data_5I73
# 
_entry.id   5I73 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I73         
WWPDB D_1000218380 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5I75 unspecified 
PDB . 5I74 unspecified 
PDB . 5I71 unspecified 
PDB . 5I6Z unspecified 
PDB . 5I6X unspecified 
PDB . 5I66 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I73 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coleman, J.A.' 1 
'Green, E.M.'   2 
'Gouaux, E.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            532 
_citation.language                  ? 
_citation.page_first                334 
_citation.page_last                 339 
_citation.title                     'X-ray structures and mechanism of the human serotonin transporter.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature17629 
_citation.pdbx_database_id_PubMed   27049939 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Coleman, J.A.' 1 ? 
primary 'Green, E.M.'   2 ? 
primary 'Gouaux, E.'    3 ? 
# 
_cell.entry_id           5I73 
_cell.length_a           129.850 
_cell.length_b           163.210 
_cell.length_c           140.470 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I73 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Sodium-dependent serotonin transporter'                                                      61689.766 1 ? ? ? 
? 
2  polymer     man '8B6 antibody, heavy chain'                                                                   23688.365 1 ? ? ? 
? 
3  polymer     man '8B6 antibody, light chain'                                                                   23718.217 1 ? ? ? 
? 
4  non-polymer syn '(1S)-1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile' 324.392   2 ? ? ? 
? 
5  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                      221.208   2 ? ? ? 
? 
6  non-polymer syn CHOLESTEROL                                                                                   386.654   1 ? ? ? 
? 
7  non-polymer syn TETRADECANE                                                                                   198.388   1 ? ? ? 
? 
8  non-polymer syn 'SODIUM ION'                                                                                  22.990    2 ? ? ? 
? 
9  non-polymer syn '6-AMINOHEXANOIC ACID'                                                                        131.173   1 ? ? ? 
? 
10 water       nat water                                                                                         18.015    1 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SERT,5HT transporter,5HTT,Solute carrier family 6 member 4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRK
ICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYT
RHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNED
VSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITC
FFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTLVPR
;
;GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRK
ICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYT
RHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNED
VSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITC
FFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTLVPR
;
A ? 
2 'polypeptide(L)' no no 
;EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAY
MELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTW
NSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
;
;EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAY
MELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTW
NSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
;
B ? 
3 'polypeptide(L)' no no 
;DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQA
EDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQA
EDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   GLY n 
1 5   GLU n 
1 6   ARG n 
1 7   GLU n 
1 8   THR n 
1 9   TRP n 
1 10  GLY n 
1 11  LYS n 
1 12  LYS n 
1 13  VAL n 
1 14  ASP n 
1 15  PHE n 
1 16  LEU n 
1 17  LEU n 
1 18  SER n 
1 19  VAL n 
1 20  ILE n 
1 21  GLY n 
1 22  TYR n 
1 23  ALA n 
1 24  VAL n 
1 25  ASP n 
1 26  LEU n 
1 27  GLY n 
1 28  ASN n 
1 29  VAL n 
1 30  TRP n 
1 31  ARG n 
1 32  PHE n 
1 33  PRO n 
1 34  TYR n 
1 35  ILE n 
1 36  CYS n 
1 37  ALA n 
1 38  GLN n 
1 39  ASN n 
1 40  GLY n 
1 41  GLY n 
1 42  GLY n 
1 43  ALA n 
1 44  PHE n 
1 45  LEU n 
1 46  LEU n 
1 47  PRO n 
1 48  TYR n 
1 49  THR n 
1 50  ILE n 
1 51  MET n 
1 52  ALA n 
1 53  ILE n 
1 54  PHE n 
1 55  GLY n 
1 56  GLY n 
1 57  ILE n 
1 58  PRO n 
1 59  LEU n 
1 60  PHE n 
1 61  TYR n 
1 62  MET n 
1 63  GLU n 
1 64  LEU n 
1 65  ALA n 
1 66  LEU n 
1 67  GLY n 
1 68  GLN n 
1 69  TYR n 
1 70  HIS n 
1 71  ARG n 
1 72  ASN n 
1 73  GLY n 
1 74  CYS n 
1 75  ILE n 
1 76  SER n 
1 77  ILE n 
1 78  TRP n 
1 79  ARG n 
1 80  LYS n 
1 81  ILE n 
1 82  CYS n 
1 83  PRO n 
1 84  ILE n 
1 85  PHE n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  GLY n 
1 90  TYR n 
1 91  ALA n 
1 92  ILE n 
1 93  CYS n 
1 94  ILE n 
1 95  ILE n 
1 96  ALA n 
1 97  PHE n 
1 98  TYR n 
1 99  ILE n 
1 100 ALA n 
1 101 SER n 
1 102 TYR n 
1 103 TYR n 
1 104 ASN n 
1 105 THR n 
1 106 ILE n 
1 107 MET n 
1 108 ALA n 
1 109 TRP n 
1 110 ALA n 
1 111 LEU n 
1 112 TYR n 
1 113 TYR n 
1 114 LEU n 
1 115 ILE n 
1 116 SER n 
1 117 SER n 
1 118 PHE n 
1 119 THR n 
1 120 ASP n 
1 121 GLN n 
1 122 LEU n 
1 123 PRO n 
1 124 TRP n 
1 125 THR n 
1 126 SER n 
1 127 CYS n 
1 128 LYS n 
1 129 ASN n 
1 130 SER n 
1 131 TRP n 
1 132 ASN n 
1 133 THR n 
1 134 GLY n 
1 135 ASN n 
1 136 CYS n 
1 137 THR n 
1 138 ASN n 
1 139 TYR n 
1 140 PHE n 
1 141 SER n 
1 142 GLU n 
1 143 ASP n 
1 144 ASN n 
1 145 ILE n 
1 146 THR n 
1 147 TRP n 
1 148 THR n 
1 149 LEU n 
1 150 HIS n 
1 151 SER n 
1 152 THR n 
1 153 SER n 
1 154 PRO n 
1 155 ALA n 
1 156 GLU n 
1 157 GLU n 
1 158 PHE n 
1 159 TYR n 
1 160 THR n 
1 161 ARG n 
1 162 HIS n 
1 163 VAL n 
1 164 LEU n 
1 165 GLN n 
1 166 ILE n 
1 167 HIS n 
1 168 ARG n 
1 169 SER n 
1 170 LYS n 
1 171 GLY n 
1 172 LEU n 
1 173 GLN n 
1 174 ASP n 
1 175 LEU n 
1 176 GLY n 
1 177 GLY n 
1 178 ILE n 
1 179 SER n 
1 180 TRP n 
1 181 GLN n 
1 182 LEU n 
1 183 ALA n 
1 184 LEU n 
1 185 CYS n 
1 186 ILE n 
1 187 MET n 
1 188 LEU n 
1 189 ILE n 
1 190 PHE n 
1 191 THR n 
1 192 VAL n 
1 193 ILE n 
1 194 TYR n 
1 195 PHE n 
1 196 SER n 
1 197 ILE n 
1 198 TRP n 
1 199 LYS n 
1 200 GLY n 
1 201 VAL n 
1 202 LYS n 
1 203 THR n 
1 204 SER n 
1 205 GLY n 
1 206 LYS n 
1 207 VAL n 
1 208 VAL n 
1 209 TRP n 
1 210 VAL n 
1 211 THR n 
1 212 ALA n 
1 213 THR n 
1 214 PHE n 
1 215 PRO n 
1 216 TYR n 
1 217 ILE n 
1 218 ALA n 
1 219 LEU n 
1 220 SER n 
1 221 VAL n 
1 222 LEU n 
1 223 LEU n 
1 224 VAL n 
1 225 ARG n 
1 226 GLY n 
1 227 ALA n 
1 228 THR n 
1 229 LEU n 
1 230 PRO n 
1 231 GLY n 
1 232 ALA n 
1 233 TRP n 
1 234 ARG n 
1 235 GLY n 
1 236 VAL n 
1 237 LEU n 
1 238 PHE n 
1 239 TYR n 
1 240 LEU n 
1 241 LYS n 
1 242 PRO n 
1 243 ASN n 
1 244 TRP n 
1 245 GLN n 
1 246 LYS n 
1 247 LEU n 
1 248 LEU n 
1 249 GLU n 
1 250 THR n 
1 251 GLY n 
1 252 VAL n 
1 253 TRP n 
1 254 ILE n 
1 255 ASP n 
1 256 ALA n 
1 257 ALA n 
1 258 ALA n 
1 259 GLN n 
1 260 ILE n 
1 261 PHE n 
1 262 PHE n 
1 263 SER n 
1 264 LEU n 
1 265 GLY n 
1 266 PRO n 
1 267 GLY n 
1 268 PHE n 
1 269 GLY n 
1 270 VAL n 
1 271 LEU n 
1 272 LEU n 
1 273 ALA n 
1 274 PHE n 
1 275 ALA n 
1 276 SER n 
1 277 TYR n 
1 278 ASN n 
1 279 LYS n 
1 280 PHE n 
1 281 ASN n 
1 282 ASN n 
1 283 ASN n 
1 284 CYS n 
1 285 TYR n 
1 286 GLN n 
1 287 ASP n 
1 288 ALA n 
1 289 LEU n 
1 290 VAL n 
1 291 THR n 
1 292 SER n 
1 293 VAL n 
1 294 VAL n 
1 295 ASN n 
1 296 CYS n 
1 297 MET n 
1 298 THR n 
1 299 SER n 
1 300 PHE n 
1 301 VAL n 
1 302 SER n 
1 303 GLY n 
1 304 PHE n 
1 305 VAL n 
1 306 ILE n 
1 307 PHE n 
1 308 THR n 
1 309 VAL n 
1 310 LEU n 
1 311 GLY n 
1 312 TYR n 
1 313 MET n 
1 314 ALA n 
1 315 GLU n 
1 316 MET n 
1 317 ARG n 
1 318 ASN n 
1 319 GLU n 
1 320 ASP n 
1 321 VAL n 
1 322 SER n 
1 323 GLU n 
1 324 VAL n 
1 325 ALA n 
1 326 LYS n 
1 327 ASP n 
1 328 ALA n 
1 329 GLY n 
1 330 PRO n 
1 331 SER n 
1 332 LEU n 
1 333 LEU n 
1 334 PHE n 
1 335 ILE n 
1 336 THR n 
1 337 TYR n 
1 338 ALA n 
1 339 GLU n 
1 340 ALA n 
1 341 ILE n 
1 342 ALA n 
1 343 ASN n 
1 344 MET n 
1 345 PRO n 
1 346 ALA n 
1 347 SER n 
1 348 THR n 
1 349 PHE n 
1 350 PHE n 
1 351 ALA n 
1 352 ILE n 
1 353 ILE n 
1 354 PHE n 
1 355 PHE n 
1 356 LEU n 
1 357 MET n 
1 358 LEU n 
1 359 ILE n 
1 360 THR n 
1 361 LEU n 
1 362 GLY n 
1 363 LEU n 
1 364 ASP n 
1 365 SER n 
1 366 SER n 
1 367 PHE n 
1 368 ALA n 
1 369 GLY n 
1 370 LEU n 
1 371 GLU n 
1 372 GLY n 
1 373 VAL n 
1 374 ILE n 
1 375 THR n 
1 376 ALA n 
1 377 VAL n 
1 378 LEU n 
1 379 ASP n 
1 380 GLU n 
1 381 PHE n 
1 382 PRO n 
1 383 HIS n 
1 384 VAL n 
1 385 TRP n 
1 386 ALA n 
1 387 LYS n 
1 388 ARG n 
1 389 ARG n 
1 390 GLU n 
1 391 ARG n 
1 392 PHE n 
1 393 VAL n 
1 394 LEU n 
1 395 ALA n 
1 396 VAL n 
1 397 VAL n 
1 398 ILE n 
1 399 THR n 
1 400 CYS n 
1 401 PHE n 
1 402 PHE n 
1 403 GLY n 
1 404 SER n 
1 405 LEU n 
1 406 VAL n 
1 407 THR n 
1 408 LEU n 
1 409 THR n 
1 410 PHE n 
1 411 GLY n 
1 412 GLY n 
1 413 ALA n 
1 414 TYR n 
1 415 VAL n 
1 416 VAL n 
1 417 LYS n 
1 418 LEU n 
1 419 LEU n 
1 420 GLU n 
1 421 GLU n 
1 422 TYR n 
1 423 ALA n 
1 424 THR n 
1 425 GLY n 
1 426 PRO n 
1 427 ALA n 
1 428 VAL n 
1 429 LEU n 
1 430 THR n 
1 431 VAL n 
1 432 ALA n 
1 433 LEU n 
1 434 ILE n 
1 435 GLU n 
1 436 ALA n 
1 437 VAL n 
1 438 ALA n 
1 439 VAL n 
1 440 SER n 
1 441 TRP n 
1 442 PHE n 
1 443 TYR n 
1 444 GLY n 
1 445 ILE n 
1 446 THR n 
1 447 GLN n 
1 448 PHE n 
1 449 CYS n 
1 450 ARG n 
1 451 ASP n 
1 452 VAL n 
1 453 LYS n 
1 454 GLU n 
1 455 MET n 
1 456 LEU n 
1 457 GLY n 
1 458 PHE n 
1 459 SER n 
1 460 PRO n 
1 461 GLY n 
1 462 TRP n 
1 463 PHE n 
1 464 TRP n 
1 465 ARG n 
1 466 ILE n 
1 467 CYS n 
1 468 TRP n 
1 469 VAL n 
1 470 ALA n 
1 471 ILE n 
1 472 SER n 
1 473 PRO n 
1 474 LEU n 
1 475 PHE n 
1 476 LEU n 
1 477 LEU n 
1 478 PHE n 
1 479 ILE n 
1 480 ILE n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 LEU n 
1 485 MET n 
1 486 SER n 
1 487 PRO n 
1 488 PRO n 
1 489 GLN n 
1 490 LEU n 
1 491 ARG n 
1 492 LEU n 
1 493 PHE n 
1 494 GLN n 
1 495 TYR n 
1 496 ASN n 
1 497 TYR n 
1 498 PRO n 
1 499 TYR n 
1 500 TRP n 
1 501 SER n 
1 502 ILE n 
1 503 ILE n 
1 504 LEU n 
1 505 GLY n 
1 506 TYR n 
1 507 ALA n 
1 508 ILE n 
1 509 GLY n 
1 510 THR n 
1 511 SER n 
1 512 SER n 
1 513 PHE n 
1 514 ILE n 
1 515 CYS n 
1 516 ILE n 
1 517 PRO n 
1 518 THR n 
1 519 TYR n 
1 520 ILE n 
1 521 ALA n 
1 522 TYR n 
1 523 ARG n 
1 524 LEU n 
1 525 ILE n 
1 526 ILE n 
1 527 THR n 
1 528 PRO n 
1 529 GLY n 
1 530 THR n 
1 531 PHE n 
1 532 LYS n 
1 533 GLU n 
1 534 ARG n 
1 535 ILE n 
1 536 ILE n 
1 537 LYS n 
1 538 SER n 
1 539 ILE n 
1 540 THR n 
1 541 PRO n 
1 542 GLU n 
1 543 THR n 
1 544 PRO n 
1 545 THR n 
1 546 LEU n 
1 547 VAL n 
1 548 PRO n 
1 549 ARG n 
2 1   GLU n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  TYR n 
2 34  MET n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  SER n 
2 41  HIS n 
2 42  GLY n 
2 43  LYS n 
2 44  SER n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  ASN n 
2 51  ILE n 
2 52  ASN n 
2 53  PRO n 
2 54  ASN n 
2 55  ASN n 
2 56  GLY n 
2 57  GLY n 
2 58  THR n 
2 59  SER n 
2 60  TYR n 
2 61  ASN n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  VAL n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  THR n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  ARG n 
2 85  SER n 
2 86  LEU n 
2 87  THR n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  THR n 
2 98  ARG n 
2 99  SER n 
2 100 PRO n 
2 101 VAL n 
2 102 ARG n 
2 103 PRO n 
2 104 TYR n 
2 105 TYR n 
2 106 PHE n 
2 107 ASP n 
2 108 TYR n 
2 109 TRP n 
2 110 GLY n 
2 111 GLN n 
2 112 GLY n 
2 113 THR n 
2 114 THR n 
2 115 LEU n 
2 116 THR n 
2 117 VAL n 
2 118 SER n 
2 119 SER n 
2 120 ALA n 
2 121 LYS n 
2 122 THR n 
2 123 THR n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 VAL n 
2 128 TYR n 
2 129 PRO n 
2 130 LEU n 
2 131 ALA n 
2 132 PRO n 
2 133 GLY n 
2 134 CYS n 
2 135 GLY n 
2 136 ASP n 
2 137 THR n 
2 138 THR n 
2 139 GLY n 
2 140 SER n 
2 141 SER n 
2 142 VAL n 
2 143 THR n 
2 144 LEU n 
2 145 GLY n 
2 146 CYS n 
2 147 LEU n 
2 148 VAL n 
2 149 LYS n 
2 150 GLY n 
2 151 TYR n 
2 152 PHE n 
2 153 PRO n 
2 154 GLU n 
2 155 SER n 
2 156 VAL n 
2 157 THR n 
2 158 VAL n 
2 159 THR n 
2 160 TRP n 
2 161 ASN n 
2 162 SER n 
2 163 GLY n 
2 164 SER n 
2 165 LEU n 
2 166 SER n 
2 167 SER n 
2 168 SER n 
2 169 VAL n 
2 170 HIS n 
2 171 THR n 
2 172 PHE n 
2 173 PRO n 
2 174 ALA n 
2 175 LEU n 
2 176 LEU n 
2 177 GLN n 
2 178 SER n 
2 179 GLY n 
2 180 LEU n 
2 181 TYR n 
2 182 THR n 
2 183 MET n 
2 184 SER n 
2 185 SER n 
2 186 SER n 
2 187 VAL n 
2 188 THR n 
2 189 VAL n 
2 190 PRO n 
2 191 SER n 
2 192 SER n 
2 193 THR n 
2 194 TRP n 
2 195 PRO n 
2 196 SER n 
2 197 GLN n 
2 198 THR n 
2 199 VAL n 
2 200 THR n 
2 201 CYS n 
2 202 SER n 
2 203 VAL n 
2 204 ALA n 
2 205 HIS n 
2 206 PRO n 
2 207 ALA n 
2 208 SER n 
2 209 SER n 
2 210 THR n 
2 211 THR n 
2 212 VAL n 
2 213 ASP n 
2 214 LYS n 
2 215 LYS n 
2 216 LEU n 
2 217 GLU n 
2 218 PRO n 
2 219 SER n 
2 220 GLY n 
2 221 PRO n 
3 1   ASP n 
3 2   ILE n 
3 3   VAL n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   HIS n 
3 9   LYS n 
3 10  PHE n 
3 11  MET n 
3 12  SER n 
3 13  THR n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  ASP n 
3 18  ARG n 
3 19  VAL n 
3 20  SER n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  LYS n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  ASP n 
3 29  VAL n 
3 30  SER n 
3 31  THR n 
3 32  ALA n 
3 33  VAL n 
3 34  ALA n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  PRO n 
3 41  GLY n 
3 42  GLN n 
3 43  SER n 
3 44  PRO n 
3 45  LYS n 
3 46  LEU n 
3 47  LEU n 
3 48  ILE n 
3 49  TYR n 
3 50  SER n 
3 51  ALA n 
3 52  SER n 
3 53  TYR n 
3 54  ARG n 
3 55  TYR n 
3 56  THR n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  ASP n 
3 61  ARG n 
3 62  PHE n 
3 63  THR n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  ASP n 
3 71  PHE n 
3 72  THR n 
3 73  PHE n 
3 74  THR n 
3 75  ILE n 
3 76  SER n 
3 77  SER n 
3 78  VAL n 
3 79  GLN n 
3 80  ALA n 
3 81  GLU n 
3 82  ASP n 
3 83  LEU n 
3 84  ALA n 
3 85  VAL n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  HIS n 
3 92  TYR n 
3 93  SER n 
3 94  ILE n 
3 95  PRO n 
3 96  ARG n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLY n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 LEU n 
3 105 GLU n 
3 106 ILE n 
3 107 LYS n 
3 108 ARG n 
3 109 ALA n 
3 110 ASP n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 THR n 
3 115 VAL n 
3 116 SER n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 SER n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 THR n 
3 127 SER n 
3 128 GLY n 
3 129 GLY n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 PHE n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 LYS n 
3 143 ASP n 
3 144 ILE n 
3 145 ASN n 
3 146 VAL n 
3 147 LYS n 
3 148 TRP n 
3 149 LYS n 
3 150 ILE n 
3 151 ASP n 
3 152 GLY n 
3 153 SER n 
3 154 GLU n 
3 155 ARG n 
3 156 GLN n 
3 157 ASN n 
3 158 GLY n 
3 159 VAL n 
3 160 LEU n 
3 161 ASN n 
3 162 SER n 
3 163 TRP n 
3 164 THR n 
3 165 ASP n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 MET n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 THR n 
3 183 LYS n 
3 184 ASP n 
3 185 GLU n 
3 186 TYR n 
3 187 GLU n 
3 188 ARG n 
3 189 HIS n 
3 190 ASN n 
3 191 SER n 
3 192 TYR n 
3 193 THR n 
3 194 CYS n 
3 195 GLU n 
3 196 ALA n 
3 197 THR n 
3 198 HIS n 
3 199 LYS n 
3 200 THR n 
3 201 SER n 
3 202 THR n 
3 203 SER n 
3 204 PRO n 
3 205 ILE n 
3 206 VAL n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 ASN n 
3 213 GLU n 
3 214 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 549 Human ? 'SLC6A4, HTT, SERT' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Homo sapiens' 
9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 221 ?     ? ?                   ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 214 ?     ? ?                   ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SC6A4_HUMAN P31645 ? 1 
;QGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKIC
PIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRH
VLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKP
NWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVS
EVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFF
GSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICS
FLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPT
;
76 
2 PDB 5I73        5I73   ? 2 ? 1  
3 PDB 5I73        5I73   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5I73 A 3 ? 545 ? P31645 76 ? 618 ? 76 618 
2 2 5I73 B 1 ? 221 ? 5I73   20 ? 240 ? 20 240 
3 3 5I73 C 1 ? 214 ? 5I73   21 ? 234 ? 21 234 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I6Z GLY A 1   ? UNP P31645 ?   ?   'cloning artifact'    74  1  
1 5I6Z SER A 2   ? UNP P31645 ?   ?   'cloning artifact'    75  2  
1 5I6Z ALA A 218 ? UNP P31645 ILE 291 'engineered mutation' 291 3  
1 5I6Z SER A 366 ? UNP P31645 THR 439 'engineered mutation' 439 4  
1 5I6Z ALA A 481 ? UNP P31645 CYS 554 'engineered mutation' 554 5  
1 5I6Z ALA A 507 ? UNP P31645 CYS 580 'engineered mutation' 580 6  
1 5I6Z LEU A 546 ? UNP P31645 ?   ?   'cloning artifact'    619 7  
1 5I6Z VAL A 547 ? UNP P31645 ?   ?   'cloning artifact'    620 8  
1 5I6Z PRO A 548 ? UNP P31645 ?   ?   'cloning artifact'    621 9  
1 5I6Z ARG A 549 ? UNP P31645 ?   ?   'cloning artifact'    622 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
68P non-polymer                  . '(1S)-1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile' ? 
