CB    . PRO C 1 394 ? 43.036  23.689  4.553   1.00 33.30  ?  391  PRO C CB    1 
ATOM   8796  C CG    . PRO C 1 394 ? 41.902  23.303  3.654   1.00 29.85  ?  391  PRO C CG    1 
ATOM   8797  C CD    . PRO C 1 394 ? 41.557  21.890  4.018   1.00 33.68  ?  391  PRO C CD    1 
ATOM   8798  N N     . ASP C 1 395 ? 45.676  22.343  6.339   1.00 31.08  ?  392  ASP C N     1 
ATOM   8799  C CA    . ASP C 1 395 ? 46.303  22.076  7.627   1.00 29.57  ?  392  ASP C CA    1 
ATOM   8800  C C     . ASP C 1 395 ? 46.157  23.231  8.608   1.00 27.23  ?  392  ASP C C     1 
ATOM   8801  O O     . ASP C 1 395 ? 46.343  23.027  9.812   1.00 38.26  ?  392  ASP C O     1 
ATOM   8802  C CB    . ASP C 1 395 ? 47.781  21.735  7.429   1.00 50.95  ?  392  ASP C CB    1 
ATOM   8803  C CG    . ASP C 1 395 ? 48.375  22.409  6.211   1.00 57.43  ?  392  ASP C CG    1 
ATOM   8804  O OD1   . ASP C 1 395 ? 48.221  23.640  6.075   1.00 65.06  ?  392  ASP C OD1   1 
ATOM   8805  O OD2   . ASP C 1 395 ? 48.985  21.701  5.382   1.00 64.47  -1 392  ASP C OD2   1 
ATOM   8806  N N     . ASN C 1 396 ? 45.823  24.429  8.139   1.00 29.40  ?  393  ASN C N     1 
ATOM   8807  C CA    . ASN C 1 396 ? 45.590  25.538  9.054   1.00 27.48  ?  393  ASN C CA    1 
ATOM   8808  C C     . ASN C 1 396 ? 44.189  25.518  9.661   1.00 25.81  ?  393  ASN C C     1 
ATOM   8809  O O     . ASN C 1 396 ? 43.829  26.457  10.378  1.00 27.09  ?  393  ASN C O     1 
ATOM   8810  C CB    . ASN C 1 396 ? 45.834  26.875  8.348   1.00 23.78  ?  393  ASN C CB    1 
ATOM   8811  C CG    . ASN C 1 396 ? 44.935  27.075  7.148   1.00 26.79  ?  393  ASN C CG    1 
ATOM   8812  O OD1   . ASN C 1 396 ? 44.644  26.135  6.411   1.00 30.22  ?  393  ASN C OD1   1 
ATOM   8813  N ND2   . ASN C 1 396 ? 44.485  28.308  6.948   1.00 26.79  ?  393  ASN C ND2   1 
ATOM   8814  N N     . LEU C 1 397 ? 43.401  24.477  9.398   1.00 22.59  ?  394  LEU C N     1 
ATOM   8815  C CA    . LEU C 1 397 ? 42.090  24.299  10.003  1.00 18.73  ?  394  LEU C CA    1 
ATOM   8816  C C     . LEU C 1 397 ? 42.098  23.077  10.913  1.00 20.98  ?  394  LEU C C     1 
ATOM   8817  O O     . LEU C 1 397 ? 42.811  22.103  10.663  1.00 22.45  ?  394  LEU C O     1 
ATOM   8818  C CB    . LEU C 1 397 ? 41.001  24.133  8.935   1.00 18.55  ?  394  LEU C CB    1 
ATOM   8819  C CG    . LEU C 1 397 ? 40.782  25.281  7.947   1.00 22.78  ?  394  LEU C CG    1 
ATOM   8820  C CD1   . LEU C 1 397 ? 39.791  24.871  6.865   1.00 20.33  ?  394  LEU C CD1   1 
ATOM   8821  C CD2   . LEU C 1 397 ? 40.297  26.529  8.670   1.00 25.14  ?  394  LEU C CD2   1 
ATOM   8822  N N     . ILE C 1 398 ? 41.293  23.137  11.969  1.00 24.06  ?  395  ILE C N     1 
ATOM   8823  C CA    . ILE C 1 398 ? 41.110  22.022  12.892  1.00 20.91  ?  395  ILE C CA    1 
ATOM   8824  C C     . ILE C 1 398 ? 39.857  21.272  12.458  1.00 18.84  ?  395  ILE C C     1 
ATOM   8825  O O     . ILE C 1 398 ? 38.732  21.729  12.686  1.00 17.16  ?  395  ILE C O     1 
ATOM   8826  C CB    . ILE C 1 398 ? 41.011  22.491  14.349  1.00 19.11  ?  395  ILE C CB    1 
ATOM   8827  C CG1   . ILE C 1 398 ? 42.253  23.292  14.737  1.00 23.62  ?  395  ILE C CG1   1 
ATOM   8828  C CG2   . ILE C 1 398 ? 40.836  21.295  15.275  1.00 16.78  ?  395  ILE C CG2   1 
ATOM   8829  C CD1   . ILE C 1 398 ? 42.225  23.804  16.163  1.00 23.92  ?  395  ILE C CD1   1 
ATOM   8830  N N     . LEU C 1 399 ? 40.060  20.116  11.834  1.00 17.26  ?  396  LEU C N     1 
ATOM   8831  C CA    . LEU C 1 399 ? 38.975  19.345  11.241  1.00 22.38  ?  396  LEU C CA    1 
ATOM   8832  C C     . LEU C 1 399 ? 38.048  18.800  12.323  1.00 26.97  ?  396  LEU C C     1 
ATOM   8833  O O     . LEU C 1 399 ? 38.480  18.051  13.206  1.00 21.05  ?  396  LEU C O     1 
ATOM   8834  C CB    . LEU C 1 399 ? 39.567  18.219  10.399  1.00 20.87  ?  396  LEU C CB    1 
ATOM   8835  C CG    . LEU C 1 399 ? 38.669  17.216  9.678   1.00 25.32  ?  396  LEU C CG    1 
ATOM   8836  C CD1   . LEU C 1 399 ? 37.526  17.917  8.986   1.00 26.24  ?  396  LEU C CD1   1 
ATOM   8837  C CD2   . LEU C 1 399 ? 39.502  16.436  8.672   1.00 21.72  ?  396  LEU C CD2   1 
ATOM   8838  N N     . GLN C 1 400 ? 36.770  19.173  12.249  1.00 20.80  ?  397  GLN C N     1 
ATOM   8839  C CA    . GLN C 1 400 ? 35.756  18.752  13.215  1.00 18.85  ?  397  GLN C CA    1 
ATOM   8840  C C     . GLN C 1 400 ? 34.540  18.213  12.478  1.00 16.25  ?  397  GLN C C     1 
ATOM   8841  O O     . GLN C 1 400 ? 33.488  18.865  12.429  1.00 17.29  ?  397  GLN C O     1 
ATOM   8842  C CB    . GLN C 1 400 ? 35.359  19.907  14.134  1.00 18.99  ?  397  GLN C CB    1 
ATOM   8843  C CG    . GLN C 1 400 ? 36.467  20.379  15.056  1.00 17.71  ?  397  GLN C CG    1 
ATOM   8844  C CD    . GLN C 1 400 ? 36.793  19.374  16.146  1.00 21.96  ?  397  GLN C CD    1 
ATOM   8845  O OE1   . GLN C 1 400 ? 36.133  18.345  16.281  1.00 22.33  ?  397  GLN C OE1   1 
ATOM   8846  N NE2   . GLN C 1 400 ? 37.819  19.674  16.931  1.00 27.50  ?  397  GLN C NE2   1 
ATOM   8847  N N     . PRO C 1 401 ? 34.644  17.016  11.905  1.00 16.51  ?  398  PRO C N     1 
ATOM   8848  C CA    . PRO C 1 401 ? 33.498  16.433  11.204  1.00 14.81  ?  398  PRO C CA    1 
ATOM   8849  C C     . PRO C 1 401 ? 32.394  16.036  12.170  1.00 24.01  ?  398  PRO C C     1 
ATOM   8850  O O     . PRO C 1 401 ? 32.621  15.756  13.351  1.00 24.57  ?  398  PRO C O     1 
ATOM   8851  C CB    . PRO C 1 401 ? 34.093  15.205  10.509  1.00 18.17  ?  398  PRO C CB    1 
ATOM   8852  C CG    . PRO C 1 401 ? 35.254  14.829  11.356  1.00 35.06  ?  398  PRO C CG    1 
ATOM   8853  C CD    . PRO C 1 401 ? 35.812  16.119  11.897  1.00 20.56  ?  398  PRO C CD    1 
ATOM   8854  N N     . ILE C 1 402 ? 31.175  16.013  11.638  1.00 26.16  ?  399  ILE C N     1 
ATOM   8855  C CA    . ILE C 1 402 ? 29.987  15.660  12.404  1.00 21.22  ?  399  ILE C CA    1 
ATOM   8856  C C     . ILE C 1 402 ? 28.955  15.104  11.435  1.00 24.74  ?  399  ILE C C     1 
ATOM   8857  O O     . ILE C 1 402 ? 28.813  15.593  10.310  1.00 20.05  ?  399  ILE C O     1 
ATOM   8858  C CB    . ILE C 1 402 ? 29.448  16.874  13.194  1.00 26.54  ?  399  ILE C CB    1 
ATOM   8859  C CG1   . ILE C 1 402 ? 28.224  16.482  14.027  1.00 22.34  ?  399  ILE C CG1   1 
ATOM   8860  C CG2   . ILE C 1 402 ? 29.135  18.037  12.248  1.00 21.51  ?  399  ILE C CG2   1 
ATOM   8861  C CD1   . ILE C 1 402 ? 27.834  17.516  15.068  1.00 21.81  ?  399  ILE C CD1   1 
ATOM   8862  N N     . LEU C 1 403 ? 28.253  14.061  11.866  1.00 25.85  ?  400  LEU C N     1 
ATOM   8863  C CA    . LEU C 1 403 ? 27.266  13.422  11.008  1.00 29.27  ?  400  LEU C CA    1 
ATOM   8864  C C     . LEU C 1 403 ? 26.065  14.335  10.803  1.00 22.85  ?  400  LEU C C     1 
ATOM   8865  O O     . LEU C 1 403 ? 25.557  14.937  11.755  1.00 21.09  ?  400  LEU C O     1 
ATOM   8866  C CB    . LEU C 1 403 ? 26.824  12.089  11.611  1.00 24.84  ?  400  LEU C CB    1 
ATOM   8867  C CG    . LEU C 1 403 ? 27.914  11.019  11.663  1.00 28.73  ?  400  LEU C CG    1 
ATOM   8868  C CD1   . LEU C 1 403 ? 27.404  9.753   12.337  1.00 23.05  ?  400  LEU C CD1   1 
ATOM   8869  C CD2   . LEU C 1 403 ? 28.421  10.717  10.263  1.00 34.41  ?  400  LEU C CD2   1 
ATOM   8870  N N     . LYS C 1 404 ? 25.618  14.440  9.550   1.00 21.38  ?  401  LYS C N     1 
ATOM   8871  C CA    . LYS C 1 404 ? 24.436  15.237  9.233   1.00 35.82  ?  401  LYS C CA    1 
ATOM   8872  C C     . LYS C 1 404 ? 23.241  14.821  10.082  1.00 35.31  ?  401  LYS C C     1 
ATOM   8873  O O     . LYS C 1 404 ? 22.465  15.671  10.536  1.00 34.06  ?  401  LYS C O     1 
ATOM   8874  C CB    . LYS C 1 404 ? 24.115  15.104  7.742   1.00 33.66  ?  401  LYS C CB    1 
ATOM   8875  C CG    . LYS C 1 404 ? 22.679  15.405  7.357   1.00 47.60  ?  401  LYS C CG    1 
ATOM   8876  C CD    . LYS C 1 404 ? 22.414  14.974  5.921   1.00 50.57  ?  401  LYS C CD    1 
ATOM   8877  C CE    . LYS C 1 404 ? 22.688  13.487  5.741   1.00 54.62  ?  401  LYS C CE    1 
ATOM   8878  N NZ    . LYS C 1 404 ? 22.657  13.070  4.311   1.00 57.20  1  401  LYS C NZ    1 
ATOM   8879  N N     . GLU C 1 405 ? 23.092  13.515  10.324  1.00 40.70  ?  402  GLU C N     1 
ATOM   8880  C CA    . GLU C 1 405 ? 21.975  13.019  11.123  1.00 40.99  ?  402  GLU C CA    1 
ATOM   8881  C C     . GLU C 1 405 ? 21.962  13.642  12.511  1.00 34.76  ?  402  GLU C C     1 
ATOM   8882  O O     . GLU C 1 405 ? 20.901  14.012  13.028  1.00 32.68  ?  402  GLU C O     1 
ATOM   8883  C CB    . GLU C 1 405 ? 22.055  11.498  11.235  1.00 52.83  ?  402  GLU C CB    1 
ATOM   8884  C CG    . GLU C 1 405 ? 22.588  10.821  9.991   1.00 71.41  ?  402  GLU C CG    1 
ATOM   8885  C CD    . GLU C 1 405 ? 23.209  9.471   10.288  1.00 79.04  ?  402  GLU C CD    1 
ATOM   8886  O OE1   . GLU C 1 405 ? 23.283  9.093   11.476  1.00 79.86  ?  402  GLU C OE1   1 
ATOM   8887  O OE2   . GLU C 1 405 ? 23.623  8.789   9.326   1.00 77.49  -1 402  GLU C OE2   1 
ATOM   8888  N N     . LYS C 1 406 ? 23.132  13.760  13.137  1.00 30.24  ?  403  LYS C N     1 
ATOM   8889  C CA    . LYS C 1 406 ? 23.195  14.288  14.492  1.00 31.98  ?  403  LYS C CA    1 
ATOM   8890  C C     . LYS C 1 406 ? 22.964  15.790  14.542  1.00 29.66  ?  403  LYS C C     1 
ATOM   8891  O O     . LYS C 1 406 ? 22.820  16.344  15.637  1.00 27.01  ?  403  LYS C O     1 
ATOM   8892  C CB    . LYS C 1 406 ? 24.537  13.917  15.122  1.00 29.96  ?  403  LYS C CB    1 
ATOM   8893  C CG    . LYS C 1 406 ? 24.785  12.415  15.104  1.00 28.38  ?  403  LYS C CG    1 
ATOM   8894  C CD    . LYS C 1 406 ? 26.064  12.023  15.817  1.00 34.90  ?  403  LYS C CD    1 
ATOM   8895  C CE    . LYS C 1 406 ? 26.248  10.510  15.784  1.00 28.93  ?  403  LYS C CE    1 
ATOM   8896  N NZ    . LYS C 1 406 ? 27.314  10.051  16.718  1.00 28.15  1  403  LYS C NZ    1 
ATOM   8897  N N     . LEU C 1 407 ? 22.919  16.455  13.390  1.00 27.16  ?  404  LEU C N     1 
ATOM   8898  C CA    . LEU C 1 407 ? 22.457  17.834  13.325  1.00 38.27  ?  404  LEU C CA    1 
ATOM   8899  C C     . LEU C 1 407 ? 20.964  17.930  13.045  1.00 44.25  ?  404  LEU C C     1 
ATOM   8900  O O     . LEU C 1 407 ? 20.312  18.852  13.542  1.00 45.36  ?  404  LEU C O     1 
ATOM   8901  C CB    . LEU C 1 407 ? 23.241  18.604  12.260  1.00 46.27  ?  404  LEU C CB    1 
ATOM   8902  C CG    . LEU C 1 407 ? 24.493  19.286  12.812  1.00 50.16  ?  404  LEU C CG    1 
ATOM   8903  C CD1   . LEU C 1 407 ? 25.538  19.494  11.739  1.00 46.06  ?  404  LEU C CD1   1 
ATOM   8904  C CD2   . LEU C 1 407 ? 24.110  20.610  13.427  1.00 56.37  ?  404  LEU C CD2   1 
ATOM   8905  N N     . GLU C 1 408 ? 20.402  16.984  12.287  1.00 46.64  ?  405  GLU C N     1 
ATOM   8906  C CA    . GLU C 1 408 ? 18.971  17.009  11.994  1.00 43.25  ?  405  GLU C CA    1 
ATOM   8907  C C     . GLU C 1 408 ? 18.142  16.830  13.261  1.00 42.85  ?  405  GLU C C     1 
ATOM   8908  O O     . GLU C 1 408 ? 17.278  17.658  13.571  1.00 53.58  ?  405  GLU C O     1 
ATOM   8909  C CB    . GLU C 1 408 ? 18.631  15.935  10.960  1.00 43.75  ?  405  GLU C CB    1 
ATOM   8910  C CG    . GLU C 1 408 ? 19.132  16.256  9.559   1.00 45.12  ?  405  GLU C CG    1 
ATOM   8911  C CD    . GLU C 1 408 ? 19.070  15.065  8.621   1.00 61.40  ?  405  GLU C CD    1 
ATOM   8912  O OE1   . GLU C 1 408 ? 18.908  13.926  9.110   1.00 67.21  ?  405  GLU C OE1   1 
ATOM   8913  O OE2   . GLU C 1 408 ? 19.188  15.267  7.394   1.00 61.16  -1 405  GLU C OE2   1 
ATOM   8914  N N     . ASP C 1 409 ? 18.385  15.753  14.005  1.00 36.74  ?  406  ASP C N     1 
ATOM   8915  C CA    . ASP C 1 409 ? 17.714  15.516  15.283  1.00 46.90  ?  406  ASP C CA    1 
ATOM   8916  C C     . ASP C 1 409 ? 18.679  15.934  16.386  1.00 49.31  ?  406  ASP C C     1 
ATOM   8917  O O     . ASP C 1 409 ? 19.537  15.163  16.816  1.00 55.99  ?  406  ASP C O     1 
ATOM   8918  C CB    . ASP C 1 409 ? 17.282  14.061  15.424  1.00 56.67  ?  406  ASP C CB    1 
ATOM   8919  C CG    . ASP C 1 409 ? 15.961  13.780  14.736  1.00 62.97  ?  406  ASP C CG    1 
ATOM   8920  O OD1   . ASP C 1 409 ? 14.929  14.302  15.205  1.00 64.93  ?  406  ASP C OD1   1 
ATOM   8921  O OD2   . ASP C 1 409 ? 15.951  13.042  13.729  1.00 67.15  -1 406  ASP C OD2   1 
ATOM   8922  N N     . ILE C 1 410 ? 18.524  17.172  16.849  1.00 47.48  ?  407  ILE C N     1 
ATOM   8923  C CA    . ILE C 1 410 ? 19.469  17.757  17.793  1.00 49.04  ?  407  ILE C CA    1 
ATOM   8924  C C     . ILE C 1 410 ? 19.311  17.089  19.153  1.00 44.83  ?  407  ILE C C     1 
ATOM   8925  O O     . ILE C 1 410 ? 18.247  17.159  19.778  1.00 48.28  ?  407  ILE C O     1 
ATOM   8926  C CB    . ILE C 1 410 ? 19.269  19.274  17.898  1.00 45.55  ?  407  ILE C CB    1 
ATOM   8927  C CG1   . ILE C 1 410 ? 19.496  19.939  16.539  1.00 36.25  ?  407  ILE C CG1   1 
ATOM   8928  C CG2   . ILE C 1 410 ? 20.201  19.864  18.951  1.00 39.66  ?  407  ILE C CG2   1 
ATOM   8929  C CD1   . ILE C 1 410 ? 19.109  21.404  16.507  1.00 31.42  ?  407  ILE C CD1   1 
ATOM   8930  N N     . LYS C 1 411 ? 20.375  16.434  19.614  1.00 41.40  ?  408  LYS C N     1 
ATOM   8931  C CA    . LYS C 1 411 ? 20.456  15.947  20.981  1.00 40.07  ?  408  LYS C CA    1 
ATOM   8932  C C     . LYS C 1 411 ? 21.420  16.835  21.749  1.00 38.14  ?  408  LYS C C     1 
ATOM   8933  O O     . LYS C 1 411 ? 22.580  16.978  21.336  1.00 34.09  ?  408  LYS C O     1 
ATOM   8934  C CB    . LYS C 1 411 ? 20.913  14.491  21.019  1.00 41.07  ?  408  LYS C CB    1 
ATOM   8935  C CG    . LYS C 1 411 ? 20.091  13.578  20.125  1.00 45.53  ?  408  LYS C CG    1 
ATOM   8936  C CD    . LYS C 1 411 ? 20.345  12.116  20.428  1.00 45.67  ?  408  LYS C CD    1 
ATOM   8937  C CE    . LYS C 1 411 ? 19.590  11.225  19.460  1.00 56.69  ?  408  LYS C CE    1 
ATOM   8938  N NZ    . LYS C 1 411 ? 19.732  9.791   19.822  1.00 60.06  1  408  LYS C NZ    1 
ATOM   8939  N N     . PRO C 1 412 ? 20.985  17.466  22.842  1.00 35.13  ?  409  PRO C N     1 
ATOM   8940  C CA    . PRO C 1 412 ? 21.855  18.455  23.505  1.00 30.12  ?  409  PRO C CA    1 
ATOM   8941  C C     . PRO C 1 412 ? 23.192  17.904  23.981  1.00 30.17  ?  409  PRO C C     1 
ATOM   8942  O O     . PRO C 1 412 ? 24.217  18.574  23.804  1.00 28.20  ?  409  PRO C O     1 
ATOM   8943  C CB    . PRO C 1 412 ? 20.986  18.943  24.673  1.00 34.62  ?  409  PRO C CB    1 
ATOM   8944  C CG    . PRO C 1 412 ? 19.580  18.745  24.198  1.00 41.28  ?  409  PRO C CG    1 
ATOM   8945  C CD    . PRO C 1 412 ? 19.612  17.486  23.376  1.00 38.96  ?  409  PRO C CD    1 
ATOM   8946  N N     . PHE C 1 413 ? 23.224  16.708  24.579  1.00 27.51  ?  410  PHE C N     1 
ATOM   8947  C CA    . PHE C 1 413 ? 24.494  16.208  25.103  1.00 28.12  ?  410  PHE C CA    1 
ATOM   8948  C C     . PHE C 1 413 ? 25.506  15.972  23.986  1.00 24.03  ?  410  PHE C C     1 
ATOM   8949  O O     . PHE C 1 413 ? 26.716  16.067  24.218  1.00 31.39  ?  410  PHE C O     1 
ATOM   8950  C CB    . PHE C 1 413 ? 24.275  14.931  25.925  1.00 27.07  ?  410  PHE C CB    1 
ATOM   8951  C CG    . PHE C 1 413 ? 24.032  13.693  25.100  1.00 30.48  ?  410  PHE C CG    1 
ATOM   8952  C CD1   . PHE C 1 413 ? 22.747  13.330  24.734  1.00 39.46  ?  410  PHE C CD1   1 
ATOM   8953  C CD2   . PHE C 1 413 ? 25.087  12.876  24.720  1.00 40.12  ?  410  PHE C CD2   1 
ATOM   8954  C CE1   . PHE C 1 413 ? 22.519  12.189  23.987  1.00 39.82  ?  410  PHE C CE1   1 
ATOM   8955  C CE2   . PHE C 1 413 ? 24.865  11.733  23.969  1.00 35.20  ?  410  PHE C CE2   1 
ATOM   8956  C CZ    . PHE C 1 413 ? 23.579  11.389  23.604  1.00 40.30  ?  410  PHE C CZ    1 
ATOM   8957  N N     . ILE C 1 414 ? 25.033  15.681  22.771  1.00 27.10  ?  411  ILE C N     1 
ATOM   8958  C CA    . ILE C 1 414 ? 25.937  15.537  21.634  1.00 24.24  ?  411  ILE C CA    1 
ATOM   8959  C C     . ILE C 1 414 ? 26.523  16.889  21.243  1.00 26.78  ?  411  ILE C C     1 
ATOM   8960  O O     . ILE C 1 414 ? 27.725  17.006  20.965  1.00 26.35  ?  411  ILE C O     1 
ATOM   8961  C CB    . ILE C 1 414 ? 25.204  14.867  20.458  1.00 23.77  ?  411  ILE C CB    1 
ATOM   8962  C CG1   . ILE C 1 414 ? 24.934  13.393  20.771  1.00 23.79  ?  411  ILE C CG1   1 
ATOM   8963  C CG2   . ILE C 1 414 ? 25.995  15.017  19.161  1.00 25.34  ?  411  ILE C CG2   1 
ATOM   8964  C CD1   . ILE C 1 414 ? 24.134  12.674  19.707  1.00 30.61  ?  411  ILE C CD1   1 
ATOM   8965  N N     . ILE C 1 415 ? 25.690  17.932  21.222  1.00 21.95  ?  412  ILE C N     1 
ATOM   8966  C CA    . ILE C 1 415 ? 26.181  19.270  20.903  1.00 22.29  ?  412  ILE C CA    1 
ATOM   8967  C C     . ILE C 1 415 ? 27.171  19.739  21.961  1.00 27.75  ?  412  ILE C C     1 
ATOM   8968  O O     . ILE C 1 415 ? 28.242  20.269  21.639  1.00 17.62  ?  412  ILE C O     1 
ATOM   8969  C CB    . ILE C 1 415 ? 25.006  20.253  20.757  1.00 22.52  ?  412  ILE C CB    1 
ATOM   8970  C CG1   . ILE C 1 415 ? 24.006  19.750  19.711  1.00 22.73  ?  412  ILE C CG1   1 
ATOM   8971  C CG2   . ILE C 1 415 ? 25.517  21.648  20.411  1.00 19.78  ?  412  ILE C CG2   1 
ATOM   8972  C CD1   . ILE C 1 415 ? 24.605  19.526  18.336  1.00 30.84  ?  412  ILE C CD1   1 
ATOM   8973  N N     . LYS C 1 416 ? 26.833  19.547  23.241  1.00 14.24  ?  413  LYS C N     1 
ATOM   8974  C CA    . LYS C 1 416 ? 27.737  19.959  24.310  1.00 18.41  ?  413  LYS C CA    1 
ATOM   8975  C C     . LYS C 1 416 ? 29.070  19.221  24.223  1.00 15.66  ?  413  LYS C C     1 
ATOM   8976  O O     . LYS C 1 416 ? 30.136  19.826  24.396  1.00 25.44  ?  413  LYS C O     1 
ATOM   8977  C CB    . LYS C 1 416 ? 27.083  19.728  25.673  1.00 25.44  ?  413  LYS C CB    1 
ATOM   8978  C CG    . LYS C 1 416 ? 25.802  20.520  25.905  1.00 27.14  ?  413  LYS C CG    1 
ATOM   8979  C CD    . LYS C 1 416 ? 25.222  20.242  27.289  1.00 37.62  ?  413  LYS C CD    1 
ATOM   8980  C CE    . LYS C 1 416 ? 25.766  21.207  28.334  1.00 46.28  ?  413  LYS C CE    1 
ATOM   8981  N NZ    . LYS C 1 416 ? 25.166  22.566  28.200  1.00 53.27  1  413  LYS C NZ    1 
ATOM   8982  N N     . SER C 1 417 ? 29.033  17.915  23.951  1.00 19.11  ?  414  SER C N     1 
ATOM   8983  C CA    . SER C 1 417 ? 30.275  17.156  23.837  1.00 25.16  ?  414  SER C CA    1 
ATOM   8984  C C     . SER C 1 417 ? 31.068  17.587  22.608  1.00 18.39  ?  414  SER C C     1 
ATOM   8985  O O     . SER C 1 417 ? 32.307  17.600  22.630  1.00 18.51  ?  414  SER C O     1 
ATOM   8986  C CB    . SER C 1 417 ? 29.976  15.658  23.786  1.00 22.53  ?  414  SER C CB    1 
ATOM   8987  O OG    . SER C 1 417 ? 29.673  15.246  22.466  1.00 45.81  ?  414  SER C OG    1 
ATOM   8988  N N     . TYR C 1 418 ? 30.367  17.938  21.528  1.00 21.13  ?  415  TYR C N     1 
