data_5I4E
# 
_entry.id   5I4E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I4E         
WWPDB D_1000218209 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2017-09-13 
_pdbx_database_PDB_obs_spr.pdb_id           5I4E 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2YCU 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I4E 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chinthalapudi, K.' 1 ? 
'Heissler, S.M.'    2 ? 
'Preller, M.'       3 ? 
'Sellers, J.R.'     4 ? 
'Manstein, D.J.'    5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Mechanistic insights into the active site and allosteric communication pathways in human nonmuscle myosin-2C.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.32742 
_citation.pdbx_database_id_PubMed   29256864 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chinthalapudi, K.' 1 ?                   
primary 'Heissler, S.M.'    2 ?                   
primary 'Preller, M.'       3 0000-0002-7784-4012 
primary 'Sellers, J.R.'     4 0000-0001-6296-564X 
primary 'Manstein, D.J.'    5 0000-0003-0763-0147 
# 
_cell.entry_id           5I4E 
_cell.length_a           81.120 
_cell.length_b           125.610 
_cell.length_c           153.960 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I4E 
_symmetry.space_group_name_H-M             'P 2 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Myosin-14,Alpha-actinin A' 111588.789 1   ? ? 'UNP residues 265-489,UNP residues 265-489' 
;NONMUSCLE MYOSIN 2C MOTOR DOMAIN, RESIDUES 47-799

ALPHA-ACTININ REPEATS,
RESIDUES 265-502
;
2 non-polymer syn 'ADP ORTHOVANADATE'         544.156    1   ? ? ?                                           ? 
3 non-polymer syn 'MAGNESIUM ION'             24.305     1   ? ? ?                                           ? 
4 water       nat water                       18.015     665 ? ? ?                                           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Myosin heavy chain 14,Myosin heavy chain,non-muscle IIc,Non-muscle myosin heavy chain IIc,NMHC II-C,Actin-binding protein A,F-actin cross-linking protein
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QVEWTARRLVWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLR
ERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTE
NTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLL
EKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEEIISML
RMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKA
TYERLFRWLVLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWT
FLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYK
ANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLS
NTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEK
MIQALELDPNLYRVGQSKIFFRAGVLAQLEEERASEQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHK
EYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKREPFVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQ
KYNRILKKLENWATTKSVYLGSNETGDSITAVQAKLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKD
TFFAQQWTGVKSSAETYKNT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QVEWTARRLVWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLR
ERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTE
NTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLL
EKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEEIISML
RMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKA
TYERLFRWLVLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWT
FLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYK
ANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLS
NTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEK
MIQALELDPNLYRVGQSKIFFRAGVLAQLEEERASEQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHK
EYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKREPFVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQ
KYNRILKKLENWATTKSVYLGSNETGDSITAVQAKLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKD
TFFAQQWTGVKSSAETYKNT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   VAL n 
1 3   GLU n 
1 4   TRP n 
1 5   THR n 
1 6   ALA n 
1 7   ARG n 
1 8   ARG n 
1 9   LEU n 
1 10  VAL n 
1 11  TRP n 
1 12  VAL n 
1 13  PRO n 
1 14  SER n 
1 15  GLU n 
1 16  LEU n 
1 17  HIS n 
1 18  GLY n 
1 19  PHE n 
1 20  GLU n 
1 21  ALA n 
1 22  ALA n 
1 23  ALA n 
1 24  LEU n 
1 25  ARG n 
1 26  ASP n 
1 27  GLU n 
1 28  GLY n 
1 29  GLU n 
1 30  GLU n 
1 31  GLU n 
1 32  ALA n 
1 33  GLU n 
1 34  VAL n 
1 35  GLU n 
1 36  LEU n 
1 37  ALA n 
1 38  GLU n 
1 39  SER n 
1 40  GLY n 
1 41  ARG n 
1 42  ARG n 
1 43  LEU n 
1 44  ARG n 
1 45  LEU n 
1 46  PRO n 
1 47  ARG n 
1 48  ASP n 
1 49  GLN n 
1 50  ILE n 
1 51  GLN n 
1 52  ARG n 
1 53  MET n 
1 54  ASN n 
1 55  PRO n 
1 56  PRO n 
1 57  LYS n 
1 58  PHE n 
1 59  SER n 
1 60  LYS n 
1 61  ALA n 
1 62  GLU n 
1 63  ASP n 
1 64  MET n 
1 65  ALA n 
1 66  GLU n 
1 67  LEU n 
1 68  THR n 
1 69  CYS n 
1 70  LEU n 
1 71  ASN n 
1 72  GLU n 
1 73  ALA n 
1 74  SER n 
1 75  VAL n 
1 76  LEU n 
1 77  HIS n 
1 78  ASN n 
1 79  LEU n 
1 80  ARG n 
1 81  GLU n 
1 82  ARG n 
1 83  TYR n 
1 84  TYR n 
1 85  SER n 
1 86  GLY n 
1 87  LEU n 
1 88  ILE n 
1 89  TYR n 
1 90  THR n 
1 91  TYR n 
1 92  SER n 
1 93  GLY n 
1 94  LEU n 
1 95  PHE n 
1 96  CYS n 
1 97  VAL n 
1 98  VAL n 
1 99  ILE n 
1 100 ASN n 
1 101 PRO n 
1 102 TYR n 
1 103 LYS n 
1 104 GLN n 
1 105 LEU n 
1 106 PRO n 
1 107 ILE n 
1 108 TYR n 
1 109 THR n 
1 110 GLU n 
1 111 ALA n 
1 112 ILE n 
1 113 VAL n 
1 114 GLU n 
1 115 MET n 
1 116 TYR n 
1 117 ARG n 
1 118 GLY n 
1 119 LYS n 
1 120 LYS n 
1 121 ARG n 
1 122 HIS n 
1 123 GLU n 
1 124 VAL n 
1 125 PRO n 
1 126 PRO n 
1 127 HIS n 
1 128 VAL n 
1 129 TYR n 
1 130 ALA n 
1 131 VAL n 
1 132 THR n 
1 133 GLU n 
1 134 GLY n 
1 135 ALA n 
1 136 TYR n 
1 137 ARG n 
1 138 SER n 
1 139 MET n 
1 140 LEU n 
1 141 GLN n 
1 142 ASP n 
1 143 ARG n 
1 144 GLU n 
1 145 ASP n 
1 146 GLN n 
1 147 SER n 
1 148 ILE n 
1 149 LEU n 
1 150 CYS n 
1 151 THR n 
1 152 GLY n 
1 153 GLU n 
1 154 SER n 
1 155 GLY n 
1 156 ALA n 
1 157 GLY n 
1 158 LYS n 
1 159 THR n 
1 160 GLU n 
1 161 ASN n 
1 162 THR n 
1 163 LYS n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 GLN n 
1 168 TYR n 
1 169 LEU n 
1 170 ALA n 
1 171 HIS n 
1 172 VAL n 
1 173 ALA n 
1 174 SER n 
1 175 SER n 
1 176 PRO n 
1 177 LYS n 
1 178 GLY n 
1 179 ARG n 
1 180 LYS n 
1 181 GLU n 
1 182 PRO n 
1 183 GLY n 
1 184 VAL n 
1 185 PRO n 
1 186 GLY n 
1 187 GLU n 
1 188 LEU n 
1 189 GLU n 
1 190 ARG n 
1 191 GLN n 
1 192 LEU n 
1 193 LEU n 
1 194 GLN n 
1 195 ALA n 
1 196 ASN n 
1 197 PRO n 
1 198 ILE n 
1 199 LEU n 
1 200 GLU n 
1 201 ALA n 
1 202 PHE n 
1 203 GLY n 
1 204 ASN n 
1 205 ALA n 
1 206 LYS n 
1 207 THR n 
1 208 VAL n 
1 209 LYS n 
1 210 ASN n 
1 211 ASP n 
1 212 ASN n 
1 213 SER n 
1 214 SER n 
1 215 ARG n 
1 216 PHE n 
1 217 GLY n 
1 218 LYS n 
1 219 PHE n 
1 220 ILE n 
1 221 ARG n 
1 222 ILE n 
1 223 ASN n 
1 224 PHE n 
1 225 ASP n 
1 226 VAL n 
1 227 ALA n 
1 228 GLY n 
1 229 TYR n 
1 230 ILE n 
1 231 VAL n 
1 232 GLY n 
1 233 ALA n 
1 234 ASN n 
1 235 ILE n 
1 236 GLU n 
1 237 THR n 
1 238 TYR n 
1 239 LEU n 
1 240 LEU n 
1 241 GLU n 
1 242 LYS n 
1 243 SER n 
1 244 ARG n 
1 245 ALA n 
1 246 ILE n 
1 247 ARG n 
1 248 GLN n 
1 249 ALA n 
1 250 LYS n 
1 251 ASP n 
1 252 GLU n 
1 253 CYS n 
1 254 SER n 
1 255 PHE n 
1 256 HIS n 
1 257 ILE n 
1 258 PHE n 
1 259 TYR n 
1 260 GLN n 
1 261 LEU n 
1 262 LEU n 
1 263 GLY n 
1 264 GLY n 
1 265 ALA n 
1 266 GLY n 
1 267 GLU n 
1 268 GLN n 
1 269 LEU n 
1 270 LYS n 
1 271 ALA n 
1 272 ASP n 
1 273 LEU n 
1 274 LEU n 
1 275 LEU n 
1 276 GLU n 
1 277 PRO n 
1 278 CYS n 
1 279 SER n 
1 280 HIS n 
1 281 TYR n 
1 282 ARG n 
1 283 PHE n 
1 284 LEU n 
1 285 THR n 
1 286 ASN n 
1 287 GLY n 
1 288 PRO n 
1 289 SER n 
1 290 SER n 
1 291 SER n 
1 292 PRO n 
1 293 GLY n 
1 294 GLN n 
1 295 GLU n 
1 296 ARG n 
1 297 GLU n 
1 298 LEU n 
1 299 PHE n 
1 300 GLN n 
1 301 GLU n 
1 302 THR n 
1 303 LEU n 
1 304 GLU n 
1 305 SER n 
1 306 LEU n 
1 307 ARG n 
1 308 VAL n 
1 309 LEU n 
1 310 GLY n 
1 311 PHE n 
1 312 SER n 
1 313 HIS n 
1 314 GLU n 
1 315 GLU n 
1 316 ILE n 
1 317 ILE n 
1 318 SER n 
1 319 MET n 
1 320 LEU n 
1 321 ARG n 
1 322 MET n 
1 323 VAL n 
1 324 SER n 
1 325 ALA n 
1 326 VAL n 
1 327 LEU n 
1 328 GLN n 
1 329 PHE n 
1 330 GLY n 
1 331 ASN n 
1 332 ILE n 
1 333 ALA n 
1 334 LEU n 
1 335 LYS n 
1 336 ARG n 
1 337 GLU n 
1 338 ARG n 
1 339 ASN n 
1 340 THR n 
1 341 ASP n 
1 342 GLN n 
1 343 ALA n 
1 344 THR n 
1 345 MET n 
1 346 PRO n 
1 347 ASP n 
1 348 ASN n 
1 349 THR n 
1 350 ALA n 
1 351 ALA n 
1 352 GLN n 
1 353 LYS n 
1 354 LEU n 
1 355 CYS n 
1 356 ARG n 
1 357 LEU n 
1 358 LEU n 
1 359 GLY n 
1 360 LEU n 
1 361 GLY n 
1 362 VAL n 
1 363 THR n 
1 364 ASP n 
1 365 PHE n 
1 366 SER n 
1 367 ARG n 
1 368 ALA n 
1 369 LEU n 
1 370 LEU n 
1 371 THR n 
1 372 PRO n 
1 373 ARG n 
1 374 ILE n 
1 375 LYS n 
1 376 VAL n 
1 377 GLY n 
1 378 ARG n 
1 379 ASP n 
1 380 TYR n 
1 381 VAL n 
1 382 GLN n 
1 383 LYS n 
1 384 ALA n 
1 385 GLN n 
1 386 THR n 
1 387 LYS n 
1 388 GLU n 
1 389 GLN n 
1 390 ALA n 
1 391 ASP n 
1 392 PHE n 
1 393 ALA n 
1 394 LEU n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 ALA n 
1 399 LYS n 
1 400 ALA n 
1 401 THR n 
1 402 TYR n 
1 403 GLU n 
1 404 ARG n 
1 405 LEU n 
1 406 PHE n 
1 407 ARG n 
1 408 TRP n 
1 409 LEU n 
1 410 VAL n 
1 411 LEU n 
1 412 ARG n 
1 413 LEU n 
1 414 ASN n 
1 415 ARG n 
1 416 ALA n 
1 417 LEU n 
1 418 ASP n 
1 419 ARG n 
1 420 SER n 
1 421 PRO n 
1 422 ARG n 
1 423 GLN n 
1 424 GLY n 
1 425 ALA n 
1 426 SER n 
1 427 PHE n 
1 428 LEU n 
1 429 GLY n 
1 430 ILE n 
1 431 LEU n 
1 432 ASP n 
1 433 ILE n 
1 434 ALA n 
1 435 GLY n 
1 436 PHE n 
1 437 GLU n 
1 438 ILE n 
1 439 PHE n 
1 440 GLN n 
1 441 LEU n 
1 442 ASN n 
1 443 SER n 
1 444 PHE n 
1 445 GLU n 
1 446 GLN n 
1 447 LEU n 
1 448 CYS n 
1 449 ILE n 
1 450 ASN n 
1 451 TYR n 
1 452 THR n 
1 453 ASN n 
1 454 GLU n 
1 455 LYS n 
1 456 LEU n 
1 457 GLN n 
1 458 GLN n 
1 459 LEU n 
1 460 PHE n 
1 461 ASN n 
1 462 HIS n 
1 463 THR n 
1 464 MET n 
1 465 PHE n 
1 466 VAL n 
1 467 LEU n 
1 468 GLU n 
1 469 GLN n 
1 470 GLU n 
1 471 GLU n 
1 472 TYR n 
1 473 GLN n 
1 474 ARG n 
1 475 GLU n 
1 476 GLY n 
1 477 ILE n 
1 478 PRO n 
1 479 TRP n 
1 480 THR n 
1 481 PHE n 
1 482 LEU n 
1 483 ASP n 
1 484 PHE n 
1 485 GLY n 
1 486 LEU n 
1 487 ASP n 
1 488 LEU n 
1 489 GLN n 
1 490 PRO n 
1 491 CYS n 
1 492 ILE n 
1 493 ASP n 
1 494 LEU n 
1 495 ILE n 
1 496 GLU n 
1 497 ARG n 
1 498 PRO n 
1 499 ALA n 
1 500 ASN n 
1 501 PRO n 
1 502 PRO n 
1 503 GLY n 
1 504 LEU n 
1 505 LEU n 
1 506 ALA n 
1 507 LEU n 
1 508 LEU n 
1 509 ASP n 
1 510 GLU n 
1 511 GLU n 
1 512 CYS n 
1 513 TRP n 
1 514 PHE n 
1 515 PRO n 
1 516 LYS n 
1 517 ALA n 
1 518 THR n 
1 519 ASP n 
1 520 LYS n 
1 521 SER n 
1 522 PHE n 
1 523 VAL n 
1 524 GLU n 
1 525 LYS n 
1 526 VAL n 
1 527 ALA n 
1 528 GLN n 
1 529 GLU n 
1 530 GLN n 
1 531 GLY n 
1 532 GLY n 
1 533 HIS n 
1 534 PRO n 
1 535 LYS n 
1 536 PHE n 
1 537 GLN n 
1 538 ARG n 
1 539 PRO n 
1 540 ARG n 
1 541 HIS n 
1 542 LEU n 
1 543 ARG n 
1 544 ASP n 
1 545 GLN n 
1 546 ALA n 
1 547 ASP n 
1 548 PHE n 
1 549 SER n 
1 550 VAL n 
1 551 LEU n 
1 552 HIS n 
1 553 TYR n 
1 554 ALA n 
1 555 GLY n 
1 556 LYS n 
1 557 VAL n 
1 558 ASP n 
1 559 TYR n 
1 560 LYS n 
1 561 ALA n 
1 562 ASN n 
1 563 GLU n 
1 564 TRP n 
1 565 LEU n 
1 566 MET n 
1 567 LYS n 
1 568 ASN n 
1 569 MET n 
1 570 ASP n 
1 571 PRO n 
1 572 LEU n 
1 573 ASN n 
1 574 ASP n 
1 575 ASN n 
1 576 VAL n 
1 577 ALA n 
1 578 ALA n 
1 579 LEU n 
1 580 LEU n 
1 581 HIS n 
1 582 GLN n 
1 583 SER n 
1 584 THR n 
1 585 ASP n 
1 586 ARG n 
1 587 LEU n 
1 588 THR n 
1 589 ALA n 
1 590 GLU n 
1 591 ILE n 
1 592 TRP n 
1 593 LYS n 
1 594 ASP n 
1 595 VAL n 
1 596 GLU n 
1 597 GLY n 
1 598 ILE n 
1 599 VAL n 
1 600 GLY n 
1 601 LEU n 
1 602 GLU n 
1 603 GLN n 
1 604 VAL n 
1 605 SER n 
1 606 SER n 
1 607 LEU n 
1 608 GLY n 
1 609 ASP n 
1 610 GLY n 
1 611 PRO n 
1 612 PRO n 
1 613 GLY n 
1 614 GLY n 
1 615 ARG n 
1 616 PRO n 
1 617 ARG n 
1 618 ARG n 
1 619 GLY n 
1 620 MET n 
1 621 PHE n 
1 622 ARG n 
1 623 THR n 
1 624 VAL n 
1 625 GLY n 
1 626 GLN n 
1 627 LEU n 
1 628 TYR n 
1 629 LYS n 
1 630 GLU n 
1 631 SER n 
1 632 LEU n 
1 633 SER n 
1 634 ARG n 
1 635 LEU n 
1 636 MET n 
1 637 ALA n 
1 638 THR n 
1 639 LEU n 
1 640 SER n 
1 641 ASN n 
1 642 THR n 
1 643 ASN n 
1 644 PRO n 
1 645 SER n 
1 646 PHE n 
1 647 VAL n 
1 648 ARG n 
1 649 CYS n 
1 650 ILE n 
1 651 VAL n 
1 652 PRO n 
1 653 ASN n 
1 654 HIS n 
1 655 GLU n 
1 656 LYS n 
1 657 ARG n 
1 658 ALA n 
1 659 GLY n 
1 660 LYS n 
1 661 LEU n 
1 662 GLU n 
1 663 PRO n 
1 664 ARG n 
1 665 LEU n 
1 666 VAL n 
1 667 LEU n 
1 668 ASP n 
1 669 GLN n 
1 670 LEU n 
1 671 ARG n 
1 672 CYS n 
1 673 ASN n 
1 674 GLY n 
1 675 VAL n 
1 676 LEU n 
1 677 GLU n 
1 678 GLY n 
1 679 ILE n 
1 680 ARG n 
1 681 ILE n 
1 682 CYS n 
1 683 ARG n 
1 684 GLN n 
1 685 GLY n 
1 686 PHE n 
1 687 PRO n 
1 688 ASN n 
1 689 ARG n 
1 690 ILE n 
1 691 LEU n 
1 692 PHE n 
1 693 GLN n 
1 694 GLU n 
1 695 PHE n 
1 696 ARG n 
1 697 GLN n 
1 698 ARG n 
1 699 TYR n 
1 700 GLU n 
1 701 ILE n 
1 702 LEU n 
1 703 THR n 
1 704 PRO n 
1 705 ASN n 
1 706 ALA n 
1 707 ILE n 
1 708 PRO n 
1 709 LYS n 
1 710 GLY n 
1 711 PHE n 
1 712 MET n 
1 713 ASP n 
1 714 GLY n 
1 715 LYS n 
1 716 GLN n 
1 717 ALA n 
1 718 CYS n 
1 719 GLU n 
1 720 LYS n 
1 721 MET n 
1 722 ILE n 
1 723 GLN n 
1 724 ALA n 
1 725 LEU n 
1 726 GLU n 
1 727 LEU n 
1 728 ASP n 
1 729 PRO n 
1 730 ASN n 
1 731 LEU n 
1 732 TYR n 
1 733 ARG n 
1 734 VAL n 
1 735 GLY n 
1 736 GLN n 
1 737 SER n 
1 738 LYS n 
1 739 ILE n 
1 740 PHE n 
1 741 PHE n 
1 742 ARG n 
1 743 ALA n 
1 744 GLY n 
1 745 VAL n 
1 746 LEU n 
1 747 ALA n 
1 748 GLN n 
1 749 LEU n 
1 750 GLU n 
1 751 GLU n 
1 752 GLU n 
1 753 ARG n 
1 754 ALA n 
1 755 SER n 
1 756 GLU n 
1 757 GLN n 
1 758 THR n 
1 759 LYS n 
1 760 SER n 
1 761 ASP n 
1 762 TYR n 
1 763 LEU n 
1 764 LYS n 
1 765 ARG n 
1 766 ALA n 
1 767 ASN n 
1 768 GLU n 
1 769 LEU n 
1 770 VAL n 
1 771 GLN n 
1 772 TRP n 
1 773 ILE n 
1 774 ASN n 
1 775 ASP n 
1 776 LYS n 
1 777 GLN n 
1 778 ALA n 
1 779 SER n 
1 780 LEU n 
1 781 GLU n 
1 782 SER n 
1 783 ARG n 
1 784 ASP n 
1 785 PHE n 
1 786 GLY n 
1 787 ASP n 
1 788 SER n 
1 789 ILE n 
1 790 GLU n 
1 791 SER n 
1 792 VAL n 
1 793 GLN n 
1 794 SER n 
1 795 PHE n 
1 796 MET n 
1 797 ASN n 
1 798 ALA n 
1 799 HIS n 
1 800 LYS n 
1 801 GLU n 
1 802 TYR n 
1 803 LYS n 
1 804 LYS n 
1 805 THR n 
1 806 GLU n 
1 807 LYS n 
1 808 PRO n 
1 809 PRO n 
1 810 LYS n 
1 811 GLY n 
1 812 GLN n 
1 813 GLU n 
1 814 VAL n 
1 815 SER n 
1 816 GLU n 
1 817 LEU n 
1 818 GLU n 
1 819 ALA n 
1 820 ILE n 
1 821 TYR n 
1 822 ASN n 
1 823 SER n 
1 824 LEU n 
1 825 GLN n 
1 826 THR n 
1 827 LYS n 
1 828 LEU n 
1 829 ARG n 
1 830 LEU n 
1 831 ILE n 
1 832 LYS n 
1 833 ARG n 
1 834 GLU n 
1 835 PRO n 
1 836 PHE n 
1 837 VAL n 
1 838 ALA n 
1 839 PRO n 
1 840 ALA n 
1 841 GLY n 
1 842 LEU n 
1 843 THR n 
1 844 PRO n 
1 845 ASN n 
1 846 GLU n 
1 847 ILE n 
1 848 ASP n 
1 849 SER n 
1 850 THR n 
1 851 TRP n 
1 852 SER n 
1 853 ALA n 
1 854 LEU n 
1 855 GLU n 
1 856 LYS n 
1 857 ALA n 
1 858 GLU n 
1 859 GLN n 
1 860 GLU n 
1 861 HIS n 
1 862 ALA n 
1 863 GLU n 
1 864 ALA n 
1 865 LEU n 
1 866 ARG n 
1 867 ILE n 
1 868 GLU n 
1 869 LEU n 
1 870 LYS n 
1 871 ARG n 
1 872 GLN n 
1 873 LYS n 
1 874 LYS n 
1 875 ILE n 
1 876 ALA n 
1 877 VAL n 
1 878 LEU n 
1 879 LEU n 
1 880 GLN n 
1 881 LYS n 
1 882 TYR n 
1 883 ASN n 
1 884 ARG n 
1 885 ILE n 
1 886 LEU n 
1 887 LYS n 
1 888 LYS n 
1 889 LEU n 
1 890 GLU n 
1 891 ASN n 
1 892 TRP n 
1 893 ALA n 
1 894 THR n 
1 895 THR n 
1 896 LYS n 
1 897 SER n 
1 898 VAL n 
1 899 TYR n 
1 900 LEU n 
1 901 GLY n 
1 902 SER n 
1 903 ASN n 
1 904 GLU n 
1 905 THR n 
1 906 GLY n 
1 907 ASP n 
1 908 SER n 
1 909 ILE n 
1 910 THR n 
1 911 ALA n 
1 912 VAL n 
1 913 GLN n 
1 914 ALA n 
1 915 LYS n 
1 916 LEU n 
1 917 LYS n 
1 918 ASN n 
1 919 LEU n 
1 920 GLU n 
1 921 ALA n 
1 922 PHE n 
1 923 ASP n 
1 924 GLY n 
1 925 GLU n 
1 926 CYS n 
1 927 GLN n 
1 928 SER n 
1 929 LEU n 
1 930 GLU n 
1 931 GLY n 
1 932 GLN n 
1 933 SER n 
1 934 ASN n 
1 935 SER n 
1 936 ASP n 
1 937 LEU n 
1 938 LEU n 
1 939 SER n 
1 940 ILE n 
1 941 LEU n 
1 942 ALA n 
1 943 GLN n 
1 944 LEU n 
1 945 THR n 
1 946 GLU n 
1 947 LEU n 
1 948 ASN n 
1 949 TYR n 
1 950 ASN n 
1 951 GLY n 
1 952 VAL n 
1 953 PRO n 
1 954 GLU n 
1 955 LEU n 
1 956 THR n 
1 957 GLU n 
1 958 ARG n 
1 959 LYS n 
1 960 ASP n 
1 961 THR n 
1 962 PHE n 
1 963 PHE n 
1 964 ALA n 
1 965 GLN n 
1 966 GLN n 
1 967 TRP n 
1 968 THR n 
1 969 GLY n 
1 970 VAL n 
1 971 LYS n 
1 972 SER n 
1 973 SER n 
1 974 ALA n 
1 975 GLU n 
1 976 THR n 
1 977 TYR n 
1 978 LYS n 
1 979 ASN n 
1 980 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   738 Human        ? 'MYH14, KIAA2034, FP17425'  ? ? ? ? ? ? 'Homo sapiens'             9606  ? 
? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? pFastBac ? ? ? pFastBac1 ? ? 
1 2 sample 'Biological sequence' 739 980 'Slime mold' ? 'abpA, actnA, DDB_G0268632' ? ? ? ? ? ? 'Dictyostelium discoideum' 44689 ? 
? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? pFastBac ? ? ? pFastBac1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MYH14_HUMAN Q7Z406 Q7Z406-5 1 
;QVEWTARRLVWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLR
ERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTE
NTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLL
EKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEEIISML
RMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKA
TYERLFRWLVLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWT
FLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYK
ANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLS
NTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEK
MIQALELDPNLYRVGQSK
;
47  
2 UNP ACTNA_DICDI P05095 ?        1 
;EQTKSDYLKRANELVQWINDKQASLESRDFGDSIESVQSFMNAHKEYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKREP
FVAPAGLTPNEIDSTWSALEKAEQEHAEALRIELKRQKKIAVLLQKYNRILKKLENWATTKSVYLGSNETGDSITAVQAK
LKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKDTFFAQQWTGVKSSAETYKNT
;
265 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5I4E A 1   ? 738 ? Q7Z406 47  ? 784 ? 47  784  
2 2 5I4E A 756 ? 980 ? P05095 265 ? 489 ? 802 1026 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I4E ILE A 739 ? UNP Q7Z406 ? ? linker 785 1  
1 5I4E PHE A 740 ? UNP Q7Z406 ? ? linker 786 2  
1 5I4E PHE A 741 ? UNP Q7Z406 ? ? linker 787 3  
1 5I4E ARG A 742 ? UNP Q7Z406 ? ? linker 788 4  
1 5I4E ALA A 743 ? UNP Q7Z406 ? ? linker 789 5  
1 5I4E GLY A 744 ? UNP Q7Z406 ? ? linker 790 6  
1 5I4E VAL A 745 ? UNP Q7Z406 ? ? linker 791 7  
1 5I4E LEU A 746 ? UNP Q7Z406 ? ? linker 792 8  
1 5I4E ALA A 747 ? UNP Q7Z406 ? ? linker 793 9  
1 5I4E GLN A 748 ? UNP Q7Z406 ? ? linker 794 10 
1 5I4E LEU A 749 ? UNP Q7Z406 ? ? linker 795 11 
1 5I4E GLU A 750 ? UNP Q7Z406 ? ? linker 796 12 
1 5I4E GLU A 751 ? UNP Q7Z406 ? ? linker 797 13 
1 5I4E GLU A 752 ? UNP Q7Z406 ? ? linker 798 14 
1 5I4E ARG A 753 ? UNP Q7Z406 ? ? linker 799 15 
1 5I4E ALA A 754 ? UNP Q7Z406 ? ? linker 800 16 
1 5I4E SER A 755 ? UNP Q7Z406 ? ? linker 801 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'          89.093  
AOV non-polymer         . 'ADP ORTHOVANADATE' ? 'C10 H17 N5 O14 P2 V' 544.156 
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER               ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'     ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I4E 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.58 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            281.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'TRIS PH 8.2, PEG 5K MME, MPD, NACL.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MARRESEARCH 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-01-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91841 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.91841 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate            42.47 
_reflns.entry_id                         5I4E 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 97.33 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       75357 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  14.82 
_reflns.pdbx_Rmerge_I_obs                0.12 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.35 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.63 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.23 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             14.97 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I4E 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     75245 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.77 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.220 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 0.000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.030 
_refine.ls_number_reflns_R_free                  3786 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.893 
_refine.correlation_coeff_Fo_to_Fc_free          0.888 
_refine.B_iso_mean                               74.91 
_refine.aniso_B[1][1]                            10.71650 
_refine.aniso_B[2][2]                            18.87500 
_refine.aniso_B[3][3]                            -29.59150 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1BR2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.222 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.181 
_refine.pdbx_overall_SU_R_Blow_DPI               0.233 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.184 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        5I4E 
_refine_analyze.Luzzati_coordinate_error_obs    0.00 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        7697 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             666 
_refine_hist.number_atoms_total               8396 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        34.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  7878  'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.16  ? 2.00  10641 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  2886  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  233   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  1121  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 7878  'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  1     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           2.96  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           18.12 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  990   'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  9213  'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.25 
_refine_ls_shell.d_res_low                        2.31 
_refine_ls_shell.number_reflns_R_work             5211 
_refine_ls_shell.R_factor_R_work                  0.292 
_refine_ls_shell.percent_reflns_obs               99.16 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.percent_reflns_R_free            4.65 
_refine_ls_shell.number_reflns_R_free             254 
_refine_ls_shell.number_reflns_all                5465 
_refine_ls_shell.R_factor_all                     0.292 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5I4E 
_struct.title                        'Crystal Structure of Human Nonmuscle Myosin 2C motor domain' 
_struct.pdbx_descriptor              Myosin-2C 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I4E 
_struct_keywords.text            'Motor protein' 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TRP A 4   ? ARG A 7   ? TRP A 50  ARG A 53   5 ? 4  
HELX_P HELX_P2  AA2 ASP A 48  ? ILE A 50  ? ASP A 94  ILE A 96   5 ? 3  
HELX_P HELX_P3  AA3 PRO A 55  ? SER A 59  ? PRO A 101 SER A 105  5 ? 5  
HELX_P HELX_P4  AA4 ASP A 63  ? LEU A 67  ? ASP A 109 LEU A 113  5 ? 5  
HELX_P HELX_P5  AA5 ASN A 71  ? TYR A 84  ? ASN A 117 TYR A 130  1 ? 14 
HELX_P HELX_P6  AA6 THR A 109 ? ARG A 117 ? THR A 155 ARG A 163  1 ? 9  
HELX_P HELX_P7  AA7 HIS A 127 ? ARG A 143 ? HIS A 173 ARG A 189  1 ? 17 
HELX_P HELX_P8  AA8 GLY A 157 ? ALA A 173 ? GLY A 203 ALA A 219  1 ? 17 
HELX_P HELX_P9  AA9 GLY A 186 ? GLY A 203 ? GLY A 232 GLY A 249  1 ? 18 
HELX_P HELX_P10 AB1 GLU A 241 ? ILE A 246 ? GLU A 287 ILE A 292  5 ? 6  
HELX_P HELX_P11 AB2 PHE A 255 ? ALA A 265 ? PHE A 301 ALA A 311  1 ? 11 
HELX_P HELX_P12 AB3 GLY A 266 ? LEU A 273 ? GLY A 312 LEU A 319  1 ? 8  
HELX_P HELX_P13 AB4 PRO A 277 ? TYR A 281 ? PRO A 323 TYR A 327  5 ? 5  
HELX_P HELX_P14 AB5 GLY A 293 ? LEU A 309 ? GLY A 339 LEU A 355  1 ? 17 
HELX_P HELX_P15 AB6 SER A 312 ? PHE A 329 ? SER A 358 PHE A 375  1 ? 18 
HELX_P HELX_P16 AB7 GLY A 330 ? ILE A 332 ? GLY A 376 ILE A 378  5 ? 3  
HELX_P HELX_P17 AB8 ASN A 348 ? GLY A 359 ? ASN A 394 GLY A 405  1 ? 12 
HELX_P HELX_P18 AB9 GLY A 361 ? THR A 371 ? GLY A 407 THR A 417  1 ? 11 
HELX_P HELX_P19 AC1 THR A 386 ? ASP A 418 ? THR A 432 ASP A 464  1 ? 33 
HELX_P HELX_P20 AC2 SER A 443 ? ARG A 474 ? SER A 489 ARG A 520  1 ? 32 
HELX_P HELX_P21 AC3 LEU A 488 ? ARG A 497 ? LEU A 534 ARG A 543  1 ? 10 
HELX_P HELX_P22 AC4 GLY A 503 ? TRP A 513 ? GLY A 549 TRP A 559  1 ? 11 
HELX_P HELX_P23 AC5 THR A 518 ? GLY A 531 ? THR A 564 GLY A 577  1 ? 14 
HELX_P HELX_P24 AC6 GLU A 563 ? ASP A 570 ? GLU A 609 ASP A 616  1 ? 8  
HELX_P HELX_P25 AC7 ASN A 573 ? GLN A 582 ? ASN A 619 GLN A 628  1 ? 10 
HELX_P HELX_P26 AC8 ASP A 585 ? TRP A 592 ? ASP A 631 TRP A 638  1 ? 8  
HELX_P HELX_P27 AC9 THR A 623 ? ASN A 641 ? THR A 669 ASN A 687  1 ? 19 
HELX_P HELX_P28 AD1 GLU A 662 ? GLY A 674 ? GLU A 708 GLY A 720  1 ? 13 
HELX_P HELX_P29 AD2 GLY A 674 ? GLY A 685 ? GLY A 720 GLY A 731  1 ? 12 
HELX_P HELX_P30 AD3 PHE A 692 ? GLU A 700 ? PHE A 738 GLU A 746  1 ? 9  
HELX_P HELX_P31 AD4 ASP A 713 ? GLU A 726 ? ASP A 759 GLU A 772  1 ? 14 
HELX_P HELX_P32 AD5 ASP A 728 ? ASN A 730 ? ASP A 774 ASN A 776  5 ? 3  
HELX_P HELX_P33 AD6 GLY A 744 ? GLU A 781 ? GLY A 790 GLU A 827  1 ? 38 
HELX_P HELX_P34 AD7 SER A 788 ? GLU A 806 ? SER A 834 GLU A 852  1 ? 19 
HELX_P HELX_P35 AD8 GLU A 806 ? LEU A 828 ? GLU A 852 LEU A 874  1 ? 23 
HELX_P HELX_P36 AD9 THR A 843 ? LYS A 896 ? THR A 889 LYS A 942  1 ? 54 
HELX_P HELX_P37 AE1 SER A 897 ? GLY A 901 ? SER A 943 GLY A 947  5 ? 5  
HELX_P HELX_P38 AE2 SER A 908 ? LEU A 919 ? SER A 954 LEU A 965  1 ? 12 
HELX_P HELX_P39 AE3 PHE A 922 ? ALA A 942 ? PHE A 968 ALA A 988  1 ? 21 
HELX_P HELX_P40 AE4 ASN A 950 ? GLU A 975 ? ASN A 996 GLU A 1021 1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A THR 159 OG1 ? ? ? 1_555 C MG  . MG ? ? A THR 205  A MG  1501 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc2 metalc ? ? A SER 214 OG  ? ? ? 1_555 C MG  . MG ? ? A SER 260  A MG  1501 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc3 metalc ? ? B AOV .   O2B ? ? ? 1_555 C MG  . MG ? ? A AOV 1500 A MG  1501 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc4 metalc ? ? B AOV .   O1G ? ? ? 1_555 C MG  . MG ? ? A AOV 1500 A MG  1501 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc5 metalc ? ? C MG  .   MG  ? ? ? 1_555 D HOH . O  ? ? A MG  1501 A HOH 1639 1_555 ? ? ? ? ? ? ? 2.618 ? 
metalc6 metalc ? ? C MG  .   MG  ? ? ? 1_555 D HOH . O  ? ? A MG  1501 A HOH 1609 1_555 ? ? ? ? ? ? ? 1.919 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 7 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 42  ? PRO A 46  ? ARG A 88  PRO A 92  
AA1 2 GLU A 31  ? LEU A 36  ? GLU A 77  LEU A 82  
AA1 3 GLY A 18  ? GLU A 27  ? GLY A 64  GLU A 73  
AA1 4 LEU A 9   ? SER A 14  ? LEU A 55  SER A 60  
AA1 5 GLN A 51  ? ARG A 52  ? GLN A 97  ARG A 98  
AA2 1 TYR A 89  ? SER A 92  ? TYR A 135 SER A 138 
AA2 2 PHE A 95  ? ILE A 99  ? PHE A 141 ILE A 145 
AA2 3 ASN A 643 ? ILE A 650 ? ASN A 689 ILE A 696 
AA2 4 GLN A 146 ? THR A 151 ? GLN A 192 THR A 197 
AA2 5 PHE A 427 ? LEU A 431 ? PHE A 473 LEU A 477 
AA2 6 GLY A 217 ? PHE A 224 ? GLY A 263 PHE A 270 
AA2 7 ILE A 230 ? TYR A 238 ? ILE A 276 TYR A 284 
AA3 1 ASN A 204 ? ALA A 205 ? ASN A 250 ALA A 251 
AA3 2 SER A 213 ? SER A 214 ? SER A 259 SER A 260 
AA4 1 LYS A 335 ? ARG A 336 ? LYS A 381 ARG A 382 
AA4 2 ALA A 343 ? THR A 344 ? ALA A 389 THR A 390 
AA5 1 ARG A 373 ? VAL A 376 ? ARG A 419 VAL A 422 
AA5 2 ASP A 379 ? GLN A 382 ? ASP A 425 GLN A 428 
AA6 1 PHE A 536 ? GLN A 537 ? PHE A 582 GLN A 583 
AA6 2 PHE A 548 ? HIS A 552 ? PHE A 594 HIS A 598 
AA6 3 GLY A 555 ? TYR A 559 ? GLY A 601 TYR A 605 
AA7 1 ASN A 688 ? LEU A 691 ? ASN A 734 LEU A 737 
AA7 2 LYS A 738 ? PHE A 741 ? LYS A 784 PHE A 787 
AA7 3 TYR A 732 ? VAL A 734 ? TYR A 778 VAL A 780 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 45  ? O LEU A 91  N ALA A 32  ? N ALA A 78  
AA1 2 3 O GLU A 35  ? O GLU A 81  N ALA A 23  ? N ALA A 69  
AA1 3 4 O ALA A 22  ? O ALA A 68  N VAL A 10  ? N VAL A 56  
AA1 4 5 N TRP A 11  ? N TRP A 57  O GLN A 51  ? O GLN A 97  
AA2 1 2 N THR A 90  ? N THR A 136 O VAL A 97  ? O VAL A 143 
AA2 2 3 N CYS A 96  ? N CYS A 142 O ARG A 648 ? O ARG A 694 
AA2 3 4 O SER A 645 ? O SER A 691 N LEU A 149 ? N LEU A 195 
AA2 4 5 N ILE A 148 ? N ILE A 194 O GLY A 429 ? O GLY A 475 
AA2 5 6 O ILE A 430 ? O ILE A 476 N ILE A 220 ? N ILE A 266 
AA2 6 7 N ASN A 223 ? N ASN A 269 O VAL A 231 ? O VAL A 277 
AA3 1 2 N ALA A 205 ? N ALA A 251 O SER A 213 ? O SER A 259 
AA4 1 2 N LYS A 335 ? N LYS A 381 O THR A 344 ? O THR A 390 
AA5 1 2 N ILE A 374 ? N ILE A 420 O VAL A 381 ? O VAL A 427 
AA6 1 2 N GLN A 537 ? N GLN A 583 O SER A 549 ? O SER A 595 
AA6 2 3 N PHE A 548 ? N PHE A 594 O TYR A 559 ? O TYR A 605 
AA7 1 2 N ASN A 688 ? N ASN A 734 O PHE A 741 ? O PHE A 787 
AA7 2 3 O PHE A 740 ? O PHE A 786 N ARG A 733 ? N ARG A 779 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A AOV 1500 ? 23 'binding site for residue AOV A 1500' 
AC2 Software A MG  1501 ? 5  'binding site for residue MG A 1501'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASN A 100 ? ASN A 146  . ? 1_555 ? 
2  AC1 23 TYR A 102 ? TYR A 148  . ? 1_555 ? 
3  AC1 23 LYS A 103 ? LYS A 149  . ? 1_555 ? 
4  AC1 23 TYR A 108 ? TYR A 154  . ? 1_555 ? 
5  AC1 23 SER A 154 ? SER A 200  . ? 1_555 ? 
6  AC1 23 GLY A 155 ? GLY A 201  . ? 1_555 ? 
7  AC1 23 ALA A 156 ? ALA A 202  . ? 1_555 ? 
8  AC1 23 GLY A 157 ? GLY A 203  . ? 1_555 ? 
9  AC1 23 LYS A 158 ? LYS A 204  . ? 1_555 ? 
10 AC1 23 THR A 159 ? THR A 205  . ? 1_555 ? 
11 AC1 23 GLU A 160 ? GLU A 206  . ? 1_555 ? 
12 AC1 23 ASN A 210 ? ASN A 256  . ? 1_555 ? 
13 AC1 23 SER A 213 ? SER A 259  . ? 1_555 ? 
14 AC1 23 SER A 214 ? SER A 260  . ? 1_555 ? 
15 AC1 23 GLY A 435 ? GLY A 481  . ? 1_555 ? 
16 AC1 23 MG  C .   ? MG  A 1501 . ? 1_555 ? 
17 AC1 23 HOH D .   ? HOH A 1609 . ? 1_555 ? 
18 AC1 23 HOH D .   ? HOH A 1612 . ? 1_555 ? 
19 AC1 23 HOH D .   ? HOH A 1634 . ? 1_555 ? 
20 AC1 23 HOH D .   ? HOH A 1639 . ? 1_555 ? 
21 AC1 23 HOH D .   ? HOH A 1680 . ? 1_555 ? 
22 AC1 23 HOH D .   ? HOH A 1782 . ? 1_555 ? 
23 AC1 23 HOH D .   ? HOH A 1797 . ? 1_555 ? 
24 AC2 5  THR A 159 ? THR A 205  . ? 1_555 ? 
25 AC2 5  SER A 214 ? SER A 260  . ? 1_555 ? 
26 AC2 5  AOV B .   ? AOV A 1500 . ? 1_555 ? 
27 AC2 5  HOH D .   ? HOH A 1609 . ? 1_555 ? 
28 AC2 5  HOH D .   ? HOH A 1639 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5I4E 
_atom_sites.fract_transf_matrix[1][1]   0.012327 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007961 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006495 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
V  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 3   ? -12.817 -37.971  -17.113 1.00 82.71  ? 49   GLU A N     1 
ATOM   2    C  CA    . GLU A 1 3   ? -13.371 -37.043  -16.131 1.00 82.37  ? 49   GLU A CA    1 
ATOM   3    C  C     . GLU A 1 3   ? -13.066 -35.590  -16.501 1.00 82.97  ? 49   GLU A C     1 
ATOM   4    O  O     . GLU A 1 3   ? -13.970 -34.756  -16.407 1.00 82.04  ? 49   GLU A O     1 
ATOM   5    C  CB    . GLU A 1 3   ? -12.880 -37.390  -14.713 1.00 84.43  ? 49   GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 3   ? -13.605 -36.671  -13.581 1.00 100.18 ? 49   GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 3   ? -13.071 -35.296  -13.220 1.00 134.09 ? 49   GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 3   ? -11.832 -35.107  -13.235 1.00 135.93 ? 49   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 3   ? -13.898 -34.406  -12.918 1.00 132.07 ? 49   GLU A OE2   1 
ATOM   10   N  N     . TRP A 1 4   ? -11.802 -35.276  -16.899 1.00 77.37  ? 50   TRP A N     1 
ATOM   11   C  CA    . TRP A 1 4   ? -11.432 -33.910  -17.314 1.00 75.76  ? 50   TRP A CA    1 
ATOM   12   C  C     . TRP A 1 4   ? -12.251 -33.525  -18.534 1.00 76.35  ? 50   TRP A C     1 
ATOM   13   O  O     . TRP A 1 4   ? -12.713 -32.396  -18.606 1.00 75.77  ? 50   TRP A O     1 
ATOM   14   C  CB    . TRP A 1 4   ? -9.921  -33.756  -17.598 1.00 74.49  ? 50   TRP A CB    1 
ATOM   15   C  CG    . TRP A 1 4   ? -9.525  -32.394  -18.126 1.00 75.06  ? 50   TRP A CG    1 
ATOM   16   C  CD1   . TRP A 1 4   ? -9.232  -31.282  -17.392 1.00 78.25  ? 50   TRP A CD1   1 
ATOM   17   C  CD2   . TRP A 1 4   ? -9.411  -32.003  -19.505 1.00 74.95  ? 50   TRP A CD2   1 
ATOM   18   N  NE1   . TRP A 1 4   ? -8.939  -30.225  -18.223 1.00 77.42  ? 50   TRP A NE1   1 
ATOM   19   C  CE2   . TRP A 1 4   ? -9.045  -30.639  -19.525 1.00 78.54  ? 50   TRP A CE2   1 
ATOM   20   C  CE3   . TRP A 1 4   ? -9.589  -32.673  -20.727 1.00 75.82  ? 50   TRP A CE3   1 
ATOM   21   C  CZ2   . TRP A 1 4   ? -8.855  -29.933  -20.714 1.00 77.50  ? 50   TRP A CZ2   1 
ATOM   22   C  CZ3   . TRP A 1 4   ? -9.394  -31.972  -21.906 1.00 77.25  ? 50   TRP A CZ3   1 
ATOM   23   C  CH2   . TRP A 1 4   ? -9.045  -30.616  -21.893 1.00 77.70  ? 50   TRP A CH2   1 
ATOM   24   N  N     . THR A 1 5   ? -12.460 -34.477  -19.464 1.00 71.74  ? 51   THR A N     1 
ATOM   25   C  CA    . THR A 1 5   ? -13.240 -34.296  -20.690 1.00 71.61  ? 51   THR A CA    1 
ATOM   26   C  C     . THR A 1 5   ? -14.732 -33.948  -20.402 1.00 73.96  ? 51   THR A C     1 
ATOM   27   O  O     . THR A 1 5   ? -15.343 -33.245  -21.207 1.00 73.80  ? 51   THR A O     1 
ATOM   28   C  CB    . THR A 1 5   ? -13.062 -35.502  -21.640 1.00 85.14  ? 51   THR A CB    1 
ATOM   29   O  OG1   . THR A 1 5   ? -13.703 -35.218  -22.891 1.00 88.30  ? 51   THR A OG1   1 
ATOM   30   C  CG2   . THR A 1 5   ? -13.573 -36.836  -21.045 1.00 84.40  ? 51   THR A CG2   1 
ATOM   31   N  N     . ALA A 1 6   ? -15.292 -34.412  -19.249 1.00 68.84  ? 52   ALA A N     1 
ATOM   32   C  CA    . ALA A 1 6   ? -16.675 -34.140  -18.813 1.00 67.02  ? 52   ALA A CA    1 
ATOM   33   C  C     . ALA A 1 6   ? -16.901 -32.651  -18.452 1.00 68.23  ? 52   ALA A C     1 
ATOM   34   O  O     . ALA A 1 6   ? -18.046 -32.183  -18.452 1.00 68.88  ? 52   ALA A O     1 
ATOM   35   C  CB    . ALA A 1 6   ? -17.044 -35.030  -17.640 1.00 67.21  ? 52   ALA A CB    1 
ATOM   36   N  N     . ARG A 1 7   ? -15.803 -31.914  -18.177 1.00 61.64  ? 53   ARG A N     1 
ATOM   37   C  CA    . ARG A 1 7   ? -15.779 -30.472  -17.873 1.00 60.06  ? 53   ARG A CA    1 
ATOM   38   C  C     . ARG A 1 7   ? -16.134 -29.631  -19.126 1.00 58.07  ? 53   ARG A C     1 
ATOM   39   O  O     . ARG A 1 7   ? -16.550 -28.483  -18.994 1.00 57.21  ? 53   ARG A O     1 
ATOM   40   C  CB    . ARG A 1 7   ? -14.402 -30.052  -17.315 1.00 59.95  ? 53   ARG A CB    1 
ATOM   41   C  CG    . ARG A 1 7   ? -14.021 -30.717  -15.995 1.00 70.97  ? 53   ARG A CG    1 
ATOM   42   C  CD    . ARG A 1 7   ? -12.637 -30.334  -15.500 1.00 87.69  ? 53   ARG A CD    1 
ATOM   43   N  NE    . ARG A 1 7   ? -12.434 -28.883  -15.483 1.00 107.08 ? 53   ARG A NE    1 
ATOM   44   C  CZ    . ARG A 1 7   ? -12.808 -28.074  -14.498 1.00 129.77 ? 53   ARG A CZ    1 
ATOM   45   N  NH1   . ARG A 1 7   ? -13.399 -28.563  -13.412 1.00 123.56 ? 53   ARG A NH1   1 
ATOM   46   N  NH2   . ARG A 1 7   ? -12.592 -26.767  -14.588 1.00 115.67 ? 53   ARG A NH2   1 
ATOM   47   N  N     . ARG A 1 8   ? -16.000 -30.237  -20.327 1.00 51.30  ? 54   ARG A N     1 
ATOM   48   C  CA    . ARG A 1 8   ? -16.295 -29.679  -21.648 1.00 49.94  ? 54   ARG A CA    1 
ATOM   49   C  C     . ARG A 1 8   ? -15.429 -28.425  -21.979 1.00 49.40  ? 54   ARG A C     1 
ATOM   50   O  O     . ARG A 1 8   ? -15.875 -27.561  -22.747 1.00 48.36  ? 54   ARG A O     1 
ATOM   51   C  CB    . ARG A 1 8   ? -17.808 -29.385  -21.766 1.00 52.77  ? 54   ARG A CB    1 
ATOM   52   C  CG    . ARG A 1 8   ? -18.702 -30.614  -21.796 1.00 63.62  ? 54   ARG A CG    1 
ATOM   53   C  CD    . ARG A 1 8   ? -19.245 -30.868  -23.190 1.00 71.43  ? 54   ARG A CD    1 
ATOM   54   N  NE    . ARG A 1 8   ? -20.479 -30.129  -23.469 1.00 72.96  ? 54   ARG A NE    1 
ATOM   55   C  CZ    . ARG A 1 8   ? -21.010 -29.989  -24.683 1.00 88.94  ? 54   ARG A CZ    1 
ATOM   56   N  NH1   . ARG A 1 8   ? -20.405 -30.512  -25.745 1.00 75.40  ? 54   ARG A NH1   1 
ATOM   57   N  NH2   . ARG A 1 8   ? -22.142 -29.313  -24.846 1.00 72.04  ? 54   ARG A NH2   1 
ATOM   58   N  N     . LEU A 1 9   ? -14.203 -28.329  -21.385 1.00 43.35  ? 55   LEU A N     1 
ATOM   59   C  CA    . LEU A 1 9   ? -13.300 -27.169  -21.518 1.00 43.39  ? 55   LEU A CA    1 
ATOM   60   C  C     . LEU A 1 9   ? -12.788 -26.890  -22.944 1.00 42.64  ? 55   LEU A C     1 
ATOM   61   O  O     . LEU A 1 9   ? -12.263 -27.768  -23.616 1.00 41.54  ? 55   LEU A O     1 
ATOM   62   C  CB    . LEU A 1 9   ? -12.108 -27.250  -20.548 1.00 43.63  ? 55   LEU A CB    1 
ATOM   63   C  CG    . LEU A 1 9   ? -12.384 -27.249  -19.043 1.00 48.58  ? 55   LEU A CG    1 
ATOM   64   C  CD1   . LEU A 1 9   ? -11.114 -27.561  -18.286 1.00 49.60  ? 55   LEU A CD1   1 
ATOM   65   C  CD2   . LEU A 1 9   ? -12.953 -25.916  -18.561 1.00 50.87  ? 55   LEU A CD2   1 
ATOM   66   N  N     . VAL A 1 10  ? -12.923 -25.652  -23.370 1.00 39.64  ? 56   VAL A N     1 
ATOM   67   C  CA    . VAL A 1 10  ? -12.509 -25.127  -24.695 1.00 39.40  ? 56   VAL A CA    1 
ATOM   68   C  C     . VAL A 1 10  ? -11.834 -23.754  -24.533 1.00 43.63  ? 56   VAL A C     1 
ATOM   69   O  O     . VAL A 1 10  ? -12.049 -23.086  -23.517 1.00 42.89  ? 56   VAL A O     1 
ATOM   70   C  CB    . VAL A 1 10  ? -13.712 -25.021  -25.697 1.00 43.23  ? 56   VAL A CB    1 
ATOM   71   C  CG1   . VAL A 1 10  ? -14.247 -26.389  -26.112 1.00 43.51  ? 56   VAL A CG1   1 
ATOM   72   C  CG2   . VAL A 1 10  ? -14.845 -24.141  -25.168 1.00 43.28  ? 56   VAL A CG2   1 
ATOM   73   N  N     . TRP A 1 11  ? -11.048 -23.313  -25.548 1.00 39.31  ? 57   TRP A N     1 
ATOM   74   C  CA    . TRP A 1 11  ? -10.497 -21.965  -25.572 1.00 37.42  ? 57   TRP A CA    1 
ATOM   75   C  C     . TRP A 1 11  ? -11.407 -21.133  -26.430 1.00 42.24  ? 57   TRP A C     1 
ATOM   76   O  O     . TRP A 1 11  ? -11.769 -21.555  -27.538 1.00 41.69  ? 57   TRP A O     1 
ATOM   77   C  CB    . TRP A 1 11  ? -9.097  -21.900  -26.215 1.00 34.92  ? 57   TRP A CB    1 
ATOM   78   C  CG    . TRP A 1 11  ? -8.030  -22.658  -25.504 1.00 33.75  ? 57   TRP A CG    1 
ATOM   79   C  CD1   . TRP A 1 11  ? -7.407  -23.798  -25.926 1.00 36.60  ? 57   TRP A CD1   1 
ATOM   80   C  CD2   . TRP A 1 11  ? -7.446  -22.327  -24.246 1.00 33.13  ? 57   TRP A CD2   1 
ATOM   81   N  NE1   . TRP A 1 11  ? -6.466  -24.192  -25.006 1.00 35.88  ? 57   TRP A NE1   1 
ATOM   82   C  CE2   . TRP A 1 11  ? -6.482  -23.309  -23.953 1.00 36.95  ? 57   TRP A CE2   1 
ATOM   83   C  CE3   . TRP A 1 11  ? -7.697  -21.316  -23.296 1.00 33.58  ? 57   TRP A CE3   1 
ATOM   84   C  CZ2   . TRP A 1 11  ? -5.755  -23.309  -22.764 1.00 35.85  ? 57   TRP A CZ2   1 
ATOM   85   C  CZ3   . TRP A 1 11  ? -6.979  -21.322  -22.117 1.00 33.94  ? 57   TRP A CZ3   1 
ATOM   86   C  CH2   . TRP A 1 11  ? -5.989  -22.276  -21.883 1.00 34.82  ? 57   TRP A CH2   1 
ATOM   87   N  N     . VAL A 1 12  ? -11.733 -19.921  -25.955 1.00 40.48  ? 58   VAL A N     1 
ATOM   88   C  CA    . VAL A 1 12  ? -12.512 -18.926  -26.702 1.00 40.23  ? 58   VAL A CA    1 
ATOM   89   C  C     . VAL A 1 12  ? -11.637 -17.659  -26.869 1.00 46.75  ? 58   VAL A C     1 
ATOM   90   O  O     . VAL A 1 12  ? -10.805 -17.424  -25.986 1.00 46.10  ? 58   VAL A O     1 
ATOM   91   C  CB    . VAL A 1 12  ? -13.888 -18.599  -26.037 1.00 43.28  ? 58   VAL A CB    1 
ATOM   92   C  CG1   . VAL A 1 12  ? -14.717 -19.860  -25.794 1.00 42.57  ? 58   VAL A CG1   1 
ATOM   93   C  CG2   . VAL A 1 12  ? -13.738 -17.793  -24.752 1.00 42.78  ? 58   VAL A CG2   1 
ATOM   94   N  N     . PRO A 1 13  ? -11.821 -16.798  -27.908 1.00 46.10  ? 59   PRO A N     1 
ATOM   95   C  CA    . PRO A 1 13  ? -11.019 -15.572  -27.981 1.00 47.07  ? 59   PRO A CA    1 
ATOM   96   C  C     . PRO A 1 13  ? -11.345 -14.611  -26.839 1.00 55.09  ? 59   PRO A C     1 
ATOM   97   O  O     . PRO A 1 13  ? -12.478 -14.537  -26.397 1.00 55.13  ? 59   PRO A O     1 
ATOM   98   C  CB    . PRO A 1 13  ? -11.412 -14.974  -29.333 1.00 48.62  ? 59   PRO A CB    1 
ATOM   99   C  CG    . PRO A 1 13  ? -12.750 -15.530  -29.632 1.00 52.34  ? 59   PRO A CG    1 
ATOM   100  C  CD    . PRO A 1 13  ? -12.757 -16.888  -29.054 1.00 48.45  ? 59   PRO A CD    1 
ATOM   101  N  N     . SER A 1 14  ? -10.333 -13.918  -26.337 1.00 53.91  ? 60   SER A N     1 
ATOM   102  C  CA    . SER A 1 14  ? -10.458 -12.937  -25.265 1.00 54.24  ? 60   SER A CA    1 
ATOM   103  C  C     . SER A 1 14  ? -9.675  -11.697  -25.706 1.00 62.85  ? 60   SER A C     1 
ATOM   104  O  O     . SER A 1 14  ? -8.552  -11.837  -26.213 1.00 61.15  ? 60   SER A O     1 
ATOM   105  C  CB    . SER A 1 14  ? -9.872  -13.491  -23.973 1.00 54.42  ? 60   SER A CB    1 
ATOM   106  O  OG    . SER A 1 14  ? -9.895  -12.509  -22.953 1.00 60.24  ? 60   SER A OG    1 
ATOM   107  N  N     . GLU A 1 15  ? -10.265 -10.493  -25.551 1.00 62.42  ? 61   GLU A N     1 
ATOM   108  C  CA    . GLU A 1 15  ? -9.559  -9.263   -25.937 1.00 63.43  ? 61   GLU A CA    1 
ATOM   109  C  C     . GLU A 1 15  ? -8.361  -9.035   -24.998 1.00 66.37  ? 61   GLU A C     1 
ATOM   110  O  O     . GLU A 1 15  ? -7.245  -8.801   -25.475 1.00 65.41  ? 61   GLU A O     1 
ATOM   111  C  CB    . GLU A 1 15  ? -10.499 -8.037   -25.938 1.00 65.32  ? 61   GLU A CB    1 
ATOM   112  C  CG    . GLU A 1 15  ? -11.415 -7.934   -27.151 1.00 80.85  ? 61   GLU A CG    1 
ATOM   113  C  CD    . GLU A 1 15  ? -10.785 -7.499   -28.463 1.00 118.70 ? 61   GLU A CD    1 
ATOM   114  O  OE1   . GLU A 1 15  ? -9.794  -6.732   -28.439 1.00 119.13 ? 61   GLU A OE1   1 
ATOM   115  O  OE2   . GLU A 1 15  ? -11.320 -7.893   -29.524 1.00 122.40 ? 61   GLU A OE2   1 
ATOM   116  N  N     . LEU A 1 16  ? -8.594  -9.172   -23.673 1.00 62.38  ? 62   LEU A N     1 
ATOM   117  C  CA    . LEU A 1 16  ? -7.597  -8.962   -22.637 1.00 62.51  ? 62   LEU A CA    1 
ATOM   118  C  C     . LEU A 1 16  ? -6.502  -10.038  -22.604 1.00 64.86  ? 62   LEU A C     1 
ATOM   119  O  O     . LEU A 1 16  ? -5.325  -9.686   -22.695 1.00 64.41  ? 62   LEU A O     1 
ATOM   120  C  CB    . LEU A 1 16  ? -8.270  -8.792   -21.248 1.00 63.20  ? 62   LEU A CB    1 
ATOM   121  C  CG    . LEU A 1 16  ? -7.363  -8.732   -19.989 1.00 69.43  ? 62   LEU A CG    1 
ATOM   122  C  CD1   . LEU A 1 16  ? -6.438  -7.521   -20.012 1.00 70.69  ? 62   LEU A CD1   1 
ATOM   123  C  CD2   . LEU A 1 16  ? -8.190  -8.656   -18.738 1.00 72.75  ? 62   LEU A CD2   1 
ATOM   124  N  N     . HIS A 1 17  ? -6.893  -11.323  -22.485 1.00 59.33  ? 63   HIS A N     1 
ATOM   125  C  CA    . HIS A 1 17  ? -6.020  -12.490  -22.316 1.00 58.28  ? 63   HIS A CA    1 
ATOM   126  C  C     . HIS A 1 17  ? -5.613  -13.259  -23.572 1.00 54.49  ? 63   HIS A C     1 
ATOM   127  O  O     . HIS A 1 17  ? -4.917  -14.277  -23.457 1.00 52.59  ? 63   HIS A O     1 
ATOM   128  C  CB    . HIS A 1 17  ? -6.698  -13.476  -21.346 1.00 60.57  ? 63   HIS A CB    1 
ATOM   129  C  CG    . HIS A 1 17  ? -6.961  -12.892  -20.000 1.00 65.11  ? 63   HIS A CG    1 
ATOM   130  N  ND1   . HIS A 1 17  ? -5.934  -12.651  -19.115 1.00 67.51  ? 63   HIS A ND1   1 
ATOM   131  C  CD2   . HIS A 1 17  ? -8.127  -12.495  -19.442 1.00 67.59  ? 63   HIS A CD2   1 
ATOM   132  C  CE1   . HIS A 1 17  ? -6.502  -12.128  -18.042 1.00 67.32  ? 63   HIS A CE1   1 
ATOM   133  N  NE2   . HIS A 1 17  ? -7.824  -12.022  -18.191 1.00 67.46  ? 63   HIS A NE2   1 
ATOM   134  N  N     . GLY A 1 18  ? -6.094  -12.826  -24.729 1.00 47.43  ? 64   GLY A N     1 
ATOM   135  C  CA    . GLY A 1 18  ? -5.827  -13.488  -26.002 1.00 47.17  ? 64   GLY A CA    1 
ATOM   136  C  C     . GLY A 1 18  ? -6.846  -14.576  -26.246 1.00 51.93  ? 64   GLY A C     1 
ATOM   137  O  O     . GLY A 1 18  ? -7.699  -14.448  -27.138 1.00 53.12  ? 64   GLY A O     1 
ATOM   138  N  N     . PHE A 1 19  ? -6.773  -15.637  -25.414 1.00 47.11  ? 65   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 19  ? -7.670  -16.794  -25.386 1.00 46.18  ? 65   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 19  ? -7.903  -17.147  -23.968 1.00 48.87  ? 65   PHE A C     1 
ATOM   141  O  O     . PHE A 1 19  ? -6.983  -17.028  -23.179 1.00 49.72  ? 65   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 19  ? -7.062  -18.003  -26.101 1.00 47.66  ? 65   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 19  ? -6.859  -17.769  -27.577 1.00 49.92  ? 65   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 19  ? -7.892  -17.996  -28.487 1.00 52.69  ? 65   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 19  ? -5.637  -17.306  -28.064 1.00 50.78  ? 65   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 19  ? -7.688  -17.793  -29.859 1.00 53.50  ? 65   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 19  ? -5.440  -17.104  -29.429 1.00 53.41  ? 65   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 19  ? -6.467  -17.340  -30.319 1.00 51.89  ? 65   PHE A CZ    1 
ATOM   149  N  N     . GLU A 1 20  ? -9.118  -17.570  -23.619 1.00 45.78  ? 66   GLU A N     1 
ATOM   150  C  CA    . GLU A 1 20  ? -9.399  -17.992  -22.238 1.00 45.79  ? 66   GLU A CA    1 
ATOM   151  C  C     . GLU A 1 20  ? -10.271 -19.253  -22.168 1.00 46.26  ? 66   GLU A C     1 
ATOM   152  O  O     . GLU A 1 20  ? -11.043 -19.531  -23.088 1.00 44.58  ? 66   GLU A O     1 
ATOM   153  C  CB    . GLU A 1 20  ? -9.959  -16.852  -21.365 1.00 47.41  ? 66   GLU A CB    1 
ATOM   154  C  CG    . GLU A 1 20  ? -11.297 -16.276  -21.793 1.00 57.99  ? 66   GLU A CG    1 
ATOM   155  C  CD    . GLU A 1 20  ? -11.806 -15.196  -20.859 1.00 84.23  ? 66   GLU A CD    1 
ATOM   156  O  OE1   . GLU A 1 20  ? -12.050 -15.501  -19.667 1.00 87.43  ? 66   GLU A OE1   1 
ATOM   157  O  OE2   . GLU A 1 20  ? -11.981 -14.045  -21.327 1.00 70.89  ? 66   GLU A OE2   1 
ATOM   158  N  N     . ALA A 1 21  ? -10.093 -20.028  -21.089 1.00 42.28  ? 67   ALA A N     1 
ATOM   159  C  CA    . ALA A 1 21  ? -10.825 -21.269  -20.824 1.00 42.68  ? 67   ALA A CA    1 
ATOM   160  C  C     . ALA A 1 21  ? -12.310 -20.995  -20.647 1.00 47.50  ? 67   ALA A C     1 
ATOM   161  O  O     . ALA A 1 21  ? -12.701 -19.990  -20.047 1.00 48.17  ? 67   ALA A O     1 
ATOM   162  C  CB    . ALA A 1 21  ? -10.268 -21.959  -19.588 1.00 43.09  ? 67   ALA A CB    1 
ATOM   163  N  N     . ALA A 1 22  ? -13.124 -21.829  -21.274 1.00 43.57  ? 68   ALA A N     1 
ATOM   164  C  CA    . ALA A 1 22  ? -14.579 -21.774  -21.205 1.00 43.11  ? 68   ALA A CA    1 
ATOM   165  C  C     . ALA A 1 22  ? -15.182 -23.193  -21.275 1.00 47.15  ? 68   ALA A C     1 
ATOM   166  O  O     . ALA A 1 22  ? -14.640 -24.064  -21.956 1.00 45.86  ? 68   ALA A O     1 
ATOM   167  C  CB    . ALA A 1 22  ? -15.139 -20.888  -22.307 1.00 43.26  ? 68   ALA A CB    1 
ATOM   168  N  N     . ALA A 1 23  ? -16.245 -23.450  -20.498 1.00 44.46  ? 69   ALA A N     1 
ATOM   169  C  CA    . ALA A 1 23  ? -16.932 -24.739  -20.486 1.00 44.31  ? 69   ALA A CA    1 
ATOM   170  C  C     . ALA A 1 23  ? -17.913 -24.704  -21.634 1.00 50.01  ? 69   ALA A C     1 
ATOM   171  O  O     . ALA A 1 23  ? -18.707 -23.756  -21.716 1.00 51.30  ? 69   ALA A O     1 
ATOM   172  C  CB    . ALA A 1 23  ? -17.669 -24.921  -19.172 1.00 45.14  ? 69   ALA A CB    1 
ATOM   173  N  N     . LEU A 1 24  ? -17.828 -25.665  -22.567 1.00 46.55  ? 70   LEU A N     1 
ATOM   174  C  CA    . LEU A 1 24  ? -18.753 -25.671  -23.706 1.00 47.45  ? 70   LEU A CA    1 
ATOM   175  C  C     . LEU A 1 24  ? -20.178 -26.093  -23.233 1.00 57.49  ? 70   LEU A C     1 
ATOM   176  O  O     . LEU A 1 24  ? -20.385 -27.226  -22.797 1.00 57.46  ? 70   LEU A O     1 
ATOM   177  C  CB    . LEU A 1 24  ? -18.208 -26.545  -24.856 1.00 46.82  ? 70   LEU A CB    1 
ATOM   178  C  CG    . LEU A 1 24  ? -19.053 -26.695  -26.119 1.00 50.48  ? 70   LEU A CG    1 
ATOM   179  C  CD1   . LEU A 1 24  ? -19.091 -25.411  -26.931 1.00 49.80  ? 70   LEU A CD1   1 
ATOM   180  C  CD2   . LEU A 1 24  ? -18.533 -27.837  -26.967 1.00 51.91  ? 70   LEU A CD2   1 
ATOM   181  N  N     . ARG A 1 25  ? -21.060 -25.104  -23.094 1.00 57.51  ? 71   ARG A N     1 
ATOM   182  C  CA    . ARG A 1 25  ? -22.434 -25.345  -22.641 1.00 58.14  ? 71   ARG A CA    1 
ATOM   183  C  C     . ARG A 1 25  ? -23.357 -26.107  -23.595 1.00 62.79  ? 71   ARG A C     1 
ATOM   184  O  O     . ARG A 1 25  ? -24.069 -27.024  -23.184 1.00 63.30  ? 71   ARG A O     1 
ATOM   185  C  CB    . ARG A 1 25  ? -23.093 -24.021  -22.239 1.00 60.91  ? 71   ARG A CB    1 
ATOM   186  C  CG    . ARG A 1 25  ? -24.517 -24.166  -21.727 1.00 86.34  ? 71   ARG A CG    1 
ATOM   187  C  CD    . ARG A 1 25  ? -25.105 -22.819  -21.341 1.00 114.78 ? 71   ARG A CD    1 
ATOM   188  N  NE    . ARG A 1 25  ? -26.468 -22.943  -20.833 1.00 136.87 ? 71   ARG A NE    1 
ATOM   189  C  CZ    . ARG A 1 25  ? -26.774 -23.126  -19.553 1.00 159.02 ? 71   ARG A CZ    1 
ATOM   190  N  NH1   . ARG A 1 25  ? -25.813 -23.209  -18.644 1.00 150.62 ? 71   ARG A NH1   1 
ATOM   191  N  NH2   . ARG A 1 25  ? -28.043 -23.228  -19.181 1.00 147.99 ? 71   ARG A NH2   1 
ATOM   192  N  N     . ASP A 1 26  ? -23.337 -25.720  -24.866 1.00 59.31  ? 72   ASP A N     1 
ATOM   193  C  CA    . ASP A 1 26  ? -24.174 -26.351  -25.882 1.00 59.96  ? 72   ASP A CA    1 
ATOM   194  C  C     . ASP A 1 26  ? -23.582 -26.069  -27.257 1.00 65.34  ? 72   ASP A C     1 
ATOM   195  O  O     . ASP A 1 26  ? -22.828 -25.110  -27.420 1.00 64.70  ? 72   ASP A O     1 
ATOM   196  C  CB    . ASP A 1 26  ? -25.605 -25.815  -25.795 1.00 62.32  ? 72   ASP A CB    1 
ATOM   197  C  CG    . ASP A 1 26  ? -26.616 -26.734  -26.455 1.00 70.25  ? 72   ASP A CG    1 
ATOM   198  O  OD1   . ASP A 1 26  ? -26.206 -27.785  -26.990 1.00 69.98  ? 72   ASP A OD1   1 
ATOM   199  O  OD2   . ASP A 1 26  ? -27.821 -26.404  -26.439 1.00 72.36  ? 72   ASP A OD2   1 
ATOM   200  N  N     . GLU A 1 27  ? -23.913 -26.891  -28.247 1.00 62.83  ? 73   GLU A N     1 
ATOM   201  C  CA    . GLU A 1 27  ? -23.375 -26.668  -29.584 1.00 62.65  ? 73   GLU A CA    1 
ATOM   202  C  C     . GLU A 1 27  ? -24.354 -26.722  -30.763 1.00 62.18  ? 73   GLU A C     1 
ATOM   203  O  O     . GLU A 1 27  ? -25.161 -27.643  -30.880 1.00 61.05  ? 73   GLU A O     1 
ATOM   204  C  CB    . GLU A 1 27  ? -22.210 -27.630  -29.846 1.00 65.04  ? 73   GLU A CB    1 
ATOM   205  C  CG    . GLU A 1 27  ? -21.577 -27.479  -31.220 1.00 81.70  ? 73   GLU A CG    1 
ATOM   206  C  CD    . GLU A 1 27  ? -20.430 -28.445  -31.442 1.00 106.28 ? 73   GLU A CD    1 
ATOM   207  O  OE1   . GLU A 1 27  ? -20.123 -29.228  -30.519 1.00 85.55  ? 73   GLU A OE1   1 
ATOM   208  O  OE2   . GLU A 1 27  ? -19.836 -28.421  -32.540 1.00 112.10 ? 73   GLU A OE2   1 
ATOM   209  N  N     . GLY A 1 28  ? -24.260 -25.716  -31.628 1.00 57.76  ? 74   GLY A N     1 
ATOM   210  C  CA    . GLY A 1 28  ? -25.021 -25.655  -32.873 1.00 57.15  ? 74   GLY A CA    1 
ATOM   211  C  C     . GLY A 1 28  ? -24.118 -25.627  -34.099 1.00 60.85  ? 74   GLY A C     1 
ATOM   212  O  O     . GLY A 1 28  ? -22.898 -25.531  -33.963 1.00 60.77  ? 74   GLY A O     1 
ATOM   213  N  N     . GLU A 1 29  ? -24.701 -25.691  -35.304 1.00 57.90  ? 75   GLU A N     1 
ATOM   214  C  CA    . GLU A 1 29  ? -23.966 -25.659  -36.577 1.00 58.33  ? 75   GLU A CA    1 
ATOM   215  C  C     . GLU A 1 29  ? -23.361 -24.275  -36.879 1.00 62.78  ? 75   GLU A C     1 
ATOM   216  O  O     . GLU A 1 29  ? -22.391 -24.181  -37.636 1.00 62.49  ? 75   GLU A O     1 
ATOM   217  C  CB    . GLU A 1 29  ? -24.874 -26.119  -37.737 1.00 59.51  ? 75   GLU A CB    1 
ATOM   218  C  CG    . GLU A 1 29  ? -24.138 -26.410  -39.041 1.00 69.30  ? 75   GLU A CG    1 
ATOM   219  C  CD    . GLU A 1 29  ? -23.175 -27.586  -39.069 1.00 94.21  ? 75   GLU A CD    1 
ATOM   220  O  OE1   . GLU A 1 29  ? -23.341 -28.536  -38.266 1.00 86.49  ? 75   GLU A OE1   1 
ATOM   221  O  OE2   . GLU A 1 29  ? -22.261 -27.566  -39.926 1.00 88.74  ? 75   GLU A OE2   1 
ATOM   222  N  N     . GLU A 1 30  ? -23.945 -23.212  -36.296 1.00 59.90  ? 76   GLU A N     1 
ATOM   223  C  CA    . GLU A 1 30  ? -23.523 -21.822  -36.495 1.00 60.19  ? 76   GLU A CA    1 
ATOM   224  C  C     . GLU A 1 30  ? -23.029 -21.187  -35.199 1.00 62.15  ? 76   GLU A C     1 
ATOM   225  O  O     . GLU A 1 30  ? -21.946 -20.608  -35.167 1.00 61.86  ? 76   GLU A O     1 
ATOM   226  C  CB    . GLU A 1 30  ? -24.681 -20.964  -37.080 1.00 61.97  ? 76   GLU A CB    1 
ATOM   227  C  CG    . GLU A 1 30  ? -25.198 -21.362  -38.457 1.00 75.64  ? 76   GLU A CG    1 
ATOM   228  C  CD    . GLU A 1 30  ? -24.240 -21.223  -39.627 1.00 111.86 ? 76   GLU A CD    1 
ATOM   229  O  OE1   . GLU A 1 30  ? -23.320 -20.374  -39.568 1.00 106.00 ? 76   GLU A OE1   1 
ATOM   230  O  OE2   . GLU A 1 30  ? -24.421 -21.971  -40.616 1.00 117.02 ? 76   GLU A OE2   1 
ATOM   231  N  N     . GLU A 1 31  ? -23.852 -21.249  -34.151 1.00 57.42  ? 77   GLU A N     1 
ATOM   232  C  CA    . GLU A 1 31  ? -23.580 -20.649  -32.855 1.00 57.32  ? 77   GLU A CA    1 
ATOM   233  C  C     . GLU A 1 31  ? -23.131 -21.699  -31.841 1.00 62.28  ? 77   GLU A C     1 
ATOM   234  O  O     . GLU A 1 31  ? -23.231 -22.899  -32.102 1.00 63.21  ? 77   GLU A O     1 
ATOM   235  C  CB    . GLU A 1 31  ? -24.839 -19.911  -32.366 1.00 58.89  ? 77   GLU A CB    1 
ATOM   236  C  CG    . GLU A 1 31  ? -24.564 -18.638  -31.583 1.00 69.20  ? 77   GLU A CG    1 
ATOM   237  C  CD    . GLU A 1 31  ? -25.780 -17.759  -31.374 1.00 85.92  ? 77   GLU A CD    1 
ATOM   238  O  OE1   . GLU A 1 31  ? -25.911 -16.748  -32.103 1.00 90.13  ? 77   GLU A OE1   1 
ATOM   239  O  OE2   . GLU A 1 31  ? -26.594 -18.069  -30.475 1.00 73.09  ? 77   GLU A OE2   1 
ATOM   240  N  N     . ALA A 1 32  ? -22.592 -21.245  -30.703 1.00 57.77  ? 78   ALA A N     1 
ATOM   241  C  CA    . ALA A 1 32  ? -22.150 -22.079  -29.595 1.00 57.30  ? 78   ALA A CA    1 
ATOM   242  C  C     . ALA A 1 32  ? -22.244 -21.262  -28.330 1.00 61.07  ? 78   ALA A C     1 
ATOM   243  O  O     . ALA A 1 32  ? -21.986 -20.062  -28.348 1.00 62.47  ? 78   ALA A O     1 
ATOM   244  C  CB    . ALA A 1 32  ? -20.721 -22.554  -29.807 1.00 58.16  ? 78   ALA A CB    1 
ATOM   245  N  N     . GLU A 1 33  ? -22.669 -21.890  -27.252 1.00 56.15  ? 79   GLU A N     1 
ATOM   246  C  CA    . GLU A 1 33  ? -22.792 -21.246  -25.958 1.00 55.20  ? 79   GLU A CA    1 
ATOM   247  C  C     . GLU A 1 33  ? -21.720 -21.838  -25.062 1.00 53.72  ? 79   GLU A C     1 
ATOM   248  O  O     . GLU A 1 33  ? -21.455 -23.046  -25.077 1.00 53.65  ? 79   GLU A O     1 
ATOM   249  C  CB    . GLU A 1 33  ? -24.203 -21.419  -25.368 1.00 57.24  ? 79   GLU A CB    1 
ATOM   250  C  CG    . GLU A 1 33  ? -24.521 -20.444  -24.242 1.00 71.32  ? 79   GLU A CG    1 
ATOM   251  C  CD    . GLU A 1 33  ? -25.989 -20.312  -23.888 1.00 105.36 ? 79   GLU A CD    1 
ATOM   252  O  OE1   . GLU A 1 33  ? -26.631 -21.350  -23.604 1.00 108.79 ? 79   GLU A OE1   1 
ATOM   253  O  OE2   . GLU A 1 33  ? -26.497 -19.168  -23.878 1.00 106.56 ? 79   GLU A OE2   1 
ATOM   254  N  N     . VAL A 1 34  ? -21.047 -20.963  -24.353 1.00 44.98  ? 80   VAL A N     1 
ATOM   255  C  CA    . VAL A 1 34  ? -19.943 -21.309  -23.488 1.00 42.28  ? 80   VAL A CA    1 
ATOM   256  C  C     . VAL A 1 34  ? -20.157 -20.574  -22.198 1.00 46.28  ? 80   VAL A C     1 
ATOM   257  O  O     . VAL A 1 34  ? -20.906 -19.593  -22.154 1.00 45.25  ? 80   VAL A O     1 
ATOM   258  C  CB    . VAL A 1 34  ? -18.557 -20.946  -24.123 1.00 44.13  ? 80   VAL A CB    1 
ATOM   259  C  CG1   . VAL A 1 34  ? -18.267 -21.794  -25.357 1.00 43.06  ? 80   VAL A CG1   1 
ATOM   260  C  CG2   . VAL A 1 34  ? -18.443 -19.444  -24.447 1.00 43.58  ? 80   VAL A CG2   1 
ATOM   261  N  N     . GLU A 1 35  ? -19.474 -21.036  -21.154 1.00 44.60  ? 81   GLU A N     1 
ATOM   262  C  CA    . GLU A 1 35  ? -19.452 -20.414  -19.849 1.00 44.91  ? 81   GLU A CA    1 
ATOM   263  C  C     . GLU A 1 35  ? -17.981 -20.191  -19.539 1.00 49.98  ? 81   GLU A C     1 
ATOM   264  O  O     . GLU A 1 35  ? -17.230 -21.160  -19.520 1.00 45.78  ? 81   GLU A O     1 
ATOM   265  C  CB    . GLU A 1 35  ? -20.067 -21.343  -18.813 1.00 46.04  ? 81   GLU A CB    1 
ATOM   266  C  CG    . GLU A 1 35  ? -20.003 -20.801  -17.398 1.00 58.31  ? 81   GLU A CG    1 
ATOM   267  C  CD    . GLU A 1 35  ? -20.104 -21.862  -16.315 1.00 76.10  ? 81   GLU A CD    1 
ATOM   268  O  OE1   . GLU A 1 35  ? -21.147 -22.556  -16.248 1.00 57.90  ? 81   GLU A OE1   1 
ATOM   269  O  OE2   . GLU A 1 35  ? -19.128 -22.008  -15.543 1.00 61.97  ? 81   GLU A OE2   1 
ATOM   270  N  N     . LEU A 1 36  ? -17.564 -18.934  -19.286 1.00 51.53  ? 82   LEU A N     1 
ATOM   271  C  CA    . LEU A 1 36  ? -16.159 -18.652  -18.945 1.00 54.11  ? 82   LEU A CA    1 
ATOM   272  C  C     . LEU A 1 36  ? -15.776 -19.293  -17.624 1.00 61.78  ? 82   LEU A C     1 
ATOM   273  O  O     . LEU A 1 36  ? -16.568 -19.270  -16.682 1.00 62.56  ? 82   LEU A O     1 
ATOM   274  C  CB    . LEU A 1 36  ? -15.849 -17.141  -18.928 1.00 54.73  ? 82   LEU A CB    1 
ATOM   275  C  CG    . LEU A 1 36  ? -16.001 -16.391  -20.263 1.00 59.83  ? 82   LEU A CG    1 
ATOM   276  C  CD1   . LEU A 1 36  ? -15.784 -14.900  -20.081 1.00 60.18  ? 82   LEU A CD1   1 
ATOM   277  C  CD2   . LEU A 1 36  ? -15.044 -16.922  -21.310 1.00 62.65  ? 82   LEU A CD2   1 
ATOM   278  N  N     . ALA A 1 37  ? -14.603 -19.928  -17.572 1.00 59.73  ? 83   ALA A N     1 
ATOM   279  C  CA    . ALA A 1 37  ? -14.153 -20.588  -16.356 1.00 60.87  ? 83   ALA A CA    1 
ATOM   280  C  C     . ALA A 1 37  ? -13.891 -19.576  -15.232 1.00 67.73  ? 83   ALA A C     1 
ATOM   281  O  O     . ALA A 1 37  ? -14.424 -19.750  -14.138 1.00 67.02  ? 83   ALA A O     1 
ATOM   282  C  CB    . ALA A 1 37  ? -12.914 -21.429  -16.633 1.00 61.72  ? 83   ALA A CB    1 
ATOM   283  N  N     . GLU A 1 38  ? -13.131 -18.496  -15.521 1.00 67.06  ? 84   GLU A N     1 
ATOM   284  C  CA    . GLU A 1 38  ? -12.764 -17.447  -14.562 1.00 67.75  ? 84   GLU A CA    1 
ATOM   285  C  C     . GLU A 1 38  ? -13.958 -16.767  -13.874 1.00 69.13  ? 84   GLU A C     1 
ATOM   286  O  O     . GLU A 1 38  ? -14.065 -16.837  -12.649 1.00 69.42  ? 84   GLU A O     1 
ATOM   287  C  CB    . GLU A 1 38  ? -11.867 -16.387  -15.223 1.00 70.17  ? 84   GLU A CB    1 
ATOM   288  C  CG    . GLU A 1 38  ? -10.373 -16.675  -15.212 1.00 87.13  ? 84   GLU A CG    1 
ATOM   289  C  CD    . GLU A 1 38  ? -9.506  -15.514  -15.677 1.00 121.90 ? 84   GLU A CD    1 
ATOM   290  O  OE1   . GLU A 1 38  ? -9.936  -14.761  -16.583 1.00 120.39 ? 84   GLU A OE1   1 
ATOM   291  O  OE2   . GLU A 1 38  ? -8.382  -15.367  -15.142 1.00 122.71 ? 84   GLU A OE2   1 
ATOM   292  N  N     . SER A 1 39  ? -14.851 -16.125  -14.653 1.00 63.06  ? 85   SER A N     1 
ATOM   293  C  CA    . SER A 1 39  ? -15.993 -15.378  -14.116 1.00 61.86  ? 85   SER A CA    1 
ATOM   294  C  C     . SER A 1 39  ? -17.350 -16.128  -14.053 1.00 63.32  ? 85   SER A C     1 
ATOM   295  O  O     . SER A 1 39  ? -18.232 -15.701  -13.307 1.00 61.96  ? 85   SER A O     1 
ATOM   296  C  CB    . SER A 1 39  ? -16.166 -14.074  -14.880 1.00 64.32  ? 85   SER A CB    1 
ATOM   297  O  OG    . SER A 1 39  ? -16.333 -14.328  -16.263 1.00 74.73  ? 85   SER A OG    1 
ATOM   298  N  N     . GLY A 1 40  ? -17.508 -17.197  -14.832 1.00 58.78  ? 86   GLY A N     1 
ATOM   299  C  CA    . GLY A 1 40  ? -18.759 -17.946  -14.904 1.00 58.75  ? 86   GLY A CA    1 
ATOM   300  C  C     . GLY A 1 40  ? -19.741 -17.342  -15.893 1.00 64.39  ? 86   GLY A C     1 
ATOM   301  O  O     . GLY A 1 40  ? -20.851 -17.847  -16.052 1.00 63.60  ? 86   GLY A O     1 
ATOM   302  N  N     . ARG A 1 41  ? -19.335 -16.249  -16.569 1.00 62.94  ? 87   ARG A N     1 
ATOM   303  C  CA    . ARG A 1 41  ? -20.135 -15.534  -17.556 1.00 63.53  ? 87   ARG A CA    1 
ATOM   304  C  C     . ARG A 1 41  ? -20.481 -16.403  -18.761 1.00 67.55  ? 87   ARG A C     1 
ATOM   305  O  O     . ARG A 1 41  ? -19.618 -17.100  -19.308 1.00 66.62  ? 87   ARG A O     1 
ATOM   306  C  CB    . ARG A 1 41  ? -19.432 -14.245  -18.011 1.00 63.95  ? 87   ARG A CB    1 
ATOM   307  C  CG    . ARG A 1 41  ? -20.337 -13.265  -18.751 1.00 74.74  ? 87   ARG A CG    1 
ATOM   308  C  CD    . ARG A 1 41  ? -19.726 -11.874  -18.882 1.00 93.42  ? 87   ARG A CD    1 
ATOM   309  N  NE    . ARG A 1 41  ? -18.535 -11.848  -19.739 1.00 110.62 ? 87   ARG A NE    1 
ATOM   310  C  CZ    . ARG A 1 41  ? -18.548 -11.635  -21.053 1.00 130.02 ? 87   ARG A CZ    1 
ATOM   311  N  NH1   . ARG A 1 41  ? -19.694 -11.431  -21.689 1.00 121.34 ? 87   ARG A NH1   1 
ATOM   312  N  NH2   . ARG A 1 41  ? -17.414 -11.632  -21.740 1.00 116.49 ? 87   ARG A NH2   1 
ATOM   313  N  N     . ARG A 1 42  ? -21.759 -16.357  -19.148 1.00 63.71  ? 88   ARG A N     1 
ATOM   314  C  CA    . ARG A 1 42  ? -22.282 -17.068  -20.299 1.00 63.60  ? 88   ARG A CA    1 
ATOM   315  C  C     . ARG A 1 42  ? -22.080 -16.202  -21.531 1.00 66.75  ? 88   ARG A C     1 
ATOM   316  O  O     . ARG A 1 42  ? -22.111 -14.971  -21.453 1.00 66.13  ? 88   ARG A O     1 
ATOM   317  C  CB    . ARG A 1 42  ? -23.750 -17.450  -20.111 1.00 62.87  ? 88   ARG A CB    1 
ATOM   318  C  CG    . ARG A 1 42  ? -23.931 -18.720  -19.302 1.00 75.81  ? 88   ARG A CG    1 
ATOM   319  C  CD    . ARG A 1 42  ? -25.353 -19.268  -19.358 1.00 91.22  ? 88   ARG A CD    1 
ATOM   320  N  NE    . ARG A 1 42  ? -26.378 -18.306  -18.931 1.00 104.36 ? 88   ARG A NE    1 
ATOM   321  C  CZ    . ARG A 1 42  ? -26.674 -18.021  -17.664 1.00 119.71 ? 88   ARG A CZ    1 
ATOM   322  N  NH1   . ARG A 1 42  ? -26.006 -18.600  -16.675 1.00 104.04 ? 88   ARG A NH1   1 
ATOM   323  N  NH2   . ARG A 1 42  ? -27.623 -17.138  -17.383 1.00 109.59 ? 88   ARG A NH2   1 
ATOM   324  N  N     . LEU A 1 43  ? -21.850 -16.850  -22.663 1.00 62.47  ? 89   LEU A N     1 
ATOM   325  C  CA    . LEU A 1 43  ? -21.535 -16.173  -23.898 1.00 61.88  ? 89   LEU A CA    1 
ATOM   326  C  C     . LEU A 1 43  ? -21.970 -17.003  -25.081 1.00 64.07  ? 89   LEU A C     1 
ATOM   327  O  O     . LEU A 1 43  ? -21.729 -18.206  -25.120 1.00 62.69  ? 89   LEU A O     1 
ATOM   328  C  CB    . LEU A 1 43  ? -20.000 -16.028  -23.927 1.00 62.36  ? 89   LEU A CB    1 
ATOM   329  C  CG    . LEU A 1 43  ? -19.382 -15.206  -24.998 1.00 68.59  ? 89   LEU A CG    1 
ATOM   330  C  CD1   . LEU A 1 43  ? -18.140 -14.532  -24.466 1.00 69.83  ? 89   LEU A CD1   1 
ATOM   331  C  CD2   . LEU A 1 43  ? -19.059 -16.057  -26.223 1.00 72.25  ? 89   LEU A CD2   1 
ATOM   332  N  N     . ARG A 1 44  ? -22.548 -16.345  -26.074 1.00 62.01  ? 90   ARG A N     1 
ATOM   333  C  CA    . ARG A 1 44  ? -22.937 -16.950  -27.340 1.00 62.21  ? 90   ARG A CA    1 
ATOM   334  C  C     . ARG A 1 44  ? -21.929 -16.433  -28.367 1.00 64.59  ? 90   ARG A C     1 
ATOM   335  O  O     . ARG A 1 44  ? -21.711 -15.225  -28.458 1.00 64.75  ? 90   ARG A O     1 
ATOM   336  C  CB    . ARG A 1 44  ? -24.378 -16.563  -27.721 1.00 65.77  ? 90   ARG A CB    1 
ATOM   337  C  CG    . ARG A 1 44  ? -25.447 -17.333  -26.945 1.00 86.27  ? 90   ARG A CG    1 
ATOM   338  C  CD    . ARG A 1 44  ? -26.740 -16.549  -26.803 1.00 109.76 ? 90   ARG A CD    1 
ATOM   339  N  NE    . ARG A 1 44  ? -27.747 -16.948  -27.787 1.00 128.62 ? 90   ARG A NE    1 
ATOM   340  C  CZ    . ARG A 1 44  ? -29.018 -16.553  -27.766 1.00 148.11 ? 90   ARG A CZ    1 
ATOM   341  N  NH1   . ARG A 1 44  ? -29.456 -15.745  -26.807 1.00 137.36 ? 90   ARG A NH1   1 
ATOM   342  N  NH2   . ARG A 1 44  ? -29.864 -16.970  -28.699 1.00 136.62 ? 90   ARG A NH2   1 
ATOM   343  N  N     . LEU A 1 45  ? -21.251 -17.342  -29.066 1.00 59.51  ? 91   LEU A N     1 
ATOM   344  C  CA    . LEU A 1 45  ? -20.267 -16.966  -30.080 1.00 58.94  ? 91   LEU A CA    1 
ATOM   345  C  C     . LEU A 1 45  ? -20.304 -17.943  -31.255 1.00 60.84  ? 91   LEU A C     1 
ATOM   346  O  O     . LEU A 1 45  ? -20.767 -19.060  -31.061 1.00 58.54  ? 91   LEU A O     1 
ATOM   347  C  CB    . LEU A 1 45  ? -18.832 -16.784  -29.499 1.00 58.88  ? 91   LEU A CB    1 
ATOM   348  C  CG    . LEU A 1 45  ? -18.091 -17.975  -28.835 1.00 63.44  ? 91   LEU A CG    1 
ATOM   349  C  CD1   . LEU A 1 45  ? -17.484 -18.881  -29.853 1.00 63.31  ? 91   LEU A CD1   1 
ATOM   350  C  CD2   . LEU A 1 45  ? -16.922 -17.476  -28.001 1.00 64.65  ? 91   LEU A CD2   1 
ATOM   351  N  N     . PRO A 1 46  ? -19.845 -17.575  -32.476 1.00 58.19  ? 92   PRO A N     1 
ATOM   352  C  CA    . PRO A 1 46  ? -19.881 -18.545  -33.580 1.00 57.56  ? 92   PRO A CA    1 
ATOM   353  C  C     . PRO A 1 46  ? -18.980 -19.730  -33.284 1.00 58.89  ? 92   PRO A C     1 
ATOM   354  O  O     . PRO A 1 46  ? -17.926 -19.559  -32.684 1.00 56.63  ? 92   PRO A O     1 
ATOM   355  C  CB    . PRO A 1 46  ? -19.380 -17.734  -34.781 1.00 59.63  ? 92   PRO A CB    1 
ATOM   356  C  CG    . PRO A 1 46  ? -19.592 -16.291  -34.394 1.00 64.34  ? 92   PRO A CG    1 
ATOM   357  C  CD    . PRO A 1 46  ? -19.284 -16.285  -32.932 1.00 60.12  ? 92   PRO A CD    1 
ATOM   358  N  N     . ARG A 1 47  ? -19.380 -20.895  -33.715 1.00 55.76  ? 93   ARG A N     1 
ATOM   359  C  CA    . ARG A 1 47  ? -18.655 -22.089  -33.425 1.00 55.10  ? 93   ARG A CA    1 
ATOM   360  C  C     . ARG A 1 47  ? -17.241 -22.068  -33.940 1.00 59.69  ? 93   ARG A C     1 
ATOM   361  O  O     . ARG A 1 47  ? -16.372 -22.631  -33.338 1.00 60.29  ? 93   ARG A O     1 
ATOM   362  C  CB    . ARG A 1 47  ? -19.402 -23.290  -33.956 1.00 54.36  ? 93   ARG A CB    1 
ATOM   363  C  CG    . ARG A 1 47  ? -18.931 -24.552  -33.297 1.00 67.25  ? 93   ARG A CG    1 
ATOM   364  C  CD    . ARG A 1 47  ? -19.835 -25.713  -33.569 1.00 80.26  ? 93   ARG A CD    1 
ATOM   365  N  NE    . ARG A 1 47  ? -19.992 -25.867  -34.984 1.00 102.36 ? 93   ARG A NE    1 
ATOM   366  C  CZ    . ARG A 1 47  ? -18.983 -26.031  -35.805 1.00 128.57 ? 93   ARG A CZ    1 
ATOM   367  N  NH1   . ARG A 1 47  ? -17.751 -26.043  -35.342 1.00 117.80 ? 93   ARG A NH1   1 
ATOM   368  N  NH2   . ARG A 1 47  ? -19.216 -26.160  -37.092 1.00 123.64 ? 93   ARG A NH2   1 
ATOM   369  N  N     . ASP A 1 48  ? -17.011 -21.461  -35.083 1.00 56.24  ? 94   ASP A N     1 
ATOM   370  C  CA    . ASP A 1 48  ? -15.676 -21.401  -35.644 1.00 55.10  ? 94   ASP A CA    1 
ATOM   371  C  C     . ASP A 1 48  ? -14.672 -20.813  -34.654 1.00 55.83  ? 94   ASP A C     1 
ATOM   372  O  O     . ASP A 1 48  ? -13.530 -21.268  -34.598 1.00 57.17  ? 94   ASP A O     1 
ATOM   373  C  CB    . ASP A 1 48  ? -15.676 -20.584  -36.938 1.00 57.25  ? 94   ASP A CB    1 
ATOM   374  C  CG    . ASP A 1 48  ? -16.129 -19.153  -36.723 1.00 70.38  ? 94   ASP A CG    1 
ATOM   375  O  OD1   . ASP A 1 48  ? -16.449 -18.796  -35.570 1.00 73.44  ? 94   ASP A OD1   1 
ATOM   376  O  OD2   . ASP A 1 48  ? -16.166 -18.385  -37.708 1.00 72.06  ? 94   ASP A OD2   1 
ATOM   377  N  N     . GLN A 1 49  ? -15.074 -19.811  -33.874 1.00 47.92  ? 95   GLN A N     1 
ATOM   378  C  CA    . GLN A 1 49  ? -14.132 -19.218  -32.963 1.00 45.90  ? 95   GLN A CA    1 
ATOM   379  C  C     . GLN A 1 49  ? -13.619 -20.109  -31.824 1.00 48.01  ? 95   GLN A C     1 
ATOM   380  O  O     . GLN A 1 49  ? -12.704 -19.740  -31.152 1.00 45.69  ? 95   GLN A O     1 
ATOM   381  C  CB    . GLN A 1 49  ? -14.695 -17.921  -32.439 1.00 46.80  ? 95   GLN A CB    1 
ATOM   382  C  CG    . GLN A 1 49  ? -14.837 -16.890  -33.523 1.00 61.44  ? 95   GLN A CG    1 
ATOM   383  C  CD    . GLN A 1 49  ? -15.381 -15.579  -33.033 1.00 81.54  ? 95   GLN A CD    1 
ATOM   384  O  OE1   . GLN A 1 49  ? -15.368 -15.285  -31.855 1.00 74.17  ? 95   GLN A OE1   1 
ATOM   385  N  NE2   . GLN A 1 49  ? -15.869 -14.781  -33.947 1.00 83.17  ? 95   GLN A NE2   1 
ATOM   386  N  N     . ILE A 1 50  ? -14.240 -21.250  -31.586 1.00 43.20  ? 96   ILE A N     1 
ATOM   387  C  CA    . ILE A 1 50  ? -13.859 -22.185  -30.516 1.00 42.57  ? 96   ILE A CA    1 
ATOM   388  C  C     . ILE A 1 50  ? -12.572 -22.872  -30.923 1.00 41.11  ? 96   ILE A C     1 
ATOM   389  O  O     . ILE A 1 50  ? -12.441 -23.268  -32.072 1.00 40.97  ? 96   ILE A O     1 
ATOM   390  C  CB    . ILE A 1 50  ? -14.990 -23.250  -30.236 1.00 45.69  ? 96   ILE A CB    1 
ATOM   391  C  CG1   . ILE A 1 50  ? -16.317 -22.618  -29.723 1.00 47.04  ? 96   ILE A CG1   1 
ATOM   392  C  CG2   . ILE A 1 50  ? -14.533 -24.391  -29.329 1.00 45.59  ? 96   ILE A CG2   1 
ATOM   393  C  CD1   . ILE A 1 50  ? -16.245 -21.827  -28.495 1.00 58.68  ? 96   ILE A CD1   1 
ATOM   394  N  N     . GLN A 1 51  ? -11.664 -23.074  -29.977 1.00 34.87  ? 97   GLN A N     1 
ATOM   395  C  CA    . GLN A 1 51  ? -10.420 -23.787  -30.217 1.00 34.54  ? 97   GLN A CA    1 
ATOM   396  C  C     . GLN A 1 51  ? -10.318 -24.902  -29.231 1.00 39.91  ? 97   GLN A C     1 
ATOM   397  O  O     . GLN A 1 51  ? -10.499 -24.675  -28.033 1.00 38.68  ? 97   GLN A O     1 
ATOM   398  C  CB    . GLN A 1 51  ? -9.190  -22.858  -30.130 1.00 35.93  ? 97   GLN A CB    1 
ATOM   399  C  CG    . GLN A 1 51  ? -9.193  -21.748  -31.201 1.00 42.74  ? 97   GLN A CG    1 
ATOM   400  C  CD    . GLN A 1 51  ? -7.840  -21.155  -31.498 1.00 55.73  ? 97   GLN A CD    1 
ATOM   401  O  OE1   . GLN A 1 51  ? -6.799  -21.590  -30.996 1.00 50.64  ? 97   GLN A OE1   1 
ATOM   402  N  NE2   . GLN A 1 51  ? -7.826  -20.150  -32.340 1.00 53.69  ? 97   GLN A NE2   1 
ATOM   403  N  N     . ARG A 1 52  ? -10.071 -26.126  -29.738 1.00 39.19  ? 98   ARG A N     1 
ATOM   404  C  CA    . ARG A 1 52  ? -9.934  -27.346  -28.934 1.00 39.39  ? 98   ARG A CA    1 
ATOM   405  C  C     . ARG A 1 52  ? -8.737  -27.168  -28.005 1.00 46.40  ? 98   ARG A C     1 
ATOM   406  O  O     . ARG A 1 52  ? -7.736  -26.553  -28.393 1.00 46.05  ? 98   ARG A O     1 
ATOM   407  C  CB    . ARG A 1 52  ? -9.774  -28.607  -29.812 1.00 37.24  ? 98   ARG A CB    1 
ATOM   408  C  CG    . ARG A 1 52  ? -10.970 -28.912  -30.720 1.00 43.31  ? 98   ARG A CG    1 
ATOM   409  C  CD    . ARG A 1 52  ? -10.907 -30.296  -31.350 1.00 60.48  ? 98   ARG A CD    1 
ATOM   410  N  NE    . ARG A 1 52  ? -10.835 -31.361  -30.340 1.00 79.58  ? 98   ARG A NE    1 
ATOM   411  C  CZ    . ARG A 1 52  ? -11.886 -31.944  -29.770 1.00 97.61  ? 98   ARG A CZ    1 
ATOM   412  N  NH1   . ARG A 1 52  ? -13.123 -31.591  -30.116 1.00 82.45  ? 98   ARG A NH1   1 
ATOM   413  N  NH2   . ARG A 1 52  ? -11.711 -32.886  -28.852 1.00 85.31  ? 98   ARG A NH2   1 
ATOM   414  N  N     . MET A 1 53  ? -8.898  -27.629  -26.752 1.00 43.21  ? 99   MET A N     1 
ATOM   415  C  CA    . MET A 1 53  ? -7.930  -27.502  -25.677 1.00 42.29  ? 99   MET A CA    1 
ATOM   416  C  C     . MET A 1 53  ? -7.348  -28.884  -25.368 1.00 47.63  ? 99   MET A C     1 
ATOM   417  O  O     . MET A 1 53  ? -8.065  -29.884  -25.444 1.00 48.27  ? 99   MET A O     1 
ATOM   418  C  CB    . MET A 1 53  ? -8.653  -26.895  -24.453 1.00 44.20  ? 99   MET A CB    1 
ATOM   419  C  CG    . MET A 1 53  ? -7.869  -26.922  -23.154 1.00 47.23  ? 99   MET A CG    1 
ATOM   420  S  SD    . MET A 1 53  ? -8.755  -25.985  -21.905 1.00 50.88  ? 99   MET A SD    1 
ATOM   421  C  CE    . MET A 1 53  ? -7.818  -26.356  -20.470 1.00 47.53  ? 99   MET A CE    1 
ATOM   422  N  N     . ASN A 1 54  ? -6.049  -28.927  -25.029 1.00 44.30  ? 100  ASN A N     1 
ATOM   423  C  CA    . ASN A 1 54  ? -5.313  -30.138  -24.678 1.00 43.75  ? 100  ASN A CA    1 
ATOM   424  C  C     . ASN A 1 54  ? -5.589  -30.545  -23.240 1.00 47.50  ? 100  ASN A C     1 
ATOM   425  O  O     . ASN A 1 54  ? -5.765  -29.652  -22.397 1.00 44.85  ? 100  ASN A O     1 
ATOM   426  C  CB    . ASN A 1 54  ? -3.813  -29.933  -24.867 1.00 41.98  ? 100  ASN A CB    1 
ATOM   427  C  CG    . ASN A 1 54  ? -3.385  -29.921  -26.299 1.00 59.89  ? 100  ASN A CG    1 
ATOM   428  O  OD1   . ASN A 1 54  ? -3.252  -30.951  -26.956 1.00 42.64  ? 100  ASN A OD1   1 
ATOM   429  N  ND2   . ASN A 1 54  ? -3.160  -28.747  -26.817 1.00 62.25  ? 100  ASN A ND2   1 
ATOM   430  N  N     . PRO A 1 55  ? -5.559  -31.878  -22.926 1.00 46.70  ? 101  PRO A N     1 
ATOM   431  C  CA    . PRO A 1 55  ? -5.801  -32.323  -21.535 1.00 46.59  ? 101  PRO A CA    1 
ATOM   432  C  C     . PRO A 1 55  ? -4.614  -31.979  -20.621 1.00 51.21  ? 101  PRO A C     1 
ATOM   433  O  O     . PRO A 1 55  ? -3.549  -31.667  -21.156 1.00 51.61  ? 101  PRO A O     1 
ATOM   434  C  CB    . PRO A 1 55  ? -6.041  -33.831  -21.680 1.00 47.87  ? 101  PRO A CB    1 
ATOM   435  C  CG    . PRO A 1 55  ? -5.302  -34.225  -22.893 1.00 52.72  ? 101  PRO A CG    1 
ATOM   436  C  CD    . PRO A 1 55  ? -5.338  -33.038  -23.823 1.00 48.85  ? 101  PRO A CD    1 
ATOM   437  N  N     . PRO A 1 56  ? -4.751  -32.014  -19.268 1.00 47.25  ? 102  PRO A N     1 
ATOM   438  C  CA    . PRO A 1 56  ? -3.634  -31.578  -18.399 1.00 46.45  ? 102  PRO A CA    1 
ATOM   439  C  C     . PRO A 1 56  ? -2.325  -32.386  -18.435 1.00 48.21  ? 102  PRO A C     1 
ATOM   440  O  O     . PRO A 1 56  ? -1.375  -31.945  -17.802 1.00 46.38  ? 102  PRO A O     1 
ATOM   441  C  CB    . PRO A 1 56  ? -4.249  -31.584  -16.997 1.00 48.47  ? 102  PRO A CB    1 
ATOM   442  C  CG    . PRO A 1 56  ? -5.427  -32.500  -17.090 1.00 53.18  ? 102  PRO A CG    1 
ATOM   443  C  CD    . PRO A 1 56  ? -5.963  -32.298  -18.468 1.00 48.99  ? 102  PRO A CD    1 
ATOM   444  N  N     . LYS A 1 57  ? -2.248  -33.536  -19.151 1.00 46.27  ? 103  LYS A N     1 
ATOM   445  C  CA    . LYS A 1 57  ? -0.994  -34.307  -19.282 1.00 46.17  ? 103  LYS A CA    1 
ATOM   446  C  C     . LYS A 1 57  ? -0.022  -33.556  -20.232 1.00 51.78  ? 103  LYS A C     1 
ATOM   447  O  O     . LYS A 1 57  ? 1.178   -33.843  -20.217 1.00 52.41  ? 103  LYS A O     1 
ATOM   448  C  CB    . LYS A 1 57  ? -1.238  -35.743  -19.788 1.00 48.14  ? 103  LYS A CB    1 
ATOM   449  C  CG    . LYS A 1 57  ? -1.715  -35.850  -21.243 1.00 68.44  ? 103  LYS A CG    1 
ATOM   450  C  CD    . LYS A 1 57  ? -1.746  -37.287  -21.737 1.00 82.64  ? 103  LYS A CD    1 
ATOM   451  C  CE    . LYS A 1 57  ? -2.613  -37.430  -22.962 1.00 99.30  ? 103  LYS A CE    1 
ATOM   452  N  NZ    . LYS A 1 57  ? -2.613  -38.821  -23.478 1.00 111.67 ? 103  LYS A NZ    1 
ATOM   453  N  N     . PHE A 1 58  ? -0.566  -32.636  -21.086 1.00 47.08  ? 104  PHE A N     1 
ATOM   454  C  CA    . PHE A 1 58  ? 0.202   -31.813  -22.020 1.00 46.94  ? 104  PHE A CA    1 
ATOM   455  C  C     . PHE A 1 58  ? 0.670   -30.482  -21.385 1.00 49.86  ? 104  PHE A C     1 
ATOM   456  O  O     . PHE A 1 58  ? 1.270   -29.666  -22.072 1.00 47.58  ? 104  PHE A O     1 
ATOM   457  C  CB    . PHE A 1 58  ? -0.557  -31.597  -23.355 1.00 48.76  ? 104  PHE A CB    1 
ATOM   458  C  CG    . PHE A 1 58  ? -0.687  -32.841  -24.212 1.00 50.72  ? 104  PHE A CG    1 
ATOM   459  C  CD1   . PHE A 1 58  ? 0.417   -33.378  -24.866 1.00 54.27  ? 104  PHE A CD1   1 
ATOM   460  C  CD2   . PHE A 1 58  ? -1.914  -33.476  -24.363 1.00 53.43  ? 104  PHE A CD2   1 
ATOM   461  C  CE1   . PHE A 1 58  ? 0.299   -34.542  -25.641 1.00 55.16  ? 104  PHE A CE1   1 
ATOM   462  C  CE2   . PHE A 1 58  ? -2.033  -34.633  -25.146 1.00 56.33  ? 104  PHE A CE2   1 
ATOM   463  C  CZ    . PHE A 1 58  ? -0.924  -35.160  -25.774 1.00 54.30  ? 104  PHE A CZ    1 
ATOM   464  N  N     . SER A 1 59  ? 0.456   -30.294  -20.058 1.00 47.18  ? 105  SER A N     1 
ATOM   465  C  CA    . SER A 1 59  ? 0.906   -29.098  -19.326 1.00 46.25  ? 105  SER A CA    1 
ATOM   466  C  C     . SER A 1 59  ? 2.441   -28.910  -19.391 1.00 46.66  ? 105  SER A C     1 
ATOM   467  O  O     . SER A 1 59  ? 3.197   -29.859  -19.226 1.00 45.72  ? 105  SER A O     1 
ATOM   468  C  CB    . SER A 1 59  ? 0.443   -29.141  -17.879 1.00 49.06  ? 105  SER A CB    1 
ATOM   469  O  OG    . SER A 1 59  ? 0.796   -27.961  -17.180 1.00 57.01  ? 105  SER A OG    1 
ATOM   470  N  N     . LYS A 1 60  ? 2.879   -27.677  -19.672 1.00 41.96  ? 106  LYS A N     1 
ATOM   471  C  CA    . LYS A 1 60  ? 4.291   -27.295  -19.796 1.00 39.83  ? 106  LYS A CA    1 
ATOM   472  C  C     . LYS A 1 60  ? 5.079   -28.258  -20.712 1.00 39.62  ? 106  LYS A C     1 
ATOM   473  O  O     . LYS A 1 60  ? 6.209   -28.620  -20.413 1.00 38.10  ? 106  LYS A O     1 
ATOM   474  C  CB    . LYS A 1 60  ? 4.950   -27.104  -18.414 1.00 39.88  ? 106  LYS A CB    1 
ATOM   475  C  CG    . LYS A 1 60  ? 4.382   -25.911  -17.640 1.00 37.43  ? 106  LYS A CG    1 
ATOM   476  C  CD    . LYS A 1 60  ? 5.016   -25.792  -16.261 1.00 51.99  ? 106  LYS A CD    1 
ATOM   477  C  CE    . LYS A 1 60  ? 4.139   -26.350  -15.164 1.00 65.14  ? 106  LYS A CE    1 
ATOM   478  N  NZ    . LYS A 1 60  ? 3.819   -25.327  -14.134 1.00 73.98  ? 106  LYS A NZ    1 
ATOM   479  N  N     . ALA A 1 61  ? 4.455   -28.660  -21.832 1.00 35.47  ? 107  ALA A N     1 
ATOM   480  C  CA    . ALA A 1 61  ? 5.027   -29.549  -22.835 1.00 35.20  ? 107  ALA A CA    1 
ATOM   481  C  C     . ALA A 1 61  ? 6.307   -28.914  -23.442 1.00 40.72  ? 107  ALA A C     1 
ATOM   482  O  O     . ALA A 1 61  ? 6.319   -27.729  -23.810 1.00 41.79  ? 107  ALA A O     1 
ATOM   483  C  CB    . ALA A 1 61  ? 3.994   -29.820  -23.926 1.00 35.58  ? 107  ALA A CB    1 
ATOM   484  N  N     . GLU A 1 62  ? 7.371   -29.711  -23.517 1.00 36.75  ? 108  GLU A N     1 
ATOM   485  C  CA    . GLU A 1 62  ? 8.694   -29.324  -24.004 1.00 35.64  ? 108  GLU A CA    1 
ATOM   486  C  C     . GLU A 1 62  ? 8.714   -29.084  -25.496 1.00 38.92  ? 108  GLU A C     1 
ATOM   487  O  O     . GLU A 1 62  ? 9.357   -28.137  -25.948 1.00 38.89  ? 108  GLU A O     1 
ATOM   488  C  CB    . GLU A 1 62  ? 9.751   -30.365  -23.570 1.00 36.13  ? 108  GLU A CB    1 
ATOM   489  C  CG    . GLU A 1 62  ? 9.908   -30.420  -22.056 1.00 41.35  ? 108  GLU A CG    1 
ATOM   490  C  CD    . GLU A 1 62  ? 11.069  -31.218  -21.497 1.00 49.84  ? 108  GLU A CD    1 
ATOM   491  O  OE1   . GLU A 1 62  ? 11.477  -32.214  -22.134 1.00 47.87  ? 108  GLU A OE1   1 
ATOM   492  O  OE2   . GLU A 1 62  ? 11.560  -30.855  -20.404 1.00 43.50  ? 108  GLU A OE2   1 
ATOM   493  N  N     . ASP A 1 63  ? 8.084   -29.984  -26.241 1.00 36.75  ? 109  ASP A N     1 
ATOM   494  C  CA    . ASP A 1 63  ? 7.988   -29.848  -27.679 1.00 37.54  ? 109  ASP A CA    1 
ATOM   495  C  C     . ASP A 1 63  ? 6.510   -29.715  -27.992 1.00 41.08  ? 109  ASP A C     1 
ATOM   496  O  O     . ASP A 1 63  ? 5.716   -30.609  -27.697 1.00 40.41  ? 109  ASP A O     1 
ATOM   497  C  CB    . ASP A 1 63  ? 8.573   -31.073  -28.380 1.00 39.13  ? 109  ASP A CB    1 
ATOM   498  C  CG    . ASP A 1 63  ? 8.494   -30.973  -29.891 1.00 49.47  ? 109  ASP A CG    1 
ATOM   499  O  OD1   . ASP A 1 63  ? 7.983   -29.951  -30.395 1.00 53.10  ? 109  ASP A OD1   1 
ATOM   500  O  OD2   . ASP A 1 63  ? 8.943   -31.917  -30.575 1.00 49.56  ? 109  ASP A OD2   1 
ATOM   501  N  N     . MET A 1 64  ? 6.133   -28.602  -28.575 1.00 41.45  ? 110  MET A N     1 
ATOM   502  C  CA    . MET A 1 64  ? 4.758   -28.337  -28.943 1.00 41.62  ? 110  MET A CA    1 
ATOM   503  C  C     . MET A 1 64  ? 4.233   -29.142  -30.118 1.00 44.57  ? 110  MET A C     1 
ATOM   504  O  O     . MET A 1 64  ? 3.069   -29.243  -30.309 1.00 43.51  ? 110  MET A O     1 
ATOM   505  C  CB    . MET A 1 64  ? 4.495   -26.845  -29.067 1.00 44.19  ? 110  MET A CB    1 
ATOM   506  C  CG    . MET A 1 64  ? 4.595   -26.151  -27.731 1.00 48.39  ? 110  MET A CG    1 
ATOM   507  S  SD    . MET A 1 64  ? 4.225   -24.424  -27.749 1.00 54.21  ? 110  MET A SD    1 
ATOM   508  C  CE    . MET A 1 64  ? 5.671   -23.730  -28.456 1.00 51.78  ? 110  MET A CE    1 
ATOM   509  N  N     . ALA A 1 65  ? 5.124   -29.648  -30.935 1.00 41.92  ? 111  ALA A N     1 
ATOM   510  C  CA    . ALA A 1 65  ? 4.747   -30.505  -32.065 1.00 42.18  ? 111  ALA A CA    1 
ATOM   511  C  C     . ALA A 1 65  ? 4.155   -31.852  -31.592 1.00 47.28  ? 111  ALA A C     1 
ATOM   512  O  O     . ALA A 1 65  ? 3.741   -32.649  -32.431 1.00 48.55  ? 111  ALA A O     1 
ATOM   513  C  CB    . ALA A 1 65  ? 5.934   -30.733  -32.990 1.00 42.28  ? 111  ALA A CB    1 
ATOM   514  N  N     . GLU A 1 66  ? 4.112   -32.089  -30.261 1.00 43.08  ? 112  GLU A N     1 
ATOM   515  C  CA    . GLU A 1 66  ? 3.578   -33.310  -29.634 1.00 44.34  ? 112  GLU A CA    1 
ATOM   516  C  C     . GLU A 1 66  ? 2.107   -33.146  -29.149 1.00 51.54  ? 112  GLU A C     1 
ATOM   517  O  O     . GLU A 1 66  ? 1.453   -34.145  -28.872 1.00 51.88  ? 112  GLU A O     1 
ATOM   518  C  CB    . GLU A 1 66  ? 4.470   -33.763  -28.448 1.00 45.20  ? 112  GLU A CB    1 
ATOM   519  C  CG    . GLU A 1 66  ? 5.878   -34.186  -28.835 1.00 53.87  ? 112  GLU A CG    1 
ATOM   520  C  CD    . GLU A 1 66  ? 6.825   -34.525  -27.696 1.00 81.66  ? 112  GLU A CD    1 
ATOM   521  O  OE1   . GLU A 1 66  ? 6.641   -34.001  -26.574 1.00 84.12  ? 112  GLU A OE1   1 
ATOM   522  O  OE2   . GLU A 1 66  ? 7.791   -35.278  -27.947 1.00 76.02  ? 112  GLU A OE2   1 
ATOM   523  N  N     . LEU A 1 67  ? 1.605   -31.893  -29.025 1.00 48.66  ? 113  LEU A N     1 
ATOM   524  C  CA    . LEU A 1 67  ? 0.231   -31.594  -28.589 1.00 47.74  ? 113  LEU A CA    1 
ATOM   525  C  C     . LEU A 1 67  ? -0.770  -32.250  -29.527 1.00 52.23  ? 113  LEU A C     1 
ATOM   526  O  O     . LEU A 1 67  ? -0.555  -32.257  -30.742 1.00 52.89  ? 113  LEU A O     1 
ATOM   527  C  CB    . LEU A 1 67  ? -0.051  -30.067  -28.588 1.00 46.94  ? 113  LEU A CB    1 
ATOM   528  C  CG    . LEU A 1 67  ? 0.855   -29.124  -27.772 1.00 49.75  ? 113  LEU A CG    1 
ATOM   529  C  CD1   . LEU A 1 67  ? 0.484   -27.662  -28.021 1.00 48.15  ? 113  LEU A CD1   1 
ATOM   530  C  CD2   . LEU A 1 67  ? 0.871   -29.472  -26.268 1.00 48.79  ? 113  LEU A CD2   1 
ATOM   531  N  N     . THR A 1 68  ? -1.879  -32.764  -28.976 1.00 47.10  ? 114  THR A N     1 
ATOM   532  C  CA    . THR A 1 68  ? -2.950  -33.379  -29.761 1.00 45.93  ? 114  THR A CA    1 
ATOM   533  C  C     . THR A 1 68  ? -3.633  -32.296  -30.580 1.00 50.06  ? 114  THR A C     1 
ATOM   534  O  O     . THR A 1 68  ? -3.756  -32.438  -31.798 1.00 49.56  ? 114  THR A O     1 
ATOM   535  C  CB    . THR A 1 68  ? -3.922  -34.142  -28.837 1.00 50.76  ? 114  THR A CB    1 
ATOM   536  O  OG1   . THR A 1 68  ? -3.185  -35.161  -28.173 1.00 50.43  ? 114  THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 68  ? -5.063  -34.788  -29.589 1.00 48.97  ? 114  THR A CG2   1 
ATOM   538  N  N     . CYS A 1 69  ? -4.031  -31.201  -29.918 1.00 47.77  ? 115  CYS A N     1 
ATOM   539  C  CA    . CYS A 1 69  ? -4.720  -30.095  -30.557 1.00 48.70  ? 115  CYS A CA    1 
ATOM   540  C  C     . CYS A 1 69  ? -3.734  -28.948  -30.747 1.00 50.53  ? 115  CYS A C     1 
ATOM   541  O  O     . CYS A 1 69  ? -3.354  -28.308  -29.758 1.00 49.20  ? 115  CYS A O     1 
ATOM   542  C  CB    . CYS A 1 69  ? -5.935  -29.664  -29.740 1.00 50.90  ? 115  CYS A CB    1 
ATOM   543  S  SG    . CYS A 1 69  ? -6.942  -31.032  -29.097 1.00 56.60  ? 115  CYS A SG    1 
ATOM   544  N  N     . LEU A 1 70  ? -3.295  -28.706  -32.010 1.00 46.21  ? 116  LEU A N     1 
ATOM   545  C  CA    . LEU A 1 70  ? -2.360  -27.612  -32.315 1.00 45.54  ? 116  LEU A CA    1 
ATOM   546  C  C     . LEU A 1 70  ? -3.038  -26.425  -32.976 1.00 46.04  ? 116  LEU A C     1 
ATOM   547  O  O     . LEU A 1 70  ? -3.360  -26.430  -34.168 1.00 46.32  ? 116  LEU A O     1 
ATOM   548  C  CB    . LEU A 1 70  ? -1.130  -28.045  -33.096 1.00 46.08  ? 116  LEU A CB    1 
ATOM   549  C  CG    . LEU A 1 70  ? -0.075  -26.954  -33.170 1.00 52.56  ? 116  LEU A CG    1 
ATOM   550  C  CD1   . LEU A 1 70  ? 0.962   -27.111  -32.118 1.00 52.81  ? 116  LEU A CD1   1 
ATOM   551  C  CD2   . LEU A 1 70  ? 0.500   -26.852  -34.535 1.00 57.97  ? 116  LEU A CD2   1 
ATOM   552  N  N     . ASN A 1 71  ? -3.223  -25.390  -32.181 1.00 39.55  ? 117  ASN A N     1 
ATOM   553  C  CA    . ASN A 1 71  ? -3.877  -24.155  -32.580 1.00 38.37  ? 117  ASN A CA    1 
ATOM   554  C  C     . ASN A 1 71  ? -3.228  -23.018  -31.787 1.00 36.26  ? 117  ASN A C     1 
ATOM   555  O  O     . ASN A 1 71  ? -2.457  -23.327  -30.885 1.00 34.95  ? 117  ASN A O     1 
ATOM   556  C  CB    . ASN A 1 71  ? -5.412  -24.278  -32.323 1.00 39.84  ? 117  ASN A CB    1 
ATOM   557  C  CG    . ASN A 1 71  ? -5.782  -24.701  -30.920 1.00 51.31  ? 117  ASN A CG    1 
ATOM   558  O  OD1   . ASN A 1 71  ? -5.545  -23.974  -29.952 1.00 40.50  ? 117  ASN A OD1   1 
ATOM   559  N  ND2   . ASN A 1 71  ? -6.406  -25.870  -30.782 1.00 45.06  ? 117  ASN A ND2   1 
ATOM   560  N  N     . GLU A 1 72  ? -3.543  -21.737  -32.084 1.00 32.32  ? 118  GLU A N     1 
ATOM   561  C  CA    . GLU A 1 72  ? -2.913  -20.570  -31.421 1.00 33.57  ? 118  GLU A CA    1 
ATOM   562  C  C     . GLU A 1 72  ? -3.066  -20.538  -29.899 1.00 37.32  ? 118  GLU A C     1 
ATOM   563  O  O     . GLU A 1 72  ? -2.107  -20.236  -29.174 1.00 35.83  ? 118  GLU A O     1 
ATOM   564  C  CB    . GLU A 1 72  ? -3.380  -19.220  -32.006 1.00 35.06  ? 118  GLU A CB    1 
ATOM   565  C  CG    . GLU A 1 72  ? -3.154  -19.008  -33.493 1.00 47.18  ? 118  GLU A CG    1 
ATOM   566  C  CD    . GLU A 1 72  ? -3.381  -17.597  -34.006 1.00 76.81  ? 118  GLU A CD    1 
ATOM   567  O  OE1   . GLU A 1 72  ? -4.275  -16.901  -33.465 1.00 73.20  ? 118  GLU A OE1   1 
ATOM   568  O  OE2   . GLU A 1 72  ? -2.710  -17.207  -34.993 1.00 69.43  ? 118  GLU A OE2   1 
ATOM   569  N  N     . ALA A 1 73  ? -4.280  -20.823  -29.431 1.00 34.48  ? 119  ALA A N     1 
ATOM   570  C  CA    . ALA A 1 73  ? -4.662  -20.808  -28.027 1.00 33.54  ? 119  ALA A CA    1 
ATOM   571  C  C     . ALA A 1 73  ? -3.913  -21.771  -27.171 1.00 36.83  ? 119  ALA A C     1 
ATOM   572  O  O     . ALA A 1 73  ? -3.679  -21.441  -26.010 1.00 36.98  ? 119  ALA A O     1 
ATOM   573  C  CB    . ALA A 1 73  ? -6.147  -21.035  -27.892 1.00 33.79  ? 119  ALA A CB    1 
ATOM   574  N  N     . SER A 1 74  ? -3.549  -22.961  -27.710 1.00 34.31  ? 120  SER A N     1 
ATOM   575  C  CA    . SER A 1 74  ? -2.821  -23.992  -26.961 1.00 35.57  ? 120  SER A CA    1 
ATOM   576  C  C     . SER A 1 74  ? -1.339  -23.720  -26.940 1.00 38.20  ? 120  SER A C     1 
ATOM   577  O  O     . SER A 1 74  ? -0.665  -23.929  -25.918 1.00 35.51  ? 120  SER A O     1 
ATOM   578  C  CB    . SER A 1 74  ? -3.140  -25.411  -27.448 1.00 41.97  ? 120  SER A CB    1 
ATOM   579  O  OG    . SER A 1 74  ? -2.743  -25.680  -28.780 1.00 59.86  ? 120  SER A OG    1 
ATOM   580  N  N     . VAL A 1 75  ? -0.840  -23.202  -28.054 1.00 37.05  ? 121  VAL A N     1 
ATOM   581  C  CA    . VAL A 1 75  ? 0.558   -22.797  -28.167 1.00 37.80  ? 121  VAL A CA    1 
ATOM   582  C  C     . VAL A 1 75  ? 0.780   -21.635  -27.196 1.00 38.79  ? 121  VAL A C     1 
ATOM   583  O  O     . VAL A 1 75  ? 1.666   -21.717  -26.349 1.00 37.86  ? 121  VAL A O     1 
ATOM   584  C  CB    . VAL A 1 75  ? 0.945   -22.505  -29.643 1.00 42.67  ? 121  VAL A CB    1 
ATOM   585  C  CG1   . VAL A 1 75  ? 2.223   -21.651  -29.743 1.00 42.44  ? 121  VAL A CG1   1 
ATOM   586  C  CG2   . VAL A 1 75  ? 1.120   -23.827  -30.390 1.00 42.69  ? 121  VAL A CG2   1 
ATOM   587  N  N     . LEU A 1 76  ? -0.104  -20.632  -27.235 1.00 34.83  ? 122  LEU A N     1 
ATOM   588  C  CA    . LEU A 1 76  ? -0.038  -19.497  -26.319 1.00 33.68  ? 122  LEU A CA    1 
ATOM   589  C  C     . LEU A 1 76  ? -0.012  -20.000  -24.865 1.00 38.25  ? 122  LEU A C     1 
ATOM   590  O  O     . LEU A 1 76  ? 0.963   -19.743  -24.161 1.00 38.11  ? 122  LEU A O     1 
ATOM   591  C  CB    . LEU A 1 76  ? -1.225  -18.542  -26.579 1.00 32.54  ? 122  LEU A CB    1 
ATOM   592  C  CG    . LEU A 1 76  ? -1.468  -17.374  -25.592 1.00 36.60  ? 122  LEU A CG    1 
ATOM   593  C  CD1   . LEU A 1 76  ? -0.239  -16.442  -25.455 1.00 36.62  ? 122  LEU A CD1   1 
ATOM   594  C  CD2   . LEU A 1 76  ? -2.695  -16.606  -25.978 1.00 39.71  ? 122  LEU A CD2   1 
ATOM   595  N  N     . HIS A 1 77  ? -1.022  -20.809  -24.467 1.00 35.44  ? 123  HIS A N     1 
ATOM   596  C  CA    . HIS A 1 77  ? -1.144  -21.369  -23.117 1.00 35.28  ? 123  HIS A CA    1 
ATOM   597  C  C     . HIS A 1 77  ? 0.084   -22.203  -22.694 1.00 37.46  ? 123  HIS A C     1 
ATOM   598  O  O     . HIS A 1 77  ? 0.559   -22.059  -21.557 1.00 39.04  ? 123  HIS A O     1 
ATOM   599  C  CB    . HIS A 1 77  ? -2.465  -22.151  -22.990 1.00 36.73  ? 123  HIS A CB    1 
ATOM   600  C  CG    . HIS A 1 77  ? -2.521  -23.082  -21.829 1.00 41.33  ? 123  HIS A CG    1 
ATOM   601  N  ND1   . HIS A 1 77  ? -2.268  -24.443  -21.977 1.00 44.20  ? 123  HIS A ND1   1 
ATOM   602  C  CD2   . HIS A 1 77  ? -2.788  -22.830  -20.526 1.00 43.97  ? 123  HIS A CD2   1 
ATOM   603  C  CE1   . HIS A 1 77  ? -2.382  -24.969  -20.764 1.00 43.00  ? 123  HIS A CE1   1 
ATOM   604  N  NE2   . HIS A 1 77  ? -2.701  -24.042  -19.859 1.00 43.55  ? 123  HIS A NE2   1 
ATOM   605  N  N     . ASN A 1 78  ? 0.614   -23.057  -23.589 1.00 31.42  ? 124  ASN A N     1 
ATOM   606  C  CA    . ASN A 1 78  ? 1.795   -23.843  -23.232 1.00 31.56  ? 124  ASN A CA    1 
ATOM   607  C  C     . ASN A 1 78  ? 3.024   -22.963  -22.942 1.00 37.47  ? 124  ASN A C     1 
ATOM   608  O  O     . ASN A 1 78  ? 3.715   -23.209  -21.960 1.00 39.84  ? 124  ASN A O     1 
ATOM   609  C  CB    . ASN A 1 78  ? 2.097   -24.909  -24.278 1.00 34.08  ? 124  ASN A CB    1 
ATOM   610  C  CG    . ASN A 1 78  ? 3.070   -25.939  -23.801 1.00 43.06  ? 124  ASN A CG    1 
ATOM   611  O  OD1   . ASN A 1 78  ? 2.701   -26.876  -23.101 1.00 39.54  ? 124  ASN A OD1   1 
ATOM   612  N  ND2   . ASN A 1 78  ? 4.344   -25.780  -24.154 1.00 35.44  ? 124  ASN A ND2   1 
ATOM   613  N  N     . LEU A 1 79  ? 3.265   -21.927  -23.765 1.00 32.81  ? 125  LEU A N     1 
ATOM   614  C  CA    . LEU A 1 79  ? 4.362   -20.964  -23.603 1.00 32.02  ? 125  LEU A CA    1 
ATOM   615  C  C     . LEU A 1 79  ? 4.157   -20.168  -22.324 1.00 37.59  ? 125  LEU A C     1 
ATOM   616  O  O     . LEU A 1 79  ? 5.104   -20.026  -21.557 1.00 37.14  ? 125  LEU A O     1 
ATOM   617  C  CB    . LEU A 1 79  ? 4.421   -19.977  -24.805 1.00 31.06  ? 125  LEU A CB    1 
ATOM   618  C  CG    . LEU A 1 79  ? 4.900   -20.524  -26.135 1.00 32.96  ? 125  LEU A CG    1 
ATOM   619  C  CD1   . LEU A 1 79  ? 4.742   -19.497  -27.217 1.00 31.87  ? 125  LEU A CD1   1 
ATOM   620  C  CD2   . LEU A 1 79  ? 6.358   -20.984  -26.050 1.00 32.22  ? 125  LEU A CD2   1 
ATOM   621  N  N     . ARG A 1 80  ? 2.924   -19.638  -22.106 1.00 35.47  ? 126  ARG A N     1 
ATOM   622  C  CA    . ARG A 1 80  ? 2.587   -18.836  -20.926 1.00 36.29  ? 126  ARG A CA    1 
ATOM   623  C  C     . ARG A 1 80  ? 2.829   -19.625  -19.625 1.00 40.20  ? 126  ARG A C     1 
ATOM   624  O  O     . ARG A 1 80  ? 3.593   -19.143  -18.778 1.00 38.24  ? 126  ARG A O     1 
ATOM   625  C  CB    . ARG A 1 80  ? 1.176   -18.240  -21.044 1.00 39.16  ? 126  ARG A CB    1 
ATOM   626  C  CG    . ARG A 1 80  ? 0.570   -17.724  -19.744 1.00 55.29  ? 126  ARG A CG    1 
ATOM   627  C  CD    . ARG A 1 80  ? -0.309  -16.492  -19.926 1.00 72.01  ? 126  ARG A CD    1 
ATOM   628  N  NE    . ARG A 1 80  ? -1.424  -16.693  -20.852 1.00 82.06  ? 126  ARG A NE    1 
ATOM   629  C  CZ    . ARG A 1 80  ? -2.332  -15.766  -21.143 1.00 100.87 ? 126  ARG A CZ    1 
ATOM   630  N  NH1   . ARG A 1 80  ? -2.278  -14.570  -20.569 1.00 89.72  ? 126  ARG A NH1   1 
ATOM   631  N  NH2   . ARG A 1 80  ? -3.304  -16.028  -22.005 1.00 88.46  ? 126  ARG A NH2   1 
ATOM   632  N  N     . GLU A 1 81  ? 2.257   -20.867  -19.504 1.00 38.16  ? 127  GLU A N     1 
ATOM   633  C  CA    . GLU A 1 81  ? 2.450   -21.749  -18.331 1.00 38.29  ? 127  GLU A CA    1 
ATOM   634  C  C     . GLU A 1 81  ? 3.926   -22.000  -18.077 1.00 42.98  ? 127  GLU A C     1 
ATOM   635  O  O     . GLU A 1 81  ? 4.376   -21.804  -16.954 1.00 45.73  ? 127  GLU A O     1 
ATOM   636  C  CB    . GLU A 1 81  ? 1.719   -23.081  -18.512 1.00 39.93  ? 127  GLU A CB    1 
ATOM   637  C  CG    . GLU A 1 81  ? 0.243   -22.992  -18.179 1.00 58.46  ? 127  GLU A CG    1 
ATOM   638  C  CD    . GLU A 1 81  ? -0.070  -23.377  -16.746 1.00 95.54  ? 127  GLU A CD    1 
ATOM   639  O  OE1   . GLU A 1 81  ? -0.154  -24.594  -16.459 1.00 80.85  ? 127  GLU A OE1   1 
ATOM   640  O  OE2   . GLU A 1 81  ? -0.192  -22.462  -15.900 1.00 104.21 ? 127  GLU A OE2   1 
ATOM   641  N  N     . ARG A 1 82  ? 4.687   -22.387  -19.126 1.00 36.87  ? 128  ARG A N     1 
ATOM   642  C  CA    . ARG A 1 82  ? 6.130   -22.629  -19.056 1.00 35.49  ? 128  ARG A CA    1 
ATOM   643  C  C     . ARG A 1 82  ? 6.854   -21.362  -18.578 1.00 38.11  ? 128  ARG A C     1 
ATOM   644  O  O     . ARG A 1 82  ? 7.606   -21.416  -17.626 1.00 34.42  ? 128  ARG A O     1 
ATOM   645  C  CB    . ARG A 1 82  ? 6.684   -23.075  -20.429 1.00 32.57  ? 128  ARG A CB    1 
ATOM   646  C  CG    . ARG A 1 82  ? 6.304   -24.496  -20.811 1.00 32.74  ? 128  ARG A CG    1 
ATOM   647  C  CD    . ARG A 1 82  ? 7.145   -25.077  -21.931 1.00 37.81  ? 128  ARG A CD    1 
ATOM   648  N  NE    . ARG A 1 82  ? 8.576   -24.947  -21.648 1.00 43.32  ? 128  ARG A NE    1 
ATOM   649  C  CZ    . ARG A 1 82  ? 9.333   -25.874  -21.070 1.00 53.06  ? 128  ARG A CZ    1 
ATOM   650  N  NH1   . ARG A 1 82  ? 8.827   -27.060  -20.757 1.00 46.72  ? 128  ARG A NH1   1 
ATOM   651  N  NH2   . ARG A 1 82  ? 10.613  -25.628  -20.825 1.00 30.67  ? 128  ARG A NH2   1 
ATOM   652  N  N     . TYR A 1 83  ? 6.590   -20.216  -19.214 1.00 38.47  ? 129  TYR A N     1 
ATOM   653  C  CA    . TYR A 1 83  ? 7.213   -18.916  -18.898 1.00 38.88  ? 129  TYR A CA    1 
ATOM   654  C  C     . TYR A 1 83  ? 7.040   -18.474  -17.422 1.00 42.92  ? 129  TYR A C     1 
ATOM   655  O  O     . TYR A 1 83  ? 8.016   -18.047  -16.792 1.00 39.58  ? 129  TYR A O     1 
ATOM   656  C  CB    . TYR A 1 83  ? 6.711   -17.839  -19.873 1.00 39.77  ? 129  TYR A CB    1 
ATOM   657  C  CG    . TYR A 1 83  ? 7.353   -16.486  -19.686 1.00 42.51  ? 129  TYR A CG    1 
ATOM   658  C  CD1   . TYR A 1 83  ? 8.626   -16.219  -20.188 1.00 44.40  ? 129  TYR A CD1   1 
ATOM   659  C  CD2   . TYR A 1 83  ? 6.678   -15.456  -19.040 1.00 43.91  ? 129  TYR A CD2   1 
ATOM   660  C  CE1   . TYR A 1 83  ? 9.209   -14.959  -20.051 1.00 45.03  ? 129  TYR A CE1   1 
ATOM   661  C  CE2   . TYR A 1 83  ? 7.244   -14.191  -18.905 1.00 45.24  ? 129  TYR A CE2   1 
ATOM   662  C  CZ    . TYR A 1 83  ? 8.503   -13.943  -19.427 1.00 50.05  ? 129  TYR A CZ    1 
ATOM   663  O  OH    . TYR A 1 83  ? 9.062   -12.705  -19.272 1.00 47.28  ? 129  TYR A OH    1 
ATOM   664  N  N     . TYR A 1 84  ? 5.805   -18.597  -16.883 1.00 43.38  ? 130  TYR A N     1 
ATOM   665  C  CA    . TYR A 1 84  ? 5.466   -18.234  -15.508 1.00 44.61  ? 130  TYR A CA    1 
ATOM   666  C  C     . TYR A 1 84  ? 6.055   -19.223  -14.454 1.00 49.13  ? 130  TYR A C     1 
ATOM   667  O  O     . TYR A 1 84  ? 5.982   -18.941  -13.260 1.00 50.48  ? 130  TYR A O     1 
ATOM   668  C  CB    . TYR A 1 84  ? 3.951   -18.022  -15.348 1.00 46.47  ? 130  TYR A CB    1 
ATOM   669  C  CG    . TYR A 1 84  ? 3.466   -16.690  -15.893 1.00 50.48  ? 130  TYR A CG    1 
ATOM   670  C  CD1   . TYR A 1 84  ? 3.866   -15.488  -15.318 1.00 53.30  ? 130  TYR A CD1   1 
ATOM   671  C  CD2   . TYR A 1 84  ? 2.579   -16.636  -16.969 1.00 51.74  ? 130  TYR A CD2   1 
ATOM   672  C  CE1   . TYR A 1 84  ? 3.419   -14.260  -15.816 1.00 55.46  ? 130  TYR A CE1   1 
ATOM   673  C  CE2   . TYR A 1 84  ? 2.131   -15.418  -17.478 1.00 52.62  ? 130  TYR A CE2   1 
ATOM   674  C  CZ    . TYR A 1 84  ? 2.545   -14.232  -16.894 1.00 62.42  ? 130  TYR A CZ    1 
ATOM   675  O  OH    . TYR A 1 84  ? 2.078   -13.034  -17.386 1.00 64.53  ? 130  TYR A OH    1 
ATOM   676  N  N     . SER A 1 85  ? 6.673   -20.335  -14.905 1.00 43.11  ? 131  SER A N     1 
ATOM   677  C  CA    . SER A 1 85  ? 7.412   -21.305  -14.088 1.00 42.20  ? 131  SER A CA    1 
ATOM   678  C  C     . SER A 1 85  ? 8.918   -20.999  -14.193 1.00 47.89  ? 131  SER A C     1 
ATOM   679  O  O     . SER A 1 85  ? 9.723   -21.657  -13.539 1.00 51.27  ? 131  SER A O     1 
ATOM   680  C  CB    . SER A 1 85  ? 7.181   -22.729  -14.589 1.00 44.32  ? 131  SER A CB    1 
ATOM   681  O  OG    . SER A 1 85  ? 5.804   -23.059  -14.601 1.00 61.19  ? 131  SER A OG    1 
ATOM   682  N  N     . GLY A 1 86  ? 9.285   -20.021  -15.006 1.00 41.59  ? 132  GLY A N     1 
ATOM   683  C  CA    . GLY A 1 86  ? 10.681  -19.670  -15.260 1.00 41.34  ? 132  GLY A CA    1 
ATOM   684  C  C     . GLY A 1 86  ? 11.329  -20.582  -16.294 1.00 42.67  ? 132  GLY A C     1 
ATOM   685  O  O     . GLY A 1 86  ? 12.550  -20.751  -16.298 1.00 39.32  ? 132  GLY A O     1 
ATOM   686  N  N     . LEU A 1 87  ? 10.495  -21.149  -17.214 1.00 39.08  ? 133  LEU A N     1 
ATOM   687  C  CA    . LEU A 1 87  ? 10.891  -22.046  -18.308 1.00 37.08  ? 133  LEU A CA    1 
ATOM   688  C  C     . LEU A 1 87  ? 10.728  -21.209  -19.575 1.00 38.64  ? 133  LEU A C     1 
ATOM   689  O  O     . LEU A 1 87  ? 9.632   -21.080  -20.107 1.00 37.46  ? 133  LEU A O     1 
ATOM   690  C  CB    . LEU A 1 87  ? 10.032  -23.362  -18.310 1.00 36.41  ? 133  LEU A CB    1 
ATOM   691  C  CG    . LEU A 1 87  ? 10.169  -24.322  -17.078 1.00 39.34  ? 133  LEU A CG    1 
ATOM   692  C  CD1   . LEU A 1 87  ? 9.130   -25.448  -17.122 1.00 38.78  ? 133  LEU A CD1   1 
ATOM   693  C  CD2   . LEU A 1 87  ? 11.569  -24.946  -16.992 1.00 36.56  ? 133  LEU A CD2   1 
ATOM   694  N  N     . ILE A 1 88  ? 11.821  -20.540  -19.987 1.00 35.56  ? 134  ILE A N     1 
ATOM   695  C  CA    . ILE A 1 88  ? 11.810  -19.587  -21.102 1.00 34.35  ? 134  ILE A CA    1 
ATOM   696  C  C     . ILE A 1 88  ? 11.994  -20.248  -22.493 1.00 37.79  ? 134  ILE A C     1 
ATOM   697  O  O     . ILE A 1 88  ? 11.553  -19.680  -23.485 1.00 38.77  ? 134  ILE A O     1 
ATOM   698  C  CB    . ILE A 1 88  ? 12.806  -18.414  -20.852 1.00 36.76  ? 134  ILE A CB    1 
ATOM   699  C  CG1   . ILE A 1 88  ? 14.288  -18.854  -20.846 1.00 35.32  ? 134  ILE A CG1   1 
ATOM   700  C  CG2   . ILE A 1 88  ? 12.440  -17.652  -19.560 1.00 37.89  ? 134  ILE A CG2   1 
ATOM   701  C  CD1   . ILE A 1 88  ? 15.228  -17.724  -21.071 1.00 33.02  ? 134  ILE A CD1   1 
ATOM   702  N  N     . TYR A 1 89  ? 12.600  -21.435  -22.555 1.00 34.69  ? 135  TYR A N     1 
ATOM   703  C  CA    . TYR A 1 89  ? 12.819  -22.181  -23.797 1.00 34.49  ? 135  TYR A CA    1 
ATOM   704  C  C     . TYR A 1 89  ? 11.774  -23.278  -24.007 1.00 37.58  ? 135  TYR A C     1 
ATOM   705  O  O     . TYR A 1 89  ? 11.411  -23.966  -23.051 1.00 38.05  ? 135  TYR A O     1 
ATOM   706  C  CB    . TYR A 1 89  ? 14.232  -22.806  -23.806 1.00 34.87  ? 135  TYR A CB    1 
ATOM   707  C  CG    . TYR A 1 89  ? 15.354  -21.785  -23.752 1.00 34.25  ? 135  TYR A CG    1 
ATOM   708  C  CD1   . TYR A 1 89  ? 15.865  -21.216  -24.913 1.00 34.55  ? 135  TYR A CD1   1 
ATOM   709  C  CD2   . TYR A 1 89  ? 15.998  -21.501  -22.545 1.00 35.41  ? 135  TYR A CD2   1 
ATOM   710  C  CE1   . TYR A 1 89  ? 16.916  -20.295  -24.870 1.00 34.03  ? 135  TYR A CE1   1 
ATOM   711  C  CE2   . TYR A 1 89  ? 17.081  -20.617  -22.497 1.00 36.56  ? 135  TYR A CE2   1 
ATOM   712  C  CZ    . TYR A 1 89  ? 17.518  -19.995  -23.654 1.00 41.59  ? 135  TYR A CZ    1 
ATOM   713  O  OH    . TYR A 1 89  ? 18.577  -19.118  -23.591 1.00 39.69  ? 135  TYR A OH    1 
ATOM   714  N  N     . THR A 1 90  ? 11.291  -23.430  -25.253 1.00 31.22  ? 136  THR A N     1 
ATOM   715  C  CA    . THR A 1 90  ? 10.312  -24.439  -25.653 1.00 30.55  ? 136  THR A CA    1 
ATOM   716  C  C     . THR A 1 90  ? 10.560  -24.823  -27.102 1.00 35.09  ? 136  THR A C     1 
ATOM   717  O  O     . THR A 1 90  ? 10.624  -23.952  -27.944 1.00 34.05  ? 136  THR A O     1 
ATOM   718  C  CB    . THR A 1 90  ? 8.858   -23.889  -25.598 1.00 40.89  ? 136  THR A CB    1 
ATOM   719  O  OG1   . THR A 1 90  ? 8.651   -23.105  -24.433 1.00 40.95  ? 136  THR A OG1   1 
ATOM   720  C  CG2   . THR A 1 90  ? 7.790   -25.018  -25.667 1.00 39.95  ? 136  THR A CG2   1 
ATOM   721  N  N     . TYR A 1 91  ? 10.557  -26.110  -27.416 1.00 33.58  ? 137  TYR A N     1 
ATOM   722  C  CA    . TYR A 1 91  ? 10.693  -26.578  -28.795 1.00 33.35  ? 137  TYR A CA    1 
ATOM   723  C  C     . TYR A 1 91  ? 9.389   -26.470  -29.600 1.00 38.71  ? 137  TYR A C     1 
ATOM   724  O  O     . TYR A 1 91  ? 8.297   -26.584  -29.031 1.00 39.13  ? 137  TYR A O     1 
ATOM   725  C  CB    . TYR A 1 91  ? 11.203  -28.027  -28.797 1.00 33.35  ? 137  TYR A CB    1 
ATOM   726  C  CG    . TYR A 1 91  ? 12.612  -28.103  -28.269 1.00 35.61  ? 137  TYR A CG    1 
ATOM   727  C  CD1   . TYR A 1 91  ? 13.597  -27.242  -28.743 1.00 36.48  ? 137  TYR A CD1   1 
ATOM   728  C  CD2   . TYR A 1 91  ? 12.964  -29.034  -27.292 1.00 36.15  ? 137  TYR A CD2   1 
ATOM   729  C  CE1   . TYR A 1 91  ? 14.880  -27.266  -28.230 1.00 37.99  ? 137  TYR A CE1   1 
ATOM   730  C  CE2   . TYR A 1 91  ? 14.267  -29.093  -26.800 1.00 37.30  ? 137  TYR A CE2   1 
ATOM   731  C  CZ    . TYR A 1 91  ? 15.218  -28.191  -27.265 1.00 47.13  ? 137  TYR A CZ    1 
ATOM   732  O  OH    . TYR A 1 91  ? 16.516  -28.177  -26.827 1.00 47.83  ? 137  TYR A OH    1 
ATOM   733  N  N     . SER A 1 92  ? 9.498   -26.314  -30.920 1.00 33.79  ? 138  SER A N     1 
ATOM   734  C  CA    . SER A 1 92  ? 8.296   -26.271  -31.760 1.00 34.46  ? 138  SER A CA    1 
ATOM   735  C  C     . SER A 1 92  ? 8.642   -26.954  -33.076 1.00 38.67  ? 138  SER A C     1 
ATOM   736  O  O     . SER A 1 92  ? 8.944   -26.304  -34.090 1.00 35.50  ? 138  SER A O     1 
ATOM   737  C  CB    . SER A 1 92  ? 7.807   -24.830  -31.948 1.00 39.50  ? 138  SER A CB    1 
ATOM   738  O  OG    . SER A 1 92  ? 8.755   -24.046  -32.650 1.00 49.62  ? 138  SER A OG    1 
ATOM   739  N  N     . GLY A 1 93  ? 8.643   -28.283  -33.032 1.00 37.35  ? 139  GLY A N     1 
ATOM   740  C  CA    . GLY A 1 93  ? 9.098   -29.072  -34.165 1.00 37.80  ? 139  GLY A CA    1 
ATOM   741  C  C     . GLY A 1 93  ? 10.617  -28.970  -34.232 1.00 42.38  ? 139  GLY A C     1 
ATOM   742  O  O     . GLY A 1 93  ? 11.288  -29.047  -33.194 1.00 41.22  ? 139  GLY A O     1 
ATOM   743  N  N     . LEU A 1 94  ? 11.168  -28.742  -35.432 1.00 40.20  ? 140  LEU A N     1 
ATOM   744  C  CA    . LEU A 1 94  ? 12.629  -28.632  -35.648 1.00 41.39  ? 140  LEU A CA    1 
ATOM   745  C  C     . LEU A 1 94  ? 13.284  -27.342  -35.117 1.00 42.24  ? 140  LEU A C     1 
ATOM   746  O  O     . LEU A 1 94  ? 14.500  -27.195  -35.225 1.00 42.39  ? 140  LEU A O     1 
ATOM   747  C  CB    . LEU A 1 94  ? 12.993  -28.815  -37.149 1.00 42.80  ? 140  LEU A CB    1 
ATOM   748  C  CG    . LEU A 1 94  ? 12.798  -30.222  -37.780 1.00 49.21  ? 140  LEU A CG    1 
ATOM   749  C  CD1   . LEU A 1 94  ? 13.428  -30.284  -39.161 1.00 49.95  ? 140  LEU A CD1   1 
ATOM   750  C  CD2   . LEU A 1 94  ? 13.387  -31.339  -36.919 1.00 51.04  ? 140  LEU A CD2   1 
ATOM   751  N  N     . PHE A 1 95  ? 12.515  -26.409  -34.556 1.00 36.80  ? 141  PHE A N     1 
ATOM   752  C  CA    . PHE A 1 95  ? 13.142  -25.169  -34.090 1.00 36.33  ? 141  PHE A CA    1 
ATOM   753  C  C     . PHE A 1 95  ? 12.802  -24.877  -32.635 1.00 37.59  ? 141  PHE A C     1 
ATOM   754  O  O     . PHE A 1 95  ? 12.122  -25.662  -32.002 1.00 35.52  ? 141  PHE A O     1 
ATOM   755  C  CB    . PHE A 1 95  ? 12.857  -23.977  -35.030 1.00 37.21  ? 141  PHE A CB    1 
ATOM   756  C  CG    . PHE A 1 95  ? 11.393  -23.663  -35.168 1.00 38.69  ? 141  PHE A CG    1 
ATOM   757  C  CD1   . PHE A 1 95  ? 10.625  -24.276  -36.145 1.00 41.69  ? 141  PHE A CD1   1 
ATOM   758  C  CD2   . PHE A 1 95  ? 10.783  -22.744  -34.325 1.00 40.24  ? 141  PHE A CD2   1 
ATOM   759  C  CE1   . PHE A 1 95  ? 9.279   -23.953  -36.299 1.00 42.40  ? 141  PHE A CE1   1 
ATOM   760  C  CE2   . PHE A 1 95  ? 9.437   -22.431  -34.474 1.00 43.17  ? 141  PHE A CE2   1 
ATOM   761  C  CZ    . PHE A 1 95  ? 8.689   -23.048  -35.450 1.00 41.58  ? 141  PHE A CZ    1 
ATOM   762  N  N     . CYS A 1 96  ? 13.356  -23.792  -32.090 1.00 34.45  ? 142  CYS A N     1 
ATOM   763  C  CA    . CYS A 1 96  ? 13.206  -23.472  -30.682 1.00 34.73  ? 142  CYS A CA    1 
ATOM   764  C  C     . CYS A 1 96  ? 12.618  -22.111  -30.501 1.00 34.71  ? 142  CYS A C     1 
ATOM   765  O  O     . CYS A 1 96  ? 12.945  -21.217  -31.254 1.00 34.83  ? 142  CYS A O     1 
ATOM   766  C  CB    . CYS A 1 96  ? 14.560  -23.577  -29.982 1.00 35.76  ? 142  CYS A CB    1 
ATOM   767  S  SG    . CYS A 1 96  ? 14.465  -23.426  -28.185 1.00 40.28  ? 142  CYS A SG    1 
ATOM   768  N  N     . VAL A 1 97  ? 11.809  -21.935  -29.473 1.00 30.26  ? 143  VAL A N     1 
ATOM   769  C  CA    . VAL A 1 97  ? 11.219  -20.650  -29.149 1.00 30.80  ? 143  VAL A CA    1 
ATOM   770  C  C     . VAL A 1 97  ? 11.802  -20.225  -27.784 1.00 37.08  ? 143  VAL A C     1 
ATOM   771  O  O     . VAL A 1 97  ? 11.963  -21.072  -26.895 1.00 36.00  ? 143  VAL A O     1 
ATOM   772  C  CB    . VAL A 1 97  ? 9.646   -20.666  -29.224 1.00 34.29  ? 143  VAL A CB    1 
ATOM   773  C  CG1   . VAL A 1 97  ? 9.029   -19.406  -28.604 1.00 33.96  ? 143  VAL A CG1   1 
ATOM   774  C  CG2   . VAL A 1 97  ? 9.165   -20.806  -30.676 1.00 33.86  ? 143  VAL A CG2   1 
ATOM   775  N  N     . VAL A 1 98  ? 12.160  -18.922  -27.633 1.00 33.98  ? 144  VAL A N     1 
ATOM   776  C  CA    . VAL A 1 98  ? 12.646  -18.422  -26.333 1.00 33.42  ? 144  VAL A CA    1 
ATOM   777  C  C     . VAL A 1 98  ? 11.921  -17.101  -26.006 1.00 35.50  ? 144  VAL A C     1 
ATOM   778  O  O     . VAL A 1 98  ? 11.745  -16.289  -26.907 1.00 34.50  ? 144  VAL A O     1 
ATOM   779  C  CB    . VAL A 1 98  ? 14.199  -18.368  -26.159 1.00 37.64  ? 144  VAL A CB    1 
ATOM   780  C  CG1   . VAL A 1 98  ? 14.919  -17.712  -27.332 1.00 37.08  ? 144  VAL A CG1   1 
ATOM   781  C  CG2   . VAL A 1 98  ? 14.603  -17.712  -24.843 1.00 38.14  ? 144  VAL A CG2   1 
ATOM   782  N  N     . ILE A 1 99  ? 11.536  -16.912  -24.751 1.00 31.32  ? 145  ILE A N     1 
ATOM   783  C  CA    . ILE A 1 99  ? 10.868  -15.693  -24.322 1.00 30.04  ? 145  ILE A CA    1 
ATOM   784  C  C     . ILE A 1 99  ? 11.812  -15.002  -23.353 1.00 38.06  ? 145  ILE A C     1 
ATOM   785  O  O     . ILE A 1 99  ? 12.344  -15.643  -22.448 1.00 39.33  ? 145  ILE A O     1 
ATOM   786  C  CB    . ILE A 1 99  ? 9.534   -15.990  -23.617 1.00 31.83  ? 145  ILE A CB    1 
ATOM   787  C  CG1   . ILE A 1 99  ? 8.613   -16.795  -24.537 1.00 31.59  ? 145  ILE A CG1   1 
ATOM   788  C  CG2   . ILE A 1 99  ? 8.862   -14.697  -23.181 1.00 32.31  ? 145  ILE A CG2   1 
ATOM   789  C  CD1   . ILE A 1 99  ? 7.274   -17.131  -23.918 1.00 39.36  ? 145  ILE A CD1   1 
ATOM   790  N  N     . ASN A 1 100 ? 12.027  -13.702  -23.533 1.00 35.55  ? 146  ASN A N     1 
ATOM   791  C  CA    . ASN A 1 100 ? 12.946  -12.992  -22.655 1.00 37.06  ? 146  ASN A CA    1 
ATOM   792  C  C     . ASN A 1 100 ? 12.263  -12.699  -21.328 1.00 41.35  ? 146  ASN A C     1 
ATOM   793  O  O     . ASN A 1 100 ? 11.235  -12.024  -21.280 1.00 43.34  ? 146  ASN A O     1 
ATOM   794  C  CB    . ASN A 1 100 ? 13.428  -11.700  -23.319 1.00 39.57  ? 146  ASN A CB    1 
ATOM   795  C  CG    . ASN A 1 100 ? 14.597  -11.069  -22.589 1.00 80.00  ? 146  ASN A CG    1 
ATOM   796  O  OD1   . ASN A 1 100 ? 15.414  -11.762  -21.982 1.00 85.73  ? 146  ASN A OD1   1 
ATOM   797  N  ND2   . ASN A 1 100 ? 14.684  -9.745   -22.646 1.00 72.37  ? 146  ASN A ND2   1 
ATOM   798  N  N     . PRO A 1 101 ? 12.851  -13.216  -20.241 1.00 36.14  ? 147  PRO A N     1 
ATOM   799  C  CA    . PRO A 1 101 ? 12.396  -13.085  -18.854 1.00 35.90  ? 147  PRO A CA    1 
ATOM   800  C  C     . PRO A 1 101 ? 12.510  -11.670  -18.300 1.00 42.36  ? 147  PRO A C     1 
ATOM   801  O  O     . PRO A 1 101 ? 11.626  -11.225  -17.569 1.00 43.48  ? 147  PRO A O     1 
ATOM   802  C  CB    . PRO A 1 101 ? 13.336  -14.021  -18.089 1.00 37.18  ? 147  PRO A CB    1 
ATOM   803  C  CG    . PRO A 1 101 ? 14.600  -13.994  -18.874 1.00 41.63  ? 147  PRO A CG    1 
ATOM   804  C  CD    . PRO A 1 101 ? 14.170  -13.937  -20.312 1.00 37.11  ? 147  PRO A CD    1 
ATOM   805  N  N     . TYR A 1 102 ? 13.589  -10.975  -18.646 1.00 38.03  ? 148  TYR A N     1 
ATOM   806  C  CA    . TYR A 1 102 ? 13.827  -9.630   -18.094 1.00 37.42  ? 148  TYR A CA    1 
ATOM   807  C  C     . TYR A 1 102 ? 14.236  -9.651   -16.614 1.00 46.97  ? 148  TYR A C     1 
ATOM   808  O  O     . TYR A 1 102 ? 13.965  -8.712   -15.867 1.00 47.48  ? 148  TYR A O     1 
ATOM   809  C  CB    . TYR A 1 102 ? 12.666  -8.636   -18.344 1.00 37.10  ? 148  TYR A CB    1 
ATOM   810  C  CG    . TYR A 1 102 ? 12.648  -8.014   -19.718 1.00 37.81  ? 148  TYR A CG    1 
ATOM   811  C  CD1   . TYR A 1 102 ? 13.724  -7.242   -20.165 1.00 40.51  ? 148  TYR A CD1   1 
ATOM   812  C  CD2   . TYR A 1 102 ? 11.542  -8.132   -20.546 1.00 37.78  ? 148  TYR A CD2   1 
ATOM   813  C  CE1   . TYR A 1 102 ? 13.694  -6.625   -21.420 1.00 42.20  ? 148  TYR A CE1   1 
ATOM   814  C  CE2   . TYR A 1 102 ? 11.503  -7.533   -21.800 1.00 38.15  ? 148  TYR A CE2   1 
ATOM   815  C  CZ    . TYR A 1 102 ? 12.588  -6.785   -22.239 1.00 47.07  ? 148  TYR A CZ    1 
ATOM   816  O  OH    . TYR A 1 102 ? 12.561  -6.187   -23.477 1.00 44.02  ? 148  TYR A OH    1 
ATOM   817  N  N     . LYS A 1 103 ? 14.904  -10.729  -16.197 1.00 47.73  ? 149  LYS A N     1 
ATOM   818  C  CA    . LYS A 1 103 ? 15.492  -10.917  -14.870 1.00 48.22  ? 149  LYS A CA    1 
ATOM   819  C  C     . LYS A 1 103 ? 16.603  -11.930  -15.001 1.00 53.79  ? 149  LYS A C     1 
ATOM   820  O  O     . LYS A 1 103 ? 16.672  -12.626  -16.014 1.00 52.11  ? 149  LYS A O     1 
ATOM   821  C  CB    . LYS A 1 103 ? 14.461  -11.308  -13.785 1.00 50.14  ? 149  LYS A CB    1 
ATOM   822  C  CG    . LYS A 1 103 ? 13.956  -12.748  -13.796 1.00 57.38  ? 149  LYS A CG    1 
ATOM   823  C  CD    . LYS A 1 103 ? 13.022  -12.973  -12.626 1.00 67.63  ? 149  LYS A CD    1 
ATOM   824  C  CE    . LYS A 1 103 ? 12.082  -14.129  -12.841 1.00 87.63  ? 149  LYS A CE    1 
ATOM   825  N  NZ    . LYS A 1 103 ? 11.000  -14.166  -11.817 1.00 99.81  ? 149  LYS A NZ    1 
ATOM   826  N  N     . GLN A 1 104 ? 17.485  -11.998  -14.000 1.00 53.59  ? 150  GLN A N     1 
ATOM   827  C  CA    . GLN A 1 104 ? 18.563  -12.984  -13.985 1.00 54.80  ? 150  GLN A CA    1 
ATOM   828  C  C     . GLN A 1 104 ? 17.965  -14.320  -13.595 1.00 56.18  ? 150  GLN A C     1 
ATOM   829  O  O     . GLN A 1 104 ? 17.146  -14.371  -12.682 1.00 54.59  ? 150  GLN A O     1 
ATOM   830  C  CB    . GLN A 1 104 ? 19.670  -12.586  -12.986 1.00 57.06  ? 150  GLN A CB    1 
ATOM   831  C  CG    . GLN A 1 104 ? 20.712  -11.631  -13.566 1.00 86.92  ? 150  GLN A CG    1 
ATOM   832  C  CD    . GLN A 1 104 ? 21.721  -12.349  -14.430 1.00 117.93 ? 150  GLN A CD    1 
ATOM   833  O  OE1   . GLN A 1 104 ? 21.731  -12.210  -15.657 1.00 117.17 ? 150  GLN A OE1   1 
ATOM   834  N  NE2   . GLN A 1 104 ? 22.583  -13.146  -13.811 1.00 112.12 ? 150  GLN A NE2   1 
ATOM   835  N  N     . LEU A 1 105 ? 18.320  -15.385  -14.319 1.00 53.45  ? 151  LEU A N     1 
ATOM   836  C  CA    . LEU A 1 105 ? 17.842  -16.740  -14.011 1.00 53.06  ? 151  LEU A CA    1 
ATOM   837  C  C     . LEU A 1 105 ? 19.014  -17.701  -13.797 1.00 54.44  ? 151  LEU A C     1 
ATOM   838  O  O     . LEU A 1 105 ? 19.950  -17.693  -14.595 1.00 52.42  ? 151  LEU A O     1 
ATOM   839  C  CB    . LEU A 1 105 ? 16.907  -17.308  -15.093 1.00 53.30  ? 151  LEU A CB    1 
ATOM   840  C  CG    . LEU A 1 105 ? 15.639  -16.555  -15.457 1.00 57.83  ? 151  LEU A CG    1 
ATOM   841  C  CD1   . LEU A 1 105 ? 14.947  -17.255  -16.589 1.00 58.44  ? 151  LEU A CD1   1 
ATOM   842  C  CD2   . LEU A 1 105 ? 14.692  -16.440  -14.282 1.00 60.04  ? 151  LEU A CD2   1 
ATOM   843  N  N     . PRO A 1 106 ? 18.961  -18.580  -12.768 1.00 51.80  ? 152  PRO A N     1 
ATOM   844  C  CA    . PRO A 1 106 ? 20.077  -19.525  -12.546 1.00 51.34  ? 152  PRO A CA    1 
ATOM   845  C  C     . PRO A 1 106 ? 20.112  -20.718  -13.533 1.00 53.77  ? 152  PRO A C     1 
ATOM   846  O  O     . PRO A 1 106 ? 20.229  -21.862  -13.094 1.00 54.07  ? 152  PRO A O     1 
ATOM   847  C  CB    . PRO A 1 106 ? 19.806  -20.004  -11.118 1.00 53.28  ? 152  PRO A CB    1 
ATOM   848  C  CG    . PRO A 1 106 ? 18.324  -19.989  -10.994 1.00 57.11  ? 152  PRO A CG    1 
ATOM   849  C  CD    . PRO A 1 106 ? 17.919  -18.731  -11.721 1.00 52.95  ? 152  PRO A CD    1 
ATOM   850  N  N     . ILE A 1 107 ? 19.995  -20.470  -14.853 1.00 47.75  ? 153  ILE A N     1 
ATOM   851  C  CA    . ILE A 1 107 ? 19.943  -21.552  -15.850 1.00 45.42  ? 153  ILE A CA    1 
ATOM   852  C  C     . ILE A 1 107 ? 21.179  -21.592  -16.784 1.00 46.61  ? 153  ILE A C     1 
ATOM   853  O  O     . ILE A 1 107 ? 21.192  -22.373  -17.741 1.00 45.80  ? 153  ILE A O     1 