'C20 H21 F N2 O' 324.392 
ACA 'peptide linking'            . '6-AMINOHEXANOIC ACID'                                                                        
'AMINOCAPROIC ACID' 'C6 H13 N O2'    131.173 
ALA 'L-peptide linking'          y ALANINE                                                                                       ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                      ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                    ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                               ? 
'C4 H7 N O4'     133.103 
C14 non-polymer                  . TETRADECANE                                                                                   ? 
'C14 H30'        198.388 
CLR non-polymer                  . CHOLESTEROL                                                                                   ? 
'C27 H46 O'      386.654 
CYS 'L-peptide linking'          y CYSTEINE                                                                                      ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                     ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                               ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                       ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                                     ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                         ? 
'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                    ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                       ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                        ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                    ? 
'C5 H11 N O2 S'  149.211 
NA  non-polymer                  . 'SODIUM ION'                                                                                  ? 
'Na 1'           22.990  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                      ? 
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                 ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                       ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                        ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                                     ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                    ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                      ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                        ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I73 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.37 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris pH 8.5, 25-125 mM KCl, 32.5-34% PEG 400' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-08-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.978 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5I73 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.180 
_reflns.d_resolution_high            3.240 
_reflns.number_obs                   47403 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.07892 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.3200 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.50 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I73 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     45145 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.400 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.18 
_refine.ls_d_res_high                            3.24 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2258 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.570 
_refine.pdbx_overall_phase_error                 31.890 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7503 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         129 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               7633 
_refine_hist.d_res_high                       3.24 
_refine_hist.d_res_low                        50.18 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.033  ? ? 8197  'X-RAY DIFFRACTION' ? 
f_angle_d          0.814  ? ? 10736 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 10.993 ? ? 2703  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.283  ? ? 1210  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1318  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.2386 3.3090  2186 0.3812 81.00  0.3999 . . 112 . . . . 
'X-RAY DIFFRACTION' . 3.3090 3.3859  2716 0.3663 99.00  0.3688 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.3859 3.4706  2726 0.3483 99.00  0.3722 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.4706 3.5644  2685 0.3376 99.00  0.3803 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.5644 3.6693  2691 0.3043 99.00  0.3498 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.6693 3.7877  2719 0.2747 100.00 0.2889 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.7877 3.9230  2691 0.2460 100.00 0.2597 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.9230 4.0800  2735 0.2435 99.00  0.2820 . . 145 . . . . 
'X-RAY DIFFRACTION' . 4.0800 4.2656  2697 0.2182 100.00 0.3512 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.2656 4.4903  2742 0.1925 100.00 0.2453 . . 140 . . . . 
'X-RAY DIFFRACTION' . 4.4903 4.7715  2705 0.1815 100.00 0.2618 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.7715 5.1395  2708 0.1905 100.00 0.2227 . . 143 . . . . 
'X-RAY DIFFRACTION' . 5.1395 5.6561  2735 0.2041 100.00 0.2596 . . 139 . . . . 
'X-RAY DIFFRACTION' . 5.6561 6.4731  2732 0.2336 100.00 0.3454 . . 139 . . . . 
'X-RAY DIFFRACTION' . 6.4731 8.1498  2711 0.2368 100.00 0.2626 . . 146 . . . . 
'X-RAY DIFFRACTION' . 8.1498 50.1833 2708 0.2198 99.00  0.2369 . . 143 . . . . 
# 
_struct.entry_id                     5I73 
_struct.title                        
'X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central and allosteric sites' 
_struct.pdbx_descriptor              'Sodium-dependent serotonin transporter, Heavy chain, Light chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I73 
_struct_keywords.text            'Membrane protein' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 4  ? 
I N N 5  ? 
J N N 8  ? 
K N N 8  ? 
L N N 9  ? 
M N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 11  ? VAL A 24  ? LYS A 84  VAL A 97  1 ? 14 
HELX_P HELX_P2  AA2 ASP A 25  ? ASN A 39  ? ASP A 98  ASN A 112 1 ? 15 
HELX_P HELX_P3  AA3 GLY A 40  ? ALA A 43  ? GLY A 113 ALA A 116 5 ? 4  
HELX_P HELX_P4  AA4 PHE A 44  ? PHE A 54  ? PHE A 117 PHE A 127 1 ? 11 
HELX_P HELX_P5  AA5 GLY A 56  ? ARG A 71  ? GLY A 129 ARG A 144 1 ? 16 
HELX_P HELX_P6  AA6 ILE A 75  ? LYS A 80  ? ILE A 148 LYS A 153 1 ? 6  
HELX_P HELX_P7  AA7 CYS A 82  ? PHE A 85  ? CYS A 155 PHE A 158 5 ? 4  
HELX_P HELX_P8  AA8 LYS A 86  ? ALA A 100 ? LYS A 159 ALA A 173 1 ? 15 
HELX_P HELX_P9  AA9 TYR A 102 ? SER A 116 ? TYR A 175 SER A 189 1 ? 15 
HELX_P HELX_P10 AB1 LEU A 122 ? SER A 126 ? LEU A 195 SER A 199 5 ? 5  
HELX_P HELX_P11 AB2 SER A 153 ? HIS A 162 ? SER A 226 HIS A 235 1 ? 10 
HELX_P HELX_P12 AB3 GLN A 165 ? SER A 169 ? GLN A 238 SER A 242 5 ? 5  
HELX_P HELX_P13 AB4 SER A 179 ? ILE A 193 ? SER A 252 ILE A 266 1 ? 15 
HELX_P HELX_P14 AB5 ILE A 193 ? TRP A 198 ? ILE A 266 TRP A 271 1 ? 6  
HELX_P HELX_P15 AB6 VAL A 207 ? ALA A 212 ? VAL A 280 ALA A 285 1 ? 6  
HELX_P HELX_P16 AB7 THR A 213 ? LEU A 229 ? THR A 286 LEU A 302 1 ? 17 
HELX_P HELX_P17 AB8 ALA A 232 ? LYS A 241 ? ALA A 305 LYS A 314 1 ? 10 
HELX_P HELX_P18 AB9 ASN A 243 ? LEU A 248 ? ASN A 316 LEU A 321 5 ? 6  
HELX_P HELX_P19 AC1 GLU A 249 ? GLY A 265 ? GLU A 322 GLY A 338 1 ? 17 
HELX_P HELX_P20 AC2 GLY A 269 ? TYR A 277 ? GLY A 342 TYR A 350 1 ? 9  
HELX_P HELX_P21 AC3 CYS A 284 ? ARG A 317 ? CYS A 357 ARG A 390 1 ? 34 
HELX_P HELX_P22 AC4 ASP A 320 ? ALA A 325 ? ASP A 393 ALA A 398 1 ? 6  
HELX_P HELX_P23 AC5 PRO A 330 ? ILE A 335 ? PRO A 403 ILE A 408 1 ? 6  
HELX_P HELX_P24 AC6 ILE A 335 ? ASN A 343 ? ILE A 408 ASN A 416 1 ? 9  
HELX_P HELX_P25 AC7 ALA A 346 ? PHE A 381 ? ALA A 419 PHE A 454 1 ? 36 
HELX_P HELX_P26 AC8 ARG A 388 ? GLY A 403 ? ARG A 461 GLY A 476 1 ? 16 
HELX_P HELX_P27 AC9 GLY A 412 ? ALA A 423 ? GLY A 485 ALA A 496 1 ? 12 
HELX_P HELX_P28 AD1 ALA A 423 ? PHE A 442 ? ALA A 496 PHE A 515 1 ? 20 
HELX_P HELX_P29 AD2 GLY A 444 ? LEU A 456 ? GLY A 517 LEU A 529 1 ? 13 
HELX_P HELX_P30 AD3 GLY A 461 ? ALA A 470 ? GLY A 534 ALA A 543 1 ? 10 
HELX_P HELX_P31 AD4 ALA A 470 ? SER A 486 ? ALA A 543 SER A 559 1 ? 17 
HELX_P HELX_P32 AD5 TRP A 500 ? SER A 511 ? TRP A 573 SER A 584 1 ? 12 
HELX_P HELX_P33 AD6 ILE A 514 ? THR A 527 ? ILE A 587 THR A 600 1 ? 14 
HELX_P HELX_P34 AD7 THR A 530 ? THR A 540 ? THR A 603 THR A 613 1 ? 11 
HELX_P HELX_P35 AD8 THR B 28  ? TYR B 32  ? THR B 47  TYR B 51  5 ? 5  
HELX_P HELX_P36 AD9 THR B 87  ? SER B 91  ? THR B 106 SER B 110 5 ? 5  
HELX_P HELX_P37 AE1 SER B 162 ? SER B 164 ? SER B 181 SER B 183 5 ? 3  
HELX_P HELX_P38 AE2 GLN C 79  ? LEU C 83  ? GLN C 99  LEU C 103 5 ? 5  
HELX_P HELX_P39 AE3 SER C 121 ? GLY C 128 ? SER C 141 GLY C 148 1 ? 8  
HELX_P HELX_P40 AE4 LYS C 183 ? GLU C 187 ? LYS C 203 GLU C 207 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 127 SG  ? ? ? 1_555 A CYS 136 SG ? ? A CYS 200 A CYS 209  1_555 ? ? ? ? ? ? ? 2.104 ? ?               
disulf2  disulf ?   ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 41  B CYS 115  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf3  disulf ?   ? B CYS 134 SG  ? ? ? 1_555 C CYS 214 SG ? ? B CYS 153 C CYS 234  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4  disulf ?   ? B CYS 146 SG  ? ? ? 1_555 B CYS 201 SG ? ? B CYS 165 B CYS 220  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf5  disulf ?   ? C CYS 23  SG  ? ? ? 1_555 C CYS 88  SG ? ? C CYS 43  C CYS 108  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf6  disulf ?   ? C CYS 134 SG  ? ? ? 1_555 C CYS 194 SG ? ? C CYS 154 C CYS 214  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
covale1  covale one ? A ASN 135 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 208 A NAG 702  1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale2  covale one ? A ASN 144 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 217 A NAG 706  1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
metalc1  metalc ?   ? A GLY 21  O   ? ? ? 1_555 K NA  .   NA ? ? A GLY 94  A NA  708  1_555 ? ? ? ? ? ? ? 2.389 ? ?               
metalc2  metalc ?   ? A ALA 23  O   ? ? ? 1_555 J NA  .   NA ? ? A ALA 96  A NA  707  1_555 ? ? ? ? ? ? ? 2.458 ? ?               
metalc3  metalc ?   ? A VAL 24  O   ? ? ? 1_555 K NA  .   NA ? ? A VAL 97  A NA  708  1_555 ? ? ? ? ? ? ? 2.412 ? ?               
metalc4  metalc ?   ? A ASN 28  OD1 ? ? ? 1_555 J NA  .   NA ? ? A ASN 101 A NA  707  1_555 ? ? ? ? ? ? ? 2.422 ? ?               
metalc5  metalc ?   ? A SER 263 O   ? ? ? 1_555 J NA  .   NA ? ? A SER 336 A NA  707  1_555 ? ? ? ? ? ? ? 2.313 ? ?               
metalc6  metalc ?   ? A SER 263 OG  ? ? ? 1_555 J NA  .   NA ? ? A SER 336 A NA  707  1_555 ? ? ? ? ? ? ? 2.241 ? ?               
metalc7  metalc ?   ? A ASN 295 OD1 ? ? ? 1_555 J NA  .   NA ? ? A ASN 368 A NA  707  1_555 ? ? ? ? ? ? ? 2.754 ? ?               
metalc8  metalc ?   ? A LEU 361 O   ? ? ? 1_555 K NA  .   NA ? ? A LEU 434 A NA  708  1_555 ? ? ? ? ? ? ? 2.394 ? ?               
metalc9  metalc ?   ? A ASP 364 OD1 ? ? ? 1_555 K NA  .   NA ? ? A ASP 437 A NA  708  1_555 ? ? ? ? ? ? ? 2.368 ? ?               
metalc10 metalc ?   ? A SER 365 OG  ? ? ? 1_555 K NA  .   NA ? ? A SER 438 A NA  708  1_555 ? ? ? ? ? ? ? 2.450 ? ?               