ATOM   8989  C CA    . TYR C 1 418 ? 31.020  18.474  20.337  1.00 26.68  ?  415  TYR C CA    1 
ATOM   8990  C C     . TYR C 1 418 ? 31.759  19.768  20.663  1.00 17.75  ?  415  TYR C C     1 
ATOM   8991  O O     . TYR C 1 418 ? 32.909  19.962  20.247  1.00 16.42  ?  415  TYR C O     1 
ATOM   8992  C CB    . TYR C 1 418 ? 29.967  18.684  19.245  1.00 25.62  ?  415  TYR C CB    1 
ATOM   8993  C CG    . TYR C 1 418 ? 30.468  19.047  17.860  1.00 21.91  ?  415  TYR C CG    1 
ATOM   8994  C CD1   . TYR C 1 418 ? 31.487  18.328  17.244  1.00 18.97  ?  415  TYR C CD1   1 
ATOM   8995  C CD2   . TYR C 1 418 ? 29.880  20.084  17.148  1.00 19.32  ?  415  TYR C CD2   1 
ATOM   8996  C CE1   . TYR C 1 418 ? 31.924  18.659  15.965  1.00 13.63  ?  415  TYR C CE1   1 
ATOM   8997  C CE2   . TYR C 1 418 ? 30.304  20.416  15.878  1.00 22.27  ?  415  TYR C CE2   1 
ATOM   8998  C CZ    . TYR C 1 418 ? 31.327  19.706  15.291  1.00 20.40  ?  415  TYR C CZ    1 
ATOM   8999  O OH    . TYR C 1 418 ? 31.747  20.047  14.025  1.00 26.35  ?  415  TYR C OH    1 
ATOM   9000  N N     . VAL C 1 419 ? 31.128  20.652  21.438  1.00 17.60  ?  416  VAL C N     1 
ATOM   9001  C CA    . VAL C 1 419 ? 31.802  21.876  21.866  1.00 23.26  ?  416  VAL C CA    1 
ATOM   9002  C C     . VAL C 1 419 ? 32.950  21.548  22.809  1.00 13.43  ?  416  VAL C C     1 
ATOM   9003  O O     . VAL C 1 419 ? 33.997  22.206  22.786  1.00 15.61  ?  416  VAL C O     1 
ATOM   9004  C CB    . VAL C 1 419 ? 30.797  22.846  22.513  1.00 19.54  ?  416  VAL C CB    1 
ATOM   9005  C CG1   . VAL C 1 419 ? 31.515  24.090  23.041  1.00 18.36  ?  416  VAL C CG1   1 
ATOM   9006  C CG2   . VAL C 1 419 ? 29.724  23.237  21.513  1.00 20.61  ?  416  VAL C CG2   1 
ATOM   9007  N N     . TYR C 1 420 ? 32.772  20.529  23.653  1.00 17.56  ?  417  TYR C N     1 
ATOM   9008  C CA    . TYR C 1 420 ? 33.855  20.092  24.527  1.00 14.03  ?  417  TYR C CA    1 
ATOM   9009  C C     . TYR C 1 420 ? 35.060  19.636  23.713  1.00 19.40  ?  417  TYR C C     1 
ATOM   9010  O O     . TYR C 1 420 ? 36.200  20.026  23.994  1.00 14.65  ?  417  TYR C O     1 
ATOM   9011  C CB    . TYR C 1 420 ? 33.364  18.968  25.448  1.00 15.91  ?  417  TYR C CB    1 
ATOM   9012  C CG    . TYR C 1 420 ? 34.421  18.468  26.402  1.00 17.28  ?  417  TYR C CG    1 
ATOM   9013  C CD1   . TYR C 1 420 ? 35.290  17.446  26.036  1.00 15.55  ?  417  TYR C CD1   1 
ATOM   9014  C CD2   . TYR C 1 420 ? 34.552  19.019  27.671  1.00 23.53  ?  417  TYR C CD2   1 
ATOM   9015  C CE1   . TYR C 1 420 ? 36.263  16.992  26.904  1.00 24.75  ?  417  TYR C CE1   1 
ATOM   9016  C CE2   . TYR C 1 420 ? 35.521  18.570  28.546  1.00 20.72  ?  417  TYR C CE2   1 
ATOM   9017  C CZ    . TYR C 1 420 ? 36.373  17.558  28.158  1.00 25.01  ?  417  TYR C CZ    1 
ATOM   9018  O OH    . TYR C 1 420 ? 37.341  17.108  29.025  1.00 16.10  ?  417  TYR C OH    1 
ATOM   9019  N N     . LYS C 1 421 ? 34.823  18.796  22.700  1.00 14.05  ?  418  LYS C N     1 
ATOM   9020  C CA    . LYS C 1 421 ? 35.906  18.335  21.837  1.00 14.90  ?  418  LYS C CA    1 
ATOM   9021  C C     . LYS C 1 421 ? 36.655  19.506  21.213  1.00 14.90  ?  418  LYS C C     1 
ATOM   9022  O O     . LYS C 1 421 ? 37.889  19.502  21.147  1.00 36.96  ?  418  LYS C O     1 
ATOM   9023  C CB    . LYS C 1 421 ? 35.353  17.413  20.750  1.00 13.73  ?  418  LYS C CB    1 
ATOM   9024  C CG    . LYS C 1 421 ? 36.392  16.994  19.724  1.00 15.36  ?  418  LYS C CG    1 
ATOM   9025  C CD    . LYS C 1 421 ? 35.811  16.062  18.675  1.00 19.16  ?  418  LYS C CD    1 
ATOM   9026  C CE    . LYS C 1 421 ? 36.916  15.521  17.788  1.00 13.13  ?  418  LYS C CE    1 
ATOM   9027  N NZ    . LYS C 1 421 ? 36.446  14.474  16.835  1.00 17.05  1  418  LYS C NZ    1 
ATOM   9028  N N     . MET C 1 422 ? 35.920  20.522  20.753  1.00 13.01  ?  419  MET C N     1 
ATOM   9029  C CA    . MET C 1 422 ? 36.556  21.710  20.187  1.00 18.66  ?  419  MET C CA    1 
ATOM   9030  C C     . MET C 1 422 ? 37.489  22.369  21.196  1.00 16.24  ?  419  MET C C     1 
ATOM   9031  O O     . MET C 1 422 ? 38.626  22.727  20.866  1.00 16.37  ?  419  MET C O     1 
ATOM   9032  C CB    . MET C 1 422 ? 35.493  22.699  19.714  1.00 24.13  ?  419  MET C CB    1 
ATOM   9033  C CG    . MET C 1 422 ? 34.663  22.208  18.545  1.00 67.75  ?  419  MET C CG    1 
ATOM   9034  S SD    . MET C 1 422 ? 33.445  23.425  18.020  1.00 133.89 ?  419  MET C SD    1 
ATOM   9035  C CE    . MET C 1 422 ? 32.834  22.652  16.529  1.00 114.24 ?  419  MET C CE    1 
ATOM   9036  N N     . GLY C 1 423 ? 37.024  22.535  22.438  1.00 15.70  ?  420  GLY C N     1 
ATOM   9037  C CA    . GLY C 1 423 ? 37.898  23.065  23.472  1.00 13.57  ?  420  GLY C CA    1 
ATOM   9038  C C     . GLY C 1 423 ? 39.104  22.180  23.717  1.00 22.34  ?  420  GLY C C     1 
ATOM   9039  O O     . GLY C 1 423 ? 40.225  22.671  23.880  1.00 16.09  ?  420  GLY C O     1 
ATOM   9040  N N     . ASN C 1 424 ? 38.890  20.861  23.729  1.00 20.53  ?  421  ASN C N     1 
ATOM   9041  C CA    . ASN C 1 424 ? 39.988  19.912  23.877  1.00 21.91  ?  421  ASN C CA    1 
ATOM   9042  C C     . ASN C 1 424 ? 41.062  20.119  22.815  1.00 20.66  ?  421  ASN C C     1 
ATOM   9043  O O     . ASN C 1 424 ? 42.244  19.858  23.066  1.00 19.00  ?  421  ASN C O     1 
ATOM   9044  C CB    . ASN C 1 424 ? 39.439  18.483  23.804  1.00 25.35  ?  421  ASN C CB    1 
ATOM   9045  C CG    . ASN C 1 424 ? 40.174  17.516  24.718  1.00 33.08  ?  421  ASN C CG    1 
ATOM   9046  O OD1   . ASN C 1 424 ? 40.608  17.878  25.812  1.00 30.15  ?  421  ASN C OD1   1 
ATOM   9047  N ND2   . ASN C 1 424 ? 40.308  16.271  24.272  1.00 38.61  ?  421  ASN C ND2   1 
ATOM   9048  N N     . PHE C 1 425 ? 40.675  20.591  21.631  1.00 17.98  ?  422  PHE C N     1 
ATOM   9049  C CA    . PHE C 1 425 ? 41.588  20.756  20.509  1.00 27.94  ?  422  PHE C CA    1 
ATOM   9050  C C     . PHE C 1 425 ? 42.223  22.139  20.442  1.00 24.58  ?  422  PHE C C     1 
ATOM   9051  O O     . PHE C 1 425 ? 42.997  22.404  19.517  1.00 46.42  ?  422  PHE C O     1 
ATOM   9052  C CB    . PHE C 1 425 ? 40.860  20.457  19.196  1.00 17.57  ?  422  PHE C CB    1 
ATOM   9053  C CG    . PHE C 1 425 ? 40.937  19.020  18.784  1.00 21.73  ?  422  PHE C CG    1 
ATOM   9054  C CD1   . PHE C 1 425 ? 40.216  18.049  19.464  1.00 17.70  ?  422  PHE C CD1   1 
ATOM   9055  C CD2   . PHE C 1 425 ? 41.739  18.634  17.727  1.00 17.48  ?  422  PHE C CD2   1 
ATOM   9056  C CE1   . PHE C 1 425 ? 40.294  16.722  19.084  1.00 17.80  ?  422  PHE C CE1   1 
ATOM   9057  C CE2   . PHE C 1 425 ? 41.820  17.310  17.346  1.00 17.72  ?  422  PHE C CE2   1 
ATOM   9058  C CZ    . PHE C 1 425 ? 41.098  16.356  18.024  1.00 15.53  ?  422  PHE C CZ    1 
ATOM   9059  N N     . ILE C 1 426 ? 41.923  23.019  21.392  1.00 16.55  ?  423  ILE C N     1 
ATOM   9060  C CA    . ILE C 1 426 ? 42.531  24.344  21.459  1.00 23.07  ?  423  ILE C CA    1 
ATOM   9061  C C     . ILE C 1 426 ? 43.707  24.263  22.433  1.00 29.26  ?  423  ILE C C     1 
ATOM   9062  O O     . ILE C 1 426 ? 43.482  24.088  23.642  1.00 28.15  ?  423  ILE C O     1 
ATOM   9063  C CB    . ILE C 1 426 ? 41.515  25.407  21.890  1.00 22.25  ?  423  ILE C CB    1 
ATOM   9064  C CG1   . ILE C 1 426 ? 40.457  25.585  20.798  1.00 23.33  ?  423  ILE C CG1   1 
ATOM   9065  C CG2   . ILE C 1 426 ? 42.216  26.725  22.196  1.00 19.95  ?  423  ILE C CG2   1 
ATOM   9066  C CD1   . ILE C 1 426 ? 39.324  26.514  21.178  1.00 23.94  ?  423  ILE C CD1   1 
ATOM   9067  N N     . PRO C 1 427 ? 44.952  24.386  21.965  1.00 20.90  ?  424  PRO C N     1 
ATOM   9068  C CA    . PRO C 1 427 ? 46.100  24.150  22.857  1.00 18.64  ?  424  PRO C CA    1 
ATOM   9069  C C     . PRO C 1 427 ? 46.212  25.145  23.998  1.00 24.19  ?  424  PRO C C     1 
ATOM   9070  O O     . PRO C 1 427 ? 46.845  24.828  25.012  1.00 34.51  ?  424  PRO C O     1 
ATOM   9071  C CB    . PRO C 1 427 ? 47.307  24.238  21.911  1.00 25.83  ?  424  PRO C CB    1 
ATOM   9072  C CG    . PRO C 1 427 ? 46.817  25.003  20.721  1.00 28.41  ?  424  PRO C CG    1 
ATOM   9073  C CD    . PRO C 1 427 ? 45.366  24.665  20.579  1.00 17.61  ?  424  PRO C CD    1 
ATOM   9074  N N     . GLU C 1 428 ? 45.622  26.335  23.877  1.00 21.88  ?  425  GLU C N     1 
ATOM   9075  C CA    . GLU C 1 428 ? 45.620  27.271  24.991  1.00 17.42  ?  425  GLU C CA    1 
ATOM   9076  C C     . GLU C 1 428 ? 44.546  26.951  26.018  1.00 20.83  ?  425  GLU C C     1 
ATOM   9077  O O     . GLU C 1 428 ? 44.500  27.601  27.066  1.00 23.48  ?  425  GLU C O     1 
ATOM   9078  C CB    . GLU C 1 428 ? 45.438  28.707  24.487  1.00 22.16  ?  425  GLU C CB    1 
ATOM   9079  C CG    . GLU C 1 428 ? 46.586  29.222  23.629  1.00 19.83  ?  425  GLU C CG    1 
ATOM   9080  C CD    . GLU C 1 428 ? 46.618  28.583  22.252  1.00 30.01  ?  425  GLU C CD    1 
ATOM   9081  O OE1   . GLU C 1 428 ? 47.724  28.367  21.715  1.00 22.52  ?  425  GLU C OE1   1 
ATOM   9082  O OE2   . GLU C 1 428 ? 45.529  28.280  21.717  1.00 24.47  -1 425  GLU C OE2   1 
ATOM   9083  N N     . CYS C 1 429 ? 43.690  25.972  25.747  1.00 19.92  ?  426  CYS C N     1 
ATOM   9084  C CA    . CYS C 1 429 ? 42.671  25.548  26.695  1.00 20.82  ?  426  CYS C CA    1 
ATOM   9085  C C     . CYS C 1 429 ? 43.162  24.374  27.531  1.00 15.52  ?  426  CYS C C     1 
ATOM   9086  O O     . CYS C 1 429 ? 44.030  23.600  27.111  1.00 21.53  ?  426  CYS C O     1 
ATOM   9087  C CB    . CYS C 1 429 ? 41.383  25.150  25.970  1.00 28.07  ?  426  CYS C CB    1 
ATOM   9088  S SG    . CYS C 1 429 ? 40.415  26.527  25.339  1.00 22.17  ?  426  CYS C SG    1 
ATOM   9089  N N     . LYS C 1 430 ? 42.601  24.260  28.727  1.00 19.02  ?  427  LYS C N     1 
ATOM   9090  C CA    . LYS C 1 430 ? 42.758  23.072  29.558  1.00 22.30  ?  427  LYS C CA    1 
ATOM   9091  C C     . LYS C 1 430 ? 41.419  22.790  30.221  1.00 19.05  ?  427  LYS C C     1 
ATOM   9092  O O     . LYS C 1 430 ? 41.007  23.532  31.122  1.00 27.19  ?  427  LYS C O     1 
ATOM   9093  C CB    . LYS C 1 430 ? 43.861  23.261  30.605  1.00 19.15  ?  427  LYS C CB    1 
ATOM   9094  C CG    . LYS C 1 430 ? 44.056  22.060  31.533  1.00 20.75  ?  427  LYS C CG    1 
ATOM   9095  C CD    . LYS C 1 430 ? 44.380  20.789  30.754  1.00 24.46  ?  427  LYS C CD    1 
ATOM   9096  C CE    . LYS C 1 430 ? 45.716  20.887  30.027  1.00 31.20  ?  427  LYS C CE    1 
ATOM   9097  N NZ    . LYS C 1 430 ? 45.964  19.691  29.164  1.00 25.28  1  427  LYS C NZ    1 
ATOM   9098  N N     . PRO C 1 431 ? 40.695  21.759  29.779  1.00 18.99  ?  428  PRO C N     1 
ATOM   9099  C CA    . PRO C 1 431 ? 39.386  21.470  30.392  1.00 17.36  ?  428  PRO C CA    1 
ATOM   9100  C C     . PRO C 1 431 ? 39.452  21.221  31.890  1.00 17.94  ?  428  PRO C C     1 
ATOM   9101  O O     . PRO C 1 431 ? 38.519  21.598  32.610  1.00 16.98  ?  428  PRO C O     1 
ATOM   9102  C CB    . PRO C 1 431 ? 38.915  20.219  29.634  1.00 12.75  ?  428  PRO C CB    1 
ATOM   9103  C CG    . PRO C 1 431 ? 39.612  20.309  28.304  1.00 12.20  ?  428  PRO C CG    1 
ATOM   9104  C CD    . PRO C 1 431 ? 40.962  20.896  28.616  1.00 16.41  ?  428  PRO C CD    1 
ATOM   9105  N N     . PHE C 1 432 ? 40.524  20.604  32.380  1.00 23.38  ?  429  PHE C N     1 
ATOM   9106  C CA    . PHE C 1 432 ? 40.666  20.304  33.798  1.00 21.90  ?  429  PHE C CA    1 
ATOM   9107  C C     . PHE C 1 432 ? 42.088  19.829  34.058  1.00 24.25  ?  429  PHE C C     1 
ATOM   9108  O O     . PHE C 1 432 ? 42.795  19.401  33.142  1.00 21.88  ?  429  PHE C O     1 
ATOM   9109  C CB    . PHE C 1 432 ? 39.660  19.238  34.256  1.00 22.32  ?  429  PHE C CB    1 
ATOM   9110  C CG    . PHE C 1 432 ? 39.779  17.929  33.513  1.00 24.44  ?  429  PHE C CG    1 
ATOM   9111  C CD1   . PHE C 1 432 ? 40.787  17.025  33.821  1.00 21.20  ?  429  PHE C CD1   1 
ATOM   9112  C CD2   . PHE C 1 432 ? 38.878  17.599  32.513  1.00 18.82  ?  429  PHE C CD2   1 
ATOM   9113  C CE1   . PHE C 1 432 ? 40.901  15.830  33.142  1.00 27.55  ?  429  PHE C CE1   1 
ATOM   9114  C CE2   . PHE C 1 432 ? 38.983  16.397  31.833  1.00 17.91  ?  429  PHE C CE2   1 
ATOM   9115  C CZ    . PHE C 1 432 ? 39.996  15.512  32.149  1.00 20.83  ?  429  PHE C CZ    1 
ATOM   9116  N N     . ILE C 1 433 ? 42.491  19.898  35.323  1.00 22.86  ?  430  ILE C N     1 
ATOM   9117  C CA    . ILE C 1 433 ? 43.650  19.162  35.807  1.00 25.60  ?  430  ILE C CA    1 
ATOM   9118  C C     . ILE C 1 433 ? 43.170  18.228  36.908  1.00 33.85  ?  430  ILE C C     1 
ATOM   9119  O O     . ILE C 1 433 ? 42.170  18.496  37.581  1.00 43.67  ?  430  ILE C O     1 
ATOM   9120  C CB    . ILE C 1 433 ? 44.786  20.080  36.317  1.00 24.05  ?  430  ILE C CB    1 
ATOM   9121  C CG1   . ILE C 1 433 ? 44.349  20.857  37.561  1.00 28.20  ?  430  ILE C CG1   1 
ATOM   9122  C CG2   . ILE C 1 433 ? 45.246  21.029  35.218  1.00 30.25  ?  430  ILE C CG2   1 
ATOM   9123  C CD1   . ILE C 1 433 ? 45.478  21.627  38.221  1.00 31.74  ?  430  ILE C CD1   1 
ATOM   9124  N N     . LEU C 1 434 ? 43.872  17.112  37.071  1.00 27.94  ?  431  LEU C N     1 
ATOM   9125  C CA    . LEU C 1 434 ? 43.535  16.167  38.126  1.00 20.26  ?  431  LEU C CA    1 
ATOM   9126  C C     . LEU C 1 434 ? 44.143  16.623  39.445  1.00 31.37  ?  431  LEU C C     1 
ATOM   9127  O O     . LEU C 1 434 ? 45.319  17.000  39.502  1.00 24.66  ?  431  LEU C O     1 
ATOM   9128  C CB    . LEU C 1 434 ? 44.016  14.762  37.769  1.00 17.33  ?  431  LEU C CB    1 
ATOM   9129  C CG    . LEU C 1 434 ? 43.355  14.116  36.551  1.00 17.70  ?  431  LEU C CG    1 
ATOM   9130  C CD1   . LEU C 1 434 ? 43.813  12.678  36.401  1.00 17.96  ?  431  LEU C CD1   1 
ATOM   9131  C CD2   . LEU C 1 434 ? 41.834  14.186  36.657  1.00 18.28  ?  431  LEU C CD2   1 
ATOM   9132  N N     . LYS C 1 435 ? 43.331  16.592  40.504  1.00 20.25  ?  432  LYS C N     1 
ATOM   9133  C CA    . LYS C 1 435 ? 43.796  17.043  41.813  1.00 22.99  ?  432  LYS C CA    1 
ATOM   9134  C C     . LYS C 1 435 ? 45.062  16.306  42.237  1.00 31.72  ?  432  LYS C C     1 
ATOM   9135  O O     . LYS C 1 435 ? 46.018  16.927  42.716  1.00 32.42  ?  432  LYS C O     1 
ATOM   9136  C CB    . LYS C 1 435 ? 42.685  16.856  42.846  1.00 23.02  ?  432  LYS C CB    1 
ATOM   9137  C CG    . LYS C 1 435 ? 42.967  17.471  44.209  1.00 34.34  ?  432  LYS C CG    1 
ATOM   9138  C CD    . LYS C 1 435 ? 41.805  17.228  45.166  1.00 44.97  ?  432  LYS C CD    1 
ATOM   9139  C CE    . LYS C 1 435 ? 42.078  17.803  46.549  1.00 46.24  ?  432  LYS C CE    1 
ATOM   9140  N NZ    . LYS C 1 435 ? 42.041  19.291  46.561  1.00 45.85  1  432  LYS C NZ    1 
ATOM   9141  N N     . LYS C 1 436 ? 45.098  14.986  42.045  1.00 29.05  ?  433  LYS C N     1 
ATOM   9142  C CA    . LYS C 1 436 ? 46.251  14.191  42.449  1.00 22.78  ?  433  LYS C CA    1 
ATOM   9143  C C     . LYS C 1 436 ? 47.414  14.254  41.462  1.00 33.59  ?  433  LYS C C     1 
ATOM   9144  O O     . LYS C 1 436 ? 48.482  13.713  41.765  1.00 32.42  ?  433  LYS C O     1 
ATOM   9145  C CB    . LYS C 1 436 ? 45.836  12.732  42.661  1.00 35.72  ?  433  LYS C CB    1 
ATOM   9146  C CG    . LYS C 1 436 ? 45.354  12.416  44.074  1.00 36.71  ?  433  LYS C CG    1 
ATOM   9147  C CD    . LYS C 1 436 ? 44.701  11.043  44.141  1.00 31.71  ?  433  LYS C CD    1 
ATOM   9148  C CE    . LYS C 1 436 ? 44.236  10.706  45.555  1.00 33.93  ?  433  LYS C CE    1 
ATOM   9149  N NZ    . LYS C 1 436 ? 45.313  10.076  46.376  1.00 39.27  1  433  LYS C NZ    1 
ATOM   9150  N N     . MET C 1 437 ? 47.246  14.888  40.302  1.00 28.09  ?  434  MET C N     1 
ATOM   9151  C CA    . MET C 1 437 ? 48.342  15.062  39.354  1.00 22.29  ?  434  MET C CA    1 
ATOM   9152  C C     . MET C 1 437 ? 48.965  16.449  39.415  1.00 27.09  ?  434  MET C C     1 
ATOM   9153  O O     . MET C 1 437 ? 49.943  16.706  38.703  1.00 29.46  ?  434  MET C O     1 
ATOM   9154  C CB    . MET C 1 437 ? 47.863  14.781  37.922  1.00 20.95  ?  434  MET C CB    1 
ATOM   9155  C CG    . MET C 1 437 ? 47.485  13.330  37.658  1.00 32.62  ?  434  MET C CG    1 
ATOM   9156  S SD    . MET C 1 437 ? 48.886  12.199  37.797  1.00 60.50  ?  434  MET C SD    1 
ATOM   9157  C CE    . MET C 1 437 ? 49.896  12.723  36.414  1.00 43.78  ?  434  MET C CE    1 
ATOM   9158  N N     . GLU C 1 438 ? 48.434  17.343  40.254  1.00 22.41  ?  435  GLU C N     1 
ATOM   9159  C CA    . GLU C 1 438 ? 48.877  18.735  40.239  1.00 24.20  ?  435  GLU C CA    1 
ATOM   9160  C C     . GLU C 1 438 ? 50.355  18.869  40.593  1.00 37.30  ?  435  GLU C C     1 
ATOM   9161  O O     . GLU C 1 438 ? 51.021  19.797  40.122  1.00 31.84  ?  435  GLU C O     1 
ATOM   9162  C CB    . GLU C 1 438 ? 48.017  19.568  41.194  1.00 28.33  ?  435  GLU C CB    1 
ATOM   9163  C CG    . GLU C 1 438 ? 48.295  21.068  41.145  1.00 38.60  ?  435  GLU C CG    1 
ATOM   9164  C CD    . GLU C 1 438 ? 47.123  21.899  41.634  1.00 43.41  ?  435  GLU C CD    1 
ATOM   9165  O OE1   . GLU C 1 438 ? 46.086  21.309  42.001  1.00 41.73  ?  435  GLU C OE1   1 
ATOM   9166  O OE2   . GLU C 1 438 ? 47.239  23.142  41.642  1.00 52.07  -1 435  GLU C OE2   1 
ATOM   9167  N N     . ASP C 1 439 ? 50.893  17.950  41.395  1.00 33.67  ?  436  ASP C N     1 
ATOM   9168  C CA    . ASP C 1 439 ? 52.282  18.028  41.825  1.00 33.54  ?  436  ASP C CA    1 
ATOM   9169  C C     . ASP C 1 439 ? 53.200  17.089  41.043  1.00 32.49  ?  436  ASP C C     1 
ATOM   9170  O O     . ASP C 1 439 ? 54.320  16.817  41.488  1.00 37.22  ?  436  ASP C O     1 
ATOM   9171  C CB    . ASP C 1 439 ? 52.385  17.750  43.327  1.00 36.14  ?  436  ASP C CB    1 
ATOM   9172  C CG    . ASP C 1 439 ? 51.985  16.330  43.695  1.00 51.64  ?  436  ASP C CG    1 
ATOM   9173  O OD1   . ASP C 1 439 ? 51.312  15.657  42.887  1.00 54.66  ?  436  ASP C OD1   1 
ATOM   9174  O OD2   . ASP C 1 439 ? 52.341  15.890  44.807  1.00 58.59  -1 436  ASP C OD2   1 
ATOM   9175  N N     . LYS C 1 440 ? 52.761  16.611  39.876  1.00 25.37  ?  437  LYS C N     1 
ATOM   9176  C CA    . LYS C 1 440 ? 53.500  15.616  39.105  1.00 26.01  ?  437  LYS C CA    1 
ATOM   9177  C C     . LYS C 1 440 ? 54.170  16.207  37.865  1.00 20.95  ?  437  LYS C C     1 
ATOM   9178  O O     . LYS C 1 440 ? 54.523  15.463  36.944  1.00 25.88  ?  437  LYS C O     1 
ATOM   9179  C CB    . LYS C 1 440 ? 52.569  14.471  38.703  1.00 36.90  ?  437  LYS C CB    1 
ATOM   9180  C CG    . LYS C 1 440 ? 51.791  13.855  39.862  1.00 36.15  ?  437  LYS C CG    1 
ATOM   9181  C CD    . LYS C 1 440 ? 52.698  13.072  40.798  1.00 33.42  ?  437  LYS C CD    1 