ATOM   854  C  CB    . ILE A 1 107 ? 18.607  -21.516  -16.651 1.00 47.71  ? 153  ILE A CB    1 
ATOM   855  C  CG1   . ILE A 1 107 ? 18.404  -20.152  -17.382 1.00 47.65  ? 153  ILE A CG1   1 
ATOM   856  C  CG2   . ILE A 1 107 ? 17.415  -21.873  -15.757 1.00 47.02  ? 153  ILE A CG2   1 
ATOM   857  C  CD1   . ILE A 1 107 ? 17.569  -20.206  -18.602 1.00 46.79  ? 153  ILE A CD1   1 
ATOM   858  N  N     . TYR A 1 108 ? 22.220  -20.793  -16.495 1.00 40.58  ? 154  TYR A N     1 
ATOM   859  C  CA    . TYR A 1 108 ? 23.380  -20.768  -17.373 1.00 40.70  ? 154  TYR A CA    1 
ATOM   860  C  C     . TYR A 1 108 ? 24.717  -21.079  -16.677 1.00 47.93  ? 154  TYR A C     1 
ATOM   861  O  O     . TYR A 1 108 ? 25.761  -20.584  -17.109 1.00 48.11  ? 154  TYR A O     1 
ATOM   862  C  CB    . TYR A 1 108 ? 23.447  -19.412  -18.131 1.00 39.94  ? 154  TYR A CB    1 
ATOM   863  C  CG    . TYR A 1 108 ? 22.204  -19.047  -18.920 1.00 38.38  ? 154  TYR A CG    1 
ATOM   864  C  CD1   . TYR A 1 108 ? 21.872  -19.724  -20.090 1.00 39.38  ? 154  TYR A CD1   1 
ATOM   865  C  CD2   . TYR A 1 108 ? 21.405  -17.972  -18.542 1.00 37.47  ? 154  TYR A CD2   1 
ATOM   866  C  CE1   . TYR A 1 108 ? 20.761  -19.353  -20.849 1.00 35.15  ? 154  TYR A CE1   1 
ATOM   867  C  CE2   . TYR A 1 108 ? 20.293  -17.600  -19.286 1.00 36.05  ? 154  TYR A CE2   1 
ATOM   868  C  CZ    . TYR A 1 108 ? 19.971  -18.297  -20.438 1.00 37.68  ? 154  TYR A CZ    1 
ATOM   869  O  OH    . TYR A 1 108 ? 18.874  -17.920  -21.193 1.00 40.61  ? 154  TYR A OH    1 
ATOM   870  N  N     . THR A 1 109 ? 24.705  -21.916  -15.636 1.00 46.99  ? 155  THR A N     1 
ATOM   871  C  CA    . THR A 1 109 ? 25.946  -22.279  -14.906 1.00 47.79  ? 155  THR A CA    1 
ATOM   872  C  C     . THR A 1 109 ? 26.824  -23.312  -15.645 1.00 53.84  ? 155  THR A C     1 
ATOM   873  O  O     . THR A 1 109 ? 26.364  -23.923  -16.614 1.00 54.69  ? 155  THR A O     1 
ATOM   874  C  CB    . THR A 1 109 ? 25.617  -22.816  -13.529 1.00 45.14  ? 155  THR A CB    1 
ATOM   875  O  OG1   . THR A 1 109 ? 24.788  -23.954  -13.712 1.00 47.05  ? 155  THR A OG1   1 
ATOM   876  C  CG2   . THR A 1 109 ? 24.932  -21.790  -12.645 1.00 44.19  ? 155  THR A CG2   1 
ATOM   877  N  N     . GLU A 1 110 ? 28.081  -23.518  -15.164 1.00 49.75  ? 156  GLU A N     1 
ATOM   878  C  CA    . GLU A 1 110 ? 29.008  -24.531  -15.683 1.00 49.17  ? 156  GLU A CA    1 
ATOM   879  C  C     . GLU A 1 110 ? 28.422  -25.951  -15.462 1.00 51.22  ? 156  GLU A C     1 
ATOM   880  O  O     . GLU A 1 110 ? 28.673  -26.843  -16.272 1.00 51.09  ? 156  GLU A O     1 
ATOM   881  C  CB    . GLU A 1 110 ? 30.385  -24.413  -15.003 1.00 51.00  ? 156  GLU A CB    1 
ATOM   882  C  CG    . GLU A 1 110 ? 31.513  -25.064  -15.794 1.00 65.45  ? 156  GLU A CG    1 
ATOM   883  C  CD    . GLU A 1 110 ? 32.781  -25.423  -15.036 1.00 96.02  ? 156  GLU A CD    1 
ATOM   884  O  OE1   . GLU A 1 110 ? 33.426  -24.507  -14.476 1.00 102.13 ? 156  GLU A OE1   1 
ATOM   885  O  OE2   . GLU A 1 110 ? 33.164  -26.615  -15.058 1.00 92.58  ? 156  GLU A OE2   1 
ATOM   886  N  N     . ALA A 1 111 ? 27.640  -26.154  -14.383 1.00 46.49  ? 157  ALA A N     1 
ATOM   887  C  CA    . ALA A 1 111 ? 27.023  -27.454  -14.116 1.00 47.06  ? 157  ALA A CA    1 
ATOM   888  C  C     . ALA A 1 111 ? 25.891  -27.752  -15.116 1.00 49.86  ? 157  ALA A C     1 
ATOM   889  O  O     . ALA A 1 111 ? 25.698  -28.912  -15.488 1.00 49.39  ? 157  ALA A O     1 
ATOM   890  C  CB    . ALA A 1 111 ? 26.494  -27.521  -12.682 1.00 48.12  ? 157  ALA A CB    1 
ATOM   891  N  N     . ILE A 1 112 ? 25.150  -26.714  -15.552 1.00 44.46  ? 158  ILE A N     1 
ATOM   892  C  CA    . ILE A 1 112 ? 24.067  -26.900  -16.523 1.00 43.90  ? 158  ILE A CA    1 
ATOM   893  C  C     . ILE A 1 112 ? 24.697  -27.140  -17.917 1.00 47.50  ? 158  ILE A C     1 
ATOM   894  O  O     . ILE A 1 112 ? 24.181  -27.976  -18.649 1.00 47.45  ? 158  ILE A O     1 
ATOM   895  C  CB    . ILE A 1 112 ? 23.005  -25.763  -16.427 1.00 47.01  ? 158  ILE A CB    1 
ATOM   896  C  CG1   . ILE A 1 112 ? 22.306  -25.834  -15.043 1.00 47.15  ? 158  ILE A CG1   1 
ATOM   897  C  CG2   . ILE A 1 112 ? 21.958  -25.779  -17.591 1.00 47.04  ? 158  ILE A CG2   1 
ATOM   898  C  CD1   . ILE A 1 112 ? 21.623  -24.529  -14.592 1.00 53.87  ? 158  ILE A CD1   1 
ATOM   899  N  N     . VAL A 1 113 ? 25.861  -26.507  -18.227 1.00 42.56  ? 159  VAL A N     1 
ATOM   900  C  CA    . VAL A 1 113 ? 26.612  -26.719  -19.479 1.00 42.53  ? 159  VAL A CA    1 
ATOM   901  C  C     . VAL A 1 113 ? 26.969  -28.212  -19.609 1.00 50.33  ? 159  VAL A C     1 
ATOM   902  O  O     . VAL A 1 113 ? 26.643  -28.827  -20.623 1.00 50.56  ? 159  VAL A O     1 
ATOM   903  C  CB    . VAL A 1 113 ? 27.885  -25.830  -19.598 1.00 44.95  ? 159  VAL A CB    1 
ATOM   904  C  CG1   . VAL A 1 113 ? 28.702  -26.193  -20.833 1.00 43.85  ? 159  VAL A CG1   1 
ATOM   905  C  CG2   . VAL A 1 113 ? 27.540  -24.349  -19.605 1.00 44.82  ? 159  VAL A CG2   1 
ATOM   906  N  N     . GLU A 1 114 ? 27.609  -28.788  -18.557 1.00 48.93  ? 160  GLU A N     1 
ATOM   907  C  CA    . GLU A 1 114 ? 28.016  -30.200  -18.442 1.00 48.79  ? 160  GLU A CA    1 
ATOM   908  C  C     . GLU A 1 114 ? 26.877  -31.201  -18.623 1.00 52.36  ? 160  GLU A C     1 
ATOM   909  O  O     . GLU A 1 114 ? 27.091  -32.254  -19.222 1.00 51.65  ? 160  GLU A O     1 
ATOM   910  C  CB    . GLU A 1 114 ? 28.739  -30.447  -17.111 1.00 49.87  ? 160  GLU A CB    1 
ATOM   911  C  CG    . GLU A 1 114 ? 30.089  -29.745  -17.022 1.00 54.63  ? 160  GLU A CG    1 
ATOM   912  C  CD    . GLU A 1 114 ? 31.144  -30.213  -18.002 1.00 76.69  ? 160  GLU A CD    1 
ATOM   913  O  OE1   . GLU A 1 114 ? 31.157  -31.419  -18.342 1.00 83.62  ? 160  GLU A OE1   1 
ATOM   914  O  OE2   . GLU A 1 114 ? 31.996  -29.384  -18.389 1.00 74.24  ? 160  GLU A OE2   1 
ATOM   915  N  N     . MET A 1 115 ? 25.672  -30.853  -18.134 1.00 50.15  ? 161  MET A N     1 
ATOM   916  C  CA    . MET A 1 115 ? 24.424  -31.627  -18.224 1.00 50.80  ? 161  MET A CA    1 
ATOM   917  C  C     . MET A 1 115 ? 23.918  -31.759  -19.684 1.00 47.94  ? 161  MET A C     1 
ATOM   918  O  O     . MET A 1 115 ? 23.169  -32.691  -19.997 1.00 46.49  ? 161  MET A O     1 
ATOM   919  C  CB    . MET A 1 115 ? 23.367  -30.946  -17.342 1.00 55.47  ? 161  MET A CB    1 
ATOM   920  C  CG    . MET A 1 115 ? 21.959  -31.446  -17.547 1.00 62.94  ? 161  MET A CG    1 
ATOM   921  S  SD    . MET A 1 115 ? 20.756  -30.692  -16.434 1.00 71.37  ? 161  MET A SD    1 
ATOM   922  C  CE    . MET A 1 115 ? 20.432  -29.198  -17.262 1.00 68.01  ? 161  MET A CE    1 
ATOM   923  N  N     . TYR A 1 116 ? 24.311  -30.830  -20.572 1.00 38.72  ? 162  TYR A N     1 
ATOM   924  C  CA    . TYR A 1 116 ? 23.866  -30.896  -21.952 1.00 36.12  ? 162  TYR A CA    1 
ATOM   925  C  C     . TYR A 1 116 ? 24.812  -31.672  -22.846 1.00 40.66  ? 162  TYR A C     1 
ATOM   926  O  O     . TYR A 1 116 ? 24.378  -32.213  -23.861 1.00 40.52  ? 162  TYR A O     1 
ATOM   927  C  CB    . TYR A 1 116 ? 23.571  -29.485  -22.503 1.00 35.73  ? 162  TYR A CB    1 
ATOM   928  C  CG    . TYR A 1 116 ? 22.222  -29.019  -22.036 1.00 31.22  ? 162  TYR A CG    1 
ATOM   929  C  CD1   . TYR A 1 116 ? 22.077  -28.360  -20.820 1.00 31.19  ? 162  TYR A CD1   1 
ATOM   930  C  CD2   . TYR A 1 116 ? 21.069  -29.352  -22.739 1.00 31.19  ? 162  TYR A CD2   1 
ATOM   931  C  CE1   . TYR A 1 116 ? 20.823  -28.014  -20.331 1.00 31.40  ? 162  TYR A CE1   1 
ATOM   932  C  CE2   . TYR A 1 116 ? 19.808  -29.007  -22.260 1.00 31.50  ? 162  TYR A CE2   1 
ATOM   933  C  CZ    . TYR A 1 116 ? 19.690  -28.388  -21.030 1.00 35.21  ? 162  TYR A CZ    1 
ATOM   934  O  OH    . TYR A 1 116 ? 18.455  -28.074  -20.541 1.00 37.51  ? 162  TYR A OH    1 
ATOM   935  N  N     . ARG A 1 117 ? 26.076  -31.777  -22.454 1.00 39.09  ? 163  ARG A N     1 
ATOM   936  C  CA    . ARG A 1 117 ? 27.113  -32.452  -23.236 1.00 41.19  ? 163  ARG A CA    1 
ATOM   937  C  C     . ARG A 1 117 ? 26.772  -33.871  -23.651 1.00 46.38  ? 163  ARG A C     1 
ATOM   938  O  O     . ARG A 1 117 ? 26.454  -34.689  -22.806 1.00 47.21  ? 163  ARG A O     1 
ATOM   939  C  CB    . ARG A 1 117 ? 28.452  -32.426  -22.494 1.00 44.81  ? 163  ARG A CB    1 
ATOM   940  C  CG    . ARG A 1 117 ? 29.056  -31.041  -22.378 1.00 52.27  ? 163  ARG A CG    1 
ATOM   941  C  CD    . ARG A 1 117 ? 30.275  -31.083  -21.489 1.00 48.43  ? 163  ARG A CD    1 
ATOM   942  N  NE    . ARG A 1 117 ? 31.459  -31.432  -22.260 1.00 40.28  ? 163  ARG A NE    1 
ATOM   943  C  CZ    . ARG A 1 117 ? 32.693  -31.078  -21.932 1.00 53.99  ? 163  ARG A CZ    1 
ATOM   944  N  NH1   . ARG A 1 117 ? 32.920  -30.404  -20.811 1.00 44.61  ? 163  ARG A NH1   1 
ATOM   945  N  NH2   . ARG A 1 117 ? 33.709  -31.396  -22.718 1.00 40.15  ? 163  ARG A NH2   1 
ATOM   946  N  N     . GLY A 1 118 ? 26.808  -34.140  -24.952 1.00 43.48  ? 164  GLY A N     1 
ATOM   947  C  CA    . GLY A 1 118 ? 26.530  -35.468  -25.496 1.00 43.77  ? 164  GLY A CA    1 
ATOM   948  C  C     . GLY A 1 118 ? 25.116  -35.959  -25.279 1.00 48.21  ? 164  GLY A C     1 
ATOM   949  O  O     . GLY A 1 118 ? 24.859  -37.158  -25.372 1.00 47.38  ? 164  GLY A O     1 
ATOM   950  N  N     . LYS A 1 119 ? 24.184  -35.045  -24.977 1.00 46.18  ? 165  LYS A N     1 
ATOM   951  C  CA    . LYS A 1 119 ? 22.791  -35.435  -24.775 1.00 45.52  ? 165  LYS A CA    1 
ATOM   952  C  C     . LYS A 1 119 ? 21.982  -35.164  -26.030 1.00 48.75  ? 165  LYS A C     1 
ATOM   953  O  O     . LYS A 1 119 ? 22.302  -34.257  -26.793 1.00 47.90  ? 165  LYS A O     1 
ATOM   954  C  CB    . LYS A 1 119 ? 22.164  -34.751  -23.542 1.00 47.06  ? 165  LYS A CB    1 
ATOM   955  C  CG    . LYS A 1 119 ? 22.919  -34.973  -22.241 1.00 59.20  ? 165  LYS A CG    1 
ATOM   956  C  CD    . LYS A 1 119 ? 22.545  -36.271  -21.547 1.00 69.41  ? 165  LYS A CD    1 
ATOM   957  C  CE    . LYS A 1 119 ? 23.472  -36.594  -20.399 1.00 83.02  ? 165  LYS A CE    1 
ATOM   958  N  NZ    . LYS A 1 119 ? 23.330  -35.639  -19.263 1.00 90.37  ? 165  LYS A NZ    1 
ATOM   959  N  N     . LYS A 1 120 ? 20.941  -35.963  -26.229 1.00 46.40  ? 166  LYS A N     1 
ATOM   960  C  CA    . LYS A 1 120 ? 19.993  -35.858  -27.329 1.00 46.89  ? 166  LYS A CA    1 
ATOM   961  C  C     . LYS A 1 120 ? 18.903  -34.831  -26.918 1.00 47.72  ? 166  LYS A C     1 
ATOM   962  O  O     . LYS A 1 120 ? 18.616  -34.683  -25.727 1.00 43.23  ? 166  LYS A O     1 
ATOM   963  C  CB    . LYS A 1 120 ? 19.378  -37.245  -27.650 1.00 50.44  ? 166  LYS A CB    1 
ATOM   964  C  CG    . LYS A 1 120 ? 20.385  -38.328  -28.092 1.00 68.55  ? 166  LYS A CG    1 
ATOM   965  C  CD    . LYS A 1 120 ? 21.011  -38.106  -29.467 1.00 84.77  ? 166  LYS A CD    1 
ATOM   966  C  CE    . LYS A 1 120 ? 20.332  -38.915  -30.548 1.00 109.02 ? 166  LYS A CE    1 
ATOM   967  N  NZ    . LYS A 1 120 ? 20.793  -38.523  -31.909 1.00 125.59 ? 166  LYS A NZ    1 
ATOM   968  N  N     . ARG A 1 121 ? 18.372  -34.072  -27.895 1.00 45.24  ? 167  ARG A N     1 
ATOM   969  C  CA    . ARG A 1 121 ? 17.394  -32.997  -27.673 1.00 45.18  ? 167  ARG A CA    1 
ATOM   970  C  C     . ARG A 1 121 ? 16.209  -33.397  -26.771 1.00 50.13  ? 167  ARG A C     1 
ATOM   971  O  O     . ARG A 1 121 ? 15.776  -32.593  -25.946 1.00 49.30  ? 167  ARG A O     1 
ATOM   972  C  CB    . ARG A 1 121 ? 16.907  -32.409  -29.012 1.00 43.40  ? 167  ARG A CB    1 
ATOM   973  C  CG    . ARG A 1 121 ? 16.457  -30.954  -28.886 1.00 47.48  ? 167  ARG A CG    1 
ATOM   974  C  CD    . ARG A 1 121 ? 15.882  -30.335  -30.154 1.00 63.95  ? 167  ARG A CD    1 
ATOM   975  N  NE    . ARG A 1 121 ? 14.604  -30.927  -30.561 1.00 76.65  ? 167  ARG A NE    1 
ATOM   976  C  CZ    . ARG A 1 121 ? 13.722  -30.349  -31.375 1.00 84.17  ? 167  ARG A CZ    1 
ATOM   977  N  NH1   . ARG A 1 121 ? 13.944  -29.128  -31.853 1.00 58.06  ? 167  ARG A NH1   1 
ATOM   978  N  NH2   . ARG A 1 121 ? 12.598  -30.978  -31.698 1.00 70.66  ? 167  ARG A NH2   1 
ATOM   979  N  N     . HIS A 1 122 ? 15.716  -34.629  -26.897 1.00 48.49  ? 168  HIS A N     1 
ATOM   980  C  CA    . HIS A 1 122 ? 14.596  -35.119  -26.088 1.00 49.59  ? 168  HIS A CA    1 
ATOM   981  C  C     . HIS A 1 122 ? 15.036  -35.611  -24.686 1.00 55.45  ? 168  HIS A C     1 
ATOM   982  O  O     . HIS A 1 122 ? 14.187  -35.813  -23.806 1.00 55.69  ? 168  HIS A O     1 
ATOM   983  C  CB    . HIS A 1 122 ? 13.873  -36.248  -26.842 1.00 50.95  ? 168  HIS A CB    1 
ATOM   984  C  CG    . HIS A 1 122 ? 14.755  -37.431  -27.136 1.00 55.16  ? 168  HIS A CG    1 
ATOM   985  N  ND1   . HIS A 1 122 ? 14.837  -38.505  -26.271 1.00 57.26  ? 168  HIS A ND1   1 
ATOM   986  C  CD2   . HIS A 1 122 ? 15.595  -37.646  -28.179 1.00 57.92  ? 168  HIS A CD2   1 
ATOM   987  C  CE1   . HIS A 1 122 ? 15.714  -39.339  -26.809 1.00 57.02  ? 168  HIS A CE1   1 
ATOM   988  N  NE2   . HIS A 1 122 ? 16.188  -38.871  -27.966 1.00 57.52  ? 168  HIS A NE2   1 
ATOM   989  N  N     . GLU A 1 123 ? 16.346  -35.839  -24.486 1.00 52.02  ? 169  GLU A N     1 
ATOM   990  C  CA    . GLU A 1 123 ? 16.878  -36.380  -23.218 1.00 51.89  ? 169  GLU A CA    1 
ATOM   991  C  C     . GLU A 1 123 ? 16.976  -35.337  -22.106 1.00 53.44  ? 169  GLU A C     1 
ATOM   992  O  O     . GLU A 1 123 ? 16.961  -35.682  -20.906 1.00 52.44  ? 169  GLU A O     1 
ATOM   993  C  CB    . GLU A 1 123 ? 18.238  -37.085  -23.437 1.00 53.46  ? 169  GLU A CB    1 
ATOM   994  C  CG    . GLU A 1 123 ? 18.119  -38.397  -24.200 1.00 67.75  ? 169  GLU A CG    1 
ATOM   995  C  CD    . GLU A 1 123 ? 19.343  -39.291  -24.231 1.00 92.88  ? 169  GLU A CD    1 
ATOM   996  O  OE1   . GLU A 1 123 ? 20.392  -38.865  -24.765 1.00 80.18  ? 169  GLU A OE1   1 
ATOM   997  O  OE2   . GLU A 1 123 ? 19.229  -40.452  -23.775 1.00 100.76 ? 169  GLU A OE2   1 
ATOM   998  N  N     . VAL A 1 124 ? 17.044  -34.059  -22.524 1.00 46.82  ? 170  VAL A N     1 
ATOM   999  C  CA    . VAL A 1 124 ? 17.252  -32.900  -21.663 1.00 45.21  ? 170  VAL A CA    1 
ATOM   1000 C  C     . VAL A 1 124 ? 16.183  -31.822  -21.875 1.00 46.00  ? 170  VAL A C     1 
ATOM   1001 O  O     . VAL A 1 124 ? 15.669  -31.754  -22.993 1.00 47.29  ? 170  VAL A O     1 
ATOM   1002 C  CB    . VAL A 1 124 ? 18.699  -32.353  -21.854 1.00 48.46  ? 170  VAL A CB    1 
ATOM   1003 C  CG1   . VAL A 1 124 ? 19.735  -33.381  -21.404 1.00 48.14  ? 170  VAL A CG1   1 
ATOM   1004 C  CG2   . VAL A 1 124 ? 18.959  -31.901  -23.298 1.00 47.91  ? 170  VAL A CG2   1 
ATOM   1005 N  N     . PRO A 1 125 ? 15.825  -30.964  -20.863 1.00 36.82  ? 171  PRO A N     1 
ATOM   1006 C  CA    . PRO A 1 125 ? 14.799  -29.919  -21.111 1.00 34.81  ? 171  PRO A CA    1 
ATOM   1007 C  C     . PRO A 1 125 ? 15.209  -28.923  -22.195 1.00 36.30  ? 171  PRO A C     1 
ATOM   1008 O  O     . PRO A 1 125 ? 16.423  -28.788  -22.443 1.00 34.98  ? 171  PRO A O     1 
ATOM   1009 C  CB    . PRO A 1 125 ? 14.664  -29.215  -19.758 1.00 36.34  ? 171  PRO A CB    1 
ATOM   1010 C  CG    . PRO A 1 125 ? 15.280  -30.162  -18.757 1.00 41.04  ? 171  PRO A CG    1 
ATOM   1011 C  CD    . PRO A 1 125 ? 16.356  -30.872  -19.489 1.00 36.61  ? 171  PRO A CD    1 
ATOM   1012 N  N     . PRO A 1 126 ? 14.251  -28.191  -22.845 1.00 33.25  ? 172  PRO A N     1 
ATOM   1013 C  CA    . PRO A 1 126 ? 14.659  -27.200  -23.873 1.00 32.40  ? 172  PRO A CA    1 
ATOM   1014 C  C     . PRO A 1 126 ? 15.608  -26.150  -23.319 1.00 37.47  ? 172  PRO A C     1 
ATOM   1015 O  O     . PRO A 1 126 ? 15.468  -25.736  -22.173 1.00 37.88  ? 172  PRO A O     1 
ATOM   1016 C  CB    . PRO A 1 126 ? 13.331  -26.604  -24.365 1.00 32.81  ? 172  PRO A CB    1 
ATOM   1017 C  CG    . PRO A 1 126 ? 12.289  -27.620  -23.978 1.00 36.95  ? 172  PRO A CG    1 
ATOM   1018 C  CD    . PRO A 1 126 ? 12.778  -28.194  -22.682 1.00 33.12  ? 172  PRO A CD    1 
ATOM   1019 N  N     . HIS A 1 127 ? 16.633  -25.811  -24.096 1.00 34.95  ? 173  HIS A N     1 
ATOM   1020 C  CA    . HIS A 1 127 ? 17.652  -24.832  -23.731 1.00 34.88  ? 173  HIS A CA    1 
ATOM   1021 C  C     . HIS A 1 127 ? 18.442  -24.469  -24.956 1.00 36.04  ? 173  HIS A C     1 
ATOM   1022 O  O     . HIS A 1 127 ? 18.525  -25.279  -25.883 1.00 35.77  ? 173  HIS A O     1 
ATOM   1023 C  CB    . HIS A 1 127 ? 18.620  -25.444  -22.713 1.00 35.63  ? 173  HIS A CB    1 
ATOM   1024 C  CG    . HIS A 1 127 ? 19.343  -24.435  -21.876 1.00 39.40  ? 173  HIS A CG    1 
ATOM   1025 N  ND1   . HIS A 1 127 ? 18.993  -24.203  -20.549 1.00 41.45  ? 173  HIS A ND1   1 
ATOM   1026 C  CD2   . HIS A 1 127 ? 20.416  -23.679  -22.172 1.00 40.64  ? 173  HIS A CD2   1 
ATOM   1027 C  CE1   . HIS A 1 127 ? 19.850  -23.304  -20.102 1.00 40.11  ? 173  HIS A CE1   1 
ATOM   1028 N  NE2   . HIS A 1 127 ? 20.737  -22.978  -21.031 1.00 40.64  ? 173  HIS A NE2   1 
ATOM   1029 N  N     . VAL A 1 128 ? 19.094  -23.297  -24.930 1.00 30.95  ? 174  VAL A N     1 
ATOM   1030 C  CA    . VAL A 1 128 ? 20.008  -22.826  -25.985 1.00 30.17  ? 174  VAL A CA    1 
ATOM   1031 C  C     . VAL A 1 128 ? 21.223  -23.784  -26.136 1.00 33.94  ? 174  VAL A C     1 
ATOM   1032 O  O     . VAL A 1 128 ? 21.717  -23.989  -27.243 1.00 33.38  ? 174  VAL A O     1 
ATOM   1033 C  CB    . VAL A 1 128 ? 20.427  -21.332  -25.763 1.00 34.01  ? 174  VAL A CB    1 
ATOM   1034 C  CG1   . VAL A 1 128 ? 21.287  -21.162  -24.502 1.00 34.15  ? 174  VAL A CG1   1 
ATOM   1035 C  CG2   . VAL A 1 128 ? 21.130  -20.769  -26.985 1.00 32.96  ? 174  VAL A CG2   1 
ATOM   1036 N  N     . TYR A 1 129 ? 21.659  -24.396  -25.024 1.00 30.34  ? 175  TYR A N     1 
ATOM   1037 C  CA    . TYR A 1 129 ? 22.769  -25.348  -24.967 1.00 30.35  ? 175  TYR A CA    1 
ATOM   1038 C  C     . TYR A 1 129 ? 22.469  -26.594  -25.787 1.00 32.70  ? 175  TYR A C     1 
ATOM   1039 O  O     . TYR A 1 129 ? 23.374  -27.121  -26.436 1.00 33.76  ? 175  TYR A O     1 
ATOM   1040 C  CB    . TYR A 1 129 ? 23.102  -25.748  -23.503 1.00 31.11  ? 175  TYR A CB    1 
ATOM   1041 C  CG    . TYR A 1 129 ? 23.598  -24.625  -22.611 1.00 34.30  ? 175  TYR A CG    1 
ATOM   1042 C  CD1   . TYR A 1 129 ? 23.982  -23.390  -23.147 1.00 37.19  ? 175  TYR A CD1   1 
ATOM   1043 C  CD2   . TYR A 1 129 ? 23.700  -24.795  -21.231 1.00 35.44  ? 175  TYR A CD2   1 
ATOM   1044 C  CE1   . TYR A 1 129 ? 24.463  -22.362  -22.333 1.00 38.04  ? 175  TYR A CE1   1 
ATOM   1045 C  CE2   . TYR A 1 129 ? 24.160  -23.769  -20.407 1.00 36.24  ? 175  TYR A CE2   1 
ATOM   1046 C  CZ    . TYR A 1 129 ? 24.567  -22.565  -20.964 1.00 43.27  ? 175  TYR A CZ    1 
ATOM   1047 O  OH    . TYR A 1 129 ? 25.023  -21.555  -20.158 1.00 38.93  ? 175  TYR A OH    1 
ATOM   1048 N  N     . ALA A 1 130 ? 21.221  -27.086  -25.731 1.00 25.61  ? 176  ALA A N     1 
ATOM   1049 C  CA    . ALA A 1 130 ? 20.817  -28.275  -26.484 1.00 25.35  ? 176  ALA A CA    1 
ATOM   1050 C  C     . ALA A 1 130 ? 20.814  -27.954  -27.981 1.00 31.94  ? 176  ALA A C     1 
ATOM   1051 O  O     . ALA A 1 130 ? 21.265  -28.787  -28.762 1.00 31.97  ? 176  ALA A O     1 
ATOM   1052 C  CB    . ALA A 1 130 ? 19.463  -28.764  -26.029 1.00 25.87  ? 176  ALA A CB    1 
ATOM   1053 N  N     . VAL A 1 131 ? 20.385  -26.748  -28.333 1.00 29.99  ? 177  VAL A N     1 
ATOM   1054 C  CA    . VAL A 1 131 ? 20.388  -26.261  -29.708 1.00 29.13  ? 177  VAL A CA    1 
ATOM   1055 C  C     . VAL A 1 131 ? 21.814  -26.144  -30.203 1.00 32.28  ? 177  VAL A C     1 
ATOM   1056 O  O     . VAL A 1 131 ? 22.110  -26.479  -31.316 1.00 29.51  ? 177  VAL A O     1 
ATOM   1057 C  CB    . VAL A 1 131 ? 19.694  -24.898  -29.850 1.00 33.30  ? 177  VAL A CB    1 
ATOM   1058 C  CG1   . VAL A 1 131 ? 19.808  -24.376  -31.253 1.00 33.62  ? 177  VAL A CG1   1 
ATOM   1059 C  CG2   . VAL A 1 131 ? 18.247  -24.969  -29.459 1.00 33.53  ? 177  VAL A CG2   1 
ATOM   1060 N  N     . THR A 1 132 ? 22.680  -25.629  -29.353 1.00 30.28  ? 178  THR A N     1 
ATOM   1061 C  CA    . THR A 1 132 ? 24.069  -25.497  -29.672 1.00 30.56  ? 178  THR A CA    1 
ATOM   1062 C  C     . THR A 1 132 ? 24.699  -26.871  -29.813 1.00 34.74  ? 178  THR A C     1 
ATOM   1063 O  O     . THR A 1 132 ? 25.417  -27.114  -30.738 1.00 36.27  ? 178  THR A O     1 
ATOM   1064 C  CB    . THR A 1 132 ? 24.827  -24.640  -28.654 1.00 36.57  ? 178  THR A CB    1 
ATOM   1065 O  OG1   . THR A 1 132 ? 24.200  -23.381  -28.500 1.00 26.92  ? 178  THR A OG1   1 
ATOM   1066 C  CG2   . THR A 1 132 ? 26.179  -24.410  -29.114 1.00 33.12  ? 178  THR A CG2   1 
ATOM   1067 N  N     . GLU A 1 133 ? 24.359  -27.774  -28.913 1.00 30.46  ? 179  GLU A N     1 
ATOM   1068 C  CA    . GLU A 1 133 ? 24.869  -29.134  -28.911 1.00 30.13  ? 179  GLU A CA    1 
ATOM   1069 C  C     . GLU A 1 133 ? 24.459  -29.921  -30.133 1.00 33.97  ? 179  GLU A C     1 
ATOM   1070 O  O     . GLU A 1 133 ? 25.238  -30.618  -30.684 1.00 33.79  ? 179  GLU A O     1 
ATOM   1071 C  CB    . GLU A 1 133 ? 24.478  -29.854  -27.632 1.00 29.81  ? 179  GLU A CB    1 
ATOM   1072 C  CG    . GLU A 1 133 ? 24.802  -31.322  -27.594 1.00 34.35  ? 179  GLU A CG    1 
ATOM   1073 C  CD    . GLU A 1 133 ? 26.245  -31.636  -27.295 1.00 59.50  ? 179  GLU A CD    1 
ATOM   1074 O  OE1   . GLU A 1 133 ? 26.980  -30.818  -26.770 1.00 35.55  ? 179  GLU A OE1   1 
ATOM   1075 O  OE2   . GLU A 1 133 ? 26.650  -32.742  -27.592 1.00 61.93  ? 179  GLU A OE2   1 
ATOM   1076 N  N     . GLY A 1 134 ? 23.222  -29.770  -30.536 1.00 28.87  ? 180  GLY A N     1 
ATOM   1077 C  CA    . GLY A 1 134 ? 22.659  -30.377  -31.733 1.00 29.42  ? 180  GLY A CA    1 
ATOM   1078 C  C     . GLY A 1 134 ? 23.399  -29.998  -32.995 1.00 35.15  ? 180  GLY A C     1 
ATOM   1079 O  O     . GLY A 1 134 ? 23.749  -30.883  -33.781 1.00 35.59  ? 180  GLY A O     1 
ATOM   1080 N  N     . ALA A 1 135 ? 23.689  -28.673  -33.167 1.00 32.07  ? 181  ALA A N     1 
ATOM   1081 C  CA    . ALA A 1 135 ? 24.395  -28.098  -34.324 1.00 30.34  ? 181  ALA A CA    1 
ATOM   1082 C  C     . ALA A 1 135 ? 25.834  -28.534  -34.311 1.00 34.24  ? 181  ALA A C     1 
ATOM   1083 O  O     . ALA A 1 135 ? 26.350  -28.929  -35.349 1.00 35.29  ? 181  ALA A O     1 
ATOM   1084 C  CB    . ALA A 1 135 ? 24.297  -26.585  -34.312 1.00 30.79  ? 181  ALA A CB    1 
ATOM   1085 N  N     . TYR A 1 136 ? 26.482  -28.496  -33.137 1.00 30.59  ? 182  TYR A N     1 
ATOM   1086 C  CA    . TYR A 1 136 ? 27.857  -28.950  -32.912 1.00 29.96  ? 182  TYR A CA    1 
ATOM   1087 C  C     . TYR A 1 136 ? 28.011  -30.435  -33.267 1.00 34.56  ? 182  TYR A C     1 
ATOM   1088 O  O     . TYR A 1 136 ? 28.971  -30.800  -33.922 1.00 33.92  ? 182  TYR A O     1 
ATOM   1089 C  CB    . TYR A 1 136 ? 28.238  -28.730  -31.437 1.00 31.41  ? 182  TYR A CB    1 
ATOM   1090 C  CG    . TYR A 1 136 ? 29.628  -29.202  -31.084 1.00 34.81  ? 182  TYR A CG    1 
ATOM   1091 C  CD1   . TYR A 1 136 ? 30.743  -28.763  -31.803 1.00 36.68  ? 182  TYR A CD1   1 
ATOM   1092 C  CD2   . TYR A 1 136 ? 29.837  -30.065  -30.023 1.00 36.48  ? 182  TYR A CD2   1 
ATOM   1093 C  CE1   . TYR A 1 136 ? 32.025  -29.204  -31.488 1.00 36.43  ? 182  TYR A CE1   1 
ATOM   1094 C  CE2   . TYR A 1 136 ? 31.116  -30.495  -29.682 1.00 38.91  ? 182  TYR A CE2   1 
ATOM   1095 C  CZ    . TYR A 1 136 ? 32.209  -30.058  -30.413 1.00 42.19  ? 182  TYR A CZ    1 
ATOM   1096 O  OH    . TYR A 1 136 ? 33.458  -30.507  -30.063 1.00 35.78  ? 182  TYR A OH    1 
ATOM   1097 N  N     . ARG A 1 137 ? 27.065  -31.285  -32.818 1.00 33.89  ? 183  ARG A N     1 
ATOM   1098 C  CA    . ARG A 1 137 ? 27.043  -32.721  -33.101 1.00 33.76  ? 183  ARG A CA    1 
ATOM   1099 C  C     . ARG A 1 137 ? 26.721  -33.002  -34.555 1.00 37.90  ? 183  ARG A C     1 
ATOM   1100 O  O     . ARG A 1 137 ? 27.314  -33.903  -35.133 1.00 37.45  ? 183  ARG A O     1 
ATOM   1101 C  CB    . ARG A 1 137 ? 26.069  -33.460  -32.187 1.00 34.04  ? 183  ARG A CB    1 
ATOM   1102 C  CG    . ARG A 1 137 ? 26.552  -33.545  -30.757 1.00 51.92  ? 183  ARG A CG    1 
ATOM   1103 C  CD    . ARG A 1 137 ? 27.848  -34.314  -30.624 1.00 57.77  ? 183  ARG A CD    1 
ATOM   1104 N  NE    . ARG A 1 137 ? 28.358  -34.258  -29.263 1.00 60.52  ? 183  ARG A NE    1 
ATOM   1105 C  CZ    . ARG A 1 137 ? 29.370  -34.995  -28.832 1.00 81.64  ? 183  ARG A CZ    1 
ATOM   1106 N  NH1   . ARG A 1 137 ? 29.986  -35.831  -29.658 1.00 68.33  ? 183  ARG A NH1   1 
ATOM   1107 N  NH2   . ARG A 1 137 ? 29.770  -34.911  -27.571 1.00 73.82  ? 183  ARG A NH2   1 
ATOM   1108 N  N     . SER A 1 138 ? 25.821  -32.205  -35.160 1.00 33.61  ? 184  SER A N     1 
ATOM   1109 C  CA    . SER A 1 138 ? 25.481  -32.351  -36.568 1.00 33.97  ? 184  SER A CA    1 
ATOM   1110 C  C     . SER A 1 138 ? 26.720  -32.069  -37.457 1.00 39.41  ? 184  SER A C     1 
ATOM   1111 O  O     . SER A 1 138 ? 26.953  -32.788  -38.428 1.00 41.67  ? 184  SER A O     1 
ATOM   1112 C  CB    . SER A 1 138 ? 24.333  -31.412  -36.937 1.00 35.95  ? 184  SER A CB    1 
ATOM   1113 O  OG    . SER A 1 138 ? 23.168  -31.868  -36.279 1.00 51.25  ? 184  SER A OG    1 
ATOM   1114 N  N     . MET A 1 139 ? 27.501  -31.045  -37.114 1.00 33.99  ? 185  MET A N     1 
ATOM   1115 C  CA    . MET A 1 139 ? 28.699  -30.664  -37.849 1.00 34.72  ? 185  MET A CA    1 
ATOM   1116 C  C     . MET A 1 139 ? 29.729  -31.795  -37.762 1.00 39.66  ? 185  MET A C     1 
ATOM   1117 O  O     . MET A 1 139 ? 30.308  -32.164  -38.787 1.00 39.47  ? 185  MET A O     1 
ATOM   1118 C  CB    . MET A 1 139 ? 29.274  -29.365  -37.247 1.00 36.76  ? 185  MET A CB    1 
ATOM   1119 C  CG    . MET A 1 139 ? 30.538  -28.861  -37.912 1.00 39.55  ? 185  MET A CG    1 
ATOM   1120 S  SD    . MET A 1 139 ? 31.293  -27.548  -36.929 1.00 42.70  ? 185  MET A SD    1 
ATOM   1121 C  CE    . MET A 1 139 ? 32.140  -28.537  -35.649 1.00 39.36  ? 185  MET A CE    1 
ATOM   1122 N  N     . LEU A 1 140 ? 29.921  -32.355  -36.548 1.00 36.19  ? 186  LEU A N     1 
ATOM   1123 C  CA    . LEU A 1 140 ? 30.876  -33.436  -36.247 1.00 36.81  ? 186  LEU A CA    1 
ATOM   1124 C  C     . LEU A 1 140 ? 30.579  -34.731  -36.983 1.00 41.78  ? 186  LEU A C     1 
ATOM   1125 O  O     . LEU A 1 140 ? 31.513  -35.458  -37.304 1.00 42.29  ? 186  LEU A O     1 
ATOM   1126 C  CB    . LEU A 1 140 ? 30.921  -33.757  -34.730 1.00 36.62  ? 186  LEU A CB    1 
ATOM   1127 C  CG    . LEU A 1 140 ? 31.390  -32.678  -33.756 1.00 41.08  ? 186  LEU A CG    1 
ATOM   1128 C  CD1   . LEU A 1 140 ? 31.443  -33.211  -32.358 1.00 40.41  ? 186  LEU A CD1   1 
ATOM   1129 C  CD2   . LEU A 1 140 ? 32.724  -32.112  -34.140 1.00 46.53  ? 186  LEU A CD2   1 
ATOM   1130 N  N     . GLN A 1 141 ? 29.303  -35.034  -37.189 1.00 37.94  ? 187  GLN A N     1 
ATOM   1131 C  CA    . GLN A 1 141 ? 28.858  -36.243  -37.862 1.00 37.50  ? 187  GLN A CA    1 
ATOM   1132 C  C     . GLN A 1 141 ? 28.668  -36.193  -39.356 1.00 41.50  ? 187  GLN A C     1 
ATOM   1133 O  O     . GLN A 1 141 ? 29.022  -37.105  -40.033 1.00 39.41  ? 187  GLN A O     1 
ATOM   1134 C  CB    . GLN A 1 141 ? 27.552  -36.714  -37.263 1.00 38.78  ? 187  GLN A CB    1 
ATOM   1135 C  CG    . GLN A 1 141 ? 27.509  -36.717  -35.758 1.00 61.29  ? 187  GLN A CG    1 
ATOM   1136 C  CD    . GLN A 1 141 ? 26.175  -37.158  -35.192 1.00 82.77  ? 187  GLN A CD    1 
ATOM   1137 O  OE1   . GLN A 1 141 ? 25.114  -36.741  -35.637 1.00 73.52  ? 187  GLN A OE1   1 
ATOM   1138 N  NE2   . GLN A 1 141 ? 26.230  -37.987  -34.178 1.00 79.46  ? 187  GLN A NE2   1 
ATOM   1139 N  N     . ASP A 1 142 ? 28.064  -35.130  -39.848 1.00 39.90  ? 188  ASP A N     1 
ATOM   1140 C  CA    . ASP A 1 142 ? 27.817  -34.980  -41.262 1.00 39.86  ? 188  ASP A CA    1 
ATOM   1141 C  C     . ASP A 1 142 ? 28.920  -34.243  -41.957 1.00 42.03  ? 188  ASP A C     1 
ATOM   1142 O  O     . ASP A 1 142 ? 28.934  -34.153  -43.151 1.00 38.90  ? 188  ASP A O     1 
ATOM   1143 C  CB    . ASP A 1 142 ? 26.530  -34.212  -41.509 1.00 42.43  ? 188  ASP A CB    1 
ATOM   1144 C  CG    . ASP A 1 142 ? 25.331  -34.849  -40.891 1.00 54.04  ? 188  ASP A CG    1 
ATOM   1145 O  OD1   . ASP A 1 142 ? 25.281  -36.062  -40.746 1.00 56.79  ? 188  ASP A OD1   1 
ATOM   1146 O  OD2   . ASP A 1 142 ? 24.399  -34.124  -40.568 1.00 58.28  ? 188  ASP A OD2   1 
ATOM   1147 N  N     . ARG A 1 143 ? 29.824  -33.689  -41.177 1.00 42.13  ? 189  ARG A N     1 
ATOM   1148 C  CA    . ARG A 1 143 ? 30.936  -32.892  -41.661 1.00 43.15  ? 189  ARG A CA    1 
ATOM   1149 C  C     . ARG A 1 143 ? 30.436  -31.752  -42.532 1.00 45.86  ? 189  ARG A C     1 
ATOM   1150 O  O     . ARG A 1 143 ? 30.922  -31.522  -43.618 1.00 44.25  ? 189  ARG A O     1 
ATOM   1151 C  CB    . ARG A 1 143 ? 31.975  -33.742  -42.375 1.00 44.72  ? 189  ARG A CB    1 
ATOM   1152 C  CG    . ARG A 1 143 ? 32.585  -34.873  -41.564 1.00 49.68  ? 189  ARG A CG    1 
ATOM   1153 C  CD    . ARG A 1 143 ? 33.354  -34.384  -40.360 1.00 50.76  ? 189  ARG A CD    1 
ATOM   1154 N  NE    . ARG A 1 143 ? 34.146  -33.219  -40.708 1.00 67.72  ? 189  ARG A NE    1 
ATOM   1155 C  CZ    . ARG A 1 143 ? 34.604  -32.323  -39.846 1.00 82.60  ? 189  ARG A CZ    1 
ATOM   1156 N  NH1   . ARG A 1 143 ? 34.386  -32.450  -38.560 1.00 53.64  ? 189  ARG A NH1   1 
ATOM   1157 N  NH2   . ARG A 1 143 ? 35.291  -31.298  -40.291 1.00 83.47  ? 189  ARG A NH2   1 
ATOM   1158 N  N     . GLU A 1 144 ? 29.423  -31.065  -42.042 1.00 41.15  ? 190  GLU A N     1 
ATOM   1159 C  CA    . GLU A 1 144 ? 28.812  -29.951  -42.742 1.00 41.06  ? 190  GLU A CA    1 
ATOM   1160 C  C     . GLU A 1 144 ? 28.864  -28.686  -41.938 1.00 40.92  ? 190  GLU A C     1 
ATOM   1161 O  O     . GLU A 1 144 ? 28.829  -28.714  -40.741 1.00 37.06  ? 190  GLU A O     1 
ATOM   1162 C  CB    . GLU A 1 144 ? 27.350  -30.221  -42.993 1.00 43.35  ? 190  GLU A CB    1 
ATOM   1163 C  CG    . GLU A 1 144 ? 27.041  -31.516  -43.674 1.00 63.66  ? 190  GLU A CG    1 
ATOM   1164 C  CD    . GLU A 1 144 ? 26.968  -31.364  -45.150 1.00 104.06 ? 190  GLU A CD    1 
ATOM   1165 O  OE1   . GLU A 1 144 ? 26.780  -30.231  -45.609 1.00 109.40 ? 190  GLU A OE1   1 
ATOM   1166 O  OE2   . GLU A 1 144 ? 27.086  -32.374  -45.843 1.00 110.34 ? 190  GLU A OE2   1 
ATOM   1167 N  N     . ASP A 1 145 ? 28.933  -27.574  -42.625 1.00 38.65  ? 191  ASP A N     1 
ATOM   1168 C  CA    . ASP A 1 145 ? 28.964  -26.262  -41.976 1.00 39.87  ? 191  ASP A CA    1 
ATOM   1169 C  C     . ASP A 1 145 ? 27.590  -25.946  -41.410 1.00 41.58  ? 191  ASP A C     1 
ATOM   1170 O  O     . ASP A 1 145 ? 26.589  -26.182  -42.074 1.00 41.02  ? 191  ASP A O     1 
ATOM   1171 C  CB    . ASP A 1 145 ? 29.452  -25.177  -42.949 1.00 41.69  ? 191  ASP A CB    1 
ATOM   1172 C  CG    . ASP A 1 145 ? 30.906  -25.402  -43.292 1.00 42.36  ? 191  ASP A CG    1 
ATOM   1173 O  OD1   . ASP A 1 145 ? 31.589  -26.072  -42.516 1.00 44.03  ? 191  ASP A OD1   1 
ATOM   1174 O  OD2   . ASP A 1 145 ? 31.372  -24.849  -44.296 1.00 42.34  ? 191  ASP A OD2   1 
ATOM   1175 N  N     . GLN A 1 146 ? 27.542  -25.561  -40.160 1.00 36.45  ? 192  GLN A N     1 
ATOM   1176 C  CA    . GLN A 1 146 ? 26.271  -25.277  -39.501 1.00 37.12  ? 192  GLN A CA    1 
ATOM   1177 C  C     . GLN A 1 146 ? 26.106  -23.762  -39.234 1.00 38.56  ? 192  GLN A C     1 
ATOM   1178 O  O     . GLN A 1 146 ? 27.087  -23.025  -39.285 1.00 37.06  ? 192  GLN A O     1 
ATOM   1179 C  CB    . GLN A 1 146 ? 26.191  -26.047  -38.153 1.00 39.53  ? 192  GLN A CB    1 
ATOM   1180 C  CG    . GLN A 1 146 ? 26.394  -27.565  -38.233 1.00 46.87  ? 192  GLN A CG    1 
ATOM   1181 C  CD    . GLN A 1 146 ? 25.254  -28.256  -38.908 1.00 53.57  ? 192  GLN A CD    1 
ATOM   1182 O  OE1   . GLN A 1 146 ? 24.123  -28.212  -38.444 1.00 39.84  ? 192  GLN A OE1   1 
ATOM   1183 N  NE2   . GLN A 1 146 ? 25.519  -28.836  -40.065 1.00 50.72  ? 192  GLN A NE2   1 
ATOM   1184 N  N     . SER A 1 147 ? 24.862  -23.317  -38.970 1.00 34.02  ? 193  SER A N     1 
ATOM   1185 C  CA    . SER A 1 147 ? 24.523  -21.954  -38.568 1.00 34.24  ? 193  SER A CA    1 
ATOM   1186 C  C     . SER A 1 147 ? 23.363  -21.927  -37.546 1.00 39.19  ? 193  SER A C     1 
ATOM   1187 O  O     . SER A 1 147 ? 22.423  -22.722  -37.663 1.00 42.35  ? 193  SER A O     1 
ATOM   1188 C  CB    . SER A 1 147 ? 24.254  -21.047  -39.767 1.00 34.54  ? 193  SER A CB    1 
ATOM   1189 O  OG    . SER A 1 147 ? 23.008  -21.356  -40.365 1.00 30.14  ? 193  SER A OG    1 
ATOM   1190 N  N     . ILE A 1 148 ? 23.493  -21.089  -36.495 1.00 33.95  ? 194  ILE A N     1 
ATOM   1191 C  CA    . ILE A 1 148 ? 22.471  -20.821  -35.473 1.00 34.33  ? 194  ILE A CA    1 
ATOM   1192 C  C     . ILE A 1 148 ? 21.924  -19.383  -35.714 1.00 38.22  ? 194  ILE A C     1 
ATOM   1193 O  O     . ILE A 1 148 ? 22.684  -18.400  -35.631 1.00 36.08  ? 194  ILE A O     1 
ATOM   1194 C  CB    . ILE A 1 148 ? 22.994  -21.061  -34.052 1.00 37.72  ? 194  ILE A CB    1 
ATOM   1195 C  CG1   . ILE A 1 148 ? 23.146  -22.573  -33.795 1.00 37.37  ? 194  ILE A CG1   1 
ATOM   1196 C  CG2   . ILE A 1 148 ? 22.050  -20.442  -33.022 1.00 41.26  ? 194  ILE A CG2   1 
ATOM   1197 C  CD1   . ILE A 1 148 ? 24.459  -22.917  -33.260 1.00 39.65  ? 194  ILE A CD1   1 
ATOM   1198 N  N     . LEU A 1 149 ? 20.628  -19.281  -36.083 1.00 34.58  ? 195  LEU A N     1 
ATOM   1199 C  CA    . LEU A 1 149 ? 20.019  -18.000  -36.464 1.00 34.56  ? 195  LEU A CA    1 
ATOM   1200 C  C     . LEU A 1 149 ? 18.966  -17.549  -35.474 1.00 38.85  ? 195  LEU A C     1 
ATOM   1201 O  O     . LEU A 1 149 ? 17.905  -18.160  -35.380 1.00 36.24  ? 195  LEU A O     1 
ATOM   1202 C  CB    . LEU A 1 149 ? 19.487  -18.031  -37.918 1.00 33.60  ? 195  LEU A CB    1 
ATOM   1203 C  CG    . LEU A 1 149 ? 20.280  -18.877  -38.935 1.00 38.47  ? 195  LEU A CG    1 
ATOM   1204 C  CD1   . LEU A 1 149 ? 19.608  -18.875  -40.292 1.00 38.81  ? 195  LEU A CD1   1 
ATOM   1205 C  CD2   . LEU A 1 149 ? 21.663  -18.335  -39.139 1.00 42.55  ? 195  LEU A CD2   1 
ATOM   1206 N  N     . CYS A 1 150 ? 19.283  -16.472  -34.724 1.00 37.53  ? 196  CYS A N     1 
ATOM   1207 C  CA    . CYS A 1 150 ? 18.396  -15.870  -33.732 1.00 38.62  ? 196  CYS A CA    1 
ATOM   1208 C  C     . CYS A 1 150 ? 17.451  -14.857  -34.368 1.00 39.50  ? 196  CYS A C     1 
ATOM   1209 O  O     . CYS A 1 150 ? 17.887  -13.762  -34.701 1.00 42.45  ? 196  CYS A O     1 
ATOM   1210 C  CB    . CYS A 1 150 ? 19.189  -15.235  -32.594 1.00 40.73  ? 196  CYS A CB    1 
ATOM   1211 S  SG    . CYS A 1 150 ? 19.817  -16.409  -31.369 1.00 46.31  ? 196  CYS A SG    1 
ATOM   1212 N  N     . THR A 1 151 ? 16.175  -15.184  -34.546 1.00 32.50  ? 197  THR A N     1 
ATOM   1213 C  CA    . THR A 1 151 ? 15.256  -14.170  -35.078 1.00 31.58  ? 197  THR A CA    1 
ATOM   1214 C  C     . THR A 1 151 ? 14.648  -13.430  -33.902 1.00 37.16  ? 197  THR A C     1 
ATOM   1215 O  O     . THR A 1 151 ? 14.681  -13.916  -32.757 1.00 37.41  ? 197  THR A O     1 
ATOM   1216 C  CB    . THR A 1 151 ? 14.157  -14.726  -35.989 1.00 36.57  ? 197  THR A CB    1 
ATOM   1217 O  OG1   . THR A 1 151 ? 13.173  -15.394  -35.176 1.00 35.88  ? 197  THR A OG1   1 
ATOM   1218 C  CG2   . THR A 1 151 ? 14.700  -15.590  -37.135 1.00 30.71  ? 197  THR A CG2   1 
ATOM   1219 N  N     . GLY A 1 152 ? 14.071  -12.282  -34.185 1.00 32.97  ? 198  GLY A N     1 
ATOM   1220 C  CA    . GLY A 1 152 ? 13.431  -11.519  -33.133 1.00 34.91  ? 198  GLY A CA    1 
ATOM   1221 C  C     . GLY A 1 152 ? 13.484  -10.031  -33.342 1.00 41.60  ? 198  GLY A C     1 
ATOM   1222 O  O     . GLY A 1 152 ? 14.408  -9.516   -33.972 1.00 44.18  ? 198  GLY A O     1 
ATOM   1223 N  N     . GLU A 1 153 ? 12.482  -9.338   -32.798 1.00 36.59  ? 199  GLU A N     1 
ATOM   1224 C  CA    . GLU A 1 153 ? 12.411  -7.886   -32.838 1.00 34.74  ? 199  GLU A CA    1 
ATOM   1225 C  C     . GLU A 1 153 ? 13.358  -7.326   -31.787 1.00 38.74  ? 199  GLU A C     1 
ATOM   1226 O  O     . GLU A 1 153 ? 13.970  -8.093   -31.045 1.00 41.26  ? 199  GLU A O     1 
ATOM   1227 C  CB    . GLU A 1 153 ? 10.958  -7.404   -32.653 1.00 35.67  ? 199  GLU A CB    1 
ATOM   1228 C  CG    . GLU A 1 153 ? 10.295  -7.723   -31.314 1.00 37.97  ? 199  GLU A CG    1 
ATOM   1229 C  CD    . GLU A 1 153 ? 8.877   -7.177   -31.245 1.00 64.83  ? 199  GLU A CD    1 
ATOM   1230 O  OE1   . GLU A 1 153 ? 8.077   -7.469   -32.164 1.00 61.89  ? 199  GLU A OE1   1 
ATOM   1231 O  OE2   . GLU A 1 153 ? 8.582   -6.407   -30.303 1.00 58.50  ? 199  GLU A OE2   1 
ATOM   1232 N  N     . SER A 1 154 ? 13.477  -6.011   -31.714 1.00 35.15  ? 200  SER A N     1 
ATOM   1233 C  CA    . SER A 1 154 ? 14.366  -5.299   -30.800 1.00 34.93  ? 200  SER A CA    1 
ATOM   1234 C  C     . SER A 1 154 ? 14.066  -5.584   -29.320 1.00 38.22  ? 200  SER A C     1 
ATOM   1235 O  O     . SER A 1 154 ? 12.955  -5.347   -28.834 1.00 37.28  ? 200  SER A O     1 
ATOM   1236 C  CB    . SER A 1 154 ? 14.365  -3.802   -31.117 1.00 37.00  ? 200  SER A CB    1 
ATOM   1237 O  OG    . SER A 1 154 ? 15.245  -3.067   -30.287 1.00 40.10  ? 200  SER A OG    1 
ATOM   1238 N  N     . GLY A 1 155 ? 15.074  -6.130   -28.648 1.00 35.56  ? 201  GLY A N     1 
ATOM   1239 C  CA    . GLY A 1 155 ? 15.042  -6.481   -27.237 1.00 34.77  ? 201  GLY A CA    1 
ATOM   1240 C  C     . GLY A 1 155 ? 14.419  -7.825   -26.954 1.00 38.17  ? 201  GLY A C     1 
ATOM   1241 O  O     . GLY A 1 155 ? 14.044  -8.070   -25.813 1.00 39.17  ? 201  GLY A O     1 
ATOM   1242 N  N     . ALA A 1 156 ? 14.282  -8.713   -27.972 1.00 34.02  ? 202  ALA A N     1 
ATOM   1243 C  CA    . ALA A 1 156 ? 13.679  -10.050  -27.762 1.00 32.34  ? 202  ALA A CA    1 
ATOM   1244 C  C     . ALA A 1 156 ? 14.639  -10.992  -27.084 1.00 36.78  ? 202  ALA A C     1 
ATOM   1245 O  O     . ALA A 1 156 ? 14.206  -11.769  -26.251 1.00 37.01  ? 202  ALA A O     1 
ATOM   1246 C  CB    . ALA A 1 156 ? 13.173  -10.647  -29.065 1.00 32.34  ? 202  ALA A CB    1 
ATOM   1247 N  N     . GLY A 1 157 ? 15.934  -10.903  -27.397 1.00 34.85  ? 203  GLY A N     1 
ATOM   1248 C  CA    . GLY A 1 157 ? 16.938  -11.752  -26.739 1.00 33.58  ? 203  GLY A CA    1 
ATOM   1249 C  C     . GLY A 1 157 ? 17.981  -12.415  -27.610 1.00 35.93  ? 203  GLY A C     1 
ATOM   1250 O  O     . GLY A 1 157 ? 18.703  -13.264  -27.123 1.00 36.80  ? 203  GLY A O     1 
ATOM   1251 N  N     . LYS A 1 158 ? 18.107  -12.003  -28.875 1.00 34.55  ? 204  LYS A N     1 
ATOM   1252 C  CA    . LYS A 1 158 ? 19.055  -12.502  -29.881 1.00 33.09  ? 204  LYS A CA    1 
ATOM   1253 C  C     . LYS A 1 158 ? 20.533  -12.471  -29.450 1.00 33.57  ? 204  LYS A C     1 
ATOM   1254 O  O     . LYS A 1 158 ? 21.217  -13.464  -29.664 1.00 33.81  ? 204  LYS A O     1 
ATOM   1255 C  CB    . LYS A 1 158 ? 18.936  -11.657  -31.154 1.00 33.46  ? 204  LYS A CB    1 
ATOM   1256 C  CG    . LYS A 1 158 ? 17.560  -11.720  -31.839 1.00 39.47  ? 204  LYS A CG    1 
ATOM   1257 C  CD    . LYS A 1 158 ? 17.570  -10.888  -33.116 1.00 39.60  ? 204  LYS A CD    1 
ATOM   1258 C  CE    . LYS A 1 158 ? 17.708  -9.395   -32.867 1.00 32.66  ? 204  LYS A CE    1 
ATOM   1259 N  NZ    . LYS A 1 158 ? 16.592  -8.867   -32.029 1.00 25.71  ? 204  LYS A NZ    1 
ATOM   1260 N  N     . THR A 1 159 ? 20.955  -11.302  -28.986 1.00 25.96  ? 205  THR A N     1 
ATOM   1261 C  CA    . THR A 1 159 ? 22.289  -11.020  -28.506 1.00 24.76  ? 205  THR A CA    1 
ATOM   1262 C  C     . THR A 1 159 ? 22.639  -11.805  -27.265 1.00 31.37  ? 205  THR A C     1 
ATOM   1263 O  O     . THR A 1 159 ? 23.700  -12.321  -27.167 1.00 30.70  ? 205  THR A O     1 
ATOM   1264 C  CB    . THR A 1 159 ? 22.492  -9.530   -28.203 1.00 33.10  ? 205  THR A CB    1 
ATOM   1265 O  OG1   . THR A 1 159 ? 22.345  -8.742   -29.379 1.00 40.47  ? 205  THR A OG1   1 
ATOM   1266 C  CG2   . THR A 1 159 ? 23.810  -9.300   -27.672 1.00 23.52  ? 205  THR A CG2   1 
ATOM   1267 N  N     . GLU A 1 160 ? 21.721  -11.871  -26.322 1.00 29.42  ? 206  GLU A N     1 
ATOM   1268 C  CA    . GLU A 1 160 ? 21.894  -12.624  -25.103 1.00 30.52  ? 206  GLU A CA    1 
ATOM   1269 C  C     . GLU A 1 160 ? 21.993  -14.092  -25.397 1.00 39.15  ? 206  GLU A C     1 
ATOM   1270 O  O     . GLU A 1 160 ? 22.732  -14.779  -24.753 1.00 41.26  ? 206  GLU A O     1 
ATOM   1271 C  CB    . GLU A 1 160 ? 20.785  -12.384  -24.109 1.00 31.48  ? 206  GLU A CB    1 
ATOM   1272 C  CG    . GLU A 1 160 ? 20.802  -11.037  -23.430 1.00 42.05  ? 206  GLU A CG    1 
ATOM   1273 C  CD    . GLU A 1 160 ? 22.007  -10.795  -22.551 1.00 61.26  ? 206  GLU A CD    1 
ATOM   1274 O  OE1   . GLU A 1 160 ? 22.722  -11.715  -22.198 1.00 55.99  ? 206  GLU A OE1   1 
ATOM   1275 O  OE2   . GLU A 1 160 ? 22.249  -9.666   -22.214 1.00 60.15  ? 206  GLU A OE2   1 
ATOM   1276 N  N     . ASN A 1 161 ? 21.212  -14.569  -26.359 1.00 36.15  ? 207  ASN A N     1 
ATOM   1277 C  CA    . ASN A 1 161 ? 21.244  -15.994  -26.713 1.00 35.72  ? 207  ASN A CA    1 
ATOM   1278 C  C     . ASN A 1 161 ? 22.513  -16.366  -27.468 1.00 39.08  ? 207  ASN A C     1 
ATOM   1279 O  O     . ASN A 1 161 ? 23.047  -17.461  -27.262 1.00 38.77  ? 207  ASN A O     1 
ATOM   1280 C  CB    . ASN A 1 161 ? 20.002  -16.388  -27.480 1.00 33.07  ? 207  ASN A CB    1 
ATOM   1281 C  CG    . ASN A 1 161 ? 18.881  -16.729  -26.540 1.00 47.17  ? 207  ASN A CG    1 
ATOM   1282 O  OD1   . ASN A 1 161 ? 18.909  -17.754  -25.913 1.00 26.25  ? 207  ASN A OD1   1 
ATOM   1283 N  ND2   . ASN A 1 161 ? 17.942  -15.825  -26.318 1.00 43.65  ? 207  ASN A ND2   1 
ATOM   1284 N  N     . THR A 1 162 ? 22.984  -15.451  -28.346 1.00 33.97  ? 208  THR A N     1 
ATOM   1285 C  CA    . THR A 1 162 ? 24.218  -15.584  -29.129 1.00 34.05  ? 208  THR A CA    1 
ATOM   1286 C  C     . THR A 1 162 ? 25.448  -15.819  -28.185 1.00 34.71  ? 208  THR A C     1 
ATOM   1287 O  O     . THR A 1 162 ? 26.277  -16.705  -28.445 1.00 30.56  ? 208  THR A O     1 
ATOM   1288 C  CB    . THR A 1 162 ? 24.341  -14.368  -30.090 1.00 45.47  ? 208  THR A CB    1 
ATOM   1289 O  OG1   . THR A 1 162 ? 23.222  -14.371  -30.970 1.00 45.19  ? 208  THR A OG1   1 
ATOM   1290 C  CG2   . THR A 1 162 ? 25.620  -14.361  -30.896 1.00 48.64  ? 208  THR A CG2   1 
ATOM   1291 N  N     . LYS A 1 163 ? 25.507  -15.038  -27.082 1.00 31.49  ? 209  LYS A N     1 
ATOM   1292 C  CA    . LYS A 1 163 ? 26.554  -15.096  -26.058 1.00 31.55  ? 209  LYS A CA    1 
ATOM   1293 C  C     . LYS A 1 163 ? 26.549  -16.443  -25.330 1.00 34.29  ? 209  LYS A C     1 
ATOM   1294 O  O     . LYS A 1 163 ? 27.596  -16.991  -24.991 1.00 36.00  ? 209  LYS A O     1 
ATOM   1295 C  CB    . LYS A 1 163 ? 26.461  -13.877  -25.105 1.00 33.55  ? 209  LYS A CB    1 
ATOM   1296 C  CG    . LYS A 1 163 ? 26.883  -12.542  -25.802 1.00 35.81  ? 209  LYS A CG    1 
ATOM   1297 C  CD    . LYS A 1 163 ? 27.030  -11.303  -24.879 1.00 40.65  ? 209  LYS A CD    1 
ATOM   1298 C  CE    . LYS A 1 163 ? 25.720  -10.797  -24.285 1.00 49.51  ? 209  LYS A CE    1 
ATOM   1299 N  NZ    . LYS A 1 163 ? 25.873  -9.486   -23.597 1.00 49.52  ? 209  LYS A NZ    1 
ATOM   1300 N  N     . LYS A 1 164 ? 25.377  -17.025  -25.208 1.00 29.56  ? 210  LYS A N     1 
ATOM   1301 C  CA    . LYS A 1 164 ? 25.184  -18.324  -24.580 1.00 29.48  ? 210  LYS A CA    1 
ATOM   1302 C  C     . LYS A 1 164 ? 25.638  -19.469  -25.471 1.00 34.08  ? 210  LYS A C     1 
ATOM   1303 O  O     . LYS A 1 164 ? 26.064  -20.468  -24.959 1.00 36.21  ? 210  LYS A O     1 
ATOM   1304 C  CB    . LYS A 1 164 ? 23.733  -18.485  -24.098 1.00 30.62  ? 210  LYS A CB    1 
ATOM   1305 C  CG    . LYS A 1 164 ? 23.384  -17.546  -22.944 1.00 43.47  ? 210  LYS A CG    1 
ATOM   1306 C  CD    . LYS A 1 164 ? 24.271  -17.809  -21.711 1.00 50.37  ? 210  LYS A CD    1 
ATOM   1307 C  CE    . LYS A 1 164 ? 24.580  -16.609  -20.854 1.00 59.72  ? 210  LYS A CE    1 
ATOM   1308 N  NZ    . LYS A 1 164 ? 23.359  -16.022  -20.241 1.00 76.03  ? 210  LYS A NZ    1 
ATOM   1309 N  N     . VAL A 1 165 ? 25.583  -19.309  -26.788 1.00 32.01  ? 211  VAL A N     1 
ATOM   1310 C  CA    . VAL A 1 165 ? 26.023  -20.284  -27.785 1.00 31.14  ? 211  VAL A CA    1 
ATOM   1311 C  C     . VAL A 1 165 ? 27.532  -20.307  -27.706 1.00 38.06  ? 211  VAL A C     1 
ATOM   1312 O  O     . VAL A 1 165 ? 28.139  -21.376  -27.576 1.00 39.46  ? 211  VAL A O     1 
ATOM   1313 C  CB    . VAL A 1 165 ? 25.537  -19.898  -29.217 1.00 33.24  ? 211  VAL A CB    1 
ATOM   1314 C  CG1   . VAL A 1 165 ? 26.226  -20.750  -30.280 1.00 32.49  ? 211  VAL A CG1   1 
ATOM   1315 C  CG2   . VAL A 1 165 ? 24.013  -20.000  -29.333 1.00 32.51  ? 211  VAL A CG2   1 
ATOM   1316 N  N     . ILE A 1 166 ? 28.132  -19.113  -27.718 1.00 34.07  ? 212  ILE A N     1 
ATOM   1317 C  CA    . ILE A 1 166 ? 29.575  -18.939  -27.635 1.00 33.53  ? 212  ILE A CA    1 
ATOM   1318 C  C     . ILE A 1 166 ? 30.118  -19.507  -26.316 1.00 38.67  ? 212  ILE A C     1 
ATOM   1319 O  O     . ILE A 1 166 ? 31.118  -20.224  -26.345 1.00 37.24  ? 212  ILE A O     1 
ATOM   1320 C  CB    . ILE A 1 166 ? 29.958  -17.476  -27.903 1.00 35.70  ? 212  ILE A CB    1 
ATOM   1321 C  CG1   . ILE A 1 166 ? 29.631  -17.148  -29.364 1.00 36.60  ? 212  ILE A CG1   1 
ATOM   1322 C  CG2   . ILE A 1 166 ? 31.431  -17.219  -27.596 1.00 36.14  ? 212  ILE A CG2   1 
ATOM   1323 C  CD1   . ILE A 1 166 ? 29.959  -15.737  -29.864 1.00 40.61  ? 212  ILE A CD1   1 
ATOM   1324 N  N     . GLN A 1 167 ? 29.450  -19.215  -25.180 1.00 36.69  ? 213  GLN A N     1 
ATOM   1325 C  CA    . GLN A 1 167 ? 29.844  -19.731  -23.863 1.00 37.79  ? 213  GLN A CA    1 
ATOM   1326 C  C     . GLN A 1 167 ? 29.837  -21.282  -23.880 1.00 42.10  ? 213  GLN A C     1 
ATOM   1327 O  O     . GLN A 1 167 ? 30.810  -21.883  -23.430 1.00 41.70  ? 213  GLN A O     1 
ATOM   1328 C  CB    . GLN A 1 167 ? 28.905  -19.170  -22.782 1.00 39.92  ? 213  GLN A CB    1 
ATOM   1329 C  CG    . GLN A 1 167 ? 29.124  -19.707  -21.362 1.00 52.94  ? 213  GLN A CG    1 
ATOM   1330 C  CD    . GLN A 1 167 ? 27.879  -19.598  -20.523 1.00 71.47  ? 213  GLN A CD    1 
ATOM   1331 O  OE1   . GLN A 1 167 ? 26.768  -19.771  -21.005 1.00 67.22  ? 213  GLN A OE1   1 
ATOM   1332 N  NE2   . GLN A 1 167 ? 28.032  -19.348  -19.237 1.00 69.77  ? 213  GLN A NE2   1 
ATOM   1333 N  N     . TYR A 1 168 ? 28.797  -21.916  -24.474 1.00 38.28  ? 214  TYR A N     1 
ATOM   1334 C  CA    . TYR A 1 168 ? 28.730  -23.383  -24.588 1.00 36.71  ? 214  TYR A CA    1 
ATOM   1335 C  C     . TYR A 1 168 ? 29.866  -23.965  -25.397 1.00 39.84  ? 214  TYR A C     1 
ATOM   1336 O  O     . TYR A 1 168 ? 30.512  -24.896  -24.922 1.00 38.42  ? 214  TYR A O     1 
ATOM   1337 C  CB    . TYR A 1 168 ? 27.424  -23.832  -25.226 1.00 37.67  ? 214  TYR A CB    1 
ATOM   1338 C  CG    . TYR A 1 168 ? 27.176  -25.318  -25.094 1.00 37.72  ? 214  TYR A CG    1 
ATOM   1339 C  CD1   . TYR A 1 168 ? 26.694  -25.860  -23.911 1.00 38.84  ? 214  TYR A CD1   1 
ATOM   1340 C  CD2   . TYR A 1 168 ? 27.433  -26.185  -26.156 1.00 38.43  ? 214  TYR A CD2   1 
ATOM   1341 C  CE1   . TYR A 1 168 ? 26.479  -27.232  -23.776 1.00 40.30  ? 214  TYR A CE1   1 
ATOM   1342 C  CE2   . TYR A 1 168 ? 27.218  -27.562  -26.032 1.00 39.04  ? 214  TYR A CE2   1 
ATOM   1343 C  CZ    . TYR A 1 168 ? 26.726  -28.076  -24.842 1.00 44.63  ? 214  TYR A CZ    1 
ATOM   1344 O  OH    . TYR A 1 168 ? 26.477  -29.418  -24.695 1.00 45.75  ? 214  TYR A OH    1 
ATOM   1345 N  N     . LEU A 1 169 ? 30.083  -23.454  -26.630 1.00 36.65  ? 215  LEU A N     1 
ATOM   1346 C  CA    . LEU A 1 169 ? 31.132  -23.941  -27.537 1.00 36.06  ? 215  LEU A CA    1 
ATOM   1347 C  C     . LEU A 1 169 ? 32.532  -23.768  -26.985 1.00 40.44  ? 215  LEU A C     1 
ATOM   1348 O  O     . LEU A 1 169 ? 33.334  -24.687  -27.098 1.00 37.62  ? 215  LEU A O     1 
ATOM   1349 C  CB    . LEU A 1 169 ? 31.026  -23.342  -28.951 1.00 34.65  ? 215  LEU A CB    1 
ATOM   1350 C  CG    . LEU A 1 169 ? 29.742  -23.639  -29.730 1.00 37.52  ? 215  LEU A CG    1 
ATOM   1351 C  CD1   . LEU A 1 169 ? 29.616  -22.686  -30.904 1.00 39.89  ? 215  LEU A CD1   1 
ATOM   1352 C  CD2   . LEU A 1 169 ? 29.676  -25.089  -30.223 1.00 34.51  ? 215  LEU A CD2   1 
ATOM   1353 N  N     . ALA A 1 170 ? 32.824  -22.598  -26.381 1.00 39.79  ? 216  ALA A N     1 
ATOM   1354 C  CA    . ALA A 1 170 ? 34.139  -22.289  -25.810 1.00 39.68  ? 216  ALA A CA    1 
ATOM   1355 C  C     . ALA A 1 170 ? 34.468  -23.203  -24.641 1.00 46.73  ? 216  ALA A C     1 
ATOM   1356 O  O     . ALA A 1 170 ? 35.632  -23.467  -24.379 1.00 46.24  ? 216  ALA A O     1 
ATOM   1357 C  CB    . ALA A 1 170 ? 34.190  -20.844  -25.366 1.00 40.15  ? 216  ALA A CB    1 
ATOM   1358 N  N     . HIS A 1 171 ? 33.443  -23.677  -23.945 1.00 44.78  ? 217  HIS A N     1 
ATOM   1359 C  CA    . HIS A 1 171 ? 33.625  -24.555  -22.817 1.00 45.24  ? 217  HIS A CA    1 
ATOM   1360 C  C     . HIS A 1 171 ? 33.834  -26.001  -23.255 1.00 46.67  ? 217  HIS A C     1 
ATOM   1361 O  O     . HIS A 1 171 ? 34.809  -26.619  -22.817 1.00 48.27  ? 217  HIS A O     1 
ATOM   1362 C  CB    . HIS A 1 171 ? 32.430  -24.444  -21.844 1.00 47.16  ? 217  HIS A CB    1 
ATOM   1363 C  CG    . HIS A 1 171 ? 32.592  -25.245  -20.585 1.00 51.16  ? 217  HIS A CG    1 
ATOM   1364 N  ND1   . HIS A 1 171 ? 33.555  -24.924  -19.637 1.00 53.50  ? 217  HIS A ND1   1 
ATOM   1365 C  CD2   . HIS A 1 171 ? 31.932  -26.347  -20.173 1.00 53.72  ? 217  HIS A CD2   1 
ATOM   1366 C  CE1   . HIS A 1 171 ? 33.429  -25.824  -18.675 1.00 53.09  ? 217  HIS A CE1   1 
ATOM   1367 N  NE2   . HIS A 1 171 ? 32.470  -26.707  -18.956 1.00 53.35  ? 217  HIS A NE2   1 
ATOM   1368 N  N     . VAL A 1 172 ? 32.936  -26.532  -24.108 1.00 38.76  ? 218  VAL A N     1 
ATOM   1369 C  CA    . VAL A 1 172 ? 32.889  -27.945  -24.519 1.00 37.09  ? 218  VAL A CA    1 
ATOM   1370 C  C     . VAL A 1 172 ? 33.780  -28.299  -25.729 1.00 38.46  ? 218  VAL A C     1 
ATOM   1371 O  O     . VAL A 1 172 ? 34.002  -29.490  -26.000 1.00 36.19  ? 218  VAL A O     1 
ATOM   1372 C  CB    . VAL A 1 172 ? 31.427  -28.423  -24.755 1.00 39.97  ? 218  VAL A CB    1 
ATOM   1373 C  CG1   . VAL A 1 172 ? 30.483  -27.931  -23.660 1.00 39.58  ? 218  VAL A CG1   1 
ATOM   1374 C  CG2   . VAL A 1 172 ? 30.915  -28.005  -26.125 1.00 39.29  ? 218  VAL A CG2   1 
ATOM   1375 N  N     . ALA A 1 173 ? 34.263  -27.296  -26.458 1.00 35.64  ? 219  ALA A N     1 
ATOM   1376 C  CA    . ALA A 1 173 ? 35.009  -27.564  -27.687 1.00 36.40  ? 219  ALA A CA    1 
ATOM   1377 C  C     . ALA A 1 173 ? 36.376  -26.908  -27.759 1.00 42.25  ? 219  ALA A C     1 
ATOM   1378 O  O     . ALA A 1 173 ? 36.893  -26.674  -28.858 1.00 39.49  ? 219  ALA A O     1 
ATOM   1379 C  CB    . ALA A 1 173 ? 34.154  -27.198  -28.907 1.00 37.66  ? 219  ALA A CB    1 
ATOM   1380 N  N     . SER A 1 174 ? 37.005  -26.683  -26.593 1.00 44.34  ? 220  SER A N     1 
ATOM   1381 C  CA    . SER A 1 174 ? 38.375  -26.178  -26.531 1.00 47.99  ? 220  SER A CA    1 
ATOM   1382 C  C     . SER A 1 174 ? 39.298  -27.392  -26.580 1.00 57.77  ? 220  SER A C     1 
ATOM   1383 O  O     . SER A 1 174 ? 38.980  -28.422  -25.965 1.00 58.58  ? 220  SER A O     1 
ATOM   1384 C  CB    . SER A 1 174 ? 38.620  -25.393  -25.248 1.00 53.66  ? 220  SER A CB    1 
ATOM   1385 O  OG    . SER A 1 174 ? 38.378  -26.193  -24.100 1.00 65.83  ? 220  SER A OG    1 
ATOM   1386 N  N     . SER A 1 175 ? 40.414  -27.301  -27.332 1.00 56.94  ? 221  SER A N     1 
ATOM   1387 C  CA    . SER A 1 175 ? 41.378  -28.409  -27.481 1.00 58.36  ? 221  SER A CA    1 
ATOM   1388 C  C     . SER A 1 175 ? 42.265  -28.648  -26.221 1.00 67.09  ? 221  SER A C     1 
ATOM   1389 O  O     . SER A 1 175 ? 42.218  -27.801  -25.323 1.00 64.96  ? 221  SER A O     1 
ATOM   1390 C  CB    . SER A 1 175 ? 42.226  -28.209  -28.739 1.00 60.00  ? 221  SER A CB    1 
ATOM   1391 O  OG    . SER A 1 175 ? 43.303  -27.309  -28.546 1.00 66.63  ? 221  SER A OG    1 
ATOM   1392 N  N     . PRO A 1 176 ? 43.090  -29.751  -26.125 1.00 69.34  ? 222  PRO A N     1 
ATOM   1393 C  CA    . PRO A 1 176 ? 43.992  -29.908  -24.961 1.00 70.94  ? 222  PRO A CA    1 
ATOM   1394 C  C     . PRO A 1 176 ? 45.029  -28.778  -24.902 1.00 80.14  ? 222  PRO A C     1 
ATOM   1395 O  O     . PRO A 1 176 ? 45.613  -28.518  -23.847 1.00 78.49  ? 222  PRO A O     1 
ATOM   1396 C  CB    . PRO A 1 176 ? 44.638  -31.287  -25.180 1.00 72.37  ? 222  PRO A CB    1 
ATOM   1397 C  CG    . PRO A 1 176 ? 43.760  -31.977  -26.167 1.00 76.39  ? 222  PRO A CG    1 
ATOM   1398 C  CD    . PRO A 1 176 ? 43.274  -30.875  -27.062 1.00 71.96  ? 222  PRO A CD    1 
ATOM   1399 N  N     . LYS A 1 177 ? 45.228  -28.095  -26.046 1.00 82.23  ? 223  LYS A N     1 
ATOM   1400 C  CA    . LYS A 1 177 ? 46.022  -26.882  -26.170 1.00 84.95  ? 223  LYS A CA    1 
ATOM   1401 C  C     . LYS A 1 177 ? 45.021  -25.759  -25.886 1.00 94.51  ? 223  LYS A C     1 
ATOM   1402 O  O     . LYS A 1 177 ? 43.904  -25.768  -26.411 1.00 94.06  ? 223  LYS A O     1 
ATOM   1403 C  CB    . LYS A 1 177 ? 46.583  -26.709  -27.596 1.00 88.52  ? 223  LYS A CB    1 
ATOM   1404 C  CG    . LYS A 1 177 ? 47.610  -27.744  -28.028 1.00 99.78  ? 223  LYS A CG    1 
ATOM   1405 C  CD    . LYS A 1 177 ? 48.925  -27.665  -27.290 1.00 103.55 ? 223  LYS A CD    1 
ATOM   1406 C  CE    . LYS A 1 177 ? 49.612  -28.998  -27.354 1.00 107.33 ? 223  LYS A CE    1 
ATOM   1407 N  NZ    . LYS A 1 177 ? 51.037  -28.911  -26.969 1.00 115.81 ? 223  LYS A NZ    1 
ATOM   1408 N  N     . GLY A 1 178 ? 45.417  -24.811  -25.057 1.00 95.38  ? 224  GLY A N     1 
ATOM   1409 C  CA    . GLY A 1 178 ? 44.525  -23.726  -24.670 1.00 96.78  ? 224  GLY A CA    1 
ATOM   1410 C  C     . GLY A 1 178 ? 43.760  -24.089  -23.419 1.00 104.02 ? 224  GLY A C     1 
ATOM   1411 O  O     . GLY A 1 178 ? 42.867  -23.361  -22.995 1.00 104.12 ? 224  GLY A O     1 
ATOM   1412 N  N     . ARG A 1 179 ? 44.062  -25.269  -22.875 1.00 102.59 ? 225  ARG A N     1 
ATOM   1413 C  CA    . ARG A 1 179 ? 43.581  -25.818  -21.617 1.00 103.41 ? 225  ARG A CA    1 
ATOM   1414 C  C     . ARG A 1 179 ? 44.608  -26.842  -21.193 1.00 109.39 ? 225  ARG A C     1 
ATOM   1415 O  O     . ARG A 1 179 ? 44.310  -28.024  -20.987 1.00 109.11 ? 225  ARG A O     1 
ATOM   1416 C  CB    . ARG A 1 179 ? 42.127  -26.332  -21.636 1.00 103.67 ? 225  ARG A CB    1 
ATOM   1417 C  CG    . ARG A 1 179 ? 41.734  -26.859  -20.255 1.00 115.63 ? 225  ARG A CG    1 
ATOM   1418 C  CD    . ARG A 1 179 ? 40.293  -27.325  -20.145 1.00 130.89 ? 225  ARG A CD    1 
ATOM   1419 N  NE    . ARG A 1 179 ? 39.969  -27.796  -18.795 1.00 144.31 ? 225  ARG A NE    1 
ATOM   1420 C  CZ    . ARG A 1 179 ? 38.743  -28.082  -18.361 1.00 159.06 ? 225  ARG A CZ    1 
ATOM   1421 N  NH1   . ARG A 1 179 ? 37.696  -27.954  -19.170 1.00 149.01 ? 225  ARG A NH1   1 
ATOM   1422 N  NH2   . ARG A 1 179 ? 38.553  -28.506  -17.118 1.00 142.72 ? 225  ARG A NH2   1 
ATOM   1423 N  N     . LYS A 1 180 ? 45.867  -26.352  -21.134 1.00 107.42 ? 226  LYS A N     1 
ATOM   1424 C  CA    . LYS A 1 180 ? 47.073  -27.074  -20.725 1.00 108.13 ? 226  LYS A CA    1 
ATOM   1425 C  C     . LYS A 1 180 ? 46.833  -27.593  -19.309 1.00 112.11 ? 226  LYS A C     1 
ATOM   1426 O  O     . LYS A 1 180 ? 47.040  -28.777  -19.039 1.00 111.82 ? 226  LYS A O     1 
ATOM   1427 C  CB    . LYS A 1 180 ? 48.296  -26.132  -20.743 1.00 111.61 ? 226  LYS A CB    1 
ATOM   1428 C  CG    . LYS A 1 180 ? 48.735  -25.690  -22.135 1.00 136.96 ? 226  LYS A CG    1 
ATOM   1429 C  CD    . LYS A 1 180 ? 49.849  -24.650  -22.096 1.00 151.85 ? 226  LYS A CD    1 
ATOM   1430 C  CE    . LYS A 1 180 ? 51.113  -25.229  -21.509 1.00 165.87 ? 226  LYS A CE    1 
ATOM   1431 N  NZ    . LYS A 1 180 ? 52.244  -24.269  -21.571 1.00 176.14 ? 226  LYS A NZ    1 
ATOM   1432 N  N     . GLU A 1 181 ? 46.325  -26.705  -18.431 1.00 108.31 ? 227  GLU A N     1 
ATOM   1433 C  CA    . GLU A 1 181 ? 45.972  -27.010  -17.053 1.00 107.84 ? 227  GLU A CA    1 
ATOM   1434 C  C     . GLU A 1 181 ? 44.447  -27.010  -16.847 1.00 109.34 ? 227  GLU A C     1 
ATOM   1435 O  O     . GLU A 1 181 ? 43.773  -26.045  -17.233 1.00 108.66 ? 227  GLU A O     1 
ATOM   1436 C  CB    . GLU A 1 181 ? 46.715  -26.106  -16.045 1.00 109.45 ? 227  GLU A CB    1 
ATOM   1437 C  CG    . GLU A 1 181 ? 46.587  -24.607  -16.276 1.00 122.27 ? 227  GLU A CG    1 
ATOM   1438 C  CD    . GLU A 1 181 ? 47.699  -23.739  -15.713 1.00 148.42 ? 227  GLU A CD    1 
ATOM   1439 O  OE1   . GLU A 1 181 ? 47.857  -22.601  -16.210 1.00 138.34 ? 227  GLU A OE1   1 
ATOM   1440 O  OE2   . GLU A 1 181 ? 48.414  -24.189  -14.787 1.00 147.74 ? 227  GLU A OE2   1 
ATOM   1441 N  N     . PRO A 1 182 ? 43.892  -28.113  -16.280 1.00 104.08 ? 228  PRO A N     1 
ATOM   1442 C  CA    . PRO A 1 182 ? 42.435  -28.183  -16.060 1.00 102.99 ? 228  PRO A CA    1 
ATOM   1443 C  C     . PRO A 1 182 ? 41.901  -27.092  -15.128 1.00 103.32 ? 228  PRO A C     1 
ATOM   1444 O  O     . PRO A 1 182 ? 42.572  -26.723  -14.163 1.00 102.95 ? 228  PRO A O     1 
ATOM   1445 C  CB    . PRO A 1 182 ? 42.230  -29.584  -15.464 1.00 105.05 ? 228  PRO A CB    1 
ATOM   1446 C  CG    . PRO A 1 182 ? 43.472  -30.348  -15.808 1.00 109.83 ? 228  PRO A CG    1 
ATOM   1447 C  CD    . PRO A 1 182 ? 44.566  -29.335  -15.797 1.00 105.52 ? 228  PRO A CD    1 
ATOM   1448 N  N     . GLY A 1 183 ? 40.718  -26.568  -15.458 1.00 96.90  ? 229  GLY A N     1 
ATOM   1449 C  CA    . GLY A 1 183 ? 40.043  -25.515  -14.702 1.00 94.95  ? 229  GLY A CA    1 
ATOM   1450 C  C     . GLY A 1 183 ? 40.380  -24.109  -15.153 1.00 93.94  ? 229  GLY A C     1 
ATOM   1451 O  O     . GLY A 1 183 ? 39.586  -23.183  -14.947 1.00 93.12  ? 229  GLY A O     1 
ATOM   1452 N  N     . VAL A 1 184 ? 41.567  -23.940  -15.767 1.00 86.65  ? 230  VAL A N     1 
ATOM   1453 C  CA    . VAL A 1 184 ? 42.052  -22.653  -16.262 1.00 84.43  ? 230  VAL A CA    1 
ATOM   1454 C  C     . VAL A 1 184 ? 41.780  -22.500  -17.772 1.00 81.37  ? 230  VAL A C     1 
ATOM   1455 O  O     . VAL A 1 184 ? 42.387  -23.229  -18.562 1.00 79.55  ? 230  VAL A O     1 
ATOM   1456 C  CB    . VAL A 1 184 ? 43.547  -22.417  -15.904 1.00 88.60  ? 230  VAL A CB    1 
ATOM   1457 C  CG1   . VAL A 1 184 ? 44.051  -21.081  -16.459 1.00 88.82  ? 230  VAL A CG1   1 
ATOM   1458 C  CG2   . VAL A 1 184 ? 43.777  -22.499  -14.397 1.00 88.07  ? 230  VAL A CG2   1 
ATOM   1459 N  N     . PRO A 1 185 ? 40.887  -21.556  -18.189 1.00 74.38  ? 231  PRO A N     1 
ATOM   1460 C  CA    . PRO A 1 185 ? 40.664  -21.335  -19.632 1.00 72.47  ? 231  PRO A CA    1 
ATOM   1461 C  C     . PRO A 1 185 ? 41.914  -20.730  -20.241 1.00 70.35  ? 231  PRO A C     1 
ATOM   1462 O  O     . PRO A 1 185 ? 42.600  -19.930  -19.597 1.00 69.04  ? 231  PRO A O     1 
ATOM   1463 C  CB    . PRO A 1 185 ? 39.510  -20.319  -19.681 1.00 74.70  ? 231  PRO A CB    1 
ATOM   1464 C  CG    . PRO A 1 185 ? 38.969  -20.247  -18.299 1.00 80.16  ? 231  PRO A CG    1 
ATOM   1465 C  CD    . PRO A 1 185 ? 40.100  -20.603  -17.383 1.00 76.06  ? 231  PRO A CD    1 
ATOM   1466 N  N     . GLY A 1 186 ? 42.225  -21.151  -21.454 1.00 63.58  ? 232  GLY A N     1 
ATOM   1467 C  CA    . GLY A 1 186 ? 43.397  -20.665  -22.167 1.00 61.80  ? 232  GLY A CA    1 
ATOM   1468 C  C     . GLY A 1 186 ? 43.154  -19.373  -22.913 1.00 61.10  ? 232  GLY A C     1 
ATOM   1469 O  O     . GLY A 1 186 ? 42.064  -18.789  -22.835 1.00 60.12  ? 232  GLY A O     1 
ATOM   1470 N  N     . GLU A 1 187 ? 44.182  -18.932  -23.645 1.00 53.86  ? 233  GLU A N     1 
ATOM   1471 C  CA    . GLU A 1 187 ? 44.142  -17.695  -24.404 1.00 52.13  ? 233  GLU A CA    1 
ATOM   1472 C  C     . GLU A 1 187 ? 42.928  -17.612  -25.345 1.00 50.91  ? 233  GLU A C     1 
ATOM   1473 O  O     . GLU A 1 187 ? 42.089  -16.741  -25.139 1.00 49.74  ? 233  GLU A O     1 
ATOM   1474 C  CB    . GLU A 1 187 ? 45.465  -17.443  -25.142 1.00 53.31  ? 233  GLU A CB    1 
ATOM   1475 C  CG    . GLU A 1 187 ? 45.615  -16.002  -25.603 1.00 63.07  ? 233  GLU A CG    1 
ATOM   1476 C  CD    . GLU A 1 187 ? 46.986  -15.677  -26.149 1.00 91.13  ? 233  GLU A CD    1 
ATOM   1477 O  OE1   . GLU A 1 187 ? 47.147  -15.684  -27.391 1.00 89.88  ? 233  GLU A OE1   1 
ATOM   1478 O  OE2   . GLU A 1 187 ? 47.910  -15.444  -25.337 1.00 91.09  ? 233  GLU A OE2   1 
ATOM   1479 N  N     . LEU A 1 188 ? 42.806  -18.543  -26.308 1.00 44.62  ? 234  LEU A N     1 
ATOM   1480 C  CA    . LEU A 1 188 ? 41.706  -18.546  -27.255 1.00 44.77  ? 234  LEU A CA    1 
ATOM   1481 C  C     . LEU A 1 188 ? 40.306  -18.460  -26.595 1.00 48.96  ? 234  LEU A C     1 
ATOM   1482 O  O     . LEU A 1 188 ? 39.521  -17.612  -27.006 1.00 47.00  ? 234  LEU A O     1 
ATOM   1483 C  CB    . LEU A 1 188 ? 41.782  -19.711  -28.251 1.00 44.27  ? 234  LEU A CB    1 
ATOM   1484 C  CG    . LEU A 1 188 ? 40.818  -19.609  -29.451 1.00 48.65  ? 234  LEU A CG    1 
ATOM   1485 C  CD1   . LEU A 1 188 ? 40.949  -18.241  -30.188 1.00 49.10  ? 234  LEU A CD1   1 
ATOM   1486 C  CD2   . LEU A 1 188 ? 41.071  -20.713  -30.425 1.00 51.00  ? 234  LEU A CD2   1 
ATOM   1487 N  N     . GLU A 1 189 ? 40.034  -19.274  -25.555 1.00 46.43  ? 235  GLU A N     1 
ATOM   1488 C  CA    . GLU A 1 189 ? 38.758  -19.283  -24.829 1.00 45.93  ? 235  GLU A CA    1 
ATOM   1489 C  C     . GLU A 1 189 ? 38.484  -17.905  -24.217 1.00 50.36  ? 235  GLU A C     1 
ATOM   1490 O  O     . GLU A 1 189 ? 37.457  -17.315  -24.522 1.00 49.33  ? 235  GLU A O     1 
ATOM   1491 C  CB    . GLU A 1 189 ? 38.770  -20.378  -23.749 1.00 47.14  ? 235  GLU A CB    1 
ATOM   1492 C  CG    . GLU A 1 189 ? 37.410  -20.751  -23.163 1.00 57.21  ? 235  GLU A CG    1 
ATOM   1493 C  CD    . GLU A 1 189 ? 37.396  -21.913  -22.167 1.00 78.54  ? 235  GLU A CD    1 
ATOM   1494 O  OE1   . GLU A 1 189 ? 38.451  -22.566  -21.990 1.00 51.98  ? 235  GLU A OE1   1 
ATOM   1495 O  OE2   . GLU A 1 189 ? 36.320  -22.184  -21.582 1.00 72.17  ? 235  GLU A OE2   1 
ATOM   1496 N  N     . ARG A 1 190 ? 39.429  -17.372  -23.412 1.00 49.31  ? 236  ARG A N     1 
ATOM   1497 C  CA    . ARG A 1 190 ? 39.319  -16.067  -22.756 1.00 49.44  ? 236  ARG A CA    1 
ATOM   1498 C  C     . ARG A 1 190 ? 39.019  -14.935  -23.726 1.00 51.82  ? 236  ARG A C     1 
ATOM   1499 O  O     . ARG A 1 190 ? 38.150  -14.113  -23.444 1.00 52.69  ? 236  ARG A O     1 
ATOM   1500 C  CB    . ARG A 1 190 ? 40.584  -15.728  -21.971 1.00 50.38  ? 236  ARG A CB    1 
ATOM   1501 C  CG    . ARG A 1 190 ? 40.609  -16.231  -20.544 1.00 69.21  ? 236  ARG A CG    1 
ATOM   1502 C  CD    . ARG A 1 190 ? 41.571  -15.430  -19.663 1.00 98.14  ? 236  ARG A CD    1 
ATOM   1503 N  NE    . ARG A 1 190 ? 42.848  -15.105  -20.317 1.00 119.74 ? 236  ARG A NE    1 
ATOM   1504 C  CZ    . ARG A 1 190 ? 43.922  -15.892  -20.325 1.00 141.96 ? 236  ARG A CZ    1 
ATOM   1505 N  NH1   . ARG A 1 190 ? 43.895  -17.072  -19.714 1.00 133.94 ? 236  ARG A NH1   1 
ATOM   1506 N  NH2   . ARG A 1 190 ? 45.029  -15.507  -20.947 1.00 128.54 ? 236  ARG A NH2   1 
ATOM   1507 N  N     . GLN A 1 191 ? 39.740  -14.888  -24.852 1.00 46.39  ? 237  GLN A N     1 
ATOM   1508 C  CA    . GLN A 1 191 ? 39.591  -13.849  -25.871 1.00 45.15  ? 237  GLN A CA    1 
ATOM   1509 C  C     . GLN A 1 191 ? 38.216  -13.954  -26.551 1.00 50.39  ? 237  GLN A C     1 
ATOM   1510 O  O     . GLN A 1 191 ? 37.481  -12.966  -26.604 1.00 52.27  ? 237  GLN A O     1 
ATOM   1511 C  CB    . GLN A 1 191 ? 40.733  -13.901  -26.914 1.00 45.51  ? 237  GLN A CB    1 
ATOM   1512 C  CG    . GLN A 1 191 ? 42.129  -13.658  -26.332 1.00 47.11  ? 237  GLN A CG    1 
ATOM   1513 C  CD    . GLN A 1 191 ? 43.189  -13.443  -27.387 1.00 60.60  ? 237  GLN A CD    1 
ATOM   1514 O  OE1   . GLN A 1 191 ? 43.278  -14.165  -28.382 1.00 55.45  ? 237  GLN A OE1   1 
ATOM   1515 N  NE2   . GLN A 1 191 ? 44.040  -12.446  -27.188 1.00 51.15  ? 237  GLN A NE2   1 
ATOM   1516 N  N     . LEU A 1 192 ? 37.875  -15.162  -27.038 1.00 44.04  ? 238  LEU A N     1 
ATOM   1517 C  CA    . LEU A 1 192 ? 36.656  -15.552  -27.722 1.00 42.46  ? 238  LEU A CA    1 
ATOM   1518 C  C     . LEU A 1 192 ? 35.440  -15.072  -26.958 1.00 44.14  ? 238  LEU A C     1 
ATOM   1519 O  O     . LEU A 1 192 ? 34.502  -14.590  -27.570 1.00 43.02  ? 238  LEU A O     1 
ATOM   1520 C  CB    . LEU A 1 192 ? 36.650  -17.087  -27.861 1.00 42.85  ? 238  LEU A CB    1 
ATOM   1521 C  CG    . LEU A 1 192 ? 35.774  -17.720  -28.934 1.00 48.73  ? 238  LEU A CG    1 
ATOM   1522 C  CD1   . LEU A 1 192 ? 35.865  -16.949  -30.230 1.00 49.95  ? 238  LEU A CD1   1 
ATOM   1523 C  CD2   . LEU A 1 192 ? 36.185  -19.175  -29.166 1.00 50.85  ? 238  LEU A CD2   1 
ATOM   1524 N  N     . LEU A 1 193 ? 35.500  -15.122  -25.616 1.00 39.93  ? 239  LEU A N     1 
ATOM   1525 C  CA    . LEU A 1 193 ? 34.418  -14.673  -24.745 1.00 38.51  ? 239  LEU A CA    1 
ATOM   1526 C  C     . LEU A 1 193 ? 34.476  -13.173  -24.448 1.00 40.89  ? 239  LEU A C     1 
ATOM   1527 O  O     . LEU A 1 193 ? 33.450  -12.594  -24.134 1.00 38.90  ? 239  LEU A O     1 
ATOM   1528 C  CB    . LEU A 1 193 ? 34.384  -15.494  -23.441 1.00 38.50  ? 239  LEU A CB    1 
ATOM   1529 C  CG    . LEU A 1 193 ? 34.204  -17.021  -23.544 1.00 43.46  ? 239  LEU A CG    1 
ATOM   1530 C  CD1   . LEU A 1 193 ? 34.062  -17.637  -22.159 1.00 45.11  ? 239  LEU A CD1   1 
ATOM   1531 C  CD2   . LEU A 1 193 ? 32.982  -17.406  -24.325 1.00 44.31  ? 239  LEU A CD2   1 
ATOM   1532 N  N     . GLN A 1 194 ? 35.669  -12.536  -24.546 1.00 38.60  ? 240  GLN A N     1 
ATOM   1533 C  CA    . GLN A 1 194 ? 35.818  -11.096  -24.291 1.00 38.34  ? 240  GLN A CA    1 
ATOM   1534 C  C     . GLN A 1 194 ? 35.637  -10.233  -25.569 1.00 42.97  ? 240  GLN A C     1 
ATOM   1535 O  O     . GLN A 1 194 ? 35.812  -9.006   -25.508 1.00 43.72  ? 240  GLN A O     1 
ATOM   1536 C  CB    . GLN A 1 194 ? 37.180  -10.789  -23.614 1.00 39.55  ? 240  GLN A CB    1 
ATOM   1537 C  CG    . GLN A 1 194 ? 37.305  -11.164  -22.122 1.00 39.89  ? 240  GLN A CG    1 
ATOM   1538 C  CD    . GLN A 1 194 ? 36.065  -10.930  -21.294 1.00 63.64  ? 240  GLN A CD    1 
ATOM   1539 O  OE1   . GLN A 1 194 ? 35.567  -9.810   -21.149 1.00 55.85  ? 240  GLN A OE1   1 
ATOM   1540 N  NE2   . GLN A 1 194 ? 35.523  -12.005  -20.741 1.00 69.67  ? 240  GLN A NE2   1 
ATOM   1541 N  N     . ALA A 1 195 ? 35.310  -10.869  -26.718 1.00 37.12  ? 241  ALA A N     1 
ATOM   1542 C  CA    . ALA A 1 195 ? 35.188  -10.171  -27.990 1.00 37.14  ? 241  ALA A CA    1 
ATOM   1543 C  C     . ALA A 1 195 ? 33.841  -9.484   -28.123 1.00 42.72  ? 241  ALA A C     1 
ATOM   1544 O  O     . ALA A 1 195 ? 33.812  -8.384   -28.644 1.00 42.73  ? 241  ALA A O     1 
ATOM   1545 C  CB    . ALA A 1 195 ? 35.438  -11.117  -29.152 1.00 37.50  ? 241  ALA A CB    1 
ATOM   1546 N  N     . ASN A 1 196 ? 32.737  -10.117  -27.655 1.00 39.13  ? 242  ASN A N     1 
ATOM   1547 C  CA    . ASN A 1 196 ? 31.407  -9.525   -27.683 1.00 40.16  ? 242  ASN A CA    1 
ATOM   1548 C  C     . ASN A 1 196 ? 31.308  -8.297   -26.763 1.00 41.88  ? 242  ASN A C     1 
ATOM   1549 O  O     . ASN A 1 196 ? 30.890  -7.274   -27.283 1.00 42.02  ? 242  ASN A O     1 
ATOM   1550 C  CB    . ASN A 1 196 ? 30.290  -10.554  -27.413 1.00 47.95  ? 242  ASN A CB    1 
ATOM   1551 C  CG    . ASN A 1 196 ? 30.109  -11.563  -28.529 1.00 78.55  ? 242  ASN A CG    1 
ATOM   1552 O  OD1   . ASN A 1 196 ? 29.931  -12.758  -28.272 1.00 73.19  ? 242  ASN A OD1   1 
ATOM   1553 N  ND2   . ASN A 1 196 ? 30.138  -11.113  -29.788 1.00 66.07  ? 242  ASN A ND2   1 
ATOM   1554 N  N     . PRO A 1 197 ? 31.697  -8.326   -25.450 1.00 35.21  ? 243  PRO A N     1 
ATOM   1555 C  CA    . PRO A 1 197 ? 31.640  -7.090   -24.634 1.00 33.86  ? 243  PRO A CA    1 
ATOM   1556 C  C     . PRO A 1 197 ? 32.342  -5.902   -25.270 1.00 37.26  ? 243  PRO A C     1 
ATOM   1557 O  O     . PRO A 1 197 ? 31.897  -4.775   -25.060 1.00 37.00  ? 243  PRO A O     1 
ATOM   1558 C  CB    . PRO A 1 197 ? 32.396  -7.495   -23.345 1.00 35.48  ? 243  PRO A CB    1 
ATOM   1559 C  CG    . PRO A 1 197 ? 32.184  -8.949   -23.223 1.00 38.12  ? 243  PRO A CG    1 
ATOM   1560 C  CD    . PRO A 1 197 ? 32.185  -9.470   -24.634 1.00 34.52  ? 243  PRO A CD    1 
ATOM   1561 N  N     . ILE A 1 198 ? 33.474  -6.149   -25.992 1.00 33.50  ? 244  ILE A N     1 
ATOM   1562 C  CA    . ILE A 1 198 ? 34.275  -5.129   -26.710 1.00 32.75  ? 244  ILE A CA    1 
ATOM   1563 C  C     . ILE A 1 198 ? 33.434  -4.503   -27.831 1.00 36.88  ? 244  ILE A C     1 
ATOM   1564 O  O     . ILE A 1 198 ? 33.440  -3.279   -27.998 1.00 35.70  ? 244  ILE A O     1 
ATOM   1565 C  CB    . ILE A 1 198 ? 35.655  -5.688   -27.240 1.00 34.29  ? 244  ILE A CB    1 
ATOM   1566 C  CG1   . ILE A 1 198 ? 36.595  -6.068   -26.072 1.00 34.70  ? 244  ILE A CG1   1 
ATOM   1567 C  CG2   . ILE A 1 198 ? 36.374  -4.698   -28.237 1.00 33.44  ? 244  ILE A CG2   1 
ATOM   1568 C  CD1   . ILE A 1 198 ? 37.883  -6.885   -26.494 1.00 31.63  ? 244  ILE A CD1   1 
ATOM   1569 N  N     . LEU A 1 199 ? 32.743  -5.345   -28.618 1.00 35.58  ? 245  LEU A N     1 
ATOM   1570 C  CA    . LEU A 1 199 ? 31.891  -4.833   -29.705 1.00 36.77  ? 245  LEU A CA    1 
ATOM   1571 C  C     . LEU A 1 199 ? 30.673  -4.179   -29.129 1.00 39.68  ? 245  LEU A C     1 
ATOM   1572 O  O     . LEU A 1 199 ? 30.214  -3.196   -29.681 1.00 39.97  ? 245  LEU A O     1 
ATOM   1573 C  CB    . LEU A 1 199 ? 31.491  -5.934   -30.690 1.00 36.96  ? 245  LEU A CB    1 
ATOM   1574 C  CG    . LEU A 1 199 ? 32.670  -6.585   -31.393 1.00 41.69  ? 245  LEU A CG    1 
ATOM   1575 C  CD1   . LEU A 1 199 ? 32.353  -7.992   -31.816 1.00 43.11  ? 245  LEU A CD1   1 
ATOM   1576 C  CD2   . LEU A 1 199 ? 33.171  -5.743   -32.503 1.00 40.48  ? 245  LEU A CD2   1 
ATOM   1577 N  N     . GLU A 1 200 ? 30.191  -4.655   -27.984 1.00 35.16  ? 246  GLU A N     1 
ATOM   1578 C  CA    . GLU A 1 200 ? 29.035  -4.026   -27.372 1.00 35.82  ? 246  GLU A CA    1 
ATOM   1579 C  C     . GLU A 1 200 ? 29.359  -2.654   -26.809 1.00 42.08  ? 246  GLU A C     1 
ATOM   1580 O  O     . GLU A 1 200 ? 28.502  -1.786   -26.828 1.00 43.05  ? 246  GLU A O     1 
ATOM   1581 C  CB    . GLU A 1 200 ? 28.372  -4.929   -26.348 1.00 37.22  ? 246  GLU A CB    1 
ATOM   1582 C  CG    . GLU A 1 200 ? 27.744  -6.159   -26.975 1.00 46.76  ? 246  GLU A CG    1 
ATOM   1583 C  CD    . GLU A 1 200 ? 27.159  -7.141   -25.985 1.00 60.97  ? 246  GLU A CD    1 
ATOM   1584 O  OE1   . GLU A 1 200 ? 26.768  -6.711   -24.877 1.00 38.45  ? 246  GLU A OE1   1 
ATOM   1585 O  OE2   . GLU A 1 200 ? 27.042  -8.336   -26.338 1.00 62.51  ? 246  GLU A OE2   1 
ATOM   1586 N  N     . ALA A 1 201 ? 30.595  -2.420   -26.393 1.00 41.14  ? 247  ALA A N     1 
ATOM   1587 C  CA    . ALA A 1 201 ? 30.974  -1.100   -25.884 1.00 41.84  ? 247  ALA A CA    1 
ATOM   1588 C  C     . ALA A 1 201 ? 31.000  -0.067   -26.995 1.00 44.48  ? 247  ALA A C     1 
ATOM   1589 O  O     . ALA A 1 201 ? 30.519  1.047    -26.792 1.00 44.60  ? 247  ALA A O     1 
ATOM   1590 C  CB    . ALA A 1 201 ? 32.313  -1.157   -25.169 1.00 42.42  ? 247  ALA A CB    1 
ATOM   1591 N  N     . PHE A 1 202 ? 31.479  -0.453   -28.189 1.00 39.86  ? 248  PHE A N     1 
ATOM   1592 C  CA    . PHE A 1 202 ? 31.562  0.448    -29.346 1.00 38.21  ? 248  PHE A CA    1 
ATOM   1593 C  C     . PHE A 1 202 ? 30.389  0.396    -30.320 1.00 39.87  ? 248  PHE A C     1 
ATOM   1594 O  O     . PHE A 1 202 ? 30.251  1.294    -31.150 1.00 40.93  ? 248  PHE A O     1 
ATOM   1595 C  CB    . PHE A 1 202 ? 32.869  0.217    -30.103 1.00 40.18  ? 248  PHE A CB    1 
ATOM   1596 C  CG    . PHE A 1 202 ? 34.067  0.715    -29.343 1.00 42.72  ? 248  PHE A CG    1 
ATOM   1597 C  CD1   . PHE A 1 202 ? 34.624  -0.044   -28.304 1.00 46.99  ? 248  PHE A CD1   1 
ATOM   1598 C  CD2   . PHE A 1 202 ? 34.653  1.935    -29.658 1.00 44.16  ? 248  PHE A CD2   1 
ATOM   1599 C  CE1   . PHE A 1 202 ? 35.746  0.414    -27.610 1.00 47.99  ? 248  PHE A CE1   1 
ATOM   1600 C  CE2   . PHE A 1 202 ? 35.768  2.396    -28.955 1.00 47.02  ? 248  PHE A CE2   1 
ATOM   1601 C  CZ    . PHE A 1 202 ? 36.321  1.628    -27.952 1.00 45.57  ? 248  PHE A CZ    1 
ATOM   1602 N  N     . GLY A 1 203 ? 29.553  -0.625   -30.232 1.00 34.58  ? 249  GLY A N     1 
ATOM   1603 C  CA    . GLY A 1 203 ? 28.437  -0.774   -31.160 1.00 33.49  ? 249  GLY A CA    1 
ATOM   1604 C  C     . GLY A 1 203 ? 27.044  -0.874   -30.586 1.00 33.25  ? 249  GLY A C     1 
ATOM   1605 O  O     . GLY A 1 203 ? 26.111  -0.985   -31.356 1.00 29.64  ? 249  GLY A O     1 
ATOM   1606 N  N     . ASN A 1 204 ? 26.895  -0.920   -29.250 1.00 30.92  ? 250  ASN A N     1 
ATOM   1607 C  CA    . ASN A 1 204 ? 25.606  -0.974   -28.597 1.00 31.91  ? 250  ASN A CA    1 
ATOM   1608 C  C     . ASN A 1 204 ? 25.304  0.336    -27.958 1.00 39.36  ? 250  ASN A C     1 
ATOM   1609 O  O     . ASN A 1 204 ? 26.226  1.093    -27.664 1.00 41.10  ? 250  ASN A O     1 
ATOM   1610 C  CB    . ASN A 1 204 ? 25.468  -2.127   -27.577 1.00 33.77  ? 250  ASN A CB    1 
ATOM   1611 C  CG    . ASN A 1 204 ? 25.391  -3.503   -28.181 1.00 41.42  ? 250  ASN A CG    1 
ATOM   1612 O  OD1   . ASN A 1 204 ? 25.908  -3.755   -29.267 1.00 26.07  ? 250  ASN A OD1   1 
ATOM   1613 N  ND2   . ASN A 1 204 ? 24.799  -4.439   -27.463 1.00 32.39  ? 250  ASN A ND2   1 
ATOM   1614 N  N     . ALA A 1 205 ? 24.003  0.628    -27.778 1.00 36.44  ? 251  ALA A N     1 
ATOM   1615 C  CA    . ALA A 1 205 ? 23.504  1.887    -27.235 1.00 35.77  ? 251  ALA A CA    1 
ATOM   1616 C  C     . ALA A 1 205 ? 22.127  1.685    -26.648 1.00 41.20  ? 251  ALA A C     1 
ATOM   1617 O  O     . ALA A 1 205 ? 21.435  0.724    -26.992 1.00 41.65  ? 251  ALA A O     1 
ATOM   1618 C  CB    . ALA A 1 205 ? 23.434  2.932    -28.346 1.00 36.00  ? 251  ALA A CB    1 
ATOM   1619 N  N     . LYS A 1 206 ? 21.705  2.602    -25.791 1.00 37.98  ? 252  LYS A N     1 
ATOM   1620 C  CA    . LYS A 1 206 ? 20.369  2.509    -25.231 1.00 37.86  ? 252  LYS A CA    1 
ATOM   1621 C  C     . LYS A 1 206 ? 19.375  3.136    -26.212 1.00 39.87  ? 252  LYS A C     1 
ATOM   1622 O  O     . LYS A 1 206 ? 19.505  4.311    -26.564 1.00 37.94  ? 252  LYS A O     1 
ATOM   1623 C  CB    . LYS A 1 206 ? 20.297  3.208    -23.866 1.00 39.79  ? 252  LYS A CB    1 
ATOM   1624 C  CG    . LYS A 1 206 ? 18.897  3.293    -23.301 1.00 49.21  ? 252  LYS A CG    1 
ATOM   1625 C  CD    . LYS A 1 206 ? 18.869  4.130    -22.051 1.00 65.51  ? 252  LYS A CD    1 
ATOM   1626 C  CE    . LYS A 1 206 ? 17.450  4.378    -21.625 1.00 88.66  ? 252  LYS A CE    1 
ATOM   1627 N  NZ    . LYS A 1 206 ? 17.291  5.730    -21.034 1.00 106.90 ? 252  LYS A NZ    1 
ATOM   1628 N  N     . THR A 1 207 ? 18.412  2.342    -26.673 1.00 37.37  ? 253  THR A N     1 
ATOM   1629 C  CA    . THR A 1 207 ? 17.293  2.856    -27.464 1.00 38.73  ? 253  THR A CA    1 
ATOM   1630 C  C     . THR A 1 207 ? 16.073  2.723    -26.561 1.00 44.47  ? 253  THR A C     1 
ATOM   1631 O  O     . THR A 1 207 ? 16.163  2.065    -25.515 1.00 44.19  ? 253  THR A O     1 
ATOM   1632 C  CB    . THR A 1 207 ? 17.085  2.155    -28.820 1.00 40.59  ? 253  THR A CB    1 
ATOM   1633 O  OG1   . THR A 1 207 ? 16.456  0.883    -28.617 1.00 39.71  ? 253  THR A OG1   1 
ATOM   1634 C  CG2   . THR A 1 207 ? 18.362  2.069    -29.663 1.00 32.05  ? 253  THR A CG2   1 
ATOM   1635 N  N     . VAL A 1 208 ? 14.929  3.302    -26.966 1.00 42.91  ? 254  VAL A N     1 
ATOM   1636 C  CA    . VAL A 1 208 ? 13.663  3.160    -26.217 1.00 43.54  ? 254  VAL A CA    1 
ATOM   1637 C  C     . VAL A 1 208 ? 13.249  1.672    -26.087 1.00 46.97  ? 254  VAL A C     1 
ATOM   1638 O  O     . VAL A 1 208 ? 12.553  1.324    -25.133 1.00 47.46  ? 254  VAL A O     1 
ATOM   1639 C  CB    . VAL A 1 208 ? 12.495  4.045    -26.771 1.00 48.05  ? 254  VAL A CB    1 
ATOM   1640 C  CG1   . VAL A 1 208 ? 12.848  5.536    -26.687 1.00 48.36  ? 254  VAL A CG1   1 
ATOM   1641 C  CG2   . VAL A 1 208 ? 12.106  3.654    -28.206 1.00 47.81  ? 254  VAL A CG2   1 
ATOM   1642 N  N     . LYS A 1 209 ? 13.672  0.813    -27.048 1.00 43.01  ? 255  LYS A N     1 
ATOM   1643 C  CA    . LYS A 1 209 ? 13.307  -0.615   -27.107 1.00 42.86  ? 255  LYS A CA    1 
ATOM   1644 C  C     . LYS A 1 209 ? 14.236  -1.514   -26.331 1.00 44.39  ? 255  LYS A C     1 
ATOM   1645 O  O     . LYS A 1 209 ? 13.801  -2.566   -25.881 1.00 45.99  ? 255  LYS A O     1 
ATOM   1646 C  CB    . LYS A 1 209 ? 13.210  -1.127   -28.565 1.00 45.27  ? 255  LYS A CB    1 
ATOM   1647 C  CG    . LYS A 1 209 ? 12.252  -0.353   -29.490 1.00 59.35  ? 255  LYS A CG    1 
ATOM   1648 C  CD    . LYS A 1 209 ? 10.791  -0.783   -29.375 1.00 75.60  ? 255  LYS A CD    1 
ATOM   1649 C  CE    . LYS A 1 209 ? 9.889   0.198    -30.090 1.00 88.85  ? 255  LYS A CE    1 
ATOM   1650 N  NZ    . LYS A 1 209 ? 8.452   -0.047   -29.812 1.00 94.30  ? 255  LYS A NZ    1 
ATOM   1651 N  N     . ASN A 1 210 ? 15.500  -1.134   -26.204 1.00 37.84  ? 256  ASN A N     1 
ATOM   1652 C  CA    . ASN A 1 210 ? 16.514  -1.923   -25.530 1.00 36.31  ? 256  ASN A CA    1 
ATOM   1653 C  C     . ASN A 1 210 ? 17.622  -1.033   -24.969 1.00 39.41  ? 256  ASN A C     1 
ATOM   1654 O  O     . ASN A 1 210 ? 18.148  -0.228   -25.661 1.00 37.63  ? 256  ASN A O     1 
ATOM   1655 C  CB    . ASN A 1 210 ? 17.035  -2.916   -26.556 1.00 30.02  ? 256  ASN A CB    1 
ATOM   1656 C  CG    . ASN A 1 210 ? 17.956  -3.962   -26.004 1.00 37.98  ? 256  ASN A CG    1 
ATOM   1657 O  OD1   . ASN A 1 210 ? 18.238  -4.035   -24.845 1.00 30.36  ? 256  ASN A OD1   1 
ATOM   1658 N  ND2   . ASN A 1 210 ? 18.439  -4.782   -26.883 1.00 32.64  ? 256  ASN A ND2   1 
ATOM   1659 N  N     . ASP A 1 211 ? 18.033  -1.282   -23.740 1.00 37.44  ? 257  ASP A N     1 
ATOM   1660 C  CA    . ASP A 1 211 ? 19.093  -0.557   -23.051 1.00 37.18  ? 257  ASP A CA    1 
ATOM   1661 C  C     . ASP A 1 211 ? 20.480  -0.894   -23.567 1.00 39.47  ? 257  ASP A C     1 
ATOM   1662 O  O     . ASP A 1 211 ? 21.412  -0.189   -23.349 1.00 40.82  ? 257  ASP A O     1 
ATOM   1663 C  CB    . ASP A 1 211 ? 19.062  -0.849   -21.564 1.00 39.14  ? 257  ASP A CB    1 
ATOM   1664 C  CG    . ASP A 1 211 ? 17.977  -0.126   -20.845 1.00 51.85  ? 257  ASP A CG    1 
ATOM   1665 O  OD1   . ASP A 1 211 ? 17.387  0.803    -21.375 1.00 49.25  ? 257  ASP A OD1   1 
ATOM   1666 O  OD2   . ASP A 1 211 ? 17.709  -0.493   -19.710 1.00 65.00  ? 257  ASP A OD2   1 
ATOM   1667 N  N     . ASN A 1 212 ? 20.593  -2.034   -24.198 1.00 33.04  ? 258  ASN A N     1 
ATOM   1668 C  CA    . ASN A 1 212 ? 21.828  -2.559   -24.749 1.00 31.41  ? 258  ASN A CA    1 
ATOM   1669 C  C     . ASN A 1 212 ? 21.552  -3.002   -26.189 1.00 32.91  ? 258  ASN A C     1 
ATOM   1670 O  O     . ASN A 1 212 ? 21.855  -4.124   -26.575 1.00 31.73  ? 258  ASN A O     1 
ATOM   1671 C  CB    . ASN A 1 212 ? 22.379  -3.707   -23.870 1.00 29.19  ? 258  ASN A CB    1 
ATOM   1672 C  CG    . ASN A 1 212 ? 23.692  -4.228   -24.370 1.00 41.69  ? 258  ASN A CG    1 
ATOM   1673 O  OD1   . ASN A 1 212 ? 24.524  -3.464   -24.849 1.00 33.75  ? 258  ASN A OD1   1 
ATOM   1674 N  ND2   . ASN A 1 212 ? 23.873  -5.543   -24.353 1.00 33.76  ? 258  ASN A ND2   1 
ATOM   1675 N  N     . SER A 1 213 ? 20.999  -2.099   -26.986 1.00 31.34  ? 259  SER A N     1 
ATOM   1676 C  CA    . SER A 1 213 ? 20.613  -2.372   -28.373 1.00 30.39  ? 259  SER A CA    1 
ATOM   1677 C  C     . SER A 1 213 ? 21.827  -2.497   -29.290 1.00 33.63  ? 259  SER A C     1 
ATOM   1678 O  O     . SER A 1 213 ? 22.701  -1.654   -29.228 1.00 33.51  ? 259  SER A O     1 
ATOM   1679 C  CB    . SER A 1 213 ? 19.643  -1.297   -28.865 1.00 31.25  ? 259  SER A CB    1 
ATOM   1680 O  OG    . SER A 1 213 ? 19.163  -1.473   -30.191 1.00 36.76  ? 259  SER A OG    1 
ATOM   1681 N  N     . SER A 1 214 ? 21.898  -3.564   -30.114 1.00 30.55  ? 260  SER A N     1 
ATOM   1682 C  CA    . SER A 1 214 ? 22.965  -3.743   -31.109 1.00 29.43  ? 260  SER A CA    1 
ATOM   1683 C  C     . SER A 1 214 ? 22.605  -2.850   -32.246 1.00 33.79  ? 260  SER A C     1 
ATOM   1684 O  O     . SER A 1 214 ? 21.486  -2.945   -32.788 1.00 34.29  ? 260  SER A O     1 
ATOM   1685 C  CB    . SER A 1 214 ? 23.056  -5.188   -31.600 1.00 34.93  ? 260  SER A CB    1 
ATOM   1686 O  OG    . SER A 1 214 ? 22.867  -6.136   -30.564 1.00 41.54  ? 260  SER A OG    1 
ATOM   1687 N  N     . ARG A 1 215 ? 23.533  -1.910   -32.579 1.00 28.90  ? 261  ARG A N     1 
ATOM   1688 C  CA    . ARG A 1 215 ? 23.340  -0.929   -33.618 1.00 26.62  ? 261  ARG A CA    1 
ATOM   1689 C  C     . ARG A 1 215 ? 24.162  -1.311   -34.840 1.00 32.83  ? 261  ARG A C     1 
ATOM   1690 O  O     . ARG A 1 215 ? 24.559  -0.474   -35.667 1.00 31.25  ? 261  ARG A O     1 
ATOM   1691 C  CB    . ARG A 1 215 ? 23.614  0.481    -33.076 1.00 24.73  ? 261  ARG A CB    1 
ATOM   1692 C  CG    . ARG A 1 215 ? 22.767  0.889    -31.837 1.00 30.77  ? 261  ARG A CG    1 
ATOM   1693 C  CD    . ARG A 1 215 ? 21.273  0.517    -31.865 1.00 29.23  ? 261  ARG A CD    1 
ATOM   1694 N  NE    . ARG A 1 215 ? 20.556  1.150    -32.971 1.00 30.94  ? 261  ARG A NE    1 
ATOM   1695 C  CZ    . ARG A 1 215 ? 19.357  0.802    -33.424 1.00 36.73  ? 261  ARG A CZ    1 
ATOM   1696 N  NH1   . ARG A 1 215 ? 18.727  -0.249   -32.920 1.00 26.13  ? 261  ARG A NH1   1 
ATOM   1697 N  NH2   . ARG A 1 215 ? 18.808  1.457    -34.435 1.00 40.26  ? 261  ARG A NH2   1 
ATOM   1698 N  N     . PHE A 1 216 ? 24.373  -2.623   -34.975 1.00 29.99  ? 262  PHE A N     1 
ATOM   1699 C  CA    . PHE A 1 216 ? 25.107  -3.233   -36.105 1.00 30.01  ? 262  PHE A CA    1 
ATOM   1700 C  C     . PHE A 1 216 ? 24.706  -4.697   -36.082 1.00 30.93  ? 262  PHE A C     1 
ATOM   1701 O  O     . PHE A 1 216 ? 24.354  -5.200   -35.018 1.00 28.64  ? 262  PHE A O     1 
ATOM   1702 C  CB    . PHE A 1 216 ? 26.658  -3.112   -35.938 1.00 30.69  ? 262  PHE A CB    1 
ATOM   1703 C  CG    . PHE A 1 216 ? 27.251  -3.888   -34.780 1.00 32.00  ? 262  PHE A CG    1 
ATOM   1704 C  CD1   . PHE A 1 216 ? 27.247  -3.363   -33.497 1.00 36.56  ? 262  PHE A CD1   1 
ATOM   1705 C  CD2   . PHE A 1 216 ? 27.778  -5.162   -34.971 1.00 34.68  ? 262  PHE A CD2   1 
ATOM   1706 C  CE1   . PHE A 1 216 ? 27.728  -4.115   -32.407 1.00 38.18  ? 262  PHE A CE1   1 
ATOM   1707 C  CE2   . PHE A 1 216 ? 28.282  -5.909   -33.888 1.00 38.97  ? 262  PHE A CE2   1 
ATOM   1708 C  CZ    . PHE A 1 216 ? 28.252  -5.380   -32.612 1.00 37.61  ? 262  PHE A CZ    1 
ATOM   1709 N  N     . GLY A 1 217 ? 24.836  -5.368   -37.218 1.00 28.58  ? 263  GLY A N     1 
ATOM   1710 C  CA    . GLY A 1 217 ? 24.605  -6.806   -37.320 1.00 29.79  ? 263  GLY A CA    1 
ATOM   1711 C  C     . GLY A 1 217 ? 25.933  -7.539   -37.279 1.00 34.45  ? 263  GLY A C     1 
ATOM   1712 O  O     . GLY A 1 217 ? 26.988  -6.929   -37.515 1.00 31.50  ? 263  GLY A O     1 
ATOM   1713 N  N     . LYS A 1 218 ? 25.919  -8.818   -36.894 1.00 32.69  ? 264  LYS A N     1 
ATOM   1714 C  CA    . LYS A 1 218 ? 27.172  -9.572   -36.892 1.00 32.63  ? 264  LYS A CA    1 
ATOM   1715 C  C     . LYS A 1 218 ? 26.967  -11.050  -37.168 1.00 36.93  ? 264  LYS A C     1 
ATOM   1716 O  O     . LYS A 1 218 ? 25.974  -11.648  -36.755 1.00 36.66  ? 264  LYS A O     1 
ATOM   1717 C  CB    . LYS A 1 218 ? 28.027  -9.349   -35.623 1.00 37.07  ? 264  LYS A CB    1 
ATOM   1718 C  CG    . LYS A 1 218 ? 27.413  -9.858   -34.319 1.00 45.22  ? 264  LYS A CG    1 
ATOM   1719 C  CD    . LYS A 1 218 ? 28.441  -9.840   -33.219 1.00 55.47  ? 264  LYS A CD    1 
ATOM   1720 C  CE    . LYS A 1 218 ? 27.791  -9.846   -31.867 1.00 69.77  ? 264  LYS A CE    1 
ATOM   1721 N  NZ    . LYS A 1 218 ? 27.225  -11.178  -31.511 1.00 82.00  ? 264  LYS A NZ    1 
ATOM   1722 N  N     . PHE A 1 219 ? 27.894  -11.604  -37.936 1.00 33.61  ? 265  PHE A N     1 
ATOM   1723 C  CA    . PHE A 1 219 ? 27.897  -13.015  -38.241 1.00 33.25  ? 265  PHE A CA    1 
ATOM   1724 C  C     . PHE A 1 219 ? 29.229  -13.470  -37.682 1.00 37.63  ? 265  PHE A C     1 
ATOM   1725 O  O     . PHE A 1 219 ? 30.275  -12.941  -38.057 1.00 36.86  ? 265  PHE A O     1 
ATOM   1726 C  CB    . PHE A 1 219 ? 27.841  -13.246  -39.749 1.00 34.77  ? 265  PHE A CB    1 
ATOM   1727 C  CG    . PHE A 1 219 ? 27.912  -14.694  -40.144 1.00 37.11  ? 265  PHE A CG    1 
ATOM   1728 C  CD1   . PHE A 1 219 ? 26.789  -15.500  -40.075 1.00 39.58  ? 265  PHE A CD1   1 
ATOM   1729 C  CD2   . PHE A 1 219 ? 29.103  -15.248  -40.584 1.00 39.60  ? 265  PHE A CD2   1 
ATOM   1730 C  CE1   . PHE A 1 219 ? 26.851  -16.833  -40.438 1.00 41.10  ? 265  PHE A CE1   1 
ATOM   1731 C  CE2   . PHE A 1 219 ? 29.172  -16.579  -40.947 1.00 42.35  ? 265  PHE A CE2   1 
ATOM   1732 C  CZ    . PHE A 1 219 ? 28.045  -17.373  -40.874 1.00 40.61  ? 265  PHE A CZ    1 
ATOM   1733 N  N     . ILE A 1 220 ? 29.226  -14.420  -36.794 1.00 33.46  ? 266  ILE A N     1 
ATOM   1734 C  CA    . ILE A 1 220 ? 30.443  -14.906  -36.250 1.00 34.17  ? 266  ILE A CA    1 
ATOM   1735 C  C     . ILE A 1 220 ? 30.670  -16.315  -36.706 1.00 37.00  ? 266  ILE A C     1 
ATOM   1736 O  O     . ILE A 1 220 ? 29.801  -17.105  -36.649 1.00 34.27  ? 266  ILE A O     1 
ATOM   1737 C  CB    . ILE A 1 220 ? 30.339  -14.954  -34.754 1.00 38.63  ? 266  ILE A CB    1 
ATOM   1738 C  CG1   . ILE A 1 220 ? 30.046  -13.585  -34.249 1.00 40.56  ? 266  ILE A CG1   1 
ATOM   1739 C  CG2   . ILE A 1 220 ? 31.622  -15.449  -34.155 1.00 39.77  ? 266  ILE A CG2   1 
ATOM   1740 C  CD1   . ILE A 1 220 ? 29.563  -13.574  -32.837 1.00 67.18  ? 266  ILE A CD1   1 
ATOM   1741 N  N     . ARG A 1 221 ? 31.859  -16.615  -37.158 1.00 36.16  ? 267  ARG A N     1 
ATOM   1742 C  CA    . ARG A 1 221 ? 32.208  -17.948  -37.575 1.00 35.59  ? 267  ARG A CA    1 
ATOM   1743 C  C     . ARG A 1 221 ? 33.172  -18.562  -36.614 1.00 39.33  ? 267  ARG A C     1 
ATOM   1744 O  O     . ARG A 1 221 ? 34.176  -17.997  -36.335 1.00 41.14  ? 267  ARG A O     1 
ATOM   1745 C  CB    . ARG A 1 221 ? 32.956  -17.905  -38.864 1.00 35.13  ? 267  ARG A CB    1 
ATOM   1746 C  CG    . ARG A 1 221 ? 32.134  -17.705  -40.077 1.00 47.30  ? 267  ARG A CG    1 
ATOM   1747 C  CD    . ARG A 1 221 ? 33.021  -17.926  -41.264 1.00 58.09  ? 267  ARG A CD    1 
ATOM   1748 N  NE    . ARG A 1 221 ? 32.393  -17.429  -42.453 1.00 77.42  ? 267  ARG A NE    1 
ATOM   1749 C  CZ    . ARG A 1 221 ? 32.600  -17.933  -43.655 1.00 100.50 ? 267  ARG A CZ    1 
ATOM   1750 N  NH1   . ARG A 1 221 ? 33.440  -18.940  -43.816 1.00 88.20  ? 267  ARG A NH1   1 
ATOM   1751 N  NH2   . ARG A 1 221 ? 31.963  -17.429  -44.681 1.00 89.76  ? 267  ARG A NH2   1 
ATOM   1752 N  N     . ILE A 1 222 ? 32.884  -19.747  -36.140 1.00 34.04  ? 268  ILE A N     1 
ATOM   1753 C  CA    . ILE A 1 222 ? 33.800  -20.408  -35.273 1.00 33.22  ? 268  ILE A CA    1 
ATOM   1754 C  C     . ILE A 1 222 ? 34.384  -21.537  -36.087 1.00 36.74  ? 268  ILE A C     1 
ATOM   1755 O  O     . ILE A 1 222 ? 33.651  -22.317  -36.589 1.00 36.07  ? 268  ILE A O     1 
ATOM   1756 C  CB    . ILE A 1 222 ? 33.079  -20.828  -34.017 1.00 35.47  ? 268  ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1 222 ? 32.538  -19.576  -33.382 1.00 35.11  ? 268  ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1 222 ? 34.010  -21.526  -33.075 1.00 35.08  ? 268  ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1 222 ? 31.821  -19.797  -32.097 1.00 45.44  ? 268  ILE A CD1   1 
ATOM   1760 N  N     . ASN A 1 223 ? 35.706  -21.530  -36.227 1.00 33.95  ? 269  ASN A N     1 
ATOM   1761 C  CA    . ASN A 1 223 ? 36.421  -22.520  -37.014 1.00 34.22  ? 269  ASN A CA    1 
ATOM   1762 C  C     . ASN A 1 223 ? 36.909  -23.663  -36.145 1.00 36.39  ? 269  ASN A C     1 
ATOM   1763 O  O     . ASN A 1 223 ? 37.531  -23.460  -35.102 1.00 36.04  ? 269  ASN A O     1 
ATOM   1764 C  CB    . ASN A 1 223 ? 37.602  -21.873  -37.741 1.00 36.05  ? 269  ASN A CB    1 
ATOM   1765 C  CG    . ASN A 1 223 ? 37.163  -20.965  -38.872 1.00 48.02  ? 269  ASN A CG    1 
ATOM   1766 O  OD1   . ASN A 1 223 ? 36.063  -21.107  -39.407 1.00 35.96  ? 269  ASN A OD1   1 
ATOM   1767 N  ND2   . ASN A 1 223 ? 38.023  -20.023  -39.243 1.00 38.49  ? 269  ASN A ND2   1 
ATOM   1768 N  N     . PHE A 1 224 ? 36.612  -24.870  -36.600 1.00 33.02  ? 270  PHE A N     1 
ATOM   1769 C  CA    . PHE A 1 224 ? 36.978  -26.083  -35.901 1.00 31.68  ? 270  PHE A CA    1 
ATOM   1770 C  C     . PHE A 1 224 ? 37.956  -26.974  -36.661 1.00 34.22  ? 270  PHE A C     1 
ATOM   1771 O  O     . PHE A 1 224 ? 37.968  -26.924  -37.868 1.00 29.72  ? 270  PHE A O     1 
ATOM   1772 C  CB    . PHE A 1 224 ? 35.729  -26.925  -35.692 1.00 32.15  ? 270  PHE A CB    1 
ATOM   1773 C  CG    . PHE A 1 224 ? 34.684  -26.309  -34.814 1.00 33.04  ? 270  PHE A CG    1 
ATOM   1774 C  CD1   . PHE A 1 224 ? 34.768  -26.402  -33.461 1.00 33.23  ? 270  PHE A CD1   1 
ATOM   1775 C  CD2   . PHE A 1 224 ? 33.670  -25.574  -35.351 1.00 33.45  ? 270  PHE A CD2   1 
ATOM   1776 C  CE1   . PHE A 1 224 ? 33.851  -25.813  -32.660 1.00 33.33  ? 270  PHE A CE1   1 
ATOM   1777 C  CE2   . PHE A 1 224 ? 32.735  -24.989  -34.556 1.00 36.41  ? 270  PHE A CE2   1 
ATOM   1778 C  CZ    . PHE A 1 224 ? 32.831  -25.104  -33.206 1.00 33.80  ? 270  PHE A CZ    1 
ATOM   1779 N  N     . ASP A 1 225 ? 38.788  -27.742  -35.928 1.00 33.12  ? 271  ASP A N     1 
ATOM   1780 C  CA    . ASP A 1 225 ? 39.690  -28.760  -36.479 1.00 33.45  ? 271  ASP A CA    1 
ATOM   1781 C  C     . ASP A 1 225 ? 39.005  -30.105  -36.750 1.00 38.09  ? 271  ASP A C     1 
ATOM   1782 O  O     . ASP A 1 225 ? 37.974  -30.415  -36.154 1.00 34.93  ? 271  ASP A O     1 
ATOM   1783 C  CB    . ASP A 1 225 ? 40.893  -28.964  -35.555 1.00 35.54  ? 271  ASP A CB    1 
ATOM   1784 C  CG    . ASP A 1 225 ? 40.492  -29.443  -34.174 1.00 49.89  ? 271  ASP A CG    1 
ATOM   1785 O  OD1   . ASP A 1 225 ? 39.275  -29.545  -33.909 1.00 52.23  ? 271  ASP A OD1   1 
ATOM   1786 O  OD2   . ASP A 1 225 ? 41.392  -29.718  -33.353 1.00 54.96  ? 271  ASP A OD2   1 
ATOM   1787 N  N     . VAL A 1 226 ? 39.586  -30.897  -37.652 1.00 34.14  ? 272  VAL A N     1 
ATOM   1788 C  CA    . VAL A 1 226 ? 39.023  -32.188  -38.021 1.00 34.78  ? 272  VAL A CA    1 
ATOM   1789 C  C     . VAL A 1 226 ? 38.689  -33.047  -36.760 1.00 38.19  ? 272  VAL A C     1 
ATOM   1790 O  O     . VAL A 1 226 ? 37.838  -33.945  -36.827 1.00 38.04  ? 272  VAL A O     1 
ATOM   1791 C  CB    . VAL A 1 226 ? 39.914  -32.885  -39.080 1.00 38.87  ? 272  VAL A CB    1 
ATOM   1792 C  CG1   . VAL A 1 226 ? 41.299  -33.231  -38.542 1.00 38.91  ? 272  VAL A CG1   1 
ATOM   1793 C  CG2   . VAL A 1 226 ? 39.222  -34.090  -39.714 1.00 39.57  ? 272  VAL A CG2   1 
ATOM   1794 N  N     . ALA A 1 227 ? 39.232  -32.670  -35.593 1.00 34.08  ? 273  ALA A N     1 
ATOM   1795 C  CA    . ALA A 1 227 ? 38.932  -33.388  -34.337 1.00 34.13  ? 273  ALA A CA    1 
ATOM   1796 C  C     . ALA A 1 227 ? 37.757  -32.752  -33.559 1.00 36.66  ? 273  ALA A C     1 
ATOM   1797 O  O     . ALA A 1 227 ? 37.494  -33.135  -32.410 1.00 38.02  ? 273  ALA A O     1 
ATOM   1798 C  CB    . ALA A 1 227 ? 40.197  -33.475  -33.460 1.00 34.09  ? 273  ALA A CB    1 
ATOM   1799 N  N     . GLY A 1 228 ? 37.081  -31.796  -34.197 1.00 33.07  ? 274  GLY A N     1 
ATOM   1800 C  CA    . GLY A 1 228 ? 35.962  -31.034  -33.648 1.00 33.15  ? 274  GLY A CA    1 
ATOM   1801 C  C     . GLY A 1 228 ? 36.294  -30.038  -32.547 1.00 36.53  ? 274  GLY A C     1 
ATOM   1802 O  O     . GLY A 1 228 ? 35.473  -29.810  -31.658 1.00 34.76  ? 274  GLY A O     1 
ATOM   1803 N  N     . TYR A 1 229 ? 37.493  -29.462  -32.571 1.00 33.81  ? 275  TYR A N     1 
ATOM   1804 C  CA    . TYR A 1 229 ? 37.947  -28.503  -31.555 1.00 35.28  ? 275  TYR A CA    1 
ATOM   1805 C  C     . TYR A 1 229 ? 38.056  -27.128  -32.160 1.00 35.88  ? 275  TYR A C     1 
ATOM   1806 O  O     . TYR A 1 229 ? 38.495  -27.028  -33.303 1.00 33.38  ? 275  TYR A O     1 
ATOM   1807 C  CB    . TYR A 1 229 ? 39.358  -28.868  -31.047 1.00 38.31  ? 275  TYR A CB    1 
ATOM   1808 C  CG    . TYR A 1 229 ? 39.432  -30.120  -30.218 1.00 43.83  ? 275  TYR A CG    1 
ATOM   1809 C  CD1   . TYR A 1 229 ? 38.741  -30.223  -29.014 1.00 46.59  ? 275  TYR A CD1   1 
ATOM   1810 C  CD2   . TYR A 1 229 ? 40.292  -31.156  -30.566 1.00 45.15  ? 275  TYR A CD2   1 
ATOM   1811 C  CE1   . TYR A 1 229 ? 38.880  -31.336  -28.198 1.00 49.63  ? 275  TYR A CE1   1 
ATOM   1812 C  CE2   . TYR A 1 229 ? 40.406  -32.293  -29.778 1.00 45.78  ? 275  TYR A CE2   1 
ATOM   1813 C  CZ    . TYR A 1 229 ? 39.694  -32.381  -28.598 1.00 53.10  ? 275  TYR A CZ    1 
ATOM   1814 O  OH    . TYR A 1 229 ? 39.794  -33.495  -27.816 1.00 51.28  ? 275  TYR A OH    1 
ATOM   1815 N  N     . ILE A 1 230 ? 37.764  -26.070  -31.379 1.00 34.32  ? 276  ILE A N     1 
ATOM   1816 C  CA    . ILE A 1 230 ? 37.854  -24.667  -31.856 1.00 34.66  ? 276  ILE A CA    1 
ATOM   1817 C  C     . ILE A 1 230 ? 39.296  -24.336  -32.160 1.00 39.44  ? 276  ILE A C     1 
ATOM   1818 O  O     . ILE A 1 230 ? 40.140  -24.552  -31.297 1.00 38.92  ? 276  ILE A O     1 
ATOM   1819 C  CB    . ILE A 1 230 ? 37.237  -23.622  -30.867 1.00 37.58  ? 276  ILE A CB    1 
ATOM   1820 C  CG1   . ILE A 1 230 ? 35.780  -23.944  -30.537 1.00 38.02  ? 276  ILE A CG1   1 
ATOM   1821 C  CG2   . ILE A 1 230 ? 37.390  -22.165  -31.415 1.00 39.34  ? 276  ILE A CG2   1 
ATOM   1822 C  CD1   . ILE A 1 230 ? 35.278  -23.301  -29.319 1.00 49.53  ? 276  ILE A CD1   1 
ATOM   1823 N  N     . VAL A 1 231 ? 39.574  -23.793  -33.382 1.00 38.08  ? 277  VAL A N     1 
ATOM   1824 C  CA    . VAL A 1 231 ? 40.910  -23.364  -33.835 1.00 37.29  ? 277  VAL A CA    1 
ATOM   1825 C  C     . VAL A 1 231 ? 41.002  -21.839  -34.102 1.00 40.80  ? 277  VAL A C     1 
ATOM   1826 O  O     . VAL A 1 231 ? 42.101  -21.289  -34.221 1.00 39.68  ? 277  VAL A O     1 
ATOM   1827 C  CB    . VAL A 1 231 ? 41.472  -24.185  -35.034 1.00 42.02  ? 277  VAL A CB    1 
ATOM   1828 C  CG1   . VAL A 1 231 ? 41.667  -25.650  -34.665 1.00 42.46  ? 277  VAL A CG1   1 
ATOM   1829 C  CG2   . VAL A 1 231 ? 40.639  -24.037  -36.300 1.00 41.58  ? 277  VAL A CG2   1 
ATOM   1830 N  N     . GLY A 1 232 ? 39.852  -21.190  -34.225 1.00 37.38  ? 278  GLY A N     1 
ATOM   1831 C  CA    . GLY A 1 232 ? 39.758  -19.763  -34.497 1.00 36.07  ? 278  GLY A CA    1 
ATOM   1832 C  C     . GLY A 1 232 ? 38.322  -19.285  -34.619 1.00 40.27  ? 278  GLY A C     1 
ATOM   1833 O  O     . GLY A 1 232 ? 37.365  -20.066  -34.487 1.00 39.08  ? 278  GLY A O     1 
ATOM   1834 N  N     . ALA A 1 233 ? 38.168  -17.985  -34.839 1.00 35.71  ? 279  ALA A N     1 
ATOM   1835 C  CA    . ALA A 1 233 ? 36.876  -17.344  -35.030 1.00 35.87  ? 279  ALA A CA    1 
ATOM   1836 C  C     . ALA A 1 233 ? 37.077  -16.141  -35.923 1.00 38.07  ? 279  ALA A C     1 
ATOM   1837 O  O     . ALA A 1 233 ? 38.190  -15.611  -35.974 1.00 36.08  ? 279  ALA A O     1 
ATOM   1838 C  CB    . ALA A 1 233 ? 36.277  -16.925  -33.696 1.00 36.61  ? 279  ALA A CB    1 
ATOM   1839 N  N     . ASN A 1 234 ? 36.051  -15.790  -36.690 1.00 33.68  ? 280  ASN A N     1 
ATOM   1840 C  CA    . ASN A 1 234 ? 36.104  -14.651  -37.593 1.00 33.19  ? 280  ASN A CA    1 
ATOM   1841 C  C     . ASN A 1 234 ? 34.849  -13.820  -37.390 1.00 36.80  ? 280  ASN A C     1 
ATOM   1842 O  O     . ASN A 1 234 ? 33.765  -14.367  -37.186 1.00 32.74  ? 280  ASN A O     1 
ATOM   1843 C  CB    . ASN A 1 234 ? 36.201  -15.120  -39.046 1.00 31.12  ? 280  ASN A CB    1 
ATOM   1844 C  CG    . ASN A 1 234 ? 36.549  -13.994  -40.000 1.00 69.07  ? 280  ASN A CG    1 
ATOM   1845 O  OD1   . ASN A 1 234 ? 37.248  -13.048  -39.634 1.00 74.47  ? 280  ASN A OD1   1 
ATOM   1846 N  ND2   . ASN A 1 234 ? 36.062  -14.090  -41.231 1.00 71.74  ? 280  ASN A ND2   1 
ATOM   1847 N  N     . ILE A 1 235 ? 34.987  -12.501  -37.443 1.00 33.90  ? 281  ILE A N     1 
ATOM   1848 C  CA    . ILE A 1 235 ? 33.832  -11.638  -37.244 1.00 33.74  ? 281  ILE A CA    1 
ATOM   1849 C  C     . ILE A 1 235 ? 33.505  -10.744  -38.435 1.00 37.94  ? 281  ILE A C     1 
ATOM   1850 O  O     . ILE A 1 235 ? 34.364  -10.028  -38.950 1.00 36.46  ? 281  ILE A O     1 
ATOM   1851 C  CB    . ILE A 1 235 ? 34.007  -10.752  -35.994 1.00 36.86  ? 281  ILE A CB    1 
ATOM   1852 C  CG1   . ILE A 1 235 ? 34.025  -11.612  -34.729 1.00 37.10  ? 281  ILE A CG1   1 
ATOM   1853 C  CG2   . ILE A 1 235 ? 32.901  -9.710   -35.922 1.00 37.82  ? 281  ILE A CG2   1 
ATOM   1854 C  CD1   . ILE A 1 235 ? 34.452  -10.862  -33.487 1.00 47.17  ? 281  ILE A CD1   1 
ATOM   1855 N  N     . GLU A 1 236 ? 32.248  -10.799  -38.860 1.00 33.42  ? 282  GLU A N     1 
ATOM   1856 C  CA    . GLU A 1 236 ? 31.754  -9.973   -39.939 1.00 33.84  ? 282  GLU A CA    1 
ATOM   1857 C  C     . GLU A 1 236 ? 30.753  -9.049   -39.267 1.00 34.45  ? 282  GLU A C     1 
ATOM   1858 O  O     . GLU A 1 236 ? 29.926  -9.532   -38.510 1.00 35.26  ? 282  GLU A O     1 
ATOM   1859 C  CB    . GLU A 1 236 ? 30.960  -10.800  -40.947 1.00 36.30  ? 282  GLU A CB    1 
ATOM   1860 C  CG    . GLU A 1 236 ? 31.751  -11.759  -41.812 1.00 66.89  ? 282  GLU A CG    1 
ATOM   1861 C  CD    . GLU A 1 236 ? 32.903  -11.167  -42.600 1.00 116.36 ? 282  GLU A CD    1 
ATOM   1862 O  OE1   . GLU A 1 236 ? 32.711  -10.106  -43.237 1.00 112.98 ? 282  GLU A OE1   1 
ATOM   1863 O  OE2   . GLU A 1 236 ? 33.999  -11.774  -42.582 1.00 126.50 ? 282  GLU A OE2   1 
ATOM   1864 N  N     . THR A 1 237 ? 30.809  -7.751   -39.525 1.00 28.71  ? 283  THR A N     1 
ATOM   1865 C  CA    . THR A 1 237 ? 29.843  -6.819   -38.982 1.00 28.98  ? 283  THR A CA    1 
ATOM   1866 C  C     . THR A 1 237 ? 29.132  -6.165   -40.120 1.00 36.75  ? 283  THR A C     1 
ATOM   1867 O  O     . THR A 1 237 ? 29.634  -6.130   -41.249 1.00 37.66  ? 283  THR A O     1 
ATOM   1868 C  CB    . THR A 1 237 ? 30.395  -5.848   -37.972 1.00 34.74  ? 283  THR A CB    1 
ATOM   1869 O  OG1   . THR A 1 237 ? 31.410  -5.090   -38.594 1.00 33.27  ? 283  THR A OG1   1 
ATOM   1870 C  CG2   . THR A 1 237 ? 30.878  -6.548   -36.690 1.00 26.97  ? 283  THR A CG2   1 
ATOM   1871 N  N     . TYR A 1 238 ? 27.920  -5.760   -39.888 1.00 32.31  ? 284  TYR A N     1 
ATOM   1872 C  CA    . TYR A 1 238 ? 27.175  -5.174   -40.942 1.00 33.93  ? 284  TYR A CA    1 
ATOM   1873 C  C     . TYR A 1 238 ? 26.475  -3.919   -40.526 1.00 40.66  ? 284  TYR A C     1 
ATOM   1874 O  O     . TYR A 1 238 ? 25.903  -3.848   -39.472 1.00 38.21  ? 284  TYR A O     1 
ATOM   1875 C  CB    . TYR A 1 238 ? 26.126  -6.166   -41.443 1.00 34.77  ? 284  TYR A CB    1 
ATOM   1876 C  CG    . TYR A 1 238 ? 26.641  -7.511   -41.893 1.00 38.05  ? 284  TYR A CG    1 
ATOM   1877 C  CD1   . TYR A 1 238 ? 26.899  -8.518   -41.000 1.00 38.99  ? 284  TYR A CD1   1 
ATOM   1878 C  CD2   . TYR A 1 238 ? 26.860  -7.763   -43.199 1.00 39.24  ? 284  TYR A CD2   1 
ATOM   1879 C  CE1   . TYR A 1 238 ? 27.375  -9.717   -41.416 1.00 39.46  ? 284  TYR A CE1   1 
ATOM   1880 C  CE2   . TYR A 1 238 ? 27.318  -8.968   -43.609 1.00 39.68  ? 284  TYR A CE2   1 
ATOM   1881 C  CZ    . TYR A 1 238 ? 27.573  -9.930   -42.713 1.00 47.13  ? 284  TYR A CZ    1 
ATOM   1882 O  OH    . TYR A 1 238 ? 28.030  -11.103  -43.162 1.00 50.32  ? 284  TYR A OH    1 
ATOM   1883 N  N     . LEU A 1 239 ? 26.563  -2.918   -41.374 1.00 40.52  ? 285  LEU A N     1 
ATOM   1884 C  CA    . LEU A 1 239 ? 25.816  -1.700   -41.186 1.00 41.61  ? 285  LEU A CA    1 
ATOM   1885 C  C     . LEU A 1 239 ? 25.763  -1.005   -39.840 1.00 40.45  ? 285  LEU A C     1 
ATOM   1886 O  O     . LEU A 1 239 ? 24.732  -0.990   -39.232 1.00 39.91  ? 285  LEU A O     1 
ATOM   1887 C  CB    . LEU A 1 239 ? 24.416  -1.858   -41.734 1.00 43.48  ? 285  LEU A CB    1 
ATOM   1888 C  CG    . LEU A 1 239 ? 23.772  -0.552   -42.148 1.00 52.16  ? 285  LEU A CG    1 
ATOM   1889 C  CD1   . LEU A 1 239 ? 24.530  0.043    -43.317 1.00 54.07  ? 285  LEU A CD1   1 
ATOM   1890 C  CD2   . LEU A 1 239 ? 22.351  -0.850   -42.523 1.00 54.51  ? 285  LEU A CD2   1 
ATOM   1891 N  N     . LEU A 1 240 ? 26.878  -0.505   -39.348 1.00 33.15  ? 286  LEU A N     1 
ATOM   1892 C  CA    . LEU A 1 240 ? 26.879  0.232    -38.111 1.00 32.01  ? 286  LEU A CA    1 
ATOM   1893 C  C     . LEU A 1 240 ? 26.029  1.488    -38.250 1.00 35.34  ? 286  LEU A C     1 
ATOM   1894 O  O     . LEU A 1 240 ? 26.078  2.137    -39.241 1.00 33.78  ? 286  LEU A O     1 
ATOM   1895 C  CB    . LEU A 1 240 ? 28.297  0.623    -37.744 1.00 31.94  ? 286  LEU A CB    1 
ATOM   1896 C  CG    . LEU A 1 240 ? 28.514  1.358    -36.436 1.00 36.37  ? 286  LEU A CG    1 
ATOM   1897 C  CD1   . LEU A 1 240 ? 28.174  0.489    -35.255 1.00 34.95  ? 286  LEU A CD1   1 
ATOM   1898 C  CD2   . LEU A 1 240 ? 29.926  1.857    -36.312 1.00 35.40  ? 286  LEU A CD2   1 
ATOM   1899 N  N     . GLU A 1 241 ? 25.264  1.813    -37.226 1.00 33.08  ? 287  GLU A N     1 
ATOM   1900 C  CA    . GLU A 1 241 ? 24.370  3.003    -37.223 1.00 33.12  ? 287  GLU A CA    1 
ATOM   1901 C  C     . GLU A 1 241 ? 25.243  4.205    -36.801 1.00 34.51  ? 287  GLU A C     1 
ATOM   1902 O  O     . GLU A 1 241 ? 25.113  4.719    -35.685 1.00 32.06  ? 287  GLU A O     1 
ATOM   1903 C  CB    . GLU A 1 241 ? 23.214  2.776    -36.238 1.00 34.30  ? 287  GLU A CB    1 
ATOM   1904 C  CG    . GLU A 1 241 ? 21.976  3.613    -36.484 1.00 38.54  ? 287  GLU A CG    1 
ATOM   1905 C  CD    . GLU A 1 241 ? 21.123  3.863    -35.255 1.00 55.41  ? 287  GLU A CD    1 
ATOM   1906 O  OE1   . GLU A 1 241 ? 21.650  3.747    -34.129 1.00 47.56  ? 287  GLU A OE1   1 
ATOM   1907 O  OE2   . GLU A 1 241 ? 19.953  4.270    -35.417 1.00 65.67  ? 287  GLU A OE2   1 
ATOM   1908 N  N     . LYS A 1 242 ? 26.179  4.594    -37.680 1.00 32.18  ? 288  LYS A N     1 
ATOM   1909 C  CA    . LYS A 1 242 ? 27.192  5.640    -37.414 1.00 32.71  ? 288  LYS A CA    1 
ATOM   1910 C  C     . LYS A 1 242 ? 26.612  7.013    -37.059 1.00 38.05  ? 288  LYS A C     1 
ATOM   1911 O  O     . LYS A 1 242 ? 27.283  7.738    -36.342 1.00 36.54  ? 288  LYS A O     1 
ATOM   1912 C  CB    . LYS A 1 242 ? 28.222  5.759    -38.537 1.00 33.73  ? 288  LYS A CB    1 
ATOM   1913 C  CG    . LYS A 1 242 ? 27.662  6.243    -39.863 1.00 37.93  ? 288  LYS A CG    1 
ATOM   1914 C  CD    . LYS A 1 242 ? 28.716  6.114    -40.921 1.00 37.66  ? 288  LYS A CD    1 
ATOM   1915 C  CE    . LYS A 1 242 ? 28.343  6.804    -42.192 1.00 37.49  ? 288  LYS A CE    1 
ATOM   1916 N  NZ    . LYS A 1 242 ? 29.477  6.780    -43.155 1.00 47.15  ? 288  LYS A NZ    1 
ATOM   1917 N  N     . SER A 1 243 ? 25.350  7.317    -37.471 1.00 37.44  ? 289  SER A N     1 
ATOM   1918 C  CA    . SER A 1 243 ? 24.631  8.575    -37.192 1.00 38.29  ? 289  SER A CA    1 
ATOM   1919 C  C     . SER A 1 243 ? 24.325  8.731    -35.705 1.00 44.75  ? 289  SER A C     1 
ATOM   1920 O  O     . SER A 1 243 ? 24.113  9.851    -35.254 1.00 46.40  ? 289  SER A O     1 
ATOM   1921 C  CB    . SER A 1 243 ? 23.338  8.663    -38.008 1.00 43.61  ? 289  SER A CB    1 
ATOM   1922 O  OG    . SER A 1 243 ? 22.477  7.556    -37.768 1.00 53.29  ? 289  SER A OG    1 
ATOM   1923 N  N     . ARG A 1 244 ? 24.315  7.620    -34.941 1.00 40.78  ? 290  ARG A N     1 
ATOM   1924 C  CA    . ARG A 1 244 ? 24.105  7.644    -33.488 1.00 41.00  ? 290  ARG A CA    1 
ATOM   1925 C  C     . ARG A 1 244 ? 25.284  8.337    -32.772 1.00 46.02  ? 290  ARG A C     1 
ATOM   1926 O  O     . ARG A 1 244 ? 25.156  8.723    -31.604 1.00 43.94  ? 290  ARG A O     1 
ATOM   1927 C  CB    . ARG A 1 244 ? 23.884  6.231    -32.934 1.00 41.20  ? 290  ARG A CB    1 
ATOM   1928 C  CG    . ARG A 1 244 ? 23.425  6.211    -31.476 1.00 48.99  ? 290  ARG A CG    1 
ATOM   1929 C  CD    . ARG A 1 244 ? 22.837  4.889    -31.091 1.00 41.33  ? 290  ARG A CD    1 
ATOM   1930 N  NE    . ARG A 1 244 ? 21.498  4.744    -31.641 1.00 43.12  ? 290  ARG A NE    1 
ATOM   1931 C  CZ    . ARG A 1 244 ? 20.381  5.079    -31.009 1.00 49.29  ? 290  ARG A CZ    1 
ATOM   1932 N  NH1   . ARG A 1 244 ? 20.430  5.560    -29.774 1.00 31.14  ? 290  ARG A NH1   1 
ATOM   1933 N  NH2   . ARG A 1 244 ? 19.211  4.949    -31.613 1.00 42.06  ? 290  ARG A NH2   1 
ATOM   1934 N  N     . ALA A 1 245 ? 26.430  8.486    -33.471 1.00 43.97  ? 291  ALA A N     1 
ATOM   1935 C  CA    . ALA A 1 245 ? 27.575  9.171    -32.896 1.00 45.27  ? 291  ALA A CA    1 
ATOM   1936 C  C     . ALA A 1 245 ? 27.303  10.682   -32.809 1.00 47.34  ? 291  ALA A C     1 
ATOM   1937 O  O     . ALA A 1 245 ? 27.798  11.324   -31.893 1.00 48.04  ? 291  ALA A O     1 
ATOM   1938 C  CB    . ALA A 1 245 ? 28.821  8.921    -33.743 1.00 46.60  ? 291  ALA A CB    1 
ATOM   1939 N  N     . ILE A 1 246 ? 26.472  11.229   -33.706 1.00 42.77  ? 292  ILE A N     1 
ATOM   1940 C  CA    . ILE A 1 246 ? 26.229  12.679   -33.800 1.00 42.60  ? 292  ILE A CA    1 
ATOM   1941 C  C     . ILE A 1 246 ? 24.880  13.143   -33.178 1.00 45.27  ? 292  ILE A C     1 
ATOM   1942 O  O     . ILE A 1 246 ? 24.852  14.246   -32.623 1.00 43.91  ? 292  ILE A O     1 
ATOM   1943 C  CB    . ILE A 1 246 ? 26.432  13.195   -35.259 1.00 45.43  ? 292  ILE A CB    1 
ATOM   1944 C  CG1   . ILE A 1 246 ? 25.425  12.581   -36.242 1.00 46.10  ? 292  ILE A CG1   1 
ATOM   1945 C  CG2   . ILE A 1 246 ? 27.897  12.914   -35.714 1.00 43.64  ? 292  ILE A CG2   1 
ATOM   1946 C  CD1   . ILE A 1 246 ? 25.242  13.363   -37.526 1.00 56.78  ? 292  ILE A CD1   1 
ATOM   1947 N  N     . ARG A 1 247 ? 23.801  12.311   -33.229 1.00 39.66  ? 293  ARG A N     1 
ATOM   1948 C  CA    . ARG A 1 247 ? 22.514  12.613   -32.603 1.00 39.50  ? 293  ARG A CA    1 
ATOM   1949 C  C     . ARG A 1 247 ? 21.696  11.353   -32.284 1.00 43.21  ? 293  ARG A C     1 
ATOM   1950 O  O     . ARG A 1 247 ? 21.778  10.341   -32.992 1.00 42.22  ? 293  ARG A O     1 
ATOM   1951 C  CB    . ARG A 1 247 ? 21.667  13.652   -33.377 1.00 42.56  ? 293  ARG A CB    1 
ATOM   1952 C  CG    . ARG A 1 247 ? 21.210  13.243   -34.769 1.00 54.03  ? 293  ARG A CG    1 
ATOM   1953 C  CD    . ARG A 1 247 ? 20.219  14.239   -35.353 1.00 69.39  ? 293  ARG A CD    1 
ATOM   1954 N  NE    . ARG A 1 247 ? 20.757  15.601   -35.413 1.00 82.99  ? 293  ARG A NE    1 
ATOM   1955 C  CZ    . ARG A 1 247 ? 21.535  16.068   -36.384 1.00 88.93  ? 293  ARG A CZ    1 
ATOM   1956 N  NH1   . ARG A 1 247 ? 21.881  15.289   -37.402 1.00 75.49  ? 293  ARG A NH1   1 
ATOM   1957 N  NH2   . ARG A 1 247 ? 21.968  17.318   -36.349 1.00 67.74  ? 293  ARG A NH2   1 
ATOM   1958 N  N     . GLN A 1 248 ? 20.951  11.428   -31.165 1.00 39.38  ? 294  GLN A N     1 
ATOM   1959 C  CA    . GLN A 1 248 ? 20.078  10.392   -30.597 1.00 38.50  ? 294  GLN A CA    1 
ATOM   1960 C  C     . GLN A 1 248 ? 18.758  11.075   -30.304 1.00 41.48  ? 294  GLN A C     1 
ATOM   1961 O  O     . GLN A 1 248 ? 18.750  12.273   -30.054 1.00 39.69  ? 294  GLN A O     1 
ATOM   1962 C  CB    . GLN A 1 248 ? 20.645  9.846    -29.271 1.00 39.19  ? 294  GLN A CB    1 
ATOM   1963 C  CG    . GLN A 1 248 ? 22.113  9.472    -29.333 1.00 40.07  ? 294  GLN A CG    1 
ATOM   1964 C  CD    . GLN A 1 248 ? 23.065  10.622   -29.154 1.00 43.41  ? 294  GLN A CD    1 
ATOM   1965 O  OE1   . GLN A 1 248 ? 22.960  11.431   -28.240 1.00 42.61  ? 294  GLN A OE1   1 
ATOM   1966 N  NE2   . GLN A 1 248 ? 24.023  10.723   -30.037 1.00 30.98  ? 294  GLN A NE2   1 
ATOM   1967 N  N     . ALA A 1 249 ? 17.653  10.315   -30.321 1.00 38.20  ? 295  ALA A N     1 
ATOM   1968 C  CA    . ALA A 1 249 ? 16.312  10.796   -30.052 1.00 38.42  ? 295  ALA A CA    1 
ATOM   1969 C  C     . ALA A 1 249 ? 16.042  10.846   -28.535 1.00 46.63  ? 295  ALA A C     1 
ATOM   1970 O  O     . ALA A 1 249 ? 16.905  10.454   -27.730 1.00 47.58  ? 295  ALA A O     1 
ATOM   1971 C  CB    . ALA A 1 249 ? 15.322  9.868    -30.727 1.00 39.35  ? 295  ALA A CB    1 
ATOM   1972 N  N     . LYS A 1 250 ? 14.824  11.289   -28.154 1.00 44.56  ? 296  LYS A N     1 
ATOM   1973 C  CA    . LYS A 1 250 ? 14.322  11.416   -26.779 1.00 45.05  ? 296  LYS A CA    1 
ATOM   1974 C  C     . LYS A 1 250 ? 14.443  10.095   -26.019 1.00 50.01  ? 296  LYS A C     1 
ATOM   1975 O  O     . LYS A 1 250 ? 14.095  9.036    -26.553 1.00 49.43  ? 296  LYS A O     1 
ATOM   1976 C  CB    . LYS A 1 250 ? 12.866  11.935   -26.807 1.00 47.99  ? 296  LYS A CB    1 
ATOM   1977 C  CG    . LYS A 1 250 ? 12.256  12.271   -25.450 1.00 65.72  ? 296  LYS A CG    1 
ATOM   1978 C  CD    . LYS A 1 250 ? 10.761  12.576   -25.583 1.00 76.07  ? 296  LYS A CD    1 
ATOM   1979 C  CE    . LYS A 1 250 ? 9.971   12.212   -24.350 1.00 89.34  ? 296  LYS A CE    1 
ATOM   1980 N  NZ    . LYS A 1 250 ? 9.118   11.008   -24.568 1.00 98.31  ? 296  LYS A NZ    1 
ATOM   1981 N  N     . ASP A 1 251 ? 14.996  10.154   -24.795 1.00 46.86  ? 297  ASP A N     1 
ATOM   1982 C  CA    . ASP A 1 251 ? 15.215  8.987    -23.937 1.00 46.56  ? 297  ASP A CA    1 
ATOM   1983 C  C     . ASP A 1 251 ? 16.261  8.000    -24.492 1.00 45.47  ? 297  ASP A C     1 
ATOM   1984 O  O     . ASP A 1 251 ? 16.400  6.905    -23.965 1.00 43.44  ? 297  ASP A O     1 
ATOM   1985 C  CB    . ASP A 1 251 ? 13.877  8.254    -23.598 1.00 50.54  ? 297  ASP A CB    1 
ATOM   1986 C  CG    . ASP A 1 251 ? 12.851  9.064    -22.833 1.00 72.08  ? 297  ASP A CG    1 
ATOM   1987 O  OD1   . ASP A 1 251 ? 13.205  9.612    -21.763 1.00 74.80  ? 297  ASP A OD1   1 
ATOM   1988 O  OD2   . ASP A 1 251 ? 11.666  9.057    -23.239 1.00 82.83  ? 297  ASP A OD2   1 
ATOM   1989 N  N     . GLU A 1 252 ? 17.010  8.388    -25.528 1.00 41.74  ? 298  GLU A N     1 
ATOM   1990 C  CA    . GLU A 1 252 ? 18.038  7.530    -26.120 1.00 40.19  ? 298  GLU A CA    1 
ATOM   1991 C  C     . GLU A 1 252 ? 19.445  8.061    -25.918 1.00 44.84  ? 298  GLU A C     1 
ATOM   1992 O  O     . GLU A 1 252 ? 19.672  9.276    -25.837 1.00 44.02  ? 298  GLU A O     1 
ATOM   1993 C  CB    . GLU A 1 252 ? 17.746  7.253    -27.602 1.00 40.80  ? 298  GLU A CB    1 
ATOM   1994 C  CG    . GLU A 1 252 ? 16.536  6.359    -27.784 1.00 45.53  ? 298  GLU A CG    1 
ATOM   1995 C  CD    . GLU A 1 252 ? 16.289  5.766    -29.160 1.00 64.09  ? 298  GLU A CD    1 
ATOM   1996 O  OE1   . GLU A 1 252 ? 17.090  6.023    -30.092 1.00 40.65  ? 298  GLU A OE1   1 
ATOM   1997 O  OE2   . GLU A 1 252 ? 15.285  5.026    -29.295 1.00 54.74  ? 298  GLU A OE2   1 
ATOM   1998 N  N     . CYS A 1 253 ? 20.404  7.143    -25.870 1.00 42.77  ? 299  CYS A N     1 
ATOM   1999 C  CA    . CYS A 1 253 ? 21.818  7.486    -25.700 1.00 41.96  ? 299  CYS A CA    1 
ATOM   2000 C  C     . CYS A 1 253 ? 22.618  7.119    -26.906 1.00 43.48  ? 299  CYS A C     1 
ATOM   2001 O  O     . CYS A 1 253 ? 22.173  6.323    -27.736 1.00 42.14  ? 299  CYS A O     1 
ATOM   2002 C  CB    . CYS A 1 253 ? 22.398  6.828    -24.453 1.00 42.82  ? 299  CYS A CB    1 
ATOM   2003 S  SG    . CYS A 1 253 ? 21.557  7.269    -22.922 1.00 47.26  ? 299  CYS A SG    1 
ATOM   2004 N  N     . SER A 1 254 ? 23.849  7.668    -26.965 1.00 39.26  ? 300  SER A N     1 
ATOM   2005 C  CA    . SER A 1 254 ? 24.847  7.369    -27.981 1.00 39.16  ? 300  SER A CA    1 
ATOM   2006 C  C     . SER A 1 254 ? 25.469  6.000    -27.614 1.00 44.23  ? 300  SER A C     1 
ATOM   2007 O  O     . SER A 1 254 ? 24.967  5.339    -26.686 1.00 46.06  ? 300  SER A O     1 
ATOM   2008 C  CB    . SER A 1 254 ? 25.911  8.465    -28.007 1.00 39.96  ? 300  SER A CB    1 
ATOM   2009 O  OG    . SER A 1 254 ? 26.722  8.258    -29.143 1.00 42.00  ? 300  SER A OG    1 
ATOM   2010 N  N     . PHE A 1 255 ? 26.585  5.657    -28.247 1.00 38.61  ? 301  PHE A N     1 
ATOM   2011 C  CA    . PHE A 1 255 ? 27.268  4.406    -27.963 1.00 37.63  ? 301  PHE A CA    1 
ATOM   2012 C  C     . PHE A 1 255 ? 27.720  4.453    -26.510 1.00 41.08  ? 301  PHE A C     1 
ATOM   2013 O  O     . PHE A 1 255 ? 28.047  5.519    -25.987 1.00 40.49  ? 301  PHE A O     1 
ATOM   2014 C  CB    . PHE A 1 255 ? 28.470  4.223    -28.889 1.00 38.77  ? 301  PHE A CB    1 
ATOM   2015 C  CG    . PHE A 1 255 ? 28.103  4.099    -30.340 1.00 37.95  ? 301  PHE A CG    1 
ATOM   2016 C  CD1   . PHE A 1 255 ? 27.706  2.881    -30.866 1.00 37.78  ? 301  PHE A CD1   1 
ATOM   2017 C  CD2   . PHE A 1 255 ? 28.156  5.200    -31.178 1.00 37.55  ? 301  PHE A CD2   1 
ATOM   2018 C  CE1   . PHE A 1 255 ? 27.367  2.763    -32.201 1.00 37.35  ? 301  PHE A CE1   1 
ATOM   2019 C  CE2   . PHE A 1 255 ? 27.819  5.090    -32.514 1.00 39.15  ? 301  PHE A CE2   1 
ATOM   2020 C  CZ    . PHE A 1 255 ? 27.424  3.869    -33.027 1.00 36.99  ? 301  PHE A CZ    1 
ATOM   2021 N  N     . HIS A 1 256 ? 27.735  3.296    -25.860 1.00 35.14  ? 302  HIS A N     1 
ATOM   2022 C  CA    . HIS A 1 256 ? 28.098  3.217    -24.450 1.00 34.71  ? 302  HIS A CA    1 
ATOM   2023 C  C     . HIS A 1 256 ? 29.516  3.698    -24.156 1.00 41.40  ? 302  HIS A C     1 
ATOM   2024 O  O     . HIS A 1 256 ? 29.747  4.367    -23.149 1.00 43.39  ? 302  HIS A O     1 
ATOM   2025 C  CB    . HIS A 1 256 ? 27.917  1.787    -23.934 1.00 34.42  ? 302  HIS A CB    1 
ATOM   2026 C  CG    . HIS A 1 256 ? 26.514  1.278    -24.048 1.00 36.84  ? 302  HIS A CG    1 
ATOM   2027 N  ND1   . HIS A 1 256 ? 25.478  1.771    -23.284 1.00 37.82  ? 302  HIS A ND1   1 
ATOM   2028 C  CD2   . HIS A 1 256 ? 25.975  0.318    -24.837 1.00 36.96  ? 302  HIS A CD2   1 
ATOM   2029 C  CE1   . HIS A 1 256 ? 24.362  1.138    -23.597 1.00 36.75  ? 302  HIS A CE1   1 
ATOM   2030 N  NE2   . HIS A 1 256 ? 24.636  0.251    -24.537 1.00 36.95  ? 302  HIS A NE2   1 
ATOM   2031 N  N     . ILE A 1 257 ? 30.466  3.366    -25.024 1.00 37.99  ? 303  ILE A N     1 
ATOM   2032 C  CA    . ILE A 1 257 ? 31.846  3.782    -24.794 1.00 38.58  ? 303  ILE A CA    1 
ATOM   2033 C  C     . ILE A 1 257 ? 31.966  5.270    -24.434 1.00 44.78  ? 303  ILE A C     1 
ATOM   2034 O  O     . ILE A 1 257 ? 32.727  5.605    -23.534 1.00 45.16  ? 303  ILE A O     1 