metalc11 metalc ?   ? K NA  .   NA  ? ? ? 1_555 M HOH .   O  ? ? A NA  708 A HOH 1001 1_555 ? ? ? ? ? ? ? 2.389 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 176 A . ? GLY 249 A GLY 177 A ? GLY 250 A 1 13.56 
2 ARG 102 B . ? ARG 121 B PRO 103 B ? PRO 122 B 1 -1.49 
3 PHE 152 B . ? PHE 171 B PRO 153 B ? PRO 172 B 1 -2.43 
4 SER 164 B . ? SER 183 B LEU 165 B ? LEU 184 B 1 -0.23 
5 TRP 194 B . ? TRP 213 B PRO 195 B ? PRO 214 B 1 -2.81 
6 ILE 94  C . ? ILE 114 C PRO 95  C ? PRO 115 C 1 0.87  
7 TYR 140 C . ? TYR 160 C PRO 141 C ? PRO 161 C 1 1.48  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 6 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN B 3   ? GLN B 6   ? GLN B 22  GLN B 25  
AA1 2 VAL B 18  ? SER B 25  ? VAL B 37  SER B 44  
AA1 3 THR B 78  ? LEU B 83  ? THR B 97  LEU B 102 
AA1 4 ALA B 68  ? ASP B 73  ? ALA B 87  ASP B 92  
AA2 1 GLU B 10  ? VAL B 12  ? GLU B 29  VAL B 31  
AA2 2 THR B 113 ? VAL B 117 ? THR B 132 VAL B 136 
AA2 3 VAL B 93  ? SER B 99  ? VAL B 112 SER B 118 
AA2 4 TYR B 33  ? GLN B 39  ? TYR B 52  GLN B 58  
AA2 5 LEU B 45  ? ASN B 52  ? LEU B 64  ASN B 71  
AA2 6 GLY B 57  ? TYR B 60  ? GLY B 76  TYR B 79  
AA3 1 SER B 126 ? PRO B 129 ? SER B 145 PRO B 148 
AA3 2 SER B 141 ? TYR B 151 ? SER B 160 TYR B 170 
AA3 3 LEU B 180 ? PRO B 190 ? LEU B 199 PRO B 209 
AA3 4 VAL B 169 ? GLN B 177 ? VAL B 188 GLN B 196 
AA4 1 THR B 157 ? TRP B 160 ? THR B 176 TRP B 179 
AA4 2 THR B 200 ? HIS B 205 ? THR B 219 HIS B 224 
AA4 3 THR B 210 ? LYS B 215 ? THR B 229 LYS B 234 
AA5 1 PHE C 10  ? SER C 14  ? PHE C 30  SER C 34  
AA5 2 THR C 102 ? LYS C 107 ? THR C 122 LYS C 127 
AA5 3 VAL C 85  ? GLN C 90  ? VAL C 105 GLN C 110 
AA5 4 VAL C 33  ? GLN C 38  ? VAL C 53  GLN C 58  
AA5 5 LYS C 45  ? TYR C 49  ? LYS C 65  TYR C 69  
AA5 6 TYR C 53  ? ARG C 54  ? TYR C 73  ARG C 74  
AA6 1 VAL C 19  ? LYS C 24  ? VAL C 39  LYS C 44  
AA6 2 ASP C 70  ? ILE C 75  ? ASP C 90  ILE C 95  
AA6 3 PHE C 62  ? GLY C 66  ? PHE C 82  GLY C 86  
AA7 1 THR C 114 ? PHE C 118 ? THR C 134 PHE C 138 
AA7 2 GLY C 129 ? PHE C 139 ? GLY C 149 PHE C 159 
AA7 3 TYR C 173 ? THR C 182 ? TYR C 193 THR C 202 
AA7 4 VAL C 159 ? TRP C 163 ? VAL C 179 TRP C 183 
AA8 1 GLU C 154 ? ARG C 155 ? GLU C 174 ARG C 175 
AA8 2 ASN C 145 ? LYS C 149 ? ASN C 165 LYS C 169 
AA8 3 SER C 191 ? THR C 197 ? SER C 211 THR C 217 
AA8 4 ILE C 205 ? ASN C 210 ? ILE C 225 ASN C 230 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN B 5   ? N GLN B 24  O LYS B 23  ? O LYS B 42  
AA1 2 3 N ILE B 20  ? N ILE B 39  O MET B 81  ? O MET B 100 
AA1 3 4 O TYR B 80  ? O TYR B 99  N THR B 71  ? N THR B 90  
AA2 1 2 N GLU B 10  ? N GLU B 29  O THR B 116 ? O THR B 135 
AA2 2 3 O THR B 113 ? O THR B 132 N TYR B 94  ? N TYR B 113 
AA2 3 4 O VAL B 93  ? O VAL B 112 N GLN B 39  ? N GLN B 58  
AA2 4 5 N LYS B 38  ? N LYS B 57  O GLU B 46  ? O GLU B 65  
AA2 5 6 N ASN B 50  ? N ASN B 69  O SER B 59  ? O SER B 78  
AA3 1 2 N TYR B 128 ? N TYR B 147 O LEU B 147 ? O LEU B 166 
AA3 2 3 N TYR B 151 ? N TYR B 170 O TYR B 181 ? O TYR B 200 
AA3 3 4 O SER B 184 ? O SER B 203 N PHE B 172 ? N PHE B 191 
AA4 1 2 N THR B 159 ? N THR B 178 O SER B 202 ? O SER B 221 
AA4 2 3 N CYS B 201 ? N CYS B 220 O LYS B 214 ? O LYS B 233 
AA5 1 2 N THR C 13  ? N THR C 33  O LYS C 107 ? O LYS C 127 
AA5 2 3 O THR C 102 ? O THR C 122 N TYR C 86  ? N TYR C 106 
AA5 3 4 O VAL C 85  ? O VAL C 105 N GLN C 38  ? N GLN C 58  
AA5 4 5 N GLN C 37  ? N GLN C 57  O LYS C 45  ? O LYS C 65  
AA5 5 6 N TYR C 49  ? N TYR C 69  O TYR C 53  ? O TYR C 73  
AA6 1 2 N VAL C 19  ? N VAL C 39  O ILE C 75  ? O ILE C 95  
AA6 2 3 O THR C 74  ? O THR C 94  N THR C 63  ? N THR C 83  
AA7 1 2 N SER C 116 ? N SER C 136 O PHE C 135 ? O PHE C 155 
AA7 2 3 N CYS C 134 ? N CYS C 154 O SER C 177 ? O SER C 197 
AA7 3 4 O THR C 178 ? O THR C 198 N LEU C 160 ? N LEU C 180 
AA8 1 2 O ARG C 155 ? O ARG C 175 N TRP C 148 ? N TRP C 168 
AA8 2 3 N LYS C 147 ? N LYS C 167 O GLU C 195 ? O GLU C 215 
AA8 3 4 N CYS C 194 ? N CYS C 214 O LYS C 207 ? O LYS C 227 
# 
_atom_sites.entry_id                    5I73 
_atom_sites.fract_transf_matrix[1][1]   0.007701 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006127 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007119 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1  4   ? 4.497  192.262 -8.825  1.00 268.84 ? 77   GLY A N   1 
ATOM   2    C  CA  . GLY A 1  4   ? 4.975  192.459 -10.181 1.00 268.95 ? 77   GLY A CA  1 
ATOM   3    C  C   . GLY A 1  4   ? 6.478  192.367 -10.350 1.00 259.95 ? 77   GLY A C   1 
ATOM   4    O  O   . GLY A 1  4   ? 7.001  191.349 -10.804 1.00 260.94 ? 77   GLY A O   1 
ATOM   5    N  N   . GLU A 1  5   ? 7.176  193.437 -9.984  1.00 244.14 ? 78   GLU A N   1 
ATOM   6    C  CA  . GLU A 1  5   ? 8.617  193.520 -10.195 1.00 225.19 ? 78   GLU A CA  1 
ATOM   7    C  C   . GLU A 1  5   ? 9.387  193.602 -8.881  1.00 231.02 ? 78   GLU A C   1 
ATOM   8    O  O   . GLU A 1  5   ? 8.795  193.705 -7.806  1.00 229.73 ? 78   GLU A O   1 
ATOM   9    C  CB  . GLU A 1  5   ? 8.949  194.730 -11.069 1.00 217.03 ? 78   GLU A CB  1 
ATOM   10   C  CG  . GLU A 1  5   ? 8.418  196.045 -10.521 1.00 212.01 ? 78   GLU A CG  1 
ATOM   11   C  CD  . GLU A 1  5   ? 8.627  197.201 -11.476 1.00 222.73 ? 78   GLU A CD  1 
ATOM   12   O  OE1 . GLU A 1  5   ? 9.219  196.984 -12.554 1.00 237.07 ? 78   GLU A OE1 1 
ATOM   13   O  OE2 . GLU A 1  5   ? 8.197  198.328 -11.150 1.00 222.58 ? 78   GLU A OE2 1 
ATOM   14   N  N   . ARG A 1  6   ? 10.711 193.557 -8.981  1.00 239.25 ? 79   ARG A N   1 
ATOM   15   C  CA  . ARG A 1  6   ? 11.579 193.653 -7.814  1.00 235.79 ? 79   ARG A CA  1 
ATOM   16   C  C   . ARG A 1  6   ? 12.190 195.047 -7.709  1.00 242.20 ? 79   ARG A C   1 
ATOM   17   O  O   . ARG A 1  6   ? 11.843 195.945 -8.476  1.00 264.57 ? 79   ARG A O   1 
ATOM   18   C  CB  . ARG A 1  6   ? 12.682 192.595 -7.875  1.00 226.06 ? 79   ARG A CB  1 
ATOM   19   N  N   . GLU A 1  7   ? 13.102 195.221 -6.758  1.00 228.56 ? 80   GLU A N   1 
ATOM   20   C  CA  . GLU A 1  7   ? 13.741 196.514 -6.538  1.00 215.21 ? 80   GLU A CA  1 
ATOM   21   C  C   . GLU A 1  7   ? 15.038 196.644 -7.332  1.00 184.69 ? 80   GLU A C   1 
ATOM   22   O  O   . GLU A 1  7   ? 15.426 195.732 -8.062  1.00 184.43 ? 80   GLU A O   1 
ATOM   23   C  CB  . GLU A 1  7   ? 14.017 196.726 -5.046  1.00 206.24 ? 80   GLU A CB  1 
ATOM   24   C  CG  . GLU A 1  7   ? 12.763 196.833 -4.190  1.00 227.70 ? 80   GLU A CG  1 
ATOM   25   C  CD  . GLU A 1  7   ? 11.948 198.077 -4.495  1.00 244.30 ? 80   GLU A CD  1 
ATOM   26   O  OE1 . GLU A 1  7   ? 10.724 198.063 -4.247  1.00 244.39 ? 80   GLU A OE1 1 
ATOM   27   O  OE2 . GLU A 1  7   ? 12.532 199.072 -4.975  1.00 253.22 ? 80   GLU A OE2 1 
ATOM   28   N  N   . THR A 1  8   ? 15.701 197.787 -7.183  1.00 179.28 ? 81   THR A N   1 
ATOM   29   C  CA  . THR A 1  8   ? 16.957 198.049 -7.878  1.00 196.72 ? 81   THR A CA  1 
ATOM   30   C  C   . THR A 1  8   ? 17.945 198.766 -6.963  1.00 197.49 ? 81   THR A C   1 
ATOM   31   O  O   . THR A 1  8   ? 17.711 198.894 -5.761  1.00 179.63 ? 81   THR A O   1 
ATOM   32   C  CB  . THR A 1  8   ? 16.737 198.895 -9.147  1.00 200.54 ? 81   THR A CB  1 
ATOM   33   O  OG1 . THR A 1  8   ? 17.997 199.149 -9.780  1.00 217.27 ? 81   THR A OG1 1 
ATOM   34   C  CG2 . THR A 1  8   ? 16.073 200.219 -8.798  1.00 182.81 ? 81   THR A CG2 1 
ATOM   35   N  N   . TRP A 1  9   ? 19.050 199.231 -7.537  1.00 199.58 ? 82   TRP A N   1 
ATOM   36   C  CA  . TRP A 1  9   ? 20.069 199.941 -6.773  1.00 168.50 ? 82   TRP A CA  1 
ATOM   37   C  C   . TRP A 1  9   ? 19.763 201.433 -6.701  1.00 185.50 ? 82   TRP A C   1 
ATOM   38   O  O   . TRP A 1  9   ? 19.259 202.019 -7.659  1.00 190.02 ? 82   TRP A O   1 
ATOM   39   C  CB  . TRP A 1  9   ? 21.453 199.719 -7.387  1.00 164.15 ? 82   TRP A CB  1 
ATOM   40   N  N   . GLY A 1  10  ? 20.070 202.041 -5.560  1.00 188.53 ? 83   GLY A N   1 
ATOM   41   C  CA  . GLY A 1  10  ? 19.872 203.468 -5.382  1.00 183.79 ? 83   GLY A CA  1 
ATOM   42   C  C   . GLY A 1  10  ? 20.815 204.281 -6.245  1.00 194.63 ? 83   GLY A C   1 
ATOM   43   O  O   . GLY A 1  10  ? 20.495 205.397 -6.655  1.00 225.10 ? 83   GLY A O   1 
ATOM   44   N  N   . LYS A 1  11  ? 21.983 203.709 -6.522  1.00 177.46 ? 84   LYS A N   1 
ATOM   45   C  CA  . LYS A 1  11  ? 22.984 204.354 -7.362  1.00 177.83 ? 84   LYS A CA  1 
ATOM   46   C  C   . LYS A 1  11  ? 24.018 203.331 -7.826  1.00 202.41 ? 84   LYS A C   1 
ATOM   47   O  O   . LYS A 1  11  ? 24.272 202.340 -7.142  1.00 203.71 ? 84   LYS A O   1 
ATOM   48   C  CB  . LYS A 1  11  ? 23.659 205.506 -6.607  1.00 180.47 ? 84   LYS A CB  1 
ATOM   49   C  CG  . LYS A 1  11  ? 24.685 206.282 -7.421  1.00 181.60 ? 84   LYS A CG  1 
ATOM   50   C  CD  . LYS A 1  11  ? 24.964 207.645 -6.814  1.00 186.54 ? 84   LYS A CD  1 
ATOM   51   C  CE  . LYS A 1  11  ? 23.749 208.551 -6.926  1.00 218.71 ? 84   LYS A CE  1 
ATOM   52   N  NZ  . LYS A 1  11  ? 24.035 209.929 -6.439  1.00 222.45 ? 84   LYS A NZ  1 
ATOM   53   N  N   . LYS A 1  12  ? 24.625 203.553 -8.975  1.00 183.82 ? 85   LYS A N   1 
ATOM   54   C  CA  . LYS A 1  12  ? 25.457 202.509 -9.518  1.00 181.56 ? 85   LYS A CA  1 
ATOM   55   C  C   . LYS A 1  12  ? 26.529 202.236 -8.496  1.00 201.38 ? 85   LYS A C   1 
ATOM   56   O  O   . LYS A 1  12  ? 26.901 201.094 -8.261  1.00 225.06 ? 85   LYS A O   1 
ATOM   57   C  CB  . LYS A 1  12  ? 26.083 202.923 -10.840 1.00 186.26 ? 85   LYS A CB  1 
ATOM   58   C  CG  . LYS A 1  12  ? 26.987 201.855 -11.432 1.00 194.26 ? 85   LYS A CG  1 
ATOM   59   C  CD  . LYS A 1  12  ? 26.229 200.575 -11.750 1.00 196.92 ? 85   LYS A CD  1 
ATOM   60   C  CE  . LYS A 1  12  ? 27.106 199.580 -12.497 1.00 187.70 ? 85   LYS A CE  1 
ATOM   61   N  NZ  . LYS A 1  12  ? 26.466 198.242 -12.634 1.00 188.19 ? 85   LYS A NZ  1 
ATOM   62   N  N   . VAL A 1  13  ? 27.012 203.282 -7.852  1.00 195.59 ? 86   VAL A N   1 
ATOM   63   C  CA  . VAL A 1  13  ? 28.149 203.122 -6.978  1.00 166.50 ? 86   VAL A CA  1 
ATOM   64   C  C   . VAL A 1  13  ? 27.875 202.154 -5.846  1.00 156.74 ? 86   VAL A C   1 
ATOM   65   O  O   . VAL A 1  13  ? 28.718 201.320 -5.549  1.00 151.72 ? 86   VAL A O   1 
ATOM   66   C  CB  . VAL A 1  13  ? 28.566 204.477 -6.400  1.00 169.76 ? 86   VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1  13  ? 29.665 204.320 -5.366  1.00 161.27 ? 86   VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1  13  ? 29.029 205.384 -7.522  1.00 182.76 ? 86   VAL A CG2 1 
ATOM   69   N  N   . ASP A 1  14  ? 26.702 202.225 -5.238  1.00 169.44 ? 87   ASP A N   1 
ATOM   70   C  CA  . ASP A 1  14  ? 26.514 201.499 -3.999  1.00 182.09 ? 87   ASP A CA  1 
ATOM   71   C  C   . ASP A 1  14  ? 26.733 200.032 -4.241  1.00 176.88 ? 87   ASP A C   1 
ATOM   72   O  O   . ASP A 1  14  ? 27.479 199.381 -3.518  1.00 177.72 ? 87   ASP A O   1 
ATOM   73   C  CB  . ASP A 1  14  ? 25.093 201.691 -3.493  1.00 183.33 ? 87   ASP A CB  1 
ATOM   74   C  CG  . ASP A 1  14  ? 24.807 203.112 -3.102  1.00 176.71 ? 87   ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1  14  ? 25.699 203.969 -3.262  1.00 176.34 ? 87   ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1  14  ? 23.685 203.369 -2.628  1.00 173.82 ? 87   ASP A OD2 1 
ATOM   77   N  N   . PHE A 1  15  ? 26.129 199.513 -5.293  1.00 187.43 ? 88   PHE A N   1 
ATOM   78   C  CA  . PHE A 1  15  ? 26.396 198.148 -5.665  1.00 183.23 ? 88   PHE A CA  1 
ATOM   79   C  C   . PHE A 1  15  ? 27.817 198.033 -6.128  1.00 177.79 ? 88   PHE A C   1 
ATOM   80   O  O   . PHE A 1  15  ? 28.501 197.071 -5.813  1.00 198.78 ? 88   PHE A O   1 
ATOM   81   C  CB  . PHE A 1  15  ? 25.391 197.638 -6.681  1.00 188.84 ? 88   PHE A CB  1 
ATOM   82   C  CG  . PHE A 1  15  ? 24.136 197.103 -6.056  1.00 199.29 ? 88   PHE A CG  1 
ATOM   83   C  CD1 . PHE A 1  15  ? 23.787 197.446 -4.760  1.00 198.19 ? 88   PHE A CD1 1 
ATOM   84   C  CD2 . PHE A 1  15  ? 23.310 196.258 -6.757  1.00 202.20 ? 88   PHE A CD2 1 