ATOM   9182  C CE    . LYS C 1 440 ? 51.902  12.368  41.892  1.00 25.89  ?  437  LYS C CE    1 
ATOM   9183  N NZ    . LYS C 1 440 ? 51.353  13.316  42.905  1.00 30.82  1  437  LYS C NZ    1 
ATOM   9184  N N     . GLU C 1 441 ? 54.363  17.529  37.826  1.00 27.96  ?  438  GLU C N     1 
ATOM   9185  C CA    . GLU C 1 441 ? 54.937  18.161  36.642  1.00 29.64  ?  438  GLU C CA    1 
ATOM   9186  C C     . GLU C 1 441 ? 56.357  17.679  36.370  1.00 29.14  ?  438  GLU C C     1 
ATOM   9187  O O     . GLU C 1 441 ? 56.797  17.663  35.214  1.00 23.26  ?  438  GLU C O     1 
ATOM   9188  C CB    . GLU C 1 441 ? 54.915  19.681  36.800  1.00 33.50  ?  438  GLU C CB    1 
ATOM   9189  C CG    . GLU C 1 441 ? 55.456  20.443  35.604  1.00 41.56  ?  438  GLU C CG    1 
ATOM   9190  C CD    . GLU C 1 441 ? 55.394  21.942  35.803  1.00 52.47  ?  438  GLU C CD    1 
ATOM   9191  O OE1   . GLU C 1 441 ? 56.384  22.521  36.299  1.00 58.13  ?  438  GLU C OE1   1 
ATOM   9192  O OE2   . GLU C 1 441 ? 54.347  22.537  35.475  1.00 46.62  -1 438  GLU C OE2   1 
ATOM   9193  N N     . LYS C 1 442 ? 57.084  17.273  37.411  1.00 25.71  ?  439  LYS C N     1 
ATOM   9194  C CA    . LYS C 1 442 ? 58.461  16.821  37.252  1.00 28.08  ?  439  LYS C CA    1 
ATOM   9195  C C     . LYS C 1 442 ? 58.577  15.480  36.544  1.00 23.68  ?  439  LYS C C     1 
ATOM   9196  O O     . LYS C 1 442 ? 59.700  15.007  36.337  1.00 25.84  ?  439  LYS C O     1 
ATOM   9197  C CB    . LYS C 1 442 ? 59.140  16.724  38.617  1.00 27.80  ?  439  LYS C CB    1 
ATOM   9198  C CG    . LYS C 1 442 ? 58.521  15.681  39.536  1.00 26.38  ?  439  LYS C CG    1 
ATOM   9199  C CD    . LYS C 1 442 ? 59.318  15.553  40.822  1.00 39.95  ?  439  LYS C CD    1 
ATOM   9200  C CE    . LYS C 1 442 ? 58.410  15.306  42.012  1.00 41.92  ?  439  LYS C CE    1 
ATOM   9201  N NZ    . LYS C 1 442 ? 59.182  15.225  43.280  1.00 48.18  1  439  LYS C NZ    1 
ATOM   9202  N N     . ASN C 1 443 ? 57.467  14.856  36.167  1.00 27.95  ?  440  ASN C N     1 
ATOM   9203  C CA    . ASN C 1 443 ? 57.481  13.511  35.617  1.00 31.70  ?  440  ASN C CA    1 
ATOM   9204  C C     . ASN C 1 443 ? 57.121  13.532  34.138  1.00 29.06  ?  440  ASN C C     1 
ATOM   9205  O O     . ASN C 1 443 ? 56.243  14.288  33.710  1.00 26.96  ?  440  ASN C O     1 
ATOM   9206  C CB    . ASN C 1 443 ? 56.518  12.609  36.388  1.00 32.57  ?  440  ASN C CB    1 
ATOM   9207  C CG    . ASN C 1 443 ? 56.806  12.599  37.878  1.00 26.16  ?  440  ASN C CG    1 
ATOM   9208  O OD1   . ASN C 1 443 ? 57.962  12.525  38.299  1.00 30.28  ?  440  ASN C OD1   1 
ATOM   9209  N ND2   . ASN C 1 443 ? 55.756  12.691  38.684  1.00 28.98  ?  440  ASN C ND2   1 
ATOM   9210  N N     . LEU C 1 444 ? 57.811  12.700  33.366  1.00 30.89  ?  441  LEU C N     1 
ATOM   9211  C CA    . LEU C 1 444 ? 57.564  12.538  31.940  1.00 29.77  ?  441  LEU C CA    1 
ATOM   9212  C C     . LEU C 1 444 ? 56.908  11.182  31.721  1.00 29.09  ?  441  LEU C C     1 
ATOM   9213  O O     . LEU C 1 444 ? 57.499  10.144  32.039  1.00 32.33  ?  441  LEU C O     1 
ATOM   9214  C CB    . LEU C 1 444 ? 58.865  12.649  31.146  1.00 26.49  ?  441  LEU C CB    1 
ATOM   9215  C CG    . LEU C 1 444 ? 58.782  12.378  29.644  1.00 29.52  ?  441  LEU C CG    1 
ATOM   9216  C CD1   . LEU C 1 444 ? 57.754  13.292  28.998  1.00 19.73  ?  441  LEU C CD1   1 
ATOM   9217  C CD2   . LEU C 1 444 ? 60.150  12.553  29.001  1.00 35.61  ?  441  LEU C CD2   1 
ATOM   9218  N N     . TYR C 1 445 ? 55.689  11.197  31.191  1.00 25.54  ?  442  TYR C N     1 
ATOM   9219  C CA    . TYR C 1 445 ? 54.909  9.987   30.973  1.00 28.28  ?  442  TYR C CA    1 
ATOM   9220  C C     . TYR C 1 445 ? 54.919  9.653   29.488  1.00 28.86  ?  442  TYR C C     1 
ATOM   9221  O O     . TYR C 1 445 ? 54.480  10.460  28.662  1.00 25.55  ?  442  TYR C O     1 
ATOM   9222  C CB    . TYR C 1 445 ? 53.480  10.168  31.481  1.00 23.66  ?  442  TYR C CB    1 
ATOM   9223  C CG    . TYR C 1 445 ? 53.417  10.571  32.937  1.00 21.56  ?  442  TYR C CG    1 
ATOM   9224  C CD1   . TYR C 1 445 ? 53.573  9.629   33.945  1.00 28.08  ?  442  TYR C CD1   1 
ATOM   9225  C CD2   . TYR C 1 445 ? 53.208  11.895  33.303  1.00 29.71  ?  442  TYR C CD2   1 
ATOM   9226  C CE1   . TYR C 1 445 ? 53.521  9.991   35.278  1.00 26.49  ?  442  TYR C CE1   1 
ATOM   9227  C CE2   . TYR C 1 445 ? 53.152  12.269  34.634  1.00 20.87  ?  442  TYR C CE2   1 
ATOM   9228  C CZ    . TYR C 1 445 ? 53.309  11.311  35.616  1.00 27.90  ?  442  TYR C CZ    1 
ATOM   9229  O OH    . TYR C 1 445 ? 53.256  11.671  36.940  1.00 30.38  ?  442  TYR C OH    1 
ATOM   9230  N N     . ILE C 1 446 ? 55.417  8.464   29.156  1.00 26.96  ?  443  ILE C N     1 
ATOM   9231  C CA    . ILE C 1 446 ? 55.625  8.040   27.778  1.00 26.91  ?  443  ILE C CA    1 
ATOM   9232  C C     . ILE C 1 446 ? 54.947  6.691   27.576  1.00 25.85  ?  443  ILE C C     1 
ATOM   9233  O O     . ILE C 1 446 ? 55.071  5.795   28.419  1.00 27.46  ?  443  ILE C O     1 
ATOM   9234  C CB    . ILE C 1 446 ? 57.128  7.954   27.444  1.00 32.13  ?  443  ILE C CB    1 
ATOM   9235  C CG1   . ILE C 1 446 ? 57.795  9.319   27.626  1.00 37.02  ?  443  ILE C CG1   1 
ATOM   9236  C CG2   . ILE C 1 446 ? 57.340  7.460   26.031  1.00 30.71  ?  443  ILE C CG2   1 
ATOM   9237  C CD1   . ILE C 1 446 ? 59.303  9.276   27.515  1.00 41.19  ?  443  ILE C CD1   1 
ATOM   9238  N N     . GLY C 1 447 ? 54.227  6.551   26.469  1.00 20.48  ?  444  GLY C N     1 
ATOM   9239  C CA    . GLY C 1 447 ? 53.599  5.292   26.088  1.00 24.35  ?  444  GLY C CA    1 
ATOM   9240  C C     . GLY C 1 447 ? 54.243  4.750   24.824  1.00 33.46  ?  444  GLY C C     1 
ATOM   9241  O O     . GLY C 1 447 ? 54.569  5.513   23.912  1.00 31.98  ?  444  GLY C O     1 
ATOM   9242  N N     . ILE C 1 448 ? 54.417  3.430   24.774  1.00 37.27  ?  445  ILE C N     1 
ATOM   9243  C CA    . ILE C 1 448 ? 55.133  2.768   23.689  1.00 39.81  ?  445  ILE C CA    1 
ATOM   9244  C C     . ILE C 1 448 ? 54.231  1.705   23.079  1.00 36.82  ?  445  ILE C C     1 
ATOM   9245  O O     . ILE C 1 448 ? 53.794  0.780   23.775  1.00 29.48  ?  445  ILE C O     1 
ATOM   9246  C CB    . ILE C 1 448 ? 56.445  2.132   24.172  1.00 41.99  ?  445  ILE C CB    1 
ATOM   9247  C CG1   . ILE C 1 448 ? 57.220  3.095   25.073  1.00 41.89  ?  445  ILE C CG1   1 
ATOM   9248  C CG2   . ILE C 1 448 ? 57.296  1.701   22.985  1.00 36.11  ?  445  ILE C CG2   1 
ATOM   9249  C CD1   . ILE C 1 448 ? 57.699  4.333   24.371  1.00 41.79  ?  445  ILE C CD1   1 
ATOM   9250  N N     . ASP C 1 449 ? 53.973  1.822   21.778  1.00 32.63  ?  446  ASP C N     1 
ATOM   9251  C CA    . ASP C 1 449 ? 53.307  0.781   20.999  1.00 31.56  ?  446  ASP C CA    1 
ATOM   9252  C C     . ASP C 1 449 ? 54.337  0.263   19.998  1.00 38.50  ?  446  ASP C C     1 
ATOM   9253  O O     . ASP C 1 449 ? 54.631  0.924   18.998  1.00 39.67  ?  446  ASP C O     1 
ATOM   9254  C CB    . ASP C 1 449 ? 52.056  1.313   20.302  1.00 26.77  ?  446  ASP C CB    1 
ATOM   9255  C CG    . ASP C 1 449 ? 51.235  0.212   19.641  1.00 40.18  ?  446  ASP C CG    1 
ATOM   9256  O OD1   . ASP C 1 449 ? 51.781  -0.878  19.374  1.00 50.16  ?  446  ASP C OD1   1 
ATOM   9257  O OD2   . ASP C 1 449 ? 50.034  0.441   19.383  1.00 42.38  -1 446  ASP C OD2   1 
ATOM   9258  N N     . LEU C 1 450 ? 54.878  -0.925  20.271  1.00 36.54  ?  447  LEU C N     1 
ATOM   9259  C CA    . LEU C 1 450 ? 55.935  -1.521  19.458  1.00 38.87  ?  447  LEU C CA    1 
ATOM   9260  C C     . LEU C 1 450 ? 55.546  -2.955  19.129  1.00 40.09  ?  447  LEU C C     1 
ATOM   9261  O O     . LEU C 1 450 ? 55.521  -3.813  20.017  1.00 37.39  ?  447  LEU C O     1 
ATOM   9262  C CB    . LEU C 1 450 ? 57.277  -1.468  20.187  1.00 28.84  ?  447  LEU C CB    1 
ATOM   9263  C CG    . LEU C 1 450 ? 58.491  -2.099  19.506  1.00 44.14  ?  447  LEU C CG    1 
ATOM   9264  C CD1   . LEU C 1 450 ? 58.628  -1.606  18.077  1.00 36.87  ?  447  LEU C CD1   1 
ATOM   9265  C CD2   . LEU C 1 450 ? 59.744  -1.780  20.303  1.00 43.54  ?  447  LEU C CD2   1 
ATOM   9266  N N     . SER C 1 451 ? 55.249  -3.213  17.858  1.00 38.87  ?  448  SER C N     1 
ATOM   9267  C CA    . SER C 1 451 ? 54.844  -4.529  17.388  1.00 46.41  ?  448  SER C CA    1 
ATOM   9268  C C     . SER C 1 451 ? 55.799  -5.012  16.304  1.00 51.95  ?  448  SER C C     1 
ATOM   9269  O O     . SER C 1 451 ? 56.356  -4.216  15.541  1.00 41.55  ?  448  SER C O     1 
ATOM   9270  C CB    . SER C 1 451 ? 53.408  -4.508  16.849  1.00 49.22  ?  448  SER C CB    1 
ATOM   9271  O OG    . SER C 1 451 ? 53.260  -3.540  15.825  1.00 56.82  ?  448  SER C OG    1 
ATOM   9272  N N     . HIS C 1 452 ? 55.978  -6.329  16.241  1.00 56.77  ?  449  HIS C N     1 
ATOM   9273  C CA    . HIS C 1 452 ? 56.900  -6.960  15.306  1.00 63.01  ?  449  HIS C CA    1 
ATOM   9274  C C     . HIS C 1 452 ? 56.147  -7.982  14.466  1.00 66.39  ?  449  HIS C C     1 
ATOM   9275  O O     . HIS C 1 452 ? 55.444  -8.841  15.008  1.00 64.63  ?  449  HIS C O     1 
ATOM   9276  C CB    . HIS C 1 452 ? 58.061  -7.629  16.049  1.00 55.06  ?  449  HIS C CB    1 
ATOM   9277  C CG    . HIS C 1 452 ? 58.802  -6.706  16.965  1.00 53.98  ?  449  HIS C CG    1 
ATOM   9278  N ND1   . HIS C 1 452 ? 59.559  -5.651  16.504  1.00 53.10  ?  449  HIS C ND1   1 
ATOM   9279  C CD2   . HIS C 1 452 ? 58.902  -6.678  18.315  1.00 54.44  ?  449  HIS C CD2   1 
ATOM   9280  C CE1   . HIS C 1 452 ? 60.095  -5.013  17.529  1.00 58.53  ?  449  HIS C CE1   1 
ATOM   9281  N NE2   . HIS C 1 452 ? 59.712  -5.616  18.640  1.00 55.93  ?  449  HIS C NE2   1 
ATOM   9282  N N     . ASP C 1 453 ? 56.300  -7.886  13.148  1.00 66.32  ?  450  ASP C N     1 
ATOM   9283  C CA    . ASP C 1 453 ? 55.646  -8.785  12.202  1.00 68.42  ?  450  ASP C CA    1 
ATOM   9284  C C     . ASP C 1 453 ? 56.633  -9.892  11.845  1.00 64.29  ?  450  ASP C C     1 
ATOM   9285  O O     . ASP C 1 453 ? 57.597  -9.657  11.110  1.00 58.18  ?  450  ASP C O     1 
ATOM   9286  C CB    . ASP C 1 453 ? 55.191  -8.017  10.962  1.00 70.54  ?  450  ASP C CB    1 
ATOM   9287  C CG    . ASP C 1 453 ? 54.260  -8.823  10.083  1.00 79.05  ?  450  ASP C CG    1 
ATOM   9288  O OD1   . ASP C 1 453 ? 54.297  -10.066 10.162  1.00 82.06  ?  450  ASP C OD1   1 
ATOM   9289  O OD2   . ASP C 1 453 ? 53.495  -8.212  9.306   1.00 80.13  -1 450  ASP C OD2   1 
ATOM   9290  N N     . THR C 1 454 ? 56.382  -11.103 12.348  1.00 62.17  ?  451  THR C N     1 
ATOM   9291  C CA    . THR C 1 454 ? 57.369  -12.171 12.214  1.00 68.98  ?  451  THR C CA    1 
ATOM   9292  C C     . THR C 1 454 ? 57.415  -12.731 10.795  1.00 67.57  ?  451  THR C C     1 
ATOM   9293  O O     . THR C 1 454 ? 58.495  -13.070 10.295  1.00 67.02  ?  451  THR C O     1 
ATOM   9294  C CB    . THR C 1 454 ? 57.089  -13.282 13.227  1.00 67.61  ?  451  THR C CB    1 
ATOM   9295  O OG1   . THR C 1 454 ? 57.945  -14.400 12.963  1.00 75.80  ?  451  THR C OG1   1 
ATOM   9296  C CG2   . THR C 1 454 ? 55.632  -13.726 13.162  1.00 65.66  ?  451  THR C CG2   1 
ATOM   9297  N N     . TYR C 1 455 ? 56.265  -12.842 10.124  1.00 63.46  ?  452  TYR C N     1 
ATOM   9298  C CA    . TYR C 1 455 ? 56.285  -13.380 8.766   1.00 67.61  ?  452  TYR C CA    1 
ATOM   9299  C C     . TYR C 1 455 ? 56.815  -12.348 7.776   1.00 73.15  ?  452  TYR C C     1 
ATOM   9300  O O     . TYR C 1 455 ? 57.645  -12.670 6.919   1.00 82.94  ?  452  TYR C O     1 
ATOM   9301  C CB    . TYR C 1 455 ? 54.891  -13.883 8.355   1.00 67.60  ?  452  TYR C CB    1 
ATOM   9302  C CG    . TYR C 1 455 ? 53.848  -12.815 8.077   1.00 71.09  ?  452  TYR C CG    1 
ATOM   9303  C CD1   . TYR C 1 455 ? 53.761  -12.201 6.829   1.00 73.50  ?  452  TYR C CD1   1 
ATOM   9304  C CD2   . TYR C 1 455 ? 52.925  -12.452 9.047   1.00 68.54  ?  452  TYR C CD2   1 
ATOM   9305  C CE1   . TYR C 1 455 ? 52.810  -11.230 6.572   1.00 73.18  ?  452  TYR C CE1   1 
ATOM   9306  C CE2   . TYR C 1 455 ? 51.965  -11.484 8.796   1.00 67.41  ?  452  TYR C CE2   1 
ATOM   9307  C CZ    . TYR C 1 455 ? 51.913  -10.878 7.557   1.00 69.15  ?  452  TYR C CZ    1 
ATOM   9308  O OH    . TYR C 1 455 ? 50.961  -9.917  7.302   1.00 73.58  ?  452  TYR C OH    1 
ATOM   9309  N N     . ALA C 1 456 ? 56.364  -11.099 7.892   1.00 63.75  ?  453  ALA C N     1 
ATOM   9310  C CA    . ALA C 1 456 ? 56.816  -10.044 6.998   1.00 52.05  ?  453  ALA C CA    1 
ATOM   9311  C C     . ALA C 1 456 ? 58.161  -9.465  7.408   1.00 51.93  ?  453  ALA C C     1 
ATOM   9312  O O     . ALA C 1 456 ? 58.748  -8.700  6.634   1.00 53.72  ?  453  ALA C O     1 
ATOM   9313  C CB    . ALA C 1 456 ? 55.769  -8.929  6.932   1.00 50.10  ?  453  ALA C CB    1 
ATOM   9314  N N     . ARG C 1 457 ? 58.658  -9.821  8.593   1.00 60.41  ?  454  ARG C N     1 
ATOM   9315  C CA    . ARG C 1 457 ? 59.928  -9.320  9.117   1.00 65.18  ?  454  ARG C CA    1 
ATOM   9316  C C     . ARG C 1 457 ? 59.966  -7.793  9.093   1.00 66.89  ?  454  ARG C C     1 
ATOM   9317  O O     . ARG C 1 457 ? 60.923  -7.172  8.622   1.00 68.36  ?  454  ARG C O     1 
ATOM   9318  C CB    . ARG C 1 457 ? 61.110  -9.924  8.359   1.00 66.55  ?  454  ARG C CB    1 
ATOM   9319  C CG    . ARG C 1 457 ? 61.220  -11.435 8.508   1.00 69.16  ?  454  ARG C CG    1 
ATOM   9320  C CD    . ARG C 1 457 ? 61.370  -11.851 9.967   1.00 73.37  ?  454  ARG C CD    1 
ATOM   9321  N NE    . ARG C 1 457 ? 62.677  -11.504 10.516  1.00 78.08  ?  454  ARG C NE    1 
ATOM   9322  C CZ    . ARG C 1 457 ? 63.156  -11.987 11.659  1.00 78.74  ?  454  ARG C CZ    1 
ATOM   9323  N NH1   . ARG C 1 457 ? 62.434  -12.841 12.372  1.00 78.90  1  454  ARG C NH1   1 
ATOM   9324  N NH2   . ARG C 1 457 ? 64.357  -11.622 12.086  1.00 78.17  ?  454  ARG C NH2   1 
ATOM   9325  N N     . LYS C 1 458 ? 58.901  -7.189  9.618   1.00 59.93  ?  455  LYS C N     1 
ATOM   9326  C CA    . LYS C 1 458 ? 58.775  -5.743  9.719   1.00 57.32  ?  455  LYS C CA    1 
ATOM   9327  C C     . LYS C 1 458 ? 58.338  -5.375  11.131  1.00 54.60  ?  455  LYS C C     1 
ATOM   9328  O O     . LYS C 1 458 ? 57.699  -6.171  11.825  1.00 47.55  ?  455  LYS C O     1 
ATOM   9329  C CB    . LYS C 1 458 ? 57.769  -5.187  8.697   1.00 57.24  ?  455  LYS C CB    1 
ATOM   9330  C CG    . LYS C 1 458 ? 58.090  -5.518  7.244   1.00 62.87  ?  455  LYS C CG    1 
ATOM   9331  C CD    . LYS C 1 458 ? 59.280  -4.720  6.732   1.00 67.64  ?  455  LYS C CD    1 
ATOM   9332  C CE    . LYS C 1 458 ? 59.739  -5.219  5.368   1.00 58.93  ?  455  LYS C CE    1 
ATOM   9333  N NZ    . LYS C 1 458 ? 61.041  -4.615  4.971   1.00 59.16  1  455  LYS C NZ    1 
ATOM   9334  N N     . THR C 1 459 ? 58.694  -4.163  11.557  1.00 53.21  ?  456  THR C N     1 
ATOM   9335  C CA    . THR C 1 459 ? 58.308  -3.657  12.868  1.00 57.51  ?  456  THR C CA    1 
ATOM   9336  C C     . THR C 1 459 ? 57.632  -2.304  12.726  1.00 42.03  ?  456  THR C C     1 
ATOM   9337  O O     . THR C 1 459 ? 57.991  -1.504  11.857  1.00 39.34  ?  456  THR C O     1 
ATOM   9338  C CB    . THR C 1 459 ? 59.507  -3.512  13.811  1.00 65.43  ?  456  THR C CB    1 
ATOM   9339  O OG1   . THR C 1 459 ? 60.197  -2.290  13.523  1.00 75.94  ?  456  THR C OG1   1 
ATOM   9340  C CG2   . THR C 1 459 ? 60.455  -4.659  13.628  1.00 51.72  ?  456  THR C CG2   1 
ATOM   9341  N N     . ASN C 1 460 ? 56.664  -2.052  13.600  1.00 38.14  ?  457  ASN C N     1 
ATOM   9342  C CA    . ASN C 1 460 ? 55.933  -0.796  13.645  1.00 38.12  ?  457  ASN C CA    1 
ATOM   9343  C C     . ASN C 1 460 ? 56.045  -0.219  15.048  1.00 44.36  ?  457  ASN C C     1 
ATOM   9344  O O     . ASN C 1 460 ? 55.838  -0.933  16.036  1.00 42.25  ?  457  ASN C O     1 
ATOM   9345  C CB    . ASN C 1 460 ? 54.469  -1.008  13.254  1.00 37.72  ?  457  ASN C CB    1 
ATOM   9346  C CG    . ASN C 1 460 ? 54.321  -1.573  11.855  1.00 45.10  ?  457  ASN C CG    1 
ATOM   9347  O OD1   . ASN C 1 460 ? 54.837  -1.011  10.889  1.00 52.10  ?  457  ASN C OD1   1 
ATOM   9348  N ND2   . ASN C 1 460 ? 53.628  -2.700  11.742  1.00 43.46  ?  457  ASN C ND2   1 
ATOM   9349  N N     . LEU C 1 461 ? 56.383  1.065   15.133  1.00 31.25  ?  458  LEU C N     1 
ATOM   9350  C CA    . LEU C 1 461 ? 56.642  1.727   16.402  1.00 26.11  ?  458  LEU C CA    1 
ATOM   9351  C C     . LEU C 1 461 ? 55.879  3.041   16.471  1.00 35.69  ?  458  LEU C C     1 
ATOM   9352  O O     . LEU C 1 461 ? 55.799  3.778   15.484  1.00 36.38  ?  458  LEU C O     1 
ATOM   9353  C CB    . LEU C 1 461 ? 58.143  1.993   16.588  1.00 24.81  ?  458  LEU C CB    1 
ATOM   9354  C CG    . LEU C 1 461 ? 58.554  2.916   17.739  1.00 26.74  ?  458  LEU C CG    1 
ATOM   9355  C CD1   . LEU C 1 461 ? 58.330  2.249   19.091  1.00 29.37  ?  458  LEU C CD1   1 
ATOM   9356  C CD2   . LEU C 1 461 ? 59.996  3.375   17.597  1.00 34.72  ?  458  LEU C CD2   1 
ATOM   9357  N N     . CYS C 1 462 ? 55.318  3.327   17.643  1.00 26.93  ?  459  CYS C N     1 
ATOM   9358  C CA    . CYS C 1 462 ? 54.705  4.621   17.908  1.00 23.15  ?  459  CYS C CA    1 
ATOM   9359  C C     . CYS C 1 462 ? 54.855  4.922   19.389  1.00 30.40  ?  459  CYS C C     1 
ATOM   9360  O O     . CYS C 1 462 ? 54.584  4.057   20.228  1.00 27.48  ?  459  CYS C O     1 
ATOM   9361  C CB    . CYS C 1 462 ? 53.228  4.643   17.502  1.00 29.82  ?  459  CYS C CB    1 
ATOM   9362  S SG    . CYS C 1 462 ? 52.398  6.217   17.846  1.00 33.43  ?  459  CYS C SG    1 
ATOM   9363  N N     . ILE C 1 463 ? 55.307  6.133   19.706  1.00 26.58  ?  460  ILE C N     1 
ATOM   9364  C CA    . ILE C 1 463 ? 55.472  6.563   21.087  1.00 26.21  ?  460  ILE C CA    1 
ATOM   9365  C C     . ILE C 1 463 ? 54.745  7.886   21.276  1.00 19.94  ?  460  ILE C C     1 
ATOM   9366  O O     . ILE C 1 463 ? 54.603  8.682   20.341  1.00 28.81  ?  460  ILE C O     1 
ATOM   9367  C CB    . ILE C 1 463 ? 56.964  6.680   21.491  1.00 34.55  ?  460  ILE C CB    1 
ATOM   9368  C CG1   . ILE C 1 463 ? 57.603  7.947   20.916  1.00 45.46  ?  460  ILE C CG1   1 
ATOM   9369  C CG2   . ILE C 1 463 ? 57.742  5.463   21.016  1.00 39.26  ?  460  ILE C CG2   1 
ATOM   9370  C CD1   . ILE C 1 463 ? 57.860  9.033   21.946  1.00 49.09  ?  460  ILE C CD1   1 
ATOM   9371  N N     . ALA C 1 464 ? 54.270  8.110   22.498  1.00 18.54  ?  461  ALA C N     1 
ATOM   9372  C CA    . ALA C 1 464 ? 53.520  9.307   22.848  1.00 25.52  ?  461  ALA C CA    1 
ATOM   9373  C C     . ALA C 1 464 ? 53.956  9.770   24.229  1.00 24.24  ?  461  ALA C C     1 
ATOM   9374  O O     . ALA C 1 464 ? 54.037  8.961   25.158  1.00 22.49  ?  461  ALA C O     1 