ATOM   2035 C  CB    . ILE A 1 257 ? 32.764  3.364    -25.979 1.00 41.43  ? 303  ILE A CB    1 
ATOM   2036 C  CG1   . ILE A 1 257 ? 34.279  3.471    -25.619 1.00 41.65  ? 303  ILE A CG1   1 
ATOM   2037 C  CG2   . ILE A 1 257 ? 32.416  4.121    -27.289 1.00 41.19  ? 303  ILE A CG2   1 
ATOM   2038 C  CD1   . ILE A 1 257 ? 34.769  2.657    -24.384 1.00 47.86  ? 303  ILE A CD1   1 
ATOM   2039 N  N     . PHE A 1 258 ? 31.188  6.141    -25.096 1.00 42.41  ? 304  PHE A N     1 
ATOM   2040 C  CA    . PHE A 1 258 ? 31.173  7.577    -24.844 1.00 41.85  ? 304  PHE A CA    1 
ATOM   2041 C  C     . PHE A 1 258 ? 30.979  7.916    -23.363 1.00 46.93  ? 304  PHE A C     1 
ATOM   2042 O  O     . PHE A 1 258 ? 31.737  8.717    -22.816 1.00 46.49  ? 304  PHE A O     1 
ATOM   2043 C  CB    . PHE A 1 258 ? 30.110  8.252    -25.726 1.00 42.93  ? 304  PHE A CB    1 
ATOM   2044 C  CG    . PHE A 1 258 ? 30.492  8.260    -27.192 1.00 44.55  ? 304  PHE A CG    1 
ATOM   2045 C  CD1   . PHE A 1 258 ? 31.475  9.122    -27.672 1.00 45.86  ? 304  PHE A CD1   1 
ATOM   2046 C  CD2   . PHE A 1 258 ? 29.892  7.382    -28.088 1.00 47.13  ? 304  PHE A CD2   1 
ATOM   2047 C  CE1   . PHE A 1 258 ? 31.852  9.109    -29.017 1.00 46.12  ? 304  PHE A CE1   1 
ATOM   2048 C  CE2   . PHE A 1 258 ? 30.257  7.387    -29.443 1.00 49.33  ? 304  PHE A CE2   1 
ATOM   2049 C  CZ    . PHE A 1 258 ? 31.234  8.251    -29.893 1.00 46.46  ? 304  PHE A CZ    1 
ATOM   2050 N  N     . TYR A 1 259 ? 30.027  7.224    -22.716 1.00 44.52  ? 305  TYR A N     1 
ATOM   2051 C  CA    . TYR A 1 259 ? 29.600  7.375    -21.327 1.00 45.17  ? 305  TYR A CA    1 
ATOM   2052 C  C     . TYR A 1 259 ? 30.605  6.798    -20.342 1.00 52.27  ? 305  TYR A C     1 
ATOM   2053 O  O     . TYR A 1 259 ? 30.944  7.476    -19.367 1.00 53.07  ? 305  TYR A O     1 
ATOM   2054 C  CB    . TYR A 1 259 ? 28.187  6.786    -21.154 1.00 46.31  ? 305  TYR A CB    1 
ATOM   2055 C  CG    . TYR A 1 259 ? 27.188  7.471    -22.071 1.00 50.11  ? 305  TYR A CG    1 
ATOM   2056 C  CD1   . TYR A 1 259 ? 26.692  8.741    -21.775 1.00 52.21  ? 305  TYR A CD1   1 
ATOM   2057 C  CD2   . TYR A 1 259 ? 26.860  6.918    -23.308 1.00 51.10  ? 305  TYR A CD2   1 
ATOM   2058 C  CE1   . TYR A 1 259 ? 25.849  9.417    -22.661 1.00 53.10  ? 305  TYR A CE1   1 
ATOM   2059 C  CE2   . TYR A 1 259 ? 26.037  7.592    -24.208 1.00 52.15  ? 305  TYR A CE2   1 
ATOM   2060 C  CZ    . TYR A 1 259 ? 25.515  8.831    -23.872 1.00 57.50  ? 305  TYR A CZ    1 
ATOM   2061 O  OH    . TYR A 1 259 ? 24.688  9.467    -24.755 1.00 52.34  ? 305  TYR A OH    1 
ATOM   2062 N  N     . GLN A 1 260 ? 31.114  5.571    -20.621 1.00 48.50  ? 306  GLN A N     1 
ATOM   2063 C  CA    . GLN A 1 260 ? 32.132  4.859    -19.839 1.00 47.90  ? 306  GLN A CA    1 
ATOM   2064 C  C     . GLN A 1 260 ? 33.417  5.701    -19.754 1.00 52.48  ? 306  GLN A C     1 
ATOM   2065 O  O     . GLN A 1 260 ? 33.947  5.898    -18.667 1.00 52.01  ? 306  GLN A O     1 
ATOM   2066 C  CB    . GLN A 1 260 ? 32.426  3.477    -20.457 1.00 48.66  ? 306  GLN A CB    1 
ATOM   2067 C  CG    . GLN A 1 260 ? 31.299  2.451    -20.264 1.00 53.12  ? 306  GLN A CG    1 
ATOM   2068 C  CD    . GLN A 1 260 ? 31.556  1.130    -20.957 1.00 61.04  ? 306  GLN A CD    1 
ATOM   2069 O  OE1   . GLN A 1 260 ? 32.678  0.803    -21.360 1.00 50.15  ? 306  GLN A OE1   1 
ATOM   2070 N  NE2   . GLN A 1 260 ? 30.510  0.342    -21.124 1.00 54.96  ? 306  GLN A NE2   1 
ATOM   2071 N  N     . LEU A 1 261 ? 33.856  6.253    -20.881 1.00 50.20  ? 307  LEU A N     1 
ATOM   2072 C  CA    . LEU A 1 261 ? 35.022  7.127    -20.947 1.00 51.45  ? 307  LEU A CA    1 
ATOM   2073 C  C     . LEU A 1 261 ? 34.842  8.428    -20.152 1.00 59.56  ? 307  LEU A C     1 
ATOM   2074 O  O     . LEU A 1 261 ? 35.694  8.740    -19.324 1.00 59.88  ? 307  LEU A O     1 
ATOM   2075 C  CB    . LEU A 1 261 ? 35.383  7.427    -22.415 1.00 51.00  ? 307  LEU A CB    1 
ATOM   2076 C  CG    . LEU A 1 261 ? 36.624  8.276    -22.705 1.00 54.99  ? 307  LEU A CG    1 
ATOM   2077 C  CD1   . LEU A 1 261 ? 37.905  7.715    -22.006 1.00 54.65  ? 307  LEU A CD1   1 
ATOM   2078 C  CD2   . LEU A 1 261 ? 36.840  8.373    -24.179 1.00 56.26  ? 307  LEU A CD2   1 
ATOM   2079 N  N     . LEU A 1 262 ? 33.736  9.166    -20.380 1.00 58.44  ? 308  LEU A N     1 
ATOM   2080 C  CA    . LEU A 1 262 ? 33.508  10.458   -19.727 1.00 59.04  ? 308  LEU A CA    1 
ATOM   2081 C  C     . LEU A 1 262 ? 33.254  10.356   -18.216 1.00 63.77  ? 308  LEU A C     1 
ATOM   2082 O  O     . LEU A 1 262 ? 33.762  11.187   -17.462 1.00 63.10  ? 308  LEU A O     1 
ATOM   2083 C  CB    . LEU A 1 262 ? 32.415  11.285   -20.437 1.00 58.79  ? 308  LEU A CB    1 
ATOM   2084 C  CG    . LEU A 1 262 ? 32.855  11.849   -21.805 1.00 63.27  ? 308  LEU A CG    1 
ATOM   2085 C  CD1   . LEU A 1 262 ? 31.726  12.542   -22.503 1.00 63.29  ? 308  LEU A CD1   1 
ATOM   2086 C  CD2   . LEU A 1 262 ? 34.002  12.817   -21.662 1.00 65.68  ? 308  LEU A CD2   1 
ATOM   2087 N  N     . GLY A 1 263 ? 32.519  9.336    -17.792 1.00 61.22  ? 309  GLY A N     1 
ATOM   2088 C  CA    . GLY A 1 263 ? 32.227  9.121    -16.382 1.00 61.50  ? 309  GLY A CA    1 
ATOM   2089 C  C     . GLY A 1 263 ? 33.257  8.310    -15.625 1.00 67.03  ? 309  GLY A C     1 
ATOM   2090 O  O     . GLY A 1 263 ? 33.373  8.469    -14.409 1.00 67.72  ? 309  GLY A O     1 
ATOM   2091 N  N     . GLY A 1 264 ? 33.989  7.448    -16.330 1.00 64.21  ? 310  GLY A N     1 
ATOM   2092 C  CA    . GLY A 1 264 ? 34.959  6.539    -15.728 1.00 65.37  ? 310  GLY A CA    1 
ATOM   2093 C  C     . GLY A 1 264 ? 36.441  6.865    -15.730 1.00 72.39  ? 310  GLY A C     1 
ATOM   2094 O  O     . GLY A 1 264 ? 37.188  6.216    -14.991 1.00 72.59  ? 310  GLY A O     1 
ATOM   2095 N  N     . ALA A 1 265 ? 36.898  7.835    -16.557 1.00 70.60  ? 311  ALA A N     1 
ATOM   2096 C  CA    . ALA A 1 265 ? 38.326  8.177    -16.647 1.00 70.81  ? 311  ALA A CA    1 
ATOM   2097 C  C     . ALA A 1 265 ? 38.884  8.908    -15.429 1.00 77.21  ? 311  ALA A C     1 
ATOM   2098 O  O     . ALA A 1 265 ? 38.160  9.633    -14.746 1.00 76.64  ? 311  ALA A O     1 
ATOM   2099 C  CB    . ALA A 1 265 ? 38.612  8.962    -17.910 1.00 71.32  ? 311  ALA A CB    1 
ATOM   2100 N  N     . GLY A 1 266 ? 40.169  8.681    -15.164 1.00 76.27  ? 312  GLY A N     1 
ATOM   2101 C  CA    . GLY A 1 266 ? 40.891  9.314    -14.070 1.00 77.60  ? 312  GLY A CA    1 
ATOM   2102 C  C     . GLY A 1 266 ? 41.277  10.725   -14.444 1.00 84.81  ? 312  GLY A C     1 
ATOM   2103 O  O     . GLY A 1 266 ? 41.251  11.067   -15.628 1.00 85.46  ? 312  GLY A O     1 
ATOM   2104 N  N     . GLU A 1 267 ? 41.649  11.555   -13.450 1.00 82.78  ? 313  GLU A N     1 
ATOM   2105 C  CA    . GLU A 1 267 ? 42.024  12.961   -13.664 1.00 83.07  ? 313  GLU A CA    1 
ATOM   2106 C  C     . GLU A 1 267 ? 43.095  13.157   -14.742 1.00 85.28  ? 313  GLU A C     1 
ATOM   2107 O  O     . GLU A 1 267 ? 42.996  14.103   -15.526 1.00 85.10  ? 313  GLU A O     1 
ATOM   2108 C  CB    . GLU A 1 267 ? 42.427  13.653   -12.349 1.00 84.83  ? 313  GLU A CB    1 
ATOM   2109 C  CG    . GLU A 1 267 ? 41.258  13.929   -11.411 1.00 96.67  ? 313  GLU A CG    1 
ATOM   2110 C  CD    . GLU A 1 267 ? 40.133  14.775   -11.979 1.00 114.22 ? 313  GLU A CD    1 
ATOM   2111 O  OE1   . GLU A 1 267 ? 40.325  16.003   -12.132 1.00 112.95 ? 313  GLU A OE1   1 
ATOM   2112 O  OE2   . GLU A 1 267 ? 39.058  14.205   -12.277 1.00 100.93 ? 313  GLU A OE2   1 
ATOM   2113 N  N     . GLN A 1 268 ? 44.071  12.234   -14.815 1.00 80.41  ? 314  GLN A N     1 
ATOM   2114 C  CA    . GLN A 1 268 ? 45.141  12.274   -15.810 1.00 79.21  ? 314  GLN A CA    1 
ATOM   2115 C  C     . GLN A 1 268 ? 44.656  11.852   -17.209 1.00 80.11  ? 314  GLN A C     1 
ATOM   2116 O  O     . GLN A 1 268 ? 45.144  12.397   -18.206 1.00 79.22  ? 314  GLN A O     1 
ATOM   2117 C  CB    . GLN A 1 268 ? 46.376  11.475   -15.347 1.00 80.26  ? 314  GLN A CB    1 
ATOM   2118 C  CG    . GLN A 1 268 ? 47.667  11.744   -16.149 1.00 98.84  ? 314  GLN A CG    1 
ATOM   2119 C  CD    . GLN A 1 268 ? 48.035  13.205   -16.354 1.00 120.02 ? 314  GLN A CD    1 
ATOM   2120 O  OE1   . GLN A 1 268 ? 47.853  14.069   -15.485 1.00 116.71 ? 314  GLN A OE1   1 
ATOM   2121 N  NE2   . GLN A 1 268 ? 48.606  13.506   -17.506 1.00 111.96 ? 314  GLN A NE2   1 
ATOM   2122 N  N     . LEU A 1 269 ? 43.693  10.907   -17.282 1.00 74.63  ? 315  LEU A N     1 
ATOM   2123 C  CA    . LEU A 1 269 ? 43.147  10.485   -18.574 1.00 73.78  ? 315  LEU A CA    1 
ATOM   2124 C  C     . LEU A 1 269 ? 42.205  11.551   -19.149 1.00 77.17  ? 315  LEU A C     1 
ATOM   2125 O  O     . LEU A 1 269 ? 42.111  11.679   -20.367 1.00 76.54  ? 315  LEU A O     1 
ATOM   2126 C  CB    . LEU A 1 269 ? 42.493  9.094    -18.523 1.00 73.39  ? 315  LEU A CB    1 
ATOM   2127 C  CG    . LEU A 1 269 ? 42.167  8.451    -19.882 1.00 77.33  ? 315  LEU A CG    1 
ATOM   2128 C  CD1   . LEU A 1 269 ? 43.412  8.201    -20.696 1.00 76.80  ? 315  LEU A CD1   1 
ATOM   2129 C  CD2   . LEU A 1 269 ? 41.387  7.162    -19.709 1.00 80.77  ? 315  LEU A CD2   1 
ATOM   2130 N  N     . LYS A 1 270 ? 41.550  12.341   -18.276 1.00 73.80  ? 316  LYS A N     1 
ATOM   2131 C  CA    . LYS A 1 270 ? 40.706  13.462   -18.685 1.00 73.95  ? 316  LYS A CA    1 
ATOM   2132 C  C     . LYS A 1 270 ? 41.642  14.563   -19.220 1.00 79.06  ? 316  LYS A C     1 
ATOM   2133 O  O     . LYS A 1 270 ? 41.310  15.232   -20.202 1.00 78.59  ? 316  LYS A O     1 
ATOM   2134 C  CB    . LYS A 1 270 ? 39.881  13.990   -17.504 1.00 76.25  ? 316  LYS A CB    1 
ATOM   2135 C  CG    . LYS A 1 270 ? 38.750  13.067   -17.065 1.00 82.06  ? 316  LYS A CG    1 
ATOM   2136 C  CD    . LYS A 1 270 ? 38.062  13.608   -15.826 1.00 90.00  ? 316  LYS A CD    1 
ATOM   2137 C  CE    . LYS A 1 270 ? 36.944  12.709   -15.367 1.00 105.29 ? 316  LYS A CE    1 
ATOM   2138 N  NZ    . LYS A 1 270 ? 36.540  13.004   -13.967 1.00 117.34 ? 316  LYS A NZ    1 
ATOM   2139 N  N     . ALA A 1 271 ? 42.845  14.685   -18.602 1.00 76.19  ? 317  ALA A N     1 
ATOM   2140 C  CA    . ALA A 1 271 ? 43.898  15.641   -18.960 1.00 75.67  ? 317  ALA A CA    1 
ATOM   2141 C  C     . ALA A 1 271 ? 44.557  15.314   -20.306 1.00 77.28  ? 317  ALA A C     1 
ATOM   2142 O  O     . ALA A 1 271 ? 44.564  16.168   -21.182 1.00 77.47  ? 317  ALA A O     1 
ATOM   2143 C  CB    . ALA A 1 271 ? 44.946  15.714   -17.850 1.00 76.39  ? 317  ALA A CB    1 
ATOM   2144 N  N     . ASP A 1 272 ? 45.070  14.082   -20.482 1.00 72.25  ? 318  ASP A N     1 
ATOM   2145 C  CA    . ASP A 1 272 ? 45.768  13.634   -21.691 1.00 71.50  ? 318  ASP A CA    1 
ATOM   2146 C  C     . ASP A 1 272 ? 44.905  13.496   -22.949 1.00 72.17  ? 318  ASP A C     1 
ATOM   2147 O  O     . ASP A 1 272 ? 45.461  13.564   -24.043 1.00 70.91  ? 318  ASP A O     1 
ATOM   2148 C  CB    . ASP A 1 272 ? 46.515  12.320   -21.431 1.00 74.27  ? 318  ASP A CB    1 
ATOM   2149 C  CG    . ASP A 1 272 ? 47.731  12.447   -20.537 1.00 87.99  ? 318  ASP A CG    1 
ATOM   2150 O  OD1   . ASP A 1 272 ? 48.659  13.210   -20.898 1.00 89.78  ? 318  ASP A OD1   1 
ATOM   2151 O  OD2   . ASP A 1 272 ? 47.796  11.728   -19.521 1.00 92.79  ? 318  ASP A OD2   1 
ATOM   2152 N  N     . LEU A 1 273 ? 43.613  13.225   -22.770 1.00 66.87  ? 319  LEU A N     1 
ATOM   2153 C  CA    . LEU A 1 273 ? 42.668  13.090   -23.875 1.00 65.29  ? 319  LEU A CA    1 
ATOM   2154 C  C     . LEU A 1 273 ? 41.773  14.323   -24.027 1.00 67.04  ? 319  LEU A C     1 
ATOM   2155 O  O     . LEU A 1 273 ? 40.876  14.342   -24.873 1.00 65.07  ? 319  LEU A O     1 
ATOM   2156 C  CB    . LEU A 1 273 ? 41.808  11.838   -23.692 1.00 65.26  ? 319  LEU A CB    1 
ATOM   2157 C  CG    . LEU A 1 273 ? 42.556  10.505   -23.631 1.00 69.44  ? 319  LEU A CG    1 
ATOM   2158 C  CD1   . LEU A 1 273 ? 41.592  9.359    -23.365 1.00 68.83  ? 319  LEU A CD1   1 
ATOM   2159 C  CD2   . LEU A 1 273 ? 43.338  10.267   -24.913 1.00 71.35  ? 319  LEU A CD2   1 
ATOM   2160 N  N     . LEU A 1 274 ? 42.010  15.329   -23.186 1.00 64.59  ? 320  LEU A N     1 
ATOM   2161 C  CA    . LEU A 1 274 ? 41.252  16.587   -23.192 1.00 64.68  ? 320  LEU A CA    1 
ATOM   2162 C  C     . LEU A 1 274 ? 39.733  16.419   -23.048 1.00 71.36  ? 320  LEU A C     1 
ATOM   2163 O  O     . LEU A 1 274 ? 38.961  17.108   -23.714 1.00 70.96  ? 320  LEU A O     1 
ATOM   2164 C  CB    . LEU A 1 274 ? 41.593  17.442   -24.422 1.00 64.38  ? 320  LEU A CB    1 
ATOM   2165 C  CG    . LEU A 1 274 ? 43.028  17.965   -24.507 1.00 68.23  ? 320  LEU A CG    1 
ATOM   2166 C  CD1   . LEU A 1 274 ? 43.268  18.665   -25.836 1.00 67.53  ? 320  LEU A CD1   1 
ATOM   2167 C  CD2   . LEU A 1 274 ? 43.331  18.896   -23.343 1.00 71.01  ? 320  LEU A CD2   1 
ATOM   2168 N  N     . LEU A 1 275 ? 39.315  15.503   -22.178 1.00 70.08  ? 321  LEU A N     1 
ATOM   2169 C  CA    . LEU A 1 275 ? 37.894  15.246   -21.937 1.00 70.87  ? 321  LEU A CA    1 
ATOM   2170 C  C     . LEU A 1 275 ? 37.201  16.399   -21.207 1.00 76.35  ? 321  LEU A C     1 
ATOM   2171 O  O     . LEU A 1 275 ? 37.820  17.094   -20.401 1.00 75.97  ? 321  LEU A O     1 
ATOM   2172 C  CB    . LEU A 1 275 ? 37.713  13.945   -21.151 1.00 71.16  ? 321  LEU A CB    1 
ATOM   2173 C  CG    . LEU A 1 275 ? 38.142  12.659   -21.861 1.00 76.44  ? 321  LEU A CG    1 
ATOM   2174 C  CD1   . LEU A 1 275 ? 38.047  11.468   -20.920 1.00 76.79  ? 321  LEU A CD1   1 
ATOM   2175 C  CD2   . LEU A 1 275 ? 37.305  12.429   -23.110 1.00 79.54  ? 321  LEU A CD2   1 
ATOM   2176 N  N     . GLU A 1 276 ? 35.915  16.599   -21.493 1.00 74.56  ? 322  GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 276 ? 35.143  17.669   -20.858 1.00 75.41  ? 322  GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 276 ? 33.873  17.069   -20.239 1.00 81.55  ? 322  GLU A C     1 
ATOM   2179 O  O     . GLU A 1 276 ? 33.540  15.940   -20.598 1.00 81.19  ? 322  GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 276 ? 34.768  18.725   -21.922 1.00 76.64  ? 322  GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 276 ? 35.931  19.576   -22.415 1.00 86.24  ? 322  GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 276 ? 35.849  20.018   -23.864 1.00 92.27  ? 322  GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 276 ? 34.835  20.650   -24.240 1.00 83.45  ? 322  GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 276 ? 36.808  19.745   -24.622 1.00 69.73  ? 322  GLU A OE2   1 
ATOM   2185 N  N     . PRO A 1 277 ? 33.115  17.772   -19.354 1.00 80.29  ? 323  PRO A N     1 
ATOM   2186 C  CA    . PRO A 1 277 ? 31.863  17.175   -18.839 1.00 80.84  ? 323  PRO A CA    1 
ATOM   2187 C  C     . PRO A 1 277 ? 30.875  16.839   -19.958 1.00 86.65  ? 323  PRO A C     1 
ATOM   2188 O  O     . PRO A 1 277 ? 31.029  17.305   -21.089 1.00 85.37  ? 323  PRO A O     1 
ATOM   2189 C  CB    . PRO A 1 277 ? 31.314  18.238   -17.881 1.00 82.67  ? 323  PRO A CB    1 
ATOM   2190 C  CG    . PRO A 1 277 ? 32.483  19.108   -17.557 1.00 87.34  ? 323  PRO A CG    1 
ATOM   2191 C  CD    . PRO A 1 277 ? 33.334  19.118   -18.790 1.00 82.52  ? 323  PRO A CD    1 
ATOM   2192 N  N     . CYS A 1 278 ? 29.891  15.986   -19.653 1.00 85.99  ? 324  CYS A N     1 
ATOM   2193 C  CA    . CYS A 1 278 ? 28.908  15.503   -20.622 1.00 86.86  ? 324  CYS A CA    1 
ATOM   2194 C  C     . CYS A 1 278 ? 28.111  16.616   -21.282 1.00 90.38  ? 324  CYS A C     1 
ATOM   2195 O  O     . CYS A 1 278 ? 28.113  16.694   -22.514 1.00 90.29  ? 324  CYS A O     1 
ATOM   2196 C  CB    . CYS A 1 278 ? 28.007  14.446   -19.994 1.00 87.88  ? 324  CYS A CB    1 
ATOM   2197 S  SG    . CYS A 1 278 ? 28.911  13.024   -19.328 1.00 92.50  ? 324  CYS A SG    1 
ATOM   2198 N  N     . SER A 1 279 ? 27.511  17.518   -20.472 1.00 86.38  ? 325  SER A N     1 
ATOM   2199 C  CA    . SER A 1 279 ? 26.698  18.672   -20.911 1.00 86.12  ? 325  SER A CA    1 
ATOM   2200 C  C     . SER A 1 279 ? 27.411  19.613   -21.911 1.00 85.69  ? 325  SER A C     1 
ATOM   2201 O  O     . SER A 1 279 ? 26.765  20.430   -22.577 1.00 85.00  ? 325  SER A O     1 
ATOM   2202 C  CB    . SER A 1 279 ? 26.221  19.468   -19.699 1.00 91.67  ? 325  SER A CB    1 
ATOM   2203 O  OG    . SER A 1 279 ? 27.318  19.897   -18.909 1.00 104.96 ? 325  SER A OG    1 
ATOM   2204 N  N     . HIS A 1 280 ? 28.737  19.478   -22.002 1.00 78.27  ? 326  HIS A N     1 
ATOM   2205 C  CA    . HIS A 1 280 ? 29.578  20.276   -22.868 1.00 76.51  ? 326  HIS A CA    1 
ATOM   2206 C  C     . HIS A 1 280 ? 29.559  19.756   -24.301 1.00 72.86  ? 326  HIS A C     1 
ATOM   2207 O  O     . HIS A 1 280 ? 29.879  20.519   -25.215 1.00 72.42  ? 326  HIS A O     1 
ATOM   2208 C  CB    . HIS A 1 280 ? 31.006  20.337   -22.294 1.00 78.24  ? 326  HIS A CB    1 
ATOM   2209 C  CG    . HIS A 1 280 ? 31.095  21.003   -20.948 1.00 82.39  ? 326  HIS A CG    1 
ATOM   2210 N  ND1   . HIS A 1 280 ? 32.164  21.821   -20.619 1.00 84.59  ? 326  HIS A ND1   1 
ATOM   2211 C  CD2   . HIS A 1 280 ? 30.234  20.971   -19.901 1.00 84.38  ? 326  HIS A CD2   1 
ATOM   2212 C  CE1   . HIS A 1 280 ? 31.921  22.253   -19.391 1.00 84.16  ? 326  HIS A CE1   1 
ATOM   2213 N  NE2   . HIS A 1 280 ? 30.770  21.767   -18.920 1.00 84.44  ? 326  HIS A NE2   1 
ATOM   2214 N  N     . TYR A 1 281 ? 29.167  18.480   -24.515 1.00 63.06  ? 327  TYR A N     1 
ATOM   2215 C  CA    . TYR A 1 281 ? 29.141  17.915   -25.865 1.00 60.96  ? 327  TYR A CA    1 
ATOM   2216 C  C     . TYR A 1 281 ? 27.800  17.999   -26.546 1.00 61.62  ? 327  TYR A C     1 
ATOM   2217 O  O     . TYR A 1 281 ? 26.789  17.524   -26.027 1.00 61.55  ? 327  TYR A O     1 
ATOM   2218 C  CB    . TYR A 1 281 ? 29.663  16.479   -25.897 1.00 62.33  ? 327  TYR A CB    1 
ATOM   2219 C  CG    . TYR A 1 281 ? 31.101  16.372   -25.453 1.00 63.97  ? 327  TYR A CG    1 
ATOM   2220 C  CD1   . TYR A 1 281 ? 32.145  16.651   -26.332 1.00 65.79  ? 327  TYR A CD1   1 
ATOM   2221 C  CD2   . TYR A 1 281 ? 31.421  16.026   -24.144 1.00 64.72  ? 327  TYR A CD2   1 
ATOM   2222 C  CE1   . TYR A 1 281 ? 33.473  16.571   -25.923 1.00 67.24  ? 327  TYR A CE1   1 
ATOM   2223 C  CE2   . TYR A 1 281 ? 32.748  15.928   -23.727 1.00 65.70  ? 327  TYR A CE2   1 
ATOM   2224 C  CZ    . TYR A 1 281 ? 33.771  16.194   -24.621 1.00 73.68  ? 327  TYR A CZ    1 
ATOM   2225 O  OH    . TYR A 1 281 ? 35.075  16.092   -24.202 1.00 76.13  ? 327  TYR A OH    1 
ATOM   2226 N  N     . ARG A 1 282 ? 27.814  18.588   -27.737 1.00 55.93  ? 328  ARG A N     1 
ATOM   2227 C  CA    . ARG A 1 282 ? 26.668  18.783   -28.618 1.00 54.21  ? 328  ARG A CA    1 
ATOM   2228 C  C     . ARG A 1 282 ? 26.172  17.420   -29.135 1.00 53.86  ? 328  ARG A C     1 
ATOM   2229 O  O     . ARG A 1 282 ? 24.966  17.161   -29.106 1.00 53.96  ? 328  ARG A O     1 
ATOM   2230 C  CB    . ARG A 1 282 ? 27.074  19.734   -29.761 1.00 52.58  ? 328  ARG A CB    1 
ATOM   2231 C  CG    . ARG A 1 282 ? 26.110  19.829   -30.927 1.00 58.02  ? 328  ARG A CG    1 
ATOM   2232 C  CD    . ARG A 1 282 ? 26.517  20.929   -31.882 1.00 57.17  ? 328  ARG A CD    1 
ATOM   2233 N  NE    . ARG A 1 282 ? 27.301  20.465   -33.032 1.00 51.29  ? 328  ARG A NE    1 
ATOM   2234 C  CZ    . ARG A 1 282 ? 26.774  20.146   -34.213 1.00 70.58  ? 328  ARG A CZ    1 
ATOM   2235 N  NH1   . ARG A 1 282 ? 25.459  20.167   -34.389 1.00 58.24  ? 328  ARG A NH1   1 
ATOM   2236 N  NH2   . ARG A 1 282 ? 27.559  19.792   -35.223 1.00 58.19  ? 328  ARG A NH2   1 
ATOM   2237 N  N     . PHE A 1 283 ? 27.110  16.545   -29.540 1.00 45.90  ? 329  PHE A N     1 
ATOM   2238 C  CA    . PHE A 1 283 ? 26.850  15.196   -30.063 1.00 44.16  ? 329  PHE A CA    1 
ATOM   2239 C  C     . PHE A 1 283 ? 26.168  14.230   -29.060 1.00 45.85  ? 329  PHE A C     1 
ATOM   2240 O  O     . PHE A 1 283 ? 25.679  13.175   -29.475 1.00 45.86  ? 329  PHE A O     1 
ATOM   2241 C  CB    . PHE A 1 283 ? 28.142  14.584   -30.634 1.00 45.51  ? 329  PHE A CB    1 
ATOM   2242 C  CG    . PHE A 1 283 ? 28.601  15.110   -31.983 1.00 46.34  ? 329  PHE A CG    1 
ATOM   2243 C  CD1   . PHE A 1 283 ? 27.822  16.016   -32.707 1.00 48.98  ? 329  PHE A CD1   1 
ATOM   2244 C  CD2   . PHE A 1 283 ? 29.790  14.675   -32.545 1.00 47.44  ? 329  PHE A CD2   1 
ATOM   2245 C  CE1   . PHE A 1 283 ? 28.232  16.467   -33.962 1.00 49.80  ? 329  PHE A CE1   1 
ATOM   2246 C  CE2   . PHE A 1 283 ? 30.197  15.131   -33.807 1.00 49.83  ? 329  PHE A CE2   1 
ATOM   2247 C  CZ    . PHE A 1 283 ? 29.417  16.010   -34.504 1.00 48.17  ? 329  PHE A CZ    1 
ATOM   2248 N  N     . LEU A 1 284 ? 26.156  14.573   -27.755 1.00 40.37  ? 330  LEU A N     1 
ATOM   2249 C  CA    . LEU A 1 284 ? 25.471  13.797   -26.733 1.00 41.08  ? 330  LEU A CA    1 
ATOM   2250 C  C     . LEU A 1 284 ? 24.194  14.567   -26.450 1.00 47.93  ? 330  LEU A C     1 
ATOM   2251 O  O     . LEU A 1 284 ? 24.132  15.380   -25.520 1.00 46.87  ? 330  LEU A O     1 
ATOM   2252 C  CB    . LEU A 1 284 ? 26.318  13.574   -25.456 1.00 41.02  ? 330  LEU A CB    1 
ATOM   2253 C  CG    . LEU A 1 284 ? 27.619  12.794   -25.633 1.00 45.01  ? 330  LEU A CG    1 
ATOM   2254 C  CD1   . LEU A 1 284 ? 28.493  12.955   -24.437 1.00 46.24  ? 330  LEU A CD1   1 
ATOM   2255 C  CD2   . LEU A 1 284 ? 27.375  11.327   -25.952 1.00 41.50  ? 330  LEU A CD2   1 
ATOM   2256 N  N     . THR A 1 285 ? 23.189  14.333   -27.319 1.00 47.42  ? 331  THR A N     1 
ATOM   2257 C  CA    . THR A 1 285 ? 21.892  14.998   -27.368 1.00 49.62  ? 331  THR A CA    1 
ATOM   2258 C  C     . THR A 1 285 ? 21.171  15.130   -26.025 1.00 61.44  ? 331  THR A C     1 
ATOM   2259 O  O     . THR A 1 285 ? 20.663  16.212   -25.734 1.00 62.94  ? 331  THR A O     1 
ATOM   2260 C  CB    . THR A 1 285 ? 20.977  14.326   -28.399 1.00 53.02  ? 331  THR A CB    1 
ATOM   2261 O  OG1   . THR A 1 285 ? 21.701  14.080   -29.607 1.00 51.30  ? 331  THR A OG1   1 
ATOM   2262 C  CG2   . THR A 1 285 ? 19.764  15.171   -28.719 1.00 53.06  ? 331  THR A CG2   1 
ATOM   2263 N  N     . ASN A 1 286 ? 21.117  14.065   -25.220 1.00 62.65  ? 332  ASN A N     1 
ATOM   2264 C  CA    . ASN A 1 286 ? 20.352  14.132   -23.982 1.00 65.46  ? 332  ASN A CA    1 
ATOM   2265 C  C     . ASN A 1 286 ? 21.219  14.164   -22.704 1.00 78.27  ? 332  ASN A C     1 
ATOM   2266 O  O     . ASN A 1 286 ? 20.895  13.529   -21.696 1.00 77.99  ? 332  ASN A O     1 
ATOM   2267 C  CB    . ASN A 1 286 ? 19.295  13.021   -23.963 1.00 62.33  ? 332  ASN A CB    1 
ATOM   2268 C  CG    . ASN A 1 286 ? 18.404  13.070   -25.194 1.00 58.17  ? 332  ASN A CG    1 
ATOM   2269 O  OD1   . ASN A 1 286 ? 17.964  14.145   -25.666 1.00 43.50  ? 332  ASN A OD1   1 
ATOM   2270 N  ND2   . ASN A 1 286 ? 18.199  11.914   -25.791 1.00 40.53  ? 332  ASN A ND2   1 
ATOM   2271 N  N     . GLY A 1 287 ? 22.254  14.996   -22.754 1.00 82.08  ? 333  GLY A N     1 
ATOM   2272 C  CA    . GLY A 1 287 ? 23.163  15.292   -21.651 1.00 85.23  ? 333  GLY A CA    1 
ATOM   2273 C  C     . GLY A 1 287 ? 23.865  14.134   -20.971 1.00 97.27  ? 333  GLY A C     1 
ATOM   2274 O  O     . GLY A 1 287 ? 24.407  13.246   -21.636 1.00 96.45  ? 333  GLY A O     1 
ATOM   2275 N  N     . PRO A 1 288 ? 23.810  14.124   -19.630 1.00 100.40 ? 334  PRO A N     1 
ATOM   2276 C  CA    . PRO A 1 288 ? 24.427  13.185   -18.685 1.00 102.36 ? 334  PRO A CA    1 
ATOM   2277 C  C     . PRO A 1 288 ? 23.883  11.769   -18.794 1.00 112.08 ? 334  PRO A C     1 
ATOM   2278 O  O     . PRO A 1 288 ? 22.748  11.564   -19.225 1.00 112.12 ? 334  PRO A O     1 
ATOM   2279 C  CB    . PRO A 1 288 ? 24.073  13.780   -17.318 1.00 104.04 ? 334  PRO A CB    1 
ATOM   2280 C  CG    . PRO A 1 288 ? 22.841  14.580   -17.563 1.00 108.11 ? 334  PRO A CG    1 
ATOM   2281 C  CD    . PRO A 1 288 ? 23.025  15.158   -18.934 1.00 103.16 ? 334  PRO A CD    1 
ATOM   2282 N  N     . SER A 1 289 ? 24.704  10.802   -18.400 1.00 112.50 ? 335  SER A N     1 
ATOM   2283 C  CA    . SER A 1 289 ? 24.328  9.399    -18.486 1.00 114.33 ? 335  SER A CA    1 
ATOM   2284 C  C     . SER A 1 289 ? 23.075  9.094    -17.676 1.00 122.09 ? 335  SER A C     1 
ATOM   2285 O  O     . SER A 1 289 ? 22.893  9.575    -16.557 1.00 121.55 ? 335  SER A O     1 
ATOM   2286 C  CB    . SER A 1 289 ? 25.482  8.508    -18.021 1.00 118.68 ? 335  SER A CB    1 
ATOM   2287 O  OG    . SER A 1 289 ? 26.595  8.621    -18.890 1.00 128.40 ? 335  SER A OG    1 
ATOM   2288 N  N     . SER A 1 290 ? 22.219  8.280    -18.279 1.00 121.75 ? 336  SER A N     1 
ATOM   2289 C  CA    . SER A 1 290 ? 20.948  7.865    -17.713 1.00 123.08 ? 336  SER A CA    1 
ATOM   2290 C  C     . SER A 1 290 ? 21.117  7.212    -16.349 1.00 129.00 ? 336  SER A C     1 
ATOM   2291 O  O     . SER A 1 290 ? 20.256  7.288    -15.484 1.00 128.70 ? 336  SER A O     1 
ATOM   2292 C  CB    . SER A 1 290 ? 20.246  6.920    -18.684 1.00 127.50 ? 336  SER A CB    1 
ATOM   2293 O  OG    . SER A 1 290 ? 19.847  7.618    -19.847 1.00 136.96 ? 336  SER A OG    1 
ATOM   2294 N  N     . SER A 1 291 ? 22.215  6.495    -16.218 1.00 126.69 ? 337  SER A N     1 
ATOM   2295 C  CA    . SER A 1 291 ? 22.626  5.803    -14.999 1.00 126.93 ? 337  SER A CA    1 
ATOM   2296 C  C     . SER A 1 291 ? 24.131  6.076    -14.747 1.00 130.13 ? 337  SER A C     1 
ATOM   2297 O  O     . SER A 1 291 ? 24.983  5.532    -15.459 1.00 129.55 ? 337  SER A O     1 
ATOM   2298 C  CB    . SER A 1 291 ? 22.317  4.309    -15.081 1.00 131.58 ? 337  SER A CB    1 
ATOM   2299 O  OG    . SER A 1 291 ? 22.866  3.722    -16.250 1.00 142.94 ? 337  SER A OG    1 
ATOM   2300 N  N     . PRO A 1 292 ? 24.469  6.970    -13.779 1.00 125.97 ? 338  PRO A N     1 
ATOM   2301 C  CA    . PRO A 1 292 ? 25.886  7.309    -13.540 1.00 125.08 ? 338  PRO A CA    1 
ATOM   2302 C  C     . PRO A 1 292 ? 26.570  6.483    -12.442 1.00 125.60 ? 338  PRO A C     1 
ATOM   2303 O  O     . PRO A 1 292 ? 25.942  5.616    -11.825 1.00 125.07 ? 338  PRO A O     1 
ATOM   2304 C  CB    . PRO A 1 292 ? 25.815  8.791    -13.161 1.00 127.16 ? 338  PRO A CB    1 
ATOM   2305 C  CG    . PRO A 1 292 ? 24.430  8.963    -12.545 1.00 132.08 ? 338  PRO A CG    1 
ATOM   2306 C  CD    . PRO A 1 292 ? 23.588  7.752    -12.887 1.00 127.67 ? 338  PRO A CD    1 
ATOM   2307 N  N     . GLY A 1 293 ? 27.856  6.759    -12.219 1.00 119.35 ? 339  GLY A N     1 
ATOM   2308 C  CA    . GLY A 1 293 ? 28.664  6.084    -11.207 1.00 117.89 ? 339  GLY A CA    1 
ATOM   2309 C  C     . GLY A 1 293 ? 29.130  4.703    -11.623 1.00 117.80 ? 339  GLY A C     1 
ATOM   2310 O  O     . GLY A 1 293 ? 30.320  4.388    -11.502 1.00 118.02 ? 339  GLY A O     1 
ATOM   2311 N  N     . GLN A 1 294 ? 28.184  3.873    -12.126 1.00 109.67 ? 340  GLN A N     1 
ATOM   2312 C  CA    . GLN A 1 294 ? 28.393  2.510    -12.639 1.00 106.92 ? 340  GLN A CA    1 
ATOM   2313 C  C     . GLN A 1 294 ? 29.384  2.486    -13.822 1.00 103.69 ? 340  GLN A C     1 
ATOM   2314 O  O     . GLN A 1 294 ? 29.902  1.427    -14.181 1.00 103.64 ? 340  GLN A O     1 
ATOM   2315 C  CB    . GLN A 1 294 ? 27.044  1.872    -13.047 1.00 108.45 ? 340  GLN A CB    1 
ATOM   2316 C  CG    . GLN A 1 294 ? 26.225  2.687    -14.060 1.00 131.26 ? 340  GLN A CG    1 
ATOM   2317 C  CD    . GLN A 1 294 ? 25.032  1.942    -14.612 1.00 155.44 ? 340  GLN A CD    1 
ATOM   2318 O  OE1   . GLN A 1 294 ? 24.121  1.536    -13.880 1.00 151.88 ? 340  GLN A OE1   1 
ATOM   2319 N  NE2   . GLN A 1 294 ? 24.980  1.804    -15.930 1.00 148.38 ? 340  GLN A NE2   1 
ATOM   2320 N  N     . GLU A 1 295 ? 29.639  3.667    -14.406 1.00 93.81  ? 341  GLU A N     1 
ATOM   2321 C  CA    . GLU A 1 295 ? 30.514  3.880    -15.550 1.00 90.23  ? 341  GLU A CA    1 
ATOM   2322 C  C     . GLU A 1 295 ? 31.962  3.642    -15.242 1.00 84.70  ? 341  GLU A C     1 
ATOM   2323 O  O     . GLU A 1 295 ? 32.659  3.117    -16.107 1.00 82.63  ? 341  GLU A O     1 
ATOM   2324 C  CB    . GLU A 1 295 ? 30.301  5.268    -16.131 1.00 91.94  ? 341  GLU A CB    1 
ATOM   2325 C  CG    . GLU A 1 295 ? 28.850  5.503    -16.492 1.00 104.95 ? 341  GLU A CG    1 
ATOM   2326 C  CD    . GLU A 1 295 ? 28.587  6.767    -17.269 1.00 136.42 ? 341  GLU A CD    1 
ATOM   2327 O  OE1   . GLU A 1 295 ? 29.048  7.854    -16.850 1.00 143.46 ? 341  GLU A OE1   1 
ATOM   2328 O  OE2   . GLU A 1 295 ? 27.879  6.666    -18.292 1.00 133.19 ? 341  GLU A OE2   1 
ATOM   2329 N  N     . ARG A 1 296 ? 32.421  4.005    -14.017 1.00 76.61  ? 342  ARG A N     1 
ATOM   2330 C  CA    . ARG A 1 296 ? 33.801  3.759    -13.572 1.00 74.28  ? 342  ARG A CA    1 
ATOM   2331 C  C     . ARG A 1 296 ? 34.064  2.264    -13.677 1.00 70.24  ? 342  ARG A C     1 
ATOM   2332 O  O     . ARG A 1 296 ? 35.024  1.873    -14.327 1.00 69.86  ? 342  ARG A O     1 
ATOM   2333 C  CB    . ARG A 1 296 ? 34.059  4.283    -12.149 1.00 77.40  ? 342  ARG A CB    1 
ATOM   2334 C  CG    . ARG A 1 296 ? 35.537  4.243    -11.764 1.00 98.83  ? 342  ARG A CG    1 
ATOM   2335 C  CD    . ARG A 1 296 ? 35.943  5.382    -10.852 1.00 125.73 ? 342  ARG A CD    1 
ATOM   2336 N  NE    . ARG A 1 296 ? 36.434  6.542    -11.602 1.00 147.91 ? 342  ARG A NE    1 
ATOM   2337 C  CZ    . ARG A 1 296 ? 35.836  7.729    -11.629 1.00 170.77 ? 342  ARG A CZ    1 
ATOM   2338 N  NH1   . ARG A 1 296 ? 34.716  7.934    -10.945 1.00 161.69 ? 342  ARG A NH1   1 
ATOM   2339 N  NH2   . ARG A 1 296 ? 36.356  8.725    -12.334 1.00 160.91 ? 342  ARG A NH2   1 
ATOM   2340 N  N     . GLU A 1 297 ? 33.124  1.452    -13.164 1.00 61.15  ? 343  GLU A N     1 
ATOM   2341 C  CA    . GLU A 1 297 ? 33.113  -0.002   -13.206 1.00 59.39  ? 343  GLU A CA    1 
ATOM   2342 C  C     . GLU A 1 297 ? 33.082  -0.537   -14.647 1.00 57.74  ? 343  GLU A C     1 
ATOM   2343 O  O     . GLU A 1 297 ? 33.953  -1.314   -14.999 1.00 56.73  ? 343  GLU A O     1 
ATOM   2344 C  CB    . GLU A 1 297 ? 31.932  -0.547   -12.372 1.00 61.19  ? 343  GLU A CB    1 
ATOM   2345 C  CG    . GLU A 1 297 ? 32.034  -2.022   -12.009 1.00 79.75  ? 343  GLU A CG    1 
ATOM   2346 C  CD    . GLU A 1 297 ? 30.919  -2.592   -11.145 1.00 110.03 ? 343  GLU A CD    1 
ATOM   2347 O  OE1   . GLU A 1 297 ? 29.731  -2.349   -11.463 1.00 112.49 ? 343  GLU A OE1   1 
ATOM   2348 O  OE2   . GLU A 1 297 ? 31.233  -3.326   -10.177 1.00 105.03 ? 343  GLU A OE2   1 
ATOM   2349 N  N     . LEU A 1 298 ? 32.113  -0.117   -15.484 1.00 51.60  ? 344  LEU A N     1 
ATOM   2350 C  CA    . LEU A 1 298 ? 31.994  -0.593   -16.873 1.00 49.66  ? 344  LEU A CA    1 
ATOM   2351 C  C     . LEU A 1 298 ? 33.199  -0.231   -17.755 1.00 48.62  ? 344  LEU A C     1 
ATOM   2352 O  O     . LEU A 1 298 ? 33.629  -1.046   -18.576 1.00 45.90  ? 344  LEU A O     1 
ATOM   2353 C  CB    . LEU A 1 298 ? 30.668  -0.125   -17.505 1.00 50.32  ? 344  LEU A CB    1 
ATOM   2354 C  CG    . LEU A 1 298 ? 29.401  -0.767   -16.910 1.00 55.34  ? 344  LEU A CG    1 
ATOM   2355 C  CD1   . LEU A 1 298 ? 28.156  0.008    -17.279 1.00 55.83  ? 344  LEU A CD1   1 
ATOM   2356 C  CD2   . LEU A 1 298 ? 29.275  -2.241   -17.292 1.00 58.62  ? 344  LEU A CD2   1 
ATOM   2357 N  N     . PHE A 1 299 ? 33.770  0.962    -17.541 1.00 43.78  ? 345  PHE A N     1 
ATOM   2358 C  CA    . PHE A 1 299 ? 34.943  1.424    -18.255 1.00 43.83  ? 345  PHE A CA    1 
ATOM   2359 C  C     . PHE A 1 299 ? 36.105  0.481    -18.005 1.00 49.45  ? 345  PHE A C     1 
ATOM   2360 O  O     . PHE A 1 299 ? 36.671  -0.045   -18.959 1.00 49.24  ? 345  PHE A O     1 
ATOM   2361 C  CB    . PHE A 1 299 ? 35.284  2.878    -17.873 1.00 45.55  ? 345  PHE A CB    1 
ATOM   2362 C  CG    . PHE A 1 299 ? 36.454  3.493    -18.604 1.00 47.26  ? 345  PHE A CG    1 
ATOM   2363 C  CD1   . PHE A 1 299 ? 36.580  3.364    -19.988 1.00 49.91  ? 345  PHE A CD1   1 
ATOM   2364 C  CD2   . PHE A 1 299 ? 37.423  4.214    -17.915 1.00 49.71  ? 345  PHE A CD2   1 
ATOM   2365 C  CE1   . PHE A 1 299 ? 37.664  3.927    -20.661 1.00 50.69  ? 345  PHE A CE1   1 
ATOM   2366 C  CE2   . PHE A 1 299 ? 38.499  4.797    -18.595 1.00 52.45  ? 345  PHE A CE2   1 
ATOM   2367 C  CZ    . PHE A 1 299 ? 38.613  4.647    -19.961 1.00 50.47  ? 345  PHE A CZ    1 
ATOM   2368 N  N     . GLN A 1 300 ? 36.394  0.205    -16.723 1.00 47.34  ? 346  GLN A N     1 
ATOM   2369 C  CA    . GLN A 1 300 ? 37.436  -0.708   -16.256 1.00 47.64  ? 346  GLN A CA    1 
ATOM   2370 C  C     . GLN A 1 300 ? 37.294  -2.132   -16.833 1.00 50.86  ? 346  GLN A C     1 
ATOM   2371 O  O     . GLN A 1 300 ? 38.297  -2.781   -17.131 1.00 51.23  ? 346  GLN A O     1 
ATOM   2372 C  CB    . GLN A 1 300 ? 37.480  -0.733   -14.714 1.00 49.32  ? 346  GLN A CB    1 
ATOM   2373 C  CG    . GLN A 1 300 ? 37.910  0.589    -14.048 1.00 60.21  ? 346  GLN A CG    1 
ATOM   2374 C  CD    . GLN A 1 300 ? 39.303  1.060    -14.395 1.00 85.27  ? 346  GLN A CD    1 
ATOM   2375 O  OE1   . GLN A 1 300 ? 40.266  0.293    -14.390 1.00 82.16  ? 346  GLN A OE1   1 
ATOM   2376 N  NE2   . GLN A 1 300 ? 39.441  2.352    -14.680 1.00 82.56  ? 346  GLN A NE2   1 
ATOM   2377 N  N     . GLU A 1 301 ? 36.057  -2.597   -17.008 1.00 46.26  ? 347  GLU A N     1 
ATOM   2378 C  CA    . GLU A 1 301 ? 35.743  -3.905   -17.590 1.00 45.61  ? 347  GLU A CA    1 
ATOM   2379 C  C     . GLU A 1 301 ? 36.070  -3.904   -19.079 1.00 49.38  ? 347  GLU A C     1 
ATOM   2380 O  O     . GLU A 1 301 ? 36.564  -4.907   -19.582 1.00 49.29  ? 347  GLU A O     1 
ATOM   2381 C  CB    . GLU A 1 301 ? 34.266  -4.280   -17.372 1.00 46.43  ? 347  GLU A CB    1 
ATOM   2382 C  CG    . GLU A 1 301 ? 33.913  -4.564   -15.919 1.00 58.47  ? 347  GLU A CG    1 
ATOM   2383 C  CD    . GLU A 1 301 ? 32.619  -5.319   -15.666 1.00 83.19  ? 347  GLU A CD    1 
ATOM   2384 O  OE1   . GLU A 1 301 ? 31.730  -5.308   -16.549 1.00 64.84  ? 347  GLU A OE1   1 
ATOM   2385 O  OE2   . GLU A 1 301 ? 32.495  -5.927   -14.578 1.00 83.59  ? 347  GLU A OE2   1 
ATOM   2386 N  N     . THR A 1 302 ? 35.804  -2.775   -19.782 1.00 45.57  ? 348  THR A N     1 
ATOM   2387 C  CA    . THR A 1 302 ? 36.098  -2.638   -21.211 1.00 44.28  ? 348  THR A CA    1 
ATOM   2388 C  C     . THR A 1 302 ? 37.593  -2.634   -21.410 1.00 46.63  ? 348  THR A C     1 
ATOM   2389 O  O     . THR A 1 302 ? 38.081  -3.331   -22.290 1.00 45.97  ? 348  THR A O     1 
ATOM   2390 C  CB    . THR A 1 302 ? 35.377  -1.433   -21.841 1.00 46.93  ? 348  THR A CB    1 
ATOM   2391 O  OG1   . THR A 1 302 ? 33.968  -1.567   -21.607 1.00 43.62  ? 348  THR A OG1   1 
ATOM   2392 C  CG2   . THR A 1 302 ? 35.619  -1.338   -23.356 1.00 41.10  ? 348  THR A CG2   1 
ATOM   2393 N  N     . LEU A 1 303 ? 38.317  -1.905   -20.540 1.00 44.06  ? 349  LEU A N     1 
ATOM   2394 C  CA    . LEU A 1 303 ? 39.785  -1.817   -20.529 1.00 44.17  ? 349  LEU A CA    1 
ATOM   2395 C  C     . LEU A 1 303 ? 40.423  -3.176   -20.292 1.00 44.03  ? 349  LEU A C     1 
ATOM   2396 O  O     . LEU A 1 303 ? 41.397  -3.509   -20.970 1.00 41.78  ? 349  LEU A O     1 
ATOM   2397 C  CB    . LEU A 1 303 ? 40.278  -0.823   -19.460 1.00 44.56  ? 349  LEU A CB    1 
ATOM   2398 C  CG    . LEU A 1 303 ? 39.926  0.637    -19.653 1.00 48.72  ? 349  LEU A CG    1 
ATOM   2399 C  CD1   . LEU A 1 303 ? 40.507  1.468    -18.554 1.00 48.72  ? 349  LEU A CD1   1 
ATOM   2400 C  CD2   . LEU A 1 303 ? 40.429  1.147    -20.967 1.00 52.86  ? 349  LEU A CD2   1 
ATOM   2401 N  N     . GLU A 1 304 ? 39.848  -3.969   -19.363 1.00 39.13  ? 350  GLU A N     1 
ATOM   2402 C  CA    . GLU A 1 304 ? 40.347  -5.300   -19.057 1.00 40.30  ? 350  GLU A CA    1 
ATOM   2403 C  C     . GLU A 1 304 ? 40.097  -6.238   -20.231 1.00 45.37  ? 350  GLU A C     1 
ATOM   2404 O  O     . GLU A 1 304 ? 41.013  -6.960   -20.606 1.00 46.67  ? 350  GLU A O     1 
ATOM   2405 C  CB    . GLU A 1 304 ? 39.785  -5.848   -17.714 1.00 41.87  ? 350  GLU A CB    1 
ATOM   2406 C  CG    . GLU A 1 304 ? 40.317  -7.219   -17.279 1.00 53.18  ? 350  GLU A CG    1 
ATOM   2407 C  CD    . GLU A 1 304 ? 41.796  -7.352   -16.937 1.00 77.91  ? 350  GLU A CD    1 
ATOM   2408 O  OE1   . GLU A 1 304 ? 42.479  -6.314   -16.781 1.00 76.92  ? 350  GLU A OE1   1 
ATOM   2409 O  OE2   . GLU A 1 304 ? 42.267  -8.506   -16.816 1.00 72.91  ? 350  GLU A OE2   1 
ATOM   2410 N  N     . SER A 1 305 ? 38.908  -6.172   -20.863 1.00 41.04  ? 351  SER A N     1 
ATOM   2411 C  CA    . SER A 1 305 ? 38.571  -6.995   -22.033 1.00 40.71  ? 351  SER A CA    1 
ATOM   2412 C  C     . SER A 1 305 ? 39.533  -6.705   -23.181 1.00 44.95  ? 351  SER A C     1 
ATOM   2413 O  O     . SER A 1 305 ? 40.030  -7.645   -23.805 1.00 46.89  ? 351  SER A O     1 
ATOM   2414 C  CB    . SER A 1 305 ? 37.132  -6.751   -22.474 1.00 45.20  ? 351  SER A CB    1 
ATOM   2415 O  OG    . SER A 1 305 ? 36.206  -7.208   -21.502 1.00 56.98  ? 351  SER A OG    1 
ATOM   2416 N  N     . LEU A 1 306 ? 39.842  -5.417   -23.415 1.00 38.50  ? 352  LEU A N     1 
ATOM   2417 C  CA    . LEU A 1 306 ? 40.780  -4.994   -24.446 1.00 38.29  ? 352  LEU A CA    1 
ATOM   2418 C  C     . LEU A 1 306 ? 42.178  -5.556   -24.137 1.00 41.43  ? 352  LEU A C     1 
ATOM   2419 O  O     . LEU A 1 306 ? 42.901  -5.936   -25.056 1.00 36.77  ? 352  LEU A O     1 
ATOM   2420 C  CB    . LEU A 1 306 ? 40.822  -3.453   -24.582 1.00 38.08  ? 352  LEU A CB    1 
ATOM   2421 C  CG    . LEU A 1 306 ? 39.627  -2.783   -25.277 1.00 42.96  ? 352  LEU A CG    1 
ATOM   2422 C  CD1   . LEU A 1 306 ? 39.531  -1.311   -24.920 1.00 42.71  ? 352  LEU A CD1   1 
ATOM   2423 C  CD2   . LEU A 1 306 ? 39.669  -2.973   -26.781 1.00 43.85  ? 352  LEU A CD2   1 
ATOM   2424 N  N     . ARG A 1 307 ? 42.523  -5.651   -22.842 1.00 42.37  ? 353  ARG A N     1 
ATOM   2425 C  CA    . ARG A 1 307 ? 43.814  -6.216   -22.404 1.00 43.57  ? 353  ARG A CA    1 
ATOM   2426 C  C     . ARG A 1 307 ? 43.878  -7.727   -22.651 1.00 50.67  ? 353  ARG A C     1 
ATOM   2427 O  O     . ARG A 1 307 ? 44.913  -8.194   -23.114 1.00 51.41  ? 353  ARG A O     1 
ATOM   2428 C  CB    . ARG A 1 307 ? 44.145  -5.834   -20.958 1.00 41.16  ? 353  ARG A CB    1 
ATOM   2429 C  CG    . ARG A 1 307 ? 44.563  -4.362   -20.845 1.00 54.70  ? 353  ARG A CG    1 
ATOM   2430 C  CD    . ARG A 1 307 ? 45.159  -4.010   -19.501 1.00 71.04  ? 353  ARG A CD    1 
ATOM   2431 N  NE    . ARG A 1 307 ? 44.149  -4.029   -18.444 1.00 81.47  ? 353  ARG A NE    1 
ATOM   2432 C  CZ    . ARG A 1 307 ? 43.534  -2.953   -17.968 1.00 88.84  ? 353  ARG A CZ    1 
ATOM   2433 N  NH1   . ARG A 1 307 ? 43.833  -1.743   -18.436 1.00 76.55  ? 353  ARG A NH1   1 
ATOM   2434 N  NH2   . ARG A 1 307 ? 42.616  -3.075   -17.017 1.00 64.16  ? 353  ARG A NH2   1 
ATOM   2435 N  N     . VAL A 1 308 ? 42.741  -8.461   -22.444 1.00 47.56  ? 354  VAL A N     1 
ATOM   2436 C  CA    . VAL A 1 308 ? 42.577  -9.899   -22.733 1.00 46.68  ? 354  VAL A CA    1 
ATOM   2437 C  C     . VAL A 1 308 ? 42.798  -10.120  -24.245 1.00 48.81  ? 354  VAL A C     1 
ATOM   2438 O  O     . VAL A 1 308 ? 43.510  -11.042  -24.624 1.00 45.75  ? 354  VAL A O     1 
ATOM   2439 C  CB    . VAL A 1 308 ? 41.221  -10.482  -22.229 1.00 50.76  ? 354  VAL A CB    1 
ATOM   2440 C  CG1   . VAL A 1 308 ? 41.005  -11.923  -22.701 1.00 50.43  ? 354  VAL A CG1   1 
ATOM   2441 C  CG2   . VAL A 1 308 ? 41.106  -10.401  -20.704 1.00 50.17  ? 354  VAL A CG2   1 
ATOM   2442 N  N     . LEU A 1 309 ? 42.269  -9.238   -25.057 1.00 46.35  ? 355  LEU A N     1 
ATOM   2443 C  CA    . LEU A 1 309 ? 42.534  -9.294   -26.470 1.00 46.32  ? 355  LEU A CA    1 
ATOM   2444 C  C     . LEU A 1 309 ? 43.933  -8.716   -26.672 1.00 55.89  ? 355  LEU A C     1 
ATOM   2445 O  O     . LEU A 1 309 ? 44.577  -8.206   -25.778 1.00 57.67  ? 355  LEU A O     1 
ATOM   2446 C  CB    . LEU A 1 309 ? 41.456  -8.597   -27.304 1.00 45.39  ? 355  LEU A CB    1 
ATOM   2447 C  CG    . LEU A 1 309 ? 40.177  -9.371   -27.634 1.00 46.38  ? 355  LEU A CG    1 
ATOM   2448 C  CD1   . LEU A 1 309 ? 40.386  -10.414  -28.693 1.00 47.35  ? 355  LEU A CD1   1 
ATOM   2449 C  CD2   . LEU A 1 309 ? 39.584  -10.028  -26.421 1.00 44.39  ? 355  LEU A CD2   1 
ATOM   2450 N  N     . GLY A 1 310 ? 44.448  -8.820   -27.853 1.00 54.68  ? 356  GLY A N     1 
ATOM   2451 C  CA    . GLY A 1 310 ? 45.816  -8.377   -28.064 1.00 55.55  ? 356  GLY A CA    1 
ATOM   2452 C  C     . GLY A 1 310 ? 46.252  -6.936   -27.829 1.00 58.29  ? 356  GLY A C     1 
ATOM   2453 O  O     . GLY A 1 310 ? 47.408  -6.660   -27.912 1.00 58.58  ? 356  GLY A O     1 
ATOM   2454 N  N     . PHE A 1 311 ? 45.333  -6.029   -27.567 1.00 52.79  ? 357  PHE A N     1 
ATOM   2455 C  CA    . PHE A 1 311 ? 45.625  -4.620   -27.492 1.00 51.07  ? 357  PHE A CA    1 
ATOM   2456 C  C     . PHE A 1 311 ? 46.596  -4.101   -26.479 1.00 52.73  ? 357  PHE A C     1 
ATOM   2457 O  O     . PHE A 1 311 ? 46.435  -4.215   -25.299 1.00 51.31  ? 357  PHE A O     1 
ATOM   2458 C  CB    . PHE A 1 311 ? 44.325  -3.865   -27.283 1.00 52.06  ? 357  PHE A CB    1 
ATOM   2459 C  CG    . PHE A 1 311 ? 43.341  -4.026   -28.391 1.00 52.70  ? 357  PHE A CG    1 
ATOM   2460 C  CD1   . PHE A 1 311 ? 43.417  -3.253   -29.506 1.00 55.87  ? 357  PHE A CD1   1 
ATOM   2461 C  CD2   . PHE A 1 311 ? 42.330  -4.947   -28.302 1.00 54.28  ? 357  PHE A CD2   1 
ATOM   2462 C  CE1   . PHE A 1 311 ? 42.509  -3.392   -30.522 1.00 56.08  ? 357  PHE A CE1   1 
ATOM   2463 C  CE2   . PHE A 1 311 ? 41.425  -5.099   -29.314 1.00 57.48  ? 357  PHE A CE2   1 
ATOM   2464 C  CZ    . PHE A 1 311 ? 41.512  -4.317   -30.426 1.00 54.75  ? 357  PHE A CZ    1 
ATOM   2465 N  N     . SER A 1 312 ? 47.552  -3.404   -27.035 1.00 49.13  ? 358  SER A N     1 
ATOM   2466 C  CA    . SER A 1 312 ? 48.629  -2.699   -26.330 1.00 49.75  ? 358  SER A CA    1 
ATOM   2467 C  C     . SER A 1 312 ? 48.115  -1.403   -25.677 1.00 56.10  ? 358  SER A C     1 
ATOM   2468 O  O     . SER A 1 312 ? 47.020  -0.957   -26.016 1.00 55.89  ? 358  SER A O     1 
ATOM   2469 C  CB    . SER A 1 312 ? 49.768  -2.383   -27.295 1.00 50.63  ? 358  SER A CB    1 
ATOM   2470 O  OG    . SER A 1 312 ? 49.418  -1.372   -28.224 1.00 54.33  ? 358  SER A OG    1 
ATOM   2471 N  N     . HIS A 1 313 ? 48.888  -0.816   -24.732 1.00 53.31  ? 359  HIS A N     1 
ATOM   2472 C  CA    . HIS A 1 313 ? 48.504  0.404    -24.013 1.00 53.80  ? 359  HIS A CA    1 
ATOM   2473 C  C     . HIS A 1 313 ? 48.352  1.592    -24.977 1.00 58.13  ? 359  HIS A C     1 
ATOM   2474 O  O     . HIS A 1 313 ? 47.408  2.377    -24.837 1.00 58.89  ? 359  HIS A O     1 
ATOM   2475 C  CB    . HIS A 1 313 ? 49.479  0.722    -22.870 1.00 55.08  ? 359  HIS A CB    1 
ATOM   2476 C  CG    . HIS A 1 313 ? 49.149  1.983    -22.136 1.00 59.13  ? 359  HIS A CG    1 
ATOM   2477 N  ND1   . HIS A 1 313 ? 48.188  2.007    -21.142 1.00 61.49  ? 359  HIS A ND1   1 
ATOM   2478 C  CD2   . HIS A 1 313 ? 49.644  3.234    -22.298 1.00 61.29  ? 359  HIS A CD2   1 
ATOM   2479 C  CE1   . HIS A 1 313 ? 48.136  3.262    -20.727 1.00 61.19  ? 359  HIS A CE1   1 
ATOM   2480 N  NE2   . HIS A 1 313 ? 48.998  4.037    -21.394 1.00 61.36  ? 359  HIS A NE2   1 
ATOM   2481 N  N     . GLU A 1 314 ? 49.245  1.678    -25.978 1.00 51.54  ? 360  GLU A N     1 
ATOM   2482 C  CA    . GLU A 1 314 ? 49.210  2.701    -27.010 1.00 50.51  ? 360  GLU A CA    1 
ATOM   2483 C  C     . GLU A 1 314 ? 47.988  2.478    -27.924 1.00 50.17  ? 360  GLU A C     1 
ATOM   2484 O  O     . GLU A 1 314 ? 47.513  3.437    -28.527 1.00 47.53  ? 360  GLU A O     1 
ATOM   2485 C  CB    . GLU A 1 314 ? 50.507  2.710    -27.848 1.00 52.21  ? 360  GLU A CB    1 
ATOM   2486 C  CG    . GLU A 1 314 ? 51.808  2.662    -27.049 1.00 65.97  ? 360  GLU A CG    1 
ATOM   2487 C  CD    . GLU A 1 314 ? 52.178  1.278    -26.544 1.00 83.48  ? 360  GLU A CD    1 
ATOM   2488 O  OE1   . GLU A 1 314 ? 52.608  0.438    -27.367 1.00 67.51  ? 360  GLU A OE1   1 
ATOM   2489 O  OE2   . GLU A 1 314 ? 51.966  1.011    -25.339 1.00 78.56  ? 360  GLU A OE2   1 
ATOM   2490 N  N     . GLU A 1 315 ? 47.530  1.219    -28.066 1.00 44.89  ? 361  GLU A N     1 
ATOM   2491 C  CA    . GLU A 1 315 ? 46.378  0.870    -28.886 1.00 44.56  ? 361  GLU A CA    1 
ATOM   2492 C  C     . GLU A 1 315 ? 45.113  1.359    -28.212 1.00 47.33  ? 361  GLU A C     1 
ATOM   2493 O  O     . GLU A 1 315 ? 44.346  2.124    -28.820 1.00 47.39  ? 361  GLU A O     1 
ATOM   2494 C  CB    . GLU A 1 315 ? 46.311  -0.639   -29.194 1.00 45.79  ? 361  GLU A CB    1 
ATOM   2495 C  CG    . GLU A 1 315 ? 47.104  -1.020   -30.437 1.00 53.50  ? 361  GLU A CG    1 
ATOM   2496 C  CD    . GLU A 1 315 ? 46.964  -2.456   -30.914 1.00 68.54  ? 361  GLU A CD    1 
ATOM   2497 O  OE1   . GLU A 1 315 ? 47.008  -3.389   -30.079 1.00 58.65  ? 361  GLU A OE1   1 
ATOM   2498 O  OE2   . GLU A 1 315 ? 46.889  -2.647   -32.148 1.00 65.34  ? 361  GLU A OE2   1 
ATOM   2499 N  N     . ILE A 1 316 ? 44.941  1.004    -26.932 1.00 43.12  ? 362  ILE A N     1 
ATOM   2500 C  CA    . ILE A 1 316 ? 43.768  1.390    -26.132 1.00 42.91  ? 362  ILE A CA    1 
ATOM   2501 C  C     . ILE A 1 316 ? 43.679  2.959    -26.002 1.00 47.27  ? 362  ILE A C     1 
ATOM   2502 O  O     . ILE A 1 316 ? 42.625  3.547    -26.286 1.00 46.37  ? 362  ILE A O     1 
ATOM   2503 C  CB    . ILE A 1 316 ? 43.742  0.610    -24.788 1.00 45.50  ? 362  ILE A CB    1 
ATOM   2504 C  CG1   . ILE A 1 316 ? 43.842  -0.914   -25.055 1.00 45.44  ? 362  ILE A CG1   1 
ATOM   2505 C  CG2   . ILE A 1 316 ? 42.479  0.923    -23.983 1.00 47.33  ? 362  ILE A CG2   1 
ATOM   2506 C  CD1   . ILE A 1 316 ? 44.146  -1.807   -23.848 1.00 47.87  ? 362  ILE A CD1   1 
ATOM   2507 N  N     . ILE A 1 317 ? 44.812  3.624    -25.704 1.00 42.87  ? 363  ILE A N     1 
ATOM   2508 C  CA    . ILE A 1 317 ? 44.862  5.077    -25.582 1.00 42.56  ? 363  ILE A CA    1 
ATOM   2509 C  C     . ILE A 1 317 ? 44.474  5.734    -26.906 1.00 46.24  ? 363  ILE A C     1 
ATOM   2510 O  O     . ILE A 1 317 ? 43.694  6.684    -26.900 1.00 46.22  ? 363  ILE A O     1 
ATOM   2511 C  CB    . ILE A 1 317 ? 46.228  5.553    -25.023 1.00 46.20  ? 363  ILE A CB    1 
ATOM   2512 C  CG1   . ILE A 1 317 ? 46.404  5.191    -23.510 1.00 47.86  ? 363  ILE A CG1   1 
ATOM   2513 C  CG2   . ILE A 1 317 ? 46.516  7.038    -25.291 1.00 46.45  ? 363  ILE A CG2   1 
ATOM   2514 C  CD1   . ILE A 1 317 ? 45.393  5.767    -22.534 1.00 62.96  ? 363  ILE A CD1   1 
ATOM   2515 N  N     . SER A 1 318 ? 44.964  5.182    -28.027 1.00 41.54  ? 364  SER A N     1 
ATOM   2516 C  CA    . SER A 1 318 ? 44.686  5.676    -29.367 1.00 41.64  ? 364  SER A CA    1 
ATOM   2517 C  C     . SER A 1 318 ? 43.199  5.575    -29.771 1.00 44.90  ? 364  SER A C     1 
ATOM   2518 O  O     . SER A 1 318 ? 42.708  6.454    -30.463 1.00 44.65  ? 364  SER A O     1 
ATOM   2519 C  CB    . SER A 1 318 ? 45.590  5.004    -30.387 1.00 44.88  ? 364  SER A CB    1 
ATOM   2520 O  OG    . SER A 1 318 ? 46.919  5.479    -30.243 1.00 54.72  ? 364  SER A OG    1 
ATOM   2521 N  N     . MET A 1 319 ? 42.504  4.524    -29.315 1.00 40.56  ? 365  MET A N     1 
ATOM   2522 C  CA    . MET A 1 319 ? 41.091  4.268    -29.556 1.00 39.77  ? 365  MET A CA    1 
ATOM   2523 C  C     . MET A 1 319 ? 40.222  5.287    -28.810 1.00 41.23  ? 365  MET A C     1 
ATOM   2524 O  O     . MET A 1 319 ? 39.216  5.717    -29.349 1.00 38.01  ? 365  MET A O     1 
ATOM   2525 C  CB    . MET A 1 319 ? 40.720  2.891    -29.005 1.00 42.06  ? 365  MET A CB    1 
ATOM   2526 C  CG    . MET A 1 319 ? 41.158  1.726    -29.854 1.00 46.67  ? 365  MET A CG    1 
ATOM   2527 S  SD    . MET A 1 319 ? 41.045  0.165    -28.877 1.00 51.68  ? 365  MET A SD    1 
ATOM   2528 C  CE    . MET A 1 319 ? 39.391  0.231    -28.389 1.00 47.47  ? 365  MET A CE    1 
ATOM   2529 N  N     . LEU A 1 320 ? 40.563  5.573    -27.530 1.00 38.73  ? 366  LEU A N     1 
ATOM   2530 C  CA    . LEU A 1 320 ? 39.878  6.491    -26.616 1.00 38.75  ? 366  LEU A CA    1 
ATOM   2531 C  C     . LEU A 1 320 ? 40.109  7.935    -27.035 1.00 44.11  ? 366  LEU A C     1 
ATOM   2532 O  O     . LEU A 1 320 ? 39.249  8.796    -26.810 1.00 44.15  ? 366  LEU A O     1 
ATOM   2533 C  CB    . LEU A 1 320 ? 40.372  6.271    -25.174 1.00 39.27  ? 366  LEU A CB    1 
ATOM   2534 C  CG    . LEU A 1 320 ? 40.226  4.850    -24.593 1.00 44.57  ? 366  LEU A CG    1 
ATOM   2535 C  CD1   . LEU A 1 320 ? 40.809  4.766    -23.205 1.00 43.97  ? 366  LEU A CD1   1 
ATOM   2536 C  CD2   . LEU A 1 320 ? 38.783  4.392    -24.598 1.00 50.64  ? 366  LEU A CD2   1 
ATOM   2537 N  N     . ARG A 1 321 ? 41.276  8.192    -27.661 1.00 39.05  ? 367  ARG A N     1 
ATOM   2538 C  CA    . ARG A 1 321 ? 41.611  9.498    -28.173 1.00 37.92  ? 367  ARG A CA    1 
ATOM   2539 C  C     . ARG A 1 321 ? 40.727  9.758    -29.429 1.00 41.86  ? 367  ARG A C     1 
ATOM   2540 O  O     . ARG A 1 321 ? 40.271  10.891   -29.648 1.00 41.83  ? 367  ARG A O     1 
ATOM   2541 C  CB    . ARG A 1 321 ? 43.097  9.519    -28.493 1.00 36.76  ? 367  ARG A CB    1 
ATOM   2542 C  CG    . ARG A 1 321 ? 43.614  10.873   -28.936 1.00 56.26  ? 367  ARG A CG    1 
ATOM   2543 C  CD    . ARG A 1 321 ? 45.102  11.056   -28.728 1.00 67.86  ? 367  ARG A CD    1 
ATOM   2544 N  NE    . ARG A 1 321 ? 45.891  10.071   -29.458 1.00 82.36  ? 367  ARG A NE    1 
ATOM   2545 C  CZ    . ARG A 1 321 ? 46.821  9.301    -28.903 1.00 92.90  ? 367  ARG A CZ    1 
ATOM   2546 N  NH1   . ARG A 1 321 ? 47.114  9.424    -27.613 1.00 62.15  ? 367  ARG A NH1   1 
ATOM   2547 N  NH2   . ARG A 1 321 ? 47.488  8.425    -29.640 1.00 87.44  ? 367  ARG A NH2   1 
ATOM   2548 N  N     . MET A 1 322 ? 40.470  8.691    -30.220 1.00 38.05  ? 368  MET A N     1 
ATOM   2549 C  CA    . MET A 1 322 ? 39.633  8.741    -31.413 1.00 38.21  ? 368  MET A CA    1 
ATOM   2550 C  C     . MET A 1 322 ? 38.175  8.961    -30.997 1.00 40.00  ? 368  MET A C     1 
ATOM   2551 O  O     . MET A 1 322 ? 37.490  9.708    -31.663 1.00 39.81  ? 368  MET A O     1 
ATOM   2552 C  CB    . MET A 1 322 ? 39.774  7.462    -32.241 1.00 40.57  ? 368  MET A CB    1 
ATOM   2553 C  CG    . MET A 1 322 ? 39.434  7.647    -33.705 1.00 43.98  ? 368  MET A CG    1 
ATOM   2554 S  SD    . MET A 1 322 ? 40.663  8.578    -34.675 1.00 48.61  ? 368  MET A SD    1 
ATOM   2555 C  CE    . MET A 1 322 ? 42.034  7.557    -34.487 1.00 45.95  ? 368  MET A CE    1 
ATOM   2556 N  N     . VAL A 1 323 ? 37.742  8.374    -29.866 1.00 36.10  ? 369  VAL A N     1 
ATOM   2557 C  CA    . VAL A 1 323 ? 36.382  8.531    -29.303 1.00 35.04  ? 369  VAL A CA    1 
ATOM   2558 C  C     . VAL A 1 323 ? 36.173  10.024   -28.972 1.00 40.52  ? 369  VAL A C     1 
ATOM   2559 O  O     . VAL A 1 323 ? 35.260  10.646   -29.516 1.00 38.58  ? 369  VAL A O     1 
ATOM   2560 C  CB    . VAL A 1 323 ? 36.138  7.589    -28.088 1.00 36.47  ? 369  VAL A CB    1 
ATOM   2561 C  CG1   . VAL A 1 323 ? 34.856  7.951    -27.346 1.00 35.73  ? 369  VAL A CG1   1 
ATOM   2562 C  CG2   . VAL A 1 323 ? 36.094  6.135    -28.530 1.00 35.83  ? 369  VAL A CG2   1 
ATOM   2563 N  N     . SER A 1 324 ? 37.101  10.600   -28.185 1.00 39.73  ? 370  SER A N     1 
ATOM   2564 C  CA    . SER A 1 324 ? 37.153  12.014   -27.789 1.00 41.06  ? 370  SER A CA    1 
ATOM   2565 C  C     . SER A 1 324 ? 37.212  12.934   -29.031 1.00 45.34  ? 370  SER A C     1 
ATOM   2566 O  O     . SER A 1 324 ? 36.675  14.041   -28.996 1.00 46.32  ? 370  SER A O     1 
ATOM   2567 C  CB    . SER A 1 324 ? 38.373  12.241   -26.891 1.00 45.28  ? 370  SER A CB    1 
ATOM   2568 O  OG    . SER A 1 324 ? 38.585  13.587   -26.493 1.00 53.40  ? 370  SER A OG    1 
ATOM   2569 N  N     . ALA A 1 325 ? 37.872  12.463   -30.119 1.00 40.78  ? 371  ALA A N     1 
ATOM   2570 C  CA    . ALA A 1 325 ? 38.014  13.180   -31.388 1.00 39.80  ? 371  ALA A CA    1 
ATOM   2571 C  C     . ALA A 1 325 ? 36.679  13.231   -32.101 1.00 40.08  ? 371  ALA A C     1 
ATOM   2572 O  O     . ALA A 1 325 ? 36.295  14.322   -32.524 1.00 39.79  ? 371  ALA A O     1 
ATOM   2573 C  CB    . ALA A 1 325 ? 39.068  12.523   -32.266 1.00 40.62  ? 371  ALA A CB    1 
ATOM   2574 N  N     . VAL A 1 326 ? 35.941  12.081   -32.192 1.00 33.53  ? 372  VAL A N     1 
ATOM   2575 C  CA    . VAL A 1 326 ? 34.560  12.018   -32.765 1.00 32.01  ? 372  VAL A CA    1 
ATOM   2576 C  C     . VAL A 1 326 ? 33.681  13.039   -32.010 1.00 33.18  ? 372  VAL A C     1 
ATOM   2577 O  O     . VAL A 1 326 ? 32.961  13.806   -32.638 1.00 34.05  ? 372  VAL A O     1 
ATOM   2578 C  CB    . VAL A 1 326 ? 33.952  10.572   -32.681 1.00 35.90  ? 372  VAL A CB    1 
ATOM   2579 C  CG1   . VAL A 1 326 ? 32.493  10.556   -33.133 1.00 36.21  ? 372  VAL A CG1   1 
ATOM   2580 C  CG2   . VAL A 1 326 ? 34.763  9.572    -33.492 1.00 34.74  ? 372  VAL A CG2   1 
ATOM   2581 N  N     . LEU A 1 327 ? 33.784  13.093   -30.664 1.00 31.12  ? 373  LEU A N     1 
ATOM   2582 C  CA    . LEU A 1 327 ? 33.041  14.067   -29.855 1.00 32.72  ? 373  LEU A CA    1 
ATOM   2583 C  C     . LEU A 1 327 ? 33.440  15.541   -30.123 1.00 41.28  ? 373  LEU A C     1 
ATOM   2584 O  O     . LEU A 1 327 ? 32.564  16.376   -30.338 1.00 42.19  ? 373  LEU A O     1 
ATOM   2585 C  CB    . LEU A 1 327 ? 33.119  13.746   -28.357 1.00 32.62  ? 373  LEU A CB    1 
ATOM   2586 C  CG    . LEU A 1 327 ? 32.283  12.574   -27.822 1.00 37.40  ? 373  LEU A CG    1 
ATOM   2587 C  CD1   . LEU A 1 327 ? 32.692  12.222   -26.390 1.00 38.99  ? 373  LEU A CD1   1 
ATOM   2588 C  CD2   . LEU A 1 327 ? 30.796  12.862   -27.837 1.00 41.12  ? 373  LEU A CD2   1 
ATOM   2589 N  N     . GLN A 1 328 ? 34.750  15.850   -30.151 1.00 39.61  ? 374  GLN A N     1 
ATOM   2590 C  CA    . GLN A 1 328 ? 35.285  17.207   -30.350 1.00 39.55  ? 374  GLN A CA    1 
ATOM   2591 C  C     . GLN A 1 328 ? 34.836  17.867   -31.657 1.00 43.59  ? 374  GLN A C     1 
ATOM   2592 O  O     . GLN A 1 328 ? 34.649  19.095   -31.690 1.00 44.29  ? 374  GLN A O     1 
ATOM   2593 C  CB    . GLN A 1 328 ? 36.825  17.204   -30.221 1.00 41.16  ? 374  GLN A CB    1 
ATOM   2594 C  CG    . GLN A 1 328 ? 37.459  18.553   -29.895 1.00 62.25  ? 374  GLN A CG    1 
ATOM   2595 C  CD    . GLN A 1 328 ? 36.854  19.232   -28.695 1.00 79.73  ? 374  GLN A CD    1 
ATOM   2596 O  OE1   . GLN A 1 328 ? 36.863  18.726   -27.572 1.00 77.74  ? 374  GLN A OE1   1 
ATOM   2597 N  NE2   . GLN A 1 328 ? 36.301  20.392   -28.921 1.00 68.40  ? 374  GLN A NE2   1 
ATOM   2598 N  N     . PHE A 1 329 ? 34.621  17.070   -32.719 1.00 38.16  ? 375  PHE A N     1 
ATOM   2599 C  CA    . PHE A 1 329 ? 34.124  17.584   -34.000 1.00 37.24  ? 375  PHE A CA    1 
ATOM   2600 C  C     . PHE A 1 329 ? 32.823  18.415   -33.789 1.00 46.35  ? 375  PHE A C     1 
ATOM   2601 O  O     . PHE A 1 329 ? 32.602  19.417   -34.462 1.00 45.82  ? 375  PHE A O     1 
ATOM   2602 C  CB    . PHE A 1 329 ? 33.806  16.405   -34.920 1.00 38.16  ? 375  PHE A CB    1 
ATOM   2603 C  CG    . PHE A 1 329 ? 34.909  15.902   -35.816 1.00 38.70  ? 375  PHE A CG    1 
ATOM   2604 C  CD1   . PHE A 1 329 ? 35.330  16.646   -36.914 1.00 41.32  ? 375  PHE A CD1   1 
ATOM   2605 C  CD2   . PHE A 1 329 ? 35.441  14.633   -35.640 1.00 39.18  ? 375  PHE A CD2   1 
ATOM   2606 C  CE1   . PHE A 1 329 ? 36.341  16.171   -37.755 1.00 41.67  ? 375  PHE A CE1   1 
ATOM   2607 C  CE2   . PHE A 1 329 ? 36.432  14.148   -36.496 1.00 41.89  ? 375  PHE A CE2   1 
ATOM   2608 C  CZ    . PHE A 1 329 ? 36.858  14.910   -37.561 1.00 40.23  ? 375  PHE A CZ    1 
ATOM   2609 N  N     . GLY A 1 330 ? 31.984  17.970   -32.860 1.00 46.18  ? 376  GLY A N     1 
ATOM   2610 C  CA    . GLY A 1 330 ? 30.736  18.631   -32.523 1.00 46.82  ? 376  GLY A CA    1 
ATOM   2611 C  C     . GLY A 1 330 ? 30.845  19.869   -31.660 1.00 52.36  ? 376  GLY A C     1 
ATOM   2612 O  O     . GLY A 1 330 ? 29.825  20.537   -31.467 1.00 53.63  ? 376  GLY A O     1 
ATOM   2613 N  N     . ASN A 1 331 ? 32.046  20.217   -31.138 1.00 47.37  ? 377  ASN A N     1 
ATOM   2614 C  CA    . ASN A 1 331 ? 32.165  21.438   -30.312 1.00 47.11  ? 377  ASN A CA    1 
ATOM   2615 C  C     . ASN A 1 331 ? 32.635  22.659   -31.076 1.00 50.04  ? 377  ASN A C     1 
ATOM   2616 O  O     . ASN A 1 331 ? 32.730  23.762   -30.518 1.00 50.25  ? 377  ASN A O     1 
ATOM   2617 C  CB    . ASN A 1 331 ? 33.019  21.214   -29.092 1.00 51.29  ? 377  ASN A CB    1 
ATOM   2618 C  CG    . ASN A 1 331 ? 32.438  20.241   -28.109 1.00 75.29  ? 377  ASN A CG    1 
ATOM   2619 O  OD1   . ASN A 1 331 ? 31.216  20.039   -28.023 1.00 60.32  ? 377  ASN A OD1   1 
ATOM   2620 N  ND2   . ASN A 1 331 ? 33.320  19.641   -27.319 1.00 72.77  ? 377  ASN A ND2   1 
ATOM   2621 N  N     . ILE A 1 332 ? 32.903  22.469   -32.366 1.00 45.05  ? 378  ILE A N     1 
ATOM   2622 C  CA    . ILE A 1 332 ? 33.335  23.520   -33.271 1.00 43.82  ? 378  ILE A CA    1 
ATOM   2623 C  C     . ILE A 1 332 ? 32.106  24.375   -33.627 1.00 49.30  ? 378  ILE A C     1 
ATOM   2624 O  O     . ILE A 1 332 ? 31.209  23.893   -34.324 1.00 49.22  ? 378  ILE A O     1 
ATOM   2625 C  CB    . ILE A 1 332 ? 34.025  22.882   -34.513 1.00 46.10  ? 378  ILE A CB    1 
ATOM   2626 C  CG1   . ILE A 1 332 ? 35.247  21.990   -34.065 1.00 46.39  ? 378  ILE A CG1   1 
ATOM   2627 C  CG2   . ILE A 1 332 ? 34.423  23.958   -35.550 1.00 44.65  ? 378  ILE A CG2   1 
ATOM   2628 C  CD1   . ILE A 1 332 ? 35.963  21.190   -35.200 1.00 50.52  ? 378  ILE A CD1   1 
ATOM   2629 N  N     . ALA A 1 333 ? 32.050  25.627   -33.116 1.00 45.30  ? 379  ALA A N     1 
ATOM   2630 C  CA    . ALA A 1 333 ? 30.947  26.538   -33.416 1.00 44.11  ? 379  ALA A CA    1 
ATOM   2631 C  C     . ALA A 1 333 ? 31.279  27.375   -34.626 1.00 45.70  ? 379  ALA A C     1 
ATOM   2632 O  O     . ALA A 1 333 ? 32.181  28.241   -34.605 1.00 44.48  ? 379  ALA A O     1 
ATOM   2633 C  CB    . ALA A 1 333 ? 30.603  27.416   -32.224 1.00 44.93  ? 379  ALA A CB    1 
ATOM   2634 N  N     . LEU A 1 334 ? 30.596  27.031   -35.723 1.00 40.31  ? 380  LEU A N     1 
ATOM   2635 C  CA    . LEU A 1 334 ? 30.714  27.724   -36.989 1.00 38.78  ? 380  LEU A CA    1 
ATOM   2636 C  C     . LEU A 1 334 ? 29.625  28.753   -37.021 1.00 42.72  ? 380  LEU A C     1 
ATOM   2637 O  O     . LEU A 1 334 ? 28.541  28.548   -36.441 1.00 41.54  ? 380  LEU A O     1 
ATOM   2638 C  CB    . LEU A 1 334 ? 30.592  26.768   -38.195 1.00 38.38  ? 380  LEU A CB    1 
ATOM   2639 C  CG    . LEU A 1 334 ? 31.632  25.639   -38.272 1.00 43.61  ? 380  LEU A CG    1 
ATOM   2640 C  CD1   . LEU A 1 334 ? 31.360  24.741   -39.456 1.00 44.02  ? 380  LEU A CD1   1 
ATOM   2641 C  CD2   . LEU A 1 334 ? 33.065  26.199   -38.351 1.00 47.19  ? 380  LEU A CD2   1 
ATOM   2642 N  N     . LYS A 1 335 ? 29.923  29.884   -37.671 1.00 39.57  ? 381  LYS A N     1 
ATOM   2643 C  CA    . LYS A 1 335 ? 28.985  30.983   -37.856 1.00 39.05  ? 381  LYS A CA    1 
ATOM   2644 C  C     . LYS A 1 335 ? 29.033  31.367   -39.329 1.00 43.88  ? 381  LYS A C     1 
ATOM   2645 O  O     . LYS A 1 335 ? 29.739  30.733   -40.099 1.00 42.82  ? 381  LYS A O     1 
ATOM   2646 C  CB    . LYS A 1 335 ? 29.359  32.174   -36.933 1.00 41.19  ? 381  LYS A CB    1 
ATOM   2647 C  CG    . LYS A 1 335 ? 29.350  31.885   -35.408 1.00 44.12  ? 381  LYS A CG    1 
ATOM   2648 C  CD    . LYS A 1 335 ? 27.970  31.514   -34.813 1.00 57.73  ? 381  LYS A CD    1 
ATOM   2649 C  CE    . LYS A 1 335 ? 28.065  30.918   -33.410 1.00 66.20  ? 381  LYS A CE    1 
ATOM   2650 N  NZ    . LYS A 1 335 ? 27.750  29.447   -33.351 1.00 63.22  ? 381  LYS A NZ    1 
ATOM   2651 N  N     . ARG A 1 336 ? 28.258  32.350   -39.749 1.00 42.50  ? 382  ARG A N     1 
ATOM   2652 C  CA    . ARG A 1 336 ? 28.366  32.824   -41.120 1.00 43.05  ? 382  ARG A CA    1 
ATOM   2653 C  C     . ARG A 1 336 ? 29.087  34.166   -41.067 1.00 44.59  ? 382  ARG A C     1 
ATOM   2654 O  O     . ARG A 1 336 ? 29.324  34.667   -39.966 1.00 43.55  ? 382  ARG A O     1 
ATOM   2655 C  CB    . ARG A 1 336 ? 26.999  32.955   -41.808 1.00 46.64  ? 382  ARG A CB    1 
ATOM   2656 C  CG    . ARG A 1 336 ? 26.115  34.092   -41.319 1.00 72.57  ? 382  ARG A CG    1 
ATOM   2657 C  CD    . ARG A 1 336 ? 24.890  34.274   -42.201 1.00 100.71 ? 382  ARG A CD    1 
ATOM   2658 N  NE    . ARG A 1 336 ? 23.985  33.123   -42.156 1.00 122.17 ? 382  ARG A NE    1 
ATOM   2659 C  CZ    . ARG A 1 336 ? 23.058  32.860   -43.071 1.00 146.60 ? 382  ARG A CZ    1 
ATOM   2660 N  NH1   . ARG A 1 336 ? 22.882  33.678   -44.102 1.00 138.31 ? 382  ARG A NH1   1 
ATOM   2661 N  NH2   . ARG A 1 336 ? 22.289  31.787   -42.952 1.00 136.40 ? 382  ARG A NH2   1 
ATOM   2662 N  N     . GLU A 1 337 ? 29.410  34.763   -42.192 1.00 40.76  ? 383  GLU A N     1 
ATOM   2663 C  CA    . GLU A 1 337 ? 29.981  36.094   -42.242 1.00 41.98  ? 383  GLU A CA    1 
ATOM   2664 C  C     . GLU A 1 337 ? 28.839  37.117   -42.069 1.00 50.12  ? 383  GLU A C     1 
ATOM   2665 O  O     . GLU A 1 337 ? 27.697  36.769   -42.211 1.00 48.78  ? 383  GLU A O     1 
ATOM   2666 C  CB    . GLU A 1 337 ? 30.757  36.306   -43.528 1.00 43.47  ? 383  GLU A CB    1 
ATOM   2667 C  CG    . GLU A 1 337 ? 32.167  35.798   -43.412 1.00 55.75  ? 383  GLU A CG    1 
ATOM   2668 C  CD    . GLU A 1 337 ? 33.015  36.000   -44.637 1.00 81.86  ? 383  GLU A CD    1 
ATOM   2669 O  OE1   . GLU A 1 337 ? 32.632  36.739   -45.541 1.00 76.36  ? 383  GLU A OE1   1 
ATOM   2670 O  OE2   . GLU A 1 337 ? 34.092  35.410   -44.693 1.00 86.45  ? 383  GLU A OE2   1 
ATOM   2671 N  N     . ARG A 1 338 ? 29.152  38.362   -41.748 1.00 49.61  ? 384  ARG A N     1 
ATOM   2672 C  CA    . ARG A 1 338 ? 28.156  39.404   -41.484 1.00 51.04  ? 384  ARG A CA    1 
ATOM   2673 C  C     . ARG A 1 338 ? 27.370  39.735   -42.738 1.00 57.70  ? 384  ARG A C     1 
ATOM   2674 O  O     . ARG A 1 338 ? 26.174  39.990   -42.653 1.00 58.18  ? 384  ARG A O     1 
ATOM   2675 C  CB    . ARG A 1 338 ? 28.878  40.659   -40.941 1.00 55.71  ? 384  ARG A CB    1 
ATOM   2676 C  CG    . ARG A 1 338 ? 28.142  42.006   -41.027 1.00 75.47  ? 384  ARG A CG    1 
ATOM   2677 C  CD    . ARG A 1 338 ? 29.069  43.195   -40.770 1.00 95.39  ? 384  ARG A CD    1 
ATOM   2678 N  NE    . ARG A 1 338 ? 29.940  43.474   -41.918 1.00 111.42 ? 384  ARG A NE    1 
ATOM   2679 C  CZ    . ARG A 1 338 ? 31.256  43.260   -41.942 1.00 128.74 ? 384  ARG A CZ    1 
ATOM   2680 N  NH1   . ARG A 1 338 ? 31.876  42.784   -40.870 1.00 118.40 ? 384  ARG A NH1   1 
ATOM   2681 N  NH2   . ARG A 1 338 ? 31.957  43.533   -43.034 1.00 113.48 ? 384  ARG A NH2   1 
ATOM   2682 N  N     . ASN A 1 339 ? 28.038  39.709   -43.903 1.00 55.80  ? 385  ASN A N     1 
ATOM   2683 C  CA    . ASN A 1 339 ? 27.463  40.089   -45.190 1.00 55.40  ? 385  ASN A CA    1 
ATOM   2684 C  C     . ASN A 1 339 ? 27.457  39.007   -46.225 1.00 56.89  ? 385  ASN A C     1 
ATOM   2685 O  O     . ASN A 1 339 ? 27.081  39.293   -47.362 1.00 56.93  ? 385  ASN A O     1 
ATOM   2686 C  CB    . ASN A 1 339 ? 28.192  41.339   -45.726 1.00 62.46  ? 385  ASN A CB    1 
ATOM   2687 C  CG    . ASN A 1 339 ? 29.693  41.188   -45.852 1.00 91.37  ? 385  ASN A CG    1 
ATOM   2688 O  OD1   . ASN A 1 339 ? 30.398  40.832   -44.899 1.00 87.50  ? 385  ASN A OD1   1 
ATOM   2689 N  ND2   . ASN A 1 339 ? 30.216  41.492   -47.028 1.00 84.15  ? 385  ASN A ND2   1 
ATOM   2690 N  N     . THR A 1 340 ? 27.892  37.772   -45.863 1.00 52.70  ? 386  THR A N     1 
ATOM   2691 C  CA    . THR A 1 340 ? 27.950  36.610   -46.773 1.00 52.43  ? 386  THR A CA    1 
ATOM   2692 C  C     . THR A 1 340 ? 27.564  35.292   -46.045 1.00 53.90  ? 386  THR A C     1 
ATOM   2693 O  O     . THR A 1 340 ? 27.803  35.173   -44.843 1.00 52.65  ? 386  THR A O     1 
ATOM   2694 C  CB    . THR A 1 340 ? 29.368  36.461   -47.461 1.00 64.30  ? 386  THR A CB    1 
ATOM   2695 O  OG1   . THR A 1 340 ? 30.327  35.957   -46.541 1.00 63.60  ? 386  THR A OG1   1 
ATOM   2696 C  CG2   . THR A 1 340 ? 29.913  37.755   -48.105 1.00 62.36  ? 386  THR A CG2   1 
ATOM   2697 N  N     . ASP A 1 341 ? 27.031  34.285   -46.777 1.00 49.96  ? 387  ASP A N     1 
ATOM   2698 C  CA    . ASP A 1 341 ? 26.726  32.980   -46.160 1.00 49.98  ? 387  ASP A CA    1 
ATOM   2699 C  C     . ASP A 1 341 ? 27.975  32.083   -45.917 1.00 50.61  ? 387  ASP A C     1 
ATOM   2700 O  O     . ASP A 1 341 ? 27.793  30.946   -45.486 1.00 49.37  ? 387  ASP A O     1 
ATOM   2701 C  CB    . ASP A 1 341 ? 25.629  32.183   -46.911 1.00 51.67  ? 387  ASP A CB    1 
ATOM   2702 C  CG    . ASP A 1 341 ? 25.812  32.054   -48.396 1.00 69.22  ? 387  ASP A CG    1 
ATOM   2703 O  OD1   . ASP A 1 341 ? 26.985  31.972   -48.850 1.00 72.39  ? 387  ASP A OD1   1 
ATOM   2704 O  OD2   . ASP A 1 341 ? 24.784  31.964   -49.109 1.00 78.25  ? 387  ASP A OD2   1 
ATOM   2705 N  N     . GLN A 1 342 ? 29.214  32.599   -46.132 1.00 45.36  ? 388  GLN A N     1 
ATOM   2706 C  CA    . GLN A 1 342 ? 30.451  31.849   -45.889 1.00 44.66  ? 388  GLN A CA    1 
ATOM   2707 C  C     . GLN A 1 342 ? 30.494  31.406   -44.438 1.00 46.32  ? 388  GLN A C     1 
ATOM   2708 O  O     . GLN A 1 342 ? 30.187  32.192   -43.554 1.00 43.66  ? 388  GLN A O     1 
ATOM   2709 C  CB    . GLN A 1 342 ? 31.698  32.702   -46.210 1.00 46.58  ? 388  GLN A CB    1 
ATOM   2710 C  CG    . GLN A 1 342 ? 33.079  32.108   -45.763 1.00 62.13  ? 388  GLN A CG    1 
ATOM   2711 C  CD    . GLN A 1 342 ? 33.455  30.771   -46.401 1.00 79.10  ? 388  GLN A CD    1 
ATOM   2712 O  OE1   . GLN A 1 342 ? 33.557  30.638   -47.619 1.00 71.38  ? 388  GLN A OE1   1 
ATOM   2713 N  NE2   . GLN A 1 342 ? 33.723  29.756   -45.593 1.00 65.85  ? 388  GLN A NE2   1 
ATOM   2714 N  N     . ALA A 1 343 ? 30.869  30.142   -44.203 1.00 43.82  ? 389  ALA A N     1 
ATOM   2715 C  CA    . ALA A 1 343 ? 31.052  29.622   -42.852 1.00 43.99  ? 389  ALA A CA    1 
ATOM   2716 C  C     . ALA A 1 343 ? 32.358  30.239   -42.272 1.00 48.73  ? 389  ALA A C     1 
ATOM   2717 O  O     . ALA A 1 343 ? 33.373  30.309   -42.962 1.00 50.18  ? 389  ALA A O     1 
ATOM   2718 C  CB    . ALA A 1 343 ? 31.167  28.101   -42.901 1.00 44.46  ? 389  ALA A CB    1 
ATOM   2719 N  N     . THR A 1 344 ? 32.321  30.699   -41.038 1.00 43.85  ? 390  THR A N     1 
ATOM   2720 C  CA    . THR A 1 344 ? 33.483  31.255   -40.364 1.00 42.78  ? 390  THR A CA    1 
ATOM   2721 C  C     . THR A 1 344 ? 33.665  30.416   -39.104 1.00 47.93  ? 390  THR A C     1 
ATOM   2722 O  O     . THR A 1 344 ? 32.779  29.641   -38.754 1.00 47.69  ? 390  THR A O     1 
ATOM   2723 C  CB    . THR A 1 344 ? 33.259  32.752   -39.986 1.00 45.61  ? 390  THR A CB    1 
ATOM   2724 O  OG1   . THR A 1 344 ? 32.276  32.853   -38.965 1.00 43.99  ? 390  THR A OG1   1 
ATOM   2725 C  CG2   . THR A 1 344 ? 32.921  33.648   -41.173 1.00 35.90  ? 390  THR A CG2   1 
ATOM   2726 N  N     . MET A 1 345 ? 34.792  30.577   -38.413 1.00 45.24  ? 391  MET A N     1 
ATOM   2727 C  CA    . MET A 1 345 ? 35.048  29.892   -37.155 1.00 45.09  ? 391  MET A CA    1 
ATOM   2728 C  C     . MET A 1 345 ? 35.532  30.962   -36.147 1.00 52.53  ? 391  MET A C     1 
ATOM   2729 O  O     . MET A 1 345 ? 36.732  31.145   -35.969 1.00 51.03  ? 391  MET A O     1 
ATOM   2730 C  CB    . MET A 1 345 ? 36.046  28.745   -37.356 1.00 46.67  ? 391  MET A CB    1 
ATOM   2731 C  CG    . MET A 1 345 ? 36.086  27.782   -36.194 1.00 50.10  ? 391  MET A CG    1 
ATOM   2732 S  SD    . MET A 1 345 ? 37.575  26.754   -36.226 1.00 54.19  ? 391  MET A SD    1 
ATOM   2733 C  CE    . MET A 1 345 ? 37.188  25.626   -37.590 1.00 50.18  ? 391  MET A CE    1 
ATOM   2734 N  N     . PRO A 1 346 ? 34.604  31.757   -35.559 1.00 54.62  ? 392  PRO A N     1 
ATOM   2735 C  CA    . PRO A 1 346 ? 35.022  32.816   -34.613 1.00 55.08  ? 392  PRO A CA    1 
ATOM   2736 C  C     . PRO A 1 346 ? 35.827  32.303   -33.418 1.00 57.38  ? 392  PRO A C     1 
ATOM   2737 O  O     . PRO A 1 346 ? 36.735  32.993   -32.952 1.00 57.10  ? 392  PRO A O     1 
ATOM   2738 C  CB    . PRO A 1 346 ? 33.691  33.455   -34.187 1.00 57.46  ? 392  PRO A CB    1 
ATOM   2739 C  CG    . PRO A 1 346 ? 32.732  33.101   -35.270 1.00 61.81  ? 392  PRO A CG    1 
ATOM   2740 C  CD    . PRO A 1 346 ? 33.129  31.718   -35.678 1.00 57.11  ? 392  PRO A CD    1 
ATOM   2741 N  N     . ASP A 1 347 ? 35.513  31.102   -32.931 1.00 52.88  ? 393  ASP A N     1 
ATOM   2742 C  CA    . ASP A 1 347 ? 36.308  30.519   -31.855 1.00 52.84  ? 393  ASP A CA    1 
ATOM   2743 C  C     . ASP A 1 347 ? 37.013  29.236   -32.365 1.00 53.06  ? 393  ASP A C     1 
ATOM   2744 O  O     . ASP A 1 347 ? 36.356  28.381   -32.947 1.00 51.39  ? 393  ASP A O     1 
ATOM   2745 C  CB    . ASP A 1 347 ? 35.486  30.311   -30.579 1.00 55.66  ? 393  ASP A CB    1 
ATOM   2746 C  CG    . ASP A 1 347 ? 36.377  29.964   -29.395 1.00 67.92  ? 393  ASP A CG    1 
ATOM   2747 O  OD1   . ASP A 1 347 ? 37.079  30.871   -28.890 1.00 66.64  ? 393  ASP A OD1   1 
ATOM   2748 O  OD2   . ASP A 1 347 ? 36.382  28.790   -28.984 1.00 73.73  ? 393  ASP A OD2   1 
ATOM   2749 N  N     . ASN A 1 348 ? 38.350  29.145   -32.225 1.00 48.84  ? 394  ASN A N     1 
ATOM   2750 C  CA    . ASN A 1 348 ? 39.110  28.019   -32.779 1.00 48.58  ? 394  ASN A CA    1 
ATOM   2751 C  C     . ASN A 1 348 ? 39.678  27.035   -31.732 1.00 52.30  ? 394  ASN A C     1 
ATOM   2752 O  O     . ASN A 1 348 ? 40.450  26.145   -32.099 1.00 50.79  ? 394  ASN A O     1 
ATOM   2753 C  CB    . ASN A 1 348 ? 40.221  28.528   -33.721 1.00 48.58  ? 394  ASN A CB    1 
ATOM   2754 C  CG    . ASN A 1 348 ? 41.072  29.629   -33.141 1.00 68.30  ? 394  ASN A CG    1 
ATOM   2755 O  OD1   . ASN A 1 348 ? 41.627  29.517   -32.040 1.00 66.87  ? 394  ASN A OD1   1 
ATOM   2756 N  ND2   . ASN A 1 348 ? 41.176  30.730   -33.869 1.00 47.38  ? 394  ASN A ND2   1 
ATOM   2757 N  N     . THR A 1 349 ? 39.263  27.171   -30.452 1.00 49.63  ? 395  THR A N     1 
ATOM   2758 C  CA    . THR A 1 349 ? 39.696  26.339   -29.336 1.00 50.20  ? 395  THR A CA    1 
ATOM   2759 C  C     . THR A 1 349 ? 39.351  24.847   -29.571 1.00 52.87  ? 395  THR A C     1 
ATOM   2760 O  O     . THR A 1 349 ? 40.209  23.996   -29.384 1.00 52.91  ? 395  THR A O     1 
ATOM   2761 C  CB    . THR A 1 349 ? 39.106  26.847   -28.003 1.00 65.09  ? 395  THR A CB    1 
ATOM   2762 O  OG1   . THR A 1 349 ? 37.689  26.627   -27.993 1.00 74.80  ? 395  THR A OG1   1 
ATOM   2763 C  CG2   . THR A 1 349 ? 39.448  28.309   -27.701 1.00 57.60  ? 395  THR A CG2   1 
ATOM   2764 N  N     . ALA A 1 350 ? 38.121  24.551   -30.035 1.00 47.21  ? 396  ALA A N     1 
ATOM   2765 C  CA    . ALA A 1 350 ? 37.667  23.184   -30.308 1.00 45.80  ? 396  ALA A CA    1 
ATOM   2766 C  C     . ALA A 1 350 ? 38.375  22.584   -31.501 1.00 46.13  ? 396  ALA A C     1 
ATOM   2767 O  O     . ALA A 1 350 ? 38.580  21.381   -31.527 1.00 44.76  ? 396  ALA A O     1 
ATOM   2768 C  CB    . ALA A 1 350 ? 36.158  23.149   -30.515 1.00 46.44  ? 396  ALA A CB    1 
ATOM   2769 N  N     . ALA A 1 351 ? 38.762  23.404   -32.486 1.00 42.49  ? 397  ALA A N     1 
ATOM   2770 C  CA    . ALA A 1 351 ? 39.497  22.895   -33.649 1.00 42.75  ? 397  ALA A CA    1 
ATOM   2771 C  C     . ALA A 1 351 ? 40.984  22.706   -33.299 1.00 47.49  ? 397  ALA A C     1 
ATOM   2772 O  O     . ALA A 1 351 ? 41.679  21.933   -33.954 1.00 46.55  ? 397  ALA A O     1 
ATOM   2773 C  CB    . ALA A 1 351 ? 39.329  23.815   -34.853 1.00 43.08  ? 397  ALA A CB    1 
ATOM   2774 N  N     . GLN A 1 352 ? 41.457  23.394   -32.239 1.00 44.77  ? 398  GLN A N     1 
ATOM   2775 C  CA    . GLN A 1 352 ? 42.827  23.274   -31.767 1.00 44.40  ? 398  GLN A CA    1 
ATOM   2776 C  C     . GLN A 1 352 ? 42.921  21.901   -31.138 1.00 46.86  ? 398  GLN A C     1 
ATOM   2777 O  O     . GLN A 1 352 ? 43.736  21.103   -31.585 1.00 47.91  ? 398  GLN A O     1 
ATOM   2778 C  CB    . GLN A 1 352 ? 43.182  24.406   -30.788 1.00 45.63  ? 398  GLN A CB    1 
ATOM   2779 C  CG    . GLN A 1 352 ? 43.724  25.664   -31.472 1.00 53.92  ? 398  GLN A CG    1 
ATOM   2780 C  CD    . GLN A 1 352 ? 44.001  26.767   -30.475 1.00 63.07  ? 398  GLN A CD    1 
ATOM   2781 O  OE1   . GLN A 1 352 ? 44.724  26.588   -29.476 1.00 54.57  ? 398  GLN A OE1   1 
ATOM   2782 N  NE2   . GLN A 1 352 ? 43.457  27.949   -30.743 1.00 52.00  ? 398  GLN A NE2   1 
ATOM   2783 N  N     . LYS A 1 353 ? 41.984  21.592   -30.221 1.00 41.51  ? 399  LYS A N     1 
ATOM   2784 C  CA    . LYS A 1 353 ? 41.794  20.291   -29.545 1.00 40.28  ? 399  LYS A CA    1 
ATOM   2785 C  C     . LYS A 1 353 ? 41.597  19.154   -30.560 1.00 40.71  ? 399  LYS A C     1 
ATOM   2786 O  O     . LYS A 1 353 ? 42.285  18.146   -30.487 1.00 38.30  ? 399  LYS A O     1 
ATOM   2787 C  CB    . LYS A 1 353 ? 40.593  20.340   -28.567 1.00 41.66  ? 399  LYS A CB    1 
ATOM   2788 C  CG    . LYS A 1 353 ? 40.755  21.333   -27.423 1.00 54.33  ? 399  LYS A CG    1 
ATOM   2789 C  CD    . LYS A 1 353 ? 39.704  21.138   -26.329 1.00 63.19  ? 399  LYS A CD    1 
ATOM   2790 C  CE    . LYS A 1 353 ? 39.828  22.165   -25.223 1.00 74.26  ? 399  LYS A CE    1 
ATOM   2791 N  NZ    . LYS A 1 353 ? 38.655  22.143   -24.301 1.00 80.35  ? 399  LYS A NZ    1 
ATOM   2792 N  N     . LEU A 1 354 ? 40.677  19.324   -31.511 1.00 37.84  ? 400  LEU A N     1 
ATOM   2793 C  CA    . LEU A 1 354 ? 40.416  18.313   -32.526 1.00 38.64  ? 400  LEU A CA    1 
ATOM   2794 C  C     . LEU A 1 354 ? 41.648  17.924   -33.352 1.00 40.38  ? 400  LEU A C     1 
ATOM   2795 O  O     . LEU A 1 354 ? 41.820  16.763   -33.668 1.00 40.02  ? 400  LEU A O     1 
ATOM   2796 C  CB    . LEU A 1 354 ? 39.300  18.780   -33.465 1.00 39.52  ? 400  LEU A CB    1 
ATOM   2797 C  CG    . LEU A 1 354 ? 38.836  17.722   -34.450 1.00 45.81  ? 400  LEU A CG    1 
ATOM   2798 C  CD1   . LEU A 1 354 ? 37.892  16.729   -33.789 1.00 45.41  ? 400  LEU A CD1   1 
ATOM   2799 C  CD2   . LEU A 1 354 ? 38.239  18.329   -35.651 1.00 49.58  ? 400  LEU A CD2   1 
ATOM   2800 N  N     . CYS A 1 355 ? 42.473  18.895   -33.728 1.00 37.63  ? 401  CYS A N     1 
ATOM   2801 C  CA    . CYS A 1 355 ? 43.671  18.699   -34.546 1.00 36.59  ? 401  CYS A CA    1 
ATOM   2802 C  C     . CYS A 1 355 ? 44.796  18.020   -33.803 1.00 42.07  ? 401  CYS A C     1 
ATOM   2803 O  O     . CYS A 1 355 ? 45.525  17.222   -34.400 1.00 42.59  ? 401  CYS A O     1 
ATOM   2804 C  CB    . CYS A 1 355 ? 44.103  20.017   -35.163 1.00 36.80  ? 401  CYS A CB    1 
ATOM   2805 S  SG    . CYS A 1 355 ? 42.975  20.609   -36.452 1.00 41.12  ? 401  CYS A SG    1 
ATOM   2806 N  N     . ARG A 1 356 ? 44.923  18.306   -32.498 1.00 39.70  ? 402  ARG A N     1 
ATOM   2807 C  CA    . ARG A 1 356 ? 45.862  17.656   -31.576 1.00 40.86  ? 402  ARG A CA    1 
ATOM   2808 C  C     . ARG A 1 356 ? 45.475  16.142   -31.482 1.00 45.52  ? 402  ARG A C     1 
ATOM   2809 O  O     . ARG A 1 356 ? 46.342  15.282   -31.669 1.00 45.81  ? 402  ARG A O     1 
ATOM   2810 C  CB    . ARG A 1 356 ? 45.731  18.296   -30.171 1.00 45.52  ? 402  ARG A CB    1 
ATOM   2811 C  CG    . ARG A 1 356 ? 46.945  18.139   -29.270 1.00 68.88  ? 402  ARG A CG    1 
ATOM   2812 C  CD    . ARG A 1 356 ? 46.698  18.705   -27.878 1.00 95.10  ? 402  ARG A CD    1 
ATOM   2813 N  NE    . ARG A 1 356 ? 46.295  20.114   -27.916 1.00 117.04 ? 402  ARG A NE    1 
ATOM   2814 C  CZ    . ARG A 1 356 ? 46.141  20.884   -26.844 1.00 139.29 ? 402  ARG A CZ    1 
ATOM   2815 N  NH1   . ARG A 1 356 ? 46.366  20.398   -25.629 1.00 128.34 ? 402  ARG A NH1   1 
ATOM   2816 N  NH2   . ARG A 1 356 ? 45.769  22.152   -26.978 1.00 129.59 ? 402  ARG A NH2   1 
ATOM   2817 N  N     . LEU A 1 357 ? 44.180  15.831   -31.238 1.00 40.88  ? 403  LEU A N     1 
ATOM   2818 C  CA    . LEU A 1 357 ? 43.692  14.430   -31.150 1.00 40.86  ? 403  LEU A CA    1 
ATOM   2819 C  C     . LEU A 1 357 ? 43.801  13.674   -32.497 1.00 42.74  ? 403  LEU A C     1 
ATOM   2820 O  O     . LEU A 1 357 ? 43.956  12.460   -32.482 1.00 41.14  ? 403  LEU A O     1 
ATOM   2821 C  CB    . LEU A 1 357 ? 42.211  14.358   -30.653 1.00 40.22  ? 403  LEU A CB    1 
ATOM   2822 C  CG    . LEU A 1 357 ? 41.861  15.046   -29.339 1.00 42.52  ? 403  LEU A CG    1 
ATOM   2823 C  CD1   . LEU A 1 357 ? 40.421  15.448   -29.310 1.00 41.47  ? 403  LEU A CD1   1 
ATOM   2824 C  CD2   . LEU A 1 357 ? 42.274  14.220   -28.138 1.00 44.44  ? 403  LEU A CD2   1 
ATOM   2825 N  N     . LEU A 1 358 ? 43.717  14.389   -33.646 1.00 37.84  ? 404  LEU A N     1 
ATOM   2826 C  CA    . LEU A 1 358 ? 43.735  13.751   -34.965 1.00 36.72  ? 404  LEU A CA    1 
ATOM   2827 C  C     . LEU A 1 358 ? 45.058  13.870   -35.714 1.00 41.42  ? 404  LEU A C     1 
ATOM   2828 O  O     . LEU A 1 358 ? 45.142  13.432   -36.860 1.00 41.94  ? 404  LEU A O     1 
ATOM   2829 C  CB    . LEU A 1 358 ? 42.549  14.279   -35.850 1.00 36.33  ? 404  LEU A CB    1 
ATOM   2830 C  CG    . LEU A 1 358 ? 41.124  13.845   -35.429 1.00 40.42  ? 404  LEU A CG    1 
ATOM   2831 C  CD1   . LEU A 1 358 ? 40.104  14.504   -36.273 1.00 41.00  ? 404  LEU A CD1   1 
ATOM   2832 C  CD2   . LEU A 1 358 ? 40.938  12.306   -35.486 1.00 41.28  ? 404  LEU A CD2   1 
ATOM   2833 N  N     . GLY A 1 359 ? 46.063  14.469   -35.083 1.00 37.49  ? 405  GLY A N     1 
ATOM   2834 C  CA    . GLY A 1 359 ? 47.400  14.640   -35.645 1.00 36.66  ? 405  GLY A CA    1 
ATOM   2835 C  C     . GLY A 1 359 ? 47.446  15.387   -36.961 1.00 38.09  ? 405  GLY A C     1 
ATOM   2836 O  O     . GLY A 1 359 ? 48.041  14.906   -37.934 1.00 34.42  ? 405  GLY A O     1 
ATOM   2837 N  N     . LEU A 1 360 ? 46.822  16.584   -36.981 1.00 35.80  ? 406  LEU A N     1 
ATOM   2838 C  CA    . LEU A 1 360 ? 46.744  17.459   -38.160 1.00 36.30  ? 406  LEU A CA    1 
ATOM   2839 C  C     . LEU A 1 360 ? 47.205  18.872   -37.839 1.00 38.87  ? 406  LEU A C     1 
ATOM   2840 O  O     . LEU A 1 360 ? 47.378  19.233   -36.678 1.00 38.78  ? 406  LEU A O     1 
ATOM   2841 C  CB    . LEU A 1 360 ? 45.261  17.563   -38.635 1.00 37.32  ? 406  LEU A CB    1 
ATOM   2842 C  CG    . LEU A 1 360 ? 44.418  16.269   -38.753 1.00 42.34  ? 406  LEU A CG    1 
ATOM   2843 C  CD1   . LEU A 1 360 ? 42.935  16.604   -38.960 1.00 42.71  ? 406  LEU A CD1   1 
ATOM   2844 C  CD2   . LEU A 1 360 ? 44.960  15.373   -39.840 1.00 42.79  ? 406  LEU A CD2   1 
ATOM   2845 N  N     . GLY A 1 361 ? 47.261  19.686   -38.880 1.00 35.38  ? 407  GLY A N     1 
ATOM   2846 C  CA    . GLY A 1 361 ? 47.537  21.108   -38.802 1.00 34.14  ? 407  GLY A CA    1 
ATOM   2847 C  C     . GLY A 1 361 ? 46.237  21.879   -38.729 1.00 37.79  ? 407  GLY A C     1 
ATOM   2848 O  O     . GLY A 1 361 ? 45.389  21.745   -39.610 1.00 35.49  ? 407  GLY A O     1 
ATOM   2849 N  N     . VAL A 1 362 ? 46.093  22.714   -37.693 1.00 35.08  ? 408  VAL A N     1 
ATOM   2850 C  CA    . VAL A 1 362 ? 44.950  23.603   -37.448 1.00 35.75  ? 408  VAL A CA    1 
ATOM   2851 C  C     . VAL A 1 362 ? 44.549  24.399   -38.733 1.00 41.17  ? 408  VAL A C     1 
ATOM   2852 O  O     . VAL A 1 362 ? 43.377  24.401   -39.090 1.00 40.85  ? 408  VAL A O     1 
ATOM   2853 C  CB    . VAL A 1 362 ? 45.274  24.537   -36.251 1.00 39.88  ? 408  VAL A CB    1 
ATOM   2854 C  CG1   . VAL A 1 362 ? 44.225  25.612   -36.061 1.00 39.45  ? 408  VAL A CG1   1 
ATOM   2855 C  CG2   . VAL A 1 362 ? 45.473  23.738   -34.955 1.00 39.87  ? 408  VAL A CG2   1 
ATOM   2856 N  N     . THR A 1 363 ? 45.526  25.047   -39.415 1.00 37.70  ? 409  THR A N     1 
ATOM   2857 C  CA    . THR A 1 363 ? 45.314  25.869   -40.618 1.00 36.50  ? 409  THR A CA    1 
ATOM   2858 C  C     . THR A 1 363 ? 44.858  25.012   -41.750 1.00 37.56  ? 409  THR A C     1 
ATOM   2859 O  O     . THR A 1 363 ? 43.824  25.326   -42.331 1.00 35.14  ? 409  THR A O     1 
ATOM   2860 C  CB    . THR A 1 363 ? 46.554  26.746   -40.944 1.00 39.15  ? 409  THR A CB    1 
ATOM   2861 O  OG1   . THR A 1 363 ? 46.690  27.678   -39.883 1.00 34.39  ? 409  THR A OG1   1 
ATOM   2862 C  CG2   . THR A 1 363 ? 46.416  27.549   -42.238 1.00 33.99  ? 409  THR A CG2   1 
ATOM   2863 N  N     . ASP A 1 364 ? 45.618  23.929   -42.065 1.00 34.68  ? 410  ASP A N     1 
ATOM   2864 C  CA    . ASP A 1 364 ? 45.259  22.967   -43.110 1.00 34.92  ? 410  ASP A CA    1 
ATOM   2865 C  C     . ASP A 1 364 ? 43.819  22.504   -42.925 1.00 36.65  ? 410  ASP A C     1 
ATOM   2866 O  O     . ASP A 1 364 ? 43.040  22.594   -43.873 1.00 36.06  ? 410  ASP A O     1 
ATOM   2867 C  CB    . ASP A 1 364 ? 46.212  21.764   -43.142 1.00 37.06  ? 410  ASP A CB    1 
ATOM   2868 C  CG    . ASP A 1 364 ? 47.553  22.034   -43.784 1.00 56.10  ? 410  ASP A CG    1 
ATOM   2869 O  OD1   . ASP A 1 364 ? 47.883  23.226   -44.005 1.00 59.83  ? 410  ASP A OD1   1 
ATOM   2870 O  OD2   . ASP A 1 364 ? 48.298  21.072   -44.007 1.00 65.77  ? 410  ASP A OD2   1 
ATOM   2871 N  N     . PHE A 1 365 ? 43.456  22.099   -41.694 1.00 31.93  ? 411  PHE A N     1 
ATOM   2872 C  CA    . PHE A 1 365 ? 42.123  21.666   -41.354 1.00 33.69  ? 411  PHE A CA    1 
ATOM   2873 C  C     . PHE A 1 365 ? 41.103  22.743   -41.666 1.00 40.54  ? 411  PHE A C     1 
ATOM   2874 O  O     . PHE A 1 365 ? 40.155  22.506   -42.395 1.00 39.01  ? 411  PHE A O     1 
ATOM   2875 C  CB    . PHE A 1 365 ? 42.027  21.284   -39.862 1.00 36.52  ? 411  PHE A CB    1 
ATOM   2876 C  CG    . PHE A 1 365 ? 40.608  20.890   -39.477 1.00 38.95  ? 411  PHE A CG    1 
ATOM   2877 C  CD1   . PHE A 1 365 ? 40.022  19.742   -40.000 1.00 41.55  ? 411  PHE A CD1   1 
ATOM   2878 C  CD2   . PHE A 1 365 ? 39.841  21.702   -38.652 1.00 41.76  ? 411  PHE A CD2   1 
ATOM   2879 C  CE1   . PHE A 1 365 ? 38.706  19.391   -39.663 1.00 43.58  ? 411  PHE A CE1   1 
ATOM   2880 C  CE2   . PHE A 1 365 ? 38.531  21.340   -38.306 1.00 45.30  ? 411  PHE A CE2   1 
ATOM   2881 C  CZ    . PHE A 1 365 ? 37.970  20.189   -38.821 1.00 42.78  ? 411  PHE A CZ    1 
ATOM   2882 N  N     . SER A 1 366 ? 41.306  23.926   -41.085 1.00 39.33  ? 412  SER A N     1 
ATOM   2883 C  CA    . SER A 1 366 ? 40.420  25.066   -41.228 1.00 38.87  ? 412  SER A CA    1 
ATOM   2884 C  C     . SER A 1 366 ? 40.195  25.437   -42.714 1.00 42.80  ? 412  SER A C     1 
ATOM   2885 O  O     . SER A 1 366 ? 39.052  25.480   -43.149 1.00 44.08  ? 412  SER A O     1 
ATOM   2886 C  CB    . SER A 1 366 ? 40.931  26.213   -40.368 1.00 41.77  ? 412  SER A CB    1 
ATOM   2887 O  OG    . SER A 1 366 ? 41.092  25.748   -39.033 1.00 40.73  ? 412  SER A OG    1 
ATOM   2888 N  N     . ARG A 1 367 ? 41.256  25.578   -43.504 1.00 37.66  ? 413  ARG A N     1 
ATOM   2889 C  CA    . ARG A 1 367 ? 41.139  25.900   -44.917 1.00 37.79  ? 413  ARG A CA    1 
ATOM   2890 C  C     . ARG A 1 367 ? 40.406  24.775   -45.698 1.00 45.72  ? 413  ARG A C     1 
ATOM   2891 O  O     . ARG A 1 367 ? 39.578  25.062   -46.572 1.00 43.94  ? 413  ARG A O     1 
ATOM   2892 C  CB    . ARG A 1 367 ? 42.533  26.177   -45.483 1.00 37.26  ? 413  ARG A CB    1 
ATOM   2893 C  CG    . ARG A 1 367 ? 42.559  26.680   -46.913 1.00 47.44  ? 413  ARG A CG    1 
ATOM   2894 C  CD    . ARG A 1 367 ? 43.973  27.046   -47.305 1.00 62.87  ? 413  ARG A CD    1 
ATOM   2895 N  NE    . ARG A 1 367 ? 44.268  28.446   -46.998 1.00 67.24  ? 413  ARG A NE    1 
ATOM   2896 C  CZ    . ARG A 1 367 ? 44.850  29.287   -47.842 1.00 73.46  ? 413  ARG A CZ    1 
ATOM   2897 N  NH1   . ARG A 1 367 ? 45.214  28.879   -49.054 1.00 51.71  ? 413  ARG A NH1   1 
ATOM   2898 N  NH2   . ARG A 1 367 ? 45.063  30.549   -47.491 1.00 54.09  ? 413  ARG A NH2   1 
ATOM   2899 N  N     . ALA A 1 368 ? 40.717  23.499   -45.368 1.00 43.67  ? 414  ALA A N     1 
ATOM   2900 C  CA    . ALA A 1 368 ? 40.112  22.334   -45.997 1.00 42.77  ? 414  ALA A CA    1 
ATOM   2901 C  C     . ALA A 1 368 ? 38.637  22.220   -45.670 1.00 41.81  ? 414  ALA A C     1 
ATOM   2902 O  O     . ALA A 1 368 ? 37.881  21.880   -46.560 1.00 41.89  ? 414  ALA A O     1 
ATOM   2903 C  CB    . ALA A 1 368 ? 40.837  21.076   -45.574 1.00 43.91  ? 414  ALA A CB    1 
ATOM   2904 N  N     . LEU A 1 369 ? 38.232  22.496   -44.414 1.00 35.85  ? 415  LEU A N     1 
ATOM   2905 C  CA    . LEU A 1 369 ? 36.839  22.472   -43.930 1.00 34.79  ? 415  LEU A CA    1 
ATOM   2906 C  C     . LEU A 1 369 ? 36.029  23.688   -44.408 1.00 39.22  ? 415  LEU A C     1 
ATOM   2907 O  O     . LEU A 1 369 ? 34.897  23.538   -44.877 1.00 39.97  ? 415  LEU A O     1 
ATOM   2908 C  CB    . LEU A 1 369 ? 36.766  22.407   -42.369 1.00 33.66  ? 415  LEU A CB    1 
ATOM   2909 C  CG    . LEU A 1 369 ? 35.334  22.339   -41.777 1.00 35.79  ? 415  LEU A CG    1 
ATOM   2910 C  CD1   . LEU A 1 369 ? 34.751  20.916   -41.872 1.00 36.19  ? 415  LEU A CD1   1 
ATOM   2911 C  CD2   . LEU A 1 369 ? 35.296  22.792   -40.362 1.00 33.85  ? 415  LEU A CD2   1 
ATOM   2912 N  N     . LEU A 1 370 ? 36.581  24.890   -44.235 1.00 35.22  ? 416  LEU A N     1 
ATOM   2913 C  CA    . LEU A 1 370 ? 35.844  26.106   -44.566 1.00 34.46  ? 416  LEU A CA    1 
ATOM   2914 C  C     . LEU A 1 370 ? 35.887  26.504   -46.040 1.00 37.64  ? 416  LEU A C     1 
ATOM   2915 O  O     . LEU A 1 370 ? 34.902  27.058   -46.526 1.00 36.88  ? 416  LEU A O     1 
ATOM   2916 C  CB    . LEU A 1 370 ? 36.280  27.264   -43.680 1.00 34.05  ? 416  LEU A CB    1 
ATOM   2917 C  CG    . LEU A 1 370 ? 36.153  27.075   -42.150 1.00 37.86  ? 416  LEU A CG    1 
ATOM   2918 C  CD1   . LEU A 1 370 ? 36.625  28.346   -41.405 1.00 35.82  ? 416  LEU A CD1   1 
ATOM   2919 C  CD2   . LEU A 1 370 ? 34.720  26.723   -41.728 1.00 37.48  ? 416  LEU A CD2   1 
ATOM   2920 N  N     . THR A 1 371 ? 37.004  26.231   -46.747 1.00 35.13  ? 417  THR A N     1 
ATOM   2921 C  CA    . THR A 1 371 ? 37.213  26.576   -48.173 1.00 35.68  ? 417  THR A CA    1 
ATOM   2922 C  C     . THR A 1 371 ? 37.879  25.400   -48.915 1.00 41.89  ? 417  THR A C     1 
ATOM   2923 O  O     . THR A 1 371 ? 39.031  25.519   -49.344 1.00 41.74  ? 417  THR A O     1 
ATOM   2924 C  CB    . THR A 1 371 ? 38.005  27.912   -48.320 1.00 43.38  ? 417  THR A CB    1 
ATOM   2925 O  OG1   . THR A 1 371 ? 39.379  27.700   -47.956 1.00 33.44  ? 417  THR A OG1   1 
ATOM   2926 C  CG2   . THR A 1 371 ? 37.405  29.069   -47.475 1.00 43.44  ? 417  THR A CG2   1 
ATOM   2927 N  N     . PRO A 1 372 ? 37.211  24.229   -49.014 1.00 42.06  ? 418  PRO A N     1 
ATOM   2928 C  CA    . PRO A 1 372 ? 37.847  23.072   -49.667 1.00 43.81  ? 418  PRO A CA    1 
ATOM   2929 C  C     . PRO A 1 372 ? 38.183  23.273   -51.139 1.00 55.81  ? 418  PRO A C     1 
ATOM   2930 O  O     . PRO A 1 372 ? 37.371  23.774   -51.919 1.00 54.71  ? 418  PRO A O     1 
ATOM   2931 C  CB    . PRO A 1 372 ? 36.811  21.952   -49.492 1.00 44.81  ? 418  PRO A CB    1 
ATOM   2932 C  CG    . PRO A 1 372 ? 35.523  22.633   -49.306 1.00 47.76  ? 418  PRO A CG    1 
ATOM   2933 C  CD    . PRO A 1 372 ? 35.846  23.889   -48.558 1.00 43.76  ? 418  PRO A CD    1 
ATOM   2934 N  N     . ARG A 1 373 ? 39.383  22.842   -51.510 1.00 60.24  ? 419  ARG A N     1 
ATOM   2935 C  CA    . ARG A 1 373 ? 39.894  22.902   -52.862 1.00 64.18  ? 419  ARG A CA    1 
ATOM   2936 C  C     . ARG A 1 373 ? 39.281  21.738   -53.638 1.00 79.07  ? 419  ARG A C     1 
ATOM   2937 O  O     . ARG A 1 373 ? 39.258  20.610   -53.132 1.00 77.88  ? 419  ARG A O     1 
ATOM   2938 C  CB    . ARG A 1 373 ? 41.421  22.793   -52.804 1.00 65.01  ? 419  ARG A CB    1 
ATOM   2939 C  CG    . ARG A 1 373 ? 42.149  23.419   -53.975 1.00 78.35  ? 419  ARG A CG    1 
ATOM   2940 C  CD    . ARG A 1 373 ? 43.648  23.458   -53.728 1.00 95.53  ? 419  ARG A CD    1 
ATOM   2941 N  NE    . ARG A 1 373 ? 44.231  22.119   -53.603 1.00 106.12 ? 419  ARG A NE    1 
ATOM   2942 C  CZ    . ARG A 1 373 ? 45.428  21.869   -53.084 1.00 121.58 ? 419  ARG A CZ    1 
ATOM   2943 N  NH1   . ARG A 1 373 ? 46.186  22.863   -52.636 1.00 105.55 ? 419  ARG A NH1   1 
ATOM   2944 N  NH2   . ARG A 1 373 ? 45.876  20.624   -53.002 1.00 112.02 ? 419  ARG A NH2   1 
ATOM   2945 N  N     . ILE A 1 374 ? 38.725  22.028   -54.832 1.00 85.20  ? 420  ILE A N     1 
ATOM   2946 C  CA    . ILE A 1 374 ? 38.106  21.035   -55.718 1.00 89.47  ? 420  ILE A CA    1 
ATOM   2947 C  C     . ILE A 1 374 ? 38.899  20.893   -57.026 1.00 103.75 ? 420  ILE A C     1 
ATOM   2948 O  O     . ILE A 1 374 ? 39.403  21.890   -57.550 1.00 103.29 ? 420  ILE A O     1 
ATOM   2949 C  CB    . ILE A 1 374 ? 36.583  21.272   -55.950 1.00 92.93  ? 420  ILE A CB    1 
ATOM   2950 C  CG1   . ILE A 1 374 ? 36.275  22.634   -56.611 1.00 93.52  ? 420  ILE A CG1   1 
ATOM   2951 C  CG2   . ILE A 1 374 ? 35.780  21.087   -54.659 1.00 93.92  ? 420  ILE A CG2   1 
ATOM   2952 C  CD1   . ILE A 1 374 ? 36.078  22.608   -58.119 1.00 100.93 ? 420  ILE A CD1   1 
ATOM   2953 N  N     . LYS A 1 375 ? 39.004  19.656   -57.548 1.00 108.35 ? 421  LYS A N     1 
ATOM   2954 C  CA    . LYS A 1 375 ? 39.733  19.363   -58.784 1.00 111.74 ? 421  LYS A CA    1 
ATOM   2955 C  C     . LYS A 1 375 ? 38.790  19.296   -59.991 1.00 122.81 ? 421  LYS A C     1 
ATOM   2956 O  O     . LYS A 1 375 ? 37.777  18.591   -59.948 1.00 122.19 ? 421  LYS A O     1 
ATOM   2957 C  CB    . LYS A 1 375 ? 40.557  18.069   -58.641 1.00 115.03 ? 421  LYS A CB    1 
ATOM   2958 C  CG    . LYS A 1 375 ? 41.598  17.862   -59.744 1.00 136.68 ? 421  LYS A CG    1 
ATOM   2959 C  CD    . LYS A 1 375 ? 41.554  16.446   -60.325 1.00 151.21 ? 421  LYS A CD    1 
ATOM   2960 C  CE    . LYS A 1 375 ? 40.557  16.288   -61.453 1.00 165.60 ? 421  LYS A CE    1 
ATOM   2961 N  NZ    . LYS A 1 375 ? 40.372  14.861   -61.827 1.00 175.55 ? 421  LYS A NZ    1 
ATOM   2962 N  N     . VAL A 1 376 ? 39.138  20.052   -61.059 1.00 124.93 ? 422  VAL A N     1 
ATOM   2963 C  CA    . VAL A 1 376 ? 38.409  20.143   -62.334 1.00 127.14 ? 422  VAL A CA    1 
ATOM   2964 C  C     . VAL A 1 376 ? 39.325  20.709   -63.452 1.00 134.68 ? 422  VAL A C     1 
ATOM   2965 O  O     . VAL A 1 376 ? 39.950  21.755   -63.265 1.00 134.63 ? 422  VAL A O     1 
ATOM   2966 C  CB    . VAL A 1 376 ? 37.035  20.895   -62.217 1.00 131.58 ? 422  VAL A CB    1 
ATOM   2967 C  CG1   . VAL A 1 376 ? 37.190  22.344   -61.749 1.00 131.37 ? 422  VAL A CG1   1 
ATOM   2968 C  CG2   . VAL A 1 376 ? 36.228  20.813   -63.513 1.00 131.60 ? 422  VAL A CG2   1 
ATOM   2969 N  N     . GLY A 1 377 ? 39.398  19.985   -64.571 1.00 133.28 ? 423  GLY A N     1 
ATOM   2970 C  CA    . GLY A 1 377 ? 40.157  20.351   -65.766 1.00 134.16 ? 423  GLY A CA    1 
ATOM   2971 C  C     . GLY A 1 377 ? 41.605  20.758   -65.576 1.00 140.42 ? 423  GLY A C     1 
ATOM   2972 O  O     . GLY A 1 377 ? 41.987  21.867   -65.963 1.00 140.18 ? 423  GLY A O     1 
ATOM   2973 N  N     . ARG A 1 378 ? 42.419  19.853   -64.989 1.00 138.42 ? 424  ARG A N     1 
ATOM   2974 C  CA    . ARG A 1 378 ? 43.864  20.003   -64.735 1.00 138.88 ? 424  ARG A CA    1 
ATOM   2975 C  C     . ARG A 1 378 ? 44.235  21.237   -63.855 1.00 141.92 ? 424  ARG A C     1 
ATOM   2976 O  O     . ARG A 1 378 ? 45.338  21.784   -63.973 1.00 141.61 ? 424  ARG A O     1 
ATOM   2977 C  CB    . ARG A 1 378 ? 44.670  19.984   -66.054 1.00 141.62 ? 424  ARG A CB    1 
ATOM   2978 C  CG    . ARG A 1 378 ? 44.686  18.628   -66.766 1.00 158.01 ? 424  ARG A CG    1 
ATOM   2979 C  CD    . ARG A 1 378 ? 45.409  18.689   -68.100 1.00 175.39 ? 424  ARG A CD    1 
ATOM   2980 N  NE    . ARG A 1 378 ? 46.847  18.909   -67.937 1.00 191.37 ? 424  ARG A NE    1 
ATOM   2981 C  CZ    . ARG A 1 378 ? 47.693  19.123   -68.938 1.00 210.50 ? 424  ARG A CZ    1 
ATOM   2982 N  NH1   . ARG A 1 378 ? 47.259  19.147   -70.193 1.00 199.92 ? 424  ARG A NH1   1 
ATOM   2983 N  NH2   . ARG A 1 378 ? 48.983  19.317   -68.694 1.00 199.14 ? 424  ARG A NH2   1 
ATOM   2984 N  N     . ASP A 1 379 ? 43.324  21.637   -62.951 1.00 137.32 ? 425  ASP A N     1 
ATOM   2985 C  CA    . ASP A 1 379 ? 43.533  22.744   -62.017 1.00 136.51 ? 425  ASP A CA    1 
ATOM   2986 C  C     . ASP A 1 379 ? 42.752  22.533   -60.718 1.00 137.18 ? 425  ASP A C     1 
ATOM   2987 O  O     . ASP A 1 379 ? 41.891  21.652   -60.651 1.00 136.80 ? 425  ASP A O     1 
ATOM   2988 C  CB    . ASP A 1 379 ? 43.224  24.112   -62.666 1.00 138.90 ? 425  ASP A CB    1 
ATOM   2989 C  CG    . ASP A 1 379 ? 41.803  24.288   -63.161 1.00 152.51 ? 425  ASP A CG    1 
ATOM   2990 O  OD1   . ASP A 1 379 ? 40.899  24.490   -62.319 1.00 153.65 ? 425  ASP A OD1   1 
ATOM   2991 O  OD2   . ASP A 1 379 ? 41.601  24.280   -64.393 1.00 159.20 ? 425  ASP A OD2   1 
ATOM   2992 N  N     . TYR A 1 380 ? 43.062  23.340   -59.691 1.00 130.79 ? 426  TYR A N     1 
ATOM   2993 C  CA    . TYR A 1 380 ? 42.421  23.281   -58.379 1.00 129.04 ? 426  TYR A CA    1 
ATOM   2994 C  C     . TYR A 1 380 ? 41.681  24.596   -58.084 1.00 125.47 ? 426  TYR A C     1 
ATOM   2995 O  O     . TYR A 1 380 ? 42.288  25.670   -58.161 1.00 125.37 ? 426  TYR A O     1 
ATOM   2996 C  CB    . TYR A 1 380 ? 43.475  22.999   -57.297 1.00 131.58 ? 426  TYR A CB    1 
ATOM   2997 C  CG    . TYR A 1 380 ? 44.069  21.607   -57.325 1.00 135.20 ? 426  TYR A CG    1 
ATOM   2998 C  CD1   . TYR A 1 380 ? 43.501  20.570   -56.588 1.00 137.65 ? 426  TYR A CD1   1 
ATOM   2999 C  CD2   . TYR A 1 380 ? 45.237  21.341   -58.031 1.00 136.43 ? 426  TYR A CD2   1 
ATOM   3000 C  CE1   . TYR A 1 380 ? 44.060  19.292   -56.589 1.00 139.25 ? 426  TYR A CE1   1 
ATOM   3001 C  CE2   . TYR A 1 380 ? 45.805  20.068   -58.040 1.00 137.65 ? 426  TYR A CE2   1 
ATOM   3002 C  CZ    . TYR A 1 380 ? 45.213  19.045   -57.317 1.00 146.49 ? 426  TYR A CZ    1 
ATOM   3003 O  OH    . TYR A 1 380 ? 45.776  17.792   -57.323 1.00 148.61 ? 426  TYR A OH    1 
ATOM   3004 N  N     . VAL A 1 381 ? 40.369  24.514   -57.757 1.00 115.46 ? 427  VAL A N     1 
ATOM   3005 C  CA    . VAL A 1 381 ? 39.521  25.683   -57.462 1.00 111.75 ? 427  VAL A CA    1 
ATOM   3006 C  C     . VAL A 1 381 ? 39.087  25.732   -55.987 1.00 105.70 ? 427  VAL A C     1 
ATOM   3007 O  O     . VAL A 1 381 ? 38.420  24.813   -55.510 1.00 104.42 ? 427  VAL A O     1 
ATOM   3008 C  CB    . VAL A 1 381 ? 38.300  25.828   -58.423 1.00 115.87 ? 427  VAL A CB    1 
ATOM   3009 C  CG1   . VAL A 1 381 ? 37.675  27.220   -58.310 1.00 115.63 ? 427  VAL A CG1   1 
ATOM   3010 C  CG2   . VAL A 1 381 ? 38.673  25.523   -59.876 1.00 115.70 ? 427  VAL A CG2   1 
ATOM   3011 N  N     . GLN A 1 382 ? 39.455  26.819   -55.280 1.00 95.46  ? 428  GLN A N     1 
ATOM   3012 C  CA    . GLN A 1 382 ? 39.087  27.045   -53.875 1.00 91.75  ? 428  GLN A CA    1 
ATOM   3013 C  C     . GLN A 1 382 ? 37.619  27.510   -53.810 1.00 86.99  ? 428  GLN A C     1 
ATOM   3014 O  O     . GLN A 1 382 ? 37.276  28.561   -54.362 1.00 85.56  ? 428  GLN A O     1 
ATOM   3015 C  CB    . GLN A 1 382 ? 40.023  28.075   -53.203 1.00 92.69  ? 428  GLN A CB    1 
ATOM   3016 C  CG    . GLN A 1 382 ? 41.456  27.589   -53.007 1.00 98.29  ? 428  GLN A CG    1 
ATOM   3017 C  CD    . GLN A 1 382 ? 41.742  27.118   -51.603 1.00 102.81 ? 428  GLN A CD    1 
ATOM   3018 O  OE1   . GLN A 1 382 ? 41.044  26.267   -51.046 1.00 92.54  ? 428  GLN A OE1   1 
ATOM   3019 N  NE2   . GLN A 1 382 ? 42.824  27.614   -51.027 1.00 92.50  ? 428  GLN A NE2   1 
ATOM   3020 N  N     . LYS A 1 383 ? 36.755  26.707   -53.170 1.00 77.66  ? 429  LYS A N     1 
ATOM   3021 C  CA    . LYS A 1 383 ? 35.331  27.014   -53.059 1.00 75.15  ? 429  LYS A CA    1 
ATOM   3022 C  C     . LYS A 1 383 ? 34.908  27.350   -51.635 1.00 72.41  ? 429  LYS A C     1 
ATOM   3023 O  O     . LYS A 1 383 ? 35.353  26.715   -50.683 1.00 71.95  ? 429  LYS A O     1 
ATOM   3024 C  CB    . LYS A 1 383 ? 34.457  25.873   -53.624 1.00 77.41  ? 429  LYS A CB    1 
ATOM   3025 C  CG    . LYS A 1 383 ? 34.692  25.549   -55.100 1.00 92.53  ? 429  LYS A CG    1 
ATOM   3026 C  CD    . LYS A 1 383 ? 34.149  26.603   -56.062 1.00 107.97 ? 429  LYS A CD    1 
ATOM   3027 C  CE    . LYS A 1 383 ? 34.140  26.106   -57.487 1.00 127.21 ? 429  LYS A CE    1 
ATOM   3028 N  NZ    . LYS A 1 383 ? 33.680  27.150   -58.442 1.00 138.55 ? 429  LYS A NZ    1 
ATOM   3029 N  N     . ALA A 1 384 ? 34.027  28.339   -51.506 1.00 63.72  ? 430  ALA A N     1 
ATOM   3030 C  CA    . ALA A 1 384 ? 33.437  28.777   -50.241 1.00 60.22  ? 430  ALA A CA    1 
ATOM   3031 C  C     . ALA A 1 384 ? 32.362  27.768   -49.797 1.00 54.74  ? 430  ALA A C     1 
ATOM   3032 O  O     . ALA A 1 384 ? 31.719  27.164   -50.638 1.00 53.42  ? 430  ALA A O     1 
ATOM   3033 C  CB    . ALA A 1 384 ? 32.816  30.155   -50.424 1.00 60.68  ? 430  ALA A CB    1 
ATOM   3034 N  N     . GLN A 1 385 ? 32.212  27.547   -48.491 1.00 46.85  ? 431  GLN A N     1 
ATOM   3035 C  CA    . GLN A 1 385 ? 31.197  26.648   -47.938 1.00 44.95  ? 431  GLN A CA    1 
ATOM   3036 C  C     . GLN A 1 385 ? 30.274  27.460   -47.051 1.00 46.96  ? 431  GLN A C     1 
ATOM   3037 O  O     . GLN A 1 385 ? 30.753  28.355   -46.340 1.00 47.73  ? 431  GLN A O     1 
ATOM   3038 C  CB    . GLN A 1 385 ? 31.819  25.542   -47.069 1.00 45.46  ? 431  GLN A CB    1 
ATOM   3039 C  CG    . GLN A 1 385 ? 32.654  24.521   -47.801 1.00 44.52  ? 431  GLN A CG    1 
ATOM   3040 C  CD    . GLN A 1 385 ? 31.857  23.469   -48.523 1.00 61.05  ? 431  GLN A CD    1 
ATOM   3041 O  OE1   . GLN A 1 385 ? 31.630  22.350   -48.027 1.00 50.61  ? 431  GLN A OE1   1 
ATOM   3042 N  NE2   . GLN A 1 385 ? 31.498  23.772   -49.756 1.00 56.27  ? 431  GLN A NE2   1 
ATOM   3043 N  N     . THR A 1 386 ? 28.973  27.136   -47.029 1.00 39.69  ? 432  THR A N     1 
ATOM   3044 C  CA    . THR A 1 386 ? 28.061  27.851   -46.107 1.00 38.74  ? 432  THR A CA    1 
ATOM   3045 C  C     . THR A 1 386 ? 28.180  27.181   -44.751 1.00 40.96  ? 432  THR A C     1 
ATOM   3046 O  O     . THR A 1 386 ? 28.826  26.139   -44.642 1.00 39.88  ? 432  THR A O     1 
ATOM   3047 C  CB    . THR A 1 386 ? 26.606  27.849   -46.589 1.00 47.09  ? 432  THR A CB    1 
ATOM   3048 O  OG1   . THR A 1 386 ? 26.153  26.502   -46.724 1.00 52.24  ? 432  THR A OG1   1 
ATOM   3049 C  CG2   . THR A 1 386 ? 26.432  28.589   -47.886 1.00 47.96  ? 432  THR A CG2   1 
ATOM   3050 N  N     . LYS A 1 387 ? 27.631  27.807   -43.716 1.00 37.71  ? 433  LYS A N     1 
ATOM   3051 C  CA    . LYS A 1 387 ? 27.586  27.277   -42.359 1.00 37.56  ? 433  LYS A CA    1 
ATOM   3052 C  C     . LYS A 1 387 ? 26.945  25.871   -42.385 1.00 44.53  ? 433  LYS A C     1 
ATOM   3053 O  O     . LYS A 1 387 ? 27.476  24.981   -41.727 1.00 44.03  ? 433  LYS A O     1 
ATOM   3054 C  CB    . LYS A 1 387 ? 26.796  28.223   -41.444 1.00 37.79  ? 433  LYS A CB    1 
ATOM   3055 C  CG    . LYS A 1 387 ? 26.733  27.753   -39.993 1.00 48.66  ? 433  LYS A CG    1 
ATOM   3056 C  CD    . LYS A 1 387 ? 25.528  28.317   -39.216 1.00 58.29  ? 433  LYS A CD    1 
ATOM   3057 C  CE    . LYS A 1 387 ? 24.860  27.311   -38.291 1.00 60.17  ? 433  LYS A CE    1 
ATOM   3058 N  NZ    . LYS A 1 387 ? 25.721  26.929   -37.137 1.00 59.06  ? 433  LYS A NZ    1 
ATOM   3059 N  N     . GLU A 1 388 ? 25.826  25.678   -43.149 1.00 42.05  ? 434  GLU A N     1 
ATOM   3060 C  CA    . GLU A 1 388 ? 25.147  24.380   -43.246 1.00 42.87  ? 434  GLU A CA    1 
ATOM   3061 C  C     . GLU A 1 388 ? 26.016  23.335   -43.922 1.00 45.06  ? 434  GLU A C     1 
ATOM   3062 O  O     . GLU A 1 388 ? 26.188  22.264   -43.349 1.00 45.97  ? 434  GLU A O     1 
ATOM   3063 C  CB    . GLU A 1 388 ? 23.765  24.472   -43.920 1.00 44.81  ? 434  GLU A CB    1 
ATOM   3064 C  CG    . GLU A 1 388 ? 22.901  23.235   -43.676 1.00 61.22  ? 434  GLU A CG    1 
ATOM   3065 C  CD    . GLU A 1 388 ? 21.484  23.216   -44.240 1.00 96.74  ? 434  GLU A CD    1 
ATOM   3066 O  OE1   . GLU A 1 388 ? 21.068  24.201   -44.892 1.00 104.99 ? 434  GLU A OE1   1 
ATOM   3067 O  OE2   . GLU A 1 388 ? 20.777  22.208   -44.009 1.00 88.29  ? 434  GLU A OE2   1 
ATOM   3068 N  N     . GLN A 1 389 ? 26.561  23.638   -45.131 1.00 39.29  ? 435  GLN A N     1 
ATOM   3069 C  CA    . GLN A 1 389 ? 27.457  22.765   -45.887 1.00 37.44  ? 435  GLN A CA    1 
ATOM   3070 C  C     . GLN A 1 389 ? 28.592  22.316   -44.981 1.00 40.04  ? 435  GLN A C     1 
ATOM   3071 O  O     . GLN A 1 389 ? 28.789  21.115   -44.814 1.00 38.40  ? 435  GLN A O     1 
ATOM   3072 C  CB    . GLN A 1 389 ? 28.042  23.502   -47.106 1.00 38.90  ? 435  GLN A CB    1 
ATOM   3073 C  CG    . GLN A 1 389 ? 27.067  23.709   -48.247 1.00 53.96  ? 435  GLN A CG    1 
ATOM   3074 C  CD    . GLN A 1 389 ? 27.707  24.441   -49.402 1.00 69.93  ? 435  GLN A CD    1 
ATOM   3075 O  OE1   . GLN A 1 389 ? 28.225  25.563   -49.254 1.00 62.97  ? 435  GLN A OE1   1 
ATOM   3076 N  NE2   . GLN A 1 389 ? 27.636  23.837   -50.592 1.00 54.96  ? 435  GLN A NE2   1 
ATOM   3077 N  N     . ALA A 1 390 ? 29.321  23.292   -44.361 1.00 36.16  ? 436  ALA A N     1 
ATOM   3078 C  CA    . ALA A 1 390 ? 30.436  23.029   -43.450 1.00 36.23  ? 436  ALA A CA    1 
ATOM   3079 C  C     . ALA A 1 390 ? 30.017  22.239   -42.198 1.00 39.24  ? 436  ALA A C     1 
ATOM   3080 O  O     . ALA A 1 390 ? 30.751  21.336   -41.802 1.00 36.98  ? 436  ALA A O     1 
ATOM   3081 C  CB    . ALA A 1 390 ? 31.128  24.335   -43.057 1.00 37.48  ? 436  ALA A CB    1 
ATOM   3082 N  N     . ASP A 1 391 ? 28.841  22.553   -41.582 1.00 36.69  ? 437  ASP A N     1 
ATOM   3083 C  CA    . ASP A 1 391 ? 28.357  21.803   -40.407 1.00 37.55  ? 437  ASP A CA    1 
ATOM   3084 C  C     . ASP A 1 391 ? 28.029  20.342   -40.794 1.00 44.81  ? 437  ASP A C     1 
ATOM   3085 O  O     . ASP A 1 391 ? 28.249  19.440   -39.984 1.00 44.50  ? 437  ASP A O     1 
ATOM   3086 C  CB    . ASP A 1 391 ? 27.137  22.458   -39.745 1.00 39.77  ? 437  ASP A CB    1 
ATOM   3087 C  CG    . ASP A 1 391 ? 27.430  23.571   -38.739 1.00 58.86  ? 437  ASP A CG    1 
ATOM   3088 O  OD1   . ASP A 1 391 ? 28.252  23.346   -37.819 1.00 62.92  ? 437  ASP A OD1   1 
ATOM   3089 O  OD2   . ASP A 1 391 ? 26.756  24.617   -38.804 1.00 60.93  ? 437  ASP A OD2   1 
ATOM   3090 N  N     . PHE A 1 392 ? 27.533  20.111   -42.025 1.00 43.37  ? 438  PHE A N     1 
ATOM   3091 C  CA    . PHE A 1 392 ? 27.198  18.768   -42.474 1.00 46.29  ? 438  PHE A CA    1 
ATOM   3092 C  C     . PHE A 1 392 ? 28.491  17.959   -42.613 1.00 45.82  ? 438  PHE A C     1 
ATOM   3093 O  O     . PHE A 1 392 ? 28.536  16.822   -42.154 1.00 43.75  ? 438  PHE A O     1 
ATOM   3094 C  CB    . PHE A 1 392 ? 26.462  18.822   -43.817 1.00 51.32  ? 438  PHE A CB    1 
ATOM   3095 C  CG    . PHE A 1 392 ? 24.952  18.783   -43.784 1.00 56.14  ? 438  PHE A CG    1 
ATOM   3096 C  CD1   . PHE A 1 392 ? 24.279  17.665   -43.299 1.00 61.78  ? 438  PHE A CD1   1 
ATOM   3097 C  CD2   . PHE A 1 392 ? 24.203  19.790   -44.384 1.00 60.16  ? 438  PHE A CD2   1 
ATOM   3098 C  CE1   . PHE A 1 392 ? 22.879  17.592   -43.347 1.00 63.97  ? 438  PHE A CE1   1 
ATOM   3099 C  CE2   . PHE A 1 392 ? 22.805  19.715   -44.433 1.00 63.84  ? 438  PHE A CE2   1 
ATOM   3100 C  CZ    . PHE A 1 392 ? 22.153  18.623   -43.906 1.00 62.60  ? 438  PHE A CZ    1 
ATOM   3101 N  N     . ALA A 1 393 ? 29.554  18.593   -43.180 1.00 40.02  ? 439  ALA A N     1 
ATOM   3102 C  CA    . ALA A 1 393 ? 30.895  18.029   -43.370 1.00 39.64  ? 439  ALA A CA    1 
ATOM   3103 C  C     . ALA A 1 393 ? 31.484  17.588   -42.029 1.00 41.07  ? 439  ALA A C     1 
ATOM   3104 O  O     . ALA A 1 393 ? 32.042  16.510   -41.917 1.00 39.49  ? 439  ALA A O     1 
ATOM   3105 C  CB    . ALA A 1 393 ? 31.817  19.052   -44.046 1.00 40.48  ? 439  ALA A CB    1 
ATOM   3106 N  N     . LEU A 1 394 ? 31.311  18.395   -41.014 1.00 39.44  ? 440  LEU A N     1 
ATOM   3107 C  CA    . LEU A 1 394 ? 31.781  18.082   -39.670 1.00 39.51  ? 440  LEU A CA    1 
ATOM   3108 C  C     . LEU A 1 394 ? 31.151  16.773   -39.196 1.00 39.62  ? 440  LEU A C     1 
ATOM   3109 O  O     . LEU A 1 394 ? 31.856  15.846   -38.815 1.00 40.74  ? 440  LEU A O     1 
ATOM   3110 C  CB    . LEU A 1 394 ? 31.485  19.250   -38.692 1.00 39.40  ? 440  LEU A CB    1 
ATOM   3111 C  CG    . LEU A 1 394 ? 32.503  20.399   -38.712 1.00 45.62  ? 440  LEU A CG    1 
ATOM   3112 C  CD1   . LEU A 1 394 ? 32.028  21.569   -37.867 1.00 45.92  ? 440  LEU A CD1   1 
ATOM   3113 C  CD2   . LEU A 1 394 ? 33.911  19.950   -38.241 1.00 48.29  ? 440  LEU A CD2   1 
ATOM   3114 N  N     . GLU A 1 395 ? 29.840  16.687   -39.294 1.00 32.63  ? 441  GLU A N     1 
ATOM   3115 C  CA    . GLU A 1 395 ? 29.074  15.546   -38.889 1.00 31.39  ? 441  GLU A CA    1 
ATOM   3116 C  C     . GLU A 1 395 ? 29.384  14.347   -39.745 1.00 36.40  ? 441  GLU A C     1 
ATOM   3117 O  O     . GLU A 1 395 ? 29.409  13.248   -39.201 1.00 37.69  ? 441  GLU A O     1 
ATOM   3118 C  CB    . GLU A 1 395 ? 27.594  15.888   -38.942 1.00 32.79  ? 441  GLU A CB    1 
ATOM   3119 C  CG    . GLU A 1 395 ? 27.179  16.952   -37.932 1.00 41.79  ? 441  GLU A CG    1 
ATOM   3120 C  CD    . GLU A 1 395 ? 25.771  17.520   -38.092 1.00 80.88  ? 441  GLU A CD    1 
ATOM   3121 O  OE1   . GLU A 1 395 ? 25.209  17.444   -39.209 1.00 88.09  ? 441  GLU A OE1   1 
ATOM   3122 O  OE2   . GLU A 1 395 ? 25.229  18.044   -37.092 1.00 78.32  ? 441  GLU A OE2   1 
ATOM   3123 N  N     . ALA A 1 396 ? 29.626  14.534   -41.082 1.00 30.52  ? 442  ALA A N     1 
ATOM   3124 C  CA    . ALA A 1 396 ? 29.979  13.429   -41.957 1.00 30.53  ? 442  ALA A CA    1 
ATOM   3125 C  C     . ALA A 1 396 ? 31.344  12.897   -41.543 1.00 34.03  ? 442  ALA A C     1 
ATOM   3126 O  O     . ALA A 1 396 ? 31.537  11.674   -41.544 1.00 33.86  ? 442  ALA A O     1 
ATOM   3127 C  CB    . ALA A 1 396 ? 30.021  13.868   -43.429 1.00 31.35  ? 442  ALA A CB    1 
ATOM   3128 N  N     . LEU A 1 397 ? 32.287  13.810   -41.192 1.00 29.86  ? 443  LEU A N     1 
ATOM   3129 C  CA    . LEU A 1 397 ? 33.650  13.432   -40.803 1.00 29.89  ? 443  LEU A CA    1 
ATOM   3130 C  C     . LEU A 1 397 ? 33.679  12.712   -39.471 1.00 31.76  ? 443  LEU A C     1 
ATOM   3131 O  O     . LEU A 1 397 ? 34.420  11.732   -39.342 1.00 30.67  ? 443  LEU A O     1 
ATOM   3132 C  CB    . LEU A 1 397 ? 34.650  14.615   -40.814 1.00 29.70  ? 443  LEU A CB    1 
ATOM   3133 C  CG    . LEU A 1 397 ? 35.079  15.131   -42.185 1.00 32.18  ? 443  LEU A CG    1 
ATOM   3134 C  CD1   . LEU A 1 397 ? 35.372  16.607   -42.130 1.00 31.95  ? 443  LEU A CD1   1 
ATOM   3135 C  CD2   . LEU A 1 397 ? 36.168  14.298   -42.805 1.00 29.51  ? 443  LEU A CD2   1 
ATOM   3136 N  N     . ALA A 1 398 ? 32.875  13.173   -38.497 1.00 26.60  ? 444  ALA A N     1 
ATOM   3137 C  CA    . ALA A 1 398 ? 32.853  12.535   -37.186 1.00 27.27  ? 444  ALA A CA    1 
ATOM   3138 C  C     . ALA A 1 398 ? 32.221  11.125   -37.238 1.00 34.94  ? 444  ALA A C     1 
ATOM   3139 O  O     . ALA A 1 398 ? 32.656  10.234   -36.479 1.00 35.94  ? 444  ALA A O     1 
ATOM   3140 C  CB    . ALA A 1 398 ? 32.110  13.404   -36.194 1.00 27.99  ? 444  ALA A CB    1 
ATOM   3141 N  N     . LYS A 1 399 ? 31.205  10.930   -38.122 1.00 31.38  ? 445  LYS A N     1 
ATOM   3142 C  CA    . LYS A 1 399 ? 30.518  9.643    -38.328 1.00 31.41  ? 445  LYS A CA    1 
ATOM   3143 C  C     . LYS A 1 399 ? 31.417  8.685    -39.071 1.00 35.77  ? 445  LYS A C     1 
ATOM   3144 O  O     . LYS A 1 399 ? 31.419  7.508    -38.741 1.00 36.71  ? 445  LYS A O     1 
ATOM   3145 C  CB    . LYS A 1 399 ? 29.237  9.793    -39.162 1.00 33.79  ? 445  LYS A CB    1 
ATOM   3146 C  CG    . LYS A 1 399 ? 27.988  10.258   -38.425 1.00 35.16  ? 445  LYS A CG    1 
ATOM   3147 C  CD    . LYS A 1 399 ? 26.827  10.315   -39.418 1.00 43.56  ? 445  LYS A CD    1 
ATOM   3148 C  CE    . LYS A 1 399 ? 27.051  11.335   -40.512 1.00 48.40  ? 445  LYS A CE    1 
ATOM   3149 N  NZ    . LYS A 1 399 ? 26.029  11.260   -41.566 1.00 43.66  ? 445  LYS A NZ    1 
ATOM   3150 N  N     . ALA A 1 400 ? 32.131  9.173    -40.117 1.00 32.17  ? 446  ALA A N     1 
ATOM   3151 C  CA    . ALA A 1 400 ? 33.072  8.402    -40.936 1.00 29.32  ? 446  ALA A CA    1 
ATOM   3152 C  C     . ALA A 1 400 ? 34.251  7.946    -40.108 1.00 30.41  ? 446  ALA A C     1 
ATOM   3153 O  O     . ALA A 1 400 ? 34.755  6.886    -40.396 1.00 30.44  ? 446  ALA A O     1 
ATOM   3154 C  CB    . ALA A 1 400 ? 33.578  9.242    -42.085 1.00 29.54  ? 446  ALA A CB    1 
ATOM   3155 N  N     . THR A 1 401 ? 34.667  8.716    -39.087 1.00 27.25  ? 447  THR A N     1 
ATOM   3156 C  CA    . THR A 1 401 ? 35.776  8.426    -38.177 1.00 28.75  ? 447  THR A CA    1 
ATOM   3157 C  C     . THR A 1 401 ? 35.360  7.393    -37.136 1.00 37.38  ? 447  THR A C     1 
ATOM   3158 O  O     . THR A 1 401 ? 36.169  6.510    -36.793 1.00 37.66  ? 447  THR A O     1 
ATOM   3159 C  CB    . THR A 1 401 ? 36.278  9.718    -37.544 1.00 35.48  ? 447  THR A CB    1 
ATOM   3160 O  OG1   . THR A 1 401 ? 36.694  10.537   -38.598 1.00 34.83  ? 447  THR A OG1   1 
ATOM   3161 C  CG2   . THR A 1 401 ? 37.449  9.515    -36.606 1.00 37.15  ? 447  THR A CG2   1 
ATOM   3162 N  N     . TYR A 1 402 ? 34.117  7.495    -36.614 1.00 34.39  ? 448  TYR A N     1 
ATOM   3163 C  CA    . TYR A 1 402 ? 33.663  6.498    -35.654 1.00 34.52  ? 448  TYR A CA    1 
ATOM   3164 C  C     . TYR A 1 402 ? 33.526  5.120    -36.316 1.00 36.45  ? 448  TYR A C     1 
ATOM   3165 O  O     . TYR A 1 402 ? 33.946  4.122    -35.758 1.00 37.03  ? 448  TYR A O     1 
ATOM   3166 C  CB    . TYR A 1 402 ? 32.353  6.898    -34.955 1.00 35.85  ? 448  TYR A CB    1 
ATOM   3167 C  CG    . TYR A 1 402 ? 32.101  6.018    -33.745 1.00 37.36  ? 448  TYR A CG    1 
ATOM   3168 C  CD1   . TYR A 1 402 ? 32.752  6.262    -32.536 1.00 38.95  ? 448  TYR A CD1   1 
ATOM   3169 C  CD2   . TYR A 1 402 ? 31.305  4.874    -33.842 1.00 38.23  ? 448  TYR A CD2   1 
ATOM   3170 C  CE1   . TYR A 1 402 ? 32.575  5.419    -31.439 1.00 40.21  ? 448  TYR A CE1   1 
ATOM   3171 C  CE2   . TYR A 1 402 ? 31.157  4.002    -32.760 1.00 38.19  ? 448  TYR A CE2   1 
ATOM   3172 C  CZ    . TYR A 1 402 ? 31.752  4.309    -31.548 1.00 43.46  ? 448  TYR A CZ    1 
ATOM   3173 O  OH    . TYR A 1 402 ? 31.569  3.514    -30.455 1.00 41.85  ? 448  TYR A OH    1 
ATOM   3174 N  N     . GLU A 1 403 ? 32.914  5.097    -37.485 1.00 33.54  ? 449  GLU A N     1 
ATOM   3175 C  CA    . GLU A 1 403 ? 32.707  3.952    -38.356 1.00 34.09  ? 449  GLU A CA    1 
ATOM   3176 C  C     . GLU A 1 403 ? 34.049  3.247    -38.681 1.00 36.31  ? 449  GLU A C     1 
ATOM   3177 O  O     . GLU A 1 403 ? 34.147  2.035    -38.520 1.00 35.81  ? 449  GLU A O     1 
ATOM   3178 C  CB    . GLU A 1 403 ? 31.957  4.404    -39.640 1.00 35.43  ? 449  GLU A CB    1 
ATOM   3179 C  CG    . GLU A 1 403 ? 31.799  3.334    -40.711 1.00 43.90  ? 449  GLU A CG    1 
ATOM   3180 C  CD    . GLU A 1 403 ? 31.284  3.866    -42.032 1.00 68.22  ? 449  GLU A CD    1 
ATOM   3181 O  OE1   . GLU A 1 403 ? 31.851  4.863    -42.541 1.00 54.70  ? 449  GLU A OE1   1 
ATOM   3182 O  OE2   . GLU A 1 403 ? 30.312  3.277    -42.561 1.00 59.70  ? 449  GLU A OE2   1 
ATOM   3183 N  N     . ARG A 1 404 ? 35.050  4.006    -39.125 1.00 32.52  ? 450  ARG A N     1 
ATOM   3184 C  CA    . ARG A 1 404 ? 36.410  3.525    -39.421 1.00 31.95  ? 450  ARG A CA    1 
ATOM   3185 C  C     . ARG A 1 404 ? 37.110  2.998    -38.158 1.00 35.31  ? 450  ARG A C     1 
ATOM   3186 O  O     . ARG A 1 404 ? 37.814  1.977    -38.232 1.00 38.30  ? 450  ARG A O     1 
ATOM   3187 C  CB    . ARG A 1 404 ? 37.225  4.623    -40.103 1.00 26.60  ? 450  ARG A CB    1 
ATOM   3188 C  CG    . ARG A 1 404 ? 36.846  4.746    -41.551 1.00 30.50  ? 450  ARG A CG    1 
ATOM   3189 C  CD    . ARG A 1 404 ? 37.305  6.080    -42.077 1.00 41.52  ? 450  ARG A CD    1 
ATOM   3190 N  NE    . ARG A 1 404 ? 37.014  6.232    -43.506 1.00 54.98  ? 450  ARG A NE    1 
ATOM   3191 C  CZ    . ARG A 1 404 ? 37.794  5.785    -44.485 1.00 54.90  ? 450  ARG A CZ    1 
ATOM   3192 N  NH1   . ARG A 1 404 ? 38.904  5.110    -44.206 1.00 37.79  ? 450  ARG A NH1   1 
ATOM   3193 N  NH2   . ARG A 1 404 ? 37.465  5.997    -45.747 1.00 43.73  ? 450  ARG A NH2   1 
ATOM   3194 N  N     . LEU A 1 405 ? 36.870  3.633    -36.995 1.00 28.58  ? 451  LEU A N     1 
ATOM   3195 C  CA    . LEU A 1 405 ? 37.384  3.106    -35.716 1.00 28.37  ? 451  LEU A CA    1 
ATOM   3196 C  C     . LEU A 1 405 ? 36.760  1.726    -35.459 1.00 36.09  ? 451  LEU A C     1 
ATOM   3197 O  O     . LEU A 1 405 ? 37.500  0.795    -35.121 1.00 39.40  ? 451  LEU A O     1 
ATOM   3198 C  CB    . LEU A 1 405 ? 37.086  4.046    -34.523 1.00 27.85  ? 451  LEU A CB    1 
ATOM   3199 C  CG    . LEU A 1 405 ? 37.543  3.585    -33.108 1.00 31.33  ? 451  LEU A CG    1 
ATOM   3200 C  CD1   . LEU A 1 405 ? 39.026  3.375    -33.057 1.00 32.09  ? 451  LEU A CD1   1 
ATOM   3201 C  CD2   . LEU A 1 405 ? 37.108  4.578    -32.047 1.00 29.89  ? 451  LEU A CD2   1 
ATOM   3202 N  N     . PHE A 1 406 ? 35.454  1.594    -35.665 1.00 29.13  ? 452  PHE A N     1 
ATOM   3203 C  CA    . PHE A 1 406 ? 34.771  0.320    -35.463 1.00 28.43  ? 452  PHE A CA    1 
ATOM   3204 C  C     . PHE A 1 406 ? 35.279  -0.764   -36.417 1.00 31.86  ? 452  PHE A C     1 
ATOM   3205 O  O     . PHE A 1 406 ? 35.460  -1.913   -36.016 1.00 29.58  ? 452  PHE A O     1 
ATOM   3206 C  CB    . PHE A 1 406 ? 33.259  0.492    -35.623 1.00 28.96  ? 452  PHE A CB    1 
ATOM   3207 C  CG    . PHE A 1 406 ? 32.487  -0.790   -35.501 1.00 28.56  ? 452  PHE A CG    1 
ATOM   3208 C  CD1   . PHE A 1 406 ? 32.198  -1.324   -34.256 1.00 30.10  ? 452  PHE A CD1   1 
ATOM   3209 C  CD2   . PHE A 1 406 ? 32.050  -1.462   -36.630 1.00 29.24  ? 452  PHE A CD2   1 
ATOM   3210 C  CE1   . PHE A 1 406 ? 31.488  -2.504   -34.140 1.00 31.49  ? 452  PHE A CE1   1 
ATOM   3211 C  CE2   . PHE A 1 406 ? 31.340  -2.642   -36.522 1.00 31.21  ? 452  PHE A CE2   1 
ATOM   3212 C  CZ    . PHE A 1 406 ? 31.058  -3.164   -35.274 1.00 29.57  ? 452  PHE A CZ    1 
ATOM   3213 N  N     . ARG A 1 407 ? 35.501  -0.387   -37.662 1.00 30.95  ? 453  ARG A N     1 
ATOM   3214 C  CA    . ARG A 1 407 ? 35.988  -1.267   -38.693 1.00 31.26  ? 453  ARG A CA    1 