ATOM   85   C  CE1 . PHE A 1  15  ? 22.643 196.956 -4.180  1.00 190.00 ? 88   PHE A CE1 1 
ATOM   86   C  CE2 . PHE A 1  15  ? 22.159 195.766 -6.185  1.00 205.32 ? 88   PHE A CE2 1 
ATOM   87   C  CZ  . PHE A 1  15  ? 21.825 196.114 -4.894  1.00 197.63 ? 88   PHE A CZ  1 
ATOM   88   N  N   . LEU A 1  16  ? 28.273 199.039 -6.850  1.00 153.73 ? 89   LEU A N   1 
ATOM   89   C  CA  . LEU A 1  16  ? 29.596 198.960 -7.400  1.00 166.69 ? 89   LEU A CA  1 
ATOM   90   C  C   . LEU A 1  16  ? 30.576 198.835 -6.256  1.00 149.29 ? 89   LEU A C   1 
ATOM   91   O  O   . LEU A 1  16  ? 31.441 197.976 -6.279  1.00 140.12 ? 89   LEU A O   1 
ATOM   92   C  CB  . LEU A 1  16  ? 29.894 200.225 -8.175  1.00 175.94 ? 89   LEU A CB  1 
ATOM   93   C  CG  . LEU A 1  16  ? 31.354 200.437 -8.536  1.00 165.90 ? 89   LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1  16  ? 31.656 199.649 -9.791  1.00 163.67 ? 89   LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1  16  ? 31.628 201.911 -8.765  1.00 152.68 ? 89   LEU A CD2 1 
ATOM   96   N  N   . LEU A 1  17  ? 30.430 199.661 -5.231  1.00 157.82 ? 90   LEU A N   1 
ATOM   97   C  CA  . LEU A 1  17  ? 31.269 199.506 -4.058  1.00 146.12 ? 90   LEU A CA  1 
ATOM   98   C  C   . LEU A 1  17  ? 30.921 198.220 -3.364  1.00 137.36 ? 90   LEU A C   1 
ATOM   99   O  O   . LEU A 1  17  ? 31.771 197.424 -3.007  1.00 151.30 ? 90   LEU A O   1 
ATOM   100  C  CB  . LEU A 1  17  ? 31.037 200.651 -3.091  1.00 143.66 ? 90   LEU A CB  1 
ATOM   101  C  CG  . LEU A 1  17  ? 31.859 201.892 -3.388  1.00 167.88 ? 90   LEU A CG  1 
ATOM   102  C  CD1 . LEU A 1  17  ? 31.418 202.495 -4.708  1.00 198.27 ? 90   LEU A CD1 1 
ATOM   103  C  CD2 . LEU A 1  17  ? 31.724 202.889 -2.254  1.00 150.42 ? 90   LEU A CD2 1 
ATOM   104  N  N   . SER A 1  18  ? 29.632 198.007 -3.228  1.00 142.81 ? 91   SER A N   1 
ATOM   105  C  CA  . SER A 1  18  ? 29.111 196.905 -2.429  1.00 141.24 ? 91   SER A CA  1 
ATOM   106  C  C   . SER A 1  18  ? 29.780 195.589 -2.816  1.00 145.66 ? 91   SER A C   1 
ATOM   107  O  O   . SER A 1  18  ? 30.113 194.775 -1.952  1.00 163.94 ? 91   SER A O   1 
ATOM   108  C  CB  . SER A 1  18  ? 27.593 196.795 -2.584  1.00 162.86 ? 91   SER A CB  1 
ATOM   109  O  OG  . SER A 1  18  ? 27.050 195.883 -1.647  1.00 179.24 ? 91   SER A OG  1 
ATOM   110  N  N   . VAL A 1  19  ? 29.980 195.385 -4.115  1.00 134.18 ? 92   VAL A N   1 
ATOM   111  C  CA  . VAL A 1  19  ? 30.638 194.173 -4.592  1.00 139.37 ? 92   VAL A CA  1 
ATOM   112  C  C   . VAL A 1  19  ? 32.117 194.194 -4.196  1.00 145.12 ? 92   VAL A C   1 
ATOM   113  O  O   . VAL A 1  19  ? 32.700 193.153 -3.879  1.00 123.92 ? 92   VAL A O   1 
ATOM   114  C  CB  . VAL A 1  19  ? 30.459 194.002 -6.120  1.00 125.05 ? 92   VAL A CB  1 
ATOM   115  C  CG1 . VAL A 1  19  ? 30.978 195.217 -6.870  1.00 128.15 ? 92   VAL A CG1 1 
ATOM   116  C  CG2 . VAL A 1  19  ? 31.144 192.732 -6.604  1.00 120.75 ? 92   VAL A CG2 1 
ATOM   117  N  N   . ILE A 1  20  ? 32.715 195.382 -4.196  1.00 166.67 ? 93   ILE A N   1 
ATOM   118  C  CA  . ILE A 1  20  ? 34.097 195.543 -3.759  1.00 122.30 ? 93   ILE A CA  1 
ATOM   119  C  C   . ILE A 1  20  ? 34.174 195.280 -2.262  1.00 134.66 ? 93   ILE A C   1 
ATOM   120  O  O   . ILE A 1  20  ? 35.115 194.650 -1.777  1.00 117.33 ? 93   ILE A O   1 
ATOM   121  C  CB  . ILE A 1  20  ? 34.642 196.941 -4.105  1.00 125.96 ? 93   ILE A CB  1 
ATOM   122  C  CG1 . ILE A 1  20  ? 34.678 197.139 -5.619  1.00 153.73 ? 93   ILE A CG1 1 
ATOM   123  C  CG2 . ILE A 1  20  ? 36.030 197.137 -3.516  1.00 124.41 ? 93   ILE A CG2 1 
ATOM   124  C  CD1 . ILE A 1  20  ? 35.222 198.485 -6.045  1.00 131.30 ? 93   ILE A CD1 1 
ATOM   125  N  N   . GLY A 1  21  ? 33.171 195.763 -1.535  1.00 147.35 ? 94   GLY A N   1 
ATOM   126  C  CA  . GLY A 1  21  ? 33.066 195.512 -0.111  1.00 160.38 ? 94   GLY A CA  1 
ATOM   127  C  C   . GLY A 1  21  ? 32.937 194.031 0.182   1.00 148.15 ? 94   GLY A C   1 
ATOM   128  O  O   . GLY A 1  21  ? 33.386 193.550 1.221   1.00 128.80 ? 94   GLY A O   1 
ATOM   129  N  N   . TYR A 1  22  ? 32.319 193.305 -0.744  1.00 149.02 ? 95   TYR A N   1 
ATOM   130  C  CA  . TYR A 1  22  ? 32.222 191.855 -0.640  1.00 113.57 ? 95   TYR A CA  1 
ATOM   131  C  C   . TYR A 1  22  ? 33.572 191.190 -0.881  1.00 131.19 ? 95   TYR A C   1 
ATOM   132  O  O   . TYR A 1  22  ? 33.987 190.314 -0.123  1.00 147.18 ? 95   TYR A O   1 
ATOM   133  C  CB  . TYR A 1  22  ? 31.196 191.312 -1.634  1.00 141.11 ? 95   TYR A CB  1 
ATOM   134  C  CG  . TYR A 1  22  ? 31.347 189.834 -1.923  1.00 110.53 ? 95   TYR A CG  1 
ATOM   135  C  CD1 . TYR A 1  22  ? 30.989 188.880 -0.979  1.00 108.56 ? 95   TYR A CD1 1 
ATOM   136  C  CD2 . TYR A 1  22  ? 31.844 189.393 -3.142  1.00 136.74 ? 95   TYR A CD2 1 
ATOM   137  C  CE1 . TYR A 1  22  ? 31.123 187.529 -1.242  1.00 105.50 ? 95   TYR A CE1 1 
ATOM   138  C  CE2 . TYR A 1  22  ? 31.984 188.044 -3.413  1.00 122.77 ? 95   TYR A CE2 1 
ATOM   139  C  CZ  . TYR A 1  22  ? 31.621 187.118 -2.460  1.00 104.39 ? 95   TYR A CZ  1 
ATOM   140  O  OH  . TYR A 1  22  ? 31.758 185.775 -2.727  1.00 101.70 ? 95   TYR A OH  1 
ATOM   141  N  N   . ALA A 1  23  ? 34.249 191.613 -1.944  1.00 119.07 ? 96   ALA A N   1 
ATOM   142  C  CA  . ALA A 1  23  ? 35.497 190.983 -2.363  1.00 129.54 ? 96   ALA A CA  1 
ATOM   143  C  C   . ALA A 1  23  ? 36.638 191.212 -1.372  1.00 141.17 ? 96   ALA A C   1 
ATOM   144  O  O   . ALA A 1  23  ? 37.387 190.290 -1.057  1.00 133.01 ? 96   ALA A O   1 
ATOM   145  C  CB  . ALA A 1  23  ? 35.895 191.483 -3.743  1.00 125.48 ? 96   ALA A CB  1 
ATOM   146  N  N   . VAL A 1  24  ? 36.772 192.442 -0.888  1.00 137.38 ? 97   VAL A N   1 
ATOM   147  C  CA  . VAL A 1  24  ? 37.868 192.793 0.008   1.00 122.78 ? 97   VAL A CA  1 
ATOM   148  C  C   . VAL A 1  24  ? 37.543 192.417 1.451   1.00 134.57 ? 97   VAL A C   1 
ATOM   149  O  O   . VAL A 1  24  ? 36.513 192.823 1.987   1.00 133.84 ? 97   VAL A O   1 
ATOM   150  C  CB  . VAL A 1  24  ? 38.203 194.292 -0.096  1.00 137.58 ? 97   VAL A CB  1 
ATOM   151  C  CG1 . VAL A 1  24  ? 39.332 194.653 0.855   1.00 143.13 ? 97   VAL A CG1 1 
ATOM   152  C  CG2 . VAL A 1  24  ? 38.565 194.658 -1.528  1.00 165.85 ? 97   VAL A CG2 1 
ATOM   153  N  N   . ASP A 1  25  ? 38.594 191.725 2.014   1.00 169.74 ? 98   ASP A N   1 
ATOM   154  C  CA  . ASP A 1  25  ? 38.443 191.198 3.364   1.00 167.19 ? 98   ASP A CA  1 
ATOM   155  C  C   . ASP A 1  25  ? 39.754 190.989 4.108   1.00 158.29 ? 98   ASP A C   1 
ATOM   156  O  O   . ASP A 1  25  ? 40.754 191.648 3.823   1.00 162.42 ? 98   ASP A O   1 
ATOM   157  C  CB  . ASP A 1  25  ? 37.732 189.844 3.338   1.00 179.82 ? 98   ASP A CB  1 
ATOM   158  C  CG  . ASP A 1  25  ? 38.544 188.771 2.635   1.00 190.16 ? 98   ASP A CG  1 
ATOM   159  O  OD1 . ASP A 1  25  ? 39.727 189.023 2.316   1.00 201.06 ? 98   ASP A OD1 1 
ATOM   160  O  OD2 . ASP A 1  25  ? 37.995 187.672 2.405   1.00 189.74 ? 98   ASP A OD2 1 
ATOM   161  N  N   . LEU A 1  26  ? 39.663 190.171 5.119   1.00 150.64 ? 99   LEU A N   1 
ATOM   162  C  CA  . LEU A 1  26  ? 40.862 189.958 5.922   1.00 132.21 ? 99   LEU A CA  1 
ATOM   163  C  C   . LEU A 1  26  ? 41.932 189.203 5.140   1.00 107.11 ? 99   LEU A C   1 
ATOM   164  O  O   . LEU A 1  26  ? 43.121 189.502 5.261   1.00 103.16 ? 99   LEU A O   1 
ATOM   165  C  CB  . LEU A 1  26  ? 40.514 189.199 7.203   1.00 120.99 ? 99   LEU A CB  1 
ATOM   166  C  CG  . LEU A 1  26  ? 39.495 189.881 8.120   1.00 151.89 ? 99   LEU A CG  1 
ATOM   167  C  CD1 . LEU A 1  26  ? 39.128 188.978 9.282   1.00 156.65 ? 99   LEU A CD1 1 
ATOM   168  C  CD2 . LEU A 1  26  ? 40.030 191.213 8.622   1.00 154.13 ? 99   LEU A CD2 1 
ATOM   169  N  N   . GLY A 1  27  ? 41.507 188.225 4.342   1.00 104.23 ? 100  GLY A N   1 
ATOM   170  C  CA  . GLY A 1  27  ? 42.426 187.444 3.529   1.00 112.47 ? 100  GLY A CA  1 
ATOM   171  C  C   . GLY A 1  27  ? 43.295 188.295 2.626   1.00 124.68 ? 100  GLY A C   1 
ATOM   172  O  O   . GLY A 1  27  ? 44.479 188.008 2.432   1.00 125.67 ? 100  GLY A O   1 
ATOM   173  N  N   . ASN A 1  28  ? 42.695 189.354 2.086   1.00 134.83 ? 101  ASN A N   1 
ATOM   174  C  CA  . ASN A 1  28  ? 43.398 190.323 1.253   1.00 127.37 ? 101  ASN A CA  1 
ATOM   175  C  C   . ASN A 1  28  ? 44.508 191.025 2.031   1.00 128.08 ? 101  ASN A C   1 
ATOM   176  O  O   . ASN A 1  28  ? 45.520 191.426 1.459   1.00 157.28 ? 101  ASN A O   1 
ATOM   177  C  CB  . ASN A 1  28  ? 42.421 191.367 0.701   1.00 146.12 ? 101  ASN A CB  1 
ATOM   178  C  CG  . ASN A 1  28  ? 41.656 190.874 -0.512  1.00 171.04 ? 101  ASN A CG  1 
ATOM   179  O  OD1 . ASN A 1  28  ? 40.609 190.241 -0.387  1.00 174.02 ? 101  ASN A OD1 1 
ATOM   180  N  ND2 . ASN A 1  28  ? 42.175 191.173 -1.698  1.00 189.40 ? 101  ASN A ND2 1 
ATOM   181  N  N   . VAL A 1  29  ? 44.305 191.170 3.338   1.00 139.92 ? 102  VAL A N   1 
ATOM   182  C  CA  . VAL A 1  29  ? 45.212 191.936 4.184   1.00 143.85 ? 102  VAL A CA  1 
ATOM   183  C  C   . VAL A 1  29  ? 46.423 191.125 4.632   1.00 150.11 ? 102  VAL A C   1 
ATOM   184  O  O   . VAL A 1  29  ? 47.557 191.573 4.482   1.00 164.55 ? 102  VAL A O   1 
ATOM   185  C  CB  . VAL A 1  29  ? 44.467 192.499 5.407   1.00 134.84 ? 102  VAL A CB  1 
ATOM   186  C  CG1 . VAL A 1  29  ? 45.406 193.319 6.275   1.00 137.83 ? 102  VAL A CG1 1 
ATOM   187  C  CG2 . VAL A 1  29  ? 43.281 193.337 4.957   1.00 174.50 ? 102  VAL A CG2 1 
ATOM   188  N  N   . TRP A 1  30  ? 46.193 189.935 5.180   1.00 122.22 ? 103  TRP A N   1 
ATOM   189  C  CA  . TRP A 1  30  ? 47.288 189.165 5.767   1.00 117.39 ? 103  TRP A CA  1 
ATOM   190  C  C   . TRP A 1  30  ? 47.639 187.900 4.989   1.00 137.88 ? 103  TRP A C   1 
ATOM   191  O  O   . TRP A 1  30  ? 48.771 187.422 5.062   1.00 171.21 ? 103  TRP A O   1 
ATOM   192  C  CB  . TRP A 1  30  ? 46.957 188.793 7.217   1.00 120.28 ? 103  TRP A CB  1 
ATOM   193  C  CG  . TRP A 1  30  ? 45.799 187.852 7.366   1.00 124.16 ? 103  TRP A CG  1 
ATOM   194  C  CD1 . TRP A 1  30  ? 44.496 188.187 7.588   1.00 151.49 ? 103  TRP A CD1 1 
ATOM   195  C  CD2 . TRP A 1  30  ? 45.841 186.420 7.312   1.00 113.07 ? 103  TRP A CD2 1 
ATOM   196  N  NE1 . TRP A 1  30  ? 43.723 187.054 7.671   1.00 146.99 ? 103  TRP A NE1 1 
ATOM   197  C  CE2 . TRP A 1  30  ? 44.525 185.956 7.505   1.00 113.65 ? 103  TRP A CE2 1 
ATOM   198  C  CE3 . TRP A 1  30  ? 46.863 185.487 7.118   1.00 127.76 ? 103  TRP A CE3 1 
ATOM   199  C  CZ2 . TRP A 1  30  ? 44.204 184.601 7.509   1.00 108.86 ? 103  TRP A CZ2 1 
ATOM   200  C  CZ3 . TRP A 1  30  ? 46.543 184.142 7.120   1.00 147.71 ? 103  TRP A CZ3 1 
ATOM   201  C  CH2 . TRP A 1  30  ? 45.225 183.711 7.315   1.00 137.06 ? 103  TRP A CH2 1 
ATOM   202  N  N   . ARG A 1  31  ? 46.679 187.358 4.245   1.00 119.41 ? 104  ARG A N   1 
ATOM   203  C  CA  . ARG A 1  31  ? 46.884 186.075 3.578   1.00 119.56 ? 104  ARG A CA  1 
ATOM   204  C  C   . ARG A 1  31  ? 47.773 186.215 2.345   1.00 112.62 ? 104  ARG A C   1 
ATOM   205  O  O   . ARG A 1  31  ? 48.732 185.464 2.173   1.00 137.44 ? 104  ARG A O   1 
ATOM   206  C  CB  . ARG A 1  31  ? 45.540 185.452 3.196   1.00 151.09 ? 104  ARG A CB  1 
ATOM   207  C  CG  . ARG A 1  31  ? 45.556 183.932 3.148   1.00 137.69 ? 104  ARG A CG  1 
ATOM   208  C  CD  . ARG A 1  31  ? 44.261 183.352 3.700   1.00 148.07 ? 104  ARG A CD  1 
ATOM   209  N  NE  . ARG A 1  31  ? 44.378 181.924 3.979   1.00 150.51 ? 104  ARG A NE  1 
ATOM   210  C  CZ  . ARG A 1  31  ? 43.433 181.197 4.568   1.00 156.80 ? 104  ARG A CZ  1 
ATOM   211  N  NH1 . ARG A 1  31  ? 43.628 179.903 4.783   1.00 179.19 ? 104  ARG A NH1 1 
ATOM   212  N  NH2 . ARG A 1  31  ? 42.295 181.764 4.944   1.00 153.21 ? 104  ARG A NH2 1 
ATOM   213  N  N   . PHE A 1  32  ? 47.447 187.180 1.491   1.00 99.10  ? 105  PHE A N   1 
ATOM   214  C  CA  . PHE A 1  32  ? 48.221 187.430 0.276   1.00 98.67  ? 105  PHE A CA  1 
ATOM   215  C  C   . PHE A 1  32  ? 49.694 187.804 0.526   1.00 106.82 ? 105  PHE A C   1 
ATOM   216  O  O   . PHE A 1  32  ? 50.569 187.320 -0.191  1.00 142.04 ? 105  PHE A O   1 