ATOM   9375  C CB    . ALA C 1 464 ? 52.011  9.044   22.831  1.00 22.73  ?  461  ALA C CB    1 
ATOM   9376  N N     . ALA C 1 465 ? 54.235  11.064  24.360  1.00 23.00  ?  462  ALA C N     1 
ATOM   9377  C CA    . ALA C 1 465 ? 54.684  11.653  25.614  1.00 24.12  ?  462  ALA C CA    1 
ATOM   9378  C C     . ALA C 1 465 ? 53.711  12.746  26.032  1.00 19.82  ?  462  ALA C C     1 
ATOM   9379  O O     . ALA C 1 465 ? 53.310  13.573  25.207  1.00 16.34  ?  462  ALA C O     1 
ATOM   9380  C CB    . ALA C 1 465 ? 56.098  12.222  25.481  1.00 28.42  ?  462  ALA C CB    1 
ATOM   9381  N N     . VAL C 1 466 ? 53.323  12.738  27.310  1.00 23.18  ?  463  VAL C N     1 
ATOM   9382  C CA    . VAL C 1 466 ? 52.401  13.725  27.858  1.00 21.35  ?  463  VAL C CA    1 
ATOM   9383  C C     . VAL C 1 466 ? 52.927  14.188  29.210  1.00 20.08  ?  463  VAL C C     1 
ATOM   9384  O O     . VAL C 1 466 ? 53.688  13.487  29.882  1.00 28.65  ?  463  VAL C O     1 
ATOM   9385  C CB    . VAL C 1 466 ? 50.953  13.184  28.013  1.00 18.59  ?  463  VAL C CB    1 
ATOM   9386  C CG1   . VAL C 1 466 ? 50.513  12.419  26.769  1.00 22.56  ?  463  VAL C CG1   1 
ATOM   9387  C CG2   . VAL C 1 466 ? 50.830  12.312  29.251  1.00 30.22  ?  463  VAL C CG2   1 
ATOM   9388  N N     . ASP C 1 467 ? 52.518  15.392  29.606  1.00 23.50  ?  464  ASP C N     1 
ATOM   9389  C CA    . ASP C 1 467 ? 52.884  15.909  30.916  1.00 20.31  ?  464  ASP C CA    1 
ATOM   9390  C C     . ASP C 1 467 ? 51.776  15.582  31.918  1.00 31.04  ?  464  ASP C C     1 
ATOM   9391  O O     . ASP C 1 467 ? 50.820  14.863  31.612  1.00 37.92  ?  464  ASP C O     1 
ATOM   9392  C CB    . ASP C 1 467 ? 53.201  17.408  30.848  1.00 14.91  ?  464  ASP C CB    1 
ATOM   9393  C CG    . ASP C 1 467 ? 51.993  18.275  30.504  1.00 21.72  ?  464  ASP C CG    1 
ATOM   9394  O OD1   . ASP C 1 467 ? 50.830  17.845  30.658  1.00 22.07  ?  464  ASP C OD1   1 
ATOM   9395  O OD2   . ASP C 1 467 ? 52.219  19.430  30.087  1.00 30.98  -1 464  ASP C OD2   1 
ATOM   9396  N N     . ASN C 1 468 ? 51.889  16.132  33.129  1.00 30.04  ?  465  ASN C N     1 
ATOM   9397  C CA    . ASN C 1 468 ? 50.955  15.797  34.198  1.00 23.75  ?  465  ASN C CA    1 
ATOM   9398  C C     . ASN C 1 468 ? 49.554  16.341  33.954  1.00 28.05  ?  465  ASN C C     1 
ATOM   9399  O O     . ASN C 1 468 ? 48.608  15.884  34.603  1.00 24.70  ?  465  ASN C O     1 
ATOM   9400  C CB    . ASN C 1 468 ? 51.481  16.323  35.531  1.00 32.15  ?  465  ASN C CB    1 
ATOM   9401  C CG    . ASN C 1 468 ? 51.616  17.829  35.544  1.00 19.90  ?  465  ASN C CG    1 
ATOM   9402  O OD1   . ASN C 1 468 ? 52.175  18.423  34.623  1.00 26.21  ?  465  ASN C OD1   1 
ATOM   9403  N ND2   . ASN C 1 468 ? 51.091  18.460  36.588  1.00 26.26  ?  465  ASN C ND2   1 
ATOM   9404  N N     . THR C 1 469 ? 49.398  17.305  33.050  1.00 25.01  ?  466  THR C N     1 
ATOM   9405  C CA    . THR C 1 469 ? 48.101  17.903  32.761  1.00 30.90  ?  466  THR C CA    1 
ATOM   9406  C C     . THR C 1 469 ? 47.421  17.282  31.550  1.00 34.15  ?  466  THR C C     1 
ATOM   9407  O O     . THR C 1 469 ? 46.316  17.702  31.196  1.00 24.71  ?  466  THR C O     1 
ATOM   9408  C CB    . THR C 1 469 ? 48.247  19.412  32.533  1.00 28.96  ?  466  THR C CB    1 
ATOM   9409  O OG1   . THR C 1 469 ? 48.902  19.642  31.281  1.00 33.80  ?  466  THR C OG1   1 
ATOM   9410  C CG2   . THR C 1 469 ? 49.065  20.046  33.646  1.00 29.09  ?  466  THR C CG2   1 
ATOM   9411  N N     . GLY C 1 470 ? 48.047  16.299  30.908  1.00 27.16  ?  467  GLY C N     1 
ATOM   9412  C CA    . GLY C 1 470 ? 47.511  15.719  29.699  1.00 23.75  ?  467  GLY C CA    1 
ATOM   9413  C C     . GLY C 1 470 ? 47.960  16.392  28.419  1.00 22.06  ?  467  GLY C C     1 
ATOM   9414  O O     . GLY C 1 470 ? 47.627  15.901  27.334  1.00 22.42  ?  467  GLY C O     1 
ATOM   9415  N N     . ASP C 1 471 ? 48.689  17.504  28.508  1.00 24.78  ?  468  ASP C N     1 
ATOM   9416  C CA    . ASP C 1 471 ? 49.290  18.102  27.325  1.00 22.56  ?  468  ASP C CA    1 
ATOM   9417  C C     . ASP C 1 471 ? 50.178  17.085  26.628  1.00 30.25  ?  468  ASP C C     1 
ATOM   9418  O O     . ASP C 1 471 ? 50.998  16.419  27.263  1.00 18.11  ?  468  ASP C O     1 
ATOM   9419  C CB    . ASP C 1 471 ? 50.105  19.338  27.705  1.00 21.78  ?  468  ASP C CB    1 
ATOM   9420  C CG    . ASP C 1 471 ? 49.262  20.596  27.782  1.00 39.04  ?  468  ASP C CG    1 
ATOM   9421  O OD1   . ASP C 1 471 ? 48.023  20.488  27.663  1.00 29.75  ?  468  ASP C OD1   1 
ATOM   9422  O OD2   . ASP C 1 471 ? 49.839  21.689  27.964  1.00 50.45  -1 468  ASP C OD2   1 
ATOM   9423  N N     . ILE C 1 472 ? 50.007  16.957  25.317  1.00 22.48  ?  469  ILE C N     1 
ATOM   9424  C CA    . ILE C 1 472 ? 50.790  16.016  24.528  1.00 18.22  ?  469  ILE C CA    1 
ATOM   9425  C C     . ILE C 1 472 ? 52.110  16.688  24.176  1.00 27.84  ?  469  ILE C C     1 
ATOM   9426  O O     . ILE C 1 472 ? 52.141  17.664  23.424  1.00 29.82  ?  469  ILE C O     1 
ATOM   9427  C CB    . ILE C 1 472 ? 50.034  15.561  23.277  1.00 19.44  ?  469  ILE C CB    1 
ATOM   9428  C CG1   . ILE C 1 472 ? 48.724  14.893  23.684  1.00 18.20  ?  469  ILE C CG1   1 
ATOM   9429  C CG2   . ILE C 1 472 ? 50.887  14.606  22.459  1.00 21.82  ?  469  ILE C CG2   1 
ATOM   9430  C CD1   . ILE C 1 472 ? 47.931  14.383  22.518  1.00 16.96  ?  469  ILE C CD1   1 
ATOM   9431  N N     . LEU C 1 473 ? 53.203  16.160  24.722  1.00 20.70  ?  470  LEU C N     1 
ATOM   9432  C CA    . LEU C 1 473 ? 54.512  16.740  24.460  1.00 23.41  ?  470  LEU C CA    1 
ATOM   9433  C C     . LEU C 1 473 ? 55.051  16.312  23.105  1.00 37.65  ?  470  LEU C C     1 
ATOM   9434  O O     . LEU C 1 473 ? 55.617  17.134  22.374  1.00 45.65  ?  470  LEU C O     1 
ATOM   9435  C CB    . LEU C 1 473 ? 55.486  16.348  25.567  1.00 27.67  ?  470  LEU C CB    1 
ATOM   9436  C CG    . LEU C 1 473 ? 55.112  16.877  26.953  1.00 26.43  ?  470  LEU C CG    1 
ATOM   9437  C CD1   . LEU C 1 473 ? 56.048  16.328  28.009  1.00 24.46  ?  470  LEU C CD1   1 
ATOM   9438  C CD2   . LEU C 1 473 ? 55.133  18.395  26.954  1.00 25.63  ?  470  LEU C CD2   1 
ATOM   9439  N N     . TYR C 1 474 ? 54.882  15.042  22.751  1.00 27.88  ?  471  TYR C N     1 
ATOM   9440  C CA    . TYR C 1 474 ? 55.478  14.554  21.520  1.00 26.30  ?  471  TYR C CA    1 
ATOM   9441  C C     . TYR C 1 474 ? 54.787  13.269  21.094  1.00 18.36  ?  471  TYR C C     1 
ATOM   9442  O O     . TYR C 1 474 ? 54.364  12.465  21.928  1.00 21.44  ?  471  TYR C O     1 
ATOM   9443  C CB    . TYR C 1 474 ? 56.988  14.330  21.692  1.00 28.76  ?  471  TYR C CB    1 
ATOM   9444  C CG    . TYR C 1 474 ? 57.662  13.731  20.480  1.00 25.29  ?  471  TYR C CG    1 
ATOM   9445  C CD1   . TYR C 1 474 ? 58.053  14.529  19.412  1.00 29.01  ?  471  TYR C CD1   1 
ATOM   9446  C CD2   . TYR C 1 474 ? 57.908  12.368  20.406  1.00 26.63  ?  471  TYR C CD2   1 
ATOM   9447  C CE1   . TYR C 1 474 ? 58.667  13.982  18.301  1.00 26.38  ?  471  TYR C CE1   1 
ATOM   9448  C CE2   . TYR C 1 474 ? 58.521  11.811  19.302  1.00 31.63  ?  471  TYR C CE2   1 
ATOM   9449  C CZ    . TYR C 1 474 ? 58.898  12.622  18.253  1.00 35.58  ?  471  TYR C CZ    1 
ATOM   9450  O OH    . TYR C 1 474 ? 59.509  12.076  17.150  1.00 34.61  ?  471  TYR C OH    1 
ATOM   9451  N N     . ILE C 1 475 ? 54.677  13.097  19.782  1.00 20.72  ?  472  ILE C N     1 
ATOM   9452  C CA    . ILE C 1 475 ? 54.203  11.863  19.173  1.00 20.68  ?  472  ILE C CA    1 
ATOM   9453  C C     . ILE C 1 475 ? 55.171  11.502  18.060  1.00 30.04  ?  472  ILE C C     1 
ATOM   9454  O O     . ILE C 1 475 ? 55.447  12.329  17.187  1.00 30.44  ?  472  ILE C O     1 
ATOM   9455  C CB    . ILE C 1 475 ? 52.771  11.997  18.624  1.00 19.79  ?  472  ILE C CB    1 
ATOM   9456  C CG1   . ILE C 1 475 ? 51.772  12.172  19.768  1.00 14.92  ?  472  ILE C CG1   1 
ATOM   9457  C CG2   . ILE C 1 475 ? 52.405  10.783  17.781  1.00 24.77  ?  472  ILE C CG2   1 
ATOM   9458  C CD1   . ILE C 1 475 ? 50.355  12.412  19.298  1.00 17.17  ?  472  ILE C CD1   1 
ATOM   9459  N N     . GLY C 1 476 ? 55.697  10.292  18.107  1.00 29.17  ?  473  GLY C N     1 
ATOM   9460  C CA    . GLY C 1 476 ? 56.566  9.796   17.053  1.00 33.01  ?  473  GLY C CA    1 
ATOM   9461  C C     . GLY C 1 476 ? 56.061  8.464   16.550  1.00 29.13  ?  473  GLY C C     1 
ATOM   9462  O O     . GLY C 1 476 ? 55.627  7.619   17.331  1.00 28.15  ?  473  GLY C O     1 
ATOM   9463  N N     . LYS C 1 477 ? 56.118  8.286   15.232  1.00 22.77  ?  474  LYS C N     1 
ATOM   9464  C CA    . LYS C 1 477 ? 55.555  7.102   14.599  1.00 21.39  ?  474  LYS C CA    1 
ATOM   9465  C C     . LYS C 1 477 ? 56.450  6.651   13.459  1.00 36.04  ?  474  LYS C C     1 
ATOM   9466  O O     . LYS C 1 477 ? 56.840  7.460   12.611  1.00 36.30  ?  474  LYS C O     1 
ATOM   9467  C CB    . LYS C 1 477 ? 54.139  7.378   14.080  1.00 29.97  ?  474  LYS C CB    1 
ATOM   9468  C CG    . LYS C 1 477 ? 53.506  6.214   13.334  1.00 29.79  ?  474  LYS C CG    1 
ATOM   9469  C CD    . LYS C 1 477 ? 52.084  6.547   12.904  1.00 27.87  ?  474  LYS C CD    1 
ATOM   9470  C CE    . LYS C 1 477 ? 51.429  5.375   12.191  1.00 26.37  ?  474  LYS C CE    1 
ATOM   9471  N NZ    . LYS C 1 477 ? 50.050  5.707   11.732  1.00 20.87  1  474  LYS C NZ    1 
ATOM   9472  N N     . HIS C 1 478 ? 56.766  5.358   13.440  1.00 29.63  ?  475  HIS C N     1 
ATOM   9473  C CA    . HIS C 1 478 ? 57.515  4.743   12.357  1.00 27.74  ?  475  HIS C CA    1 
ATOM   9474  C C     . HIS C 1 478 ? 56.788  3.487   11.906  1.00 35.11  ?  475  HIS C C     1 
ATOM   9475  O O     . HIS C 1 478 ? 56.288  2.717   12.731  1.00 38.88  ?  475  HIS C O     1 
ATOM   9476  C CB    . HIS C 1 478 ? 58.948  4.397   12.786  1.00 36.24  ?  475  HIS C CB    1 
ATOM   9477  C CG    . HIS C 1 478 ? 59.783  5.593   13.117  1.00 43.59  ?  475  HIS C CG    1 
ATOM   9478  N ND1   . HIS C 1 478 ? 60.484  6.299   12.162  1.00 51.74  ?  475  HIS C ND1   1 
ATOM   9479  C CD2   . HIS C 1 478 ? 60.028  6.212   14.296  1.00 43.72  ?  475  HIS C CD2   1 
ATOM   9480  C CE1   . HIS C 1 478 ? 61.125  7.299   12.740  1.00 51.27  ?  475  HIS C CE1   1 
ATOM   9481  N NE2   . HIS C 1 478 ? 60.865  7.269   14.034  1.00 41.31  ?  475  HIS C NE2   1 
ATOM   9482  N N     . LYS C 1 479 ? 56.728  3.289   10.593  1.00 33.20  ?  476  LYS C N     1 
ATOM   9483  C CA    . LYS C 1 479 ? 56.091  2.120   10.009  1.00 46.79  ?  476  LYS C CA    1 
ATOM   9484  C C     . LYS C 1 479 ? 57.066  1.379   9.106   1.00 48.74  ?  476  LYS C C     1 
ATOM   9485  O O     . LYS C 1 479 ? 57.930  1.983   8.463   1.00 56.47  ?  476  LYS C O     1 
ATOM   9486  C CB    . LYS C 1 479 ? 54.843  2.499   9.203   1.00 52.78  ?  476  LYS C CB    1 
ATOM   9487  C CG    . LYS C 1 479 ? 53.604  2.758   10.044  1.00 53.88  ?  476  LYS C CG    1 
ATOM   9488  C CD    . LYS C 1 479 ? 52.360  2.780   9.172   1.00 57.89  ?  476  LYS C CD    1 
ATOM   9489  C CE    . LYS C 1 479 ? 52.458  3.858   8.106   1.00 57.45  ?  476  LYS C CE    1 
ATOM   9490  N NZ    . LYS C 1 479 ? 51.431  3.690   7.038   1.00 56.85  1  476  LYS C NZ    1 
ATOM   9491  N N     . ASN C 1 480 ? 56.912  0.056   9.077   1.00 40.77  ?  477  ASN C N     1 
ATOM   9492  C CA    . ASN C 1 480 ? 57.638  -0.818  8.157   1.00 55.60  ?  477  ASN C CA    1 
ATOM   9493  C C     . ASN C 1 480 ? 59.153  -0.668  8.304   1.00 65.32  ?  477  ASN C C     1 
ATOM   9494  O O     . ASN C 1 480 ? 59.887  -0.497  7.328   1.00 73.25  ?  477  ASN C O     1 
ATOM   9495  C CB    . ASN C 1 480 ? 57.190  -0.571  6.715   1.00 47.87  ?  477  ASN C CB    1 
ATOM   9496  C CG    . ASN C 1 480 ? 55.697  -0.778  6.529   1.00 56.13  ?  477  ASN C CG    1 
ATOM   9497  O OD1   . ASN C 1 480 ? 55.201  -1.903  6.598   1.00 56.64  ?  477  ASN C OD1   1 
ATOM   9498  N ND2   . ASN C 1 480 ? 54.973  0.310   6.291   1.00 57.73  ?  477  ASN C ND2   1 
ATOM   9499  N N     . LEU C 1 481 ? 59.617  -0.731  9.546   1.00 51.30  ?  478  LEU C N     1 
ATOM   9500  C CA    . LEU C 1 481 ? 61.034  -0.902  9.819   1.00 50.79  ?  478  LEU C CA    1 
ATOM   9501  C C     . LEU C 1 481 ? 61.379  -2.382  9.746   1.00 49.56  ?  478  LEU C C     1 
ATOM   9502  O O     . LEU C 1 481 ? 60.545  -3.244  10.028  1.00 50.36  ?  478  LEU C O     1 
ATOM   9503  C CB    . LEU C 1 481 ? 61.389  -0.351  11.200  1.00 49.07  ?  478  LEU C CB    1 
ATOM   9504  C CG    . LEU C 1 481 ? 60.895  1.066   11.487  1.00 44.00  ?  478  LEU C CG    1 
ATOM   9505  C CD1   . LEU C 1 481 ? 61.027  1.386   12.966  1.00 46.33  ?  478  LEU C CD1   1 
ATOM   9506  C CD2   . LEU C 1 481 ? 61.656  2.075   10.641  1.00 44.04  ?  478  LEU C CD2   1 
ATOM   9507  N N     . GLU C 1 482 ? 62.614  -2.679  9.355   1.00 54.95  ?  479  GLU C N     1 
ATOM   9508  C CA    . GLU C 1 482 ? 63.013  -4.072  9.215   1.00 56.88  ?  479  GLU C CA    1 
ATOM   9509  C C     . GLU C 1 482 ? 63.171  -4.718  10.586  1.00 54.19  ?  479  GLU C C     1 
ATOM   9510  O O     . GLU C 1 482 ? 63.695  -4.109  11.523  1.00 57.12  ?  479  GLU C O     1 
ATOM   9511  C CB    . GLU C 1 482 ? 64.311  -4.183  8.418   1.00 67.81  ?  479  GLU C CB    1 
ATOM   9512  C CG    . GLU C 1 482 ? 64.427  -5.485  7.645   1.00 78.31  ?  479  GLU C CG    1 
ATOM   9513  C CD    . GLU C 1 482 ? 63.293  -5.670  6.651   1.00 82.37  ?  479  GLU C CD    1 
ATOM   9514  O OE1   . GLU C 1 482 ? 63.069  -4.757  5.827   1.00 75.90  ?  479  GLU C OE1   1 
ATOM   9515  O OE2   . GLU C 1 482 ? 62.620  -6.721  6.700   1.00 87.31  -1 479  GLU C OE2   1 
ATOM   9516  N N     . LEU C 1 483 ? 62.704  -5.959  10.700  1.00 54.49  ?  480  LEU C N     1 
ATOM   9517  C CA    . LEU C 1 483 ? 62.714  -6.681  11.972  1.00 59.23  ?  480  LEU C CA    1 
ATOM   9518  C C     . LEU C 1 483 ? 64.150  -6.995  12.363  1.00 62.67  ?  480  LEU C C     1 
ATOM   9519  O O     . LEU C 1 483 ? 64.732  -7.983  11.910  1.00 64.93  ?  480  LEU C O     1 
ATOM   9520  C CB    . LEU C 1 483 ? 61.871  -7.948  11.871  1.00 64.51  ?  480  LEU C CB    1 
ATOM   9521  C CG    . LEU C 1 483 ? 61.587  -8.793  13.119  1.00 66.49  ?  480  LEU C CG    1 
ATOM   9522  C CD1   . LEU C 1 483 ? 61.599  -7.962  14.394  1.00 58.27  ?  480  LEU C CD1   1 
ATOM   9523  C CD2   . LEU C 1 483 ? 60.245  -9.499  12.970  1.00 68.92  ?  480  LEU C CD2   1 
ATOM   9524  N N     . ASN C 1 484 ? 64.725  -6.149  13.214  1.00 55.96  ?  481  ASN C N     1 
ATOM   9525  C CA    . ASN C 1 484 ? 66.080  -6.348  13.712  1.00 54.45  ?  481  ASN C CA    1 
ATOM   9526  C C     . ASN C 1 484 ? 66.178  -5.674  15.070  1.00 55.05  ?  481  ASN C C     1 
ATOM   9527  O O     . ASN C 1 484 ? 65.925  -4.470  15.183  1.00 48.26  ?  481  ASN C O     1 
ATOM   9528  C CB    . ASN C 1 484 ? 67.119  -5.782  12.743  1.00 65.23  ?  481  ASN C CB    1 
ATOM   9529  C CG    . ASN C 1 484 ? 68.539  -5.926  13.257  1.00 76.30  ?  481  ASN C CG    1 
ATOM   9530  O OD1   . ASN C 1 484 ? 69.054  -5.043  13.942  1.00 72.16  ?  481  ASN C OD1   1 
ATOM   9531  N ND2   . ASN C 1 484 ? 69.179  -7.043  12.928  1.00 82.86  ?  481  ASN C ND2   1 
ATOM   9532  N N     . GLU C 1 485 ? 66.535  -6.455  16.093  1.00 62.43  ?  482  GLU C N     1 
ATOM   9533  C CA    . GLU C 1 485 ? 66.563  -5.951  17.463  1.00 63.05  ?  482  GLU C CA    1 
ATOM   9534  C C     . GLU C 1 485 ? 67.416  -4.694  17.582  1.00 57.92  ?  482  GLU C C     1 
ATOM   9535  O O     . GLU C 1 485 ? 66.984  -3.684  18.151  1.00 50.37  ?  482  GLU C O     1 
ATOM   9536  C CB    . GLU C 1 485 ? 67.083  -7.040  18.404  1.00 69.20  ?  482  GLU C CB    1 
ATOM   9537  C CG    . GLU C 1 485 ? 66.035  -7.631  19.334  1.00 74.21  ?  482  GLU C CG    1 
ATOM   9538  C CD    . GLU C 1 485 ? 65.471  -6.608  20.299  1.00 69.94  ?  482  GLU C CD    1 
ATOM   9539  O OE1   . GLU C 1 485 ? 64.590  -5.823  19.889  1.00 69.40  ?  482  GLU C OE1   1 
ATOM   9540  O OE2   . GLU C 1 485 ? 65.917  -6.583  21.465  1.00 68.03  -1 482  GLU C OE2   1 
ATOM   9541  N N     . LYS C 1 486 ? 68.634  -4.737  17.038  1.00 55.68  ?  483  LYS C N     1 
ATOM   9542  C CA    . LYS C 1 486 ? 69.556  -3.616  17.183  1.00 58.22  ?  483  LYS C CA    1 
ATOM   9543  C C     . LYS C 1 486 ? 69.021  -2.363  16.498  1.00 54.34  ?  483  LYS C C     1 
ATOM   9544  O O     . LYS C 1 486 ? 69.041  -1.271  17.078  1.00 46.89  ?  483  LYS C O     1 
ATOM   9545  C CB    . LYS C 1 486 ? 70.928  -3.998  16.626  1.00 54.47  ?  483  LYS C CB    1 
ATOM   9546  C CG    . LYS C 1 486 ? 71.959  -2.883  16.673  1.00 57.14  ?  483  LYS C CG    1 
ATOM   9547  C CD    . LYS C 1 486 ? 72.067  -2.276  18.063  1.00 57.41  ?  483  LYS C CD    1 
ATOM   9548  C CE    . LYS C 1 486 ? 73.332  -1.447  18.197  1.00 57.25  ?  483  LYS C CE    1 
ATOM   9549  N NZ    . LYS C 1 486 ? 73.541  -0.567  17.015  1.00 61.18  1  483  LYS C NZ    1 
ATOM   9550  N N     . MET C 1 487 ? 68.532  -2.500  15.262  1.00 47.82  ?  484  MET C N     1 
ATOM   9551  C CA    . MET C 1 487 ? 68.060  -1.332  14.524  1.00 52.23  ?  484  MET C CA    1 
ATOM   9552  C C     . MET C 1 487 ? 66.822  -0.725  15.174  1.00 49.09  ?  484  MET C C     1 
ATOM   9553  O O     . MET C 1 487 ? 66.698  0.502   15.265  1.00 49.47  ?  484  MET C O     1 
ATOM   9554  C CB    . MET C 1 487 ? 67.775  -1.705  13.068  1.00 58.08  ?  484  MET C CB    1 
ATOM   9555  C CG    . MET C 1 487 ? 68.966  -2.304  12.333  1.00 73.93  ?  484  MET C CG    1 
ATOM   9556  S SD    . MET C 1 487 ? 68.725  -2.415  10.548  1.00 87.53  ?  484  MET C SD    1 
ATOM   9557  C CE    . MET C 1 487 ? 67.071  -3.091  10.458  1.00 85.94  ?  484  MET C CE    1 
ATOM   9558  N N     . ASN C 1 488 ? 65.916  -1.563  15.637  1.00 51.58  ?  485  ASN C N     1 
ATOM   9559  C CA    . ASN C 1 488 ? 64.696  -1.104  16.278  1.00 52.64  ?  485  ASN C CA    1 
ATOM   9560  C C     . ASN C 1 488 ? 64.988  -0.386  17.588  1.00 49.50  ?  485  ASN C C     1 
ATOM   9561  O O     . ASN C 1 488 ? 64.403  0.607   17.887  1.00 47.27  ?  485  ASN C O     1 
ATOM   9562  C CB    . ASN C 1 488 ? 63.752  -2.247  16.511  1.00 46.68  ?  485  ASN C CB    1 
ATOM   9563  C CG    . ASN C 1 488 ? 63.302  -2.909  15.231  1.00 55.36  ?  485  ASN C CG    1 
ATOM   9564  O OD1   . ASN C 1 488 ? 62.819  -4.021  15.265  1.00 53.46  ?  485  ASN C OD1   1 
ATOM   9565  N ND2   . ASN C 1 488 ? 63.443  -2.234  14.115  1.00 53.08  ?  485  ASN C ND2   1 
ATOM   9566  N N     . LEU C 1 489 ? 65.932  -0.892  18.347  1.00 40.38  ?  486  LEU C N     1 
ATOM   9567  C CA    . LEU C 1 489 ? 66.324  -0.243  19.592  1.00 50.23  ?  486  LEU C CA    1 
ATOM   9568  C C     . LEU C 1 489 ? 67.000  1.098   19.338  1.00 53.54  ?  486  LEU C C     1 