ATOM   3215 C  C     . ARG A 1 407 ? 37.356  -1.805   -38.336 1.00 38.04  ? 453  ARG A C     1 
ATOM   3216 O  O     . ARG A 1 407 ? 37.607  -2.946   -38.534 1.00 37.56  ? 453  ARG A O     1 
ATOM   3217 C  CB    . ARG A 1 407 ? 36.043  -0.540   -40.020 1.00 32.50  ? 453  ARG A CB    1 
ATOM   3218 C  CG    . ARG A 1 407 ? 35.977  -1.459   -41.205 1.00 49.39  ? 453  ARG A CG    1 
ATOM   3219 C  CD    . ARG A 1 407 ? 36.540  -0.902   -42.500 1.00 73.15  ? 453  ARG A CD    1 
ATOM   3220 N  NE    . ARG A 1 407 ? 36.114  0.450    -42.816 1.00 88.15  ? 453  ARG A NE    1 
ATOM   3221 C  CZ    . ARG A 1 407 ? 34.874  0.824    -43.113 1.00 100.63 ? 453  ARG A CZ    1 
ATOM   3222 N  NH1   . ARG A 1 407 ? 34.636  2.084    -43.396 1.00 78.28  ? 453  ARG A NH1   1 
ATOM   3223 N  NH2   . ARG A 1 407 ? 33.878  -0.043   -43.127 1.00 92.32  ? 453  ARG A NH2   1 
ATOM   3224 N  N     . TRP A 1 408 ? 38.208  -0.949   -37.790 1.00 35.91  ? 454  TRP A N     1 
ATOM   3225 C  CA    . TRP A 1 408 ? 39.561  -1.270   -37.321 1.00 35.38  ? 454  TRP A CA    1 
ATOM   3226 C  C     . TRP A 1 408 ? 39.482  -2.175   -36.114 1.00 41.22  ? 454  TRP A C     1 
ATOM   3227 O  O     . TRP A 1 408 ? 40.297  -3.093   -35.993 1.00 39.87  ? 454  TRP A O     1 
ATOM   3228 C  CB    . TRP A 1 408 ? 40.333  0.026    -36.959 1.00 33.91  ? 454  TRP A CB    1 
ATOM   3229 C  CG    . TRP A 1 408 ? 41.721  -0.210   -36.425 1.00 35.30  ? 454  TRP A CG    1 
ATOM   3230 C  CD1   . TRP A 1 408 ? 42.858  -0.419   -37.155 1.00 38.16  ? 454  TRP A CD1   1 
ATOM   3231 C  CD2   . TRP A 1 408 ? 42.102  -0.314   -35.042 1.00 34.52  ? 454  TRP A CD2   1 
ATOM   3232 N  NE1   . TRP A 1 408 ? 43.931  -0.633   -36.311 1.00 37.11  ? 454  TRP A NE1   1 
ATOM   3233 C  CE2   . TRP A 1 408 ? 43.494  -0.580   -35.012 1.00 37.35  ? 454  TRP A CE2   1 
ATOM   3234 C  CE3   . TRP A 1 408 ? 41.421  -0.137   -33.828 1.00 34.81  ? 454  TRP A CE3   1 
ATOM   3235 C  CZ2   . TRP A 1 408 ? 44.206  -0.690   -33.811 1.00 35.69  ? 454  TRP A CZ2   1 
ATOM   3236 C  CZ3   . TRP A 1 408 ? 42.127  -0.293   -32.643 1.00 36.23  ? 454  TRP A CZ3   1 
ATOM   3237 C  CH2   . TRP A 1 408 ? 43.510  -0.516   -32.645 1.00 35.95  ? 454  TRP A CH2   1 
ATOM   3238 N  N     . LEU A 1 409 ? 38.528  -1.890   -35.196 1.00 39.98  ? 455  LEU A N     1 
ATOM   3239 C  CA    . LEU A 1 409 ? 38.285  -2.704   -34.001 1.00 41.13  ? 455  LEU A CA    1 
ATOM   3240 C  C     . LEU A 1 409 ? 37.969  -4.138   -34.345 1.00 40.59  ? 455  LEU A C     1 
ATOM   3241 O  O     . LEU A 1 409 ? 38.524  -5.019   -33.733 1.00 37.49  ? 455  LEU A O     1 
ATOM   3242 C  CB    . LEU A 1 409 ? 37.164  -2.130   -33.126 1.00 42.33  ? 455  LEU A CB    1 
ATOM   3243 C  CG    . LEU A 1 409 ? 36.776  -2.936   -31.888 1.00 48.83  ? 455  LEU A CG    1 
ATOM   3244 C  CD1   . LEU A 1 409 ? 37.948  -3.007   -30.952 1.00 47.77  ? 455  LEU A CD1   1 
ATOM   3245 C  CD2   . LEU A 1 409 ? 35.604  -2.263   -31.116 1.00 53.48  ? 455  LEU A CD2   1 
ATOM   3246 N  N     . VAL A 1 410 ? 37.162  -4.359   -35.390 1.00 38.97  ? 456  VAL A N     1 
ATOM   3247 C  CA    . VAL A 1 410 ? 36.761  -5.686   -35.879 1.00 39.41  ? 456  VAL A CA    1 
ATOM   3248 C  C     . VAL A 1 410 ? 37.963  -6.412   -36.528 1.00 42.79  ? 456  VAL A C     1 
ATOM   3249 O  O     . VAL A 1 410 ? 38.156  -7.611   -36.285 1.00 42.36  ? 456  VAL A O     1 
ATOM   3250 C  CB    . VAL A 1 410 ? 35.523  -5.579   -36.812 1.00 42.04  ? 456  VAL A CB    1 
ATOM   3251 C  CG1   . VAL A 1 410 ? 35.251  -6.882   -37.557 1.00 40.88  ? 456  VAL A CG1   1 
ATOM   3252 C  CG2   . VAL A 1 410 ? 34.298  -5.141   -36.024 1.00 42.01  ? 456  VAL A CG2   1 
ATOM   3253 N  N     . LEU A 1 411 ? 38.756  -5.672   -37.328 1.00 38.50  ? 457  LEU A N     1 
ATOM   3254 C  CA    . LEU A 1 411 ? 39.941  -6.161   -38.032 1.00 39.13  ? 457  LEU A CA    1 
ATOM   3255 C  C     . LEU A 1 411 ? 40.969  -6.692   -37.032 1.00 39.31  ? 457  LEU A C     1 
ATOM   3256 O  O     . LEU A 1 411 ? 41.468  -7.809   -37.209 1.00 37.86  ? 457  LEU A O     1 
ATOM   3257 C  CB    . LEU A 1 411 ? 40.528  -5.035   -38.914 1.00 40.53  ? 457  LEU A CB    1 
ATOM   3258 C  CG    . LEU A 1 411 ? 41.721  -5.399   -39.816 1.00 47.11  ? 457  LEU A CG    1 
ATOM   3259 C  CD1   . LEU A 1 411 ? 41.270  -5.808   -41.220 1.00 47.43  ? 457  LEU A CD1   1 
ATOM   3260 C  CD2   . LEU A 1 411 ? 42.720  -4.254   -39.887 1.00 51.01  ? 457  LEU A CD2   1 
ATOM   3261 N  N     . ARG A 1 412 ? 41.155  -5.955   -35.917 1.00 34.94  ? 458  ARG A N     1 
ATOM   3262 C  CA    . ARG A 1 412 ? 42.050  -6.294   -34.812 1.00 34.26  ? 458  ARG A CA    1 
ATOM   3263 C  C     . ARG A 1 412 ? 41.612  -7.489   -34.008 1.00 36.65  ? 458  ARG A C     1 
ATOM   3264 O  O     . ARG A 1 412 ? 42.467  -8.316   -33.657 1.00 35.85  ? 458  ARG A O     1 
ATOM   3265 C  CB    . ARG A 1 412 ? 42.293  -5.093   -33.899 1.00 36.48  ? 458  ARG A CB    1 
ATOM   3266 C  CG    . ARG A 1 412 ? 43.450  -4.209   -34.345 1.00 44.56  ? 458  ARG A CG    1 
ATOM   3267 C  CD    . ARG A 1 412 ? 44.811  -4.874   -34.149 1.00 61.92  ? 458  ARG A CD    1 
ATOM   3268 N  NE    . ARG A 1 412 ? 45.264  -4.868   -32.753 1.00 78.49  ? 458  ARG A NE    1 
ATOM   3269 C  CZ    . ARG A 1 412 ? 45.234  -5.916   -31.924 1.00 99.28  ? 458  ARG A CZ    1 
ATOM   3270 N  NH1   . ARG A 1 412 ? 44.746  -7.085   -32.333 1.00 82.35  ? 458  ARG A NH1   1 
ATOM   3271 N  NH2   . ARG A 1 412 ? 45.683  -5.797   -30.684 1.00 88.65  ? 458  ARG A NH2   1 
ATOM   3272 N  N     . LEU A 1 413 ? 40.293  -7.586   -33.691 1.00 34.09  ? 459  LEU A N     1 
ATOM   3273 C  CA    . LEU A 1 413 ? 39.724  -8.724   -32.983 1.00 34.13  ? 459  LEU A CA    1 
ATOM   3274 C  C     . LEU A 1 413 ? 39.933  -9.948   -33.868 1.00 36.63  ? 459  LEU A C     1 
ATOM   3275 O  O     . LEU A 1 413 ? 40.446  -10.946  -33.386 1.00 34.97  ? 459  LEU A O     1 
ATOM   3276 C  CB    . LEU A 1 413 ? 38.241  -8.528   -32.660 1.00 35.04  ? 459  LEU A CB    1 
ATOM   3277 C  CG    . LEU A 1 413 ? 37.871  -7.430   -31.663 1.00 40.06  ? 459  LEU A CG    1 
ATOM   3278 C  CD1   . LEU A 1 413 ? 36.379  -7.214   -31.656 1.00 39.20  ? 459  LEU A CD1   1 
ATOM   3279 C  CD2   . LEU A 1 413 ? 38.281  -7.791   -30.246 1.00 41.90  ? 459  LEU A CD2   1 
ATOM   3280 N  N     . ASN A 1 414 ? 39.685  -9.817   -35.200 1.00 34.59  ? 460  ASN A N     1 
ATOM   3281 C  CA    . ASN A 1 414 ? 39.974  -10.902  -36.144 1.00 34.33  ? 460  ASN A CA    1 
ATOM   3282 C  C     . ASN A 1 414 ? 41.463  -11.252  -36.169 1.00 40.66  ? 460  ASN A C     1 
ATOM   3283 O  O     . ASN A 1 414 ? 41.786  -12.417  -36.346 1.00 42.06  ? 460  ASN A O     1 
ATOM   3284 C  CB    . ASN A 1 414 ? 39.465  -10.593  -37.544 1.00 28.15  ? 460  ASN A CB    1 
ATOM   3285 C  CG    . ASN A 1 414 ? 37.991  -10.800  -37.671 1.00 34.13  ? 460  ASN A CG    1 
ATOM   3286 O  OD1   . ASN A 1 414 ? 37.386  -11.584  -36.953 1.00 37.05  ? 460  ASN A OD1   1 
ATOM   3287 N  ND2   . ASN A 1 414 ? 37.366  -10.084  -38.569 1.00 31.60  ? 460  ASN A ND2   1 
ATOM   3288 N  N     . ARG A 1 415 ? 42.355  -10.304  -35.966 1.00 36.50  ? 461  ARG A N     1 
ATOM   3289 C  CA    . ARG A 1 415 ? 43.762  -10.612  -35.876 1.00 37.08  ? 461  ARG A CA    1 
ATOM   3290 C  C     . ARG A 1 415 ? 44.115  -11.439  -34.641 1.00 39.19  ? 461  ARG A C     1 
ATOM   3291 O  O     . ARG A 1 415 ? 44.889  -12.334  -34.723 1.00 39.77  ? 461  ARG A O     1 
ATOM   3292 C  CB    . ARG A 1 415 ? 44.610  -9.361   -36.000 1.00 40.54  ? 461  ARG A CB    1 
ATOM   3293 C  CG    . ARG A 1 415 ? 44.939  -9.055   -37.434 1.00 59.41  ? 461  ARG A CG    1 
ATOM   3294 C  CD    . ARG A 1 415 ? 46.019  -8.017   -37.563 1.00 88.54  ? 461  ARG A CD    1 
ATOM   3295 N  NE    . ARG A 1 415 ? 46.909  -8.013   -36.423 1.00 110.31 ? 461  ARG A NE    1 
ATOM   3296 C  CZ    . ARG A 1 415 ? 47.169  -6.934   -35.700 1.00 132.21 ? 461  ARG A CZ    1 
ATOM   3297 N  NH1   . ARG A 1 415 ? 46.605  -5.783   -36.008 1.00 122.68 ? 461  ARG A NH1   1 
ATOM   3298 N  NH2   . ARG A 1 415 ? 47.990  -7.002   -34.676 1.00 120.97 ? 461  ARG A NH2   1 
ATOM   3299 N  N     . ALA A 1 416 ? 43.559  -11.090  -33.500 1.00 33.81  ? 462  ALA A N     1 
ATOM   3300 C  CA    . ALA A 1 416 ? 43.716  -11.877  -32.295 1.00 33.93  ? 462  ALA A CA    1 
ATOM   3301 C  C     . ALA A 1 416 ? 42.987  -13.249  -32.379 1.00 40.45  ? 462  ALA A C     1 
ATOM   3302 O  O     . ALA A 1 416 ? 43.554  -14.230  -31.945 1.00 41.27  ? 462  ALA A O     1 
ATOM   3303 C  CB    . ALA A 1 416 ? 43.209  -11.097  -31.083 1.00 34.69  ? 462  ALA A CB    1 
ATOM   3304 N  N     . LEU A 1 417 ? 41.682  -13.163  -32.634 1.00 40.29  ? 463  LEU A N     1 
ATOM   3305 C  CA    . LEU A 1 417 ? 40.758  -14.291  -32.740 1.00 40.16  ? 463  LEU A CA    1 
ATOM   3306 C  C     . LEU A 1 417 ? 40.954  -15.221  -33.926 1.00 44.22  ? 463  LEU A C     1 
ATOM   3307 O  O     . LEU A 1 417 ? 40.846  -16.440  -33.791 1.00 42.57  ? 463  LEU A O     1 
ATOM   3308 C  CB    . LEU A 1 417 ? 39.311  -13.787  -32.718 1.00 39.56  ? 463  LEU A CB    1 
ATOM   3309 C  CG    . LEU A 1 417 ? 38.880  -13.017  -31.469 1.00 44.10  ? 463  LEU A CG    1 
ATOM   3310 C  CD1   . LEU A 1 417 ? 37.452  -12.513  -31.614 1.00 44.86  ? 463  LEU A CD1   1 
ATOM   3311 C  CD2   . LEU A 1 417 ? 39.023  -13.883  -30.227 1.00 46.01  ? 463  LEU A CD2   1 
ATOM   3312 N  N     . ASP A 1 418 ? 41.243  -14.649  -35.090 1.00 43.81  ? 464  ASP A N     1 
ATOM   3313 C  CA    . ASP A 1 418 ? 41.405  -15.466  -36.278 1.00 44.94  ? 464  ASP A CA    1 
ATOM   3314 C  C     . ASP A 1 418 ? 42.807  -16.031  -36.297 1.00 53.60  ? 464  ASP A C     1 
ATOM   3315 O  O     . ASP A 1 418 ? 43.791  -15.297  -36.390 1.00 54.91  ? 464  ASP A O     1 
ATOM   3316 C  CB    . ASP A 1 418 ? 41.151  -14.639  -37.539 1.00 46.09  ? 464  ASP A CB    1 
ATOM   3317 C  CG    . ASP A 1 418 ? 41.309  -15.450  -38.810 1.00 50.78  ? 464  ASP A CG    1 
ATOM   3318 O  OD1   . ASP A 1 418 ? 41.615  -16.657  -38.712 1.00 48.92  ? 464  ASP A OD1   1 
ATOM   3319 O  OD2   . ASP A 1 418 ? 41.127  -14.881  -39.907 1.00 55.74  ? 464  ASP A OD2   1 
ATOM   3320 N  N     . ARG A 1 419 ? 42.875  -17.347  -36.277 1.00 52.76  ? 465  ARG A N     1 
ATOM   3321 C  CA    . ARG A 1 419 ? 44.139  -18.028  -36.263 1.00 52.97  ? 465  ARG A CA    1 
ATOM   3322 C  C     . ARG A 1 419 ? 44.037  -19.431  -36.777 1.00 56.64  ? 465  ARG A C     1 
ATOM   3323 O  O     . ARG A 1 419 ? 42.964  -19.944  -36.929 1.00 54.39  ? 465  ARG A O     1 
ATOM   3324 C  CB    . ARG A 1 419 ? 44.719  -18.008  -34.864 1.00 52.48  ? 465  ARG A CB    1 
ATOM   3325 C  CG    . ARG A 1 419 ? 43.705  -18.157  -33.771 1.00 51.30  ? 465  ARG A CG    1 
ATOM   3326 C  CD    . ARG A 1 419 ? 44.066  -17.298  -32.581 1.00 53.42  ? 465  ARG A CD    1 
ATOM   3327 N  NE    . ARG A 1 419 ? 44.793  -18.017  -31.561 1.00 60.62  ? 465  ARG A NE    1 
ATOM   3328 C  CZ    . ARG A 1 419 ? 44.943  -17.603  -30.312 1.00 68.03  ? 465  ARG A CZ    1 
ATOM   3329 N  NH1   . ARG A 1 419 ? 44.421  -16.473  -29.910 1.00 46.39  ? 465  ARG A NH1   1 
ATOM   3330 N  NH2   . ARG A 1 419 ? 45.616  -18.335  -29.463 1.00 58.60  ? 465  ARG A NH2   1 
ATOM   3331 N  N     . SER A 1 420 ? 45.185  -19.992  -37.122 1.00 56.04  ? 466  SER A N     1 
ATOM   3332 C  CA    . SER A 1 420 ? 45.289  -21.371  -37.570 1.00 56.85  ? 466  SER A CA    1 
ATOM   3333 C  C     . SER A 1 420 ? 44.398  -21.813  -38.702 1.00 63.33  ? 466  SER A C     1 
ATOM   3334 O  O     . SER A 1 420 ? 43.556  -22.647  -38.504 1.00 60.39  ? 466  SER A O     1 
ATOM   3335 C  CB    . SER A 1 420 ? 45.110  -22.340  -36.400 1.00 59.44  ? 466  SER A CB    1 
ATOM   3336 O  OG    . SER A 1 420 ? 45.967  -22.034  -35.338 1.00 64.33  ? 466  SER A OG    1 
ATOM   3337 N  N     . PRO A 1 421 ? 44.620  -21.347  -39.922 1.00 64.36  ? 467  PRO A N     1 
ATOM   3338 C  CA    . PRO A 1 421 ? 43.697  -21.778  -40.980 1.00 65.41  ? 467  PRO A CA    1 
ATOM   3339 C  C     . PRO A 1 421 ? 43.898  -23.213  -41.488 1.00 72.77  ? 467  PRO A C     1 
ATOM   3340 O  O     . PRO A 1 421 ? 44.512  -23.475  -42.484 1.00 72.00  ? 467  PRO A O     1 
ATOM   3341 C  CB    . PRO A 1 421 ? 43.999  -20.799  -42.113 1.00 67.08  ? 467  PRO A CB    1 
ATOM   3342 C  CG    . PRO A 1 421 ? 44.839  -19.732  -41.533 1.00 71.43  ? 467  PRO A CG    1 
ATOM   3343 C  CD    . PRO A 1 421 ? 45.554  -20.317  -40.377 1.00 66.62  ? 467  PRO A CD    1 
ATOM   3344 N  N     . ARG A 1 422 ? 43.483  -24.107  -40.622 1.00 71.93  ? 468  ARG A N     1 
ATOM   3345 C  CA    . ARG A 1 422 ? 43.454  -25.533  -40.826 1.00 71.83  ? 468  ARG A CA    1 
ATOM   3346 C  C     . ARG A 1 422 ? 42.107  -25.905  -40.230 1.00 75.66  ? 468  ARG A C     1 
ATOM   3347 O  O     . ARG A 1 422 ? 41.941  -26.936  -39.630 1.00 74.61  ? 468  ARG A O     1 
ATOM   3348 C  CB    . ARG A 1 422 ? 44.530  -26.191  -40.050 1.00 71.49  ? 468  ARG A CB    1 
ATOM   3349 C  CG    . ARG A 1 422 ? 44.278  -26.075  -38.579 1.00 82.40  ? 468  ARG A CG    1 
ATOM   3350 C  CD    . ARG A 1 422 ? 45.091  -27.100  -37.859 1.00 91.80  ? 468  ARG A CD    1 
ATOM   3351 N  NE    . ARG A 1 422 ? 45.366  -26.664  -36.521 1.00 99.61  ? 468  ARG A NE    1 
ATOM   3352 C  CZ    . ARG A 1 422 ? 46.277  -25.763  -36.254 1.00 112.12 ? 468  ARG A CZ    1 
ATOM   3353 N  NH1   . ARG A 1 422 ? 46.498  -25.403  -35.018 1.00 102.17 ? 468  ARG A NH1   1 
ATOM   3354 N  NH2   . ARG A 1 422 ? 46.961  -25.224  -37.241 1.00 98.54  ? 468  ARG A NH2   1 
ATOM   3355 N  N     . GLN A 1 423 ? 41.154  -25.009  -40.438 1.00 72.74  ? 469  GLN A N     1 
ATOM   3356 C  CA    . GLN A 1 423 ? 39.805  -25.178  -39.988 1.00 72.89  ? 469  GLN A CA    1 
ATOM   3357 C  C     . GLN A 1 423 ? 39.411  -26.383  -40.694 1.00 73.27  ? 469  GLN A C     1 
ATOM   3358 O  O     . GLN A 1 423 ? 39.464  -26.430  -41.878 1.00 71.50  ? 469  GLN A O     1 
ATOM   3359 C  CB    . GLN A 1 423 ? 38.942  -24.041  -40.490 1.00 74.98  ? 469  GLN A CB    1 
ATOM   3360 C  CG    . GLN A 1 423 ? 38.815  -23.991  -41.990 1.00 105.89 ? 469  GLN A CG    1 
ATOM   3361 C  CD    . GLN A 1 423 ? 37.953  -22.851  -42.441 1.00 131.13 ? 469  GLN A CD    1 
ATOM   3362 O  OE1   . GLN A 1 423 ? 37.746  -21.896  -41.701 1.00 127.69 ? 469  GLN A OE1   1 
ATOM   3363 N  NE2   . GLN A 1 423 ? 37.454  -22.932  -43.669 1.00 125.22 ? 469  GLN A NE2   1 
ATOM   3364 N  N     . GLY A 1 424 ? 38.967  -27.405  -39.972 1.00 70.76  ? 470  GLY A N     1 
ATOM   3365 C  CA    . GLY A 1 424 ? 38.709  -28.677  -40.624 1.00 71.68  ? 470  GLY A CA    1 
ATOM   3366 C  C     . GLY A 1 424 ? 37.422  -28.873  -41.388 1.00 78.20  ? 470  GLY A C     1 
ATOM   3367 O  O     . GLY A 1 424 ? 36.518  -29.586  -40.948 1.00 80.45  ? 470  GLY A O     1 
ATOM   3368 N  N     . ALA A 1 425 ? 37.354  -28.203  -42.537 1.00 73.03  ? 471  ALA A N     1 
ATOM   3369 C  CA    . ALA A 1 425 ? 36.223  -28.295  -43.451 1.00 70.58  ? 471  ALA A CA    1 
ATOM   3370 C  C     . ALA A 1 425 ? 34.931  -28.024  -42.710 1.00 67.31  ? 471  ALA A C     1 
ATOM   3371 O  O     . ALA A 1 425 ? 33.924  -28.692  -42.945 1.00 68.61  ? 471  ALA A O     1 
ATOM   3372 C  CB    . ALA A 1 425 ? 36.185  -29.659  -44.123 1.00 30.00  ? 471  ALA A CB    1 
ATOM   3373 N  N     . SER A 1 426 ? 34.953  -27.047  -41.813 1.00 55.75  ? 472  SER A N     1 
ATOM   3374 C  CA    . SER A 1 426 ? 33.757  -26.761  -41.060 1.00 51.34  ? 472  SER A CA    1 
ATOM   3375 C  C     . SER A 1 426 ? 33.858  -25.461  -40.287 1.00 49.95  ? 472  SER A C     1 
ATOM   3376 O  O     . SER A 1 426 ? 34.930  -24.888  -40.095 1.00 49.11  ? 472  SER A O     1 
ATOM   3377 C  CB    . SER A 1 426 ? 33.451  -27.905  -40.088 1.00 51.31  ? 472  SER A CB    1 
ATOM   3378 O  OG    . SER A 1 426 ? 34.473  -28.035  -39.115 1.00 52.50  ? 472  SER A OG    1 
ATOM   3379 N  N     . PHE A 1 427 ? 32.691  -25.025  -39.855 1.00 42.79  ? 473  PHE A N     1 
ATOM   3380 C  CA    . PHE A 1 427 ? 32.477  -23.856  -39.057 1.00 39.49  ? 473  PHE A CA    1 
ATOM   3381 C  C     . PHE A 1 427 ? 31.067  -23.832  -38.567 1.00 35.72  ? 473  PHE A C     1 
ATOM   3382 O  O     . PHE A 1 427 ? 30.230  -24.485  -39.073 1.00 32.27  ? 473  PHE A O     1 
ATOM   3383 C  CB    . PHE A 1 427 ? 32.871  -22.563  -39.782 1.00 40.31  ? 473  PHE A CB    1 
ATOM   3384 C  CG    . PHE A 1 427 ? 31.928  -22.130  -40.854 1.00 40.80  ? 473  PHE A CG    1 
ATOM   3385 C  CD1   . PHE A 1 427 ? 30.824  -21.395  -40.562 1.00 43.53  ? 473  PHE A CD1   1 
ATOM   3386 C  CD2   . PHE A 1 427 ? 32.178  -22.426  -42.144 1.00 43.54  ? 473  PHE A CD2   1 
ATOM   3387 C  CE1   . PHE A 1 427 ? 29.967  -20.992  -41.539 1.00 45.20  ? 473  PHE A CE1   1 
ATOM   3388 C  CE2   . PHE A 1 427 ? 31.328  -22.038  -43.136 1.00 46.87  ? 473  PHE A CE2   1 
ATOM   3389 C  CZ    . PHE A 1 427 ? 30.220  -21.320  -42.835 1.00 44.65  ? 473  PHE A CZ    1 
ATOM   3390 N  N     . LEU A 1 428 ? 30.879  -23.088  -37.512 1.00 33.64  ? 474  LEU A N     1 
ATOM   3391 C  CA    . LEU A 1 428 ? 29.597  -22.874  -36.885 1.00 34.17  ? 474  LEU A CA    1 
ATOM   3392 C  C     . LEU A 1 428 ? 29.339  -21.343  -36.886 1.00 37.86  ? 474  LEU A C     1 
ATOM   3393 O  O     . LEU A 1 428 ? 29.959  -20.588  -36.114 1.00 37.81  ? 474  LEU A O     1 
ATOM   3394 C  CB    . LEU A 1 428 ? 29.546  -23.476  -35.479 1.00 34.81  ? 474  LEU A CB    1 
ATOM   3395 C  CG    . LEU A 1 428 ? 28.160  -23.706  -34.870 1.00 40.46  ? 474  LEU A CG    1 
ATOM   3396 C  CD1   . LEU A 1 428 ? 28.233  -24.747  -33.777 1.00 41.45  ? 474  LEU A CD1   1 
ATOM   3397 C  CD2   . LEU A 1 428 ? 27.587  -22.409  -34.290 1.00 42.55  ? 474  LEU A CD2   1 
ATOM   3398 N  N     . GLY A 1 429 ? 28.457  -20.922  -37.800 1.00 31.74  ? 475  GLY A N     1 
ATOM   3399 C  CA    . GLY A 1 429 ? 28.035  -19.543  -37.932 1.00 30.75  ? 475  GLY A CA    1 
ATOM   3400 C  C     . GLY A 1 429 ? 26.926  -19.186  -36.967 1.00 37.43  ? 475  GLY A C     1 
ATOM   3401 O  O     . GLY A 1 429 ? 25.961  -19.935  -36.837 1.00 39.20  ? 475  GLY A O     1 
ATOM   3402 N  N     . ILE A 1 430 ? 27.059  -18.058  -36.251 1.00 33.50  ? 476  ILE A N     1 
ATOM   3403 C  CA    . ILE A 1 430 ? 26.050  -17.542  -35.315 1.00 32.17  ? 476  ILE A CA    1 
ATOM   3404 C  C     . ILE A 1 430 ? 25.603  -16.148  -35.783 1.00 36.44  ? 476  ILE A C     1 
ATOM   3405 O  O     . ILE A 1 430 ? 26.357  -15.181  -35.608 1.00 35.68  ? 476  ILE A O     1 
ATOM   3406 C  CB    . ILE A 1 430 ? 26.597  -17.445  -33.878 1.00 34.72  ? 476  ILE A CB    1 
ATOM   3407 C  CG1   . ILE A 1 430 ? 27.366  -18.705  -33.467 1.00 34.70  ? 476  ILE A CG1   1 
ATOM   3408 C  CG2   . ILE A 1 430 ? 25.457  -17.091  -32.906 1.00 35.78  ? 476  ILE A CG2   1 
ATOM   3409 C  CD1   . ILE A 1 430 ? 28.260  -18.531  -32.355 1.00 29.45  ? 476  ILE A CD1   1 
ATOM   3410 N  N     . LEU A 1 431 ? 24.384  -16.036  -36.348 1.00 32.98  ? 477  LEU A N     1 
ATOM   3411 C  CA    . LEU A 1 431 ? 23.867  -14.761  -36.812 1.00 33.38  ? 477  LEU A CA    1 
ATOM   3412 C  C     . LEU A 1 431 ? 23.201  -13.943  -35.708 1.00 39.46  ? 477  LEU A C     1 
ATOM   3413 O  O     . LEU A 1 431 ? 22.209  -14.358  -35.103 1.00 39.00  ? 477  LEU A O     1 
ATOM   3414 C  CB    . LEU A 1 431 ? 22.936  -14.933  -38.031 1.00 33.76  ? 477  LEU A CB    1 
ATOM   3415 C  CG    . LEU A 1 431 ? 22.251  -13.665  -38.594 1.00 38.15  ? 477  LEU A CG    1 
ATOM   3416 C  CD1   . LEU A 1 431 ? 23.273  -12.655  -39.126 1.00 38.15  ? 477  LEU A CD1   1 
ATOM   3417 C  CD2   . LEU A 1 431 ? 21.264  -14.016  -39.681 1.00 37.06  ? 477  LEU A CD2   1 
ATOM   3418 N  N     . ASP A 1 432 ? 23.684  -12.713  -35.530 1.00 38.64  ? 478  ASP A N     1 
ATOM   3419 C  CA    . ASP A 1 432 ? 23.117  -11.792  -34.543 1.00 38.71  ? 478  ASP A CA    1 
ATOM   3420 C  C     . ASP A 1 432 ? 22.839  -10.401  -35.141 1.00 41.69  ? 478  ASP A C     1 
ATOM   3421 O  O     . ASP A 1 432 ? 23.527  -9.431   -34.822 1.00 39.29  ? 478  ASP A O     1 
ATOM   3422 C  CB    . ASP A 1 432 ? 24.042  -11.667  -33.331 1.00 40.46  ? 478  ASP A CB    1 
ATOM   3423 C  CG    . ASP A 1 432 ? 23.455  -10.799  -32.236 1.00 41.82  ? 478  ASP A CG    1 
ATOM   3424 O  OD1   . ASP A 1 432 ? 22.320  -10.307  -32.410 1.00 38.20  ? 478  ASP A OD1   1 
ATOM   3425 O  OD2   . ASP A 1 432 ? 24.129  -10.607  -31.202 1.00 40.95  ? 478  ASP A OD2   1 
ATOM   3426 N  N     . ILE A 1 433 ? 21.829  -10.319  -36.007 1.00 36.97  ? 479  ILE A N     1 
ATOM   3427 C  CA    . ILE A 1 433 ? 21.431  -9.069   -36.671 1.00 34.47  ? 479  ILE A CA    1 
ATOM   3428 C  C     . ILE A 1 433 ? 20.597  -8.113   -35.805 1.00 34.59  ? 479  ILE A C     1 
ATOM   3429 O  O     . ILE A 1 433 ? 19.985  -8.534   -34.824 1.00 30.96  ? 479  ILE A O     1 
ATOM   3430 C  CB    . ILE A 1 433 ? 20.661  -9.350   -37.976 1.00 38.43  ? 479  ILE A CB    1 
ATOM   3431 C  CG1   . ILE A 1 433 ? 19.353  -10.085  -37.676 1.00 39.91  ? 479  ILE A CG1   1 
ATOM   3432 C  CG2   . ILE A 1 433 ? 21.521  -10.154  -38.939 1.00 38.46  ? 479  ILE A CG2   1 
ATOM   3433 C  CD1   . ILE A 1 433 ? 18.534  -10.402  -38.908 1.00 41.00  ? 479  ILE A CD1   1 
ATOM   3434 N  N     . ALA A 1 434 ? 20.577  -6.830   -36.172 1.00 30.70  ? 480  ALA A N     1 
ATOM   3435 C  CA    . ALA A 1 434 ? 19.795  -5.830   -35.426 1.00 29.94  ? 480  ALA A CA    1 
ATOM   3436 C  C     . ALA A 1 434 ? 18.333  -6.126   -35.767 1.00 31.04  ? 480  ALA A C     1 
ATOM   3437 O  O     . ALA A 1 434 ? 17.996  -6.234   -36.942 1.00 31.10  ? 480  ALA A O     1 
ATOM   3438 C  CB    . ALA A 1 434 ? 20.163  -4.415   -35.826 1.00 29.62  ? 480  ALA A CB    1 
ATOM   3439 N  N     . GLY A 1 435 ? 17.516  -6.287   -34.731 1.00 26.53  ? 481  GLY A N     1 
ATOM   3440 C  CA    . GLY A 1 435 ? 16.117  -6.661   -34.845 1.00 26.26  ? 481  GLY A CA    1 
ATOM   3441 C  C     . GLY A 1 435 ? 15.131  -5.659   -35.400 1.00 31.00  ? 481  GLY A C     1 
ATOM   3442 O  O     . GLY A 1 435 ? 15.405  -4.461   -35.466 1.00 31.48  ? 481  GLY A O     1 
ATOM   3443 N  N     . PHE A 1 436 ? 13.967  -6.166   -35.804 1.00 27.58  ? 482  PHE A N     1 
ATOM   3444 C  CA    . PHE A 1 436 ? 12.922  -5.325   -36.366 1.00 28.23  ? 482  PHE A CA    1 
ATOM   3445 C  C     . PHE A 1 436 ? 12.556  -4.268   -35.335 1.00 33.57  ? 482  PHE A C     1 
ATOM   3446 O  O     . PHE A 1 436 ? 12.382  -4.556   -34.149 1.00 33.44  ? 482  PHE A O     1 
ATOM   3447 C  CB    . PHE A 1 436 ? 11.695  -6.160   -36.730 1.00 28.35  ? 482  PHE A CB    1 
ATOM   3448 C  CG    . PHE A 1 436 ? 10.543  -5.350   -37.252 1.00 27.80  ? 482  PHE A CG    1 
ATOM   3449 C  CD1   . PHE A 1 436 ? 10.521  -4.921   -38.568 1.00 26.86  ? 482  PHE A CD1   1 
ATOM   3450 C  CD2   . PHE A 1 436 ? 9.481   -5.019   -36.427 1.00 28.47  ? 482  PHE A CD2   1 
ATOM   3451 C  CE1   . PHE A 1 436 ? 9.463   -4.175   -39.052 1.00 25.83  ? 482  PHE A CE1   1 
ATOM   3452 C  CE2   . PHE A 1 436 ? 8.419   -4.274   -36.904 1.00 30.16  ? 482  PHE A CE2   1 
ATOM   3453 C  CZ    . PHE A 1 436 ? 8.410   -3.852   -38.219 1.00 24.80  ? 482  PHE A CZ    1 
ATOM   3454 N  N     . GLU A 1 437 ? 12.410  -3.042   -35.816 1.00 28.09  ? 483  GLU A N     1 
ATOM   3455 C  CA    . GLU A 1 437 ? 12.144  -1.886   -34.950 1.00 29.83  ? 483  GLU A CA    1 
ATOM   3456 C  C     . GLU A 1 437 ? 11.272  -0.798   -35.587 1.00 35.40  ? 483  GLU A C     1 
ATOM   3457 O  O     . GLU A 1 437 ? 11.409  -0.472   -36.783 1.00 34.74  ? 483  GLU A O     1 
ATOM   3458 C  CB    . GLU A 1 437 ? 13.438  -1.260   -34.372 1.00 31.44  ? 483  GLU A CB    1 
ATOM   3459 C  CG    . GLU A 1 437 ? 14.386  -0.606   -35.375 1.00 40.59  ? 483  GLU A CG    1 
ATOM   3460 C  CD    . GLU A 1 437 ? 15.722  -0.106   -34.840 1.00 66.06  ? 483  GLU A CD    1 
ATOM   3461 O  OE1   . GLU A 1 437 ? 16.127  -0.501   -33.715 1.00 40.90  ? 483  GLU A OE1   1 
ATOM   3462 O  OE2   . GLU A 1 437 ? 16.350  0.722    -35.545 1.00 54.27  ? 483  GLU A OE2   1 
ATOM   3463 N  N     . ILE A 1 438 ? 10.394  -0.230   -34.738 1.00 33.70  ? 484  ILE A N     1 
ATOM   3464 C  CA    . ILE A 1 438 ? 9.438   0.839    -35.026 1.00 35.09  ? 484  ILE A CA    1 
ATOM   3465 C  C     . ILE A 1 438 ? 9.554   1.929    -33.948 1.00 43.18  ? 484  ILE A C     1 
ATOM   3466 O  O     . ILE A 1 438 ? 9.213   1.688    -32.791 1.00 43.59  ? 484  ILE A O     1 
ATOM   3467 C  CB    . ILE A 1 438 ? 7.977   0.291    -35.111 1.00 37.75  ? 484  ILE A CB    1 
ATOM   3468 C  CG1   . ILE A 1 438 ? 7.815   -0.821   -36.186 1.00 38.37  ? 484  ILE A CG1   1 
ATOM   3469 C  CG2   . ILE A 1 438 ? 6.963   1.431    -35.310 1.00 36.34  ? 484  ILE A CG2   1 
ATOM   3470 C  CD1   . ILE A 1 438 ? 6.385   -1.429   -36.331 1.00 35.82  ? 484  ILE A CD1   1 
ATOM   3471 N  N     . PHE A 1 439 ? 10.027  3.121    -34.333 1.00 42.65  ? 485  PHE A N     1 
ATOM   3472 C  CA    . PHE A 1 439 ? 10.137  4.274    -33.439 1.00 44.11  ? 485  PHE A CA    1 
ATOM   3473 C  C     . PHE A 1 439 ? 9.133   5.352    -33.858 1.00 49.21  ? 485  PHE A C     1 
ATOM   3474 O  O     . PHE A 1 439 ? 8.378   5.135    -34.803 1.00 46.78  ? 485  PHE A O     1 
ATOM   3475 C  CB    . PHE A 1 439 ? 11.537  4.869    -33.515 1.00 46.93  ? 485  PHE A CB    1 
ATOM   3476 C  CG    . PHE A 1 439 ? 12.654  3.933    -33.162 1.00 50.40  ? 485  PHE A CG    1 
ATOM   3477 C  CD1   . PHE A 1 439 ? 12.726  3.358    -31.897 1.00 52.96  ? 485  PHE A CD1   1 
ATOM   3478 C  CD2   . PHE A 1 439 ? 13.678  3.684    -34.062 1.00 54.58  ? 485  PHE A CD2   1 
ATOM   3479 C  CE1   . PHE A 1 439 ? 13.762  2.510    -31.568 1.00 55.06  ? 485  PHE A CE1   1 
ATOM   3480 C  CE2   . PHE A 1 439 ? 14.738  2.858    -33.715 1.00 57.81  ? 485  PHE A CE2   1 
ATOM   3481 C  CZ    . PHE A 1 439 ? 14.771  2.274    -32.475 1.00 55.94  ? 485  PHE A CZ    1 
ATOM   3482 N  N     . GLN A 1 440 ? 9.146   6.516    -33.166 1.00 48.49  ? 486  GLN A N     1 
ATOM   3483 C  CA    . GLN A 1 440 ? 8.327   7.680    -33.510 1.00 49.30  ? 486  GLN A CA    1 
ATOM   3484 C  C     . GLN A 1 440 ? 8.761   8.126    -34.925 1.00 51.90  ? 486  GLN A C     1 
ATOM   3485 O  O     . GLN A 1 440 ? 7.898   8.349    -35.781 1.00 52.52  ? 486  GLN A O     1 
ATOM   3486 C  CB    . GLN A 1 440 ? 8.525   8.818    -32.484 1.00 51.27  ? 486  GLN A CB    1 
ATOM   3487 C  CG    . GLN A 1 440 ? 7.658   10.059   -32.767 1.00 86.91  ? 486  GLN A CG    1 
ATOM   3488 C  CD    . GLN A 1 440 ? 7.762   11.133   -31.708 1.00 120.10 ? 486  GLN A CD    1 
ATOM   3489 O  OE1   . GLN A 1 440 ? 8.837   11.412   -31.155 1.00 119.37 ? 486  GLN A OE1   1 
ATOM   3490 N  NE2   . GLN A 1 440 ? 6.641   11.788   -31.427 1.00 113.01 ? 486  GLN A NE2   1 
ATOM   3491 N  N     . LEU A 1 441 ? 10.093  8.166    -35.174 1.00 45.90  ? 487  LEU A N     1 
ATOM   3492 C  CA    . LEU A 1 441 ? 10.684  8.502    -36.472 1.00 44.94  ? 487  LEU A CA    1 
ATOM   3493 C  C     . LEU A 1 441 ? 11.510  7.346    -37.017 1.00 45.61  ? 487  LEU A C     1 
ATOM   3494 O  O     . LEU A 1 441 ? 12.485  6.918    -36.403 1.00 43.93  ? 487  LEU A O     1 
ATOM   3495 C  CB    . LEU A 1 441 ? 11.517  9.798    -36.457 1.00 45.12  ? 487  LEU A CB    1 
ATOM   3496 C  CG    . LEU A 1 441 ? 11.989  10.277   -37.853 1.00 52.77  ? 487  LEU A CG    1 
ATOM   3497 C  CD1   . LEU A 1 441 ? 12.057  11.820   -37.936 1.00 53.69  ? 487  LEU A CD1   1 
ATOM   3498 C  CD2   . LEU A 1 441 ? 13.345  9.689    -38.235 1.00 56.84  ? 487  LEU A CD2   1 
ATOM   3499 N  N     . ASN A 1 442 ? 11.120  6.849    -38.179 1.00 40.46  ? 488  ASN A N     1 
ATOM   3500 C  CA    . ASN A 1 442 ? 11.848  5.760    -38.795 1.00 39.20  ? 488  ASN A CA    1 
ATOM   3501 C  C     . ASN A 1 442 ? 12.520  6.318    -40.002 1.00 40.54  ? 488  ASN A C     1 
ATOM   3502 O  O     . ASN A 1 442 ? 11.864  6.885    -40.882 1.00 42.21  ? 488  ASN A O     1 
ATOM   3503 C  CB    . ASN A 1 442 ? 10.919  4.590    -39.121 1.00 38.18  ? 488  ASN A CB    1 
ATOM   3504 C  CG    . ASN A 1 442 ? 10.273  4.039    -37.874 1.00 51.44  ? 488  ASN A CG    1 
ATOM   3505 O  OD1   . ASN A 1 442 ? 10.949  3.496    -36.978 1.00 35.35  ? 488  ASN A OD1   1 
ATOM   3506 N  ND2   . ASN A 1 442 ? 8.970   4.272    -37.742 1.00 33.18  ? 488  ASN A ND2   1 
ATOM   3507 N  N     . SER A 1 443 ? 13.828  6.248    -40.018 1.00 32.80  ? 489  SER A N     1 
ATOM   3508 C  CA    . SER A 1 443 ? 14.611  6.750    -41.103 1.00 31.23  ? 489  SER A CA    1 
ATOM   3509 C  C     . SER A 1 443 ? 15.204  5.629    -41.931 1.00 33.18  ? 489  SER A C     1 
ATOM   3510 O  O     . SER A 1 443 ? 14.709  4.550    -41.967 1.00 31.04  ? 489  SER A O     1 
ATOM   3511 C  CB    . SER A 1 443 ? 15.661  7.693    -40.571 1.00 34.81  ? 489  SER A CB    1 
ATOM   3512 O  OG    . SER A 1 443 ? 16.210  8.504    -41.558 1.00 43.34  ? 489  SER A OG    1 
ATOM   3513 N  N     . PHE A 1 444 ? 16.259  5.954    -42.628 1.00 29.32  ? 490  PHE A N     1 
ATOM   3514 C  CA    . PHE A 1 444 ? 16.955  5.063    -43.506 1.00 28.54  ? 490  PHE A CA    1 
ATOM   3515 C  C     . PHE A 1 444 ? 17.567  3.882    -42.775 1.00 32.31  ? 490  PHE A C     1 
ATOM   3516 O  O     . PHE A 1 444 ? 17.666  2.824    -43.286 1.00 32.51  ? 490  PHE A O     1 
ATOM   3517 C  CB    . PHE A 1 444 ? 17.960  5.846    -44.308 1.00 29.80  ? 490  PHE A CB    1 
ATOM   3518 C  CG    . PHE A 1 444 ? 18.616  5.064    -45.364 1.00 31.02  ? 490  PHE A CG    1 
ATOM   3519 C  CD1   . PHE A 1 444 ? 17.912  4.630    -46.440 1.00 32.91  ? 490  PHE A CD1   1 
ATOM   3520 C  CD2   . PHE A 1 444 ? 19.937  4.766    -45.287 1.00 30.92  ? 490  PHE A CD2   1 
ATOM   3521 C  CE1   . PHE A 1 444 ? 18.514  3.905    -47.414 1.00 32.61  ? 490  PHE A CE1   1 
ATOM   3522 C  CE2   . PHE A 1 444 ? 20.556  4.051    -46.276 1.00 33.70  ? 490  PHE A CE2   1 
ATOM   3523 C  CZ    . PHE A 1 444 ? 19.836  3.622    -47.342 1.00 31.54  ? 490  PHE A CZ    1 
ATOM   3524 N  N     . GLU A 1 445 ? 18.026  4.125    -41.577 1.00 31.52  ? 491  GLU A N     1 
ATOM   3525 C  CA    . GLU A 1 445 ? 18.588  3.114    -40.756 1.00 31.20  ? 491  GLU A CA    1 
ATOM   3526 C  C     . GLU A 1 445 ? 17.553  2.049    -40.437 1.00 34.12  ? 491  GLU A C     1 
ATOM   3527 O  O     . GLU A 1 445 ? 17.845  0.897    -40.479 1.00 34.46  ? 491  GLU A O     1 
ATOM   3528 C  CB    . GLU A 1 445 ? 19.092  3.755    -39.483 1.00 32.49  ? 491  GLU A CB    1 
ATOM   3529 C  CG    . GLU A 1 445 ? 20.234  4.730    -39.655 1.00 41.54  ? 491  GLU A CG    1 
ATOM   3530 C  CD    . GLU A 1 445 ? 19.823  6.142    -40.006 1.00 63.65  ? 491  GLU A CD    1 
ATOM   3531 O  OE1   . GLU A 1 445 ? 18.658  6.421    -40.184 1.00 45.88  ? 491  GLU A OE1   1 
ATOM   3532 O  OE2   . GLU A 1 445 ? 20.691  6.983    -40.102 1.00 60.22  ? 491  GLU A OE2   1 
ATOM   3533 N  N     . GLN A 1 446 ? 16.347  2.468    -40.120 1.00 28.20  ? 492  GLN A N     1 
ATOM   3534 C  CA    . GLN A 1 446 ? 15.243  1.594    -39.814 1.00 27.29  ? 492  GLN A CA    1 
ATOM   3535 C  C     . GLN A 1 446 ? 14.802  0.801    -41.004 1.00 33.02  ? 492  GLN A C     1 
ATOM   3536 O  O     . GLN A 1 446 ? 14.458  -0.316   -40.896 1.00 36.56  ? 492  GLN A O     1 
ATOM   3537 C  CB    . GLN A 1 446 ? 14.084  2.361    -39.236 1.00 28.21  ? 492  GLN A CB    1 
ATOM   3538 C  CG    . GLN A 1 446 ? 14.217  2.668    -37.784 1.00 32.57  ? 492  GLN A CG    1 
ATOM   3539 C  CD    . GLN A 1 446 ? 15.322  3.630    -37.483 1.00 42.45  ? 492  GLN A CD    1 
ATOM   3540 O  OE1   . GLN A 1 446 ? 15.432  4.666    -38.076 1.00 38.78  ? 492  GLN A OE1   1 
ATOM   3541 N  NE2   . GLN A 1 446 ? 16.129  3.286    -36.537 1.00 44.37  ? 492  GLN A NE2   1 
ATOM   3542 N  N     . LEU A 1 447 ? 14.794  1.432    -42.145 1.00 29.49  ? 493  LEU A N     1 
ATOM   3543 C  CA    . LEU A 1 447 ? 14.444  0.768    -43.413 1.00 30.44  ? 493  LEU A CA    1 
ATOM   3544 C  C     . LEU A 1 447 ? 15.417  -0.390   -43.731 1.00 38.15  ? 493  LEU A C     1 
ATOM   3545 O  O     . LEU A 1 447 ? 15.004  -1.455   -44.193 1.00 38.57  ? 493  LEU A O     1 
ATOM   3546 C  CB    . LEU A 1 447 ? 14.374  1.764    -44.585 1.00 30.29  ? 493  LEU A CB    1 
ATOM   3547 C  CG    . LEU A 1 447 ? 14.086  1.139    -45.953 1.00 36.58  ? 493  LEU A CG    1 
ATOM   3548 C  CD1   . LEU A 1 447 ? 12.710  0.466    -45.991 1.00 36.94  ? 493  LEU A CD1   1 
ATOM   3549 C  CD2   . LEU A 1 447 ? 14.281  2.134    -47.057 1.00 40.78  ? 493  LEU A CD2   1 
ATOM   3550 N  N     . CYS A 1 448 ? 16.695  -0.154   -43.475 1.00 35.80  ? 494  CYS A N     1 
ATOM   3551 C  CA    . CYS A 1 448 ? 17.777  -1.089   -43.673 1.00 36.54  ? 494  CYS A CA    1 
ATOM   3552 C  C     . CYS A 1 448 ? 17.709  -2.258   -42.688 1.00 34.40  ? 494  CYS A C     1 
ATOM   3553 O  O     . CYS A 1 448 ? 17.911  -3.398   -43.103 1.00 30.48  ? 494  CYS A O     1 
ATOM   3554 C  CB    . CYS A 1 448 ? 19.115  -0.351   -43.611 1.00 38.74  ? 494  CYS A CB    1 
ATOM   3555 S  SG    . CYS A 1 448 ? 19.572  0.466    -45.167 1.00 43.56  ? 494  CYS A SG    1 
ATOM   3556 N  N     . ILE A 1 449 ? 17.376  -1.997   -41.412 1.00 30.75  ? 495  ILE A N     1 
ATOM   3557 C  CA    . ILE A 1 449 ? 17.245  -3.047   -40.385 1.00 30.91  ? 495  ILE A CA    1 
ATOM   3558 C  C     . ILE A 1 449 ? 15.998  -3.922   -40.669 1.00 34.01  ? 495  ILE A C     1 
ATOM   3559 O  O     . ILE A 1 449 ? 16.073  -5.158   -40.668 1.00 34.48  ? 495  ILE A O     1 
ATOM   3560 C  CB    . ILE A 1 449 ? 17.221  -2.428   -38.944 1.00 33.91  ? 495  ILE A CB    1 
ATOM   3561 C  CG1   . ILE A 1 449 ? 18.620  -2.017   -38.495 1.00 33.49  ? 495  ILE A CG1   1 
ATOM   3562 C  CG2   . ILE A 1 449 ? 16.602  -3.360   -37.912 1.00 34.88  ? 495  ILE A CG2   1 
ATOM   3563 C  CD1   . ILE A 1 449 ? 18.547  -0.758   -37.729 1.00 33.08  ? 495  ILE A CD1   1 
ATOM   3564 N  N     . ASN A 1 450 ? 14.860  -3.265   -40.881 1.00 29.23  ? 496  ASN A N     1 
ATOM   3565 C  CA    . ASN A 1 450 ? 13.600  -3.921   -41.141 1.00 29.06  ? 496  ASN A CA    1 
ATOM   3566 C  C     . ASN A 1 450 ? 13.653  -4.786   -42.414 1.00 34.81  ? 496  ASN A C     1 
ATOM   3567 O  O     . ASN A 1 450 ? 13.133  -5.894   -42.390 1.00 32.29  ? 496  ASN A O     1 
ATOM   3568 C  CB    . ASN A 1 450 ? 12.469  -2.899   -41.129 1.00 21.65  ? 496  ASN A CB    1 
ATOM   3569 C  CG    . ASN A 1 450 ? 12.298  -2.248   -39.782 1.00 35.44  ? 496  ASN A CG    1 
ATOM   3570 O  OD1   . ASN A 1 450 ? 12.753  -2.786   -38.767 1.00 26.92  ? 496  ASN A OD1   1 
ATOM   3571 N  ND2   . ASN A 1 450 ? 11.622  -1.084   -39.734 1.00 26.60  ? 496  ASN A ND2   1 
ATOM   3572 N  N     . TYR A 1 451 ? 14.371  -4.332   -43.468 1.00 34.19  ? 497  TYR A N     1 
ATOM   3573 C  CA    . TYR A 1 451 ? 14.612  -5.083   -44.705 1.00 34.06  ? 497  TYR A CA    1 
ATOM   3574 C  C     . TYR A 1 451 ? 15.385  -6.398   -44.387 1.00 37.62  ? 497  TYR A C     1 
ATOM   3575 O  O     . TYR A 1 451 ? 14.988  -7.457   -44.842 1.00 37.70  ? 497  TYR A O     1 
ATOM   3576 C  CB    . TYR A 1 451 ? 15.383  -4.198   -45.719 1.00 36.10  ? 497  TYR A CB    1 
ATOM   3577 C  CG    . TYR A 1 451 ? 16.075  -4.920   -46.866 1.00 40.06  ? 497  TYR A CG    1 
ATOM   3578 C  CD1   . TYR A 1 451 ? 15.371  -5.773   -47.718 1.00 42.03  ? 497  TYR A CD1   1 
ATOM   3579 C  CD2   . TYR A 1 451 ? 17.420  -4.696   -47.143 1.00 41.96  ? 497  TYR A CD2   1 
ATOM   3580 C  CE1   . TYR A 1 451 ? 15.999  -6.407   -48.790 1.00 43.40  ? 497  TYR A CE1   1 
ATOM   3581 C  CE2   . TYR A 1 451 ? 18.058  -5.324   -48.210 1.00 43.03  ? 497  TYR A CE2   1 
ATOM   3582 C  CZ    . TYR A 1 451 ? 17.347  -6.184   -49.026 1.00 52.03  ? 497  TYR A CZ    1 
ATOM   3583 O  OH    . TYR A 1 451 ? 18.001  -6.804   -50.073 1.00 56.44  ? 497  TYR A OH    1 
ATOM   3584 N  N     . THR A 1 452 ? 16.439  -6.327   -43.574 1.00 33.00  ? 498  THR A N     1 
ATOM   3585 C  CA    . THR A 1 452 ? 17.241  -7.483   -43.132 1.00 32.09  ? 498  THR A CA    1 
ATOM   3586 C  C     . THR A 1 452 ? 16.410  -8.442   -42.279 1.00 34.93  ? 498  THR A C     1 
ATOM   3587 O  O     . THR A 1 452 ? 16.689  -9.615   -42.273 1.00 34.22  ? 498  THR A O     1 
ATOM   3588 C  CB    . THR A 1 452 ? 18.417  -6.972   -42.299 1.00 31.17  ? 498  THR A CB    1 
ATOM   3589 O  OG1   . THR A 1 452 ? 18.999  -5.881   -42.984 1.00 32.89  ? 498  THR A OG1   1 
ATOM   3590 C  CG2   . THR A 1 452 ? 19.463  -8.031   -42.022 1.00 26.99  ? 498  THR A CG2   1 
ATOM   3591 N  N     . ASN A 1 453 ? 15.444  -7.932   -41.483 1.00 33.41  ? 499  ASN A N     1 
ATOM   3592 C  CA    . ASN A 1 453 ? 14.607  -8.816   -40.669 1.00 31.20  ? 499  ASN A CA    1 
ATOM   3593 C  C     . ASN A 1 453 ? 13.636  -9.522   -41.602 1.00 31.59  ? 499  ASN A C     1 
ATOM   3594 O  O     . ASN A 1 453 ? 13.479  -10.728  -41.484 1.00 29.86  ? 499  ASN A O     1 
ATOM   3595 C  CB    . ASN A 1 453 ? 13.909  -8.078   -39.555 1.00 23.66  ? 499  ASN A CB    1 
ATOM   3596 C  CG    . ASN A 1 453 ? 14.791  -7.847   -38.361 1.00 42.88  ? 499  ASN A CG    1 
ATOM   3597 O  OD1   . ASN A 1 453 ? 14.657  -8.506   -37.311 1.00 33.71  ? 499  ASN A OD1   1 
ATOM   3598 N  ND2   . ASN A 1 453 ? 15.715  -6.898   -38.490 1.00 31.16  ? 499  ASN A ND2   1 
ATOM   3599 N  N     . GLU A 1 454 ? 13.108  -8.797   -42.611 1.00 27.16  ? 500  GLU A N     1 
ATOM   3600 C  CA    . GLU A 1 454 ? 12.223  -9.361   -43.615 1.00 28.00  ? 500  GLU A CA    1 
ATOM   3601 C  C     . GLU A 1 454 ? 12.917  -10.569  -44.301 1.00 29.87  ? 500  GLU A C     1 
ATOM   3602 O  O     . GLU A 1 454 ? 12.337  -11.664  -44.362 1.00 30.32  ? 500  GLU A O     1 
ATOM   3603 C  CB    . GLU A 1 454 ? 11.804  -8.291   -44.648 1.00 29.50  ? 500  GLU A CB    1 
ATOM   3604 C  CG    . GLU A 1 454 ? 10.550  -8.675   -45.435 1.00 29.75  ? 500  GLU A CG    1 
ATOM   3605 C  CD    . GLU A 1 454 ? 9.275   -8.142   -44.815 1.00 43.33  ? 500  GLU A CD    1 
ATOM   3606 O  OE1   . GLU A 1 454 ? 9.376   -7.266   -43.928 1.00 35.66  ? 500  GLU A OE1   1 
ATOM   3607 O  OE2   . GLU A 1 454 ? 8.178   -8.614   -45.188 1.00 34.80  ? 500  GLU A OE2   1 
ATOM   3608 N  N     . LYS A 1 455 ? 14.163  -10.360  -44.757 1.00 23.98  ? 501  LYS A N     1 
ATOM   3609 C  CA    . LYS A 1 455 ? 15.006  -11.363  -45.435 1.00 25.28  ? 501  LYS A CA    1 
ATOM   3610 C  C     . LYS A 1 455 ? 15.306  -12.595  -44.599 1.00 28.42  ? 501  LYS A C     1 
ATOM   3611 O  O     . LYS A 1 455 ? 15.420  -13.665  -45.157 1.00 29.19  ? 501  LYS A O     1 
ATOM   3612 C  CB    . LYS A 1 455 ? 16.324  -10.741  -45.938 1.00 29.37  ? 501  LYS A CB    1 
ATOM   3613 C  CG    . LYS A 1 455 ? 16.156  -9.581   -46.927 1.00 42.59  ? 501  LYS A CG    1 
ATOM   3614 C  CD    . LYS A 1 455 ? 16.003  -10.051  -48.368 1.00 48.87  ? 501  LYS A CD    1 
ATOM   3615 C  CE    . LYS A 1 455 ? 17.315  -10.403  -49.049 1.00 35.24  ? 501  LYS A CE    1 
ATOM   3616 N  NZ    . LYS A 1 455 ? 17.072  -11.224  -50.271 1.00 43.44  ? 501  LYS A NZ    1 
ATOM   3617 N  N     . LEU A 1 456 ? 15.519  -12.441  -43.289 1.00 27.58  ? 502  LEU A N     1 
ATOM   3618 C  CA    . LEU A 1 456 ? 15.789  -13.565  -42.401 1.00 27.74  ? 502  LEU A CA    1 
ATOM   3619 C  C     . LEU A 1 456 ? 14.505  -14.355  -42.200 1.00 34.82  ? 502  LEU A C     1 
ATOM   3620 O  O     . LEU A 1 456 ? 14.562  -15.578  -42.215 1.00 36.39  ? 502  LEU A O     1 
ATOM   3621 C  CB    . LEU A 1 456 ? 16.331  -13.069  -41.053 1.00 27.96  ? 502  LEU A CB    1 
ATOM   3622 C  CG    . LEU A 1 456 ? 16.704  -14.118  -40.005 1.00 31.88  ? 502  LEU A CG    1 
ATOM   3623 C  CD1   . LEU A 1 456 ? 17.771  -15.124  -40.533 1.00 31.32  ? 502  LEU A CD1   1 
ATOM   3624 C  CD2   . LEU A 1 456 ? 17.260  -13.418  -38.791 1.00 37.67  ? 502  LEU A CD2   1 
ATOM   3625 N  N     . GLN A 1 457 ? 13.355  -13.673  -42.028 1.00 31.58  ? 503  GLN A N     1 
ATOM   3626 C  CA    . GLN A 1 457 ? 12.065  -14.345  -41.890 1.00 31.24  ? 503  GLN A CA    1 
ATOM   3627 C  C     . GLN A 1 457 ? 11.774  -15.167  -43.125 1.00 32.79  ? 503  GLN A C     1 
ATOM   3628 O  O     . GLN A 1 457 ? 11.299  -16.296  -43.002 1.00 33.53  ? 503  GLN A O     1 
ATOM   3629 C  CB    . GLN A 1 457 ? 10.914  -13.346  -41.633 1.00 32.05  ? 503  GLN A CB    1 
ATOM   3630 C  CG    . GLN A 1 457 ? 9.521   -14.015  -41.466 1.00 29.10  ? 503  GLN A CG    1 
ATOM   3631 C  CD    . GLN A 1 457 ? 9.477   -15.177  -40.492 1.00 33.28  ? 503  GLN A CD    1 
ATOM   3632 O  OE1   . GLN A 1 457 ? 9.850   -15.070  -39.338 1.00 34.94  ? 503  GLN A OE1   1 
ATOM   3633 N  NE2   . GLN A 1 457 ? 8.945   -16.295  -40.905 1.00 25.69  ? 503  GLN A NE2   1 
ATOM   3634 N  N     . GLN A 1 458 ? 12.107  -14.620  -44.311 1.00 27.77  ? 504  GLN A N     1 
ATOM   3635 C  CA    . GLN A 1 458 ? 11.905  -15.304  -45.583 1.00 27.74  ? 504  GLN A CA    1 
ATOM   3636 C  C     . GLN A 1 458 ? 12.867  -16.495  -45.683 1.00 31.03  ? 504  GLN A C     1 
ATOM   3637 O  O     . GLN A 1 458 ? 12.495  -17.498  -46.256 1.00 28.12  ? 504  GLN A O     1 
ATOM   3638 C  CB    . GLN A 1 458 ? 12.079  -14.328  -46.749 1.00 29.48  ? 504  GLN A CB    1 
ATOM   3639 C  CG    . GLN A 1 458 ? 11.789  -14.886  -48.165 1.00 34.00  ? 504  GLN A CG    1 
ATOM   3640 C  CD    . GLN A 1 458 ? 10.475  -15.622  -48.359 1.00 46.94  ? 504  GLN A CD    1 
ATOM   3641 O  OE1   . GLN A 1 458 ? 9.456   -15.356  -47.722 1.00 35.21  ? 504  GLN A OE1   1 
ATOM   3642 N  NE2   . GLN A 1 458 ? 10.494  -16.619  -49.228 1.00 47.55  ? 504  GLN A NE2   1 
ATOM   3643 N  N     . LEU A 1 459 ? 14.069  -16.401  -45.060 1.00 29.23  ? 505  LEU A N     1 
ATOM   3644 C  CA    . LEU A 1 459 ? 15.014  -17.512  -45.012 1.00 28.74  ? 505  LEU A CA    1 
ATOM   3645 C  C     . LEU A 1 459 ? 14.421  -18.611  -44.162 1.00 33.51  ? 505  LEU A C     1 
ATOM   3646 O  O     . LEU A 1 459 ? 14.633  -19.771  -44.458 1.00 34.23  ? 505  LEU A O     1 
ATOM   3647 C  CB    . LEU A 1 459 ? 16.391  -17.092  -44.483 1.00 27.42  ? 505  LEU A CB    1 
ATOM   3648 C  CG    . LEU A 1 459 ? 17.473  -18.184  -44.483 1.00 30.74  ? 505  LEU A CG    1 
ATOM   3649 C  CD1   . LEU A 1 459 ? 17.761  -18.664  -45.890 1.00 30.89  ? 505  LEU A CD1   1 
ATOM   3650 C  CD2   . LEU A 1 459 ? 18.796  -17.664  -43.827 1.00 32.50  ? 505  LEU A CD2   1 
ATOM   3651 N  N     . PHE A 1 460 ? 13.653  -18.261  -43.132 1.00 31.26  ? 506  PHE A N     1 
ATOM   3652 C  CA    . PHE A 1 460 ? 12.985  -19.286  -42.344 1.00 30.75  ? 506  PHE A CA    1 
ATOM   3653 C  C     . PHE A 1 460 ? 11.870  -19.957  -43.227 1.00 34.25  ? 506  PHE A C     1 
ATOM   3654 O  O     . PHE A 1 460 ? 11.794  -21.190  -43.309 1.00 31.96  ? 506  PHE A O     1 
ATOM   3655 C  CB    . PHE A 1 460 ? 12.449  -18.660  -41.054 1.00 31.06  ? 506  PHE A CB    1 
ATOM   3656 C  CG    . PHE A 1 460 ? 11.552  -19.566  -40.249 1.00 31.12  ? 506  PHE A CG    1 
ATOM   3657 C  CD1   . PHE A 1 460 ? 12.085  -20.471  -39.347 1.00 31.81  ? 506  PHE A CD1   1 
ATOM   3658 C  CD2   . PHE A 1 460 ? 10.169  -19.466  -40.347 1.00 32.77  ? 506  PHE A CD2   1 
ATOM   3659 C  CE1   . PHE A 1 460 ? 11.245  -21.275  -38.566 1.00 33.17  ? 506  PHE A CE1   1 
ATOM   3660 C  CE2   . PHE A 1 460 ? 9.331   -20.294  -39.599 1.00 35.12  ? 506  PHE A CE2   1 
ATOM   3661 C  CZ    . PHE A 1 460 ? 9.870   -21.190  -38.712 1.00 32.96  ? 506  PHE A CZ    1 
ATOM   3662 N  N     . ASN A 1 461 ? 11.059  -19.127  -43.931 1.00 32.00  ? 507  ASN A N     1 
ATOM   3663 C  CA    . ASN A 1 461 ? 9.988   -19.595  -44.815 1.00 32.04  ? 507  ASN A CA    1 
ATOM   3664 C  C     . ASN A 1 461 ? 10.514  -20.529  -45.867 1.00 37.68  ? 507  ASN A C     1 
ATOM   3665 O  O     . ASN A 1 461 ? 9.982   -21.621  -46.015 1.00 38.78  ? 507  ASN A O     1 
ATOM   3666 C  CB    . ASN A 1 461 ? 9.216   -18.429  -45.457 1.00 30.07  ? 507  ASN A CB    1 
ATOM   3667 C  CG    . ASN A 1 461 ? 8.504   -17.514  -44.494 1.00 43.48  ? 507  ASN A CG    1 
ATOM   3668 O  OD1   . ASN A 1 461 ? 8.343   -17.805  -43.299 1.00 37.95  ? 507  ASN A OD1   1 
ATOM   3669 N  ND2   . ASN A 1 461 ? 8.047   -16.382  -45.004 1.00 27.68  ? 507  ASN A ND2   1 
ATOM   3670 N  N     . HIS A 1 462 ? 11.602  -20.138  -46.541 1.00 34.80  ? 508  HIS A N     1 
ATOM   3671 C  CA    . HIS A 1 462 ? 12.260  -20.916  -47.577 1.00 36.06  ? 508  HIS A CA    1 
ATOM   3672 C  C     . HIS A 1 462 ? 12.817  -22.256  -47.031 1.00 41.56  ? 508  HIS A C     1 
ATOM   3673 O  O     . HIS A 1 462 ? 12.621  -23.296  -47.650 1.00 40.52  ? 508  HIS A O     1 
ATOM   3674 C  CB    . HIS A 1 462 ? 13.338  -20.053  -48.243 1.00 37.33  ? 508  HIS A CB    1 
ATOM   3675 C  CG    . HIS A 1 462 ? 14.020  -20.693  -49.404 1.00 41.28  ? 508  HIS A CG    1 
ATOM   3676 N  ND1   . HIS A 1 462 ? 13.366  -20.882  -50.611 1.00 43.26  ? 508  HIS A ND1   1 
ATOM   3677 C  CD2   . HIS A 1 462 ? 15.306  -21.105  -49.530 1.00 43.62  ? 508  HIS A CD2   1 
ATOM   3678 C  CE1   . HIS A 1 462 ? 14.252  -21.453  -51.409 1.00 42.68  ? 508  HIS A CE1   1 
ATOM   3679 N  NE2   . HIS A 1 462 ? 15.435  -21.602  -50.807 1.00 43.20  ? 508  HIS A NE2   1 
ATOM   3680 N  N     . THR A 1 463 ? 13.440  -22.238  -45.846 1.00 39.99  ? 509  THR A N     1 
ATOM   3681 C  CA    . THR A 1 463 ? 14.002  -23.442  -45.211 1.00 39.76  ? 509  THR A CA    1 
ATOM   3682 C  C     . THR A 1 463 ? 12.929  -24.410  -44.684 1.00 41.55  ? 509  THR A C     1 
ATOM   3683 O  O     . THR A 1 463 ? 13.097  -25.608  -44.804 1.00 41.21  ? 509  THR A O     1 
ATOM   3684 C  CB    . THR A 1 463 ? 15.003  -23.028  -44.118 1.00 45.12  ? 509  THR A CB    1 
ATOM   3685 O  OG1   . THR A 1 463 ? 15.943  -22.151  -44.720 1.00 42.31  ? 509  THR A OG1   1 
ATOM   3686 C  CG2   . THR A 1 463 ? 15.729  -24.214  -43.497 1.00 42.54  ? 509  THR A CG2   1 
ATOM   3687 N  N     . MET A 1 464 ? 11.867  -23.897  -44.075 1.00 38.32  ? 510  MET A N     1 
ATOM   3688 C  CA    . MET A 1 464 ? 10.810  -24.713  -43.479 1.00 38.11  ? 510  MET A CA    1 
ATOM   3689 C  C     . MET A 1 464 ? 9.747   -25.210  -44.445 1.00 40.69  ? 510  MET A C     1 
ATOM   3690 O  O     . MET A 1 464 ? 9.192   -26.299  -44.233 1.00 37.82  ? 510  MET A O     1 
ATOM   3691 C  CB    . MET A 1 464 ? 10.127  -23.967  -42.339 1.00 40.18  ? 510  MET A CB    1 
ATOM   3692 C  CG    . MET A 1 464 ? 11.079  -23.579  -41.233 1.00 44.90  ? 510  MET A CG    1 
ATOM   3693 S  SD    . MET A 1 464 ? 11.716  -24.989  -40.319 1.00 50.09  ? 510  MET A SD    1 
ATOM   3694 C  CE    . MET A 1 464 ? 10.162  -25.580  -39.558 1.00 46.78  ? 510  MET A CE    1 
ATOM   3695 N  N     . PHE A 1 465 ? 9.408   -24.399  -45.463 1.00 37.32  ? 511  PHE A N     1 
ATOM   3696 C  CA    . PHE A 1 465 ? 8.303   -24.769  -46.340 1.00 36.41  ? 511  PHE A CA    1 
ATOM   3697 C  C     . PHE A 1 465 ? 8.677   -25.018  -47.812 1.00 40.54  ? 511  PHE A C     1 
ATOM   3698 O  O     . PHE A 1 465 ? 8.002   -25.837  -48.456 1.00 41.01  ? 511  PHE A O     1 
ATOM   3699 C  CB    . PHE A 1 465 ? 7.170   -23.727  -46.230 1.00 37.37  ? 511  PHE A CB    1 
ATOM   3700 C  CG    . PHE A 1 465 ? 6.846   -23.279  -44.817 1.00 38.63  ? 511  PHE A CG    1 
ATOM   3701 C  CD1   . PHE A 1 465 ? 6.186   -24.124  -43.933 1.00 40.56  ? 511  PHE A CD1   1 
ATOM   3702 C  CD2   . PHE A 1 465 ? 7.259   -22.035  -44.351 1.00 40.41  ? 511  PHE A CD2   1 
ATOM   3703 C  CE1   . PHE A 1 465 ? 5.940   -23.729  -42.617 1.00 41.09  ? 511  PHE A CE1   1 
ATOM   3704 C  CE2   . PHE A 1 465 ? 7.021   -21.647  -43.029 1.00 42.53  ? 511  PHE A CE2   1 
ATOM   3705 C  CZ    . PHE A 1 465 ? 6.357   -22.495  -42.175 1.00 40.35  ? 511  PHE A CZ    1 
ATOM   3706 N  N     . VAL A 1 466 ? 9.676   -24.305  -48.365 1.00 36.08  ? 512  VAL A N     1 
ATOM   3707 C  CA    . VAL A 1 466 ? 10.054  -24.480  -49.779 1.00 37.65  ? 512  VAL A CA    1 
ATOM   3708 C  C     . VAL A 1 466 ? 11.038  -25.649  -49.916 1.00 42.82  ? 512  VAL A C     1 
ATOM   3709 O  O     . VAL A 1 466 ? 10.697  -26.672  -50.536 1.00 42.41  ? 512  VAL A O     1 
ATOM   3710 C  CB    . VAL A 1 466 ? 10.533  -23.170  -50.459 1.00 43.17  ? 512  VAL A CB    1 
ATOM   3711 C  CG1   . VAL A 1 466 ? 11.032  -23.434  -51.867 1.00 43.46  ? 512  VAL A CG1   1 
ATOM   3712 C  CG2   . VAL A 1 466 ? 9.422   -22.114  -50.472 1.00 43.07  ? 512  VAL A CG2   1 
ATOM   3713 N  N     . LEU A 1 467 ? 12.221  -25.524  -49.277 1.00 39.68  ? 513  LEU A N     1 
ATOM   3714 C  CA    . LEU A 1 467 ? 13.249  -26.565  -49.247 1.00 40.33  ? 513  LEU A CA    1 
ATOM   3715 C  C     . LEU A 1 467 ? 12.709  -27.919  -48.764 1.00 43.97  ? 513  LEU A C     1 
ATOM   3716 O  O     . LEU A 1 467 ? 13.054  -28.937  -49.368 1.00 42.09  ? 513  LEU A O     1 
ATOM   3717 C  CB    . LEU A 1 467 ? 14.460  -26.145  -48.404 1.00 40.92  ? 513  LEU A CB    1 
ATOM   3718 C  CG    . LEU A 1 467 ? 15.352  -25.052  -49.007 1.00 46.58  ? 513  LEU A CG    1 
ATOM   3719 C  CD1   . LEU A 1 467 ? 16.548  -24.760  -48.099 1.00 46.15  ? 513  LEU A CD1   1 
ATOM   3720 C  CD2   . LEU A 1 467 ? 15.863  -25.451  -50.407 1.00 48.76  ? 513  LEU A CD2   1 
ATOM   3721 N  N     . GLU A 1 468 ? 11.848  -27.927  -47.700 1.00 41.05  ? 514  GLU A N     1 
ATOM   3722 C  CA    . GLU A 1 468 ? 11.267  -29.159  -47.172 1.00 41.30  ? 514  GLU A CA    1 
ATOM   3723 C  C     . GLU A 1 468 ? 10.474  -29.935  -48.268 1.00 46.66  ? 514  GLU A C     1 
ATOM   3724 O  O     . GLU A 1 468 ? 10.814  -31.079  -48.603 1.00 46.27  ? 514  GLU A O     1 
ATOM   3725 C  CB    . GLU A 1 468 ? 10.407  -28.882  -45.928 1.00 42.35  ? 514  GLU A CB    1 
ATOM   3726 C  CG    . GLU A 1 468 ? 10.013  -30.144  -45.159 1.00 51.10  ? 514  GLU A CG    1 
ATOM   3727 C  CD    . GLU A 1 468 ? 11.108  -30.970  -44.495 1.00 64.63  ? 514  GLU A CD    1 
ATOM   3728 O  OE1   . GLU A 1 468 ? 12.285  -30.544  -44.492 1.00 44.53  ? 514  GLU A OE1   1 
ATOM   3729 O  OE2   . GLU A 1 468 ? 10.776  -32.052  -43.961 1.00 54.55  ? 514  GLU A OE2   1 
ATOM   3730 N  N     . GLN A 1 469 ? 9.497   -29.251  -48.884 1.00 42.39  ? 515  GLN A N     1 
ATOM   3731 C  CA    . GLN A 1 469 ? 8.636   -29.786  -49.913 1.00 41.31  ? 515  GLN A CA    1 
ATOM   3732 C  C     . GLN A 1 469 ? 9.366   -30.080  -51.222 1.00 46.71  ? 515  GLN A C     1 
ATOM   3733 O  O     . GLN A 1 469 ? 9.043   -31.095  -51.864 1.00 47.52  ? 515  GLN A O     1 
ATOM   3734 C  CB    . GLN A 1 469 ? 7.425   -28.887  -50.104 1.00 41.61  ? 515  GLN A CB    1 
ATOM   3735 C  CG    . GLN A 1 469 ? 6.580   -28.854  -48.841 1.00 35.95  ? 515  GLN A CG    1 
ATOM   3736 C  CD    . GLN A 1 469 ? 5.319   -28.092  -49.048 1.00 48.95  ? 515  GLN A CD    1 
ATOM   3737 O  OE1   . GLN A 1 469 ? 4.264   -28.670  -49.319 1.00 43.80  ? 515  GLN A OE1   1 
ATOM   3738 N  NE2   . GLN A 1 469 ? 5.394   -26.775  -48.911 1.00 40.04  ? 515  GLN A NE2   1 
ATOM   3739 N  N     . GLU A 1 470 ? 10.367  -29.251  -51.609 1.00 41.63  ? 516  GLU A N     1 
ATOM   3740 C  CA    . GLU A 1 470 ? 11.161  -29.506  -52.838 1.00 40.14  ? 516  GLU A CA    1 
ATOM   3741 C  C     . GLU A 1 470 ? 11.972  -30.785  -52.727 1.00 43.95  ? 516  GLU A C     1 
ATOM   3742 O  O     . GLU A 1 470 ? 12.243  -31.430  -53.744 1.00 45.91  ? 516  GLU A O     1 
ATOM   3743 C  CB    . GLU A 1 470 ? 12.105  -28.347  -53.169 1.00 40.91  ? 516  GLU A CB    1 
ATOM   3744 C  CG    . GLU A 1 470 ? 11.441  -27.168  -53.852 1.00 52.20  ? 516  GLU A CG    1 
ATOM   3745 C  CD    . GLU A 1 470 ? 12.364  -25.998  -54.151 1.00 78.90  ? 516  GLU A CD    1 
ATOM   3746 O  OE1   . GLU A 1 470 ? 13.553  -26.038  -53.754 1.00 71.03  ? 516  GLU A OE1   1 
ATOM   3747 O  OE2   . GLU A 1 470 ? 11.886  -25.031  -54.787 1.00 73.97  ? 516  GLU A OE2   1 
ATOM   3748 N  N     . GLU A 1 471 ? 12.375  -31.139  -51.500 1.00 38.91  ? 517  GLU A N     1 
ATOM   3749 C  CA    . GLU A 1 471 ? 13.167  -32.334  -51.210 1.00 39.00  ? 517  GLU A CA    1 
ATOM   3750 C  C     . GLU A 1 471 ? 12.305  -33.581  -51.391 1.00 41.90  ? 517  GLU A C     1 
ATOM   3751 O  O     . GLU A 1 471 ? 12.810  -34.616  -51.835 1.00 35.92  ? 517  GLU A O     1 
ATOM   3752 C  CB    . GLU A 1 471 ? 13.744  -32.251  -49.777 1.00 40.83  ? 517  GLU A CB    1 
ATOM   3753 C  CG    . GLU A 1 471 ? 14.695  -33.367  -49.360 1.00 47.87  ? 517  GLU A CG    1 
ATOM   3754 C  CD    . GLU A 1 471 ? 15.844  -33.745  -50.278 1.00 62.59  ? 517  GLU A CD    1 
ATOM   3755 O  OE1   . GLU A 1 471 ? 16.128  -33.011  -51.254 1.00 50.62  ? 517  GLU A OE1   1 
ATOM   3756 O  OE2   . GLU A 1 471 ? 16.460  -34.803  -50.016 1.00 51.87  ? 517  GLU A OE2   1 
ATOM   3757 N  N     . TYR A 1 472 ? 10.991  -33.466  -51.032 1.00 41.54  ? 518  TYR A N     1 
ATOM   3758 C  CA    . TYR A 1 472 ? 10.035  -34.551  -51.186 1.00 42.58  ? 518  TYR A CA    1 
ATOM   3759 C  C     . TYR A 1 472 ? 9.784   -34.819  -52.685 1.00 49.67  ? 518  TYR A C     1 
ATOM   3760 O  O     . TYR A 1 472 ? 9.755   -35.987  -53.095 1.00 48.79  ? 518  TYR A O     1 
ATOM   3761 C  CB    . TYR A 1 472 ? 8.712   -34.229  -50.493 1.00 43.18  ? 518  TYR A CB    1 
ATOM   3762 C  CG    . TYR A 1 472 ? 8.744   -33.979  -49.000 1.00 42.91  ? 518  TYR A CG    1 
ATOM   3763 C  CD1   . TYR A 1 472 ? 9.622   -34.674  -48.166 1.00 44.48  ? 518  TYR A CD1   1 
ATOM   3764 C  CD2   . TYR A 1 472 ? 7.809   -33.142  -48.403 1.00 42.77  ? 518  TYR A CD2   1 
ATOM   3765 C  CE1   . TYR A 1 472 ? 9.628   -34.464  -46.778 1.00 43.38  ? 518  TYR A CE1   1 
ATOM   3766 C  CE2   . TYR A 1 472 ? 7.791   -32.940  -47.021 1.00 42.84  ? 518  TYR A CE2   1 
ATOM   3767 C  CZ    . TYR A 1 472 ? 8.689   -33.613  -46.212 1.00 45.79  ? 518  TYR A CZ    1 
ATOM   3768 O  OH    . TYR A 1 472 ? 8.611   -33.400  -44.859 1.00 47.80  ? 518  TYR A OH    1 
ATOM   3769 N  N     . GLN A 1 473 ? 9.621   -33.733  -53.496 1.00 48.01  ? 519  GLN A N     1 
ATOM   3770 C  CA    . GLN A 1 473 ? 9.430   -33.820  -54.953 1.00 48.45  ? 519  GLN A CA    1 
ATOM   3771 C  C     . GLN A 1 473 ? 10.654  -34.471  -55.597 1.00 51.33  ? 519  GLN A C     1 
ATOM   3772 O  O     . GLN A 1 473 ? 10.501  -35.372  -56.403 1.00 50.39  ? 519  GLN A O     1 
ATOM   3773 C  CB    . GLN A 1 473 ? 9.159   -32.433  -55.567 1.00 50.45  ? 519  GLN A CB    1 
ATOM   3774 C  CG    . GLN A 1 473 ? 8.894   -32.430  -57.081 1.00 83.43  ? 519  GLN A CG    1 
ATOM   3775 C  CD    . GLN A 1 473 ? 7.616   -33.138  -57.474 1.00 122.46 ? 519  GLN A CD    1 
ATOM   3776 O  OE1   . GLN A 1 473 ? 6.521   -32.834  -56.981 1.00 122.07 ? 519  GLN A OE1   1 
ATOM   3777 N  NE2   . GLN A 1 473 ? 7.727   -34.089  -58.397 1.00 120.37 ? 519  GLN A NE2   1 
ATOM   3778 N  N     . ARG A 1 474 ? 11.852  -34.052  -55.177 1.00 48.69  ? 520  ARG A N     1 
ATOM   3779 C  CA    . ARG A 1 474 ? 13.146  -34.547  -55.634 1.00 48.98  ? 520  ARG A CA    1 
ATOM   3780 C  C     . ARG A 1 474 ? 13.387  -36.021  -55.266 1.00 53.50  ? 520  ARG A C     1 
ATOM   3781 O  O     . ARG A 1 474 ? 14.256  -36.649  -55.857 1.00 53.78  ? 520  ARG A O     1 
ATOM   3782 C  CB    . ARG A 1 474 ? 14.266  -33.659  -55.085 1.00 50.24  ? 520  ARG A CB    1 
ATOM   3783 C  CG    . ARG A 1 474 ? 15.464  -33.572  -56.004 1.00 63.49  ? 520  ARG A CG    1 
ATOM   3784 C  CD    . ARG A 1 474 ? 16.138  -32.225  -55.956 1.00 74.09  ? 520  ARG A CD    1 
ATOM   3785 N  NE    . ARG A 1 474 ? 17.105  -32.129  -54.865 1.00 75.30  ? 520  ARG A NE    1 
ATOM   3786 C  CZ    . ARG A 1 474 ? 17.008  -31.266  -53.862 1.00 75.94  ? 520  ARG A CZ    1 
ATOM   3787 N  NH1   . ARG A 1 474 ? 15.994  -30.417  -53.802 1.00 43.59  ? 520  ARG A NH1   1 
ATOM   3788 N  NH2   . ARG A 1 474 ? 17.937  -31.242  -52.914 1.00 66.87  ? 520  ARG A NH2   1 
ATOM   3789 N  N     . GLU A 1 475 ? 12.616  -36.583  -54.329 1.00 49.43  ? 521  GLU A N     1 
ATOM   3790 C  CA    . GLU A 1 475 ? 12.813  -37.976  -53.946 1.00 48.80  ? 521  GLU A CA    1 
ATOM   3791 C  C     . GLU A 1 475 ? 11.653  -38.890  -54.388 1.00 52.48  ? 521  GLU A C     1 
ATOM   3792 O  O     . GLU A 1 475 ? 11.621  -40.056  -54.003 1.00 50.73  ? 521  GLU A O     1 
ATOM   3793 C  CB    . GLU A 1 475 ? 13.114  -38.086  -52.443 1.00 49.51  ? 521  GLU A CB    1 
ATOM   3794 C  CG    . GLU A 1 475 ? 14.551  -37.742  -52.115 1.00 53.12  ? 521  GLU A CG    1 
ATOM   3795 C  CD    . GLU A 1 475 ? 15.534  -38.896  -52.155 1.00 66.32  ? 521  GLU A CD    1 
ATOM   3796 O  OE1   . GLU A 1 475 ? 15.171  -40.006  -51.705 1.00 48.24  ? 521  GLU A OE1   1 
ATOM   3797 O  OE2   . GLU A 1 475 ? 16.695  -38.671  -52.568 1.00 57.22  ? 521  GLU A OE2   1 
ATOM   3798 N  N     . GLY A 1 476 ? 10.738  -38.337  -55.198 1.00 50.64  ? 522  GLY A N     1 
ATOM   3799 C  CA    . GLY A 1 476 ? 9.576   -39.003  -55.778 1.00 51.17  ? 522  GLY A CA    1 
ATOM   3800 C  C     . GLY A 1 476 ? 8.492   -39.459  -54.827 1.00 59.69  ? 522  GLY A C     1 
ATOM   3801 O  O     . GLY A 1 476 ? 7.651   -40.283  -55.198 1.00 61.19  ? 522  GLY A O     1 
ATOM   3802 N  N     . ILE A 1 477 ? 8.497   -38.923  -53.609 1.00 58.20  ? 523  ILE A N     1 
ATOM   3803 C  CA    . ILE A 1 477 ? 7.566   -39.228  -52.532 1.00 59.63  ? 523  ILE A CA    1 
ATOM   3804 C  C     . ILE A 1 477 ? 6.129   -38.762  -52.850 1.00 65.32  ? 523  ILE A C     1 
ATOM   3805 O  O     . ILE A 1 477 ? 5.962   -37.638  -53.337 1.00 65.40  ? 523  ILE A O     1 
ATOM   3806 C  CB    . ILE A 1 477 ? 8.126   -38.555  -51.238 1.00 63.70  ? 523  ILE A CB    1 
ATOM   3807 C  CG1   . ILE A 1 477 ? 9.564   -39.037  -50.917 1.00 64.38  ? 523  ILE A CG1   1 
ATOM   3808 C  CG2   . ILE A 1 477 ? 7.198   -38.658  -50.010 1.00 65.48  ? 523  ILE A CG2   1 
ATOM   3809 C  CD1   . ILE A 1 477 ? 9.771   -40.479  -50.705 1.00 66.00  ? 523  ILE A CD1   1 
ATOM   3810 N  N     . PRO A 1 478 ? 5.075   -39.567  -52.527 1.00 61.91  ? 524  PRO A N     1 
ATOM   3811 C  CA    . PRO A 1 478 ? 3.706   -39.079  -52.731 1.00 61.30  ? 524  PRO A CA    1 
ATOM   3812 C  C     . PRO A 1 478 ? 3.451   -37.893  -51.788 1.00 64.03  ? 524  PRO A C     1 
ATOM   3813 O  O     . PRO A 1 478 ? 3.362   -38.032  -50.556 1.00 63.70  ? 524  PRO A O     1 
ATOM   3814 C  CB    . PRO A 1 478 ? 2.819   -40.299  -52.423 1.00 63.14  ? 524  PRO A CB    1 
ATOM   3815 C  CG    . PRO A 1 478 ? 3.737   -41.458  -52.294 1.00 67.59  ? 524  PRO A CG    1 
ATOM   3816 C  CD    . PRO A 1 478 ? 5.075   -40.915  -51.923 1.00 63.72  ? 524  PRO A CD    1 
ATOM   3817 N  N     . TRP A 1 479 ? 3.422   -36.699  -52.383 1.00 57.59  ? 525  TRP A N     1 
ATOM   3818 C  CA    . TRP A 1 479 ? 3.221   -35.472  -51.642 1.00 55.68  ? 525  TRP A CA    1 
ATOM   3819 C  C     . TRP A 1 479 ? 2.525   -34.428  -52.494 1.00 59.71  ? 525  TRP A C     1 
ATOM   3820 O  O     . TRP A 1 479 ? 2.949   -34.169  -53.620 1.00 60.60  ? 525  TRP A O     1 
ATOM   3821 C  CB    . TRP A 1 479 ? 4.587   -34.931  -51.164 1.00 53.15  ? 525  TRP A CB    1 
ATOM   3822 C  CG    . TRP A 1 479 ? 4.476   -33.707  -50.314 1.00 53.47  ? 525  TRP A CG    1 
ATOM   3823 C  CD1   . TRP A 1 479 ? 4.513   -32.407  -50.732 1.00 55.53  ? 525  TRP A CD1   1 
ATOM   3824 C  CD2   . TRP A 1 479 ? 4.193   -33.666  -48.916 1.00 52.90  ? 525  TRP A CD2   1 
ATOM   3825 N  NE1   . TRP A 1 479 ? 4.308   -31.568  -49.675 1.00 54.98  ? 525  TRP A NE1   1 
ATOM   3826 C  CE2   . TRP A 1 479 ? 4.130   -32.315  -48.539 1.00 56.15  ? 525  TRP A CE2   1 
ATOM   3827 C  CE3   . TRP A 1 479 ? 4.020   -34.654  -47.929 1.00 53.90  ? 525  TRP A CE3   1 
ATOM   3828 C  CZ2   . TRP A 1 479 ? 3.920   -31.918  -47.225 1.00 55.22  ? 525  TRP A CZ2   1 
ATOM   3829 C  CZ3   . TRP A 1 479 ? 3.781   -34.257  -46.629 1.00 54.89  ? 525  TRP A CZ3   1 
ATOM   3830 C  CH2   . TRP A 1 479 ? 3.751   -32.905  -46.286 1.00 55.54  ? 525  TRP A CH2   1 
ATOM   3831 N  N     . THR A 1 480 ? 1.513   -33.780  -51.924 1.00 55.76  ? 526  THR A N     1 
ATOM   3832 C  CA    . THR A 1 480 ? 0.795   -32.670  -52.547 1.00 56.27  ? 526  THR A CA    1 
ATOM   3833 C  C     . THR A 1 480 ? 1.253   -31.387  -51.828 1.00 61.25  ? 526  THR A C     1 
ATOM   3834 O  O     . THR A 1 480 ? 1.199   -31.332  -50.594 1.00 59.80  ? 526  THR A O     1 
ATOM   3835 C  CB    . THR A 1 480 ? -0.737  -32.886  -52.483 1.00 66.42  ? 526  THR A CB    1 
ATOM   3836 O  OG1   . THR A 1 480 ? -1.173  -32.871  -51.123 1.00 67.88  ? 526  THR A OG1   1 
ATOM   3837 C  CG2   . THR A 1 480 ? -1.184  -34.182  -53.170 1.00 63.21  ? 526  THR A CG2   1 
ATOM   3838 N  N     . PHE A 1 481 ? 1.753   -30.390  -52.596 1.00 58.85  ? 527  PHE A N     1 
ATOM   3839 C  CA    . PHE A 1 481 ? 2.255   -29.118  -52.070 1.00 59.05  ? 527  PHE A CA    1 
ATOM   3840 C  C     . PHE A 1 481 ? 1.247   -28.402  -51.196 1.00 59.71  ? 527  PHE A C     1 
ATOM   3841 O  O     . PHE A 1 481 ? 0.080   -28.262  -51.562 1.00 60.91  ? 527  PHE A O     1 
ATOM   3842 C  CB    . PHE A 1 481 ? 2.775   -28.187  -53.183 1.00 61.79  ? 527  PHE A CB    1 
ATOM   3843 C  CG    . PHE A 1 481 ? 3.648   -27.054  -52.680 1.00 64.82  ? 527  PHE A CG    1 
ATOM   3844 C  CD1   . PHE A 1 481 ? 5.017   -27.231  -52.508 1.00 68.64  ? 527  PHE A CD1   1 
ATOM   3845 C  CD2   . PHE A 1 481 ? 3.102   -25.806  -52.392 1.00 67.47  ? 527  PHE A CD2   1 
ATOM   3846 C  CE1   . PHE A 1 481 ? 5.825   -26.181  -52.047 1.00 69.82  ? 527  PHE A CE1   1 
ATOM   3847 C  CE2   . PHE A 1 481 ? 3.909   -24.760  -51.926 1.00 70.32  ? 527  PHE A CE2   1 
ATOM   3848 C  CZ    . PHE A 1 481 ? 5.261   -24.956  -51.748 1.00 68.54  ? 527  PHE A CZ    1 
ATOM   3849 N  N     . LEU A 1 482 ? 1.710   -28.015  -50.009 1.00 52.68  ? 528  LEU A N     1 
ATOM   3850 C  CA    . LEU A 1 482 ? 0.974   -27.282  -48.981 1.00 50.60  ? 528  LEU A CA    1 
ATOM   3851 C  C     . LEU A 1 482 ? 1.427   -25.826  -49.026 1.00 51.67  ? 528  LEU A C     1 
ATOM   3852 O  O     . LEU A 1 482 ? 2.631   -25.563  -49.077 1.00 48.53  ? 528  LEU A O     1 
ATOM   3853 C  CB    . LEU A 1 482 ? 1.238   -27.872  -47.564 1.00 50.07  ? 528  LEU A CB    1 
ATOM   3854 C  CG    . LEU A 1 482 ? 1.024   -29.396  -47.352 1.00 54.50  ? 528  LEU A CG    1 
ATOM   3855 C  CD1   . LEU A 1 482 ? 1.443   -29.818  -45.954 1.00 53.72  ? 528  LEU A CD1   1 
ATOM   3856 C  CD2   . LEU A 1 482 ? -0.441  -29.818  -47.609 1.00 56.17  ? 528  LEU A CD2   1 
ATOM   3857 N  N     . ASP A 1 483 ? 0.460   -24.890  -49.047 1.00 49.31  ? 529  ASP A N     1 
ATOM   3858 C  CA    . ASP A 1 483 ? 0.692   -23.445  -49.048 1.00 49.82  ? 529  ASP A CA    1 
ATOM   3859 C  C     . ASP A 1 483 ? 0.281   -22.919  -47.687 1.00 51.77  ? 529  ASP A C     1 
ATOM   3860 O  O     . ASP A 1 483 ? -0.880  -23.049  -47.290 1.00 50.81  ? 529  ASP A O     1 
ATOM   3861 C  CB    . ASP A 1 483 ? -0.090  -22.725  -50.173 1.00 52.52  ? 529  ASP A CB    1 
ATOM   3862 C  CG    . ASP A 1 483 ? 0.369   -21.302  -50.489 1.00 63.58  ? 529  ASP A CG    1 
ATOM   3863 O  OD1   . ASP A 1 483 ? 0.835   -20.601  -49.560 1.00 63.63  ? 529  ASP A OD1   1 
ATOM   3864 O  OD2   . ASP A 1 483 ? 0.253   -20.888  -51.666 1.00 71.21  ? 529  ASP A OD2   1 
ATOM   3865 N  N     . PHE A 1 484 ? 1.260   -22.367  -46.959 1.00 47.38  ? 530  PHE A N     1 
ATOM   3866 C  CA    . PHE A 1 484 ? 1.075   -21.836  -45.618 1.00 46.19  ? 530  PHE A CA    1 
ATOM   3867 C  C     . PHE A 1 484 ? 0.924   -20.323  -45.624 1.00 48.23  ? 530  PHE A C     1 
ATOM   3868 O  O     . PHE A 1 484 ? 0.753   -19.715  -44.563 1.00 48.97  ? 530  PHE A O     1 
ATOM   3869 C  CB    . PHE A 1 484 ? 2.250   -22.251  -44.742 1.00 48.38  ? 530  PHE A CB    1 
ATOM   3870 C  CG    . PHE A 1 484 ? 2.309   -23.718  -44.417 1.00 49.08  ? 530  PHE A CG    1 
ATOM   3871 C  CD1   . PHE A 1 484 ? 1.638   -24.228  -43.308 1.00 51.55  ? 530  PHE A CD1   1 
ATOM   3872 C  CD2   . PHE A 1 484 ? 3.057   -24.590  -45.197 1.00 49.94  ? 530  PHE A CD2   1 
ATOM   3873 C  CE1   . PHE A 1 484 ? 1.734   -25.579  -42.975 1.00 52.50  ? 530  PHE A CE1   1 
ATOM   3874 C  CE2   . PHE A 1 484 ? 3.119   -25.948  -44.889 1.00 53.08  ? 530  PHE A CE2   1 
ATOM   3875 C  CZ    . PHE A 1 484 ? 2.468   -26.432  -43.773 1.00 51.64  ? 530  PHE A CZ    1 
ATOM   3876 N  N     . GLY A 1 485 ? 0.935   -19.755  -46.804 1.00 43.56  ? 531  GLY A N     1 
ATOM   3877 C  CA    . GLY A 1 485 ? 0.772   -18.346  -46.948 1.00 42.75  ? 531  GLY A CA    1 
ATOM   3878 C  C     . GLY A 1 485 ? 1.866   -17.513  -46.344 1.00 46.12  ? 531  GLY A C     1 
ATOM   3879 O  O     . GLY A 1 485 ? 1.644   -16.395  -45.939 1.00 45.92  ? 531  GLY A O     1 
ATOM   3880 N  N     . LEU A 1 486 ? 3.059   -18.076  -46.283 1.00 42.20  ? 532  LEU A N     1 
ATOM   3881 C  CA    . LEU A 1 486 ? 4.198   -17.356  -45.765 1.00 40.55  ? 532  LEU A CA    1 
ATOM   3882 C  C     . LEU A 1 486 ? 5.204   -17.139  -46.875 1.00 42.17  ? 532  LEU A C     1 
ATOM   3883 O  O     . LEU A 1 486 ? 6.031   -17.970  -47.142 1.00 42.37  ? 532  LEU A O     1 
ATOM   3884 C  CB    . LEU A 1 486 ? 4.840   -18.128  -44.637 1.00 39.82  ? 532  LEU A CB    1 
ATOM   3885 C  CG    . LEU A 1 486 ? 4.033   -18.223  -43.363 1.00 44.32  ? 532  LEU A CG    1 
ATOM   3886 C  CD1   . LEU A 1 486 ? 4.427   -19.410  -42.544 1.00 43.79  ? 532  LEU A CD1   1 
ATOM   3887 C  CD2   . LEU A 1 486 ? 4.111   -16.972  -42.534 1.00 47.87  ? 532  LEU A CD2   1 
ATOM   3888 N  N     . ASP A 1 487 ? 5.090   -16.007  -47.530 1.00 35.85  ? 533  ASP A N     1 
ATOM   3889 C  CA    . ASP A 1 487 ? 5.973   -15.633  -48.604 1.00 34.58  ? 533  ASP A CA    1 
ATOM   3890 C  C     . ASP A 1 487 ? 6.096   -14.120  -48.624 1.00 35.90  ? 533  ASP A C     1 
ATOM   3891 O  O     . ASP A 1 487 ? 5.140   -13.429  -48.817 1.00 34.71  ? 533  ASP A O     1 
ATOM   3892 C  CB    . ASP A 1 487 ? 5.427   -16.195  -49.910 1.00 34.67  ? 533  ASP A CB    1 
ATOM   3893 C  CG    . ASP A 1 487 ? 6.375   -16.070  -51.055 1.00 43.22  ? 533  ASP A CG    1 
ATOM   3894 O  OD1   . ASP A 1 487 ? 7.375   -15.375  -50.950 1.00 40.78  ? 533  ASP A OD1   1 
ATOM   3895 O  OD2   . ASP A 1 487 ? 6.101   -16.678  -52.089 1.00 44.79  ? 533  ASP A OD2   1 
ATOM   3896 N  N     . LEU A 1 488 ? 7.323   -13.640  -48.441 1.00 33.40  ? 534  LEU A N     1 
ATOM   3897 C  CA    . LEU A 1 488 ? 7.636   -12.211  -48.345 1.00 33.48  ? 534  LEU A CA    1 
ATOM   3898 C  C     . LEU A 1 488 ? 8.191   -11.559  -49.611 1.00 36.66  ? 534  LEU A C     1 
ATOM   3899 O  O     . LEU A 1 488 ? 8.810   -10.497  -49.545 1.00 37.95  ? 534  LEU A O     1 
ATOM   3900 C  CB    . LEU A 1 488 ? 8.591   -11.958  -47.174 1.00 33.45  ? 534  LEU A CB    1 
ATOM   3901 C  CG    . LEU A 1 488 ? 8.086   -12.362  -45.787 1.00 36.56  ? 534  LEU A CG    1 
ATOM   3902 C  CD1   . LEU A 1 488 ? 9.160   -12.130  -44.735 1.00 35.29  ? 534  LEU A CD1   1 
ATOM   3903 C  CD2   . LEU A 1 488 ? 6.814   -11.606  -45.437 1.00 37.73  ? 534  LEU A CD2   1 
ATOM   3904 N  N     . GLN A 1 489 ? 7.974   -12.191  -50.758 1.00 32.20  ? 535  GLN A N     1 
ATOM   3905 C  CA    . GLN A 1 489 ? 8.487   -11.674  -52.025 1.00 32.32  ? 535  GLN A CA    1 
ATOM   3906 C  C     . GLN A 1 489 ? 7.973   -10.277  -52.400 1.00 36.34  ? 535  GLN A C     1 
ATOM   3907 O  O     . GLN A 1 489 ? 8.734   -9.462   -52.921 1.00 38.68  ? 535  GLN A O     1 
ATOM   3908 C  CB    . GLN A 1 489 ? 8.196   -12.662  -53.160 1.00 34.38  ? 535  GLN A CB    1 
ATOM   3909 C  CG    . GLN A 1 489 ? 6.726   -13.021  -53.312 1.00 63.78  ? 535  GLN A CG    1 
ATOM   3910 C  CD    . GLN A 1 489 ? 6.480   -14.000  -54.443 1.00 113.37 ? 535  GLN A CD    1 
ATOM   3911 O  OE1   . GLN A 1 489 ? 7.413   -14.429  -55.122 1.00 109.71 ? 535  GLN A OE1   1 
ATOM   3912 N  NE2   . GLN A 1 489 ? 5.219   -14.358  -54.651 1.00 117.28 ? 535  GLN A NE2   1 
ATOM   3913 N  N     . PRO A 1 490 ? 6.686   -9.990   -52.140 1.00 30.81  ? 536  PRO A N     1 
ATOM   3914 C  CA    . PRO A 1 490 ? 6.168   -8.663   -52.500 1.00 30.33  ? 536  PRO A CA    1 
ATOM   3915 C  C     . PRO A 1 490 ? 6.878   -7.513   -51.778 1.00 36.77  ? 536  PRO A C     1 
ATOM   3916 O  O     . PRO A 1 490 ? 7.159   -6.492   -52.405 1.00 36.50  ? 536  PRO A O     1 
ATOM   3917 C  CB    . PRO A 1 490 ? 4.704   -8.733   -52.058 1.00 31.78  ? 536  PRO A CB    1 
ATOM   3918 C  CG    . PRO A 1 490 ? 4.345   -10.175  -52.181 1.00 36.32  ? 536  PRO A CG    1 
ATOM   3919 C  CD    . PRO A 1 490 ? 5.566   -10.936  -51.750 1.00 32.82  ? 536  PRO A CD    1 
ATOM   3920 N  N     . CYS A 1 491 ? 7.163   -7.674   -50.489 1.00 32.87  ? 537  CYS A N     1 
ATOM   3921 C  CA    . CYS A 1 491 ? 7.858   -6.645   -49.722 1.00 34.88  ? 537  CYS A CA    1 
ATOM   3922 C  C     . CYS A 1 491 ? 9.343   -6.578   -50.040 1.00 37.95  ? 537  CYS A C     1 
ATOM   3923 O  O     . CYS A 1 491 ? 9.875   -5.483   -50.258 1.00 38.03  ? 537  CYS A O     1 
ATOM   3924 C  CB    . CYS A 1 491 ? 7.610   -6.787   -48.219 1.00 36.15  ? 537  CYS A CB    1 
ATOM   3925 S  SG    . CYS A 1 491 ? 8.421   -5.508   -47.218 1.00 41.14  ? 537  CYS A SG    1 
ATOM   3926 N  N     . ILE A 1 492 ? 10.005  -7.751   -50.077 1.00 33.40  ? 538  ILE A N     1 
ATOM   3927 C  CA    . ILE A 1 492 ? 11.426  -7.880   -50.333 1.00 32.28  ? 538  ILE A CA    1 
ATOM   3928 C  C     . ILE A 1 492 ? 11.782  -7.303   -51.693 1.00 38.65  ? 538  ILE A C     1 
ATOM   3929 O  O     . ILE A 1 492 ? 12.767  -6.579   -51.806 1.00 38.82  ? 538  ILE A O     1 
ATOM   3930 C  CB    . ILE A 1 492 ? 11.867  -9.343   -50.118 1.00 34.18  ? 538  ILE A CB    1 
ATOM   3931 C  CG1   . ILE A 1 492 ? 11.715  -9.718   -48.631 1.00 33.57  ? 538  ILE A CG1   1 
ATOM   3932 C  CG2   . ILE A 1 492 ? 13.272  -9.614   -50.647 1.00 33.01  ? 538  ILE A CG2   1 
ATOM   3933 C  CD1   . ILE A 1 492 ? 11.852  -11.156  -48.280 1.00 36.89  ? 538  ILE A CD1   1 
ATOM   3934 N  N     . ASP A 1 493 ? 10.942  -7.589   -52.662 1.00 36.92  ? 539  ASP A N     1 
ATOM   3935 C  CA    . ASP A 1 493 ? 11.028  -7.104   -54.014 1.00 36.90  ? 539  ASP A CA    1 
ATOM   3936 C  C     . ASP A 1 493 ? 10.813  -5.591   -54.124 1.00 38.15  ? 539  ASP A C     1 
ATOM   3937 O  O     . ASP A 1 493 ? 11.551  -4.929   -54.787 1.00 37.07  ? 539  ASP A O     1 
ATOM   3938 C  CB    . ASP A 1 493 ? 10.004  -7.852   -54.847 1.00 40.14  ? 539  ASP A CB    1 
ATOM   3939 C  CG    . ASP A 1 493 ? 10.183  -7.664   -56.313 1.00 58.18  ? 539  ASP A CG    1 
ATOM   3940 O  OD1   . ASP A 1 493 ? 11.299  -7.812   -56.796 1.00 60.19  ? 539  ASP A OD1   1 
ATOM   3941 O  OD2   . ASP A 1 493 ? 9.195   -7.409   -56.997 1.00 65.97  ? 539  ASP A OD2   1 
ATOM   3942 N  N     . LEU A 1 494 ? 9.838   -5.055   -53.407 1.00 32.41  ? 540  LEU A N     1 
ATOM   3943 C  CA    . LEU A 1 494 ? 9.543   -3.643   -53.437 1.00 33.06  ? 540  LEU A CA    1 
ATOM   3944 C  C     . LEU A 1 494 ? 10.769  -2.877   -52.969 1.00 38.63  ? 540  LEU A C     1 
ATOM   3945 O  O     . LEU A 1 494 ? 11.146  -1.888   -53.516 1.00 39.79  ? 540  LEU A O     1 
ATOM   3946 C  CB    . LEU A 1 494 ? 8.362   -3.359   -52.506 1.00 32.73  ? 540  LEU A CB    1 
ATOM   3947 C  CG    . LEU A 1 494 ? 8.115   -1.986   -51.899 1.00 38.13  ? 540  LEU A CG    1 
ATOM   3948 C  CD1   . LEU A 1 494 ? 7.634   -1.024   -52.935 1.00 39.13  ? 540  LEU A CD1   1 
ATOM   3949 C  CD2   . LEU A 1 494 ? 7.174   -1.967   -50.729 1.00 36.67  ? 540  LEU A CD2   1 
ATOM   3950 N  N     . ILE A 1 495 ? 11.385  -3.393   -51.923 1.00 32.77  ? 541  ILE A N     1 
ATOM   3951 C  CA    . ILE A 1 495 ? 12.598  -2.835   -51.407 1.00 32.44  ? 541  ILE A CA    1 
ATOM   3952 C  C     . ILE A 1 495 ? 13.904  -3.006   -52.182 1.00 36.07  ? 541  ILE A C     1 
ATOM   3953 O  O     . ILE A 1 495 ? 14.611  -2.072   -52.411 1.00 34.10  ? 541  ILE A O     1 
ATOM   3954 C  CB    . ILE A 1 495 ? 12.865  -3.384   -50.018 1.00 35.59  ? 541  ILE A CB    1 
ATOM   3955 C  CG1   . ILE A 1 495 ? 11.813  -2.898   -49.048 1.00 35.34  ? 541  ILE A CG1   1 
ATOM   3956 C  CG2   . ILE A 1 495 ? 14.226  -2.943   -49.564 1.00 39.47  ? 541  ILE A CG2   1 
ATOM   3957 C  CD1   . ILE A 1 495 ? 11.936  -3.490   -47.673 1.00 35.87  ? 541  ILE A CD1   1 
ATOM   3958 N  N     . GLU A 1 496 ? 14.176  -4.220   -52.610 1.00 33.89  ? 542  GLU A N     1 
ATOM   3959 C  CA    . GLU A 1 496 ? 15.440  -4.529   -53.224 1.00 34.65  ? 542  GLU A CA    1 
ATOM   3960 C  C     . GLU A 1 496 ? 15.550  -4.722   -54.717 1.00 44.53  ? 542  GLU A C     1 
ATOM   3961 O  O     . GLU A 1 496 ? 16.638  -4.862   -55.206 1.00 44.52  ? 542  GLU A O     1 
ATOM   3962 C  CB    . GLU A 1 496 ? 16.014  -5.771   -52.564 1.00 35.99  ? 542  GLU A CB    1 
ATOM   3963 C  CG    . GLU A 1 496 ? 15.447  -7.053   -53.100 1.00 41.91  ? 542  GLU A CG    1 
ATOM   3964 C  CD    . GLU A 1 496 ? 16.144  -8.272   -52.595 1.00 59.11  ? 542  GLU A CD    1 
ATOM   3965 O  OE1   . GLU A 1 496 ? 16.644  -8.241   -51.489 1.00 42.34  ? 542  GLU A OE1   1 
ATOM   3966 O  OE2   . GLU A 1 496 ? 16.192  -9.270   -53.306 1.00 51.85  ? 542  GLU A OE2   1 
ATOM   3967 N  N     . ARG A 1 497 ? 14.459  -4.718   -55.453 1.00 42.52  ? 543  ARG A N     1 
ATOM   3968 C  CA    . ARG A 1 497 ? 14.581  -4.985   -56.862 1.00 43.44  ? 543  ARG A CA    1 
ATOM   3969 C  C     . ARG A 1 497 ? 15.349  -3.904   -57.544 1.00 49.79  ? 543  ARG A C     1 
ATOM   3970 O  O     . ARG A 1 497 ? 14.988  -2.763   -57.489 1.00 51.07  ? 543  ARG A O     1 
ATOM   3971 C  CB    . ARG A 1 497 ? 13.221  -5.099   -57.487 1.00 42.51  ? 543  ARG A CB    1 
ATOM   3972 C  CG    . ARG A 1 497 ? 13.234  -5.539   -58.923 1.00 42.95  ? 543  ARG A CG    1 
ATOM   3973 C  CD    . ARG A 1 497 ? 11.825  -5.716   -59.384 1.00 43.02  ? 543  ARG A CD    1 
ATOM   3974 N  NE    . ARG A 1 497 ? 11.772  -6.429   -60.617 1.00 62.28  ? 543  ARG A NE    1 
ATOM   3975 C  CZ    . ARG A 1 497 ? 11.627  -7.731   -60.702 1.00 87.49  ? 543  ARG A CZ    1 
ATOM   3976 N  NH1   . ARG A 1 497 ? 11.524  -8.450   -59.615 1.00 69.63  ? 543  ARG A NH1   1 
ATOM   3977 N  NH2   . ARG A 1 497 ? 11.589  -8.309   -61.878 1.00 85.43  ? 543  ARG A NH2   1 
ATOM   3978 N  N     . PRO A 1 498 ? 16.420  -4.286   -58.205 1.00 47.54  ? 544  PRO A N     1 
ATOM   3979 C  CA    . PRO A 1 498 ? 17.324  -3.400   -58.912 1.00 47.86  ? 544  PRO A CA    1 
ATOM   3980 C  C     . PRO A 1 498 ? 16.780  -2.735   -60.144 1.00 54.69  ? 544  PRO A C     1 
ATOM   3981 O  O     . PRO A 1 498 ? 17.028  -1.574   -60.299 1.00 53.49  ? 544  PRO A O     1 
ATOM   3982 C  CB    . PRO A 1 498 ? 18.502  -4.289   -59.229 1.00 48.88  ? 544  PRO A CB    1 
ATOM   3983 C  CG    . PRO A 1 498 ? 17.941  -5.639   -59.268 1.00 53.53  ? 544  PRO A CG    1 
ATOM   3984 C  CD    . PRO A 1 498 ? 16.800  -5.687   -58.341 1.00 49.22  ? 544  PRO A CD    1 
ATOM   3985 N  N     . ALA A 1 499 ? 16.016  -3.446   -60.958 1.00 54.09  ? 545  ALA A N     1 
ATOM   3986 C  CA    . ALA A 1 499 ? 15.524  -2.922   -62.225 1.00 55.43  ? 545  ALA A CA    1 
ATOM   3987 C  C     . ALA A 1 499 ? 14.138  -3.357   -62.613 1.00 62.95  ? 545  ALA A C     1 
ATOM   3988 O  O     . ALA A 1 499 ? 13.422  -3.851   -61.791 1.00 61.42  ? 545  ALA A O     1 
ATOM   3989 C  CB    . ALA A 1 499 ? 16.496  -3.297   -63.333 1.00 30.00  ? 545  ALA A CB    1 
ATOM   3990 N  N     . ASN A 1 500 ? 13.842  -3.231   -63.906 1.00 63.80  ? 546  ASN A N     1 
ATOM   3991 C  CA    . ASN A 1 500 ? 12.514  -3.399   -64.532 1.00 63.92  ? 546  ASN A CA    1 
ATOM   3992 C  C     . ASN A 1 500 ? 11.883  -2.419   -63.595 1.00 66.04  ? 546  ASN A C     1 
ATOM   3993 O  O     . ASN A 1 500 ? 12.426  -1.319   -63.509 1.00 67.73  ? 546  ASN A O     1 
ATOM   3994 C  CB    . ASN A 1 500 ? 11.928  -4.811   -64.548 1.00 68.63  ? 546  ASN A CB    1 
ATOM   3995 C  CG    . ASN A 1 500 ? 11.494  -5.220   -65.937 1.00 108.48 ? 546  ASN A CG    1 
ATOM   3996 O  OD1   . ASN A 1 500 ? 10.772  -4.494   -66.601 1.00 108.62 ? 546  ASN A OD1   1 
ATOM   3997 N  ND2   . ASN A 1 500 ? 11.953  -6.371   -66.391 1.00 101.75 ? 546  ASN A ND2   1 
ATOM   3998 N  N     . PRO A 1 501 ? 10.720  -2.715   -62.997 1.00 57.42  ? 547  PRO A N     1 
ATOM   3999 C  CA    . PRO A 1 501 ? 10.324  -1.717   -62.004 1.00 54.49  ? 547  PRO A CA    1 
ATOM   4000 C  C     . PRO A 1 501 ? 11.360  -1.654   -60.880 1.00 51.41  ? 547  PRO A C     1 
ATOM   4001 O  O     . PRO A 1 501 ? 11.512  -2.609   -60.167 1.00 51.07  ? 547  PRO A O     1 
ATOM   4002 C  CB    . PRO A 1 501 ? 9.001   -2.246   -61.505 1.00 55.86  ? 547  PRO A CB    1 
ATOM   4003 C  CG    . PRO A 1 501 ? 9.130   -3.703   -61.592 1.00 61.25  ? 547  PRO A CG    1 
ATOM   4004 C  CD    . PRO A 1 501 ? 10.087  -4.046   -62.672 1.00 57.63  ? 547  PRO A CD    1 
ATOM   4005 N  N     . PRO A 1 502 ? 12.089  -0.552   -60.743 1.00 43.06  ? 548  PRO A N     1 
ATOM   4006 C  CA    . PRO A 1 502 ? 13.073  -0.543   -59.675 1.00 41.38  ? 548  PRO A CA    1 
ATOM   4007 C  C     . PRO A 1 502 ? 12.442  -0.342   -58.319 1.00 43.56  ? 548  PRO A C     1 
ATOM   4008 O  O     . PRO A 1 502 ? 11.451  0.314    -58.240 1.00 41.48  ? 548  PRO A O     1 
ATOM   4009 C  CB    . PRO A 1 502 ? 13.975  0.610    -60.058 1.00 42.67  ? 548  PRO A CB    1 
ATOM   4010 C  CG    . PRO A 1 502 ? 13.133  1.512    -60.844 1.00 47.93  ? 548  PRO A CG    1 
ATOM   4011 C  CD    . PRO A 1 502 ? 11.955  0.766    -61.352 1.00 44.44  ? 548  PRO A CD    1 
ATOM   4012 N  N     . GLY A 1 503 ? 13.031  -0.921   -57.289 1.00 40.79  ? 549  GLY A N     1 
ATOM   4013 C  CA    . GLY A 1 503 ? 12.574  -0.842   -55.917 1.00 40.52  ? 549  GLY A CA    1 
ATOM   4014 C  C     . GLY A 1 503 ? 12.960  0.427    -55.196 1.00 44.01  ? 549  GLY A C     1 
ATOM   4015 O  O     . GLY A 1 503 ? 13.572  1.258    -55.779 1.00 45.11  ? 549  GLY A O     1 
ATOM   4016 N  N     . LEU A 1 504 ? 12.570  0.569    -53.938 1.00 37.57  ? 550  LEU A N     1 
ATOM   4017 C  CA    . LEU A 1 504 ? 12.833  1.764    -53.141 1.00 35.62  ? 550  LEU A CA    1 
ATOM   4018 C  C     . LEU A 1 504 ? 14.324  2.134    -53.084 1.00 40.31  ? 550  LEU A C     1 
ATOM   4019 O  O     . LEU A 1 504 ? 14.665  3.298    -53.328 1.00 39.78  ? 550  LEU A O     1 
ATOM   4020 C  CB    . LEU A 1 504 ? 12.237  1.607    -51.733 1.00 34.39  ? 550  LEU A CB    1 
ATOM   4021 C  CG    . LEU A 1 504 ? 10.715  1.319    -51.663 1.00 36.55  ? 550  LEU A CG    1 
ATOM   4022 C  CD1   . LEU A 1 504 ? 10.282  0.976    -50.266 1.00 33.95  ? 550  LEU A CD1   1 
ATOM   4023 C  CD2   . LEU A 1 504 ? 9.898   2.474    -52.204 1.00 39.69  ? 550  LEU A CD2   1 
ATOM   4024 N  N     . LEU A 1 505 ? 15.206  1.131    -52.829 1.00 36.19  ? 551  LEU A N     1 
ATOM   4025 C  CA    . LEU A 1 505 ? 16.649  1.330    -52.719 1.00 36.35  ? 551  LEU A CA    1 
ATOM   4026 C  C     . LEU A 1 505 ? 17.231  1.755    -54.043 1.00 42.60  ? 551  LEU A C     1 
ATOM   4027 O  O     . LEU A 1 505 ? 18.104  2.599    -54.058 1.00 41.31  ? 551  LEU A O     1 
ATOM   4028 C  CB    . LEU A 1 505 ? 17.374  0.069    -52.199 1.00 36.49  ? 551  LEU A CB    1 
ATOM   4029 C  CG    . LEU A 1 505 ? 17.044  -0.439   -50.772 1.00 40.83  ? 551  LEU A CG    1 
ATOM   4030 C  CD1   . LEU A 1 505 ? 17.877  -1.667   -50.432 1.00 40.60  ? 551  LEU A CD1   1 
ATOM   4031 C  CD2   . LEU A 1 505 ? 17.252  0.630    -49.699 1.00 41.83  ? 551  LEU A CD2   1 
ATOM   4032 N  N     . ALA A 1 506 ? 16.749  1.179    -55.162 1.00 42.23  ? 552  ALA A N     1 
ATOM   4033 C  CA    . ALA A 1 506 ? 17.204  1.557    -56.495 1.00 42.10  ? 552  ALA A CA    1 
ATOM   4034 C  C     . ALA A 1 506 ? 16.659  2.948    -56.873 1.00 45.31  ? 552  ALA A C     1 
ATOM   4035 O  O     . ALA A 1 506 ? 17.384  3.725    -57.479 1.00 44.07  ? 552  ALA A O     1 
ATOM   4036 C  CB    . ALA A 1 506 ? 16.778  0.519    -57.504 1.00 42.66  ? 552  ALA A CB    1 
ATOM   4037 N  N     . LEU A 1 507 ? 15.410  3.277    -56.475 1.00 43.31  ? 553  LEU A N     1 
ATOM   4038 C  CA    . LEU A 1 507 ? 14.802  4.596    -56.719 1.00 42.99  ? 553  LEU A CA    1 
ATOM   4039 C  C     . LEU A 1 507 ? 15.550  5.674    -55.944 1.00 49.21  ? 553  LEU A C     1 
ATOM   4040 O  O     . LEU A 1 507 ? 15.793  6.743    -56.502 1.00 51.29  ? 553  LEU A O     1 
ATOM   4041 C  CB    . LEU A 1 507 ? 13.299  4.622    -56.439 1.00 43.03  ? 553  LEU A CB    1 
ATOM   4042 C  CG    . LEU A 1 507 ? 12.437  3.924    -57.504 1.00 47.60  ? 553  LEU A CG    1 
ATOM   4043 C  CD1   . LEU A 1 507 ? 11.028  3.713    -57.005 1.00 47.42  ? 553  LEU A CD1   1 
ATOM   4044 C  CD2   . LEU A 1 507 ? 12.482  4.661    -58.859 1.00 47.75  ? 553  LEU A CD2   1 
ATOM   4045 N  N     . LEU A 1 508 ? 16.012  5.335    -54.756 1.00 42.58  ? 554  LEU A N     1 
ATOM   4046 C  CA    . LEU A 1 508 ? 16.837  6.199    -53.991 1.00 41.00  ? 554  LEU A CA    1 
ATOM   4047 C  C     . LEU A 1 508 ? 18.164  6.394    -54.695 1.00 49.77  ? 554  LEU A C     1 
ATOM   4048 O  O     . LEU A 1 508 ? 18.621  7.483    -54.765 1.00 50.85  ? 554  LEU A O     1 
ATOM   4049 C  CB    . LEU A 1 508 ? 17.052  5.634    -52.600 1.00 39.96  ? 554  LEU A CB    1 
ATOM   4050 C  CG    . LEU A 1 508 ? 17.814  6.449    -51.577 1.00 43.14  ? 554  LEU A CG    1 
ATOM   4051 C  CD1   . LEU A 1 508 ? 17.295  7.854    -51.529 1.00 42.15  ? 554  LEU A CD1   1 
ATOM   4052 C  CD2   . LEU A 1 508 ? 17.769  5.829    -50.205 1.00 42.89  ? 554  LEU A CD2   1 
ATOM   4053 N  N     . ASP A 1 509 ? 18.766  5.351    -55.249 1.00 48.33  ? 555  ASP A N     1 
ATOM   4054 C  CA    . ASP A 1 509 ? 20.047  5.511    -55.913 1.00 48.99  ? 555  ASP A CA    1 
ATOM   4055 C  C     . ASP A 1 509 ? 19.977  6.437    -57.118 1.00 53.90  ? 555  ASP A C     1 
ATOM   4056 O  O     . ASP A 1 509 ? 20.784  7.313    -57.262 1.00 52.92  ? 555  ASP A O     1 
ATOM   4057 C  CB    . ASP A 1 509 ? 20.621  4.176    -56.388 1.00 51.07  ? 555  ASP A CB    1 
ATOM   4058 C  CG    . ASP A 1 509 ? 20.877  3.187    -55.270 1.00 61.10  ? 555  ASP A CG    1 
ATOM   4059 O  OD1   . ASP A 1 509 ? 21.003  3.588    -54.129 1.00 62.76  ? 555  ASP A OD1   1 
ATOM   4060 O  OD2   . ASP A 1 509 ? 20.948  1.983    -55.533 1.00 63.17  ? 555  ASP A OD2   1 
ATOM   4061 N  N     . GLU A 1 510 ? 18.991  6.268    -57.969 1.00 51.41  ? 556  GLU A N     1 
ATOM   4062 C  CA    . GLU A 1 510 ? 18.859  7.119    -59.125 1.00 52.69  ? 556  GLU A CA    1 
ATOM   4063 C  C     . GLU A 1 510 ? 18.598  8.564    -58.766 1.00 60.82  ? 556  GLU A C     1 
ATOM   4064 O  O     . GLU A 1 510 ? 19.119  9.440    -59.383 1.00 60.59  ? 556  GLU A O     1 
ATOM   4065 C  CB    . GLU A 1 510 ? 17.716  6.655    -60.007 1.00 54.17  ? 556  GLU A CB    1 
ATOM   4066 C  CG    . GLU A 1 510 ? 17.918  5.322    -60.676 1.00 73.03  ? 556  GLU A CG    1 
ATOM   4067 C  CD    . GLU A 1 510 ? 16.709  4.891    -61.481 1.00 114.96 ? 556  GLU A CD    1 
ATOM   4068 O  OE1   . GLU A 1 510 ? 15.653  5.537    -61.364 1.00 119.30 ? 556  GLU A OE1   1 
ATOM   4069 O  OE2   . GLU A 1 510 ? 16.820  3.913    -62.241 1.00 116.06 ? 556  GLU A OE2   1 
ATOM   4070 N  N     . GLU A 1 511 ? 17.775  8.797    -57.766 1.00 59.28  ? 557  GLU A N     1 
ATOM   4071 C  CA    . GLU A 1 511 ? 17.383  10.123   -57.388 1.00 61.01  ? 557  GLU A CA    1 
ATOM   4072 C  C     . GLU A 1 511 ? 18.519  10.974   -56.923 1.00 72.58  ? 557  GLU A C     1 
ATOM   4073 O  O     . GLU A 1 511 ? 18.675  12.109   -57.286 1.00 72.20  ? 557  GLU A O     1 
ATOM   4074 C  CB    . GLU A 1 511 ? 16.373  10.015   -56.270 1.00 62.10  ? 557  GLU A CB    1 
ATOM   4075 C  CG    . GLU A 1 511 ? 15.804  11.322   -55.803 1.00 71.26  ? 557  GLU A CG    1 
ATOM   4076 C  CD    . GLU A 1 511 ? 14.985  12.015   -56.860 1.00 101.54 ? 557  GLU A CD    1 
ATOM   4077 O  OE1   . GLU A 1 511 ? 14.653  11.389   -57.865 1.00 96.98  ? 557  GLU A OE1   1 
ATOM   4078 O  OE2   . GLU A 1 511 ? 14.676  13.194   -56.695 1.00 106.68 ? 557  GLU A OE2   1 
ATOM   4079 N  N     . CYS A 1 512 ? 19.355  10.386   -56.132 1.00 74.87  ? 558  CYS A N     1 
ATOM   4080 C  CA    . CYS A 1 512 ? 20.489  11.098   -55.546 1.00 77.74  ? 558  CYS A CA    1 
ATOM   4081 C  C     . CYS A 1 512 ? 21.500  11.580   -56.584 1.00 89.86  ? 558  CYS A C     1 
ATOM   4082 O  O     . CYS A 1 512 ? 22.024  12.689   -56.489 1.00 91.03  ? 558  CYS A O     1 
ATOM   4083 C  CB    . CYS A 1 512 ? 21.188  10.220   -54.504 1.00 77.73  ? 558  CYS A CB    1 
ATOM   4084 S  SG    . CYS A 1 512 ? 21.716  8.605    -55.123 1.00 81.23  ? 558  CYS A SG    1 
ATOM   4085 N  N     . TRP A 1 513 ? 21.766  10.734   -57.572 1.00 90.43  ? 559  TRP A N     1 
ATOM   4086 C  CA    . TRP A 1 513 ? 22.731  11.042   -58.640 1.00 92.86  ? 559  TRP A CA    1 
ATOM   4087 C  C     . TRP A 1 513 ? 22.156  11.989   -59.703 1.00 98.36  ? 559  TRP A C     1 
ATOM   4088 O  O     . TRP A 1 513 ? 22.778  12.207   -60.749 1.00 97.90  ? 559  TRP A O     1 
ATOM   4089 C  CB    . TRP A 1 513 ? 23.366  9.788    -59.273 1.00 92.87  ? 559  TRP A CB    1 
ATOM   4090 C  CG    . TRP A 1 513 ? 24.339  9.086    -58.371 1.00 94.78  ? 559  TRP A CG    1 
ATOM   4091 C  CD1   . TRP A 1 513 ? 24.158  7.880    -57.763 1.00 98.01  ? 559  TRP A CD1   1 
ATOM   4092 C  CD2   . TRP A 1 513 ? 25.604  9.587    -57.896 1.00 95.03  ? 559  TRP A CD2   1 
ATOM   4093 N  NE1   . TRP A 1 513 ? 25.233  7.587    -56.956 1.00 98.03  ? 559  TRP A NE1   1 
ATOM   4094 C  CE2   . TRP A 1 513 ? 26.134  8.621    -57.016 1.00 99.56  ? 559  TRP A CE2   1 
ATOM   4095 C  CE3   . TRP A 1 513 ? 26.349  10.754   -58.148 1.00 96.42  ? 559  TRP A CE3   1 
ATOM   4096 C  CZ2   . TRP A 1 513 ? 27.376  8.779    -56.382 1.00 99.12  ? 559  TRP A CZ2   1 
ATOM   4097 C  CZ3   . TRP A 1 513 ? 27.577  10.912   -57.516 1.00 98.16  ? 559  TRP A CZ3   1 
ATOM   4098 C  CH2   . TRP A 1 513 ? 28.080  9.933    -56.649 1.00 98.89  ? 559  TRP A CH2   1 
ATOM   4099 N  N     . PHE A 1 514 ? 21.082  12.662   -59.332 1.00 96.40  ? 560  PHE A N     1 
ATOM   4100 C  CA    . PHE A 1 514 ? 20.396  13.632   -60.165 1.00 96.89  ? 560  PHE A CA    1 
ATOM   4101 C  C     . PHE A 1 514 ? 20.816  14.998   -59.649 1.00 99.87  ? 560  PHE A C     1 
ATOM   4102 O  O     . PHE A 1 514 ? 20.796  15.210   -58.453 1.00 99.00  ? 560  PHE A O     1 
ATOM   4103 C  CB    . PHE A 1 514 ? 18.910  13.452   -59.986 1.00 99.12  ? 560  PHE A CB    1 
ATOM   4104 C  CG    . PHE A 1 514 ? 18.118  13.775   -61.194 1.00 101.30 ? 560  PHE A CG    1 
ATOM   4105 C  CD1   . PHE A 1 514 ? 18.471  13.254   -62.414 1.00 104.89 ? 560  PHE A CD1   1 
ATOM   4106 C  CD2   . PHE A 1 514 ? 17.010  14.586   -61.107 1.00 103.92 ? 560  PHE A CD2   1 
ATOM   4107 C  CE1   . PHE A 1 514 ? 17.734  13.540   -63.531 1.00 106.17 ? 560  PHE A CE1   1 
ATOM   4108 C  CE2   . PHE A 1 514 ? 16.266  14.885   -62.220 1.00 107.19 ? 560  PHE A CE2   1 
ATOM   4109 C  CZ    . PHE A 1 514 ? 16.627  14.355   -63.437 1.00 105.55 ? 560  PHE A CZ    1 
ATOM   4110 N  N     . PRO A 1 515 ? 21.191  15.931   -60.552 1.00 96.02  ? 561  PRO A N     1 
ATOM   4111 C  CA    . PRO A 1 515 ? 21.705  17.254   -60.162 1.00 95.39  ? 561  PRO A CA    1 
ATOM   4112 C  C     . PRO A 1 515 ? 20.759  18.123   -59.326 1.00 96.21  ? 561  PRO A C     1 
ATOM   4113 O  O     . PRO A 1 515 ? 21.219  18.758   -58.378 1.00 95.54  ? 561  PRO A O     1 
ATOM   4114 C  CB    . PRO A 1 515 ? 21.981  17.932   -61.511 1.00 97.46  ? 561  PRO A CB    1 
ATOM   4115 C  CG    . PRO A 1 515 ? 21.108  17.217   -62.487 1.00 102.02 ? 561  PRO A CG    1 
ATOM   4116 C  CD    . PRO A 1 515 ? 21.063  15.795   -62.012 1.00 97.51  ? 561  PRO A CD    1 
ATOM   4117 N  N     . LYS A 1 516 ? 19.474  18.154   -59.661 1.00 90.35  ? 562  LYS A N     1 
ATOM   4118 C  CA    . LYS A 1 516 ? 18.510  18.958   -58.902 1.00 88.70  ? 562  LYS A CA    1 
ATOM   4119 C  C     . LYS A 1 516 ? 17.663  18.187   -57.876 1.00 86.77  ? 562  LYS A C     1 
ATOM   4120 O  O     . LYS A 1 516 ? 16.737  18.748   -57.292 1.00 87.33  ? 562  LYS A O     1 
ATOM   4121 C  CB    . LYS A 1 516 ? 17.592  19.724   -59.859 1.00 92.20  ? 562  LYS A CB    1 
ATOM   4122 C  CG    . LYS A 1 516 ? 18.297  20.798   -60.671 1.00 114.97 ? 562  LYS A CG    1 
ATOM   4123 C  CD    . LYS A 1 516 ? 17.334  21.500   -61.614 1.00 130.63 ? 562  LYS A CD    1 
ATOM   4124 C  CE    . LYS A 1 516 ? 18.034  22.591   -62.408 1.00 149.19 ? 562  LYS A CE    1 
ATOM   4125 N  NZ    . LYS A 1 516 ? 17.107  23.271   -63.354 1.00 161.26 ? 562  LYS A NZ    1 
ATOM   4126 N  N     . ALA A 1 517 ? 17.977  16.912   -57.659 1.00 77.91  ? 563  ALA A N     1 
ATOM   4127 C  CA    . ALA A 1 517 ? 17.210  16.071   -56.732 1.00 75.50  ? 563  ALA A CA    1 
ATOM   4128 C  C     . ALA A 1 517 ? 17.230  16.500   -55.256 1.00 73.89  ? 563  ALA A C     1 
ATOM   4129 O  O     . ALA A 1 517 ? 18.251  16.952   -54.739 1.00 74.02  ? 563  ALA A O     1 
ATOM   4130 C  CB    . ALA A 1 517 ? 17.645  14.617   -56.863 1.00 76.27  ? 563  ALA A CB    1 
ATOM   4131 N  N     . THR A 1 518 ? 16.081  16.346   -54.597 1.00 65.64  ? 564  THR A N     1 
ATOM   4132 C  CA    . THR A 1 518 ? 15.903  16.687   -53.183 1.00 63.56  ? 564  THR A CA    1 
ATOM   4133 C  C     . THR A 1 518 ? 15.105  15.588   -52.470 1.00 63.85  ? 564  THR A C     1 
ATOM   4134 O  O     . THR A 1 518 ? 14.367  14.845   -53.117 1.00 62.64  ? 564  THR A O     1 
ATOM   4135 C  CB    . THR A 1 518 ? 15.175  18.033   -53.007 1.00 68.64  ? 564  THR A CB    1 
ATOM   4136 O  OG1   . THR A 1 518 ? 13.891  17.971   -53.639 1.00 66.35  ? 564  THR A OG1   1 
ATOM   4137 C  CG2   . THR A 1 518 ? 15.985  19.165   -53.624 1.00 65.80  ? 564  THR A CG2   1 
ATOM   4138 N  N     . ASP A 1 519 ? 15.247  15.480   -51.149 1.00 59.20  ? 565  ASP A N     1 
ATOM   4139 C  CA    . ASP A 1 519 ? 14.533  14.443   -50.407 1.00 58.28  ? 565  ASP A CA    1 
ATOM   4140 C  C     . ASP A 1 519 ? 13.046  14.431   -50.795 1.00 59.09  ? 565  ASP A C     1 
ATOM   4141 O  O     . ASP A 1 519 ? 12.480  13.346   -50.916 1.00 59.07  ? 565  ASP A O     1 
ATOM   4142 C  CB    . ASP A 1 519 ? 14.688  14.650   -48.889 1.00 60.98  ? 565  ASP A CB    1 
ATOM   4143 C  CG    . ASP A 1 519 ? 16.122  14.592   -48.378 1.00 78.95  ? 565  ASP A CG    1 
ATOM   4144 O  OD1   . ASP A 1 519 ? 16.874  13.694   -48.819 1.00 81.08  ? 565  ASP A OD1   1 
ATOM   4145 O  OD2   . ASP A 1 519 ? 16.475  15.412   -47.498 1.00 86.48  ? 565  ASP A OD2   1 
ATOM   4146 N  N     . LYS A 1 520 ? 12.437  15.632   -51.029 1.00 52.79  ? 566  LYS A N     1 
ATOM   4147 C  CA    . LYS A 1 520 ? 11.034  15.850   -51.419 1.00 52.19  ? 566  LYS A CA    1 
ATOM   4148 C  C     . LYS A 1 520 ? 10.693  15.234   -52.794 1.00 57.29  ? 566  LYS A C     1 
ATOM   4149 O  O     . LYS A 1 520 ? 9.651   14.587   -52.940 1.00 55.18  ? 566  LYS A O     1 
ATOM   4150 C  CB    . LYS A 1 520 ? 10.707  17.353   -51.412 1.00 55.09  ? 566  LYS A CB    1 
ATOM   4151 C  CG    . LYS A 1 520 ? 9.236   17.658   -51.146 1.00 84.52  ? 566  LYS A CG    1 
ATOM   4152 C  CD    . LYS A 1 520 ? 8.905   19.141   -51.294 1.00 99.33  ? 566  LYS A CD    1 
ATOM   4153 C  CE    . LYS A 1 520 ? 7.438   19.380   -51.595 1.00 115.85 ? 566  LYS A CE    1 
ATOM   4154 N  NZ    . LYS A 1 520 ? 7.092   19.069   -53.012 1.00 125.84 ? 566  LYS A NZ    1 
ATOM   4155 N  N     . SER A 1 521 ? 11.587  15.426   -53.791 1.00 55.06  ? 567  SER A N     1 
ATOM   4156 C  CA    . SER A 1 521 ? 11.441  14.901   -55.146 1.00 55.12  ? 567  SER A CA    1 
ATOM   4157 C  C     . SER A 1 521 ? 11.561  13.361   -55.175 1.00 59.77  ? 567  SER A C     1 
ATOM   4158 O  O     . SER A 1 521 ? 11.001  12.708   -56.072 1.00 60.84  ? 567  SER A O     1 
ATOM   4159 C  CB    . SER A 1 521 ? 12.471  15.543   -56.071 1.00 59.20  ? 567  SER A CB    1 
ATOM   4160 O  OG    . SER A 1 521 ? 13.808  15.277   -55.666 1.00 67.59  ? 567  SER A OG    1 
ATOM   4161 N  N     . PHE A 1 522 ? 12.298  12.789   -54.194 1.00 54.12  ? 568  PHE A N     1 
ATOM   4162 C  CA    . PHE A 1 522 ? 12.456  11.344   -54.058 1.00 52.42  ? 568  PHE A CA    1 
ATOM   4163 C  C     . PHE A 1 522 ? 11.110  10.805   -53.568 1.00 56.25  ? 568  PHE A C     1 
ATOM   4164 O  O     . PHE A 1 522 ? 10.585  9.869    -54.168 1.00 56.23  ? 568  PHE A O     1 
ATOM   4165 C  CB    . PHE A 1 522 ? 13.604  10.978   -53.091 1.00 52.45  ? 568  PHE A CB    1 
ATOM   4166 C  CG    . PHE A 1 522 ? 13.535  9.582    -52.515 1.00 51.59  ? 568  PHE A CG    1 
ATOM   4167 C  CD1   . PHE A 1 522 ? 13.771  8.470    -53.313 1.00 53.00  ? 568  PHE A CD1   1 
ATOM   4168 C  CD2   . PHE A 1 522 ? 13.212  9.380    -51.180 1.00 51.72  ? 568  PHE A CD2   1 
ATOM   4169 C  CE1   . PHE A 1 522 ? 13.690  7.180    -52.782 1.00 52.89  ? 568  PHE A CE1   1 
ATOM   4170 C  CE2   . PHE A 1 522 ? 13.129  8.090    -50.650 1.00 53.75  ? 568  PHE A CE2   1 
ATOM   4171 C  CZ    . PHE A 1 522 ? 13.374  7.000    -51.453 1.00 51.84  ? 568  PHE A CZ    1 
ATOM   4172 N  N     . VAL A 1 523 ? 10.546  11.442   -52.518 1.00 51.41  ? 569  VAL A N     1 
ATOM   4173 C  CA    . VAL A 1 523 ? 9.248   11.112   -51.922 1.00 51.65  ? 569  VAL A CA    1 
ATOM   4174 C  C     . VAL A 1 523 ? 8.151   11.148   -53.004 1.00 55.95  ? 569  VAL A C     1 
ATOM   4175 O  O     . VAL A 1 523 ? 7.335   10.232   -53.064 1.00 54.06  ? 569  VAL A O     1 
ATOM   4176 C  CB    . VAL A 1 523 ? 8.946   12.012   -50.691 1.00 55.59  ? 569  VAL A CB    1 
ATOM   4177 C  CG1   . VAL A 1 523 ? 7.503   11.847   -50.194 1.00 55.57  ? 569  VAL A CG1   1 
ATOM   4178 C  CG2   . VAL A 1 523 ? 9.927   11.722   -49.564 1.00 55.15  ? 569  VAL A CG2   1 
ATOM   4179 N  N     . GLU A 1 524 ? 8.201   12.162   -53.895 1.00 54.17  ? 570  GLU A N     1 
ATOM   4180 C  CA    . GLU A 1 524 ? 7.297   12.339   -55.036 1.00 54.28  ? 570  GLU A CA    1 
ATOM   4181 C  C     . GLU A 1 524 ? 7.446   11.209   -56.044 1.00 57.00  ? 570  GLU A C     1 
ATOM   4182 O  O     . GLU A 1 524 ? 6.435   10.669   -56.513 1.00 55.67  ? 570  GLU A O     1 
ATOM   4183 C  CB    . GLU A 1 524 ? 7.550   13.683   -55.732 1.00 56.02  ? 570  GLU A CB    1 
ATOM   4184 C  CG    . GLU A 1 524 ? 6.934   14.864   -55.002 1.00 71.84  ? 570  GLU A CG    1 
ATOM   4185 C  CD    . GLU A 1 524 ? 7.196   16.244   -55.579 1.00 102.14 ? 570  GLU A CD    1 
ATOM   4186 O  OE1   . GLU A 1 524 ? 8.132   16.393   -56.402 1.00 99.51  ? 570  GLU A OE1   1 
ATOM   4187 O  OE2   . GLU A 1 524 ? 6.481   17.188   -55.173 1.00 96.23  ? 570  GLU A OE2   1 
ATOM   4188 N  N     . LYS A 1 525 ? 8.704   10.866   -56.384 1.00 53.83  ? 571  LYS A N     1 
ATOM   4189 C  CA    . LYS A 1 525 ? 9.047   9.810    -57.343 1.00 54.01  ? 571  LYS A CA    1 
ATOM   4190 C  C     . LYS A 1 525 ? 8.559   8.440    -56.848 1.00 57.68  ? 571  LYS A C     1 
ATOM   4191 O  O     . LYS A 1 525 ? 7.959   7.688    -57.614 1.00 57.09  ? 571  LYS A O     1 
ATOM   4192 C  CB    . LYS A 1 525 ? 10.578  9.798    -57.612 1.00 56.43  ? 571  LYS A CB    1 
ATOM   4193 C  CG    . LYS A 1 525 ? 11.124  8.634    -58.478 1.00 61.97  ? 571  LYS A CG    1 
ATOM   4194 C  CD    . LYS A 1 525 ? 10.992  8.880    -59.986 1.00 76.63  ? 571  LYS A CD    1 
ATOM   4195 C  CE    . LYS A 1 525 ? 12.241  9.445    -60.621 1.00 94.14  ? 571  LYS A CE    1 
ATOM   4196 N  NZ    . LYS A 1 525 ? 11.998  9.864    -62.028 1.00 105.92 ? 571  LYS A NZ    1 
ATOM   4197 N  N     . VAL A 1 526 ? 8.795   8.151    -55.564 1.00 53.77  ? 572  VAL A N     1 
ATOM   4198 C  CA    . VAL A 1 526 ? 8.477   6.897    -54.908 1.00 53.86  ? 572  VAL A CA    1 
ATOM   4199 C  C     . VAL A 1 526 ? 6.957   6.744    -54.672 1.00 59.54  ? 572  VAL A C     1 
ATOM   4200 O  O     . VAL A 1 526 ? 6.454   5.625    -54.735 1.00 59.09  ? 572  VAL A O     1 
ATOM   4201 C  CB    . VAL A 1 526 ? 9.367   6.752    -53.651 1.00 57.52  ? 572  VAL A CB    1 
ATOM   4202 C  CG1   . VAL A 1 526 ? 9.042   5.533    -52.813 1.00 57.53  ? 572  VAL A CG1   1 
ATOM   4203 C  CG2   . VAL A 1 526 ? 10.837  6.769    -54.031 1.00 57.01  ? 572  VAL A CG2   1 
ATOM   4204 N  N     . ALA A 1 527 ? 6.223   7.846    -54.491 1.00 57.62  ? 573  ALA A N     1 
ATOM   4205 C  CA    . ALA A 1 527 ? 4.769   7.783    -54.328 1.00 57.51  ? 573  ALA A CA    1 
ATOM   4206 C  C     . ALA A 1 527 ? 4.104   7.570    -55.695 1.00 61.57  ? 573  ALA A C     1 
ATOM   4207 O  O     . ALA A 1 527 ? 3.048   6.942    -55.779 1.00 60.53  ? 573  ALA A O     1 
ATOM   4208 C  CB    . ALA A 1 527 ? 4.251   9.055    -53.676 1.00 58.02  ? 573  ALA A CB    1 
ATOM   4209 N  N     . GLN A 1 528 ? 4.737   8.093    -56.759 1.00 58.25  ? 574  GLN A N     1 
ATOM   4210 C  CA    . GLN A 1 528 ? 4.272   7.980    -58.138 1.00 57.76  ? 574  GLN A CA    1 
ATOM   4211 C  C     . GLN A 1 528 ? 4.535   6.573    -58.655 1.00 60.66  ? 574  GLN A C     1 
ATOM   4212 O  O     . GLN A 1 528 ? 3.607   5.922    -59.136 1.00 63.40  ? 574  GLN A O     1 
ATOM   4213 C  CB    . GLN A 1 528 ? 5.000   9.007    -59.023 1.00 59.50  ? 574  GLN A CB    1 
ATOM   4214 C  CG    . GLN A 1 528 ? 4.311   9.316    -60.343 1.00 90.77  ? 574  GLN A CG    1 
ATOM   4215 C  CD    . GLN A 1 528 ? 5.214   10.113   -61.252 1.00 125.98 ? 574  GLN A CD    1 
ATOM   4216 O  OE1   . GLN A 1 528 ? 5.497   11.296   -61.014 1.00 123.58 ? 574  GLN A OE1   1 
ATOM   4217 N  NE2   . GLN A 1 528 ? 5.690   9.478    -62.318 1.00 123.50 ? 574  GLN A NE2   1 
ATOM   4218 N  N     . GLU A 1 529 ? 5.786   6.099    -58.546 1.00 52.87  ? 575  GLU A N     1 
ATOM   4219 C  CA    . GLU A 1 529 ? 6.198   4.800    -59.064 1.00 51.90  ? 575  GLU A CA    1 
ATOM   4220 C  C     . GLU A 1 529 ? 5.699   3.567    -58.285 1.00 52.21  ? 575  GLU A C     1 
ATOM   4221 O  O     . GLU A 1 529 ? 5.377   2.544    -58.908 1.00 52.00  ? 575  GLU A O     1 
ATOM   4222 C  CB    . GLU A 1 529 ? 7.731   4.737    -59.206 1.00 53.54  ? 575  GLU A CB    1 
ATOM   4223 C  CG    . GLU A 1 529 ? 8.326   5.745    -60.180 1.00 67.78  ? 575  GLU A CG    1 
ATOM   4224 C  CD    . GLU A 1 529 ? 7.872   5.611    -61.621 1.00 93.26  ? 575  GLU A CD    1 
ATOM   4225 O  OE1   . GLU A 1 529 ? 8.365   4.695    -62.321 1.00 87.23  ? 575  GLU A OE1   1 
ATOM   4226 O  OE2   . GLU A 1 529 ? 7.025   6.429    -62.049 1.00 88.30  ? 575  GLU A OE2   1 
ATOM   4227 N  N     . GLN A 1 530 ? 5.689   3.645    -56.949 1.00 45.74  ? 576  GLN A N     1 
ATOM   4228 C  CA    . GLN A 1 530 ? 5.368   2.540    -56.045 1.00 44.37  ? 576  GLN A CA    1 
ATOM   4229 C  C     . GLN A 1 530 ? 4.021   2.625    -55.362 1.00 47.71  ? 576  GLN A C     1 
ATOM   4230 O  O     . GLN A 1 530 ? 3.663   1.706    -54.626 1.00 47.28  ? 576  GLN A O     1 
ATOM   4231 C  CB    . GLN A 1 530 ? 6.476   2.378    -54.964 1.00 45.20  ? 576  GLN A CB    1 
ATOM   4232 C  CG    . GLN A 1 530 ? 7.859   1.968    -55.481 1.00 48.61  ? 576  GLN A CG    1 
ATOM   4233 C  CD    . GLN A 1 530 ? 7.906   0.611    -56.149 1.00 63.90  ? 576  GLN A CD    1 
ATOM   4234 O  OE1   . GLN A 1 530 ? 7.109   -0.297   -55.869 1.00 51.62  ? 576  GLN A OE1   1 
ATOM   4235 N  NE2   . GLN A 1 530 ? 8.849   0.448    -57.068 1.00 65.46  ? 576  GLN A NE2   1 
ATOM   4236 N  N     . GLY A 1 531 ? 3.286   3.705    -55.597 1.00 45.08  ? 577  GLY A N     1 
ATOM   4237 C  CA    . GLY A 1 531 ? 1.987   3.932    -54.977 1.00 46.13  ? 577  GLY A CA    1 
ATOM   4238 C  C     . GLY A 1 531 ? 0.997   2.789    -55.078 1.00 51.39  ? 577  GLY A C     1 
ATOM   4239 O  O     . GLY A 1 531 ? 0.221   2.554    -54.144 1.00 51.72  ? 577  GLY A O     1 
ATOM   4240 N  N     . GLY A 1 532 ? 1.046   2.085    -56.206 1.00 46.71  ? 578  GLY A N     1 
ATOM   4241 C  CA    . GLY A 1 532 ? 0.169   0.957    -56.505 1.00 46.63  ? 578  GLY A CA    1 
ATOM   4242 C  C     . GLY A 1 532 ? 0.616   -0.405   -56.005 1.00 49.37  ? 578  GLY A C     1 
ATOM   4243 O  O     . GLY A 1 532 ? -0.135  -1.365   -56.165 1.00 50.75  ? 578  GLY A O     1 
ATOM   4244 N  N     . HIS A 1 533 ? 1.829   -0.521   -55.391 1.00 42.19  ? 579  HIS A N     1 
ATOM   4245 C  CA    . HIS A 1 533 ? 2.324   -1.802   -54.863 1.00 39.34  ? 579  HIS A CA    1 
ATOM   4246 C  C     . HIS A 1 533 ? 1.535   -2.205   -53.588 1.00 39.98  ? 579  HIS A C     1 
ATOM   4247 O  O     . HIS A 1 533 ? 1.296   -1.334   -52.770 1.00 41.19  ? 579  HIS A O     1 
ATOM   4248 C  CB    . HIS A 1 533 ? 3.832   -1.738   -54.619 1.00 39.02  ? 579  HIS A CB    1 
ATOM   4249 C  CG    . HIS A 1 533 ? 4.416   -3.020   -54.126 1.00 41.57  ? 579  HIS A CG    1 
ATOM   4250 N  ND1   . HIS A 1 533 ? 4.370   -4.179   -54.886 1.00 42.52  ? 579  HIS A ND1   1 
ATOM   4251 C  CD2   . HIS A 1 533 ? 5.059   -3.282   -52.965 1.00 42.38  ? 579  HIS A CD2   1 
ATOM   4252 C  CE1   . HIS A 1 533 ? 4.970   -5.108   -54.159 1.00 41.58  ? 579  HIS A CE1   1 
ATOM   4253 N  NE2   . HIS A 1 533 ? 5.394   -4.618   -52.992 1.00 42.10  ? 579  HIS A NE2   1 
ATOM   4254 N  N     . PRO A 1 534 ? 1.104   -3.483   -53.405 1.00 34.24  ? 580  PRO A N     1 
ATOM   4255 C  CA    . PRO A 1 534 ? 0.311   -3.843   -52.216 1.00 32.47  ? 580  PRO A CA    1 
ATOM   4256 C  C     . PRO A 1 534 ? 1.019   -3.713   -50.863 1.00 39.20  ? 580  PRO A C     1 
ATOM   4257 O  O     . PRO A 1 534 ? 0.351   -3.669   -49.825 1.00 40.02  ? 580  PRO A O     1 
ATOM   4258 C  CB    . PRO A 1 534 ? -0.108  -5.293   -52.502 1.00 34.34  ? 580  PRO A CB    1 
ATOM   4259 C  CG    . PRO A 1 534 ? 0.972   -5.830   -53.378 1.00 40.47  ? 580  PRO A CG    1 
ATOM   4260 C  CD    . PRO A 1 534 ? 1.307   -4.666   -54.280 1.00 37.13  ? 580  PRO A CD    1 
ATOM   4261 N  N     . LYS A 1 535 ? 2.364   -3.626   -50.865 1.00 35.67  ? 581  LYS A N     1 
ATOM   4262 C  CA    . LYS A 1 535 ? 3.127   -3.503   -49.644 1.00 34.93  ? 581  LYS A CA    1 
ATOM   4263 C  C     . LYS A 1 535 ? 3.611   -2.062   -49.400 1.00 38.32  ? 581  LYS A C     1 
ATOM   4264 O  O     . LYS A 1 535 ? 4.119   -1.772   -48.311 1.00 36.02  ? 581  LYS A O     1 
ATOM   4265 C  CB    . LYS A 1 535 ? 4.255   -4.541   -49.606 1.00 37.22  ? 581  LYS A CB    1 
ATOM   4266 C  CG    . LYS A 1 535 ? 3.746   -5.993   -49.659 1.00 40.91  ? 581  LYS A CG    1 
ATOM   4267 C  CD    . LYS A 1 535 ? 2.912   -6.427   -48.444 1.00 44.07  ? 581  LYS A CD    1 
ATOM   4268 C  CE    . LYS A 1 535 ? 2.284   -7.788   -48.661 1.00 50.39  ? 581  LYS A CE    1 
ATOM   4269 N  NZ    . LYS A 1 535 ? 1.111   -8.016   -47.765 1.00 46.85  ? 581  LYS A NZ    1 
ATOM   4270 N  N     . PHE A 1 536 ? 3.394   -1.151   -50.381 1.00 35.52  ? 582  PHE A N     1 
ATOM   4271 C  CA    . PHE A 1 536 ? 3.715   0.276    -50.249 1.00 36.59  ? 582  PHE A CA    1 
ATOM   4272 C  C     . PHE A 1 536 ? 2.426   1.070    -50.040 1.00 44.01  ? 582  PHE A C     1 
ATOM   4273 O  O     . PHE A 1 536 ? 1.427   0.786    -50.699 1.00 46.67  ? 582  PHE A O     1 
ATOM   4274 C  CB    . PHE A 1 536 ? 4.440   0.818    -51.487 1.00 38.39  ? 582  PHE A CB    1 
ATOM   4275 C  CG    . PHE A 1 536 ? 4.919   2.254    -51.383 1.00 40.36  ? 582  PHE A CG    1 
ATOM   4276 C  CD1   . PHE A 1 536 ? 4.101   3.310    -51.781 1.00 42.50  ? 582  PHE A CD1   1 
ATOM   4277 C  CD2   . PHE A 1 536 ? 6.207   2.548    -50.944 1.00 42.28  ? 582  PHE A CD2   1 
ATOM   4278 C  CE1   . PHE A 1 536 ? 4.560   4.620    -51.743 1.00 42.81  ? 582  PHE A CE1   1 
ATOM   4279 C  CE2   . PHE A 1 536 ? 6.665   3.864    -50.916 1.00 43.74  ? 582  PHE A CE2   1 
ATOM   4280 C  CZ    . PHE A 1 536 ? 5.837   4.890    -51.307 1.00 41.74  ? 582  PHE A CZ    1 
ATOM   4281 N  N     . GLN A 1 537 ? 2.466   2.098    -49.191 1.00 38.83  ? 583  GLN A N     1 
ATOM   4282 C  CA    . GLN A 1 537 ? 1.314   2.936    -48.932 1.00 39.21  ? 583  GLN A CA    1 
ATOM   4283 C  C     . GLN A 1 537 ? 1.701   4.419    -48.969 1.00 42.56  ? 583  GLN A C     1 
ATOM   4284 O  O     . GLN A 1 537 ? 2.639   4.825    -48.270 1.00 42.16  ? 583  GLN A O     1 
ATOM   4285 C  CB    . GLN A 1 537 ? 0.717   2.571    -47.550 1.00 41.80  ? 583  GLN A CB    1 
ATOM   4286 C  CG    . GLN A 1 537 ? -0.661  3.185    -47.209 1.00 60.03  ? 583  GLN A CG    1 
ATOM   4287 C  CD    . GLN A 1 537 ? -1.186  2.726    -45.860 1.00 85.07  ? 583  GLN A CD    1 
ATOM   4288 O  OE1   . GLN A 1 537 ? -1.262  3.500    -44.898 1.00 78.65  ? 583  GLN A OE1   1 
ATOM   4289 N  NE2   . GLN A 1 537 ? -1.558  1.449    -45.756 1.00 82.81  ? 583  GLN A NE2   1 
ATOM   4290 N  N     . ARG A 1 538 ? 0.952   5.229    -49.750 1.00 37.01  ? 584  ARG A N     1 
ATOM   4291 C  CA    . ARG A 1 538 ? 1.128   6.673    -49.813 1.00 37.28  ? 584  ARG A CA    1 
ATOM   4292 C  C     . ARG A 1 538 ? 0.569   7.260    -48.500 1.00 41.75  ? 584  ARG A C     1 
ATOM   4293 O  O     . ARG A 1 538 ? -0.318  6.647    -47.882 1.00 39.91  ? 584  ARG A O     1 
ATOM   4294 C  CB    . ARG A 1 538 ? 0.384   7.294    -51.011 1.00 39.83  ? 584  ARG A CB    1 
ATOM   4295 C  CG    . ARG A 1 538 ? 1.024   7.042    -52.382 1.00 60.92  ? 584  ARG A CG    1 
ATOM   4296 C  CD    . ARG A 1 538 ? 0.199   7.653    -53.502 1.00 82.62  ? 584  ARG A CD    1 
ATOM   4297 N  NE    . ARG A 1 538 ? -1.006  6.863    -53.772 1.00 108.89 ? 584  ARG A NE    1 
ATOM   4298 C  CZ    . ARG A 1 538 ? -1.224  6.163    -54.885 1.00 132.71 ? 584  ARG A CZ    1 
ATOM   4299 N  NH1   . ARG A 1 538 ? -0.337  6.178    -55.873 1.00 121.84 ? 584  ARG A NH1   1 
ATOM   4300 N  NH2   . ARG A 1 538 ? -2.346  5.469    -55.030 1.00 122.80 ? 584  ARG A NH2   1 
ATOM   4301 N  N     . PRO A 1 539 ? 1.097   8.418    -48.032 1.00 38.35  ? 585  PRO A N     1 
ATOM   4302 C  CA    . PRO A 1 539 ? 0.550   9.015    -46.805 1.00 37.79  ? 585  PRO A CA    1 
ATOM   4303 C  C     . PRO A 1 539 ? -0.842  9.568    -47.036 1.00 40.55  ? 585  PRO A C     1 
ATOM   4304 O  O     . PRO A 1 539 ? -1.096  10.133   -48.103 1.00 39.04  ? 585  PRO A O     1 
ATOM   4305 C  CB    . PRO A 1 539 ? 1.526   10.135   -46.472 1.00 39.48  ? 585  PRO A CB    1 
ATOM   4306 C  CG    . PRO A 1 539 ? 2.308   10.374   -47.706 1.00 44.07  ? 585  PRO A CG    1 
ATOM   4307 C  CD    . PRO A 1 539 ? 2.144   9.261    -48.646 1.00 39.55  ? 585  PRO A CD    1 
ATOM   4308 N  N     . ARG A 1 540 ? -1.748  9.364    -46.068 1.00 37.63  ? 586  ARG A N     1 
ATOM   4309 C  CA    . ARG A 1 540 ? -3.108  9.870    -46.186 1.00 39.86  ? 586  ARG A CA    1 
ATOM   4310 C  C     . ARG A 1 540 ? -3.171  11.294   -45.618 1.00 49.18  ? 586  ARG A C     1 
ATOM   4311 O  O     . ARG A 1 540 ? -2.654  11.579   -44.520 1.00 45.44  ? 586  ARG A O     1 
ATOM   4312 C  CB    . ARG A 1 540 ? -4.145  8.979    -45.473 1.00 39.41  ? 586  ARG A CB    1 
ATOM   4313 C  CG    . ARG A 1 540 ? -4.167  7.516    -45.913 1.00 54.16  ? 586  ARG A CG    1 
ATOM   4314 C  CD    . ARG A 1 540 ? -4.641  6.608    -44.790 1.00 64.88  ? 586  ARG A CD    1 
ATOM   4315 N  NE    . ARG A 1 540 ? -3.672  6.561    -43.691 1.00 78.41  ? 586  ARG A NE    1 
ATOM   4316 C  CZ    . ARG A 1 540 ? -3.917  6.051    -42.490 1.00 89.61  ? 586  ARG A CZ    1 
ATOM   4317 N  NH1   . ARG A 1 540 ? -5.105  5.521    -42.215 1.00 79.58  ? 586  ARG A NH1   1 
ATOM   4318 N  NH2   . ARG A 1 540 ? -2.978  6.068    -41.552 1.00 64.59  ? 586  ARG A NH2   1 
ATOM   4319 N  N     . HIS A 1 541 ? -3.854  12.168   -46.371 1.00 51.91  ? 587  HIS A N     1 
ATOM   4320 C  CA    . HIS A 1 541 ? -4.077  13.555   -46.009 1.00 54.65  ? 587  HIS A CA    1 
ATOM   4321 C  C     . HIS A 1 541 ? -4.748  13.645   -44.609 1.00 56.08  ? 587  HIS A C     1 
ATOM   4322 O  O     . HIS A 1 541 ? -5.579  12.791   -44.270 1.00 54.21  ? 587  HIS A O     1 
ATOM   4323 C  CB    . HIS A 1 541 ? -4.883  14.263   -47.119 1.00 57.71  ? 587  HIS A CB    1 
ATOM   4324 C  CG    . HIS A 1 541 ? -5.114  15.708   -46.844 1.00 63.80  ? 587  HIS A CG    1 
ATOM   4325 N  ND1   . HIS A 1 541 ? -4.056  16.603   -46.726 1.00 67.04  ? 587  HIS A ND1   1 
ATOM   4326 C  CD2   . HIS A 1 541 ? -6.273  16.366   -46.614 1.00 67.68  ? 587  HIS A CD2   1 
ATOM   4327 C  CE1   . HIS A 1 541 ? -4.607  17.768   -46.427 1.00 67.64  ? 587  HIS A CE1   1 
ATOM   4328 N  NE2   . HIS A 1 541 ? -5.942  17.674   -46.343 1.00 68.15  ? 587  HIS A NE2   1 
ATOM   4329 N  N     . LEU A 1 542 ? -4.281  14.610   -43.769 1.00 52.07  ? 588  LEU A N     1 
ATOM   4330 C  CA    . LEU A 1 542 ? -4.735  14.886   -42.391 1.00 52.02  ? 588  LEU A CA    1 
ATOM   4331 C  C     . LEU A 1 542 ? -4.341  13.815   -41.371 1.00 53.97  ? 588  LEU A C     1 
ATOM   4332 O  O     . LEU A 1 542 ? -4.808  13.846   -40.226 1.00 51.10  ? 588  LEU A O     1 
ATOM   4333 C  CB    . LEU A 1 542 ? -6.265  15.149   -42.299 1.00 52.55  ? 588  LEU A CB    1 
ATOM   4334 C  CG    . LEU A 1 542 ? -6.880  16.205   -43.207 1.00 58.76  ? 588  LEU A CG    1 
ATOM   4335 C  CD1   . LEU A 1 542 ? -8.340  15.905   -43.422 1.00 59.79  ? 588  LEU A CD1   1 
ATOM   4336 C  CD2   . LEU A 1 542 ? -6.696  17.620   -42.650 1.00 62.00  ? 588  LEU A CD2   1 
ATOM   4337 N  N     . ARG A 1 543 ? -3.482  12.866   -41.767 1.00 52.98  ? 589  ARG A N     1 
ATOM   4338 C  CA    . ARG A 1 543 ? -3.148  11.741   -40.893 1.00 52.66  ? 589  ARG A CA    1 
ATOM   4339 C  C     . ARG A 1 543 ? -1.662  11.448   -40.697 1.00 56.23  ? 589  ARG A C     1 
ATOM   4340 O  O     . ARG A 1 543 ? -1.163  11.507   -39.577 1.00 53.46  ? 589  ARG A O     1 
ATOM   4341 C  CB    . ARG A 1 543 ? -3.864  10.476   -41.403 1.00 49.85  ? 589  ARG A CB    1 
ATOM   4342 C  CG    . ARG A 1 543 ? -5.374  10.525   -41.216 1.00 53.86  ? 589  ARG A CG    1 
ATOM   4343 C  CD    . ARG A 1 543 ? -6.032  9.851    -42.372 1.00 52.52  ? 589  ARG A CD    1 
ATOM   4344 N  NE    . ARG A 1 543 ? -7.457  9.687    -42.154 1.00 55.77  ? 589  ARG A NE    1 
ATOM   4345 C  CZ    . ARG A 1 543 ? -8.391  10.420   -42.736 1.00 60.63  ? 589  ARG A CZ    1 
ATOM   4346 N  NH1   . ARG A 1 543 ? -8.052  11.397   -43.573 1.00 50.19  ? 589  ARG A NH1   1 
ATOM   4347 N  NH2   . ARG A 1 543 ? -9.670  10.202   -42.488 1.00 41.19  ? 589  ARG A NH2   1 
ATOM   4348 N  N     . ASP A 1 544 ? -1.007  11.000   -41.757 1.00 57.03  ? 590  ASP A N     1 
ATOM   4349 C  CA    . ASP A 1 544 ? 0.373   10.544   -41.719 1.00 58.18  ? 590  ASP A CA    1 
ATOM   4350 C  C     . ASP A 1 544 ? 1.325   11.671   -42.011 1.00 63.96  ? 590  ASP A C     1 
ATOM   4351 O  O     . ASP A 1 544 ? 1.391   12.171   -43.138 1.00 63.54  ? 590  ASP A O     1 
ATOM   4352 C  CB    . ASP A 1 544 ? 0.587   9.333    -42.670 1.00 60.12  ? 590  ASP A CB    1 
ATOM   4353 C  CG    . ASP A 1 544 ? -0.520  8.281    -42.601 1.00 71.83  ? 590  ASP A CG    1 
ATOM   4354 O  OD1   . ASP A 1 544 ? -0.649  7.621    -41.544 1.00 74.53  ? 590  ASP A OD1   1 
ATOM   4355 O  OD2   . ASP A 1 544 ? -1.282  8.147    -43.590 1.00 70.84  ? 590  ASP A OD2   1 
ATOM   4356 N  N     . GLN A 1 545 ? 2.102   11.996   -40.995 1.00 61.71  ? 591  GLN A N     1 
ATOM   4357 C  CA    . GLN A 1 545 ? 3.133   12.990   -41.029 1.00 61.15  ? 591  GLN A CA    1 
ATOM   4358 C  C     . GLN A 1 545 ? 4.313   12.448   -41.781 1.00 62.59  ? 591  GLN A C     1 
ATOM   4359 O  O     . GLN A 1 545 ? 5.214   13.189   -42.113 1.00 64.47  ? 591  GLN A O     1 
ATOM   4360 C  CB    . GLN A 1 545 ? 3.593   13.260   -39.612 1.00 62.73  ? 591  GLN A CB    1 
ATOM   4361 C  CG    . GLN A 1 545 ? 2.559   13.918   -38.733 1.00 68.56  ? 591  GLN A CG    1 
ATOM   4362 C  CD    . GLN A 1 545 ? 3.065   14.086   -37.327 1.00 89.26  ? 591  GLN A CD    1 
ATOM   4363 O  OE1   . GLN A 1 545 ? 3.934   13.356   -36.882 1.00 80.28  ? 591  GLN A OE1   1 
ATOM   4364 N  NE2   . GLN A 1 545 ? 2.518   15.045   -36.617 1.00 85.86  ? 591  GLN A NE2   1 
ATOM   4365 N  N     . ALA A 1 546 ? 4.329   11.128   -41.971 1.00 53.01  ? 592  ALA A N     1 
ATOM   4366 C  CA    . ALA A 1 546 ? 5.398   10.416   -42.680 1.00 49.50  ? 592  ALA A CA    1 
ATOM   4367 C  C     . ALA A 1 546 ? 5.283   10.481   -44.208 1.00 48.08  ? 592  ALA A C     1 
ATOM   4368 O  O     . ALA A 1 546 ? 4.203   10.721   -44.749 1.00 45.84  ? 592  ALA A O     1 
ATOM   4369 C  CB    . ALA A 1 546 ? 5.513   8.989    -42.162 1.00 50.10  ? 592  ALA A CB    1 
ATOM   4370 N  N     . ASP A 1 547 ? 6.405   10.265   -44.893 1.00 42.08  ? 593  ASP A N     1 
ATOM   4371 C  CA    . ASP A 1 547 ? 6.446   10.282   -46.357 1.00 40.72  ? 593  ASP A CA    1 
ATOM   4372 C  C     . ASP A 1 547 ? 5.746   9.069    -46.986 1.00 43.73  ? 593  ASP A C     1 
ATOM   4373 O  O     . ASP A 1 547 ? 5.028   9.207    -47.976 1.00 43.26  ? 593  ASP A O     1 
ATOM   4374 C  CB    . ASP A 1 547 ? 7.892   10.363   -46.855 1.00 42.32  ? 593  ASP A CB    1 
ATOM   4375 C  CG    . ASP A 1 547 ? 8.589   11.636   -46.416 1.00 49.75  ? 593  ASP A CG    1 
ATOM   4376 O  OD1   . ASP A 1 547 ? 7.951   12.455   -45.721 1.00 57.04  ? 593  ASP A OD1   1 
ATOM   4377 O  OD2   . ASP A 1 547 ? 9.774   11.817   -46.765 1.00 46.78  ? 593  ASP A OD2   1 
ATOM   4378 N  N     . PHE A 1 548 ? 6.032   7.879    -46.456 1.00 39.28  ? 594  PHE A N     1 
ATOM   4379 C  CA    . PHE A 1 548 ? 5.465   6.631    -46.975 1.00 38.73  ? 594  PHE A CA    1 
ATOM   4380 C  C     . PHE A 1 548 ? 5.449   5.489    -45.951 1.00 40.64  ? 594  PHE A C     1 
ATOM   4381 O  O     . PHE A 1 548 ? 6.122   5.558    -44.923 1.00 40.31  ? 594  PHE A O     1 
ATOM   4382 C  CB    . PHE A 1 548 ? 6.215   6.190    -48.235 1.00 40.61  ? 594  PHE A CB    1 
ATOM   4383 C  CG    . PHE A 1 548 ? 7.684   5.965    -48.019 1.00 41.85  ? 594  PHE A CG    1 
ATOM   4384 C  CD1   . PHE A 1 548 ? 8.156   4.730    -47.607 1.00 44.16  ? 594  PHE A CD1   1 
ATOM   4385 C  CD2   . PHE A 1 548 ? 8.593   6.989    -48.229 1.00 43.75  ? 594  PHE A CD2   1 
ATOM   4386 C  CE1   . PHE A 1 548 ? 9.507   4.520    -47.407 1.00 45.79  ? 594  PHE A CE1   1 
ATOM   4387 C  CE2   . PHE A 1 548 ? 9.945   6.785    -48.031 1.00 43.60  ? 594  PHE A CE2   1 
ATOM   4388 C  CZ    . PHE A 1 548 ? 10.403  5.549    -47.619 1.00 42.68  ? 594  PHE A CZ    1 
ATOM   4389 N  N     . SER A 1 549 ? 4.675   4.444    -46.242 1.00 37.09  ? 595  SER A N     1 
ATOM   4390 C  CA    . SER A 1 549 ? 4.560   3.281    -45.357 1.00 37.09  ? 595  SER A CA    1 
ATOM   4391 C  C     . SER A 1 549 ? 4.880   1.957    -46.065 1.00 40.55  ? 595  SER A C     1 
ATOM   4392 O  O     . SER A 1 549 ? 4.541   1.771    -47.234 1.00 41.64  ? 595  SER A O     1 
ATOM   4393 C  CB    . SER A 1 549 ? 3.163   3.219    -44.736 1.00 40.75  ? 595  SER A CB    1 
ATOM   4394 O  OG    . SER A 1 549 ? 2.934   4.327    -43.882 1.00 43.07  ? 595  SER A OG    1 
ATOM   4395 N  N     . VAL A 1 550 ? 5.534   1.045    -45.346 1.00 35.78  ? 596  VAL A N     1 
ATOM   4396 C  CA    . VAL A 1 550 ? 5.913   -0.247   -45.880 1.00 34.00  ? 596  VAL A CA    1 