ATOM   217  C  CB  . PHE A 1  32  ? 47.548 188.522 -0.565  1.00 102.24 ? 105  PHE A CB  1 
ATOM   218  C  CG  . PHE A 1  32  ? 48.341 188.930 -1.774  1.00 98.12  ? 105  PHE A CG  1 
ATOM   219  C  CD1 . PHE A 1  32  ? 48.429 188.095 -2.875  1.00 116.08 ? 105  PHE A CD1 1 
ATOM   220  C  CD2 . PHE A 1  32  ? 48.997 190.149 -1.811  1.00 108.29 ? 105  PHE A CD2 1 
ATOM   221  C  CE1 . PHE A 1  32  ? 49.159 188.466 -3.989  1.00 126.61 ? 105  PHE A CE1 1 
ATOM   222  C  CE2 . PHE A 1  32  ? 49.727 190.527 -2.922  1.00 119.42 ? 105  PHE A CE2 1 
ATOM   223  C  CZ  . PHE A 1  32  ? 49.808 189.684 -4.012  1.00 131.98 ? 105  PHE A CZ  1 
ATOM   224  N  N   . PRO A 1  33  ? 49.980 188.671 1.522   1.00 113.11 ? 106  PRO A N   1 
ATOM   225  C  CA  . PRO A 1  33  ? 51.395 188.999 1.748   1.00 119.95 ? 106  PRO A CA  1 
ATOM   226  C  C   . PRO A 1  33  ? 52.271 187.805 2.126   1.00 113.01 ? 106  PRO A C   1 
ATOM   227  O  O   . PRO A 1  33  ? 53.404 187.706 1.653   1.00 131.06 ? 106  PRO A O   1 
ATOM   228  C  CB  . PRO A 1  33  ? 51.336 189.999 2.906   1.00 105.13 ? 106  PRO A CB  1 
ATOM   229  C  CG  . PRO A 1  33  ? 50.014 190.625 2.785   1.00 102.25 ? 106  PRO A CG  1 
ATOM   230  C  CD  . PRO A 1  33  ? 49.098 189.535 2.329   1.00 104.75 ? 106  PRO A CD  1 
ATOM   231  N  N   . TYR A 1  34  ? 51.753 186.916 2.967   1.00 91.50  ? 107  TYR A N   1 
ATOM   232  C  CA  . TYR A 1  34  ? 52.515 185.755 3.411   1.00 101.48 ? 107  TYR A CA  1 
ATOM   233  C  C   . TYR A 1  34  ? 52.785 184.790 2.261   1.00 125.53 ? 107  TYR A C   1 
ATOM   234  O  O   . TYR A 1  34  ? 53.938 184.458 1.971   1.00 146.60 ? 107  TYR A O   1 
ATOM   235  C  CB  . TYR A 1  34  ? 51.778 185.028 4.539   1.00 118.45 ? 107  TYR A CB  1 
ATOM   236  C  CG  . TYR A 1  34  ? 52.481 183.779 5.021   1.00 132.11 ? 107  TYR A CG  1 
ATOM   237  C  CD1 . TYR A 1  34  ? 53.487 183.851 5.975   1.00 181.95 ? 107  TYR A CD1 1 
ATOM   238  C  CD2 . TYR A 1  34  ? 52.140 182.528 4.521   1.00 142.79 ? 107  TYR A CD2 1 
ATOM   239  C  CE1 . TYR A 1  34  ? 54.134 182.713 6.418   1.00 198.55 ? 107  TYR A CE1 1 
ATOM   240  C  CE2 . TYR A 1  34  ? 52.783 181.385 4.956   1.00 166.21 ? 107  TYR A CE2 1 
ATOM   241  C  CZ  . TYR A 1  34  ? 53.778 181.484 5.906   1.00 192.19 ? 107  TYR A CZ  1 
ATOM   242  O  OH  . TYR A 1  34  ? 54.420 180.349 6.345   1.00 198.55 ? 107  TYR A OH  1 
ATOM   243  N  N   . ILE A 1  35  ? 51.713 184.344 1.612   1.00 116.68 ? 108  ILE A N   1 
ATOM   244  C  CA  . ILE A 1  35  ? 51.809 183.386 0.517   1.00 113.82 ? 108  ILE A CA  1 
ATOM   245  C  C   . ILE A 1  35  ? 52.602 183.989 -0.638  1.00 128.26 ? 108  ILE A C   1 
ATOM   246  O  O   . ILE A 1  35  ? 53.222 183.272 -1.421  1.00 144.23 ? 108  ILE A O   1 
ATOM   247  C  CB  . ILE A 1  35  ? 50.409 182.928 0.056   1.00 108.95 ? 108  ILE A CB  1 
ATOM   248  C  CG1 . ILE A 1  35  ? 50.515 181.751 -0.914  1.00 127.88 ? 108  ILE A CG1 1 
ATOM   249  C  CG2 . ILE A 1  35  ? 49.646 184.077 -0.587  1.00 108.34 ? 108  ILE A CG2 1 
ATOM   250  C  CD1 . ILE A 1  35  ? 49.178 181.252 -1.413  1.00 149.93 ? 108  ILE A CD1 1 
ATOM   251  N  N   . CYS A 1  36  ? 52.587 185.314 -0.731  1.00 126.71 ? 109  CYS A N   1 
ATOM   252  C  CA  . CYS A 1  36  ? 53.355 186.016 -1.747  1.00 91.51  ? 109  CYS A CA  1 
ATOM   253  C  C   . CYS A 1  36  ? 54.833 186.027 -1.382  1.00 121.85 ? 109  CYS A C   1 
ATOM   254  O  O   . CYS A 1  36  ? 55.696 185.931 -2.252  1.00 123.18 ? 109  CYS A O   1 
ATOM   255  C  CB  . CYS A 1  36  ? 52.840 187.447 -1.916  1.00 106.83 ? 109  CYS A CB  1 
ATOM   256  S  SG  . CYS A 1  36  ? 53.817 188.459 -3.048  1.00 122.00 ? 109  CYS A SG  1 
ATOM   257  N  N   . ALA A 1  37  ? 55.116 186.129 -0.087  1.00 126.67 ? 110  ALA A N   1 
ATOM   258  C  CA  . ALA A 1  37  ? 56.490 186.242 0.389   1.00 121.20 ? 110  ALA A CA  1 
ATOM   259  C  C   . ALA A 1  37  ? 57.217 184.902 0.400   1.00 119.36 ? 110  ALA A C   1 
ATOM   260  O  O   . ALA A 1  37  ? 58.414 184.839 0.121   1.00 130.72 ? 110  ALA A O   1 
ATOM   261  C  CB  . ALA A 1  37  ? 56.513 186.855 1.775   1.00 115.95 ? 110  ALA A CB  1 
ATOM   262  N  N   . GLN A 1  38  ? 56.500 183.831 0.725   1.00 104.52 ? 111  GLN A N   1 
ATOM   263  C  CA  . GLN A 1  38  ? 57.136 182.525 0.854   1.00 116.46 ? 111  GLN A CA  1 
ATOM   264  C  C   . GLN A 1  38  ? 57.186 181.768 -0.471  1.00 117.43 ? 111  GLN A C   1 
ATOM   265  O  O   . GLN A 1  38  ? 57.856 180.741 -0.577  1.00 112.29 ? 111  GLN A O   1 
ATOM   266  C  CB  . GLN A 1  38  ? 56.416 181.677 1.902   1.00 113.42 ? 111  GLN A CB  1 
ATOM   267  C  CG  . GLN A 1  38  ? 55.096 181.096 1.434   1.00 120.56 ? 111  GLN A CG  1 
ATOM   268  C  CD  . GLN A 1  38  ? 54.595 179.997 2.349   1.00 132.94 ? 111  GLN A CD  1 
ATOM   269  O  OE1 . GLN A 1  38  ? 55.237 179.663 3.344   1.00 126.40 ? 111  GLN A OE1 1 
ATOM   270  N  NE2 . GLN A 1  38  ? 53.444 179.425 2.014   1.00 148.09 ? 111  GLN A NE2 1 
ATOM   271  N  N   . ASN A 1  39  ? 56.480 182.272 -1.478  1.00 145.68 ? 112  ASN A N   1 
ATOM   272  C  CA  . ASN A 1  39  ? 56.447 181.613 -2.780  1.00 148.89 ? 112  ASN A CA  1 
ATOM   273  C  C   . ASN A 1  39  ? 57.056 182.639 -3.728  1.00 136.89 ? 112  ASN A C   1 
ATOM   274  O  O   . ASN A 1  39  ? 56.337 183.392 -4.385  1.00 142.54 ? 112  ASN A O   1 
ATOM   275  C  CB  . ASN A 1  39  ? 55.010 181.248 -3.157  1.00 133.27 ? 112  ASN A CB  1 
ATOM   276  C  CG  . ASN A 1  39  ? 54.459 180.111 -2.321  1.00 135.59 ? 112  ASN A CG  1 
ATOM   277  O  OD1 . ASN A 1  39  ? 55.198 179.226 -1.891  1.00 159.51 ? 112  ASN A OD1 1 
ATOM   278  N  ND2 . ASN A 1  39  ? 53.152 180.127 -2.089  1.00 123.76 ? 112  ASN A ND2 1 
ATOM   279  N  N   . GLY A 1  40  ? 58.383 182.663 -3.799  1.00 131.88 ? 113  GLY A N   1 
ATOM   280  C  CA  . GLY A 1  40  ? 59.076 183.511 -4.751  1.00 139.08 ? 113  GLY A CA  1 
ATOM   281  C  C   . GLY A 1  40  ? 59.178 185.011 -4.562  1.00 144.26 ? 113  GLY A C   1 
ATOM   282  O  O   . GLY A 1  40  ? 59.869 185.691 -5.321  1.00 160.01 ? 113  GLY A O   1 
ATOM   283  N  N   . GLY A 1  41  ? 58.494 185.531 -3.548  1.00 149.64 ? 114  GLY A N   1 
ATOM   284  C  CA  . GLY A 1  41  ? 58.475 186.961 -3.308  1.00 160.97 ? 114  GLY A CA  1 
ATOM   285  C  C   . GLY A 1  41  ? 57.748 187.703 -4.411  1.00 154.89 ? 114  GLY A C   1 
ATOM   286  O  O   . GLY A 1  41  ? 56.640 187.326 -4.797  1.00 159.66 ? 114  GLY A O   1 
ATOM   287  N  N   . GLY A 1  42  ? 58.378 188.753 -4.929  1.00 140.17 ? 115  GLY A N   1 
ATOM   288  C  CA  . GLY A 1  42  ? 57.807 189.537 -6.009  1.00 121.85 ? 115  GLY A CA  1 
ATOM   289  C  C   . GLY A 1  42  ? 57.511 188.720 -7.253  1.00 118.49 ? 115  GLY A C   1 
ATOM   290  O  O   . GLY A 1  42  ? 56.600 189.043 -8.017  1.00 117.77 ? 115  GLY A O   1 
ATOM   291  N  N   . ALA A 1  43  ? 58.280 187.653 -7.448  1.00 128.86 ? 116  ALA A N   1 
ATOM   292  C  CA  . ALA A 1  43  ? 58.077 186.747 -8.573  1.00 130.58 ? 116  ALA A CA  1 
ATOM   293  C  C   . ALA A 1  43  ? 56.677 186.150 -8.541  1.00 129.87 ? 116  ALA A C   1 
ATOM   294  O  O   . ALA A 1  43  ? 56.096 185.856 -9.585  1.00 143.57 ? 116  ALA A O   1 
ATOM   295  C  CB  . ALA A 1  43  ? 59.122 185.643 -8.563  1.00 125.69 ? 116  ALA A CB  1 
ATOM   296  N  N   . PHE A 1  44  ? 56.138 185.988 -7.336  1.00 102.95 ? 117  PHE A N   1 
ATOM   297  C  CA  . PHE A 1  44  ? 54.797 185.440 -7.156  1.00 105.96 ? 117  PHE A CA  1 
ATOM   298  C  C   . PHE A 1  44  ? 53.743 186.297 -7.856  1.00 114.53 ? 117  PHE A C   1 
ATOM   299  O  O   . PHE A 1  44  ? 52.622 185.846 -8.086  1.00 129.59 ? 117  PHE A O   1 
ATOM   300  C  CB  . PHE A 1  44  ? 54.469 185.311 -5.669  1.00 130.01 ? 117  PHE A CB  1 
ATOM   301  C  CG  . PHE A 1  44  ? 53.131 184.687 -5.400  1.00 116.09 ? 117  PHE A CG  1 
ATOM   302  C  CD1 . PHE A 1  44  ? 52.954 183.320 -5.528  1.00 101.80 ? 117  PHE A CD1 1 
ATOM   303  C  CD2 . PHE A 1  44  ? 52.048 185.468 -5.028  1.00 123.46 ? 117  PHE A CD2 1 
ATOM   304  C  CE1 . PHE A 1  44  ? 51.722 182.741 -5.287  1.00 106.75 ? 117  PHE A CE1 1 
ATOM   305  C  CE2 . PHE A 1  44  ? 50.814 184.895 -4.785  1.00 110.12 ? 117  PHE A CE2 1 
ATOM   306  C  CZ  . PHE A 1  44  ? 50.652 183.530 -4.914  1.00 110.23 ? 117  PHE A CZ  1 
ATOM   307  N  N   . LEU A 1  45  ? 54.108 187.530 -8.198  1.00 121.86 ? 118  LEU A N   1 
ATOM   308  C  CA  . LEU A 1  45  ? 53.212 188.415 -8.933  1.00 104.25 ? 118  LEU A CA  1 
ATOM   309  C  C   . LEU A 1  45  ? 52.913 187.889 -10.339 1.00 115.75 ? 118  LEU A C   1 
ATOM   310  O  O   . LEU A 1  45  ? 51.878 188.214 -10.920 1.00 127.82 ? 118  LEU A O   1 
ATOM   311  C  CB  . LEU A 1  45  ? 53.804 189.823 -9.020  1.00 110.59 ? 118  LEU A CB  1 
ATOM   312  C  CG  . LEU A 1  45  ? 53.839 190.634 -7.723  1.00 110.56 ? 118  LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1  45  ? 54.481 191.991 -7.957  1.00 125.91 ? 118  LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1  45  ? 52.437 190.789 -7.153  1.00 109.41 ? 118  LEU A CD2 1 
ATOM   315  N  N   . LEU A 1  46  ? 53.816 187.076 -10.882 1.00 110.28 ? 119  LEU A N   1 
ATOM   316  C  CA  . LEU A 1  46  ? 53.651 186.548 -12.236 1.00 121.38 ? 119  LEU A CA  1 
ATOM   317  C  C   . LEU A 1  46  ? 52.556 185.471 -12.320 1.00 140.90 ? 119  LEU A C   1 
ATOM   318  O  O   . LEU A 1  46  ? 51.644 185.600 -13.133 1.00 114.69 ? 119  LEU A O   1 
ATOM   319  C  CB  . LEU A 1  46  ? 54.985 186.003 -12.772 1.00 114.76 ? 119  LEU A CB  1 
ATOM   320  C  CG  . LEU A 1  46  ? 54.989 185.499 -14.220 1.00 109.27 ? 119  LEU A CG  1 
ATOM   321  C  CD1 . LEU A 1  46  ? 56.227 185.986 -14.956 1.00 112.93 ? 119  LEU A CD1 1 
ATOM   322  C  CD2 . LEU A 1  46  ? 54.900 183.979 -14.281 1.00 129.14 ? 119  LEU A CD2 1 
ATOM   323  N  N   . PRO A 1  47  ? 52.626 184.409 -11.489 1.00 156.41 ? 120  PRO A N   1 
ATOM   324  C  CA  . PRO A 1  47  ? 51.549 183.423 -11.629 1.00 136.79 ? 120  PRO A CA  1 
ATOM   325  C  C   . PRO A 1  47  ? 50.234 183.875 -10.998 1.00 123.20 ? 120  PRO A C   1 
ATOM   326  O  O   . PRO A 1  47  ? 49.186 183.304 -11.295 1.00 134.88 ? 120  PRO A O   1 
ATOM   327  C  CB  . PRO A 1  47  ? 52.104 182.201 -10.897 1.00 132.91 ? 120  PRO A CB  1 
ATOM   328  C  CG  . PRO A 1  47  ? 52.977 182.779 -9.853  1.00 132.71 ? 120  PRO A CG  1 
ATOM   329  C  CD  . PRO A 1  47  ? 53.617 183.983 -10.482 1.00 144.42 ? 120  PRO A CD  1 
ATOM   330  N  N   . TYR A 1  48  ? 50.295 184.887 -10.138 1.00 116.66 ? 121  TYR A N   1 
ATOM   331  C  CA  . TYR A 1  48  ? 49.104 185.392 -9.462  1.00 126.40 ? 121  TYR A CA  1 
ATOM   332  C  C   . TYR A 1  48  ? 48.160 186.075 -10.446 1.00 134.47 ? 121  TYR A C   1 
ATOM   333  O  O   . TYR A 1  48  ? 46.940 186.018 -10.293 1.00 133.56 ? 121  TYR A O   1 
ATOM   334  C  CB  . TYR A 1  48  ? 49.495 186.361 -8.345  1.00 119.91 ? 121  TYR A CB  1 
ATOM   335  C  CG  . TYR A 1  48  ? 48.323 186.995 -7.633  1.00 109.99 ? 121  TYR A CG  1 
ATOM   336  C  CD1 . TYR A 1  48  ? 47.581 186.281 -6.702  1.00 111.95 ? 121  TYR A CD1 1 
ATOM   337  C  CD2 . TYR A 1  48  ? 47.964 188.313 -7.884  1.00 110.69 ? 121  TYR A CD2 1 
ATOM   338  C  CE1 . TYR A 1  48  ? 46.510 186.858 -6.046  1.00 118.23 ? 121  TYR A CE1 1 
ATOM   339  C  CE2 . TYR A 1  48  ? 46.895 188.900 -7.233  1.00 112.37 ? 121  TYR A CE2 1 
ATOM   340  C  CZ  . TYR A 1  48  ? 46.173 188.168 -6.315  1.00 111.96 ? 121  TYR A CZ  1 
ATOM   341  O  OH  . TYR A 1  48  ? 45.108 188.747 -5.664  1.00 115.18 ? 121  TYR A OH  1 
ATOM   342  N  N   . THR A 1  49  ? 48.734 186.718 -11.457 1.00 114.72 ? 122  THR A N   1 
ATOM   343  C  CA  . THR A 1  49  ? 47.946 187.418 -12.463 1.00 117.79 ? 122  THR A CA  1 
ATOM   344  C  C   . THR A 1  49  ? 47.444 186.459 -13.538 1.00 120.96 ? 122  THR A C   1 
ATOM   345  O  O   . THR A 1  49  ? 46.311 186.577 -14.005 1.00 148.33 ? 122  THR A O   1 
ATOM   346  C  CB  . THR A 1  49  ? 48.758 188.543 -13.129 1.00 106.22 ? 122  THR A CB  1 
ATOM   347  O  OG1 . THR A 1  49  ? 49.958 187.999 -13.692 1.00 132.33 ? 122  THR A OG1 1 