ATOM   9569  O O     . LEU C 1 489 ? 66.848  2.027   20.139  1.00 44.12  ?  486  LEU C O     1 
ATOM   9570  C CB    . LEU C 1 489 ? 67.240  -1.165  20.394  1.00 53.56  ?  486  LEU C CB    1 
ATOM   9571  C CG    . LEU C 1 489 ? 66.538  -2.299  21.140  1.00 55.64  ?  486  LEU C CG    1 
ATOM   9572  C CD1   . LEU C 1 489 ? 67.531  -3.381  21.514  1.00 52.21  ?  486  LEU C CD1   1 
ATOM   9573  C CD2   . LEU C 1 489 ? 65.850  -1.758  22.379  1.00 57.89  ?  486  LEU C CD2   1 
ATOM   9574  N N     . ASP C 1 490 ? 67.745  1.221   18.235  1.00 59.58  ?  487  ASP C N     1 
ATOM   9575  C CA    . ASP C 1 490 ? 68.330  2.510   17.881  1.00 53.61  ?  487  ASP C CA    1 
ATOM   9576  C C     . ASP C 1 490 ? 67.248  3.547   17.609  1.00 45.64  ?  487  ASP C C     1 
ATOM   9577  O O     . ASP C 1 490 ? 67.348  4.695   18.057  1.00 42.08  ?  487  ASP C O     1 
ATOM   9578  C CB    . ASP C 1 490 ? 69.244  2.361   16.665  1.00 53.47  ?  487  ASP C CB    1 
ATOM   9579  C CG    . ASP C 1 490 ? 70.514  1.595   16.980  1.00 63.42  ?  487  ASP C CG    1 
ATOM   9580  O OD1   . ASP C 1 490 ? 70.891  1.531   18.170  1.00 62.54  ?  487  ASP C OD1   1 
ATOM   9581  O OD2   . ASP C 1 490 ? 71.139  1.064   16.040  1.00 64.81  ?  487  ASP C OD2   1 
ATOM   9582  N N     . ILE C 1 491 ? 66.201  3.159   16.880  1.00 41.59  ?  488  ILE C N     1 
ATOM   9583  C CA    . ILE C 1 491 ? 65.131  4.101   16.574  1.00 41.99  ?  488  ILE C CA    1 
ATOM   9584  C C     . ILE C 1 491 ? 64.322  4.419   17.826  1.00 36.46  ?  488  ILE C C     1 
ATOM   9585  O O     . ILE C 1 491 ? 63.920  5.568   18.044  1.00 40.42  ?  488  ILE C O     1 
ATOM   9586  C CB    . ILE C 1 491 ? 64.244  3.551   15.444  1.00 40.08  ?  488  ILE C CB    1 
ATOM   9587  C CG1   . ILE C 1 491 ? 65.114  3.132   14.257  1.00 55.26  ?  488  ILE C CG1   1 
ATOM   9588  C CG2   . ILE C 1 491 ? 63.215  4.591   15.015  1.00 51.79  ?  488  ILE C CG2   1 
ATOM   9589  C CD1   . ILE C 1 491 ? 64.338  2.829   12.999  1.00 57.41  ?  488  ILE C CD1   1 
ATOM   9590  N N     . LEU C 1 492 ? 64.078  3.415   18.672  1.00 39.44  ?  489  LEU C N     1 
ATOM   9591  C CA    . LEU C 1 492 ? 63.339  3.648   19.911  1.00 41.97  ?  489  LEU C CA    1 
ATOM   9592  C C     . LEU C 1 492 ? 64.060  4.656   20.798  1.00 39.62  ?  489  LEU C C     1 
ATOM   9593  O O     . LEU C 1 492 ? 63.444  5.592   21.321  1.00 33.50  ?  489  LEU C O     1 
ATOM   9594  C CB    . LEU C 1 492 ? 63.125  2.330   20.657  1.00 36.49  ?  489  LEU C CB    1 
ATOM   9595  C CG    . LEU C 1 492 ? 62.500  2.452   22.052  1.00 37.65  ?  489  LEU C CG    1 
ATOM   9596  C CD1   . LEU C 1 492 ? 61.192  3.231   22.001  1.00 45.32  ?  489  LEU C CD1   1 
ATOM   9597  C CD2   . LEU C 1 492 ? 62.279  1.083   22.677  1.00 40.55  ?  489  LEU C CD2   1 
ATOM   9598  N N     . GLU C 1 493 ? 65.371  4.478   20.981  1.00 38.86  ?  490  GLU C N     1 
ATOM   9599  C CA    . GLU C 1 493 ? 66.145  5.454   21.741  1.00 42.74  ?  490  GLU C CA    1 
ATOM   9600  C C     . GLU C 1 493 ? 66.084  6.827   21.086  1.00 36.23  ?  490  GLU C C     1 
ATOM   9601  O O     . GLU C 1 493 ? 65.963  7.847   21.773  1.00 35.62  ?  490  GLU C O     1 
ATOM   9602  C CB    . GLU C 1 493 ? 67.596  4.991   21.874  1.00 43.05  ?  490  GLU C CB    1 
ATOM   9603  C CG    . GLU C 1 493 ? 68.523  6.046   22.462  1.00 45.86  ?  490  GLU C CG    1 
ATOM   9604  C CD    . GLU C 1 493 ? 69.978  5.619   22.465  1.00 49.19  ?  490  GLU C CD    1 
ATOM   9605  O OE1   . GLU C 1 493 ? 70.826  6.405   22.937  1.00 46.87  ?  490  GLU C OE1   1 
ATOM   9606  O OE2   . GLU C 1 493 ? 70.276  4.498   21.999  1.00 49.92  -1 490  GLU C OE2   1 
ATOM   9607  N N     . LYS C 1 494 ? 66.148  6.865   19.753  1.00 39.90  ?  491  LYS C N     1 
ATOM   9608  C CA    . LYS C 1 494 ? 66.115  8.130   19.026  1.00 36.37  ?  491  LYS C CA    1 
ATOM   9609  C C     . LYS C 1 494 ? 64.809  8.875   19.277  1.00 35.75  ?  491  LYS C C     1 
ATOM   9610  O O     . LYS C 1 494 ? 64.810  10.074  19.580  1.00 33.59  ?  491  LYS C O     1 
ATOM   9611  C CB    . LYS C 1 494 ? 66.314  7.857   17.535  1.00 35.53  ?  491  LYS C CB    1 
ATOM   9612  C CG    . LYS C 1 494 ? 66.471  9.082   16.660  1.00 48.83  ?  491  LYS C CG    1 
ATOM   9613  C CD    . LYS C 1 494 ? 66.759  8.652   15.226  1.00 59.05  ?  491  LYS C CD    1 
ATOM   9614  C CE    . LYS C 1 494 ? 67.059  9.835   14.325  1.00 64.09  ?  491  LYS C CE    1 
ATOM   9615  N NZ    . LYS C 1 494 ? 65.865  10.701  14.130  1.00 67.16  1  491  LYS C NZ    1 
ATOM   9616  N N     . GLU C 1 495 ? 63.679  8.175   19.158  1.00 32.95  ?  492  GLU C N     1 
ATOM   9617  C CA    . GLU C 1 495 ? 62.392  8.803   19.440  1.00 41.56  ?  492  GLU C CA    1 
ATOM   9618  C C     . GLU C 1 495 ? 62.262  9.158   20.915  1.00 39.11  ?  492  GLU C C     1 
ATOM   9619  O O     . GLU C 1 495 ? 61.649  10.174  21.261  1.00 34.79  ?  492  GLU C O     1 
ATOM   9620  C CB    . GLU C 1 495 ? 61.252  7.884   19.003  1.00 27.61  ?  492  GLU C CB    1 
ATOM   9621  C CG    . GLU C 1 495 ? 61.150  7.701   17.498  1.00 42.98  ?  492  GLU C CG    1 
ATOM   9622  C CD    . GLU C 1 495 ? 60.790  8.988   16.777  1.00 53.20  ?  492  GLU C CD    1 
ATOM   9623  O OE1   . GLU C 1 495 ? 60.196  9.886   17.414  1.00 43.62  ?  492  GLU C OE1   1 
ATOM   9624  O OE2   . GLU C 1 495 ? 61.102  9.101   15.573  1.00 55.38  -1 492  GLU C OE2   1 
ATOM   9625  N N     . TYR C 1 496 ? 62.836  8.334   21.795  1.00 35.17  ?  493  TYR C N     1 
ATOM   9626  C CA    . TYR C 1 496 ? 62.778  8.617   23.226  1.00 38.95  ?  493  TYR C CA    1 
ATOM   9627  C C     . TYR C 1 496 ? 63.468  9.935   23.554  1.00 40.01  ?  493  TYR C C     1 
ATOM   9628  O O     . TYR C 1 496 ? 62.932  10.761  24.302  1.00 40.02  ?  493  TYR C O     1 
ATOM   9629  C CB    . TYR C 1 496 ? 63.410  7.471   24.017  1.00 41.38  ?  493  TYR C CB    1 
ATOM   9630  C CG    . TYR C 1 496 ? 63.625  7.795   25.478  1.00 44.74  ?  493  TYR C CG    1 
ATOM   9631  C CD1   . TYR C 1 496 ? 62.549  8.060   26.314  1.00 36.68  ?  493  TYR C CD1   1 
ATOM   9632  C CD2   . TYR C 1 496 ? 64.903  7.836   26.023  1.00 34.57  ?  493  TYR C CD2   1 
ATOM   9633  C CE1   . TYR C 1 496 ? 62.738  8.360   27.650  1.00 32.03  ?  493  TYR C CE1   1 
ATOM   9634  C CE2   . TYR C 1 496 ? 65.101  8.134   27.359  1.00 37.46  ?  493  TYR C CE2   1 
ATOM   9635  C CZ    . TYR C 1 496 ? 64.014  8.395   28.168  1.00 40.36  ?  493  TYR C CZ    1 
ATOM   9636  O OH    . TYR C 1 496 ? 64.201  8.692   29.499  1.00 43.56  ?  493  TYR C OH    1 
ATOM   9637  N N     . ILE C 1 497 ? 64.662  10.151  22.997  1.00 37.70  ?  494  ILE C N     1 
ATOM   9638  C CA    . ILE C 1 497 ? 65.383  11.398  23.237  1.00 40.88  ?  494  ILE C CA    1 
ATOM   9639  C C     . ILE C 1 497 ? 64.593  12.585  22.697  1.00 36.06  ?  494  ILE C C     1 
ATOM   9640  O O     . ILE C 1 497 ? 64.612  13.677  23.278  1.00 32.03  ?  494  ILE C O     1 
ATOM   9641  C CB    . ILE C 1 497 ? 66.794  11.322  22.622  1.00 40.98  ?  494  ILE C CB    1 
ATOM   9642  C CG1   . ILE C 1 497 ? 67.550  10.116  23.182  1.00 46.94  ?  494  ILE C CG1   1 
ATOM   9643  C CG2   . ILE C 1 497 ? 67.577  12.597  22.902  1.00 41.97  ?  494  ILE C CG2   1 
ATOM   9644  C CD1   . ILE C 1 497 ? 68.874  9.849   22.495  1.00 51.96  ?  494  ILE C CD1   1 
ATOM   9645  N N     . LYS C 1 498 ? 63.880  12.388  21.585  1.00 40.39  ?  495  LYS C N     1 
ATOM   9646  C CA    . LYS C 1 498 ? 63.024  13.445  21.050  1.00 46.09  ?  495  LYS C CA    1 
ATOM   9647  C C     . LYS C 1 498 ? 61.944  13.835  22.051  1.00 41.41  ?  495  LYS C C     1 
ATOM   9648  O O     . LYS C 1 498 ? 61.736  15.022  22.330  1.00 37.05  ?  495  LYS C O     1 
ATOM   9649  C CB    . LYS C 1 498 ? 62.393  12.992  19.733  1.00 35.45  ?  495  LYS C CB    1 
ATOM   9650  C CG    . LYS C 1 498 ? 63.231  13.250  18.490  1.00 40.10  ?  495  LYS C CG    1 
ATOM   9651  C CD    . LYS C 1 498 ? 62.716  12.412  17.329  1.00 39.29  ?  495  LYS C CD    1 
ATOM   9652  C CE    . LYS C 1 498 ? 63.084  13.003  15.980  1.00 54.78  ?  495  LYS C CE    1 
ATOM   9653  N NZ    . LYS C 1 498 ? 62.115  14.045  15.534  1.00 53.49  1  495  LYS C NZ    1 
ATOM   9654  N N     . ALA C 1 499 ? 61.237  12.843  22.596  1.00 28.89  ?  496  ALA C N     1 
ATOM   9655  C CA    . ALA C 1 499 ? 60.239  13.119  23.624  1.00 37.92  ?  496  ALA C CA    1 
ATOM   9656  C C     . ALA C 1 499 ? 60.885  13.753  24.848  1.00 43.78  ?  496  ALA C C     1 
ATOM   9657  O O     . ALA C 1 499 ? 60.359  14.718  25.416  1.00 34.68  ?  496  ALA C O     1 
ATOM   9658  C CB    . ALA C 1 499 ? 59.509  11.831  24.003  1.00 33.83  ?  496  ALA C CB    1 
ATOM   9659  N N     . PHE C 1 500 ? 62.033  13.215  25.265  1.00 42.36  ?  497  PHE C N     1 
ATOM   9660  C CA    . PHE C 1 500 ? 62.796  13.791  26.367  1.00 44.18  ?  497  PHE C CA    1 
ATOM   9661  C C     . PHE C 1 500 ? 63.086  15.268  26.120  1.00 33.44  ?  497  PHE C C     1 
ATOM   9662  O O     . PHE C 1 500 ? 62.851  16.115  26.989  1.00 35.78  ?  497  PHE C O     1 
ATOM   9663  C CB    . PHE C 1 500 ? 64.099  13.006  26.543  1.00 43.73  ?  497  PHE C CB    1 
ATOM   9664  C CG    . PHE C 1 500 ? 64.676  13.065  27.930  1.00 40.47  ?  497  PHE C CG    1 
ATOM   9665  C CD1   . PHE C 1 500 ? 65.366  14.186  28.366  1.00 35.58  ?  497  PHE C CD1   1 
ATOM   9666  C CD2   . PHE C 1 500 ? 64.557  11.982  28.787  1.00 28.65  ?  497  PHE C CD2   1 
ATOM   9667  C CE1   . PHE C 1 500 ? 65.909  14.231  29.638  1.00 41.21  ?  497  PHE C CE1   1 
ATOM   9668  C CE2   . PHE C 1 500 ? 65.095  12.022  30.057  1.00 42.90  ?  497  PHE C CE2   1 
ATOM   9669  C CZ    . PHE C 1 500 ? 65.773  13.148  30.484  1.00 45.75  ?  497  PHE C CZ    1 
ATOM   9670  N N     . GLU C 1 501 ? 63.594  15.593  24.927  1.00 30.34  ?  498  GLU C N     1 
ATOM   9671  C CA    . GLU C 1 501 ? 63.929  16.980  24.616  1.00 34.08  ?  498  GLU C CA    1 
ATOM   9672  C C     . GLU C 1 501 ? 62.690  17.864  24.555  1.00 38.58  ?  498  GLU C C     1 
ATOM   9673  O O     . GLU C 1 501 ? 62.771  19.061  24.855  1.00 28.72  ?  498  GLU C O     1 
ATOM   9674  C CB    . GLU C 1 501 ? 64.702  17.053  23.299  1.00 37.22  ?  498  GLU C CB    1 
ATOM   9675  C CG    . GLU C 1 501 ? 66.107  16.475  23.379  1.00 47.58  ?  498  GLU C CG    1 
ATOM   9676  C CD    . GLU C 1 501 ? 66.958  17.157  24.433  1.00 48.88  ?  498  GLU C CD    1 
ATOM   9677  O OE1   . GLU C 1 501 ? 66.957  18.406  24.483  1.00 48.83  ?  498  GLU C OE1   1 
ATOM   9678  O OE2   . GLU C 1 501 ? 67.618  16.445  25.218  1.00 55.90  -1 498  GLU C OE2   1 
ATOM   9679  N N     . LYS C 1 502 ? 61.542  17.300  24.169  1.00 34.45  ?  499  LYS C N     1 
ATOM   9680  C CA    . LYS C 1 502 ? 60.307  18.077  24.164  1.00 38.65  ?  499  LYS C CA    1 
ATOM   9681  C C     . LYS C 1 502 ? 59.927  18.516  25.572  1.00 33.90  ?  499  LYS C C     1 
ATOM   9682  O O     . LYS C 1 502 ? 59.466  19.646  25.772  1.00 24.88  ?  499  LYS C O     1 
ATOM   9683  C CB    . LYS C 1 502 ? 59.177  17.270  23.522  1.00 38.95  ?  499  LYS C CB    1 
ATOM   9684  C CG    . LYS C 1 502 ? 59.151  17.356  22.005  1.00 47.51  ?  499  LYS C CG    1 
ATOM   9685  C CD    . LYS C 1 502 ? 58.857  18.776  21.550  1.00 46.91  ?  499  LYS C CD    1 
ATOM   9686  C CE    . LYS C 1 502 ? 59.782  19.191  20.420  1.00 52.38  ?  499  LYS C CE    1 
ATOM   9687  N NZ    . LYS C 1 502 ? 59.575  18.374  19.198  1.00 43.21  1  499  LYS C NZ    1 
ATOM   9688  N N     . TYR C 1 503 ? 60.115  17.639  26.561  1.00 25.97  ?  500  TYR C N     1 
ATOM   9689  C CA    . TYR C 1 503 ? 59.875  18.032  27.946  1.00 31.82  ?  500  TYR C CA    1 
ATOM   9690  C C     . TYR C 1 503 ? 60.792  19.179  28.348  1.00 32.64  ?  500  TYR C C     1 
ATOM   9691  O O     . TYR C 1 503 ? 60.336  20.192  28.892  1.00 31.81  ?  500  TYR C O     1 
ATOM   9692  C CB    . TYR C 1 503 ? 60.072  16.839  28.887  1.00 27.57  ?  500  TYR C CB    1 
ATOM   9693  C CG    . TYR C 1 503 ? 59.816  17.164  30.351  1.00 30.79  ?  500  TYR C CG    1 
ATOM   9694  C CD1   . TYR C 1 503 ? 60.754  17.863  31.107  1.00 26.30  ?  500  TYR C CD1   1 
ATOM   9695  C CD2   . TYR C 1 503 ? 58.639  16.769  30.977  1.00 26.67  ?  500  TYR C CD2   1 
ATOM   9696  C CE1   . TYR C 1 503 ? 60.528  18.167  32.429  1.00 23.71  ?  500  TYR C CE1   1 
ATOM   9697  C CE2   . TYR C 1 503 ? 58.406  17.067  32.311  1.00 28.06  ?  500  TYR C CE2   1 
ATOM   9698  C CZ    . TYR C 1 503 ? 59.357  17.768  33.029  1.00 32.12  ?  500  TYR C CZ    1 
ATOM   9699  O OH    . TYR C 1 503 ? 59.147  18.076  34.352  1.00 27.01  ?  500  TYR C OH    1 
ATOM   9700  N N     . ILE C 1 504 ? 62.098  19.017  28.116  1.00 34.32  ?  501  ILE C N     1 
ATOM   9701  C CA    . ILE C 1 504 ? 63.055  20.079  28.416  1.00 33.34  ?  501  ILE C CA    1 
ATOM   9702  C C     . ILE C 1 504 ? 62.658  21.363  27.705  1.00 35.18  ?  501  ILE C C     1 
ATOM   9703  O O     . ILE C 1 504 ? 62.734  22.457  28.276  1.00 32.98  ?  501  ILE C O     1 
ATOM   9704  C CB    . ILE C 1 504 ? 64.479  19.637  28.026  1.00 40.44  ?  501  ILE C CB    1 
ATOM   9705  C CG1   . ILE C 1 504 ? 64.891  18.390  28.814  1.00 35.75  ?  501  ILE C CG1   1 
ATOM   9706  C CG2   . ILE C 1 504 ? 65.471  20.774  28.237  1.00 27.30  ?  501  ILE C CG2   1 
ATOM   9707  C CD1   . ILE C 1 504 ? 66.172  17.750  28.317  1.00 36.87  ?  501  ILE C CD1   1 
ATOM   9708  N N     . GLU C 1 505 ? 62.214  21.244  26.452  1.00 27.77  ?  502  GLU C N     1 
ATOM   9709  C CA    . GLU C 1 505 ? 61.776  22.409  25.696  1.00 28.25  ?  502  GLU C CA    1 
ATOM   9710  C C     . GLU C 1 505 ? 60.652  23.149  26.412  1.00 37.56  ?  502  GLU C C     1 
ATOM   9711  O O     . GLU C 1 505 ? 60.612  24.385  26.413  1.00 33.92  ?  502  GLU C O     1 
ATOM   9712  C CB    . GLU C 1 505 ? 61.329  21.968  24.304  1.00 37.60  ?  502  GLU C CB    1 
ATOM   9713  C CG    . GLU C 1 505 ? 60.949  23.091  23.376  1.00 42.44  ?  502  GLU C CG    1 
ATOM   9714  C CD    . GLU C 1 505 ? 60.732  22.601  21.964  1.00 48.38  ?  502  GLU C CD    1 
ATOM   9715  O OE1   . GLU C 1 505 ? 59.642  22.060  21.683  1.00 51.63  ?  502  GLU C OE1   1 
ATOM   9716  O OE2   . GLU C 1 505 ? 61.658  22.745  21.140  1.00 59.28  -1 502  GLU C OE2   1 
ATOM   9717  N N     . LYS C 1 506 ? 59.736  22.412  27.040  1.00 34.62  ?  503  LYS C N     1 
ATOM   9718  C CA    . LYS C 1 506 ? 58.591  23.060  27.667  1.00 32.78  ?  503  LYS C CA    1 
ATOM   9719  C C     . LYS C 1 506 ? 58.914  23.568  29.068  1.00 35.55  ?  503  LYS C C     1 
ATOM   9720  O O     . LYS C 1 506 ? 58.496  24.671  29.438  1.00 35.16  ?  503  LYS C O     1 
ATOM   9721  C CB    . LYS C 1 506 ? 57.403  22.102  27.716  1.00 23.97  ?  503  LYS C CB    1 
ATOM   9722  C CG    . LYS C 1 506 ? 56.174  22.704  28.377  1.00 25.87  ?  503  LYS C CG    1 
ATOM   9723  C CD    . LYS C 1 506 ? 54.940  21.865  28.124  1.00 22.74  ?  503  LYS C CD    1 
ATOM   9724  C CE    . LYS C 1 506 ? 53.699  22.552  28.664  1.00 23.66  ?  503  LYS C CE    1 
ATOM   9725  N NZ    . LYS C 1 506 ? 52.496  21.690  28.531  1.00 25.74  1  503  LYS C NZ    1 
ATOM   9726  N N     . PHE C 1 507 ? 59.651  22.789  29.860  1.00 27.74  ?  504  PHE C N     1 
ATOM   9727  C CA    . PHE C 1 507 ? 59.844  23.099  31.269  1.00 30.79  ?  504  PHE C CA    1 
ATOM   9728  C C     . PHE C 1 507 ? 61.249  23.587  31.606  1.00 30.74  ?  504  PHE C C     1 
ATOM   9729  O O     . PHE C 1 507 ? 61.519  23.883  32.774  1.00 34.53  ?  504  PHE C O     1 
ATOM   9730  C CB    . PHE C 1 507 ? 59.492  21.873  32.120  1.00 23.41  ?  504  PHE C CB    1 
ATOM   9731  C CG    . PHE C 1 507 ? 58.084  21.381  31.910  1.00 28.62  ?  504  PHE C CG    1 
ATOM   9732  C CD1   . PHE C 1 507 ? 57.006  22.092  32.413  1.00 31.80  ?  504  PHE C CD1   1 
ATOM   9733  C CD2   . PHE C 1 507 ? 57.840  20.214  31.209  1.00 23.03  ?  504  PHE C CD2   1 
ATOM   9734  C CE1   . PHE C 1 507 ? 55.709  21.647  32.221  1.00 26.36  ?  504  PHE C CE1   1 
ATOM   9735  C CE2   . PHE C 1 507 ? 56.546  19.762  31.014  1.00 33.75  ?  504  PHE C CE2   1 
ATOM   9736  C CZ    . PHE C 1 507 ? 55.479  20.480  31.522  1.00 27.37  ?  504  PHE C CZ    1 
ATOM   9737  N N     . ASN C 1 508 ? 62.146  23.677  30.621  1.00 40.80  ?  505  ASN C N     1 
ATOM   9738  C CA    . ASN C 1 508 ? 63.502  24.196  30.788  1.00 48.47  ?  505  ASN C CA    1 
ATOM   9739  C C     . ASN C 1 508 ? 64.344  23.351  31.739  1.00 54.40  ?  505  ASN C C     1 
ATOM   9740  O O     . ASN C 1 508 ? 65.483  23.713  32.052  1.00 45.71  ?  505  ASN C O     1 
ATOM   9741  C CB    . ASN C 1 508 ? 63.476  25.653  31.269  1.00 51.47  ?  505  ASN C CB    1 
ATOM   9742  C CG    . ASN C 1 508 ? 64.802  26.365  31.051  1.00 56.76  ?  505  ASN C CG    1 
ATOM   9743  O OD1   . ASN C 1 508 ? 65.580  25.990  30.171  1.00 67.82  ?  505  ASN C OD1   1 
ATOM   9744  N ND2   . ASN C 1 508 ? 65.071  27.385  31.855  1.00 40.60  ?  505  ASN C ND2   1 
ATOM   9745  N N     . VAL C 1 509 ? 63.812  22.218  32.192  1.00 55.54  ?  506  VAL C N     1 
ATOM   9746  C CA    . VAL C 1 509 ? 64.544  21.314  33.067  1.00 41.54  ?  506  VAL C CA    1 
ATOM   9747  C C     . VAL C 1 509 ? 64.322  19.885  32.597  1.00 38.46  ?  506  VAL C C     1 
ATOM   9748  O O     . VAL C 1 509 ? 63.304  19.563  31.979  1.00 40.10  ?  506  VAL C O     1 
ATOM   9749  C CB    . VAL C 1 509 ? 64.131  21.471  34.548  1.00 43.85  ?  506  VAL C CB    1 
ATOM   9750  C CG1   . VAL C 1 509 ? 64.773  22.714  35.153  1.00 38.85  ?  506  VAL C CG1   1 
ATOM   9751  C CG2   . VAL C 1 509 ? 62.615  21.529  34.678  1.00 41.15  ?  506  VAL C CG2   1 
ATOM   9752  N N     . SER C 1 510 ? 65.300  19.032  32.881  1.00 38.61  ?  507  SER C N     1 
ATOM   9753  C CA    . SER C 1 510 ? 65.157  17.614  32.612  1.00 41.91  ?  507  SER C CA    1 
ATOM   9754  C C     . SER C 1 510 ? 64.060  17.026  33.496  1.00 41.35  ?  507  SER C C     1 
ATOM   9755  O O     . SER C 1 510 ? 63.843  17.492  34.619  1.00 31.40  ?  507  SER C O     1 
ATOM   9756  C CB    . SER C 1 510 ? 66.479  16.891  32.866  1.00 49.56  ?  507  SER C CB    1 
ATOM   9757  O OG    . SER C 1 510 ? 66.376  15.503  32.608  1.00 63.95  ?  507  SER C OG    1 
ATOM   9758  N N     . PRO C 1 511 ? 63.337  16.022  33.004  1.00 30.78  ?  508  PRO C N     1 
ATOM   9759  C CA    . PRO C 1 511 ? 62.356  15.344  33.858  1.00 34.28  ?  508  PRO C CA    1 
ATOM   9760  C C     . PRO C 1 511 ? 63.052  14.651  35.019  1.00 31.22  ?  508  PRO C C     1 
ATOM   9761  O O     . PRO C 1 511 ? 64.129  14.069  34.862  1.00 32.61  ?  508  PRO C O     1 