ATOM   4397 C  C     . VAL A 1 550 ? 5.277   -1.285   -44.983 1.00 36.69  ? 596  VAL A C     1 
ATOM   4398 O  O     . VAL A 1 550 ? 5.408   -1.201   -43.755 1.00 35.39  ? 596  VAL A O     1 
ATOM   4399 C  CB    . VAL A 1 550 ? 7.459   -0.423   -46.015 1.00 38.75  ? 596  VAL A CB    1 
ATOM   4400 C  CG1   . VAL A 1 550 ? 7.826   -1.822   -46.518 1.00 37.84  ? 596  VAL A CG1   1 
ATOM   4401 C  CG2   . VAL A 1 550 ? 8.063   0.634    -46.946 1.00 38.99  ? 596  VAL A CG2   1 
ATOM   4402 N  N     . LEU A 1 551 ? 4.569   -2.261   -45.604 1.00 32.74  ? 597  LEU A N     1 
ATOM   4403 C  CA    . LEU A 1 551 ? 3.900   -3.333   -44.874 1.00 32.77  ? 597  LEU A CA    1 
ATOM   4404 C  C     . LEU A 1 551 ? 4.870   -4.455   -44.712 1.00 36.69  ? 597  LEU A C     1 
ATOM   4405 O  O     . LEU A 1 551 ? 4.939   -5.387   -45.535 1.00 34.35  ? 597  LEU A O     1 
ATOM   4406 C  CB    . LEU A 1 551 ? 2.584   -3.826   -45.518 1.00 32.60  ? 597  LEU A CB    1 
ATOM   4407 C  CG    . LEU A 1 551 ? 1.384   -2.890   -45.620 1.00 36.62  ? 597  LEU A CG    1 
ATOM   4408 C  CD1   . LEU A 1 551 ? 0.241   -3.563   -46.436 1.00 35.33  ? 597  LEU A CD1   1 
ATOM   4409 C  CD2   . LEU A 1 551 ? 0.881   -2.429   -44.242 1.00 37.96  ? 597  LEU A CD2   1 
ATOM   4410 N  N     . HIS A 1 552 ? 5.655   -4.347   -43.647 1.00 34.86  ? 598  HIS A N     1 
ATOM   4411 C  CA    . HIS A 1 552 ? 6.639   -5.348   -43.284 1.00 33.74  ? 598  HIS A CA    1 
ATOM   4412 C  C     . HIS A 1 552 ? 5.892   -6.543   -42.714 1.00 36.58  ? 598  HIS A C     1 
ATOM   4413 O  O     . HIS A 1 552 ? 4.735   -6.426   -42.308 1.00 34.53  ? 598  HIS A O     1 
ATOM   4414 C  CB    . HIS A 1 552 ? 7.618   -4.793   -42.249 1.00 32.42  ? 598  HIS A CB    1 
ATOM   4415 C  CG    . HIS A 1 552 ? 8.382   -3.596   -42.722 1.00 35.14  ? 598  HIS A CG    1 
ATOM   4416 N  ND1   . HIS A 1 552 ? 9.341   -3.667   -43.710 1.00 35.44  ? 598  HIS A ND1   1 
ATOM   4417 C  CD2   . HIS A 1 552 ? 8.328   -2.297   -42.343 1.00 34.68  ? 598  HIS A CD2   1 
ATOM   4418 C  CE1   . HIS A 1 552 ? 9.845   -2.464   -43.919 1.00 34.08  ? 598  HIS A CE1   1 
ATOM   4419 N  NE2   . HIS A 1 552 ? 9.248   -1.614   -43.102 1.00 33.75  ? 598  HIS A NE2   1 
ATOM   4420 N  N     . TYR A 1 553 ? 6.550   -7.692   -42.681 1.00 32.73  ? 599  TYR A N     1 
ATOM   4421 C  CA    . TYR A 1 553 ? 5.919   -8.893   -42.162 1.00 31.40  ? 599  TYR A CA    1 
ATOM   4422 C  C     . TYR A 1 553 ? 5.530   -8.675   -40.705 1.00 34.42  ? 599  TYR A C     1 
ATOM   4423 O  O     . TYR A 1 553 ? 4.476   -9.131   -40.262 1.00 32.73  ? 599  TYR A O     1 
ATOM   4424 C  CB    . TYR A 1 553 ? 6.860   -10.092  -42.284 1.00 30.78  ? 599  TYR A CB    1 
ATOM   4425 C  CG    . TYR A 1 553 ? 8.130   -9.960   -41.473 1.00 30.77  ? 599  TYR A CG    1 
ATOM   4426 C  CD1   . TYR A 1 553 ? 8.184   -10.396  -40.155 1.00 32.63  ? 599  TYR A CD1   1 
ATOM   4427 C  CD2   . TYR A 1 553 ? 9.274   -9.399   -42.024 1.00 31.61  ? 599  TYR A CD2   1 
ATOM   4428 C  CE1   . TYR A 1 553 ? 9.342   -10.277  -39.410 1.00 32.13  ? 599  TYR A CE1   1 
ATOM   4429 C  CE2   . TYR A 1 553 ? 10.436  -9.275   -41.287 1.00 32.35  ? 599  TYR A CE2   1 
ATOM   4430 C  CZ    . TYR A 1 553 ? 10.464  -9.716   -39.981 1.00 40.49  ? 599  TYR A CZ    1 
ATOM   4431 O  OH    . TYR A 1 553 ? 11.620  -9.595   -39.243 1.00 41.47  ? 599  TYR A OH    1 
ATOM   4432 N  N     . ALA A 1 554 ? 6.383   -7.977   -39.961 1.00 31.22  ? 600  ALA A N     1 
ATOM   4433 C  CA    . ALA A 1 554 ? 6.118   -7.726   -38.541 1.00 32.76  ? 600  ALA A CA    1 
ATOM   4434 C  C     . ALA A 1 554 ? 5.278   -6.454   -38.243 1.00 38.71  ? 600  ALA A C     1 
ATOM   4435 O  O     . ALA A 1 554 ? 5.120   -6.091   -37.069 1.00 36.68  ? 600  ALA A O     1 
ATOM   4436 C  CB    . ALA A 1 554 ? 7.423   -7.695   -37.769 1.00 33.21  ? 600  ALA A CB    1 
ATOM   4437 N  N     . GLY A 1 555 ? 4.778   -5.788   -39.294 1.00 38.42  ? 601  GLY A N     1 
ATOM   4438 C  CA    . GLY A 1 555 ? 3.957   -4.580   -39.141 1.00 38.70  ? 601  GLY A CA    1 
ATOM   4439 C  C     . GLY A 1 555 ? 4.176   -3.433   -40.110 1.00 41.13  ? 601  GLY A C     1 
ATOM   4440 O  O     . GLY A 1 555 ? 5.178   -3.386   -40.814 1.00 38.85  ? 601  GLY A O     1 
ATOM   4441 N  N     . LYS A 1 556 ? 3.216   -2.479   -40.145 1.00 39.52  ? 602  LYS A N     1 
ATOM   4442 C  CA    . LYS A 1 556 ? 3.305   -1.296   -40.992 1.00 38.58  ? 602  LYS A CA    1 
ATOM   4443 C  C     . LYS A 1 556 ? 4.266   -0.337   -40.328 1.00 41.18  ? 602  LYS A C     1 
ATOM   4444 O  O     . LYS A 1 556 ? 4.171   -0.074   -39.111 1.00 41.10  ? 602  LYS A O     1 
ATOM   4445 C  CB    . LYS A 1 556 ? 1.925   -0.638   -41.204 1.00 42.62  ? 602  LYS A CB    1 
ATOM   4446 C  CG    . LYS A 1 556 ? 1.973   0.703    -41.972 1.00 51.13  ? 602  LYS A CG    1 
ATOM   4447 C  CD    . LYS A 1 556 ? 0.589   1.343    -42.237 1.00 60.16  ? 602  LYS A CD    1 
ATOM   4448 C  CE    . LYS A 1 556 ? -0.118  1.887    -41.014 1.00 84.73  ? 602  LYS A CE    1 
ATOM   4449 N  NZ    . LYS A 1 556 ? 0.730   2.833    -40.242 1.00 106.37 ? 602  LYS A NZ    1 
ATOM   4450 N  N     . VAL A 1 557 ? 5.229   0.148    -41.112 1.00 34.68  ? 603  VAL A N     1 
ATOM   4451 C  CA    . VAL A 1 557 ? 6.222   1.088    -40.605 1.00 32.61  ? 603  VAL A CA    1 
ATOM   4452 C  C     . VAL A 1 557 ? 6.202   2.308    -41.493 1.00 33.20  ? 603  VAL A C     1 
ATOM   4453 O  O     . VAL A 1 557 ? 6.321   2.198    -42.712 1.00 30.71  ? 603  VAL A O     1 
ATOM   4454 C  CB    . VAL A 1 557 ? 7.655   0.471    -40.485 1.00 36.72  ? 603  VAL A CB    1 
ATOM   4455 C  CG1   . VAL A 1 557 ? 8.543   1.358    -39.615 1.00 36.37  ? 603  VAL A CG1   1 
ATOM   4456 C  CG2   . VAL A 1 557 ? 7.616   -0.953   -39.922 1.00 35.82  ? 603  VAL A CG2   1 
ATOM   4457 N  N     . ASP A 1 558 ? 6.052   3.463    -40.861 1.00 31.94  ? 604  ASP A N     1 
ATOM   4458 C  CA    . ASP A 1 558 ? 6.019   4.802    -41.438 1.00 32.01  ? 604  ASP A CA    1 
ATOM   4459 C  C     . ASP A 1 558 ? 7.434   5.354    -41.516 1.00 35.28  ? 604  ASP A C     1 
ATOM   4460 O  O     . ASP A 1 558 ? 8.151   5.341    -40.518 1.00 31.80  ? 604  ASP A O     1 
ATOM   4461 C  CB    . ASP A 1 558 ? 5.113   5.716    -40.586 1.00 32.62  ? 604  ASP A CB    1 
ATOM   4462 C  CG    . ASP A 1 558 ? 3.699   5.143    -40.321 1.00 42.92  ? 604  ASP A CG    1 
ATOM   4463 O  OD1   . ASP A 1 558 ? 3.147   4.456    -41.219 1.00 38.54  ? 604  ASP A OD1   1 
ATOM   4464 O  OD2   . ASP A 1 558 ? 3.177   5.336    -39.202 1.00 47.44  ? 604  ASP A OD2   1 
ATOM   4465 N  N     . TYR A 1 559 ? 7.839   5.800    -42.715 1.00 34.18  ? 605  TYR A N     1 
ATOM   4466 C  CA    . TYR A 1 559 ? 9.191   6.297    -42.978 1.00 34.61  ? 605  TYR A CA    1 
ATOM   4467 C  C     . TYR A 1 559 ? 9.233   7.782    -43.310 1.00 39.32  ? 605  TYR A C     1 
ATOM   4468 O  O     . TYR A 1 559 ? 8.473   8.229    -44.167 1.00 38.64  ? 605  TYR A O     1 
ATOM   4469 C  CB    . TYR A 1 559 ? 9.874   5.468    -44.094 1.00 35.91  ? 605  TYR A CB    1 
ATOM   4470 C  CG    . TYR A 1 559 ? 10.200  4.055    -43.666 1.00 37.09  ? 605  TYR A CG    1 
ATOM   4471 C  CD1   . TYR A 1 559 ? 11.250  3.798    -42.791 1.00 38.32  ? 605  TYR A CD1   1 
ATOM   4472 C  CD2   . TYR A 1 559 ? 9.425   2.981    -44.090 1.00 37.86  ? 605  TYR A CD2   1 
ATOM   4473 C  CE1   . TYR A 1 559 ? 11.505  2.513    -42.325 1.00 37.79  ? 605  TYR A CE1   1 
ATOM   4474 C  CE2   . TYR A 1 559 ? 9.700   1.682    -43.669 1.00 38.95  ? 605  TYR A CE2   1 
ATOM   4475 C  CZ    . TYR A 1 559 ? 10.745  1.452    -42.786 1.00 44.07  ? 605  TYR A CZ    1 
ATOM   4476 O  OH    . TYR A 1 559 ? 11.037  0.183    -42.347 1.00 36.49  ? 605  TYR A OH    1 
ATOM   4477 N  N     . LYS A 1 560 ? 10.131  8.542    -42.618 1.00 36.41  ? 606  LYS A N     1 
ATOM   4478 C  CA    . LYS A 1 560 ? 10.394  9.967    -42.863 1.00 35.81  ? 606  LYS A CA    1 
ATOM   4479 C  C     . LYS A 1 560 ? 11.719  9.974    -43.668 1.00 40.11  ? 606  LYS A C     1 
ATOM   4480 O  O     . LYS A 1 560 ? 12.725  9.445    -43.184 1.00 39.69  ? 606  LYS A O     1 
ATOM   4481 C  CB    . LYS A 1 560 ? 10.504  10.735   -41.532 1.00 38.94  ? 606  LYS A CB    1 
ATOM   4482 C  CG    . LYS A 1 560 ? 10.240  12.223   -41.649 1.00 61.21  ? 606  LYS A CG    1 
ATOM   4483 C  CD    . LYS A 1 560 ? 8.797   12.590   -41.345 1.00 75.89  ? 606  LYS A CD    1 
ATOM   4484 C  CE    . LYS A 1 560 ? 8.485   14.019   -41.730 1.00 88.61  ? 606  LYS A CE    1 
ATOM   4485 N  NZ    . LYS A 1 560 ? 8.158   14.156   -43.178 1.00 98.16  ? 606  LYS A NZ    1 
ATOM   4486 N  N     . ALA A 1 561 ? 11.691  10.439   -44.941 1.00 36.25  ? 607  ALA A N     1 
ATOM   4487 C  CA    . ALA A 1 561 ? 12.871  10.449   -45.801 1.00 36.36  ? 607  ALA A CA    1 
ATOM   4488 C  C     . ALA A 1 561 ? 13.798  11.676   -45.590 1.00 40.98  ? 607  ALA A C     1 
ATOM   4489 O  O     . ALA A 1 561 ? 14.381  12.171   -46.552 1.00 40.55  ? 607  ALA A O     1 
ATOM   4490 C  CB    . ALA A 1 561 ? 12.450  10.354   -47.257 1.00 37.21  ? 607  ALA A CB    1 
ATOM   4491 N  N     . ASN A 1 562 ? 13.957  12.144   -44.355 1.00 38.41  ? 608  ASN A N     1 
ATOM   4492 C  CA    . ASN A 1 562 ? 14.791  13.311   -44.088 1.00 39.68  ? 608  ASN A CA    1 
ATOM   4493 C  C     . ASN A 1 562 ? 16.239  12.931   -44.129 1.00 45.15  ? 608  ASN A C     1 
ATOM   4494 O  O     . ASN A 1 562 ? 16.669  12.105   -43.317 1.00 45.80  ? 608  ASN A O     1 
ATOM   4495 C  CB    . ASN A 1 562 ? 14.429  13.975   -42.749 1.00 42.09  ? 608  ASN A CB    1 
ATOM   4496 C  CG    . ASN A 1 562 ? 13.044  14.561   -42.713 1.00 75.24  ? 608  ASN A CG    1 
ATOM   4497 O  OD1   . ASN A 1 562 ? 12.275  14.491   -43.678 1.00 72.87  ? 608  ASN A OD1   1 
ATOM   4498 N  ND2   . ASN A 1 562 ? 12.699  15.183   -41.597 1.00 75.29  ? 608  ASN A ND2   1 
ATOM   4499 N  N     . GLU A 1 563 ? 16.981  13.520   -45.105 1.00 40.92  ? 609  GLU A N     1 
ATOM   4500 C  CA    . GLU A 1 563 ? 18.420  13.354   -45.357 1.00 40.92  ? 609  GLU A CA    1 
ATOM   4501 C  C     . GLU A 1 563 ? 18.779  11.958   -45.934 1.00 45.28  ? 609  GLU A C     1 
ATOM   4502 O  O     . GLU A 1 563 ? 19.904  11.492   -45.759 1.00 44.41  ? 609  GLU A O     1 
ATOM   4503 C  CB    . GLU A 1 563 ? 19.290  13.698   -44.121 1.00 42.27  ? 609  GLU A CB    1 
ATOM   4504 C  CG    . GLU A 1 563 ? 18.985  15.036   -43.444 1.00 57.88  ? 609  GLU A CG    1 
ATOM   4505 C  CD    . GLU A 1 563 ? 19.728  15.339   -42.154 1.00 84.50  ? 609  GLU A CD    1 
ATOM   4506 O  OE1   . GLU A 1 563 ? 20.862  14.837   -41.968 1.00 79.22  ? 609  GLU A OE1   1 
ATOM   4507 O  OE2   . GLU A 1 563 ? 19.188  16.131   -41.348 1.00 84.66  ? 609  GLU A OE2   1 
ATOM   4508 N  N     . TRP A 1 564 ? 17.839  11.324   -46.658 1.00 41.71  ? 610  TRP A N     1 
ATOM   4509 C  CA    . TRP A 1 564 ? 18.065  10.016   -47.282 1.00 40.35  ? 610  TRP A CA    1 
ATOM   4510 C  C     . TRP A 1 564 ? 18.984  10.071   -48.464 1.00 43.12  ? 610  TRP A C     1 
ATOM   4511 O  O     . TRP A 1 564 ? 19.758  9.128    -48.649 1.00 42.06  ? 610  TRP A O     1 
ATOM   4512 C  CB    . TRP A 1 564 ? 16.751  9.343    -47.665 1.00 38.46  ? 610  TRP A CB    1 
ATOM   4513 C  CG    . TRP A 1 564 ? 16.045  8.697    -46.510 1.00 39.02  ? 610  TRP A CG    1 
ATOM   4514 C  CD1   . TRP A 1 564 ? 16.077  9.085    -45.196 1.00 41.83  ? 610  TRP A CD1   1 
ATOM   4515 C  CD2   . TRP A 1 564 ? 15.154  7.575    -46.585 1.00 38.79  ? 610  TRP A CD2   1 
ATOM   4516 N  NE1   . TRP A 1 564 ? 15.254  8.275    -44.448 1.00 41.46  ? 610  TRP A NE1   1 
ATOM   4517 C  CE2   . TRP A 1 564 ? 14.684  7.329    -45.273 1.00 42.85  ? 610  TRP A CE2   1 
ATOM   4518 C  CE3   . TRP A 1 564 ? 14.703  6.751    -47.629 1.00 40.68  ? 610  TRP A CE3   1 
ATOM   4519 C  CZ2   . TRP A 1 564 ? 13.776  6.293    -44.988 1.00 41.66  ? 610  TRP A CZ2   1 
ATOM   4520 C  CZ3   . TRP A 1 564 ? 13.822  5.717    -47.339 1.00 41.56  ? 610  TRP A CZ3   1 
ATOM   4521 C  CH2   . TRP A 1 564 ? 13.365  5.503    -46.032 1.00 42.13  ? 610  TRP A CH2   1 
ATOM   4522 N  N     . LEU A 1 565 ? 18.939  11.157   -49.270 1.00 40.59  ? 611  LEU A N     1 
ATOM   4523 C  CA    . LEU A 1 565 ? 19.840  11.265   -50.436 1.00 42.02  ? 611  LEU A CA    1 
ATOM   4524 C  C     . LEU A 1 565 ? 21.313  11.304   -50.011 1.00 44.53  ? 611  LEU A C     1 
ATOM   4525 O  O     . LEU A 1 565 ? 22.187  10.746   -50.654 1.00 40.92  ? 611  LEU A O     1 
ATOM   4526 C  CB    . LEU A 1 565 ? 19.523  12.511   -51.279 1.00 43.38  ? 611  LEU A CB    1 
ATOM   4527 C  CG    . LEU A 1 565 ? 18.098  12.718   -51.872 1.00 49.68  ? 611  LEU A CG    1 
ATOM   4528 C  CD1   . LEU A 1 565 ? 18.145  13.765   -52.958 1.00 50.60  ? 611  LEU A CD1   1 
ATOM   4529 C  CD2   . LEU A 1 565 ? 17.536  11.465   -52.500 1.00 51.06  ? 611  LEU A CD2   1 
ATOM   4530 N  N     . MET A 1 566 ? 21.557  11.944   -48.889 1.00 46.39  ? 612  MET A N     1 
ATOM   4531 C  CA    . MET A 1 566 ? 22.870  12.146   -48.308 1.00 48.15  ? 612  MET A CA    1 
ATOM   4532 C  C     . MET A 1 566 ? 23.349  10.913   -47.531 1.00 46.24  ? 612  MET A C     1 
ATOM   4533 O  O     . MET A 1 566 ? 24.485  10.506   -47.736 1.00 43.48  ? 612  MET A O     1 
ATOM   4534 C  CB    . MET A 1 566 ? 22.885  13.450   -47.480 1.00 52.39  ? 612  MET A CB    1 
ATOM   4535 C  CG    . MET A 1 566 ? 22.667  14.726   -48.341 1.00 59.10  ? 612  MET A CG    1 
ATOM   4536 S  SD    . MET A 1 566 ? 24.024  15.186   -49.499 1.00 66.56  ? 612  MET A SD    1 
ATOM   4537 C  CE    . MET A 1 566 ? 23.557  14.254   -50.994 1.00 63.16  ? 612  MET A CE    1 
ATOM   4538 N  N     . LYS A 1 567 ? 22.484  10.288   -46.703 1.00 40.84  ? 613  LYS A N     1 
ATOM   4539 C  CA    . LYS A 1 567 ? 22.811  9.069    -45.952 1.00 40.61  ? 613  LYS A CA    1 
ATOM   4540 C  C     . LYS A 1 567 ? 23.088  7.888    -46.912 1.00 45.49  ? 613  LYS A C     1 
ATOM   4541 O  O     . LYS A 1 567 ? 23.796  6.965    -46.519 1.00 46.06  ? 613  LYS A O     1 
ATOM   4542 C  CB    . LYS A 1 567 ? 21.664  8.686    -45.001 1.00 43.93  ? 613  LYS A CB    1 
ATOM   4543 C  CG    . LYS A 1 567 ? 21.575  9.488    -43.726 1.00 53.58  ? 613  LYS A CG    1 
ATOM   4544 C  CD    . LYS A 1 567 ? 20.280  9.181    -42.972 1.00 63.89  ? 613  LYS A CD    1 
ATOM   4545 C  CE    . LYS A 1 567 ? 20.281  9.803    -41.598 1.00 63.50  ? 613  LYS A CE    1 
ATOM   4546 N  NZ    . LYS A 1 567 ? 19.164  9.298    -40.760 1.00 72.53  ? 613  LYS A NZ    1 
ATOM   4547 N  N     . ASN A 1 568 ? 22.538  7.921    -48.155 1.00 40.49  ? 614  ASN A N     1 
ATOM   4548 C  CA    . ASN A 1 568 ? 22.739  6.877    -49.178 1.00 39.79  ? 614  ASN A CA    1 
ATOM   4549 C  C     . ASN A 1 568 ? 24.018  7.151    -49.993 1.00 43.51  ? 614  ASN A C     1 
ATOM   4550 O  O     . ASN A 1 568 ? 24.827  6.241    -50.192 1.00 40.66  ? 614  ASN A O     1 
ATOM   4551 C  CB    . ASN A 1 568 ? 21.513  6.758    -50.109 1.00 33.04  ? 614  ASN A CB    1 
ATOM   4552 C  CG    . ASN A 1 568 ? 21.544  5.610    -51.087 1.00 47.74  ? 614  ASN A CG    1 
ATOM   4553 O  OD1   . ASN A 1 568 ? 21.684  4.438    -50.715 1.00 32.28  ? 614  ASN A OD1   1 
ATOM   4554 N  ND2   . ASN A 1 568 ? 21.378  5.922    -52.364 1.00 40.35  ? 614  ASN A ND2   1 
ATOM   4555 N  N     . MET A 1 569 ? 24.187  8.391    -50.469 1.00 42.84  ? 615  MET A N     1 
ATOM   4556 C  CA    . MET A 1 569 ? 25.359  8.808    -51.236 1.00 45.57  ? 615  MET A CA    1 
ATOM   4557 C  C     . MET A 1 569 ? 26.624  8.867    -50.336 1.00 43.92  ? 615  MET A C     1 
ATOM   4558 O  O     . MET A 1 569 ? 27.726  8.646    -50.828 1.00 41.78  ? 615  MET A O     1 
ATOM   4559 C  CB    . MET A 1 569 ? 25.058  10.141   -51.931 1.00 51.02  ? 615  MET A CB    1 
ATOM   4560 C  CG    . MET A 1 569 ? 26.211  10.731   -52.705 1.00 59.03  ? 615  MET A CG    1 
ATOM   4561 S  SD    . MET A 1 569 ? 25.774  12.404   -53.267 1.00 67.54  ? 615  MET A SD    1 
ATOM   4562 C  CE    . MET A 1 569 ? 25.083  11.951   -54.935 1.00 64.20  ? 615  MET A CE    1 
ATOM   4563 N  N     . ASP A 1 570 ? 26.437  9.085    -49.003 1.00 39.97  ? 616  ASP A N     1 
ATOM   4564 C  CA    . ASP A 1 570 ? 27.470  9.129    -47.964 1.00 40.14  ? 616  ASP A CA    1 
ATOM   4565 C  C     . ASP A 1 570 ? 28.647  10.076   -48.378 1.00 43.07  ? 616  ASP A C     1 
ATOM   4566 O  O     . ASP A 1 570 ? 29.780  9.629    -48.613 1.00 37.77  ? 616  ASP A O     1 
ATOM   4567 C  CB    . ASP A 1 570 ? 27.926  7.686    -47.619 1.00 42.30  ? 616  ASP A CB    1 
ATOM   4568 C  CG    . ASP A 1 570 ? 28.297  7.439    -46.164 1.00 61.67  ? 616  ASP A CG    1 
ATOM   4569 O  OD1   . ASP A 1 570 ? 28.002  8.312    -45.316 1.00 66.60  ? 616  ASP A OD1   1 
ATOM   4570 O  OD2   . ASP A 1 570 ? 28.847  6.362    -45.868 1.00 67.11  ? 616  ASP A OD2   1 
ATOM   4571 N  N     . PRO A 1 571 ? 28.396  11.393   -48.554 1.00 43.51  ? 617  PRO A N     1 
ATOM   4572 C  CA    . PRO A 1 571 ? 29.489  12.252   -49.017 1.00 44.81  ? 617  PRO A CA    1 
ATOM   4573 C  C     . PRO A 1 571 ? 30.434  12.699   -47.902 1.00 49.48  ? 617  PRO A C     1 
ATOM   4574 O  O     . PRO A 1 571 ? 30.040  12.793   -46.754 1.00 51.09  ? 617  PRO A O     1 
ATOM   4575 C  CB    . PRO A 1 571 ? 28.759  13.396   -49.725 1.00 46.62  ? 617  PRO A CB    1 
ATOM   4576 C  CG    . PRO A 1 571 ? 27.428  13.473   -49.048 1.00 50.60  ? 617  PRO A CG    1 
ATOM   4577 C  CD    . PRO A 1 571 ? 27.162  12.171   -48.340 1.00 45.46  ? 617  PRO A CD    1 
ATOM   4578 N  N     . LEU A 1 572 ? 31.679  12.942   -48.254 1.00 45.55  ? 618  LEU A N     1 
ATOM   4579 C  CA    . LEU A 1 572 ? 32.700  13.385   -47.319 1.00 45.21  ? 618  LEU A CA    1 
ATOM   4580 C  C     . LEU A 1 572 ? 33.524  14.463   -47.952 1.00 44.80  ? 618  LEU A C     1 
ATOM   4581 O  O     . LEU A 1 572 ? 33.603  14.555   -49.153 1.00 41.44  ? 618  LEU A O     1 
ATOM   4582 C  CB    . LEU A 1 572 ? 33.668  12.261   -47.012 1.00 45.62  ? 618  LEU A CB    1 
ATOM   4583 C  CG    . LEU A 1 572 ? 33.203  11.028   -46.293 1.00 51.06  ? 618  LEU A CG    1 
ATOM   4584 C  CD1   . LEU A 1 572 ? 34.335  10.037   -46.261 1.00 51.23  ? 618  LEU A CD1   1 
ATOM   4585 C  CD2   . LEU A 1 572 ? 32.756  11.357   -44.892 1.00 52.40  ? 618  LEU A CD2   1 
ATOM   4586 N  N     . ASN A 1 573 ? 34.175  15.266   -47.141 1.00 41.33  ? 619  ASN A N     1 
ATOM   4587 C  CA    . ASN A 1 573 ? 35.035  16.279   -47.724 1.00 40.74  ? 619  ASN A CA    1 
ATOM   4588 C  C     . ASN A 1 573 ? 36.316  15.606   -48.188 1.00 44.41  ? 619  ASN A C     1 
ATOM   4589 O  O     . ASN A 1 573 ? 36.996  14.931   -47.416 1.00 41.20  ? 619  ASN A O     1 
ATOM   4590 C  CB    . ASN A 1 573 ? 35.351  17.372   -46.702 1.00 38.00  ? 619  ASN A CB    1 
ATOM   4591 C  CG    . ASN A 1 573 ? 35.997  18.590   -47.332 1.00 44.31  ? 619  ASN A CG    1 
ATOM   4592 O  OD1   . ASN A 1 573 ? 35.733  18.918   -48.489 1.00 38.15  ? 619  ASN A OD1   1 
ATOM   4593 N  ND2   . ASN A 1 573 ? 36.849  19.267   -46.572 1.00 38.25  ? 619  ASN A ND2   1 
ATOM   4594 N  N     . ASP A 1 574 ? 36.651  15.804   -49.458 1.00 45.03  ? 620  ASP A N     1 
ATOM   4595 C  CA    . ASP A 1 574 ? 37.884  15.264   -50.015 1.00 46.18  ? 620  ASP A CA    1 
ATOM   4596 C  C     . ASP A 1 574 ? 39.125  15.892   -49.366 1.00 44.62  ? 620  ASP A C     1 
ATOM   4597 O  O     . ASP A 1 574 ? 40.103  15.201   -49.081 1.00 43.72  ? 620  ASP A O     1 
ATOM   4598 C  CB    . ASP A 1 574 ? 37.921  15.471   -51.530 1.00 50.12  ? 620  ASP A CB    1 
ATOM   4599 C  CG    . ASP A 1 574 ? 39.141  14.842   -52.175 1.00 85.76  ? 620  ASP A CG    1 
ATOM   4600 O  OD1   . ASP A 1 574 ? 39.949  14.227   -51.448 1.00 90.57  ? 620  ASP A OD1   1 
ATOM   4601 O  OD2   . ASP A 1 574 ? 39.290  14.960   -53.409 1.00 99.41  ? 620  ASP A OD2   1 
ATOM   4602 N  N     . ASN A 1 575 ? 39.074  17.204   -49.136 1.00 38.33  ? 621  ASN A N     1 
ATOM   4603 C  CA    . ASN A 1 575 ? 40.200  17.942   -48.553 1.00 36.67  ? 621  ASN A CA    1 
ATOM   4604 C  C     . ASN A 1 575 ? 40.579  17.517   -47.132 1.00 36.63  ? 621  ASN A C     1 
ATOM   4605 O  O     . ASN A 1 575 ? 41.760  17.376   -46.816 1.00 37.20  ? 621  ASN A O     1 
ATOM   4606 C  CB    . ASN A 1 575 ? 39.921  19.448   -48.587 1.00 40.88  ? 621  ASN A CB    1 
ATOM   4607 C  CG    . ASN A 1 575 ? 39.978  20.020   -49.990 1.00 80.04  ? 621  ASN A CG    1 
ATOM   4608 O  OD1   . ASN A 1 575 ? 41.057  20.215   -50.550 1.00 83.84  ? 621  ASN A OD1   1 
ATOM   4609 N  ND2   . ASN A 1 575 ? 38.813  20.291   -50.566 1.00 65.30  ? 621  ASN A ND2   1 
ATOM   4610 N  N     . VAL A 1 576 ? 39.578  17.310   -46.283 1.00 33.45  ? 622  VAL A N     1 
ATOM   4611 C  CA    . VAL A 1 576 ? 39.820  16.864   -44.889 1.00 32.37  ? 622  VAL A CA    1 
ATOM   4612 C  C     . VAL A 1 576 ? 40.238  15.378   -44.832 1.00 36.97  ? 622  VAL A C     1 
ATOM   4613 O  O     . VAL A 1 576 ? 41.171  15.038   -44.090 1.00 34.80  ? 622  VAL A O     1 
ATOM   4614 C  CB    . VAL A 1 576 ? 38.668  17.183   -43.919 1.00 35.26  ? 622  VAL A CB    1 
ATOM   4615 C  CG1   . VAL A 1 576 ? 38.988  16.726   -42.495 1.00 34.08  ? 622  VAL A CG1   1 
ATOM   4616 C  CG2   . VAL A 1 576 ? 38.340  18.676   -43.924 1.00 35.65  ? 622  VAL A CG2   1 
ATOM   4617 N  N     . ALA A 1 577 ? 39.585  14.514   -45.657 1.00 36.03  ? 623  ALA A N     1 
ATOM   4618 C  CA    . ALA A 1 577 ? 39.888  13.076   -45.740 1.00 36.74  ? 623  ALA A CA    1 
ATOM   4619 C  C     . ALA A 1 577 ? 41.346  12.864   -46.076 1.00 42.91  ? 623  ALA A C     1 
ATOM   4620 O  O     . ALA A 1 577 ? 42.028  12.181   -45.305 1.00 43.41  ? 623  ALA A O     1 
ATOM   4621 C  CB    . ALA A 1 577 ? 38.977  12.379   -46.742 1.00 37.00  ? 623  ALA A CB    1 
ATOM   4622 N  N     . ALA A 1 578 ? 41.866  13.578   -47.116 1.00 41.24  ? 624  ALA A N     1 
ATOM   4623 C  CA    . ALA A 1 578 ? 43.298  13.576   -47.512 1.00 40.79  ? 624  ALA A CA    1 
ATOM   4624 C  C     . ALA A 1 578 ? 44.197  13.977   -46.349 1.00 43.60  ? 624  ALA A C     1 
ATOM   4625 O  O     . ALA A 1 578 ? 45.224  13.355   -46.135 1.00 44.26  ? 624  ALA A O     1 
ATOM   4626 C  CB    . ALA A 1 578 ? 43.527  14.538   -48.666 1.00 41.29  ? 624  ALA A CB    1 
ATOM   4627 N  N     . LEU A 1 579 ? 43.799  14.985   -45.583 1.00 38.67  ? 625  LEU A N     1 
ATOM   4628 C  CA    . LEU A 1 579 ? 44.578  15.460   -44.441 1.00 38.78  ? 625  LEU A CA    1 
ATOM   4629 C  C     . LEU A 1 579 ? 44.646  14.377   -43.359 1.00 39.54  ? 625  LEU A C     1 
ATOM   4630 O  O     . LEU A 1 579 ? 45.716  14.141   -42.813 1.00 38.22  ? 625  LEU A O     1 
ATOM   4631 C  CB    . LEU A 1 579 ? 43.991  16.773   -43.852 1.00 38.92  ? 625  LEU A CB    1 
ATOM   4632 C  CG    . LEU A 1 579 ? 43.907  18.032   -44.737 1.00 44.60  ? 625  LEU A CG    1 
ATOM   4633 C  CD1   . LEU A 1 579 ? 43.334  19.163   -43.951 1.00 44.06  ? 625  LEU A CD1   1 
ATOM   4634 C  CD2   . LEU A 1 579 ? 45.287  18.496   -45.230 1.00 47.54  ? 625  LEU A CD2   1 
ATOM   4635 N  N     . LEU A 1 580 ? 43.506  13.727   -43.054 1.00 36.61  ? 626  LEU A N     1 
ATOM   4636 C  CA    . LEU A 1 580 ? 43.426  12.615   -42.087 1.00 37.01  ? 626  LEU A CA    1 
ATOM   4637 C  C     . LEU A 1 580 ? 44.297  11.407   -42.563 1.00 39.20  ? 626  LEU A C     1 
ATOM   4638 O  O     . LEU A 1 580 ? 44.880  10.713   -41.742 1.00 37.57  ? 626  LEU A O     1 
ATOM   4639 C  CB    . LEU A 1 580 ? 41.962  12.181   -41.862 1.00 36.75  ? 626  LEU A CB    1 
ATOM   4640 C  CG    . LEU A 1 580 ? 41.037  13.219   -41.202 1.00 40.86  ? 626  LEU A CG    1 
ATOM   4641 C  CD1   . LEU A 1 580 ? 39.603  12.729   -41.171 1.00 41.69  ? 626  LEU A CD1   1 
ATOM   4642 C  CD2   . LEU A 1 580 ? 41.469  13.504   -39.795 1.00 42.57  ? 626  LEU A CD2   1 
ATOM   4643 N  N     . HIS A 1 581 ? 44.433  11.225   -43.877 1.00 35.72  ? 627  HIS A N     1 
ATOM   4644 C  CA    . HIS A 1 581 ? 45.238  10.172   -44.473 1.00 37.52  ? 627  HIS A CA    1 
ATOM   4645 C  C     . HIS A 1 581 ? 46.740  10.444   -44.216 1.00 38.54  ? 627  HIS A C     1 
ATOM   4646 O  O     . HIS A 1 581 ? 47.530  9.505    -43.969 1.00 34.39  ? 627  HIS A O     1 
ATOM   4647 C  CB    . HIS A 1 581 ? 44.925  10.135   -45.976 1.00 39.65  ? 627  HIS A CB    1 
ATOM   4648 C  CG    . HIS A 1 581 ? 45.627  9.079    -46.755 1.00 44.38  ? 627  HIS A CG    1 
ATOM   4649 N  ND1   . HIS A 1 581 ? 45.428  7.729    -46.488 1.00 47.01  ? 627  HIS A ND1   1 
ATOM   4650 C  CD2   . HIS A 1 581 ? 46.409  9.196    -47.853 1.00 47.24  ? 627  HIS A CD2   1 
ATOM   4651 C  CE1   . HIS A 1 581 ? 46.125  7.077    -47.406 1.00 46.57  ? 627  HIS A CE1   1 
ATOM   4652 N  NE2   . HIS A 1 581 ? 46.731  7.916    -48.250 1.00 47.09  ? 627  HIS A NE2   1 
ATOM   4653 N  N     . GLN A 1 582 ? 47.102  11.751   -44.261 1.00 33.75  ? 628  GLN A N     1 
ATOM   4654 C  CA    . GLN A 1 582 ? 48.466  12.269   -44.081 1.00 33.86  ? 628  GLN A CA    1 
ATOM   4655 C  C     . GLN A 1 582 ? 48.705  12.641   -42.641 1.00 38.63  ? 628  GLN A C     1 
ATOM   4656 O  O     . GLN A 1 582 ? 49.645  13.366   -42.364 1.00 38.85  ? 628  GLN A O     1 
ATOM   4657 C  CB    . GLN A 1 582 ? 48.736  13.490   -44.999 1.00 35.02  ? 628  GLN A CB    1 
ATOM   4658 C  CG    . GLN A 1 582 ? 48.505  13.226   -46.502 1.00 45.31  ? 628  GLN A CG    1 
ATOM   4659 C  CD    . GLN A 1 582 ? 48.372  14.490   -47.331 1.00 72.81  ? 628  GLN A CD    1 
ATOM   4660 O  OE1   . GLN A 1 582 ? 47.871  15.540   -46.880 1.00 65.32  ? 628  GLN A OE1   1 
ATOM   4661 N  NE2   . GLN A 1 582 ? 48.766  14.400   -48.596 1.00 75.52  ? 628  GLN A NE2   1 
ATOM   4662 N  N     . SER A 1 583 ? 47.899  12.132   -41.739 1.00 36.30  ? 629  SER A N     1 
ATOM   4663 C  CA    . SER A 1 583 ? 47.996  12.425   -40.338 1.00 36.30  ? 629  SER A CA    1 
ATOM   4664 C  C     . SER A 1 583 ? 49.249  11.944   -39.644 1.00 44.53  ? 629  SER A C     1 
ATOM   4665 O  O     . SER A 1 583 ? 49.748  10.882   -39.916 1.00 45.58  ? 629  SER A O     1 
ATOM   4666 C  CB    . SER A 1 583 ? 46.815  11.820   -39.631 1.00 35.86  ? 629  SER A CB    1 
ATOM   4667 O  OG    . SER A 1 583 ? 46.889  12.055   -38.274 1.00 40.58  ? 629  SER A OG    1 
ATOM   4668 N  N     . THR A 1 584 ? 49.746  12.755   -38.717 1.00 40.96  ? 630  THR A N     1 
ATOM   4669 C  CA    . THR A 1 584 ? 50.921  12.394   -37.934 1.00 41.30  ? 630  THR A CA    1 
ATOM   4670 C  C     . THR A 1 584 ? 50.644  11.175   -37.049 1.00 46.91  ? 630  THR A C     1 
ATOM   4671 O  O     . THR A 1 584 ? 51.495  10.298   -36.897 1.00 49.33  ? 630  THR A O     1 
ATOM   4672 C  CB    . THR A 1 584 ? 51.390  13.564   -37.049 1.00 51.82  ? 630  THR A CB    1 
ATOM   4673 O  OG1   . THR A 1 584 ? 50.346  13.927   -36.138 1.00 53.04  ? 630  THR A OG1   1 
ATOM   4674 C  CG2   . THR A 1 584 ? 51.751  14.768   -37.906 1.00 46.24  ? 630  THR A CG2   1 
ATOM   4675 N  N     . ASP A 1 585 ? 49.446  11.133   -36.468 1.00 41.85  ? 631  ASP A N     1 
ATOM   4676 C  CA    . ASP A 1 585 ? 49.040  10.050   -35.569 1.00 41.33  ? 631  ASP A CA    1 
ATOM   4677 C  C     . ASP A 1 585 ? 48.955  8.676    -36.240 1.00 41.24  ? 631  ASP A C     1 
ATOM   4678 O  O     . ASP A 1 585 ? 48.479  8.549    -37.368 1.00 38.93  ? 631  ASP A O     1 
ATOM   4679 C  CB    . ASP A 1 585 ? 47.701  10.393   -34.908 1.00 43.79  ? 631  ASP A CB    1 
ATOM   4680 C  CG    . ASP A 1 585 ? 47.339  9.437    -33.787 1.00 57.50  ? 631  ASP A CG    1 
ATOM   4681 O  OD1   . ASP A 1 585 ? 48.157  8.546    -33.476 1.00 59.53  ? 631  ASP A OD1   1 
ATOM   4682 O  OD2   . ASP A 1 585 ? 46.237  9.577    -33.217 1.00 64.69  ? 631  ASP A OD2   1 
ATOM   4683 N  N     . ARG A 1 586 ? 49.434  7.675    -35.546 1.00 37.84  ? 632  ARG A N     1 
ATOM   4684 C  CA    . ARG A 1 586 ? 49.404  6.362    -36.103 1.00 36.95  ? 632  ARG A CA    1 
ATOM   4685 C  C     . ARG A 1 586 ? 47.992  5.814    -36.310 1.00 40.02  ? 632  ARG A C     1 
ATOM   4686 O  O     . ARG A 1 586 ? 47.673  5.346    -37.373 1.00 40.36  ? 632  ARG A O     1 
ATOM   4687 C  CB    . ARG A 1 586 ? 50.269  5.424    -35.259 1.00 39.23  ? 632  ARG A CB    1 
ATOM   4688 C  CG    . ARG A 1 586 ? 50.579  4.105    -35.937 1.00 60.27  ? 632  ARG A CG    1 
ATOM   4689 C  CD    . ARG A 1 586 ? 50.992  2.976    -34.989 1.00 72.83  ? 632  ARG A CD    1 
ATOM   4690 N  NE    . ARG A 1 586 ? 50.120  2.810    -33.820 1.00 79.87  ? 632  ARG A NE    1 
ATOM   4691 C  CZ    . ARG A 1 586 ? 48.883  2.329    -33.840 1.00 84.89  ? 632  ARG A CZ    1 
ATOM   4692 N  NH1   . ARG A 1 586 ? 48.313  1.983    -34.976 1.00 80.93  ? 632  ARG A NH1   1 
ATOM   4693 N  NH2   . ARG A 1 586 ? 48.216  2.230    -32.724 1.00 41.95  ? 632  ARG A NH2   1 
ATOM   4694 N  N     . LEU A 1 587 ? 47.124  5.928    -35.327 1.00 35.73  ? 633  LEU A N     1 
ATOM   4695 C  CA    . LEU A 1 587 ? 45.782  5.404    -35.502 1.00 36.27  ? 633  LEU A CA    1 
ATOM   4696 C  C     . LEU A 1 587 ? 44.929  6.096    -36.529 1.00 37.83  ? 633  LEU A C     1 
ATOM   4697 O  O     . LEU A 1 587 ? 44.278  5.432    -37.287 1.00 37.19  ? 633  LEU A O     1 
ATOM   4698 C  CB    . LEU A 1 587 ? 45.034  5.278    -34.193 1.00 37.70  ? 633  LEU A CB    1 
ATOM   4699 C  CG    . LEU A 1 587 ? 43.796  4.399    -34.231 1.00 43.23  ? 633  LEU A CG    1 
ATOM   4700 C  CD1   . LEU A 1 587 ? 44.134  3.092    -34.890 1.00 44.18  ? 633  LEU A CD1   1 
ATOM   4701 C  CD2   . LEU A 1 587 ? 43.241  4.151    -32.851 1.00 44.61  ? 633  LEU A CD2   1 
ATOM   4702 N  N     . THR A 1 588 ? 44.976  7.423    -36.557 1.00 32.22  ? 634  THR A N     1 
ATOM   4703 C  CA    . THR A 1 588 ? 44.173  8.204    -37.462 1.00 30.89  ? 634  THR A CA    1 
ATOM   4704 C  C     . THR A 1 588 ? 44.546  7.868    -38.861 1.00 36.31  ? 634  THR A C     1 
ATOM   4705 O  O     . THR A 1 588 ? 43.712  7.555    -39.642 1.00 35.15  ? 634  THR A O     1 
ATOM   4706 C  CB    . THR A 1 588 ? 44.403  9.722    -37.274 1.00 30.32  ? 634  THR A CB    1 
ATOM   4707 O  OG1   . THR A 1 588 ? 44.071  10.110   -35.963 1.00 33.73  ? 634  THR A OG1   1 
ATOM   4708 C  CG2   . THR A 1 588 ? 43.616  10.507   -38.232 1.00 19.33  ? 634  THR A CG2   1 
ATOM   4709 N  N     . ALA A 1 589 ? 45.838  7.867    -39.119 1.00 35.53  ? 635  ALA A N     1 
ATOM   4710 C  CA    . ALA A 1 589 ? 46.404  7.498    -40.424 1.00 35.69  ? 635  ALA A CA    1 
ATOM   4711 C  C     . ALA A 1 589 ? 46.038  6.089    -40.803 1.00 37.29  ? 635  ALA A C     1 
ATOM   4712 O  O     . ALA A 1 589 ? 45.848  5.839    -41.985 1.00 36.94  ? 635  ALA A O     1 
ATOM   4713 C  CB    . ALA A 1 589 ? 47.930  7.637    -40.414 1.00 36.46  ? 635  ALA A CB    1 
ATOM   4714 N  N     . GLU A 1 590 ? 46.079  5.151    -39.860 1.00 35.26  ? 636  GLU A N     1 
ATOM   4715 C  CA    . GLU A 1 590 ? 45.740  3.763    -40.176 1.00 37.35  ? 636  GLU A CA    1 
ATOM   4716 C  C     . GLU A 1 590 ? 44.277  3.557    -40.574 1.00 39.74  ? 636  GLU A C     1 
ATOM   4717 O  O     . GLU A 1 590 ? 43.982  2.875    -41.555 1.00 36.65  ? 636  GLU A O     1 
ATOM   4718 C  CB    . GLU A 1 590 ? 46.092  2.849    -38.999 1.00 39.58  ? 636  GLU A CB    1 
ATOM   4719 C  CG    . GLU A 1 590 ? 45.790  1.379    -39.244 1.00 56.09  ? 636  GLU A CG    1 
ATOM   4720 C  CD    . GLU A 1 590 ? 46.554  0.817    -40.427 1.00 88.02  ? 636  GLU A CD    1 
ATOM   4721 O  OE1   . GLU A 1 590 ? 47.331  1.572    -41.048 1.00 94.73  ? 636  GLU A OE1   1 
ATOM   4722 O  OE2   . GLU A 1 590 ? 46.378  -0.381   -40.735 1.00 91.88  ? 636  GLU A OE2   1 
ATOM   4723 N  N     . ILE A 1 591 ? 43.369  4.152    -39.807 1.00 35.33  ? 637  ILE A N     1 
ATOM   4724 C  CA    . ILE A 1 591 ? 41.938  4.056    -40.082 1.00 35.12  ? 637  ILE A CA    1 
ATOM   4725 C  C     . ILE A 1 591 ? 41.591  4.772    -41.378 1.00 40.06  ? 637  ILE A C     1 
ATOM   4726 O  O     . ILE A 1 591 ? 40.782  4.305    -42.181 1.00 36.85  ? 637  ILE A O     1 
ATOM   4727 C  CB    . ILE A 1 591 ? 41.101  4.653    -38.935 1.00 37.31  ? 637  ILE A CB    1 
ATOM   4728 C  CG1   . ILE A 1 591 ? 41.390  6.148    -38.786 1.00 37.13  ? 637  ILE A CG1   1 
ATOM   4729 C  CG2   . ILE A 1 591 ? 41.381  3.919    -37.633 1.00 35.67  ? 637  ILE A CG2   1 
ATOM   4730 C  CD1   . ILE A 1 591 ? 40.605  6.815    -37.679 1.00 36.62  ? 637  ILE A CD1   1 
ATOM   4731 N  N     . TRP A 1 592 ? 42.229  5.921    -41.555 1.00 39.22  ? 638  TRP A N     1 
ATOM   4732 C  CA    . TRP A 1 592 ? 42.036  6.801    -42.714 1.00 39.44  ? 638  TRP A CA    1 
ATOM   4733 C  C     . TRP A 1 592 ? 42.958  6.433    -43.939 1.00 46.08  ? 638  TRP A C     1 
ATOM   4734 O  O     . TRP A 1 592 ? 42.992  7.168    -44.932 1.00 45.55  ? 638  TRP A O     1 
ATOM   4735 C  CB    . TRP A 1 592 ? 42.172  8.276    -42.300 1.00 36.95  ? 638  TRP A CB    1 
ATOM   4736 C  CG    . TRP A 1 592 ? 40.922  8.779    -41.647 1.00 37.92  ? 638  TRP A CG    1 
ATOM   4737 C  CD1   . TRP A 1 592 ? 40.696  8.943    -40.309 1.00 40.45  ? 638  TRP A CD1   1 
ATOM   4738 C  CD2   . TRP A 1 592 ? 39.696  9.103    -42.306 1.00 37.07  ? 638  TRP A CD2   1 
ATOM   4739 N  NE1   . TRP A 1 592 ? 39.399  9.331    -40.095 1.00 40.15  ? 638  TRP A NE1   1 
ATOM   4740 C  CE2   . TRP A 1 592 ? 38.758  9.437    -41.305 1.00 41.01  ? 638  TRP A CE2   1 
ATOM   4741 C  CE3   . TRP A 1 592 ? 39.281  9.097    -43.656 1.00 38.16  ? 638  TRP A CE3   1 
ATOM   4742 C  CZ2   . TRP A 1 592 ? 37.450  9.841    -41.611 1.00 39.37  ? 638  TRP A CZ2   1 
ATOM   4743 C  CZ3   . TRP A 1 592 ? 37.983  9.487    -43.957 1.00 38.69  ? 638  TRP A CZ3   1 
ATOM   4744 C  CH2   . TRP A 1 592 ? 37.085  9.861    -42.945 1.00 39.16  ? 638  TRP A CH2   1 
ATOM   4745 N  N     . LYS A 1 593 ? 43.639  5.272    -43.885 1.00 45.56  ? 639  LYS A N     1 
ATOM   4746 C  CA    . LYS A 1 593 ? 44.508  4.814    -44.977 1.00 47.35  ? 639  LYS A CA    1 
ATOM   4747 C  C     . LYS A 1 593 ? 43.745  4.484    -46.290 1.00 54.24  ? 639  LYS A C     1 
ATOM   4748 O  O     . LYS A 1 593 ? 44.303  4.708    -47.362 1.00 54.11  ? 639  LYS A O     1 
ATOM   4749 C  CB    . LYS A 1 593 ? 45.441  3.664    -44.550 1.00 50.20  ? 639  LYS A CB    1 
ATOM   4750 C  CG    . LYS A 1 593 ? 44.805  2.298    -44.346 1.00 74.67  ? 639  LYS A CG    1 
ATOM   4751 C  CD    . LYS A 1 593 ? 45.874  1.262    -43.967 1.00 88.94  ? 639  LYS A CD    1 
ATOM   4752 C  CE    . LYS A 1 593 ? 45.304  -0.107   -43.679 1.00 103.71 ? 639  LYS A CE    1 
ATOM   4753 N  NZ    . LYS A 1 593 ? 45.027  -0.874   -44.922 1.00 114.56 ? 639  LYS A NZ    1 
ATOM   4754 N  N     . ASP A 1 594 ? 42.490  4.012    -46.222 1.00 53.59  ? 640  ASP A N     1 
ATOM   4755 C  CA    . ASP A 1 594 ? 41.721  3.743    -47.441 1.00 55.85  ? 640  ASP A CA    1 
ATOM   4756 C  C     . ASP A 1 594 ? 40.834  4.946    -47.776 1.00 64.75  ? 640  ASP A C     1 
ATOM   4757 O  O     . ASP A 1 594 ? 39.930  5.275    -47.002 1.00 63.81  ? 640  ASP A O     1 
ATOM   4758 C  CB    . ASP A 1 594 ? 40.890  2.457    -47.302 1.00 58.38  ? 640  ASP A CB    1 
ATOM   4759 C  CG    . ASP A 1 594 ? 40.442  1.842    -48.619 1.00 77.61  ? 640  ASP A CG    1 
ATOM   4760 O  OD1   . ASP A 1 594 ? 39.640  2.491    -49.342 1.00 78.84  ? 640  ASP A OD1   1 
ATOM   4761 O  OD2   . ASP A 1 594 ? 40.830  0.678    -48.895 1.00 86.85  ? 640  ASP A OD2   1 
ATOM   4762 N  N     . VAL A 1 595 ? 41.124  5.626    -48.906 1.00 66.47  ? 641  VAL A N     1 
ATOM   4763 C  CA    . VAL A 1 595 ? 40.388  6.810    -49.384 1.00 69.42  ? 641  VAL A CA    1 
ATOM   4764 C  C     . VAL A 1 595 ? 39.918  6.567    -50.834 1.00 81.51  ? 641  VAL A C     1 
ATOM   4765 O  O     . VAL A 1 595 ? 40.721  6.648    -51.768 1.00 81.73  ? 641  VAL A O     1 
ATOM   4766 C  CB    . VAL A 1 595 ? 41.186  8.142    -49.209 1.00 73.48  ? 641  VAL A CB    1 
ATOM   4767 C  CG1   . VAL A 1 595 ? 40.421  9.328    -49.788 1.00 73.47  ? 641  VAL A CG1   1 
ATOM   4768 C  CG2   . VAL A 1 595 ? 41.537  8.404    -47.743 1.00 73.17  ? 641  VAL A CG2   1 
ATOM   4769 N  N     . GLU A 1 596 ? 38.624  6.219    -51.006 1.00 83.97  ? 642  GLU A N     1 
ATOM   4770 C  CA    . GLU A 1 596 ? 37.996  5.914    -52.306 1.00 86.11  ? 642  GLU A CA    1 
ATOM   4771 C  C     . GLU A 1 596 ? 36.591  6.536    -52.492 1.00 94.70  ? 642  GLU A C     1 
ATOM   4772 O  O     . GLU A 1 596 ? 35.999  6.367    -53.559 1.00 94.51  ? 642  GLU A O     1 
ATOM   4773 C  CB    . GLU A 1 596 ? 37.888  4.391    -52.490 1.00 87.72  ? 642  GLU A CB    1 
ATOM   4774 C  CG    . GLU A 1 596 ? 39.212  3.639    -52.546 1.00 105.11 ? 642  GLU A CG    1 
ATOM   4775 C  CD    . GLU A 1 596 ? 40.178  4.037    -53.649 1.00 142.63 ? 642  GLU A CD    1 
ATOM   4776 O  OE1   . GLU A 1 596 ? 39.754  4.088    -54.827 1.00 152.18 ? 642  GLU A OE1   1 
ATOM   4777 O  OE2   . GLU A 1 596 ? 41.369  4.266    -53.338 1.00 140.61 ? 642  GLU A OE2   1 
ATOM   4778 N  N     . GLY A 1 597 ? 36.094  7.247    -51.472 1.00 93.86  ? 643  GLY A N     1 
ATOM   4779 C  CA    . GLY A 1 597 ? 34.747  7.813    -51.410 1.00 94.80  ? 643  GLY A CA    1 
ATOM   4780 C  C     . GLY A 1 597 ? 34.321  8.956    -52.309 1.00 101.43 ? 643  GLY A C     1 
ATOM   4781 O  O     . GLY A 1 597 ? 35.098  9.460    -53.127 1.00 99.96  ? 643  GLY A O     1 
ATOM   4782 N  N     . ILE A 1 598 ? 33.101  9.450    -52.134 1.00 101.66 ? 644  ILE A N     1 
ATOM   4783 C  CA    . ILE A 1 598 ? 32.650  10.523   -53.014 1.00 103.43 ? 644  ILE A CA    1 
ATOM   4784 C  C     . ILE A 1 598 ? 33.191  11.897   -52.623 1.00 110.89 ? 644  ILE A C     1 
ATOM   4785 O  O     . ILE A 1 598 ? 32.903  12.416   -51.544 1.00 109.49 ? 644  ILE A O     1 
ATOM   4786 C  CB    . ILE A 1 598 ? 31.111  10.592   -53.074 1.00 106.74 ? 644  ILE A CB    1 
ATOM   4787 C  CG1   . ILE A 1 598 ? 30.535  9.273    -53.593 1.00 107.62 ? 644  ILE A CG1   1 
ATOM   4788 C  CG2   . ILE A 1 598 ? 30.664  11.753   -53.949 1.00 107.15 ? 644  ILE A CG2   1 
ATOM   4789 C  CD1   . ILE A 1 598 ? 30.801  8.089    -52.688 1.00 116.69 ? 644  ILE A CD1   1 
ATOM   4790 N  N     . VAL A 1 599 ? 33.980  12.471   -53.528 1.00 111.73 ? 645  VAL A N     1 
ATOM   4791 C  CA    . VAL A 1 599 ? 34.571  13.795   -53.355 1.00 113.64 ? 645  VAL A CA    1 
ATOM   4792 C  C     . VAL A 1 599 ? 33.563  14.866   -53.750 1.00 119.76 ? 645  VAL A C     1 
ATOM   4793 O  O     . VAL A 1 599 ? 32.619  14.584   -54.488 1.00 119.37 ? 645  VAL A O     1 
ATOM   4794 C  CB    . VAL A 1 599 ? 35.846  13.961   -54.202 1.00 118.68 ? 645  VAL A CB    1 
ATOM   4795 C  CG1   . VAL A 1 599 ? 36.370  15.385   -54.099 1.00 118.88 ? 645  VAL A CG1   1 
ATOM   4796 C  CG2   . VAL A 1 599 ? 36.907  12.962   -53.765 1.00 118.52 ? 645  VAL A CG2   1 
ATOM   4797 N  N     . GLY A 1 600 ? 33.751  16.091   -53.269 1.00 118.20 ? 646  GLY A N     1 
ATOM   4798 C  CA    . GLY A 1 600 ? 32.823  17.149   -53.622 1.00 118.84 ? 646  GLY A CA    1 
ATOM   4799 C  C     . GLY A 1 600 ? 32.714  17.116   -55.134 1.00 124.24 ? 646  GLY A C     1 
ATOM   4800 O  O     . GLY A 1 600 ? 33.720  17.094   -55.845 1.00 124.27 ? 646  GLY A O     1 
ATOM   4801 N  N     . LEU A 1 601 ? 31.482  17.124   -55.623 1.00 121.06 ? 647  LEU A N     1 
ATOM   4802 C  CA    . LEU A 1 601 ? 31.229  17.026   -57.066 1.00 154.21 ? 647  LEU A CA    1 
ATOM   4803 C  C     . LEU A 1 601 ? 29.738  17.144   -57.415 1.00 182.45 ? 647  LEU A C     1 
ATOM   4804 O  O     . LEU A 1 601 ? 28.881  17.065   -56.537 1.00 142.65 ? 647  LEU A O     1 
ATOM   4805 C  CB    . LEU A 1 601 ? 31.875  15.743   -57.665 1.00 154.31 ? 647  LEU A CB    1 
ATOM   4806 C  CG    . LEU A 1 601 ? 31.439  14.334   -57.198 1.00 159.13 ? 647  LEU A CG    1 
ATOM   4807 C  CD1   . LEU A 1 601 ? 30.150  13.929   -57.881 1.00 161.80 ? 647  LEU A CD1   1 
ATOM   4808 C  CD2   . LEU A 1 601 ? 32.484  13.272   -57.500 1.00 159.26 ? 647  LEU A CD2   1 
ATOM   4809 N  N     . ARG A 1 617 ? 24.515  8.884    -67.739 1.00 152.86 ? 663  ARG A N     1 
ATOM   4810 C  CA    . ARG A 1 617 ? 24.562  7.767    -66.795 1.00 152.61 ? 663  ARG A CA    1 
ATOM   4811 C  C     . ARG A 1 617 ? 24.568  8.214    -65.313 1.00 154.00 ? 663  ARG A C     1 
ATOM   4812 O  O     . ARG A 1 617 ? 24.826  9.385    -65.019 1.00 154.03 ? 663  ARG A O     1 
ATOM   4813 C  CB    . ARG A 1 617 ? 25.736  6.813    -67.109 1.00 155.55 ? 663  ARG A CB    1 
ATOM   4814 C  CG    . ARG A 1 617 ? 27.130  7.446    -67.050 1.00 174.62 ? 663  ARG A CG    1 
ATOM   4815 C  CD    . ARG A 1 617 ? 28.230  6.404    -66.930 1.00 195.91 ? 663  ARG A CD    1 
ATOM   4816 N  NE    . ARG A 1 617 ? 28.384  5.614    -68.153 1.00 214.37 ? 663  ARG A NE    1 
ATOM   4817 C  CZ    . ARG A 1 617 ? 29.279  5.864    -69.103 1.00 235.26 ? 663  ARG A CZ    1 
ATOM   4818 N  NH1   . ARG A 1 617 ? 30.121  6.882    -68.984 1.00 225.28 ? 663  ARG A NH1   1 
ATOM   4819 N  NH2   . ARG A 1 617 ? 29.345  5.092    -70.181 1.00 224.83 ? 663  ARG A NH2   1 
ATOM   4820 N  N     . ARG A 1 618 ? 24.280  7.269    -64.393 1.00 147.60 ? 664  ARG A N     1 
ATOM   4821 C  CA    . ARG A 1 618 ? 24.230  7.485    -62.943 1.00 145.72 ? 664  ARG A CA    1 
ATOM   4822 C  C     . ARG A 1 618 ? 25.626  7.738    -62.333 1.00 144.45 ? 664  ARG A C     1 
ATOM   4823 O  O     . ARG A 1 618 ? 25.790  8.708    -61.593 1.00 143.93 ? 664  ARG A O     1 
ATOM   4824 C  CB    . ARG A 1 618 ? 23.508  6.311    -62.263 1.00 146.82 ? 664  ARG A CB    1 
ATOM   4825 C  CG    . ARG A 1 618 ? 22.873  6.650    -60.923 1.00 159.81 ? 664  ARG A CG    1 
ATOM   4826 C  CD    . ARG A 1 618 ? 22.099  5.490    -60.315 1.00 174.47 ? 664  ARG A CD    1 
ATOM   4827 N  NE    . ARG A 1 618 ? 22.839  4.230    -60.393 1.00 189.31 ? 664  ARG A NE    1 
ATOM   4828 C  CZ    . ARG A 1 618 ? 23.751  3.834    -59.513 1.00 209.18 ? 664  ARG A CZ    1 
ATOM   4829 N  NH1   . ARG A 1 618 ? 24.030  4.577    -58.451 1.00 197.28 ? 664  ARG A NH1   1 
ATOM   4830 N  NH2   . ARG A 1 618 ? 24.387  2.682    -59.686 1.00 200.43 ? 664  ARG A NH2   1 
ATOM   4831 N  N     . GLY A 1 619 ? 26.604  6.884    -62.661 1.00 136.86 ? 665  GLY A N     1 
ATOM   4832 C  CA    . GLY A 1 619 ? 27.978  7.021    -62.181 1.00 134.32 ? 665  GLY A CA    1 
ATOM   4833 C  C     . GLY A 1 619 ? 28.830  5.763    -62.156 1.00 131.78 ? 665  GLY A C     1 
ATOM   4834 O  O     . GLY A 1 619 ? 28.626  4.833    -62.946 1.00 131.26 ? 665  GLY A O     1 
ATOM   4835 N  N     . MET A 1 620 ? 29.828  5.765    -61.242 1.00 122.67 ? 666  MET A N     1 
ATOM   4836 C  CA    . MET A 1 620 ? 30.800  4.689    -60.995 1.00 119.47 ? 666  MET A CA    1 
ATOM   4837 C  C     . MET A 1 620 ? 31.075  4.520    -59.472 1.00 114.97 ? 666  MET A C     1 
ATOM   4838 O  O     . MET A 1 620 ? 32.067  3.890    -59.079 1.00 114.83 ? 666  MET A O     1 
ATOM   4839 C  CB    . MET A 1 620 ? 32.105  4.927    -61.798 1.00 121.82 ? 666  MET A CB    1 
ATOM   4840 C  CG    . MET A 1 620 ? 32.881  6.182    -61.379 1.00 125.40 ? 666  MET A CG    1 
ATOM   4841 S  SD    . MET A 1 620 ? 34.516  6.362    -62.132 1.00 129.41 ? 666  MET A SD    1 
ATOM   4842 C  CE    . MET A 1 620 ? 35.390  5.011    -61.359 1.00 126.13 ? 666  MET A CE    1 
ATOM   4843 N  N     . PHE A 1 621 ? 30.182  5.083    -58.628 1.00 104.12 ? 667  PHE A N     1 
ATOM   4844 C  CA    . PHE A 1 621 ? 30.261  5.039    -57.165 1.00 99.88  ? 667  PHE A CA    1 
ATOM   4845 C  C     . PHE A 1 621 ? 29.103  4.249    -56.563 1.00 91.50  ? 667  PHE A C     1 
ATOM   4846 O  O     . PHE A 1 621 ? 27.946  4.531    -56.873 1.00 90.68  ? 667  PHE A O     1 
ATOM   4847 C  CB    . PHE A 1 621 ? 30.257  6.461    -56.578 1.00 102.17 ? 667  PHE A CB    1 
ATOM   4848 C  CG    . PHE A 1 621 ? 31.559  7.226    -56.637 1.00 104.44 ? 667  PHE A CG    1 
ATOM   4849 C  CD1   . PHE A 1 621 ? 32.630  6.875    -55.821 1.00 108.06 ? 667  PHE A CD1   1 
ATOM   4850 C  CD2   . PHE A 1 621 ? 31.683  8.355    -57.437 1.00 107.07 ? 667  PHE A CD2   1 
ATOM   4851 C  CE1   . PHE A 1 621 ? 33.825  7.604    -55.852 1.00 109.05 ? 667  PHE A CE1   1 
ATOM   4852 C  CE2   . PHE A 1 621 ? 32.877  9.088    -57.463 1.00 110.01 ? 667  PHE A CE2   1 
ATOM   4853 C  CZ    . PHE A 1 621 ? 33.939  8.706    -56.671 1.00 108.09 ? 667  PHE A CZ    1 
ATOM   4854 N  N     . ARG A 1 622 ? 29.416  3.277    -55.690 1.00 79.06  ? 668  ARG A N     1 
ATOM   4855 C  CA    . ARG A 1 622 ? 28.421  2.456    -55.002 1.00 74.87  ? 668  ARG A CA    1 
ATOM   4856 C  C     . ARG A 1 622 ? 27.797  3.214    -53.813 1.00 67.86  ? 668  ARG A C     1 
ATOM   4857 O  O     . ARG A 1 622 ? 28.516  3.801    -53.000 1.00 67.61  ? 668  ARG A O     1 
ATOM   4858 C  CB    . ARG A 1 622 ? 29.028  1.116    -54.554 1.00 76.55  ? 668  ARG A CB    1 
ATOM   4859 C  CG    . ARG A 1 622 ? 29.048  0.032    -55.635 1.00 91.42  ? 668  ARG A CG    1 
ATOM   4860 C  CD    . ARG A 1 622 ? 29.865  -1.172   -55.190 1.00 108.77 ? 668  ARG A CD    1 
ATOM   4861 N  NE    . ARG A 1 622 ? 29.687  -2.337   -56.061 1.00 125.21 ? 668  ARG A NE    1 
ATOM   4862 C  CZ    . ARG A 1 622 ? 30.520  -2.689   -57.039 1.00 145.06 ? 668  ARG A CZ    1 
ATOM   4863 N  NH1   . ARG A 1 622 ? 31.601  -1.963   -57.294 1.00 132.50 ? 668  ARG A NH1   1 
ATOM   4864 N  NH2   . ARG A 1 622 ? 30.276  -3.769   -57.770 1.00 136.06 ? 668  ARG A NH2   1 
ATOM   4865 N  N     . THR A 1 623 ? 26.458  3.230    -53.729 1.00 55.48  ? 669  THR A N     1 
ATOM   4866 C  CA    . THR A 1 623 ? 25.743  3.907    -52.637 1.00 50.62  ? 669  THR A CA    1 
ATOM   4867 C  C     . THR A 1 623 ? 25.720  2.981    -51.431 1.00 46.99  ? 669  THR A C     1 
ATOM   4868 O  O     . THR A 1 623 ? 26.096  1.809    -51.550 1.00 46.58  ? 669  THR A O     1 
ATOM   4869 C  CB    . THR A 1 623 ? 24.327  4.320    -53.061 1.00 49.84  ? 669  THR A CB    1 
ATOM   4870 O  OG1   . THR A 1 623 ? 23.548  3.158    -53.378 1.00 45.64  ? 669  THR A OG1   1 
ATOM   4871 C  CG2   . THR A 1 623 ? 24.318  5.305    -54.212 1.00 44.82  ? 669  THR A CG2   1 
ATOM   4872 N  N     . VAL A 1 624 ? 25.305  3.504    -50.270 1.00 38.52  ? 670  VAL A N     1 
ATOM   4873 C  CA    . VAL A 1 624 ? 25.177  2.748    -49.018 1.00 36.72  ? 670  VAL A CA    1 
ATOM   4874 C  C     . VAL A 1 624 ? 24.163  1.611    -49.249 1.00 40.39  ? 670  VAL A C     1 
ATOM   4875 O  O     . VAL A 1 624 ? 24.398  0.498    -48.804 1.00 39.57  ? 670  VAL A O     1 
ATOM   4876 C  CB    . VAL A 1 624 ? 24.796  3.660    -47.783 1.00 38.54  ? 670  VAL A CB    1 
ATOM   4877 C  CG1   . VAL A 1 624 ? 24.376  2.830    -46.573 1.00 37.88  ? 670  VAL A CG1   1 
ATOM   4878 C  CG2   . VAL A 1 624 ? 25.940  4.585    -47.395 1.00 38.09  ? 670  VAL A CG2   1 
ATOM   4879 N  N     . GLY A 1 625 ? 23.066  1.916    -49.948 1.00 37.60  ? 671  GLY A N     1 
ATOM   4880 C  CA    . GLY A 1 625 ? 22.016  0.961    -50.261 1.00 38.11  ? 671  GLY A CA    1 
ATOM   4881 C  C     . GLY A 1 625 ? 22.568  -0.214   -51.036 1.00 44.21  ? 671  GLY A C     1 
ATOM   4882 O  O     . GLY A 1 625 ? 22.478  -1.349   -50.568 1.00 44.31  ? 671  GLY A O     1 
ATOM   4883 N  N     . GLN A 1 626 ? 23.200  0.078    -52.200 1.00 41.89  ? 672  GLN A N     1 
ATOM   4884 C  CA    . GLN A 1 626 ? 23.866  -0.868   -53.118 1.00 41.40  ? 672  GLN A CA    1 
ATOM   4885 C  C     . GLN A 1 626 ? 24.849  -1.756   -52.360 1.00 43.16  ? 672  GLN A C     1 
ATOM   4886 O  O     . GLN A 1 626 ? 24.768  -2.967   -52.471 1.00 41.79  ? 672  GLN A O     1 
ATOM   4887 C  CB    . GLN A 1 626 ? 24.653  -0.090   -54.186 1.00 43.23  ? 672  GLN A CB    1 
ATOM   4888 C  CG    . GLN A 1 626 ? 24.000  -0.033   -55.557 1.00 60.42  ? 672  GLN A CG    1 
ATOM   4889 C  CD    . GLN A 1 626 ? 24.390  1.203    -56.335 1.00 77.80  ? 672  GLN A CD    1 
ATOM   4890 O  OE1   . GLN A 1 626 ? 25.508  1.718    -56.254 1.00 72.94  ? 672  GLN A OE1   1 
ATOM   4891 N  NE2   . GLN A 1 626 ? 23.465  1.712    -57.110 1.00 70.42  ? 672  GLN A NE2   1 
ATOM   4892 N  N     . LEU A 1 627 ? 25.765  -1.138   -51.574 1.00 39.76  ? 673  LEU A N     1 
ATOM   4893 C  CA    . LEU A 1 627 ? 26.775  -1.845   -50.792 1.00 39.27  ? 673  LEU A CA    1 
ATOM   4894 C  C     . LEU A 1 627 ? 26.191  -2.765   -49.744 1.00 42.42  ? 673  LEU A C     1 
ATOM   4895 O  O     . LEU A 1 627 ? 26.704  -3.857   -49.558 1.00 43.73  ? 673  LEU A O     1 
ATOM   4896 C  CB    . LEU A 1 627 ? 27.782  -0.883   -50.177 1.00 39.56  ? 673  LEU A CB    1 
ATOM   4897 C  CG    . LEU A 1 627 ? 28.939  -0.477   -51.073 1.00 46.04  ? 673  LEU A CG    1 
ATOM   4898 C  CD1   . LEU A 1 627 ? 29.731  0.660    -50.453 1.00 46.90  ? 673  LEU A CD1   1 
ATOM   4899 C  CD2   . LEU A 1 627 ? 29.898  -1.661   -51.327 1.00 49.22  ? 673  LEU A CD2   1 
ATOM   4900 N  N     . TYR A 1 628 ? 25.087  -2.373   -49.122 1.00 37.38  ? 674  TYR A N     1 
ATOM   4901 C  CA    . TYR A 1 628 ? 24.458  -3.176   -48.085 1.00 37.92  ? 674  TYR A CA    1 
ATOM   4902 C  C     . TYR A 1 628 ? 23.664  -4.323   -48.684 1.00 44.95  ? 674  TYR A C     1 
ATOM   4903 O  O     . TYR A 1 628 ? 23.654  -5.419   -48.124 1.00 45.49  ? 674  TYR A O     1 
ATOM   4904 C  CB    . TYR A 1 628 ? 23.610  -2.308   -47.128 1.00 39.24  ? 674  TYR A CB    1 
ATOM   4905 C  CG    . TYR A 1 628 ? 23.038  -3.104   -45.979 1.00 40.91  ? 674  TYR A CG    1 
ATOM   4906 C  CD1   . TYR A 1 628 ? 23.875  -3.694   -45.037 1.00 42.83  ? 674  TYR A CD1   1 
ATOM   4907 C  CD2   . TYR A 1 628 ? 21.676  -3.376   -45.902 1.00 41.39  ? 674  TYR A CD2   1 
ATOM   4908 C  CE1   . TYR A 1 628 ? 23.365  -4.483   -44.012 1.00 42.77  ? 674  TYR A CE1   1 
ATOM   4909 C  CE2   . TYR A 1 628 ? 21.152  -4.142   -44.864 1.00 41.95  ? 674  TYR A CE2   1 
ATOM   4910 C  CZ    . TYR A 1 628 ? 22.003  -4.686   -43.917 1.00 44.86  ? 674  TYR A CZ    1 
ATOM   4911 O  OH    . TYR A 1 628 ? 21.521  -5.422   -42.875 1.00 42.74  ? 674  TYR A OH    1 
ATOM   4912 N  N     . LYS A 1 629 ? 23.052  -4.091   -49.846 1.00 42.59  ? 675  LYS A N     1 
ATOM   4913 C  CA    . LYS A 1 629 ? 22.313  -5.116   -50.563 1.00 43.46  ? 675  LYS A CA    1 
ATOM   4914 C  C     . LYS A 1 629 ? 23.347  -6.201   -50.961 1.00 47.29  ? 675  LYS A C     1 
ATOM   4915 O  O     . LYS A 1 629 ? 23.167  -7.368   -50.605 1.00 46.16  ? 675  LYS A O     1 
ATOM   4916 C  CB    . LYS A 1 629 ? 21.599  -4.485   -51.775 1.00 46.25  ? 675  LYS A CB    1 
ATOM   4917 C  CG    . LYS A 1 629 ? 20.412  -5.278   -52.336 1.00 65.14  ? 675  LYS A CG    1 
ATOM   4918 C  CD    . LYS A 1 629 ? 20.011  -4.813   -53.760 1.00 70.10  ? 675  LYS A CD    1 
ATOM   4919 C  CE    . LYS A 1 629 ? 19.590  -3.354   -53.824 1.00 78.75  ? 675  LYS A CE    1 
ATOM   4920 N  NZ    . LYS A 1 629 ? 19.808  -2.764   -55.169 1.00 81.89  ? 675  LYS A NZ    1 
ATOM   4921 N  N     . GLU A 1 630 ? 24.482  -5.787   -51.573 1.00 44.42  ? 676  GLU A N     1 
ATOM   4922 C  CA    . GLU A 1 630 ? 25.597  -6.671   -51.967 1.00 44.26  ? 676  GLU A CA    1 
ATOM   4923 C  C     . GLU A 1 630 ? 26.136  -7.494   -50.790 1.00 47.89  ? 676  GLU A C     1 
ATOM   4924 O  O     . GLU A 1 630 ? 26.348  -8.683   -50.939 1.00 49.87  ? 676  GLU A O     1 
ATOM   4925 C  CB    . GLU A 1 630 ? 26.742  -5.864   -52.611 1.00 45.91  ? 676  GLU A CB    1 
ATOM   4926 C  CG    . GLU A 1 630 ? 26.523  -5.564   -54.087 1.00 58.70  ? 676  GLU A CG    1 
ATOM   4927 C  CD    . GLU A 1 630 ? 27.290  -4.392   -54.673 1.00 70.73  ? 676  GLU A CD    1 
ATOM   4928 O  OE1   . GLU A 1 630 ? 28.400  -4.088   -54.181 1.00 64.44  ? 676  GLU A OE1   1 
ATOM   4929 O  OE2   . GLU A 1 630 ? 26.789  -3.796   -55.655 1.00 59.86  ? 676  GLU A OE2   1 
ATOM   4930 N  N     . SER A 1 631 ? 26.324  -6.871   -49.623 1.00 43.36  ? 677  SER A N     1 
ATOM   4931 C  CA    . SER A 1 631 ? 26.801  -7.536   -48.415 1.00 42.00  ? 677  SER A CA    1 
ATOM   4932 C  C     . SER A 1 631 ? 25.780  -8.529   -47.854 1.00 42.86  ? 677  SER A C     1 
ATOM   4933 O  O     . SER A 1 631 ? 26.171  -9.542   -47.292 1.00 40.60  ? 677  SER A O     1 
ATOM   4934 C  CB    . SER A 1 631 ? 27.136  -6.490   -47.353 1.00 44.97  ? 677  SER A CB    1 
ATOM   4935 O  OG    . SER A 1 631 ? 27.574  -7.113   -46.160 1.00 53.68  ? 677  SER A OG    1 
ATOM   4936 N  N     . LEU A 1 632 ? 24.479  -8.198   -47.924 1.00 41.66  ? 678  LEU A N     1 
ATOM   4937 C  CA    . LEU A 1 632 ? 23.436  -9.088   -47.404 1.00 42.07  ? 678  LEU A CA    1 
ATOM   4938 C  C     . LEU A 1 632 ? 23.321  -10.356  -48.264 1.00 44.05  ? 678  LEU A C     1 
ATOM   4939 O  O     . LEU A 1 632 ? 23.179  -11.452  -47.717 1.00 41.15  ? 678  LEU A O     1 
ATOM   4940 C  CB    . LEU A 1 632 ? 22.085  -8.365   -47.210 1.00 42.14  ? 678  LEU A CB    1 
ATOM   4941 C  CG    . LEU A 1 632 ? 20.948  -9.139   -46.488 1.00 46.76  ? 678  LEU A CG    1 
ATOM   4942 C  CD1   . LEU A 1 632 ? 21.306  -9.475   -45.061 1.00 45.92  ? 678  LEU A CD1   1 
ATOM   4943 C  CD2   . LEU A 1 632 ? 19.664  -8.332   -46.480 1.00 49.51  ? 678  LEU A CD2   1 
ATOM   4944 N  N     . SER A 1 633 ? 23.491  -10.199  -49.596 1.00 41.73  ? 679  SER A N     1 
ATOM   4945 C  CA    . SER A 1 633 ? 23.434  -11.285  -50.570 1.00 41.97  ? 679  SER A CA    1 
ATOM   4946 C  C     . SER A 1 633 ? 24.612  -12.210  -50.362 1.00 45.42  ? 679  SER A C     1 
ATOM   4947 O  O     . SER A 1 633 ? 24.454  -13.431  -50.481 1.00 44.52  ? 679  SER A O     1 
ATOM   4948 C  CB    . SER A 1 633 ? 23.422  -10.742  -51.995 1.00 47.82  ? 679  SER A CB    1 
ATOM   4949 O  OG    . SER A 1 633 ? 22.188  -10.109  -52.294 1.00 59.73  ? 679  SER A OG    1 
ATOM   4950 N  N     . ARG A 1 634 ? 25.788  -11.642  -50.022 1.00 41.44  ? 680  ARG A N     1 
ATOM   4951 C  CA    . ARG A 1 634 ? 26.954  -12.462  -49.705 1.00 41.94  ? 680  ARG A CA    1 
ATOM   4952 C  C     . ARG A 1 634 ? 26.598  -13.323  -48.476 1.00 45.71  ? 680  ARG A C     1 
ATOM   4953 O  O     . ARG A 1 634 ? 26.711  -14.541  -48.580 1.00 46.59  ? 680  ARG A O     1 
ATOM   4954 C  CB    . ARG A 1 634 ? 28.229  -11.625  -49.460 1.00 42.27  ? 680  ARG A CB    1 
ATOM   4955 C  CG    . ARG A 1 634 ? 28.860  -11.041  -50.725 1.00 47.19  ? 680  ARG A CG    1 
ATOM   4956 C  CD    . ARG A 1 634 ? 30.280  -10.548  -50.493 1.00 59.84  ? 680  ARG A CD    1 
ATOM   4957 N  NE    . ARG A 1 634 ? 30.380  -9.548   -49.424 1.00 67.48  ? 680  ARG A NE    1 
ATOM   4958 C  CZ    . ARG A 1 634 ? 30.288  -8.236   -49.607 1.00 80.61  ? 680  ARG A CZ    1 
ATOM   4959 N  NH1   . ARG A 1 634 ? 30.079  -7.742   -50.822 1.00 67.44  ? 680  ARG A NH1   1 
ATOM   4960 N  NH2   . ARG A 1 634 ? 30.392  -7.408   -48.581 1.00 71.74  ? 680  ARG A NH2   1 
ATOM   4961 N  N     . LEU A 1 635 ? 26.059  -12.707  -47.372 1.00 39.27  ? 681  LEU A N     1 
ATOM   4962 C  CA    . LEU A 1 635 ? 25.636  -13.426  -46.159 1.00 36.90  ? 681  LEU A CA    1 
ATOM   4963 C  C     . LEU A 1 635 ? 24.606  -14.511  -46.455 1.00 39.75  ? 681  LEU A C     1 
ATOM   4964 O  O     . LEU A 1 635 ? 24.701  -15.597  -45.880 1.00 38.57  ? 681  LEU A O     1 
ATOM   4965 C  CB    . LEU A 1 635 ? 25.112  -12.461  -45.061 1.00 35.79  ? 681  LEU A CB    1 
ATOM   4966 C  CG    . LEU A 1 635 ? 24.541  -13.113  -43.762 1.00 38.30  ? 681  LEU A CG    1 
ATOM   4967 C  CD1   . LEU A 1 635 ? 25.618  -13.906  -42.993 1.00 37.70  ? 681  LEU A CD1   1 
ATOM   4968 C  CD2   . LEU A 1 635 ? 23.897  -12.069  -42.845 1.00 35.94  ? 681  LEU A CD2   1 
ATOM   4969 N  N     . MET A 1 636 ? 23.635  -14.237  -47.330 1.00 38.00  ? 682  MET A N     1 
ATOM   4970 C  CA    . MET A 1 636 ? 22.608  -15.230  -47.685 1.00 39.33  ? 682  MET A CA    1 
ATOM   4971 C  C     . MET A 1 636 ? 23.167  -16.473  -48.395 1.00 43.85  ? 682  MET A C     1 
ATOM   4972 O  O     . MET A 1 636 ? 22.794  -17.602  -48.079 1.00 44.04  ? 682  MET A O     1 
ATOM   4973 C  CB    . MET A 1 636 ? 21.518  -14.585  -48.544 1.00 42.55  ? 682  MET A CB    1 
ATOM   4974 C  CG    . MET A 1 636 ? 20.727  -13.497  -47.835 1.00 47.50  ? 682  MET A CG    1 
ATOM   4975 S  SD    . MET A 1 636 ? 19.802  -14.109  -46.413 1.00 52.77  ? 682  MET A SD    1 
ATOM   4976 C  CE    . MET A 1 636 ? 20.833  -13.543  -45.062 1.00 49.80  ? 682  MET A CE    1 
ATOM   4977 N  N     . ALA A 1 637 ? 24.063  -16.246  -49.351 1.00 39.62  ? 683  ALA A N     1 
ATOM   4978 C  CA    . ALA A 1 637 ? 24.750  -17.305  -50.090 1.00 38.62  ? 683  ALA A CA    1 
ATOM   4979 C  C     . ALA A 1 637 ? 25.669  -18.140  -49.164 1.00 42.79  ? 683  ALA A C     1 
ATOM   4980 O  O     . ALA A 1 637 ? 25.796  -19.354  -49.360 1.00 42.19  ? 683  ALA A O     1 
ATOM   4981 C  CB    . ALA A 1 637 ? 25.543  -16.697  -51.232 1.00 38.93  ? 683  ALA A CB    1 
ATOM   4982 N  N     . THR A 1 638 ? 26.248  -17.505  -48.116 1.00 37.96  ? 684  THR A N     1 
ATOM   4983 C  CA    . THR A 1 638 ? 27.063  -18.197  -47.106 1.00 37.22  ? 684  THR A CA    1 
ATOM   4984 C  C     . THR A 1 638 ? 26.143  -19.068  -46.237 1.00 42.70  ? 684  THR A C     1 
ATOM   4985 O  O     . THR A 1 638 ? 26.461  -20.240  -46.003 1.00 43.32  ? 684  THR A O     1 
ATOM   4986 C  CB    . THR A 1 638 ? 27.828  -17.203  -46.279 1.00 36.89  ? 684  THR A CB    1 
ATOM   4987 O  OG1   . THR A 1 638 ? 28.547  -16.368  -47.176 1.00 40.04  ? 684  THR A OG1   1 
ATOM   4988 C  CG2   . THR A 1 638 ? 28.764  -17.863  -45.284 1.00 36.35  ? 684  THR A CG2   1 
ATOM   4989 N  N     . LEU A 1 639 ? 24.985  -18.506  -45.795 1.00 37.72  ? 685  LEU A N     1 
ATOM   4990 C  CA    . LEU A 1 639 ? 23.991  -19.234  -45.003 1.00 35.94  ? 685  LEU A CA    1 
ATOM   4991 C  C     . LEU A 1 639 ? 23.355  -20.367  -45.818 1.00 41.44  ? 685  LEU A C     1 
ATOM   4992 O  O     . LEU A 1 639 ? 23.067  -21.413  -45.250 1.00 41.86  ? 685  LEU A O     1 
ATOM   4993 C  CB    . LEU A 1 639 ? 22.910  -18.289  -44.405 1.00 34.99  ? 685  LEU A CB    1 
ATOM   4994 C  CG    . LEU A 1 639 ? 23.369  -17.251  -43.314 1.00 35.59  ? 685  LEU A CG    1 
ATOM   4995 C  CD1   . LEU A 1 639 ? 22.333  -16.199  -43.065 1.00 32.56  ? 685  LEU A CD1   1 
ATOM   4996 C  CD2   . LEU A 1 639 ? 23.744  -17.916  -42.016 1.00 37.29  ? 685  LEU A CD2   1 
ATOM   4997 N  N     . SER A 1 640 ? 23.196  -20.202  -47.152 1.00 38.30  ? 686  SER A N     1 
ATOM   4998 C  CA    . SER A 1 640 ? 22.583  -21.227  -48.000 1.00 38.42  ? 686  SER A CA    1 
ATOM   4999 C  C     . SER A 1 640 ? 23.395  -22.538  -48.078 1.00 42.86  ? 686  SER A C     1 
ATOM   5000 O  O     . SER A 1 640 ? 22.836  -23.593  -48.395 1.00 44.47  ? 686  SER A O     1 
ATOM   5001 C  CB    . SER A 1 640 ? 22.282  -20.679  -49.394 1.00 42.54  ? 686  SER A CB    1 
ATOM   5002 O  OG    . SER A 1 640 ? 23.431  -20.598  -50.224 1.00 49.41  ? 686  SER A OG    1 
ATOM   5003 N  N     . ASN A 1 641 ? 24.691  -22.463  -47.781 1.00 38.05  ? 687  ASN A N     1 
ATOM   5004 C  CA    . ASN A 1 641 ? 25.616  -23.592  -47.785 1.00 37.77  ? 687  ASN A CA    1 
ATOM   5005 C  C     . ASN A 1 641 ? 25.948  -24.031  -46.356 1.00 40.96  ? 687  ASN A C     1 
ATOM   5006 O  O     . ASN A 1 641 ? 27.052  -24.493  -46.066 1.00 38.16  ? 687  ASN A O     1 
ATOM   5007 C  CB    . ASN A 1 641 ? 26.838  -23.291  -48.651 1.00 37.21  ? 687  ASN A CB    1 
ATOM   5008 C  CG    . ASN A 1 641 ? 26.466  -23.269  -50.117 1.00 61.69  ? 687  ASN A CG    1 
ATOM   5009 O  OD1   . ASN A 1 641 ? 25.968  -24.260  -50.673 1.00 67.89  ? 687  ASN A OD1   1 
ATOM   5010 N  ND2   . ASN A 1 641 ? 26.616  -22.121  -50.755 1.00 48.67  ? 687  ASN A ND2   1 
ATOM   5011 N  N     . THR A 1 642 ? 24.952  -23.864  -45.455 1.00 38.84  ? 688  THR A N     1 
ATOM   5012 C  CA    . THR A 1 642 ? 25.003  -24.287  -44.046 1.00 38.00  ? 688  THR A CA    1 
ATOM   5013 C  C     . THR A 1 642 ? 23.699  -25.017  -43.716 1.00 40.04  ? 688  THR A C     1 
ATOM   5014 O  O     . THR A 1 642 ? 22.721  -24.852  -44.458 1.00 41.35  ? 688  THR A O     1 
ATOM   5015 C  CB    . THR A 1 642 ? 25.228  -23.116  -43.044 1.00 35.38  ? 688  THR A CB    1 
ATOM   5016 O  OG1   . THR A 1 642 ? 24.084  -22.264  -43.001 1.00 33.97  ? 688  THR A OG1   1 
ATOM   5017 C  CG2   . THR A 1 642 ? 26.515  -22.323  -43.274 1.00 30.35  ? 688  THR A CG2   1 
ATOM   5018 N  N     . ASN A 1 643 ? 23.681  -25.832  -42.634 1.00 32.38  ? 689  ASN A N     1 
ATOM   5019 C  CA    . ASN A 1 643 ? 22.433  -26.465  -42.181 1.00 31.32  ? 689  ASN A CA    1 
ATOM   5020 C  C     . ASN A 1 643 ? 21.980  -25.547  -41.002 1.00 37.68  ? 689  ASN A C     1 
ATOM   5021 O  O     . ASN A 1 643 ? 22.664  -25.433  -39.983 1.00 35.84  ? 689  ASN A O     1 
ATOM   5022 C  CB    . ASN A 1 643 ? 22.617  -27.943  -41.780 1.00 24.77  ? 689  ASN A CB    1 
ATOM   5023 C  CG    . ASN A 1 643 ? 21.332  -28.733  -41.576 1.00 49.41  ? 689  ASN A CG    1 
ATOM   5024 O  OD1   . ASN A 1 643 ? 20.313  -28.485  -42.205 1.00 41.31  ? 689  ASN A OD1   1 
ATOM   5025 N  ND2   . ASN A 1 643 ? 21.324  -29.686  -40.649 1.00 48.36  ? 689  ASN A ND2   1 
ATOM   5026 N  N     . PRO A 1 644 ? 20.897  -24.784  -41.182 1.00 35.29  ? 690  PRO A N     1 
ATOM   5027 C  CA    . PRO A 1 644 ? 20.525  -23.818  -40.135 1.00 34.15  ? 690  PRO A CA    1 
ATOM   5028 C  C     . PRO A 1 644 ? 19.724  -24.401  -38.973 1.00 39.08  ? 690  PRO A C     1 
ATOM   5029 O  O     . PRO A 1 644 ? 19.047  -25.414  -39.109 1.00 40.32  ? 690  PRO A O     1 
ATOM   5030 C  CB    . PRO A 1 644 ? 19.753  -22.743  -40.899 1.00 35.36  ? 690  PRO A CB    1 
ATOM   5031 C  CG    . PRO A 1 644 ? 19.219  -23.420  -42.116 1.00 40.88  ? 690  PRO A CG    1 
ATOM   5032 C  CD    . PRO A 1 644 ? 20.001  -24.706  -42.356 1.00 36.58  ? 690  PRO A CD    1 
ATOM   5033 N  N     . SER A 1 645 ? 19.833  -23.759  -37.812 1.00 32.75  ? 691  SER A N     1 
ATOM   5034 C  CA    . SER A 1 645 ? 19.071  -24.068  -36.600 1.00 30.60  ? 691  SER A CA    1 
ATOM   5035 C  C     . SER A 1 645 ? 18.490  -22.688  -36.208 1.00 32.26  ? 691  SER A C     1 
ATOM   5036 O  O     . SER A 1 645 ? 19.257  -21.742  -36.088 1.00 30.98  ? 691  SER A O     1 
ATOM   5037 C  CB    . SER A 1 645 ? 20.008  -24.605  -35.517 1.00 34.33  ? 691  SER A CB    1 
ATOM   5038 O  OG    . SER A 1 645 ? 19.329  -24.796  -34.293 1.00 47.40  ? 691  SER A OG    1 
ATOM   5039 N  N     . PHE A 1 646 ? 17.168  -22.563  -36.065 1.00 27.71  ? 692  PHE A N     1 
ATOM   5040 C  CA    . PHE A 1 646 ? 16.519  -21.287  -35.763 1.00 28.00  ? 692  PHE A CA    1 
ATOM   5041 C  C     . PHE A 1 646 ? 16.166  -21.118  -34.311 1.00 35.22  ? 692  PHE A C     1 
ATOM   5042 O  O     . PHE A 1 646 ? 15.647  -22.041  -33.682 1.00 34.83  ? 692  PHE A O     1 
ATOM   5043 C  CB    . PHE A 1 646 ? 15.246  -21.079  -36.636 1.00 28.91  ? 692  PHE A CB    1 
ATOM   5044 C  CG    . PHE A 1 646 ? 15.553  -20.825  -38.086 1.00 30.90  ? 692  PHE A CG    1 
ATOM   5045 C  CD1   . PHE A 1 646 ? 15.796  -19.538  -38.547 1.00 35.66  ? 692  PHE A CD1   1 
ATOM   5046 C  CD2   . PHE A 1 646 ? 15.687  -21.878  -38.975 1.00 34.60  ? 692  PHE A CD2   1 
ATOM   5047 C  CE1   . PHE A 1 646 ? 16.142  -19.307  -39.881 1.00 37.37  ? 692  PHE A CE1   1 
ATOM   5048 C  CE2   . PHE A 1 646 ? 16.063  -21.648  -40.307 1.00 37.99  ? 692  PHE A CE2   1 
ATOM   5049 C  CZ    . PHE A 1 646 ? 16.289  -20.360  -40.751 1.00 35.34  ? 692  PHE A CZ    1 
ATOM   5050 N  N     . VAL A 1 647 ? 16.413  -19.917  -33.777 1.00 31.92  ? 693  VAL A N     1 
ATOM   5051 C  CA    . VAL A 1 647 ? 16.009  -19.621  -32.408 1.00 31.71  ? 693  VAL A CA    1 
ATOM   5052 C  C     . VAL A 1 647 ? 15.104  -18.401  -32.514 1.00 34.88  ? 693  VAL A C     1 
ATOM   5053 O  O     . VAL A 1 647 ? 15.564  -17.304  -32.831 1.00 34.40  ? 693  VAL A O     1 
ATOM   5054 C  CB    . VAL A 1 647 ? 17.169  -19.483  -31.374 1.00 35.36  ? 693  VAL A CB    1 
ATOM   5055 C  CG1   . VAL A 1 647 ? 16.627  -19.152  -29.989 1.00 35.84  ? 693  VAL A CG1   1 
ATOM   5056 C  CG2   . VAL A 1 647 ? 18.019  -20.749  -31.307 1.00 34.18  ? 693  VAL A CG2   1 
ATOM   5057 N  N     . ARG A 1 648 ? 13.797  -18.608  -32.323 1.00 30.27  ? 694  ARG A N     1 
ATOM   5058 C  CA    . ARG A 1 648 ? 12.861  -17.501  -32.434 1.00 28.04  ? 694  ARG A CA    1 
ATOM   5059 C  C     . ARG A 1 648 ? 12.724  -16.780  -31.089 1.00 31.07  ? 694  ARG A C     1 
ATOM   5060 O  O     . ARG A 1 648 ? 12.006  -17.263  -30.237 1.00 29.22  ? 694  ARG A O     1 
ATOM   5061 C  CB    . ARG A 1 648 ? 11.500  -17.977  -32.971 1.00 23.66  ? 694  ARG A CB    1 
ATOM   5062 C  CG    . ARG A 1 648 ? 11.522  -19.208  -33.888 1.00 24.80  ? 694  ARG A CG    1 
ATOM   5063 C  CD    . ARG A 1 648 ? 12.348  -19.095  -35.195 1.00 22.52  ? 694  ARG A CD    1 
ATOM   5064 N  NE    . ARG A 1 648 ? 12.159  -17.827  -35.899 1.00 26.51  ? 694  ARG A NE    1 
ATOM   5065 C  CZ    . ARG A 1 648 ? 11.173  -17.543  -36.746 1.00 38.47  ? 694  ARG A CZ    1 
ATOM   5066 N  NH1   . ARG A 1 648 ? 10.254  -18.452  -37.025 1.00 34.71  ? 694  ARG A NH1   1 
ATOM   5067 N  NH2   . ARG A 1 648 ? 11.109  -16.361  -37.327 1.00 27.89  ? 694  ARG A NH2   1 
ATOM   5068 N  N     . CYS A 1 649 ? 13.429  -15.637  -30.892 1.00 29.20  ? 695  CYS A N     1 
ATOM   5069 C  CA    . CYS A 1 649 ? 13.362  -14.850  -29.652 1.00 28.52  ? 695  CYS A CA    1 
ATOM   5070 C  C     . CYS A 1 649 ? 12.088  -13.987  -29.640 1.00 32.59  ? 695  CYS A C     1 
ATOM   5071 O  O     . CYS A 1 649 ? 11.757  -13.347  -30.636 1.00 30.11  ? 695  CYS A O     1 
ATOM   5072 C  CB    . CYS A 1 649 ? 14.627  -14.023  -29.432 1.00 28.45  ? 695  CYS A CB    1 
ATOM   5073 S  SG    . CYS A 1 649 ? 16.174  -14.974  -29.540 1.00 33.52  ? 695  CYS A SG    1 
ATOM   5074 N  N     . ILE A 1 650 ? 11.319  -14.068  -28.529 1.00 31.97  ? 696  ILE A N     1 
ATOM   5075 C  CA    . ILE A 1 650 ? 10.031  -13.406  -28.341 1.00 32.38  ? 696  ILE A CA    1 
ATOM   5076 C  C     . ILE A 1 650 ? 10.111  -12.394  -27.204 1.00 36.86  ? 696  ILE A C     1 
ATOM   5077 O  O     . ILE A 1 650 ? 10.541  -12.751  -26.126 1.00 36.67  ? 696  ILE A O     1 
ATOM   5078 C  CB    . ILE A 1 650 ? 8.914   -14.476  -28.094 1.00 36.09  ? 696  ILE A CB    1 
ATOM   5079 C  CG1   . ILE A 1 650 ? 8.798   -15.522  -29.231 1.00 37.50  ? 696  ILE A CG1   1 
ATOM   5080 C  CG2   . ILE A 1 650 ? 7.551   -13.869  -27.787 1.00 37.90  ? 696  ILE A CG2   1 
ATOM   5081 C  CD1   . ILE A 1 650 ? 8.482   -14.980  -30.694 1.00 47.18  ? 696  ILE A CD1   1 
ATOM   5082 N  N     . VAL A 1 651 ? 9.679   -11.152  -27.416 1.00 34.37  ? 697  VAL A N     1 
ATOM   5083 C  CA    . VAL A 1 651 ? 9.662   -10.209  -26.297 1.00 35.16  ? 697  VAL A CA    1 
ATOM   5084 C  C     . VAL A 1 651 ? 8.263   -10.325  -25.596 1.00 41.78  ? 697  VAL A C     1 
ATOM   5085 O  O     . VAL A 1 651 ? 7.239   -10.360  -26.297 1.00 41.43  ? 697  VAL A O     1 
ATOM   5086 C  CB    . VAL A 1 651 ? 10.118  -8.763   -26.685 1.00 38.42  ? 697  VAL A CB    1 
ATOM   5087 C  CG1   . VAL A 1 651 ? 9.118   -8.053   -27.571 1.00 37.38  ? 697  VAL A CG1   1 
ATOM   5088 C  CG2   . VAL A 1 651 ? 10.445  -7.923   -25.454 1.00 38.19  ? 697  VAL A CG2   1 
ATOM   5089 N  N     . PRO A 1 652 ? 8.203   -10.510  -24.247 1.00 37.45  ? 698  PRO A N     1 
ATOM   5090 C  CA    . PRO A 1 652 ? 6.905   -10.690  -23.575 1.00 36.83  ? 698  PRO A CA    1 
ATOM   5091 C  C     . PRO A 1 652 ? 6.016   -9.443   -23.498 1.00 43.56  ? 698  PRO A C     1 
ATOM   5092 O  O     . PRO A 1 652 ? 4.795   -9.549   -23.662 1.00 40.43  ? 698  PRO A O     1 
ATOM   5093 C  CB    . PRO A 1 652 ? 7.313   -11.128  -22.175 1.00 38.84  ? 698  PRO A CB    1 
ATOM   5094 C  CG    . PRO A 1 652 ? 8.626   -10.473  -21.962 1.00 43.10  ? 698  PRO A CG    1 
ATOM   5095 C  CD    . PRO A 1 652 ? 9.311   -10.536  -23.274 1.00 38.85  ? 698  PRO A CD    1 
ATOM   5096 N  N     . ASN A 1 653 ? 6.653   -8.304   -23.295 1.00 42.99  ? 699  ASN A N     1 
ATOM   5097 C  CA    . ASN A 1 653 ? 6.021   -7.014   -23.123 1.00 43.05  ? 699  ASN A CA    1 
ATOM   5098 C  C     . ASN A 1 653 ? 6.908   -5.918   -23.639 1.00 47.30  ? 699  ASN A C     1 
ATOM   5099 O  O     . ASN A 1 653 ? 7.986   -6.165   -24.072 1.00 46.64  ? 699  ASN A O     1 
ATOM   5100 C  CB    . ASN A 1 653 ? 5.655   -6.777   -21.662 1.00 42.19  ? 699  ASN A CB    1 
ATOM   5101 C  CG    . ASN A 1 653 ? 6.848   -6.736   -20.745 1.00 56.36  ? 699  ASN A CG    1 
ATOM   5102 O  OD1   . ASN A 1 653 ? 7.485   -5.742   -20.623 1.00 55.36  ? 699  ASN A OD1   1 
ATOM   5103 N  ND2   . ASN A 1 653 ? 7.114   -7.803   -20.080 1.00 42.96  ? 699  ASN A ND2   1 
ATOM   5104 N  N     . HIS A 1 654 ? 6.397   -4.709   -23.655 1.00 45.20  ? 700  HIS A N     1 
ATOM   5105 C  CA    . HIS A 1 654 ? 7.109   -3.535   -24.114 1.00 44.83  ? 700  HIS A CA    1 
ATOM   5106 C  C     . HIS A 1 654 ? 7.553   -2.613   -22.980 1.00 49.93  ? 700  HIS A C     1 
ATOM   5107 O  O     . HIS A 1 654 ? 7.720   -1.450   -23.179 1.00 48.40  ? 700  HIS A O     1 
ATOM   5108 C  CB    . HIS A 1 654 ? 6.235   -2.764   -25.062 1.00 45.26  ? 700  HIS A CB    1 
ATOM   5109 C  CG    . HIS A 1 654 ? 6.258   -3.282   -26.453 1.00 48.57  ? 700  HIS A CG    1 
ATOM   5110 N  ND1   . HIS A 1 654 ? 5.130   -3.379   -27.224 1.00 50.26  ? 700  HIS A ND1   1 
ATOM   5111 C  CD2   . HIS A 1 654 ? 7.276   -3.734   -27.217 1.00 50.21  ? 700  HIS A CD2   1 
ATOM   5112 C  CE1   . HIS A 1 654 ? 5.452   -3.851   -28.411 1.00 49.42  ? 700  HIS A CE1   1 
ATOM   5113 N  NE2   . HIS A 1 654 ? 6.746   -4.081   -28.428 1.00 49.69  ? 700  HIS A NE2   1 
ATOM   5114 N  N     . GLU A 1 655 ? 7.741   -3.154   -21.794 1.00 49.46  ? 701  GLU A N     1 
ATOM   5115 C  CA    . GLU A 1 655 ? 8.032   -2.352   -20.604 1.00 50.17  ? 701  GLU A CA    1 
ATOM   5116 C  C     . GLU A 1 655 ? 9.280   -2.786   -19.854 1.00 51.06  ? 701  GLU A C     1 
ATOM   5117 O  O     . GLU A 1 655 ? 9.519   -2.277   -18.753 1.00 51.08  ? 701  GLU A O     1 
ATOM   5118 C  CB    . GLU A 1 655 ? 6.833   -2.390   -19.637 1.00 52.22  ? 701  GLU A CB    1 
ATOM   5119 C  CG    . GLU A 1 655 ? 5.496   -1.961   -20.222 1.00 71.37  ? 701  GLU A CG    1 
ATOM   5120 C  CD    . GLU A 1 655 ? 4.287   -2.302   -19.368 1.00 111.01 ? 701  GLU A CD    1 
ATOM   5121 O  OE1   . GLU A 1 655 ? 4.418   -2.308   -18.122 1.00 115.65 ? 701  GLU A OE1   1 
ATOM   5122 O  OE2   . GLU A 1 655 ? 3.202   -2.544   -19.946 1.00 110.93 ? 701  GLU A OE2   1 
ATOM   5123 N  N     . LYS A 1 656 ? 9.998   -3.742   -20.421 1.00 45.75  ? 702  LYS A N     1 
ATOM   5124 C  CA    . LYS A 1 656 ? 11.197  -4.336   -19.856 1.00 45.07  ? 702  LYS A CA    1 
ATOM   5125 C  C     . LYS A 1 656 ? 10.921  -4.895   -18.500 1.00 51.39  ? 702  LYS A C     1 
ATOM   5126 O  O     . LYS A 1 656 ? 11.726  -4.812   -17.625 1.00 51.16  ? 702  LYS A O     1 
ATOM   5127 C  CB    . LYS A 1 656 ? 12.344  -3.355   -19.788 1.00 46.23  ? 702  LYS A CB    1 
ATOM   5128 C  CG    . LYS A 1 656 ? 12.755  -2.787   -21.122 1.00 54.84  ? 702  LYS A CG    1 
ATOM   5129 C  CD    . LYS A 1 656 ? 13.780  -1.706   -20.930 1.00 58.99  ? 702  LYS A CD    1 
ATOM   5130 C  CE    . LYS A 1 656 ? 13.471  -0.486   -21.748 1.00 61.29  ? 702  LYS A CE    1 
ATOM   5131 N  NZ    . LYS A 1 656 ? 14.070  -0.604   -23.076 1.00 67.93  ? 702  LYS A NZ    1 
ATOM   5132 N  N     . ARG A 1 657 ? 9.774   -5.515   -18.364 1.00 50.91  ? 703  ARG A N     1 
ATOM   5133 C  CA    . ARG A 1 657 ? 9.314   -6.046   -17.110 1.00 50.94  ? 703  ARG A CA    1 
ATOM   5134 C  C     . ARG A 1 657 ? 9.335   -7.531   -17.053 1.00 53.52  ? 703  ARG A C     1 
ATOM   5135 O  O     . ARG A 1 657 ? 8.941   -8.182   -17.969 1.00 51.87  ? 703  ARG A O     1 
ATOM   5136 C  CB    . ARG A 1 657 ? 7.866   -5.644   -16.929 1.00 54.58  ? 703  ARG A CB    1 
ATOM   5137 C  CG    . ARG A 1 657 ? 7.549   -4.898   -15.664 1.00 75.32  ? 703  ARG A CG    1 
ATOM   5138 C  CD    . ARG A 1 657 ? 7.338   -3.440   -15.973 1.00 100.03 ? 703  ARG A CD    1 
ATOM   5139 N  NE    . ARG A 1 657 ? 7.795   -2.594   -14.889 1.00 126.92 ? 703  ARG A NE    1 
ATOM   5140 C  CZ    . ARG A 1 657 ? 7.384   -2.717   -13.635 1.00 153.23 ? 703  ARG A CZ    1 
ATOM   5141 N  NH1   . ARG A 1 657 ? 6.521   -3.668   -13.329 1.00 144.12 ? 703  ARG A NH1   1 
ATOM   5142 N  NH2   . ARG A 1 657 ? 7.852   -1.907   -12.693 1.00 144.86 ? 703  ARG A NH2   1 
ATOM   5143 N  N     . ALA A 1 658 ? 9.826   -8.063   -15.959 1.00 52.03  ? 704  ALA A N     1 
ATOM   5144 C  CA    . ALA A 1 658 ? 9.832   -9.488   -15.743 1.00 52.01  ? 704  ALA A CA    1 
ATOM   5145 C  C     . ALA A 1 658 ? 8.467   -9.961   -15.273 1.00 56.61  ? 704  ALA A C     1 
ATOM   5146 O  O     . ALA A 1 658 ? 7.689   -9.182   -14.772 1.00 55.90  ? 704  ALA A O     1 
ATOM   5147 C  CB    . ALA A 1 658 ? 10.888  -9.853   -14.732 1.00 52.21  ? 704  ALA A CB    1 
ATOM   5148 N  N     . GLY A 1 659 ? 8.161   -11.231  -15.490 1.00 53.01  ? 705  GLY A N     1 
ATOM   5149 C  CA    . GLY A 1 659 ? 6.927   -11.809  -14.990 1.00 51.99  ? 705  GLY A CA    1 
ATOM   5150 C  C     . GLY A 1 659 ? 5.690   -11.049  -15.425 1.00 53.91  ? 705  GLY A C     1 
ATOM   5151 O  O     . GLY A 1 659 ? 4.732   -10.910  -14.664 1.00 53.66  ? 705  GLY A O     1 
ATOM   5152 N  N     . LYS A 1 660 ? 5.715   -10.557  -16.658 1.00 48.04  ? 706  LYS A N     1 
ATOM   5153 C  CA    . LYS A 1 660 ? 4.606   -9.815   -17.213 1.00 47.00  ? 706  LYS A CA    1 
ATOM   5154 C  C     . LYS A 1 660 ? 4.454   -10.079  -18.713 1.00 50.35  ? 706  LYS A C     1 
ATOM   5155 O  O     . LYS A 1 660 ? 4.788   -9.212   -19.515 1.00 51.48  ? 706  LYS A O     1 
ATOM   5156 C  CB    . LYS A 1 660 ? 4.773   -8.315   -16.894 1.00 48.65  ? 706  LYS A CB    1 
ATOM   5157 C  CG    . LYS A 1 660 ? 3.462   -7.543   -16.922 1.00 56.97  ? 706  LYS A CG    1 
ATOM   5158 C  CD    . LYS A 1 660 ? 3.654   -6.054   -16.670 1.00 67.89  ? 706  LYS A CD    1 
ATOM   5159 C  CE    . LYS A 1 660 ? 2.663   -5.234   -17.474 1.00 79.13  ? 706  LYS A CE    1 
ATOM   5160 N  NZ    . LYS A 1 660 ? 2.486   -3.867   -16.923 1.00 81.78  ? 706  LYS A NZ    1 
ATOM   5161 N  N     . LEU A 1 661 ? 3.953   -11.274  -19.090 1.00 44.39  ? 707  LEU A N     1 
ATOM   5162 C  CA    . LEU A 1 661 ? 3.701   -11.673  -20.484 1.00 43.10  ? 707  LEU A CA    1 
ATOM   5163 C  C     . LEU A 1 661 ? 2.440   -10.968  -21.012 1.00 49.09  ? 707  LEU A C     1 
ATOM   5164 O  O     . LEU A 1 661 ? 1.370   -11.101  -20.410 1.00 49.76  ? 707  LEU A O     1 
ATOM   5165 C  CB    . LEU A 1 661 ? 3.531   -13.220  -20.571 1.00 42.80  ? 707  LEU A CB    1 
ATOM   5166 C  CG    . LEU A 1 661 ? 3.580   -13.882  -21.965 1.00 46.38  ? 707  LEU A CG    1 
ATOM   5167 C  CD1   . LEU A 1 661 ? 3.848   -15.349  -21.861 1.00 45.18  ? 707  LEU A CD1   1 
ATOM   5168 C  CD2   . LEU A 1 661 ? 2.290   -13.712  -22.721 1.00 51.15  ? 707  LEU A CD2   1 
ATOM   5169 N  N     . GLU A 1 662 ? 2.552   -10.249  -22.155 1.00 45.43  ? 708  GLU A N     1 
ATOM   5170 C  CA    . GLU A 1 662 ? 1.409   -9.588   -22.790 1.00 45.87  ? 708  GLU A CA    1 
ATOM   5171 C  C     . GLU A 1 662 ? 0.891   -10.446  -23.982 1.00 51.73  ? 708  GLU A C     1 
ATOM   5172 O  O     . GLU A 1 662 ? 1.542   -10.538  -25.022 1.00 50.36  ? 708  GLU A O     1 
ATOM   5173 C  CB    . GLU A 1 662 ? 1.679   -8.109   -23.141 1.00 47.22  ? 708  GLU A CB    1 
ATOM   5174 C  CG    . GLU A 1 662 ? 2.011   -7.260   -21.916 1.00 55.31  ? 708  GLU A CG    1 
ATOM   5175 C  CD    . GLU A 1 662 ? 0.966   -6.279   -21.417 1.00 82.76  ? 708  GLU A CD    1 
ATOM   5176 O  OE1   . GLU A 1 662 ? -0.226  -6.653   -21.321 1.00 74.84  ? 708  GLU A OE1   1 
ATOM   5177 O  OE2   . GLU A 1 662 ? 1.359   -5.147   -21.056 1.00 84.87  ? 708  GLU A OE2   1 
ATOM   5178 N  N     . PRO A 1 663 ? -0.251  -11.148  -23.778 1.00 50.84  ? 709  PRO A N     1 
ATOM   5179 C  CA    . PRO A 1 663 ? -0.750  -12.110  -24.777 1.00 50.29  ? 709  PRO A CA    1 
ATOM   5180 C  C     . PRO A 1 663 ? -0.867  -11.660  -26.219 1.00 49.06  ? 709  PRO A C     1 
ATOM   5181 O  O     . PRO A 1 663 ? -0.518  -12.443  -27.097 1.00 48.17  ? 709  PRO A O     1 
ATOM   5182 C  CB    . PRO A 1 663 ? -2.139  -12.485  -24.235 1.00 52.57  ? 709  PRO A CB    1 
ATOM   5183 C  CG    . PRO A 1 663 ? -2.444  -11.447  -23.170 1.00 57.53  ? 709  PRO A CG    1 
ATOM   5184 C  CD    . PRO A 1 663 ? -1.112  -11.177  -22.579 1.00 53.11  ? 709  PRO A CD    1 
ATOM   5185 N  N     . ARG A 1 664 ? -1.405  -10.463  -26.461 1.00 42.47  ? 710  ARG A N     1 
ATOM   5186 C  CA    . ARG A 1 664 ? -1.613  -9.940   -27.798 1.00 41.84  ? 710  ARG A CA    1 
ATOM   5187 C  C     . ARG A 1 664 ? -0.274  -9.610   -28.501 1.00 42.52  ? 710  ARG A C     1 
ATOM   5188 O  O     . ARG A 1 664 ? -0.150  -9.818   -29.702 1.00 39.24  ? 710  ARG A O     1 
ATOM   5189 C  CB    . ARG A 1 664 ? -2.603  -8.751   -27.756 1.00 46.55  ? 710  ARG A CB    1 
ATOM   5190 C  CG    . ARG A 1 664 ? -3.140  -8.269   -29.125 1.00 69.23  ? 710  ARG A CG    1 
ATOM   5191 C  CD    . ARG A 1 664 ? -3.827  -9.337   -29.978 1.00 86.60  ? 710  ARG A CD    1 
ATOM   5192 N  NE    . ARG A 1 664 ? -4.836  -10.100  -29.235 1.00 100.86 ? 710  ARG A NE    1 
ATOM   5193 C  CZ    . ARG A 1 664 ? -6.108  -9.737   -29.110 1.00 116.99 ? 710  ARG A CZ    1 
ATOM   5194 N  NH1   . ARG A 1 664 ? -6.545  -8.612   -29.667 1.00 112.16 ? 710  ARG A NH1   1 
ATOM   5195 N  NH2   . ARG A 1 664 ? -6.954  -10.493  -28.423 1.00 94.38  ? 710  ARG A NH2   1 
ATOM   5196 N  N     . LEU A 1 665 ? 0.741   -9.177   -27.736 1.00 40.40  ? 711  LEU A N     1 
ATOM   5197 C  CA    . LEU A 1 665 ? 2.093   -8.926   -28.248 1.00 40.70  ? 711  LEU A CA    1 
ATOM   5198 C  C     . LEU A 1 665 ? 2.788   -10.269  -28.628 1.00 44.71  ? 711  LEU A C     1 
ATOM   5199 O  O     . LEU A 1 665 ? 3.407   -10.351  -29.697 1.00 43.96  ? 711  LEU A O     1 
ATOM   5200 C  CB    . LEU A 1 665 ? 2.918   -8.105   -27.233 1.00 40.79  ? 711  LEU A CB    1 
ATOM   5201 C  CG    . LEU A 1 665 ? 4.412   -7.882   -27.525 1.00 46.64  ? 711  LEU A CG    1 
ATOM   5202 C  CD1   . LEU A 1 665 ? 4.653   -7.207   -28.894 1.00 47.46  ? 711  LEU A CD1   1 
ATOM   5203 C  CD2   . LEU A 1 665 ? 5.050   -7.082   -26.438 1.00 48.97  ? 711  LEU A CD2   1 
ATOM   5204 N  N     . VAL A 1 666 ? 2.651   -11.314  -27.779 1.00 40.33  ? 712  VAL A N     1 
ATOM   5205 C  CA    . VAL A 1 666 ? 3.211   -12.647  -28.043 1.00 39.47  ? 712  VAL A CA    1 
ATOM   5206 C  C     . VAL A 1 666 ? 2.525   -13.330  -29.248 1.00 42.03  ? 712  VAL A C     1 
ATOM   5207 O  O     . VAL A 1 666 ? 3.225   -13.929  -30.063 1.00 41.35  ? 712  VAL A O     1 
ATOM   5208 C  CB    . VAL A 1 666 ? 3.230   -13.527  -26.793 1.00 43.81  ? 712  VAL A CB    1 
ATOM   5209 C  CG1   . VAL A 1 666 ? 3.507   -14.992  -27.133 1.00 44.04  ? 712  VAL A CG1   1 
ATOM   5210 C  CG2   . VAL A 1 666 ? 4.258   -13.011  -25.795 1.00 43.99  ? 712  VAL A CG2   1 
ATOM   5211 N  N     . LEU A 1 667 ? 1.227   -13.147  -29.379 1.00 37.11  ? 713  LEU A N     1 
ATOM   5212 C  CA    . LEU A 1 667 ? 0.474   -13.667  -30.476 1.00 35.94  ? 713  LEU A CA    1 
ATOM   5213 C  C     . LEU A 1 667 ? 0.891   -13.068  -31.805 1.00 36.16  ? 713  LEU A C     1 
ATOM   5214 O  O     . LEU A 1 667 ? 0.932   -13.776  -32.755 1.00 34.52  ? 713  LEU A O     1 
ATOM   5215 C  CB    . LEU A 1 667 ? -1.015  -13.474  -30.275 1.00 36.05  ? 713  LEU A CB    1 
ATOM   5216 C  CG    . LEU A 1 667 ? -1.727  -14.185  -29.146 1.00 41.74  ? 713  LEU A CG    1 
ATOM   5217 C  CD1   . LEU A 1 667 ? -3.154  -13.726  -29.063 1.00 41.59  ? 713  LEU A CD1   1 
ATOM   5218 C  CD2   . LEU A 1 667 ? -1.678  -15.676  -29.264 1.00 44.09  ? 713  LEU A CD2   1 
ATOM   5219 N  N     . ASP A 1 668 ? 1.171   -11.770  -31.856 1.00 31.86  ? 714  ASP A N     1 
ATOM   5220 C  CA    . ASP A 1 668 ? 1.590   -11.089  -33.085 1.00 32.35  ? 714  ASP A CA    1 
ATOM   5221 C  C     . ASP A 1 668 ? 2.910   -11.630  -33.605 1.00 33.33  ? 714  ASP A C     1 
ATOM   5222 O  O     . ASP A 1 668 ? 3.080   -11.830  -34.756 1.00 32.54  ? 714  ASP A O     1 
ATOM   5223 C  CB    . ASP A 1 668 ? 1.775   -9.592   -32.855 1.00 35.52  ? 714  ASP A CB    1 
ATOM   5224 C  CG    . ASP A 1 668 ? 0.492   -8.851   -32.650 1.00 54.14  ? 714  ASP A CG    1 
ATOM   5225 O  OD1   . ASP A 1 668 ? -0.575  -9.379   -32.943 1.00 56.21  ? 714  ASP A OD1   1 
ATOM   5226 O  OD2   . ASP A 1 668 ? 0.557   -7.696   -32.215 1.00 62.01  ? 714  ASP A OD2   1 
ATOM   5227 N  N     . GLN A 1 669 ? 3.824   -11.845  -32.691 1.00 29.44  ? 715  GLN A N     1 
ATOM   5228 C  CA    . GLN A 1 669 ? 5.165   -12.369  -32.914 1.00 29.67  ? 715  GLN A CA    1 
ATOM   5229 C  C     . GLN A 1 669 ? 5.099   -13.800  -33.392 1.00 33.93  ? 715  GLN A C     1 
ATOM   5230 O  O     . GLN A 1 669 ? 5.695   -14.107  -34.412 1.00 34.54  ? 715  GLN A O     1 
ATOM   5231 C  CB    . GLN A 1 669 ? 6.021   -12.267  -31.650 1.00 30.50  ? 715  GLN A CB    1 
ATOM   5232 C  CG    . GLN A 1 669 ? 6.508   -10.876  -31.390 1.00 26.66  ? 715  GLN A CG    1 
ATOM   5233 C  CD    . GLN A 1 669 ? 7.142   -10.783  -30.040 1.00 37.29  ? 715  GLN A CD    1 
ATOM   5234 O  OE1   . GLN A 1 669 ? 8.342   -10.999  -29.876 1.00 29.98  ? 715  GLN A OE1   1 
ATOM   5235 N  NE2   . GLN A 1 669 ? 6.360   -10.387  -29.058 1.00 23.63  ? 715  GLN A NE2   1 
ATOM   5236 N  N     . LEU A 1 670 ? 4.334   -14.658  -32.714 1.00 30.80  ? 716  LEU A N     1 
ATOM   5237 C  CA    . LEU A 1 670 ? 4.146   -16.062  -33.111 1.00 29.96  ? 716  LEU A CA    1 
ATOM   5238 C  C     . LEU A 1 670 ? 3.548   -16.139  -34.509 1.00 34.35  ? 716  LEU A C     1 
ATOM   5239 O  O     . LEU A 1 670 ? 3.907   -17.043  -35.262 1.00 32.97  ? 716  LEU A O     1 
ATOM   5240 C  CB    . LEU A 1 670 ? 3.197   -16.753  -32.148 1.00 30.65  ? 716  LEU A CB    1 
ATOM   5241 C  CG    . LEU A 1 670 ? 3.682   -16.964  -30.709 1.00 35.46  ? 716  LEU A CG    1 
ATOM   5242 C  CD1   . LEU A 1 670 ? 2.542   -17.503  -29.839 1.00 34.30  ? 716  LEU A CD1   1 
ATOM   5243 C  CD2   . LEU A 1 670 ? 4.973   -17.858  -30.646 1.00 39.23  ? 716  LEU A CD2   1 
ATOM   5244 N  N     . ARG A 1 671 ? 2.672   -15.147  -34.861 1.00 33.09  ? 717  ARG A N     1 
ATOM   5245 C  CA    . ARG A 1 671 ? 1.958   -14.984  -36.131 1.00 34.10  ? 717  ARG A CA    1 
ATOM   5246 C  C     . ARG A 1 671 ? 2.889   -14.584  -37.260 1.00 39.25  ? 717  ARG A C     1 
ATOM   5247 O  O     . ARG A 1 671 ? 2.894   -15.278  -38.268 1.00 42.18  ? 717  ARG A O     1 
ATOM   5248 C  CB    . ARG A 1 671 ? 0.791   -13.961  -36.027 1.00 35.49  ? 717  ARG A CB    1 
ATOM   5249 C  CG    . ARG A 1 671 ? -0.562  -14.566  -35.599 1.00 57.89  ? 717  ARG A CG    1 
ATOM   5250 C  CD    . ARG A 1 671 ? -1.634  -13.498  -35.398 1.00 70.96  ? 717  ARG A CD    1 
ATOM   5251 N  NE    . ARG A 1 671 ? -2.610  -13.886  -34.382 1.00 74.55  ? 717  ARG A NE    1 
ATOM   5252 C  CZ    . ARG A 1 671 ? -3.432  -13.045  -33.763 1.00 95.27  ? 717  ARG A CZ    1 
ATOM   5253 N  NH1   . ARG A 1 671 ? -3.419  -11.751  -34.057 1.00 81.46  ? 717  ARG A NH1   1 
ATOM   5254 N  NH2   . ARG A 1 671 ? -4.281  -13.493  -32.845 1.00 91.51  ? 717  ARG A NH2   1 
ATOM   5255 N  N     . CYS A 1 672 ? 3.661   -13.483  -37.127 1.00 32.99  ? 718  CYS A N     1 
ATOM   5256 C  CA    . CYS A 1 672 ? 4.539   -13.046  -38.229 1.00 32.19  ? 718  CYS A CA    1 
ATOM   5257 C  C     . CYS A 1 672 ? 5.745   -13.960  -38.430 1.00 35.09  ? 718  CYS A C     1 
ATOM   5258 O  O     . CYS A 1 672 ? 6.302   -14.024  -39.533 1.00 35.16  ? 718  CYS A O     1 
ATOM   5259 C  CB    . CYS A 1 672 ? 4.959   -11.582  -38.087 1.00 30.98  ? 718  CYS A CB    1 
ATOM   5260 S  SG    . CYS A 1 672 ? 6.002   -11.232  -36.651 1.00 34.58  ? 718  CYS A SG    1 
ATOM   5261 N  N     . ASN A 1 673 ? 6.138   -14.660  -37.361 1.00 29.73  ? 719  ASN A N     1 
ATOM   5262 C  CA    . ASN A 1 673 ? 7.255   -15.591  -37.363 1.00 28.97  ? 719  ASN A CA    1 
ATOM   5263 C  C     . ASN A 1 673 ? 6.930   -16.886  -38.062 1.00 33.40  ? 719  ASN A C     1 
ATOM   5264 O  O     . ASN A 1 673 ? 7.844   -17.600  -38.483 1.00 33.98  ? 719  ASN A O     1 
ATOM   5265 C  CB    . ASN A 1 673 ? 7.717   -15.872  -35.926 1.00 30.13  ? 719  ASN A CB    1 
ATOM   5266 C  CG    . ASN A 1 673 ? 8.532   -14.751  -35.320 1.00 38.58  ? 719  ASN A CG    1 
ATOM   5267 O  OD1   . ASN A 1 673 ? 8.671   -13.655  -35.875 1.00 29.69  ? 719  ASN A OD1   1 
ATOM   5268 N  ND2   . ASN A 1 673 ? 9.044   -14.986  -34.136 1.00 24.61  ? 719  ASN A ND2   1 
ATOM   5269 N  N     . GLY A 1 674 ? 5.649   -17.205  -38.133 1.00 30.87  ? 720  GLY A N     1 
ATOM   5270 C  CA    . GLY A 1 674 ? 5.171   -18.437  -38.733 1.00 31.32  ? 720  GLY A CA    1 
ATOM   5271 C  C     . GLY A 1 674 ? 5.462   -19.620  -37.853 1.00 36.80  ? 720  GLY A C     1 
ATOM   5272 O  O     . GLY A 1 674 ? 5.752   -20.712  -38.356 1.00 38.56  ? 720  GLY A O     1 
ATOM   5273 N  N     . VAL A 1 675 ? 5.410   -19.410  -36.522 1.00 33.01  ? 721  VAL A N     1 
ATOM   5274 C  CA    . VAL A 1 675 ? 5.663   -20.455  -35.543 1.00 33.08  ? 721  VAL A CA    1 
ATOM   5275 C  C     . VAL A 1 675 ? 4.706   -21.641  -35.716 1.00 40.41  ? 721  VAL A C     1 
ATOM   5276 O  O     . VAL A 1 675 ? 5.188   -22.773  -35.760 1.00 43.52  ? 721  VAL A O     1 
ATOM   5277 C  CB    . VAL A 1 675 ? 5.699   -19.911  -34.075 1.00 35.63  ? 721  VAL A CB    1 
ATOM   5278 C  CG1   . VAL A 1 675 ? 5.567   -21.035  -33.041 1.00 34.63  ? 721  VAL A CG1   1 
ATOM   5279 C  CG2   . VAL A 1 675 ? 6.965   -19.075  -33.829 1.00 34.66  ? 721  VAL A CG2   1 
ATOM   5280 N  N     . LEU A 1 676 ? 3.384   -21.414  -35.792 1.00 35.49  ? 722  LEU A N     1 
ATOM   5281 C  CA    . LEU A 1 676 ? 2.452   -22.547  -35.916 1.00 35.89  ? 722  LEU A CA    1 
ATOM   5282 C  C     . LEU A 1 676 ? 2.623   -23.312  -37.214 1.00 35.60  ? 722  LEU A C     1 
ATOM   5283 O  O     . LEU A 1 676 ? 2.537   -24.526  -37.213 1.00 33.06  ? 722  LEU A O     1 
ATOM   5284 C  CB    . LEU A 1 676 ? 0.990   -22.110  -35.818 1.00 37.04  ? 722  LEU A CB    1 
ATOM   5285 C  CG    . LEU A 1 676 ? 0.462   -21.526  -34.533 1.00 44.11  ? 722  LEU A CG    1 
ATOM   5286 C  CD1   . LEU A 1 676 ? -0.952  -21.047  -34.750 1.00 45.60  ? 722  LEU A CD1   1 
ATOM   5287 C  CD2   . LEU A 1 676 ? 0.381   -22.530  -33.483 1.00 51.31  ? 722  LEU A CD2   1 
ATOM   5288 N  N     . GLU A 1 677 ? 2.797   -22.594  -38.332 1.00 31.88  ? 723  GLU A N     1 
ATOM   5289 C  CA    . GLU A 1 677 ? 2.959   -23.200  -39.645 1.00 31.13  ? 723  GLU A CA    1 
ATOM   5290 C  C     . GLU A 1 677 ? 4.206   -24.086  -39.656 1.00 36.32  ? 723  GLU A C     1 
ATOM   5291 O  O     . GLU A 1 677 ? 4.140   -25.186  -40.188 1.00 35.93  ? 723  GLU A O     1 
ATOM   5292 C  CB    . GLU A 1 677 ? 2.993   -22.127  -40.723 1.00 32.26  ? 723  GLU A CB    1 
ATOM   5293 C  CG    . GLU A 1 677 ? 1.711   -21.312  -40.785 1.00 44.22  ? 723  GLU A CG    1 
ATOM   5294 C  CD    . GLU A 1 677 ? 1.691   -20.027  -39.974 1.00 59.43  ? 723  GLU A CD    1 
ATOM   5295 O  OE1   . GLU A 1 677 ? 2.324   -19.985  -38.895 1.00 33.56  ? 723  GLU A OE1   1 
ATOM   5296 O  OE2   . GLU A 1 677 ? 1.017   -19.066  -40.410 1.00 54.94  ? 723  GLU A OE2   1 
ATOM   5297 N  N     . GLY A 1 678 ? 5.286   -23.647  -39.021 1.00 33.15  ? 724  GLY A N     1 
ATOM   5298 C  CA    . GLY A 1 678 ? 6.486   -24.458  -38.967 1.00 33.70  ? 724  GLY A CA    1 
ATOM   5299 C  C     . GLY A 1 678 ? 6.205   -25.755  -38.228 1.00 41.02  ? 724  GLY A C     1 
ATOM   5300 O  O     . GLY A 1 678 ? 6.658   -26.823  -38.638 1.00 43.67  ? 724  GLY A O     1 
ATOM   5301 N  N     . ILE A 1 679 ? 5.452   -25.662  -37.133 1.00 35.88  ? 725  ILE A N     1 
ATOM   5302 C  CA    . ILE A 1 679 ? 5.094   -26.837  -36.342 1.00 33.99  ? 725  ILE A CA    1 
ATOM   5303 C  C     . ILE A 1 679 ? 4.229   -27.798  -37.154 1.00 39.24  ? 725  ILE A C     1 
ATOM   5304 O  O     . ILE A 1 679 ? 4.414   -29.014  -37.104 1.00 39.85  ? 725  ILE A O     1 
ATOM   5305 C  CB    . ILE A 1 679 ? 4.343   -26.445  -35.056 1.00 36.78  ? 725  ILE A CB    1 
ATOM   5306 C  CG1   . ILE A 1 679 ? 5.263   -25.663  -34.118 1.00 35.92  ? 725  ILE A CG1   1 
ATOM   5307 C  CG2   . ILE A 1 679 ? 3.793   -27.682  -34.362 1.00 38.15  ? 725  ILE A CG2   1 
ATOM   5308 C  CD1   . ILE A 1 679 ? 4.543   -25.014  -32.956 1.00 26.87  ? 725  ILE A CD1   1 
ATOM   5309 N  N     . ARG A 1 680 ? 3.286   -27.234  -37.901 1.00 35.69  ? 726  ARG A N     1 
ATOM   5310 C  CA    . ARG A 1 680 ? 2.389   -28.010  -38.762 1.00 34.38  ? 726  ARG A CA    1 
ATOM   5311 C  C     . ARG A 1 680 ? 3.103   -28.700  -39.884 1.00 42.31  ? 726  ARG A C     1 
ATOM   5312 O  O     . ARG A 1 680 ? 2.747   -29.848  -40.190 1.00 43.82  ? 726  ARG A O     1 
ATOM   5313 C  CB    . ARG A 1 680 ? 1.249   -27.173  -39.301 1.00 29.27  ? 726  ARG A CB    1 
ATOM   5314 C  CG    . ARG A 1 680 ? 0.242   -26.858  -38.246 1.00 34.89  ? 726  ARG A CG    1 
ATOM   5315 C  CD    . ARG A 1 680 ? -0.875  -25.979  -38.756 1.00 37.55  ? 726  ARG A CD    1 
ATOM   5316 N  NE    . ARG A 1 680 ? -1.755  -25.572  -37.653 1.00 47.88  ? 726  ARG A NE    1 
ATOM   5317 C  CZ    . ARG A 1 680 ? -2.123  -24.318  -37.399 1.00 67.08  ? 726  ARG A CZ    1 
ATOM   5318 N  NH1   . ARG A 1 680 ? -1.723  -23.326  -38.188 1.00 51.89  ? 726  ARG A NH1   1 
ATOM   5319 N  NH2   . ARG A 1 680 ? -2.921  -24.049  -36.373 1.00 58.22  ? 726  ARG A NH2   1 
ATOM   5320 N  N     . ILE A 1 681 ? 4.127   -28.054  -40.498 1.00 38.72  ? 727  ILE A N     1 
ATOM   5321 C  CA    . ILE A 1 681 ? 4.899   -28.728  -41.569 1.00 37.87  ? 727  ILE A CA    1 
ATOM   5322 C  C     . ILE A 1 681 ? 5.736   -29.915  -40.996 1.00 42.33  ? 727  ILE A C     1 
ATOM   5323 O  O     . ILE A 1 681 ? 6.146   -30.801  -41.736 1.00 40.33  ? 727  ILE A O     1 
ATOM   5324 C  CB    . ILE A 1 681 ? 5.737   -27.735  -42.442 1.00 40.11  ? 727  ILE A CB    1 
ATOM   5325 C  CG1   . ILE A 1 681 ? 6.333   -28.424  -43.747 1.00 41.61  ? 727  ILE A CG1   1 
ATOM   5326 C  CG2   . ILE A 1 681 ? 6.813   -27.025  -41.627 1.00 38.00  ? 727  ILE A CG2   1 
ATOM   5327 C  CD1   . ILE A 1 681 ? 5.309   -28.910  -44.836 1.00 42.88  ? 727  ILE A CD1   1 
ATOM   5328 N  N     . CYS A 1 682 ? 5.964   -29.919  -39.671 1.00 42.16  ? 728  CYS A N     1 
ATOM   5329 C  CA    . CYS A 1 682 ? 6.672   -30.969  -38.945 1.00 43.60  ? 728  CYS A CA    1 
ATOM   5330 C  C     . CYS A 1 682 ? 5.743   -32.188  -38.649 1.00 44.98  ? 728  CYS A C     1 
ATOM   5331 O  O     . CYS A 1 682 ? 6.190   -33.323  -38.711 1.00 43.98  ? 728  CYS A O     1 
ATOM   5332 C  CB    . CYS A 1 682 ? 7.293   -30.396  -37.675 1.00 45.66  ? 728  CYS A CB    1 
ATOM   5333 S  SG    . CYS A 1 682 ? 8.211   -31.594  -36.685 1.00 50.87  ? 728  CYS A SG    1 
ATOM   5334 N  N     . ARG A 1 683 ? 4.460   -31.943  -38.360 1.00 41.33  ? 729  ARG A N     1 
ATOM   5335 C  CA    . ARG A 1 683 ? 3.442   -32.964  -38.080 1.00 39.82  ? 729  ARG A CA    1 
ATOM   5336 C  C     . ARG A 1 683 ? 2.863   -33.558  -39.384 1.00 42.15  ? 729  ARG A C     1 
ATOM   5337 O  O     . ARG A 1 683 ? 2.564   -34.749  -39.447 1.00 41.73  ? 729  ARG A O     1 
ATOM   5338 C  CB    . ARG A 1 683 ? 2.313   -32.327  -37.267 1.00 39.80  ? 729  ARG A CB    1 
ATOM   5339 C  CG    . ARG A 1 683 ? 2.733   -31.800  -35.886 1.00 46.51  ? 729  ARG A CG    1 
ATOM   5340 C  CD    . ARG A 1 683 ? 1.874   -30.612  -35.438 1.00 50.65  ? 729  ARG A CD    1 
ATOM   5341 N  NE    . ARG A 1 683 ? 0.488   -30.982  -35.155 1.00 50.67  ? 729  ARG A NE    1 
ATOM   5342 C  CZ    . ARG A 1 683 ? 0.040   -31.354  -33.954 1.00 64.48  ? 729  ARG A CZ    1 
ATOM   5343 N  NH1   . ARG A 1 683 ? 0.855   -31.364  -32.908 1.00 42.74  ? 729  ARG A NH1   1 
ATOM   5344 N  NH2   . ARG A 1 683 ? -1.235  -31.703  -33.794 1.00 49.40  ? 729  ARG A NH2   1 
ATOM   5345 N  N     . GLN A 1 684 ? 2.718   -32.721  -40.427 1.00 37.62  ? 730  GLN A N     1 
ATOM   5346 C  CA    . GLN A 1 684 ? 2.151   -33.107  -41.721 1.00 35.85  ? 730  GLN A CA    1 
ATOM   5347 C  C     . GLN A 1 684 ? 3.150   -33.682  -42.669 1.00 41.21  ? 730  GLN A C     1 
ATOM   5348 O  O     . GLN A 1 684 ? 2.766   -34.456  -43.550 1.00 44.22  ? 730  GLN A O     1 
ATOM   5349 C  CB    . GLN A 1 684 ? 1.393   -31.935  -42.370 1.00 36.82  ? 730  GLN A CB    1 
ATOM   5350 C  CG    . GLN A 1 684 ? 0.233   -31.406  -41.479 1.00 37.49  ? 730  GLN A CG    1 
ATOM   5351 C  CD    . GLN A 1 684 ? -0.540  -30.263  -42.086 1.00 45.43  ? 730  GLN A CD    1 
ATOM   5352 O  OE1   . GLN A 1 684 ? -0.674  -30.147  -43.308 1.00 40.64  ? 730  GLN A OE1   1 
ATOM   5353 N  NE2   . GLN A 1 684 ? -1.068  -29.381  -41.245 1.00 40.59  ? 730  GLN A NE2   1 
ATOM   5354 N  N     . GLY A 1 685 ? 4.422   -33.347  -42.496 1.00 36.84  ? 731  GLY A N     1 
ATOM   5355 C  CA    . GLY A 1 685 ? 5.475   -33.892  -43.346 1.00 36.53  ? 731  GLY A CA    1 
ATOM   5356 C  C     . GLY A 1 685 ? 6.200   -35.046  -42.683 1.00 38.66  ? 731  GLY A C     1 
ATOM   5357 O  O     . GLY A 1 685 ? 5.687   -35.644  -41.729 1.00 37.32  ? 731  GLY A O     1 
ATOM   5358 N  N     . PHE A 1 686 ? 7.446   -35.278  -43.128 1.00 34.61  ? 732  PHE A N     1 
ATOM   5359 C  CA    . PHE A 1 686 ? 8.371   -36.298  -42.628 1.00 34.99  ? 732  PHE A CA    1 
ATOM   5360 C  C     . PHE A 1 686 ? 9.706   -35.573  -42.270 1.00 41.90  ? 732  PHE A C     1 
ATOM   5361 O  O     . PHE A 1 686 ? 10.553  -35.426  -43.154 1.00 42.87  ? 732  PHE A O     1 
ATOM   5362 C  CB    . PHE A 1 686 ? 8.583   -37.349  -43.723 1.00 36.57  ? 732  PHE A CB    1 
ATOM   5363 C  CG    . PHE A 1 686 ? 7.291   -37.997  -44.179 1.00 38.83  ? 732  PHE A CG    1 
ATOM   5364 C  CD1   . PHE A 1 686 ? 6.525   -37.427  -45.190 1.00 42.09  ? 732  PHE A CD1   1 
ATOM   5365 C  CD2   . PHE A 1 686 ? 6.814   -39.142  -43.561 1.00 41.62  ? 732  PHE A CD2   1 
ATOM   5366 C  CE1   . PHE A 1 686 ? 5.279   -37.956  -45.531 1.00 43.28  ? 732  PHE A CE1   1 
ATOM   5367 C  CE2   . PHE A 1 686 ? 5.586   -39.690  -43.928 1.00 45.05  ? 732  PHE A CE2   1 
ATOM   5368 C  CZ    . PHE A 1 686 ? 4.818   -39.079  -44.895 1.00 42.81  ? 732  PHE A CZ    1 
ATOM   5369 N  N     . PRO A 1 687 ? 9.916   -35.097  -41.014 1.00 37.83  ? 733  PRO A N     1 
ATOM   5370 C  CA    . PRO A 1 687 ? 11.125  -34.299  -40.718 1.00 37.82  ? 733  PRO A CA    1 
ATOM   5371 C  C     . PRO A 1 687 ? 12.456  -35.037  -40.629 1.00 45.17  ? 733  PRO A C     1 
ATOM   5372 O  O     . PRO A 1 687 ? 13.491  -34.384  -40.731 1.00 45.97  ? 733  PRO A O     1 
ATOM   5373 C  CB    . PRO A 1 687 ? 10.783  -33.651  -39.382 1.00 38.97  ? 733  PRO A CB    1 
ATOM   5374 C  CG    . PRO A 1 687 ? 9.888   -34.635  -38.715 1.00 43.07  ? 733  PRO A CG    1 
ATOM   5375 C  CD    . PRO A 1 687 ? 9.028   -35.155  -39.834 1.00 39.39  ? 733  PRO A CD    1 
ATOM   5376 N  N     . ASN A 1 688 ? 12.420  -36.345  -40.502 1.00 42.47  ? 734  ASN A N     1 
ATOM   5377 C  CA    . ASN A 1 688 ? 13.603  -37.161  -40.383 1.00 41.64  ? 734  ASN A CA    1 
ATOM   5378 C  C     . ASN A 1 688 ? 13.837  -38.016  -41.596 1.00 44.94  ? 734  ASN A C     1 
ATOM   5379 O  O     . ASN A 1 688 ? 12.960  -38.673  -42.051 1.00 45.40  ? 734  ASN A O     1 
ATOM   5380 C  CB    . ASN A 1 688 ? 13.473  -38.070  -39.182 1.00 42.61  ? 734  ASN A CB    1 
ATOM   5381 C  CG    . ASN A 1 688 ? 13.416  -37.318  -37.896 1.00 69.01  ? 734  ASN A CG    1 
ATOM   5382 O  OD1   . ASN A 1 688 ? 12.477  -37.424  -37.142 1.00 56.10  ? 734  ASN A OD1   1 
ATOM   5383 N  ND2   . ASN A 1 688 ? 14.423  -36.536  -37.650 1.00 67.23  ? 734  ASN A ND2   1 
ATOM   5384 N  N     . ARG A 1 689 ? 15.047  -37.979  -42.117 1.00 42.82  ? 735  ARG A N     1 
ATOM   5385 C  CA    . ARG A 1 689 ? 15.442  -38.741  -43.273 1.00 42.57  ? 735  ARG A CA    1 
ATOM   5386 C  C     . ARG A 1 689 ? 16.707  -39.504  -42.959 1.00 46.20  ? 735  ARG A C     1 
ATOM   5387 O  O     . ARG A 1 689 ? 17.514  -39.050  -42.197 1.00 46.65  ? 735  ARG A O     1 
ATOM   5388 C  CB    . ARG A 1 689 ? 15.724  -37.822  -44.440 1.00 44.05  ? 735  ARG A CB    1 
ATOM   5389 C  CG    . ARG A 1 689 ? 15.013  -36.499  -44.398 1.00 59.12  ? 735  ARG A CG    1 
ATOM   5390 C  CD    . ARG A 1 689 ? 15.808  -35.408  -45.062 1.00 66.35  ? 735  ARG A CD    1 
ATOM   5391 N  NE    . ARG A 1 689 ? 15.109  -34.152  -44.958 1.00 69.51  ? 735  ARG A NE    1 
ATOM   5392 C  CZ    . ARG A 1 689 ? 15.425  -33.074  -45.649 1.00 80.23  ? 735  ARG A CZ    1 
ATOM   5393 N  NH1   . ARG A 1 689 ? 16.442  -33.099  -46.488 1.00 70.57  ? 735  ARG A NH1   1 
ATOM   5394 N  NH2   . ARG A 1 689 ? 14.722  -31.974  -45.507 1.00 56.63  ? 735  ARG A NH2   1 
ATOM   5395 N  N     . ILE A 1 690 ? 16.831  -40.697  -43.537 1.00 40.27  ? 736  ILE A N     1 
ATOM   5396 C  CA    . ILE A 1 690 ? 18.001  -41.545  -43.334 1.00 38.18  ? 736  ILE A CA    1 
ATOM   5397 C  C     . ILE A 1 690 ? 18.419  -42.226  -44.640 1.00 41.07  ? 736  ILE A C     1 
ATOM   5398 O  O     . ILE A 1 690 ? 17.578  -42.535  -45.484 1.00 40.26  ? 736  ILE A O     1 
ATOM   5399 C  CB    . ILE A 1 690 ? 17.731  -42.619  -42.261 1.00 40.46  ? 736  ILE A CB    1 
ATOM   5400 C  CG1   . ILE A 1 690 ? 19.045  -43.171  -41.702 1.00 39.87  ? 736  ILE A CG1   1 
ATOM   5401 C  CG2   . ILE A 1 690 ? 16.861  -43.732  -42.827 1.00 42.18  ? 736  ILE A CG2   1 
ATOM   5402 C  CD1   . ILE A 1 690 ? 18.858  -44.234  -40.641 1.00 41.43  ? 736  ILE A CD1   1 
ATOM   5403 N  N     . LEU A 1 691 ? 19.698  -42.308  -44.936 1.00 38.94  ? 737  LEU A N     1 
ATOM   5404 C  CA    . LEU A 1 691 ? 20.119  -42.942  -46.182 1.00 40.27  ? 737  LEU A CA    1 
ATOM   5405 C  C     . LEU A 1 691 ? 19.920  -44.451  -46.115 1.00 43.57  ? 737  LEU A C     1 
ATOM   5406 O  O     . LEU A 1 691 ? 19.934  -44.999  -45.048 1.00 41.29  ? 737  LEU A O     1 
ATOM   5407 C  CB    . LEU A 1 691 ? 21.550  -42.585  -46.526 1.00 40.89  ? 737  LEU A CB    1 
ATOM   5408 C  CG    . LEU A 1 691 ? 21.850  -41.133  -46.850 1.00 46.67  ? 737  LEU A CG    1 
ATOM   5409 C  CD1   . LEU A 1 691 ? 23.292  -40.832  -46.551 1.00 47.29  ? 737  LEU A CD1   1 
ATOM   5410 C  CD2   . LEU A 1 691 ? 21.522  -40.773  -48.270 1.00 46.87  ? 737  LEU A CD2   1 
ATOM   5411 N  N     . PHE A 1 692 ? 19.760  -45.116  -47.248 1.00 41.91  ? 738  PHE A N     1 
ATOM   5412 C  CA    . PHE A 1 692 ? 19.522  -46.547  -47.218 1.00 43.47  ? 738  PHE A CA    1 
ATOM   5413 C  C     . PHE A 1 692 ? 20.648  -47.315  -46.541 1.00 51.77  ? 738  PHE A C     1 
ATOM   5414 O  O     . PHE A 1 692 ? 20.396  -48.131  -45.702 1.00 51.03  ? 738  PHE A O     1 
ATOM   5415 C  CB    . PHE A 1 692 ? 19.393  -47.100  -48.615 1.00 44.78  ? 738  PHE A CB    1 
ATOM   5416 C  CG    . PHE A 1 692 ? 18.242  -46.570  -49.402 1.00 45.55  ? 738  PHE A CG    1 
ATOM   5417 C  CD1   . PHE A 1 692 ? 17.010  -46.444  -48.855 1.00 48.35  ? 738  PHE A CD1   1 
ATOM   5418 C  CD2   . PHE A 1 692 ? 18.404  -46.265  -50.718 1.00 46.97  ? 738  PHE A CD2   1 
ATOM   5419 C  CE1   . PHE A 1 692 ? 15.965  -45.981  -49.594 1.00 49.56  ? 738  PHE A CE1   1 
ATOM   5420 C  CE2   . PHE A 1 692 ? 17.364  -45.816  -51.473 1.00 49.77  ? 738  PHE A CE2   1 
ATOM   5421 C  CZ    . PHE A 1 692 ? 16.139  -45.667  -50.909 1.00 48.43  ? 738  PHE A CZ    1 
ATOM   5422 N  N     . GLN A 1 693 ? 21.893  -47.011  -46.864 1.00 51.13  ? 739  GLN A N     1 
ATOM   5423 C  CA    . GLN A 1 693 ? 23.048  -47.679  -46.231 1.00 51.79  ? 739  GLN A CA    1 
ATOM   5424 C  C     . GLN A 1 693 ? 23.107  -47.501  -44.687 1.00 54.43  ? 739  GLN A C     1 
ATOM   5425 O  O     . GLN A 1 693 ? 23.415  -48.465  -43.977 1.00 53.94  ? 739  GLN A O     1 
ATOM   5426 C  CB    . GLN A 1 693 ? 24.391  -47.279  -46.901 1.00 53.33  ? 739  GLN A CB    1 
ATOM   5427 C  CG    . GLN A 1 693 ? 24.802  -45.792  -46.798 1.00 71.60  ? 739  GLN A CG    1 
ATOM   5428 C  CD    . GLN A 1 693 ? 24.505  -44.954  -48.029 1.00 86.37  ? 739  GLN A CD    1 
ATOM   5429 O  OE1   . GLN A 1 693 ? 23.515  -45.161  -48.758 1.00 77.21  ? 739  GLN A OE1   1 
ATOM   5430 N  NE2   . GLN A 1 693 ? 25.332  -43.935  -48.247 1.00 76.25  ? 739  GLN A NE2   1 
ATOM   5431 N  N     . GLU A 1 694 ? 22.778  -46.303  -44.182 1.00 50.83  ? 740  GLU A N     1 
ATOM   5432 C  CA    . GLU A 1 694 ? 22.789  -46.011  -42.748 1.00 50.66  ? 740  GLU A CA    1 
ATOM   5433 C  C     . GLU A 1 694 ? 21.640  -46.700  -42.008 1.00 51.96  ? 740  GLU A C     1 
ATOM   5434 O  O     . GLU A 1 694 ? 21.798  -47.068  -40.844 1.00 51.66  ? 740  GLU A O     1 
ATOM   5435 C  CB    . GLU A 1 694 ? 22.792  -44.500  -42.473 1.00 52.13  ? 740  GLU A CB    1 
ATOM   5436 C  CG    . GLU A 1 694 ? 22.957  -44.164  -40.993 1.00 65.38  ? 740  GLU A CG    1 
ATOM   5437 C  CD    . GLU A 1 694 ? 22.624  -42.755  -40.535 1.00 91.68  ? 740  GLU A CD    1 
ATOM   5438 O  OE1   . GLU A 1 694 ? 22.252  -41.919  -41.391 1.00 102.56 ? 740  GLU A OE1   1 
ATOM   5439 O  OE2   . GLU A 1 694 ? 22.728  -42.489  -39.313 1.00 76.87  ? 740  GLU A OE2   1 
ATOM   5440 N  N     . PHE A 1 695 ? 20.491  -46.855  -42.662 1.00 46.49  ? 741  PHE A N     1 
ATOM   5441 C  CA    . PHE A 1 695 ? 19.336  -47.516  -42.048 1.00 45.16  ? 741  PHE A CA    1 
ATOM   5442 C  C     . PHE A 1 695 ? 19.649  -49.018  -41.836 1.00 47.03  ? 741  PHE A C     1 
ATOM   5443 O  O     . PHE A 1 695 ? 19.551  -49.526  -40.711 1.00 45.76  ? 741  PHE A O     1 
ATOM   5444 C  CB    . PHE A 1 695 ? 18.070  -47.294  -42.907 1.00 45.99  ? 741  PHE A CB    1 
ATOM   5445 C  CG    . PHE A 1 695 ? 16.821  -47.859  -42.283 1.00 47.10  ? 741  PHE A CG    1 
ATOM   5446 C  CD1   . PHE A 1 695 ? 16.148  -47.161  -41.290 1.00 50.01  ? 741  PHE A CD1   1 
ATOM   5447 C  CD2   . PHE A 1 695 ? 16.337  -49.107  -42.664 1.00 48.36  ? 741  PHE A CD2   1 
ATOM   5448 C  CE1   . PHE A 1 695 ? 15.013  -47.705  -40.687 1.00 51.45  ? 741  PHE A CE1   1 
ATOM   5449 C  CE2   . PHE A 1 695 ? 15.197  -49.642  -42.071 1.00 50.63  ? 741  PHE A CE2   1 
ATOM   5450 C  CZ    . PHE A 1 695 ? 14.543  -48.944  -41.089 1.00 50.08  ? 741  PHE A CZ    1 
ATOM   5451 N  N     . ARG A 1 696 ? 20.040  -49.694  -42.919 1.00 44.07  ? 742  ARG A N     1 
ATOM   5452 C  CA    . ARG A 1 696 ? 20.432  -51.114  -42.961 1.00 45.19  ? 742  ARG A CA    1 
ATOM   5453 C  C     . ARG A 1 696 ? 21.484  -51.395  -41.894 1.00 52.19  ? 742  ARG A C     1 
ATOM   5454 O  O     . ARG A 1 696 ? 21.279  -52.267  -41.049 1.00 51.17  ? 742  ARG A O     1 
ATOM   5455 C  CB    . ARG A 1 696 ? 20.982  -51.477  -44.351 1.00 44.44  ? 742  ARG A CB    1 
ATOM   5456 C  CG    . ARG A 1 696 ? 21.156  -52.977  -44.569 1.00 62.58  ? 742  ARG A CG    1 
ATOM   5457 C  CD    . ARG A 1 696 ? 22.475  -53.324  -45.223 1.00 80.93  ? 742  ARG A CD    1 
ATOM   5458 N  NE    . ARG A 1 696 ? 22.668  -54.775  -45.297 1.00 98.23  ? 742  ARG A NE    1 
ATOM   5459 C  CZ    . ARG A 1 696 ? 22.759  -55.472  -46.428 1.00 116.69 ? 742  ARG A CZ    1 
ATOM   5460 N  NH1   . ARG A 1 696 ? 22.684  -54.858  -47.605 1.00 98.05  ? 742  ARG A NH1   1 
ATOM   5461 N  NH2   . ARG A 1 696 ? 22.935  -56.786  -46.392 1.00 110.59 ? 742  ARG A NH2   1 
ATOM   5462 N  N     . GLN A 1 697 ? 22.532  -50.594  -41.873 1.00 51.31  ? 743  GLN A N     1 
ATOM   5463 C  CA    . GLN A 1 697 ? 23.559  -50.738  -40.885 1.00 52.71  ? 743  GLN A CA    1 
ATOM   5464 C  C     . GLN A 1 697 ? 23.084  -50.504  -39.464 1.00 56.90  ? 743  GLN A C     1 
ATOM   5465 O  O     . GLN A 1 697 ? 23.438  -51.236  -38.585 1.00 57.16  ? 743  GLN A O     1 
ATOM   5466 C  CB    . GLN A 1 697 ? 24.680  -49.776  -41.194 1.00 55.12  ? 743  GLN A CB    1 
ATOM   5467 C  CG    . GLN A 1 697 ? 25.464  -49.342  -39.980 1.00 82.01  ? 743  GLN A CG    1 
ATOM   5468 C  CD    . GLN A 1 697 ? 26.189  -50.487  -39.330 1.00 110.42 ? 743  GLN A CD    1 
ATOM   5469 O  OE1   . GLN A 1 697 ? 26.533  -51.452  -39.989 1.00 107.65 ? 743  GLN A OE1   1 
ATOM   5470 N  NE2   . GLN A 1 697 ? 26.424  -50.386  -38.041 1.00 104.71 ? 743  GLN A NE2   1 
ATOM   5471 N  N     . ARG A 1 698 ? 22.334  -49.459  -39.249 1.00 53.25  ? 744  ARG A N     1 
ATOM   5472 C  CA    . ARG A 1 698 ? 21.837  -49.197  -37.945 1.00 53.00  ? 744  ARG A CA    1 
ATOM   5473 C  C     . ARG A 1 698 ? 20.800  -50.159  -37.366 1.00 56.58  ? 744  ARG A C     1 
ATOM   5474 O  O     . ARG A 1 698 ? 20.956  -50.561  -36.248 1.00 55.65  ? 744  ARG A O     1 
ATOM   5475 C  CB    . ARG A 1 698 ? 21.345  -47.768  -37.910 1.00 55.52  ? 744  ARG A CB    1 
ATOM   5476 C  CG    . ARG A 1 698 ? 21.235  -47.167  -36.539 1.00 75.06  ? 744  ARG A CG    1 
ATOM   5477 C  CD    . ARG A 1 698 ? 22.494  -46.449  -36.138 1.00 98.33  ? 744  ARG A CD    1 
ATOM   5478 N  NE    . ARG A 1 698 ? 22.329  -45.848  -34.827 1.00 111.28 ? 744  ARG A NE    1 
ATOM   5479 C  CZ    . ARG A 1 698 ? 23.299  -45.701  -33.940 1.00 125.76 ? 744  ARG A CZ    1 
ATOM   5480 N  NH1   . ARG A 1 698 ? 24.513  -46.115  -34.210 1.00 114.89 ? 744  ARG A NH1   1 
ATOM   5481 N  NH2   . ARG A 1 698 ? 23.047  -45.148  -32.781 1.00 108.52 ? 744  ARG A NH2   1 
ATOM   5482 N  N     . TYR A 1 699 ? 19.795  -50.606  -38.119 1.00 54.24  ? 745  TYR A N     1 
ATOM   5483 C  CA    . TYR A 1 699 ? 18.741  -51.416  -37.485 1.00 54.74  ? 745  TYR A CA    1 
ATOM   5484 C  C     . TYR A 1 699 ? 18.672  -52.911  -37.894 1.00 60.67  ? 745  TYR A C     1 
ATOM   5485 O  O     . TYR A 1 699 ? 17.642  -53.548  -37.658 1.00 59.68  ? 745  TYR A O     1 
ATOM   5486 C  CB    . TYR A 1 699 ? 17.372  -50.709  -37.665 1.00 55.16  ? 745  TYR A CB    1 
ATOM   5487 C  CG    . TYR A 1 699 ? 17.458  -49.238  -37.306 1.00 55.75  ? 745  TYR A CG    1 
ATOM   5488 C  CD1   . TYR A 1 699 ? 17.443  -48.822  -35.976 1.00 57.30  ? 745  TYR A CD1   1 
ATOM   5489 C  CD2   . TYR A 1 699 ? 17.669  -48.269  -38.292 1.00 56.07  ? 745  TYR A CD2   1 
ATOM   5490 C  CE1   . TYR A 1 699 ? 17.600  -47.474  -35.638 1.00 58.54  ? 745  TYR A CE1   1 
ATOM   5491 C  CE2   . TYR A 1 699 ? 17.824  -46.922  -37.965 1.00 56.03  ? 745  TYR A CE2   1 
ATOM   5492 C  CZ    . TYR A 1 699 ? 17.791  -46.529  -36.638 1.00 61.78  ? 745  TYR A CZ    1 
ATOM   5493 O  OH    . TYR A 1 699 ? 17.958  -45.205  -36.321 1.00 60.74  ? 745  TYR A OH    1 
ATOM   5494 N  N     . GLU A 1 700 ? 19.798  -53.496  -38.376 1.00 60.00  ? 746  GLU A N     1 
ATOM   5495 C  CA    . GLU A 1 700 ? 19.916  -54.922  -38.746 1.00 59.74  ? 746  GLU A CA    1 
ATOM   5496 C  C     . GLU A 1 700 ? 19.737  -55.872  -37.543 1.00 63.61  ? 746  GLU A C     1 
ATOM   5497 O  O     . GLU A 1 700 ? 19.347  -57.021  -37.755 1.00 66.10  ? 746  GLU A O     1 
ATOM   5498 C  CB    . GLU A 1 700 ? 21.233  -55.200  -39.487 1.00 61.51  ? 746  GLU A CB    1 
ATOM   5499 C  CG    . GLU A 1 700 ? 21.096  -56.136  -40.682 1.00 77.30  ? 746  GLU A CG    1 
ATOM   5500 C  CD    . GLU A 1 700 ? 22.296  -56.353  -41.603 1.00 98.20  ? 746  GLU A CD    1 
ATOM   5501 O  OE1   . GLU A 1 700 ? 23.392  -55.819  -41.307 1.00 99.29  ? 746  GLU A OE1   1 
ATOM   5502 O  OE2   . GLU A 1 700 ? 22.132  -57.057  -42.630 1.00 76.01  ? 746  GLU A OE2   1 
ATOM   5503 N  N     . ILE A 1 701 ? 19.967  -55.403  -36.288 1.00 56.99  ? 747  ILE A N     1 
ATOM   5504 C  CA    . ILE A 1 701 ? 19.733  -56.229  -35.090 1.00 56.31  ? 747  ILE A CA    1 
ATOM   5505 C  C     . ILE A 1 701 ? 18.229  -56.431  -34.853 1.00 60.08  ? 747  ILE A C     1 
ATOM   5506 O  O     . ILE A 1 701 ? 17.831  -57.342  -34.133 1.00 59.87  ? 747  ILE A O     1 
ATOM   5507 C  CB    . ILE A 1 701 ? 20.448  -55.683  -33.813 1.00 59.57  ? 747  ILE A CB    1 
ATOM   5508 C  CG1   . ILE A 1 701 ? 20.580  -56.791  -32.715 1.00 61.15  ? 747  ILE A CG1   1 
ATOM   5509 C  CG2   . ILE A 1 701 ? 19.753  -54.448  -33.257 1.00 59.11  ? 747  ILE A CG2   1 
ATOM   5510 C  CD1   . ILE A 1 701 ? 21.732  -56.639  -31.636 1.00 69.88  ? 747  ILE A CD1   1 
ATOM   5511 N  N     . LEU A 1 702 ? 17.400  -55.547  -35.424 1.00 56.99  ? 748  LEU A N     1 
ATOM   5512 C  CA    . LEU A 1 702 ? 15.952  -55.587  -35.251 1.00 56.32  ? 748  LEU A CA    1 
ATOM   5513 C  C     . LEU A 1 702 ? 15.272  -56.562  -36.198 1.00 61.57  ? 748  LEU A C     1 
ATOM   5514 O  O     . LEU A 1 702 ? 14.199  -57.079  -35.865 1.00 60.69  ? 748  LEU A O     1 
ATOM   5515 C  CB    . LEU A 1 702 ? 15.348  -54.172  -35.363 1.00 55.64  ? 748  LEU A CB    1 
ATOM   5516 C  CG    . LEU A 1 702 ? 15.846  -53.136  -34.342 1.00 59.66  ? 748  LEU A CG    1 
ATOM   5517 C  CD1   . LEU A 1 702 ? 15.327  -51.761  -34.677 1.00 59.16  ? 748  LEU A CD1   1 
ATOM   5518 C  CD2   . LEU A 1 702 ? 15.399  -53.490  -32.934 1.00 63.62  ? 748  LEU A CD2   1 
ATOM   5519 N  N     . THR A 1 703 ? 15.905  -56.834  -37.362 1.00 60.23  ? 749  THR A N     1 
ATOM   5520 C  CA    . THR A 1 703 ? 15.390  -57.718  -38.414 1.00 62.00  ? 749  THR A CA    1 
ATOM   5521 C  C     . THR A 1 703 ? 16.463  -58.767  -38.775 1.00 70.43  ? 749  THR A C     1 
ATOM   5522 O  O     . THR A 1 703 ? 16.978  -58.723  -39.892 1.00 69.26  ? 749  THR A O     1 
ATOM   5523 C  CB    . THR A 1 703 ? 14.993  -56.863  -39.640 1.00 73.92  ? 749  THR A CB    1 
ATOM   5524 O  OG1   . THR A 1 703 ? 16.142  -56.122  -40.075 1.00 75.92  ? 749  THR A OG1   1 
ATOM   5525 C  CG2   . THR A 1 703 ? 13.823  -55.919  -39.363 1.00 71.67  ? 749  THR A CG2   1 
ATOM   5526 N  N     . PRO A 1 704 ? 16.811  -59.720  -37.873 1.00 73.33  ? 750  PRO A N     1 
ATOM   5527 C  CA    . PRO A 1 704 ? 17.935  -60.634  -38.168 1.00 75.94  ? 750  PRO A CA    1 
ATOM   5528 C  C     . PRO A 1 704 ? 17.861  -61.453  -39.461 1.00 86.17  ? 750  PRO A C     1 
ATOM   5529 O  O     . PRO A 1 704 ? 18.898  -61.647  -40.103 1.00 86.46  ? 750  PRO A O     1 
ATOM   5530 C  CB    . PRO A 1 704 ? 17.996  -61.548  -36.938 1.00 77.42  ? 750  PRO A CB    1 
ATOM   5531 C  CG    . PRO A 1 704 ? 17.366  -60.767  -35.847 1.00 81.03  ? 750  PRO A CG    1 
ATOM   5532 C  CD    . PRO A 1 704 ? 16.299  -59.937  -36.500 1.00 75.94  ? 750  PRO A CD    1 
ATOM   5533 N  N     . ASN A 1 705 ? 16.658  -61.914  -39.846 1.00 85.66  ? 751  ASN A N     1 
ATOM   5534 C  CA    . ASN A 1 705 ? 16.498  -62.755  -41.032 1.00 86.56  ? 751  ASN A CA    1 
ATOM   5535 C  C     . ASN A 1 705 ? 15.709  -62.079  -42.179 1.00 92.45  ? 751  ASN A C     1 
ATOM   5536 O  O     . ASN A 1 705 ? 15.146  -62.775  -43.026 1.00 92.80  ? 751  ASN A O     1 
ATOM   5537 C  CB    . ASN A 1 705 ? 15.885  -64.106  -40.630 1.00 89.67  ? 751  ASN A CB    1 
ATOM   5538 C  CG    . ASN A 1 705 ? 16.652  -64.832  -39.542 1.00 121.48 ? 751  ASN A CG    1 
ATOM   5539 O  OD1   . ASN A 1 705 ? 17.608  -65.569  -39.802 1.00 119.19 ? 751  ASN A OD1   1 
ATOM   5540 N  ND2   . ASN A 1 705 ? 16.253  -64.638  -38.293 1.00 113.84 ? 751  ASN A ND2   1 
ATOM   5541 N  N     . ALA A 1 706 ? 15.712  -60.738  -42.235 1.00 89.91  ? 752  ALA A N     1 
ATOM   5542 C  CA    . ALA A 1 706 ? 15.024  -59.968  -43.276 1.00 90.27  ? 752  ALA A CA    1 
ATOM   5543 C  C     . ALA A 1 706 ? 15.769  -59.963  -44.616 1.00 95.39  ? 752  ALA A C     1 
ATOM   5544 O  O     . ALA A 1 706 ? 15.138  -60.075  -45.671 1.00 93.59  ? 752  ALA A O     1 
ATOM   5545 C  CB    . ALA A 1 706 ? 14.816  -58.541  -42.807 1.00 91.06  ? 752  ALA A CB    1 
ATOM   5546 N  N     . ILE A 1 707 ? 17.104  -59.782  -44.572 1.00 94.77  ? 753  ILE A N     1 
ATOM   5547 C  CA    . ILE A 1 707 ? 17.957  -59.712  -45.759 1.00 96.01  ? 753  ILE A CA    1 
ATOM   5548 C  C     . ILE A 1 707 ? 18.811  -60.989  -45.918 1.00 103.27 ? 753  ILE A C     1 
ATOM   5549 O  O     . ILE A 1 707 ? 19.615  -61.292  -45.034 1.00 102.80 ? 753  ILE A O     1 
ATOM   5550 C  CB    . ILE A 1 707 ? 18.835  -58.425  -45.769 1.00 98.99  ? 753  ILE A CB    1 
ATOM   5551 C  CG1   . ILE A 1 707 ? 18.007  -57.139  -45.563 1.00 99.04  ? 753  ILE A CG1   1 
ATOM   5552 C  CG2   . ILE A 1 707 ? 19.682  -58.341  -47.046 1.00 100.12 ? 753  ILE A CG2   1 
ATOM   5553 C  CD1   . ILE A 1 707 ? 18.844  -55.946  -45.083 1.00 103.62 ? 753  ILE A CD1   1 
ATOM   5554 N  N     . PRO A 1 708 ? 18.774  -61.609  -47.076 1.00 102.69 ? 754  PRO A N     1 
ATOM   5555 C  CA    . PRO A 1 708 ? 19.553  -62.834  -47.214 1.00 103.42 ? 754  PRO A CA    1 
ATOM   5556 C  C     . PRO A 1 708 ? 20.907  -62.703  -47.867 1.00 109.78 ? 754  PRO A C     1 
ATOM   5557 O  O     . PRO A 1 708 ? 20.981  -61.966  -48.828 1.00 109.49 ? 754  PRO A O     1 
ATOM   5558 C  CB    . PRO A 1 708 ? 18.694  -63.629  -48.170 1.00 105.03 ? 754  PRO A CB    1 
ATOM   5559 C  CG    . PRO A 1 708 ? 18.174  -62.590  -49.088 1.00 109.22 ? 754  PRO A CG    1 
ATOM   5560 C  CD    . PRO A 1 708 ? 17.865  -61.412  -48.210 1.00 104.61 ? 754  PRO A CD    1 
ATOM   5561 N  N     . LYS A 1 709 ? 21.957  -63.277  -47.291 1.00 108.54 ? 755  LYS A N     1 
ATOM   5562 C  CA    . LYS A 1 709 ? 23.261  -63.331  -47.953 1.00 109.58 ? 755  LYS A CA    1 
ATOM   5563 C  C     . LYS A 1 709 ? 23.755  -62.007  -48.513 1.00 115.50 ? 755  LYS A C     1 
ATOM   5564 O  O     . LYS A 1 709 ? 23.849  -61.014  -47.800 1.00 115.84 ? 755  LYS A O     1 
ATOM   5565 C  CB    . LYS A 1 709 ? 23.257  -64.400  -49.049 1.00 112.61 ? 755  LYS A CB    1 
ATOM   5566 C  CG    . LYS A 1 709 ? 23.545  -65.812  -48.559 1.00 131.22 ? 755  LYS A CG    1 
ATOM   5567 C  CD    . LYS A 1 709 ? 23.811  -66.771  -49.716 1.00 142.17 ? 755  LYS A CD    1 
ATOM   5568 C  CE    . LYS A 1 709 ? 24.323  -68.116  -49.229 1.00 150.80 ? 755  LYS A CE    1 
ATOM   5569 N  NZ    . LYS A 1 709 ? 23.706  -69.254  -49.956 1.00 156.46 ? 755  LYS A NZ    1 
ATOM   5570 N  N     . GLY A 1 710 ? 24.107  -62.023  -49.794 1.00 112.33 ? 756  GLY A N     1 
ATOM   5571 C  CA    . GLY A 1 710 ? 24.526  -60.821  -50.479 1.00 112.27 ? 756  GLY A CA    1 
ATOM   5572 C  C     . GLY A 1 710 ? 23.348  -60.353  -51.318 1.00 116.28 ? 756  GLY A C     1 
ATOM   5573 O  O     . GLY A 1 710 ? 22.877  -61.042  -52.225 1.00 116.24 ? 756  GLY A O     1 
ATOM   5574 N  N     . PHE A 1 711 ? 22.802  -59.200  -50.937 1.00 111.92 ? 757  PHE A N     1 
ATOM   5575 C  CA    . PHE A 1 711 ? 21.679  -58.600  -51.653 1.00 110.85 ? 757  PHE A CA    1 
ATOM   5576 C  C     . PHE A 1 711 ? 22.154  -57.528  -52.633 1.00 112.53 ? 757  PHE A C     1 
ATOM   5577 O  O     . PHE A 1 711 ? 21.533  -57.302  -53.673 1.00 112.00 ? 757  PHE A O     1 