ATOM   348  C  CG2 . THR A 1  49  ? 49.119 189.611 -12.109 1.00 107.00 ? 122  THR A CG2 1 
ATOM   349  N  N   . ILE A 1  50  ? 48.295 185.513 -13.925 1.00 115.62 ? 123  ILE A N   1 
ATOM   350  C  CA  . ILE A 1  50  ? 47.949 184.533 -14.948 1.00 110.81 ? 123  ILE A CA  1 
ATOM   351  C  C   . ILE A 1  50  ? 46.740 183.714 -14.508 1.00 121.94 ? 123  ILE A C   1 
ATOM   352  O  O   . ILE A 1  50  ? 45.844 183.435 -15.305 1.00 131.02 ? 123  ILE A O   1 
ATOM   353  C  CB  . ILE A 1  50  ? 49.147 183.619 -15.269 1.00 101.80 ? 123  ILE A CB  1 
ATOM   354  C  CG1 . ILE A 1  50  ? 50.310 184.443 -15.824 1.00 104.35 ? 123  ILE A CG1 1 
ATOM   355  C  CG2 . ILE A 1  50  ? 48.748 182.535 -16.259 1.00 104.03 ? 123  ILE A CG2 1 
ATOM   356  C  CD1 . ILE A 1  50  ? 51.537 183.621 -16.155 1.00 107.44 ? 123  ILE A CD1 1 
ATOM   357  N  N   . MET A 1  51  ? 46.713 183.343 -13.232 1.00 124.40 ? 124  MET A N   1 
ATOM   358  C  CA  . MET A 1  51  ? 45.597 182.581 -12.684 1.00 126.38 ? 124  MET A CA  1 
ATOM   359  C  C   . MET A 1  51  ? 44.358 183.456 -12.518 1.00 147.56 ? 124  MET A C   1 
ATOM   360  O  O   . MET A 1  51  ? 43.248 182.950 -12.358 1.00 143.83 ? 124  MET A O   1 
ATOM   361  C  CB  . MET A 1  51  ? 45.981 181.954 -11.343 1.00 107.20 ? 124  MET A CB  1 
ATOM   362  C  CG  . MET A 1  51  ? 47.003 180.838 -11.460 1.00 113.11 ? 124  MET A CG  1 
ATOM   363  S  SD  . MET A 1  51  ? 46.434 179.510 -12.539 1.00 112.35 ? 124  MET A SD  1 
ATOM   364  C  CE  . MET A 1  51  ? 47.847 178.410 -12.495 1.00 144.78 ? 124  MET A CE  1 
ATOM   365  N  N   . ALA A 1  52  ? 44.554 184.770 -12.559 1.00 98.65  ? 125  ALA A N   1 
ATOM   366  C  CA  . ALA A 1  52  ? 43.443 185.706 -12.454 1.00 100.14 ? 125  ALA A CA  1 
ATOM   367  C  C   . ALA A 1  52  ? 42.800 185.921 -13.818 1.00 126.21 ? 125  ALA A C   1 
ATOM   368  O  O   . ALA A 1  52  ? 41.601 185.704 -13.990 1.00 117.23 ? 125  ALA A O   1 
ATOM   369  C  CB  . ALA A 1  52  ? 43.915 187.029 -11.874 1.00 101.55 ? 125  ALA A CB  1 
ATOM   370  N  N   . ILE A 1  53  ? 43.615 186.340 -14.781 1.00 141.86 ? 126  ILE A N   1 
ATOM   371  C  CA  . ILE A 1  53  ? 43.155 186.652 -16.129 1.00 113.52 ? 126  ILE A CA  1 
ATOM   372  C  C   . ILE A 1  53  ? 42.477 185.454 -16.789 1.00 128.74 ? 126  ILE A C   1 
ATOM   373  O  O   . ILE A 1  53  ? 41.444 185.597 -17.444 1.00 149.10 ? 126  ILE A O   1 
ATOM   374  C  CB  . ILE A 1  53  ? 44.328 187.151 -16.997 1.00 119.46 ? 126  ILE A CB  1 
ATOM   375  C  CG1 . ILE A 1  53  ? 44.951 188.405 -16.382 1.00 128.05 ? 126  ILE A CG1 1 
ATOM   376  C  CG2 . ILE A 1  53  ? 43.868 187.426 -18.420 1.00 159.26 ? 126  ILE A CG2 1 
ATOM   377  C  CD1 . ILE A 1  53  ? 46.136 188.940 -17.157 1.00 132.10 ? 126  ILE A CD1 1 
ATOM   378  N  N   . PHE A 1  54  ? 43.057 184.273 -16.606 1.00 115.07 ? 127  PHE A N   1 
ATOM   379  C  CA  . PHE A 1  54  ? 42.553 183.069 -17.257 1.00 111.67 ? 127  PHE A CA  1 
ATOM   380  C  C   . PHE A 1  54  ? 41.528 182.335 -16.399 1.00 116.49 ? 127  PHE A C   1 
ATOM   381  O  O   . PHE A 1  54  ? 40.641 181.660 -16.922 1.00 138.86 ? 127  PHE A O   1 
ATOM   382  C  CB  . PHE A 1  54  ? 43.711 182.128 -17.598 1.00 109.74 ? 127  PHE A CB  1 
ATOM   383  C  CG  . PHE A 1  54  ? 44.695 182.706 -18.575 1.00 120.62 ? 127  PHE A CG  1 
ATOM   384  C  CD1 . PHE A 1  54  ? 44.313 183.705 -19.456 1.00 111.83 ? 127  PHE A CD1 1 
ATOM   385  C  CD2 . PHE A 1  54  ? 46.002 182.250 -18.614 1.00 114.16 ? 127  PHE A CD2 1 
ATOM   386  C  CE1 . PHE A 1  54  ? 45.215 184.239 -20.355 1.00 110.33 ? 127  PHE A CE1 1 
ATOM   387  C  CE2 . PHE A 1  54  ? 46.909 182.779 -19.512 1.00 121.39 ? 127  PHE A CE2 1 
ATOM   388  C  CZ  . PHE A 1  54  ? 46.515 183.775 -20.384 1.00 114.85 ? 127  PHE A CZ  1 
ATOM   389  N  N   . GLY A 1  55  ? 41.648 182.470 -15.082 1.00 105.31 ? 128  GLY A N   1 
ATOM   390  C  CA  . GLY A 1  55  ? 40.786 181.743 -14.168 1.00 103.38 ? 128  GLY A CA  1 
ATOM   391  C  C   . GLY A 1  55  ? 39.836 182.449 -13.220 1.00 111.89 ? 128  GLY A C   1 
ATOM   392  O  O   . GLY A 1  55  ? 38.766 181.931 -12.901 1.00 131.33 ? 128  GLY A O   1 
ATOM   393  N  N   . GLY A 1  56  ? 40.228 183.634 -12.765 1.00 110.93 ? 129  GLY A N   1 
ATOM   394  C  CA  . GLY A 1  56  ? 39.459 184.363 -11.774 1.00 112.37 ? 129  GLY A CA  1 
ATOM   395  C  C   . GLY A 1  56  ? 38.503 185.307 -12.480 1.00 144.22 ? 129  GLY A C   1 
ATOM   396  O  O   . GLY A 1  56  ? 37.302 185.302 -12.207 1.00 155.67 ? 129  GLY A O   1 
ATOM   397  N  N   . ILE A 1  57  ? 39.039 186.122 -13.383 1.00 152.11 ? 130  ILE A N   1 
ATOM   398  C  CA  . ILE A 1  57  ? 38.242 187.119 -14.094 1.00 118.62 ? 130  ILE A CA  1 
ATOM   399  C  C   . ILE A 1  57  ? 37.097 186.508 -14.923 1.00 132.98 ? 130  ILE A C   1 
ATOM   400  O  O   . ILE A 1  57  ? 35.976 187.017 -14.870 1.00 129.23 ? 130  ILE A O   1 
ATOM   401  C  CB  . ILE A 1  57  ? 39.138 188.003 -14.990 1.00 116.24 ? 130  ILE A CB  1 
ATOM   402  C  CG1 . ILE A 1  57  ? 40.322 188.551 -14.193 1.00 108.79 ? 130  ILE A CG1 1 
ATOM   403  C  CG2 . ILE A 1  57  ? 38.337 189.152 -15.574 1.00 129.43 ? 130  ILE A CG2 1 
ATOM   404  C  CD1 . ILE A 1  57  ? 39.921 189.398 -13.015 1.00 109.21 ? 130  ILE A CD1 1 
ATOM   405  N  N   . PRO A 1  58  ? 37.360 185.430 -15.693 1.00 137.17 ? 131  PRO A N   1 
ATOM   406  C  CA  . PRO A 1  58  ? 36.234 184.880 -16.461 1.00 124.68 ? 131  PRO A CA  1 
ATOM   407  C  C   . PRO A 1  58  ? 35.106 184.329 -15.589 1.00 127.63 ? 131  PRO A C   1 
ATOM   408  O  O   . PRO A 1  58  ? 33.946 184.366 -15.998 1.00 153.91 ? 131  PRO A O   1 
ATOM   409  C  CB  . PRO A 1  58  ? 36.881 183.752 -17.274 1.00 124.86 ? 131  PRO A CB  1 
ATOM   410  C  CG  . PRO A 1  58  ? 38.319 184.118 -17.353 1.00 123.78 ? 131  PRO A CG  1 
ATOM   411  C  CD  . PRO A 1  58  ? 38.624 184.750 -16.035 1.00 118.01 ? 131  PRO A CD  1 
ATOM   412  N  N   . LEU A 1  59  ? 35.445 183.828 -14.406 1.00 136.23 ? 132  LEU A N   1 
ATOM   413  C  CA  . LEU A 1  59  ? 34.440 183.312 -13.482 1.00 135.51 ? 132  LEU A CA  1 
ATOM   414  C  C   . LEU A 1  59  ? 33.702 184.449 -12.787 1.00 132.88 ? 132  LEU A C   1 
ATOM   415  O  O   . LEU A 1  59  ? 32.510 184.344 -12.498 1.00 129.82 ? 132  LEU A O   1 
ATOM   416  C  CB  . LEU A 1  59  ? 35.085 182.392 -12.445 1.00 127.74 ? 132  LEU A CB  1 
ATOM   417  C  CG  . LEU A 1  59  ? 35.577 181.042 -12.967 1.00 134.50 ? 132  LEU A CG  1 
ATOM   418  C  CD1 . LEU A 1  59  ? 36.289 180.273 -11.867 1.00 130.31 ? 132  LEU A CD1 1 
ATOM   419  C  CD2 . LEU A 1  59  ? 34.415 180.235 -13.525 1.00 136.90 ? 132  LEU A CD2 1 
ATOM   420  N  N   . PHE A 1  60  ? 34.420 185.535 -12.520 1.00 125.14 ? 133  PHE A N   1 
ATOM   421  C  CA  . PHE A 1  60  ? 33.836 186.704 -11.874 1.00 125.61 ? 133  PHE A CA  1 
ATOM   422  C  C   . PHE A 1  60  ? 32.840 187.384 -12.809 1.00 156.12 ? 133  PHE A C   1 
ATOM   423  O  O   . PHE A 1  60  ? 31.743 187.766 -12.400 1.00 179.05 ? 133  PHE A O   1 
ATOM   424  C  CB  . PHE A 1  60  ? 34.933 187.686 -11.455 1.00 123.46 ? 133  PHE A CB  1 
ATOM   425  C  CG  . PHE A 1  60  ? 34.465 188.758 -10.511 1.00 128.15 ? 133  PHE A CG  1 
ATOM   426  C  CD1 . PHE A 1  60  ? 33.971 189.958 -10.993 1.00 183.22 ? 133  PHE A CD1 1 
ATOM   427  C  CD2 . PHE A 1  60  ? 34.528 188.567 -9.141  1.00 126.85 ? 133  PHE A CD2 1 
ATOM   428  C  CE1 . PHE A 1  60  ? 33.542 190.946 -10.126 1.00 198.35 ? 133  PHE A CE1 1 
ATOM   429  C  CE2 . PHE A 1  60  ? 34.101 189.551 -8.269  1.00 146.78 ? 133  PHE A CE2 1 
ATOM   430  C  CZ  . PHE A 1  60  ? 33.608 190.742 -8.762  1.00 163.50 ? 133  PHE A CZ  1 
ATOM   431  N  N   . TYR A 1  61  ? 33.234 187.523 -14.070 1.00 162.33 ? 134  TYR A N   1 
ATOM   432  C  CA  . TYR A 1  61  ? 32.407 188.174 -15.078 1.00 162.18 ? 134  TYR A CA  1 
ATOM   433  C  C   . TYR A 1  61  ? 31.262 187.268 -15.525 1.00 155.98 ? 134  TYR A C   1 
ATOM   434  O  O   . TYR A 1  61  ? 30.135 187.726 -15.720 1.00 161.15 ? 134  TYR A O   1 
ATOM   435  C  CB  . TYR A 1  61  ? 33.270 188.584 -16.274 1.00 189.36 ? 134  TYR A CB  1 
ATOM   436  C  CG  . TYR A 1  61  ? 32.499 189.134 -17.452 1.00 202.68 ? 134  TYR A CG  1 
ATOM   437  C  CD1 . TYR A 1  61  ? 31.744 190.293 -17.334 1.00 210.25 ? 134  TYR A CD1 1 
ATOM   438  C  CD2 . TYR A 1  61  ? 32.545 188.506 -18.688 1.00 195.25 ? 134  TYR A CD2 1 
ATOM   439  C  CE1 . TYR A 1  61  ? 31.044 190.801 -18.413 1.00 189.54 ? 134  TYR A CE1 1 
ATOM   440  C  CE2 . TYR A 1  61  ? 31.850 189.006 -19.771 1.00 199.91 ? 134  TYR A CE2 1 
ATOM   441  C  CZ  . TYR A 1  61  ? 31.101 190.153 -19.629 1.00 194.10 ? 134  TYR A CZ  1 
ATOM   442  O  OH  . TYR A 1  61  ? 30.409 190.654 -20.707 1.00 201.76 ? 134  TYR A OH  1 
ATOM   443  N  N   . MET A 1  62  ? 31.558 185.981 -15.680 1.00 139.28 ? 135  MET A N   1 
ATOM   444  C  CA  . MET A 1  62  ? 30.553 185.002 -16.078 1.00 125.45 ? 135  MET A CA  1 
ATOM   445  C  C   . MET A 1  62  ? 29.508 184.839 -14.977 1.00 147.53 ? 135  MET A C   1 
ATOM   446  O  O   . MET A 1  62  ? 28.326 184.632 -15.253 1.00 142.04 ? 135  MET A O   1 
ATOM   447  C  CB  . MET A 1  62  ? 31.217 183.659 -16.401 1.00 125.44 ? 135  MET A CB  1 
ATOM   448  C  CG  . MET A 1  62  ? 30.294 182.626 -17.035 1.00 118.44 ? 135  MET A CG  1 
ATOM   449  S  SD  . MET A 1  62  ? 29.442 181.584 -15.833 1.00 145.63 ? 135  MET A SD  1 
ATOM   450  C  CE  . MET A 1  62  ? 30.830 180.777 -15.040 1.00 167.84 ? 135  MET A CE  1 
ATOM   451  N  N   . GLU A 1  63  ? 29.954 184.938 -13.729 1.00 204.22 ? 136  GLU A N   1 
ATOM   452  C  CA  . GLU A 1  63  ? 29.059 184.872 -12.580 1.00 215.98 ? 136  GLU A CA  1 
ATOM   453  C  C   . GLU A 1  63  ? 28.269 186.169 -12.439 1.00 199.96 ? 136  GLU A C   1 
ATOM   454  O  O   . GLU A 1  63  ? 27.109 186.165 -12.027 1.00 199.45 ? 136  GLU A O   1 
ATOM   455  C  CB  . GLU A 1  63  ? 29.855 184.592 -11.301 1.00 215.07 ? 136  GLU A CB  1 
ATOM   456  C  CG  . GLU A 1  63  ? 29.086 184.796 -10.000 1.00 204.98 ? 136  GLU A CG  1 
ATOM   457  C  CD  . GLU A 1  63  ? 28.040 183.726 -9.753  1.00 214.81 ? 136  GLU A CD  1 
ATOM   458  O  OE1 . GLU A 1  63  ? 28.075 182.683 -10.441 1.00 226.03 ? 136  GLU A OE1 1 
ATOM   459  O  OE2 . GLU A 1  63  ? 27.183 183.927 -8.867  1.00 211.35 ? 136  GLU A OE2 1 
ATOM   460  N  N   . LEU A 1  64  ? 28.906 187.278 -12.800 1.00 156.61 ? 137  LEU A N   1 
ATOM   461  C  CA  . LEU A 1  64  ? 28.316 188.599 -12.621 1.00 144.21 ? 137  LEU A CA  1 
ATOM   462  C  C   . LEU A 1  64  ? 27.310 188.936 -13.722 1.00 161.50 ? 137  LEU A C   1 
ATOM   463  O  O   . LEU A 1  64  ? 26.457 189.806 -13.547 1.00 128.25 ? 137  LEU A O   1 
ATOM   464  C  CB  . LEU A 1  64  ? 29.419 189.659 -12.575 1.00 121.41 ? 137  LEU A CB  1 
ATOM   465  C  CG  . LEU A 1  64  ? 29.051 191.025 -11.994 1.00 126.87 ? 137  LEU A CG  1 
ATOM   466  C  CD1 . LEU A 1  64  ? 28.552 190.879 -10.566 1.00 123.78 ? 137  LEU A CD1 1 
ATOM   467  C  CD2 . LEU A 1  64  ? 30.244 191.965 -12.054 1.00 125.01 ? 137  LEU A CD2 1 
ATOM   468  N  N   . ALA A 1  65  ? 27.409 188.243 -14.852 1.00 180.46 ? 138  ALA A N   1 
ATOM   469  C  CA  . ALA A 1  65  ? 26.534 188.512 -15.990 1.00 156.85 ? 138  ALA A CA  1 
ATOM   470  C  C   . ALA A 1  65  ? 25.170 187.841 -15.831 1.00 146.05 ? 138  ALA A C   1 
ATOM   471  O  O   . ALA A 1  65  ? 24.130 188.461 -16.073 1.00 133.00 ? 138  ALA A O   1 
ATOM   472  C  CB  . ALA A 1  65  ? 27.197 188.058 -17.282 1.00 127.59 ? 138  ALA A CB  1 
ATOM   473  N  N   . LEU A 1  66  ? 25.184 186.575 -15.425 1.00 145.63 ? 139  LEU A N   1 
ATOM   474  C  CA  . LEU A 1  66  ? 23.960 185.794 -15.266 1.00 127.88 ? 139  LEU A CA  1 
ATOM   475  C  C   . LEU A 1  66  ? 23.003 186.437 -14.268 1.00 152.70 ? 139  LEU A C   1 
ATOM   476  O  O   . LEU A 1  66  ? 21.785 186.410 -14.454 1.00 191.56 ? 139  LEU A O   1 
ATOM   477  C  CB  . LEU A 1  66  ? 24.292 184.368 -14.823 1.00 123.18 ? 139  LEU A CB  1 
ATOM   478  C  CG  . LEU A 1  66  ? 25.114 183.524 -15.799 1.00 125.16 ? 139  LEU A CG  1 
ATOM   479  C  CD1 . LEU A 1  66  ? 25.469 182.183 -15.180 1.00 117.77 ? 139  LEU A CD1 1 