ATOM   9762  C CB    . PRO C 1 511 ? 61.696  14.327  32.917  1.00 34.51  ?  508  PRO C CB    1 
ATOM   9763  C CG    . PRO C 1 511 ? 62.067  14.754  31.534  1.00 42.77  ?  508  PRO C CG    1 
ATOM   9764  C CD    . PRO C 1 511 ? 63.372  15.468  31.643  1.00 34.24  ?  508  PRO C CD    1 
ATOM   9765  N N     . GLU C 1 512 ? 62.436  14.730  36.198  1.00 33.14  ?  509  GLU C N     1 
ATOM   9766  C CA    . GLU C 1 512 ? 63.024  14.075  37.361  1.00 36.02  ?  509  GLU C CA    1 
ATOM   9767  C C     . GLU C 1 512 ? 62.827  12.564  37.296  1.00 37.93  ?  509  GLU C C     1 
ATOM   9768  O O     . GLU C 1 512 ? 63.712  11.798  37.699  1.00 33.56  ?  509  GLU C O     1 
ATOM   9769  C CB    . GLU C 1 512 ? 62.424  14.648  38.647  1.00 37.03  ?  509  GLU C CB    1 
ATOM   9770  C CG    . GLU C 1 512 ? 63.085  14.146  39.926  1.00 51.32  ?  509  GLU C CG    1 
ATOM   9771  C CD    . GLU C 1 512 ? 64.465  14.739  40.156  1.00 58.52  ?  509  GLU C CD    1 
ATOM   9772  O OE1   . GLU C 1 512 ? 64.837  15.694  39.438  1.00 61.78  ?  509  GLU C OE1   1 
ATOM   9773  O OE2   . GLU C 1 512 ? 65.178  14.250  41.058  1.00 50.70  -1 509  GLU C OE2   1 
ATOM   9774  N N     . ASN C 1 513 ? 61.676  12.121  36.790  1.00 37.58  ?  510  ASN C N     1 
ATOM   9775  C CA    . ASN C 1 513 ? 61.382  10.706  36.634  1.00 37.23  ?  510  ASN C CA    1 
ATOM   9776  C C     . ASN C 1 513 ? 60.737  10.484  35.274  1.00 36.67  ?  510  ASN C C     1 
ATOM   9777  O O     . ASN C 1 513 ? 60.013  11.343  34.767  1.00 34.30  ?  510  ASN C O     1 
ATOM   9778  C CB    . ASN C 1 513 ? 60.453  10.197  37.744  1.00 30.07  ?  510  ASN C CB    1 
ATOM   9779  C CG    . ASN C 1 513 ? 60.932  10.584  39.130  1.00 28.03  ?  510  ASN C CG    1 
ATOM   9780  O OD1   . ASN C 1 513 ? 61.741  9.885   39.735  1.00 26.96  ?  510  ASN C OD1   1 
ATOM   9781  N ND2   . ASN C 1 513 ? 60.437  11.708  39.636  1.00 35.35  ?  510  ASN C ND2   1 
ATOM   9782  N N     . VAL C 1 514 ? 61.009  9.321   34.688  1.00 39.38  ?  511  VAL C N     1 
ATOM   9783  C CA    . VAL C 1 514 ? 60.485  8.951   33.377  1.00 29.62  ?  511  VAL C CA    1 
ATOM   9784  C C     . VAL C 1 514 ? 59.656  7.684   33.533  1.00 29.53  ?  511  VAL C C     1 
ATOM   9785  O O     . VAL C 1 514 ? 60.178  6.640   33.945  1.00 30.29  ?  511  VAL C O     1 
ATOM   9786  C CB    . VAL C 1 514 ? 61.605  8.744   32.346  1.00 36.83  ?  511  VAL C CB    1 
ATOM   9787  C CG1   . VAL C 1 514 ? 61.014  8.376   31.001  1.00 33.24  ?  511  VAL C CG1   1 
ATOM   9788  C CG2   . VAL C 1 514 ? 62.457  9.996   32.231  1.00 36.03  ?  511  VAL C CG2   1 
ATOM   9789  N N     . PHE C 1 515 ? 58.369  7.779   33.210  1.00 27.65  ?  512  PHE C N     1 
ATOM   9790  C CA    . PHE C 1 515 ? 57.463  6.634   33.203  1.00 27.11  ?  512  PHE C CA    1 
ATOM   9791  C C     . PHE C 1 515 ? 57.417  6.073   31.786  1.00 30.19  ?  512  PHE C C     1 
ATOM   9792  O O     . PHE C 1 515 ? 56.931  6.740   30.868  1.00 26.01  ?  512  PHE C O     1 
ATOM   9793  C CB    . PHE C 1 515 ? 56.067  7.047   33.663  1.00 24.74  ?  512  PHE C CB    1 
ATOM   9794  C CG    . PHE C 1 515 ? 55.956  7.315   35.139  1.00 26.71  ?  512  PHE C CG    1 
ATOM   9795  C CD1   . PHE C 1 515 ? 56.627  8.378   35.721  1.00 23.15  ?  512  PHE C CD1   1 
ATOM   9796  C CD2   . PHE C 1 515 ? 55.150  6.521   35.939  1.00 24.62  ?  512  PHE C CD2   1 
ATOM   9797  C CE1   . PHE C 1 515 ? 56.514  8.630   37.077  1.00 25.20  ?  512  PHE C CE1   1 
ATOM   9798  C CE2   . PHE C 1 515 ? 55.034  6.767   37.296  1.00 24.90  ?  512  PHE C CE2   1 
ATOM   9799  C CZ    . PHE C 1 515 ? 55.716  7.824   37.865  1.00 28.09  ?  512  PHE C CZ    1 
ATOM   9800  N N     . ILE C 1 516 ? 57.918  4.856   31.603  1.00 31.01  ?  513  ILE C N     1 
ATOM   9801  C CA    . ILE C 1 516 ? 57.902  4.187   30.307  1.00 30.58  ?  513  ILE C CA    1 
ATOM   9802  C C     . ILE C 1 516 ? 56.823  3.115   30.375  1.00 29.64  ?  513  ILE C C     1 
ATOM   9803  O O     . ILE C 1 516 ? 57.021  2.049   30.971  1.00 38.12  ?  513  ILE C O     1 
ATOM   9804  C CB    . ILE C 1 516 ? 59.268  3.596   29.941  1.00 34.76  ?  513  ILE C CB    1 
ATOM   9805  C CG1   . ILE C 1 516 ? 60.309  4.709   29.813  1.00 29.34  ?  513  ILE C CG1   1 
ATOM   9806  C CG2   . ILE C 1 516 ? 59.184  2.811   28.637  1.00 35.37  ?  513  ILE C CG2   1 
ATOM   9807  C CD1   . ILE C 1 516 ? 59.950  5.751   28.787  1.00 33.28  ?  513  ILE C CD1   1 
ATOM   9808  N N     . LEU C 1 517 ? 55.673  3.400   29.771  1.00 25.94  ?  514  LEU C N     1 
ATOM   9809  C CA    . LEU C 1 517 ? 54.534  2.492   29.765  1.00 25.19  ?  514  LEU C CA    1 
ATOM   9810  C C     . LEU C 1 517 ? 54.489  1.772   28.421  1.00 33.90  ?  514  LEU C C     1 
ATOM   9811  O O     . LEU C 1 517 ? 54.446  2.417   27.368  1.00 30.39  ?  514  LEU C O     1 
ATOM   9812  C CB    . LEU C 1 517 ? 53.234  3.255   30.018  1.00 23.77  ?  514  LEU C CB    1 
ATOM   9813  C CG    . LEU C 1 517 ? 53.291  4.374   31.063  1.00 28.42  ?  514  LEU C CG    1 
ATOM   9814  C CD1   . LEU C 1 517 ? 51.940  5.063   31.169  1.00 23.90  ?  514  LEU C CD1   1 
ATOM   9815  C CD2   . LEU C 1 517 ? 53.739  3.848   32.422  1.00 28.32  ?  514  LEU C CD2   1 
ATOM   9816  N N     . ARG C 1 518 ? 54.494  0.444   28.459  1.00 26.12  ?  515  ARG C N     1 
ATOM   9817  C CA    . ARG C 1 518 ? 54.571  -0.378  27.260  1.00 29.53  ?  515  ARG C CA    1 
ATOM   9818  C C     . ARG C 1 518 ? 53.255  -1.112  27.038  1.00 32.17  ?  515  ARG C C     1 
ATOM   9819  O O     . ARG C 1 518 ? 52.698  -1.699  27.972  1.00 25.69  ?  515  ARG C O     1 
ATOM   9820  C CB    . ARG C 1 518 ? 55.723  -1.380  27.369  1.00 29.55  ?  515  ARG C CB    1 
ATOM   9821  C CG    . ARG C 1 518 ? 55.812  -2.396  26.239  1.00 35.28  ?  515  ARG C CG    1 
ATOM   9822  C CD    . ARG C 1 518 ? 56.234  -1.762  24.924  1.00 39.55  ?  515  ARG C CD    1 
ATOM   9823  N NE    . ARG C 1 518 ? 56.404  -2.763  23.871  1.00 48.70  ?  515  ARG C NE    1 
ATOM   9824  C CZ    . ARG C 1 518 ? 57.577  -3.265  23.496  1.00 49.94  ?  515  ARG C CZ    1 
ATOM   9825  N NH1   . ARG C 1 518 ? 58.695  -2.855  24.079  1.00 44.25  1  515  ARG C NH1   1 
ATOM   9826  N NH2   . ARG C 1 518 ? 57.632  -4.173  22.530  1.00 43.20  ?  515  ARG C NH2   1 
ATOM   9827  N N     . ASP C 1 519 ? 52.762  -1.070  25.801  1.00 28.86  ?  516  ASP C N     1 
ATOM   9828  C CA    . ASP C 1 519 ? 51.625  -1.890  25.391  1.00 26.89  ?  516  ASP C CA    1 
ATOM   9829  C C     . ASP C 1 519 ? 52.080  -3.342  25.386  1.00 33.28  ?  516  ASP C C     1 
ATOM   9830  O O     . ASP C 1 519 ? 52.702  -3.808  24.430  1.00 37.25  ?  516  ASP C O     1 
ATOM   9831  C CB    . ASP C 1 519 ? 51.124  -1.460  24.016  1.00 31.58  ?  516  ASP C CB    1 
ATOM   9832  C CG    . ASP C 1 519 ? 49.884  -2.225  23.568  1.00 40.97  ?  516  ASP C CG    1 
ATOM   9833  O OD1   . ASP C 1 519 ? 49.438  -3.147  24.285  1.00 46.78  ?  516  ASP C OD1   1 
ATOM   9834  O OD2   . ASP C 1 519 ? 49.355  -1.906  22.483  1.00 35.90  -1 516  ASP C OD2   1 
ATOM   9835  N N     . GLY C 1 520 ? 51.772  -4.063  26.452  1.00 36.43  ?  517  GLY C N     1 
ATOM   9836  C CA    . GLY C 1 520 ? 52.204  -5.437  26.571  1.00 37.34  ?  517  GLY C CA    1 
ATOM   9837  C C     . GLY C 1 520 ? 53.570  -5.549  27.219  1.00 41.48  ?  517  GLY C C     1 
ATOM   9838  O O     . GLY C 1 520 ? 54.050  -4.651  27.917  1.00 42.31  ?  517  GLY C O     1 
ATOM   9839  N N     . ARG C 1 521 ? 54.209  -6.681  26.963  1.00 44.15  ?  518  ARG C N     1 
ATOM   9840  C CA    . ARG C 1 521 ? 55.479  -7.013  27.586  1.00 45.78  ?  518  ARG C CA    1 
ATOM   9841  C C     . ARG C 1 521 ? 56.649  -6.482  26.764  1.00 41.77  ?  518  ARG C C     1 
ATOM   9842  O O     . ARG C 1 521 ? 56.547  -6.293  25.548  1.00 44.88  ?  518  ARG C O     1 
ATOM   9843  C CB    . ARG C 1 521 ? 55.603  -8.528  27.741  1.00 51.19  ?  518  ARG C CB    1 
ATOM   9844  C CG    . ARG C 1 521 ? 55.670  -9.242  26.410  1.00 63.65  ?  518  ARG C CG    1 
ATOM   9845  C CD    . ARG C 1 521 ? 54.829  -10.500 26.373  1.00 74.25  ?  518  ARG C CD    1 
ATOM   9846  N NE    . ARG C 1 521 ? 54.694  -10.990 25.004  1.00 74.27  ?  518  ARG C NE    1 
ATOM   9847  C CZ    . ARG C 1 521 ? 53.592  -11.553 24.520  1.00 69.27  ?  518  ARG C CZ    1 
ATOM   9848  N NH1   . ARG C 1 521 ? 52.524  -11.692 25.294  1.00 64.96  1  518  ARG C NH1   1 
ATOM   9849  N NH2   . ARG C 1 521 ? 53.554  -11.967 23.261  1.00 69.98  ?  518  ARG C NH2   1 
ATOM   9850  N N     . PHE C 1 522 ? 57.767  -6.238  27.448  1.00 34.38  ?  519  PHE C N     1 
ATOM   9851  C CA    . PHE C 1 522 ? 59.031  -5.956  26.777  1.00 41.50  ?  519  PHE C CA    1 
ATOM   9852  C C     . PHE C 1 522 ? 59.638  -7.268  26.294  1.00 42.36  ?  519  PHE C C     1 
ATOM   9853  O O     . PHE C 1 522 ? 59.929  -8.155  27.101  1.00 39.16  ?  519  PHE C O     1 
ATOM   9854  C CB    . PHE C 1 522 ? 60.005  -5.244  27.715  1.00 41.15  ?  519  PHE C CB    1 
ATOM   9855  C CG    . PHE C 1 522 ? 59.649  -3.812  28.009  1.00 35.60  ?  519  PHE C CG    1 
ATOM   9856  C CD1   . PHE C 1 522 ? 58.822  -3.495  29.071  1.00 35.60  ?  519  PHE C CD1   1 
ATOM   9857  C CD2   . PHE C 1 522 ? 60.165  -2.781  27.241  1.00 36.85  ?  519  PHE C CD2   1 
ATOM   9858  C CE1   . PHE C 1 522 ? 58.502  -2.180  29.357  1.00 38.30  ?  519  PHE C CE1   1 
ATOM   9859  C CE2   . PHE C 1 522 ? 59.844  -1.460  27.520  1.00 35.93  ?  519  PHE C CE2   1 
ATOM   9860  C CZ    . PHE C 1 522 ? 59.013  -1.162  28.579  1.00 37.11  ?  519  PHE C CZ    1 
ATOM   9861  N N     . ILE C 1 523 ? 59.820  -7.396  24.981  1.00 50.39  ?  520  ILE C N     1 
ATOM   9862  C CA    . ILE C 1 523 ? 60.505  -8.536  24.379  1.00 50.12  ?  520  ILE C CA    1 
ATOM   9863  C C     . ILE C 1 523 ? 61.843  -8.133  23.767  1.00 55.91  ?  520  ILE C C     1 
ATOM   9864  O O     . ILE C 1 523 ? 62.560  -8.987  23.226  1.00 56.78  ?  520  ILE C O     1 
ATOM   9865  C CB    . ILE C 1 523 ? 59.596  -9.242  23.348  1.00 54.41  ?  520  ILE C CB    1 
ATOM   9866  C CG1   . ILE C 1 523 ? 58.292  -9.644  24.015  1.00 57.09  ?  520  ILE C CG1   1 
ATOM   9867  C CG2   . ILE C 1 523 ? 60.197  -10.544 22.830  1.00 63.46  ?  520  ILE C CG2   1 
ATOM   9868  C CD1   . ILE C 1 523 ? 58.494  -10.723 25.070  1.00 62.24  ?  520  ILE C CD1   1 
ATOM   9869  N N     . GLU C 1 524 ? 62.227  -6.869  23.882  1.00 54.39  ?  521  GLU C N     1 
ATOM   9870  C CA    . GLU C 1 524 ? 63.494  -6.406  23.345  1.00 49.68  ?  521  GLU C CA    1 
ATOM   9871  C C     . GLU C 1 524 ? 64.602  -6.542  24.386  1.00 48.53  ?  521  GLU C C     1 
ATOM   9872  O O     . GLU C 1 524 ? 64.366  -6.877  25.548  1.00 51.99  ?  521  GLU C O     1 
ATOM   9873  C CB    . GLU C 1 524 ? 63.376  -4.951  22.877  1.00 55.03  ?  521  GLU C CB    1 
ATOM   9874  C CG    . GLU C 1 524 ? 62.354  -4.723  21.771  1.00 57.12  ?  521  GLU C CG    1 
ATOM   9875  C CD    . GLU C 1 524 ? 60.931  -4.628  22.288  1.00 55.10  ?  521  GLU C CD    1 
ATOM   9876  O OE1   . GLU C 1 524 ? 60.749  -4.385  23.499  1.00 52.48  ?  521  GLU C OE1   1 
ATOM   9877  O OE2   . GLU C 1 524 ? 59.994  -4.802  21.480  1.00 53.58  ?  521  GLU C OE2   1 
ATOM   9878  N N     . ASP C 1 525 ? 65.834  -6.285  23.942  1.00 50.58  ?  522  ASP C N     1 
ATOM   9879  C CA    . ASP C 1 525 ? 67.009  -6.321  24.805  1.00 56.02  ?  522  ASP C CA    1 
ATOM   9880  C C     . ASP C 1 525 ? 66.836  -5.335  25.954  1.00 53.71  ?  522  ASP C C     1 
ATOM   9881  O O     . ASP C 1 525 ? 67.073  -4.133  25.792  1.00 51.25  ?  522  ASP C O     1 
ATOM   9882  C CB    . ASP C 1 525 ? 68.268  -6.004  23.991  1.00 58.01  ?  522  ASP C CB    1 
ATOM   9883  C CG    . ASP C 1 525 ? 69.538  -6.491  24.658  1.00 55.79  ?  522  ASP C CG    1 
ATOM   9884  O OD1   . ASP C 1 525 ? 69.627  -6.424  25.902  1.00 49.12  ?  522  ASP C OD1   1 
ATOM   9885  O OD2   . ASP C 1 525 ? 70.455  -6.930  23.932  1.00 59.48  -1 522  ASP C OD2   1 
ATOM   9886  N N     . ILE C 1 526 ? 66.425  -5.837  27.120  1.00 50.07  ?  523  ILE C N     1 
ATOM   9887  C CA    . ILE C 1 526 ? 65.963  -4.952  28.186  1.00 53.85  ?  523  ILE C CA    1 
ATOM   9888  C C     . ILE C 1 526 ? 67.113  -4.121  28.745  1.00 61.15  ?  523  ILE C C     1 
ATOM   9889  O O     . ILE C 1 526 ? 66.935  -2.945  29.089  1.00 47.50  ?  523  ILE C O     1 
ATOM   9890  C CB    . ILE C 1 526 ? 65.250  -5.763  29.285  1.00 49.30  ?  523  ILE C CB    1 
ATOM   9891  C CG1   . ILE C 1 526 ? 64.579  -4.817  30.278  1.00 43.67  ?  523  ILE C CG1   1 
ATOM   9892  C CG2   . ILE C 1 526 ? 66.211  -6.707  30.000  1.00 50.14  ?  523  ILE C CG2   1 
ATOM   9893  C CD1   . ILE C 1 526 ? 63.652  -3.834  29.620  1.00 38.98  ?  523  ILE C CD1   1 
ATOM   9894  N N     . GLU C 1 527 ? 68.312  -4.702  28.830  1.00 69.07  ?  524  GLU C N     1 
ATOM   9895  C CA    . GLU C 1 527 ? 69.442  -3.963  29.383  1.00 59.77  ?  524  GLU C CA    1 
ATOM   9896  C C     . GLU C 1 527 ? 69.860  -2.819  28.468  1.00 52.52  ?  524  GLU C C     1 
ATOM   9897  O O     . GLU C 1 527 ? 70.323  -1.779  28.951  1.00 49.90  ?  524  GLU C O     1 
ATOM   9898  C CB    . GLU C 1 527 ? 70.611  -4.912  29.646  1.00 51.26  ?  524  GLU C CB    1 
ATOM   9899  C CG    . GLU C 1 527 ? 70.310  -5.974  30.700  1.00 48.96  ?  524  GLU C CG    1 
ATOM   9900  C CD    . GLU C 1 527 ? 70.032  -5.380  32.070  1.00 56.74  ?  524  GLU C CD    1 
ATOM   9901  O OE1   . GLU C 1 527 ? 70.614  -4.325  32.397  1.00 61.81  ?  524  GLU C OE1   1 
ATOM   9902  O OE2   . GLU C 1 527 ? 69.224  -5.968  32.820  1.00 58.49  -1 524  GLU C OE2   1 
ATOM   9903  N N     . ILE C 1 528 ? 69.697  -2.986  27.153  1.00 49.09  ?  525  ILE C N     1 
ATOM   9904  C CA    . ILE C 1 528 ? 69.878  -1.866  26.232  1.00 59.53  ?  525  ILE C CA    1 
ATOM   9905  C C     . ILE C 1 528 ? 68.890  -0.755  26.561  1.00 53.42  ?  525  ILE C C     1 
ATOM   9906  O O     . ILE C 1 528 ? 69.253  0.425   26.640  1.00 43.28  ?  525  ILE C O     1 
ATOM   9907  C CB    . ILE C 1 528 ? 69.726  -2.332  24.772  1.00 50.37  ?  525  ILE C CB    1 
ATOM   9908  C CG1   . ILE C 1 528 ? 70.762  -3.406  24.429  1.00 58.04  ?  525  ILE C CG1   1 
ATOM   9909  C CG2   . ILE C 1 528 ? 69.843  -1.152  23.816  1.00 41.91  ?  525  ILE C CG2   1 
ATOM   9910  C CD1   . ILE C 1 528 ? 72.189  -2.911  24.418  1.00 51.49  ?  525  ILE C CD1   1 
ATOM   9911  N N     . ILE C 1 529 ? 67.622  -1.124  26.764  1.00 55.93  ?  526  ILE C N     1 
ATOM   9912  C CA    . ILE C 1 529 ? 66.594  -0.137  27.084  1.00 59.90  ?  526  ILE C CA    1 
ATOM   9913  C C     . ILE C 1 529 ? 66.926  0.571   28.391  1.00 51.51  ?  526  ILE C C     1 
ATOM   9914  O O     . ILE C 1 529 ? 66.996  1.803   28.447  1.00 39.77  ?  526  ILE C O     1 
ATOM   9915  C CB    . ILE C 1 529 ? 65.209  -0.805  27.137  1.00 58.31  ?  526  ILE C CB    1 
ATOM   9916  C CG1   . ILE C 1 529 ? 64.828  -1.335  25.754  1.00 58.22  ?  526  ILE C CG1   1 
ATOM   9917  C CG2   . ILE C 1 529 ? 64.160  0.172   27.649  1.00 42.38  ?  526  ILE C CG2   1 
ATOM   9918  C CD1   . ILE C 1 529 ? 63.606  -2.223  25.746  1.00 54.28  ?  526  ILE C CD1   1 
ATOM   9919  N N     . LYS C 1 530 ? 67.151  -0.203  29.457  1.00 49.59  ?  527  LYS C N     1 
ATOM   9920  C CA    . LYS C 1 530 ? 67.524  0.379   30.744  1.00 49.75  ?  527  LYS C CA    1 
ATOM   9921  C C     . LYS C 1 530 ? 68.699  1.339   30.598  1.00 56.59  ?  527  LYS C C     1 
ATOM   9922  O O     . LYS C 1 530 ? 68.771  2.359   31.293  1.00 50.06  ?  527  LYS C O     1 
ATOM   9923  C CB    . LYS C 1 530 ? 67.868  -0.731  31.739  1.00 50.25  ?  527  LYS C CB    1 
ATOM   9924  C CG    . LYS C 1 530 ? 66.699  -1.629  32.106  1.00 47.44  ?  527  LYS C CG    1 
ATOM   9925  C CD    . LYS C 1 530 ? 67.159  -2.894  32.820  1.00 50.75  ?  527  LYS C CD    1 
ATOM   9926  C CE    . LYS C 1 530 ? 67.830  -2.591  34.153  1.00 58.31  ?  527  LYS C CE    1 
ATOM   9927  N NZ    . LYS C 1 530 ? 68.090  -3.840  34.929  1.00 53.97  1  527  LYS C NZ    1 
ATOM   9928  N N     . ASN C 1 531 ? 69.617  1.038   29.677  1.00 64.20  ?  528  ASN C N     1 
ATOM   9929  C CA    . ASN C 1 531 ? 70.814  1.855   29.513  1.00 57.52  ?  528  ASN C CA    1 
ATOM   9930  C C     . ASN C 1 531 ? 70.471  3.243   28.980  1.00 50.66  ?  528  ASN C C     1 
ATOM   9931  O O     . ASN C 1 531 ? 70.783  4.257   29.616  1.00 47.08  ?  528  ASN C O     1 
ATOM   9932  C CB    . ASN C 1 531 ? 71.808  1.141   28.593  1.00 62.95  ?  528  ASN C CB    1 
ATOM   9933  C CG    . ASN C 1 531 ? 73.223  1.685   28.721  1.00 69.83  ?  528  ASN C CG    1 
ATOM   9934  O OD1   . ASN C 1 531 ? 73.437  2.898   28.735  1.00 72.75  ?  528  ASN C OD1   1 
ATOM   9935  N ND2   . ASN C 1 531 ? 74.196  0.786   28.817  1.00 73.90  ?  528  ASN C ND2   1 
ATOM   9936  N N     . PHE C 1 532 ? 69.822  3.318   27.811  1.00 46.04  ?  529  PHE C N     1 
ATOM   9937  C CA    . PHE C 1 532 ? 69.605  4.630   27.208  1.00 47.81  ?  529  PHE C CA    1 
ATOM   9938  C C     . PHE C 1 532 ? 68.430  5.383   27.822  1.00 47.21  ?  529  PHE C C     1 
ATOM   9939  O O     . PHE C 1 532 ? 68.406  6.617   27.751  1.00 47.39  ?  529  PHE C O     1 
ATOM   9940  C CB    . PHE C 1 532 ? 69.444  4.520   25.679  1.00 39.63  ?  529  PHE C CB    1 
ATOM   9941  C CG    . PHE C 1 532 ? 68.193  3.805   25.211  1.00 47.43  ?  529  PHE C CG    1 
ATOM   9942  C CD1   . PHE C 1 532 ? 66.940  4.401   25.307  1.00 44.11  ?  529  PHE C CD1   1 
ATOM   9943  C CD2   . PHE C 1 532 ? 68.286  2.566   24.596  1.00 51.62  ?  529  PHE C CD2   1 
ATOM   9944  C CE1   . PHE C 1 532 ? 65.805  3.750   24.853  1.00 39.82  ?  529  PHE C CE1   1 
ATOM   9945  C CE2   . PHE C 1 532 ? 67.156  1.913   24.133  1.00 44.47  ?  529  PHE C CE2   1 
ATOM   9946  C CZ    . PHE C 1 532 ? 65.914  2.505   24.260  1.00 42.42  ?  529  PHE C CZ    1 
ATOM   9947  N N     . ILE C 1 533 ? 67.465  4.683   28.428  1.00 42.52  ?  530  ILE C N     1 
ATOM   9948  C CA    . ILE C 1 533 ? 66.400  5.370   29.153  1.00 52.10  ?  530  ILE C CA    1 
ATOM   9949  C C     . ILE C 1 533 ? 66.978  6.223   30.273  1.00 52.14  ?  530  ILE C C     1 
ATOM   9950  O O     . ILE C 1 533 ? 66.380  7.233   30.659  1.00 50.36  ?  530  ILE C O     1 
ATOM   9951  C CB    . ILE C 1 533 ? 65.364  4.346   29.681  1.00 48.76  ?  530  ILE C CB    1 
ATOM   9952  C CG1   . ILE C 1 533 ? 64.615  3.695   28.519  1.00 39.70  ?  530  ILE C CG1   1 
ATOM   9953  C CG2   . ILE C 1 533 ? 64.354  5.001   30.611  1.00 51.06  ?  530  ILE C CG2   1 
ATOM   9954  C CD1   . ILE C 1 533 ? 63.839  4.677   27.667  1.00 44.19  ?  530  ILE C CD1   1 
ATOM   9955  N N     . SER C 1 534 ? 68.164  5.869   30.769  1.00 57.62  ?  531  SER C N     1 