ATOM   5578 C  CB    . PHE A 1 711 ? 20.669  -58.011  -50.665 1.00 112.49 ? 757  PHE A CB    1 
ATOM   5579 C  CG    . PHE A 1 711 ? 19.516  -57.310  -51.324 1.00 113.79 ? 757  PHE A CG    1 
ATOM   5580 C  CD1   . PHE A 1 711 ? 18.450  -58.031  -51.834 1.00 116.72 ? 757  PHE A CD1   1 
ATOM   5581 C  CD2   . PHE A 1 711 ? 19.497  -55.930  -51.431 1.00 115.40 ? 757  PHE A CD2   1 
ATOM   5582 C  CE1   . PHE A 1 711 ? 17.387  -57.389  -52.440 1.00 117.41 ? 757  PHE A CE1   1 
ATOM   5583 C  CE2   . PHE A 1 711 ? 18.438  -55.281  -52.036 1.00 117.96 ? 757  PHE A CE2   1 
ATOM   5584 C  CZ    . PHE A 1 711 ? 17.380  -56.012  -52.542 1.00 116.11 ? 757  PHE A CZ    1 
ATOM   5585 N  N     . MET A 1 712 ? 23.250  -56.864  -52.269 1.00 107.08 ? 758  MET A N     1 
ATOM   5586 C  CA    . MET A 1 712 ? 23.875  -55.812  -53.078 1.00 105.97 ? 758  MET A CA    1 
ATOM   5587 C  C     . MET A 1 712 ? 22.952  -54.652  -53.467 1.00 102.87 ? 758  MET A C     1 
ATOM   5588 O  O     . MET A 1 712 ? 23.030  -54.147  -54.587 1.00 103.13 ? 758  MET A O     1 
ATOM   5589 C  CB    . MET A 1 712 ? 24.550  -56.402  -54.323 1.00 109.03 ? 758  MET A CB    1 
ATOM   5590 C  CG    . MET A 1 712 ? 25.283  -55.379  -55.176 1.00 113.54 ? 758  MET A CG    1 
ATOM   5591 S  SD    . MET A 1 712 ? 26.157  -56.127  -56.564 1.00 118.43 ? 758  MET A SD    1 
ATOM   5592 C  CE    . MET A 1 712 ? 27.605  -56.783  -55.738 1.00 115.29 ? 758  MET A CE    1 
ATOM   5593 N  N     . ASP A 1 713 ? 22.083  -54.230  -52.553 1.00 92.14  ? 759  ASP A N     1 
ATOM   5594 C  CA    . ASP A 1 713 ? 21.171  -53.121  -52.835 1.00 88.38  ? 759  ASP A CA    1 
ATOM   5595 C  C     . ASP A 1 713 ? 20.560  -52.343  -51.668 1.00 83.03  ? 759  ASP A C     1 
ATOM   5596 O  O     . ASP A 1 713 ? 20.059  -52.935  -50.712 1.00 82.27  ? 759  ASP A O     1 
ATOM   5597 C  CB    . ASP A 1 713 ? 19.894  -53.634  -53.506 1.00 90.49  ? 759  ASP A CB    1 
ATOM   5598 C  CG    . ASP A 1 713 ? 18.956  -52.513  -53.907 1.00 102.98 ? 759  ASP A CG    1 
ATOM   5599 O  OD1   . ASP A 1 713 ? 19.305  -51.335  -53.682 1.00 104.08 ? 759  ASP A OD1   1 
ATOM   5600 O  OD2   . ASP A 1 713 ? 17.870  -52.809  -54.448 1.00 107.98 ? 759  ASP A OD2   1 
ATOM   5601 N  N     . GLY A 1 714 ? 20.604  -51.015  -51.754 1.00 71.28  ? 760  GLY A N     1 
ATOM   5602 C  CA    . GLY A 1 714 ? 20.030  -50.162  -50.722 1.00 65.93  ? 760  GLY A CA    1 
ATOM   5603 C  C     . GLY A 1 714 ? 18.530  -50.083  -50.540 1.00 60.17  ? 760  GLY A C     1 
ATOM   5604 O  O     . GLY A 1 714 ? 18.020  -50.525  -49.509 1.00 57.48  ? 760  GLY A O     1 
ATOM   5605 N  N     . LYS A 1 715 ? 17.809  -49.626  -51.586 1.00 52.63  ? 761  LYS A N     1 
ATOM   5606 C  CA    . LYS A 1 715 ? 16.349  -49.463  -51.581 1.00 51.44  ? 761  LYS A CA    1 
ATOM   5607 C  C     . LYS A 1 715 ? 15.569  -50.741  -51.217 1.00 54.96  ? 761  LYS A C     1 
ATOM   5608 O  O     . LYS A 1 715 ? 14.632  -50.676  -50.407 1.00 52.51  ? 761  LYS A O     1 
ATOM   5609 C  CB    . LYS A 1 715 ? 15.853  -48.883  -52.922 1.00 53.47  ? 761  LYS A CB    1 
ATOM   5610 C  CG    . LYS A 1 715 ? 14.394  -48.400  -52.887 1.00 54.52  ? 761  LYS A CG    1 
ATOM   5611 C  CD    . LYS A 1 715 ? 13.917  -47.903  -54.235 1.00 53.08  ? 761  LYS A CD    1 
ATOM   5612 C  CE    . LYS A 1 715 ? 12.667  -47.080  -54.142 1.00 56.02  ? 761  LYS A CE    1 
ATOM   5613 N  NZ    . LYS A 1 715 ? 11.530  -47.860  -53.583 1.00 72.98  ? 761  LYS A NZ    1 
ATOM   5614 N  N     . GLN A 1 716 ? 15.938  -51.891  -51.839 1.00 52.87  ? 762  GLN A N     1 
ATOM   5615 C  CA    . GLN A 1 716 ? 15.260  -53.161  -51.592 1.00 53.31  ? 762  GLN A CA    1 
ATOM   5616 C  C     . GLN A 1 716 ? 15.556  -53.733  -50.201 1.00 55.19  ? 762  GLN A C     1 
ATOM   5617 O  O     . GLN A 1 716 ? 14.622  -54.190  -49.533 1.00 54.78  ? 762  GLN A O     1 
ATOM   5618 C  CB    . GLN A 1 716 ? 15.539  -54.195  -52.704 1.00 55.58  ? 762  GLN A CB    1 
ATOM   5619 C  CG    . GLN A 1 716 ? 14.801  -54.010  -54.031 1.00 81.23  ? 762  GLN A CG    1 
ATOM   5620 C  CD    . GLN A 1 716 ? 13.298  -53.908  -53.932 1.00 117.60 ? 762  GLN A CD    1 
ATOM   5621 O  OE1   . GLN A 1 716 ? 12.630  -54.641  -53.193 1.00 115.54 ? 762  GLN A OE1   1 
ATOM   5622 N  NE2   . GLN A 1 716 ? 12.728  -53.009  -54.716 1.00 118.03 ? 762  GLN A NE2   1 
ATOM   5623 N  N     . ALA A 1 717 ? 16.837  -53.674  -49.759 1.00 50.75  ? 763  ALA A N     1 
ATOM   5624 C  CA    . ALA A 1 717 ? 17.317  -54.149  -48.450 1.00 49.74  ? 763  ALA A CA    1 
ATOM   5625 C  C     . ALA A 1 717 ? 16.597  -53.433  -47.332 1.00 50.56  ? 763  ALA A C     1 
ATOM   5626 O  O     . ALA A 1 717 ? 16.262  -54.062  -46.334 1.00 49.91  ? 763  ALA A O     1 
ATOM   5627 C  CB    . ALA A 1 717 ? 18.828  -53.954  -48.317 1.00 50.48  ? 763  ALA A CB    1 
ATOM   5628 N  N     . CYS A 1 718 ? 16.315  -52.131  -47.522 1.00 45.75  ? 764  CYS A N     1 
ATOM   5629 C  CA    . CYS A 1 718 ? 15.549  -51.305  -46.579 1.00 43.79  ? 764  CYS A CA    1 
ATOM   5630 C  C     . CYS A 1 718 ? 14.086  -51.688  -46.674 1.00 45.33  ? 764  CYS A C     1 
ATOM   5631 O  O     . CYS A 1 718 ? 13.399  -51.755  -45.660 1.00 41.98  ? 764  CYS A O     1 
ATOM   5632 C  CB    . CYS A 1 718 ? 15.755  -49.826  -46.878 1.00 43.75  ? 764  CYS A CB    1 
ATOM   5633 S  SG    . CYS A 1 718 ? 17.442  -49.251  -46.589 1.00 47.47  ? 764  CYS A SG    1 
ATOM   5634 N  N     . GLU A 1 719 ? 13.609  -51.958  -47.902 1.00 45.21  ? 765  GLU A N     1 
ATOM   5635 C  CA    . GLU A 1 719 ? 12.215  -52.358  -48.122 1.00 45.91  ? 765  GLU A CA    1 
ATOM   5636 C  C     . GLU A 1 719 ? 11.880  -53.701  -47.442 1.00 48.84  ? 765  GLU A C     1 
ATOM   5637 O  O     . GLU A 1 719 ? 10.786  -53.842  -46.900 1.00 45.49  ? 765  GLU A O     1 
ATOM   5638 C  CB    . GLU A 1 719 ? 11.862  -52.365  -49.609 1.00 47.88  ? 765  GLU A CB    1 
ATOM   5639 C  CG    . GLU A 1 719 ? 11.146  -51.101  -50.038 1.00 58.29  ? 765  GLU A CG    1 
ATOM   5640 C  CD    . GLU A 1 719 ? 10.721  -50.993  -51.489 1.00 78.29  ? 765  GLU A CD    1 
ATOM   5641 O  OE1   . GLU A 1 719 ? 11.429  -51.535  -52.369 1.00 78.61  ? 765  GLU A OE1   1 
ATOM   5642 O  OE2   . GLU A 1 719 ? 9.718   -50.290  -51.750 1.00 78.74  ? 765  GLU A OE2   1 
ATOM   5643 N  N     . LYS A 1 720 ? 12.850  -54.648  -47.405 1.00 48.71  ? 766  LYS A N     1 
ATOM   5644 C  CA    . LYS A 1 720 ? 12.663  -55.946  -46.732 1.00 49.50  ? 766  LYS A CA    1 
ATOM   5645 C  C     . LYS A 1 720 ? 12.687  -55.782  -45.210 1.00 53.48  ? 766  LYS A C     1 
ATOM   5646 O  O     . LYS A 1 720 ? 11.902  -56.440  -44.509 1.00 54.36  ? 766  LYS A O     1 
ATOM   5647 C  CB    . LYS A 1 720 ? 13.700  -56.970  -47.187 1.00 52.32  ? 766  LYS A CB    1 
ATOM   5648 C  CG    . LYS A 1 720 ? 13.461  -57.430  -48.613 1.00 77.83  ? 766  LYS A CG    1 
ATOM   5649 C  CD    . LYS A 1 720 ? 14.300  -58.628  -48.976 1.00 94.54  ? 766  LYS A CD    1 
ATOM   5650 C  CE    . LYS A 1 720 ? 13.849  -59.136  -50.314 1.00 111.80 ? 766  LYS A CE    1 
ATOM   5651 N  NZ    . LYS A 1 720 ? 14.590  -60.350  -50.732 1.00 125.22 ? 766  LYS A NZ    1 
ATOM   5652 N  N     . MET A 1 721 ? 13.570  -54.886  -44.708 1.00 45.66  ? 767  MET A N     1 
ATOM   5653 C  CA    . MET A 1 721 ? 13.668  -54.590  -43.283 1.00 45.38  ? 767  MET A CA    1 
ATOM   5654 C  C     . MET A 1 721 ? 12.394  -53.917  -42.800 1.00 48.32  ? 767  MET A C     1 
ATOM   5655 O  O     . MET A 1 721 ? 11.913  -54.274  -41.725 1.00 48.94  ? 767  MET A O     1 
ATOM   5656 C  CB    . MET A 1 721 ? 14.871  -53.680  -42.986 1.00 47.53  ? 767  MET A CB    1 
ATOM   5657 C  CG    . MET A 1 721 ? 16.194  -54.408  -42.999 1.00 50.79  ? 767  MET A CG    1 
ATOM   5658 S  SD    . MET A 1 721 ? 17.557  -53.238  -42.823 1.00 55.11  ? 767  MET A SD    1 
ATOM   5659 C  CE    . MET A 1 721 ? 17.363  -52.773  -41.161 1.00 50.70  ? 767  MET A CE    1 
ATOM   5660 N  N     . ILE A 1 722 ? 11.861  -52.926  -43.559 1.00 44.60  ? 768  ILE A N     1 
ATOM   5661 C  CA    . ILE A 1 722 ? 10.606  -52.260  -43.176 1.00 45.48  ? 768  ILE A CA    1 
ATOM   5662 C  C     . ILE A 1 722 ? 9.483   -53.324  -43.079 1.00 51.42  ? 768  ILE A C     1 
ATOM   5663 O  O     . ILE A 1 722 ? 8.880   -53.469  -42.009 1.00 50.06  ? 768  ILE A O     1 
ATOM   5664 C  CB    . ILE A 1 722 ? 10.243  -51.023  -44.056 1.00 48.95  ? 768  ILE A CB    1 
ATOM   5665 C  CG1   . ILE A 1 722 ? 11.224  -49.842  -43.813 1.00 50.36  ? 768  ILE A CG1   1 
ATOM   5666 C  CG2   . ILE A 1 722 ? 8.811   -50.562  -43.761 1.00 48.36  ? 768  ILE A CG2   1 
ATOM   5667 C  CD1   . ILE A 1 722 ? 11.318  -48.847  -44.972 1.00 59.21  ? 768  ILE A CD1   1 
ATOM   5668 N  N     . GLN A 1 723 ? 9.285   -54.121  -44.162 1.00 50.61  ? 769  GLN A N     1 
ATOM   5669 C  CA    . GLN A 1 723 ? 8.325   -55.240  -44.239 1.00 52.19  ? 769  GLN A CA    1 
ATOM   5670 C  C     . GLN A 1 723 ? 8.419   -56.140  -42.989 1.00 56.57  ? 769  GLN A C     1 
ATOM   5671 O  O     . GLN A 1 723 ? 7.406   -56.376  -42.327 1.00 55.43  ? 769  GLN A O     1 
ATOM   5672 C  CB    . GLN A 1 723 ? 8.563   -56.069  -45.520 1.00 54.29  ? 769  GLN A CB    1 
ATOM   5673 C  CG    . GLN A 1 723 ? 7.844   -55.493  -46.744 1.00 85.00  ? 769  GLN A CG    1 
ATOM   5674 C  CD    . GLN A 1 723 ? 8.237   -56.113  -48.065 1.00 112.66 ? 769  GLN A CD    1 
ATOM   5675 O  OE1   . GLN A 1 723 ? 8.675   -57.267  -48.154 1.00 110.64 ? 769  GLN A OE1   1 
ATOM   5676 N  NE2   . GLN A 1 723 ? 8.048   -55.360  -49.138 1.00 108.35 ? 769  GLN A NE2   1 
ATOM   5677 N  N     . ALA A 1 724 ? 9.659   -56.571  -42.637 1.00 54.18  ? 770  ALA A N     1 
ATOM   5678 C  CA    . ALA A 1 724 ? 9.968   -57.376  -41.449 1.00 53.74  ? 770  ALA A CA    1 
ATOM   5679 C  C     . ALA A 1 724 ? 9.629   -56.649  -40.142 1.00 54.61  ? 770  ALA A C     1 
ATOM   5680 O  O     . ALA A 1 724 ? 9.091   -57.291  -39.237 1.00 53.78  ? 770  ALA A O     1 
ATOM   5681 C  CB    . ALA A 1 724 ? 11.429  -57.799  -41.458 1.00 54.32  ? 770  ALA A CB    1 
ATOM   5682 N  N     . LEU A 1 725 ? 9.893   -55.308  -40.059 1.00 49.31  ? 771  LEU A N     1 
ATOM   5683 C  CA    . LEU A 1 725 ? 9.555   -54.497  -38.873 1.00 48.45  ? 771  LEU A CA    1 
ATOM   5684 C  C     . LEU A 1 725 ? 8.050   -54.299  -38.732 1.00 48.14  ? 771  LEU A C     1 
ATOM   5685 O  O     . LEU A 1 725 ? 7.580   -53.981  -37.643 1.00 44.03  ? 771  LEU A O     1 
ATOM   5686 C  CB    . LEU A 1 725 ? 10.233  -53.106  -38.905 1.00 48.88  ? 771  LEU A CB    1 
ATOM   5687 C  CG    . LEU A 1 725 ? 11.727  -53.019  -38.615 1.00 53.33  ? 771  LEU A CG    1 
ATOM   5688 C  CD1   . LEU A 1 725 ? 12.281  -51.660  -39.046 1.00 52.85  ? 771  LEU A CD1   1 
ATOM   5689 C  CD2   . LEU A 1 725 ? 12.030  -53.323  -37.144 1.00 55.54  ? 771  LEU A CD2   1 
ATOM   5690 N  N     . GLU A 1 726 ? 7.308   -54.436  -39.851 1.00 47.51  ? 772  GLU A N     1 
ATOM   5691 C  CA    . GLU A 1 726 ? 5.854   -54.257  -39.939 1.00 49.25  ? 772  GLU A CA    1 
ATOM   5692 C  C     . GLU A 1 726 ? 5.415   -52.816  -39.547 1.00 57.74  ? 772  GLU A C     1 
ATOM   5693 O  O     . GLU A 1 726 ? 4.385   -52.616  -38.895 1.00 57.96  ? 772  GLU A O     1 
ATOM   5694 C  CB    . GLU A 1 726 ? 5.097   -55.351  -39.147 1.00 50.56  ? 772  GLU A CB    1 
ATOM   5695 C  CG    . GLU A 1 726 ? 5.074   -56.705  -39.843 1.00 57.81  ? 772  GLU A CG    1 
ATOM   5696 C  CD    . GLU A 1 726 ? 4.980   -57.915  -38.933 1.00 74.75  ? 772  GLU A CD    1 
ATOM   5697 O  OE1   . GLU A 1 726 ? 4.458   -57.769  -37.805 1.00 47.16  ? 772  GLU A OE1   1 
ATOM   5698 O  OE2   . GLU A 1 726 ? 5.405   -59.015  -39.353 1.00 76.10  ? 772  GLU A OE2   1 
ATOM   5699 N  N     . LEU A 1 727 ? 6.266   -51.857  -39.891 1.00 56.03  ? 773  LEU A N     1 
ATOM   5700 C  CA    . LEU A 1 727 ? 6.032   -50.461  -39.570 1.00 56.79  ? 773  LEU A CA    1 
ATOM   5701 C  C     . LEU A 1 727 ? 4.804   -49.954  -40.294 1.00 61.33  ? 773  LEU A C     1 
ATOM   5702 O  O     . LEU A 1 727 ? 4.510   -50.378  -41.411 1.00 62.62  ? 773  LEU A O     1 
ATOM   5703 C  CB    . LEU A 1 727 ? 7.249   -49.614  -39.942 1.00 57.33  ? 773  LEU A CB    1 
ATOM   5704 C  CG    . LEU A 1 727 ? 8.564   -49.971  -39.245 1.00 62.47  ? 773  LEU A CG    1 
ATOM   5705 C  CD1   . LEU A 1 727 ? 9.700   -49.103  -39.763 1.00 62.86  ? 773  LEU A CD1   1 
ATOM   5706 C  CD2   . LEU A 1 727 ? 8.426   -49.836  -37.737 1.00 64.96  ? 773  LEU A CD2   1 
ATOM   5707 N  N     . ASP A 1 728 ? 4.084   -49.041  -39.653 1.00 57.53  ? 774  ASP A N     1 
ATOM   5708 C  CA    . ASP A 1 728 ? 2.890   -48.486  -40.261 1.00 57.42  ? 774  ASP A CA    1 
ATOM   5709 C  C     . ASP A 1 728 ? 3.305   -47.775  -41.539 1.00 62.18  ? 774  ASP A C     1 
ATOM   5710 O  O     . ASP A 1 728 ? 4.299   -47.045  -41.563 1.00 62.51  ? 774  ASP A O     1 
ATOM   5711 C  CB    . ASP A 1 728 ? 2.208   -47.506  -39.305 1.00 58.75  ? 774  ASP A CB    1 
ATOM   5712 C  CG    . ASP A 1 728 ? 0.841   -47.069  -39.795 1.00 71.98  ? 774  ASP A CG    1 
ATOM   5713 O  OD1   . ASP A 1 728 ? 0.217   -47.819  -40.574 1.00 74.80  ? 774  ASP A OD1   1 
ATOM   5714 O  OD2   . ASP A 1 728 ? 0.387   -45.976  -39.395 1.00 78.67  ? 774  ASP A OD2   1 
ATOM   5715 N  N     . PRO A 1 729 ? 2.517   -47.953  -42.603 1.00 58.59  ? 775  PRO A N     1 
ATOM   5716 C  CA    . PRO A 1 729 ? 2.839   -47.338  -43.890 1.00 57.15  ? 775  PRO A CA    1 
ATOM   5717 C  C     . PRO A 1 729 ? 2.856   -45.828  -43.755 1.00 55.32  ? 775  PRO A C     1 
ATOM   5718 O  O     . PRO A 1 729 ? 3.692   -45.160  -44.364 1.00 54.50  ? 775  PRO A O     1 
ATOM   5719 C  CB    . PRO A 1 729 ? 1.681   -47.779  -44.792 1.00 59.23  ? 775  PRO A CB    1 
ATOM   5720 C  CG    . PRO A 1 729 ? 0.573   -48.135  -43.858 1.00 64.52  ? 775  PRO A CG    1 
ATOM   5721 C  CD    . PRO A 1 729 ? 1.247   -48.697  -42.643 1.00 60.42  ? 775  PRO A CD    1 
ATOM   5722 N  N     . ASN A 1 730 ? 1.936   -45.296  -42.960 1.00 46.27  ? 776  ASN A N     1 
ATOM   5723 C  CA    . ASN A 1 730 ? 1.846   -43.862  -42.786 1.00 44.99  ? 776  ASN A CA    1 
ATOM   5724 C  C     . ASN A 1 730 ? 2.989   -43.271  -41.930 1.00 44.51  ? 776  ASN A C     1 
ATOM   5725 O  O     . ASN A 1 730 ? 3.071   -42.056  -41.818 1.00 41.33  ? 776  ASN A O     1 
ATOM   5726 C  CB    . ASN A 1 730 ? 0.480   -43.454  -42.224 1.00 48.42  ? 776  ASN A CB    1 
ATOM   5727 C  CG    . ASN A 1 730 ? 0.221   -41.967  -42.323 1.00 72.27  ? 776  ASN A CG    1 
ATOM   5728 O  OD1   . ASN A 1 730 ? 0.403   -41.332  -43.375 1.00 70.32  ? 776  ASN A OD1   1 
ATOM   5729 N  ND2   . ASN A 1 730 ? -0.114  -41.361  -41.201 1.00 63.27  ? 776  ASN A ND2   1 
ATOM   5730 N  N     . LEU A 1 731 ? 3.873   -44.109  -41.348 1.00 41.06  ? 777  LEU A N     1 
ATOM   5731 C  CA    . LEU A 1 731 ? 4.992   -43.599  -40.536 1.00 40.22  ? 777  LEU A CA    1 
ATOM   5732 C  C     . LEU A 1 731 ? 6.257   -43.353  -41.321 1.00 44.63  ? 777  LEU A C     1 
ATOM   5733 O  O     . LEU A 1 731 ? 7.198   -42.798  -40.771 1.00 46.03  ? 777  LEU A O     1 
ATOM   5734 C  CB    . LEU A 1 731 ? 5.283   -44.483  -39.317 1.00 39.71  ? 777  LEU A CB    1 
ATOM   5735 C  CG    . LEU A 1 731 ? 4.194   -44.518  -38.227 1.00 45.46  ? 777  LEU A CG    1 
ATOM   5736 C  CD1   . LEU A 1 731 ? 4.428   -45.649  -37.298 1.00 43.89  ? 777  LEU A CD1   1 
ATOM   5737 C  CD2   . LEU A 1 731 ? 4.104   -43.178  -37.434 1.00 48.71  ? 777  LEU A CD2   1 
ATOM   5738 N  N     . TYR A 1 732 ? 6.292   -43.736  -42.599 1.00 42.15  ? 778  TYR A N     1 
ATOM   5739 C  CA    . TYR A 1 732 ? 7.484   -43.627  -43.436 1.00 41.83  ? 778  TYR A CA    1 
ATOM   5740 C  C     . TYR A 1 732 ? 7.140   -43.474  -44.908 1.00 44.54  ? 778  TYR A C     1 
ATOM   5741 O  O     . TYR A 1 732 ? 6.008   -43.721  -45.274 1.00 43.73  ? 778  TYR A O     1 
ATOM   5742 C  CB    . TYR A 1 732 ? 8.380   -44.884  -43.235 1.00 43.61  ? 778  TYR A CB    1 
ATOM   5743 C  CG    . TYR A 1 732 ? 7.728   -46.169  -43.695 1.00 45.01  ? 778  TYR A CG    1 
ATOM   5744 C  CD1   . TYR A 1 732 ? 6.875   -46.877  -42.858 1.00 46.60  ? 778  TYR A CD1   1 
ATOM   5745 C  CD2   . TYR A 1 732 ? 7.948   -46.669  -44.976 1.00 45.58  ? 778  TYR A CD2   1 
ATOM   5746 C  CE1   . TYR A 1 732 ? 6.236   -48.040  -43.287 1.00 45.13  ? 778  TYR A CE1   1 
ATOM   5747 C  CE2   . TYR A 1 732 ? 7.275   -47.808  -45.435 1.00 46.50  ? 778  TYR A CE2   1 
ATOM   5748 C  CZ    . TYR A 1 732 ? 6.412   -48.489  -44.586 1.00 51.61  ? 778  TYR A CZ    1 
ATOM   5749 O  OH    . TYR A 1 732 ? 5.748   -49.639  -44.990 1.00 49.45  ? 778  TYR A OH    1 
ATOM   5750 N  N     . ARG A 1 733 ? 8.132   -43.146  -45.763 1.00 42.59  ? 779  ARG A N     1 
ATOM   5751 C  CA    . ARG A 1 733 ? 7.994   -43.057  -47.226 1.00 43.52  ? 779  ARG A CA    1 
ATOM   5752 C  C     . ARG A 1 733 ? 9.336   -43.428  -47.857 1.00 51.00  ? 779  ARG A C     1 
ATOM   5753 O  O     . ARG A 1 733 ? 10.324  -42.729  -47.607 1.00 51.80  ? 779  ARG A O     1 
ATOM   5754 C  CB    . ARG A 1 733 ? 7.582   -41.644  -47.711 1.00 42.91  ? 779  ARG A CB    1 
ATOM   5755 C  CG    . ARG A 1 733 ? 6.221   -41.107  -47.298 1.00 45.62  ? 779  ARG A CG    1 
ATOM   5756 C  CD    . ARG A 1 733 ? 5.035   -41.765  -47.970 1.00 44.81  ? 779  ARG A CD    1 
ATOM   5757 N  NE    . ARG A 1 733 ? 4.031   -42.184  -46.985 1.00 34.23  ? 779  ARG A NE    1 
ATOM   5758 C  CZ    . ARG A 1 733 ? 2.927   -41.512  -46.697 1.00 47.76  ? 779  ARG A CZ    1 
ATOM   5759 N  NH1   . ARG A 1 733 ? 2.661   -40.363  -47.298 1.00 42.42  ? 779  ARG A NH1   1 
ATOM   5760 N  NH2   . ARG A 1 733 ? 2.081   -41.992  -45.795 1.00 52.07  ? 779  ARG A NH2   1 
ATOM   5761 N  N     . VAL A 1 734 ? 9.393   -44.521  -48.657 1.00 48.92  ? 780  VAL A N     1 
ATOM   5762 C  CA    . VAL A 1 734 ? 10.647  -44.899  -49.312 1.00 48.83  ? 780  VAL A CA    1 
ATOM   5763 C  C     . VAL A 1 734 ? 10.880  -43.976  -50.506 1.00 51.28  ? 780  VAL A C     1 
ATOM   5764 O  O     . VAL A 1 734 ? 10.024  -43.884  -51.387 1.00 51.51  ? 780  VAL A O     1 
ATOM   5765 C  CB    . VAL A 1 734 ? 10.806  -46.414  -49.684 1.00 53.88  ? 780  VAL A CB    1 
ATOM   5766 C  CG1   . VAL A 1 734 ? 10.965  -47.296  -48.455 1.00 53.53  ? 780  VAL A CG1   1 
ATOM   5767 C  CG2   . VAL A 1 734 ? 9.672   -46.922  -50.567 1.00 54.69  ? 780  VAL A CG2   1 
ATOM   5768 N  N     . GLY A 1 735 ? 11.993  -43.256  -50.491 1.00 46.32  ? 781  GLY A N     1 
ATOM   5769 C  CA    . GLY A 1 735 ? 12.364  -42.356  -51.578 1.00 46.61  ? 781  GLY A CA    1 
ATOM   5770 C  C     . GLY A 1 735 ? 13.379  -42.959  -52.529 1.00 51.63  ? 781  GLY A C     1 
ATOM   5771 O  O     . GLY A 1 735 ? 13.646  -44.164  -52.459 1.00 51.45  ? 781  GLY A O     1 
ATOM   5772 N  N     . GLN A 1 736 ? 13.973  -42.130  -53.417 1.00 48.75  ? 782  GLN A N     1 
ATOM   5773 C  CA    . GLN A 1 736 ? 14.994  -42.612  -54.356 1.00 49.08  ? 782  GLN A CA    1 
ATOM   5774 C  C     . GLN A 1 736 ? 16.347  -42.875  -53.697 1.00 53.52  ? 782  GLN A C     1 
ATOM   5775 O  O     . GLN A 1 736 ? 17.083  -43.720  -54.206 1.00 55.92  ? 782  GLN A O     1 
ATOM   5776 C  CB    . GLN A 1 736 ? 15.155  -41.695  -55.586 1.00 50.48  ? 782  GLN A CB    1 
ATOM   5777 C  CG    . GLN A 1 736 ? 14.202  -42.020  -56.747 1.00 75.71  ? 782  GLN A CG    1 
ATOM   5778 C  CD    . GLN A 1 736 ? 14.250  -43.460  -57.234 1.00 106.59 ? 782  GLN A CD    1 
ATOM   5779 O  OE1   . GLN A 1 736 ? 15.276  -43.958  -57.717 1.00 107.26 ? 782  GLN A OE1   1 
ATOM   5780 N  NE2   . GLN A 1 736 ? 13.123  -44.155  -57.146 1.00 96.79  ? 782  GLN A NE2   1 
ATOM   5781 N  N     . SER A 1 737 ? 16.681  -42.198  -52.573 1.00 45.86  ? 783  SER A N     1 
ATOM   5782 C  CA    . SER A 1 737 ? 17.975  -42.421  -51.928 1.00 44.71  ? 783  SER A CA    1 
ATOM   5783 C  C     . SER A 1 737 ? 17.921  -42.585  -50.386 1.00 45.65  ? 783  SER A C     1 
ATOM   5784 O  O     . SER A 1 737 ? 18.916  -42.976  -49.759 1.00 43.88  ? 783  SER A O     1 
ATOM   5785 C  CB    . SER A 1 737 ? 18.954  -41.314  -52.318 1.00 49.94  ? 783  SER A CB    1 
ATOM   5786 O  OG    . SER A 1 737 ? 18.836  -40.154  -51.507 1.00 60.19  ? 783  SER A OG    1 
ATOM   5787 N  N     . LYS A 1 738 ? 16.789  -42.245  -49.776 1.00 41.22  ? 784  LYS A N     1 
ATOM   5788 C  CA    . LYS A 1 738 ? 16.644  -42.292  -48.320 1.00 39.99  ? 784  LYS A CA    1 
ATOM   5789 C  C     . LYS A 1 738 ? 15.263  -42.722  -47.949 1.00 40.89  ? 784  LYS A C     1 
ATOM   5790 O  O     . LYS A 1 738 ? 14.373  -42.741  -48.792 1.00 39.97  ? 784  LYS A O     1 
ATOM   5791 C  CB    . LYS A 1 738 ? 16.810  -40.875  -47.723 1.00 43.21  ? 784  LYS A CB    1 
ATOM   5792 C  CG    . LYS A 1 738 ? 18.023  -40.063  -48.108 1.00 63.86  ? 784  LYS A CG    1 
ATOM   5793 C  CD    . LYS A 1 738 ? 17.992  -38.739  -47.366 1.00 76.85  ? 784  LYS A CD    1 
ATOM   5794 C  CE    . LYS A 1 738 ? 18.711  -37.637  -48.095 1.00 90.48  ? 784  LYS A CE    1 
ATOM   5795 N  NZ    . LYS A 1 738 ? 19.109  -36.547  -47.164 1.00 102.55 ? 784  LYS A NZ    1 
ATOM   5796 N  N     . ILE A 1 739 ? 15.056  -42.966  -46.663 1.00 38.11  ? 785  ILE A N     1 
ATOM   5797 C  CA    . ILE A 1 739 ? 13.731  -43.195  -46.087 1.00 39.00  ? 785  ILE A CA    1 
ATOM   5798 C  C     . ILE A 1 739 ? 13.395  -41.976  -45.226 1.00 44.47  ? 785  ILE A C     1 
ATOM   5799 O  O     . ILE A 1 739 ? 14.200  -41.549  -44.377 1.00 42.99  ? 785  ILE A O     1 
ATOM   5800 C  CB    . ILE A 1 739 ? 13.625  -44.474  -45.239 1.00 42.27  ? 785  ILE A CB    1 
ATOM   5801 C  CG1   . ILE A 1 739 ? 14.292  -45.678  -45.941 1.00 42.74  ? 785  ILE A CG1   1 
ATOM   5802 C  CG2   . ILE A 1 739 ? 12.154  -44.740  -44.834 1.00 42.23  ? 785  ILE A CG2   1 
ATOM   5803 C  CD1   . ILE A 1 739 ? 15.032  -46.550  -45.020 1.00 48.62  ? 785  ILE A CD1   1 
ATOM   5804 N  N     . PHE A 1 740 ? 12.181  -41.453  -45.432 1.00 41.38  ? 786  PHE A N     1 
ATOM   5805 C  CA    . PHE A 1 740 ? 11.610  -40.342  -44.696 1.00 40.21  ? 786  PHE A CA    1 
ATOM   5806 C  C     . PHE A 1 740 ? 10.742  -40.915  -43.591 1.00 44.16  ? 786  PHE A C     1 
ATOM   5807 O  O     . PHE A 1 740 ? 9.971   -41.824  -43.868 1.00 44.38  ? 786  PHE A O     1 
ATOM   5808 C  CB    . PHE A 1 740 ? 10.717  -39.535  -45.642 1.00 41.64  ? 786  PHE A CB    1 
ATOM   5809 C  CG    . PHE A 1 740 ? 11.485  -38.746  -46.664 1.00 43.26  ? 786  PHE A CG    1 
ATOM   5810 C  CD1   . PHE A 1 740 ? 11.933  -37.453  -46.377 1.00 45.55  ? 786  PHE A CD1   1 
ATOM   5811 C  CD2   . PHE A 1 740 ? 11.785  -39.292  -47.904 1.00 44.69  ? 786  PHE A CD2   1 
ATOM   5812 C  CE1   . PHE A 1 740 ? 12.659  -36.727  -47.322 1.00 45.94  ? 786  PHE A CE1   1 
ATOM   5813 C  CE2   . PHE A 1 740 ? 12.512  -38.562  -48.846 1.00 47.92  ? 786  PHE A CE2   1 
ATOM   5814 C  CZ    . PHE A 1 740 ? 12.943  -37.282  -48.551 1.00 45.20  ? 786  PHE A CZ    1 
ATOM   5815 N  N     . PHE A 1 741 ? 10.845  -40.401  -42.354 1.00 39.71  ? 787  PHE A N     1 
ATOM   5816 C  CA    . PHE A 1 741 ? 10.024  -40.856  -41.229 1.00 38.61  ? 787  PHE A CA    1 
ATOM   5817 C  C     . PHE A 1 741 ? 9.255   -39.671  -40.625 1.00 43.33  ? 787  PHE A C     1 
ATOM   5818 O  O     . PHE A 1 741 ? 9.721   -38.536  -40.743 1.00 40.36  ? 787  PHE A O     1 
ATOM   5819 C  CB    . PHE A 1 741 ? 10.890  -41.529  -40.143 1.00 40.19  ? 787  PHE A CB    1 
ATOM   5820 C  CG    . PHE A 1 741 ? 11.493  -42.859  -40.538 1.00 42.96  ? 787  PHE A CG    1 
ATOM   5821 C  CD1   . PHE A 1 741 ? 10.752  -44.031  -40.452 1.00 46.79  ? 787  PHE A CD1   1 
ATOM   5822 C  CD2   . PHE A 1 741 ? 12.799  -42.937  -41.003 1.00 45.66  ? 787  PHE A CD2   1 
ATOM   5823 C  CE1   . PHE A 1 741 ? 11.306  -45.259  -40.827 1.00 47.54  ? 787  PHE A CE1   1 
ATOM   5824 C  CE2   . PHE A 1 741 ? 13.350  -44.167  -41.383 1.00 48.50  ? 787  PHE A CE2   1 
ATOM   5825 C  CZ    . PHE A 1 741 ? 12.600  -45.316  -41.289 1.00 46.62  ? 787  PHE A CZ    1 
ATOM   5826 N  N     . ARG A 1 742 ? 8.103   -39.945  -39.954 1.00 41.64  ? 788  ARG A N     1 
ATOM   5827 C  CA    . ARG A 1 742 ? 7.322   -38.948  -39.196 1.00 43.26  ? 788  ARG A CA    1 
ATOM   5828 C  C     . ARG A 1 742 ? 8.117   -38.668  -37.907 1.00 53.37  ? 788  ARG A C     1 
ATOM   5829 O  O     . ARG A 1 742 ? 8.917   -39.527  -37.496 1.00 54.28  ? 788  ARG A O     1 
ATOM   5830 C  CB    . ARG A 1 742 ? 5.929   -39.510  -38.819 1.00 40.44  ? 788  ARG A CB    1 
ATOM   5831 C  CG    . ARG A 1 742 ? 5.044   -39.919  -40.002 1.00 43.45  ? 788  ARG A CG    1 
ATOM   5832 C  CD    . ARG A 1 742 ? 4.451   -38.729  -40.723 1.00 47.65  ? 788  ARG A CD    1 
ATOM   5833 N  NE    . ARG A 1 742 ? 3.328   -39.122  -41.573 1.00 50.80  ? 788  ARG A NE    1 
ATOM   5834 C  CZ    . ARG A 1 742 ? 2.715   -38.319  -42.439 1.00 59.38  ? 788  ARG A CZ    1 
ATOM   5835 N  NH1   . ARG A 1 742 ? 3.145   -37.077  -42.631 1.00 41.43  ? 788  ARG A NH1   1 
ATOM   5836 N  NH2   . ARG A 1 742 ? 1.689   -38.764  -43.151 1.00 36.72  ? 788  ARG A NH2   1 
ATOM   5837 N  N     . ALA A 1 743 ? 7.921   -37.505  -37.250 1.00 51.74  ? 789  ALA A N     1 
ATOM   5838 C  CA    . ALA A 1 743 ? 8.673   -37.206  -36.007 1.00 52.33  ? 789  ALA A CA    1 
ATOM   5839 C  C     . ALA A 1 743 ? 8.565   -38.312  -34.937 1.00 56.04  ? 789  ALA A C     1 
ATOM   5840 O  O     . ALA A 1 743 ? 7.489   -38.864  -34.732 1.00 56.13  ? 789  ALA A O     1 
ATOM   5841 C  CB    . ALA A 1 743 ? 8.241   -35.869  -35.422 1.00 53.22  ? 789  ALA A CB    1 
ATOM   5842 N  N     . GLY A 1 744 ? 9.696   -38.645  -34.325 1.00 52.64  ? 790  GLY A N     1 
ATOM   5843 C  CA    . GLY A 1 744 ? 9.801   -39.624  -33.242 1.00 52.00  ? 790  GLY A CA    1 
ATOM   5844 C  C     . GLY A 1 744 ? 9.936   -41.096  -33.598 1.00 53.63  ? 790  GLY A C     1 
ATOM   5845 O  O     . GLY A 1 744 ? 10.060  -41.925  -32.690 1.00 53.63  ? 790  GLY A O     1 
ATOM   5846 N  N     . VAL A 1 745 ? 9.892   -41.444  -34.906 1.00 47.11  ? 791  VAL A N     1 
ATOM   5847 C  CA    . VAL A 1 745 ? 9.974   -42.830  -35.387 1.00 44.66  ? 791  VAL A CA    1 
ATOM   5848 C  C     . VAL A 1 745 ? 11.413  -43.360  -35.255 1.00 48.42  ? 791  VAL A C     1 
ATOM   5849 O  O     . VAL A 1 745 ? 11.611  -44.519  -34.882 1.00 46.69  ? 791  VAL A O     1 
ATOM   5850 C  CB    . VAL A 1 745 ? 9.377   -43.033  -36.812 1.00 46.61  ? 791  VAL A CB    1 
ATOM   5851 C  CG1   . VAL A 1 745 ? 9.447   -44.494  -37.223 1.00 46.78  ? 791  VAL A CG1   1 
ATOM   5852 C  CG2   . VAL A 1 745 ? 7.937   -42.523  -36.918 1.00 45.12  ? 791  VAL A CG2   1 
ATOM   5853 N  N     . LEU A 1 746 ? 12.414  -42.516  -35.525 1.00 46.35  ? 792  LEU A N     1 
ATOM   5854 C  CA    . LEU A 1 746 ? 13.789  -42.973  -35.393 1.00 46.70  ? 792  LEU A CA    1 
ATOM   5855 C  C     . LEU A 1 746 ? 14.206  -43.082  -33.935 1.00 53.39  ? 792  LEU A C     1 
ATOM   5856 O  O     . LEU A 1 746 ? 14.807  -44.087  -33.556 1.00 52.09  ? 792  LEU A O     1 
ATOM   5857 C  CB    . LEU A 1 746 ? 14.753  -42.123  -36.213 1.00 46.47  ? 792  LEU A CB    1 
ATOM   5858 C  CG    . LEU A 1 746 ? 14.685  -42.306  -37.741 1.00 49.89  ? 792  LEU A CG    1 
ATOM   5859 C  CD1   . LEU A 1 746 ? 15.506  -41.243  -38.450 1.00 47.92  ? 792  LEU A CD1   1 
ATOM   5860 C  CD2   . LEU A 1 746 ? 15.117  -43.732  -38.159 1.00 52.34  ? 792  LEU A CD2   1 
ATOM   5861 N  N     . ALA A 1 747 ? 13.787  -42.102  -33.103 1.00 52.52  ? 793  ALA A N     1 
ATOM   5862 C  CA    . ALA A 1 747 ? 14.032  -42.042  -31.652 1.00 53.58  ? 793  ALA A CA    1 
ATOM   5863 C  C     . ALA A 1 747 ? 13.554  -43.298  -30.932 1.00 59.15  ? 793  ALA A C     1 
ATOM   5864 O  O     . ALA A 1 747 ? 14.165  -43.709  -29.942 1.00 60.92  ? 793  ALA A O     1 
ATOM   5865 C  CB    . ALA A 1 747 ? 13.340  -40.826  -31.060 1.00 54.62  ? 793  ALA A CB    1 
ATOM   5866 N  N     . GLN A 1 748 ? 12.458  -43.894  -31.420 1.00 54.72  ? 794  GLN A N     1 
ATOM   5867 C  CA    . GLN A 1 748 ? 11.900  -45.110  -30.859 1.00 54.80  ? 794  GLN A CA    1 
ATOM   5868 C  C     . GLN A 1 748 ? 12.620  -46.353  -31.396 1.00 57.12  ? 794  GLN A C     1 
ATOM   5869 O  O     . GLN A 1 748 ? 12.682  -47.356  -30.685 1.00 57.66  ? 794  GLN A O     1 
ATOM   5870 C  CB    . GLN A 1 748 ? 10.396  -45.184  -31.103 1.00 56.57  ? 794  GLN A CB    1 
ATOM   5871 C  CG    . GLN A 1 748 ? 9.653   -45.881  -29.969 1.00 90.80  ? 794  GLN A CG    1 
ATOM   5872 C  CD    . GLN A 1 748 ? 9.335   -44.965  -28.812 1.00 119.83 ? 794  GLN A CD    1 
ATOM   5873 O  OE1   . GLN A 1 748 ? 8.653   -43.940  -28.954 1.00 115.66 ? 794  GLN A OE1   1 
ATOM   5874 N  NE2   . GLN A 1 748 ? 9.788   -45.344  -27.628 1.00 114.96 ? 794  GLN A NE2   1 
ATOM   5875 N  N     . LEU A 1 749 ? 13.160  -46.290  -32.641 1.00 51.24  ? 795  LEU A N     1 
ATOM   5876 C  CA    . LEU A 1 749 ? 13.923  -47.392  -33.237 1.00 50.33  ? 795  LEU A CA    1 
ATOM   5877 C  C     . LEU A 1 749 ? 15.313  -47.501  -32.603 1.00 56.23  ? 795  LEU A C     1 
ATOM   5878 O  O     . LEU A 1 749 ? 15.837  -48.613  -32.490 1.00 56.20  ? 795  LEU A O     1 
ATOM   5879 C  CB    . LEU A 1 749 ? 14.022  -47.292  -34.768 1.00 49.64  ? 795  LEU A CB    1 
ATOM   5880 C  CG    . LEU A 1 749 ? 12.739  -47.576  -35.564 1.00 53.87  ? 795  LEU A CG    1 
ATOM   5881 C  CD1   . LEU A 1 749 ? 12.916  -47.217  -37.036 1.00 52.01  ? 795  LEU A CD1   1 
ATOM   5882 C  CD2   . LEU A 1 749 ? 12.273  -49.042  -35.403 1.00 55.90  ? 795  LEU A CD2   1 
ATOM   5883 N  N     . GLU A 1 750 ? 15.902  -46.345  -32.187 1.00 53.96  ? 796  GLU A N     1 
ATOM   5884 C  CA    . GLU A 1 750 ? 17.190  -46.240  -31.492 1.00 54.39  ? 796  GLU A CA    1 
ATOM   5885 C  C     . GLU A 1 750 ? 17.083  -46.851  -30.098 1.00 62.98  ? 796  GLU A C     1 
ATOM   5886 O  O     . GLU A 1 750 ? 18.075  -47.380  -29.593 1.00 63.89  ? 796  GLU A O     1 
ATOM   5887 C  CB    . GLU A 1 750 ? 17.612  -44.778  -31.349 1.00 55.67  ? 796  GLU A CB    1 
ATOM   5888 C  CG    . GLU A 1 750 ? 18.205  -44.180  -32.611 1.00 67.47  ? 796  GLU A CG    1 
ATOM   5889 C  CD    . GLU A 1 750 ? 19.559  -44.728  -33.007 1.00 85.30  ? 796  GLU A CD    1 
ATOM   5890 O  OE1   . GLU A 1 750 ? 19.776  -44.961  -34.218 1.00 80.73  ? 796  GLU A OE1   1 
ATOM   5891 O  OE2   . GLU A 1 750 ? 20.405  -44.926  -32.104 1.00 78.79  ? 796  GLU A OE2   1 
ATOM   5892 N  N     . GLU A 1 751 ? 15.885  -46.756  -29.466 1.00 60.90  ? 797  GLU A N     1 
ATOM   5893 C  CA    . GLU A 1 751 ? 15.616  -47.317  -28.148 1.00 61.15  ? 797  GLU A CA    1 
ATOM   5894 C  C     . GLU A 1 751 ? 15.358  -48.822  -28.261 1.00 65.61  ? 797  GLU A C     1 
ATOM   5895 O  O     . GLU A 1 751 ? 15.686  -49.566  -27.334 1.00 64.61  ? 797  GLU A O     1 
ATOM   5896 C  CB    . GLU A 1 751 ? 14.438  -46.605  -27.451 1.00 62.68  ? 797  GLU A CB    1 
ATOM   5897 C  CG    . GLU A 1 751 ? 14.694  -45.152  -27.075 1.00 76.23  ? 797  GLU A CG    1 
ATOM   5898 C  CD    . GLU A 1 751 ? 15.672  -44.889  -25.945 1.00 109.04 ? 797  GLU A CD    1 
ATOM   5899 O  OE1   . GLU A 1 751 ? 15.206  -44.593  -24.821 1.00 113.09 ? 797  GLU A OE1   1 
ATOM   5900 O  OE2   . GLU A 1 751 ? 16.899  -44.928  -26.194 1.00 108.13 ? 797  GLU A OE2   1 
ATOM   5901 N  N     . GLU A 1 752 ? 14.758  -49.262  -29.392 1.00 62.00  ? 798  GLU A N     1 
ATOM   5902 C  CA    . GLU A 1 752 ? 14.453  -50.663  -29.683 1.00 61.68  ? 798  GLU A CA    1 
ATOM   5903 C  C     . GLU A 1 752 ? 15.725  -51.399  -30.039 1.00 67.00  ? 798  GLU A C     1 
ATOM   5904 O  O     . GLU A 1 752 ? 15.877  -52.572  -29.706 1.00 65.88  ? 798  GLU A O     1 
ATOM   5905 C  CB    . GLU A 1 752 ? 13.470  -50.774  -30.847 1.00 62.87  ? 798  GLU A CB    1 
ATOM   5906 C  CG    . GLU A 1 752 ? 12.016  -50.919  -30.424 1.00 71.52  ? 798  GLU A CG    1 
ATOM   5907 C  CD    . GLU A 1 752 ? 11.038  -51.125  -31.565 1.00 79.30  ? 798  GLU A CD    1 
ATOM   5908 O  OE1   . GLU A 1 752 ? 11.432  -51.712  -32.597 1.00 52.00  ? 798  GLU A OE1   1 
ATOM   5909 O  OE2   . GLU A 1 752 ? 9.863   -50.724  -31.417 1.00 74.93  ? 798  GLU A OE2   1 
ATOM   5910 N  N     . ARG A 1 753 ? 16.625  -50.714  -30.739 1.00 65.37  ? 799  ARG A N     1 
ATOM   5911 C  CA    . ARG A 1 753 ? 17.916  -51.239  -31.160 1.00 66.09  ? 799  ARG A CA    1 
ATOM   5912 C  C     . ARG A 1 753 ? 18.833  -51.395  -29.918 1.00 72.18  ? 799  ARG A C     1 
ATOM   5913 O  O     . ARG A 1 753 ? 19.503  -52.425  -29.775 1.00 71.05  ? 799  ARG A O     1 
ATOM   5914 C  CB    . ARG A 1 753 ? 18.521  -50.278  -32.190 1.00 65.55  ? 799  ARG A CB    1 
ATOM   5915 C  CG    . ARG A 1 753 ? 19.671  -50.835  -32.986 1.00 75.03  ? 799  ARG A CG    1 
ATOM   5916 C  CD    . ARG A 1 753 ? 20.413  -49.718  -33.660 1.00 81.01  ? 799  ARG A CD    1 
ATOM   5917 N  NE    . ARG A 1 753 ? 21.090  -48.841  -32.707 1.00 93.72  ? 799  ARG A NE    1 
ATOM   5918 C  CZ    . ARG A 1 753 ? 22.409  -48.750  -32.570 1.00 109.65 ? 799  ARG A CZ    1 
ATOM   5919 N  NH1   . ARG A 1 753 ? 23.217  -49.482  -33.330 1.00 82.77  ? 799  ARG A NH1   1 
ATOM   5920 N  NH2   . ARG A 1 753 ? 22.930  -47.921  -31.677 1.00 107.54 ? 799  ARG A NH2   1 
ATOM   5921 N  N     . ALA A 1 754 ? 18.817  -50.385  -29.008 1.00 70.08  ? 800  ALA A N     1 
ATOM   5922 C  CA    . ALA A 1 754 ? 19.573  -50.372  -27.748 1.00 70.40  ? 800  ALA A CA    1 
ATOM   5923 C  C     . ALA A 1 754 ? 19.058  -51.454  -26.817 1.00 74.37  ? 800  ALA A C     1 
ATOM   5924 O  O     . ALA A 1 754 ? 19.828  -52.021  -26.041 1.00 74.41  ? 800  ALA A O     1 
ATOM   5925 C  CB    . ALA A 1 754 ? 19.453  -49.016  -27.075 1.00 71.37  ? 800  ALA A CB    1 
ATOM   5926 N  N     . SER A 1 755 ? 17.750  -51.739  -26.906 1.00 70.54  ? 801  SER A N     1 
ATOM   5927 C  CA    . SER A 1 755 ? 17.079  -52.771  -26.147 1.00 70.45  ? 801  SER A CA    1 
ATOM   5928 C  C     . SER A 1 755 ? 17.561  -54.141  -26.643 1.00 75.33  ? 801  SER A C     1 
ATOM   5929 O  O     . SER A 1 755 ? 17.968  -54.970  -25.821 1.00 75.62  ? 801  SER A O     1 
ATOM   5930 C  CB    . SER A 1 755 ? 15.568  -52.640  -26.297 1.00 74.13  ? 801  SER A CB    1 
ATOM   5931 O  OG    . SER A 1 755 ? 14.890  -53.478  -25.378 1.00 85.56  ? 801  SER A OG    1 
ATOM   5932 N  N     . GLU A 1 756 ? 17.576  -54.355  -27.982 1.00 71.08  ? 802  GLU A N     1 
ATOM   5933 C  CA    . GLU A 1 756 ? 18.040  -55.607  -28.580 1.00 70.76  ? 802  GLU A CA    1 
ATOM   5934 C  C     . GLU A 1 756 ? 19.537  -55.841  -28.396 1.00 75.30  ? 802  GLU A C     1 
ATOM   5935 O  O     . GLU A 1 756 ? 19.941  -56.992  -28.260 1.00 75.09  ? 802  GLU A O     1 
ATOM   5936 C  CB    . GLU A 1 756 ? 17.632  -55.740  -30.049 1.00 71.79  ? 802  GLU A CB    1 
ATOM   5937 C  CG    . GLU A 1 756 ? 16.293  -56.438  -30.243 1.00 83.18  ? 802  GLU A CG    1 
ATOM   5938 C  CD    . GLU A 1 756 ? 16.228  -57.928  -29.951 1.00 110.21 ? 802  GLU A CD    1 
ATOM   5939 O  OE1   . GLU A 1 756 ? 15.143  -58.397  -29.539 1.00 115.94 ? 802  GLU A OE1   1 
ATOM   5940 O  OE2   . GLU A 1 756 ? 17.245  -58.630  -30.154 1.00 102.60 ? 802  GLU A OE2   1 
ATOM   5941 N  N     . GLN A 1 757 ? 20.347  -54.762  -28.363 1.00 71.54  ? 803  GLN A N     1 
ATOM   5942 C  CA    . GLN A 1 757 ? 21.796  -54.809  -28.143 1.00 71.30  ? 803  GLN A CA    1 
ATOM   5943 C  C     . GLN A 1 757 ? 22.100  -55.330  -26.744 1.00 77.82  ? 803  GLN A C     1 
ATOM   5944 O  O     . GLN A 1 757 ? 23.008  -56.150  -26.575 1.00 77.98  ? 803  GLN A O     1 
ATOM   5945 C  CB    . GLN A 1 757 ? 22.416  -53.419  -28.317 1.00 72.24  ? 803  GLN A CB    1 
ATOM   5946 C  CG    . GLN A 1 757 ? 22.886  -53.150  -29.732 1.00 82.35  ? 803  GLN A CG    1 
ATOM   5947 C  CD    . GLN A 1 757 ? 23.525  -51.795  -29.898 1.00 101.74 ? 803  GLN A CD    1 
ATOM   5948 O  OE1   . GLN A 1 757 ? 23.511  -50.937  -29.006 1.00 97.06  ? 803  GLN A OE1   1 
ATOM   5949 N  NE2   . GLN A 1 757 ? 24.093  -51.569  -31.062 1.00 97.19  ? 803  GLN A NE2   1 
ATOM   5950 N  N     . THR A 1 758 ? 21.320  -54.869  -25.747 1.00 75.62  ? 804  THR A N     1 
ATOM   5951 C  CA    . THR A 1 758 ? 21.431  -55.279  -24.354 1.00 75.99  ? 804  THR A CA    1 
ATOM   5952 C  C     . THR A 1 758 ? 20.920  -56.718  -24.209 1.00 82.01  ? 804  THR A C     1 
ATOM   5953 O  O     . THR A 1 758 ? 21.562  -57.530  -23.548 1.00 82.49  ? 804  THR A O     1 
ATOM   5954 C  CB    . THR A 1 758 ? 20.758  -54.235  -23.457 1.00 83.14  ? 804  THR A CB    1 
ATOM   5955 O  OG1   . THR A 1 758 ? 21.401  -52.982  -23.687 1.00 82.93  ? 804  THR A OG1   1 
ATOM   5956 C  CG2   . THR A 1 758 ? 20.846  -54.574  -21.974 1.00 81.26  ? 804  THR A CG2   1 
ATOM   5957 N  N     . LYS A 1 759 ? 19.806  -57.041  -24.883 1.00 79.52  ? 805  LYS A N     1 
ATOM   5958 C  CA    . LYS A 1 759 ? 19.184  -58.368  -24.904 1.00 79.25  ? 805  LYS A CA    1 
ATOM   5959 C  C     . LYS A 1 759 ? 20.126  -59.403  -25.525 1.00 84.15  ? 805  LYS A C     1 
ATOM   5960 O  O     . LYS A 1 759 ? 20.151  -60.534  -25.058 1.00 84.05  ? 805  LYS A O     1 
ATOM   5961 C  CB    . LYS A 1 759 ? 17.868  -58.313  -25.692 1.00 81.10  ? 805  LYS A CB    1 
ATOM   5962 C  CG    . LYS A 1 759 ? 16.924  -59.473  -25.431 1.00 89.17  ? 805  LYS A CG    1 
ATOM   5963 C  CD    . LYS A 1 759 ? 16.279  -60.013  -26.704 1.00 95.94  ? 805  LYS A CD    1 
ATOM   5964 C  CE    . LYS A 1 759 ? 17.160  -61.007  -27.425 1.00 104.07 ? 805  LYS A CE    1 
ATOM   5965 N  NZ    . LYS A 1 759 ? 16.409  -61.761  -28.459 1.00 112.19 ? 805  LYS A NZ    1 
ATOM   5966 N  N     . SER A 1 760 ? 20.895  -59.019  -26.561 1.00 81.63  ? 806  SER A N     1 
ATOM   5967 C  CA    . SER A 1 760 ? 21.843  -59.897  -27.243 1.00 82.42  ? 806  SER A CA    1 
ATOM   5968 C  C     . SER A 1 760 ? 23.074  -60.174  -26.370 1.00 88.85  ? 806  SER A C     1 
ATOM   5969 O  O     . SER A 1 760 ? 23.502  -61.328  -26.294 1.00 87.95  ? 806  SER A O     1 
ATOM   5970 C  CB    . SER A 1 760 ? 22.253  -59.306  -28.588 1.00 86.89  ? 806  SER A CB    1 
ATOM   5971 O  OG    . SER A 1 760 ? 23.287  -60.037  -29.229 1.00 98.53  ? 806  SER A OG    1 
ATOM   5972 N  N     . ASP A 1 761 ? 23.635  -59.117  -25.724 1.00 87.36  ? 807  ASP A N     1 
ATOM   5973 C  CA    . ASP A 1 761 ? 24.805  -59.179  -24.838 1.00 87.80  ? 807  ASP A CA    1 
ATOM   5974 C  C     . ASP A 1 761 ? 24.520  -60.027  -23.603 1.00 91.99  ? 807  ASP A C     1 
ATOM   5975 O  O     . ASP A 1 761 ? 25.374  -60.825  -23.206 1.00 91.40  ? 807  ASP A O     1 
ATOM   5976 C  CB    . ASP A 1 761 ? 25.262  -57.768  -24.424 1.00 90.20  ? 807  ASP A CB    1 
ATOM   5977 C  CG    . ASP A 1 761 ? 26.552  -57.713  -23.613 1.00 103.45 ? 807  ASP A CG    1 
ATOM   5978 O  OD1   . ASP A 1 761 ? 27.521  -58.416  -23.983 1.00 104.87 ? 807  ASP A OD1   1 
ATOM   5979 O  OD2   . ASP A 1 761 ? 26.612  -56.918  -22.651 1.00 109.32 ? 807  ASP A OD2   1 
ATOM   5980 N  N     . TYR A 1 762 ? 23.317  -59.866  -23.009 1.00 88.72  ? 808  TYR A N     1 
ATOM   5981 C  CA    . TYR A 1 762 ? 22.883  -60.641  -21.849 1.00 88.61  ? 808  TYR A CA    1 
ATOM   5982 C  C     . TYR A 1 762 ? 22.762  -62.117  -22.230 1.00 93.80  ? 808  TYR A C     1 
ATOM   5983 O  O     . TYR A 1 762 ? 23.286  -62.966  -21.511 1.00 93.45  ? 808  TYR A O     1 
ATOM   5984 C  CB    . TYR A 1 762 ? 21.549  -60.112  -21.284 1.00 89.53  ? 808  TYR A CB    1 
ATOM   5985 C  CG    . TYR A 1 762 ? 21.013  -60.923  -20.121 1.00 90.93  ? 808  TYR A CG    1 
ATOM   5986 C  CD1   . TYR A 1 762 ? 20.285  -62.090  -20.334 1.00 92.79  ? 808  TYR A CD1   1 
ATOM   5987 C  CD2   . TYR A 1 762 ? 21.219  -60.516  -18.809 1.00 91.56  ? 808  TYR A CD2   1 
ATOM   5988 C  CE1   . TYR A 1 762 ? 19.809  -62.853  -19.270 1.00 93.28  ? 808  TYR A CE1   1 
ATOM   5989 C  CE2   . TYR A 1 762 ? 20.734  -61.261  -17.737 1.00 92.62  ? 808  TYR A CE2   1 
ATOM   5990 C  CZ    . TYR A 1 762 ? 20.022  -62.426  -17.971 1.00 98.91  ? 808  TYR A CZ    1 
ATOM   5991 O  OH    . TYR A 1 762 ? 19.538  -63.170  -16.921 1.00 97.28  ? 808  TYR A OH    1 
ATOM   5992 N  N     . LEU A 1 763 ? 22.063  -62.418  -23.344 1.00 90.99  ? 809  LEU A N     1 
ATOM   5993 C  CA    . LEU A 1 763 ? 21.846  -63.781  -23.832 1.00 91.07  ? 809  LEU A CA    1 
ATOM   5994 C  C     . LEU A 1 763 ? 23.130  -64.544  -24.137 1.00 95.36  ? 809  LEU A C     1 
ATOM   5995 O  O     . LEU A 1 763 ? 23.177  -65.742  -23.891 1.00 94.13  ? 809  LEU A O     1 
ATOM   5996 C  CB    . LEU A 1 763 ? 20.914  -63.786  -25.047 1.00 91.05  ? 809  LEU A CB    1 
ATOM   5997 C  CG    . LEU A 1 763 ? 19.525  -64.349  -24.808 1.00 95.80  ? 809  LEU A CG    1 
ATOM   5998 C  CD1   . LEU A 1 763 ? 18.678  -63.401  -23.968 1.00 95.90  ? 809  LEU A CD1   1 
ATOM   5999 C  CD2   . LEU A 1 763 ? 18.831  -64.615  -26.118 1.00 99.39  ? 809  LEU A CD2   1 
ATOM   6000 N  N     . LYS A 1 764 ? 24.164  -63.852  -24.656 1.00 93.36  ? 810  LYS A N     1 
ATOM   6001 C  CA    . LYS A 1 764 ? 25.465  -64.433  -24.997 1.00 94.17  ? 810  LYS A CA    1 
ATOM   6002 C  C     . LYS A 1 764 ? 26.219  -64.829  -23.714 1.00 99.75  ? 810  LYS A C     1 
ATOM   6003 O  O     . LYS A 1 764 ? 26.622  -65.985  -23.573 1.00 99.40  ? 810  LYS A O     1 
ATOM   6004 C  CB    . LYS A 1 764 ? 26.284  -63.439  -25.851 1.00 97.03  ? 810  LYS A CB    1 
ATOM   6005 C  CG    . LYS A 1 764 ? 27.552  -64.010  -26.479 1.00 116.21 ? 810  LYS A CG    1 
ATOM   6006 C  CD    . LYS A 1 764 ? 28.792  -63.287  -25.973 1.00 129.09 ? 810  LYS A CD    1 
ATOM   6007 C  CE    . LYS A 1 764 ? 30.029  -63.685  -26.737 1.00 143.72 ? 810  LYS A CE    1 
ATOM   6008 N  NZ    . LYS A 1 764 ? 31.262  -63.154  -26.100 1.00 155.20 ? 810  LYS A NZ    1 
ATOM   6009 N  N     . ARG A 1 765 ? 26.369  -63.869  -22.781 1.00 97.20  ? 811  ARG A N     1 
ATOM   6010 C  CA    . ARG A 1 765 ? 27.056  -64.014  -21.500 1.00 97.11  ? 811  ARG A CA    1 
ATOM   6011 C  C     . ARG A 1 765 ? 26.394  -65.036  -20.576 1.00 103.18 ? 811  ARG A C     1 
ATOM   6012 O  O     . ARG A 1 765 ? 27.098  -65.868  -20.009 1.00 103.02 ? 811  ARG A O     1 
ATOM   6013 C  CB    . ARG A 1 765 ? 27.207  -62.650  -20.812 1.00 94.95  ? 811  ARG A CB    1 
ATOM   6014 C  CG    . ARG A 1 765 ? 28.307  -61.777  -21.402 1.00 95.55  ? 811  ARG A CG    1 
ATOM   6015 C  CD    . ARG A 1 765 ? 28.074  -60.306  -21.127 1.00 97.54  ? 811  ARG A CD    1 
ATOM   6016 N  NE    . ARG A 1 765 ? 28.337  -59.941  -19.736 1.00 103.13 ? 811  ARG A NE    1 
ATOM   6017 C  CZ    . ARG A 1 765 ? 28.379  -58.694  -19.279 1.00 121.86 ? 811  ARG A CZ    1 
ATOM   6018 N  NH1   . ARG A 1 765 ? 28.181  -57.669  -20.101 1.00 111.15 ? 811  ARG A NH1   1 
ATOM   6019 N  NH2   . ARG A 1 765 ? 28.624  -58.457  -17.998 1.00 111.52 ? 811  ARG A NH2   1 
ATOM   6020 N  N     . ALA A 1 766 ? 25.053  -64.996  -20.447 1.00 101.28 ? 812  ALA A N     1 
ATOM   6021 C  CA    . ALA A 1 766 ? 24.294  -65.937  -19.617 1.00 102.18 ? 812  ALA A CA    1 
ATOM   6022 C  C     . ALA A 1 766 ? 24.308  -67.365  -20.178 1.00 109.31 ? 812  ALA A C     1 
ATOM   6023 O  O     . ALA A 1 766 ? 24.083  -68.309  -19.422 1.00 109.25 ? 812  ALA A O     1 
ATOM   6024 C  CB    . ALA A 1 766 ? 22.864  -65.455  -19.423 1.00 102.88 ? 812  ALA A CB    1 
ATOM   6025 N  N     . ASN A 1 767 ? 24.571  -67.525  -21.490 1.00 108.17 ? 813  ASN A N     1 
ATOM   6026 C  CA    . ASN A 1 767 ? 24.675  -68.842  -22.123 1.00 109.36 ? 813  ASN A CA    1 
ATOM   6027 C  C     . ASN A 1 767 ? 26.063  -69.412  -21.863 1.00 116.76 ? 813  ASN A C     1 
ATOM   6028 O  O     . ASN A 1 767 ? 26.200  -70.622  -21.680 1.00 116.45 ? 813  ASN A O     1 
ATOM   6029 C  CB    . ASN A 1 767 ? 24.409  -68.774  -23.627 1.00 110.26 ? 813  ASN A CB    1 
ATOM   6030 C  CG    . ASN A 1 767 ? 22.980  -69.046  -24.029 1.00 136.02 ? 813  ASN A CG    1 
ATOM   6031 O  OD1   . ASN A 1 767 ? 22.345  -70.007  -23.585 1.00 129.53 ? 813  ASN A OD1   1 
ATOM   6032 N  ND2   . ASN A 1 767 ? 22.461  -68.242  -24.939 1.00 131.47 ? 813  ASN A ND2   1 
ATOM   6033 N  N     . GLU A 1 768 ? 27.088  -68.537  -21.846 1.00 115.86 ? 814  GLU A N     1 
ATOM   6034 C  CA    . GLU A 1 768 ? 28.482  -68.901  -21.589 1.00 116.95 ? 814  GLU A CA    1 
ATOM   6035 C  C     . GLU A 1 768 ? 28.706  -69.219  -20.105 1.00 122.60 ? 814  GLU A C     1 
ATOM   6036 O  O     . GLU A 1 768 ? 29.518  -70.090  -19.786 1.00 121.90 ? 814  GLU A O     1 
ATOM   6037 C  CB    . GLU A 1 768 ? 29.430  -67.791  -22.060 1.00 118.53 ? 814  GLU A CB    1 
ATOM   6038 C  CG    . GLU A 1 768 ? 29.534  -67.695  -23.573 1.00 132.19 ? 814  GLU A CG    1 
ATOM   6039 C  CD    . GLU A 1 768 ? 30.377  -66.561  -24.125 1.00 164.28 ? 814  GLU A CD    1 
ATOM   6040 O  OE1   . GLU A 1 768 ? 30.599  -65.560  -23.403 1.00 166.72 ? 814  GLU A OE1   1 
ATOM   6041 O  OE2   . GLU A 1 768 ? 30.793  -66.664  -25.300 1.00 162.89 ? 814  GLU A OE2   1 
ATOM   6042 N  N     . LEU A 1 769 ? 27.977  -68.516  -19.211 1.00 120.72 ? 815  LEU A N     1 
ATOM   6043 C  CA    . LEU A 1 769 ? 28.021  -68.689  -17.759 1.00 121.35 ? 815  LEU A CA    1 
ATOM   6044 C  C     . LEU A 1 769 ? 27.459  -70.062  -17.374 1.00 129.09 ? 815  LEU A C     1 
ATOM   6045 O  O     . LEU A 1 769 ? 28.080  -70.759  -16.573 1.00 128.69 ? 815  LEU A O     1 
ATOM   6046 C  CB    . LEU A 1 769 ? 27.241  -67.554  -17.069 1.00 121.04 ? 815  LEU A CB    1 
ATOM   6047 C  CG    . LEU A 1 769 ? 27.390  -67.394  -15.556 1.00 125.22 ? 815  LEU A CG    1 
ATOM   6048 C  CD1   . LEU A 1 769 ? 28.744  -66.827  -15.187 1.00 125.30 ? 815  LEU A CD1   1 
ATOM   6049 C  CD2   . LEU A 1 769 ? 26.327  -66.477  -15.019 1.00 127.42 ? 815  LEU A CD2   1 
ATOM   6050 N  N     . VAL A 1 770 ? 26.311  -70.454  -17.969 1.00 128.83 ? 816  VAL A N     1 
ATOM   6051 C  CA    . VAL A 1 770 ? 25.656  -71.749  -17.753 1.00 130.24 ? 816  VAL A CA    1 
ATOM   6052 C  C     . VAL A 1 770 ? 26.535  -72.875  -18.306 1.00 138.89 ? 816  VAL A C     1 
ATOM   6053 O  O     . VAL A 1 770 ? 26.695  -73.895  -17.638 1.00 138.88 ? 816  VAL A O     1 
ATOM   6054 C  CB    . VAL A 1 770 ? 24.187  -71.764  -18.272 1.00 133.87 ? 816  VAL A CB    1 
ATOM   6055 C  CG1   . VAL A 1 770 ? 23.690  -73.173  -18.599 1.00 133.65 ? 816  VAL A CG1   1 
ATOM   6056 C  CG2   . VAL A 1 770 ? 23.260  -71.096  -17.269 1.00 133.59 ? 816  VAL A CG2   1 
ATOM   6057 N  N     . GLN A 1 771 ? 27.157  -72.660  -19.483 1.00 138.87 ? 817  GLN A N     1 
ATOM   6058 C  CA    . GLN A 1 771 ? 28.067  -73.615  -20.120 1.00 140.52 ? 817  GLN A CA    1 
ATOM   6059 C  C     . GLN A 1 771 ? 29.289  -73.881  -19.226 1.00 148.48 ? 817  GLN A C     1 
ATOM   6060 O  O     . GLN A 1 771 ? 29.770  -75.011  -19.170 1.00 148.20 ? 817  GLN A O     1 
ATOM   6061 C  CB    . GLN A 1 771 ? 28.505  -73.093  -21.500 1.00 142.16 ? 817  GLN A CB    1 
ATOM   6062 C  CG    . GLN A 1 771 ? 29.281  -74.091  -22.366 1.00 167.13 ? 817  GLN A CG    1 
ATOM   6063 C  CD    . GLN A 1 771 ? 28.465  -75.297  -22.765 1.00 195.81 ? 817  GLN A CD    1 
ATOM   6064 O  OE1   . GLN A 1 771 ? 27.465  -75.199  -23.485 1.00 192.86 ? 817  GLN A OE1   1 
ATOM   6065 N  NE2   . GLN A 1 771 ? 28.888  -76.469  -22.316 1.00 191.52 ? 817  GLN A NE2   1 
ATOM   6066 N  N     . TRP A 1 772 ? 29.761  -72.845  -18.511 1.00 148.00 ? 818  TRP A N     1 
ATOM   6067 C  CA    . TRP A 1 772 ? 30.908  -72.925  -17.613 1.00 149.22 ? 818  TRP A CA    1 
ATOM   6068 C  C     . TRP A 1 772 ? 30.571  -73.595  -16.280 1.00 156.25 ? 818  TRP A C     1 
ATOM   6069 O  O     . TRP A 1 772 ? 31.354  -74.426  -15.821 1.00 155.92 ? 818  TRP A O     1 
ATOM   6070 C  CB    . TRP A 1 772 ? 31.510  -71.532  -17.387 1.00 148.10 ? 818  TRP A CB    1 
ATOM   6071 C  CG    . TRP A 1 772 ? 32.759  -71.535  -16.563 1.00 149.07 ? 818  TRP A CG    1 
ATOM   6072 C  CD1   . TRP A 1 772 ? 34.042  -71.627  -17.017 1.00 152.09 ? 818  TRP A CD1   1 
ATOM   6073 C  CD2   . TRP A 1 772 ? 32.845  -71.428  -15.138 1.00 149.01 ? 818  TRP A CD2   1 
ATOM   6074 N  NE1   . TRP A 1 772 ? 34.921  -71.584  -15.962 1.00 151.64 ? 818  TRP A NE1   1 
ATOM   6075 C  CE2   . TRP A 1 772 ? 34.211  -71.468  -14.795 1.00 153.13 ? 818  TRP A CE2   1 
ATOM   6076 C  CE3   . TRP A 1 772 ? 31.892  -71.310  -14.113 1.00 150.22 ? 818  TRP A CE3   1 
ATOM   6077 C  CZ2   . TRP A 1 772 ? 34.653  -71.396  -13.468 1.00 152.57 ? 818  TRP A CZ2   1 
ATOM   6078 C  CZ3   . TRP A 1 772 ? 32.326  -71.245  -12.799 1.00 151.79 ? 818  TRP A CZ3   1 
ATOM   6079 C  CH2   . TRP A 1 772 ? 33.691  -71.290  -12.486 1.00 152.54 ? 818  TRP A CH2   1 
ATOM   6080 N  N     . ILE A 1 773 ? 29.447  -73.207  -15.638 1.00 155.28 ? 819  ILE A N     1 
ATOM   6081 C  CA    . ILE A 1 773 ? 29.039  -73.763  -14.338 1.00 156.28 ? 819  ILE A CA    1 
ATOM   6082 C  C     . ILE A 1 773 ? 28.582  -75.239  -14.451 1.00 162.43 ? 819  ILE A C     1 
ATOM   6083 O  O     . ILE A 1 773 ? 28.767  -75.987  -13.496 1.00 162.19 ? 819  ILE A O     1 
ATOM   6084 C  CB    . ILE A 1 773 ? 28.018  -72.889  -13.546 1.00 159.56 ? 819  ILE A CB    1 
ATOM   6085 C  CG1   . ILE A 1 773 ? 26.638  -72.815  -14.234 1.00 160.23 ? 819  ILE A CG1   1 
ATOM   6086 C  CG2   . ILE A 1 773 ? 28.575  -71.491  -13.239 1.00 160.29 ? 819  ILE A CG2   1 
ATOM   6087 C  CD1   . ILE A 1 773 ? 25.495  -72.490  -13.302 1.00 168.31 ? 819  ILE A CD1   1 
ATOM   6088 N  N     . ASN A 1 774 ? 28.009  -75.654  -15.601 1.00 160.66 ? 820  ASN A N     1 
ATOM   6089 C  CA    . ASN A 1 774 ? 27.575  -77.039  -15.821 1.00 161.28 ? 820  ASN A CA    1 
ATOM   6090 C  C     . ASN A 1 774 ? 28.757  -77.955  -16.138 1.00 166.77 ? 820  ASN A C     1 
ATOM   6091 O  O     . ASN A 1 774 ? 28.693  -79.147  -15.841 1.00 166.19 ? 820  ASN A O     1 
ATOM   6092 C  CB    . ASN A 1 774 ? 26.507  -77.134  -16.915 1.00 163.21 ? 820  ASN A CB    1 
ATOM   6093 C  CG    . ASN A 1 774 ? 25.109  -76.726  -16.495 1.00 191.41 ? 820  ASN A CG    1 
ATOM   6094 O  OD1   . ASN A 1 774 ? 24.802  -76.524  -15.313 1.00 187.45 ? 820  ASN A OD1   1 
ATOM   6095 N  ND2   . ASN A 1 774 ? 24.215  -76.623  -17.465 1.00 184.31 ? 820  ASN A ND2   1 
ATOM   6096 N  N     . ASP A 1 775 ? 29.827  -77.402  -16.743 1.00 164.96 ? 821  ASP A N     1 
ATOM   6097 C  CA    . ASP A 1 775 ? 31.047  -78.140  -17.076 1.00 165.52 ? 821  ASP A CA    1 
ATOM   6098 C  C     . ASP A 1 775 ? 31.903  -78.374  -15.832 1.00 171.22 ? 821  ASP A C     1 
ATOM   6099 O  O     . ASP A 1 775 ? 32.472  -79.458  -15.682 1.00 170.75 ? 821  ASP A O     1 
ATOM   6100 C  CB    . ASP A 1 775 ? 31.851  -77.424  -18.177 1.00 167.22 ? 821  ASP A CB    1 
ATOM   6101 C  CG    . ASP A 1 775 ? 31.443  -77.774  -19.599 1.00 175.72 ? 821  ASP A CG    1 
ATOM   6102 O  OD1   . ASP A 1 775 ? 30.277  -78.183  -19.805 1.00 175.93 ? 821  ASP A OD1   1 
ATOM   6103 O  OD2   . ASP A 1 775 ? 32.284  -77.621  -20.510 1.00 181.17 ? 821  ASP A OD2   1 
ATOM   6104 N  N     . LYS A 1 776 ? 31.979  -77.368  -14.934 1.00 169.14 ? 822  LYS A N     1 
ATOM   6105 C  CA    . LYS A 1 776 ? 32.731  -77.477  -13.684 1.00 169.59 ? 822  LYS A CA    1 
ATOM   6106 C  C     . LYS A 1 776 ? 32.004  -78.349  -12.660 1.00 174.82 ? 822  LYS A C     1 
ATOM   6107 O  O     . LYS A 1 776 ? 32.671  -79.041  -11.894 1.00 174.79 ? 822  LYS A O     1 
ATOM   6108 C  CB    . LYS A 1 776 ? 33.119  -76.103  -13.106 1.00 172.32 ? 822  LYS A CB    1 
ATOM   6109 C  CG    . LYS A 1 776 ? 34.102  -75.286  -13.968 1.00 190.45 ? 822  LYS A CG    1 
ATOM   6110 C  CD    . LYS A 1 776 ? 35.420  -76.005  -14.346 1.00 202.65 ? 822  LYS A CD    1 
ATOM   6111 C  CE    . LYS A 1 776 ? 36.449  -76.057  -13.241 1.00 215.54 ? 822  LYS A CE    1 
ATOM   6112 N  NZ    . LYS A 1 776 ? 37.689  -76.749  -13.680 1.00 225.28 ? 822  LYS A NZ    1 
ATOM   6113 N  N     . GLN A 1 777 ? 30.647  -78.352  -12.674 1.00 171.95 ? 823  GLN A N     1 
ATOM   6114 C  CA    . GLN A 1 777 ? 29.811  -79.195  -11.805 1.00 172.05 ? 823  GLN A CA    1 
ATOM   6115 C  C     . GLN A 1 777 ? 30.132  -80.665  -12.105 1.00 177.19 ? 823  GLN A C     1 
ATOM   6116 O  O     . GLN A 1 777 ? 30.332  -81.439  -11.174 1.00 176.92 ? 823  GLN A O     1 
ATOM   6117 C  CB    . GLN A 1 777 ? 28.312  -78.896  -12.021 1.00 173.26 ? 823  GLN A CB    1 
ATOM   6118 C  CG    . GLN A 1 777 ? 27.341  -79.868  -11.337 1.00 183.15 ? 823  GLN A CG    1 
ATOM   6119 C  CD    . GLN A 1 777 ? 26.490  -79.250  -10.253 1.00 198.20 ? 823  GLN A CD    1 
ATOM   6120 O  OE1   . GLN A 1 777 ? 26.349  -78.029  -10.134 1.00 192.35 ? 823  GLN A OE1   1 
ATOM   6121 N  NE2   . GLN A 1 777 ? 25.867  -80.098  -9.454  1.00 190.57 ? 823  GLN A NE2   1 
ATOM   6122 N  N     . ALA A 1 778 ? 30.246  -81.017  -13.406 1.00 174.72 ? 824  ALA A N     1 
ATOM   6123 C  CA    . ALA A 1 778 ? 30.588  -82.354  -13.898 1.00 175.00 ? 824  ALA A CA    1 
ATOM   6124 C  C     . ALA A 1 778 ? 32.012  -82.760  -13.502 1.00 179.84 ? 824  ALA A C     1 
ATOM   6125 O  O     . ALA A 1 778 ? 32.288  -83.952  -13.374 1.00 179.45 ? 824  ALA A O     1 
ATOM   6126 C  CB    . ALA A 1 778 ? 30.430  -82.410  -15.408 1.00 175.79 ? 824  ALA A CB    1 
ATOM   6127 N  N     . SER A 1 779 ? 32.907  -81.770  -13.309 1.00 177.17 ? 825  SER A N     1 
ATOM   6128 C  CA    . SER A 1 779 ? 34.290  -81.991  -12.881 1.00 177.38 ? 825  SER A CA    1 
ATOM   6129 C  C     . SER A 1 779 ? 34.357  -82.185  -11.363 1.00 181.69 ? 825  SER A C     1 
ATOM   6130 O  O     . SER A 1 779 ? 35.282  -82.834  -10.875 1.00 181.31 ? 825  SER A O     1 
ATOM   6131 C  CB    . SER A 1 779 ? 35.180  -80.828  -13.308 1.00 181.20 ? 825  SER A CB    1 
ATOM   6132 O  OG    . SER A 1 779 ? 36.538  -81.056  -12.966 1.00 190.31 ? 825  SER A OG    1 
ATOM   6133 N  N     . LEU A 1 780 ? 33.378  -81.626  -10.623 1.00 178.59 ? 826  LEU A N     1 
ATOM   6134 C  CA    . LEU A 1 780 ? 33.286  -81.734  -9.165  1.00 178.66 ? 826  LEU A CA    1 
ATOM   6135 C  C     . LEU A 1 780 ? 32.652  -83.059  -8.713  1.00 183.89 ? 826  LEU A C     1 
ATOM   6136 O  O     . LEU A 1 780 ? 32.914  -83.496  -7.589  1.00 183.73 ? 826  LEU A O     1 
ATOM   6137 C  CB    . LEU A 1 780 ? 32.517  -80.543  -8.563  1.00 178.59 ? 826  LEU A CB    1 
ATOM   6138 C  CG    . LEU A 1 780 ? 33.187  -79.171  -8.625  1.00 183.17 ? 826  LEU A CG    1 
ATOM   6139 C  CD1   . LEU A 1 780 ? 32.155  -78.073  -8.652  1.00 183.40 ? 826  LEU A CD1   1 
ATOM   6140 C  CD2   . LEU A 1 780 ? 34.141  -78.957  -7.468  1.00 185.49 ? 826  LEU A CD2   1 
ATOM   6141 N  N     . GLU A 1 781 ? 31.820  -83.695  -9.572  1.00 181.14 ? 827  GLU A N     1 
ATOM   6142 C  CA    . GLU A 1 781 ? 31.155  -84.966  -9.252  1.00 181.24 ? 827  GLU A CA    1 
ATOM   6143 C  C     . GLU A 1 781 ? 31.531  -86.097  -10.248 1.00 184.80 ? 827  GLU A C     1 
ATOM   6144 O  O     . GLU A 1 781 ? 30.694  -86.577  -11.020 1.00 184.39 ? 827  GLU A O     1 
ATOM   6145 C  CB    . GLU A 1 781 ? 29.622  -84.802  -9.075  1.00 182.80 ? 827  GLU A CB    1 
ATOM   6146 C  CG    . GLU A 1 781 ? 28.869  -84.165  -10.241 1.00 195.99 ? 827  GLU A CG    1 
ATOM   6147 C  CD    . GLU A 1 781 ? 27.363  -84.019  -10.114 1.00 223.13 ? 827  GLU A CD    1 
ATOM   6148 O  OE1   . GLU A 1 781 ? 26.775  -84.576  -9.158  1.00 226.34 ? 827  GLU A OE1   1 
ATOM   6149 O  OE2   . GLU A 1 781 ? 26.763  -83.356  -10.991 1.00 216.71 ? 827  GLU A OE2   1 
ATOM   6150 N  N     . SER A 1 782 ? 32.808  -86.522  -10.204 1.00 180.99 ? 828  SER A N     1 
ATOM   6151 C  CA    . SER A 1 782 ? 33.344  -87.603  -11.039 1.00 180.54 ? 828  SER A CA    1 
ATOM   6152 C  C     . SER A 1 782 ? 33.685  -88.835  -10.190 1.00 183.98 ? 828  SER A C     1 
ATOM   6153 O  O     . SER A 1 782 ? 33.518  -89.963  -10.657 1.00 183.74 ? 828  SER A O     1 
ATOM   6154 C  CB    . SER A 1 782 ? 34.560  -87.132  -11.833 1.00 183.75 ? 828  SER A CB    1 
ATOM   6155 O  OG    . SER A 1 782 ? 35.588  -86.643  -10.989 1.00 191.72 ? 828  SER A OG    1 
ATOM   6156 N  N     . ARG A 1 783 ? 34.142  -88.605  -8.937  1.00 179.78 ? 829  ARG A N     1 
ATOM   6157 C  CA    . ARG A 1 783 ? 34.505  -89.601  -7.917  1.00 179.13 ? 829  ARG A CA    1 
ATOM   6158 C  C     . ARG A 1 783 ? 35.649  -90.557  -8.355  1.00 181.57 ? 829  ARG A C     1 
ATOM   6159 O  O     . ARG A 1 783 ? 35.617  -91.751  -8.044  1.00 181.14 ? 829  ARG A O     1 
ATOM   6160 C  CB    . ARG A 1 783 ? 33.263  -90.381  -7.410  1.00 179.72 ? 829  ARG A CB    1 
ATOM   6161 C  CG    . ARG A 1 783 ? 32.141  -89.515  -6.821  1.00 191.50 ? 829  ARG A CG    1 
ATOM   6162 C  CD    . ARG A 1 783 ? 32.447  -88.997  -5.427  1.00 203.52 ? 829  ARG A CD    1 
ATOM   6163 N  NE    . ARG A 1 783 ? 32.633  -87.546  -5.411  1.00 213.95 ? 829  ARG A NE    1 
ATOM   6164 C  CZ    . ARG A 1 783 ? 31.734  -86.677  -4.956  1.00 229.66 ? 829  ARG A CZ    1 
ATOM   6165 N  NH1   . ARG A 1 783 ? 30.577  -87.106  -4.464  1.00 217.89 ? 829  ARG A NH1   1 
ATOM   6166 N  NH2   . ARG A 1 783 ? 31.989  -85.377  -4.980  1.00 216.77 ? 829  ARG A NH2   1 
ATOM   6167 N  N     . ASP A 1 784 ? 36.673  -90.008  -9.044  1.00 176.97 ? 830  ASP A N     1 
ATOM   6168 C  CA    . ASP A 1 784 ? 37.872  -90.726  -9.493  1.00 176.15 ? 830  ASP A CA    1 
ATOM   6169 C  C     . ASP A 1 784 ? 39.078  -89.807  -9.258  1.00 178.14 ? 830  ASP A C     1 
ATOM   6170 O  O     . ASP A 1 784 ? 39.338  -88.896  -10.047 1.00 177.52 ? 830  ASP A O     1 
ATOM   6171 C  CB    . ASP A 1 784 ? 37.753  -91.172  -10.966 1.00 178.07 ? 830  ASP A CB    1 
ATOM   6172 C  CG    . ASP A 1 784 ? 38.767  -92.211  -11.430 1.00 189.03 ? 830  ASP A CG    1 
ATOM   6173 O  OD1   . ASP A 1 784 ? 39.626  -92.617  -10.613 1.00 189.92 ? 830  ASP A OD1   1 
ATOM   6174 O  OD2   . ASP A 1 784 ? 38.694  -92.625  -12.605 1.00 194.92 ? 830  ASP A OD2   1 
ATOM   6175 N  N     . PHE A 1 785 ? 39.785  -90.036  -8.140  1.00 173.51 ? 831  PHE A N     1 
ATOM   6176 C  CA    . PHE A 1 785 ? 40.901  -89.206  -7.688  1.00 172.67 ? 831  PHE A CA    1 
ATOM   6177 C  C     . PHE A 1 785 ? 42.306  -89.759  -8.048  1.00 175.48 ? 831  PHE A C     1 
ATOM   6178 O  O     . PHE A 1 785 ? 43.243  -88.967  -8.118  1.00 175.01 ? 831  PHE A O     1 
ATOM   6179 C  CB    . PHE A 1 785 ? 40.767  -88.905  -6.184  1.00 174.26 ? 831  PHE A CB    1 
ATOM   6180 C  CG    . PHE A 1 785 ? 39.562  -88.054  -5.828  1.00 175.51 ? 831  PHE A CG    1 
ATOM   6181 C  CD1   . PHE A 1 785 ? 38.294  -88.617  -5.728  1.00 178.42 ? 831  PHE A CD1   1 
ATOM   6182 C  CD2   . PHE A 1 785 ? 39.700  -86.697  -5.572  1.00 177.41 ? 831  PHE A CD2   1 
ATOM   6183 C  CE1   . PHE A 1 785 ? 37.184  -87.830  -5.408  1.00 179.22 ? 831  PHE A CE1   1 
ATOM   6184 C  CE2   . PHE A 1 785 ? 38.589  -85.915  -5.248  1.00 180.13 ? 831  PHE A CE2   1 
ATOM   6185 C  CZ    . PHE A 1 785 ? 37.340  -86.487  -5.159  1.00 178.19 ? 831  PHE A CZ    1 
ATOM   6186 N  N     . GLY A 1 786 ? 42.446  -91.067  -8.293  1.00 171.24 ? 832  GLY A N     1 
ATOM   6187 C  CA    . GLY A 1 786 ? 43.722  -91.623  -8.748  1.00 170.63 ? 832  GLY A CA    1 
ATOM   6188 C  C     . GLY A 1 786 ? 44.495  -92.665  -7.955  1.00 173.26 ? 832  GLY A C     1 
ATOM   6189 O  O     . GLY A 1 786 ? 45.517  -93.145  -8.456  1.00 173.09 ? 832  GLY A O     1 
ATOM   6190 N  N     . ASP A 1 787 ? 44.056  -93.018  -6.725  1.00 168.31 ? 833  ASP A N     1 
ATOM   6191 C  CA    . ASP A 1 787 ? 44.694  -94.022  -5.844  1.00 167.34 ? 833  ASP A CA    1 
ATOM   6192 C  C     . ASP A 1 787 ? 46.111  -93.654  -5.329  1.00 168.23 ? 833  ASP A C     1 
ATOM   6193 O  O     . ASP A 1 787 ? 46.819  -94.529  -4.827  1.00 167.83 ? 833  ASP A O     1 
ATOM   6194 C  CB    . ASP A 1 787 ? 44.720  -95.427  -6.496  1.00 169.49 ? 833  ASP A CB    1 
ATOM   6195 C  CG    . ASP A 1 787 ? 43.396  -96.168  -6.541  1.00 182.19 ? 833  ASP A CG    1 
ATOM   6196 O  OD1   . ASP A 1 787 ? 42.524  -95.888  -5.685  1.00 183.14 ? 833  ASP A OD1   1 
ATOM   6197 O  OD2   . ASP A 1 787 ? 43.255  -97.072  -7.389  1.00 188.94 ? 833  ASP A OD2   1 
ATOM   6198 N  N     . SER A 1 788 ? 46.507  -92.378  -5.411  1.00 162.56 ? 834  SER A N     1 
ATOM   6199 C  CA    . SER A 1 788 ? 47.811  -91.924  -4.920  1.00 161.37 ? 834  SER A CA    1 
ATOM   6200 C  C     . SER A 1 788 ? 47.605  -90.769  -3.948  1.00 163.27 ? 834  SER A C     1 
ATOM   6201 O  O     . SER A 1 788 ? 46.696  -89.968  -4.162  1.00 163.12 ? 834  SER A O     1 
ATOM   6202 C  CB    . SER A 1 788 ? 48.693  -91.470  -6.079  1.00 164.66 ? 834  SER A CB    1 
ATOM   6203 O  OG    . SER A 1 788 ? 48.802  -92.461  -7.089  1.00 172.83 ? 834  SER A OG    1 
ATOM   6204 N  N     . ILE A 1 789 ? 48.439  -90.668  -2.889  1.00 158.16 ? 835  ILE A N     1 
ATOM   6205 C  CA    . ILE A 1 789 ? 48.351  -89.565  -1.915  1.00 157.24 ? 835  ILE A CA    1 
ATOM   6206 C  C     . ILE A 1 789 ? 48.707  -88.249  -2.618  1.00 159.72 ? 835  ILE A C     1 
ATOM   6207 O  O     . ILE A 1 789 ? 48.077  -87.226  -2.354  1.00 159.49 ? 835  ILE A O     1 
ATOM   6208 C  CB    . ILE A 1 789 ? 49.189  -89.806  -0.624  1.00 160.23 ? 835  ILE A CB    1 
ATOM   6209 C  CG1   . ILE A 1 789 ? 48.760  -91.109  0.085   1.00 160.49 ? 835  ILE A CG1   1 
ATOM   6210 C  CG2   . ILE A 1 789 ? 49.108  -88.598  0.342   1.00 160.87 ? 835  ILE A CG2   1 
ATOM   6211 C  CD1   . ILE A 1 789 ? 49.637  -91.531  1.193   1.00 166.09 ? 835  ILE A CD1   1 
ATOM   6212 N  N     . GLU A 1 790 ? 49.675  -88.302  -3.554  1.00 154.89 ? 836  GLU A N     1 
ATOM   6213 C  CA    . GLU A 1 790 ? 50.116  -87.161  -4.359  1.00 154.12 ? 836  GLU A CA    1 
ATOM   6214 C  C     . GLU A 1 790 ? 49.030  -86.712  -5.354  1.00 156.31 ? 836  GLU A C     1 
ATOM   6215 O  O     . GLU A 1 790 ? 48.979  -85.529  -5.699  1.00 156.03 ? 836  GLU A O     1 
ATOM   6216 C  CB    . GLU A 1 790 ? 51.439  -87.475  -5.065  1.00 155.51 ? 836  GLU A CB    1 
ATOM   6217 C  CG    . GLU A 1 790 ? 52.591  -87.676  -4.092  1.00 166.85 ? 836  GLU A CG    1 
ATOM   6218 C  CD    . GLU A 1 790 ? 53.939  -88.041  -4.682  1.00 191.01 ? 836  GLU A CD    1 
ATOM   6219 O  OE1   . GLU A 1 790 ? 53.983  -88.551  -5.825  1.00 190.61 ? 836  GLU A OE1   1 
ATOM   6220 O  OE2   . GLU A 1 790 ? 54.956  -87.844  -3.979  1.00 184.94 ? 836  GLU A OE2   1 
ATOM   6221 N  N     . SER A 1 791 ? 48.154  -87.648  -5.790  1.00 151.03 ? 837  SER A N     1 
ATOM   6222 C  CA    . SER A 1 791 ? 47.030  -87.357  -6.682  1.00 149.81 ? 837  SER A CA    1 
ATOM   6223 C  C     . SER A 1 791 ? 45.923  -86.676  -5.872  1.00 151.62 ? 837  SER A C     1 
ATOM   6224 O  O     . SER A 1 791 ? 45.405  -85.654  -6.307  1.00 151.48 ? 837  SER A O     1 
ATOM   6225 C  CB    . SER A 1 791 ? 46.515  -88.626  -7.360  1.00 153.04 ? 837  SER A CB    1 
ATOM   6226 O  OG    . SER A 1 791 ? 45.508  -89.288  -6.614  1.00 161.18 ? 837  SER A OG    1 
ATOM   6227 N  N     . VAL A 1 792 ? 45.606  -87.215  -4.673  1.00 146.40 ? 838  VAL A N     1 
ATOM   6228 C  CA    . VAL A 1 792 ? 44.602  -86.674  -3.746  1.00 145.45 ? 838  VAL A CA    1 
ATOM   6229 C  C     . VAL A 1 792 ? 45.082  -85.307  -3.181  1.00 148.35 ? 838  VAL A C     1 
ATOM   6230 O  O     . VAL A 1 792 ? 44.251  -84.487  -2.786  1.00 148.26 ? 838  VAL A O     1 
ATOM   6231 C  CB    . VAL A 1 792 ? 44.179  -87.714  -2.664  1.00 149.09 ? 838  VAL A CB    1 
ATOM   6232 C  CG1   . VAL A 1 792 ? 43.126  -87.160  -1.707  1.00 148.82 ? 838  VAL A CG1   1 
ATOM   6233 C  CG2   . VAL A 1 792 ? 43.656  -88.986  -3.323  1.00 148.86 ? 838  VAL A CG2   1 
ATOM   6234 N  N     . GLN A 1 793 ? 46.406  -85.039  -3.222  1.00 143.77 ? 839  GLN A N     1 
ATOM   6235 C  CA    . GLN A 1 793 ? 46.985  -83.750  -2.826  1.00 143.02 ? 839  GLN A CA    1 
ATOM   6236 C  C     . GLN A 1 793 ? 46.797  -82.744  -3.974  1.00 144.90 ? 839  GLN A C     1 
ATOM   6237 O  O     . GLN A 1 793 ? 46.479  -81.582  -3.719  1.00 144.29 ? 839  GLN A O     1 
ATOM   6238 C  CB    . GLN A 1 793 ? 48.477  -83.890  -2.495  1.00 144.54 ? 839  GLN A CB    1 
ATOM   6239 C  CG    . GLN A 1 793 ? 48.759  -84.259  -1.044  1.00 164.01 ? 839  GLN A CG    1 
ATOM   6240 C  CD    . GLN A 1 793 ? 50.196  -84.669  -0.809  1.00 186.91 ? 839  GLN A CD    1 
ATOM   6241 O  OE1   . GLN A 1 793 ? 50.924  -85.092  -1.718  1.00 182.72 ? 839  GLN A OE1   1 
ATOM   6242 N  NE2   . GLN A 1 793 ? 50.627  -84.589  0.439   1.00 180.54 ? 839  GLN A NE2   1 
ATOM   6243 N  N     . SER A 1 794 ? 46.991  -83.206  -5.236  1.00 139.96 ? 840  SER A N     1 
ATOM   6244 C  CA    . SER A 1 794 ? 46.851  -82.418  -6.466  1.00 139.06 ? 840  SER A CA    1 
ATOM   6245 C  C     . SER A 1 794 ? 45.427  -81.890  -6.632  1.00 141.11 ? 840  SER A C     1 
ATOM   6246 O  O     . SER A 1 794 ? 45.256  -80.729  -6.996  1.00 140.89 ? 840  SER A O     1 
ATOM   6247 C  CB    . SER A 1 794 ? 47.265  -83.240  -7.683  1.00 142.87 ? 840  SER A CB    1 
ATOM   6248 O  OG    . SER A 1 794 ? 47.203  -82.488  -8.884  1.00 152.66 ? 840  SER A OG    1 
ATOM   6249 N  N     . PHE A 1 795 ? 44.414  -82.731  -6.336  1.00 136.08 ? 841  PHE A N     1 
ATOM   6250 C  CA    . PHE A 1 795 ? 42.997  -82.367  -6.401  1.00 135.15 ? 841  PHE A CA    1 
ATOM   6251 C  C     . PHE A 1 795 ? 42.644  -81.349  -5.313  1.00 138.30 ? 841  PHE A C     1 
ATOM   6252 O  O     . PHE A 1 795 ? 41.727  -80.552  -5.510  1.00 137.85 ? 841  PHE A O     1 
ATOM   6253 C  CB    . PHE A 1 795 ? 42.101  -83.611  -6.300  1.00 136.70 ? 841  PHE A CB    1 
ATOM   6254 C  CG    . PHE A 1 795 ? 41.889  -84.354  -7.597  1.00 138.05 ? 841  PHE A CG    1 
ATOM   6255 C  CD1   . PHE A 1 795 ? 42.763  -85.358  -7.992  1.00 140.14 ? 841  PHE A CD1   1 
ATOM   6256 C  CD2   . PHE A 1 795 ? 40.798  -84.076  -8.406  1.00 141.02 ? 841  PHE A CD2   1 
ATOM   6257 C  CE1   . PHE A 1 795 ? 42.564  -86.048  -9.190  1.00 142.87 ? 841  PHE A CE1   1 
ATOM   6258 C  CE2   . PHE A 1 795 ? 40.597  -84.775  -9.599  1.00 141.92 ? 841  PHE A CE2   1 
ATOM   6259 C  CZ    . PHE A 1 795 ? 41.481  -85.759  -9.981  1.00 140.94 ? 841  PHE A CZ    1 
ATOM   6260 N  N     . MET A 1 796 ? 43.378  -81.363  -4.180  1.00 134.52 ? 842  MET A N     1 
ATOM   6261 C  CA    . MET A 1 796 ? 43.178  -80.409  -3.090  1.00 134.26 ? 842  MET A CA    1 
ATOM   6262 C  C     . MET A 1 796 ? 43.863  -79.086  -3.406  1.00 137.74 ? 842  MET A C     1 
ATOM   6263 O  O     . MET A 1 796 ? 43.318  -78.038  -3.076  1.00 137.30 ? 842  MET A O     1 
ATOM   6264 C  CB    . MET A 1 796 ? 43.644  -80.967  -1.735  1.00 136.63 ? 842  MET A CB    1 
ATOM   6265 C  CG    . MET A 1 796 ? 42.500  -81.488  -0.885  1.00 140.22 ? 842  MET A CG    1 
ATOM   6266 S  SD    . MET A 1 796 ? 42.922  -81.800  0.849   1.00 144.26 ? 842  MET A SD    1 
ATOM   6267 C  CE    . MET A 1 796 ? 42.644  -80.187  1.547   1.00 140.98 ? 842  MET A CE    1 
ATOM   6268 N  N     . ASN A 1 797 ? 45.041  -79.133  -4.062  1.00 133.98 ? 843  ASN A N     1 
ATOM   6269 C  CA    . ASN A 1 797 ? 45.801  -77.946  -4.463  1.00 133.59 ? 843  ASN A CA    1 
ATOM   6270 C  C     . ASN A 1 797 ? 45.084  -77.170  -5.574  1.00 136.69 ? 843  ASN A C     1 
ATOM   6271 O  O     . ASN A 1 797 ? 45.091  -75.936  -5.558  1.00 136.46 ? 843  ASN A O     1 
ATOM   6272 C  CB    . ASN A 1 797 ? 47.222  -78.329  -4.900  1.00 135.08 ? 843  ASN A CB    1 
ATOM   6273 C  CG    . ASN A 1 797 ? 48.224  -78.477  -3.776  1.00 159.39 ? 843  ASN A CG    1 
ATOM   6274 O  OD1   . ASN A 1 797 ? 47.882  -78.659  -2.600  1.00 155.55 ? 843  ASN A OD1   1 
ATOM   6275 N  ND2   . ASN A 1 797 ? 49.500  -78.417  -4.123  1.00 150.56 ? 843  ASN A ND2   1 
ATOM   6276 N  N     . ALA A 1 798 ? 44.453  -77.898  -6.523  1.00 132.14 ? 844  ALA A N     1 
ATOM   6277 C  CA    . ALA A 1 798 ? 43.712  -77.336  -7.652  1.00 131.19 ? 844  ALA A CA    1 
ATOM   6278 C  C     . ALA A 1 798 ? 42.432  -76.640  -7.193  1.00 133.41 ? 844  ALA A C     1 
ATOM   6279 O  O     . ALA A 1 798 ? 42.259  -75.459  -7.489  1.00 132.93 ? 844  ALA A O     1 
ATOM   6280 C  CB    . ALA A 1 798 ? 43.392  -78.422  -8.669  1.00 131.87 ? 844  ALA A CB    1 
ATOM   6281 N  N     . HIS A 1 799 ? 41.562  -77.357  -6.444  1.00 129.00 ? 845  HIS A N     1 
ATOM   6282 C  CA    . HIS A 1 799 ? 40.292  -76.850  -5.911  1.00 128.47 ? 845  HIS A CA    1 
ATOM   6283 C  C     . HIS A 1 799 ? 40.460  -75.581  -5.067  1.00 134.25 ? 845  HIS A C     1 
ATOM   6284 O  O     . HIS A 1 799 ? 39.592  -74.714  -5.128  1.00 134.19 ? 845  HIS A O     1 
ATOM   6285 C  CB    . HIS A 1 799 ? 39.542  -77.942  -5.123  1.00 128.53 ? 845  HIS A CB    1 
ATOM   6286 C  CG    . HIS A 1 799 ? 38.192  -77.527  -4.611  1.00 131.31 ? 845  HIS A CG    1 
ATOM   6287 N  ND1   . HIS A 1 799 ? 38.054  -76.781  -3.453  1.00 132.71 ? 845  HIS A ND1   1 
ATOM   6288 C  CD2   . HIS A 1 799 ? 36.961  -77.789  -5.106  1.00 132.54 ? 845  HIS A CD2   1 
ATOM   6289 C  CE1   . HIS A 1 799 ? 36.755  -76.603  -3.291  1.00 131.81 ? 845  HIS A CE1   1 
ATOM   6290 N  NE2   . HIS A 1 799 ? 36.056  -77.198  -4.254  1.00 132.11 ? 845  HIS A NE2   1 
ATOM   6291 N  N     . LYS A 1 800 ? 41.555  -75.473  -4.284  1.00 132.03 ? 846  LYS A N     1 
ATOM   6292 C  CA    . LYS A 1 800 ? 41.812  -74.296  -3.442  1.00 132.37 ? 846  LYS A CA    1 
ATOM   6293 C  C     . LYS A 1 800 ? 42.201  -73.072  -4.267  1.00 136.67 ? 846  LYS A C     1 
ATOM   6294 O  O     . LYS A 1 800 ? 41.851  -71.953  -3.889  1.00 135.89 ? 846  LYS A O     1 
ATOM   6295 C  CB    . LYS A 1 800 ? 42.833  -74.577  -2.317  1.00 135.19 ? 846  LYS A CB    1 
ATOM   6296 C  CG    . LYS A 1 800 ? 42.386  -75.604  -1.259  1.00 153.20 ? 846  LYS A CG    1 
ATOM   6297 C  CD    . LYS A 1 800 ? 41.159  -75.202  -0.418  1.00 163.82 ? 846  LYS A CD    1 
ATOM   6298 C  CE    . LYS A 1 800 ? 40.752  -76.274  0.574   1.00 172.79 ? 846  LYS A CE    1 
ATOM   6299 N  NZ    . LYS A 1 800 ? 40.179  -77.478  -0.089  1.00 179.97 ? 846  LYS A NZ    1 
ATOM   6300 N  N     . GLU A 1 801 ? 42.902  -73.284  -5.401  1.00 134.02 ? 847  GLU A N     1 
ATOM   6301 C  CA    . GLU A 1 801 ? 43.276  -72.200  -6.309  1.00 134.29 ? 847  GLU A CA    1 
ATOM   6302 C  C     . GLU A 1 801 ? 42.040  -71.792  -7.117  1.00 138.30 ? 847  GLU A C     1 
ATOM   6303 O  O     . GLU A 1 801 ? 41.759  -70.601  -7.217  1.00 137.76 ? 847  GLU A O     1 
ATOM   6304 C  CB    . GLU A 1 801 ? 44.468  -72.588  -7.213  1.00 135.86 ? 847  GLU A CB    1 
ATOM   6305 C  CG    . GLU A 1 801 ? 44.928  -71.504  -8.188  1.00 148.55 ? 847  GLU A CG    1 
ATOM   6306 C  CD    . GLU A 1 801 ? 45.729  -70.332  -7.645  1.00 173.14 ? 847  GLU A CD    1 
ATOM   6307 O  OE1   . GLU A 1 801 ? 46.861  -70.116  -8.137  1.00 168.38 ? 847  GLU A OE1   1 
ATOM   6308 O  OE2   . GLU A 1 801 ? 45.197  -69.577  -6.800  1.00 168.73 ? 847  GLU A OE2   1 
ATOM   6309 N  N     . TYR A 1 802 ? 41.273  -72.787  -7.631  1.00 135.01 ? 848  TYR A N     1 
ATOM   6310 C  CA    . TYR A 1 802 ? 40.027  -72.605  -8.393  1.00 134.81 ? 848  TYR A CA    1 
ATOM   6311 C  C     . TYR A 1 802 ? 38.992  -71.792  -7.600  1.00 138.12 ? 848  TYR A C     1 
ATOM   6312 O  O     . TYR A 1 802 ? 38.277  -70.983  -8.186  1.00 137.94 ? 848  TYR A O     1 
ATOM   6313 C  CB    . TYR A 1 802 ? 39.470  -73.974  -8.855  1.00 136.09 ? 848  TYR A CB    1 
ATOM   6314 C  CG    . TYR A 1 802 ? 37.982  -74.013  -9.141  1.00 137.95 ? 848  TYR A CG    1 
ATOM   6315 C  CD1   . TYR A 1 802 ? 37.461  -73.478  -10.316 1.00 139.93 ? 848  TYR A CD1   1 
ATOM   6316 C  CD2   . TYR A 1 802 ? 37.099  -74.621  -8.254  1.00 138.79 ? 848  TYR A CD2   1 
ATOM   6317 C  CE1   . TYR A 1 802 ? 36.093  -73.512  -10.580 1.00 140.46 ? 848  TYR A CE1   1 
ATOM   6318 C  CE2   . TYR A 1 802 ? 35.731  -74.666  -8.513  1.00 139.67 ? 848  TYR A CE2   1 
ATOM   6319 C  CZ    . TYR A 1 802 ? 35.232  -74.110  -9.676  1.00 146.24 ? 848  TYR A CZ    1 
ATOM   6320 O  OH    . TYR A 1 802 ? 33.885  -74.159  -9.929  1.00 146.82 ? 848  TYR A OH    1 
ATOM   6321 N  N     . LYS A 1 803 ? 38.946  -71.991  -6.271  1.00 133.96 ? 849  LYS A N     1 
ATOM   6322 C  CA    . LYS A 1 803 ? 38.077  -71.288  -5.328  1.00 133.50 ? 849  LYS A CA    1 
ATOM   6323 C  C     . LYS A 1 803 ? 38.477  -69.796  -5.203  1.00 136.36 ? 849  LYS A C     1 
ATOM   6324 O  O     . LYS A 1 803 ? 37.623  -68.967  -4.890  1.00 135.71 ? 849  LYS A O     1 
ATOM   6325 C  CB    . LYS A 1 803 ? 38.115  -72.017  -3.960  1.00 136.39 ? 849  LYS A CB    1 
ATOM   6326 C  CG    . LYS A 1 803 ? 37.457  -71.319  -2.768  1.00 155.46 ? 849  LYS A CG    1 
ATOM   6327 C  CD    . LYS A 1 803 ? 35.964  -71.565  -2.660  1.00 169.74 ? 849  LYS A CD    1 
ATOM   6328 C  CE    . LYS A 1 803 ? 35.307  -70.447  -1.891  1.00 186.34 ? 849  LYS A CE    1 
ATOM   6329 N  NZ    . LYS A 1 803 ? 33.987  -70.846  -1.339  1.00 198.79 ? 849  LYS A NZ    1 
ATOM   6330 N  N     . LYS A 1 804 ? 39.757  -69.457  -5.469  1.00 132.48 ? 850  LYS A N     1 
ATOM   6331 C  CA    . LYS A 1 804 ? 40.242  -68.076  -5.343  1.00 132.14 ? 850  LYS A CA    1 
ATOM   6332 C  C     . LYS A 1 804 ? 40.885  -67.492  -6.625  1.00 134.62 ? 850  LYS A C     1 
ATOM   6333 O  O     . LYS A 1 804 ? 41.565  -66.465  -6.540  1.00 133.92 ? 850  LYS A O     1 
ATOM   6334 C  CB    . LYS A 1 804 ? 41.204  -67.943  -4.137  1.00 135.30 ? 850  LYS A CB    1 
ATOM   6335 C  CG    . LYS A 1 804 ? 40.567  -68.173  -2.755  1.00 154.98 ? 850  LYS A CG    1 
ATOM   6336 C  CD    . LYS A 1 804 ? 39.517  -67.113  -2.371  1.00 167.00 ? 850  LYS A CD    1 
ATOM   6337 C  CE    . LYS A 1 804 ? 38.940  -67.307  -0.987  1.00 177.63 ? 850  LYS A CE    1 
ATOM   6338 N  NZ    . LYS A 1 804 ? 38.111  -68.536  -0.885  1.00 185.96 ? 850  LYS A NZ    1 
ATOM   6339 N  N     . THR A 1 805 ? 40.640  -68.106  -7.807  1.00 130.42 ? 851  THR A N     1 
ATOM   6340 C  CA    . THR A 1 805 ? 41.172  -67.631  -9.098  1.00 129.68 ? 851  THR A CA    1 
ATOM   6341 C  C     . THR A 1 805 ? 40.091  -67.602  -10.192 1.00 131.19 ? 851  THR A C     1 
ATOM   6342 O  O     . THR A 1 805 ? 39.878  -66.555  -10.802 1.00 130.72 ? 851  THR A O     1 
ATOM   6343 C  CB    . THR A 1 805 ? 42.428  -68.424  -9.512  1.00 140.45 ? 851  THR A CB    1 
ATOM   6344 O  OG1   . THR A 1 805 ? 43.382  -68.372  -8.451  1.00 141.65 ? 851  THR A OG1   1 
ATOM   6345 C  CG2   . THR A 1 805 ? 43.063  -67.904  -10.803 1.00 139.37 ? 851  THR A CG2   1 
ATOM   6346 N  N     . GLU A 1 806 ? 39.442  -68.750  -10.455 1.00 125.96 ? 852  GLU A N     1 
ATOM   6347 C  CA    . GLU A 1 806 ? 38.393  -68.892  -11.466 1.00 124.86 ? 852  GLU A CA    1 
ATOM   6348 C  C     . GLU A 1 806 ? 37.021  -68.550  -10.908 1.00 125.87 ? 852  GLU A C     1 
ATOM   6349 O  O     . GLU A 1 806 ? 36.148  -68.133  -11.665 1.00 125.26 ? 852  GLU A O     1 
ATOM   6350 C  CB    . GLU A 1 806 ? 38.372  -70.316  -12.028 1.00 126.36 ? 852  GLU A CB    1 
ATOM   6351 C  CG    . GLU A 1 806 ? 39.522  -70.627  -12.964 1.00 139.36 ? 852  GLU A CG    1 
ATOM   6352 C  CD    . GLU A 1 806 ? 39.519  -72.051  -13.477 1.00 166.22 ? 852  GLU A CD    1 
ATOM   6353 O  OE1   . GLU A 1 806 ? 38.563  -72.426  -14.194 1.00 163.81 ? 852  GLU A OE1   1 
ATOM   6354 O  OE2   . GLU A 1 806 ? 40.477  -72.795  -13.164 1.00 161.92 ? 852  GLU A OE2   1 
ATOM   6355 N  N     . LYS A 1 807 ? 36.785  -68.823  -9.647  1.00 120.56 ? 853  LYS A N     1 
ATOM   6356 C  CA    . LYS A 1 807 ? 35.475  -68.566  -9.103  1.00 119.59 ? 853  LYS A CA    1 
ATOM   6357 C  C     . LYS A 1 807 ? 35.000  -67.141  -8.961  1.00 121.52 ? 853  LYS A C     1 
ATOM   6358 O  O     . LYS A 1 807 ? 33.872  -66.837  -9.294  1.00 120.93 ? 853  LYS A O     1 
ATOM   6359 C  CB    . LYS A 1 807 ? 35.286  -69.307  -7.791  1.00 122.10 ? 853  LYS A CB    1 
ATOM   6360 C  CG    . LYS A 1 807 ? 33.883  -69.198  -7.247  1.00 135.13 ? 853  LYS A CG    1 
ATOM   6361 C  CD    . LYS A 1 807 ? 33.478  -70.449  -6.521  1.00 143.92 ? 853  LYS A CD    1 
ATOM   6362 C  CE    . LYS A 1 807 ? 32.248  -70.191  -5.699  1.00 152.80 ? 853  LYS A CE    1 
ATOM   6363 N  NZ    . LYS A 1 807 ? 32.262  -71.031  -4.485  1.00 162.19 ? 853  LYS A NZ    1 
ATOM   6364 N  N     . PRO A 1 808 ? 35.867  -66.254  -8.501  1.00 116.88 ? 854  PRO A N     1 
ATOM   6365 C  CA    . PRO A 1 808 ? 35.473  -64.876  -8.220  1.00 116.24 ? 854  PRO A CA    1 
ATOM   6366 C  C     . PRO A 1 808 ? 35.012  -64.110  -9.422  1.00 117.67 ? 854  PRO A C     1 
ATOM   6367 O  O     . PRO A 1 808 ? 34.052  -63.377  -9.342  1.00 116.73 ? 854  PRO A O     1 
ATOM   6368 C  CB    . PRO A 1 808 ? 36.749  -64.263  -7.648  1.00 118.19 ? 854  PRO A CB    1 
ATOM   6369 C  CG    . PRO A 1 808 ? 37.845  -65.008  -8.306  1.00 122.81 ? 854  PRO A CG    1 
ATOM   6370 C  CD    . PRO A 1 808 ? 37.339  -66.406  -8.393  1.00 118.35 ? 854  PRO A CD    1 
ATOM   6371 N  N     . PRO A 1 809 ? 35.702  -64.264  -10.532 1.00 112.63 ? 855  PRO A N     1 
ATOM   6372 C  CA    . PRO A 1 809 ? 35.221  -63.555  -11.702 1.00 111.67 ? 855  PRO A CA    1 
ATOM   6373 C  C     . PRO A 1 809 ? 33.842  -64.060  -12.094 1.00 112.88 ? 855  PRO A C     1 
ATOM   6374 O  O     . PRO A 1 809 ? 32.960  -63.268  -12.359 1.00 112.31 ? 855  PRO A O     1 
ATOM   6375 C  CB    . PRO A 1 809 ? 36.230  -63.956  -12.761 1.00 113.57 ? 855  PRO A CB    1 
ATOM   6376 C  CG    . PRO A 1 809 ? 36.677  -65.307  -12.367 1.00 118.12 ? 855  PRO A CG    1 
ATOM   6377 C  CD    . PRO A 1 809 ? 36.741  -65.270  -10.886 1.00 113.85 ? 855  PRO A CD    1 
ATOM   6378 N  N     . LYS A 1 810 ? 33.639  -65.366  -12.086 1.00 107.82 ? 856  LYS A N     1 
ATOM   6379 C  CA    . LYS A 1 810 ? 32.354  -65.905  -12.459 1.00 107.02 ? 856  LYS A CA    1 
ATOM   6380 C  C     . LYS A 1 810 ? 31.264  -65.466  -11.512 1.00 110.66 ? 856  LYS A C     1 
ATOM   6381 O  O     . LYS A 1 810 ? 30.190  -65.096  -11.928 1.00 110.80 ? 856  LYS A O     1 
ATOM   6382 C  CB    . LYS A 1 810 ? 32.376  -67.428  -12.489 1.00 108.97 ? 856  LYS A CB    1 
ATOM   6383 C  CG    . LYS A 1 810 ? 33.457  -68.036  -13.340 1.00 123.44 ? 856  LYS A CG    1 
ATOM   6384 C  CD    . LYS A 1 810 ? 33.282  -67.707  -14.798 1.00 134.53 ? 856  LYS A CD    1 
ATOM   6385 C  CE    . LYS A 1 810 ? 34.629  -67.394  -15.410 1.00 146.75 ? 856  LYS A CE    1 
ATOM   6386 N  NZ    . LYS A 1 810 ? 34.714  -67.670  -16.866 1.00 158.16 ? 856  LYS A NZ    1 
ATOM   6387 N  N     . GLY A 1 811 ? 31.556  -65.466  -10.232 1.00 106.46 ? 857  GLY A N     1 
ATOM   6388 C  CA    . GLY A 1 811 ? 30.563  -65.107  -9.249  1.00 105.89 ? 857  GLY A CA    1 
ATOM   6389 C  C     . GLY A 1 811 ? 30.103  -63.693  -9.465  1.00 108.72 ? 857  GLY A C     1 
ATOM   6390 O  O     . GLY A 1 811 ? 28.985  -63.339  -9.158  1.00 108.33 ? 857  GLY A O     1 
ATOM   6391 N  N     . GLN A 1 812 ? 31.026  -62.880  -9.935  1.00 104.06 ? 858  GLN A N     1 
ATOM   6392 C  CA    . GLN A 1 812 ? 30.832  -61.460  -10.214 1.00 103.39 ? 858  GLN A CA    1 
ATOM   6393 C  C     . GLN A 1 812 ? 29.916  -61.325  -11.439 1.00 105.10 ? 858  GLN A C     1 
ATOM   6394 O  O     . GLN A 1 812 ? 29.029  -60.475  -11.435 1.00 104.16 ? 858  GLN A O     1 
ATOM   6395 C  CB    . GLN A 1 812 ? 32.193  -60.787  -10.466 1.00 105.00 ? 858  GLN A CB    1 
ATOM   6396 C  CG    . GLN A 1 812 ? 32.145  -59.267  -10.604 1.00 128.63 ? 858  GLN A CG    1 
ATOM   6397 C  CD    . GLN A 1 812 ? 33.522  -58.646  -10.571 1.00 158.71 ? 858  GLN A CD    1 
ATOM   6398 O  OE1   . GLN A 1 812 ? 34.457  -59.078  -11.258 1.00 156.88 ? 858  GLN A OE1   1 
ATOM   6399 N  NE2   . GLN A 1 812 ? 33.672  -57.594  -9.782  1.00 153.78 ? 858  GLN A NE2   1 
ATOM   6400 N  N     . GLU A 1 813 ? 30.116  -62.185  -12.468 1.00 100.38 ? 859  GLU A N     1 
ATOM   6401 C  CA    . GLU A 1 813 ? 29.307  -62.233  -13.690 1.00 99.41  ? 859  GLU A CA    1 
ATOM   6402 C  C     . GLU A 1 813 ? 27.853  -62.576  -13.350 1.00 101.50 ? 859  GLU A C     1 
ATOM   6403 O  O     . GLU A 1 813 ? 26.949  -62.083  -14.018 1.00 100.83 ? 859  GLU A O     1 
ATOM   6404 C  CB    . GLU A 1 813 ? 29.896  -63.230  -14.707 1.00 100.81 ? 859  GLU A CB    1 
ATOM   6405 C  CG    . GLU A 1 813 ? 29.338  -63.104  -16.121 1.00 112.01 ? 859  GLU A CG    1 
ATOM   6406 C  CD    . GLU A 1 813 ? 29.944  -62.062  -17.047 1.00 125.08 ? 859  GLU A CD    1 
ATOM   6407 O  OE1   . GLU A 1 813 ? 29.838  -62.248  -18.281 1.00 102.60 ? 859  GLU A OE1   1 
ATOM   6408 O  OE2   . GLU A 1 813 ? 30.512  -61.060  -16.554 1.00 119.54 ? 859  GLU A OE2   1 
ATOM   6409 N  N     . VAL A 1 814 ? 27.638  -63.385  -12.289 1.00 97.10  ? 860  VAL A N     1 
ATOM   6410 C  CA    . VAL A 1 814 ? 26.316  -63.760  -11.771 1.00 96.45  ? 860  VAL A CA    1 
ATOM   6411 C  C     . VAL A 1 814 ? 25.614  -62.484  -11.247 1.00 100.56 ? 860  VAL A C     1 
ATOM   6412 O  O     . VAL A 1 814 ? 24.447  -62.260  -11.571 1.00 100.24 ? 860  VAL A O     1 
ATOM   6413 C  CB    . VAL A 1 814 ? 26.394  -64.890  -10.694 1.00 99.50  ? 860  VAL A CB    1 
ATOM   6414 C  CG1   . VAL A 1 814 ? 25.039  -65.142  -10.037 1.00 98.89  ? 860  VAL A CG1   1 
ATOM   6415 C  CG2   . VAL A 1 814 ? 26.939  -66.187  -11.285 1.00 99.19  ? 860  VAL A CG2   1 
ATOM   6416 N  N     . SER A 1 815 ? 26.342  -61.641  -10.484 1.00 96.97  ? 861  SER A N     1 
ATOM   6417 C  CA    . SER A 1 815 ? 25.830  -60.389  -9.918  1.00 96.86  ? 861  SER A CA    1 
ATOM   6418 C  C     . SER A 1 815 ? 25.714  -59.252  -10.950 1.00 100.15 ? 861  SER A C     1 
ATOM   6419 O  O     . SER A 1 815 ? 24.881  -58.361  -10.771 1.00 99.71  ? 861  SER A O     1 
ATOM   6420 C  CB    . SER A 1 815 ? 26.675  -59.946  -8.730  1.00 101.12 ? 861  SER A CB    1 
ATOM   6421 O  OG    . SER A 1 815 ? 27.965  -59.519  -9.135  1.00 111.61 ? 861  SER A OG    1 
ATOM   6422 N  N     . GLU A 1 816 ? 26.562  -59.275  -12.006 1.00 95.77  ? 862  GLU A N     1 
ATOM   6423 C  CA    . GLU A 1 816 ? 26.571  -58.286  -13.086 1.00 94.89  ? 862  GLU A CA    1 
ATOM   6424 C  C     . GLU A 1 816 ? 25.372  -58.501  -14.007 1.00 97.68  ? 862  GLU A C     1 
ATOM   6425 O  O     . GLU A 1 816 ? 24.651  -57.542  -14.289 1.00 97.26  ? 862  GLU A O     1 
ATOM   6426 C  CB    . GLU A 1 816 ? 27.881  -58.344  -13.882 1.00 96.31  ? 862  GLU A CB    1 
ATOM   6427 C  CG    . GLU A 1 816 ? 28.983  -57.478  -13.306 1.00 109.75 ? 862  GLU A CG    1 
ATOM   6428 C  CD    . GLU A 1 816 ? 30.226  -57.407  -14.170 1.00 141.01 ? 862  GLU A CD    1 
ATOM   6429 O  OE1   . GLU A 1 816 ? 30.388  -56.398  -14.895 1.00 139.70 ? 862  GLU A OE1   1 
ATOM   6430 O  OE2   . GLU A 1 816 ? 31.036  -58.361  -14.130 1.00 140.56 ? 862  GLU A OE2   1 
ATOM   6431 N  N     . LEU A 1 817 ? 25.151  -59.756  -14.458 1.00 93.26  ? 863  LEU A N     1 
ATOM   6432 C  CA    . LEU A 1 817 ? 24.030  -60.132  -15.318 1.00 92.82  ? 863  LEU A CA    1 
ATOM   6433 C  C     . LEU A 1 817 ? 22.676  -59.951  -14.618 1.00 97.39  ? 863  LEU A C     1 
ATOM   6434 O  O     . LEU A 1 817 ? 21.725  -59.508  -15.266 1.00 97.71  ? 863  LEU A O     1 
ATOM   6435 C  CB    . LEU A 1 817 ? 24.176  -61.561  -15.867 1.00 92.72  ? 863  LEU A CB    1 
ATOM   6436 C  CG    . LEU A 1 817 ? 25.257  -61.787  -16.929 1.00 97.34  ? 863  LEU A CG    1 
ATOM   6437 C  CD1   . LEU A 1 817 ? 25.594  -63.260  -17.048 1.00 97.71  ? 863  LEU A CD1   1 
ATOM   6438 C  CD2   . LEU A 1 817 ? 24.841  -61.238  -18.285 1.00 99.12  ? 863  LEU A CD2   1 
ATOM   6439 N  N     . GLU A 1 818 ? 22.597  -60.247  -13.298 1.00 92.96  ? 864  GLU A N     1 
ATOM   6440 C  CA    . GLU A 1 818 ? 21.385  -60.072  -12.489 1.00 92.46  ? 864  GLU A CA    1 
ATOM   6441 C  C     . GLU A 1 818 ? 20.962  -58.595  -12.460 1.00 95.15  ? 864  GLU A C     1 
ATOM   6442 O  O     . GLU A 1 818 ? 19.769  -58.307  -12.549 1.00 94.89  ? 864  GLU A O     1 
ATOM   6443 C  CB    . GLU A 1 818 ? 21.595  -60.602  -11.065 1.00 94.08  ? 864  GLU A CB    1 
ATOM   6444 C  CG    . GLU A 1 818 ? 20.314  -60.743  -10.259 1.00 107.55 ? 864  GLU A CG    1 
ATOM   6445 C  CD    . GLU A 1 818 ? 20.424  -61.551  -8.982  1.00 137.27 ? 864  GLU A CD    1 
ATOM   6446 O  OE1   . GLU A 1 818 ? 19.816  -61.131  -7.971  1.00 142.99 ? 864  GLU A OE1   1 
ATOM   6447 O  OE2   . GLU A 1 818 ? 21.091  -62.611  -8.993  1.00 131.52 ? 864  GLU A OE2   1 
ATOM   6448 N  N     . ALA A 1 819 ? 21.944  -57.671  -12.365 1.00 90.76  ? 865  ALA A N     1 
ATOM   6449 C  CA    . ALA A 1 819 ? 21.725  -56.224  -12.365 1.00 90.44  ? 865  ALA A CA    1 
ATOM   6450 C  C     . ALA A 1 819 ? 21.270  -55.753  -13.755 1.00 94.72  ? 865  ALA A C     1 
ATOM   6451 O  O     . ALA A 1 819 ? 20.285  -55.015  -13.846 1.00 94.31  ? 865  ALA A O     1 
ATOM   6452 C  CB    . ALA A 1 819 ? 23.000  -55.500  -11.957 1.00 91.08  ? 865  ALA A CB    1 
ATOM   6453 N  N     . ILE A 1 820 ? 21.979  -56.202  -14.830 1.00 90.63  ? 866  ILE A N     1 
ATOM   6454 C  CA    . ILE A 1 820 ? 21.699  -55.897  -16.238 1.00 89.96  ? 866  ILE A CA    1 
ATOM   6455 C  C     . ILE A 1 820 ? 20.243  -56.261  -16.606 1.00 92.49  ? 866  ILE A C     1 
ATOM   6456 O  O     . ILE A 1 820 ? 19.541  -55.421  -17.160 1.00 91.97  ? 866  ILE A O     1 
ATOM   6457 C  CB    . ILE A 1 820 ? 22.767  -56.538  -17.182 1.00 93.02  ? 866  ILE A CB    1 
ATOM   6458 C  CG1   . ILE A 1 820 ? 24.101  -55.773  -17.073 1.00 93.62  ? 866  ILE A CG1   1 
ATOM   6459 C  CG2   . ILE A 1 820 ? 22.288  -56.600  -18.653 1.00 93.86  ? 866  ILE A CG2   1 
ATOM   6460 C  CD1   . ILE A 1 820 ? 25.334  -56.487  -17.636 1.00 104.37 ? 866  ILE A CD1   1 
ATOM   6461 N  N     . TYR A 1 821 ? 19.797  -57.482  -16.255 1.00 87.81  ? 867  TYR A N     1 
ATOM   6462 C  CA    . TYR A 1 821 ? 18.448  -57.988  -16.494 1.00 87.27  ? 867  TYR A CA    1 
ATOM   6463 C  C     . TYR A 1 821 ? 17.409  -57.084  -15.853 1.00 96.73  ? 867  TYR A C     1 
ATOM   6464 O  O     . TYR A 1 821 ? 16.483  -56.685  -16.545 1.00 97.22  ? 867  TYR A O     1 
ATOM   6465 C  CB    . TYR A 1 821 ? 18.331  -59.426  -15.981 1.00 86.32  ? 867  TYR A CB    1 
ATOM   6466 C  CG    . TYR A 1 821 ? 16.941  -60.028  -15.957 1.00 84.83  ? 867  TYR A CG    1 
ATOM   6467 C  CD1   . TYR A 1 821 ? 16.093  -59.827  -14.874 1.00 85.81  ? 867  TYR A CD1   1 
ATOM   6468 C  CD2   . TYR A 1 821 ? 16.528  -60.907  -16.953 1.00 84.78  ? 867  TYR A CD2   1 
ATOM   6469 C  CE1   . TYR A 1 821 ? 14.846  -60.438  -14.808 1.00 85.15  ? 867  TYR A CE1   1 
ATOM   6470 C  CE2   . TYR A 1 821 ? 15.282  -61.527  -16.896 1.00 85.09  ? 867  TYR A CE2   1 
ATOM   6471 C  CZ    . TYR A 1 821 ? 14.447  -61.297  -15.817 1.00 91.48  ? 867  TYR A CZ    1 
ATOM   6472 O  OH    . TYR A 1 821 ? 13.219  -61.914  -15.740 1.00 93.20  ? 867  TYR A OH    1 
ATOM   6473 N  N     . ASN A 1 822 ? 17.560  -56.744  -14.556 1.00 96.92  ? 868  ASN A N     1 
ATOM   6474 C  CA    . ASN A 1 822 ? 16.626  -55.863  -13.840 1.00 98.66  ? 868  ASN A CA    1 
ATOM   6475 C  C     . ASN A 1 822 ? 16.581  -54.438  -14.419 1.00 105.82 ? 868  ASN A C     1 
ATOM   6476 O  O     . ASN A 1 822 ? 15.520  -53.806  -14.396 1.00 104.84 ? 868  ASN A O     1 
ATOM   6477 C  CB    . ASN A 1 822 ? 16.944  -55.822  -12.349 1.00 102.14 ? 868  ASN A CB    1 
ATOM   6478 C  CG    . ASN A 1 822 ? 16.877  -57.155  -11.648 1.00 136.14 ? 868  ASN A CG    1 
ATOM   6479 O  OD1   . ASN A 1 822 ? 16.011  -58.001  -11.913 1.00 133.83 ? 868  ASN A OD1   1 
ATOM   6480 N  ND2   . ASN A 1 822 ? 17.782  -57.356  -10.704 1.00 129.87 ? 868  ASN A ND2   1 
ATOM   6481 N  N     . SER A 1 823 ? 17.732  -53.950  -14.948 1.00 105.44 ? 869  SER A N     1 
ATOM   6482 C  CA    . SER A 1 823 ? 17.871  -52.628  -15.574 1.00 106.52 ? 869  SER A CA    1 
ATOM   6483 C  C     . SER A 1 823 ? 17.243  -52.597  -16.973 1.00 112.82 ? 869  SER A C     1 
ATOM   6484 O  O     . SER A 1 823 ? 16.708  -51.560  -17.366 1.00 112.49 ? 869  SER A O     1 
ATOM   6485 C  CB    . SER A 1 823 ? 19.334  -52.186  -15.615 1.00 110.65 ? 869  SER A CB    1 
ATOM   6486 O  OG    . SER A 1 823 ? 20.079  -52.787  -16.662 1.00 121.38 ? 869  SER A OG    1 
ATOM   6487 N  N     . LEU A 1 824 ? 17.316  -53.727  -17.720 1.00 110.96 ? 870  LEU A N     1 
ATOM   6488 C  CA    . LEU A 1 824 ? 16.727  -53.889  -19.053 1.00 111.49 ? 870  LEU A CA    1 
ATOM   6489 C  C     . LEU A 1 824 ? 15.216  -54.079  -18.924 1.00 117.97 ? 870  LEU A C     1 
ATOM   6490 O  O     . LEU A 1 824 ? 14.481  -53.619  -19.798 1.00 117.64 ? 870  LEU A O     1 
ATOM   6491 C  CB    . LEU A 1 824 ? 17.381  -55.056  -19.834 1.00 111.41 ? 870  LEU A CB    1 
ATOM   6492 C  CG    . LEU A 1 824 ? 16.853  -55.386  -21.251 1.00 116.07 ? 870  LEU A CG    1 
ATOM   6493 C  CD1   . LEU A 1 824 ? 17.075  -54.234  -22.227 1.00 116.43 ? 870  LEU A CD1   1 
ATOM   6494 C  CD2   . LEU A 1 824 ? 17.500  -56.639  -21.794 1.00 118.23 ? 870  LEU A CD2   1 
ATOM   6495 N  N     . GLN A 1 825 ? 14.754  -54.724  -17.825 1.00 116.75 ? 871  GLN A N     1 
ATOM   6496 C  CA    . GLN A 1 825 ? 13.329  -54.930  -17.532 1.00 117.75 ? 871  GLN A CA    1 
ATOM   6497 C  C     . GLN A 1 825 ? 12.666  -53.571  -17.308 1.00 125.07 ? 871  GLN A C     1 
ATOM   6498 O  O     . GLN A 1 825 ? 11.719  -53.232  -18.015 1.00 124.40 ? 871  GLN A O     1 
ATOM   6499 C  CB    . GLN A 1 825 ? 13.113  -55.817  -16.283 1.00 118.83 ? 871  GLN A CB    1 
ATOM   6500 C  CG    . GLN A 1 825 ? 13.467  -57.297  -16.423 1.00 128.72 ? 871  GLN A CG    1 
ATOM   6501 C  CD    . GLN A 1 825 ? 12.853  -58.013  -17.600 1.00 142.38 ? 871  GLN A CD    1 
ATOM   6502 O  OE1   . GLN A 1 825 ? 11.668  -57.898  -17.894 1.00 136.47 ? 871  GLN A OE1   1 
ATOM   6503 N  NE2   . GLN A 1 825 ? 13.643  -58.833  -18.252 1.00 135.09 ? 871  GLN A NE2   1 
ATOM   6504 N  N     . THR A 1 826 ? 13.205  -52.778  -16.350 1.00 124.61 ? 872  THR A N     1 
ATOM   6505 C  CA    . THR A 1 826 ? 12.722  -51.438  -16.000 1.00 125.86 ? 872  THR A CA    1 
ATOM   6506 C  C     . THR A 1 826 ? 12.825  -50.472  -17.184 1.00 132.93 ? 872  THR A C     1 
ATOM   6507 O  O     . THR A 1 826 ? 11.963  -49.604  -17.329 1.00 132.55 ? 872  THR A O     1 
ATOM   6508 C  CB    . THR A 1 826 ? 13.423  -50.896  -14.739 1.00 135.45 ? 872  THR A CB    1 
ATOM   6509 O  OG1   . THR A 1 826 ? 14.838  -50.940  -14.921 1.00 135.89 ? 872  THR A OG1   1 
ATOM   6510 C  CG2   . THR A 1 826 ? 13.029  -51.647  -13.467 1.00 134.44 ? 872  THR A CG2   1 
ATOM   6511 N  N     . LYS A 1 827 ? 13.863  -50.649  -18.044 1.00 131.85 ? 873  LYS A N     1 
ATOM   6512 C  CA    . LYS A 1 827 ? 14.116  -49.846  -19.247 1.00 132.63 ? 873  LYS A CA    1 
ATOM   6513 C  C     . LYS A 1 827 ? 12.939  -49.921  -20.222 1.00 138.77 ? 873  LYS A C     1 
ATOM   6514 O  O     . LYS A 1 827 ? 12.586  -48.896  -20.815 1.00 138.56 ? 873  LYS A O     1 
ATOM   6515 C  CB    . LYS A 1 827 ? 15.410  -50.299  -19.948 1.00 135.30 ? 873  LYS A CB    1 
ATOM   6516 C  CG    . LYS A 1 827 ? 15.778  -49.464  -21.166 1.00 151.61 ? 873  LYS A CG    1 
ATOM   6517 C  CD    . LYS A 1 827 ? 16.913  -50.098  -21.952 1.00 163.87 ? 873  LYS A CD    1 
ATOM   6518 C  CE    . LYS A 1 827 ? 17.352  -49.259  -23.128 1.00 178.97 ? 873  LYS A CE    1 
ATOM   6519 N  NZ    . LYS A 1 827 ? 18.033  -48.003  -22.707 1.00 191.10 ? 873  LYS A NZ    1 
ATOM   6520 N  N     . LEU A 1 828 ? 12.335  -51.123  -20.380 1.00 136.76 ? 874  LEU A N     1 
ATOM   6521 C  CA    . LEU A 1 828 ? 11.190  -51.348  -21.267 1.00 137.23 ? 874  LEU A CA    1 
ATOM   6522 C  C     . LEU A 1 828 ? 9.952   -50.575  -20.775 1.00 142.64 ? 874  LEU A C     1 
ATOM   6523 O  O     . LEU A 1 828 ? 9.237   -51.030  -19.874 1.00 142.03 ? 874  LEU A O     1 
ATOM   6524 C  CB    . LEU A 1 828 ? 10.918  -52.851  -21.469 1.00 137.24 ? 874  LEU A CB    1 
ATOM   6525 C  CG    . LEU A 1 828 ? 12.020  -53.633  -22.197 1.00 141.91 ? 874  LEU A CG    1 
ATOM   6526 C  CD1   . LEU A 1 828 ? 11.720  -55.107  -22.211 1.00 142.24 ? 874  LEU A CD1   1 
ATOM   6527 C  CD2   . LEU A 1 828 ? 12.223  -53.127  -23.616 1.00 144.20 ? 874  LEU A CD2   1 
ATOM   6528 N  N     . ARG A 1 829 ? 9.764   -49.356  -21.340 1.00 140.31 ? 875  ARG A N     1 
ATOM   6529 C  CA    . ARG A 1 829 ? 8.696   -48.408  -21.011 1.00 182.99 ? 875  ARG A CA    1 
ATOM   6530 C  C     . ARG A 1 829 ? 7.460   -48.622  -21.872 1.00 201.38 ? 875  ARG A C     1 
ATOM   6531 O  O     . ARG A 1 829 ? 6.344   -48.484  -21.381 1.00 158.56 ? 875  ARG A O     1 
ATOM   6532 C  CB    . ARG A 1 829 ? 9.197   -46.956  -21.140 1.00 184.38 ? 875  ARG A CB    1 
ATOM   6533 C  CG    . ARG A 1 829 ? 10.123  -46.524  -20.006 1.00 199.08 ? 875  ARG A CG    1 
ATOM   6534 C  CD    . ARG A 1 829 ? 10.729  -45.155  -20.244 1.00 215.92 ? 875  ARG A CD    1 
ATOM   6535 N  NE    . ARG A 1 829 ? 11.782  -44.852  -19.273 1.00 231.28 ? 875  ARG A NE    1 
ATOM   6536 C  CZ    . ARG A 1 829 ? 12.593  -43.799  -19.340 1.00 249.92 ? 875  ARG A CZ    1 
ATOM   6537 N  NH1   . ARG A 1 829 ? 12.483  -42.930  -20.338 1.00 239.04 ? 875  ARG A NH1   1 
ATOM   6538 N  NH2   . ARG A 1 829 ? 13.521  -43.609  -18.413 1.00 238.33 ? 875  ARG A NH2   1 
ATOM   6539 N  N     . GLU A 1 834 ? 8.201   -52.051  -25.160 1.00 130.05 ? 880  GLU A N     1 
ATOM   6540 C  CA    . GLU A 1 834 ? 6.971   -52.435  -24.464 1.00 129.96 ? 880  GLU A CA    1 
ATOM   6541 C  C     . GLU A 1 834 ? 6.953   -53.906  -23.956 1.00 131.91 ? 880  GLU A C     1 
ATOM   6542 O  O     . GLU A 1 834 ? 6.559   -54.095  -22.803 1.00 131.39 ? 880  GLU A O     1 
ATOM   6543 C  CB    . GLU A 1 834 ? 5.710   -52.133  -25.305 1.00 131.69 ? 880  GLU A CB    1 
ATOM   6544 C  CG    . GLU A 1 834 ? 5.513   -50.673  -25.696 1.00 146.01 ? 880  GLU A CG    1 
ATOM   6545 C  CD    . GLU A 1 834 ? 5.331   -49.646  -24.589 1.00 175.16 ? 880  GLU A CD    1 
ATOM   6546 O  OE1   . GLU A 1 834 ? 4.870   -50.013  -23.483 1.00 174.36 ? 880  GLU A OE1   1 
ATOM   6547 O  OE2   . GLU A 1 834 ? 5.623   -48.457  -24.850 1.00 171.27 ? 880  GLU A OE2   1 
ATOM   6548 N  N     . PRO A 1 835 ? 7.324   -54.962  -24.735 1.00 127.05 ? 881  PRO A N     1 
ATOM   6549 C  CA    . PRO A 1 835 ? 7.266   -56.322  -24.165 1.00 126.35 ? 881  PRO A CA    1 
ATOM   6550 C  C     . PRO A 1 835 ? 8.523   -56.696  -23.378 1.00 128.55 ? 881  PRO A C     1 
ATOM   6551 O  O     . PRO A 1 835 ? 9.641   -56.434  -23.832 1.00 128.19 ? 881  PRO A O     1 
ATOM   6552 C  CB    . PRO A 1 835 ? 7.051   -57.216  -25.390 1.00 128.19 ? 881  PRO A CB    1 
ATOM   6553 C  CG    . PRO A 1 835 ? 7.576   -56.422  -26.562 1.00 132.80 ? 881  PRO A CG    1 
ATOM   6554 C  CD    . PRO A 1 835 ? 7.813   -54.997  -26.133 1.00 128.43 ? 881  PRO A CD    1 
ATOM   6555 N  N     . PHE A 1 836 ? 8.341   -57.299  -22.192 1.00 123.60 ? 882  PHE A N     1 
ATOM   6556 C  CA    . PHE A 1 836 ? 9.458   -57.719  -21.342 1.00 122.62 ? 882  PHE A CA    1 
ATOM   6557 C  C     . PHE A 1 836 ? 10.129  -58.976  -21.900 1.00 122.58 ? 882  PHE A C     1 
ATOM   6558 O  O     . PHE A 1 836 ? 9.448   -59.810  -22.503 1.00 121.63 ? 882  PHE A O     1 
ATOM   6559 C  CB    . PHE A 1 836 ? 9.001   -57.920  -19.890 1.00 124.92 ? 882  PHE A CB    1 
ATOM   6560 C  CG    . PHE A 1 836 ? 8.485   -56.668  -19.216 1.00 127.16 ? 882  PHE A CG    1 
ATOM   6561 C  CD1   . PHE A 1 836 ? 9.360   -55.764  -18.622 1.00 130.69 ? 882  PHE A CD1   1 
ATOM   6562 C  CD2   . PHE A 1 836 ? 7.121   -56.397  -19.165 1.00 129.83 ? 882  PHE A CD2   1 
ATOM   6563 C  CE1   . PHE A 1 836 ? 8.880   -54.609  -17.996 1.00 131.87 ? 882  PHE A CE1   1 
ATOM   6564 C  CE2   . PHE A 1 836 ? 6.643   -55.242  -18.537 1.00 132.85 ? 882  PHE A CE2   1 
ATOM   6565 C  CZ    . PHE A 1 836 ? 7.526   -54.355  -17.960 1.00 131.04 ? 882  PHE A CZ    1 
ATOM   6566 N  N     . VAL A 1 837 ? 11.448  -59.035  -21.766 1.00 116.79 ? 883  VAL A N     1 
ATOM   6567 C  CA    . VAL A 1 837 ? 12.213  -60.148  -22.279 1.00 115.53 ? 883  VAL A CA    1 
ATOM   6568 C  C     . VAL A 1 837 ? 11.962  -61.357  -21.424 1.00 118.09 ? 883  VAL A C     1 
ATOM   6569 O  O     . VAL A 1 837 ? 11.901  -61.280  -20.209 1.00 117.25 ? 883  VAL A O     1 
ATOM   6570 C  CB    . VAL A 1 837 ? 13.719  -59.803  -22.372 1.00 118.99 ? 883  VAL A CB    1 
ATOM   6571 C  CG1   . VAL A 1 837 ? 14.149  -59.006  -21.165 1.00 118.65 ? 883  VAL A CG1   1 
ATOM   6572 C  CG2   . VAL A 1 837 ? 14.599  -61.031  -22.548 1.00 118.71 ? 883  VAL A CG2   1 
ATOM   6573 N  N     . ALA A 1 838 ? 11.724  -62.462  -22.093 1.00 114.06 ? 884  ALA A N     1 
ATOM   6574 C  CA    . ALA A 1 838 ? 11.534  -63.716  -21.441 1.00 113.63 ? 884  ALA A CA    1 
ATOM   6575 C  C     . ALA A 1 838 ? 12.404  -64.717  -22.146 1.00 116.92 ? 884  ALA A C     1 
ATOM   6576 O  O     . ALA A 1 838 ? 12.174  -65.024  -23.306 1.00 116.53 ? 884  ALA A O     1 
ATOM   6577 C  CB    . ALA A 1 838 ? 10.128  -64.197  -21.654 1.00 114.29 ? 884  ALA A CB    1 
ATOM   6578 N  N     . PRO A 1 839 ? 13.419  -65.256  -21.456 1.00 112.43 ? 885  PRO A N     1 
ATOM   6579 C  CA    . PRO A 1 839 ? 14.346  -66.262  -21.977 1.00 111.72 ? 885  PRO A CA    1 
ATOM   6580 C  C     . PRO A 1 839 ? 14.217  -67.601  -21.298 1.00 115.25 ? 885  PRO A C     1 
ATOM   6581 O  O     . PRO A 1 839 ? 13.626  -67.652  -20.233 1.00 114.86 ? 885  PRO A O     1 
ATOM   6582 C  CB    . PRO A 1 839 ? 15.632  -65.620  -21.520 1.00 113.29 ? 885  PRO A CB    1 
ATOM   6583 C  CG    . PRO A 1 839 ? 15.229  -64.946  -20.236 1.00 117.90 ? 885  PRO A CG    1 
ATOM   6584 C  CD    . PRO A 1 839 ? 13.835  -64.384  -20.390 1.00 113.63 ? 885  PRO A CD    1 
ATOM   6585 N  N     . ALA A 1 840 ? 14.707  -68.676  -21.891 1.00 111.40 ? 886  ALA A N     1 
ATOM   6586 C  CA    . ALA A 1 840 ? 14.618  -69.976  -21.226 1.00 110.92 ? 886  ALA A CA    1 
ATOM   6587 C  C     . ALA A 1 840 ? 15.783  -70.520  -20.430 1.00 113.97 ? 886  ALA A C     1 
ATOM   6588 O  O     . ALA A 1 840 ? 16.849  -70.687  -20.991 1.00 113.48 ? 886  ALA A O     1 
ATOM   6589 C  CB    . ALA A 1 840 ? 14.250  -71.011  -22.279 1.00 30.00  ? 886  ALA A CB    1 
ATOM   6590 N  N     . GLY A 1 841 ? 15.574  -70.780  -19.137 1.00 109.47 ? 887  GLY A N     1 
ATOM   6591 C  CA    . GLY A 1 841 ? 16.566  -71.367  -18.232 1.00 108.45 ? 887  GLY A CA    1 
ATOM   6592 C  C     . GLY A 1 841 ? 17.644  -70.367  -17.859 1.00 110.68 ? 887  GLY A C     1 
ATOM   6593 O  O     . GLY A 1 841 ? 18.540  -70.630  -17.091 1.00 109.39 ? 887  GLY A O     1 
ATOM   6594 N  N     . LEU A 1 842 ? 17.544  -69.203  -18.458 1.00 106.95 ? 888  LEU A N     1 
ATOM   6595 C  CA    . LEU A 1 842 ? 18.519  -68.133  -18.257 1.00 106.61 ? 888  LEU A CA    1 
ATOM   6596 C  C     . LEU A 1 842 ? 17.998  -66.940  -17.434 1.00 111.03 ? 888  LEU A C     1 
ATOM   6597 O  O     . LEU A 1 842 ? 18.535  -65.834  -17.559 1.00 110.16 ? 888  LEU A O     1 
ATOM   6598 C  CB    . LEU A 1 842 ? 19.095  -67.669  -19.614 1.00 106.52 ? 888  LEU A CB    1 
ATOM   6599 C  CG    . LEU A 1 842 ? 19.645  -68.758  -20.556 1.00 111.14 ? 888  LEU A CG    1 
ATOM   6600 C  CD1   . LEU A 1 842 ? 19.933  -68.195  -21.922 1.00 111.19 ? 888  LEU A CD1   1 
ATOM   6601 C  CD2   . LEU A 1 842 ? 20.900  -69.423  -19.991 1.00 113.38 ? 888  LEU A CD2   1 
ATOM   6602 N  N     . THR A 1 843 ? 16.991  -67.164  -16.562 1.00 109.01 ? 889  THR A N     1 
ATOM   6603 C  CA    . THR A 1 843 ? 16.473  -66.102  -15.689 1.00 109.79 ? 889  THR A CA    1 
ATOM   6604 C  C     . THR A 1 843 ? 17.483  -65.908  -14.562 1.00 116.94 ? 889  THR A C     1 
ATOM   6605 O  O     . THR A 1 843 ? 18.067  -66.909  -14.142 1.00 117.18 ? 889  THR A O     1 
ATOM   6606 C  CB    . THR A 1 843 ? 15.082  -66.437  -15.129 1.00 116.87 ? 889  THR A CB    1 
ATOM   6607 O  OG1   . THR A 1 843 ? 15.135  -67.651  -14.388 1.00 114.27 ? 889  THR A OG1   1 
ATOM   6608 C  CG2   . THR A 1 843 ? 14.014  -66.513  -16.201 1.00 116.86 ? 889  THR A CG2   1 
ATOM   6609 N  N     . PRO A 1 844 ? 17.721  -64.674  -14.049 1.00 115.52 ? 890  PRO A N     1 
ATOM   6610 C  CA    . PRO A 1 844 ? 18.708  -64.498  -12.963 1.00 116.24 ? 890  PRO A CA    1 
ATOM   6611 C  C     . PRO A 1 844 ? 18.435  -65.314  -11.703 1.00 121.79 ? 890  PRO A C     1 
ATOM   6612 O  O     . PRO A 1 844 ? 19.384  -65.673  -11.002 1.00 121.19 ? 890  PRO A O     1 
ATOM   6613 C  CB    . PRO A 1 844 ? 18.667  -62.994  -12.687 1.00 117.96 ? 890  PRO A CB    1 
ATOM   6614 C  CG    . PRO A 1 844 ? 17.353  -62.556  -13.186 1.00 122.06 ? 890  PRO A CG    1 
ATOM   6615 C  CD    . PRO A 1 844 ? 17.121  -63.379  -14.413 1.00 117.31 ? 890  PRO A CD    1 
ATOM   6616 N  N     . ASN A 1 845 ? 17.147  -65.618  -11.431 1.00 119.70 ? 891  ASN A N     1 
ATOM   6617 C  CA    . ASN A 1 845 ? 16.722  -66.439  -10.301 1.00 120.27 ? 891  ASN A CA    1 
ATOM   6618 C  C     . ASN A 1 845 ? 17.121  -67.895  -10.527 1.00 125.05 ? 891  ASN A C     1 
ATOM   6619 O  O     . ASN A 1 845 ? 17.520  -68.561  -9.570  1.00 125.14 ? 891  ASN A O     1 
ATOM   6620 C  CB    . ASN A 1 845 ? 15.222  -66.300  -10.044 1.00 123.50 ? 891  ASN A CB    1 
ATOM   6621 C  CG    . ASN A 1 845 ? 14.873  -65.197  -9.072  1.00 156.25 ? 891  ASN A CG    1 
ATOM   6622 O  OD1   . ASN A 1 845 ? 15.221  -64.027  -9.260  1.00 153.80 ? 891  ASN A OD1   1 
ATOM   6623 N  ND2   . ASN A 1 845 ? 14.156  -65.543  -8.013  1.00 149.58 ? 891  ASN A ND2   1 
ATOM   6624 N  N     . GLU A 1 846 ? 17.052  -68.380  -11.786 1.00 121.75 ? 892  GLU A N     1 
ATOM   6625 C  CA    . GLU A 1 846 ? 17.481  -69.740  -12.113 1.00 121.90 ? 892  GLU A CA    1 
ATOM   6626 C  C     . GLU A 1 846 ? 19.002  -69.825  -12.277 1.00 125.24 ? 892  GLU A C     1 
ATOM   6627 O  O     . GLU A 1 846 ? 19.564  -70.916  -12.172 1.00 124.74 ? 892  GLU A O     1 
ATOM   6628 C  CB    . GLU A 1 846 ? 16.730  -70.325  -13.316 1.00 123.60 ? 892  GLU A CB    1 
ATOM   6629 C  CG    . GLU A 1 846 ? 15.374  -70.926  -12.959 1.00 139.20 ? 892  GLU A CG    1 
ATOM   6630 C  CD    . GLU A 1 846 ? 15.355  -72.216  -12.154 1.00 170.67 ? 892  GLU A CD    1 
ATOM   6631 O  OE1   . GLU A 1 846 ? 16.244  -73.074  -12.362 1.00 171.62 ? 892  GLU A OE1   1 
ATOM   6632 O  OE2   . GLU A 1 846 ? 14.417  -72.388  -11.340 1.00 167.87 ? 892  GLU A OE2   1 
ATOM   6633 N  N     . ILE A 1 847 ? 19.669  -68.669  -12.496 1.00 121.42 ? 893  ILE A N     1 
ATOM   6634 C  CA    . ILE A 1 847 ? 21.128  -68.569  -12.567 1.00 121.12 ? 893  ILE A CA    1 
ATOM   6635 C  C     . ILE A 1 847 ? 21.630  -68.812  -11.136 1.00 124.28 ? 893  ILE A C     1 
ATOM   6636 O  O     . ILE A 1 847 ? 22.610  -69.532  -10.945 1.00 124.16 ? 893  ILE A O     1 
ATOM   6637 C  CB    . ILE A 1 847 ? 21.584  -67.195  -13.156 1.00 124.52 ? 893  ILE A CB    1 
ATOM   6638 C  CG1   . ILE A 1 847 ? 21.223  -67.044  -14.660 1.00 125.36 ? 893  ILE A CG1   1 
ATOM   6639 C  CG2   . ILE A 1 847 ? 23.070  -66.888  -12.905 1.00 125.35 ? 893  ILE A CG2   1 
ATOM   6640 C  CD1   . ILE A 1 847 ? 21.815  -68.076  -15.677 1.00 133.83 ? 893  ILE A CD1   1 
ATOM   6641 N  N     . ASP A 1 848 ? 20.902  -68.265  -10.142 1.00 119.91 ? 894  ASP A N     1 
ATOM   6642 C  CA    . ASP A 1 848 ? 21.166  -68.410  -8.712  1.00 119.39 ? 894  ASP A CA    1 
ATOM   6643 C  C     . ASP A 1 848 ? 20.975  -69.871  -8.259  1.00 121.88 ? 894  ASP A C     1 
ATOM   6644 O  O     . ASP A 1 848 ? 21.846  -70.404  -7.570  1.00 121.69 ? 894  ASP A O     1 
ATOM   6645 C  CB    . ASP A 1 848 ? 20.263  -67.455  -7.916  1.00 121.48 ? 894  ASP A CB    1 
ATOM   6646 C  CG    . ASP A 1 848 ? 20.453  -67.516  -6.419  1.00 134.84 ? 894  ASP A CG    1 
ATOM   6647 O  OD1   . ASP A 1 848 ? 21.396  -66.870  -5.917  1.00 135.66 ? 894  ASP A OD1   1 
ATOM   6648 O  OD2   . ASP A 1 848 ? 19.650  -68.201  -5.746  1.00 142.41 ? 894  ASP A OD2   1 
ATOM   6649 N  N     . SER A 1 849 ? 19.860  -70.520  -8.673  1.00 116.86 ? 895  SER A N     1 
ATOM   6650 C  CA    . SER A 1 849 ? 19.530  -71.910  -8.338  1.00 115.91 ? 895  SER A CA    1 
ATOM   6651 C  C     . SER A 1 849 ? 20.502  -72.950  -8.918  1.00 118.29 ? 895  SER A C     1 
ATOM   6652 O  O     . SER A 1 849 ? 20.642  -74.023  -8.331  1.00 118.28 ? 895  SER A O     1 
ATOM   6653 C  CB    . SER A 1 849 ? 18.094  -72.241  -8.724  1.00 119.25 ? 895  SER A CB    1 
ATOM   6654 O  OG    . SER A 1 849 ? 17.177  -71.595  -7.856  1.00 127.54 ? 895  SER A OG    1 
ATOM   6655 N  N     . THR A 1 850 ? 21.167  -72.646  -10.050 1.00 113.18 ? 896  THR A N     1 
ATOM   6656 C  CA    . THR A 1 850 ? 22.153  -73.557  -10.643 1.00 112.39 ? 896  THR A CA    1 
ATOM   6657 C  C     . THR A 1 850 ? 23.549  -73.287  -10.070 1.00 115.62 ? 896  THR A C     1 
ATOM   6658 O  O     . THR A 1 850 ? 24.382  -74.194  -10.050 1.00 114.98 ? 896  THR A O     1 
ATOM   6659 C  CB    . THR A 1 850 ? 22.123  -73.540  -12.172 1.00 117.28 ? 896  THR A CB    1 
ATOM   6660 O  OG1   . THR A 1 850 ? 22.216  -72.195  -12.623 1.00 117.32 ? 896  THR A OG1   1 
ATOM   6661 C  CG2   . THR A 1 850 ? 20.893  -74.218  -12.746 1.00 114.86 ? 896  THR A CG2   1 
ATOM   6662 N  N     . TRP A 1 851 ? 23.791  -72.046  -9.592  1.00 111.65 ? 897  TRP A N     1 
ATOM   6663 C  CA    . TRP A 1 851 ? 25.046  -71.638  -8.961  1.00 111.24 ? 897  TRP A CA    1 
ATOM   6664 C  C     . TRP A 1 851 ? 25.092  -72.126  -7.513  1.00 114.33 ? 897  TRP A C     1 
ATOM   6665 O  O     . TRP A 1 851 ? 26.182  -72.376  -6.993  1.00 114.10 ? 897  TRP A O     1 
ATOM   6666 C  CB    . TRP A 1 851 ? 25.219  -70.126  -9.017  1.00 110.18 ? 897  TRP A CB    1 
ATOM   6667 C  CG    . TRP A 1 851 ? 26.629  -69.661  -8.814  1.00 111.56 ? 897  TRP A CG    1 
ATOM   6668 C  CD1   . TRP A 1 851 ? 27.641  -69.689  -9.730  1.00 114.54 ? 897  TRP A CD1   1 
ATOM   6669 C  CD2   . TRP A 1 851 ? 27.148  -68.994  -7.661  1.00 111.45 ? 897  TRP A CD2   1 
ATOM   6670 N  NE1   . TRP A 1 851 ? 28.772  -69.109  -9.204  1.00 114.05 ? 897  TRP A NE1   1 
ATOM   6671 C  CE2   . TRP A 1 851 ? 28.496  -68.666  -7.937  1.00 115.54 ? 897  TRP A CE2   1 
ATOM   6672 C  CE3   . TRP A 1 851 ? 26.607  -68.643  -6.413  1.00 112.98 ? 897  TRP A CE3   1 
ATOM   6673 C  CZ2   . TRP A 1 851 ? 29.311  -68.013  -7.008  1.00 115.09 ? 897  TRP A CZ2   1 
ATOM   6674 C  CZ3   . TRP A 1 851 ? 27.418  -67.999  -5.492  1.00 114.70 ? 897  TRP A CZ3   1 
ATOM   6675 C  CH2   . TRP A 1 851 ? 28.756  -67.699  -5.788  1.00 115.45 ? 897  TRP A CH2   1 
ATOM   6676 N  N     . SER A 1 852 ? 23.912  -72.273  -6.865  1.00 109.54 ? 898  SER A N     1 
ATOM   6677 C  CA    . SER A 1 852 ? 23.787  -72.810  -5.506  1.00 108.53 ? 898  SER A CA    1 
ATOM   6678 C  C     . SER A 1 852 ? 24.059  -74.315  -5.548  1.00 110.91 ? 898  SER A C     1 
ATOM   6679 O  O     . SER A 1 852 ? 24.612  -74.868  -4.597  1.00 110.68 ? 898  SER A O     1 
ATOM   6680 C  CB    . SER A 1 852 ? 22.401  -72.536  -4.936  1.00 111.44 ? 898  SER A CB    1 
ATOM   6681 O  OG    . SER A 1 852 ? 22.319  -71.204  -4.460  1.00 119.48 ? 898  SER A OG    1 
ATOM   6682 N  N     . ALA A 1 853 ? 23.697  -74.958  -6.678  1.00 105.97 ? 899  ALA A N     1 
ATOM   6683 C  CA    . ALA A 1 853 ? 23.934  -76.373  -6.954  1.00 104.96 ? 899  ALA A CA    1 
ATOM   6684 C  C     . ALA A 1 853 ? 25.418  -76.588  -7.295  1.00 106.28 ? 899  ALA A C     1 
ATOM   6685 O  O     . ALA A 1 853 ? 25.943  -77.680  -7.064  1.00 105.96 ? 899  ALA A O     1 
ATOM   6686 C  CB    . ALA A 1 853 ? 23.054  -76.839  -8.101  1.00 105.70 ? 899  ALA A CB    1 
ATOM   6687 N  N     . LEU A 1 854 ? 26.088  -75.547  -7.834  1.00 100.56 ? 900  LEU A N     1 
ATOM   6688 C  CA    . LEU A 1 854 ? 27.516  -75.585  -8.138  1.00 99.65  ? 900  LEU A CA    1 
ATOM   6689 C  C     . LEU A 1 854 ? 28.288  -75.538  -6.814  1.00 103.63 ? 900  LEU A C     1 
ATOM   6690 O  O     . LEU A 1 854 ? 29.259  -76.277  -6.653  1.00 103.28 ? 900  LEU A O     1 
ATOM   6691 C  CB    . LEU A 1 854 ? 27.931  -74.423  -9.061  1.00 99.33  ? 900  LEU A CB    1 
ATOM   6692 C  CG    . LEU A 1 854 ? 29.435  -74.262  -9.356  1.00 103.56 ? 900  LEU A CG    1 
ATOM   6693 C  CD1   . LEU A 1 854 ? 29.925  -75.278  -10.378 1.00 103.44 ? 900  LEU A CD1   1 
ATOM   6694 C  CD2   . LEU A 1 854 ? 29.756  -72.857  -9.806  1.00 105.88 ? 900  LEU A CD2   1 
ATOM   6695 N  N     . GLU A 1 855 ? 27.840  -74.686  -5.866  1.00 99.62  ? 901  GLU A N     1 
ATOM   6696 C  CA    . GLU A 1 855 ? 28.456  -74.557  -4.544  1.00 98.78  ? 901  GLU A CA    1 
ATOM   6697 C  C     . GLU A 1 855 ? 28.186  -75.787  -3.681  1.00 101.75 ? 901  GLU A C     1 
ATOM   6698 O  O     . GLU A 1 855 ? 29.061  -76.176  -2.910  1.00 101.85 ? 901  GLU A O     1 
ATOM   6699 C  CB    . GLU A 1 855 ? 28.044  -73.254  -3.846  1.00 100.00 ? 901  GLU A CB    1 
ATOM   6700 C  CG    . GLU A 1 855 ? 28.792  -72.041  -4.379  1.00 109.86 ? 901  GLU A CG    1 
ATOM   6701 C  CD    . GLU A 1 855 ? 28.620  -70.745  -3.609  1.00 131.94 ? 901  GLU A CD    1 
ATOM   6702 O  OE1   . GLU A 1 855 ? 27.485  -70.453  -3.167  1.00 136.88 ? 901  GLU A OE1   1 
ATOM   6703 O  OE2   . GLU A 1 855 ? 29.612  -69.992  -3.496  1.00 122.46 ? 901  GLU A OE2   1 
ATOM   6704 N  N     . LYS A 1 856 ? 27.005  -76.429  -3.854  1.00 97.26  ? 902  LYS A N     1 
ATOM   6705 C  CA    . LYS A 1 856 ? 26.608  -77.665  -3.163  1.00 96.65  ? 902  LYS A CA    1 
ATOM   6706 C  C     . LYS A 1 856 ? 27.441  -78.842  -3.665  1.00 98.14  ? 902  LYS A C     1 
ATOM   6707 O  O     . LYS A 1 856 ? 27.567  -79.843  -2.965  1.00 97.95  ? 902  LYS A O     1 
ATOM   6708 C  CB    . LYS A 1 856 ? 25.122  -77.961  -3.381  1.00 100.08 ? 902  LYS A CB    1 
ATOM   6709 C  CG    . LYS A 1 856 ? 24.321  -78.070  -2.089  1.00 125.61 ? 902  LYS A CG    1 
ATOM   6710 C  CD    . LYS A 1 856 ? 22.806  -77.972  -2.335  1.00 142.93 ? 902  LYS A CD    1 
ATOM   6711 C  CE    . LYS A 1 856 ? 22.302  -76.550  -2.515  1.00 157.63 ? 902  LYS A CE    1 
ATOM   6712 N  NZ    . LYS A 1 856 ? 20.890  -76.510  -2.987  1.00 165.21 ? 902  LYS A NZ    1 
ATOM   6713 N  N     . ALA A 1 857 ? 27.989  -78.727  -4.883  1.00 92.64  ? 903  ALA A N     1 
ATOM   6714 C  CA    . ALA A 1 857 ? 28.855  -79.729  -5.486  1.00 91.69  ? 903  ALA A CA    1 
ATOM   6715 C  C     . ALA A 1 857 ? 30.289  -79.463  -5.043  1.00 93.99  ? 903  ALA A C     1 
ATOM   6716 O  O     . ALA A 1 857 ? 31.086  -80.394  -5.003  1.00 92.91  ? 903  ALA A O     1 
ATOM   6717 C  CB    . ALA A 1 857 ? 28.756  -79.665  -7.002  1.00 92.39  ? 903  ALA A CB    1 
ATOM   6718 N  N     . GLU A 1 858 ? 30.609  -78.194  -4.707  1.00 90.26  ? 904  GLU A N     1 
ATOM   6719 C  CA    . GLU A 1 858 ? 31.930  -77.763  -4.246  1.00 90.09  ? 904  GLU A CA    1 
ATOM   6720 C  C     . GLU A 1 858 ? 32.217  -78.283  -2.826  1.00 94.17  ? 904  GLU A C     1 
ATOM   6721 O  O     . GLU A 1 858 ? 33.310  -78.789  -2.569  1.00 93.09  ? 904  GLU A O     1 
ATOM   6722 C  CB    . GLU A 1 858 ? 32.085  -76.229  -4.339  1.00 91.26  ? 904  GLU A CB    1 
ATOM   6723 C  CG    . GLU A 1 858 ? 32.450  -75.728  -5.735  1.00 99.76  ? 904  GLU A CG    1 
ATOM   6724 C  CD    . GLU A 1 858 ? 32.394  -74.231  -6.011  1.00 114.56 ? 904  GLU A CD    1 
ATOM   6725 O  OE1   . GLU A 1 858 ? 31.775  -73.486  -5.217  1.00 106.37 ? 904  GLU A OE1   1 
ATOM   6726 O  OE2   . GLU A 1 858 ? 32.938  -73.806  -7.056  1.00 103.29 ? 904  GLU A OE2   1 
ATOM   6727 N  N     . GLN A 1 859 ? 31.221  -78.178  -1.928  1.00 91.40  ? 905  GLN A N     1 
ATOM   6728 C  CA    . GLN A 1 859 ? 31.275  -78.644  -0.538  1.00 91.63  ? 905  GLN A CA    1 
ATOM   6729 C  C     . GLN A 1 859 ? 31.391  -80.175  -0.482  1.00 94.26  ? 905  GLN A C     1 
ATOM   6730 O  O     . GLN A 1 859 ? 32.214  -80.697  0.269   1.00 94.23  ? 905  GLN A O     1 
ATOM   6731 C  CB    . GLN A 1 859 ? 30.029  -78.177  0.242   1.00 93.49  ? 905  GLN A CB    1 
ATOM   6732 C  CG    . GLN A 1 859 ? 29.982  -76.668  0.500   1.00 124.84 ? 905  GLN A CG    1 
ATOM   6733 C  CD    . GLN A 1 859 ? 28.591  -76.179  0.836   1.00 157.49 ? 905  GLN A CD    1 
ATOM   6734 O  OE1   . GLN A 1 859 ? 27.911  -76.700  1.732   1.00 156.67 ? 905  GLN A OE1   1 
ATOM   6735 N  NE2   . GLN A 1 859 ? 28.144  -75.142  0.136   1.00 151.13 ? 905  GLN A NE2   1 
ATOM   6736 N  N     . GLU A 1 860 ? 30.581  -80.879  -1.298  1.00 89.01  ? 906  GLU A N     1 
ATOM   6737 C  CA    . GLU A 1 860 ? 30.551  -82.338  -1.413  1.00 87.82  ? 906  GLU A CA    1 
ATOM   6738 C  C     . GLU A 1 860 ? 31.770  -82.905  -2.162  1.00 89.81  ? 906  GLU A C     1 
ATOM   6739 O  O     . GLU A 1 860 ? 31.972  -84.121  -2.147  1.00 90.30  ? 906  GLU A O     1 
ATOM   6740 C  CB    . GLU A 1 860 ? 29.247  -82.806  -2.069  1.00 89.27  ? 906  GLU A CB    1 
ATOM   6741 C  CG    . GLU A 1 860 ? 28.019  -82.694  -1.174  1.00 101.92 ? 906  GLU A CG    1 
ATOM   6742 C  CD    . GLU A 1 860 ? 26.656  -82.791  -1.843  1.00 123.48 ? 906  GLU A CD    1 
ATOM   6743 O  OE1   . GLU A 1 860 ? 26.583  -83.131  -3.047  1.00 114.29 ? 906  GLU A OE1   1 
ATOM   6744 O  OE2   . GLU A 1 860 ? 25.651  -82.524  -1.146  1.00 120.34 ? 906  GLU A OE2   1 
ATOM   6745 N  N     . HIS A 1 861 ? 32.574  -82.044  -2.808  1.00 83.67  ? 907  HIS A N     1 
ATOM   6746 C  CA    . HIS A 1 861 ? 33.789  -82.451  -3.512  1.00 83.01  ? 907  HIS A CA    1 
ATOM   6747 C  C     . HIS A 1 861 ? 34.979  -82.396  -2.538  1.00 89.01  ? 907  HIS A C     1 
ATOM   6748 O  O     . HIS A 1 861 ? 35.773  -83.338  -2.489  1.00 87.89  ? 907  HIS A O     1 
ATOM   6749 C  CB    . HIS A 1 861 ? 34.029  -81.535  -4.719  1.00 82.87  ? 907  HIS A CB    1 
ATOM   6750 C  CG    . HIS A 1 861 ? 35.289  -81.795  -5.484  1.00 85.28  ? 907  HIS A CG    1 
ATOM   6751 N  ND1   . HIS A 1 861 ? 35.382  -82.833  -6.393  1.00 86.47  ? 907  HIS A ND1   1 
ATOM   6752 C  CD2   . HIS A 1 861 ? 36.443  -81.092  -5.507  1.00 85.96  ? 907  HIS A CD2   1 
ATOM   6753 C  CE1   . HIS A 1 861 ? 36.593  -82.748  -6.913  1.00 85.26  ? 907  HIS A CE1   1 
ATOM   6754 N  NE2   . HIS A 1 861 ? 37.266  -81.711  -6.414  1.00 85.50  ? 907  HIS A NE2   1 
ATOM   6755 N  N     . ALA A 1 862 ? 35.083  -81.283  -1.768  1.00 87.44  ? 908  ALA A N     1 
ATOM   6756 C  CA    . ALA A 1 862 ? 36.129  -81.006  -0.779  1.00 87.80  ? 908  ALA A CA    1 
ATOM   6757 C  C     . ALA A 1 862 ? 36.042  -81.925  0.430   1.00 93.17  ? 908  ALA A C     1 
ATOM   6758 O  O     . ALA A 1 862 ? 37.074  -82.234  1.025   1.00 92.64  ? 908  ALA A O     1 
ATOM   6759 C  CB    . ALA A 1 862 ? 36.053  -79.555  -0.328  1.00 88.51  ? 908  ALA A CB    1 