ATOM   480  C  CD2 . LEU A 1  66  ? 24.358 183.330 -17.103 1.00 153.67 ? 139  LEU A CD2 1 
ATOM   481  N  N   . GLY A 1  67  ? 23.562 187.016 -13.211 1.00 161.41 ? 140  GLY A N   1 
ATOM   482  C  CA  . GLY A 1  67  ? 22.767 187.671 -12.191 1.00 164.77 ? 140  GLY A CA  1 
ATOM   483  C  C   . GLY A 1  67  ? 22.040 188.898 -12.699 1.00 163.79 ? 140  GLY A C   1 
ATOM   484  O  O   . GLY A 1  67  ? 20.907 189.166 -12.303 1.00 140.71 ? 140  GLY A O   1 
ATOM   485  N  N   . GLN A 1  68  ? 22.691 189.643 -13.586 1.00 184.16 ? 141  GLN A N   1 
ATOM   486  C  CA  . GLN A 1  68  ? 22.104 190.860 -14.129 1.00 189.53 ? 141  GLN A CA  1 
ATOM   487  C  C   . GLN A 1  68  ? 21.240 190.547 -15.345 1.00 190.94 ? 141  GLN A C   1 
ATOM   488  O  O   . GLN A 1  68  ? 20.485 191.399 -15.815 1.00 206.20 ? 141  GLN A O   1 
ATOM   489  C  CB  . GLN A 1  68  ? 23.202 191.858 -14.507 1.00 198.49 ? 141  GLN A CB  1 
ATOM   490  C  CG  . GLN A 1  68  ? 22.769 193.310 -14.455 1.00 219.78 ? 141  GLN A CG  1 
ATOM   491  C  CD  . GLN A 1  68  ? 23.941 194.257 -14.288 1.00 239.70 ? 141  GLN A CD  1 
ATOM   492  O  OE1 . GLN A 1  68  ? 25.059 193.836 -13.992 1.00 259.40 ? 141  GLN A OE1 1 
ATOM   493  N  NE2 . GLN A 1  68  ? 23.689 195.543 -14.474 1.00 237.83 ? 141  GLN A NE2 1 
ATOM   494  N  N   . TYR A 1  69  ? 21.348 189.322 -15.850 1.00 163.36 ? 142  TYR A N   1 
ATOM   495  C  CA  . TYR A 1  69  ? 20.533 188.903 -16.986 1.00 158.76 ? 142  TYR A CA  1 
ATOM   496  C  C   . TYR A 1  69  ? 19.214 188.281 -16.532 1.00 156.52 ? 142  TYR A C   1 
ATOM   497  O  O   . TYR A 1  69  ? 18.140 188.744 -16.914 1.00 184.62 ? 142  TYR A O   1 
ATOM   498  C  CB  . TYR A 1  69  ? 21.298 187.916 -17.869 1.00 160.65 ? 142  TYR A CB  1 
ATOM   499  C  CG  . TYR A 1  69  ? 20.536 187.502 -19.109 1.00 179.25 ? 142  TYR A CG  1 
ATOM   500  C  CD1 . TYR A 1  69  ? 20.453 188.346 -20.209 1.00 185.67 ? 142  TYR A CD1 1 
ATOM   501  C  CD2 . TYR A 1  69  ? 19.900 186.270 -19.179 1.00 196.68 ? 142  TYR A CD2 1 
ATOM   502  C  CE1 . TYR A 1  69  ? 19.756 187.974 -21.344 1.00 197.95 ? 142  TYR A CE1 1 
ATOM   503  C  CE2 . TYR A 1  69  ? 19.202 185.888 -20.311 1.00 204.05 ? 142  TYR A CE2 1 
ATOM   504  C  CZ  . TYR A 1  69  ? 19.134 186.744 -21.390 1.00 195.00 ? 142  TYR A CZ  1 
ATOM   505  O  OH  . TYR A 1  69  ? 18.441 186.370 -22.519 1.00 193.93 ? 142  TYR A OH  1 
ATOM   506  N  N   . HIS A 1  70  ? 19.298 187.232 -15.719 1.00 175.66 ? 143  HIS A N   1 
ATOM   507  C  CA  . HIS A 1  70  ? 18.104 186.519 -15.273 1.00 171.86 ? 143  HIS A CA  1 
ATOM   508  C  C   . HIS A 1  70  ? 17.407 187.228 -14.115 1.00 164.19 ? 143  HIS A C   1 
ATOM   509  O  O   . HIS A 1  70  ? 16.203 187.059 -13.913 1.00 162.59 ? 143  HIS A O   1 
ATOM   510  C  CB  . HIS A 1  70  ? 18.458 185.086 -14.867 1.00 161.92 ? 143  HIS A CB  1 
ATOM   511  C  CG  . HIS A 1  70  ? 18.857 184.212 -16.016 1.00 174.60 ? 143  HIS A CG  1 
ATOM   512  N  ND1 . HIS A 1  70  ? 20.121 184.234 -16.565 1.00 186.60 ? 143  HIS A ND1 1 
ATOM   513  C  CD2 . HIS A 1  70  ? 18.157 183.292 -16.720 1.00 173.29 ? 143  HIS A CD2 1 
ATOM   514  C  CE1 . HIS A 1  70  ? 20.183 183.363 -17.557 1.00 174.82 ? 143  HIS A CE1 1 
ATOM   515  N  NE2 . HIS A 1  70  ? 19.004 182.779 -17.673 1.00 170.20 ? 143  HIS A NE2 1 
ATOM   516  N  N   . ARG A 1  71  ? 18.171 188.019 -13.365 1.00 176.92 ? 144  ARG A N   1 
ATOM   517  C  CA  . ARG A 1  71  ? 17.666 188.741 -12.197 1.00 176.65 ? 144  ARG A CA  1 
ATOM   518  C  C   . ARG A 1  71  ? 16.979 187.807 -11.203 1.00 181.44 ? 144  ARG A C   1 
ATOM   519  O  O   . ARG A 1  71  ? 15.938 188.144 -10.638 1.00 159.30 ? 144  ARG A O   1 
ATOM   520  C  CB  . ARG A 1  71  ? 16.700 189.853 -12.619 1.00 156.42 ? 144  ARG A CB  1 
ATOM   521  C  CG  . ARG A 1  71  ? 17.289 190.858 -13.595 1.00 162.08 ? 144  ARG A CG  1 
ATOM   522  C  CD  . ARG A 1  71  ? 16.525 192.172 -13.557 1.00 167.30 ? 144  ARG A CD  1 
ATOM   523  N  NE  . ARG A 1  71  ? 15.085 191.980 -13.710 1.00 190.56 ? 144  ARG A NE  1 
ATOM   524  C  CZ  . ARG A 1  71  ? 14.435 192.078 -14.865 1.00 203.48 ? 144  ARG A CZ  1 
ATOM   525  N  NH1 . ARG A 1  71  ? 13.123 191.888 -14.907 1.00 209.32 ? 144  ARG A NH1 1 
ATOM   526  N  NH2 . ARG A 1  71  ? 15.095 192.367 -15.978 1.00 214.64 ? 144  ARG A NH2 1 
ATOM   527  N  N   . ASN A 1  72  ? 17.567 186.634 -10.996 1.00 191.52 ? 145  ASN A N   1 
ATOM   528  C  CA  . ASN A 1  72  ? 17.016 185.654 -10.068 1.00 189.18 ? 145  ASN A CA  1 
ATOM   529  C  C   . ASN A 1  72  ? 18.022 185.318 -8.973  1.00 190.09 ? 145  ASN A C   1 
ATOM   530  O  O   . ASN A 1  72  ? 19.204 185.642 -9.084  1.00 176.39 ? 145  ASN A O   1 
ATOM   531  C  CB  . ASN A 1  72  ? 16.599 184.384 -10.813 1.00 175.42 ? 145  ASN A CB  1 
ATOM   532  N  N   . GLY A 1  73  ? 17.547 184.664 -7.918  1.00 204.12 ? 146  GLY A N   1 
ATOM   533  C  CA  . GLY A 1  73  ? 18.401 184.283 -6.809  1.00 199.08 ? 146  GLY A CA  1 
ATOM   534  C  C   . GLY A 1  73  ? 19.340 183.140 -7.143  1.00 196.60 ? 146  GLY A C   1 
ATOM   535  O  O   . GLY A 1  73  ? 19.490 182.767 -8.304  1.00 184.73 ? 146  GLY A O   1 
ATOM   536  N  N   . CYS A 1  74  ? 19.973 182.580 -6.118  1.00 232.08 ? 147  CYS A N   1 
ATOM   537  C  CA  . CYS A 1  74  ? 20.912 181.481 -6.309  1.00 237.58 ? 147  CYS A CA  1 
ATOM   538  C  C   . CYS A 1  74  ? 20.176 180.173 -6.577  1.00 229.32 ? 147  CYS A C   1 
ATOM   539  O  O   . CYS A 1  74  ? 20.767 179.201 -7.047  1.00 230.02 ? 147  CYS A O   1 
ATOM   540  C  CB  . CYS A 1  74  ? 21.816 181.332 -5.085  1.00 248.50 ? 147  CYS A CB  1 
ATOM   541  S  SG  . CYS A 1  74  ? 22.458 182.893 -4.438  1.00 273.59 ? 147  CYS A SG  1 
ATOM   542  N  N   . ILE A 1  75  ? 18.881 180.157 -6.276  1.00 208.00 ? 148  ILE A N   1 
ATOM   543  C  CA  . ILE A 1  75  ? 18.082 178.944 -6.389  1.00 177.01 ? 148  ILE A CA  1 
ATOM   544  C  C   . ILE A 1  75  ? 17.176 178.988 -7.614  1.00 184.96 ? 148  ILE A C   1 
ATOM   545  O  O   . ILE A 1  75  ? 17.129 178.040 -8.399  1.00 190.18 ? 148  ILE A O   1 
ATOM   546  C  CB  . ILE A 1  75  ? 17.245 178.720 -5.118  1.00 143.26 ? 148  ILE A CB  1 
ATOM   547  C  CG1 . ILE A 1  75  ? 18.125 178.842 -3.872  1.00 163.97 ? 148  ILE A CG1 1 
ATOM   548  C  CG2 . ILE A 1  75  ? 16.563 177.361 -5.161  1.00 145.92 ? 148  ILE A CG2 1 
ATOM   549  C  CD1 . ILE A 1  75  ? 17.359 178.740 -2.572  1.00 131.14 ? 148  ILE A CD1 1 
ATOM   550  N  N   . SER A 1  76  ? 16.457 180.095 -7.772  1.00 197.94 ? 149  SER A N   1 
ATOM   551  C  CA  . SER A 1  76  ? 15.455 180.218 -8.825  1.00 200.96 ? 149  SER A CA  1 
ATOM   552  C  C   . SER A 1  76  ? 16.071 180.408 -10.209 1.00 190.49 ? 149  SER A C   1 
ATOM   553  O  O   . SER A 1  76  ? 15.379 180.291 -11.220 1.00 208.95 ? 149  SER A O   1 
ATOM   554  C  CB  . SER A 1  76  ? 14.506 181.379 -8.517  1.00 193.67 ? 149  SER A CB  1 
ATOM   555  O  OG  . SER A 1  76  ? 15.211 182.603 -8.413  1.00 194.43 ? 149  SER A OG  1 
ATOM   556  N  N   . ILE A 1  77  ? 17.367 180.701 -10.258 1.00 144.20 ? 150  ILE A N   1 
ATOM   557  C  CA  . ILE A 1  77  ? 18.039 180.908 -11.535 1.00 140.29 ? 150  ILE A CA  1 
ATOM   558  C  C   . ILE A 1  77  ? 18.299 179.561 -12.204 1.00 156.01 ? 150  ILE A C   1 
ATOM   559  O  O   . ILE A 1  77  ? 18.447 179.483 -13.423 1.00 128.33 ? 150  ILE A O   1 
ATOM   560  C  CB  . ILE A 1  77  ? 19.348 181.709 -11.365 1.00 145.09 ? 150  ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1  77  ? 19.823 182.246 -12.718 1.00 136.12 ? 150  ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1  77  ? 20.429 180.851 -10.724 1.00 122.37 ? 150  ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1  77  ? 21.090 183.067 -12.641 1.00 125.91 ? 150  ILE A CD1 1 
ATOM   564  N  N   . TRP A 1  78  ? 18.341 178.498 -11.407 1.00 175.78 ? 151  TRP A N   1 
ATOM   565  C  CA  . TRP A 1  78  ? 18.566 177.161 -11.941 1.00 182.77 ? 151  TRP A CA  1 
ATOM   566  C  C   . TRP A 1  78  ? 17.288 176.593 -12.544 1.00 188.63 ? 151  TRP A C   1 
ATOM   567  O  O   . TRP A 1  78  ? 17.336 175.765 -13.451 1.00 183.92 ? 151  TRP A O   1 
ATOM   568  C  CB  . TRP A 1  78  ? 19.099 176.226 -10.857 1.00 181.94 ? 151  TRP A CB  1 
ATOM   569  C  CG  . TRP A 1  78  ? 20.507 176.525 -10.457 1.00 165.68 ? 151  TRP A CG  1 
ATOM   570  C  CD1 . TRP A 1  78  ? 20.925 177.096 -9.292  1.00 172.48 ? 151  TRP A CD1 1 
ATOM   571  C  CD2 . TRP A 1  78  ? 21.686 176.279 -11.230 1.00 167.49 ? 151  TRP A CD2 1 
ATOM   572  N  NE1 . TRP A 1  78  ? 22.293 177.216 -9.288  1.00 181.14 ? 151  TRP A NE1 1 
ATOM   573  C  CE2 . TRP A 1  78  ? 22.784 176.723 -10.468 1.00 178.86 ? 151  TRP A CE2 1 
ATOM   574  C  CE3 . TRP A 1  78  ? 21.920 175.725 -12.493 1.00 181.90 ? 151  TRP A CE3 1 
ATOM   575  C  CZ2 . TRP A 1  78  ? 24.096 176.630 -10.925 1.00 184.41 ? 151  TRP A CZ2 1 
ATOM   576  C  CZ3 . TRP A 1  78  ? 23.223 175.634 -12.945 1.00 197.07 ? 151  TRP A CZ3 1 
ATOM   577  C  CH2 . TRP A 1  78  ? 24.294 176.083 -12.163 1.00 196.40 ? 151  TRP A CH2 1 
ATOM   578  N  N   . ARG A 1  79  ? 16.146 177.048 -12.039 1.00 201.49 ? 152  ARG A N   1 
ATOM   579  C  CA  . ARG A 1  79  ? 14.856 176.639 -12.581 1.00 207.35 ? 152  ARG A CA  1 
ATOM   580  C  C   . ARG A 1  79  ? 14.715 177.126 -14.022 1.00 205.89 ? 152  ARG A C   1 
ATOM   581  O  O   . ARG A 1  79  ? 13.980 176.543 -14.819 1.00 211.58 ? 152  ARG A O   1 
ATOM   582  C  CB  . ARG A 1  79  ? 13.711 177.179 -11.719 1.00 204.47 ? 152  ARG A CB  1 
ATOM   583  C  CG  . ARG A 1  79  ? 12.337 176.641 -12.092 1.00 205.80 ? 152  ARG A CG  1 
ATOM   584  C  CD  . ARG A 1  79  ? 11.225 177.407 -11.391 1.00 222.51 ? 152  ARG A CD  1 
ATOM   585  N  NE  . ARG A 1  79  ? 11.305 177.303 -9.937  1.00 219.97 ? 152  ARG A NE  1 
ATOM   586  C  CZ  . ARG A 1  79  ? 10.440 177.868 -9.100  1.00 215.06 ? 152  ARG A CZ  1 
ATOM   587  N  NH1 . ARG A 1  79  ? 9.426  178.580 -9.573  1.00 204.74 ? 152  ARG A NH1 1 
ATOM   588  N  NH2 . ARG A 1  79  ? 10.587 177.722 -7.791  1.00 212.99 ? 152  ARG A NH2 1 
ATOM   589  N  N   . LYS A 1  80  ? 15.435 178.196 -14.348 1.00 172.51 ? 153  LYS A N   1 
ATOM   590  C  CA  . LYS A 1  80  ? 15.394 178.778 -15.684 1.00 168.30 ? 153  LYS A CA  1 
ATOM   591  C  C   . LYS A 1  80  ? 16.550 178.276 -16.550 1.00 179.27 ? 153  LYS A C   1 
ATOM   592  O  O   . LYS A 1  80  ? 16.644 178.619 -17.729 1.00 181.19 ? 153  LYS A O   1 
ATOM   593  C  CB  . LYS A 1  80  ? 15.429 180.306 -15.601 1.00 163.01 ? 153  LYS A CB  1 
ATOM   594  C  CG  . LYS A 1  80  ? 14.450 180.904 -14.598 1.00 167.86 ? 153  LYS A CG  1 
ATOM   595  C  CD  . LYS A 1  80  ? 13.016 180.498 -14.899 1.00 204.32 ? 153  LYS A CD  1 
ATOM   596  C  CE  . LYS A 1  80  ? 12.043 181.139 -13.919 1.00 198.39 ? 153  LYS A CE  1 
ATOM   597  N  NZ  . LYS A 1  80  ? 12.351 180.779 -12.507 1.00 175.96 ? 153  LYS A NZ  1 
ATOM   598  N  N   . ILE A 1  81  ? 17.429 177.470 -15.961 1.00 181.62 ? 154  ILE A N   1 
ATOM   599  C  CA  . ILE A 1  81  ? 18.573 176.921 -16.683 1.00 174.88 ? 154  ILE A CA  1 
ATOM   600  C  C   . ILE A 1  81  ? 18.544 175.396 -16.633 1.00 179.46 ? 154  ILE A C   1 
ATOM   601  O  O   . ILE A 1  81  ? 18.134 174.742 -17.592 1.00 199.60 ? 154  ILE A O   1 
ATOM   602  C  CB  . ILE A 1  81  ? 19.903 177.462 -16.120 1.00 171.34 ? 154  ILE A CB  1 
ATOM   603  C  CG1 . ILE A 1  81  ? 19.936 178.990 -16.192 1.00 180.64 ? 154  ILE A CG1 1 
ATOM   604  C  CG2 . ILE A 1  81  ? 21.086 176.877 -16.879 1.00 150.59 ? 154  ILE A CG2 1 
ATOM   605  C  CD1 . ILE A 1  81  ? 19.814 179.538 -17.593 1.00 177.17 ? 154  ILE A CD1 1 
ATOM   606  N  N   . CYS A 1  82  ? 18.984 174.837 -15.510 1.00 187.56 ? 155  CYS A N   1 
ATOM   607  C  CA  . CYS A 1  82  ? 18.988 173.393 -15.313 1.00 185.81 ? 155  CYS A CA  1 
ATOM   608  C  C   . CYS A 1  82  ? 18.405 173.056 -13.948 1.00 188.84 ? 155  CYS A C   1 
ATOM   609  O  O   . CYS A 1  82  ? 19.113 173.092 -12.941 1.00 203.61 ? 155  CYS A O   1 
ATOM   610  C  CB  . CYS A 1  82  ? 20.403 172.830 -15.442 1.00 186.96 ? 155  CYS A CB  1 
ATOM   611  S  SG  . CYS A 1  82  ? 21.167 173.107 -17.055 1.00 185.14 ? 155  CYS A SG  1 