ATOM   9956  C CA    . SER C 1 534 ? 68.878  6.671   31.755  1.00 59.26  ?  531  SER C CA    1 
ATOM   9957  C C     . SER C 1 534 ? 69.478  7.927   31.131  1.00 61.06  ?  531  SER C C     1 
ATOM   9958  O O     . SER C 1 534 ? 70.465  8.461   31.647  1.00 64.94  ?  531  SER C O     1 
ATOM   9959  C CB    . SER C 1 534 ? 69.987  5.843   32.409  1.00 47.51  ?  531  SER C CB    1 
ATOM   9960  O OG    . SER C 1 534 ? 69.575  4.501   32.601  1.00 63.94  ?  531  SER C OG    1 
ATOM   9961  N N     . TYR C 1 535 ? 68.900  8.394   30.024  1.00 56.13  ?  532  TYR C N     1 
ATOM   9962  C CA    . TYR C 1 535 ? 69.358  9.607   29.350  1.00 59.39  ?  532  TYR C CA    1 
ATOM   9963  C C     . TYR C 1 535 ? 69.471  10.767  30.331  1.00 63.53  ?  532  TYR C C     1 
ATOM   9964  O O     . TYR C 1 535 ? 68.518  11.075  31.053  1.00 59.58  ?  532  TYR C O     1 
ATOM   9965  C CB    . TYR C 1 535 ? 68.387  9.951   28.214  1.00 49.36  ?  532  TYR C CB    1 
ATOM   9966  C CG    . TYR C 1 535 ? 68.742  11.197  27.430  1.00 53.54  ?  532  TYR C CG    1 
ATOM   9967  C CD1   . TYR C 1 535 ? 69.622  11.141  26.358  1.00 52.04  ?  532  TYR C CD1   1 
ATOM   9968  C CD2   . TYR C 1 535 ? 68.189  12.429  27.757  1.00 56.48  ?  532  TYR C CD2   1 
ATOM   9969  C CE1   . TYR C 1 535 ? 69.946  12.277  25.638  1.00 58.06  ?  532  TYR C CE1   1 
ATOM   9970  C CE2   . TYR C 1 535 ? 68.508  13.572  27.043  1.00 61.41  ?  532  TYR C CE2   1 
ATOM   9971  C CZ    . TYR C 1 535 ? 69.387  13.489  25.985  1.00 61.64  ?  532  TYR C CZ    1 
ATOM   9972  O OH    . TYR C 1 535 ? 69.710  14.618  25.268  1.00 66.42  ?  532  TYR C OH    1 
ATOM   9973  N N     . ASN C 1 536 ? 70.648  11.400  30.355  1.00 64.38  ?  533  ASN C N     1 
ATOM   9974  C CA    . ASN C 1 536 ? 71.011  12.450  31.306  1.00 59.16  ?  533  ASN C CA    1 
ATOM   9975  C C     . ASN C 1 536 ? 71.042  11.962  32.750  1.00 63.03  ?  533  ASN C C     1 
ATOM   9976  O O     . ASN C 1 536 ? 70.851  12.765  33.671  1.00 68.42  ?  533  ASN C O     1 
ATOM   9977  C CB    . ASN C 1 536 ? 70.076  13.664  31.205  1.00 57.39  ?  533  ASN C CB    1 
ATOM   9978  C CG    . ASN C 1 536 ? 70.414  14.567  30.041  1.00 72.58  ?  533  ASN C CG    1 
ATOM   9979  O OD1   . ASN C 1 536 ? 71.188  14.194  29.157  1.00 83.68  ?  533  ASN C OD1   1 
ATOM   9980  N ND2   . ASN C 1 536 ? 69.834  15.758  30.027  1.00 77.76  ?  533  ASN C ND2   1 
ATOM   9981  N N     . ASP C 1 537 ? 71.296  10.672  32.968  1.00 63.68  ?  534  ASP C N     1 
ATOM   9982  C CA    . ASP C 1 537 ? 71.241  10.060  34.295  1.00 65.91  ?  534  ASP C CA    1 
ATOM   9983  C C     . ASP C 1 537 ? 69.916  10.382  34.985  1.00 57.64  ?  534  ASP C C     1 
ATOM   9984  O O     . ASP C 1 537 ? 69.855  11.062  36.011  1.00 52.85  ?  534  ASP C O     1 
ATOM   9985  C CB    . ASP C 1 537 ? 72.438  10.479  35.153  1.00 73.63  ?  534  ASP C CB    1 
ATOM   9986  C CG    . ASP C 1 537 ? 73.737  9.852   34.680  1.00 84.19  ?  534  ASP C CG    1 
ATOM   9987  O OD1   . ASP C 1 537 ? 73.672  8.835   33.958  1.00 85.22  ?  534  ASP C OD1   1 
ATOM   9988  O OD2   . ASP C 1 537 ? 74.820  10.368  35.030  1.00 92.92  -1 534  ASP C OD2   1 
ATOM   9989  N N     . THR C 1 538 ? 68.844  9.865   34.394  1.00 56.84  ?  535  THR C N     1 
ATOM   9990  C CA    . THR C 1 538 ? 67.484  10.161  34.814  1.00 51.57  ?  535  THR C CA    1 
ATOM   9991  C C     . THR C 1 538 ? 66.861  8.944   35.483  1.00 44.03  ?  535  THR C C     1 
ATOM   9992  O O     . THR C 1 538 ? 67.008  7.814   35.003  1.00 38.83  ?  535  THR C O     1 
ATOM   9993  C CB    . THR C 1 538 ? 66.631  10.587  33.615  1.00 56.38  ?  535  THR C CB    1 
ATOM   9994  O OG1   . THR C 1 538 ? 67.373  11.511  32.809  1.00 61.79  ?  535  THR C OG1   1 
ATOM   9995  C CG2   . THR C 1 538 ? 65.353  11.258  34.079  1.00 49.53  ?  535  THR C CG2   1 
ATOM   9996  N N     . LYS C 1 539 ? 66.174  9.181   36.598  1.00 41.73  ?  536  LYS C N     1 
ATOM   9997  C CA    . LYS C 1 539 ? 65.401  8.129   37.242  1.00 40.69  ?  536  LYS C CA    1 
ATOM   9998  C C     . LYS C 1 539 ? 64.245  7.713   36.338  1.00 36.48  ?  536  LYS C C     1 
ATOM   9999  O O     . LYS C 1 539 ? 63.671  8.529   35.614  1.00 35.24  ?  536  LYS C O     1 
ATOM   10000 C CB    . LYS C 1 539 ? 64.884  8.610   38.599  1.00 35.44  ?  536  LYS C CB    1 
ATOM   10001 C CG    . LYS C 1 539 ? 65.995  8.891   39.605  1.00 41.71  ?  536  LYS C CG    1 
ATOM   10002 C CD    . LYS C 1 539 ? 65.487  9.633   40.834  1.00 50.46  ?  536  LYS C CD    1 
ATOM   10003 C CE    . LYS C 1 539 ? 65.469  11.140  40.609  1.00 48.55  ?  536  LYS C CE    1 
ATOM   10004 N NZ    . LYS C 1 539 ? 65.077  11.886  41.841  1.00 48.25  1  536  LYS C NZ    1 
ATOM   10005 N N     . TYR C 1 540 ? 63.914  6.425   36.366  1.00 35.38  ?  537  TYR C N     1 
ATOM   10006 C CA    . TYR C 1 540 ? 62.936  5.900   35.424  1.00 34.18  ?  537  TYR C CA    1 
ATOM   10007 C C     . TYR C 1 540 ? 62.239  4.684   36.018  1.00 36.36  ?  537  TYR C C     1 
ATOM   10008 O O     . TYR C 1 540 ? 62.661  4.128   37.035  1.00 44.00  ?  537  TYR C O     1 
ATOM   10009 C CB    . TYR C 1 540 ? 63.593  5.540   34.085  1.00 31.94  ?  537  TYR C CB    1 
ATOM   10010 C CG    . TYR C 1 540 ? 64.505  4.330   34.146  1.00 38.09  ?  537  TYR C CG    1 
ATOM   10011 C CD1   . TYR C 1 540 ? 63.996  3.041   34.012  1.00 37.25  ?  537  TYR C CD1   1 
ATOM   10012 C CD2   . TYR C 1 540 ? 65.875  4.475   34.329  1.00 41.64  ?  537  TYR C CD2   1 
ATOM   10013 C CE1   . TYR C 1 540 ? 64.820  1.934   34.071  1.00 43.26  ?  537  TYR C CE1   1 
ATOM   10014 C CE2   . TYR C 1 540 ? 66.709  3.371   34.385  1.00 49.02  ?  537  TYR C CE2   1 
ATOM   10015 C CZ    . TYR C 1 540 ? 66.176  2.105   34.256  1.00 48.30  ?  537  TYR C CZ    1 
ATOM   10016 O OH    . TYR C 1 540 ? 67.000  1.005   34.312  1.00 39.99  ?  537  TYR C OH    1 
ATOM   10017 N N     . THR C 1 541 ? 61.156  4.282   35.355  1.00 37.03  ?  538  THR C N     1 
ATOM   10018 C CA    . THR C 1 541 ? 60.470  3.028   35.628  1.00 36.09  ?  538  THR C CA    1 
ATOM   10019 C C     . THR C 1 541 ? 60.004  2.433   34.306  1.00 39.13  ?  538  THR C C     1 
ATOM   10020 O O     . THR C 1 541 ? 59.559  3.159   33.412  1.00 34.96  ?  538  THR C O     1 
ATOM   10021 C CB    . THR C 1 541 ? 59.276  3.218   36.577  1.00 33.68  ?  538  THR C CB    1 
ATOM   10022 O OG1   . THR C 1 541 ? 58.613  1.961   36.767  1.00 39.85  ?  538  THR C OG1   1 
ATOM   10023 C CG2   . THR C 1 541 ? 58.282  4.235   36.021  1.00 28.49  ?  538  THR C CG2   1 
ATOM   10024 N N     . LEU C 1 542 ? 60.128  1.114   34.182  1.00 35.07  ?  539  LEU C N     1 
ATOM   10025 C CA    . LEU C 1 542 ? 59.667  0.380   33.010  1.00 39.93  ?  539  LEU C CA    1 
ATOM   10026 C C     . LEU C 1 542 ? 58.419  -0.401  33.397  1.00 37.20  ?  539  LEU C C     1 
ATOM   10027 O O     . LEU C 1 542 ? 58.454  -1.208  34.333  1.00 38.78  ?  539  LEU C O     1 
ATOM   10028 C CB    . LEU C 1 542 ? 60.754  -0.555  32.482  1.00 43.26  ?  539  LEU C CB    1 
ATOM   10029 C CG    . LEU C 1 542 ? 62.121  0.084   32.226  1.00 40.09  ?  539  LEU C CG    1 
ATOM   10030 C CD1   . LEU C 1 542 ? 63.065  -0.919  31.588  1.00 38.84  ?  539  LEU C CD1   1 
ATOM   10031 C CD2   . LEU C 1 542 ? 61.991  1.329   31.362  1.00 31.18  ?  539  LEU C CD2   1 
ATOM   10032 N N     . VAL C 1 543 ? 57.322  -0.160  32.682  1.00 26.29  ?  540  VAL C N     1 
ATOM   10033 C CA    . VAL C 1 543 ? 56.009  -0.676  33.049  1.00 28.50  ?  540  VAL C CA    1 
ATOM   10034 C C     . VAL C 1 543 ? 55.425  -1.443  31.871  1.00 30.25  ?  540  VAL C C     1 
ATOM   10035 O O     . VAL C 1 543 ? 55.395  -0.935  30.745  1.00 31.67  ?  540  VAL C O     1 
ATOM   10036 C CB    . VAL C 1 543 ? 55.057  0.457   33.472  1.00 29.94  ?  540  VAL C CB    1 
ATOM   10037 C CG1   . VAL C 1 543 ? 53.736  -0.115  33.945  1.00 33.61  ?  540  VAL C CG1   1 
ATOM   10038 C CG2   . VAL C 1 543 ? 55.697  1.320   34.552  1.00 37.88  ?  540  VAL C CG2   1 
ATOM   10039 N N     . GLU C 1 544 ? 54.952  -2.657  32.135  1.00 36.48  ?  541  GLU C N     1 
ATOM   10040 C CA    . GLU C 1 544 ? 54.239  -3.457  31.148  1.00 32.31  ?  541  GLU C CA    1 
ATOM   10041 C C     . GLU C 1 544 ? 52.748  -3.375  31.441  1.00 30.16  ?  541  GLU C C     1 
ATOM   10042 O O     . GLU C 1 544 ? 52.308  -3.707  32.547  1.00 30.38  ?  541  GLU C O     1 
ATOM   10043 C CB    . GLU C 1 544 ? 54.714  -4.909  31.167  1.00 38.13  ?  541  GLU C CB    1 
ATOM   10044 C CG    . GLU C 1 544 ? 56.142  -5.088  30.697  1.00 37.94  ?  541  GLU C CG    1 
ATOM   10045 C CD    . GLU C 1 544 ? 56.599  -6.531  30.750  1.00 46.49  ?  541  GLU C CD    1 
ATOM   10046 O OE1   . GLU C 1 544 ? 56.005  -7.321  31.516  1.00 37.79  ?  541  GLU C OE1   1 
ATOM   10047 O OE2   . GLU C 1 544 ? 57.552  -6.874  30.020  1.00 45.62  -1 541  GLU C OE2   1 
ATOM   10048 N N     . VAL C 1 545 ? 51.978  -2.934  30.453  1.00 30.67  ?  542  VAL C N     1 
ATOM   10049 C CA    . VAL C 1 545 ? 50.538  -2.747  30.584  1.00 20.35  ?  542  VAL C CA    1 
ATOM   10050 C C     . VAL C 1 545 ? 49.852  -3.745  29.662  1.00 33.17  ?  542  VAL C C     1 
ATOM   10051 O O     . VAL C 1 545 ? 50.038  -3.702  28.440  1.00 35.64  ?  542  VAL C O     1 
ATOM   10052 C CB    . VAL C 1 545 ? 50.129  -1.305  30.250  1.00 27.91  ?  542  VAL C CB    1 
ATOM   10053 C CG1   . VAL C 1 545 ? 48.644  -1.097  30.480  1.00 27.83  ?  542  VAL C CG1   1 
ATOM   10054 C CG2   . VAL C 1 545 ? 50.947  -0.319  31.074  1.00 34.80  ?  542  VAL C CG2   1 
ATOM   10055 N N     . ASN C 1 546 ? 49.065  -4.644  30.244  1.00 34.71  ?  543  ASN C N     1 
ATOM   10056 C CA    . ASN C 1 546 ? 48.343  -5.671  29.496  1.00 32.12  ?  543  ASN C CA    1 
ATOM   10057 C C     . ASN C 1 546 ? 46.859  -5.317  29.526  1.00 30.71  ?  543  ASN C C     1 
ATOM   10058 O O     . ASN C 1 546 ? 46.172  -5.568  30.520  1.00 43.40  ?  543  ASN C O     1 
ATOM   10059 C CB    . ASN C 1 546 ? 48.603  -7.056  30.081  1.00 33.69  ?  543  ASN C CB    1 
ATOM   10060 C CG    . ASN C 1 546 ? 47.942  -8.163  29.279  1.00 46.07  ?  543  ASN C CG    1 
ATOM   10061 O OD1   . ASN C 1 546 ? 47.461  -7.939  28.168  1.00 47.33  ?  543  ASN C OD1   1 
ATOM   10062 N ND2   . ASN C 1 546 ? 47.921  -9.368  29.838  1.00 46.35  ?  543  ASN C ND2   1 
ATOM   10063 N N     . LYS C 1 547 ? 46.368  -4.742  28.426  1.00 23.32  ?  544  LYS C N     1 
ATOM   10064 C CA    . LYS C 1 547 ? 44.970  -4.339  28.347  1.00 22.64  ?  544  LYS C CA    1 
ATOM   10065 C C     . LYS C 1 547 ? 44.020  -5.512  28.151  1.00 27.56  ?  544  LYS C C     1 
ATOM   10066 O O     . LYS C 1 547 ? 42.802  -5.313  28.206  1.00 42.79  ?  544  LYS C O     1 
ATOM   10067 C CB    . LYS C 1 547 ? 44.775  -3.334  27.211  1.00 32.16  ?  544  LYS C CB    1 
ATOM   10068 C CG    . LYS C 1 547 ? 45.095  -3.884  25.828  1.00 32.52  ?  544  LYS C CG    1 
ATOM   10069 C CD    . LYS C 1 547 ? 44.911  -2.813  24.761  1.00 42.04  ?  544  LYS C CD    1 
ATOM   10070 C CE    . LYS C 1 547 ? 45.205  -3.341  23.365  1.00 38.80  ?  544  LYS C CE    1 
ATOM   10071 N NZ    . LYS C 1 547 ? 46.640  -3.200  22.998  1.00 50.70  1  544  LYS C NZ    1 
ATOM   10072 N N     . ASN C 1 548 ? 44.537  -6.720  27.928  1.00 37.15  ?  545  ASN C N     1 
ATOM   10073 C CA    . ASN C 1 548 ? 43.711  -7.888  27.653  1.00 45.82  ?  545  ASN C CA    1 
ATOM   10074 C C     . ASN C 1 548 ? 43.889  -8.974  28.708  1.00 36.22  ?  545  ASN C C     1 
ATOM   10075 O O     . ASN C 1 548 ? 43.836  -10.164 28.390  1.00 44.98  ?  545  ASN C O     1 
ATOM   10076 C CB    . ASN C 1 548 ? 44.019  -8.454  26.266  1.00 56.50  ?  545  ASN C CB    1 
ATOM   10077 C CG    . ASN C 1 548 ? 43.635  -7.506  25.148  1.00 69.22  ?  545  ASN C CG    1 
ATOM   10078 O OD1   . ASN C 1 548 ? 42.618  -6.815  25.225  1.00 80.99  ?  545  ASN C OD1   1 
ATOM   10079 N ND2   . ASN C 1 548 ? 44.448  -7.471  24.099  1.00 64.30  ?  545  ASN C ND2   1 
ATOM   10080 N N     . THR C 1 549 ? 44.096  -8.589  29.967  1.00 34.98  ?  546  THR C N     1 
ATOM   10081 C CA    . THR C 1 549 ? 44.325  -9.584  31.007  1.00 33.28  ?  546  THR C CA    1 
ATOM   10082 C C     . THR C 1 549 ? 43.094  -10.467 31.181  1.00 33.85  ?  546  THR C C     1 
ATOM   10083 O O     . THR C 1 549 ? 41.953  -10.006 31.080  1.00 29.11  ?  546  THR C O     1 
ATOM   10084 C CB    . THR C 1 549 ? 44.688  -8.916  32.336  1.00 39.95  ?  546  THR C CB    1 
ATOM   10085 O OG1   . THR C 1 549 ? 44.860  -9.919  33.347  1.00 32.89  ?  546  THR C OG1   1 
ATOM   10086 C CG2   . THR C 1 549 ? 43.600  -7.969  32.773  1.00 35.33  ?  546  THR C CG2   1 
ATOM   10087 N N     . ASN C 1 550 ? 43.340  -11.750 31.428  1.00 25.06  ?  547  ASN C N     1 
ATOM   10088 C CA    . ASN C 1 550 ? 42.284  -12.736 31.593  1.00 29.48  ?  547  ASN C CA    1 
ATOM   10089 C C     . ASN C 1 550 ? 41.770  -12.819 33.023  1.00 34.46  ?  547  ASN C C     1 
ATOM   10090 O O     . ASN C 1 550 ? 40.797  -13.537 33.277  1.00 29.71  ?  547  ASN C O     1 
ATOM   10091 C CB    . ASN C 1 550 ? 42.794  -14.113 31.152  1.00 27.88  ?  547  ASN C CB    1 
ATOM   10092 C CG    . ASN C 1 550 ? 41.674  -15.073 30.819  1.00 37.30  ?  547  ASN C CG    1 
ATOM   10093 O OD1   . ASN C 1 550 ? 40.693  -14.696 30.181  1.00 29.82  ?  547  ASN C OD1   1 
ATOM   10094 N ND2   . ASN C 1 550 ? 41.812  -16.320 31.255  1.00 30.51  ?  547  ASN C ND2   1 
ATOM   10095 N N     . ILE C 1 551 ? 42.396  -12.106 33.954  1.00 32.17  ?  548  ILE C N     1 
ATOM   10096 C CA    . ILE C 1 551 ? 42.006  -12.152 35.359  1.00 33.09  ?  548  ILE C CA    1 
ATOM   10097 C C     . ILE C 1 551 ? 40.733  -11.338 35.545  1.00 32.92  ?  548  ILE C C     1 
ATOM   10098 O O     . ILE C 1 551 ? 40.657  -10.176 35.126  1.00 30.69  ?  548  ILE C O     1 
ATOM   10099 C CB    . ILE C 1 551 ? 43.141  -11.626 36.252  1.00 32.75  ?  548  ILE C CB    1 
ATOM   10100 C CG1   . ILE C 1 551 ? 44.387  -12.503 36.096  1.00 33.52  ?  548  ILE C CG1   1 
ATOM   10101 C CG2   . ILE C 1 551 ? 42.698  -11.562 37.709  1.00 35.34  ?  548  ILE C CG2   1 
ATOM   10102 C CD1   . ILE C 1 551 ? 45.645  -11.890 36.677  1.00 33.38  ?  548  ILE C CD1   1 
ATOM   10103 N N     . ASN C 1 552 ? 39.731  -11.941 36.171  1.00 29.66  ?  549  ASN C N     1 
ATOM   10104 C CA    . ASN C 1 552 ? 38.434  -11.296 36.301  1.00 31.89  ?  549  ASN C CA    1 
ATOM   10105 C C     . ASN C 1 552 ? 37.664  -11.956 37.439  1.00 38.15  ?  549  ASN C C     1 
ATOM   10106 O O     . ASN C 1 552 ? 38.223  -12.722 38.231  1.00 34.72  ?  549  ASN C O     1 
ATOM   10107 C CB    . ASN C 1 552 ? 37.663  -11.358 34.977  1.00 37.67  ?  549  ASN C CB    1 
ATOM   10108 C CG    . ASN C 1 552 ? 36.926  -10.071 34.677  1.00 40.76  ?  549  ASN C CG    1 
ATOM   10109 O OD1   . ASN C 1 552 ? 36.416  -9.410  35.577  1.00 37.77  ?  549  ASN C OD1   1 
ATOM   10110 N ND2   . ASN C 1 552 ? 36.881  -9.701  33.399  1.00 42.34  ?  549  ASN C ND2   1 
ATOM   10111 N N     . SER C 1 553 ? 36.367  -11.668 37.503  1.00 38.04  ?  550  SER C N     1 
ATOM   10112 C CA    . SER C 1 553 ? 35.534  -12.066 38.627  1.00 42.70  ?  550  SER C CA    1 
ATOM   10113 C C     . SER C 1 553 ? 34.075  -11.861 38.255  1.00 44.13  ?  550  SER C C     1 
ATOM   10114 O O     . SER C 1 553 ? 33.750  -11.107 37.334  1.00 41.28  ?  550  SER C O     1 
ATOM   10115 C CB    . SER C 1 553 ? 35.875  -11.259 39.882  1.00 48.54  ?  550  SER C CB    1 
ATOM   10116 O OG    . SER C 1 553 ? 34.914  -11.468 40.903  1.00 49.25  ?  550  SER C OG    1 
ATOM   10117 N N     . TYR C 1 554 ? 33.198  -12.540 38.994  1.00 44.56  ?  551  TYR C N     1 
ATOM   10118 C CA    . TYR C 1 554 ? 31.774  -12.253 38.901  1.00 43.68  ?  551  TYR C CA    1 
ATOM   10119 C C     . TYR C 1 554 ? 31.366  -11.076 39.777  1.00 41.18  ?  551  TYR C C     1 
ATOM   10120 O O     . TYR C 1 554 ? 30.299  -10.494 39.553  1.00 45.21  ?  551  TYR C O     1 
ATOM   10121 C CB    . TYR C 1 554 ? 30.947  -13.492 39.264  1.00 46.79  ?  551  TYR C CB    1 
ATOM   10122 C CG    . TYR C 1 554 ? 31.394  -14.228 40.512  1.00 56.40  ?  551  TYR C CG    1 
ATOM   10123 C CD1   . TYR C 1 554 ? 30.974  -13.820 41.774  1.00 62.29  ?  551  TYR C CD1   1 
ATOM   10124 C CD2   . TYR C 1 554 ? 32.214  -15.346 40.426  1.00 60.13  ?  551  TYR C CD2   1 
ATOM   10125 C CE1   . TYR C 1 554 ? 31.372  -14.498 42.916  1.00 55.13  ?  551  TYR C CE1   1 
ATOM   10126 C CE2   . TYR C 1 554 ? 32.613  -16.030 41.560  1.00 62.35  ?  551  TYR C CE2   1 
ATOM   10127 C CZ    . TYR C 1 554 ? 32.192  -15.602 42.802  1.00 60.58  ?  551  TYR C CZ    1 
ATOM   10128 O OH    . TYR C 1 554 ? 32.591  -16.280 43.931  1.00 59.28  ?  551  TYR C OH    1 
ATOM   10129 N N     . ASP C 1 555 ? 32.190  -10.708 40.755  1.00 40.46  ?  552  ASP C N     1 
ATOM   10130 C CA    . ASP C 1 555 ? 31.936  -9.525  41.561  1.00 37.75  ?  552  ASP C CA    1 
ATOM   10131 C C     . ASP C 1 555 ? 32.242  -8.260  40.764  1.00 44.26  ?  552  ASP C C     1 
ATOM   10132 O O     . ASP C 1 555 ? 33.019  -8.268  39.805  1.00 58.81  ?  552  ASP C O     1 
ATOM   10133 C CB    . ASP C 1 555 ? 32.777  -9.550  42.837  1.00 50.14  ?  552  ASP C CB    1 
ATOM   10134 C CG    . ASP C 1 555 ? 32.422  -10.706 43.751  1.00 52.08  ?  552  ASP C CG    1 
ATOM   10135 O OD1   . ASP C 1 555 ? 31.223  -11.038 43.861  1.00 56.05  ?  552  ASP C OD1   1 
ATOM   10136 O OD2   . ASP C 1 555 ? 33.345  -11.282 44.363  1.00 51.16  -1 552  ASP C OD2   1 
ATOM   10137 N N     . ASP C 1 556 ? 31.622  -7.159  41.181  1.00 43.42  ?  553  ASP C N     1 
ATOM   10138 C CA    . ASP C 1 556 ? 31.803  -5.870  40.522  1.00 40.97  ?  553  ASP C CA    1 
ATOM   10139 C C     . ASP C 1 556 ? 33.122  -5.260  40.984  1.00 40.34  ?  553  ASP C C     1 
ATOM   10140 O O     . ASP C 1 556 ? 33.264  -4.875  42.150  1.00 42.96  ?  553  ASP C O     1 
ATOM   10141 C CB    . ASP C 1 556 ? 30.625  -4.948  40.827  1.00 48.01  ?  553  ASP C CB    1 
ATOM   10142 C CG    . ASP C 1 556 ? 30.673  -3.656  40.035  1.00 59.48  ?  553  ASP C CG    1 
ATOM   10143 O OD1   . ASP C 1 556 ? 31.505  -3.551  39.110  1.00 67.09  ?  553  ASP C OD1   1 
ATOM   10144 O OD2   . ASP C 1 556 ? 29.868  -2.749  40.329  1.00 57.78  -1 553  ASP C OD2   1 
ATOM   10145 N N     . LEU C 1 557 ? 34.088  -5.169  40.071  1.00 39.04  ?  554  LEU C N     1 
ATOM   10146 C CA    . LEU C 1 557 ? 35.409  -4.639  40.375  1.00 39.91  ?  554  LEU C CA    1 
ATOM   10147 C C     . LEU C 1 557 ? 35.712  -3.348  39.626  1.00 37.72  ?  554  LEU C C     1 
ATOM   10148 O O     . LEU C 1 557 ? 36.858  -2.884  39.653  1.00 38.34  ?  554  LEU C O     1 