ATOM   6760 N  N     . GLU A 1 863 ? 34.815  -82.332  0.812   1.00 90.74  ? 909  GLU A N     1 
ATOM   6761 C  CA    . GLU A 1 863 ? 34.569  -83.233  1.937   1.00 90.75  ? 909  GLU A CA    1 
ATOM   6762 C  C     . GLU A 1 863 ? 34.961  -84.644  1.533   1.00 93.11  ? 909  GLU A C     1 
ATOM   6763 O  O     . GLU A 1 863 ? 35.597  -85.340  2.320   1.00 93.01  ? 909  GLU A O     1 
ATOM   6764 C  CB    . GLU A 1 863 ? 33.103  -83.173  2.365   1.00 92.65  ? 909  GLU A CB    1 
ATOM   6765 C  CG    . GLU A 1 863 ? 32.884  -83.545  3.819   1.00 108.49 ? 909  GLU A CG    1 
ATOM   6766 C  CD    . GLU A 1 863 ? 31.482  -83.269  4.326   1.00 143.50 ? 909  GLU A CD    1 
ATOM   6767 O  OE1   . GLU A 1 863 ? 30.847  -84.215  4.847   1.00 150.89 ? 909  GLU A OE1   1 
ATOM   6768 O  OE2   . GLU A 1 863 ? 31.016  -82.112  4.201   1.00 140.40 ? 909  GLU A OE2   1 
ATOM   6769 N  N     . ALA A 1 864 ? 34.634  -85.040  0.284   1.00 88.59  ? 910  ALA A N     1 
ATOM   6770 C  CA    . ALA A 1 864 ? 34.993  -86.333  -0.298  1.00 88.22  ? 910  ALA A CA    1 
ATOM   6771 C  C     . ALA A 1 864 ? 36.510  -86.406  -0.520  1.00 92.21  ? 910  ALA A C     1 
ATOM   6772 O  O     . ALA A 1 864 ? 37.049  -87.504  -0.631  1.00 92.09  ? 910  ALA A O     1 
ATOM   6773 C  CB    . ALA A 1 864 ? 34.260  -86.543  -1.611  1.00 88.87  ? 910  ALA A CB    1 
ATOM   6774 N  N     . LEU A 1 865 ? 37.188  -85.239  -0.564  1.00 88.23  ? 911  LEU A N     1 
ATOM   6775 C  CA    . LEU A 1 865 ? 38.639  -85.101  -0.689  1.00 88.15  ? 911  LEU A CA    1 
ATOM   6776 C  C     . LEU A 1 865 ? 39.324  -85.306  0.674   1.00 91.61  ? 911  LEU A C     1 
ATOM   6777 O  O     . LEU A 1 865 ? 40.469  -85.757  0.718   1.00 90.89  ? 911  LEU A O     1 
ATOM   6778 C  CB    . LEU A 1 865 ? 39.006  -83.714  -1.237  1.00 88.23  ? 911  LEU A CB    1 
ATOM   6779 C  CG    . LEU A 1 865 ? 39.461  -83.650  -2.679  1.00 92.82  ? 911  LEU A CG    1 
ATOM   6780 C  CD1   . LEU A 1 865 ? 39.470  -82.229  -3.166  1.00 92.94  ? 911  LEU A CD1   1 
ATOM   6781 C  CD2   . LEU A 1 865 ? 40.828  -84.276  -2.854  1.00 95.44  ? 911  LEU A CD2   1 
ATOM   6782 N  N     . ARG A 1 866 ? 38.633  -84.930  1.774   1.00 87.87  ? 912  ARG A N     1 
ATOM   6783 C  CA    . ARG A 1 866 ? 39.124  -85.098  3.140   1.00 87.56  ? 912  ARG A CA    1 
ATOM   6784 C  C     . ARG A 1 866 ? 38.972  -86.555  3.526   1.00 89.88  ? 912  ARG A C     1 
ATOM   6785 O  O     . ARG A 1 866 ? 39.898  -87.130  4.107   1.00 88.08  ? 912  ARG A O     1 
ATOM   6786 C  CB    . ARG A 1 866 ? 38.400  -84.172  4.126   1.00 88.87  ? 912  ARG A CB    1 
ATOM   6787 C  CG    . ARG A 1 866 ? 39.253  -82.970  4.505   1.00 106.17 ? 912  ARG A CG    1 
ATOM   6788 C  CD    . ARG A 1 866 ? 38.440  -81.854  5.123   1.00 127.80 ? 912  ARG A CD    1 
ATOM   6789 N  NE    . ARG A 1 866 ? 39.212  -80.613  5.213   1.00 146.24 ? 912  ARG A NE    1 
ATOM   6790 C  CZ    . ARG A 1 866 ? 38.688  -79.414  5.455   1.00 166.77 ? 912  ARG A CZ    1 
ATOM   6791 N  NH1   . ARG A 1 866 ? 37.379  -79.278  5.628   1.00 158.04 ? 912  ARG A NH1   1 
ATOM   6792 N  NH2   . ARG A 1 866 ? 39.467  -78.344  5.519   1.00 154.58 ? 912  ARG A NH2   1 
ATOM   6793 N  N     . ILE A 1 867 ? 37.842  -87.160  3.180   1.00 86.35  ? 913  ILE A N     1 
ATOM   6794 C  CA    . ILE A 1 867 ? 37.643  -88.573  3.459   1.00 86.02  ? 913  ILE A CA    1 
ATOM   6795 C  C     . ILE A 1 867 ? 38.670  -89.382  2.666   1.00 90.40  ? 913  ILE A C     1 
ATOM   6796 O  O     . ILE A 1 867 ? 39.245  -90.344  3.175   1.00 90.78  ? 913  ILE A O     1 
ATOM   6797 C  CB    . ILE A 1 867 ? 36.225  -89.033  3.076   1.00 88.94  ? 913  ILE A CB    1 
ATOM   6798 C  CG1   . ILE A 1 867 ? 35.185  -88.354  3.970   1.00 89.45  ? 913  ILE A CG1   1 
ATOM   6799 C  CG2   . ILE A 1 867 ? 36.112  -90.547  3.173   1.00 89.48  ? 913  ILE A CG2   1 
ATOM   6800 C  CD1   . ILE A 1 867 ? 33.760  -88.541  3.498   1.00 99.93  ? 913  ILE A CD1   1 
ATOM   6801 N  N     . GLU A 1 868 ? 38.892  -88.982  1.414   1.00 85.89  ? 914  GLU A N     1 
ATOM   6802 C  CA    . GLU A 1 868 ? 39.849  -89.659  0.538   1.00 85.14  ? 914  GLU A CA    1 
ATOM   6803 C  C     . GLU A 1 868 ? 41.283  -89.561  1.055   1.00 87.29  ? 914  GLU A C     1 
ATOM   6804 O  O     . GLU A 1 868 ? 42.033  -90.537  1.023   1.00 87.30  ? 914  GLU A O     1 
ATOM   6805 C  CB    . GLU A 1 868 ? 39.765  -89.095  -0.882  1.00 86.62  ? 914  GLU A CB    1 
ATOM   6806 C  CG    . GLU A 1 868 ? 40.675  -89.790  -1.881  1.00 96.11  ? 914  GLU A CG    1 
ATOM   6807 C  CD    . GLU A 1 868 ? 40.292  -91.239  -2.108  1.00 110.25 ? 914  GLU A CD    1 
ATOM   6808 O  OE1   . GLU A 1 868 ? 39.186  -91.636  -1.687  1.00 96.33  ? 914  GLU A OE1   1 
ATOM   6809 O  OE2   . GLU A 1 868 ? 41.098  -91.982  -2.708  1.00 99.89  ? 914  GLU A OE2   1 
ATOM   6810 N  N     . LEU A 1 869 ? 41.656  -88.377  1.531   1.00 81.92  ? 915  LEU A N     1 
ATOM   6811 C  CA    . LEU A 1 869 ? 42.994  -88.149  2.090   1.00 81.09  ? 915  LEU A CA    1 
ATOM   6812 C  C     . LEU A 1 869 ? 43.268  -89.016  3.335   1.00 84.57  ? 915  LEU A C     1 
ATOM   6813 O  O     . LEU A 1 869 ? 44.387  -89.493  3.500   1.00 83.36  ? 915  LEU A O     1 
ATOM   6814 C  CB    . LEU A 1 869 ? 43.228  -86.661  2.383   1.00 80.72  ? 915  LEU A CB    1 
ATOM   6815 C  CG    . LEU A 1 869 ? 44.665  -86.238  2.681   1.00 85.13  ? 915  LEU A CG    1 
ATOM   6816 C  CD1   . LEU A 1 869 ? 45.541  -86.275  1.426   1.00 84.92  ? 915  LEU A CD1   1 
ATOM   6817 C  CD2   . LEU A 1 869 ? 44.697  -84.866  3.297   1.00 88.09  ? 915  LEU A CD2   1 
ATOM   6818 N  N     . LYS A 1 870 ? 42.240  -89.229  4.182   1.00 82.02  ? 916  LYS A N     1 
ATOM   6819 C  CA    . LYS A 1 870 ? 42.279  -90.062  5.388   1.00 82.42  ? 916  LYS A CA    1 
ATOM   6820 C  C     . LYS A 1 870 ? 42.598  -91.503  5.006   1.00 88.43  ? 916  LYS A C     1 
ATOM   6821 O  O     . LYS A 1 870 ? 43.540  -92.106  5.529   1.00 89.17  ? 916  LYS A O     1 
ATOM   6822 C  CB    . LYS A 1 870 ? 40.909  -90.047  6.098   1.00 84.62  ? 916  LYS A CB    1 
ATOM   6823 C  CG    . LYS A 1 870 ? 40.865  -89.179  7.331   1.00 97.64  ? 916  LYS A CG    1 
ATOM   6824 C  CD    . LYS A 1 870 ? 39.692  -89.540  8.233   1.00 106.03 ? 916  LYS A CD    1 
ATOM   6825 C  CE    . LYS A 1 870 ? 39.577  -88.594  9.405   1.00 116.12 ? 916  LYS A CE    1 
ATOM   6826 N  NZ    . LYS A 1 870 ? 40.781  -88.627  10.280  1.00 125.76 ? 916  LYS A NZ    1 
ATOM   6827 N  N     . ARG A 1 871 ? 41.804  -92.015  4.078   1.00 84.73  ? 917  ARG A N     1 
ATOM   6828 C  CA    . ARG A 1 871 ? 41.936  -93.359  3.575   1.00 84.72  ? 917  ARG A CA    1 
ATOM   6829 C  C     . ARG A 1 871 ? 43.206  -93.644  2.831   1.00 87.08  ? 917  ARG A C     1 
ATOM   6830 O  O     . ARG A 1 871 ? 43.752  -94.709  2.971   1.00 86.37  ? 917  ARG A O     1 
ATOM   6831 C  CB    . ARG A 1 871 ? 40.765  -93.716  2.687   1.00 88.28  ? 917  ARG A CB    1 
ATOM   6832 C  CG    . ARG A 1 871 ? 40.960  -95.025  1.960   1.00 106.86 ? 917  ARG A CG    1 
ATOM   6833 C  CD    . ARG A 1 871 ? 39.903  -95.261  0.906   1.00 129.17 ? 917  ARG A CD    1 
ATOM   6834 N  NE    . ARG A 1 871 ? 40.557  -95.473  -0.367  1.00 149.29 ? 917  ARG A NE    1 
ATOM   6835 C  CZ    . ARG A 1 871 ? 40.562  -96.609  -1.038  1.00 173.40 ? 917  ARG A CZ    1 
ATOM   6836 N  NH1   . ARG A 1 871 ? 39.920  -97.658  -0.574  1.00 167.24 ? 917  ARG A NH1   1 
ATOM   6837 N  NH2   . ARG A 1 871 ? 41.215  -96.685  -2.180  1.00 161.48 ? 917  ARG A NH2   1 
ATOM   6838 N  N     . GLN A 1 872 ? 43.657  -92.712  2.011   1.00 82.92  ? 918  GLN A N     1 
ATOM   6839 C  CA    . GLN A 1 872 ? 44.888  -92.891  1.224   1.00 82.74  ? 918  GLN A CA    1 
ATOM   6840 C  C     . GLN A 1 872 ? 46.123  -92.962  2.118   1.00 87.87  ? 918  GLN A C     1 
ATOM   6841 O  O     . GLN A 1 872 ? 47.085  -93.655  1.776   1.00 87.53  ? 918  GLN A O     1 
ATOM   6842 C  CB    . GLN A 1 872 ? 45.081  -91.762  0.190   1.00 83.68  ? 918  GLN A CB    1 
ATOM   6843 C  CG    . GLN A 1 872 ? 44.191  -91.847  -1.046  1.00 85.82  ? 918  GLN A CG    1 
ATOM   6844 C  CD    . GLN A 1 872 ? 44.275  -93.152  -1.789  1.00 87.22  ? 918  GLN A CD    1 
ATOM   6845 O  OE1   . GLN A 1 872 ? 45.340  -93.609  -2.203  1.00 79.50  ? 918  GLN A OE1   1 
ATOM   6846 N  NE2   . GLN A 1 872 ? 43.140  -93.765  -1.986  1.00 68.73  ? 918  GLN A NE2   1 
ATOM   6847 N  N     . LYS A 1 873 ? 46.105  -92.200  3.233   1.00 84.84  ? 919  LYS A N     1 
ATOM   6848 C  CA    . LYS A 1 873 ? 47.173  -92.134  4.233   1.00 84.72  ? 919  LYS A CA    1 
ATOM   6849 C  C     . LYS A 1 873 ? 47.081  -93.296  5.243   1.00 88.11  ? 919  LYS A C     1 
ATOM   6850 O  O     . LYS A 1 873 ? 48.088  -93.657  5.851   1.00 86.61  ? 919  LYS A O     1 
ATOM   6851 C  CB    . LYS A 1 873 ? 47.200  -90.762  4.926   1.00 87.38  ? 919  LYS A CB    1 
ATOM   6852 C  CG    . LYS A 1 873 ? 47.776  -89.659  4.045   1.00 105.02 ? 919  LYS A CG    1 
ATOM   6853 C  CD    . LYS A 1 873 ? 47.979  -88.361  4.808   1.00 118.18 ? 919  LYS A CD    1 
ATOM   6854 C  CE    . LYS A 1 873 ? 48.642  -87.311  3.950   1.00 132.81 ? 919  LYS A CE    1 
ATOM   6855 N  NZ    . LYS A 1 873 ? 48.987  -86.097  4.733   1.00 145.19 ? 919  LYS A NZ    1 
ATOM   6856 N  N     . LYS A 1 874 ? 45.877  -93.889  5.397   1.00 85.30  ? 920  LYS A N     1 
ATOM   6857 C  CA    . LYS A 1 874 ? 45.637  -95.056  6.241   1.00 85.54  ? 920  LYS A CA    1 
ATOM   6858 C  C     . LYS A 1 874 ? 46.193  -96.280  5.527   1.00 91.11  ? 920  LYS A C     1 
ATOM   6859 O  O     . LYS A 1 874 ? 46.623  -97.230  6.186   1.00 91.72  ? 920  LYS A O     1 
ATOM   6860 C  CB    . LYS A 1 874 ? 44.140  -95.254  6.512   1.00 88.01  ? 920  LYS A CB    1 
ATOM   6861 C  CG    . LYS A 1 874 ? 43.658  -94.575  7.782   1.00 99.40  ? 920  LYS A CG    1 
ATOM   6862 C  CD    . LYS A 1 874 ? 42.201  -94.875  8.062   1.00 106.26 ? 920  LYS A CD    1 
ATOM   6863 C  CE    . LYS A 1 874 ? 41.680  -94.025  9.189   1.00 115.44 ? 920  LYS A CE    1 
ATOM   6864 N  NZ    . LYS A 1 874 ? 40.266  -94.341  9.499   1.00 125.05 ? 920  LYS A NZ    1 
ATOM   6865 N  N     . ILE A 1 875 ? 46.190  -96.245  4.178   1.00 87.58  ? 921  ILE A N     1 
ATOM   6866 C  CA    . ILE A 1 875 ? 46.714  -97.299  3.311   1.00 87.47  ? 921  ILE A CA    1 
ATOM   6867 C  C     . ILE A 1 875 ? 48.257  -97.232  3.271   1.00 88.73  ? 921  ILE A C     1 
ATOM   6868 O  O     . ILE A 1 875 ? 48.887  -98.281  3.375   1.00 87.95  ? 921  ILE A O     1 
ATOM   6869 C  CB    . ILE A 1 875 ? 46.018  -97.297  1.910   1.00 91.27  ? 921  ILE A CB    1 
ATOM   6870 C  CG1   . ILE A 1 875 ? 44.599  -97.916  2.020   1.00 92.09  ? 921  ILE A CG1   1 
ATOM   6871 C  CG2   . ILE A 1 875 ? 46.848  -98.017  0.818   1.00 92.46  ? 921  ILE A CG2   1 
ATOM   6872 C  CD1   . ILE A 1 875 ? 43.612  -97.530  0.889   1.00 102.03 ? 921  ILE A CD1   1 
ATOM   6873 N  N     . ALA A 1 876 ? 48.855  -96.018  3.174   1.00 83.45  ? 922  ALA A N     1 
ATOM   6874 C  CA    . ALA A 1 876 ? 50.317  -95.831  3.164   1.00 82.60  ? 922  ALA A CA    1 
ATOM   6875 C  C     . ALA A 1 876 ? 51.019  -96.328  4.454   1.00 84.85  ? 922  ALA A C     1 
ATOM   6876 O  O     . ALA A 1 876 ? 52.132  -96.851  4.381   1.00 83.23  ? 922  ALA A O     1 
ATOM   6877 C  CB    . ALA A 1 876 ? 50.658  -94.377  2.925   1.00 83.23  ? 922  ALA A CB    1 
ATOM   6878 N  N     . VAL A 1 877 ? 50.363  -96.141  5.622   1.00 81.21  ? 923  VAL A N     1 
ATOM   6879 C  CA    . VAL A 1 877 ? 50.826  -96.562  6.948   1.00 80.84  ? 923  VAL A CA    1 
ATOM   6880 C  C     . VAL A 1 877 ? 50.803  -98.097  7.010   1.00 83.40  ? 923  VAL A C     1 
ATOM   6881 O  O     . VAL A 1 877 ? 51.801  -98.703  7.399   1.00 83.75  ? 923  VAL A O     1 
ATOM   6882 C  CB    . VAL A 1 877 ? 49.997  -95.883  8.081   1.00 84.94  ? 923  VAL A CB    1 
ATOM   6883 C  CG1   . VAL A 1 877 ? 50.176  -96.589  9.425   1.00 84.65  ? 923  VAL A CG1   1 
ATOM   6884 C  CG2   . VAL A 1 877 ? 50.350  -94.403  8.204   1.00 84.74  ? 923  VAL A CG2   1 
ATOM   6885 N  N     . LEU A 1 878 ? 49.687  -98.714  6.575   1.00 77.96  ? 924  LEU A N     1 
ATOM   6886 C  CA    . LEU A 1 878 ? 49.517  -100.160 6.500   1.00 77.22  ? 924  LEU A CA    1 
ATOM   6887 C  C     . LEU A 1 878 ? 50.498  -100.819 5.524   1.00 80.38  ? 924  LEU A C     1 
ATOM   6888 O  O     . LEU A 1 878 ? 50.874  -101.965 5.738   1.00 80.28  ? 924  LEU A O     1 
ATOM   6889 C  CB    . LEU A 1 878 ? 48.069  -100.525 6.140   1.00 77.51  ? 924  LEU A CB    1 
ATOM   6890 C  CG    . LEU A 1 878 ? 46.993  -100.153 7.168   1.00 82.73  ? 924  LEU A CG    1 
ATOM   6891 C  CD1   . LEU A 1 878 ? 45.613  -100.432 6.629   1.00 83.20  ? 924  LEU A CD1   1 
ATOM   6892 C  CD2   . LEU A 1 878 ? 47.190  -100.892 8.490   1.00 84.24  ? 924  LEU A CD2   1 
ATOM   6893 N  N     . LEU A 1 879 ? 50.915  -100.104 4.469   1.00 76.74  ? 925  LEU A N     1 
ATOM   6894 C  CA    . LEU A 1 879 ? 51.865  -100.615 3.478   1.00 76.58  ? 925  LEU A CA    1 
ATOM   6895 C  C     . LEU A 1 879 ? 53.307  -100.568 3.993   1.00 79.80  ? 925  LEU A C     1 
ATOM   6896 O  O     . LEU A 1 879 ? 54.050  -101.513 3.744   1.00 78.49  ? 925  LEU A O     1 
ATOM   6897 C  CB    . LEU A 1 879 ? 51.750  -99.878  2.119   1.00 76.60  ? 925  LEU A CB    1 
ATOM   6898 C  CG    . LEU A 1 879 ? 50.445  -100.026 1.320   1.00 81.01  ? 925  LEU A CG    1 
ATOM   6899 C  CD1   . LEU A 1 879 ? 50.463  -99.128  0.108   1.00 81.62  ? 925  LEU A CD1   1 
ATOM   6900 C  CD2   . LEU A 1 879 ? 50.176  -101.470 0.913   1.00 81.62  ? 925  LEU A CD2   1 
ATOM   6901 N  N     . GLN A 1 880 ? 53.709  -99.468  4.684   1.00 77.06  ? 926  GLN A N     1 
ATOM   6902 C  CA    . GLN A 1 880 ? 55.063  -99.322  5.229   1.00 77.93  ? 926  GLN A CA    1 
ATOM   6903 C  C     . GLN A 1 880 ? 55.298  -100.252 6.416   1.00 83.65  ? 926  GLN A C     1 
ATOM   6904 O  O     . GLN A 1 880 ? 56.428  -100.687 6.616   1.00 82.68  ? 926  GLN A O     1 
ATOM   6905 C  CB    . GLN A 1 880 ? 55.443  -97.861  5.545   1.00 79.57  ? 926  GLN A CB    1 
ATOM   6906 C  CG    . GLN A 1 880 ? 54.663  -97.187  6.673   1.00 106.02 ? 926  GLN A CG    1 
ATOM   6907 C  CD    . GLN A 1 880 ? 55.191  -95.815  7.037   1.00 138.31 ? 926  GLN A CD    1 
ATOM   6908 O  OE1   . GLN A 1 880 ? 55.861  -95.126  6.251   1.00 136.01 ? 926  GLN A OE1   1 
ATOM   6909 N  NE2   . GLN A 1 880 ? 54.868  -95.374  8.242   1.00 134.84 ? 926  GLN A NE2   1 
ATOM   6910 N  N     . LYS A 1 881 ? 54.218  -100.566 7.178   1.00 81.91  ? 927  LYS A N     1 
ATOM   6911 C  CA    . LYS A 1 881 ? 54.201  -101.498 8.304   1.00 82.26  ? 927  LYS A CA    1 
ATOM   6912 C  C     . LYS A 1 881 ? 54.363  -102.898 7.749   1.00 89.41  ? 927  LYS A C     1 
ATOM   6913 O  O     . LYS A 1 881 ? 54.998  -103.736 8.376   1.00 89.98  ? 927  LYS A O     1 
ATOM   6914 C  CB    . LYS A 1 881 ? 52.863  -101.430 9.058   1.00 84.02  ? 927  LYS A CB    1 
ATOM   6915 C  CG    . LYS A 1 881 ? 52.868  -100.535 10.278  1.00 94.61  ? 927  LYS A CG    1 
ATOM   6916 C  CD    . LYS A 1 881 ? 51.837  -101.004 11.291  1.00 105.26 ? 927  LYS A CD    1 
ATOM   6917 C  CE    . LYS A 1 881 ? 51.691  -100.061 12.458  1.00 118.50 ? 927  LYS A CE    1 
ATOM   6918 N  NZ    . LYS A 1 881 ? 50.841  -98.891  12.118  1.00 130.59 ? 927  LYS A NZ    1 
ATOM   6919 N  N     . TYR A 1 882 ? 53.778  -103.149 6.577   1.00 87.80  ? 928  TYR A N     1 
ATOM   6920 C  CA    . TYR A 1 882 ? 53.817  -104.429 5.894   1.00 88.64  ? 928  TYR A CA    1 
ATOM   6921 C  C     . TYR A 1 882 ? 55.182  -104.687 5.257   1.00 95.43  ? 928  TYR A C     1 
ATOM   6922 O  O     . TYR A 1 882 ? 55.709  -105.790 5.400   1.00 94.70  ? 928  TYR A O     1 
ATOM   6923 C  CB    . TYR A 1 882 ? 52.693  -104.494 4.843   1.00 89.55  ? 928  TYR A CB    1 
ATOM   6924 C  CG    . TYR A 1 882 ? 52.760  -105.704 3.945   1.00 90.42  ? 928  TYR A CG    1 
ATOM   6925 C  CD1   . TYR A 1 882 ? 53.652  -105.751 2.874   1.00 92.58  ? 928  TYR A CD1   1 
ATOM   6926 C  CD2   . TYR A 1 882 ? 51.909  -106.787 4.134   1.00 90.54  ? 928  TYR A CD2   1 
ATOM   6927 C  CE1   . TYR A 1 882 ? 53.751  -106.878 2.071   1.00 93.33  ? 928  TYR A CE1   1 
ATOM   6928 C  CE2   . TYR A 1 882 ? 51.974  -107.905 3.311   1.00 91.27  ? 928  TYR A CE2   1 
ATOM   6929 C  CZ    . TYR A 1 882 ? 52.899  -107.944 2.282   1.00 99.84  ? 928  TYR A CZ    1 
ATOM   6930 O  OH    . TYR A 1 882 ? 52.985  -109.015 1.447   1.00 102.03 ? 928  TYR A OH    1 
ATOM   6931 N  N     . ASN A 1 883 ? 55.709  -103.711 4.495   1.00 95.05  ? 929  ASN A N     1 
ATOM   6932 C  CA    . ASN A 1 883 ? 56.983  -103.847 3.790   1.00 96.57  ? 929  ASN A CA    1 
ATOM   6933 C  C     . ASN A 1 883 ? 58.173  -103.929 4.742   1.00 104.21 ? 929  ASN A C     1 
ATOM   6934 O  O     . ASN A 1 883 ? 59.135  -104.634 4.436   1.00 103.59 ? 929  ASN A O     1 
ATOM   6935 C  CB    . ASN A 1 883 ? 57.163  -102.760 2.731   1.00 97.79  ? 929  ASN A CB    1 
ATOM   6936 C  CG    . ASN A 1 883 ? 56.351  -103.020 1.484   1.00 121.89 ? 929  ASN A CG    1 
ATOM   6937 O  OD1   . ASN A 1 883 ? 56.622  -103.950 0.713   1.00 114.07 ? 929  ASN A OD1   1 
ATOM   6938 N  ND2   . ASN A 1 883 ? 55.321  -102.214 1.269   1.00 115.14 ? 929  ASN A ND2   1 
ATOM   6939 N  N     . ARG A 1 884 ? 58.088  -103.246 5.906   1.00 103.79 ? 930  ARG A N     1 
ATOM   6940 C  CA    . ARG A 1 884 ? 59.103  -103.272 6.966   1.00 104.87 ? 930  ARG A CA    1 
ATOM   6941 C  C     . ARG A 1 884 ? 59.131  -104.692 7.548   1.00 109.81 ? 930  ARG A C     1 
ATOM   6942 O  O     . ARG A 1 884 ? 60.208  -105.267 7.683   1.00 109.32 ? 930  ARG A O     1 
ATOM   6943 C  CB    . ARG A 1 884 ? 58.772  -102.224 8.053   1.00 107.51 ? 930  ARG A CB    1 
ATOM   6944 C  CG    . ARG A 1 884 ? 59.767  -102.109 9.214   1.00 127.42 ? 930  ARG A CG    1 
ATOM   6945 C  CD    . ARG A 1 884 ? 59.338  -102.892 10.456  1.00 152.01 ? 930  ARG A CD    1 
ATOM   6946 N  NE    . ARG A 1 884 ? 58.131  -102.363 11.098  1.00 172.92 ? 930  ARG A NE    1 
ATOM   6947 C  CZ    . ARG A 1 884 ? 57.499  -102.950 12.112  1.00 193.93 ? 930  ARG A CZ    1 
ATOM   6948 N  NH1   . ARG A 1 884 ? 57.950  -104.093 12.614  1.00 183.43 ? 930  ARG A NH1   1 
ATOM   6949 N  NH2   . ARG A 1 884 ? 56.409  -102.399 12.630  1.00 183.52 ? 930  ARG A NH2   1 
ATOM   6950 N  N     . ILE A 1 885 ? 57.976  -105.286 7.783   1.00 107.56 ? 931  ILE A N     1 
ATOM   6951 C  CA    . ILE A 1 885 ? 57.918  -106.625 8.318   1.00 108.21 ? 931  ILE A CA    1 
ATOM   6952 C  C     . ILE A 1 885 ? 58.506  -107.672 7.404   1.00 116.12 ? 931  ILE A C     1 
ATOM   6953 O  O     . ILE A 1 885 ? 59.199  -108.574 7.826   1.00 116.17 ? 931  ILE A O     1 
ATOM   6954 C  CB    . ILE A 1 885 ? 56.481  -107.020 8.616   1.00 110.87 ? 931  ILE A CB    1 
ATOM   6955 C  CG1   . ILE A 1 885 ? 56.028  -106.359 9.899   1.00 110.99 ? 931  ILE A CG1   1 
ATOM   6956 C  CG2   . ILE A 1 885 ? 56.380  -108.514 8.757   1.00 111.45 ? 931  ILE A CG2   1 
ATOM   6957 C  CD1   . ILE A 1 885 ? 54.610  -106.683 10.262  1.00 118.05 ? 931  ILE A CD1   1 
ATOM   6958 N  N     . LEU A 1 886 ? 58.181  -107.588 6.141   1.00 115.85 ? 932  LEU A N     1 
ATOM   6959 C  CA    . LEU A 1 886 ? 58.733  -108.514 5.195   1.00 117.30 ? 932  LEU A CA    1 
ATOM   6960 C  C     . LEU A 1 886 ? 60.198  -108.304 5.006   1.00 125.25 ? 932  LEU A C     1 
ATOM   6961 O  O     . LEU A 1 886 ? 60.931  -109.232 4.793   1.00 124.72 ? 932  LEU A O     1 
ATOM   6962 C  CB    . LEU A 1 886 ? 58.052  -108.389 3.869   1.00 117.46 ? 932  LEU A CB    1 
ATOM   6963 C  CG    . LEU A 1 886 ? 56.784  -109.188 3.744   1.00 122.43 ? 932  LEU A CG    1 
ATOM   6964 C  CD1   . LEU A 1 886 ? 55.798  -108.573 4.719   1.00 122.56 ? 932  LEU A CD1   1 
ATOM   6965 C  CD2   . LEU A 1 886 ? 56.282  -109.024 2.333   1.00 125.85 ? 932  LEU A CD2   1 
ATOM   6966 N  N     . LYS A 1 887 ? 60.626  -107.062 5.038   1.00 125.28 ? 933  LYS A N     1 
ATOM   6967 C  CA    . LYS A 1 887 ? 62.040  -106.774 4.761   1.00 126.82 ? 933  LYS A CA    1 
ATOM   6968 C  C     . LYS A 1 887 ? 62.916  -107.445 5.829   1.00 134.16 ? 933  LYS A C     1 
ATOM   6969 O  O     . LYS A 1 887 ? 63.916  -108.078 5.487   1.00 133.59 ? 933  LYS A O     1 
ATOM   6970 C  CB    . LYS A 1 887 ? 62.307  -105.258 4.705   1.00 129.94 ? 933  LYS A CB    1 
ATOM   6971 C  CG    . LYS A 1 887 ? 63.514  -104.882 3.851   1.00 151.55 ? 933  LYS A CG    1 
ATOM   6972 C  CD    . LYS A 1 887 ? 63.693  -103.374 3.750   1.00 164.87 ? 933  LYS A CD    1 
ATOM   6973 C  CE    . LYS A 1 887 ? 64.842  -103.004 2.846   1.00 179.35 ? 933  LYS A CE    1 
ATOM   6974 N  NZ    . LYS A 1 887 ? 65.004  -101.532 2.743   1.00 190.24 ? 933  LYS A NZ    1 
ATOM   6975 N  N     . LYS A 1 888 ? 62.511  -107.324 7.116   1.00 133.51 ? 934  LYS A N     1 
ATOM   6976 C  CA    . LYS A 1 888 ? 63.170  -107.915 8.284   1.00 134.56 ? 934  LYS A CA    1 
ATOM   6977 C  C     . LYS A 1 888 ? 63.174  -109.440 8.184   1.00 142.16 ? 934  LYS A C     1 
ATOM   6978 O  O     . LYS A 1 888 ? 64.171  -110.064 8.534   1.00 141.81 ? 934  LYS A O     1 
ATOM   6979 C  CB    . LYS A 1 888 ? 62.488  -107.453 9.581   1.00 137.00 ? 934  LYS A CB    1 
ATOM   6980 C  CG    . LYS A 1 888 ? 62.853  -106.028 9.976   1.00 153.06 ? 934  LYS A CG    1 
ATOM   6981 C  CD    . LYS A 1 888 ? 62.086  -105.551 11.198  1.00 163.99 ? 934  LYS A CD    1 
ATOM   6982 C  CE    . LYS A 1 888 ? 62.587  -104.203 11.653  1.00 175.76 ? 934  LYS A CE    1 
ATOM   6983 N  NZ    . LYS A 1 888 ? 61.758  -103.640 12.750  1.00 184.87 ? 934  LYS A NZ    1 
ATOM   6984 N  N     . LEU A 1 889 ? 62.076  -110.026 7.665   1.00 141.79 ? 935  LEU A N     1 
ATOM   6985 C  CA    . LEU A 1 889 ? 61.893  -111.466 7.438   1.00 143.17 ? 935  LEU A CA    1 
ATOM   6986 C  C     . LEU A 1 889 ? 62.814  -111.958 6.350   1.00 151.71 ? 935  LEU A C     1 
ATOM   6987 O  O     . LEU A 1 889 ? 63.340  -113.061 6.457   1.00 151.34 ? 935  LEU A O     1 
ATOM   6988 C  CB    . LEU A 1 889 ? 60.450  -111.759 7.011   1.00 143.11 ? 935  LEU A CB    1 
ATOM   6989 C  CG    . LEU A 1 889 ? 59.447  -111.931 8.116   1.00 147.72 ? 935  LEU A CG    1 
ATOM   6990 C  CD1   . LEU A 1 889 ? 59.257  -110.650 8.861   1.00 147.85 ? 935  LEU A CD1   1 
ATOM   6991 C  CD2   . LEU A 1 889 ? 58.123  -112.416 7.570   1.00 150.27 ? 935  LEU A CD2   1 
ATOM   6992 N  N     . GLU A 1 890 ? 62.969  -111.157 5.280   1.00 152.00 ? 936  GLU A N     1 
ATOM   6993 C  CA    . GLU A 1 890 ? 63.835  -111.467 4.152   1.00 153.49 ? 936  GLU A CA    1 
ATOM   6994 C  C     . GLU A 1 890 ? 65.274  -111.404 4.631   1.00 160.91 ? 936  GLU A C     1 
ATOM   6995 O  O     . GLU A 1 890 ? 66.032  -112.324 4.347   1.00 160.37 ? 936  GLU A O     1 
ATOM   6996 C  CB    . GLU A 1 890 ? 63.595  -110.485 2.996   1.00 154.98 ? 936  GLU A CB    1 
ATOM   6997 C  CG    . GLU A 1 890 ? 63.684  -111.138 1.628   1.00 166.71 ? 936  GLU A CG    1 
ATOM   6998 C  CD    . GLU A 1 890 ? 63.355  -110.236 0.454   1.00 188.37 ? 936  GLU A CD    1 
ATOM   6999 O  OE1   . GLU A 1 890 ? 64.204  -110.124 -0.459  1.00 185.75 ? 936  GLU A OE1   1 
ATOM   7000 O  OE2   . GLU A 1 890 ? 62.244  -109.657 0.433   1.00 180.41 ? 936  GLU A OE2   1 
ATOM   7001 N  N     . ASN A 1 891 ? 65.617  -110.363 5.428   1.00 160.53 ? 937  ASN A N     1 
ATOM   7002 C  CA    . ASN A 1 891 ? 66.943  -110.139 6.012   1.00 161.83 ? 937  ASN A CA    1 
ATOM   7003 C  C     . ASN A 1 891 ? 67.353  -111.256 6.982   1.00 168.51 ? 937  ASN A C     1 
ATOM   7004 O  O     . ASN A 1 891 ? 68.418  -111.837 6.794   1.00 168.16 ? 937  ASN A O     1 
ATOM   7005 C  CB    . ASN A 1 891 ? 67.022  -108.759 6.687   1.00 164.17 ? 937  ASN A CB    1 
ATOM   7006 C  CG    . ASN A 1 891 ? 68.347  -108.466 7.357   1.00 194.47 ? 937  ASN A CG    1 
ATOM   7007 O  OD1   . ASN A 1 891 ? 69.360  -108.195 6.704   1.00 190.66 ? 937  ASN A OD1   1 
ATOM   7008 N  ND2   . ASN A 1 891 ? 68.365  -108.516 8.681   1.00 187.52 ? 937  ASN A ND2   1 
ATOM   7009 N  N     . TRP A 1 892 ? 66.511  -111.562 7.997   1.00 166.96 ? 938  TRP A N     1 
ATOM   7010 C  CA    . TRP A 1 892 ? 66.771  -112.591 9.015   1.00 167.48 ? 938  TRP A CA    1 
ATOM   7011 C  C     . TRP A 1 892 ? 66.971  -113.991 8.424   1.00 172.41 ? 938  TRP A C     1 
ATOM   7012 O  O     . TRP A 1 892 ? 67.915  -114.676 8.815   1.00 172.00 ? 938  TRP A O     1 
ATOM   7013 C  CB    . TRP A 1 892 ? 65.685  -112.587 10.103  1.00 166.39 ? 938  TRP A CB    1 
ATOM   7014 C  CG    . TRP A 1 892 ? 65.931  -113.552 11.227  1.00 167.53 ? 938  TRP A CG    1 
ATOM   7015 C  CD1   . TRP A 1 892 ? 66.656  -113.328 12.358  1.00 170.41 ? 938  TRP A CD1   1 
ATOM   7016 C  CD2   . TRP A 1 892 ? 65.431  -114.891 11.326  1.00 167.43 ? 938  TRP A CD2   1 
ATOM   7017 N  NE1   . TRP A 1 892 ? 66.638  -114.445 13.161  1.00 169.90 ? 938  TRP A NE1   1 
ATOM   7018 C  CE2   . TRP A 1 892 ? 65.900  -115.422 12.548  1.00 171.35 ? 938  TRP A CE2   1 
ATOM   7019 C  CE3   . TRP A 1 892 ? 64.640  -115.702 10.495  1.00 168.78 ? 938  TRP A CE3   1 
ATOM   7020 C  CZ2   . TRP A 1 892 ? 65.596  -116.726 12.961  1.00 170.69 ? 938  TRP A CZ2   1 
ATOM   7021 C  CZ3   . TRP A 1 892 ? 64.344  -116.993 10.902  1.00 170.25 ? 938  TRP A CZ3   1 
ATOM   7022 C  CH2   . TRP A 1 892 ? 64.824  -117.494 12.118  1.00 170.85 ? 938  TRP A CH2   1 
ATOM   7023 N  N     . ALA A 1 893 ? 66.101  -114.401 7.482   1.00 169.97 ? 939  ALA A N     1 
ATOM   7024 C  CA    . ALA A 1 893 ? 66.176  -115.706 6.820   1.00 170.37 ? 939  ALA A CA    1 
ATOM   7025 C  C     . ALA A 1 893 ? 67.394  -115.828 5.901   1.00 175.37 ? 939  ALA A C     1 
ATOM   7026 O  O     . ALA A 1 893 ? 67.891  -116.937 5.703   1.00 174.88 ? 939  ALA A O     1 
ATOM   7027 C  CB    . ALA A 1 893 ? 64.900  -115.976 6.040   1.00 171.19 ? 939  ALA A CB    1 
ATOM   7028 N  N     . THR A 1 894 ? 67.871  -114.698 5.338   1.00 172.98 ? 940  THR A N     1 
ATOM   7029 C  CA    . THR A 1 894 ? 69.046  -114.693 4.461   1.00 173.29 ? 940  THR A CA    1 
ATOM   7030 C  C     . THR A 1 894 ? 70.340  -114.474 5.256   1.00 177.85 ? 940  THR A C     1 
ATOM   7031 O  O     . THR A 1 894 ? 71.403  -114.850 4.769   1.00 177.44 ? 940  THR A O     1 
ATOM   7032 C  CB    . THR A 1 894 ? 68.898  -113.738 3.275   1.00 182.56 ? 940  THR A CB    1 
ATOM   7033 O  OG1   . THR A 1 894 ? 68.651  -112.417 3.752   1.00 182.95 ? 940  THR A OG1   1 
ATOM   7034 C  CG2   . THR A 1 894 ? 67.820  -114.185 2.285   1.00 181.32 ? 940  THR A CG2   1 
ATOM   7035 N  N     . THR A 1 895 ? 70.263  -113.893 6.478   1.00 174.93 ? 941  THR A N     1 
ATOM   7036 C  CA    . THR A 1 895 ? 71.440  -113.747 7.353   1.00 175.01 ? 941  THR A CA    1 
ATOM   7037 C  C     . THR A 1 895 ? 71.659  -115.102 8.014   1.00 179.01 ? 941  THR A C     1 
ATOM   7038 O  O     . THR A 1 895 ? 72.756  -115.394 8.490   1.00 178.40 ? 941  THR A O     1 
ATOM   7039 C  CB    . THR A 1 895 ? 71.275  -112.651 8.413   1.00 184.24 ? 941  THR A CB    1 
ATOM   7040 O  OG1   . THR A 1 895 ? 70.020  -112.798 9.072   1.00 184.57 ? 941  THR A OG1   1 
ATOM   7041 C  CG2   . THR A 1 895 ? 71.445  -111.247 7.852   1.00 182.93 ? 941  THR A CG2   1 
ATOM   7042 N  N     . LYS A 1 896 ? 70.598  -115.939 8.013   1.00 175.84 ? 942  LYS A N     1 
ATOM   7043 C  CA    . LYS A 1 896 ? 70.588  -117.304 8.520   1.00 175.75 ? 942  LYS A CA    1 
ATOM   7044 C  C     . LYS A 1 896 ? 71.465  -118.196 7.628   1.00 179.68 ? 942  LYS A C     1 
ATOM   7045 O  O     . LYS A 1 896 ? 71.850  -119.275 8.069   1.00 179.22 ? 942  LYS A O     1 
ATOM   7046 C  CB    . LYS A 1 896 ? 69.150  -117.846 8.572   1.00 178.50 ? 942  LYS A CB    1 
ATOM   7047 C  CG    . LYS A 1 896 ? 69.068  -119.274 9.069   1.00 196.84 ? 942  LYS A CG    1 
ATOM   7048 C  CD    . LYS A 1 896 ? 69.578  -119.438 10.498  1.00 209.61 ? 942  LYS A CD    1 
ATOM   7049 C  CE    . LYS A 1 896 ? 69.337  -120.831 11.047  1.00 223.53 ? 942  LYS A CE    1 
ATOM   7050 N  NZ    . LYS A 1 896 ? 70.015  -121.071 12.355  1.00 233.22 ? 942  LYS A NZ    1 
ATOM   7051 N  N     . SER A 1 897 ? 71.823  -117.718 6.402   1.00 176.45 ? 943  SER A N     1 
ATOM   7052 C  CA    . SER A 1 897 ? 72.668  -118.403 5.410   1.00 176.31 ? 943  SER A CA    1 
ATOM   7053 C  C     . SER A 1 897 ? 74.072  -118.791 5.905   1.00 180.10 ? 943  SER A C     1 
ATOM   7054 O  O     . SER A 1 897 ? 74.721  -119.632 5.279   1.00 179.69 ? 943  SER A O     1 
ATOM   7055 C  CB    . SER A 1 897 ? 72.778  -117.587 4.126   1.00 179.95 ? 943  SER A CB    1 
ATOM   7056 O  OG    . SER A 1 897 ? 73.599  -116.444 4.303   1.00 188.52 ? 943  SER A OG    1 
ATOM   7057 N  N     . VAL A 1 898 ? 74.528  -118.194 7.030   1.00 176.49 ? 944  VAL A N     1 
ATOM   7058 C  CA    . VAL A 1 898 ? 75.835  -118.436 7.666   1.00 176.14 ? 944  VAL A CA    1 
ATOM   7059 C  C     . VAL A 1 898 ? 75.922  -119.886 8.246   1.00 179.89 ? 944  VAL A C     1 
ATOM   7060 O  O     . VAL A 1 898 ? 76.978  -120.300 8.732   1.00 179.15 ? 944  VAL A O     1 
ATOM   7061 C  CB    . VAL A 1 898 ? 76.174  -117.316 8.705   1.00 179.93 ? 944  VAL A CB    1 
ATOM   7062 C  CG1   . VAL A 1 898 ? 77.467  -117.611 9.465   1.00 179.72 ? 944  VAL A CG1   1 
ATOM   7063 C  CG2   . VAL A 1 898 ? 76.278  -115.949 8.029   1.00 179.67 ? 944  VAL A CG2   1 
ATOM   7064 N  N     . TYR A 1 899 ? 74.830  -120.671 8.114   1.00 176.85 ? 945  TYR A N     1 
ATOM   7065 C  CA    . TYR A 1 899 ? 74.716  -122.064 8.552   1.00 177.03 ? 945  TYR A CA    1 
ATOM   7066 C  C     . TYR A 1 899 ? 75.718  -123.022 7.859   1.00 181.15 ? 945  TYR A C     1 
ATOM   7067 O  O     . TYR A 1 899 ? 75.901  -124.150 8.323   1.00 181.14 ? 945  TYR A O     1 
ATOM   7068 C  CB    . TYR A 1 899 ? 73.261  -122.570 8.348   1.00 178.55 ? 945  TYR A CB    1 
ATOM   7069 C  CG    . TYR A 1 899 ? 72.785  -122.616 6.906   1.00 181.00 ? 945  TYR A CG    1 
ATOM   7070 C  CD1   . TYR A 1 899 ? 73.238  -123.600 6.030   1.00 183.16 ? 945  TYR A CD1   1 
ATOM   7071 C  CD2   . TYR A 1 899 ? 71.816  -121.734 6.443   1.00 182.00 ? 945  TYR A CD2   1 
ATOM   7072 C  CE1   . TYR A 1 899 ? 72.820  -123.634 4.701   1.00 184.32 ? 945  TYR A CE1   1 
ATOM   7073 C  CE2   . TYR A 1 899 ? 71.376  -121.768 5.120   1.00 183.04 ? 945  TYR A CE2   1 
ATOM   7074 C  CZ    . TYR A 1 899 ? 71.878  -122.723 4.253   1.00 191.11 ? 945  TYR A CZ    1 
ATOM   7075 O  OH    . TYR A 1 899 ? 71.439  -122.767 2.951   1.00 192.77 ? 945  TYR A OH    1 
ATOM   7076 N  N     . LEU A 1 900 ? 76.338  -122.575 6.745   1.00 177.43 ? 946  LEU A N     1 
ATOM   7077 C  CA    . LEU A 1 900 ? 77.234  -123.342 5.871   1.00 177.24 ? 946  LEU A CA    1 
ATOM   7078 C  C     . LEU A 1 900 ? 78.532  -123.886 6.507   1.00 181.22 ? 946  LEU A C     1 
ATOM   7079 O  O     . LEU A 1 900 ? 78.889  -125.030 6.218   1.00 180.44 ? 946  LEU A O     1 
ATOM   7080 C  CB    . LEU A 1 900 ? 77.578  -122.529 4.610   1.00 177.28 ? 946  LEU A CB    1 
ATOM   7081 C  CG    . LEU A 1 900 ? 76.409  -122.213 3.659   1.00 181.99 ? 946  LEU A CG    1 
ATOM   7082 C  CD1   . LEU A 1 900 ? 76.716  -121.007 2.799   1.00 182.17 ? 946  LEU A CD1   1 
ATOM   7083 C  CD2   . LEU A 1 900 ? 76.054  -123.408 2.783   1.00 184.41 ? 946  LEU A CD2   1 
ATOM   7084 N  N     . GLY A 1 901 ? 79.223  -123.074 7.317   1.00 178.43 ? 947  GLY A N     1 
ATOM   7085 C  CA    . GLY A 1 901 ? 80.487  -123.425 7.975   1.00 178.67 ? 947  GLY A CA    1 
ATOM   7086 C  C     . GLY A 1 901 ? 80.500  -124.750 8.720   1.00 183.58 ? 947  GLY A C     1 
ATOM   7087 O  O     . GLY A 1 901 ? 79.498  -125.108 9.347   1.00 183.22 ? 947  GLY A O     1 
ATOM   7088 N  N     . SER A 1 902 ? 81.502  -125.582 8.459   1.00 180.83 ? 948  SER A N     1 
ATOM   7089 C  CA    . SER A 1 902 ? 81.581  -126.892 9.104   1.00 181.00 ? 948  SER A CA    1 
ATOM   7090 C  C     . SER A 1 902 ? 82.962  -127.242 9.643   1.00 185.51 ? 948  SER A C     1 
ATOM   7091 O  O     . SER A 1 902 ? 83.244  -128.407 9.922   1.00 184.99 ? 948  SER A O     1 
ATOM   7092 C  CB    . SER A 1 902 ? 81.108  -127.986 8.142   1.00 184.72 ? 948  SER A CB    1 
ATOM   7093 O  OG    . SER A 1 902 ? 81.909  -128.019 6.973   1.00 193.84 ? 948  SER A OG    1 
ATOM   7094 N  N     . ASN A 1 903 ? 83.821  -126.244 9.790   1.00 182.61 ? 949  ASN A N     1 
ATOM   7095 C  CA    . ASN A 1 903 ? 85.183  -126.501 10.239  1.00 182.57 ? 949  ASN A CA    1 
ATOM   7096 C  C     . ASN A 1 903 ? 85.406  -126.597 11.747  1.00 186.35 ? 949  ASN A C     1 
ATOM   7097 O  O     . ASN A 1 903 ? 85.913  -125.656 12.357  1.00 186.02 ? 949  ASN A O     1 
ATOM   7098 C  CB    . ASN A 1 903 ? 86.137  -125.457 9.647   1.00 183.93 ? 949  ASN A CB    1 
ATOM   7099 C  CG    . ASN A 1 903 ? 86.348  -125.639 8.157   1.00 208.87 ? 949  ASN A CG    1 
ATOM   7100 O  OD1   . ASN A 1 903 ? 86.158  -126.731 7.620   1.00 204.32 ? 949  ASN A OD1   1 
ATOM   7101 N  ND2   . ASN A 1 903 ? 86.744  -124.568 7.480   1.00 200.66 ? 949  ASN A ND2   1 
ATOM   7102 N  N     . GLU A 1 904 ? 85.033  -127.723 12.352  1.00 182.59 ? 950  GLU A N     1 
ATOM   7103 C  CA    . GLU A 1 904 ? 85.302  -127.887 13.775  1.00 182.22 ? 950  GLU A CA    1 
ATOM   7104 C  C     . GLU A 1 904 ? 85.909  -129.173 14.334  1.00 185.43 ? 950  GLU A C     1 
ATOM   7105 O  O     . GLU A 1 904 ? 86.011  -130.193 13.654  1.00 184.98 ? 950  GLU A O     1 
ATOM   7106 C  CB    . GLU A 1 904 ? 83.881  -127.731 14.333  1.00 183.61 ? 950  GLU A CB    1 
ATOM   7107 C  CG    . GLU A 1 904 ? 83.277  -126.344 14.178  1.00 194.35 ? 950  GLU A CG    1 
ATOM   7108 C  CD    . GLU A 1 904 ? 81.849  -126.271 14.681  1.00 213.95 ? 950  GLU A CD    1 
ATOM   7109 O  OE1   . GLU A 1 904 ? 81.265  -127.335 14.974  1.00 208.68 ? 950  GLU A OE1   1 
ATOM   7110 O  OE2   . GLU A 1 904 ? 81.309  -125.148 14.781  1.00 206.33 ? 950  GLU A OE2   1 
ATOM   7111 N  N     . THR A 1 905 ? 86.305  -129.082 15.597  1.00 181.47 ? 951  THR A N     1 
ATOM   7112 C  CA    . THR A 1 905 ? 86.865  -130.186 16.391  1.00 181.00 ? 951  THR A CA    1 
ATOM   7113 C  C     . THR A 1 905 ? 85.766  -130.724 17.340  1.00 183.57 ? 951  THR A C     1 
ATOM   7114 O  O     . THR A 1 905 ? 84.611  -130.320 17.222  1.00 183.19 ? 951  THR A O     1 
ATOM   7115 C  CB    . THR A 1 905 ? 88.098  -129.699 17.193  1.00 190.69 ? 951  THR A CB    1 
ATOM   7116 O  OG1   . THR A 1 905 ? 87.741  -128.557 17.978  1.00 191.29 ? 951  THR A OG1   1 
ATOM   7117 C  CG2   . THR A 1 905 ? 89.303  -129.387 16.309  1.00 189.23 ? 951  THR A CG2   1 
ATOM   7118 N  N     . GLY A 1 906 ? 86.132  -131.622 18.257  1.00 179.00 ? 952  GLY A N     1 
ATOM   7119 C  CA    . GLY A 1 906 ? 85.213  -132.159 19.257  1.00 178.21 ? 952  GLY A CA    1 
ATOM   7120 C  C     . GLY A 1 906 ? 84.922  -131.116 20.318  1.00 180.60 ? 952  GLY A C     1 
ATOM   7121 O  O     . GLY A 1 906 ? 85.745  -130.220 20.532  1.00 180.09 ? 952  GLY A O     1 
ATOM   7122 N  N     . ASP A 1 907 ? 83.751  -131.154 20.939  1.00 176.17 ? 953  ASP A N     1 
ATOM   7123 C  CA    . ASP A 1 907 ? 83.423  -130.181 21.985  1.00 175.59 ? 953  ASP A CA    1 
ATOM   7124 C  C     . ASP A 1 907 ? 82.871  -128.861 21.434  1.00 178.68 ? 953  ASP A C     1 
ATOM   7125 O  O     . ASP A 1 907 ? 82.487  -127.972 22.195  1.00 178.30 ? 953  ASP A O     1 
ATOM   7126 C  CB    . ASP A 1 907 ? 84.648  -129.911 22.862  1.00 177.34 ? 953  ASP A CB    1 
ATOM   7127 C  CG    . ASP A 1 907 ? 84.319  -129.068 24.079  1.00 186.54 ? 953  ASP A CG    1 
ATOM   7128 O  OD1   . ASP A 1 907 ? 83.128  -128.989 24.447  1.00 186.78 ? 953  ASP A OD1   1 
ATOM   7129 O  OD2   . ASP A 1 907 ? 85.253  -128.487 24.671  1.00 192.47 ? 953  ASP A OD2   1 
ATOM   7130 N  N     . SER A 1 908 ? 82.836  -128.772 20.107  1.00 174.50 ? 954  SER A N     1 
ATOM   7131 C  CA    . SER A 1 908 ? 82.263  -127.630 19.414  1.00 173.94 ? 954  SER A CA    1 
ATOM   7132 C  C     . SER A 1 908 ? 80.860  -127.987 18.907  1.00 176.39 ? 954  SER A C     1 
ATOM   7133 O  O     . SER A 1 908 ? 79.953  -127.155 18.927  1.00 175.88 ? 954  SER A O     1 
ATOM   7134 C  CB    . SER A 1 908 ? 83.155  -127.204 18.247  1.00 177.73 ? 954  SER A CB    1 
ATOM   7135 O  OG    . SER A 1 908 ? 83.307  -128.257 17.311  1.00 186.79 ? 954  SER A OG    1 
ATOM   7136 N  N     . ILE A 1 909 ? 80.695  -129.231 18.454  1.00 171.85 ? 955  ILE A N     1 
ATOM   7137 C  CA    . ILE A 1 909 ? 79.413  -129.713 17.925  1.00 171.11 ? 955  ILE A CA    1 
ATOM   7138 C  C     . ILE A 1 909 ? 78.289  -129.742 18.960  1.00 173.29 ? 955  ILE A C     1 
ATOM   7139 O  O     . ILE A 1 909 ? 77.161  -129.336 18.677  1.00 173.02 ? 955  ILE A O     1 
ATOM   7140 C  CB    . ILE A 1 909 ? 79.554  -131.116 17.304  1.00 174.27 ? 955  ILE A CB    1 
ATOM   7141 C  CG1   . ILE A 1 909 ? 80.616  -131.108 16.203  1.00 174.79 ? 955  ILE A CG1   1 
ATOM   7142 C  CG2   . ILE A 1 909 ? 78.217  -131.595 16.759  1.00 175.06 ? 955  ILE A CG2   1 
ATOM   7143 C  CD1   . ILE A 1 909 ? 80.311  -130.156 15.068  1.00 182.36 ? 955  ILE A CD1   1 
ATOM   7144 N  N     . THR A 1 910 ? 78.605  -130.222 20.158  1.00 168.39 ? 956  THR A N     1 
ATOM   7145 C  CA    . THR A 1 910 ? 77.639  -130.264 21.264  1.00 167.56 ? 956  THR A CA    1 
ATOM   7146 C  C     . THR A 1 910 ? 77.215  -128.842 21.668  1.00 169.43 ? 956  THR A C     1 
ATOM   7147 O  O     . THR A 1 910 ? 76.037  -128.620 21.961  1.00 169.05 ? 956  THR A O     1 
ATOM   7148 C  CB    . THR A 1 910 ? 78.175  -131.111 22.438  1.00 176.80 ? 956  THR A CB    1 
ATOM   7149 O  OG1   . THR A 1 910 ? 78.800  -132.291 21.929  1.00 177.06 ? 956  THR A OG1   1 
ATOM   7150 C  CG2   . THR A 1 910 ? 77.079  -131.508 23.429  1.00 175.39 ? 956  THR A CG2   1 
ATOM   7151 N  N     . ALA A 1 911 ? 78.166  -127.884 21.646  1.00 164.43 ? 957  ALA A N     1 
ATOM   7152 C  CA    . ALA A 1 911 ? 77.913  -126.474 21.949  1.00 163.56 ? 957  ALA A CA    1 
ATOM   7153 C  C     . ALA A 1 911 ? 77.039  -125.850 20.855  1.00 165.94 ? 957  ALA A C     1 
ATOM   7154 O  O     . ALA A 1 911 ? 76.117  -125.105 21.178  1.00 165.50 ? 957  ALA A O     1 
ATOM   7155 C  CB    . ALA A 1 911 ? 79.226  -125.717 22.080  1.00 164.28 ? 957  ALA A CB    1 
ATOM   7156 N  N     . VAL A 1 912 ? 77.302  -126.195 19.570  1.00 161.22 ? 958  VAL A N     1 
ATOM   7157 C  CA    . VAL A 1 912 ? 76.540  -125.741 18.395  1.00 160.34 ? 958  VAL A CA    1 
ATOM   7158 C  C     . VAL A 1 912 ? 75.113  -126.319 18.460  1.00 162.45 ? 958  VAL A C     1 
ATOM   7159 O  O     . VAL A 1 912 ? 74.149  -125.582 18.240  1.00 162.05 ? 958  VAL A O     1 
ATOM   7160 C  CB    . VAL A 1 912 ? 77.284  -126.065 17.062  1.00 164.32 ? 958  VAL A CB    1 
ATOM   7161 C  CG1   . VAL A 1 912 ? 76.355  -126.004 15.849  1.00 164.18 ? 958  VAL A CG1   1 
ATOM   7162 C  CG2   . VAL A 1 912 ? 78.479  -125.135 16.861  1.00 164.15 ? 958  VAL A CG2   1 
ATOM   7163 N  N     . GLN A 1 913 ? 74.990  -127.619 18.822  1.00 157.58 ? 959  GLN A N     1 
ATOM   7164 C  CA    . GLN A 1 913 ? 73.715  -128.327 18.980  1.00 156.70 ? 959  GLN A CA    1 
ATOM   7165 C  C     . GLN A 1 913 ? 72.869  -127.738 20.110  1.00 159.49 ? 959  GLN A C     1 
ATOM   7166 O  O     . GLN A 1 913 ? 71.647  -127.863 20.075  1.00 159.01 ? 959  GLN A O     1 
ATOM   7167 C  CB    . GLN A 1 913 ? 73.938  -129.825 19.197  1.00 157.97 ? 959  GLN A CB    1 
ATOM   7168 C  CG    . GLN A 1 913 ? 74.223  -130.587 17.910  1.00 175.23 ? 959  GLN A CG    1 
ATOM   7169 C  CD    . GLN A 1 913 ? 74.885  -131.927 18.139  1.00 201.48 ? 959  GLN A CD    1 
ATOM   7170 O  OE1   . GLN A 1 913 ? 75.282  -132.292 19.254  1.00 199.35 ? 959  GLN A OE1   1 
ATOM   7171 N  NE2   . GLN A 1 913 ? 75.044  -132.687 17.069  1.00 195.16 ? 959  GLN A NE2   1 
ATOM   7172 N  N     . ALA A 1 914 ? 73.515  -127.090 21.100  1.00 155.53 ? 960  ALA A N     1 
ATOM   7173 C  CA    . ALA A 1 914 ? 72.835  -126.417 22.206  1.00 155.14 ? 960  ALA A CA    1 
ATOM   7174 C  C     . ALA A 1 914 ? 72.334  -125.035 21.742  1.00 158.74 ? 960  ALA A C     1 
ATOM   7175 O  O     . ALA A 1 914 ? 71.283  -124.583 22.203  1.00 158.34 ? 960  ALA A O     1 
ATOM   7176 C  CB    . ALA A 1 914 ? 73.774  -126.270 23.395  1.00 155.83 ? 960  ALA A CB    1 
ATOM   7177 N  N     . LYS A 1 915 ? 73.079  -124.383 20.817  1.00 154.91 ? 961  LYS A N     1 
ATOM   7178 C  CA    . LYS A 1 915 ? 72.740  -123.071 20.246  1.00 154.47 ? 961  LYS A CA    1 
ATOM   7179 C  C     . LYS A 1 915 ? 71.675  -123.197 19.144  1.00 157.40 ? 961  LYS A C     1 
ATOM   7180 O  O     . LYS A 1 915 ? 70.984  -122.223 18.851  1.00 156.77 ? 961  LYS A O     1 
ATOM   7181 C  CB    . LYS A 1 915 ? 73.996  -122.342 19.722  1.00 157.14 ? 961  LYS A CB    1 
ATOM   7182 C  CG    . LYS A 1 915 ? 75.068  -122.090 20.791  1.00 174.13 ? 961  LYS A CG    1 
ATOM   7183 C  CD    . LYS A 1 915 ? 76.239  -121.213 20.328  1.00 186.87 ? 961  LYS A CD    1 
ATOM   7184 C  CE    . LYS A 1 915 ? 77.124  -121.784 19.241  1.00 201.57 ? 961  LYS A CE    1 
ATOM   7185 N  NZ    . LYS A 1 915 ? 78.071  -120.762 18.716  1.00 211.99 ? 961  LYS A NZ    1 
ATOM   7186 N  N     . LEU A 1 916 ? 71.540  -124.399 18.550  1.00 153.60 ? 962  LEU A N     1 
ATOM   7187 C  CA    . LEU A 1 916 ? 70.565  -124.724 17.508  1.00 153.40 ? 962  LEU A CA    1 
ATOM   7188 C  C     . LEU A 1 916 ? 69.177  -124.997 18.132  1.00 159.04 ? 962  LEU A C     1 
ATOM   7189 O  O     . LEU A 1 916 ? 68.166  -124.913 17.432  1.00 158.64 ? 962  LEU A O     1 
ATOM   7190 C  CB    . LEU A 1 916 ? 71.064  -125.941 16.708  1.00 153.20 ? 962  LEU A CB    1 
ATOM   7191 C  CG    . LEU A 1 916 ? 70.408  -126.216 15.358  1.00 157.53 ? 962  LEU A CG    1 
ATOM   7192 C  CD1   . LEU A 1 916 ? 71.449  -126.448 14.287  1.00 157.43 ? 962  LEU A CD1   1 
ATOM   7193 C  CD2   . LEU A 1 916 ? 69.476  -127.411 15.442  1.00 160.24 ? 962  LEU A CD2   1 
ATOM   7194 N  N     . LYS A 1 917 ? 69.137  -125.311 19.447  1.00 157.19 ? 963  LYS A N     1 
ATOM   7195 C  CA    . LYS A 1 917 ? 67.919  -125.590 20.221  1.00 157.79 ? 963  LYS A CA    1 
ATOM   7196 C  C     . LYS A 1 917 ? 67.141  -124.311 20.524  1.00 163.39 ? 963  LYS A C     1 
ATOM   7197 O  O     . LYS A 1 917 ? 65.918  -124.301 20.379  1.00 163.05 ? 963  LYS A O     1 
ATOM   7198 C  CB    . LYS A 1 917 ? 68.260  -126.315 21.532  1.00 160.57 ? 963  LYS A CB    1 
ATOM   7199 C  CG    . LYS A 1 917 ? 67.828  -127.777 21.566  1.00 177.81 ? 963  LYS A CG    1 
ATOM   7200 C  CD    . LYS A 1 917 ? 68.043  -128.408 22.947  1.00 189.34 ? 963  LYS A CD    1 
ATOM   7201 C  CE    . LYS A 1 917 ? 69.441  -128.955 23.128  1.00 201.55 ? 963  LYS A CE    1 
ATOM   7202 N  NZ    . LYS A 1 917 ? 69.651  -129.526 24.482  1.00 211.30 ? 963  LYS A NZ    1 
ATOM   7203 N  N     . ASN A 1 918 ? 67.851  -123.237 20.959  1.00 161.30 ? 964  ASN A N     1 
ATOM   7204 C  CA    . ASN A 1 918 ? 67.302  -121.904 21.267  1.00 161.71 ? 964  ASN A CA    1 
ATOM   7205 C  C     . ASN A 1 918 ? 66.766  -121.289 19.998  1.00 166.23 ? 964  ASN A C     1 
ATOM   7206 O  O     . ASN A 1 918 ? 65.828  -120.492 20.028  1.00 165.59 ? 964  ASN A O     1 
ATOM   7207 C  CB    . ASN A 1 918 ? 68.402  -120.974 21.784  1.00 164.00 ? 964  ASN A CB    1 
ATOM   7208 C  CG    . ASN A 1 918 ? 69.088  -121.394 23.055  1.00 193.55 ? 964  ASN A CG    1 
ATOM   7209 O  OD1   . ASN A 1 918 ? 69.035  -122.553 23.486  1.00 189.73 ? 964  ASN A OD1   1 
ATOM   7210 N  ND2   . ASN A 1 918 ? 69.790  -120.453 23.662  1.00 186.23 ? 964  ASN A ND2   1 
ATOM   7211 N  N     . LEU A 1 919 ? 67.400  -121.647 18.881  1.00 163.68 ? 965  LEU A N     1 
ATOM   7212 C  CA    . LEU A 1 919 ? 67.061  -121.188 17.557  1.00 163.95 ? 965  LEU A CA    1 
ATOM   7213 C  C     . LEU A 1 919 ? 65.704  -121.733 17.089  1.00 169.02 ? 965  LEU A C     1 
ATOM   7214 O  O     . LEU A 1 919 ? 65.177  -121.214 16.119  1.00 168.62 ? 965  LEU A O     1 
ATOM   7215 C  CB    . LEU A 1 919 ? 68.222  -121.502 16.600  1.00 163.99 ? 965  LEU A CB    1 
ATOM   7216 C  CG    . LEU A 1 919 ? 69.053  -120.303 16.095  1.00 168.66 ? 965  LEU A CG    1 
ATOM   7217 C  CD1   . LEU A 1 919 ? 69.715  -119.540 17.236  1.00 168.79 ? 965  LEU A CD1   1 
ATOM   7218 C  CD2   . LEU A 1 919 ? 70.119  -120.753 15.116  1.00 171.13 ? 965  LEU A CD2   1 
ATOM   7219 N  N     . GLU A 1 920 ? 65.088  -122.683 17.841  1.00 166.63 ? 966  GLU A N     1 
ATOM   7220 C  CA    . GLU A 1 920 ? 63.748  -123.213 17.555  1.00 166.95 ? 966  GLU A CA    1 
ATOM   7221 C  C     . GLU A 1 920 ? 62.627  -122.309 18.118  1.00 170.71 ? 966  GLU A C     1 
ATOM   7222 O  O     . GLU A 1 920 ? 61.445  -122.588 17.898  1.00 170.05 ? 966  GLU A O     1 
ATOM   7223 C  CB    . GLU A 1 920 ? 63.591  -124.678 17.987  1.00 168.62 ? 966  GLU A CB    1 
ATOM   7224 C  CG    . GLU A 1 920 ? 63.898  -125.647 16.853  1.00 182.31 ? 966  GLU A CG    1 
ATOM   7225 C  CD    . GLU A 1 920 ? 63.955  -127.128 17.185  1.00 210.54 ? 966  GLU A CD    1 
ATOM   7226 O  OE1   . GLU A 1 920 ? 63.397  -127.542 18.227  1.00 208.75 ? 966  GLU A OE1   1 
ATOM   7227 O  OE2   . GLU A 1 920 ? 64.542  -127.883 16.375  1.00 207.82 ? 966  GLU A OE2   1 
ATOM   7228 N  N     . ALA A 1 921 ? 63.013  -121.196 18.792  1.00 167.41 ? 967  ALA A N     1 
ATOM   7229 C  CA    . ALA A 1 921 ? 62.107  -120.168 19.320  1.00 167.16 ? 967  ALA A CA    1 
ATOM   7230 C  C     . ALA A 1 921 ? 61.837  -119.121 18.221  1.00 170.43 ? 967  ALA A C     1 
ATOM   7231 O  O     . ALA A 1 921 ? 61.246  -118.071 18.482  1.00 169.78 ? 967  ALA A O     1 
ATOM   7232 C  CB    . ALA A 1 921 ? 62.713  -119.508 20.553  1.00 167.94 ? 967  ALA A CB    1 
ATOM   7233 N  N     . PHE A 1 922 ? 62.263  -119.444 16.980  1.00 167.00 ? 968  PHE A N     1 
ATOM   7234 C  CA    . PHE A 1 922 ? 62.077  -118.657 15.762  1.00 166.91 ? 968  PHE A CA    1 
ATOM   7235 C  C     . PHE A 1 922 ? 60.604  -118.651 15.362  1.00 169.50 ? 968  PHE A C     1 
ATOM   7236 O  O     . PHE A 1 922 ? 60.170  -117.744 14.660  1.00 169.22 ? 968  PHE A O     1 
ATOM   7237 C  CB    . PHE A 1 922 ? 62.940  -119.213 14.611  1.00 169.17 ? 968  PHE A CB    1 
ATOM   7238 C  CG    . PHE A 1 922 ? 62.510  -120.545 14.032  1.00 171.40 ? 968  PHE A CG    1 
ATOM   7239 C  CD1   . PHE A 1 922 ? 62.907  -121.739 14.619  1.00 174.25 ? 968  PHE A CD1   1 
ATOM   7240 C  CD2   . PHE A 1 922 ? 61.728  -120.605 12.885  1.00 174.91 ? 968  PHE A CD2   1 
ATOM   7241 C  CE1   . PHE A 1 922 ? 62.527  -122.971 14.082  1.00 177.31 ? 968  PHE A CE1   1 
ATOM   7242 C  CE2   . PHE A 1 922 ? 61.334  -121.839 12.352  1.00 176.15 ? 968  PHE A CE2   1 
ATOM   7243 C  CZ    . PHE A 1 922 ? 61.738  -123.013 12.954  1.00 175.48 ? 968  PHE A CZ    1 
ATOM   7244 N  N     . ASP A 1 923 ? 59.846  -119.684 15.787  1.00 164.92 ? 969  ASP A N     1 
ATOM   7245 C  CA    . ASP A 1 923 ? 58.410  -119.809 15.537  1.00 164.17 ? 969  ASP A CA    1 
ATOM   7246 C  C     . ASP A 1 923 ? 57.669  -118.681 16.259  1.00 165.83 ? 969  ASP A C     1 
ATOM   7247 O  O     . ASP A 1 923 ? 56.591  -118.288 15.817  1.00 165.57 ? 969  ASP A O     1 
ATOM   7248 C  CB    . ASP A 1 923 ? 57.881  -121.183 15.991  1.00 166.30 ? 969  ASP A CB    1 
ATOM   7249 C  CG    . ASP A 1 923 ? 58.546  -122.384 15.337  1.00 178.23 ? 969  ASP A CG    1 
ATOM   7250 O  OD1   . ASP A 1 923 ? 58.545  -122.459 14.086  1.00 178.92 ? 969  ASP A OD1   1 
ATOM   7251 O  OD2   . ASP A 1 923 ? 59.016  -123.276 16.076  1.00 184.84 ? 969  ASP A OD2   1 
ATOM   7252 N  N     . GLY A 1 924 ? 58.282  -118.150 17.327  1.00 160.54 ? 970  GLY A N     1 
ATOM   7253 C  CA    . GLY A 1 924 ? 57.788  -117.017 18.105  1.00 159.57 ? 970  GLY A CA    1 
ATOM   7254 C  C     . GLY A 1 924 ? 57.686  -115.766 17.256  1.00 161.48 ? 970  GLY A C     1 
ATOM   7255 O  O     . GLY A 1 924 ? 56.873  -114.880 17.532  1.00 160.97 ? 970  GLY A O     1 
ATOM   7256 N  N     . GLU A 1 925 ? 58.512  -115.708 16.195  1.00 156.50 ? 971  GLU A N     1 
ATOM   7257 C  CA    . GLU A 1 925 ? 58.524  -114.659 15.190  1.00 155.52 ? 971  GLU A CA    1 
ATOM   7258 C  C     . GLU A 1 925 ? 57.369  -114.981 14.237  1.00 157.63 ? 971  GLU A C     1 
ATOM   7259 O  O     . GLU A 1 925 ? 56.453  -114.170 14.123  1.00 157.35 ? 971  GLU A O     1 
ATOM   7260 C  CB    . GLU A 1 925 ? 59.860  -114.664 14.436  1.00 156.86 ? 971  GLU A CB    1 
ATOM   7261 C  CG    . GLU A 1 925 ? 60.548  -113.319 14.340  1.00 168.07 ? 971  GLU A CG    1 
ATOM   7262 C  CD    . GLU A 1 925 ? 61.783  -113.374 13.464  1.00 193.00 ? 971  GLU A CD    1 
ATOM   7263 O  OE1   . GLU A 1 925 ? 61.701  -112.946 12.291  1.00 190.84 ? 971  GLU A OE1   1 
ATOM   7264 O  OE2   . GLU A 1 925 ? 62.816  -113.903 13.931  1.00 189.47 ? 971  GLU A OE2   1 
ATOM   7265 N  N     . CYS A 1 926 ? 57.367  -116.198 13.625  1.00 152.56 ? 972  CYS A N     1 
ATOM   7266 C  CA    . CYS A 1 926 ? 56.338  -116.692 12.695  1.00 151.60 ? 972  CYS A CA    1 
ATOM   7267 C  C     . CYS A 1 926 ? 54.910  -116.565 13.235  1.00 153.54 ? 972  CYS A C     1 
ATOM   7268 O  O     . CYS A 1 926 ? 53.976  -116.434 12.451  1.00 152.65 ? 972  CYS A O     1 
ATOM   7269 C  CB    . CYS A 1 926 ? 56.643  -118.120 12.249  1.00 151.94 ? 972  CYS A CB    1 
ATOM   7270 S  SG    . CYS A 1 926 ? 58.083  -118.265 11.158  1.00 155.87 ? 972  CYS A SG    1 
ATOM   7271 N  N     . GLN A 1 927 ? 54.752  -116.583 14.566  1.00 149.47 ? 973  GLN A N     1 
ATOM   7272 C  CA    . GLN A 1 927 ? 53.473  -116.428 15.259  1.00 148.97 ? 973  GLN A CA    1 
ATOM   7273 C  C     . GLN A 1 927 ? 53.068  -114.951 15.230  1.00 150.68 ? 973  GLN A C     1 
ATOM   7274 O  O     . GLN A 1 927 ? 51.919  -114.640 14.917  1.00 150.32 ? 973  GLN A O     1 
ATOM   7275 C  CB    . GLN A 1 927 ? 53.593  -116.932 16.714  1.00 150.61 ? 973  GLN A CB    1 
ATOM   7276 C  CG    . GLN A 1 927 ? 52.259  -117.149 17.438  1.00 169.95 ? 973  GLN A CG    1 
ATOM   7277 C  CD    . GLN A 1 927 ? 52.419  -117.587 18.880  1.00 194.21 ? 973  GLN A CD    1 
ATOM   7278 O  OE1   . GLN A 1 927 ? 53.406  -118.222 19.272  1.00 191.73 ? 973  GLN A OE1   1 
ATOM   7279 N  NE2   . GLN A 1 927 ? 51.424  -117.287 19.700  1.00 186.73 ? 973  GLN A NE2   1 
ATOM   7280 N  N     . SER A 1 928 ? 54.019  -114.049 15.548  1.00 145.58 ? 974  SER A N     1 
ATOM   7281 C  CA    . SER A 1 928 ? 53.806  -112.605 15.581  1.00 144.63 ? 974  SER A CA    1 
ATOM   7282 C  C     . SER A 1 928 ? 53.654  -111.999 14.194  1.00 146.86 ? 974  SER A C     1 
ATOM   7283 O  O     . SER A 1 928 ? 52.752  -111.195 13.998  1.00 146.50 ? 974  SER A O     1 
ATOM   7284 C  CB    . SER A 1 928 ? 54.931  -111.908 16.338  1.00 147.88 ? 974  SER A CB    1 
ATOM   7285 O  OG    . SER A 1 928 ? 54.825  -112.101 17.738  1.00 156.06 ? 974  SER A OG    1 
ATOM   7286 N  N     . LEU A 1 929 ? 54.519  -112.385 13.237  1.00 142.08 ? 975  LEU A N     1 
ATOM   7287 C  CA    . LEU A 1 929 ? 54.538  -111.873 11.863  1.00 141.30 ? 975  LEU A CA    1 
ATOM   7288 C  C     . LEU A 1 929 ? 53.305  -112.244 11.057  1.00 143.72 ? 975  LEU A C     1 
ATOM   7289 O  O     . LEU A 1 929 ? 52.681  -111.352 10.491  1.00 143.31 ? 975  LEU A O     1 
ATOM   7290 C  CB    . LEU A 1 929 ? 55.819  -112.282 11.131  1.00 141.39 ? 975  LEU A CB    1 
ATOM   7291 C  CG    . LEU A 1 929 ? 57.100  -112.017 11.899  1.00 146.43 ? 975  LEU A CG    1 
ATOM   7292 C  CD1   . LEU A 1 929 ? 58.178  -112.979 11.491  1.00 146.85 ? 975  LEU A CD1   1 
ATOM   7293 C  CD2   . LEU A 1 929 ? 57.506  -110.544 11.856  1.00 149.08 ? 975  LEU A CD2   1 
ATOM   7294 N  N     . GLU A 1 930 ? 52.933  -113.542 11.028  1.00 139.17 ? 976  GLU A N     1 
ATOM   7295 C  CA    . GLU A 1 930 ? 51.729  -114.033 10.350  1.00 138.44 ? 976  GLU A CA    1 
ATOM   7296 C  C     . GLU A 1 930 ? 50.499  -113.425 11.042  1.00 141.80 ? 976  GLU A C     1 
ATOM   7297 O  O     . GLU A 1 930 ? 49.499  -113.163 10.384  1.00 141.41 ? 976  GLU A O     1 
ATOM   7298 C  CB    . GLU A 1 930 ? 51.699  -115.573 10.355  1.00 139.64 ? 976  GLU A CB    1 
ATOM   7299 C  CG    . GLU A 1 930 ? 50.543  -116.221 9.610   1.00 147.30 ? 976  GLU A CG    1 
ATOM   7300 C  CD    . GLU A 1 930 ? 49.284  -116.449 10.423  1.00 159.74 ? 976  GLU A CD    1 
ATOM   7301 O  OE1   . GLU A 1 930 ? 49.354  -116.419 11.673  1.00 144.43 ? 976  GLU A OE1   1 
ATOM   7302 O  OE2   . GLU A 1 930 ? 48.219  -116.657 9.802   1.00 155.61 ? 976  GLU A OE2   1 
ATOM   7303 N  N     . GLY A 1 931 ? 50.617  -113.164 12.343  1.00 138.21 ? 977  GLY A N     1 
ATOM   7304 C  CA    . GLY A 1 931 ? 49.589  -112.513 13.145  1.00 138.09 ? 977  GLY A CA    1 
ATOM   7305 C  C     . GLY A 1 931 ? 49.491  -111.021 12.865  1.00 142.22 ? 977  GLY A C     1 
ATOM   7306 O  O     . GLY A 1 931 ? 48.424  -110.431 13.045  1.00 141.64 ? 977  GLY A O     1 
ATOM   7307 N  N     . GLN A 1 932 ? 50.608  -110.399 12.419  1.00 139.14 ? 978  GLN A N     1 
ATOM   7308 C  CA    . GLN A 1 932 ? 50.692  -108.972 12.085  1.00 139.15 ? 978  GLN A CA    1 
ATOM   7309 C  C     . GLN A 1 932 ? 50.275  -108.698 10.642  1.00 143.56 ? 978  GLN A C     1 
ATOM   7310 O  O     . GLN A 1 932 ? 49.512  -107.761 10.402  1.00 143.10 ? 978  GLN A O     1 
ATOM   7311 C  CB    . GLN A 1 932 ? 52.105  -108.432 12.320  1.00 140.50 ? 978  GLN A CB    1 
ATOM   7312 C  CG    . GLN A 1 932 ? 52.373  -108.000 13.746  1.00 158.60 ? 978  GLN A CG    1 
ATOM   7313 C  CD    . GLN A 1 932 ? 53.843  -107.753 13.947  1.00 183.81 ? 978  GLN A CD    1 
ATOM   7314 O  OE1   . GLN A 1 932 ? 54.305  -106.609 13.989  1.00 180.77 ? 978  GLN A OE1   1 
ATOM   7315 N  NE2   . GLN A 1 932 ? 54.618  -108.819 14.096  1.00 177.89 ? 978  GLN A NE2   1 
ATOM   7316 N  N     . SER A 1 933 ? 50.798  -109.499 9.683   1.00 140.42 ? 979  SER A N     1 
ATOM   7317 C  CA    . SER A 1 933 ? 50.499  -109.398 8.255   1.00 140.32 ? 979  SER A CA    1 
ATOM   7318 C  C     . SER A 1 933 ? 49.009  -109.609 7.996   1.00 145.89 ? 979  SER A C     1 
ATOM   7319 O  O     . SER A 1 933 ? 48.420  -108.804 7.281   1.00 145.43 ? 979  SER A O     1 
ATOM   7320 C  CB    . SER A 1 933 ? 51.343  -110.379 7.446   1.00 142.58 ? 979  SER A CB    1 
ATOM   7321 O  OG    . SER A 1 933 ? 52.651  -109.872 7.239   1.00 147.45 ? 979  SER A OG    1 
ATOM   7322 N  N     . ASN A 1 934 ? 48.389  -110.638 8.633   1.00 143.73 ? 980  ASN A N     1 
ATOM   7323 C  CA    . ASN A 1 934 ? 46.950  -110.931 8.534   1.00 144.03 ? 980  ASN A CA    1 
ATOM   7324 C  C     . ASN A 1 934 ? 46.114  -109.773 9.084   1.00 148.72 ? 980  ASN A C     1 
ATOM   7325 O  O     . ASN A 1 934 ? 45.057  -109.486 8.530   1.00 148.45 ? 980  ASN A O     1 
ATOM   7326 C  CB    . ASN A 1 934 ? 46.584  -112.238 9.257   1.00 145.25 ? 980  ASN A CB    1 
ATOM   7327 C  CG    . ASN A 1 934 ? 46.780  -113.514 8.461   1.00 170.30 ? 980  ASN A CG    1 
ATOM   7328 O  OD1   . ASN A 1 934 ? 47.635  -113.619 7.572   1.00 165.26 ? 980  ASN A OD1   1 
ATOM   7329 N  ND2   . ASN A 1 934 ? 46.014  -114.538 8.803   1.00 162.64 ? 980  ASN A ND2   1 
ATOM   7330 N  N     . SER A 1 935 ? 46.601  -109.101 10.154  1.00 145.80 ? 981  SER A N     1 
ATOM   7331 C  CA    . SER A 1 935 ? 45.956  -107.940 10.774  1.00 145.96 ? 981  SER A CA    1 
ATOM   7332 C  C     . SER A 1 935 ? 46.092  -106.718 9.864   1.00 150.68 ? 981  SER A C     1 
ATOM   7333 O  O     . SER A 1 935 ? 45.145  -105.936 9.761   1.00 150.41 ? 981  SER A O     1 
ATOM   7334 C  CB    . SER A 1 935 ? 46.561  -107.649 12.144  1.00 149.61 ? 981  SER A CB    1 
ATOM   7335 O  OG    . SER A 1 935 ? 45.941  -106.534 12.762  1.00 158.16 ? 981  SER A OG    1 
ATOM   7336 N  N     . ASP A 1 936 ? 47.265  -106.559 9.206   1.00 147.57 ? 982  ASP A N     1 
ATOM   7337 C  CA    . ASP A 1 936 ? 47.520  -105.472 8.260   1.00 147.44 ? 982  ASP A CA    1 
ATOM   7338 C  C     . ASP A 1 936 ? 46.600  -105.660 7.059   1.00 151.74 ? 982  ASP A C     1 
ATOM   7339 O  O     . ASP A 1 936 ? 45.837  -104.751 6.735   1.00 151.09 ? 982  ASP A O     1 
ATOM   7340 C  CB    . ASP A 1 936 ? 48.999  -105.439 7.825   1.00 149.14 ? 982  ASP A CB    1 
ATOM   7341 C  CG    . ASP A 1 936 ? 49.962  -104.911 8.874   1.00 158.36 ? 982  ASP A CG    1 
ATOM   7342 O  OD1   . ASP A 1 936 ? 49.704  -103.816 9.422   1.00 158.69 ? 982  ASP A OD1   1 
ATOM   7343 O  OD2   . ASP A 1 936 ? 51.004  -105.557 9.099   1.00 163.91 ? 982  ASP A OD2   1 
ATOM   7344 N  N     . LEU A 1 937 ? 46.597  -106.878 6.481   1.00 149.13 ? 983  LEU A N     1 
ATOM   7345 C  CA    . LEU A 1 937 ? 45.764  -107.263 5.343   1.00 149.52 ? 983  LEU A CA    1 
ATOM   7346 C  C     . LEU A 1 937 ? 44.266  -107.287 5.669   1.00 155.71 ? 983  LEU A C     1 
ATOM   7347 O  O     . LEU A 1 937 ? 43.470  -107.108 4.755   1.00 155.44 ? 983  LEU A O     1 
ATOM   7348 C  CB    . LEU A 1 937 ? 46.222  -108.594 4.711   1.00 149.45 ? 983  LEU A CB    1 
ATOM   7349 C  CG    . LEU A 1 937 ? 47.679  -108.690 4.212   1.00 154.05 ? 983  LEU A CG    1 
ATOM   7350 C  CD1   . LEU A 1 937 ? 48.005  -110.093 3.768   1.00 154.22 ? 983  LEU A CD1   1 
ATOM   7351 C  CD2   . LEU A 1 937 ? 47.976  -107.706 3.091   1.00 156.33 ? 983  LEU A CD2   1 
ATOM   7352 N  N     . LEU A 1 938 ? 43.879  -107.478 6.955   1.00 154.05 ? 984  LEU A N     1 
ATOM   7353 C  CA    . LEU A 1 938 ? 42.471  -107.458 7.389   1.00 154.74 ? 984  LEU A CA    1 
ATOM   7354 C  C     . LEU A 1 938 ? 41.963  -106.010 7.382   1.00 159.84 ? 984  LEU A C     1 
ATOM   7355 O  O     . LEU A 1 938 ? 40.851  -105.758 6.913   1.00 159.36 ? 984  LEU A O     1 
ATOM   7356 C  CB    . LEU A 1 938 ? 42.297  -108.101 8.789   1.00 154.99 ? 984  LEU A CB    1 
ATOM   7357 C  CG    . LEU A 1 938 ? 40.900  -108.093 9.448   1.00 160.06 ? 984  LEU A CG    1 
ATOM   7358 C  CD1   . LEU A 1 938 ? 39.944  -109.070 8.768   1.00 160.37 ? 984  LEU A CD1   1 
ATOM   7359 C  CD2   . LEU A 1 938 ? 40.998  -108.440 10.921  1.00 162.93 ? 984  LEU A CD2   1 
ATOM   7360 N  N     . SER A 1 939 ? 42.794  -105.067 7.889   1.00 157.38 ? 985  SER A N     1 
ATOM   7361 C  CA    . SER A 1 939 ? 42.499  -103.633 7.937   1.00 157.65 ? 985  SER A CA    1 
ATOM   7362 C  C     . SER A 1 939 ? 42.408  -103.060 6.524   1.00 163.43 ? 985  SER A C     1 
ATOM   7363 O  O     . SER A 1 939 ? 41.547  -102.218 6.270   1.00 163.39 ? 985  SER A O     1 
ATOM   7364 C  CB    . SER A 1 939 ? 43.562  -102.891 8.740   1.00 160.51 ? 985  SER A CB    1 
ATOM   7365 O  OG    . SER A 1 939 ? 43.482  -103.189 10.124  1.00 167.54 ? 985  SER A OG    1 
ATOM   7366 N  N     . ILE A 1 940 ? 43.276  -103.544 5.606   1.00 160.92 ? 986  ILE A N     1 
ATOM   7367 C  CA    . ILE A 1 940 ? 43.330  -103.154 4.192   1.00 161.14 ? 986  ILE A CA    1 
ATOM   7368 C  C     . ILE A 1 940 ? 41.998  -103.489 3.474   1.00 166.29 ? 986  ILE A C     1 
ATOM   7369 O  O     . ILE A 1 940 ? 41.440  -102.608 2.823   1.00 165.95 ? 986  ILE A O     1 
ATOM   7370 C  CB    . ILE A 1 940 ? 44.599  -103.759 3.503   1.00 164.15 ? 986  ILE A CB    1 
ATOM   7371 C  CG1   . ILE A 1 940 ? 45.878  -103.006 3.936   1.00 164.64 ? 986  ILE A CG1   1 
ATOM   7372 C  CG2   . ILE A 1 940 ? 44.489  -103.789 1.973   1.00 164.75 ? 986  ILE A CG2   1 
ATOM   7373 C  CD1   . ILE A 1 940 ? 47.211  -103.794 3.766   1.00 173.11 ? 986  ILE A CD1   1 
ATOM   7374 N  N     . LEU A 1 941 ? 41.523  -104.724 3.628   1.00 163.69 ? 987  LEU A N     1 
ATOM   7375 C  CA    . LEU A 1 941 ? 40.385  -105.246 2.864   1.00 163.86 ? 987  LEU A CA    1 
ATOM   7376 C  C     . LEU A 1 941 ? 39.091  -104.466 2.975   1.00 168.12 ? 987  LEU A C     1 
ATOM   7377 O  O     . LEU A 1 941 ? 38.367  -104.317 1.991   1.00 168.05 ? 987  LEU A O     1 
ATOM   7378 C  CB    . LEU A 1 941 ? 40.133  -106.712 3.233   1.00 164.04 ? 987  LEU A CB    1 
ATOM   7379 C  CG    . LEU A 1 941 ? 41.238  -107.704 2.864   1.00 169.09 ? 987  LEU A CG    1 
ATOM   7380 C  CD1   . LEU A 1 941 ? 40.925  -109.087 3.415   1.00 169.42 ? 987  LEU A CD1   1 
ATOM   7381 C  CD2   . LEU A 1 941 ? 41.432  -107.756 1.356   1.00 171.69 ? 987  LEU A CD2   1 
ATOM   7382 N  N     . ALA A 1 942 ? 38.957  -103.970 4.198   1.00 164.63 ? 988  ALA A N     1 
ATOM   7383 C  CA    . ALA A 1 942 ? 37.881  -103.168 4.693   1.00 164.63 ? 988  ALA A CA    1 
ATOM   7384 C  C     . ALA A 1 942 ? 37.899  -101.814 4.025   1.00 169.39 ? 988  ALA A C     1 
ATOM   7385 O  O     . ALA A 1 942 ? 36.965  -101.052 4.176   1.00 169.25 ? 988  ALA A O     1 
ATOM   7386 C  CB    . ALA A 1 942 ? 38.002  -103.019 6.191   1.00 165.31 ? 988  ALA A CB    1 
ATOM   7387 N  N     . GLN A 1 943 ? 39.002  -101.477 3.372   1.00 166.12 ? 989  GLN A N     1 
ATOM   7388 C  CA    . GLN A 1 943 ? 39.094  -100.233 2.632   1.00 165.83 ? 989  GLN A CA    1 
ATOM   7389 C  C     . GLN A 1 943 ? 39.243  -100.489 1.134   1.00 168.53 ? 989  GLN A C     1 
ATOM   7390 O  O     . GLN A 1 943 ? 38.259  -100.525 0.396   1.00 167.91 ? 989  GLN A O     1 
ATOM   7391 C  CB    . GLN A 1 943 ? 40.264  -99.431  3.155   1.00 167.32 ? 989  GLN A CB    1 
ATOM   7392 C  CG    . GLN A 1 943 ? 40.324  -99.478  4.671   1.00 185.82 ? 989  GLN A CG    1 
ATOM   7393 C  CD    . GLN A 1 943 ? 41.600  -98.899  5.228   1.00 208.13 ? 989  GLN A CD    1 
ATOM   7394 O  OE1   . GLN A 1 943 ? 42.620  -98.883  4.557   1.00 204.50 ? 989  GLN A OE1   1 
ATOM   7395 N  NE2   . GLN A 1 943 ? 41.552  -98.435  6.462   1.00 200.93 ? 989  GLN A NE2   1 
ATOM   7396 N  N     . LEU A 1 944 ? 40.476  -100.720 0.705   1.00 164.39 ? 990  LEU A N     1 
ATOM   7397 C  CA    . LEU A 1 944 ? 40.814  -100.941 -0.699  1.00 163.96 ? 990  LEU A CA    1 
ATOM   7398 C  C     . LEU A 1 944 ? 41.734  -102.128 -0.839  1.00 167.26 ? 990  LEU A C     1 
ATOM   7399 O  O     . LEU A 1 944 ? 42.233  -102.639 0.141   1.00 167.06 ? 990  LEU A O     1 
ATOM   7400 C  CB    . LEU A 1 944 ? 41.445  -99.719  -1.342  1.00 164.05 ? 990  LEU A CB    1 
ATOM   7401 C  CG    . LEU A 1 944 ? 41.866  -100.021 -2.785  1.00 168.84 ? 990  LEU A CG    1 
ATOM   7402 C  CD1   . LEU A 1 944 ? 40.635  -100.400 -3.594  1.00 171.09 ? 990  LEU A CD1   1 
ATOM   7403 C  CD2   . LEU A 1 944 ? 42.641  -98.883  -3.447  1.00 169.09 ? 990  LEU A CD2   1 
ATOM   7404 N  N     . THR A 1 945 ? 41.977  -102.553 -2.066  1.00 163.18 ? 991  THR A N     1 
ATOM   7405 C  CA    . THR A 1 945 ? 42.721  -103.773 -2.269  1.00 162.71 ? 991  THR A CA    1 
ATOM   7406 C  C     . THR A 1 945 ? 43.851  -103.815 -3.302  1.00 165.36 ? 991  THR A C     1 
ATOM   7407 O  O     . THR A 1 945 ? 43.693  -103.386 -4.433  1.00 164.64 ? 991  THR A O     1 
ATOM   7408 C  CB    . THR A 1 945 ? 41.745  -104.866 -2.640  1.00 171.98 ? 991  THR A CB    1 
ATOM   7409 O  OG1   . THR A 1 945 ? 41.097  -104.488 -3.854  1.00 172.12 ? 991  THR A OG1   1 
ATOM   7410 C  CG2   . THR A 1 945 ? 40.714  -104.979 -1.554  1.00 170.77 ? 991  THR A CG2   1 
ATOM   7411 N  N     . GLU A 1 946 ? 44.997  -104.326 -2.873  1.00 161.34 ? 992  GLU A N     1 
ATOM   7412 C  CA    . GLU A 1 946 ? 46.156  -104.582 -3.713  1.00 160.72 ? 992  GLU A CA    1 
ATOM   7413 C  C     . GLU A 1 946 ? 46.665  -105.888 -3.135  1.00 164.76 ? 992  GLU A C     1 
ATOM   7414 O  O     . GLU A 1 946 ? 47.788  -105.981 -2.701  1.00 164.72 ? 992  GLU A O     1 
ATOM   7415 C  CB    . GLU A 1 946 ? 47.187  -103.484 -3.560  1.00 161.73 ? 992  GLU A CB    1 
ATOM   7416 C  CG    . GLU A 1 946 ? 46.694  -102.140 -4.058  1.00 167.81 ? 992  GLU A CG    1 
ATOM   7417 C  CD    . GLU A 1 946 ? 45.906  -101.385 -3.021  1.00 175.65 ? 992  GLU A CD    1 
ATOM   7418 O  OE1   . GLU A 1 946 ? 45.707  -101.956 -1.936  1.00 162.51 ? 992  GLU A OE1   1 
ATOM   7419 O  OE2   . GLU A 1 946 ? 45.507  -100.232 -3.289  1.00 163.98 ? 992  GLU A OE2   1 
ATOM   7420 N  N     . LEU A 1 947 ? 45.885  -106.940 -3.273  1.00 160.69 ? 993  LEU A N     1 
ATOM   7421 C  CA    . LEU A 1 947 ? 46.199  -108.190 -2.624  1.00 160.23 ? 993  LEU A CA    1 
ATOM   7422 C  C     . LEU A 1 947 ? 47.116  -109.150 -3.327  1.00 164.60 ? 993  LEU A C     1 
ATOM   7423 O  O     . LEU A 1 947 ? 47.103  -110.343 -3.056  1.00 163.92 ? 993  LEU A O     1 
ATOM   7424 C  CB    . LEU A 1 947 ? 44.939  -108.876 -2.127  1.00 160.08 ? 993  LEU A CB    1 
ATOM   7425 C  CG    . LEU A 1 947 ? 44.311  -108.008 -1.036  1.00 164.51 ? 993  LEU A CG    1 
ATOM   7426 C  CD1   . LEU A 1 947 ? 42.974  -108.582 -0.615  1.00 164.57 ? 993  LEU A CD1   1 
ATOM   7427 C  CD2   . LEU A 1 947 ? 45.234  -107.829 0.151   1.00 166.77 ? 993  LEU A CD2   1 
ATOM   7428 N  N     . ASN A 1 948 ? 47.911  -108.611 -4.220  1.00 162.01 ? 994  ASN A N     1 
ATOM   7429 C  CA    . ASN A 1 948 ? 48.927  -109.403 -4.878  1.00 162.22 ? 994  ASN A CA    1 
ATOM   7430 C  C     . ASN A 1 948 ? 49.916  -109.891 -3.814  1.00 167.42 ? 994  ASN A C     1 
ATOM   7431 O  O     . ASN A 1 948 ? 50.656  -110.846 -4.003  1.00 167.07 ? 994  ASN A O     1 
ATOM   7432 C  CB    . ASN A 1 948 ? 49.674  -108.522 -5.855  1.00 162.08 ? 994  ASN A CB    1 
ATOM   7433 C  CG    . ASN A 1 948 ? 49.709  -107.088 -5.409  1.00 180.74 ? 994  ASN A CG    1 
ATOM   7434 O  OD1   . ASN A 1 948 ? 48.758  -106.594 -4.801  1.00 173.46 ? 994  ASN A OD1   1 
ATOM   7435 N  ND2   . ASN A 1 948 ? 50.802  -106.411 -5.701  1.00 171.84 ? 994  ASN A ND2   1 
ATOM   7436 N  N     . TYR A 1 949 ? 49.814  -109.201 -2.698  1.00 164.93 ? 995  TYR A N     1 
ATOM   7437 C  CA    . TYR A 1 949 ? 50.658  -109.388 -1.564  1.00 165.21 ? 995  TYR A CA    1 
ATOM   7438 C  C     . TYR A 1 949 ? 50.583  -110.814 -1.116  1.00 170.99 ? 995  TYR A C     1 
ATOM   7439 O  O     . TYR A 1 949 ? 51.570  -111.538 -1.208  1.00 170.85 ? 995  TYR A O     1 
ATOM   7440 C  CB    . TYR A 1 949 ? 50.420  -108.266 -0.585  1.00 166.19 ? 995  TYR A CB    1 
ATOM   7441 C  CG    . TYR A 1 949 ? 51.312  -107.139 -0.964  1.00 167.77 ? 995  TYR A CG    1 
ATOM   7442 C  CD1   . TYR A 1 949 ? 52.457  -107.397 -1.705  1.00 169.75 ? 995  TYR A CD1   1 
ATOM   7443 C  CD2   . TYR A 1 949 ? 51.054  -105.844 -0.586  1.00 168.48 ? 995  TYR A CD2   1 
ATOM   7444 C  CE1   . TYR A 1 949 ? 53.322  -106.392 -2.072  1.00 170.43 ? 995  TYR A CE1   1 
ATOM   7445 C  CE2   . TYR A 1 949 ? 51.919  -104.828 -0.943  1.00 169.41 ? 995  TYR A CE2   1 
ATOM   7446 C  CZ    . TYR A 1 949 ? 53.052  -105.112 -1.688  1.00 176.62 ? 995  TYR A CZ    1 
ATOM   7447 O  OH    . TYR A 1 949 ? 53.925  -104.125 -2.061  1.00 177.33 ? 995  TYR A OH    1 
ATOM   7448 N  N     . ASN A 1 950 ? 49.392  -111.294 -0.774  1.00 168.73 ? 996  ASN A N     1 
ATOM   7449 C  CA    . ASN A 1 950 ? 49.250  -112.679 -0.326  1.00 169.13 ? 996  ASN A CA    1 
ATOM   7450 C  C     . ASN A 1 950 ? 50.095  -113.704 -1.057  1.00 174.24 ? 996  ASN A C     1 
ATOM   7451 O  O     . ASN A 1 950 ? 50.668  -114.580 -0.440  1.00 173.70 ? 996  ASN A O     1 
ATOM   7452 C  CB    . ASN A 1 950 ? 47.795  -113.084 -0.252  1.00 170.32 ? 996  ASN A CB    1 
ATOM   7453 C  CG    . ASN A 1 950 ? 46.966  -112.050 0.460   1.00 194.54 ? 996  ASN A CG    1 
ATOM   7454 O  OD1   . ASN A 1 950 ? 47.353  -110.891 0.517   1.00 189.80 ? 996  ASN A OD1   1 
ATOM   7455 N  ND2   . ASN A 1 950 ? 45.832  -112.454 1.008   1.00 186.00 ? 996  ASN A ND2   1 
ATOM   7456 N  N     . GLY A 1 951 ? 50.168  -113.586 -2.375  1.00 172.02 ? 997  GLY A N     1 
ATOM   7457 C  CA    . GLY A 1 951 ? 51.011  -114.417 -3.174  1.00 172.43 ? 997  GLY A CA    1 
ATOM   7458 C  C     . GLY A 1 951 ? 52.441  -114.196 -2.704  1.00 177.71 ? 997  GLY A C     1 
ATOM   7459 O  O     . GLY A 1 951 ? 53.202  -115.154 -2.742  1.00 177.58 ? 997  GLY A O     1 
ATOM   7460 N  N     . VAL A 1 952 ? 52.802  -112.951 -2.388  1.00 174.89 ? 998  VAL A N     1 
ATOM   7461 C  CA    . VAL A 1 952 ? 54.163  -112.612 -1.978  1.00 174.99 ? 998  VAL A CA    1 
ATOM   7462 C  C     . VAL A 1 952 ? 54.668  -113.211 -0.663  1.00 180.19 ? 998  VAL A C     1 
ATOM   7463 O  O     . VAL A 1 952 ? 55.773  -113.736 -0.605  1.00 180.06 ? 998  VAL A O     1 
ATOM   7464 C  CB    . VAL A 1 952 ? 54.315  -111.088 -1.842  1.00 178.71 ? 998  VAL A CB    1 
ATOM   7465 C  CG1   . VAL A 1 952 ? 55.690  -110.742 -1.298  1.00 178.47 ? 998  VAL A CG1   1 
ATOM   7466 C  CG2   . VAL A 1 952 ? 54.102  -110.403 -3.174  1.00 178.50 ? 998  VAL A CG2   1 
ATOM   7467 N  N     . PRO A 1 953 ? 53.861  -113.115 0.399   1.00 177.23 ? 999  PRO A N     1 
ATOM   7468 C  CA    . PRO A 1 953 ? 54.115  -113.626 1.747   1.00 177.07 ? 999  PRO A CA    1 
ATOM   7469 C  C     . PRO A 1 953 ? 54.114  -115.127 1.795   1.00 181.18 ? 999  PRO A C     1 
ATOM   7470 O  O     . PRO A 1 953 ? 54.883  -115.742 2.517   1.00 180.88 ? 999  PRO A O     1 
ATOM   7471 C  CB    . PRO A 1 953 ? 52.948  -113.069 2.557   1.00 178.75 ? 999  PRO A CB    1 
ATOM   7472 C  CG    . PRO A 1 953 ? 52.605  -111.811 1.853   1.00 183.26 ? 999  PRO A CG    1 
ATOM   7473 C  CD    . PRO A 1 953 ? 52.800  -112.156 0.406   1.00 178.89 ? 999  PRO A CD    1 
ATOM   7474 N  N     . GLU A 1 954 ? 53.197  -115.705 1.046   1.00 177.89 ? 1000 GLU A N     1 
ATOM   7475 C  CA    . GLU A 1 954 ? 53.058  -117.141 0.975   1.00 177.96 ? 1000 GLU A CA    1 
ATOM   7476 C  C     . GLU A 1 954 ? 54.290  -117.772 0.384   1.00 183.20 ? 1000 GLU A C     1 
ATOM   7477 O  O     . GLU A 1 954 ? 54.646  -118.886 0.712   1.00 182.83 ? 1000 GLU A O     1 
ATOM   7478 C  CB    . GLU A 1 954 ? 51.839  -117.503 0.168   1.00 179.21 ? 1000 GLU A CB    1 
ATOM   7479 C  CG    . GLU A 1 954 ? 50.630  -116.704 0.576   1.00 188.56 ? 1000 GLU A CG    1 
ATOM   7480 C  CD    . GLU A 1 954 ? 49.974  -117.258 1.807   1.00 206.46 ? 1000 GLU A CD    1 
ATOM   7481 O  OE1   . GLU A 1 954 ? 50.700  -117.531 2.776   1.00 199.84 ? 1000 GLU A OE1   1 
ATOM   7482 O  OE2   . GLU A 1 954 ? 48.735  -117.420 1.800   1.00 198.85 ? 1000 GLU A OE2   1 
ATOM   7483 N  N     . LEU A 1 955 ? 54.906  -117.071 -0.543  1.00 180.83 ? 1001 LEU A N     1 
ATOM   7484 C  CA    . LEU A 1 955 ? 56.112  -117.566 -1.219  1.00 181.15 ? 1001 LEU A CA    1 
ATOM   7485 C  C     . LEU A 1 955 ? 57.293  -117.421 -0.238  1.00 186.02 ? 1001 LEU A C     1 
ATOM   7486 O  O     . LEU A 1 955 ? 58.205  -118.247 -0.268  1.00 185.61 ? 1001 LEU A O     1 
ATOM   7487 C  CB    . LEU A 1 955 ? 56.426  -116.807 -2.527  1.00 181.25 ? 1001 LEU A CB    1 
ATOM   7488 C  CG    . LEU A 1 955 ? 55.461  -116.945 -3.707  1.00 186.03 ? 1001 LEU A CG    1 
ATOM   7489 C  CD1   . LEU A 1 955 ? 55.769  -115.910 -4.772  1.00 186.30 ? 1001 LEU A CD1   1 
ATOM   7490 C  CD2   . LEU A 1 955 ? 55.485  -118.345 -4.308  1.00 188.43 ? 1001 LEU A CD2   1 
ATOM   7491 N  N     . THR A 1 956 ? 57.270  -116.371 0.628   1.00 183.27 ? 1002 THR A N     1 
ATOM   7492 C  CA    . THR A 1 956 ? 58.292  -116.136 1.660   1.00 183.35 ? 1002 THR A CA    1 
ATOM   7493 C  C     . THR A 1 956 ? 58.123  -117.179 2.763   1.00 187.88 ? 1002 THR A C     1 
ATOM   7494 O  O     . THR A 1 956 ? 59.118  -117.573 3.357   1.00 187.67 ? 1002 THR A O     1 
ATOM   7495 C  CB    . THR A 1 956 ? 58.272  -114.688 2.193   1.00 191.81 ? 1002 THR A CB    1 
ATOM   7496 O  OG1   . THR A 1 956 ? 58.197  -113.779 1.094   1.00 193.20 ? 1002 THR A OG1   1 
ATOM   7497 C  CG2   . THR A 1 956 ? 59.506  -114.349 3.038   1.00 189.48 ? 1002 THR A CG2   1 
ATOM   7498 N  N     . GLU A 1 957 ? 56.871  -117.642 3.017   1.00 184.81 ? 1003 GLU A N     1 
ATOM   7499 C  CA    . GLU A 1 957 ? 56.562  -118.702 3.982   1.00 184.84 ? 1003 GLU A CA    1 
ATOM   7500 C  C     . GLU A 1 957 ? 57.104  -120.027 3.441   1.00 189.62 ? 1003 GLU A C     1 
ATOM   7501 O  O     . GLU A 1 957 ? 57.581  -120.850 4.219   1.00 189.27 ? 1003 GLU A O     1 
ATOM   7502 C  CB    . GLU A 1 957 ? 55.051  -118.806 4.252   1.00 186.16 ? 1003 GLU A CB    1 
ATOM   7503 C  CG    . GLU A 1 957 ? 54.588  -118.003 5.458   1.00 196.00 ? 1003 GLU A CG    1 
ATOM   7504 C  CD    . GLU A 1 957 ? 53.234  -118.390 6.026   1.00 214.55 ? 1003 GLU A CD    1 
ATOM   7505 O  OE1   . GLU A 1 957 ? 52.234  -118.353 5.274   1.00 209.45 ? 1003 GLU A OE1   1 
ATOM   7506 O  OE2   . GLU A 1 957 ? 53.170  -118.690 7.238   1.00 206.82 ? 1003 GLU A OE2   1 
ATOM   7507 N  N     . ARG A 1 958 ? 57.060  -120.210 2.100   1.00 186.79 ? 1004 ARG A N     1 
ATOM   7508 C  CA    . ARG A 1 958 ? 57.597  -121.374 1.387   1.00 186.90 ? 1004 ARG A CA    1 
ATOM   7509 C  C     . ARG A 1 958 ? 59.125  -121.279 1.382   1.00 191.20 ? 1004 ARG A C     1 
ATOM   7510 O  O     . ARG A 1 958 ? 59.804  -122.305 1.441   1.00 190.80 ? 1004 ARG A O     1 
ATOM   7511 C  CB    . ARG A 1 958 ? 57.066  -121.415 -0.052  1.00 187.54 ? 1004 ARG A CB    1 
ATOM   7512 C  CG    . ARG A 1 958 ? 57.284  -122.746 -0.774  1.00 198.55 ? 1004 ARG A CG    1 
ATOM   7513 C  CD    . ARG A 1 958 ? 56.030  -123.609 -0.827  1.00 208.30 ? 1004 ARG A CD    1 
ATOM   7514 N  NE    . ARG A 1 958 ? 54.867  -122.887 -1.356  1.00 216.02 ? 1004 ARG A NE    1 
ATOM   7515 C  CZ    . ARG A 1 958 ? 54.574  -122.759 -2.647  1.00 229.03 ? 1004 ARG A CZ    1 
ATOM   7516 N  NH1   . ARG A 1 958 ? 55.353  -123.309 -3.572  1.00 215.36 ? 1004 ARG A NH1   1 
ATOM   7517 N  NH2   . ARG A 1 958 ? 53.500  -122.079 -3.025  1.00 215.41 ? 1004 ARG A NH2   1 
ATOM   7518 N  N     . LYS A 1 959 ? 59.661  -120.043 1.314   1.00 188.07 ? 1005 LYS A N     1 
ATOM   7519 C  CA    . LYS A 1 959 ? 61.098  -119.803 1.375   1.00 188.09 ? 1005 LYS A CA    1 
ATOM   7520 C  C     . LYS A 1 959 ? 61.579  -120.003 2.819   1.00 192.72 ? 1005 LYS A C     1 
ATOM   7521 O  O     . LYS A 1 959 ? 62.704  -120.444 3.012   1.00 192.15 ? 1005 LYS A O     1 
ATOM   7522 C  CB    . LYS A 1 959 ? 61.474  -118.421 0.812   1.00 190.52 ? 1005 LYS A CB    1 
ATOM   7523 C  CG    . LYS A 1 959 ? 61.225  -118.304 -0.694  1.00 204.59 ? 1005 LYS A CG    1 
ATOM   7524 C  CD    . LYS A 1 959 ? 61.574  -116.927 -1.250  1.00 215.02 ? 1005 LYS A CD    1 
ATOM   7525 C  CE    . LYS A 1 959 ? 61.349  -116.824 -2.742  1.00 226.54 ? 1005 LYS A CE    1 
ATOM   7526 N  NZ    . LYS A 1 959 ? 61.673  -115.468 -3.256  1.00 235.70 ? 1005 LYS A NZ    1 
ATOM   7527 N  N     . ASP A 1 960 ? 60.692  -119.766 3.817   1.00 190.09 ? 1006 ASP A N     1 
ATOM   7528 C  CA    . ASP A 1 960 ? 60.938  -119.947 5.254   1.00 190.27 ? 1006 ASP A CA    1 
ATOM   7529 C  C     . ASP A 1 960 ? 60.965  -121.436 5.612   1.00 196.57 ? 1006 ASP A C     1 
ATOM   7530 O  O     . ASP A 1 960 ? 61.732  -121.822 6.496   1.00 196.23 ? 1006 ASP A O     1 
ATOM   7531 C  CB    . ASP A 1 960 ? 59.871  -119.210 6.088   1.00 191.58 ? 1006 ASP A CB    1 
ATOM   7532 C  CG    . ASP A 1 960 ? 60.134  -119.166 7.581   1.00 196.64 ? 1006 ASP A CG    1 
ATOM   7533 O  OD1   . ASP A 1 960 ? 60.950  -118.326 8.015   1.00 196.08 ? 1006 ASP A OD1   1 
ATOM   7534 O  OD2   . ASP A 1 960 ? 59.478  -119.926 8.320   1.00 201.20 ? 1006 ASP A OD2   1 
ATOM   7535 N  N     . THR A 1 961 ? 60.149  -122.246 4.949   1.00 195.01 ? 1007 THR A N     1 
ATOM   7536 C  CA    . THR A 1 961 ? 60.130  -123.689 5.168   1.00 195.73 ? 1007 THR A CA    1 
ATOM   7537 C  C     . THR A 1 961 ? 61.451  -124.295 4.736   1.00 201.80 ? 1007 THR A C     1 
ATOM   7538 O  O     . THR A 1 961 ? 61.974  -125.210 5.344   1.00 201.41 ? 1007 THR A O     1 
ATOM   7539 C  CB    . THR A 1 961 ? 59.027  -124.381 4.350   1.00 203.81 ? 1007 THR A CB    1 
ATOM   7540 O  OG1   . THR A 1 961 ? 59.023  -123.859 3.018   1.00 203.79 ? 1007 THR A OG1   1 
ATOM   7541 C  CG2   . THR A 1 961 ? 57.670  -124.161 4.965   1.00 202.25 ? 1007 THR A CG2   1 
ATOM   7542 N  N     . PHE A 1 962 ? 61.973  -123.750 3.654   1.00 199.94 ? 1008 PHE A N     1 
ATOM   7543 C  CA    . PHE A 1 962 ? 63.199  -124.208 3.023   1.00 200.47 ? 1008 PHE A CA    1 
ATOM   7544 C  C     . PHE A 1 962 ? 64.369  -124.123 3.979   1.00 204.37 ? 1008 PHE A C     1 
ATOM   7545 O  O     . PHE A 1 962 ? 65.189  -125.017 4.113   1.00 203.99 ? 1008 PHE A O     1 
ATOM   7546 C  CB    . PHE A 1 962 ? 63.464  -123.291 1.822   1.00 202.70 ? 1008 PHE A CB    1 
ATOM   7547 C  CG    . PHE A 1 962 ? 62.407  -123.375 0.747   1.00 204.83 ? 1008 PHE A CG    1 
ATOM   7548 C  CD1   . PHE A 1 962 ? 61.549  -124.466 0.680   1.00 208.38 ? 1008 PHE A CD1   1 
ATOM   7549 C  CD2   . PHE A 1 962 ? 62.308  -122.388 -0.220  1.00 207.37 ? 1008 PHE A CD2   1 
ATOM   7550 C  CE1   . PHE A 1 962 ? 60.596  -124.551 -0.317  1.00 209.47 ? 1008 PHE A CE1   1 
ATOM   7551 C  CE2   . PHE A 1 962 ? 61.357  -122.465 -1.218  1.00 210.40 ? 1008 PHE A CE2   1 
ATOM   7552 C  CZ    . PHE A 1 962 ? 60.499  -123.546 -1.263  1.00 208.58 ? 1008 PHE A CZ    1 
ATOM   7553 N  N     . PHE A 1 963 ? 64.401  -123.029 4.678   1.00 200.84 ? 1009 PHE A N     1 
ATOM   7554 C  CA    . PHE A 1 963 ? 65.429  -122.739 5.676   1.00 200.60 ? 1009 PHE A CA    1 
ATOM   7555 C  C     . PHE A 1 963 ? 65.114  -123.573 6.906   1.00 203.86 ? 1009 PHE A C     1 
ATOM   7556 O  O     . PHE A 1 963 ? 66.027  -123.872 7.670   1.00 203.47 ? 1009 PHE A O     1 
ATOM   7557 C  CB    . PHE A 1 963 ? 65.524  -121.245 6.019   1.00 202.61 ? 1009 PHE A CB    1 
ATOM   7558 C  CG    . PHE A 1 963 ? 65.950  -120.370 4.865   1.00 204.52 ? 1009 PHE A CG    1 
ATOM   7559 C  CD1   . PHE A 1 963 ? 66.591  -120.913 3.755   1.00 207.77 ? 1009 PHE A CD1   1 
ATOM   7560 C  CD2   . PHE A 1 963 ? 65.745  -118.999 4.901   1.00 207.06 ? 1009 PHE A CD2   1 
ATOM   7561 C  CE1   . PHE A 1 963 ? 66.983  -120.098 2.687   1.00 208.86 ? 1009 PHE A CE1   1 
ATOM   7562 C  CE2   . PHE A 1 963 ? 66.127  -118.185 3.831   1.00 210.02 ? 1009 PHE A CE2   1 
ATOM   7563 C  CZ    . PHE A 1 963 ? 66.751  -118.738 2.733   1.00 208.11 ? 1009 PHE A CZ    1 
ATOM   7564 N  N     . ALA A 1 964 ? 63.826  -124.003 7.060   1.00 200.03 ? 1010 ALA A N     1 
ATOM   7565 C  CA    . ALA A 1 964 ? 63.365  -124.909 8.117   1.00 199.67 ? 1010 ALA A CA    1 
ATOM   7566 C  C     . ALA A 1 964 ? 63.908  -126.320 7.863   1.00 203.33 ? 1010 ALA A C     1 
ATOM   7567 O  O     . ALA A 1 964 ? 63.969  -127.135 8.786   1.00 202.92 ? 1010 ALA A O     1 
ATOM   7568 C  CB    . ALA A 1 964 ? 61.848  -124.911 8.229   1.00 200.37 ? 1010 ALA A CB    1 
ATOM   7569 N  N     . GLN A 1 965 ? 64.354  -126.572 6.610   1.00 199.65 ? 1011 GLN A N     1 
ATOM   7570 C  CA    . GLN A 1 965 ? 65.011  -127.797 6.157   1.00 199.30 ? 1011 GLN A CA    1 
ATOM   7571 C  C     . GLN A 1 965 ? 66.535  -127.615 6.292   1.00 202.39 ? 1011 GLN A C     1 
ATOM   7572 O  O     . GLN A 1 965 ? 67.264  -128.606 6.294   1.00 201.95 ? 1011 GLN A O     1 
ATOM   7573 C  CB    . GLN A 1 965 ? 64.631  -128.148 4.703   1.00 200.75 ? 1011 GLN A CB    1 
ATOM   7574 C  CG    . GLN A 1 965 ? 63.133  -128.373 4.444   1.00 219.03 ? 1011 GLN A CG    1 
ATOM   7575 C  CD    . GLN A 1 965 ? 62.518  -129.555 5.164   1.00 240.82 ? 1011 GLN A CD    1 
ATOM   7576 O  OE1   . GLN A 1 965 ? 63.121  -130.625 5.315   1.00 237.25 ? 1011 GLN A OE1   1 
ATOM   7577 N  NE2   . GLN A 1 965 ? 61.287  -129.387 5.622   1.00 232.77 ? 1011 GLN A NE2   1 
ATOM   7578 N  N     . GLN A 1 966 ? 67.009  -126.347 6.411   1.00 198.35 ? 1012 GLN A N     1 
ATOM   7579 C  CA    . GLN A 1 966 ? 68.421  -126.015 6.635   1.00 197.84 ? 1012 GLN A CA    1 
ATOM   7580 C  C     . GLN A 1 966 ? 68.708  -126.060 8.150   1.00 201.64 ? 1012 GLN A C     1 
ATOM   7581 O  O     . GLN A 1 966 ? 69.868  -126.012 8.552   1.00 200.95 ? 1012 GLN A O     1 
ATOM   7582 C  CB    . GLN A 1 966 ? 68.815  -124.649 6.022   1.00 198.96 ? 1012 GLN A CB    1 
ATOM   7583 C  CG    . GLN A 1 966 ? 68.627  -124.519 4.503   1.00 207.60 ? 1012 GLN A CG    1 
ATOM   7584 C  CD    . GLN A 1 966 ? 69.336  -125.580 3.697   1.00 221.02 ? 1012 GLN A CD    1 
ATOM   7585 O  OE1   . GLN A 1 966 ? 70.560  -125.592 3.571   1.00 215.32 ? 1012 GLN A OE1   1 
ATOM   7586 N  NE2   . GLN A 1 966 ? 68.572  -126.490 3.119   1.00 211.89 ? 1012 GLN A NE2   1 
ATOM   7587 N  N     . TRP A 1 967 ? 67.635  -126.163 8.982   1.00 198.56 ? 1013 TRP A N     1 
ATOM   7588 C  CA    . TRP A 1 967 ? 67.694  -126.326 10.442  1.00 198.50 ? 1013 TRP A CA    1 
ATOM   7589 C  C     . TRP A 1 967 ? 68.110  -127.777 10.666  1.00 201.24 ? 1013 TRP A C     1 
ATOM   7590 O  O     . TRP A 1 967 ? 69.129  -128.023 11.305  1.00 200.92 ? 1013 TRP A O     1 
ATOM   7591 C  CB    . TRP A 1 967 ? 66.317  -126.091 11.104  1.00 197.63 ? 1013 TRP A CB    1 
ATOM   7592 C  CG    . TRP A 1 967 ? 65.833  -124.671 11.111  1.00 198.89 ? 1013 TRP A CG    1 
ATOM   7593 C  CD1   . TRP A 1 967 ? 64.861  -124.137 10.325  1.00 201.92 ? 1013 TRP A CD1   1 
ATOM   7594 C  CD2   . TRP A 1 967 ? 66.215  -123.643 12.026  1.00 198.85 ? 1013 TRP A CD2   1 
ATOM   7595 N  NE1   . TRP A 1 967 ? 64.676  -122.811 10.626  1.00 201.47 ? 1013 TRP A NE1   1 
ATOM   7596 C  CE2   . TRP A 1 967 ? 65.477  -122.484 11.684  1.00 202.89 ? 1013 TRP A CE2   1 
ATOM   7597 C  CE3   . TRP A 1 967 ? 67.125  -123.575 13.086  1.00 200.12 ? 1013 TRP A CE3   1 
ATOM   7598 C  CZ2   . TRP A 1 967 ? 65.631  -121.272 12.360  1.00 202.24 ? 1013 TRP A CZ2   1 
ATOM   7599 C  CZ3   . TRP A 1 967 ? 67.266  -122.379 13.759  1.00 201.64 ? 1013 TRP A CZ3   1 
ATOM   7600 C  CH2   . TRP A 1 967 ? 66.538  -121.239 13.387  1.00 202.31 ? 1013 TRP A CH2   1 
ATOM   7601 N  N     . THR A 1 968 ? 67.331  -128.732 10.094  1.00 196.80 ? 1014 THR A N     1 
ATOM   7602 C  CA    . THR A 1 968 ? 67.597  -130.174 10.128  1.00 196.15 ? 1014 THR A CA    1 
ATOM   7603 C  C     . THR A 1 968 ? 68.793  -130.505 9.231   1.00 198.90 ? 1014 THR A C     1 
ATOM   7604 O  O     . THR A 1 968 ? 69.492  -131.481 9.488   1.00 198.60 ? 1014 THR A O     1 
ATOM   7605 C  CB    . THR A 1 968 ? 66.350  -130.994 9.756   1.00 203.87 ? 1014 THR A CB    1 
ATOM   7606 O  OG1   . THR A 1 968 ? 65.693  -130.403 8.632   1.00 203.99 ? 1014 THR A OG1   1 
ATOM   7607 C  CG2   . THR A 1 968 ? 65.379  -131.142 10.917  1.00 201.92 ? 1014 THR A CG2   1 
ATOM   7608 N  N     . GLY A 1 969 ? 69.023  -129.671 8.211   1.00 194.40 ? 1015 GLY A N     1 
ATOM   7609 C  CA    . GLY A 1 969 ? 70.144  -129.784 7.284   1.00 193.71 ? 1015 GLY A CA    1 
ATOM   7610 C  C     . GLY A 1 969 ? 71.469  -129.453 7.938   1.00 196.37 ? 1015 GLY A C     1 
ATOM   7611 O  O     . GLY A 1 969 ? 72.516  -129.891 7.458   1.00 195.86 ? 1015 GLY A O     1 
ATOM   7612 N  N     . VAL A 1 970 ? 71.430  -128.667 9.036   1.00 192.13 ? 1016 VAL A N     1 
ATOM   7613 C  CA    . VAL A 1 970 ? 72.603  -128.302 9.832   1.00 191.54 ? 1016 VAL A CA    1 
ATOM   7614 C  C     . VAL A 1 970 ? 72.622  -129.148 11.114  1.00 194.44 ? 1016 VAL A C     1 
ATOM   7615 O  O     . VAL A 1 970 ? 73.706  -129.461 11.594  1.00 193.96 ? 1016 VAL A O     1 
ATOM   7616 C  CB    . VAL A 1 970 ? 72.763  -126.772 10.049  1.00 195.43 ? 1016 VAL A CB    1 
ATOM   7617 C  CG1   . VAL A 1 970 ? 73.803  -126.436 11.123  1.00 195.14 ? 1016 VAL A CG1   1 
ATOM   7618 C  CG2   . VAL A 1 970 ? 73.138  -126.102 8.734   1.00 195.28 ? 1016 VAL A CG2   1 
ATOM   7619 N  N     . LYS A 1 971 ? 71.438  -129.592 11.610  1.00 190.21 ? 1017 LYS A N     1 
ATOM   7620 C  CA    . LYS A 1 971 ? 71.313  -130.480 12.776  1.00 189.49 ? 1017 LYS A CA    1 
ATOM   7621 C  C     . LYS A 1 971 ? 71.946  -131.834 12.423  1.00 192.85 ? 1017 LYS A C     1 
ATOM   7622 O  O     . LYS A 1 971 ? 72.878  -132.256 13.106  1.00 192.42 ? 1017 LYS A O     1 
ATOM   7623 C  CB    . LYS A 1 971 ? 69.834  -130.644 13.200  1.00 191.55 ? 1017 LYS A CB    1 
ATOM   7624 C  CG    . LYS A 1 971 ? 69.591  -131.701 14.276  1.00 200.76 ? 1017 LYS A CG    1 
ATOM   7625 C  CD    . LYS A 1 971 ? 68.114  -131.899 14.554  1.00 208.55 ? 1017 LYS A CD    1 
ATOM   7626 C  CE    . LYS A 1 971 ? 67.767  -131.487 15.961  1.00 218.76 ? 1017 LYS A CE    1 
ATOM   7627 N  NZ    . LYS A 1 971 ? 66.349  -131.782 16.288  1.00 228.27 ? 1017 LYS A NZ    1 
ATOM   7628 N  N     . SER A 1 972 ? 71.471  -132.475 11.327  1.00 189.08 ? 1018 SER A N     1 
ATOM   7629 C  CA    . SER A 1 972 ? 71.968  -133.761 10.826  1.00 188.73 ? 1018 SER A CA    1 
ATOM   7630 C  C     . SER A 1 972 ? 73.411  -133.676 10.326  1.00 191.84 ? 1018 SER A C     1 
ATOM   7631 O  O     . SER A 1 972 ? 74.151  -134.651 10.467  1.00 191.33 ? 1018 SER A O     1 
ATOM   7632 C  CB    . SER A 1 972 ? 71.062  -134.310 9.729   1.00 192.56 ? 1018 SER A CB    1 
ATOM   7633 O  OG    . SER A 1 972 ? 71.092  -133.499 8.565   1.00 201.80 ? 1018 SER A OG    1 
ATOM   7634 N  N     . SER A 1 973 ? 73.808  -132.525 9.730   1.00 187.84 ? 1019 SER A N     1 
ATOM   7635 C  CA    . SER A 1 973 ? 75.181  -132.331 9.254   1.00 187.34 ? 1019 SER A CA    1 
ATOM   7636 C  C     . SER A 1 973 ? 76.118  -132.129 10.442  1.00 190.31 ? 1019 SER A C     1 
ATOM   7637 O  O     . SER A 1 973 ? 77.263  -132.584 10.391  1.00 189.85 ? 1019 SER A O     1 
ATOM   7638 C  CB    . SER A 1 973 ? 75.283  -131.175 8.261   1.00 190.84 ? 1019 SER A CB    1 
ATOM   7639 O  OG    . SER A 1 973 ? 75.218  -129.907 8.890   1.00 199.53 ? 1019 SER A OG    1 
ATOM   7640 N  N     . ALA A 1 974 ? 75.618  -131.485 11.526  1.00 186.13 ? 1020 ALA A N     1 
ATOM   7641 C  CA    . ALA A 1 974 ? 76.371  -131.299 12.766  1.00 185.59 ? 1020 ALA A CA    1 
ATOM   7642 C  C     . ALA A 1 974 ? 76.525  -132.659 13.428  1.00 188.85 ? 1020 ALA A C     1 
ATOM   7643 O  O     . ALA A 1 974 ? 77.589  -132.931 13.976  1.00 188.76 ? 1020 ALA A O     1 
ATOM   7644 C  CB    . ALA A 1 974 ? 75.654  -130.342 13.707  1.00 186.28 ? 1020 ALA A CB    1 
ATOM   7645 N  N     . GLU A 1 975 ? 75.484  -133.533 13.326  1.00 184.57 ? 1021 GLU A N     1 
ATOM   7646 C  CA    . GLU A 1 975 ? 75.507  -134.891 13.876  1.00 184.05 ? 1021 GLU A CA    1 
ATOM   7647 C  C     . GLU A 1 975 ? 76.702  -135.649 13.343  1.00 187.00 ? 1021 GLU A C     1 
ATOM   7648 O  O     . GLU A 1 975 ? 76.843  -135.837 12.132  1.00 186.63 ? 1021 GLU A O     1 
ATOM   7649 C  CB    . GLU A 1 975 ? 74.218  -135.682 13.573  1.00 185.44 ? 1021 GLU A CB    1 
ATOM   7650 C  CG    . GLU A 1 975 ? 72.979  -135.264 14.348  1.00 196.08 ? 1021 GLU A CG    1 
ATOM   7651 C  CD    . GLU A 1 975 ? 73.107  -135.066 15.847  1.00 215.64 ? 1021 GLU A CD    1 
ATOM   7652 O  OE1   . GLU A 1 975 ? 73.703  -135.932 16.526  1.00 208.38 ? 1021 GLU A OE1   1 
ATOM   7653 O  OE2   . GLU A 1 975 ? 72.587  -134.042 16.346  1.00 209.72 ? 1021 GLU A OE2   1 
ATOM   7654 N  N     . THR A 1 976 ? 77.592  -136.012 14.255  1.00 182.68 ? 1022 THR A N     1 
ATOM   7655 C  CA    . THR A 1 976 ? 78.804  -136.745 13.941  1.00 181.99 ? 1022 THR A CA    1 
ATOM   7656 C  C     . THR A 1 976 ? 78.833  -138.008 14.802  1.00 185.19 ? 1022 THR A C     1 
ATOM   7657 O  O     . THR A 1 976 ? 78.033  -138.134 15.735  1.00 184.71 ? 1022 THR A O     1 
ATOM   7658 C  CB    . THR A 1 976 ? 80.040  -135.814 14.012  1.00 188.02 ? 1022 THR A CB    1 
ATOM   7659 O  OG1   . THR A 1 976 ? 81.206  -136.511 13.579  1.00 186.98 ? 1022 THR A OG1   1 
ATOM   7660 C  CG2   . THR A 1 976 ? 80.260  -135.186 15.386  1.00 185.86 ? 1022 THR A CG2   1 
ATOM   7661 N  N     . TYR A 1 977 ? 79.778  -138.869 14.462  1.00 181.14 ? 1023 TYR A N     1 
ATOM   7662 C  CA    . TYR A 1 977 ? 79.955  -140.163 15.059  1.00 180.56 ? 1023 TYR A CA    1 
ATOM   7663 C  C     . TYR A 1 977 ? 80.215  -140.041 16.526  1.00 182.80 ? 1023 TYR A C     1 
ATOM   7664 O  O     . TYR A 1 977 ? 79.814  -140.912 17.299  1.00 182.32 ? 1023 TYR A O     1 
ATOM   7665 C  CB    . TYR A 1 977 ? 81.093  -140.871 14.362  1.00 181.96 ? 1023 TYR A CB    1 
ATOM   7666 C  CG    . TYR A 1 977 ? 82.202  -139.983 13.867  1.00 183.94 ? 1023 TYR A CG    1 
ATOM   7667 C  CD1   . TYR A 1 977 ? 82.065  -139.238 12.714  1.00 185.91 ? 1023 TYR A CD1   1 
ATOM   7668 C  CD2   . TYR A 1 977 ? 83.412  -139.939 14.525  1.00 184.78 ? 1023 TYR A CD2   1 
ATOM   7669 C  CE1   . TYR A 1 977 ? 83.103  -138.450 12.247  1.00 186.73 ? 1023 TYR A CE1   1 
ATOM   7670 C  CE2   . TYR A 1 977 ? 84.451  -139.154 14.072  1.00 185.72 ? 1023 TYR A CE2   1 
ATOM   7671 C  CZ    . TYR A 1 977 ? 84.295  -138.411 12.933  1.00 192.92 ? 1023 TYR A CZ    1 
ATOM   7672 O  OH    . TYR A 1 977 ? 85.343  -137.644 12.500  1.00 193.31 ? 1023 TYR A OH    1 
ATOM   7673 N  N     . LYS A 1 978 ? 80.963  -138.998 16.882  1.00 177.92 ? 1024 LYS A N     1 
ATOM   7674 C  CA    . LYS A 1 978 ? 81.262  -138.644 18.273  1.00 176.84 ? 1024 LYS A CA    1 
ATOM   7675 C  C     . LYS A 1 978 ? 81.963  -139.693 19.088  1.00 177.87 ? 1024 LYS A C     1 
ATOM   7676 O  O     . LYS A 1 978 ? 83.053  -140.121 18.770  1.00 176.95 ? 1024 LYS A O     1 
ATOM   7677 C  CB    . LYS A 1 978 ? 79.983  -138.196 18.983  1.00 179.52 ? 1024 LYS A CB    1 
ATOM   7678 C  CG    . LYS A 1 978 ? 79.456  -136.898 18.426  1.00 193.01 ? 1024 LYS A CG    1 
ATOM   7679 C  CD    . LYS A 1 978 ? 78.182  -136.490 19.126  1.00 200.88 ? 1024 LYS A CD    1 
ATOM   7680 C  CE    . LYS A 1 978 ? 77.696  -135.172 18.558  1.00 209.79 ? 1024 LYS A CE    1 
ATOM   7681 N  NZ    . LYS A 1 978 ? 76.432  -134.798 19.239  1.00 218.66 ? 1024 LYS A NZ    1 
ATOM   7682 N  N     . ASN A 1 979 ? 81.333  -140.028 20.197  1.00 172.96 ? 1025 ASN A N     1 
ATOM   7683 C  CA    . ASN A 1 979 ? 81.844  -141.046 21.107  1.00 172.18 ? 1025 ASN A CA    1 
ATOM   7684 C  C     . ASN A 1 979 ? 82.011  -142.383 20.384  1.00 174.46 ? 1025 ASN A C     1 
ATOM   7685 O  O     . ASN A 1 979 ? 81.051  -142.904 19.809  1.00 173.77 ? 1025 ASN A O     1 
ATOM   7686 C  CB    . ASN A 1 979 ? 80.930  -141.179 22.339  1.00 173.04 ? 1025 ASN A CB    1 
ATOM   7687 C  CG    . ASN A 1 979 ? 80.999  -140.024 23.320  1.00 197.91 ? 1025 ASN A CG    1 
ATOM   7688 O  OD1   . ASN A 1 979 ? 81.841  -139.119 23.225  1.00 194.35 ? 1025 ASN A OD1   1 
ATOM   7689 N  ND2   . ASN A 1 979 ? 80.123  -140.046 24.312  1.00 188.87 ? 1025 ASN A ND2   1 
ATOM   7690 N  N     . THR A 1 980 ? 83.252  -142.906 20.388  1.00 170.11 ? 1026 THR A N     1 
ATOM   7691 C  CA    . THR A 1 980 ? 83.642  -144.161 19.738  1.00 170.34 ? 1026 THR A CA    1 
ATOM   7692 C  C     . THR A 1 980 ? 84.092  -145.194 20.786  1.00 178.79 ? 1026 THR A C     1 
ATOM   7693 O  O     . THR A 1 980 ? 83.223  -145.688 21.537  1.00 180.60 ? 1026 THR A O     1 
ATOM   7694 C  CB    . THR A 1 980 ? 84.692  -143.901 18.632  1.00 175.54 ? 1026 THR A CB    1 
ATOM   7695 O  OG1   . THR A 1 980 ? 85.812  -143.219 19.199  1.00 173.27 ? 1026 THR A OG1   1 
ATOM   7696 C  CG2   . THR A 1 980 ? 84.129  -143.112 17.447  1.00 173.61 ? 1026 THR A CG2   1 
ATOM   7697 O  OXT   . THR A 1 980 ? 85.306  -145.494 20.876  1.00 196.01 ? 1026 THR A OXT   1 
HETATM 7698 P  PB    . AOV B 2 .   ? 18.132  -8.258   -28.800 1.00 30.02  ? 1500 AOV A PB    1 
HETATM 7699 O  O1B   . AOV B 2 .   ? 17.322  -9.317   -29.518 1.00 36.23  ? 1500 AOV A O1B   1 
HETATM 7700 O  O2B   . AOV B 2 .   ? 19.602  -8.476   -29.049 1.00 29.32  ? 1500 AOV A O2B   1 
HETATM 7701 O  O3B   . AOV B 2 .   ? 17.872  -6.917   -29.469 1.00 30.94  ? 1500 AOV A O3B   1 
HETATM 7702 P  PA    . AOV B 2 .   ? 19.088  -8.567   -26.074 1.00 35.36  ? 1500 AOV A PA    1 
HETATM 7703 O  O1A   . AOV B 2 .   ? 19.649  -9.914   -26.417 1.00 34.40  ? 1500 AOV A O1A   1 
HETATM 7704 O  O2A   . AOV B 2 .   ? 19.836  -7.309   -25.869 1.00 37.60  ? 1500 AOV A O2A   1 
HETATM 7705 O  O3A   . AOV B 2 .   ? 17.945  -8.365   -27.183 1.00 29.79  ? 1500 AOV A O3A   1 
HETATM 7706 O  "O5'" . AOV B 2 .   ? 18.055  -8.535   -24.869 1.00 35.45  ? 1500 AOV A "O5'" 1 
HETATM 7707 C  "C5'" . AOV B 2 .   ? 17.611  -7.334   -24.225 1.00 35.43  ? 1500 AOV A "C5'" 1 
HETATM 7708 C  "C4'" . AOV B 2 .   ? 17.869  -7.371   -22.719 1.00 37.86  ? 1500 AOV A "C4'" 1 
HETATM 7709 O  "O4'" . AOV B 2 .   ? 16.806  -8.213   -22.224 1.00 40.46  ? 1500 AOV A "O4'" 1 
HETATM 7710 C  "C3'" . AOV B 2 .   ? 19.228  -7.940   -22.330 1.00 39.70  ? 1500 AOV A "C3'" 1 
HETATM 7711 O  "O3'" . AOV B 2 .   ? 20.022  -6.759   -22.164 1.00 39.57  ? 1500 AOV A "O3'" 1 
HETATM 7712 C  "C2'" . AOV B 2 .   ? 18.752  -8.537   -21.022 1.00 42.22  ? 1500 AOV A "C2'" 1 
HETATM 7713 O  "O2'" . AOV B 2 .   ? 18.807  -7.584   -19.971 1.00 43.92  ? 1500 AOV A "O2'" 1 
HETATM 7714 C  "C1'" . AOV B 2 .   ? 17.362  -9.063   -21.220 1.00 39.63  ? 1500 AOV A "C1'" 1 
HETATM 7715 N  N9    . AOV B 2 .   ? 17.480  -10.513  -21.531 1.00 38.54  ? 1500 AOV A N9    1 
HETATM 7716 C  C8    . AOV B 2 .   ? 17.318  -11.052  -22.764 1.00 35.98  ? 1500 AOV A C8    1 
HETATM 7717 N  N7    . AOV B 2 .   ? 17.489  -12.407  -22.724 1.00 34.66  ? 1500 AOV A N7    1 
HETATM 7718 C  C5    . AOV B 2 .   ? 17.756  -12.643  -21.422 1.00 39.80  ? 1500 AOV A C5    1 
HETATM 7719 C  C6    . AOV B 2 .   ? 18.042  -13.907  -20.698 1.00 36.87  ? 1500 AOV A C6    1 
HETATM 7720 N  N6    . AOV B 2 .   ? 18.052  -15.065  -21.402 1.00 36.07  ? 1500 AOV A N6    1 
HETATM 7721 N  N1    . AOV B 2 .   ? 18.286  -13.908  -19.371 1.00 36.61  ? 1500 AOV A N1    1 
HETATM 7722 C  C2    . AOV B 2 .   ? 18.270  -12.747  -18.697 1.00 36.34  ? 1500 AOV A C2    1 
HETATM 7723 N  N3    . AOV B 2 .   ? 18.019  -11.561  -19.285 1.00 40.27  ? 1500 AOV A N3    1 
HETATM 7724 C  C4    . AOV B 2 .   ? 17.760  -11.423  -20.601 1.00 40.26  ? 1500 AOV A C4    1 
HETATM 7725 V  VG    . AOV B 2 .   ? 18.422  -5.581   -30.968 1.00 30.37  ? 1500 AOV A VG    1 
HETATM 7726 O  O1G   . AOV B 2 .   ? 20.072  -5.759   -30.337 1.00 33.20  ? 1500 AOV A O1G   1 
HETATM 7727 O  O2G   . AOV B 2 .   ? 17.689  -4.300   -29.981 1.00 32.92  ? 1500 AOV A O2G   1 
HETATM 7728 O  O3G   . AOV B 2 .   ? 17.129  -6.125   -32.058 1.00 32.18  ? 1500 AOV A O3G   1 
HETATM 7729 O  O4G   . AOV B 2 .   ? 18.819  -4.337   -32.172 1.00 29.16  ? 1500 AOV A O4G   1 
HETATM 7730 MG MG    . MG  C 3 .   ? 21.325  -7.005   -29.284 1.00 23.45  2 1501 MG  A MG    1 
HETATM 7731 O  O     . HOH D 4 .   ? 47.464  6.652    -32.586 1.00 25.68  ? 1601 HOH A O     1 
HETATM 7732 O  O     . HOH D 4 .   ? 49.021  -24.746  -38.425 1.00 51.11  ? 1602 HOH A O     1 
HETATM 7733 O  O     . HOH D 4 .   ? 41.270  2.770    -44.009 1.00 106.68 ? 1603 HOH A O     1 
HETATM 7734 O  O     . HOH D 4 .   ? 9.218   -32.628  -32.890 1.00 83.63  ? 1604 HOH A O     1 
HETATM 7735 O  O     . HOH D 4 .   ? 25.789  -6.165   -29.764 1.00 25.34  ? 1605 HOH A O     1 
HETATM 7736 O  O     . HOH D 4 .   ? 24.082  -13.780  -22.371 1.00 69.21  ? 1606 HOH A O     1 
HETATM 7737 O  O     . HOH D 4 .   ? 29.108  -4.502   -49.266 1.00 40.77  ? 1607 HOH A O     1 
HETATM 7738 O  O     . HOH D 4 .   ? 19.949  -12.610  -35.636 1.00 61.97  ? 1608 HOH A O     1 
HETATM 7739 O  O     . HOH D 4 .   ? 21.681  -6.500   -27.467 1.00 98.64  ? 1609 HOH A O     1 
HETATM 7740 O  O     . HOH D 4 .   ? -0.501  0.467    -52.543 1.00 53.26  ? 1610 HOH A O     1 
HETATM 7741 O  O     . HOH D 4 .   ? 24.843  -7.618   -33.586 1.00 85.19  ? 1611 HOH A O     1 
HETATM 7742 O  O     . HOH D 4 .   ? 16.982  -2.928   -33.909 1.00 26.89  ? 1612 HOH A O     1 
HETATM 7743 O  O     . HOH D 4 .   ? 20.062  -0.145   -54.344 1.00 52.57  ? 1613 HOH A O     1 
HETATM 7744 O  O     . HOH D 4 .   ? 45.845  -13.872  -37.123 1.00 74.76  ? 1614 HOH A O     1 
HETATM 7745 O  O     . HOH D 4 .   ? 25.361  -8.364   -30.707 1.00 79.47  ? 1615 HOH A O     1 
HETATM 7746 O  O     . HOH D 4 .   ? 14.036  -28.015  -44.426 1.00 41.41  ? 1616 HOH A O     1 
HETATM 7747 O  O     . HOH D 4 .   ? 3.650   -11.283  -48.719 1.00 27.52  ? 1617 HOH A O     1 
HETATM 7748 O  O     . HOH D 4 .   ? 10.162  -11.144  -31.748 1.00 28.10  ? 1618 HOH A O     1 
HETATM 7749 O  O     . HOH D 4 .   ? 22.978  -35.263  -35.303 1.00 151.39 ? 1619 HOH A O     1 
HETATM 7750 O  O     . HOH D 4 .   ? 22.625  -26.280  -37.503 1.00 29.51  ? 1620 HOH A O     1 
HETATM 7751 O  O     . HOH D 4 .   ? 35.244  -8.818   -41.102 1.00 92.63  ? 1621 HOH A O     1 
HETATM 7752 O  O     . HOH D 4 .   ? 9.251   -20.551  -24.607 1.00 33.10  ? 1622 HOH A O     1 
HETATM 7753 O  O     . HOH D 4 .   ? 31.049  27.569   -53.149 1.00 57.40  ? 1623 HOH A O     1 
HETATM 7754 O  O     . HOH D 4 .   ? -2.713  6.203    -48.881 1.00 50.95  ? 1624 HOH A O     1 
HETATM 7755 O  O     . HOH D 4 .   ? 13.534  -25.698  -20.385 1.00 35.74  ? 1625 HOH A O     1 
HETATM 7756 O  O     . HOH D 4 .   ? 8.903   -49.040  -29.632 1.00 68.10  ? 1626 HOH A O     1 
HETATM 7757 O  O     . HOH D 4 .   ? 26.202  -34.979  -20.195 1.00 46.39  ? 1627 HOH A O     1 
HETATM 7758 O  O     . HOH D 4 .   ? 28.477  10.304   -29.555 1.00 50.44  ? 1628 HOH A O     1 
HETATM 7759 O  O     . HOH D 4 .   ? 5.932   -35.901  -38.200 1.00 44.94  ? 1629 HOH A O     1 
HETATM 7760 O  O     . HOH D 4 .   ? 13.309  -31.726  -24.178 1.00 51.61  ? 1630 HOH A O     1 
HETATM 7761 O  O     . HOH D 4 .   ? 19.346  -6.070   -39.212 1.00 39.08  ? 1631 HOH A O     1 
HETATM 7762 O  O     . HOH D 4 .   ? 0.928   -16.333  -39.691 1.00 40.43  ? 1632 HOH A O     1 
HETATM 7763 O  O     . HOH D 4 .   ? 12.513  -34.097  -44.421 1.00 34.18  ? 1633 HOH A O     1 
HETATM 7764 O  O     . HOH D 4 .   ? 21.816  -7.373   -24.020 1.00 26.09  ? 1634 HOH A O     1 
HETATM 7765 O  O     . HOH D 4 .   ? 29.602  -23.762  -45.985 1.00 36.88  ? 1635 HOH A O     1 
HETATM 7766 O  O     . HOH D 4 .   ? 23.565  11.629   -23.566 1.00 45.62  ? 1636 HOH A O     1 
HETATM 7767 O  O     . HOH D 4 .   ? 35.277  -30.029  -37.555 1.00 39.41  ? 1637 HOH A O     1 
HETATM 7768 O  O     . HOH D 4 .   ? 6.204   5.645    -36.245 1.00 60.08  ? 1638 HOH A O     1 
HETATM 7769 O  O     . HOH D 4 .   ? 21.120  -8.051   -31.675 1.00 19.94  ? 1639 HOH A O     1 
HETATM 7770 O  O     . HOH D 4 .   ? 29.278  -15.311  -23.797 1.00 40.69  ? 1640 HOH A O     1 
HETATM 7771 O  O     . HOH D 4 .   ? 2.238   -18.909  -36.463 1.00 30.62  ? 1641 HOH A O     1 
HETATM 7772 O  O     . HOH D 4 .   ? 2.183   6.492    -45.243 1.00 42.95  ? 1642 HOH A O     1 
HETATM 7773 O  O     . HOH D 4 .   ? 48.752  16.998   -44.830 1.00 32.82  ? 1643 HOH A O     1 
HETATM 7774 O  O     . HOH D 4 .   ? 45.687  13.279   -26.685 1.00 63.77  ? 1644 HOH A O     1 
HETATM 7775 O  O     . HOH D 4 .   ? 21.721  11.236   -25.881 1.00 38.69  ? 1645 HOH A O     1 
HETATM 7776 O  O     . HOH D 4 .   ? 40.218  -19.386  -37.858 1.00 55.31  ? 1646 HOH A O     1 
HETATM 7777 O  O     . HOH D 4 .   ? 24.190  -37.262  -38.091 1.00 65.49  ? 1647 HOH A O     1 
HETATM 7778 O  O     . HOH D 4 .   ? 6.586   -32.129  -24.664 1.00 76.50  ? 1648 HOH A O     1 
HETATM 7779 O  O     . HOH D 4 .   ? 23.230  16.383   -30.988 1.00 71.15  ? 1649 HOH A O     1 
HETATM 7780 O  O     . HOH D 4 .   ? 14.011  -14.366  -25.618 1.00 65.11  ? 1650 HOH A O     1 
HETATM 7781 O  O     . HOH D 4 .   ? 17.774  7.644    -32.115 1.00 51.40  ? 1651 HOH A O     1 
HETATM 7782 O  O     . HOH D 4 .   ? 47.611  16.025   -42.583 1.00 33.62  ? 1652 HOH A O     1 
HETATM 7783 O  O     . HOH D 4 .   ? 28.804  10.955   -45.240 1.00 50.39  ? 1653 HOH A O     1 
HETATM 7784 O  O     . HOH D 4 .   ? -0.369  -18.181  -35.873 1.00 49.87  ? 1654 HOH A O     1 
HETATM 7785 O  O     . HOH D 4 .   ? 16.683  -30.184  -24.922 1.00 35.55  ? 1655 HOH A O     1 
HETATM 7786 O  O     . HOH D 4 .   ? 15.103  -69.749  -16.065 1.00 84.02  ? 1656 HOH A O     1 
HETATM 7787 O  O     . HOH D 4 .   ? 22.837  -14.467  -52.360 1.00 71.70  ? 1657 HOH A O     1 
HETATM 7788 O  O     . HOH D 4 .   ? 25.626  16.417   -23.541 1.00 63.44  ? 1658 HOH A O     1 
HETATM 7789 O  O     . HOH D 4 .   ? 32.746  -37.580  -38.402 1.00 46.05  ? 1659 HOH A O     1 
HETATM 7790 O  O     . HOH D 4 .   ? 48.742  6.645    -28.061 1.00 60.58  ? 1660 HOH A O     1 
HETATM 7791 O  O     . HOH D 4 .   ? 25.539  7.513    -44.545 1.00 124.67 ? 1661 HOH A O     1 
HETATM 7792 O  O     . HOH D 4 .   ? 42.768  10.068   -32.161 1.00 46.11  ? 1662 HOH A O     1 
HETATM 7793 O  O     . HOH D 4 .   ? 43.450  23.074   -46.488 1.00 37.31  ? 1663 HOH A O     1 
HETATM 7794 O  O     . HOH D 4 .   ? 26.264  -0.146   -46.973 1.00 51.37  ? 1664 HOH A O     1 
HETATM 7795 O  O     . HOH D 4 .   ? 14.631  8.008    -35.191 1.00 46.54  ? 1665 HOH A O     1 
HETATM 7796 O  O     . HOH D 4 .   ? 49.484  19.439   -45.793 1.00 65.70  ? 1666 HOH A O     1 
HETATM 7797 O  O     . HOH D 4 .   ? 16.045  -0.560   -30.873 1.00 44.43  ? 1667 HOH A O     1 
HETATM 7798 O  O     . HOH D 4 .   ? 13.424  -12.013  -39.114 1.00 28.03  ? 1668 HOH A O     1 
HETATM 7799 O  O     . HOH D 4 .   ? -22.996 -17.907  -40.610 1.00 72.30  ? 1669 HOH A O     1 
HETATM 7800 O  O     . HOH D 4 .   ? 62.654  -129.418 8.200   1.00 90.11  ? 1670 HOH A O     1 
HETATM 7801 O  O     . HOH D 4 .   ? 12.358  8.444    -28.534 1.00 50.61  ? 1671 HOH A O     1 
HETATM 7802 O  O     . HOH D 4 .   ? 32.215  -13.280  -26.928 1.00 51.52  ? 1672 HOH A O     1 
HETATM 7803 O  O     . HOH D 4 .   ? 7.724   -9.183   -34.222 1.00 42.38  ? 1673 HOH A O     1 
HETATM 7804 O  O     . HOH D 4 .   ? 44.826  -23.819  -19.566 1.00 65.44  ? 1674 HOH A O     1 
HETATM 7805 O  O     . HOH D 4 .   ? 20.889  -4.311   -40.492 1.00 45.47  ? 1675 HOH A O     1 
HETATM 7806 O  O     . HOH D 4 .   ? 40.472  -2.091   -15.658 1.00 57.33  ? 1676 HOH A O     1 
HETATM 7807 O  O     . HOH D 4 .   ? -12.097 -17.942  -18.381 1.00 72.52  ? 1677 HOH A O     1 
HETATM 7808 O  O     . HOH D 4 .   ? 19.548  -64.180  -38.520 1.00 101.57 ? 1678 HOH A O     1 
HETATM 7809 O  O     . HOH D 4 .   ? 20.170  -50.540  -23.799 1.00 72.31  ? 1679 HOH A O     1 
HETATM 7810 O  O     . HOH D 4 .   ? 19.233  -4.218   -21.655 1.00 38.59  ? 1680 HOH A O     1 
HETATM 7811 O  O     . HOH D 4 .   ? -0.170  13.255   -45.069 1.00 54.68  ? 1681 HOH A O     1 
HETATM 7812 O  O     . HOH D 4 .   ? 28.933  3.613    -44.869 1.00 83.69  ? 1682 HOH A O     1 
HETATM 7813 O  O     . HOH D 4 .   ? 47.025  6.859    -44.479 1.00 49.93  ? 1683 HOH A O     1 
HETATM 7814 O  O     . HOH D 4 .   ? 8.675   -31.784  -41.753 1.00 56.63  ? 1684 HOH A O     1 
HETATM 7815 O  O     . HOH D 4 .   ? 19.520  3.007    -51.779 1.00 43.52  ? 1685 HOH A O     1 
HETATM 7816 O  O     . HOH D 4 .   ? 30.666  -3.947   -22.787 1.00 66.54  ? 1686 HOH A O     1 
HETATM 7817 O  O     . HOH D 4 .   ? 22.484  -52.257  -49.696 1.00 69.23  ? 1687 HOH A O     1 
HETATM 7818 O  O     . HOH D 4 .   ? 12.073  -56.059  -34.516 1.00 45.27  ? 1688 HOH A O     1 
HETATM 7819 O  O     . HOH D 4 .   ? 33.929  -24.331  -45.056 1.00 45.94  ? 1689 HOH A O     1 
HETATM 7820 O  O     . HOH D 4 .   ? 11.501  -13.498  -37.859 1.00 36.22  ? 1690 HOH A O     1 
HETATM 7821 O  O     . HOH D 4 .   ? 22.386  -16.490  -14.653 1.00 74.95  ? 1691 HOH A O     1 
HETATM 7822 O  O     . HOH D 4 .   ? 7.535   -10.506  -18.802 1.00 48.15  ? 1692 HOH A O     1 
HETATM 7823 O  O     . HOH D 4 .   ? 47.405  -6.337   -23.901 1.00 75.39  ? 1693 HOH A O     1 
HETATM 7824 O  O     . HOH D 4 .   ? -0.473  5.186    -39.597 1.00 75.70  ? 1694 HOH A O     1 
HETATM 7825 O  O     . HOH D 4 .   ? 24.168  3.974    -24.198 1.00 39.34  ? 1695 HOH A O     1 
HETATM 7826 O  O     . HOH D 4 .   ? -6.391  -18.249  -34.521 1.00 54.36  ? 1696 HOH A O     1 
HETATM 7827 O  O     . HOH D 4 .   ? 11.506  -14.056  -33.435 1.00 23.12  ? 1697 HOH A O     1 
HETATM 7828 O  O     . HOH D 4 .   ? 31.957  35.421   -38.113 1.00 57.74  ? 1698 HOH A O     1 
HETATM 7829 O  O     . HOH D 4 .   ? 14.133  -11.360  -36.748 1.00 22.59  ? 1699 HOH A O     1 
HETATM 7830 O  O     . HOH D 4 .   ? -0.319  -12.807  -18.662 1.00 53.82  ? 1700 HOH A O     1 
HETATM 7831 O  O     . HOH D 4 .   ? 4.871   -38.241  -35.167 1.00 51.12  ? 1701 HOH A O     1 
HETATM 7832 O  O     . HOH D 4 .   ? 3.509   8.038    -39.053 1.00 60.10  ? 1702 HOH A O     1 
HETATM 7833 O  O     . HOH D 4 .   ? -2.584  -28.529  -51.046 1.00 80.13  ? 1703 HOH A O     1 
HETATM 7834 O  O     . HOH D 4 .   ? 44.553  8.036    -31.703 1.00 44.80  ? 1704 HOH A O     1 
HETATM 7835 O  O     . HOH D 4 .   ? 20.618  -27.451  -33.384 1.00 29.91  ? 1705 HOH A O     1 
HETATM 7836 O  O     . HOH D 4 .   ? 14.640  7.860    -58.709 1.00 47.12  ? 1706 HOH A O     1 
HETATM 7837 O  O     . HOH D 4 .   ? 16.679  -24.877  -33.645 1.00 38.91  ? 1707 HOH A O     1 
HETATM 7838 O  O     . HOH D 4 .   ? 31.388  -78.940  -22.726 1.00 74.33  ? 1708 HOH A O     1 
HETATM 7839 O  O     . HOH D 4 .   ? 17.963  -26.903  -18.124 1.00 50.91  ? 1709 HOH A O     1 
HETATM 7840 O  O     . HOH D 4 .   ? 32.203  -3.404   -20.624 1.00 71.46  ? 1710 HOH A O     1 
HETATM 7841 O  O     . HOH D 4 .   ? 30.053  -5.256   -52.348 1.00 49.23  ? 1711 HOH A O     1 
HETATM 7842 O  O     . HOH D 4 .   ? 9.939   -41.389  -30.015 1.00 54.39  ? 1712 HOH A O     1 
HETATM 7843 O  O     . HOH D 4 .   ? 30.507  19.989   -48.817 1.00 66.95  ? 1713 HOH A O     1 
HETATM 7844 O  O     . HOH D 4 .   ? 10.533  -4.186   -29.342 1.00 56.72  ? 1714 HOH A O     1 
HETATM 7845 O  O     . HOH D 4 .   ? 10.351  -4.580   -23.401 1.00 42.00  ? 1715 HOH A O     1 
HETATM 7846 O  O     . HOH D 4 .   ? 39.233  1.565    -40.535 1.00 34.99  ? 1716 HOH A O     1 
HETATM 7847 O  O     . HOH D 4 .   ? 46.203  9.501    -19.512 1.00 87.29  ? 1717 HOH A O     1 
HETATM 7848 O  O     . HOH D 4 .   ? 19.477  14.218   -48.147 1.00 35.49  ? 1718 HOH A O     1 
HETATM 7849 O  O     . HOH D 4 .   ? 11.142  -3.170   -25.618 1.00 47.11  ? 1719 HOH A O     1 
HETATM 7850 O  O     . HOH D 4 .   ? 6.556   -0.603   -16.306 1.00 141.41 ? 1720 HOH A O     1 
HETATM 7851 O  O     . HOH D 4 .   ? 46.786  17.105   -48.850 1.00 100.38 ? 1721 HOH A O     1 
HETATM 7852 O  O     . HOH D 4 .   ? 29.677  -64.678  -19.543 1.00 64.74  ? 1722 HOH A O     1 
HETATM 7853 O  O     . HOH D 4 .   ? 22.479  -33.298  -33.485 1.00 48.30  ? 1723 HOH A O     1 
HETATM 7854 O  O     . HOH D 4 .   ? 41.526  12.399   -50.138 1.00 75.44  ? 1724 HOH A O     1 
HETATM 7855 O  O     . HOH D 4 .   ? 39.416  32.084   -35.491 1.00 46.86  ? 1725 HOH A O     1 
HETATM 7856 O  O     . HOH D 4 .   ? 15.519  -1.584   -55.061 1.00 33.36  ? 1726 HOH A O     1 
HETATM 7857 O  O     . HOH D 4 .   ? -11.436 -28.961  -25.954 1.00 43.10  ? 1727 HOH A O     1 
HETATM 7858 O  O     . HOH D 4 .   ? 14.872  -12.876  -50.411 1.00 30.52  ? 1728 HOH A O     1 
HETATM 7859 O  O     . HOH D 4 .   ? 19.319  -30.291  -38.859 1.00 70.59  ? 1729 HOH A O     1 
HETATM 7860 O  O     . HOH D 4 .   ? 21.029  1.419    -58.365 1.00 58.34  ? 1730 HOH A O     1 
HETATM 7861 O  O     . HOH D 4 .   ? 20.682  -30.694  -36.546 1.00 52.77  ? 1731 HOH A O     1 
HETATM 7862 O  O     . HOH D 4 .   ? 27.779  2.576    -41.373 1.00 52.38  ? 1732 HOH A O     1 
HETATM 7863 O  O     . HOH D 4 .   ? 8.125   -20.050  -22.181 1.00 40.08  ? 1733 HOH A O     1 
HETATM 7864 O  O     . HOH D 4 .   ? 32.269  8.668    -49.332 1.00 52.57  ? 1734 HOH A O     1 
HETATM 7865 O  O     . HOH D 4 .   ? 35.897  22.122   -26.803 1.00 68.65  ? 1735 HOH A O     1 
HETATM 7866 O  O     . HOH D 4 .   ? 40.630  -10.706  -17.179 1.00 119.24 ? 1736 HOH A O     1 
HETATM 7867 O  O     . HOH D 4 .   ? 50.189  13.862   -33.376 1.00 38.05  ? 1737 HOH A O     1 
HETATM 7868 O  O     . HOH D 4 .   ? -5.084  -36.540  -26.700 1.00 52.50  ? 1738 HOH A O     1 
HETATM 7869 O  O     . HOH D 4 .   ? 29.931  21.115   -34.673 1.00 83.55  ? 1739 HOH A O     1 
HETATM 7870 O  O     . HOH D 4 .   ? 45.740  0.836    -20.568 1.00 69.69  ? 1740 HOH A O     1 
HETATM 7871 O  O     . HOH D 4 .   ? 36.757  25.650   -33.220 1.00 47.52  ? 1741 HOH A O     1 
HETATM 7872 O  O     . HOH D 4 .   ? 3.661   -32.966  -21.095 1.00 40.89  ? 1742 HOH A O     1 
HETATM 7873 O  O     . HOH D 4 .   ? 9.826   1.959    -59.777 1.00 53.27  ? 1743 HOH A O     1 
HETATM 7874 O  O     . HOH D 4 .   ? 11.831  -40.116  -36.926 1.00 28.46  ? 1744 HOH A O     1 
HETATM 7875 O  O     . HOH D 4 .   ? 24.398  -31.182  -41.040 1.00 40.27  ? 1745 HOH A O     1 
HETATM 7876 O  O     . HOH D 4 .   ? 5.455   -8.116   -45.454 1.00 38.58  ? 1746 HOH A O     1 
HETATM 7877 O  O     . HOH D 4 .   ? -5.061  -21.557  -34.405 1.00 33.12  ? 1747 HOH A O     1 
HETATM 7878 O  O     . HOH D 4 .   ? 26.672  12.120   -44.131 1.00 46.99  ? 1748 HOH A O     1 
HETATM 7879 O  O     . HOH D 4 .   ? -23.516 -15.389  -17.222 1.00 148.52 ? 1749 HOH A O     1 
HETATM 7880 O  O     . HOH D 4 .   ? 0.645   -37.204  -45.205 1.00 56.72  ? 1750 HOH A O     1 
HETATM 7881 O  O     . HOH D 4 .   ? 29.361  -32.261  -26.768 1.00 45.51  ? 1751 HOH A O     1 
HETATM 7882 O  O     . HOH D 4 .   ? 36.068  26.317   -30.683 1.00 45.69  ? 1752 HOH A O     1 
HETATM 7883 O  O     . HOH D 4 .   ? 13.593  -23.019  -20.486 1.00 33.61  ? 1753 HOH A O     1 
HETATM 7884 O  O     . HOH D 4 .   ? 23.998  -25.226  -11.355 1.00 43.79  ? 1754 HOH A O     1 
HETATM 7885 O  O     . HOH D 4 .   ? 5.007   -13.234  -41.878 1.00 52.63  ? 1755 HOH A O     1 
HETATM 7886 O  O     . HOH D 4 .   ? 29.344  24.034   -52.793 1.00 67.17  ? 1756 HOH A O     1 
HETATM 7887 O  O     . HOH D 4 .   ? 36.691  -4.841   -40.373 1.00 77.02  ? 1757 HOH A O     1 
HETATM 7888 O  O     . HOH D 4 .   ? 22.813  -36.717  -32.595 1.00 68.93  ? 1758 HOH A O     1 
HETATM 7889 O  O     . HOH D 4 .   ? -2.738  -28.122  -37.065 1.00 55.65  ? 1759 HOH A O     1 
HETATM 7890 O  O     . HOH D 4 .   ? 2.560   -0.914   -36.986 1.00 35.83  ? 1760 HOH A O     1 
HETATM 7891 O  O     . HOH D 4 .   ? 14.869  -4.732   -24.088 1.00 29.93  ? 1761 HOH A O     1 
HETATM 7892 O  O     . HOH D 4 .   ? 20.403  -38.055  -45.189 1.00 59.44  ? 1762 HOH A O     1 
HETATM 7893 O  O     . HOH D 4 .   ? 22.148  -13.752  -19.128 1.00 76.23  ? 1763 HOH A O     1 
HETATM 7894 O  O     . HOH D 4 .   ? 49.262  -22.458  -12.751 1.00 76.35  ? 1764 HOH A O     1 
HETATM 7895 O  O     . HOH D 4 .   ? 48.902  16.227   -32.313 1.00 78.27  ? 1765 HOH A O     1 
HETATM 7896 O  O     . HOH D 4 .   ? 36.225  -69.226  1.073   1.00 163.23 ? 1766 HOH A O     1 
HETATM 7897 O  O     . HOH D 4 .   ? -1.305  -23.107  -40.953 1.00 71.48  ? 1767 HOH A O     1 
HETATM 7898 O  O     . HOH D 4 .   ? 20.250  12.797   -18.893 1.00 89.76  ? 1768 HOH A O     1 
HETATM 7899 O  O     . HOH D 4 .   ? 21.930  -53.422  -35.978 1.00 68.43  ? 1769 HOH A O     1 
HETATM 7900 O  O     . HOH D 4 .   ? 36.773  32.301   -39.402 1.00 37.97  ? 1770 HOH A O     1 
HETATM 7901 O  O     . HOH D 4 .   ? 27.975  1.312    -20.404 1.00 56.97  ? 1771 HOH A O     1 
HETATM 7902 O  O     . HOH D 4 .   ? 8.652   7.884    -39.030 1.00 51.51  ? 1772 HOH A O     1 
HETATM 7903 O  O     . HOH D 4 .   ? -1.703  15.677   -44.092 1.00 70.44  ? 1773 HOH A O     1 
HETATM 7904 O  O     . HOH D 4 .   ? 15.667  -29.539  -46.540 1.00 53.24  ? 1774 HOH A O     1 
HETATM 7905 O  O     . HOH D 4 .   ? 36.369  15.577   -26.662 1.00 50.94  ? 1775 HOH A O     1 
HETATM 7906 O  O     . HOH D 4 .   ? 6.282   -14.597  -43.739 1.00 45.46  ? 1776 HOH A O     1 
HETATM 7907 O  O     . HOH D 4 .   ? 32.857  -20.859  -21.797 1.00 45.44  ? 1777 HOH A O     1 
HETATM 7908 O  O     . HOH D 4 .   ? 5.401   -39.836  -56.824 1.00 77.34  ? 1778 HOH A O     1 
HETATM 7909 O  O     . HOH D 4 .   ? -11.193 -9.920   -22.902 1.00 95.11  ? 1779 HOH A O     1 
HETATM 7910 O  O     . HOH D 4 .   ? 35.267  32.798   -48.193 1.00 51.52  ? 1780 HOH A O     1 
HETATM 7911 O  O     . HOH D 4 .   ? 16.443  17.595   -49.728 1.00 55.16  ? 1781 HOH A O     1 
HETATM 7912 O  O     . HOH D 4 .   ? 19.184  -15.550  -16.993 1.00 67.55  ? 1782 HOH A O     1 
HETATM 7913 O  O     . HOH D 4 .   ? -25.568 -14.279  -30.795 1.00 57.83  ? 1783 HOH A O     1 
HETATM 7914 O  O     . HOH D 4 .   ? -1.307  -5.837   -49.130 1.00 74.43  ? 1784 HOH A O     1 
HETATM 7915 O  O     . HOH D 4 .   ? 13.259  -31.577  -42.058 1.00 41.04  ? 1785 HOH A O     1 
HETATM 7916 O  O     . HOH D 4 .   ? 44.445  -22.262  -32.977 1.00 47.65  ? 1786 HOH A O     1 
HETATM 7917 O  O     . HOH D 4 .   ? 48.372  25.911   -44.714 1.00 70.72  ? 1787 HOH A O     1 
HETATM 7918 O  O     . HOH D 4 .   ? 1.397   -8.047   -44.959 1.00 61.07  ? 1788 HOH A O     1 
HETATM 7919 O  O     . HOH D 4 .   ? 20.673  -50.379  -47.386 1.00 88.51  ? 1789 HOH A O     1 
HETATM 7920 O  O     . HOH D 4 .   ? 30.377  -6.538   -45.894 1.00 68.59  ? 1790 HOH A O     1 
HETATM 7921 O  O     . HOH D 4 .   ? 39.515  31.334   -30.871 1.00 47.49  ? 1791 HOH A O     1 
HETATM 7922 O  O     . HOH D 4 .   ? 32.314  -14.408  -39.614 1.00 30.79  ? 1792 HOH A O     1 
HETATM 7923 O  O     . HOH D 4 .   ? 10.854  -55.436  -51.139 1.00 75.49  ? 1793 HOH A O     1 
HETATM 7924 O  O     . HOH D 4 .   ? -13.839 -13.770  -24.036 1.00 67.69  ? 1794 HOH A O     1 
HETATM 7925 O  O     . HOH D 4 .   ? 33.773  -4.991   -12.230 1.00 61.71  ? 1795 HOH A O     1 
HETATM 7926 O  O     . HOH D 4 .   ? -9.865  -37.333  -16.700 1.00 57.42  ? 1796 HOH A O     1 
HETATM 7927 O  O     . HOH D 4 .   ? 16.346  -14.670  -23.990 1.00 32.89  ? 1797 HOH A O     1 
HETATM 7928 O  O     . HOH D 4 .   ? 30.699  -37.102  -26.019 1.00 46.84  ? 1798 HOH A O     1 
HETATM 7929 O  O     . HOH D 4 .   ? -16.329 -27.369  -16.389 1.00 51.45  ? 1799 HOH A O     1 
HETATM 7930 O  O     . HOH D 4 .   ? 8.617   -49.269  -24.752 1.00 100.67 ? 1800 HOH A O     1 
HETATM 7931 O  O     . HOH D 4 .   ? 18.356  -22.711  -46.116 1.00 46.79  ? 1801 HOH A O     1 
HETATM 7932 O  O     . HOH D 4 .   ? 31.806  -14.672  -42.828 1.00 82.37  ? 1802 HOH A O     1 
HETATM 7933 O  O     . HOH D 4 .   ? 6.212   -7.655   -12.880 1.00 146.95 ? 1803 HOH A O     1 
HETATM 7934 O  O     . HOH D 4 .   ? 33.285  21.398   -45.916 1.00 35.71  ? 1804 HOH A O     1 
HETATM 7935 O  O     . HOH D 4 .   ? 13.583  -34.411  -21.403 1.00 46.92  ? 1805 HOH A O     1 
HETATM 7936 O  O     . HOH D 4 .   ? -5.292  -28.808  -19.715 1.00 54.77  ? 1806 HOH A O     1 
HETATM 7937 O  O     . HOH D 4 .   ? -12.091 -11.268  -20.689 1.00 90.36  ? 1807 HOH A O     1 
HETATM 7938 O  O     . HOH D 4 .   ? 31.724  24.313   -27.905 1.00 134.67 ? 1808 HOH A O     1 
HETATM 7939 O  O     . HOH D 4 .   ? 43.069  0.296    -16.587 1.00 56.93  ? 1809 HOH A O     1 
HETATM 7940 O  O     . HOH D 4 .   ? 13.076  6.526    -30.312 1.00 62.95  ? 1810 HOH A O     1 
HETATM 7941 O  O     . HOH D 4 .   ? 6.748   -45.458  -49.216 1.00 51.83  ? 1811 HOH A O     1 
HETATM 7942 O  O     . HOH D 4 .   ? 42.040  -29.993  -38.814 1.00 37.31  ? 1812 HOH A O     1 
HETATM 7943 O  O     . HOH D 4 .   ? -0.824  3.985    -51.896 1.00 50.90  ? 1813 HOH A O     1 
HETATM 7944 O  O     . HOH D 4 .   ? 9.336   -27.674  -37.356 1.00 51.71  ? 1814 HOH A O     1 
HETATM 7945 O  O     . HOH D 4 .   ? -0.125  -27.108  -22.690 1.00 44.23  ? 1815 HOH A O     1 
HETATM 7946 O  O     . HOH D 4 .   ? -1.340  15.853   -47.259 1.00 57.39  ? 1816 HOH A O     1 
HETATM 7947 O  O     . HOH D 4 .   ? 19.921  -8.795   -51.127 1.00 54.61  ? 1817 HOH A O     1 
HETATM 7948 O  O     . HOH D 4 .   ? -13.744 -14.754  -17.423 1.00 92.44  ? 1818 HOH A O     1 
HETATM 7949 O  O     . HOH D 4 .   ? 15.634  -14.146  -47.978 1.00 38.98  ? 1819 HOH A O     1 
HETATM 7950 O  O     . HOH D 4 .   ? 1.233   -24.101  -13.920 1.00 61.45  ? 1820 HOH A O     1 
HETATM 7951 O  O     . HOH D 4 .   ? 7.376   0.905    -60.156 1.00 58.24  ? 1821 HOH A O     1 
HETATM 7952 O  O     . HOH D 4 .   ? -3.239  -11.913  -19.775 1.00 47.62  ? 1822 HOH A O     1 
HETATM 7953 O  O     . HOH D 4 .   ? -0.009  -36.288  -30.105 1.00 116.33 ? 1823 HOH A O     1 
HETATM 7954 O  O     . HOH D 4 .   ? 5.365   3.693    -38.080 1.00 48.17  ? 1824 HOH A O     1 
HETATM 7955 O  O     . HOH D 4 .   ? -0.209  -43.386  -38.301 1.00 59.01  ? 1825 HOH A O     1 
HETATM 7956 O  O     . HOH D 4 .   ? 9.396   -16.442  -52.693 1.00 68.00  ? 1826 HOH A O     1 
HETATM 7957 O  O     . HOH D 4 .   ? 0.734   -20.020  -14.697 1.00 62.02  ? 1827 HOH A O     1 
HETATM 7958 O  O     . HOH D 4 .   ? 42.085  23.961   -49.677 1.00 68.58  ? 1828 HOH A O     1 
HETATM 7959 O  O     . HOH D 4 .   ? 29.930  17.243   -29.564 1.00 38.92  ? 1829 HOH A O     1 
HETATM 7960 O  O     . HOH D 4 .   ? -12.536 -30.637  -20.944 1.00 46.21  ? 1830 HOH A O     1 
HETATM 7961 O  O     . HOH D 4 .   ? 7.312   -30.800  -18.868 1.00 50.47  ? 1831 HOH A O     1 
HETATM 7962 O  O     . HOH D 4 .   ? -16.617 -15.582  -36.622 1.00 50.99  ? 1832 HOH A O     1 
HETATM 7963 O  O     . HOH D 4 .   ? -2.054  10.307   -50.830 1.00 66.65  ? 1833 HOH A O     1 
HETATM 7964 O  O     . HOH D 4 .   ? 48.696  24.128   -41.374 1.00 54.60  ? 1834 HOH A O     1 
HETATM 7965 O  O     . HOH D 4 .   ? 22.092  -43.832  -50.905 1.00 50.45  ? 1835 HOH A O     1 
HETATM 7966 O  O     . HOH D 4 .   ? -4.679  -27.084  -21.593 1.00 43.78  ? 1836 HOH A O     1 
HETATM 7967 O  O     . HOH D 4 .   ? 0.844   -25.800  -20.542 1.00 58.70  ? 1837 HOH A O     1 
HETATM 7968 O  O     . HOH D 4 .   ? 3.319   -19.096  -49.613 1.00 48.39  ? 1838 HOH A O     1 
HETATM 7969 O  O     . HOH D 4 .   ? 48.736  -23.545  -35.073 1.00 35.70  ? 1839 HOH A O     1 
HETATM 7970 O  O     . HOH D 4 .   ? 32.678  15.449   -44.555 1.00 37.85  ? 1840 HOH A O     1 
HETATM 7971 O  O     . HOH D 4 .   ? 31.416  -18.989  -47.095 1.00 59.02  ? 1841 HOH A O     1 
HETATM 7972 O  O     . HOH D 4 .   ? 2.632   -5.807   -31.386 1.00 86.44  ? 1842 HOH A O     1 
HETATM 7973 O  O     . HOH D 4 .   ? -10.861 -23.099  -34.529 1.00 108.53 ? 1843 HOH A O     1 
HETATM 7974 O  O     . HOH D 4 .   ? 14.727  16.707   -45.533 1.00 63.53  ? 1844 HOH A O     1 
HETATM 7975 O  O     . HOH D 4 .   ? 15.386  -28.613  -51.567 1.00 37.38  ? 1845 HOH A O     1 
HETATM 7976 O  O     . HOH D 4 .   ? 23.392  -19.013  -14.469 1.00 55.84  ? 1846 HOH A O     1 
HETATM 7977 O  O     . HOH D 4 .   ? 24.589  -35.018  -28.484 1.00 50.67  ? 1847 HOH A O     1 
HETATM 7978 O  O     . HOH D 4 .   ? -4.377  -26.203  -24.484 1.00 37.34  ? 1848 HOH A O     1 
HETATM 7979 O  O     . HOH D 4 .   ? 33.894  18.903   -50.792 1.00 92.11  ? 1849 HOH A O     1 
HETATM 7980 O  O     . HOH D 4 .   ? 29.710  -14.027  -45.809 1.00 44.36  ? 1850 HOH A O     1 
HETATM 7981 O  O     . HOH D 4 .   ? 10.982  -28.195  -19.088 1.00 44.89  ? 1851 HOH A O     1 
HETATM 7982 O  O     . HOH D 4 .   ? -23.521 -13.614  -25.505 1.00 49.72  ? 1852 HOH A O     1 
HETATM 7983 O  O     . HOH D 4 .   ? 33.655  44.647   -39.418 1.00 80.89  ? 1853 HOH A O     1 
HETATM 7984 O  O     . HOH D 4 .   ? 30.608  -13.170  -24.713 1.00 46.75  ? 1854 HOH A O     1 
HETATM 7985 O  O     . HOH D 4 .   ? 22.447  -36.901  -40.579 1.00 44.02  ? 1855 HOH A O     1 
HETATM 7986 O  O     . HOH D 4 .   ? -3.567  -7.320   -22.384 1.00 70.37  ? 1856 HOH A O     1 
HETATM 7987 O  O     . HOH D 4 .   ? 10.265  5.899    -30.489 1.00 48.25  ? 1857 HOH A O     1 
HETATM 7988 O  O     . HOH D 4 .   ? 27.589  -64.911  -7.059  1.00 91.22  ? 1858 HOH A O     1 
HETATM 7989 O  O     . HOH D 4 .   ? 34.101  6.264    -44.112 1.00 39.67  ? 1859 HOH A O     1 
HETATM 7990 O  O     . HOH D 4 .   ? 0.085   -33.039  -48.425 1.00 63.70  ? 1860 HOH A O     1 
HETATM 7991 O  O     . HOH D 4 .   ? 1.789   -7.910   -39.875 1.00 45.56  ? 1861 HOH A O     1 
HETATM 7992 O  O     . HOH D 4 .   ? 15.607  -25.119  -37.052 1.00 47.95  ? 1862 HOH A O     1 
HETATM 7993 O  O     . HOH D 4 .   ? -3.712  5.045    -52.417 1.00 73.27  ? 1863 HOH A O     1 
HETATM 7994 O  O     . HOH D 4 .   ? 14.246  -20.673  -13.850 1.00 59.54  ? 1864 HOH A O     1 
HETATM 7995 O  O     . HOH D 4 .   ? 29.652  9.860    -42.977 1.00 31.51  ? 1865 HOH A O     1 
HETATM 7996 O  O     . HOH D 4 .   ? 29.085  -27.527  -45.611 1.00 40.10  ? 1866 HOH A O     1 
HETATM 7997 O  O     . HOH D 4 .   ? 35.089  26.751   -26.521 1.00 79.82  ? 1867 HOH A O     1 
HETATM 7998 O  O     . HOH D 4 .   ? 82.056  -134.264 11.789  1.00 105.79 ? 1868 HOH A O     1 
HETATM 7999 O  O     . HOH D 4 .   ? -19.085 -31.575  -28.218 1.00 71.36  ? 1869 HOH A O     1 
HETATM 8000 O  O     . HOH D 4 .   ? 12.210  -42.675  -27.914 1.00 83.41  ? 1870 HOH A O     1 
HETATM 8001 O  O     . HOH D 4 .   ? 42.412  24.261   -27.361 1.00 66.05  ? 1871 HOH A O     1 
HETATM 8002 O  O     . HOH D 4 .   ? 51.189  8.564    -33.275 1.00 43.09  ? 1872 HOH A O     1 
HETATM 8003 O  O     . HOH D 4 .   ? 23.830  25.413   -48.288 1.00 48.61  ? 1873 HOH A O     1 
HETATM 8004 O  O     . HOH D 4 .   ? 4.461   -23.552  -47.796 1.00 38.68  ? 1874 HOH A O     1 
HETATM 8005 O  O     . HOH D 4 .   ? 49.353  1.369    -37.730 1.00 81.74  ? 1875 HOH A O     1 
HETATM 8006 O  O     . HOH D 4 .   ? 1.921   -5.383   -42.502 1.00 51.54  ? 1876 HOH A O     1 
HETATM 8007 O  O     . HOH D 4 .   ? 22.453  1.717    -21.267 1.00 52.56  ? 1877 HOH A O     1 
HETATM 8008 O  O     . HOH D 4 .   ? -1.058  -30.155  -37.606 1.00 31.46  ? 1878 HOH A O     1 
HETATM 8009 O  O     . HOH D 4 .   ? 10.996  14.616   -46.404 1.00 38.71  ? 1879 HOH A O     1 
HETATM 8010 O  O     . HOH D 4 .   ? 6.364   -1.316   -58.616 1.00 51.27  ? 1880 HOH A O     1 
HETATM 8011 O  O     . HOH D 4 .   ? 8.169   -18.686  -49.158 1.00 60.28  ? 1881 HOH A O     1 
HETATM 8012 O  O     . HOH D 4 .   ? 14.504  -22.030  -18.221 1.00 35.08  ? 1882 HOH A O     1 
HETATM 8013 O  O     . HOH D 4 .   ? -2.043  -28.852  -20.968 1.00 37.56  ? 1883 HOH A O     1 
HETATM 8014 O  O     . HOH D 4 .   ? 33.365  -6.897   -40.906 1.00 38.72  ? 1884 HOH A O     1 
HETATM 8015 O  O     . HOH D 4 .   ? 21.950  -5.777   -38.662 1.00 40.86  ? 1885 HOH A O     1 
HETATM 8016 O  O     . HOH D 4 .   ? 38.777  1.787    -43.388 1.00 82.27  ? 1886 HOH A O     1 
HETATM 8017 O  O     . HOH D 4 .   ? 5.032   -34.476  -34.485 1.00 71.16  ? 1887 HOH A O     1 
HETATM 8018 O  O     . HOH D 4 .   ? 13.882  -8.952   -55.676 1.00 48.48  ? 1888 HOH A O     1 
HETATM 8019 O  O     . HOH D 4 .   ? 16.995  -35.867  -41.128 1.00 51.47  ? 1889 HOH A O     1 
HETATM 8020 O  O     . HOH D 4 .   ? 20.286  7.846    -33.893 1.00 36.71  ? 1890 HOH A O     1 
HETATM 8021 O  O     . HOH D 4 .   ? 40.598  -21.659  -39.281 1.00 42.83  ? 1891 HOH A O     1 
HETATM 8022 O  O     . HOH D 4 .   ? 9.562   -11.128  -34.397 1.00 34.32  ? 1892 HOH A O     1 
HETATM 8023 O  O     . HOH D 4 .   ? 33.224  26.812   -30.550 1.00 52.77  ? 1893 HOH A O     1 
HETATM 8024 O  O     . HOH D 4 .   ? 28.551  -5.645   -22.624 1.00 59.42  ? 1894 HOH A O     1 
HETATM 8025 O  O     . HOH D 4 .   ? 23.473  19.846   -39.995 1.00 44.81  ? 1895 HOH A O     1 
HETATM 8026 O  O     . HOH D 4 .   ? 29.650  -0.753   -40.637 1.00 46.63  ? 1896 HOH A O     1 
HETATM 8027 O  O     . HOH D 4 .   ? 3.132   -21.181  -14.220 1.00 53.75  ? 1897 HOH A O     1 
HETATM 8028 O  O     . HOH D 4 .   ? 8.958   -11.871  -11.887 1.00 73.35  ? 1898 HOH A O     1 
HETATM 8029 O  O     . HOH D 4 .   ? 3.690   -13.945  -45.728 1.00 44.87  ? 1899 HOH A O     1 
HETATM 8030 O  O     . HOH D 4 .   ? 47.299  -3.628   -22.398 1.00 58.16  ? 1900 HOH A O     1 
HETATM 8031 O  O     . HOH D 4 .   ? 42.204  -8.782   -40.042 1.00 61.56  ? 1901 HOH A O     1 
HETATM 8032 O  O     . HOH D 4 .   ? 36.754  -7.697   -18.269 1.00 47.41  ? 1902 HOH A O     1 
HETATM 8033 O  O     . HOH D 4 .   ? 35.610  -34.477  -43.122 1.00 97.30  ? 1903 HOH A O     1 
HETATM 8034 O  O     . HOH D 4 .   ? -0.391  -19.647  -17.175 1.00 61.34  ? 1904 HOH A O     1 
HETATM 8035 O  O     . HOH D 4 .   ? 40.824  -30.818  -24.302 1.00 56.88  ? 1905 HOH A O     1 
HETATM 8036 O  O     . HOH D 4 .   ? 6.941   -43.620  -51.238 1.00 78.10  ? 1906 HOH A O     1 
HETATM 8037 O  O     . HOH D 4 .   ? 24.080  5.976    -39.961 1.00 24.06  ? 1907 HOH A O     1 
HETATM 8038 O  O     . HOH D 4 .   ? 36.463  8.315    -48.585 1.00 68.57  ? 1908 HOH A O     1 
HETATM 8039 O  O     . HOH D 4 .   ? -1.704  -26.633  -24.806 1.00 45.36  ? 1909 HOH A O     1 
HETATM 8040 O  O     . HOH D 4 .   ? 23.156  18.863   -27.247 1.00 73.87  ? 1910 HOH A O     1 
HETATM 8041 O  O     . HOH D 4 .   ? 28.812  -10.732  -46.172 1.00 38.81  ? 1911 HOH A O     1 
HETATM 8042 O  O     . HOH D 4 .   ? -8.501  -19.018  -18.617 1.00 56.32  ? 1912 HOH A O     1 
HETATM 8043 O  O     . HOH D 4 .   ? 4.281   -19.202  -52.142 1.00 61.62  ? 1913 HOH A O     1 
HETATM 8044 O  O     . HOH D 4 .   ? 10.099  8.587    -26.283 1.00 62.41  ? 1914 HOH A O     1 
HETATM 8045 O  O     . HOH D 4 .   ? 10.150  -34.786  -30.291 1.00 53.05  ? 1915 HOH A O     1 
HETATM 8046 O  O     . HOH D 4 .   ? -1.394  -10.207  -35.870 1.00 57.33  ? 1916 HOH A O     1 
HETATM 8047 O  O     . HOH D 4 .   ? 29.789  -9.093   -53.633 1.00 60.59  ? 1917 HOH A O     1 
HETATM 8048 O  O     . HOH D 4 .   ? 10.321  -13.598  -15.991 1.00 82.34  ? 1918 HOH A O     1 
HETATM 8049 O  O     . HOH D 4 .   ? 41.701  31.119   -29.346 1.00 50.02  ? 1919 HOH A O     1 
HETATM 8050 O  O     . HOH D 4 .   ? 16.371  -27.187  -32.277 1.00 43.59  ? 1920 HOH A O     1 
HETATM 8051 O  O     . HOH D 4 .   ? 2.938   -11.463  -41.697 1.00 45.83  ? 1921 HOH A O     1 
HETATM 8052 O  O     . HOH D 4 .   ? 23.079  11.811   -40.629 1.00 62.37  ? 1922 HOH A O     1 
HETATM 8053 O  O     . HOH D 4 .   ? 52.326  4.537    -32.392 1.00 94.00  ? 1923 HOH A O     1 
HETATM 8054 O  O     . HOH D 4 .   ? 41.854  -28.312  -42.684 1.00 87.26  ? 1924 HOH A O     1 
HETATM 8055 O  O     . HOH D 4 .   ? 9.633   -42.699  -54.800 1.00 56.05  ? 1925 HOH A O     1 
HETATM 8056 O  O     . HOH D 4 .   ? 30.285  -39.982  -39.794 1.00 114.18 ? 1926 HOH A O     1 
HETATM 8057 O  O     . HOH D 4 .   ? 14.716  -5.735   -17.251 1.00 69.35  ? 1927 HOH A O     1 
HETATM 8058 O  O     . HOH D 4 .   ? -2.030  -8.078   -24.495 1.00 85.71  ? 1928 HOH A O     1 
HETATM 8059 O  O     . HOH D 4 .   ? 8.460   -52.635  -29.334 1.00 68.37  ? 1929 HOH A O     1 
HETATM 8060 O  O     . HOH D 4 .   ? 19.120  2.501    -59.813 1.00 56.48  ? 1930 HOH A O     1 
HETATM 8061 O  O     . HOH D 4 .   ? -3.088  2.951    -42.046 1.00 51.89  ? 1931 HOH A O     1 
HETATM 8062 O  O     . HOH D 4 .   ? 20.648  -12.869  -52.447 1.00 59.84  ? 1932 HOH A O     1 
HETATM 8063 O  O     . HOH D 4 .   ? 6.667   -35.974  -55.940 1.00 67.01  ? 1933 HOH A O     1 
HETATM 8064 O  O     . HOH D 4 .   ? 13.869  -60.432  -39.586 1.00 74.11  ? 1934 HOH A O     1 
HETATM 8065 O  O     . HOH D 4 .   ? 0.208   -3.205   -39.460 1.00 76.22  ? 1935 HOH A O     1 
HETATM 8066 O  O     . HOH D 4 .   ? 33.672  11.526   -13.626 1.00 99.32  ? 1936 HOH A O     1 
HETATM 8067 O  O     . HOH D 4 .   ? 16.554  -3.625   -22.190 1.00 46.51  ? 1937 HOH A O     1 
HETATM 8068 O  O     . HOH D 4 .   ? 23.147  -24.409  -52.119 1.00 62.88  ? 1938 HOH A O     1 
HETATM 8069 O  O     . HOH D 4 .   ? 47.231  -23.141  -39.730 1.00 47.87  ? 1939 HOH A O     1 
HETATM 8070 O  O     . HOH D 4 .   ? 20.768  10.357   -21.773 1.00 68.41  ? 1940 HOH A O     1 
HETATM 8071 O  O     . HOH D 4 .   ? -2.652  -2.823   -54.867 1.00 85.38  ? 1941 HOH A O     1 
HETATM 8072 O  O     . HOH D 4 .   ? 37.743  -14.244  -20.272 1.00 48.15  ? 1942 HOH A O     1 
HETATM 8073 O  O     . HOH D 4 .   ? 18.196  9.123    -22.121 1.00 61.40  ? 1943 HOH A O     1 
HETATM 8074 O  O     . HOH D 4 .   ? 46.749  -20.708  -24.305 1.00 95.93  ? 1944 HOH A O     1 
HETATM 8075 O  O     . HOH D 4 .   ? 12.630  -32.911  -29.020 1.00 42.74  ? 1945 HOH A O     1 
HETATM 8076 O  O     . HOH D 4 .   ? -10.488 -18.807  -33.501 1.00 47.65  ? 1946 HOH A O     1 
HETATM 8077 O  O     . HOH D 4 .   ? 41.868  -22.041  -25.737 1.00 53.13  ? 1947 HOH A O     1 
HETATM 8078 O  O     . HOH D 4 .   ? 4.334   -45.701  -47.455 1.00 42.50  ? 1948 HOH A O     1 
HETATM 8079 O  O     . HOH D 4 .   ? 19.676  -24.029  -48.714 1.00 58.50  ? 1949 HOH A O     1 
HETATM 8080 O  O     . HOH D 4 .   ? 19.347  -36.606  -18.968 1.00 64.89  ? 1950 HOH A O     1 
HETATM 8081 O  O     . HOH D 4 .   ? 10.218  -3.313   -32.129 1.00 92.59  ? 1951 HOH A O     1 
HETATM 8082 O  O     . HOH D 4 .   ? 75.329  -119.679 11.423  1.00 79.80  ? 1952 HOH A O     1 
HETATM 8083 O  O     . HOH D 4 .   ? 46.607  -12.778  -29.101 1.00 86.98  ? 1953 HOH A O     1 
HETATM 8084 O  O     . HOH D 4 .   ? 9.600   -2.871   -57.590 1.00 41.69  ? 1954 HOH A O     1 
HETATM 8085 O  O     . HOH D 4 .   ? 3.677   -20.497  -11.633 1.00 121.04 ? 1955 HOH A O     1 
HETATM 8086 O  O     . HOH D 4 .   ? -4.259  -30.281  -34.652 1.00 52.29  ? 1956 HOH A O     1 
HETATM 8087 O  O     . HOH D 4 .   ? 36.835  3.613    -48.214 1.00 48.20  ? 1957 HOH A O     1 
HETATM 8088 O  O     . HOH D 4 .   ? 24.274  3.707    -41.407 1.00 71.84  ? 1958 HOH A O     1 
HETATM 8089 O  O     . HOH D 4 .   ? 40.728  33.521   -32.302 1.00 115.40 ? 1959 HOH A O     1 
HETATM 8090 O  O     . HOH D 4 .   ? 7.492   -32.679  -22.238 1.00 38.58  ? 1960 HOH A O     1 
HETATM 8091 O  O     . HOH D 4 .   ? -22.363 -17.898  -37.717 1.00 68.79  ? 1961 HOH A O     1 
HETATM 8092 O  O     . HOH D 4 .   ? 28.774  4.776    -49.923 1.00 48.18  ? 1962 HOH A O     1 
HETATM 8093 O  O     . HOH D 4 .   ? 23.675  -7.455   -20.323 1.00 98.75  ? 1963 HOH A O     1 
HETATM 8094 O  O     . HOH D 4 .   ? 13.113  -16.954  -51.111 1.00 39.55  ? 1964 HOH A O     1 
HETATM 8095 O  O     . HOH D 4 .   ? 27.802  24.357   -34.764 1.00 75.52  ? 1965 HOH A O     1 
HETATM 8096 O  O     . HOH D 4 .   ? -6.911  -27.998  -33.197 1.00 65.09  ? 1966 HOH A O     1 
HETATM 8097 O  O     . HOH D 4 .   ? 12.733  -28.375  -42.092 1.00 147.18 ? 1967 HOH A O     1 
HETATM 8098 O  O     . HOH D 4 .   ? 2.812   -21.156  -53.686 1.00 62.63  ? 1968 HOH A O     1 
HETATM 8099 O  O     . HOH D 4 .   ? 7.607   -4.561   -57.275 1.00 79.86  ? 1969 HOH A O     1 
HETATM 8100 O  O     . HOH D 4 .   ? 17.695  -9.243   -12.246 1.00 87.80  ? 1970 HOH A O     1 
HETATM 8101 O  O     . HOH D 4 .   ? 37.591  -7.457   -40.508 1.00 38.20  ? 1971 HOH A O     1 
HETATM 8102 O  O     . HOH D 4 .   ? 23.700  24.287   -39.931 1.00 45.32  ? 1972 HOH A O     1 
HETATM 8103 O  O     . HOH D 4 .   ? -9.001  -26.352  -32.825 1.00 41.00  ? 1973 HOH A O     1 
HETATM 8104 O  O     . HOH D 4 .   ? 26.143  14.606   -42.486 1.00 46.00  ? 1974 HOH A O     1 
HETATM 8105 O  O     . HOH D 4 .   ? 13.001  -39.036  -33.965 1.00 50.50  ? 1975 HOH A O     1 
HETATM 8106 O  O     . HOH D 4 .   ? 18.709  -34.917  -31.048 1.00 52.82  ? 1976 HOH A O     1 
HETATM 8107 O  O     . HOH D 4 .   ? -2.111  -19.168  -49.364 1.00 57.34  ? 1977 HOH A O     1 
HETATM 8108 O  O     . HOH D 4 .   ? 26.559  -23.948  -53.889 1.00 88.17  ? 1978 HOH A O     1 
HETATM 8109 O  O     . HOH D 4 .   ? 41.482  5.817    -16.101 1.00 57.90  ? 1979 HOH A O     1 
HETATM 8110 O  O     . HOH D 4 .   ? 22.217  -2.906   -38.326 1.00 67.51  ? 1980 HOH A O     1 
HETATM 8111 O  O     . HOH D 4 .   ? 30.921  14.544   -16.882 1.00 62.92  ? 1981 HOH A O     1 
HETATM 8112 O  O     . HOH D 4 .   ? 50.352  -26.895  -24.454 1.00 53.24  ? 1982 HOH A O     1 
HETATM 8113 O  O     . HOH D 4 .   ? 40.168  -23.888  -28.068 1.00 35.50  ? 1983 HOH A O     1 
HETATM 8114 O  O     . HOH D 4 .   ? 16.737  -29.461  -34.367 1.00 68.97  ? 1984 HOH A O     1 
HETATM 8115 O  O     . HOH D 4 .   ? 44.259  -29.644  -34.991 1.00 69.70  ? 1985 HOH A O     1 
HETATM 8116 O  O     . HOH D 4 .   ? 22.136  1.044    -39.051 1.00 60.18  ? 1986 HOH A O     1 
HETATM 8117 O  O     . HOH D 4 .   ? 29.059  -15.198  -50.809 1.00 36.66  ? 1987 HOH A O     1 
HETATM 8118 O  O     . HOH D 4 .   ? 15.818  -25.908  -39.603 1.00 84.63  ? 1988 HOH A O     1 
HETATM 8119 O  O     . HOH D 4 .   ? 5.641   -9.497   -48.191 1.00 42.33  ? 1989 HOH A O     1 
HETATM 8120 O  O     . HOH D 4 .   ? 21.586  1.899    -18.701 1.00 64.24  ? 1990 HOH A O     1 
HETATM 8121 O  O     . HOH D 4 .   ? 13.751  18.037   -49.169 1.00 49.20  ? 1991 HOH A O     1 
HETATM 8122 O  O     . HOH D 4 .   ? -2.942  1.877    -54.862 1.00 66.07  ? 1992 HOH A O     1 
HETATM 8123 O  O     . HOH D 4 .   ? 3.698   -36.779  -37.084 1.00 55.37  ? 1993 HOH A O     1 
HETATM 8124 O  O     . HOH D 4 .   ? 45.172  -31.205  -21.364 1.00 63.47  ? 1994 HOH A O     1 
HETATM 8125 O  O     . HOH D 4 .   ? -19.547 -20.920  -37.444 1.00 86.49  ? 1995 HOH A O     1 
HETATM 8126 O  O     . HOH D 4 .   ? -7.729  -13.993  -30.430 1.00 58.76  ? 1996 HOH A O     1 
HETATM 8127 O  O     . HOH D 4 .   ? 13.342  12.933   -21.923 1.00 61.20  ? 1997 HOH A O     1 
HETATM 8128 O  O     . HOH D 4 .   ? 41.657  -25.573  -44.234 1.00 67.72  ? 1998 HOH A O     1 
HETATM 8129 O  O     . HOH D 4 .   ? -4.176  -19.042  -23.130 1.00 62.38  ? 1999 HOH A O     1 
HETATM 8130 O  O     . HOH D 4 .   ? 3.118   -4.338   -24.128 1.00 61.51  ? 2000 HOH A O     1 
HETATM 8131 O  O     . HOH D 4 .   ? 41.948  0.122    -44.120 1.00 91.39  ? 2001 HOH A O     1 
HETATM 8132 O  O     . HOH D 4 .   ? 20.903  -18.011  -50.797 1.00 46.41  ? 2002 HOH A O     1 
HETATM 8133 O  O     . HOH D 4 .   ? 17.699  6.846    -36.961 1.00 120.28 ? 2003 HOH A O     1 
HETATM 8134 O  O     . HOH D 4 .   ? 44.369  7.907    -15.975 1.00 63.92  ? 2004 HOH A O     1 
HETATM 8135 O  O     . HOH D 4 .   ? 42.638  -93.681  -11.594 1.00 120.63 ? 2005 HOH A O     1 
HETATM 8136 O  O     . HOH D 4 .   ? 21.676  -6.243   -18.893 1.00 74.59  ? 2006 HOH A O     1 
HETATM 8137 O  O     . HOH D 4 .   ? 13.292  -54.457  -28.728 1.00 52.76  ? 2007 HOH A O     1 
HETATM 8138 O  O     . HOH D 4 .   ? -15.996 -22.619  -13.437 1.00 101.07 ? 2008 HOH A O     1 
HETATM 8139 O  O     . HOH D 4 .   ? 17.100  11.381   -39.137 1.00 74.99  ? 2009 HOH A O     1 
HETATM 8140 O  O     . HOH D 4 .   ? 31.839  3.583    -52.598 1.00 53.73  ? 2010 HOH A O     1 
HETATM 8141 O  O     . HOH D 4 .   ? 3.123   -0.659   -58.484 1.00 54.63  ? 2011 HOH A O     1 
HETATM 8142 O  O     . HOH D 4 .   ? 31.758  -2.465   -40.660 1.00 131.87 ? 2012 HOH A O     1 
HETATM 8143 O  O     . HOH D 4 .   ? 51.447  -2.112   -22.972 1.00 67.03  ? 2013 HOH A O     1 
HETATM 8144 O  O     . HOH D 4 .   ? 21.978  -60.282  -40.058 1.00 67.13  ? 2014 HOH A O     1 
HETATM 8145 O  O     . HOH D 4 .   ? 20.754  -32.458  -29.652 1.00 40.75  ? 2015 HOH A O     1 
HETATM 8146 O  O     . HOH D 4 .   ? 17.903  -8.822   -16.966 1.00 61.22  ? 2016 HOH A O     1 
HETATM 8147 O  O     . HOH D 4 .   ? 3.868   13.658   -46.382 1.00 74.38  ? 2017 HOH A O     1 
HETATM 8148 O  O     . HOH D 4 .   ? -2.667  -25.780  -49.975 1.00 61.81  ? 2018 HOH A O     1 
HETATM 8149 O  O     . HOH D 4 .   ? 0.981   -10.572  -37.093 1.00 44.70  ? 2019 HOH A O     1 
HETATM 8150 O  O     . HOH D 4 .   ? -26.402 -28.424  -39.708 1.00 63.37  ? 2020 HOH A O     1 
HETATM 8151 O  O     . HOH D 4 .   ? 30.638  -21.113  -17.974 1.00 46.63  ? 2021 HOH A O     1 
HETATM 8152 O  O     . HOH D 4 .   ? 1.749   -9.298   -14.565 1.00 70.65  ? 2022 HOH A O     1 
HETATM 8153 O  O     . HOH D 4 .   ? 38.558  -22.150  -26.595 1.00 52.08  ? 2023 HOH A O     1 
HETATM 8154 O  O     . HOH D 4 .   ? 6.928   -33.974  -32.381 1.00 79.78  ? 2024 HOH A O     1 
HETATM 8155 O  O     . HOH D 4 .   ? -15.566 -13.655  -27.511 1.00 56.05  ? 2025 HOH A O     1 
HETATM 8156 O  O     . HOH D 4 .   ? -8.707  -32.759  -27.264 1.00 79.18  ? 2026 HOH A O     1 
HETATM 8157 O  O     . HOH D 4 .   ? 18.803  -22.074  -50.855 1.00 58.87  ? 2027 HOH A O     1 
HETATM 8158 O  O     . HOH D 4 .   ? 29.601  -21.195  -46.896 1.00 47.77  ? 2028 HOH A O     1 
HETATM 8159 O  O     . HOH D 4 .   ? 49.965  -93.555  -1.933  1.00 64.04  ? 2029 HOH A O     1 
HETATM 8160 O  O     . HOH D 4 .   ? 23.302  28.829   -41.607 1.00 72.62  ? 2030 HOH A O     1 
HETATM 8161 O  O     . HOH D 4 .   ? 28.907  23.803   -31.170 1.00 40.72  ? 2031 HOH A O     1 
HETATM 8162 O  O     . HOH D 4 .   ? 24.844  8.094    -42.030 1.00 46.85  ? 2032 HOH A O     1 
HETATM 8163 O  O     . HOH D 4 .   ? 19.686  17.056   -21.846 1.00 53.66  ? 2033 HOH A O     1 
HETATM 8164 O  O     . HOH D 4 .   ? -0.312  -9.359   -18.000 1.00 115.62 ? 2034 HOH A O     1 
HETATM 8165 O  O     . HOH D 4 .   ? 8.236   -45.886  -53.501 1.00 52.33  ? 2035 HOH A O     1 
HETATM 8166 O  O     . HOH D 4 .   ? 26.649  -47.556  -43.346 1.00 70.01  ? 2036 HOH A O     1 
HETATM 8167 O  O     . HOH D 4 .   ? 38.589  -5.046   -14.586 1.00 51.26  ? 2037 HOH A O     1 
HETATM 8168 O  O     . HOH D 4 .   ? 4.395   -20.923  -47.721 1.00 46.69  ? 2038 HOH A O     1 
HETATM 8169 O  O     . HOH D 4 .   ? 30.080  -37.671  -43.242 1.00 54.62  ? 2039 HOH A O     1 
HETATM 8170 O  O     . HOH D 4 .   ? 44.383  -24.389  -29.984 1.00 60.41  ? 2040 HOH A O     1 
HETATM 8171 O  O     . HOH D 4 .   ? 25.374  -10.903  -20.178 1.00 60.03  ? 2041 HOH A O     1 
HETATM 8172 O  O     . HOH D 4 .   ? 30.310  16.215   -46.832 1.00 48.33  ? 2042 HOH A O     1 
HETATM 8173 O  O     . HOH D 4 .   ? -21.000 -25.535  -17.960 1.00 50.87  ? 2043 HOH A O     1 
HETATM 8174 O  O     . HOH D 4 .   ? 23.576  28.091   -44.121 1.00 46.56  ? 2044 HOH A O     1 
HETATM 8175 O  O     . HOH D 4 .   ? 43.123  -11.950  -39.496 1.00 61.90  ? 2045 HOH A O     1 
HETATM 8176 O  O     . HOH D 4 .   ? 44.826  -9.842   -18.714 1.00 49.04  ? 2046 HOH A O     1 
HETATM 8177 O  O     . HOH D 4 .   ? 47.174  1.294    -17.912 1.00 77.46  ? 2047 HOH A O     1 
HETATM 8178 O  O     . HOH D 4 .   ? 39.580  -9.254   -41.095 1.00 66.42  ? 2048 HOH A O     1 
HETATM 8179 O  O     . HOH D 4 .   ? 25.136  -53.371  -43.031 1.00 44.89  ? 2049 HOH A O     1 
HETATM 8180 O  O     . HOH D 4 .   ? -1.665  -20.612  -41.968 1.00 72.42  ? 2050 HOH A O     1 
HETATM 8181 O  O     . HOH D 4 .   ? 2.361   -44.399  -49.070 1.00 48.17  ? 2051 HOH A O     1 
HETATM 8182 O  O     . HOH D 4 .   ? 47.127  -1.974   -36.501 1.00 60.19  ? 2052 HOH A O     1 
HETATM 8183 O  O     . HOH D 4 .   ? -2.680  -22.153  -53.035 1.00 59.17  ? 2053 HOH A O     1 
HETATM 8184 O  O     . HOH D 4 .   ? 6.682   16.827   -44.844 1.00 90.37  ? 2054 HOH A O     1 
HETATM 8185 O  O     . HOH D 4 .   ? 24.706  -73.159  -24.052 1.00 84.22  ? 2055 HOH A O     1 
HETATM 8186 O  O     . HOH D 4 .   ? 27.861  11.178   -16.899 1.00 56.53  ? 2056 HOH A O     1 
HETATM 8187 O  O     . HOH D 4 .   ? 22.842  -30.125  -13.912 1.00 54.92  ? 2057 HOH A O     1 
HETATM 8188 O  O     . HOH D 4 .   ? 46.933  -11.281  -24.029 1.00 66.92  ? 2058 HOH A O     1 
HETATM 8189 O  O     . HOH D 4 .   ? 11.402  -11.340  -36.215 1.00 36.09  ? 2059 HOH A O     1 
HETATM 8190 O  O     . HOH D 4 .   ? 4.613   -30.424  -16.093 1.00 72.65  ? 2060 HOH A O     1 
HETATM 8191 O  O     . HOH D 4 .   ? 31.983  -32.662  -26.092 1.00 52.77  ? 2061 HOH A O     1 
HETATM 8192 O  O     . HOH D 4 .   ? -16.493 -30.126  -25.035 1.00 85.99  ? 2062 HOH A O     1 
HETATM 8193 O  O     . HOH D 4 .   ? 51.205  -0.694   -31.148 1.00 52.62  ? 2063 HOH A O     1 
HETATM 8194 O  O     . HOH D 4 .   ? 27.166  -3.166   -44.807 1.00 34.71  ? 2064 HOH A O     1 
HETATM 8195 O  O     . HOH D 4 .   ? 12.385  -59.601  -37.472 1.00 61.32  ? 2065 HOH A O     1 
HETATM 8196 O  O     . HOH D 4 .   ? 23.070  20.770   -31.905 1.00 80.89  ? 2066 HOH A O     1 
HETATM 8197 O  O     . HOH D 4 .   ? 24.084  18.623   -24.095 1.00 86.36  ? 2067 HOH A O     1 
HETATM 8198 O  O     . HOH D 4 .   ? 44.411  -21.534  -27.171 1.00 46.04  ? 2068 HOH A O     1 
HETATM 8199 O  O     . HOH D 4 .   ? -1.739  -25.673  -45.114 1.00 59.68  ? 2069 HOH A O     1 
HETATM 8200 O  O     . HOH D 4 .   ? 10.305  -53.463  -14.476 1.00 73.44  ? 2070 HOH A O     1 
HETATM 8201 O  O     . HOH D 4 .   ? 85.685  -126.377 21.885  1.00 63.87  ? 2071 HOH A O     1 
HETATM 8202 O  O     . HOH D 4 .   ? 24.109  14.328   -40.686 1.00 51.70  ? 2072 HOH A O     1 
HETATM 8203 O  O     . HOH D 4 .   ? 25.639  20.932   -50.740 1.00 54.20  ? 2073 HOH A O     1 
HETATM 8204 O  O     . HOH D 4 .   ? 4.964   -8.164   -33.678 1.00 53.09  ? 2074 HOH A O     1 
HETATM 8205 O  O     . HOH D 4 .   ? 5.237   -36.778  -24.900 1.00 91.56  ? 2075 HOH A O     1 
HETATM 8206 O  O     . HOH D 4 .   ? 25.608  31.777   -37.480 1.00 45.56  ? 2076 HOH A O     1 
HETATM 8207 O  O     . HOH D 4 .   ? 31.922  -38.573  -41.442 1.00 80.63  ? 2077 HOH A O     1 
HETATM 8208 O  O     . HOH D 4 .   ? 17.792  -64.335  -44.796 1.00 48.44  ? 2078 HOH A O     1 
HETATM 8209 O  O     . HOH D 4 .   ? 22.690  -7.548   -54.698 1.00 64.79  ? 2079 HOH A O     1 
HETATM 8210 O  O     . HOH D 4 .   ? 52.919  11.976   -42.403 1.00 59.78  ? 2080 HOH A O     1 
HETATM 8211 O  O     . HOH D 4 .   ? 17.707  -37.455  -56.227 1.00 68.88  ? 2081 HOH A O     1 
HETATM 8212 O  O     . HOH D 4 .   ? 45.761  -3.839   -41.340 1.00 84.04  ? 2082 HOH A O     1 
HETATM 8213 O  O     . HOH D 4 .   ? 47.146  -15.274  -35.184 1.00 54.11  ? 2083 HOH A O     1 
HETATM 8214 O  O     . HOH D 4 .   ? 28.232  -66.860  -2.496  1.00 74.85  ? 2084 HOH A O     1 
HETATM 8215 O  O     . HOH D 4 .   ? -6.086  -24.063  -18.728 1.00 72.57  ? 2085 HOH A O     1 
HETATM 8216 O  O     . HOH D 4 .   ? -1.767  -1.364   -43.562 1.00 46.69  ? 2086 HOH A O     1 
HETATM 8217 O  O     . HOH D 4 .   ? 6.715   -36.758  -31.945 1.00 134.14 ? 2087 HOH A O     1 
HETATM 8218 O  O     . HOH D 4 .   ? 15.263  11.235   -61.513 1.00 78.14  ? 2088 HOH A O     1 
HETATM 8219 O  O     . HOH D 4 .   ? -4.771  -36.081  -19.244 1.00 39.17  ? 2089 HOH A O     1 
HETATM 8220 O  O     . HOH D 4 .   ? 31.629  30.609   -31.968 1.00 64.81  ? 2090 HOH A O     1 
HETATM 8221 O  O     . HOH D 4 .   ? -4.043  -8.315   -33.230 1.00 66.22  ? 2091 HOH A O     1 
HETATM 8222 O  O     . HOH D 4 .   ? 44.489  -31.061  -32.116 1.00 61.96  ? 2092 HOH A O     1 
HETATM 8223 O  O     . HOH D 4 .   ? 42.231  -0.172   -40.795 1.00 60.51  ? 2093 HOH A O     1 
HETATM 8224 O  O     . HOH D 4 .   ? 14.730  -59.240  -33.036 1.00 52.60  ? 2094 HOH A O     1 
HETATM 8225 O  O     . HOH D 4 .   ? 34.596  -33.496  -19.924 1.00 79.58  ? 2095 HOH A O     1 
HETATM 8226 O  O     . HOH D 4 .   ? 17.540  17.942   -25.220 1.00 72.99  ? 2096 HOH A O     1 
HETATM 8227 O  O     . HOH D 4 .   ? 17.684  -30.487  -43.664 1.00 75.73  ? 2097 HOH A O     1 
HETATM 8228 O  O     . HOH D 4 .   ? 4.208   -5.806   -58.110 1.00 72.96  ? 2098 HOH A O     1 
HETATM 8229 O  O     . HOH D 4 .   ? 20.883  -16.034  -11.053 1.00 74.33  ? 2099 HOH A O     1 
HETATM 8230 O  O     . HOH D 4 .   ? 19.247  -7.277   -55.919 1.00 117.31 ? 2100 HOH A O     1 
HETATM 8231 O  O     . HOH D 4 .   ? 42.444  16.780   -52.108 1.00 98.21  ? 2101 HOH A O     1 
HETATM 8232 O  O     . HOH D 4 .   ? -2.760  -27.487  -18.701 1.00 64.73  ? 2102 HOH A O     1 
HETATM 8233 O  O     . HOH D 4 .   ? 0.122   -25.169  -53.475 1.00 72.85  ? 2103 HOH A O     1 
HETATM 8234 O  O     . HOH D 4 .   ? -0.999  -33.953  -39.632 1.00 82.25  ? 2104 HOH A O     1 
HETATM 8235 O  O     . HOH D 4 .   ? 36.479  -23.551  -12.702 1.00 59.42  ? 2105 HOH A O     1 
HETATM 8236 O  O     . HOH D 4 .   ? 10.136  -28.515  -41.471 1.00 39.39  ? 2106 HOH A O     1 
HETATM 8237 O  O     . HOH D 4 .   ? 30.157  -37.015  -33.124 1.00 53.49  ? 2107 HOH A O     1 
HETATM 8238 O  O     . HOH D 4 .   ? 31.928  -12.733  -20.637 1.00 46.00  ? 2108 HOH A O     1 
HETATM 8239 O  O     . HOH D 4 .   ? 24.226  -26.891  -47.582 1.00 47.21  ? 2109 HOH A O     1 
HETATM 8240 O  O     . HOH D 4 .   ? 0.471   -14.166  -48.619 1.00 69.59  ? 2110 HOH A O     1 
HETATM 8241 O  O     . HOH D 4 .   ? 44.211  5.827    -50.945 1.00 56.21  ? 2111 HOH A O     1 
HETATM 8242 O  O     . HOH D 4 .   ? 27.914  -16.029  -20.833 1.00 103.48 ? 2112 HOH A O     1 
HETATM 8243 O  O     . HOH D 4 .   ? -18.244 -12.266  -32.673 1.00 59.90  ? 2113 HOH A O     1 
HETATM 8244 O  O     . HOH D 4 .   ? 7.179   -3.947   -32.789 1.00 49.65  ? 2114 HOH A O     1 
HETATM 8245 O  O     . HOH D 4 .   ? 9.384   17.046   -45.125 1.00 83.41  ? 2115 HOH A O     1 
HETATM 8246 O  O     . HOH D 4 .   ? 11.368  -33.277  -34.318 1.00 57.44  ? 2116 HOH A O     1 
HETATM 8247 O  O     . HOH D 4 .   ? 25.318  -39.889  -39.783 1.00 64.52  ? 2117 HOH A O     1 
HETATM 8248 O  O     . HOH D 4 .   ? -4.502  -25.169  -16.823 1.00 54.65  ? 2118 HOH A O     1 
HETATM 8249 O  O     . HOH D 4 .   ? 15.794  -7.066   -61.746 1.00 56.33  ? 2119 HOH A O     1 
HETATM 8250 O  O     . HOH D 4 .   ? 45.796  15.722   -12.872 1.00 87.12  ? 2120 HOH A O     1 
HETATM 8251 O  O     . HOH D 4 .   ? 50.029  10.864   -30.836 1.00 128.29 ? 2121 HOH A O     1 
HETATM 8252 O  O     . HOH D 4 .   ? 19.259  -51.659  -20.946 1.00 79.67  ? 2122 HOH A O     1 
HETATM 8253 O  O     . HOH D 4 .   ? 34.108  -4.298   -41.036 1.00 51.39  ? 2123 HOH A O     1 
HETATM 8254 O  O     . HOH D 4 .   ? -3.852  8.433    -49.954 1.00 70.66  ? 2124 HOH A O     1 
HETATM 8255 O  O     . HOH D 4 .   ? 12.090  -32.273  -26.473 1.00 56.99  ? 2125 HOH A O     1 
HETATM 8256 O  O     . HOH D 4 .   ? 28.457  29.489   -51.229 1.00 60.89  ? 2126 HOH A O     1 
HETATM 8257 O  O     . HOH D 4 .   ? 1.228   -10.384  -50.667 1.00 51.06  ? 2127 HOH A O     1 
HETATM 8258 O  O     . HOH D 4 .   ? 20.815  -44.117  -53.939 1.00 88.88  ? 2128 HOH A O     1 
HETATM 8259 O  O     . HOH D 4 .   ? 4.364   -33.844  -23.582 1.00 44.23  ? 2129 HOH A O     1 
HETATM 8260 O  O     . HOH D 4 .   ? 5.799   -41.770  -33.037 1.00 63.39  ? 2130 HOH A O     1 
HETATM 8261 O  O     . HOH D 4 .   ? 22.883  28.280   -47.433 1.00 53.93  ? 2131 HOH A O     1 
HETATM 8262 O  O     . HOH D 4 .   ? 26.485  3.584    -20.006 1.00 57.63  ? 2132 HOH A O     1 
HETATM 8263 O  O     . HOH D 4 .   ? 30.968  17.247   -49.593 1.00 87.92  ? 2133 HOH A O     1 
HETATM 8264 O  O     . HOH D 4 .   ? 15.364  -29.817  -42.393 1.00 137.89 ? 2134 HOH A O     1 
HETATM 8265 O  O     . HOH D 4 .   ? 48.099  -11.881  -26.638 1.00 61.19  ? 2135 HOH A O     1 
HETATM 8266 O  O     . HOH D 4 .   ? 45.094  30.818   -32.885 1.00 72.19  ? 2136 HOH A O     1 
HETATM 8267 O  O     . HOH D 4 .   ? 32.393  7.605    -46.440 1.00 80.32  ? 2137 HOH A O     1 
HETATM 8268 O  O     . HOH D 4 .   ? -2.763  -19.767  -19.062 1.00 51.13  ? 2138 HOH A O     1 
HETATM 8269 O  O     . HOH D 4 .   ? 26.367  -12.981  -53.735 1.00 53.66  ? 2139 HOH A O     1 
HETATM 8270 O  O     . HOH D 4 .   ? 21.131  -28.033  -36.090 1.00 48.52  ? 2140 HOH A O     1 
HETATM 8271 O  O     . HOH D 4 .   ? -2.345  -19.494  -38.651 1.00 113.60 ? 2141 HOH A O     1 
HETATM 8272 O  O     . HOH D 4 .   ? 22.029  -47.472  -51.934 1.00 59.51  ? 2142 HOH A O     1 
HETATM 8273 O  O     . HOH D 4 .   ? 18.251  -49.211  -14.639 1.00 74.48  ? 2143 HOH A O     1 
HETATM 8274 O  O     . HOH D 4 .   ? -1.165  -17.356  -51.168 1.00 69.39  ? 2144 HOH A O     1 
HETATM 8275 O  O     . HOH D 4 .   ? 41.040  19.830   -21.973 1.00 124.26 ? 2145 HOH A O     1 
HETATM 8276 O  O     . HOH D 4 .   ? 43.700  -4.242   -43.614 1.00 77.88  ? 2146 HOH A O     1 
HETATM 8277 O  O     . HOH D 4 .   ? 14.298  -33.867  -18.788 1.00 80.94  ? 2147 HOH A O     1 
HETATM 8278 O  O     . HOH D 4 .   ? 23.368  -8.330   -41.136 1.00 60.89  ? 2148 HOH A O     1 
HETATM 8279 O  O     . HOH D 4 .   ? 50.805  8.711    -45.863 1.00 62.47  ? 2149 HOH A O     1 
HETATM 8280 O  O     . HOH D 4 .   ? 47.399  26.889   -32.269 1.00 47.64  ? 2150 HOH A O     1 
HETATM 8281 O  O     . HOH D 4 .   ? -0.385  -37.527  -52.291 1.00 59.31  ? 2151 HOH A O     1 
HETATM 8282 O  O     . HOH D 4 .   ? -14.247 -12.378  -29.500 1.00 59.46  ? 2152 HOH A O     1 
HETATM 8283 O  O     . HOH D 4 .   ? 38.749  10.851   -53.126 1.00 104.13 ? 2153 HOH A O     1 
HETATM 8284 O  O     . HOH D 4 .   ? 16.281  -33.100  -37.777 1.00 77.72  ? 2154 HOH A O     1 
HETATM 8285 O  O     . HOH D 4 .   ? 3.085   -7.874   -55.023 1.00 66.62  ? 2155 HOH A O     1 
HETATM 8286 O  O     . HOH D 4 .   ? 26.503  22.273   -27.430 1.00 89.90  ? 2156 HOH A O     1 
HETATM 8287 O  O     . HOH D 4 .   ? 23.723  -51.072  -47.629 1.00 59.57  ? 2157 HOH A O     1 
HETATM 8288 O  O     . HOH D 4 .   ? 27.743  16.694   -46.119 1.00 46.13  ? 2158 HOH A O     1 
HETATM 8289 O  O     . HOH D 4 .   ? 50.653  -114.192 4.876   1.00 97.50  ? 2159 HOH A O     1 
HETATM 8290 O  O     . HOH D 4 .   ? 50.658  6.451    -31.152 1.00 50.32  ? 2160 HOH A O     1 
HETATM 8291 O  O     . HOH D 4 .   ? 16.714  -33.607  -17.513 1.00 60.98  ? 2161 HOH A O     1 
HETATM 8292 O  O     . HOH D 4 .   ? 2.642   -11.416  -46.321 1.00 40.34  ? 2162 HOH A O     1 
HETATM 8293 O  O     . HOH D 4 .   ? 23.717  -1.981   -20.598 1.00 68.19  ? 2163 HOH A O     1 
HETATM 8294 O  O     . HOH D 4 .   ? 1.254   -11.460  -39.620 1.00 56.58  ? 2164 HOH A O     1 
HETATM 8295 O  O     . HOH D 4 .   ? 31.971  -18.734  -19.718 1.00 59.85  ? 2165 HOH A O     1 
HETATM 8296 O  O     . HOH D 4 .   ? -15.515 -24.460  -16.134 1.00 114.73 ? 2166 HOH A O     1 
HETATM 8297 O  O     . HOH D 4 .   ? 4.238   -37.998  -32.496 1.00 76.99  ? 2167 HOH A O     1 
HETATM 8298 O  O     . HOH D 4 .   ? -2.750  -1.044   -52.723 1.00 63.76  ? 2168 HOH A O     1 
HETATM 8299 O  O     . HOH D 4 .   ? 50.521  -5.833   -30.389 1.00 62.68  ? 2169 HOH A O     1 
HETATM 8300 O  O     . HOH D 4 .   ? 27.293  -3.025   -21.906 1.00 51.34  ? 2170 HOH A O     1 
HETATM 8301 O  O     . HOH D 4 .   ? -0.208  -5.685   -25.883 1.00 96.68  ? 2171 HOH A O     1 
HETATM 8302 O  O     . HOH D 4 .   ? 29.843  -12.217  -22.295 1.00 61.18  ? 2172 HOH A O     1 
HETATM 8303 O  O     . HOH D 4 .   ? 21.527  -3.577   -20.108 1.00 86.56  ? 2173 HOH A O     1 
HETATM 8304 O  O     . HOH D 4 .   ? 51.135  9.918    -28.173 1.00 104.40 ? 2174 HOH A O     1 
HETATM 8305 O  O     . HOH D 4 .   ? 26.405  3.582    -43.750 1.00 42.49  ? 2175 HOH A O     1 
HETATM 8306 O  O     . HOH D 4 .   ? 16.217  -4.455   -19.383 1.00 92.17  ? 2176 HOH A O     1 
HETATM 8307 O  O     . HOH D 4 .   ? 35.320  -3.879   -43.374 1.00 64.39  ? 2177 HOH A O     1 
HETATM 8308 O  O     . HOH D 4 .   ? 15.515  -17.216  -49.025 1.00 41.18  ? 2178 HOH A O     1 
HETATM 8309 O  O     . HOH D 4 .   ? 26.865  -56.454  -45.212 1.00 81.19  ? 2179 HOH A O     1 
HETATM 8310 O  O     . HOH D 4 .   ? 3.441   -9.718   -44.511 1.00 41.14  ? 2180 HOH A O     1 
HETATM 8311 O  O     . HOH D 4 .   ? 29.075  1.134    -45.881 1.00 49.83  ? 2181 HOH A O     1 
HETATM 8312 O  O     . HOH D 4 .   ? 46.537  -13.124  -17.896 1.00 78.24  ? 2182 HOH A O     1 
HETATM 8313 O  O     . HOH D 4 .   ? 22.406  -34.200  -30.949 1.00 54.20  ? 2183 HOH A O     1 
HETATM 8314 O  O     . HOH D 4 .   ? 25.945  -0.578   -19.859 1.00 60.90  ? 2184 HOH A O     1 
HETATM 8315 O  O     . HOH D 4 .   ? 27.286  -57.181  -41.983 1.00 85.88  ? 2185 HOH A O     1 
HETATM 8316 O  O     . HOH D 4 .   ? 44.718  3.180    -19.126 1.00 72.80  ? 2186 HOH A O     1 
HETATM 8317 O  O     . HOH D 4 .   ? 39.176  -12.538  -18.740 1.00 70.48  ? 2187 HOH A O     1 
HETATM 8318 O  O     . HOH D 4 .   ? 20.076  24.939   -40.873 1.00 46.18  ? 2188 HOH A O     1 
HETATM 8319 O  O     . HOH D 4 .   ? -0.897  -34.803  -37.041 1.00 106.10 ? 2189 HOH A O     1 
HETATM 8320 O  O     . HOH D 4 .   ? 1.614   -36.308  -32.552 1.00 93.08  ? 2190 HOH A O     1 
HETATM 8321 O  O     . HOH D 4 .   ? 50.675  -5.316   -24.897 1.00 68.44  ? 2191 HOH A O     1 
HETATM 8322 O  O     . HOH D 4 .   ? 11.692  -62.095  -7.480  1.00 71.02  ? 2192 HOH A O     1 
HETATM 8323 O  O     . HOH D 4 .   ? -0.028  -11.277  -45.244 1.00 60.14  ? 2193 HOH A O     1 
HETATM 8324 O  O     . HOH D 4 .   ? 14.697  -26.140  -17.980 1.00 56.49  ? 2194 HOH A O     1 
HETATM 8325 O  O     . HOH D 4 .   ? 27.404  -38.159  -43.866 1.00 65.59  ? 2195 HOH A O     1 
HETATM 8326 O  O     . HOH D 4 .   ? 6.200   3.908    -30.684 1.00 71.82  ? 2196 HOH A O     1 
HETATM 8327 O  O     . HOH D 4 .   ? 18.347  26.654   -42.632 1.00 92.26  ? 2197 HOH A O     1 
HETATM 8328 O  O     . HOH D 4 .   ? 21.460  -49.975  -20.591 1.00 66.92  ? 2198 HOH A O     1 
HETATM 8329 O  O     . HOH D 4 .   ? 48.193  -1.246   -18.275 1.00 81.00  ? 2199 HOH A O     1 
HETATM 8330 O  O     . HOH D 4 .   ? 12.900  -14.093  -51.839 1.00 112.89 ? 2200 HOH A O     1 
HETATM 8331 O  O     . HOH D 4 .   ? 19.006  -20.989  -48.386 1.00 54.41  ? 2201 HOH A O     1 
HETATM 8332 O  O     . HOH D 4 .   ? 8.174   -26.664  -13.975 1.00 57.02  ? 2202 HOH A O     1 
HETATM 8333 O  O     . HOH D 4 .   ? 33.452  -6.787   -57.862 1.00 98.97  ? 2203 HOH A O     1 
HETATM 8334 O  O     . HOH D 4 .   ? 1.955   -39.459  -37.412 1.00 67.74  ? 2204 HOH A O     1 
HETATM 8335 O  O     . HOH D 4 .   ? -8.565  -15.718  -33.523 1.00 57.73  ? 2205 HOH A O     1 
HETATM 8336 O  O     . HOH D 4 .   ? 15.401  10.686   -34.144 1.00 91.56  ? 2206 HOH A O     1 
HETATM 8337 O  O     . HOH D 4 .   ? 31.739  1.698    -63.615 1.00 69.55  ? 2207 HOH A O     1 
HETATM 8338 O  O     . HOH D 4 .   ? 30.019  -39.903  -36.653 1.00 69.15  ? 2208 HOH A O     1 
HETATM 8339 O  O     . HOH D 4 .   ? 51.862  -5.181   -27.793 1.00 106.13 ? 2209 HOH A O     1 
HETATM 8340 O  O     . HOH D 4 .   ? 7.358   -28.504  -16.001 1.00 54.60  ? 2210 HOH A O     1 
HETATM 8341 O  O     . HOH D 4 .   ? 17.293  12.683   -34.733 1.00 53.11  ? 2211 HOH A O     1 
HETATM 8342 O  O     . HOH D 4 .   ? -18.765 -17.299  -41.345 1.00 70.39  ? 2212 HOH A O     1 
HETATM 8343 O  O     . HOH D 4 .   ? 52.325  0.053    -20.419 1.00 57.66  ? 2213 HOH A O     1 
HETATM 8344 O  O     . HOH D 4 .   ? 11.926  -28.350  -16.513 1.00 50.04  ? 2214 HOH A O     1 
HETATM 8345 O  O     . HOH D 4 .   ? 5.391   -7.685   -59.730 1.00 110.40 ? 2215 HOH A O     1 
HETATM 8346 O  O     . HOH D 4 .   ? -0.568  -4.960   -41.483 1.00 93.18  ? 2216 HOH A O     1 
HETATM 8347 O  O     . HOH D 4 .   ? 19.389  -4.953   -63.963 1.00 67.94  ? 2217 HOH A O     1 
HETATM 8348 O  O     . HOH D 4 .   ? 27.463  -13.168  -21.026 1.00 48.91  ? 2218 HOH A O     1 
HETATM 8349 O  O     . HOH D 4 .   ? -6.645  -37.365  -21.398 1.00 54.80  ? 2219 HOH A O     1 
HETATM 8350 O  O     . HOH D 4 .   ? 27.303  18.045   -60.954 1.00 83.74  ? 2220 HOH A O     1 
HETATM 8351 O  O     . HOH D 4 .   ? 27.158  -41.429  -40.983 1.00 59.04  ? 2221 HOH A O     1 
HETATM 8352 O  O     . HOH D 4 .   ? 16.376  9.865    -36.881 1.00 102.89 ? 2222 HOH A O     1 
HETATM 8353 O  O     . HOH D 4 .   ? 36.919  -7.658   -15.450 1.00 87.50  ? 2223 HOH A O     1 
HETATM 8354 O  O     . HOH D 4 .   ? 76.622  -120.854 13.517  1.00 82.97  ? 2224 HOH A O     1 
HETATM 8355 O  O     . HOH D 4 .   ? 7.263   -51.972  -15.567 1.00 88.91  ? 2225 HOH A O     1 
HETATM 8356 O  O     . HOH D 4 .   ? -20.307 -12.904  -34.309 1.00 49.77  ? 2226 HOH A O     1 
HETATM 8357 O  O     . HOH D 4 .   ? 50.862  -122.682 8.727   1.00 66.29  ? 2227 HOH A O     1 
HETATM 8358 O  O     . HOH D 4 .   ? -1.250  -13.097  -39.520 1.00 69.65  ? 2228 HOH A O     1 
HETATM 8359 O  O     . HOH D 4 .   ? 64.825  -115.897 1.283   1.00 99.62  ? 2229 HOH A O     1 
HETATM 8360 O  O     . HOH D 4 .   ? 17.675  -28.352  -15.683 1.00 79.85  ? 2230 HOH A O     1 
HETATM 8361 O  O     . HOH D 4 .   ? 28.792  -7.131   -20.378 1.00 112.47 ? 2231 HOH A O     1 
HETATM 8362 O  O     . HOH D 4 .   ? 14.562  -12.185  -60.779 1.00 57.38  ? 2232 HOH A O     1 
HETATM 8363 O  O     . HOH D 4 .   ? 15.221  -10.630  -9.800  1.00 66.14  ? 2233 HOH A O     1 
HETATM 8364 O  O     . HOH D 4 .   ? 23.666  -14.082  -55.356 1.00 60.16  ? 2234 HOH A O     1 
HETATM 8365 O  O     . HOH D 4 .   ? 21.299  15.936   -15.711 1.00 65.22  ? 2235 HOH A O     1 
HETATM 8366 O  O     . HOH D 4 .   ? 29.743  -81.016  -24.293 1.00 65.95  ? 2236 HOH A O     1 
HETATM 8367 O  O     . HOH D 4 .   ? 16.639  -30.544  -38.932 1.00 86.69  ? 2237 HOH A O     1 
HETATM 8368 O  O     . HOH D 4 .   ? 27.678  -4.320   -19.513 1.00 88.71  ? 2238 HOH A O     1 
HETATM 8369 O  O     . HOH D 4 .   ? -7.430  4.923    -46.792 1.00 63.21  ? 2239 HOH A O     1 
HETATM 8370 O  O     . HOH D 4 .   ? 26.426  -73.671  -50.509 1.00 65.48  ? 2240 HOH A O     1 
HETATM 8371 O  O     . HOH D 4 .   ? 27.191  -8.484   -18.518 1.00 79.15  ? 2241 HOH A O     1 
HETATM 8372 O  O     . HOH D 4 .   ? -0.436  -9.257   -42.457 1.00 114.62 ? 2242 HOH A O     1 
HETATM 8373 O  O     . HOH D 4 .   ? 19.632  12.627   -13.134 1.00 74.40  ? 2243 HOH A O     1 
HETATM 8374 O  O     . HOH D 4 .   ? -24.223 -17.845  -45.041 1.00 57.54  ? 2244 HOH A O     1 
HETATM 8375 O  O     . HOH D 4 .   ? 16.104  -7.523   -10.142 1.00 69.84  ? 2245 HOH A O     1 
HETATM 8376 O  O     . HOH D 4 .   ? -3.490  -12.138  -48.341 1.00 78.90  ? 2246 HOH A O     1 
HETATM 8377 O  O     . HOH D 4 .   ? 21.493  -7.758   -59.296 1.00 72.60  ? 2247 HOH A O     1 
HETATM 8378 O  O     . HOH D 4 .   ? -3.705  -35.250  -38.877 1.00 68.02  ? 2248 HOH A O     1 
HETATM 8379 O  O     . HOH D 4 .   ? 71.251  -139.988 8.545   1.00 103.22 ? 2249 HOH A O     1 
HETATM 8380 O  O     . HOH D 4 .   ? 25.674  21.463   -62.740 1.00 101.33 ? 2250 HOH A O     1 
HETATM 8381 O  O     . HOH D 4 .   ? 17.316  25.267   -38.829 1.00 70.67  ? 2251 HOH A O     1 
HETATM 8382 O  O     . HOH D 4 .   ? 1.988   5.402    -32.018 1.00 75.38  ? 2252 HOH A O     1 
HETATM 8383 O  O     . HOH D 4 .   ? 20.941  24.887   -52.644 1.00 65.09  ? 2253 HOH A O     1 
HETATM 8384 O  O     . HOH D 4 .   ? 24.300  25.151   -58.239 1.00 86.45  ? 2254 HOH A O     1 
HETATM 8385 O  O     . HOH D 4 .   ? -4.067  -28.097  -11.663 1.00 79.82  ? 2255 HOH A O     1 
HETATM 8386 O  O     . HOH D 4 .   ? 30.018  14.102   -67.215 1.00 92.68  ? 2256 HOH A O     1 
HETATM 8387 O  O     . HOH D 4 .   ? 25.644  19.800   -65.079 1.00 60.58  ? 2257 HOH A O     1 
HETATM 8388 O  O     . HOH D 4 .   ? 26.731  -38.053  -52.582 1.00 62.20  ? 2258 HOH A O     1 
HETATM 8389 O  O     . HOH D 4 .   ? -25.829 -13.356  -39.168 1.00 68.20  ? 2259 HOH A O     1 
HETATM 8390 O  O     . HOH D 4 .   ? 30.916  -17.389  -11.960 1.00 45.98  ? 2260 HOH A O     1 
HETATM 8391 O  O     . HOH D 4 .   ? 18.818  -31.955  -12.508 1.00 64.02  ? 2261 HOH A O     1 
HETATM 8392 O  O     . HOH D 4 .   ? 18.919  6.191    -6.051  1.00 74.39  ? 2262 HOH A O     1 
HETATM 8393 O  O     . HOH D 4 .   ? 40.714  -88.148  -20.731 1.00 64.22  ? 2263 HOH A O     1 
HETATM 8394 O  O     . HOH D 4 .   ? 0.898   -30.244  -1.439  1.00 89.01  ? 2264 HOH A O     1 
HETATM 8395 O  O     . HOH D 4 .   ? 2.460   -73.676  0.086   1.00 74.85  ? 2265 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   47   ?    ?   ?   A . n 
A 1 2   VAL 2   48   ?    ?   ?   A . n 
A 1 3   GLU 3   49   49   GLU GLU A . n 
A 1 4   TRP 4   50   50   TRP TRP A . n 
A 1 5   THR 5   51   51   THR THR A . n 
A 1 6   ALA 6   52   52   ALA ALA A . n 
A 1 7   ARG 7   53   53   ARG ARG A . n 
A 1 8   ARG 8   54   54   ARG ARG A . n 
A 1 9   LEU 9   55   55   LEU LEU A . n 
A 1 10  VAL 10  56   56   VAL VAL A . n 
A 1 11  TRP 11  57   57   TRP TRP A . n 
A 1 12  VAL 12  58   58   VAL VAL A . n 
A 1 13  PRO 13  59   59   PRO PRO A . n 
A 1 14  SER 14  60   60   SER SER A . n 
A 1 15  GLU 15  61   61   GLU GLU A . n 
A 1 16  LEU 16  62   62   LEU LEU A . n 
A 1 17  HIS 17  63   63   HIS HIS A . n 
A 1 18  GLY 18  64   64   GLY GLY A . n 
A 1 19  PHE 19  65   65   PHE PHE A . n 
A 1 20  GLU 20  66   66   GLU GLU A . n 
A 1 21  ALA 21  67   67   ALA ALA A . n 
A 1 22  ALA 22  68   68   ALA ALA A . n 
A 1 23  ALA 23  69   69   ALA ALA A . n 
A 1 24  LEU 24  70   70   LEU LEU A . n 
A 1 25  ARG 25  71   71   ARG ARG A . n 
A 1 26  ASP 26  72   72   ASP ASP A . n 
A 1 27  GLU 27  73   73   GLU GLU A . n 
A 1 28  GLY 28  74   74   GLY GLY A . n 
A 1 29  GLU 29  75   75   GLU GLU A . n 
A 1 30  GLU 30  76   76   GLU GLU A . n 
A 1 31  GLU 31  77   77   GLU GLU A . n 
A 1 32  ALA 32  78   78   ALA ALA A . n 
A 1 33  GLU 33  79   79   GLU GLU A . n 
A 1 34  VAL 34  80   80   VAL VAL A . n 
A 1 35  GLU 35  81   81   GLU GLU A . n 
A 1 36  LEU 36  82   82   LEU LEU A . n 
A 1 37  ALA 37  83   83   ALA ALA A . n 
A 1 38  GLU 38  84   84   GLU GLU A . n 
A 1 39  SER 39  85   85   SER SER A . n 
A 1 40  GLY 40  86   86   GLY GLY A . n 
A 1 41  ARG 41  87   87   ARG ARG A . n 
A 1 42  ARG 42  88   88   ARG ARG A . n 
A 1 43  LEU 43  89   89   LEU LEU A . n 
A 1 44  ARG 44  90   90   ARG ARG A . n 
A 1 45  LEU 45  91   91   LEU LEU A . n 
A 1 46  PRO 46  92   92   PRO PRO A . n 
A 1 47  ARG 47  93   93   ARG ARG A . n 
A 1 48  ASP 48  94   94   ASP ASP A . n 
A 1 49  GLN 49  95   95   GLN GLN A . n 
A 1 50  ILE 50  96   96   ILE ILE A . n 
A 1 51  GLN 51  97   97   GLN GLN A . n 
A 1 52  ARG 52  98   98   ARG ARG A . n 
A 1 53  MET 53  99   99   MET MET A . n 
A 1 54  ASN 54  100  100  ASN ASN A . n 
A 1 55  PRO 55  101  101  PRO PRO A . n 
A 1 56  PRO 56  102  102  PRO PRO A . n 
A 1 57  LYS 57  103  103  LYS LYS A . n 
A 1 58  PHE 58  104  104  PHE PHE A . n 
A 1 59  SER 59  105  105  SER SER A . n 
A 1 60  LYS 60  106  106  LYS LYS A . n 
A 1 61  ALA 61  107  107  ALA ALA A . n 
A 1 62  GLU 62  108  108  GLU GLU A . n 
A 1 63  ASP 63  109  109  ASP ASP A . n 
A 1 64  MET 64  110  110  MET MET A . n 
A 1 65  ALA 65  111  111  ALA ALA A . n 
A 1 66  GLU 66  112  112  GLU GLU A . n 
A 1 67  LEU 67  113  113  LEU LEU A . n 
A 1 68  THR 68  114  114  THR THR A . n 
A 1 69  CYS 69  115  115  CYS CYS A . n 
A 1 70  LEU 70  116  116  LEU LEU A . n 
A 1 71  ASN 71  117  117  ASN ASN A . n 
A 1 72  GLU 72  118  118  GLU GLU A . n 
A 1 73  ALA 73  119  119  ALA ALA A . n 
A 1 74  SER 74  120  120  SER SER A . n 
A 1 75  VAL 75  121  121  VAL VAL A . n 
A 1 76  LEU 76  122  122  LEU LEU A . n 
A 1 77  HIS 77  123  123  HIS HIS A . n 
A 1 78  ASN 78  124  124  ASN ASN A . n 
A 1 79  LEU 79  125  125  LEU LEU A . n 
A 1 80  ARG 80  126  126  ARG ARG A . n 
A 1 81  GLU 81  127  127  GLU GLU A . n 
A 1 82  ARG 82  128  128  ARG ARG A . n 
A 1 83  TYR 83  129  129  TYR TYR A . n 
A 1 84  TYR 84  130  130  TYR TYR A . n 
A 1 85  SER 85  131  131  SER SER A . n 
A 1 86  GLY 86  132  132  GLY GLY A . n 
A 1 87  LEU 87  133  133  LEU LEU A . n 
A 1 88  ILE 88  134  134  ILE ILE A . n 
A 1 89  TYR 89  135  135  TYR TYR A . n 
A 1 90  THR 90  136  136  THR THR A . n 
A 1 91  TYR 91  137  137  TYR TYR A . n 
A 1 92  SER 92  138  138  SER SER A . n 
A 1 93  GLY 93  139  139  GLY GLY A . n 
A 1 94  LEU 94  140  140  LEU LEU A . n 
A 1 95  PHE 95  141  141  PHE PHE A . n 
A 1 96  CYS 96  142  142  CYS CYS A . n 
A 1 97  VAL 97  143  143  VAL VAL A . n 
A 1 98  VAL 98  144  144  VAL VAL A . n 
A 1 99  ILE 99  145  145  ILE ILE A . n 
A 1 100 ASN 100 146  146  ASN ASN A . n 
A 1 101 PRO 101 147  147  PRO PRO A . n 
A 1 102 TYR 102 148  148  TYR TYR A . n 
A 1 103 LYS 103 149  149  LYS LYS A . n 
A 1 104 GLN 104 150  150  GLN GLN A . n 
A 1 105 LEU 105 151  151  LEU LEU A . n 
A 1 106 PRO 106 152  152  PRO PRO A . n 
A 1 107 ILE 107 153  153  ILE ILE A . n 
A 1 108 TYR 108 154  154  TYR TYR A . n 
A 1 109 THR 109 155  155  THR THR A . n 
A 1 110 GLU 110 156  156  GLU GLU A . n 
A 1 111 ALA 111 157  157  ALA ALA A . n 
A 1 112 ILE 112 158  158  ILE ILE A . n 
A 1 113 VAL 113 159  159  VAL VAL A . n 
A 1 114 GLU 114 160  160  GLU GLU A . n 
A 1 115 MET 115 161  161  MET MET A . n 
A 1 116 TYR 116 162  162  TYR TYR A . n 
A 1 117 ARG 117 163  163  ARG ARG A . n 
A 1 118 GLY 118 164  164  GLY GLY A . n 
A 1 119 LYS 119 165  165  LYS LYS A . n 
A 1 120 LYS 120 166  166  LYS LYS A . n 
A 1 121 ARG 121 167  167  ARG ARG A . n 
A 1 122 HIS 122 168  168  HIS HIS A . n 
A 1 123 GLU 123 169  169  GLU GLU A . n 
A 1 124 VAL 124 170  170  VAL VAL A . n 
A 1 125 PRO 125 171  171  PRO PRO A . n 
A 1 126 PRO 126 172  172  PRO PRO A . n 
A 1 127 HIS 127 173  173  HIS HIS A . n 
A 1 128 VAL 128 174  174  VAL VAL A . n 
A 1 129 TYR 129 175  175  TYR TYR A . n 
A 1 130 ALA 130 176  176  ALA ALA A . n 
A 1 131 VAL 131 177  177  VAL VAL A . n 
A 1 132 THR 132 178  178  THR THR A . n 
A 1 133 GLU 133 179  179  GLU GLU A . n 
A 1 134 GLY 134 180  180  GLY GLY A . n 
A 1 135 ALA 135 181  181  ALA ALA A . n 
A 1 136 TYR 136 182  182  TYR TYR A . n 
A 1 137 ARG 137 183  183  ARG ARG A . n 
A 1 138 SER 138 184  184  SER SER A . n 
A 1 139 MET 139 185  185  MET MET A . n 
A 1 140 LEU 140 186  186  LEU LEU A . n 
A 1 141 GLN 141 187  187  GLN GLN A . n 
A 1 142 ASP 142 188  188  ASP ASP A . n 
A 1 143 ARG 143 189  189  ARG ARG A . n 
A 1 144 GLU 144 190  190  GLU GLU A . n 
A 1 145 ASP 145 191  191  ASP ASP A . n 
A 1 146 GLN 146 192  192  GLN GLN A . n 
A 1 147 SER 147 193  193  SER SER A . n 
A 1 148 ILE 148 194  194  ILE ILE A . n 
A 1 149 LEU 149 195  195  LEU LEU A . n 
A 1 150 CYS 150 196  196  CYS CYS A . n 
A 1 151 THR 151 197  197  THR THR A . n 
A 1 152 GLY 152 198  198  GLY GLY A . n 
A 1 153 GLU 153 199  199  GLU GLU A . n 
A 1 154 SER 154 200  200  SER SER A . n 
A 1 155 GLY 155 201  201  GLY GLY A . n 
A 1 156 ALA 156 202  202  ALA ALA A . n 
A 1 157 GLY 157 203  203  GLY GLY A . n 
A 1 158 LYS 158 204  204  LYS LYS A . n 
A 1 159 THR 159 205  205  THR THR A . n 
A 1 160 GLU 160 206  206  GLU GLU A . n 
A 1 161 ASN 161 207  207  ASN ASN A . n 
A 1 162 THR 162 208  208  THR THR A . n 
A 1 163 LYS 163 209  209  LYS LYS A . n 
A 1 164 LYS 164 210  210  LYS LYS A . n 
A 1 165 VAL 165 211  211  VAL VAL A . n 
A 1 166 ILE 166 212  212  ILE ILE A . n 
A 1 167 GLN 167 213  213  GLN GLN A . n 
A 1 168 TYR 168 214  214  TYR TYR A . n 
A 1 169 LEU 169 215  215  LEU LEU A . n 
A 1 170 ALA 170 216  216  ALA ALA A . n 
A 1 171 HIS 171 217  217  HIS HIS A . n 
A 1 172 VAL 172 218  218  VAL VAL A . n 
A 1 173 ALA 173 219  219  ALA ALA A . n 
A 1 174 SER 174 220  220  SER SER A . n 
A 1 175 SER 175 221  221  SER SER A . n 
A 1 176 PRO 176 222  222  PRO PRO A . n 
A 1 177 LYS 177 223  223  LYS LYS A . n 
A 1 178 GLY 178 224  224  GLY GLY A . n 
A 1 179 ARG 179 225  225  ARG ARG A . n 
A 1 180 LYS 180 226  226  LYS LYS A . n 
A 1 181 GLU 181 227  227  GLU GLU A . n 
A 1 182 PRO 182 228  228  PRO PRO A . n 
A 1 183 GLY 183 229  229  GLY GLY A . n 
A 1 184 VAL 184 230  230  VAL VAL A . n 
A 1 185 PRO 185 231  231  PRO PRO A . n 
A 1 186 GLY 186 232  232  GLY GLY A . n 
A 1 187 GLU 187 233  233  GLU GLU A . n 
A 1 188 LEU 188 234  234  LEU LEU A . n 
A 1 189 GLU 189 235  235  GLU GLU A . n 
A 1 190 ARG 190 236  236  ARG ARG A . n 
A 1 191 GLN 191 237  237  GLN GLN A . n 
A 1 192 LEU 192 238  238  LEU LEU A . n 
A 1 193 LEU 193 239  239  LEU LEU A . n 
A 1 194 GLN 194 240  240  GLN GLN A . n 
A 1 195 ALA 195 241  241  ALA ALA A . n 
A 1 196 ASN 196 242  242  ASN ASN A . n 
A 1 197 PRO 197 243  243  PRO PRO A . n 
A 1 198 ILE 198 244  244  ILE ILE A . n 
A 1 199 LEU 199 245  245  LEU LEU A . n 
A 1 200 GLU 200 246  246  GLU GLU A . n 
A 1 201 ALA 201 247  247  ALA ALA A . n 
A 1 202 PHE 202 248  248  PHE PHE A . n 
A 1 203 GLY 203 249  249  GLY GLY A . n 
A 1 204 ASN 204 250  250  ASN ASN A . n 
A 1 205 ALA 205 251  251  ALA ALA A . n 
A 1 206 LYS 206 252  252  LYS LYS A . n 
A 1 207 THR 207 253  253  THR THR A . n 
A 1 208 VAL 208 254  254  VAL VAL A . n 
A 1 209 LYS 209 255  255  LYS LYS A . n 
A 1 210 ASN 210 256  256  ASN ASN A . n 
A 1 211 ASP 211 257  257  ASP ASP A . n 
A 1 212 ASN 212 258  258  ASN ASN A . n 
A 1 213 SER 213 259  259  SER SER A . n 
A 1 214 SER 214 260  260  SER SER A . n 
A 1 215 ARG 215 261  261  ARG ARG A . n 
A 1 216 PHE 216 262  262  PHE PHE A . n 
A 1 217 GLY 217 263  263  GLY GLY A . n 
A 1 218 LYS 218 264  264  LYS LYS A . n 
A 1 219 PHE 219 265  265  PHE PHE A . n 
A 1 220 ILE 220 266  266  ILE ILE A . n 
A 1 221 ARG 221 267  267  ARG ARG A . n 
A 1 222 ILE 222 268  268  ILE ILE A . n 
A 1 223 ASN 223 269  269  ASN ASN A . n 
A 1 224 PHE 224 270  270  PHE PHE A . n 
A 1 225 ASP 225 271  271  ASP ASP A . n 
A 1 226 VAL 226 272  272  VAL VAL A . n 
A 1 227 ALA 227 273  273  ALA ALA A . n 
A 1 228 GLY 228 274  274  GLY GLY A . n 
A 1 229 TYR 229 275  275  TYR TYR A . n 
A 1 230 ILE 230 276  276  ILE ILE A . n 
A 1 231 VAL 231 277  277  VAL VAL A . n 
A 1 232 GLY 232 278  278  GLY GLY A . n 
A 1 233 ALA 233 279  279  ALA ALA A . n 
A 1 234 ASN 234 280  280  ASN ASN A . n 
A 1 235 ILE 235 281  281  ILE ILE A . n 
A 1 236 GLU 236 282  282  GLU GLU A . n 
A 1 237 THR 237 283  283  THR THR A . n 
A 1 238 TYR 238 284  284  TYR TYR A . n 
A 1 239 LEU 239 285  285  LEU LEU A . n 
A 1 240 LEU 240 286  286  LEU LEU A . n 
A 1 241 GLU 241 287  287  GLU GLU A . n 
A 1 242 LYS 242 288  288  LYS LYS A . n 
A 1 243 SER 243 289  289  SER SER A . n 
A 1 244 ARG 244 290  290  ARG ARG A . n 
A 1 245 ALA 245 291  291  ALA ALA A . n 
A 1 246 ILE 246 292  292  ILE ILE A . n 
A 1 247 ARG 247 293  293  ARG ARG A . n 
A 1 248 GLN 248 294  294  GLN GLN A . n 
A 1 249 ALA 249 295  295  ALA ALA A . n 
A 1 250 LYS 250 296  296  LYS LYS A . n 
A 1 251 ASP 251 297  297  ASP ASP A . n 
A 1 252 GLU 252 298  298  GLU GLU A . n 
A 1 253 CYS 253 299  299  CYS CYS A . n 
A 1 254 SER 254 300  300  SER SER A . n 
A 1 255 PHE 255 301  301  PHE PHE A . n 
A 1 256 HIS 256 302  302  HIS HIS A . n 
A 1 257 ILE 257 303  303  ILE ILE A . n 
A 1 258 PHE 258 304  304  PHE PHE A . n 
A 1 259 TYR 259 305  305  TYR TYR A . n 
A 1 260 GLN 260 306  306  GLN GLN A . n 
A 1 261 LEU 261 307  307  LEU LEU A . n 
A 1 262 LEU 262 308  308  LEU LEU A . n 
A 1 263 GLY 263 309  309  GLY GLY A . n 
A 1 264 GLY 264 310  310  GLY GLY A . n 
A 1 265 ALA 265 311  311  ALA ALA A . n 
A 1 266 GLY 266 312  312  GLY GLY A . n 
A 1 267 GLU 267 313  313  GLU GLU A . n 
A 1 268 GLN 268 314  314  GLN GLN A . n 
A 1 269 LEU 269 315  315  LEU LEU A . n 
A 1 270 LYS 270 316  316  LYS LYS A . n 
A 1 271 ALA 271 317  317  ALA ALA A . n 
A 1 272 ASP 272 318  318  ASP ASP A . n 
A 1 273 LEU 273 319  319  LEU LEU A . n 
A 1 274 LEU 274 320  320  LEU LEU A . n 
A 1 275 LEU 275 321  321  LEU LEU A . n 
A 1 276 GLU 276 322  322  GLU GLU A . n 
A 1 277 PRO 277 323  323  PRO PRO A . n 
A 1 278 CYS 278 324  324  CYS CYS A . n 
A 1 279 SER 279 325  325  SER SER A . n 
A 1 280 HIS 280 326  326  HIS HIS A . n 
A 1 281 TYR 281 327  327  TYR TYR A . n 
A 1 282 ARG 282 328  328  ARG ARG A . n 
A 1 283 PHE 283 329  329  PHE PHE A . n 
A 1 284 LEU 284 330  330  LEU LEU A . n 
A 1 285 THR 285 331  331  THR THR A . n 
A 1 286 ASN 286 332  332  ASN ASN A . n 
A 1 287 GLY 287 333  333  GLY GLY A . n 
A 1 288 PRO 288 334  334  PRO PRO A . n 
A 1 289 SER 289 335  335  SER SER A . n 
A 1 290 SER 290 336  336  SER SER A . n 
A 1 291 SER 291 337  337  SER SER A . n 
A 1 292 PRO 292 338  338  PRO PRO A . n 
A 1 293 GLY 293 339  339  GLY GLY A . n 
A 1 294 GLN 294 340  340  GLN GLN A . n 
A 1 295 GLU 295 341  341  GLU GLU A . n 
A 1 296 ARG 296 342  342  ARG ARG A . n 
A 1 297 GLU 297 343  343  GLU GLU A . n 
A 1 298 LEU 298 344  344  LEU LEU A . n 
A 1 299 PHE 299 345  345  PHE PHE A . n 
A 1 300 GLN 300 346  346  GLN GLN A . n 
A 1 301 GLU 301 347  347  GLU GLU A . n 
A 1 302 THR 302 348  348  THR THR A . n 
A 1 303 LEU 303 349  349  LEU LEU A . n 
A 1 304 GLU 304 350  350  GLU GLU A . n 
A 1 305 SER 305 351  351  SER SER A . n 
A 1 306 LEU 306 352  352  LEU LEU A . n 
A 1 307 ARG 307 353  353  ARG ARG A . n 
A 1 308 VAL 308 354  354  VAL VAL A . n 
A 1 309 LEU 309 355  355  LEU LEU A . n 
A 1 310 GLY 310 356  356  GLY GLY A . n 
A 1 311 PHE 311 357  357  PHE PHE A . n 
A 1 312 SER 312 358  358  SER SER A . n 
A 1 313 HIS 313 359  359  HIS HIS A . n 
A 1 314 GLU 314 360  360  GLU GLU A . n 
A 1 315 GLU 315 361  361  GLU GLU A . n 
A 1 316 ILE 316 362  362  ILE ILE A . n 
A 1 317 ILE 317 363  363  ILE ILE A . n 
A 1 318 SER 318 364  364  SER SER A . n 
A 1 319 MET 319 365  365  MET MET A . n 
A 1 320 LEU 320 366  366  LEU LEU A . n 
A 1 321 ARG 321 367  367  ARG ARG A . n 
A 1 322 MET 322 368  368  MET MET A . n 
A 1 323 VAL 323 369  369  VAL VAL A . n 
A 1 324 SER 324 370  370  SER SER A . n 
A 1 325 ALA 325 371  371  ALA ALA A . n 
A 1 326 VAL 326 372  372  VAL VAL A . n 
A 1 327 LEU 327 373  373  LEU LEU A . n 
A 1 328 GLN 328 374  374  GLN GLN A . n 
A 1 329 PHE 329 375  375  PHE PHE A . n 
A 1 330 GLY 330 376  376  GLY GLY A . n 
A 1 331 ASN 331 377  377  ASN ASN A . n 
A 1 332 ILE 332 378  378  ILE ILE A . n 
A 1 333 ALA 333 379  379  ALA ALA A . n 
A 1 334 LEU 334 380  380  LEU LEU A . n 
A 1 335 LYS 335 381  381  LYS LYS A . n 
A 1 336 ARG 336 382  382  ARG ARG A . n 
A 1 337 GLU 337 383  383  GLU GLU A . n 
A 1 338 ARG 338 384  384  ARG ARG A . n 
A 1 339 ASN 339 385  385  ASN ASN A . n 
A 1 340 THR 340 386  386  THR THR A . n 
A 1 341 ASP 341 387  387  ASP ASP A . n 
A 1 342 GLN 342 388  388  GLN GLN A . n 
A 1 343 ALA 343 389  389  ALA ALA A . n 
A 1 344 THR 344 390  390  THR THR A . n 
A 1 345 MET 345 391  391  MET MET A . n 
A 1 346 PRO 346 392  392  PRO PRO A . n 
A 1 347 ASP 347 393  393  ASP ASP A . n 
A 1 348 ASN 348 394  394  ASN ASN A . n 
A 1 349 THR 349 395  395  THR THR A . n 
A 1 350 ALA 350 396  396  ALA ALA A . n 
A 1 351 ALA 351 397  397  ALA ALA A . n 
A 1 352 GLN 352 398  398  GLN GLN A . n 
A 1 353 LYS 353 399  399  LYS LYS A . n 
A 1 354 LEU 354 400  400  LEU LEU A . n 
A 1 355 CYS 355 401  401  CYS CYS A . n 
A 1 356 ARG 356 402  402  ARG ARG A . n 
A 1 357 LEU 357 403  403  LEU LEU A . n 
A 1 358 LEU 358 404  404  LEU LEU A . n 
A 1 359 GLY 359 405  405  GLY GLY A . n 
A 1 360 LEU 360 406  406  LEU LEU A . n 
A 1 361 GLY 361 407  407  GLY GLY A . n 
A 1 362 VAL 362 408  408  VAL VAL A . n 
A 1 363 THR 363 409  409  THR THR A . n 
A 1 364 ASP 364 410  410  ASP ASP A . n 
A 1 365 PHE 365 411  411  PHE PHE A . n 
A 1 366 SER 366 412  412  SER SER A . n 
A 1 367 ARG 367 413  413  ARG ARG A . n 
A 1 368 ALA 368 414  414  ALA ALA A . n 
A 1 369 LEU 369 415  415  LEU LEU A . n 
A 1 370 LEU 370 416  416  LEU LEU A . n 
A 1 371 THR 371 417  417  THR THR A . n 
A 1 372 PRO 372 418  418  PRO PRO A . n 
A 1 373 ARG 373 419  419  ARG ARG A . n 
A 1 374 ILE 374 420  420  ILE ILE A . n 
A 1 375 LYS 375 421  421  LYS LYS A . n 
A 1 376 VAL 376 422  422  VAL VAL A . n 
A 1 377 GLY 377 423  423  GLY GLY A . n 
A 1 378 ARG 378 424  424  ARG ARG A . n 
A 1 379 ASP 379 425  425  ASP ASP A . n 
A 1 380 TYR 380 426  426  TYR TYR A . n 
A 1 381 VAL 381 427  427  VAL VAL A . n 
A 1 382 GLN 382 428  428  GLN GLN A . n 
A 1 383 LYS 383 429  429  LYS LYS A . n 
A 1 384 ALA 384 430  430  ALA ALA A . n 
A 1 385 GLN 385 431  431  GLN GLN A . n 
A 1 386 THR 386 432  432  THR THR A . n 
A 1 387 LYS 387 433  433  LYS LYS A . n 
A 1 388 GLU 388 434  434  GLU GLU A . n 
A 1 389 GLN 389 435  435  GLN GLN A . n 
A 1 390 ALA 390 436  436  ALA ALA A . n 
A 1 391 ASP 391 437  437  ASP ASP A . n 
A 1 392 PHE 392 438  438  PHE PHE A . n 
A 1 393 ALA 393 439  439  ALA ALA A . n 
A 1 394 LEU 394 440  440  LEU LEU A . n 
A 1 395 GLU 395 441  441  GLU GLU A . n 
A 1 396 ALA 396 442  442  ALA ALA A . n 
A 1 397 LEU 397 443  443  LEU LEU A . n 
A 1 398 ALA 398 444  444  ALA ALA A . n 
A 1 399 LYS 399 445  445  LYS LYS A . n 
A 1 400 ALA 400 446  446  ALA ALA A . n 
A 1 401 THR 401 447  447  THR THR A . n 
A 1 402 TYR 402 448  448  TYR TYR A . n 
A 1 403 GLU 403 449  449  GLU GLU A . n 
A 1 404 ARG 404 450  450  ARG ARG A . n 
A 1 405 LEU 405 451  451  LEU LEU A . n 
A 1 406 PHE 406 452  452  PHE PHE A . n 
A 1 407 ARG 407 453  453  ARG ARG A . n 
A 1 408 TRP 408 454  454  TRP TRP A . n 
A 1 409 LEU 409 455  455  LEU LEU A . n 
A 1 410 VAL 410 456  456  VAL VAL A . n 
A 1 411 LEU 411 457  457  LEU LEU A . n 
A 1 412 ARG 412 458  458  ARG ARG A . n 
A 1 413 LEU 413 459  459  LEU LEU A . n 
A 1 414 ASN 414 460  460  ASN ASN A . n 
A 1 415 ARG 415 461  461  ARG ARG A . n 
A 1 416 ALA 416 462  462  ALA ALA A . n 
A 1 417 LEU 417 463  463  LEU LEU A . n 
A 1 418 ASP 418 464  464  ASP ASP A . n 
A 1 419 ARG 419 465  465  ARG ARG A . n 
A 1 420 SER 420 466  466  SER SER A . n 
A 1 421 PRO 421 467  467  PRO PRO A . n 
A 1 422 ARG 422 468  468  ARG ARG A . n 
A 1 423 GLN 423 469  469  GLN GLN A . n 
A 1 424 GLY 424 470  470  GLY GLY A . n 
A 1 425 ALA 425 471  471  ALA ALA A . n 
A 1 426 SER 426 472  472  SER SER A . n 
A 1 427 PHE 427 473  473  PHE PHE A . n 
A 1 428 LEU 428 474  474  LEU LEU A . n 
A 1 429 GLY 429 475  475  GLY GLY A . n 
A 1 430 ILE 430 476  476  ILE ILE A . n 
A 1 431 LEU 431 477  477  LEU LEU A . n 
A 1 432 ASP 432 478  478  ASP ASP A . n 
A 1 433 ILE 433 479  479  ILE ILE A . n 
A 1 434 ALA 434 480  480  ALA ALA A . n 
A 1 435 GLY 435 481  481  GLY GLY A . n 
A 1 436 PHE 436 482  482  PHE PHE A . n 
A 1 437 GLU 437 483  483  GLU GLU A . n 
A 1 438 ILE 438 484  484  ILE ILE A . n 
A 1 439 PHE 439 485  485  PHE PHE A . n 
A 1 440 GLN 440 486  486  GLN GLN A . n 
A 1 441 LEU 441 487  487  LEU LEU A . n 
A 1 442 ASN 442 488  488  ASN ASN A . n 
A 1 443 SER 443 489  489  SER SER A . n 
A 1 444 PHE 444 490  490  PHE PHE A . n 
A 1 445 GLU 445 491  491  GLU GLU A . n 
A 1 446 GLN 446 492  492  GLN GLN A . n 
A 1 447 LEU 447 493  493  LEU LEU A . n 
A 1 448 CYS 448 494  494  CYS CYS A . n 
A 1 449 ILE 449 495  495  ILE ILE A . n 
A 1 450 ASN 450 496  496  ASN ASN A . n 
A 1 451 TYR 451 497  497  TYR TYR A . n 
A 1 452 THR 452 498  498  THR THR A . n 
A 1 453 ASN 453 499  499  ASN ASN A . n 
A 1 454 GLU 454 500  500  GLU GLU A . n 
A 1 455 LYS 455 501  501  LYS LYS A . n 
A 1 456 LEU 456 502  502  LEU LEU A . n 
A 1 457 GLN 457 503  503  GLN GLN A . n 
A 1 458 GLN 458 504  504  GLN GLN A . n 
A 1 459 LEU 459 505  505  LEU LEU A . n 
A 1 460 PHE 460 506  506  PHE PHE A . n 
A 1 461 ASN 461 507  507  ASN ASN A . n 
A 1 462 HIS 462 508  508  HIS HIS A . n 
A 1 463 THR 463 509  509  THR THR A . n 
A 1 464 MET 464 510  510  MET MET A . n 
A 1 465 PHE 465 511  511  PHE PHE A . n 
A 1 466 VAL 466 512  512  VAL VAL A . n 
A 1 467 LEU 467 513  513  LEU LEU A . n 
A 1 468 GLU 468 514  514  GLU GLU A . n 
A 1 469 GLN 469 515  515  GLN GLN A . n 
A 1 470 GLU 470 516  516  GLU GLU A . n 
A 1 471 GLU 471 517  517  GLU GLU A . n 
A 1 472 TYR 472 518  518  TYR TYR A . n 
A 1 473 GLN 473 519  519  GLN GLN A . n 
A 1 474 ARG 474 520  520  ARG ARG A . n 
A 1 475 GLU 475 521  521  GLU GLU A . n 
A 1 476 GLY 476 522  522  GLY GLY A . n 
A 1 477 ILE 477 523  523  ILE ILE A . n 
A 1 478 PRO 478 524  524  PRO PRO A . n 
A 1 479 TRP 479 525  525  TRP TRP A . n 
A 1 480 THR 480 526  526  THR THR A . n 
A 1 481 PHE 481 527  527  PHE PHE A . n 
A 1 482 LEU 482 528  528  LEU LEU A . n 
A 1 483 ASP 483 529  529  ASP ASP A . n 
A 1 484 PHE 484 530  530  PHE PHE A . n 
A 1 485 GLY 485 531  531  GLY GLY A . n 
A 1 486 LEU 486 532  532  LEU LEU A . n 
A 1 487 ASP 487 533  533  ASP ASP A . n 
A 1 488 LEU 488 534  534  LEU LEU A . n 
A 1 489 GLN 489 535  535  GLN GLN A . n 
A 1 490 PRO 490 536  536  PRO PRO A . n 
A 1 491 CYS 491 537  537  CYS CYS A . n 
A 1 492 ILE 492 538  538  ILE ILE A . n 
A 1 493 ASP 493 539  539  ASP ASP A . n 
A 1 494 LEU 494 540  540  LEU LEU A . n 
A 1 495 ILE 495 541  541  ILE ILE A . n 
A 1 496 GLU 496 542  542  GLU GLU A . n 
A 1 497 ARG 497 543  543  ARG ARG A . n 
A 1 498 PRO 498 544  544  PRO PRO A . n 
A 1 499 ALA 499 545  545  ALA ALA A . n 
A 1 500 ASN 500 546  546  ASN ASN A . n 
A 1 501 PRO 501 547  547  PRO PRO A . n 
A 1 502 PRO 502 548  548  PRO PRO A . n 
A 1 503 GLY 503 549  549  GLY GLY A . n 
A 1 504 LEU 504 550  550  LEU LEU A . n 
A 1 505 LEU 505 551  551  LEU LEU A . n 
A 1 506 ALA 506 552  552  ALA ALA A . n 
A 1 507 LEU 507 553  553  LEU LEU A . n 
A 1 508 LEU 508 554  554  LEU LEU A . n 
A 1 509 ASP 509 555  555  ASP ASP A . n 
A 1 510 GLU 510 556  556  GLU GLU A . n 
A 1 511 GLU 511 557  557  GLU GLU A . n 
A 1 512 CYS 512 558  558  CYS CYS A . n 
A 1 513 TRP 513 559  559  TRP TRP A . n 
A 1 514 PHE 514 560  560  PHE PHE A . n 
A 1 515 PRO 515 561  561  PRO PRO A . n 
A 1 516 LYS 516 562  562  LYS LYS A . n 
A 1 517 ALA 517 563  563  ALA ALA A . n 
A 1 518 THR 518 564  564  THR THR A . n 
A 1 519 ASP 519 565  565  ASP ASP A . n 
A 1 520 LYS 520 566  566  LYS LYS A . n 
A 1 521 SER 521 567  567  SER SER A . n 
A 1 522 PHE 522 568  568  PHE PHE A . n 
A 1 523 VAL 523 569  569  VAL VAL A . n 
A 1 524 GLU 524 570  570  GLU GLU A . n 
A 1 525 LYS 525 571  571  LYS LYS A . n 
A 1 526 VAL 526 572  572  VAL VAL A . n 
A 1 527 ALA 527 573  573  ALA ALA A . n 
A 1 528 GLN 528 574  574  GLN GLN A . n 
A 1 529 GLU 529 575  575  GLU GLU A . n 
A 1 530 GLN 530 576  576  GLN GLN A . n 
A 1 531 GLY 531 577  577  GLY GLY A . n 
A 1 532 GLY 532 578  578  GLY GLY A . n 
A 1 533 HIS 533 579  579  HIS HIS A . n 
A 1 534 PRO 534 580  580  PRO PRO A . n 
A 1 535 LYS 535 581  581  LYS LYS A . n 
A 1 536 PHE 536 582  582  PHE PHE A . n 
A 1 537 GLN 537 583  583  GLN GLN A . n 
A 1 538 ARG 538 584  584  ARG ARG A . n 
A 1 539 PRO 539 585  585  PRO PRO A . n 
A 1 540 ARG 540 586  586  ARG ARG A . n 
A 1 541 HIS 541 587  587  HIS HIS A . n 
A 1 542 LEU 542 588  588  LEU LEU A . n 
A 1 543 ARG 543 589  589  ARG ARG A . n 
A 1 544 ASP 544 590  590  ASP ASP A . n 
A 1 545 GLN 545 591  591  GLN GLN A . n 
A 1 546 ALA 546 592  592  ALA ALA A . n 
A 1 547 ASP 547 593  593  ASP ASP A . n 
A 1 548 PHE 548 594  594  PHE PHE A . n 
A 1 549 SER 549 595  595  SER SER A . n 
A 1 550 VAL 550 596  596  VAL VAL A . n 
A 1 551 LEU 551 597  597  LEU LEU A . n 
A 1 552 HIS 552 598  598  HIS HIS A . n 
A 1 553 TYR 553 599  599  TYR TYR A . n 
A 1 554 ALA 554 600  600  ALA ALA A . n 
A 1 555 GLY 555 601  601  GLY GLY A . n 
A 1 556 LYS 556 602  602  LYS LYS A . n 
A 1 557 VAL 557 603  603  VAL VAL A . n 
A 1 558 ASP 558 604  604  ASP ASP A . n 
A 1 559 TYR 559 605  605  TYR TYR A . n 
A 1 560 LYS 560 606  606  LYS LYS A . n 
A 1 561 ALA 561 607  607  ALA ALA A . n 
A 1 562 ASN 562 608  608  ASN ASN A . n 
A 1 563 GLU 563 609  609  GLU GLU A . n 
A 1 564 TRP 564 610  610  TRP TRP A . n 
A 1 565 LEU 565 611  611  LEU LEU A . n 
A 1 566 MET 566 612  612  MET MET A . n 
A 1 567 LYS 567 613  613  LYS LYS A . n 
A 1 568 ASN 568 614  614  ASN ASN A . n 
A 1 569 MET 569 615  615  MET MET A . n 
A 1 570 ASP 570 616  616  ASP ASP A . n 
A 1 571 PRO 571 617  617  PRO PRO A . n 
A 1 572 LEU 572 618  618  LEU LEU A . n 
A 1 573 ASN 573 619  619  ASN ASN A . n 
A 1 574 ASP 574 620  620  ASP ASP A . n 
A 1 575 ASN 575 621  621  ASN ASN A . n 
A 1 576 VAL 576 622  622  VAL VAL A . n 
A 1 577 ALA 577 623  623  ALA ALA A . n 
A 1 578 ALA 578 624  624  ALA ALA A . n 
A 1 579 LEU 579 625  625  LEU LEU A . n 
A 1 580 LEU 580 626  626  LEU LEU A . n 
A 1 581 HIS 581 627  627  HIS HIS A . n 
A 1 582 GLN 582 628  628  GLN GLN A . n 
A 1 583 SER 583 629  629  SER SER A . n 
A 1 584 THR 584 630  630  THR THR A . n 
A 1 585 ASP 585 631  631  ASP ASP A . n 
A 1 586 ARG 586 632  632  ARG ARG A . n 
A 1 587 LEU 587 633  633  LEU LEU A . n 
A 1 588 THR 588 634  634  THR THR A . n 
A 1 589 ALA 589 635  635  ALA ALA A . n 
A 1 590 GLU 590 636  636  GLU GLU A . n 
A 1 591 ILE 591 637  637  ILE ILE A . n 
A 1 592 TRP 592 638  638  TRP TRP A . n 
A 1 593 LYS 593 639  639  LYS LYS A . n 
A 1 594 ASP 594 640  640  ASP ASP A . n 
A 1 595 VAL 595 641  641  VAL VAL A . n 
A 1 596 GLU 596 642  642  GLU GLU A . n 
A 1 597 GLY 597 643  643  GLY GLY A . n 
A 1 598 ILE 598 644  644  ILE ILE A . n 
A 1 599 VAL 599 645  645  VAL VAL A . n 
A 1 600 GLY 600 646  646  GLY GLY A . n 
A 1 601 LEU 601 647  647  LEU LEU A . n 
A 1 602 GLU 602 648  ?    ?   ?   A . n 
A 1 603 GLN 603 649  ?    ?   ?   A . n 
A 1 604 VAL 604 650  ?    ?   ?   A . n 
A 1 605 SER 605 651  ?    ?   ?   A . n 
A 1 606 SER 606 652  ?    ?   ?   A . n 
A 1 607 LEU 607 653  ?    ?   ?   A . n 
A 1 608 GLY 608 654  ?    ?   ?   A . n 
A 1 609 ASP 609 655  ?    ?   ?   A . n 
A 1 610 GLY 610 656  ?    ?   ?   A . n 
A 1 611 PRO 611 657  ?    ?   ?   A . n 
A 1 612 PRO 612 658  ?    ?   ?   A . n 
A 1 613 GLY 613 659  ?    ?   ?   A . n 
A 1 614 GLY 614 660  ?    ?   ?   A . n 
A 1 615 ARG 615 661  ?    ?   ?   A . n 
A 1 616 PRO 616 662  ?    ?   ?   A . n 
A 1 617 ARG 617 663  663  ARG ARG A . n 
A 1 618 ARG 618 664  664  ARG ARG A . n 
A 1 619 GLY 619 665  665  GLY GLY A . n 
A 1 620 MET 620 666  666  MET MET A . n 
A 1 621 PHE 621 667  667  PHE PHE A . n 
A 1 622 ARG 622 668  668  ARG ARG A . n 
A 1 623 THR 623 669  669  THR THR A . n 
A 1 624 VAL 624 670  670  VAL VAL A . n 
A 1 625 GLY 625 671  671  GLY GLY A . n 
A 1 626 GLN 626 672  672  GLN GLN A . n 
A 1 627 LEU 627 673  673  LEU LEU A . n 
A 1 628 TYR 628 674  674  TYR TYR A . n 
A 1 629 LYS 629 675  675  LYS LYS A . n 
A 1 630 GLU 630 676  676  GLU GLU A . n 
A 1 631 SER 631 677  677  SER SER A . n 
A 1 632 LEU 632 678  678  LEU LEU A . n 
A 1 633 SER 633 679  679  SER SER A . n 
A 1 634 ARG 634 680  680  ARG ARG A . n 
A 1 635 LEU 635 681  681  LEU LEU A . n 
A 1 636 MET 636 682  682  MET MET A . n 
A 1 637 ALA 637 683  683  ALA ALA A . n 
A 1 638 THR 638 684  684  THR THR A . n 
A 1 639 LEU 639 685  685  LEU LEU A . n 
A 1 640 SER 640 686  686  SER SER A . n 
A 1 641 ASN 641 687  687  ASN ASN A . n 
A 1 642 THR 642 688  688  THR THR A . n 
A 1 643 ASN 643 689  689  ASN ASN A . n 
A 1 644 PRO 644 690  690  PRO PRO A . n 
A 1 645 SER 645 691  691  SER SER A . n 
A 1 646 PHE 646 692  692  PHE PHE A . n 
A 1 647 VAL 647 693  693  VAL VAL A . n 
A 1 648 ARG 648 694  694  ARG ARG A . n 
A 1 649 CYS 649 695  695  CYS CYS A . n 
A 1 650 ILE 650 696  696  ILE ILE A . n 
A 1 651 VAL 651 697  697  VAL VAL A . n 
A 1 652 PRO 652 698  698  PRO PRO A . n 
A 1 653 ASN 653 699  699  ASN ASN A . n 
A 1 654 HIS 654 700  700  HIS HIS A . n 
A 1 655 GLU 655 701  701  GLU GLU A . n 
A 1 656 LYS 656 702  702  LYS LYS A . n 
A 1 657 ARG 657 703  703  ARG ARG A . n 
A 1 658 ALA 658 704  704  ALA ALA A . n 
A 1 659 GLY 659 705  705  GLY GLY A . n 
A 1 660 LYS 660 706  706  LYS LYS A . n 
A 1 661 LEU 661 707  707  LEU LEU A . n 
A 1 662 GLU 662 708  708  GLU GLU A . n 
A 1 663 PRO 663 709  709  PRO PRO A . n 
A 1 664 ARG 664 710  710  ARG ARG A . n 
A 1 665 LEU 665 711  711  LEU LEU A . n 
A 1 666 VAL 666 712  712  VAL VAL A . n 
A 1 667 LEU 667 713  713  LEU LEU A . n 
A 1 668 ASP 668 714  714  ASP ASP A . n 
A 1 669 GLN 669 715  715  GLN GLN A . n 
A 1 670 LEU 670 716  716  LEU LEU A . n 
A 1 671 ARG 671 717  717  ARG ARG A . n 
A 1 672 CYS 672 718  718  CYS CYS A . n 
A 1 673 ASN 673 719  719  ASN ASN A . n 
A 1 674 GLY 674 720  720  GLY GLY A . n 
A 1 675 VAL 675 721  721  VAL VAL A . n 
A 1 676 LEU 676 722  722  LEU LEU A . n 
A 1 677 GLU 677 723  723  GLU GLU A . n 
A 1 678 GLY 678 724  724  GLY GLY A . n 
A 1 679 ILE 679 725  725  ILE ILE A . n 
A 1 680 ARG 680 726  726  ARG ARG A . n 
A 1 681 ILE 681 727  727  ILE ILE A . n 
A 1 682 CYS 682 728  728  CYS CYS A . n 
A 1 683 ARG 683 729  729  ARG ARG A . n 
A 1 684 GLN 684 730  730  GLN GLN A . n 
A 1 685 GLY 685 731  731  GLY GLY A . n 
A 1 686 PHE 686 732  732  PHE PHE A . n 
A 1 687 PRO 687 733  733  PRO PRO A . n 
A 1 688 ASN 688 734  734  ASN ASN A . n 
A 1 689 ARG 689 735  735  ARG ARG A . n 
A 1 690 ILE 690 736  736  ILE ILE A . n 
A 1 691 LEU 691 737  737  LEU LEU A . n 
A 1 692 PHE 692 738  738  PHE PHE A . n 
A 1 693 GLN 693 739  739  GLN GLN A . n 
A 1 694 GLU 694 740  740  GLU GLU A . n 
A 1 695 PHE 695 741  741  PHE PHE A . n 
A 1 696 ARG 696 742  742  ARG ARG A . n 
A 1 697 GLN 697 743  743  GLN GLN A . n 
A 1 698 ARG 698 744  744  ARG ARG A . n 
A 1 699 TYR 699 745  745  TYR TYR A . n 
A 1 700 GLU 700 746  746  GLU GLU A . n 
A 1 701 ILE 701 747  747  ILE ILE A . n 
A 1 702 LEU 702 748  748  LEU LEU A . n 
A 1 703 THR 703 749  749  THR THR A . n 
A 1 704 PRO 704 750  750  PRO PRO A . n 
A 1 705 ASN 705 751  751  ASN ASN A . n 
A 1 706 ALA 706 752  752  ALA ALA A . n 
A 1 707 ILE 707 753  753  ILE ILE A . n 
A 1 708 PRO 708 754  754  PRO PRO A . n 
A 1 709 LYS 709 755  755  LYS LYS A . n 
A 1 710 GLY 710 756  756  GLY GLY A . n 
A 1 711 PHE 711 757  757  PHE PHE A . n 
A 1 712 MET 712 758  758  MET MET A . n 
A 1 713 ASP 713 759  759  ASP ASP A . n 
A 1 714 GLY 714 760  760  GLY GLY A . n 
A 1 715 LYS 715 761  761  LYS LYS A . n 
A 1 716 GLN 716 762  762  GLN GLN A . n 
A 1 717 ALA 717 763  763  ALA ALA A . n 
A 1 718 CYS 718 764  764  CYS CYS A . n 
A 1 719 GLU 719 765  765  GLU GLU A . n 
A 1 720 LYS 720 766  766  LYS LYS A . n 
A 1 721 MET 721 767  767  MET MET A . n 
A 1 722 ILE 722 768  768  ILE ILE A . n 
A 1 723 GLN 723 769  769  GLN GLN A . n 
A 1 724 ALA 724 770  770  ALA ALA A . n 
A 1 725 LEU 725 771  771  LEU LEU A . n 
A 1 726 GLU 726 772  772  GLU GLU A . n 
A 1 727 LEU 727 773  773  LEU LEU A . n 
A 1 728 ASP 728 774  774  ASP ASP A . n 
A 1 729 PRO 729 775  775  PRO PRO A . n 
A 1 730 ASN 730 776  776  ASN ASN A . n 
A 1 731 LEU 731 777  777  LEU LEU A . n 
A 1 732 TYR 732 778  778  TYR TYR A . n 
A 1 733 ARG 733 779  779  ARG ARG A . n 
A 1 734 VAL 734 780  780  VAL VAL A . n 
A 1 735 GLY 735 781  781  GLY GLY A . n 
A 1 736 GLN 736 782  782  GLN GLN A . n 
A 1 737 SER 737 783  783  SER SER A . n 
A 1 738 LYS 738 784  784  LYS LYS A . n 
A 1 739 ILE 739 785  785  ILE ILE A . n 
A 1 740 PHE 740 786  786  PHE PHE A . n 
A 1 741 PHE 741 787  787  PHE PHE A . n 
A 1 742 ARG 742 788  788  ARG ARG A . n 
A 1 743 ALA 743 789  789  ALA ALA A . n 
A 1 744 GLY 744 790  790  GLY GLY A . n 
A 1 745 VAL 745 791  791  VAL VAL A . n 
A 1 746 LEU 746 792  792  LEU LEU A . n 
A 1 747 ALA 747 793  793  ALA ALA A . n 
A 1 748 GLN 748 794  794  GLN GLN A . n 
A 1 749 LEU 749 795  795  LEU LEU A . n 
A 1 750 GLU 750 796  796  GLU GLU A . n 
A 1 751 GLU 751 797  797  GLU GLU A . n 
A 1 752 GLU 752 798  798  GLU GLU A . n 
A 1 753 ARG 753 799  799  ARG ARG A . n 
A 1 754 ALA 754 800  800  ALA ALA A . n 
A 1 755 SER 755 801  801  SER SER A . n 
A 1 756 GLU 756 802  802  GLU GLU A . n 
A 1 757 GLN 757 803  803  GLN GLN A . n 
A 1 758 THR 758 804  804  THR THR A . n 
A 1 759 LYS 759 805  805  LYS LYS A . n 
A 1 760 SER 760 806  806  SER SER A . n 
A 1 761 ASP 761 807  807  ASP ASP A . n 
A 1 762 TYR 762 808  808  TYR TYR A . n 
A 1 763 LEU 763 809  809  LEU LEU A . n 
A 1 764 LYS 764 810  810  LYS LYS A . n 
A 1 765 ARG 765 811  811  ARG ARG A . n 
A 1 766 ALA 766 812  812  ALA ALA A . n 
A 1 767 ASN 767 813  813  ASN ASN A . n 
A 1 768 GLU 768 814  814  GLU GLU A . n 
A 1 769 LEU 769 815  815  LEU LEU A . n 
A 1 770 VAL 770 816  816  VAL VAL A . n 
A 1 771 GLN 771 817  817  GLN GLN A . n 
A 1 772 TRP 772 818  818  TRP TRP A . n 
A 1 773 ILE 773 819  819  ILE ILE A . n 
A 1 774 ASN 774 820  820  ASN ASN A . n 
A 1 775 ASP 775 821  821  ASP ASP A . n 
A 1 776 LYS 776 822  822  LYS LYS A . n 
A 1 777 GLN 777 823  823  GLN GLN A . n 
A 1 778 ALA 778 824  824  ALA ALA A . n 
A 1 779 SER 779 825  825  SER SER A . n 
A 1 780 LEU 780 826  826  LEU LEU A . n 
A 1 781 GLU 781 827  827  GLU GLU A . n 
A 1 782 SER 782 828  828  SER SER A . n 
A 1 783 ARG 783 829  829  ARG ARG A . n 
A 1 784 ASP 784 830  830  ASP ASP A . n 
A 1 785 PHE 785 831  831  PHE PHE A . n 
A 1 786 GLY 786 832  832  GLY GLY A . n 
A 1 787 ASP 787 833  833  ASP ASP A . n 
A 1 788 SER 788 834  834  SER SER A . n 
A 1 789 ILE 789 835  835  ILE ILE A . n 
A 1 790 GLU 790 836  836  GLU GLU A . n 
A 1 791 SER 791 837  837  SER SER A . n 
A 1 792 VAL 792 838  838  VAL VAL A . n 
A 1 793 GLN 793 839  839  GLN GLN A . n 
A 1 794 SER 794 840  840  SER SER A . n 
A 1 795 PHE 795 841  841  PHE PHE A . n 
A 1 796 MET 796 842  842  MET MET A . n 
A 1 797 ASN 797 843  843  ASN ASN A . n 
A 1 798 ALA 798 844  844  ALA ALA A . n 
A 1 799 HIS 799 845  845  HIS HIS A . n 
A 1 800 LYS 800 846  846  LYS LYS A . n 
A 1 801 GLU 801 847  847  GLU GLU A . n 
A 1 802 TYR 802 848  848  TYR TYR A . n 
A 1 803 LYS 803 849  849  LYS LYS A . n 
A 1 804 LYS 804 850  850  LYS LYS A . n 
A 1 805 THR 805 851  851  THR THR A . n 
A 1 806 GLU 806 852  852  GLU GLU A . n 
A 1 807 LYS 807 853  853  LYS LYS A . n 
A 1 808 PRO 808 854  854  PRO PRO A . n 
A 1 809 PRO 809 855  855  PRO PRO A . n 
A 1 810 LYS 810 856  856  LYS LYS A . n 
A 1 811 GLY 811 857  857  GLY GLY A . n 
A 1 812 GLN 812 858  858  GLN GLN A . n 
A 1 813 GLU 813 859  859  GLU GLU A . n 
A 1 814 VAL 814 860  860  VAL VAL A . n 
A 1 815 SER 815 861  861  SER SER A . n 
A 1 816 GLU 816 862  862  GLU GLU A . n 
A 1 817 LEU 817 863  863  LEU LEU A . n 
A 1 818 GLU 818 864  864  GLU GLU A . n 
A 1 819 ALA 819 865  865  ALA ALA A . n 
A 1 820 ILE 820 866  866  ILE ILE A . n 
A 1 821 TYR 821 867  867  TYR TYR A . n 
A 1 822 ASN 822 868  868  ASN ASN A . n 
A 1 823 SER 823 869  869  SER SER A . n 
A 1 824 LEU 824 870  870  LEU LEU A . n 
A 1 825 GLN 825 871  871  GLN GLN A . n 
A 1 826 THR 826 872  872  THR THR A . n 
A 1 827 LYS 827 873  873  LYS LYS A . n 
A 1 828 LEU 828 874  874  LEU LEU A . n 
A 1 829 ARG 829 875  875  ARG ARG A . n 
A 1 830 LEU 830 876  ?    ?   ?   A . n 
A 1 831 ILE 831 877  ?    ?   ?   A . n 
A 1 832 LYS 832 878  ?    ?   ?   A . n 
A 1 833 ARG 833 879  ?    ?   ?   A . n 
A 1 834 GLU 834 880  880  GLU GLU A . n 
A 1 835 PRO 835 881  881  PRO PRO A . n 
A 1 836 PHE 836 882  882  PHE PHE A . n 
A 1 837 VAL 837 883  883  VAL VAL A . n 
A 1 838 ALA 838 884  884  ALA ALA A . n 
A 1 839 PRO 839 885  885  PRO PRO A . n 
A 1 840 ALA 840 886  886  ALA ALA A . n 
A 1 841 GLY 841 887  887  GLY GLY A . n 
A 1 842 LEU 842 888  888  LEU LEU A . n 
A 1 843 THR 843 889  889  THR THR A . n 
A 1 844 PRO 844 890  890  PRO PRO A . n 
A 1 845 ASN 845 891  891  ASN ASN A . n 
A 1 846 GLU 846 892  892  GLU GLU A . n 
A 1 847 ILE 847 893  893  ILE ILE A . n 
A 1 848 ASP 848 894  894  ASP ASP A . n 
A 1 849 SER 849 895  895  SER SER A . n 
A 1 850 THR 850 896  896  THR THR A . n 
A 1 851 TRP 851 897  897  TRP TRP A . n 
A 1 852 SER 852 898  898  SER SER A . n 
A 1 853 ALA 853 899  899  ALA ALA A . n 
A 1 854 LEU 854 900  900  LEU LEU A . n 
A 1 855 GLU 855 901  901  GLU GLU A . n 
A 1 856 LYS 856 902  902  LYS LYS A . n 
A 1 857 ALA 857 903  903  ALA ALA A . n 
A 1 858 GLU 858 904  904  GLU GLU A . n 
A 1 859 GLN 859 905  905  GLN GLN A . n 
A 1 860 GLU 860 906  906  GLU GLU A . n 
A 1 861 HIS 861 907  907  HIS HIS A . n 
A 1 862 ALA 862 908  908  ALA ALA A . n 
A 1 863 GLU 863 909  909  GLU GLU A . n 
A 1 864 ALA 864 910  910  ALA ALA A . n 
A 1 865 LEU 865 911  911  LEU LEU A . n 
A 1 866 ARG 866 912  912  ARG ARG A . n 
A 1 867 ILE 867 913  913  ILE ILE A . n 
A 1 868 GLU 868 914  914  GLU GLU A . n 
A 1 869 LEU 869 915  915  LEU LEU A . n 
A 1 870 LYS 870 916  916  LYS LYS A . n 
A 1 871 ARG 871 917  917  ARG ARG A . n 
A 1 872 GLN 872 918  918  GLN GLN A . n 
A 1 873 LYS 873 919  919  LYS LYS A . n 
A 1 874 LYS 874 920  920  LYS LYS A . n 
A 1 875 ILE 875 921  921  ILE ILE A . n 
A 1 876 ALA 876 922  922  ALA ALA A . n 
A 1 877 VAL 877 923  923  VAL VAL A . n 
A 1 878 LEU 878 924  924  LEU LEU A . n 
A 1 879 LEU 879 925  925  LEU LEU A . n 
A 1 880 GLN 880 926  926  GLN GLN A . n 
A 1 881 LYS 881 927  927  LYS LYS A . n 
A 1 882 TYR 882 928  928  TYR TYR A . n 
A 1 883 ASN 883 929  929  ASN ASN A . n 
A 1 884 ARG 884 930  930  ARG ARG A . n 
A 1 885 ILE 885 931  931  ILE ILE A . n 
A 1 886 LEU 886 932  932  LEU LEU A . n 
A 1 887 LYS 887 933  933  LYS LYS A . n 
A 1 888 LYS 888 934  934  LYS LYS A . n 
A 1 889 LEU 889 935  935  LEU LEU A . n 
A 1 890 GLU 890 936  936  GLU GLU A . n 
A 1 891 ASN 891 937  937  ASN ASN A . n 
A 1 892 TRP 892 938  938  TRP TRP A . n 
A 1 893 ALA 893 939  939  ALA ALA A . n 
A 1 894 THR 894 940  940  THR THR A . n 
A 1 895 THR 895 941  941  THR THR A . n 
A 1 896 LYS 896 942  942  LYS LYS A . n 
A 1 897 SER 897 943  943  SER SER A . n 
A 1 898 VAL 898 944  944  VAL VAL A . n 
A 1 899 TYR 899 945  945  TYR TYR A . n 
A 1 900 LEU 900 946  946  LEU LEU A . n 
A 1 901 GLY 901 947  947  GLY GLY A . n 
A 1 902 SER 902 948  948  SER SER A . n 
A 1 903 ASN 903 949  949  ASN ASN A . n 
A 1 904 GLU 904 950  950  GLU GLU A . n 
A 1 905 THR 905 951  951  THR THR A . n 
A 1 906 GLY 906 952  952  GLY GLY A . n 
A 1 907 ASP 907 953  953  ASP ASP A . n 
A 1 908 SER 908 954  954  SER SER A . n 
A 1 909 ILE 909 955  955  ILE ILE A . n 
A 1 910 THR 910 956  956  THR THR A . n 
A 1 911 ALA 911 957  957  ALA ALA A . n 
A 1 912 VAL 912 958  958  VAL VAL A . n 
A 1 913 GLN 913 959  959  GLN GLN A . n 
A 1 914 ALA 914 960  960  ALA ALA A . n 
A 1 915 LYS 915 961  961  LYS LYS A . n 
A 1 916 LEU 916 962  962  LEU LEU A . n 
A 1 917 LYS 917 963  963  LYS LYS A . n 
A 1 918 ASN 918 964  964  ASN ASN A . n 
A 1 919 LEU 919 965  965  LEU LEU A . n 
A 1 920 GLU 920 966  966  GLU GLU A . n 
A 1 921 ALA 921 967  967  ALA ALA A . n 
A 1 922 PHE 922 968  968  PHE PHE A . n 
A 1 923 ASP 923 969  969  ASP ASP A . n 
A 1 924 GLY 924 970  970  GLY GLY A . n 
A 1 925 GLU 925 971  971  GLU GLU A . n 
A 1 926 CYS 926 972  972  CYS CYS A . n 
A 1 927 GLN 927 973  973  GLN GLN A . n 
A 1 928 SER 928 974  974  SER SER A . n 
A 1 929 LEU 929 975  975  LEU LEU A . n 
A 1 930 GLU 930 976  976  GLU GLU A . n 
A 1 931 GLY 931 977  977  GLY GLY A . n 
A 1 932 GLN 932 978  978  GLN GLN A . n 
A 1 933 SER 933 979  979  SER SER A . n 
A 1 934 ASN 934 980  980  ASN ASN A . n 
A 1 935 SER 935 981  981  SER SER A . n 
A 1 936 ASP 936 982  982  ASP ASP A . n 
A 1 937 LEU 937 983  983  LEU LEU A . n 
A 1 938 LEU 938 984  984  LEU LEU A . n 
A 1 939 SER 939 985  985  SER SER A . n 
A 1 940 ILE 940 986  986  ILE ILE A . n 
A 1 941 LEU 941 987  987  LEU LEU A . n 
A 1 942 ALA 942 988  988  ALA ALA A . n 
A 1 943 GLN 943 989  989  GLN GLN A . n 
A 1 944 LEU 944 990  990  LEU LEU A . n 
A 1 945 THR 945 991  991  THR THR A . n 
A 1 946 GLU 946 992  992  GLU GLU A . n 
A 1 947 LEU 947 993  993  LEU LEU A . n 
A 1 948 ASN 948 994  994  ASN ASN A . n 
A 1 949 TYR 949 995  995  TYR TYR A . n 
A 1 950 ASN 950 996  996  ASN ASN A . n 
A 1 951 GLY 951 997  997  GLY GLY A . n 
A 1 952 VAL 952 998  998  VAL VAL A . n 
A 1 953 PRO 953 999  999  PRO PRO A . n 
A 1 954 GLU 954 1000 1000 GLU GLU A . n 
A 1 955 LEU 955 1001 1001 LEU LEU A . n 
A 1 956 THR 956 1002 1002 THR THR A . n 
A 1 957 GLU 957 1003 1003 GLU GLU A . n 
A 1 958 ARG 958 1004 1004 ARG ARG A . n 
A 1 959 LYS 959 1005 1005 LYS LYS A . n 
A 1 960 ASP 960 1006 1006 ASP ASP A . n 
A 1 961 THR 961 1007 1007 THR THR A . n 
A 1 962 PHE 962 1008 1008 PHE PHE A . n 
A 1 963 PHE 963 1009 1009 PHE PHE A . n 
A 1 964 ALA 964 1010 1010 ALA ALA A . n 
A 1 965 GLN 965 1011 1011 GLN GLN A . n 
A 1 966 GLN 966 1012 1012 GLN GLN A . n 
A 1 967 TRP 967 1013 1013 TRP TRP A . n 
A 1 968 THR 968 1014 1014 THR THR A . n 
A 1 969 GLY 969 1015 1015 GLY GLY A . n 
A 1 970 VAL 970 1016 1016 VAL VAL A . n 
A 1 971 LYS 971 1017 1017 LYS LYS A . n 
A 1 972 SER 972 1018 1018 SER SER A . n 
A 1 973 SER 973 1019 1019 SER SER A . n 
A 1 974 ALA 974 1020 1020 ALA ALA A . n 
A 1 975 GLU 975 1021 1021 GLU GLU A . n 
A 1 976 THR 976 1022 1022 THR THR A . n 
A 1 977 TYR 977 1023 1023 TYR TYR A . n 
A 1 978 LYS 978 1024 1024 LYS LYS A . n 
A 1 979 ASN 979 1025 1025 ASN ASN A . n 
A 1 980 THR 980 1026 1026 THR THR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 AOV 1   1500 1500 AOV AOV A . 
C 3 MG  1   1501 1501 MG  MG  A . 
D 4 HOH 1   1601 2029 HOH HOH A . 
D 4 HOH 2   1602 2155 HOH HOH A . 
D 4 HOH 3   1603 2615 HOH HOH A . 
D 4 HOH 4   1604 2658 HOH HOH A . 
D 4 HOH 5   1605 2362 HOH HOH A . 
D 4 HOH 6   1606 2508 HOH HOH A . 
D 4 HOH 7   1607 2423 HOH HOH A . 
D 4 HOH 8   1608 2662 HOH HOH A . 
D 4 HOH 9   1609 2660 HOH HOH A . 
D 4 HOH 10  1610 2413 HOH HOH A . 
D 4 HOH 11  1611 2609 HOH HOH A . 
D 4 HOH 12  1612 2364 HOH HOH A . 
D 4 HOH 13  1613 2411 HOH HOH A . 
D 4 HOH 14  1614 2592 HOH HOH A . 
D 4 HOH 15  1615 2661 HOH HOH A . 
D 4 HOH 16  1616 2259 HOH HOH A . 
D 4 HOH 17  1617 2184 HOH HOH A . 
D 4 HOH 18  1618 2426 HOH HOH A . 
D 4 HOH 19  1619 2667 HOH HOH A . 
D 4 HOH 20  1620 2011 HOH HOH A . 
D 4 HOH 21  1621 2664 HOH HOH A . 
D 4 HOH 22  1622 2010 HOH HOH A . 
D 4 HOH 23  1623 2323 HOH HOH A . 
D 4 HOH 24  1624 2218 HOH HOH A . 
D 4 HOH 25  1625 2044 HOH HOH A . 
D 4 HOH 26  1626 2230 HOH HOH A . 
D 4 HOH 27  1627 2262 HOH HOH A . 
D 4 HOH 28  1628 2391 HOH HOH A . 
D 4 HOH 29  1629 2429 HOH HOH A . 
D 4 HOH 30  1630 2048 HOH HOH A . 
D 4 HOH 31  1631 2050 HOH HOH A . 
D 4 HOH 32  1632 2244 HOH HOH A . 
D 4 HOH 33  1633 2238 HOH HOH A . 
D 4 HOH 34  1634 2363 HOH HOH A . 
D 4 HOH 35  1635 2381 HOH HOH A . 
D 4 HOH 36  1636 2350 HOH HOH A . 
D 4 HOH 37  1637 2559 HOH HOH A . 
D 4 HOH 38  1638 2618 HOH HOH A . 
D 4 HOH 39  1639 2383 HOH HOH A . 
D 4 HOH 40  1640 2026 HOH HOH A . 
D 4 HOH 41  1641 2427 HOH HOH A . 
D 4 HOH 42  1642 2415 HOH HOH A . 
D 4 HOH 43  1643 2066 HOH HOH A . 
D 4 HOH 44  1644 2171 HOH HOH A . 
D 4 HOH 45  1645 2393 HOH HOH A . 
D 4 HOH 46  1646 2239 HOH HOH A . 
D 4 HOH 47  1647 2303 HOH HOH A . 
D 4 HOH 48  1648 2657 HOH HOH A . 
D 4 HOH 49  1649 2525 HOH HOH A . 
D 4 HOH 50  1650 2613 HOH HOH A . 
D 4 HOH 51  1651 2041 HOH HOH A . 
D 4 HOH 52  1652 2092 HOH HOH A . 
D 4 HOH 53  1653 2417 HOH HOH A . 
D 4 HOH 54  1654 2068 HOH HOH A . 
D 4 HOH 55  1655 2005 HOH HOH A . 
D 4 HOH 56  1656 2566 HOH HOH A . 
D 4 HOH 57  1657 2425 HOH HOH A . 
D 4 HOH 58  1658 2392 HOH HOH A . 
D 4 HOH 59  1659 2105 HOH HOH A . 
D 4 HOH 60  1660 2486 HOH HOH A . 
D 4 HOH 61  1661 2670 HOH HOH A . 
D 4 HOH 62  1662 2226 HOH HOH A . 
D 4 HOH 63  1663 2089 HOH HOH A . 
D 4 HOH 64  1664 2296 HOH HOH A . 
D 4 HOH 65  1665 2483 HOH HOH A . 
D 4 HOH 66  1666 2513 HOH HOH A . 
D 4 HOH 67  1667 2480 HOH HOH A . 
D 4 HOH 68  1668 2237 HOH HOH A . 
D 4 HOH 69  1669 2477 HOH HOH A . 
D 4 HOH 70  1670 2437 HOH HOH A . 
D 4 HOH 71  1671 2243 HOH HOH A . 
D 4 HOH 72  1672 2240 HOH HOH A . 
D 4 HOH 73  1673 2382 HOH HOH A . 
D 4 HOH 74  1674 2384 HOH HOH A . 
D 4 HOH 75  1675 2663 HOH HOH A . 
D 4 HOH 76  1676 2395 HOH HOH A . 
D 4 HOH 77  1677 2367 HOH HOH A . 
D 4 HOH 78  1678 2641 HOH HOH A . 
D 4 HOH 79  1679 2562 HOH HOH A . 
D 4 HOH 80  1680 2263 HOH HOH A . 
D 4 HOH 81  1681 2164 HOH HOH A . 
D 4 HOH 82  1682 2090 HOH HOH A . 
D 4 HOH 83  1683 2420 HOH HOH A . 
D 4 HOH 84  1684 2310 HOH HOH A . 
D 4 HOH 85  1685 2098 HOH HOH A . 
D 4 HOH 86  1686 2266 HOH HOH A . 
D 4 HOH 87  1687 2567 HOH HOH A . 
D 4 HOH 88  1688 2484 HOH HOH A . 
D 4 HOH 89  1689 2219 HOH HOH A . 
D 4 HOH 90  1690 2015 HOH HOH A . 
D 4 HOH 91  1691 2647 HOH HOH A . 
D 4 HOH 92  1692 2057 HOH HOH A . 
D 4 HOH 93  1693 2572 HOH HOH A . 
D 4 HOH 94  1694 2523 HOH HOH A . 
D 4 HOH 95  1695 2004 HOH HOH A . 
D 4 HOH 96  1696 2373 HOH HOH A . 
D 4 HOH 97  1697 2003 HOH HOH A . 
D 4 HOH 98  1698 2128 HOH HOH A . 
D 4 HOH 99  1699 2021 HOH HOH A . 
D 4 HOH 100 1700 2206 HOH HOH A . 
D 4 HOH 101 1701 2452 HOH HOH A . 
D 4 HOH 102 1702 2234 HOH HOH A . 
D 4 HOH 103 1703 2579 HOH HOH A . 
D 4 HOH 104 1704 2062 HOH HOH A . 
D 4 HOH 105 1705 2380 HOH HOH A . 
D 4 HOH 106 1706 2617 HOH HOH A . 
D 4 HOH 107 1707 2189 HOH HOH A . 
D 4 HOH 108 1708 2495 HOH HOH A . 
D 4 HOH 109 1709 2145 HOH HOH A . 
D 4 HOH 110 1710 2087 HOH HOH A . 
D 4 HOH 111 1711 2424 HOH HOH A . 
D 4 HOH 112 1712 2498 HOH HOH A . 
D 4 HOH 113 1713 2322 HOH HOH A . 
D 4 HOH 114 1714 2049 HOH HOH A . 
D 4 HOH 115 1715 2017 HOH HOH A . 
D 4 HOH 116 1716 2039 HOH HOH A . 
D 4 HOH 117 1717 2588 HOH HOH A . 
D 4 HOH 118 1718 2086 HOH HOH A . 
D 4 HOH 119 1719 2139 HOH HOH A . 
D 4 HOH 120 1720 2538 HOH HOH A . 
D 4 HOH 121 1721 2580 HOH HOH A . 
D 4 HOH 122 1722 2541 HOH HOH A . 
D 4 HOH 123 1723 2462 HOH HOH A . 
D 4 HOH 124 1724 2653 HOH HOH A . 
D 4 HOH 125 1725 2481 HOH HOH A . 
D 4 HOH 126 1726 2002 HOH HOH A . 
D 4 HOH 127 1727 2073 HOH HOH A . 
D 4 HOH 128 1728 2404 HOH HOH A . 
D 4 HOH 129 1729 2213 HOH HOH A . 
D 4 HOH 130 1730 2138 HOH HOH A . 
D 4 HOH 131 1731 2210 HOH HOH A . 
D 4 HOH 132 1732 2043 HOH HOH A . 
D 4 HOH 133 1733 2018 HOH HOH A . 
D 4 HOH 134 1734 2053 HOH HOH A . 
D 4 HOH 135 1735 2152 HOH HOH A . 
D 4 HOH 136 1736 2521 HOH HOH A . 
D 4 HOH 137 1737 2419 HOH HOH A . 
D 4 HOH 138 1738 2291 HOH HOH A . 
D 4 HOH 139 1739 2122 HOH HOH A . 
D 4 HOH 140 1740 2134 HOH HOH A . 
D 4 HOH 141 1741 2479 HOH HOH A . 
D 4 HOH 142 1742 2191 HOH HOH A . 
D 4 HOH 143 1743 2410 HOH HOH A . 
D 4 HOH 144 1744 2022 HOH HOH A . 
D 4 HOH 145 1745 2045 HOH HOH A . 
D 4 HOH 146 1746 2032 HOH HOH A . 
D 4 HOH 147 1747 2131 HOH HOH A . 
D 4 HOH 148 1748 2060 HOH HOH A . 
D 4 HOH 149 1749 2450 HOH HOH A . 
D 4 HOH 150 1750 2091 HOH HOH A . 
D 4 HOH 151 1751 2101 HOH HOH A . 
D 4 HOH 152 1752 2614 HOH HOH A . 
D 4 HOH 153 1753 2009 HOH HOH A . 
D 4 HOH 154 1754 2095 HOH HOH A . 
D 4 HOH 155 1755 2110 HOH HOH A . 
D 4 HOH 156 1756 2300 HOH HOH A . 
D 4 HOH 157 1757 2665 HOH HOH A . 
D 4 HOH 158 1758 2593 HOH HOH A . 
D 4 HOH 159 1759 2242 HOH HOH A . 
D 4 HOH 160 1760 2040 HOH HOH A . 
D 4 HOH 161 1761 2036 HOH HOH A . 
D 4 HOH 162 1762 2430 HOH HOH A . 
D 4 HOH 163 1763 2537 HOH HOH A . 
D 4 HOH 164 1764 2474 HOH HOH A . 
D 4 HOH 165 1765 2399 HOH HOH A . 
D 4 HOH 166 1766 2506 HOH HOH A . 
D 4 HOH 167 1767 2428 HOH HOH A . 
D 4 HOH 168 1768 2514 HOH HOH A . 
D 4 HOH 169 1769 2352 HOH HOH A . 
D 4 HOH 170 1770 2136 HOH HOH A . 
D 4 HOH 171 1771 2176 HOH HOH A . 
D 4 HOH 172 1772 2056 HOH HOH A . 
D 4 HOH 173 1773 2285 HOH HOH A . 
D 4 HOH 174 1774 2190 HOH HOH A . 
D 4 HOH 175 1775 2561 HOH HOH A . 
D 4 HOH 176 1776 2124 HOH HOH A . 
D 4 HOH 177 1777 2279 HOH HOH A . 
D 4 HOH 178 1778 2406 HOH HOH A . 
D 4 HOH 179 1779 2531 HOH HOH A . 
D 4 HOH 180 1780 2277 HOH HOH A . 
D 4 HOH 181 1781 2460 HOH HOH A . 
D 4 HOH 182 1782 2051 HOH HOH A . 
D 4 HOH 183 1783 2370 HOH HOH A . 
D 4 HOH 184 1784 2535 HOH HOH A . 
D 4 HOH 185 1785 2063 HOH HOH A . 
D 4 HOH 186 1786 2402 HOH HOH A . 
D 4 HOH 187 1787 2265 HOH HOH A . 
D 4 HOH 188 1788 2414 HOH HOH A . 
D 4 HOH 189 1789 2187 HOH HOH A . 
D 4 HOH 190 1790 2185 HOH HOH A . 
D 4 HOH 191 1791 2023 HOH HOH A . 
D 4 HOH 192 1792 2153 HOH HOH A . 
D 4 HOH 193 1793 2542 HOH HOH A . 
D 4 HOH 194 1794 2459 HOH HOH A . 
D 4 HOH 195 1795 2396 HOH HOH A . 
D 4 HOH 196 1796 2325 HOH HOH A . 
D 4 HOH 197 1797 2025 HOH HOH A . 
D 4 HOH 198 1798 2179 HOH HOH A . 
D 4 HOH 199 1799 2365 HOH HOH A . 
D 4 HOH 200 1800 2564 HOH HOH A . 
D 4 HOH 201 1801 2354 HOH HOH A . 
D 4 HOH 202 1802 2643 HOH HOH A . 
D 4 HOH 203 1803 2289 HOH HOH A . 
D 4 HOH 204 1804 2418 HOH HOH A . 
D 4 HOH 205 1805 2144 HOH HOH A . 
D 4 HOH 206 1806 2438 HOH HOH A . 
D 4 HOH 207 1807 2294 HOH HOH A . 
D 4 HOH 208 1808 2549 HOH HOH A . 
D 4 HOH 209 1809 2253 HOH HOH A . 
D 4 HOH 210 1810 2616 HOH HOH A . 
D 4 HOH 211 1811 2275 HOH HOH A . 
D 4 HOH 212 1812 2170 HOH HOH A . 
D 4 HOH 213 1813 2099 HOH HOH A . 
D 4 HOH 214 1814 2241 HOH HOH A . 
D 4 HOH 215 1815 2196 HOH HOH A . 
D 4 HOH 216 1816 2539 HOH HOH A . 
D 4 HOH 217 1817 2046 HOH HOH A . 
D 4 HOH 218 1818 2337 HOH HOH A . 
D 4 HOH 219 1819 2245 HOH HOH A . 
D 4 HOH 220 1820 2254 HOH HOH A . 
D 4 HOH 221 1821 2412 HOH HOH A . 
D 4 HOH 222 1822 2100 HOH HOH A . 
D 4 HOH 223 1823 2599 HOH HOH A . 
D 4 HOH 224 1824 2338 HOH HOH A . 
D 4 HOH 225 1825 2119 HOH HOH A . 
D 4 HOH 226 1826 2522 HOH HOH A . 
D 4 HOH 227 1827 2180 HOH HOH A . 
D 4 HOH 228 1828 2246 HOH HOH A . 
D 4 HOH 229 1829 2020 HOH HOH A . 
D 4 HOH 230 1830 2228 HOH HOH A . 
D 4 HOH 231 1831 2457 HOH HOH A . 
D 4 HOH 232 1832 2197 HOH HOH A . 
D 4 HOH 233 1833 2604 HOH HOH A . 
D 4 HOH 234 1834 2081 HOH HOH A . 
D 4 HOH 235 1835 2120 HOH HOH A . 
D 4 HOH 236 1836 2117 HOH HOH A . 
D 4 HOH 237 1837 2133 HOH HOH A . 
D 4 HOH 238 1838 2532 HOH HOH A . 
D 4 HOH 239 1839 2082 HOH HOH A . 
D 4 HOH 240 1840 2008 HOH HOH A . 
D 4 HOH 241 1841 2096 HOH HOH A . 
D 4 HOH 242 1842 2461 HOH HOH A . 
D 4 HOH 243 1843 2570 HOH HOH A . 
D 4 HOH 244 1844 2288 HOH HOH A . 
D 4 HOH 245 1845 2167 HOH HOH A . 
D 4 HOH 246 1846 2178 HOH HOH A . 
D 4 HOH 247 1847 2620 HOH HOH A . 
D 4 HOH 248 1848 2135 HOH HOH A . 
D 4 HOH 249 1849 2422 HOH HOH A . 
D 4 HOH 250 1850 2024 HOH HOH A . 
D 4 HOH 251 1851 2054 HOH HOH A . 
D 4 HOH 252 1852 2292 HOH HOH A . 
D 4 HOH 253 1853 2248 HOH HOH A . 
D 4 HOH 254 1854 2154 HOH HOH A . 
D 4 HOH 255 1855 2536 HOH HOH A . 
D 4 HOH 256 1856 2590 HOH HOH A . 
D 4 HOH 257 1857 2158 HOH HOH A . 
D 4 HOH 258 1858 2502 HOH HOH A . 
D 4 HOH 259 1859 2084 HOH HOH A . 
D 4 HOH 260 1860 2069 HOH HOH A . 
D 4 HOH 261 1861 2273 HOH HOH A . 
D 4 HOH 262 1862 2027 HOH HOH A . 
D 4 HOH 263 1863 2475 HOH HOH A . 
D 4 HOH 264 1864 2141 HOH HOH A . 
D 4 HOH 265 1865 2006 HOH HOH A . 
D 4 HOH 266 1866 2038 HOH HOH A . 
D 4 HOH 267 1867 2334 HOH HOH A . 
D 4 HOH 268 1868 2621 HOH HOH A . 
D 4 HOH 269 1869 2205 HOH HOH A . 
D 4 HOH 270 1870 2309 HOH HOH A . 
D 4 HOH 271 1871 2456 HOH HOH A . 
D 4 HOH 272 1872 2107 HOH HOH A . 
D 4 HOH 273 1873 2227 HOH HOH A . 
D 4 HOH 274 1874 2012 HOH HOH A . 
D 4 HOH 275 1875 2311 HOH HOH A . 
D 4 HOH 276 1876 2070 HOH HOH A . 
D 4 HOH 277 1877 2465 HOH HOH A . 
D 4 HOH 278 1878 2001 HOH HOH A . 
D 4 HOH 279 1879 2007 HOH HOH A . 
D 4 HOH 280 1880 2106 HOH HOH A . 
D 4 HOH 281 1881 2151 HOH HOH A . 
D 4 HOH 282 1882 2376 HOH HOH A . 
D 4 HOH 283 1883 2078 HOH HOH A . 
D 4 HOH 284 1884 2033 HOH HOH A . 
D 4 HOH 285 1885 2030 HOH HOH A . 
D 4 HOH 286 1886 2666 HOH HOH A . 
D 4 HOH 287 1887 2249 HOH HOH A . 
D 4 HOH 288 1888 2409 HOH HOH A . 
D 4 HOH 289 1889 2283 HOH HOH A . 
D 4 HOH 290 1890 2168 HOH HOH A . 
D 4 HOH 291 1891 2077 HOH HOH A . 
D 4 HOH 292 1892 2014 HOH HOH A . 
D 4 HOH 293 1893 2137 HOH HOH A . 
D 4 HOH 294 1894 2589 HOH HOH A . 
D 4 HOH 295 1895 2065 HOH HOH A . 
D 4 HOH 296 1896 2390 HOH HOH A . 
D 4 HOH 297 1897 2088 HOH HOH A . 
D 4 HOH 298 1898 2574 HOH HOH A . 
D 4 HOH 299 1899 2031 HOH HOH A . 
D 4 HOH 300 1900 2268 HOH HOH A . 
D 4 HOH 301 1901 2113 HOH HOH A . 
D 4 HOH 302 1902 2276 HOH HOH A . 
D 4 HOH 303 1903 2143 HOH HOH A . 
D 4 HOH 304 1904 2490 HOH HOH A . 
D 4 HOH 305 1905 2127 HOH HOH A . 
D 4 HOH 306 1906 2493 HOH HOH A . 
D 4 HOH 307 1907 2019 HOH HOH A . 
D 4 HOH 308 1908 2440 HOH HOH A . 
D 4 HOH 309 1909 2220 HOH HOH A . 
D 4 HOH 310 1910 2080 HOH HOH A . 
D 4 HOH 311 1911 2076 HOH HOH A . 
D 4 HOH 312 1912 2188 HOH HOH A . 
D 4 HOH 313 1913 2543 HOH HOH A . 
D 4 HOH 314 1914 2201 HOH HOH A . 
D 4 HOH 315 1915 2448 HOH HOH A . 
D 4 HOH 316 1916 2351 HOH HOH A . 
D 4 HOH 317 1917 2093 HOH HOH A . 
D 4 HOH 318 1918 2037 HOH HOH A . 
D 4 HOH 319 1919 2439 HOH HOH A . 
D 4 HOH 320 1920 2067 HOH HOH A . 
D 4 HOH 321 1921 2097 HOH HOH A . 
D 4 HOH 322 1922 2573 HOH HOH A . 
D 4 HOH 323 1923 2540 HOH HOH A . 
D 4 HOH 324 1924 2398 HOH HOH A . 
D 4 HOH 325 1925 2198 HOH HOH A . 
D 4 HOH 326 1926 2545 HOH HOH A . 
D 4 HOH 327 1927 2587 HOH HOH A . 
D 4 HOH 328 1928 2511 HOH HOH A . 
D 4 HOH 329 1929 2607 HOH HOH A . 
D 4 HOH 330 1930 2512 HOH HOH A . 
D 4 HOH 331 1931 2252 HOH HOH A . 
D 4 HOH 332 1932 2520 HOH HOH A . 
D 4 HOH 333 1933 2281 HOH HOH A . 
D 4 HOH 334 1934 2156 HOH HOH A . 
D 4 HOH 335 1935 2339 HOH HOH A . 
D 4 HOH 336 1936 2295 HOH HOH A . 
D 4 HOH 337 1937 2035 HOH HOH A . 
D 4 HOH 338 1938 2216 HOH HOH A . 
D 4 HOH 339 1939 2256 HOH HOH A . 
D 4 HOH 340 1940 2316 HOH HOH A . 
D 4 HOH 341 1941 2605 HOH HOH A . 
D 4 HOH 342 1942 2174 HOH HOH A . 
D 4 HOH 343 1943 2251 HOH HOH A . 
D 4 HOH 344 1944 2606 HOH HOH A . 
D 4 HOH 345 1945 2222 HOH HOH A . 
D 4 HOH 346 1946 2102 HOH HOH A . 
D 4 HOH 347 1947 2510 HOH HOH A . 
D 4 HOH 348 1948 2215 HOH HOH A . 
D 4 HOH 349 1949 2261 HOH HOH A . 
D 4 HOH 350 1950 2207 HOH HOH A . 
D 4 HOH 351 1951 2071 HOH HOH A . 
D 4 HOH 352 1952 2601 HOH HOH A . 
D 4 HOH 353 1953 2386 HOH HOH A . 
D 4 HOH 354 1954 2028 HOH HOH A . 
D 4 HOH 355 1955 2297 HOH HOH A . 
D 4 HOH 356 1956 2125 HOH HOH A . 
D 4 HOH 357 1957 2271 HOH HOH A . 
D 4 HOH 358 1958 2221 HOH HOH A . 
D 4 HOH 359 1959 2600 HOH HOH A . 
D 4 HOH 360 1960 2257 HOH HOH A . 
D 4 HOH 361 1961 2346 HOH HOH A . 
D 4 HOH 362 1962 2034 HOH HOH A . 
D 4 HOH 363 1963 2636 HOH HOH A . 
D 4 HOH 364 1964 2315 HOH HOH A . 
D 4 HOH 365 1965 2083 HOH HOH A . 
D 4 HOH 366 1966 2556 HOH HOH A . 
D 4 HOH 367 1967 2669 HOH HOH A . 
D 4 HOH 368 1968 2407 HOH HOH A . 
D 4 HOH 369 1969 2612 HOH HOH A . 
D 4 HOH 370 1970 2644 HOH HOH A . 
D 4 HOH 371 1971 2160 HOH HOH A . 
D 4 HOH 372 1972 2565 HOH HOH A . 
D 4 HOH 373 1973 2075 HOH HOH A . 
D 4 HOH 374 1974 2173 HOH HOH A . 
D 4 HOH 375 1975 2013 HOH HOH A . 
D 4 HOH 376 1976 2378 HOH HOH A . 
D 4 HOH 377 1977 2123 HOH HOH A . 
D 4 HOH 378 1978 2473 HOH HOH A . 
D 4 HOH 379 1979 2047 HOH HOH A . 
D 4 HOH 380 1980 2204 HOH HOH A . 
D 4 HOH 381 1981 2148 HOH HOH A . 
D 4 HOH 382 1982 2547 HOH HOH A . 
D 4 HOH 383 1983 2162 HOH HOH A . 
D 4 HOH 384 1984 2140 HOH HOH A . 
D 4 HOH 385 1985 2116 HOH HOH A . 
D 4 HOH 386 1986 2202 HOH HOH A . 
D 4 HOH 387 1987 2074 HOH HOH A . 
D 4 HOH 388 1988 2501 HOH HOH A . 
D 4 HOH 389 1989 2165 HOH HOH A . 
D 4 HOH 390 1990 2553 HOH HOH A . 
D 4 HOH 391 1991 2527 HOH HOH A . 
D 4 HOH 392 1992 2519 HOH HOH A . 
D 4 HOH 393 1993 2357 HOH HOH A . 
D 4 HOH 394 1994 2637 HOH HOH A . 
D 4 HOH 395 1995 2229 HOH HOH A . 
D 4 HOH 396 1996 2061 HOH HOH A . 
D 4 HOH 397 1997 2625 HOH HOH A . 
D 4 HOH 398 1998 2258 HOH HOH A . 
D 4 HOH 399 1999 2569 HOH HOH A . 
D 4 HOH 400 2000 2195 HOH HOH A . 
D 4 HOH 401 2001 2622 HOH HOH A . 
D 4 HOH 402 2002 2108 HOH HOH A . 
D 4 HOH 403 2003 2555 HOH HOH A . 
D 4 HOH 404 2004 2236 HOH HOH A . 
D 4 HOH 405 2005 2432 HOH HOH A . 
D 4 HOH 406 2006 2217 HOH HOH A . 
D 4 HOH 407 2007 2199 HOH HOH A . 
D 4 HOH 408 2008 2582 HOH HOH A . 
D 4 HOH 409 2009 2458 HOH HOH A . 
D 4 HOH 410 2010 2331 HOH HOH A . 
D 4 HOH 411 2011 2225 HOH HOH A . 
D 4 HOH 412 2012 2389 HOH HOH A . 
D 4 HOH 413 2013 2345 HOH HOH A . 
D 4 HOH 414 2014 2431 HOH HOH A . 
D 4 HOH 415 2015 2307 HOH HOH A . 
D 4 HOH 416 2016 2109 HOH HOH A . 
D 4 HOH 417 2017 2482 HOH HOH A . 
D 4 HOH 418 2018 2408 HOH HOH A . 
D 4 HOH 419 2019 2111 HOH HOH A . 
D 4 HOH 420 2020 2286 HOH HOH A . 
D 4 HOH 421 2021 2147 HOH HOH A . 
D 4 HOH 422 2022 2470 HOH HOH A . 
D 4 HOH 423 2023 2208 HOH HOH A . 
D 4 HOH 424 2024 2516 HOH HOH A . 
D 4 HOH 425 2025 2366 HOH HOH A . 
D 4 HOH 426 2026 2320 HOH HOH A . 
D 4 HOH 427 2027 2405 HOH HOH A . 
D 4 HOH 428 2028 2172 HOH HOH A . 
D 4 HOH 429 2029 2433 HOH HOH A . 
D 4 HOH 430 2030 2247 HOH HOH A . 
D 4 HOH 431 2031 2183 HOH HOH A . 
D 4 HOH 432 2032 2058 HOH HOH A . 
D 4 HOH 433 2033 2577 HOH HOH A . 
D 4 HOH 434 2034 2476 HOH HOH A . 
D 4 HOH 435 2035 2335 HOH HOH A . 
D 4 HOH 436 2036 2115 HOH HOH A . 
D 4 HOH 437 2037 2507 HOH HOH A . 
D 4 HOH 438 2038 2016 HOH HOH A . 
D 4 HOH 439 2039 2274 HOH HOH A . 
D 4 HOH 440 2040 2166 HOH HOH A . 
D 4 HOH 441 2041 2468 HOH HOH A . 
D 4 HOH 442 2042 2042 HOH HOH A . 
D 4 HOH 443 2043 2306 HOH HOH A . 
D 4 HOH 444 2044 2313 HOH HOH A . 
D 4 HOH 445 2045 2114 HOH HOH A . 
D 4 HOH 446 2046 2397 HOH HOH A . 
D 4 HOH 447 2047 2260 HOH HOH A . 
D 4 HOH 448 2048 2654 HOH HOH A . 
D 4 HOH 449 2049 2293 HOH HOH A . 
D 4 HOH 450 2050 2280 HOH HOH A . 
D 4 HOH 451 2051 2287 HOH HOH A . 
D 4 HOH 452 2052 2282 HOH HOH A . 
D 4 HOH 453 2053 2104 HOH HOH A . 
D 4 HOH 454 2054 2651 HOH HOH A . 
D 4 HOH 455 2055 2361 HOH HOH A . 
D 4 HOH 456 2056 2394 HOH HOH A . 
D 4 HOH 457 2057 2581 HOH HOH A . 
D 4 HOH 458 2058 2528 HOH HOH A . 
D 4 HOH 459 2059 2416 HOH HOH A . 
D 4 HOH 460 2060 2372 HOH HOH A . 
D 4 HOH 461 2061 2161 HOH HOH A . 
D 4 HOH 462 2062 2347 HOH HOH A . 
D 4 HOH 463 2063 2235 HOH HOH A . 
D 4 HOH 464 2064 2052 HOH HOH A . 
D 4 HOH 465 2065 2142 HOH HOH A . 
D 4 HOH 466 2066 2518 HOH HOH A . 
D 4 HOH 467 2067 2312 HOH HOH A . 
D 4 HOH 468 2068 2509 HOH HOH A . 
D 4 HOH 469 2069 2059 HOH HOH A . 
D 4 HOH 470 2070 2304 HOH HOH A . 
D 4 HOH 471 2071 2436 HOH HOH A . 
D 4 HOH 472 2072 2103 HOH HOH A . 
D 4 HOH 473 2073 2401 HOH HOH A . 
D 4 HOH 474 2074 2341 HOH HOH A . 
D 4 HOH 475 2075 2194 HOH HOH A . 
D 4 HOH 476 2076 2169 HOH HOH A . 
D 4 HOH 477 2077 2400 HOH HOH A . 
D 4 HOH 478 2078 2211 HOH HOH A . 
D 4 HOH 479 2079 2192 HOH HOH A . 
D 4 HOH 480 2080 2446 HOH HOH A . 
D 4 HOH 481 2081 2298 HOH HOH A . 
D 4 HOH 482 2082 2640 HOH HOH A . 
D 4 HOH 483 2083 2321 HOH HOH A . 
D 4 HOH 484 2084 2467 HOH HOH A . 
D 4 HOH 485 2085 2223 HOH HOH A . 
D 4 HOH 486 2086 2130 HOH HOH A . 
D 4 HOH 487 2087 2659 HOH HOH A . 
D 4 HOH 488 2088 2444 HOH HOH A . 
D 4 HOH 489 2089 2094 HOH HOH A . 
D 4 HOH 490 2090 2302 HOH HOH A . 
D 4 HOH 491 2091 2630 HOH HOH A . 
D 4 HOH 492 2092 2085 HOH HOH A . 
D 4 HOH 493 2093 2132 HOH HOH A . 
D 4 HOH 494 2094 2332 HOH HOH A . 
D 4 HOH 495 2095 2182 HOH HOH A . 
D 4 HOH 496 2096 2231 HOH HOH A . 
D 4 HOH 497 2097 2575 HOH HOH A . 
D 4 HOH 498 2098 2200 HOH HOH A . 
D 4 HOH 499 2099 2377 HOH HOH A . 
D 4 HOH 500 2100 2645 HOH HOH A . 
D 4 HOH 501 2101 2454 HOH HOH A . 
D 4 HOH 502 2102 2368 HOH HOH A . 
D 4 HOH 503 2103 2356 HOH HOH A . 
D 4 HOH 504 2104 2121 HOH HOH A . 
D 4 HOH 505 2105 2209 HOH HOH A . 
D 4 HOH 506 2106 2072 HOH HOH A . 
D 4 HOH 507 2107 2150 HOH HOH A . 
D 4 HOH 508 2108 2284 HOH HOH A . 
D 4 HOH 509 2109 2064 HOH HOH A . 
D 4 HOH 510 2110 2336 HOH HOH A . 
D 4 HOH 511 2111 2269 HOH HOH A . 
D 4 HOH 512 2112 2597 HOH HOH A . 
D 4 HOH 513 2113 2471 HOH HOH A . 
D 4 HOH 514 2114 2233 HOH HOH A . 
D 4 HOH 515 2115 2546 HOH HOH A . 
D 4 HOH 516 2116 2610 HOH HOH A . 
D 4 HOH 517 2117 2355 HOH HOH A . 
D 4 HOH 518 2118 2551 HOH HOH A . 
D 4 HOH 519 2119 2563 HOH HOH A . 
D 4 HOH 520 2120 2550 HOH HOH A . 
D 4 HOH 521 2121 2214 HOH HOH A . 
D 4 HOH 522 2122 2584 HOH HOH A . 
D 4 HOH 523 2123 2388 HOH HOH A . 
D 4 HOH 524 2124 2624 HOH HOH A . 
D 4 HOH 525 2125 2177 HOH HOH A . 
D 4 HOH 526 2126 2526 HOH HOH A . 
D 4 HOH 527 2127 2326 HOH HOH A . 
D 4 HOH 528 2128 2343 HOH HOH A . 
D 4 HOH 529 2129 2629 HOH HOH A . 
D 4 HOH 530 2130 2157 HOH HOH A . 
D 4 HOH 531 2131 2299 HOH HOH A . 
D 4 HOH 532 2132 2149 HOH HOH A . 
D 4 HOH 533 2133 2443 HOH HOH A . 
D 4 HOH 534 2134 2668 HOH HOH A . 
D 4 HOH 535 2135 2267 HOH HOH A . 
D 4 HOH 536 2136 2112 HOH HOH A . 
D 4 HOH 537 2137 2175 HOH HOH A . 
D 4 HOH 538 2138 2375 HOH HOH A . 
D 4 HOH 539 2139 2159 HOH HOH A . 
D 4 HOH 540 2140 2441 HOH HOH A . 
D 4 HOH 541 2141 2634 HOH HOH A . 
D 4 HOH 542 2142 2515 HOH HOH A . 
D 4 HOH 543 2143 2308 HOH HOH A . 
D 4 HOH 544 2144 2544 HOH HOH A . 
D 4 HOH 545 2145 2492 HOH HOH A . 
D 4 HOH 546 2146 2524 HOH HOH A . 
D 4 HOH 547 2147 2379 HOH HOH A . 
D 4 HOH 548 2148 2340 HOH HOH A . 
D 4 HOH 549 2149 2079 HOH HOH A . 
D 4 HOH 550 2150 2126 HOH HOH A . 
D 4 HOH 551 2151 2193 HOH HOH A . 
D 4 HOH 552 2152 2504 HOH HOH A . 
D 4 HOH 553 2153 2301 HOH HOH A . 
D 4 HOH 554 2154 2360 HOH HOH A . 
D 4 HOH 555 2155 2488 HOH HOH A . 
D 4 HOH 556 2156 2595 HOH HOH A . 
D 4 HOH 557 2157 2585 HOH HOH A . 
D 4 HOH 558 2158 2255 HOH HOH A . 
D 4 HOH 559 2159 2491 HOH HOH A . 
D 4 HOH 560 2160 2358 HOH HOH A . 
D 4 HOH 561 2161 2596 HOH HOH A . 
D 4 HOH 562 2162 2560 HOH HOH A . 
D 4 HOH 563 2163 2118 HOH HOH A . 
D 4 HOH 564 2164 2129 HOH HOH A . 
D 4 HOH 565 2165 2494 HOH HOH A . 
D 4 HOH 566 2166 2628 HOH HOH A . 
D 4 HOH 567 2167 2489 HOH HOH A . 
D 4 HOH 568 2168 2385 HOH HOH A . 
D 4 HOH 569 2169 2353 HOH HOH A . 
D 4 HOH 570 2170 2272 HOH HOH A . 
D 4 HOH 571 2171 2324 HOH HOH A . 
D 4 HOH 572 2172 2317 HOH HOH A . 
D 4 HOH 573 2173 2623 HOH HOH A . 
D 4 HOH 574 2174 2578 HOH HOH A . 
D 4 HOH 575 2175 2250 HOH HOH A . 
D 4 HOH 576 2176 2568 HOH HOH A . 
D 4 HOH 577 2177 2449 HOH HOH A . 
D 4 HOH 578 2178 2264 HOH HOH A . 
D 4 HOH 579 2179 2656 HOH HOH A . 
D 4 HOH 580 2180 2055 HOH HOH A . 
D 4 HOH 581 2181 2181 HOH HOH A . 
D 4 HOH 582 2182 2330 HOH HOH A . 
D 4 HOH 583 2183 2517 HOH HOH A . 
D 4 HOH 584 2184 2374 HOH HOH A . 
D 4 HOH 585 2185 2319 HOH HOH A . 
D 4 HOH 586 2186 2499 HOH HOH A . 
D 4 HOH 587 2187 2163 HOH HOH A . 
D 4 HOH 588 2188 2349 HOH HOH A . 
D 4 HOH 589 2189 2611 HOH HOH A . 
D 4 HOH 590 2190 2586 HOH HOH A . 
D 4 HOH 591 2191 2594 HOH HOH A . 
D 4 HOH 592 2192 2557 HOH HOH A . 
D 4 HOH 593 2193 2478 HOH HOH A . 
D 4 HOH 594 2194 2369 HOH HOH A . 
D 4 HOH 595 2195 2626 HOH HOH A . 
D 4 HOH 596 2196 2447 HOH HOH A . 
D 4 HOH 597 2197 2333 HOH HOH A . 
D 4 HOH 598 2198 2434 HOH HOH A . 
D 4 HOH 599 2199 2554 HOH HOH A . 
D 4 HOH 600 2200 2655 HOH HOH A . 
D 4 HOH 601 2201 2348 HOH HOH A . 
D 4 HOH 602 2202 2342 HOH HOH A . 
D 4 HOH 603 2203 2224 HOH HOH A . 
D 4 HOH 604 2204 2445 HOH HOH A . 
D 4 HOH 605 2205 2571 HOH HOH A . 
D 4 HOH 606 2206 2650 HOH HOH A . 
D 4 HOH 607 2207 2305 HOH HOH A . 
D 4 HOH 608 2208 2649 HOH HOH A . 
D 4 HOH 609 2209 2598 HOH HOH A . 
D 4 HOH 610 2210 2359 HOH HOH A . 
D 4 HOH 611 2211 2529 HOH HOH A . 
D 4 HOH 612 2212 2371 HOH HOH A . 
D 4 HOH 613 2213 2327 HOH HOH A . 
D 4 HOH 614 2214 2270 HOH HOH A . 
D 4 HOH 615 2215 2503 HOH HOH A . 
D 4 HOH 616 2216 2387 HOH HOH A . 
D 4 HOH 617 2217 2464 HOH HOH A . 
D 4 HOH 618 2218 2146 HOH HOH A . 
D 4 HOH 619 2219 2290 HOH HOH A . 
D 4 HOH 620 2220 2442 HOH HOH A . 
D 4 HOH 621 2221 2558 HOH HOH A . 
D 4 HOH 622 2222 2619 HOH HOH A . 
D 4 HOH 623 2223 2466 HOH HOH A . 
D 4 HOH 624 2224 2583 HOH HOH A . 
D 4 HOH 625 2225 2435 HOH HOH A . 
D 4 HOH 626 2226 2453 HOH HOH A . 
D 4 HOH 627 2227 2472 HOH HOH A . 
D 4 HOH 628 2228 2314 HOH HOH A . 
D 4 HOH 629 2229 2463 HOH HOH A . 
D 4 HOH 630 2230 2603 HOH HOH A . 
D 4 HOH 631 2231 2633 HOH HOH A . 
D 4 HOH 632 2232 2497 HOH HOH A . 
D 4 HOH 633 2233 2608 HOH HOH A . 
D 4 HOH 634 2234 2455 HOH HOH A . 
D 4 HOH 635 2235 2548 HOH HOH A . 
D 4 HOH 636 2236 2485 HOH HOH A . 
D 4 HOH 637 2237 2646 HOH HOH A . 
D 4 HOH 638 2238 2648 HOH HOH A . 
D 4 HOH 639 2239 2591 HOH HOH A . 
D 4 HOH 640 2240 2534 HOH HOH A . 
D 4 HOH 641 2241 2576 HOH HOH A . 
D 4 HOH 642 2242 2469 HOH HOH A . 
D 4 HOH 643 2243 2505 HOH HOH A . 
D 4 HOH 644 2244 2328 HOH HOH A . 
D 4 HOH 645 2245 2602 HOH HOH A . 
D 4 HOH 646 2246 2635 HOH HOH A . 
D 4 HOH 647 2247 2318 HOH HOH A . 
D 4 HOH 648 2248 2496 HOH HOH A . 
D 4 HOH 649 2249 2639 HOH HOH A . 
D 4 HOH 650 2250 2487 HOH HOH A . 
D 4 HOH 651 2251 2552 HOH HOH A . 
D 4 HOH 652 2252 2530 HOH HOH A . 
D 4 HOH 653 2253 2329 HOH HOH A . 
D 4 HOH 654 2254 2212 HOH HOH A . 
D 4 HOH 655 2255 2203 HOH HOH A . 
D 4 HOH 656 2256 2533 HOH HOH A . 
D 4 HOH 657 2257 2451 HOH HOH A . 
D 4 HOH 658 2258 2652 HOH HOH A . 
D 4 HOH 659 2259 2638 HOH HOH A . 
D 4 HOH 660 2260 2232 HOH HOH A . 
D 4 HOH 661 2261 2627 HOH HOH A . 
D 4 HOH 662 2262 2278 HOH HOH A . 
D 4 HOH 663 2263 2500 HOH HOH A . 
D 4 HOH 664 2264 2631 HOH HOH A . 
D 4 HOH 665 2265 2186 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0     ? 
1 MORE         0     ? 
1 'SSA (A^2)'  49640 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 159 ? A THR 205  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 OG  ? A SER 214 ? A SER 260  ? 1_555 87.6  ? 
2  OG1 ? A THR 159 ? A THR 205  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O2B ? B AOV .   ? A AOV 1500 ? 1_555 80.3  ? 
3  OG  ? A SER 214 ? A SER 260  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O2B ? B AOV .   ? A AOV 1500 ? 1_555 148.4 ? 
4  OG1 ? A THR 159 ? A THR 205  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O1G ? B AOV .   ? A AOV 1500 ? 1_555 143.7 ? 
5  OG  ? A SER 214 ? A SER 260  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O1G ? B AOV .   ? A AOV 1500 ? 1_555 83.6  ? 
6  O2B ? B AOV .   ? A AOV 1500 ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O1G ? B AOV .   ? A AOV 1500 ? 1_555 89.0  ? 
7  OG1 ? A THR 159 ? A THR 205  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1639 ? 1_555 69.7  ? 
8  OG  ? A SER 214 ? A SER 260  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1639 ? 1_555 71.3  ? 
9  O2B ? B AOV .   ? A AOV 1500 ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1639 ? 1_555 77.1  ? 
10 O1G ? B AOV .   ? A AOV 1500 ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1639 ? 1_555 74.1  ? 
11 OG1 ? A THR 159 ? A THR 205  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1609 ? 1_555 100.2 ? 
12 OG  ? A SER 214 ? A SER 260  ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1609 ? 1_555 108.6 ? 
13 O2B ? B AOV .   ? A AOV 1500 ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1609 ? 1_555 102.3 ? 
14 O1G ? B AOV .   ? A AOV 1500 ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1609 ? 1_555 116.0 ? 
15 O   ? D HOH .   ? A HOH 1639 ? 1_555 MG ? C MG . ? A MG 1501 ? 1_555 O   ? D HOH .   ? A HOH 1609 ? 1_555 169.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-09-13 
2 'Structure model' 1 1 2019-03-27 
3 'Structure model' 1 2 2019-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Source and taxonomy' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' citation_author    
3 2 'Structure model' pdbx_database_proc 
4 3 'Structure model' entity_src_gen     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                       
2  2 'Structure model' '_citation.journal_abbrev'                
3  2 'Structure model' '_citation.journal_id_CSD'                
4  2 'Structure model' '_citation.journal_id_ISSN'               
5  2 'Structure model' '_citation.journal_volume'                
6  2 'Structure model' '_citation.pdbx_database_id_DOI'          
7  2 'Structure model' '_citation.pdbx_database_id_PubMed'       
8  2 'Structure model' '_citation.title'                         
9  2 'Structure model' '_citation.year'                          
10 2 'Structure model' '_citation_author.identifier_ORCID'       
11 3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SADABS ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .      4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A TYR 995 ? ? CD A PRO 999  ? ? 2.12 
2 1 OD1 A ASN 146 ? ? C8 A AOV 1500 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     73 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    N 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ASP 
_pdbx_validate_symm_contact.auth_seq_id_2     387 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_544 
_pdbx_validate_symm_contact.dist              2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A GLY 333 ? ? N  A PRO 334 ? ? CA A PRO 334 ? ? 129.10 119.30 9.80   1.50 Y 
2 1 N A ASN 546 ? ? CA A ASN 546 ? ? C  A ASN 546 ? ? 92.25  111.00 -18.75 2.70 N 
3 1 C A ALA 884 ? ? N  A PRO 885 ? ? CD A PRO 885 ? ? 110.89 128.40 -17.51 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 152  ? ? -75.95  48.56   
2  1 ARG A 225  ? ? -156.99 54.16   
3  1 SER A 300  ? ? -77.43  -166.74 
4  1 ASN A 332  ? ? -108.86 45.21   
5  1 SER A 489  ? ? -107.72 -157.74 
6  1 ASN A 546  ? ? 53.47   -133.56 
7  1 ARG A 589  ? ? -129.89 -67.80  
8  1 ALA A 607  ? ? -83.38  36.94   
9  1 MET A 666  ? ? -140.34 16.72   
10 1 LYS A 755  ? ? 49.42   -126.84 
11 1 THR A 851  ? ? -133.52 -56.71  
12 1 LEU A 874  ? ? -65.45  94.68   
13 1 ASP A 953  ? ? 84.33   -3.20   
14 1 GLN A 989  ? ? -114.73 -84.24  
15 1 LYS A 1024 ? ? 58.83   -124.03 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2244 ? 6.05  . 
2  1 O ? A HOH 2245 ? 6.07  . 
3  1 O ? A HOH 2246 ? 6.20  . 
4  1 O ? A HOH 2247 ? 6.24  . 
5  1 O ? A HOH 2248 ? 6.31  . 
6  1 O ? A HOH 2249 ? 6.37  . 
7  1 O ? A HOH 2250 ? 6.80  . 
8  1 O ? A HOH 2251 ? 6.94  . 
9  1 O ? A HOH 2252 ? 6.98  . 
10 1 O ? A HOH 2253 ? 7.08  . 
11 1 O ? A HOH 2254 ? 7.10  . 
12 1 O ? A HOH 2255 ? 7.11  . 
13 1 O ? A HOH 2256 ? 7.35  . 
14 1 O ? A HOH 2257 ? 7.44  . 
15 1 O ? A HOH 2258 ? 7.44  . 
16 1 O ? A HOH 2259 ? 7.46  . 
17 1 O ? A HOH 2260 ? 7.47  . 
18 1 O ? A HOH 2261 ? 8.09  . 
19 1 O ? A HOH 2262 ? 9.11  . 
20 1 O ? A HOH 2263 ? 9.50  . 
21 1 O ? A HOH 2264 ? 13.92 . 
22 1 O ? A HOH 2265 ? 16.39 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLN 47  ? A GLN 1   
2  1 Y 1 A VAL 48  ? A VAL 2   
3  1 Y 1 A GLU 648 ? A GLU 602 
4  1 Y 1 A GLN 649 ? A GLN 603 
5  1 Y 1 A VAL 650 ? A VAL 604 
6  1 Y 1 A SER 651 ? A SER 605 
7  1 Y 1 A SER 652 ? A SER 606 
8  1 Y 1 A LEU 653 ? A LEU 607 
9  1 Y 1 A GLY 654 ? A GLY 608 
10 1 Y 1 A ASP 655 ? A ASP 609 
11 1 Y 1 A GLY 656 ? A GLY 610 
12 1 Y 1 A PRO 657 ? A PRO 611 
13 1 Y 1 A PRO 658 ? A PRO 612 
14 1 Y 1 A GLY 659 ? A GLY 613 
15 1 Y 1 A GLY 660 ? A GLY 614 
16 1 Y 1 A ARG 661 ? A ARG 615 
17 1 Y 1 A PRO 662 ? A PRO 616 
18 1 Y 1 A LEU 876 ? A LEU 830 
19 1 Y 1 A ILE 877 ? A ILE 831 
20 1 Y 1 A LYS 878 ? A LYS 832 
21 1 Y 1 A ARG 879 ? A ARG 833 
# 
_pdbx_audit_support.funding_organization   'German Research Foundation' 
_pdbx_audit_support.country                Germany 
_pdbx_audit_support.grant_number           'MA 1081/21-1' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ADP ORTHOVANADATE' AOV 
3 'MAGNESIUM ION'     MG  
4 water               HOH 
#