ATOM   10149 C CB    . LEU C 1 557 ? 36.483  -5.682  40.058  1.00 39.16  ?  554  LEU C CB    1 
ATOM   10150 C CG    . LEU C 1 557 ? 36.321  -7.040  40.746  1.00 42.55  ?  554  LEU C CG    1 
ATOM   10151 C CD1   . LEU C 1 557 ? 37.476  -7.963  40.397  1.00 39.86  ?  554  LEU C CD1   1 
ATOM   10152 C CD2   . LEU C 1 557 ? 36.195  -6.871  42.251  1.00 37.93  ?  554  LEU C CD2   1 
ATOM   10153 N N     . LYS C 1 558 ? 34.723  -2.760  38.958  1.00 34.31  ?  555  LYS C N     1 
ATOM   10154 C CA    . LYS C 1 558 ? 34.964  -1.541  38.197  1.00 42.19  ?  555  LYS C CA    1 
ATOM   10155 C C     . LYS C 1 558 ? 35.384  -0.405  39.123  1.00 44.64  ?  555  LYS C C     1 
ATOM   10156 O O     . LYS C 1 558 ? 34.814  -0.214  40.201  1.00 39.00  ?  555  LYS C O     1 
ATOM   10157 C CB    . LYS C 1 558 ? 33.717  -1.156  37.405  1.00 33.77  ?  555  LYS C CB    1 
ATOM   10158 C CG    . LYS C 1 558 ? 33.116  -2.310  36.623  1.00 35.23  ?  555  LYS C CG    1 
ATOM   10159 C CD    . LYS C 1 558 ? 32.292  -1.819  35.450  1.00 38.50  ?  555  LYS C CD    1 
ATOM   10160 C CE    . LYS C 1 558 ? 31.184  -2.800  35.122  1.00 44.24  ?  555  LYS C CE    1 
ATOM   10161 N NZ    . LYS C 1 558 ? 30.595  -2.547  33.780  1.00 46.83  1  555  LYS C NZ    1 
ATOM   10162 N N     . GLU C 1 559 ? 36.404  0.339   38.689  1.00 48.94  ?  556  GLU C N     1 
ATOM   10163 C CA    . GLU C 1 559 ? 37.054  1.431   39.415  1.00 34.08  ?  556  GLU C CA    1 
ATOM   10164 C C     . GLU C 1 559 ? 37.818  0.954   40.645  1.00 34.68  ?  556  GLU C C     1 
ATOM   10165 O O     . GLU C 1 559 ? 38.203  1.776   41.489  1.00 35.08  ?  556  GLU C O     1 
ATOM   10166 C CB    . GLU C 1 559 ? 36.061  2.532   39.804  1.00 34.72  ?  556  GLU C CB    1 
ATOM   10167 C CG    . GLU C 1 559 ? 35.355  3.153   38.606  1.00 43.16  ?  556  GLU C CG    1 
ATOM   10168 C CD    . GLU C 1 559 ? 34.458  4.316   38.982  1.00 51.46  ?  556  GLU C CD    1 
ATOM   10169 O OE1   . GLU C 1 559 ? 34.989  5.379   39.368  1.00 45.40  ?  556  GLU C OE1   1 
ATOM   10170 O OE2   . GLU C 1 559 ? 33.221  4.162   38.894  1.00 58.27  -1 556  GLU C OE2   1 
ATOM   10171 N N     . TRP C 1 560 ? 38.066  -0.347  40.767  1.00 25.34  ?  557  TRP C N     1 
ATOM   10172 C CA    . TRP C 1 560 ? 38.919  -0.892  41.811  1.00 26.28  ?  557  TRP C CA    1 
ATOM   10173 C C     . TRP C 1 560 ? 40.295  -1.222  41.244  1.00 24.16  ?  557  TRP C C     1 
ATOM   10174 O O     . TRP C 1 560 ? 40.429  -1.643  40.092  1.00 23.80  ?  557  TRP C O     1 
ATOM   10175 C CB    . TRP C 1 560 ? 38.308  -2.154  42.424  1.00 29.06  ?  557  TRP C CB    1 
ATOM   10176 C CG    . TRP C 1 560 ? 37.100  -1.921  43.280  1.00 35.94  ?  557  TRP C CG    1 
ATOM   10177 C CD1   . TRP C 1 560 ? 35.795  -1.932  42.880  1.00 31.87  ?  557  TRP C CD1   1 
ATOM   10178 C CD2   . TRP C 1 560 ? 37.087  -1.668  44.690  1.00 38.24  ?  557  TRP C CD2   1 
ATOM   10179 N NE1   . TRP C 1 560 ? 34.970  -1.691  43.955  1.00 43.28  ?  557  TRP C NE1   1 
ATOM   10180 C CE2   . TRP C 1 560 ? 35.740  -1.527  45.077  1.00 37.75  ?  557  TRP C CE2   1 
ATOM   10181 C CE3   . TRP C 1 560 ? 38.083  -1.542  45.661  1.00 49.78  ?  557  TRP C CE3   1 
ATOM   10182 C CZ2   . TRP C 1 560 ? 35.366  -1.265  46.394  1.00 43.55  ?  557  TRP C CZ2   1 
ATOM   10183 C CZ3   . TRP C 1 560 ? 37.710  -1.286  46.969  1.00 50.65  ?  557  TRP C CZ3   1 
ATOM   10184 C CH2   . TRP C 1 560 ? 36.364  -1.149  47.323  1.00 45.91  ?  557  TRP C CH2   1 
ATOM   10185 N N     . ILE C 1 561 ? 41.319  -1.028  42.070  1.00 21.21  ?  558  ILE C N     1 
ATOM   10186 C CA    . ILE C 1 561 ? 42.681  -1.458  41.771  1.00 20.34  ?  558  ILE C CA    1 
ATOM   10187 C C     . ILE C 1 561 ? 43.029  -2.600  42.712  1.00 34.11  ?  558  ILE C C     1 
ATOM   10188 O O     . ILE C 1 561 ? 42.919  -2.456  43.936  1.00 34.00  ?  558  ILE C O     1 
ATOM   10189 C CB    . ILE C 1 561 ? 43.686  -0.305  41.917  1.00 22.71  ?  558  ILE C CB    1 
ATOM   10190 C CG1   . ILE C 1 561 ? 43.334  0.829   40.954  1.00 26.47  ?  558  ILE C CG1   1 
ATOM   10191 C CG2   . ILE C 1 561 ? 45.104  -0.806  41.681  1.00 25.03  ?  558  ILE C CG2   1 
ATOM   10192 C CD1   . ILE C 1 561 ? 44.247  2.022   41.066  1.00 30.07  ?  558  ILE C CD1   1 
ATOM   10193 N N     . ILE C 1 562 ? 43.451  -3.727  42.148  1.00 28.35  ?  559  ILE C N     1 
ATOM   10194 C CA    . ILE C 1 562 ? 43.757  -4.925  42.922  1.00 30.10  ?  559  ILE C CA    1 
ATOM   10195 C C     . ILE C 1 562 ? 45.256  -5.171  42.872  1.00 31.04  ?  559  ILE C C     1 
ATOM   10196 O O     . ILE C 1 562 ? 45.864  -5.139  41.795  1.00 30.57  ?  559  ILE C O     1 
ATOM   10197 C CB    . ILE C 1 562 ? 42.985  -6.147  42.401  1.00 31.67  ?  559  ILE C CB    1 
ATOM   10198 C CG1   . ILE C 1 562 ? 41.482  -5.882  42.448  1.00 32.68  ?  559  ILE C CG1   1 
ATOM   10199 C CG2   . ILE C 1 562 ? 43.326  -7.379  43.224  1.00 37.24  ?  559  ILE C CG2   1 
ATOM   10200 C CD1   . ILE C 1 562 ? 40.663  -6.989  41.834  1.00 35.00  ?  559  ILE C CD1   1 
ATOM   10201 N N     . LYS C 1 563 ? 45.847  -5.424  44.035  1.00 31.20  ?  560  LYS C N     1 
ATOM   10202 C CA    . LYS C 1 563 ? 47.254  -5.786  44.130  1.00 39.28  ?  560  LYS C CA    1 
ATOM   10203 C C     . LYS C 1 563 ? 47.398  -7.300  44.072  1.00 38.65  ?  560  LYS C C     1 
ATOM   10204 O O     . LYS C 1 563 ? 46.789  -8.019  44.870  1.00 46.81  ?  560  LYS C O     1 
ATOM   10205 C CB    . LYS C 1 563 ? 47.862  -5.245  45.425  1.00 37.37  ?  560  LYS C CB    1 
ATOM   10206 C CG    . LYS C 1 563 ? 49.333  -5.565  45.600  1.00 41.14  ?  560  LYS C CG    1 
ATOM   10207 C CD    . LYS C 1 563 ? 49.888  -4.892  46.841  1.00 50.38  ?  560  LYS C CD    1 
ATOM   10208 C CE    . LYS C 1 563 ? 51.358  -5.222  47.034  1.00 52.04  ?  560  LYS C CE    1 
ATOM   10209 N NZ    . LYS C 1 563 ? 51.926  -4.533  48.224  1.00 50.66  1  560  LYS C NZ    1 
ATOM   10210 N N     . LEU C 1 564 ? 48.200  -7.780  43.123  1.00 34.78  ?  561  LEU C N     1 
ATOM   10211 C CA    . LEU C 1 564 ? 48.514  -9.200  43.007  1.00 28.32  ?  561  LEU C CA    1 
ATOM   10212 C C     . LEU C 1 564 ? 49.809  -9.563  43.721  1.00 38.52  ?  561  LEU C C     1 
ATOM   10213 O O     . LEU C 1 564 ? 49.836  -10.513 44.507  1.00 47.35  ?  561  LEU C O     1 
ATOM   10214 C CB    . LEU C 1 564 ? 48.593  -9.605  41.531  1.00 29.55  ?  561  LEU C CB    1 
ATOM   10215 C CG    . LEU C 1 564 ? 47.310  -9.419  40.726  1.00 33.97  ?  561  LEU C CG    1 
ATOM   10216 C CD1   . LEU C 1 564 ? 47.528  -9.824  39.276  1.00 30.32  ?  561  LEU C CD1   1 
ATOM   10217 C CD2   . LEU C 1 564 ? 46.165  -10.210 41.343  1.00 30.19  ?  561  LEU C CD2   1 
ATOM   10218 N N     . ASP C 1 565 ? 50.887  -8.829  43.462  1.00 35.51  ?  562  ASP C N     1 
ATOM   10219 C CA    . ASP C 1 565 ? 52.120  -8.969  44.229  1.00 45.79  ?  562  ASP C CA    1 
ATOM   10220 C C     . ASP C 1 565 ? 52.825  -7.618  44.252  1.00 43.01  ?  562  ASP C C     1 
ATOM   10221 O O     . ASP C 1 565 ? 52.275  -6.604  43.809  1.00 34.68  ?  562  ASP C O     1 
ATOM   10222 C CB    . ASP C 1 565 ? 53.007  -10.092 43.668  1.00 52.08  ?  562  ASP C CB    1 
ATOM   10223 C CG    . ASP C 1 565 ? 53.577  -9.774  42.300  1.00 47.61  ?  562  ASP C CG    1 
ATOM   10224 O OD1   . ASP C 1 565 ? 53.450  -8.620  41.846  1.00 45.00  -1 562  ASP C OD1   1 
ATOM   10225 O OD2   . ASP C 1 565 ? 54.165  -10.686 41.680  1.00 55.73  ?  562  ASP C OD2   1 
ATOM   10226 N N     . GLU C 1 566 ? 54.058  -7.612  44.765  1.00 45.10  ?  563  GLU C N     1 
ATOM   10227 C CA    . GLU C 1 566 ? 54.783  -6.360  44.968  1.00 47.55  ?  563  GLU C CA    1 
ATOM   10228 C C     . GLU C 1 566 ? 54.919  -5.553  43.681  1.00 46.82  ?  563  GLU C C     1 
ATOM   10229 O O     . GLU C 1 566 ? 54.892  -4.319  43.719  1.00 47.83  ?  563  GLU C O     1 
ATOM   10230 C CB    . GLU C 1 566 ? 56.167  -6.653  45.553  1.00 54.41  ?  563  GLU C CB    1 
ATOM   10231 C CG    . GLU C 1 566 ? 56.995  -5.416  45.884  1.00 69.43  ?  563  GLU C CG    1 
ATOM   10232 C CD    . GLU C 1 566 ? 56.486  -4.674  47.105  1.00 84.63  ?  563  GLU C CD    1 
ATOM   10233 O OE1   . GLU C 1 566 ? 55.707  -5.265  47.884  1.00 89.45  ?  563  GLU C OE1   1 
ATOM   10234 O OE2   . GLU C 1 566 ? 56.865  -3.498  47.284  1.00 86.36  -1 563  GLU C OE2   1 
ATOM   10235 N N     . ASN C 1 567 ? 55.054  -6.222  42.537  1.00 44.24  ?  564  ASN C N     1 
ATOM   10236 C CA    . ASN C 1 567 ? 55.320  -5.547  41.274  1.00 42.29  ?  564  ASN C CA    1 
ATOM   10237 C C     . ASN C 1 567 ? 54.159  -5.604  40.289  1.00 38.86  ?  564  ASN C C     1 
ATOM   10238 O O     . ASN C 1 567 ? 54.268  -5.034  39.197  1.00 32.79  ?  564  ASN C O     1 
ATOM   10239 C CB    . ASN C 1 567 ? 56.573  -6.142  40.618  1.00 50.03  ?  564  ASN C CB    1 
ATOM   10240 C CG    . ASN C 1 567 ? 57.843  -5.824  41.388  1.00 59.25  ?  564  ASN C CG    1 
ATOM   10241 O OD1   . ASN C 1 567 ? 58.436  -6.697  42.023  1.00 56.61  ?  564  ASN C OD1   1 
ATOM   10242 N ND2   . ASN C 1 567 ? 58.272  -4.569  41.324  1.00 65.01  ?  564  ASN C ND2   1 
ATOM   10243 N N     . THR C 1 568 ? 53.052  -6.260  40.632  1.00 33.87  ?  565  THR C N     1 
ATOM   10244 C CA    . THR C 1 568 ? 51.977  -6.495  39.676  1.00 37.89  ?  565  THR C CA    1 
ATOM   10245 C C     . THR C 1 568 ? 50.639  -6.075  40.265  1.00 27.12  ?  565  THR C C     1 
ATOM   10246 O O     . THR C 1 568 ? 50.272  -6.509  41.361  1.00 31.63  ?  565  THR C O     1 
ATOM   10247 C CB    . THR C 1 568 ? 51.924  -7.968  39.258  1.00 50.79  ?  565  THR C CB    1 
ATOM   10248 O OG1   . THR C 1 568 ? 53.242  -8.412  38.913  1.00 54.77  ?  565  THR C OG1   1 
ATOM   10249 C CG2   . THR C 1 568 ? 51.010  -8.148  38.055  1.00 51.13  ?  565  THR C CG2   1 
ATOM   10250 N N     . TYR C 1 569 ? 49.912  -5.237  39.527  1.00 32.68  ?  566  TYR C N     1 
ATOM   10251 C CA    . TYR C 1 569 ? 48.579  -4.788  39.901  1.00 29.96  ?  566  TYR C CA    1 
ATOM   10252 C C     . TYR C 1 569 ? 47.640  -4.955  38.715  1.00 30.27  ?  566  TYR C C     1 
ATOM   10253 O O     . TYR C 1 569 ? 48.066  -5.174  37.576  1.00 31.30  ?  566  TYR C O     1 
ATOM   10254 C CB    . TYR C 1 569 ? 48.572  -3.321  40.353  1.00 32.11  ?  566  TYR C CB    1 
ATOM   10255 C CG    . TYR C 1 569 ? 49.210  -3.047  41.696  1.00 34.81  ?  566  TYR C CG    1 
ATOM   10256 C CD1   . TYR C 1 569 ? 50.573  -3.225  41.891  1.00 42.12  ?  566  TYR C CD1   1 
ATOM   10257 C CD2   . TYR C 1 569 ? 48.453  -2.575  42.761  1.00 36.25  ?  566  TYR C CD2   1 
ATOM   10258 C CE1   . TYR C 1 569 ? 51.161  -2.963  43.113  1.00 41.05  ?  566  TYR C CE1   1 
ATOM   10259 C CE2   . TYR C 1 569 ? 49.034  -2.307  43.987  1.00 42.97  ?  566  TYR C CE2   1 
ATOM   10260 C CZ    . TYR C 1 569 ? 50.388  -2.504  44.157  1.00 48.18  ?  566  TYR C CZ    1 
ATOM   10261 O OH    . TYR C 1 569 ? 50.973  -2.241  45.376  1.00 51.60  ?  566  TYR C OH    1 
ATOM   10262 N N     . ILE C 1 570 ? 46.346  -4.830  38.989  1.00 28.42  ?  567  ILE C N     1 
ATOM   10263 C CA    . ILE C 1 570 ? 45.323  -4.855  37.950  1.00 32.64  ?  567  ILE C CA    1 
ATOM   10264 C C     . ILE C 1 570 ? 44.217  -3.886  38.343  1.00 32.87  ?  567  ILE C C     1 
ATOM   10265 O O     . ILE C 1 570 ? 43.732  -3.915  39.478  1.00 33.43  ?  567  ILE C O     1 
ATOM   10266 C CB    . ILE C 1 570 ? 44.765  -6.275  37.727  1.00 44.36  ?  567  ILE C CB    1 
ATOM   10267 C CG1   . ILE C 1 570 ? 43.577  -6.242  36.765  1.00 39.96  ?  567  ILE C CG1   1 
ATOM   10268 C CG2   . ILE C 1 570 ? 44.389  -6.932  39.052  1.00 53.19  ?  567  ILE C CG2   1 
ATOM   10269 C CD1   . ILE C 1 570 ? 43.130  -7.612  36.320  1.00 55.88  ?  567  ILE C CD1   1 
ATOM   10270 N N     . TYR C 1 571 ? 43.837  -3.011  37.417  1.00 30.70  ?  568  TYR C N     1 
ATOM   10271 C CA    . TYR C 1 571 ? 42.713  -2.119  37.637  1.00 22.56  ?  568  TYR C CA    1 
ATOM   10272 C C     . TYR C 1 571 ? 41.623  -2.409  36.618  1.00 23.30  ?  568  TYR C C     1 
ATOM   10273 O O     . TYR C 1 571 ? 41.874  -2.947  35.536  1.00 28.28  ?  568  TYR C O     1 
ATOM   10274 C CB    . TYR C 1 571 ? 43.128  -0.635  37.580  1.00 23.48  ?  568  TYR C CB    1 
ATOM   10275 C CG    . TYR C 1 571 ? 43.489  -0.088  36.212  1.00 28.03  ?  568  TYR C CG    1 
ATOM   10276 C CD1   . TYR C 1 571 ? 42.509  0.379   35.343  1.00 24.37  ?  568  TYR C CD1   1 
ATOM   10277 C CD2   . TYR C 1 571 ? 44.815  0.007   35.811  1.00 27.42  ?  568  TYR C CD2   1 
ATOM   10278 C CE1   . TYR C 1 571 ? 42.839  0.893   34.100  1.00 24.91  ?  568  TYR C CE1   1 
ATOM   10279 C CE2   . TYR C 1 571 ? 45.152  0.524   34.572  1.00 28.54  ?  568  TYR C CE2   1 
ATOM   10280 C CZ    . TYR C 1 571 ? 44.163  0.967   33.721  1.00 23.00  ?  568  TYR C CZ    1 
ATOM   10281 O OH    . TYR C 1 571 ? 44.493  1.479   32.485  1.00 23.00  ?  568  TYR C OH    1 
ATOM   10282 N N     . TYR C 1 572 ? 40.401  -2.055  36.991  1.00 19.64  ?  569  TYR C N     1 
ATOM   10283 C CA    . TYR C 1 572 ? 39.238  -2.222  36.123  1.00 17.84  ?  569  TYR C CA    1 
ATOM   10284 C C     . TYR C 1 572 ? 38.632  -0.853  35.875  1.00 26.91  ?  569  TYR C C     1 
ATOM   10285 O O     . TYR C 1 572 ? 38.009  -0.280  36.788  1.00 29.62  ?  569  TYR C O     1 
ATOM   10286 C CB    . TYR C 1 572 ? 38.224  -3.176  36.756  1.00 34.15  ?  569  TYR C CB    1 
ATOM   10287 C CG    . TYR C 1 572 ? 38.760  -4.583  36.921  1.00 25.23  ?  569  TYR C CG    1 
ATOM   10288 C CD1   . TYR C 1 572 ? 39.593  -4.912  37.985  1.00 32.38  ?  569  TYR C CD1   1 
ATOM   10289 C CD2   . TYR C 1 572 ? 38.447  -5.576  36.003  1.00 27.66  ?  569  TYR C CD2   1 
ATOM   10290 C CE1   . TYR C 1 572 ? 40.093  -6.196  38.130  1.00 37.02  ?  569  TYR C CE1   1 
ATOM   10291 C CE2   . TYR C 1 572 ? 38.941  -6.859  36.142  1.00 30.16  ?  569  TYR C CE2   1 
ATOM   10292 C CZ    . TYR C 1 572 ? 39.762  -7.165  37.205  1.00 32.55  ?  569  TYR C CZ    1 
ATOM   10293 O OH    . TYR C 1 572 ? 40.251  -8.443  37.343  1.00 38.84  ?  569  TYR C OH    1 
ATOM   10294 N N     . PRO C 1 573 ? 38.803  -0.281  34.685  1.00 21.52  ?  570  PRO C N     1 
ATOM   10295 C CA    . PRO C 1 573 ? 38.334  1.087   34.451  1.00 31.42  ?  570  PRO C CA    1 
ATOM   10296 C C     . PRO C 1 573 ? 36.818  1.170   34.400  1.00 33.06  ?  570  PRO C C     1 
ATOM   10297 O O     . PRO C 1 573 ? 36.128  0.217   34.028  1.00 29.81  ?  570  PRO C O     1 
ATOM   10298 C CB    . PRO C 1 573 ? 38.956  1.448   33.098  1.00 27.53  ?  570  PRO C CB    1 
ATOM   10299 C CG    . PRO C 1 573 ? 39.151  0.129   32.414  1.00 27.37  ?  570  PRO C CG    1 
ATOM   10300 C CD    . PRO C 1 573 ? 39.471  -0.856  33.504  1.00 23.49  ?  570  PRO C CD    1 
ATOM   10301 N N     . LYS C 1 574 ? 36.307  2.337   34.790  1.00 32.99  ?  571  LYS C N     1 
ATOM   10302 C CA    . LYS C 1 574 ? 34.877  2.608   34.704  1.00 34.39  ?  571  LYS C CA    1 
ATOM   10303 C C     . LYS C 1 574 ? 34.390  2.415   33.276  1.00 34.64  ?  571  LYS C C     1 
ATOM   10304 O O     . LYS C 1 574 ? 34.975  2.947   32.327  1.00 42.62  ?  571  LYS C O     1 
ATOM   10305 C CB    . LYS C 1 574 ? 34.586  4.035   35.174  1.00 26.73  ?  571  LYS C CB    1 
ATOM   10306 C CG    . LYS C 1 574 ? 33.114  4.435   35.139  1.00 31.29  ?  571  LYS C CG    1 
ATOM   10307 C CD    . LYS C 1 574 ? 32.946  5.923   35.440  1.00 40.93  ?  571  LYS C CD    1 
ATOM   10308 C CE    . LYS C 1 574 ? 31.495  6.377   35.315  1.00 45.04  ?  571  LYS C CE    1 
ATOM   10309 N NZ    . LYS C 1 574 ? 30.664  5.980   36.488  1.00 51.02  1  571  LYS C NZ    1 
ATOM   10310 N N     . THR C 1 575 ? 33.317  1.643   33.125  1.00 33.49  ?  572  THR C N     1 
ATOM   10311 C CA    . THR C 1 575 ? 32.748  1.375   31.814  1.00 28.27  ?  572  THR C CA    1 
ATOM   10312 C C     . THR C 1 575 ? 31.268  1.068   31.966  1.00 43.56  ?  572  THR C C     1 
ATOM   10313 O O     . THR C 1 575 ? 30.803  0.667   33.036  1.00 57.66  ?  572  THR C O     1 
ATOM   10314 C CB    . THR C 1 575 ? 33.450  0.206   31.110  1.00 38.98  ?  572  THR C CB    1 
ATOM   10315 O OG1   . THR C 1 575 ? 32.791  -0.068  29.867  1.00 44.74  ?  572  THR C OG1   1 
ATOM   10316 C CG2   . THR C 1 575 ? 33.418  -1.044  31.978  1.00 38.43  ?  572  THR C CG2   1 
ATOM   10317 N N     . PHE C 1 576 ? 30.529  1.266   30.878  1.00 41.82  ?  573  PHE C N     1 
ATOM   10318 C CA    . PHE C 1 576 ? 29.137  0.849   30.802  1.00 49.59  ?  573  PHE C CA    1 
ATOM   10319 C C     . PHE C 1 576 ? 28.971  -0.470  30.057  1.00 48.26  ?  573  PHE C C     1 
ATOM   10320 O O     . PHE C 1 576 ? 27.838  -0.906  29.833  1.00 53.91  ?  573  PHE C O     1 
ATOM   10321 C CB    . PHE C 1 576 ? 28.281  1.942   30.154  1.00 54.29  ?  573  PHE C CB    1 
ATOM   10322 C CG    . PHE C 1 576 ? 28.850  2.495   28.876  1.00 59.13  ?  573  PHE C CG    1 
ATOM   10323 C CD1   . PHE C 1 576 ? 28.552  1.907   27.657  1.00 63.09  ?  573  PHE C CD1   1 
ATOM   10324 C CD2   . PHE C 1 576 ? 29.667  3.616   28.890  1.00 56.54  ?  573  PHE C CD2   1 
ATOM   10325 C CE1   . PHE C 1 576 ? 29.068  2.416   26.477  1.00 58.28  ?  573  PHE C CE1   1 
ATOM   10326 C CE2   . PHE C 1 576 ? 30.189  4.129   27.714  1.00 56.42  ?  573  PHE C CE2   1 
ATOM   10327 C CZ    . PHE C 1 576 ? 29.888  3.528   26.506  1.00 54.66  ?  573  PHE C CZ    1 
ATOM   10328 N N     . LEU C 1 577 ? 30.072  -1.115  29.673  1.00 44.16  ?  574  LEU C N     1 
ATOM   10329 C CA    . LEU C 1 577 ? 30.017  -2.420  29.040  1.00 46.28  ?  574  LEU C CA    1 
ATOM   10330 C C     . LEU C 1 577 ? 30.623  -3.476  29.968  1.00 54.02  ?  574  LEU C C     1 
ATOM   10331 O O     . LEU C 1 577 ? 30.676  -3.291  31.193  1.00 47.12  ?  574  LEU C O     1 
ATOM   10332 C CB    . LEU C 1 577 ? 30.715  -2.361  27.679  1.00 48.28  ?  574  LEU C CB    1 
ATOM   10333 C CG    . LEU C 1 577 ? 29.765  -2.526  26.490  1.00 55.30  ?  574  LEU C CG    1 
ATOM   10334 C CD1   . LEU C 1 577 ? 29.078  -1.210  26.170  1.00 47.45  ?  574  LEU C CD1   1 
ATOM   10335 C CD2   . LEU C 1 577 ? 30.487  -3.082  25.271  1.00 53.02  ?  574  LEU C CD2   1 
ATOM   10336 N N     . ASN C 1 578 ? 31.080  -4.579  29.380  1.00 57.91  ?  575  ASN C N     1 
ATOM   10337 C CA    . ASN C 1 578 ? 31.583  -5.703  30.156  1.00 50.54  ?  575  ASN C CA    1 
ATOM   10338 C C     . ASN C 1 578 ? 32.790  -5.300  30.993  1.00 42.20  ?  575  ASN C C     1 
ATOM   10339 O O     . ASN C 1 578 ? 33.611  -4.477  30.582  1.00 40.11  ?  575  ASN C O     1 
ATOM   10340 C CB    . ASN C 1 578 ? 31.948  -6.853  29.217  1.00 47.85  ?  575  ASN C CB    1 
ATOM   10341 C CG    . ASN C 1 578 ? 32.683  -6.374  27.979  1.00 63.91  ?  575  ASN C CG    1 
ATOM   10342 O OD1   . ASN C 1 578