ATOM   612  N  N   . PRO A 1  83  ? 17.104 172.731 -13.913 1.00 172.18 ? 156  PRO A N   1 
ATOM   613  C  CA  . PRO A 1  83  ? 16.345 172.504 -12.677 1.00 180.94 ? 156  PRO A CA  1 
ATOM   614  C  C   . PRO A 1  83  ? 16.960 171.448 -11.763 1.00 182.49 ? 156  PRO A C   1 
ATOM   615  O  O   . PRO A 1  83  ? 16.880 171.589 -10.544 1.00 205.29 ? 156  PRO A O   1 
ATOM   616  C  CB  . PRO A 1  83  ? 14.972 172.048 -13.188 1.00 190.17 ? 156  PRO A CB  1 
ATOM   617  C  CG  . PRO A 1  83  ? 15.205 171.601 -14.592 1.00 178.67 ? 156  PRO A CG  1 
ATOM   618  C  CD  . PRO A 1  83  ? 16.280 172.495 -15.109 1.00 171.86 ? 156  PRO A CD  1 
ATOM   619  N  N   . ILE A 1  84  ? 17.568 170.416 -12.341 1.00 150.16 ? 157  ILE A N   1 
ATOM   620  C  CA  . ILE A 1  84  ? 18.190 169.357 -11.552 1.00 155.83 ? 157  ILE A CA  1 
ATOM   621  C  C   . ILE A 1  84  ? 19.344 169.902 -10.718 1.00 172.40 ? 157  ILE A C   1 
ATOM   622  O  O   . ILE A 1  84  ? 19.609 169.417 -9.619  1.00 181.50 ? 157  ILE A O   1 
ATOM   623  C  CB  . ILE A 1  84  ? 18.671 168.203 -12.448 1.00 157.09 ? 157  ILE A CB  1 
ATOM   624  C  CG1 . ILE A 1  84  ? 19.325 168.749 -13.721 1.00 153.68 ? 157  ILE A CG1 1 
ATOM   625  C  CG2 . ILE A 1  84  ? 17.520 167.263 -12.768 1.00 155.93 ? 157  ILE A CG2 1 
ATOM   626  C  CD1 . ILE A 1  84  ? 19.891 167.676 -14.623 1.00 157.78 ? 157  ILE A CD1 1 
ATOM   627  N  N   . PHE A 1  85  ? 20.025 170.916 -11.242 1.00 165.74 ? 158  PHE A N   1 
ATOM   628  C  CA  . PHE A 1  85  ? 21.134 171.541 -10.532 1.00 157.99 ? 158  PHE A CA  1 
ATOM   629  C  C   . PHE A 1  85  ? 20.634 172.598 -9.554  1.00 154.74 ? 158  PHE A C   1 
ATOM   630  O  O   . PHE A 1  85  ? 21.423 173.333 -8.960  1.00 173.40 ? 158  PHE A O   1 
ATOM   631  C  CB  . PHE A 1  85  ? 22.121 172.160 -11.522 1.00 147.36 ? 158  PHE A CB  1 
ATOM   632  C  CG  . PHE A 1  85  ? 22.843 171.150 -12.363 1.00 148.18 ? 158  PHE A CG  1 
ATOM   633  C  CD1 . PHE A 1  85  ? 23.082 169.874 -11.881 1.00 139.44 ? 158  PHE A CD1 1 
ATOM   634  C  CD2 . PHE A 1  85  ? 23.279 171.473 -13.636 1.00 157.90 ? 158  PHE A CD2 1 
ATOM   635  C  CE1 . PHE A 1  85  ? 23.745 168.940 -12.651 1.00 143.47 ? 158  PHE A CE1 1 
ATOM   636  C  CE2 . PHE A 1  85  ? 23.943 170.543 -14.412 1.00 147.54 ? 158  PHE A CE2 1 
ATOM   637  C  CZ  . PHE A 1  85  ? 24.177 169.274 -13.919 1.00 145.54 ? 158  PHE A CZ  1 
ATOM   638  N  N   . LYS A 1  86  ? 19.316 172.660 -9.390  1.00 145.93 ? 159  LYS A N   1 
ATOM   639  C  CA  . LYS A 1  86  ? 18.690 173.610 -8.479  1.00 147.38 ? 159  LYS A CA  1 
ATOM   640  C  C   . LYS A 1  86  ? 19.150 173.366 -7.046  1.00 150.50 ? 159  LYS A C   1 
ATOM   641  O  O   . LYS A 1  86  ? 19.195 174.291 -6.231  1.00 182.28 ? 159  LYS A O   1 
ATOM   642  C  CB  . LYS A 1  86  ? 17.166 173.515 -8.580  1.00 146.02 ? 159  LYS A CB  1 
ATOM   643  C  CG  . LYS A 1  86  ? 16.419 174.647 -7.901  1.00 166.91 ? 159  LYS A CG  1 
ATOM   644  C  CD  . LYS A 1  86  ? 14.924 174.530 -8.146  1.00 174.23 ? 159  LYS A CD  1 
ATOM   645  C  CE  . LYS A 1  86  ? 14.168 175.698 -7.541  1.00 174.68 ? 159  LYS A CE  1 
ATOM   646  N  NZ  . LYS A 1  86  ? 12.703 175.589 -7.780  1.00 175.88 ? 159  LYS A NZ  1 
ATOM   647  N  N   . GLY A 1  87  ? 19.504 172.117 -6.753  1.00 123.64 ? 160  GLY A N   1 
ATOM   648  C  CA  . GLY A 1  87  ? 20.047 171.751 -5.458  1.00 138.53 ? 160  GLY A CA  1 
ATOM   649  C  C   . GLY A 1  87  ? 21.281 172.554 -5.098  1.00 131.19 ? 160  GLY A C   1 
ATOM   650  O  O   . GLY A 1  87  ? 21.569 172.767 -3.918  1.00 131.32 ? 160  GLY A O   1 
ATOM   651  N  N   . ILE A 1  88  ? 22.007 172.997 -6.123  1.00 126.62 ? 161  ILE A N   1 
ATOM   652  C  CA  . ILE A 1  88  ? 23.140 173.897 -5.949  1.00 114.45 ? 161  ILE A CA  1 
ATOM   653  C  C   . ILE A 1  88  ? 22.719 175.089 -5.102  1.00 135.00 ? 161  ILE A C   1 
ATOM   654  O  O   . ILE A 1  88  ? 23.353 175.401 -4.091  1.00 139.20 ? 161  ILE A O   1 
ATOM   655  C  CB  . ILE A 1  88  ? 23.697 174.360 -7.307  1.00 118.91 ? 161  ILE A CB  1 
ATOM   656  C  CG1 . ILE A 1  88  ? 24.504 173.241 -7.967  1.00 128.02 ? 161  ILE A CG1 1 
ATOM   657  C  CG2 . ILE A 1  88  ? 24.537 175.620 -7.147  1.00 104.59 ? 161  ILE A CG2 1 
ATOM   658  C  CD1 . ILE A 1  88  ? 25.051 173.615 -9.323  1.00 113.41 ? 161  ILE A CD1 1 
ATOM   659  N  N   . GLY A 1  89  ? 21.627 175.731 -5.510  1.00 154.45 ? 162  GLY A N   1 
ATOM   660  C  CA  . GLY A 1  89  ? 21.092 176.876 -4.798  1.00 137.55 ? 162  GLY A CA  1 
ATOM   661  C  C   . GLY A 1  89  ? 20.815 176.594 -3.336  1.00 136.92 ? 162  GLY A C   1 
ATOM   662  O  O   . GLY A 1  89  ? 20.882 177.492 -2.498  1.00 140.88 ? 162  GLY A O   1 
ATOM   663  N  N   . TYR A 1  90  ? 20.507 175.338 -3.028  1.00 147.09 ? 163  TYR A N   1 
ATOM   664  C  CA  . TYR A 1  90  ? 20.299 174.926 -1.648  1.00 156.77 ? 163  TYR A CA  1 
ATOM   665  C  C   . TYR A 1  90  ? 21.637 174.669 -0.965  1.00 141.00 ? 163  TYR A C   1 
ATOM   666  O  O   . TYR A 1  90  ? 21.855 175.103 0.169   1.00 136.27 ? 163  TYR A O   1 
ATOM   667  C  CB  . TYR A 1  90  ? 19.418 173.677 -1.581  1.00 161.68 ? 163  TYR A CB  1 
ATOM   668  C  CG  . TYR A 1  90  ? 17.952 173.946 -1.840  1.00 163.28 ? 163  TYR A CG  1 
ATOM   669  C  CD1 . TYR A 1  90  ? 17.412 175.210 -1.643  1.00 161.74 ? 163  TYR A CD1 1 
ATOM   670  C  CD2 . TYR A 1  90  ? 17.107 172.934 -2.277  1.00 166.53 ? 163  TYR A CD2 1 
ATOM   671  C  CE1 . TYR A 1  90  ? 16.073 175.460 -1.876  1.00 180.29 ? 163  TYR A CE1 1 
ATOM   672  C  CE2 . TYR A 1  90  ? 15.766 173.175 -2.514  1.00 181.40 ? 163  TYR A CE2 1 
ATOM   673  C  CZ  . TYR A 1  90  ? 15.255 174.440 -2.312  1.00 193.69 ? 163  TYR A CZ  1 
ATOM   674  O  OH  . TYR A 1  90  ? 13.921 174.684 -2.546  1.00 214.98 ? 163  TYR A OH  1 
ATOM   675  N  N   . ALA A 1  91  ? 22.527 173.973 -1.671  1.00 144.30 ? 164  ALA A N   1 
ATOM   676  C  CA  . ALA A 1  91  ? 23.833 173.601 -1.134  1.00 118.95 ? 164  ALA A CA  1 
ATOM   677  C  C   . ALA A 1  91  ? 24.561 174.822 -0.595  1.00 119.86 ? 164  ALA A C   1 
ATOM   678  O  O   . ALA A 1  91  ? 24.981 174.841 0.565   1.00 136.31 ? 164  ALA A O   1 
ATOM   679  C  CB  . ALA A 1  91  ? 24.669 172.911 -2.200  1.00 117.82 ? 164  ALA A CB  1 
ATOM   680  N  N   . ILE A 1  92  ? 24.682 175.838 -1.447  1.00 119.38 ? 165  ILE A N   1 
ATOM   681  C  CA  . ILE A 1  92  ? 25.280 177.116 -1.082  1.00 119.67 ? 165  ILE A CA  1 
ATOM   682  C  C   . ILE A 1  92  ? 24.723 177.605 0.247   1.00 123.42 ? 165  ILE A C   1 
ATOM   683  O  O   . ILE A 1  92  ? 25.482 177.972 1.148   1.00 176.94 ? 165  ILE A O   1 
ATOM   684  C  CB  . ILE A 1  92  ? 25.053 178.165 -2.183  1.00 125.74 ? 165  ILE A CB  1 
ATOM   685  C  CG1 . ILE A 1  92  ? 25.782 177.759 -3.466  1.00 148.31 ? 165  ILE A CG1 1 
ATOM   686  C  CG2 . ILE A 1  92  ? 25.500 179.539 -1.710  1.00 128.64 ? 165  ILE A CG2 1 
ATOM   687  C  CD1 . ILE A 1  92  ? 25.592 178.730 -4.609  1.00 182.02 ? 165  ILE A CD1 1 
ATOM   688  N  N   . CYS A 1  93  ? 23.396 177.585 0.364   1.00 104.73 ? 166  CYS A N   1 
ATOM   689  C  CA  . CYS A 1  93  ? 22.721 177.985 1.593   1.00 136.81 ? 166  CYS A CA  1 
ATOM   690  C  C   . CYS A 1  93  ? 23.316 177.257 2.789   1.00 128.38 ? 166  CYS A C   1 
ATOM   691  O  O   . CYS A 1  93  ? 23.789 177.891 3.735   1.00 142.71 ? 166  CYS A O   1 
ATOM   692  C  CB  . CYS A 1  93  ? 21.218 177.712 1.502   1.00 153.64 ? 166  CYS A CB  1 
ATOM   693  S  SG  . CYS A 1  93  ? 20.327 178.785 0.351   1.00 144.44 ? 166  CYS A SG  1 
ATOM   694  N  N   . ILE A 1  94  ? 23.316 175.927 2.724   1.00 112.59 ? 167  ILE A N   1 
ATOM   695  C  CA  . ILE A 1  94  ? 23.884 175.108 3.787   1.00 133.65 ? 167  ILE A CA  1 
ATOM   696  C  C   . ILE A 1  94  ? 25.329 175.526 4.006   1.00 139.37 ? 167  ILE A C   1 
ATOM   697  O  O   . ILE A 1  94  ? 25.764 175.722 5.145   1.00 112.91 ? 167  ILE A O   1 
ATOM   698  C  CB  . ILE A 1  94  ? 23.780 173.609 3.460   1.00 134.42 ? 167  ILE A CB  1 
ATOM   699  C  CG1 . ILE A 1  94  ? 22.315 173.205 3.279   1.00 128.72 ? 167  ILE A CG1 1 
ATOM   700  C  CG2 . ILE A 1  94  ? 24.438 172.778 4.550   1.00 111.58 ? 167  ILE A CG2 1 
ATOM   701  C  CD1 . ILE A 1  94  ? 22.123 171.743 2.942   1.00 147.40 ? 167  ILE A CD1 1 
ATOM   702  N  N   . ILE A 1  95  ? 26.052 175.690 2.901   1.00 151.48 ? 168  ILE A N   1 
ATOM   703  C  CA  . ILE A 1  95  ? 27.436 176.139 2.936   1.00 115.96 ? 168  ILE A CA  1 
ATOM   704  C  C   . ILE A 1  95  ? 27.546 177.411 3.762   1.00 109.19 ? 168  ILE A C   1 
ATOM   705  O  O   . ILE A 1  95  ? 28.380 177.506 4.668   1.00 122.26 ? 168  ILE A O   1 
ATOM   706  C  CB  . ILE A 1  95  ? 27.983 176.357 1.515   1.00 122.19 ? 168  ILE A CB  1 
ATOM   707  C  CG1 . ILE A 1  95  ? 28.214 175.015 0.821   1.00 118.97 ? 168  ILE A CG1 1 
ATOM   708  C  CG2 . ILE A 1  95  ? 29.271 177.151 1.558   1.00 109.45 ? 168  ILE A CG2 1 
ATOM   709  C  CD1 . ILE A 1  95  ? 29.251 174.166 1.504   1.00 109.79 ? 168  ILE A CD1 1 
ATOM   710  N  N   . ALA A 1  96  ? 26.674 178.371 3.463   1.00 122.09 ? 169  ALA A N   1 
ATOM   711  C  CA  . ALA A 1  96  ? 26.673 179.652 4.156   1.00 99.32  ? 169  ALA A CA  1 
ATOM   712  C  C   . ALA A 1  96  ? 26.551 179.445 5.658   1.00 99.30  ? 169  ALA A C   1 
ATOM   713  O  O   . ALA A 1  96  ? 27.257 180.088 6.439   1.00 125.20 ? 169  ALA A O   1 
ATOM   714  C  CB  . ALA A 1  96  ? 25.544 180.530 3.646   1.00 106.26 ? 169  ALA A CB  1 
ATOM   715  N  N   . PHE A 1  97  ? 25.679 178.519 6.051   1.00 103.55 ? 170  PHE A N   1 
ATOM   716  C  CA  . PHE A 1  97  ? 25.425 178.252 7.462   1.00 105.68 ? 170  PHE A CA  1 
ATOM   717  C  C   . PHE A 1  97  ? 26.701 177.855 8.190   1.00 101.46 ? 170  PHE A C   1 
ATOM   718  O  O   . PHE A 1  97  ? 26.879 178.162 9.370   1.00 109.99 ? 170  PHE A O   1 
ATOM   719  C  CB  . PHE A 1  97  ? 24.373 177.156 7.626   1.00 118.16 ? 170  PHE A CB  1 
ATOM   720  C  CG  . PHE A 1  97  ? 24.228 176.670 9.038   1.00 122.84 ? 170  PHE A CG  1 
ATOM   721  C  CD1 . PHE A 1  97  ? 23.651 177.476 10.004  1.00 140.06 ? 170  PHE A CD1 1 
ATOM   722  C  CD2 . PHE A 1  97  ? 24.675 175.411 9.402   1.00 108.10 ? 170  PHE A CD2 1 
ATOM   723  C  CE1 . PHE A 1  97  ? 23.519 177.034 11.308  1.00 123.65 ? 170  PHE A CE1 1 
ATOM   724  C  CE2 . PHE A 1  97  ? 24.546 174.963 10.703  1.00 110.69 ? 170  PHE A CE2 1 
ATOM   725  C  CZ  . PHE A 1  97  ? 23.967 175.776 11.657  1.00 102.54 ? 170  PHE A CZ  1 
ATOM   726  N  N   . TYR A 1  98  ? 27.590 177.172 7.477   1.00 135.98 ? 171  TYR A N   1 
ATOM   727  C  CA  . TYR A 1  98  ? 28.869 176.786 8.051   1.00 107.48 ? 171  TYR A CA  1 
ATOM   728  C  C   . TYR A 1  98  ? 29.805 177.985 8.066   1.00 95.97  ? 171  TYR A C   1 
ATOM   729  O  O   . TYR A 1  98  ? 30.485 178.244 9.063   1.00 108.55 ? 171  TYR A O   1 
ATOM   730  C  CB  . TYR A 1  98  ? 29.484 175.627 7.267   1.00 108.05 ? 171  TYR A CB  1 
ATOM   731  C  CG  . TYR A 1  98  ? 28.663 174.359 7.330   1.00 113.43 ? 171  TYR A CG  1 
ATOM   732  C  CD1 . TYR A 1  98  ? 27.879 174.073 8.441   1.00 111.77 ? 171  TYR A CD1 1 
ATOM   733  C  CD2 . TYR A 1  98  ? 28.666 173.452 6.279   1.00 151.95 ? 171  TYR A CD2 1 
ATOM   734  C  CE1 . TYR A 1  98  ? 27.124 172.919 8.504   1.00 127.14 ? 171  TYR A CE1 1 
ATOM   735  C  CE2 . TYR A 1  98  ? 27.913 172.295 6.333   1.00 163.53 ? 171  TYR A CE2 1 
ATOM   736  C  CZ  . TYR A 1  98  ? 27.145 172.034 7.448   1.00 142.15 ? 171  TYR A CZ  1 
ATOM   737  O  OH  . TYR A 1  98  ? 26.394 170.885 7.510   1.00 124.78 ? 171  TYR A OH  1 
ATOM   738  N  N   . ILE A 1  99  ? 29.807 178.727 6.962   1.00 103.57 ? 172  ILE A N   1 
ATOM   739  C  CA  . ILE A 1  99  ? 30.709 179.857 6.781   1.00 104.46 ? 172  ILE A CA  1 
ATOM   740  C  C   . ILE A 1  99  ? 30.477 180.910 7.854   1.00 109.91 ? 172  ILE A C   1 
ATOM   741  O  O   . ILE A 1  99  ? 31.420 181.405 8.478   1.00 138.93 ? 172  ILE A O   1 
ATOM   742  C  CB  . ILE A 1  99  ? 30.549 180.469 5.385   1.00 118.54 ? 172  ILE A CB  1 
ATOM   743  C  CG1 . ILE A 1  99  ? 31.119 179.532 4.322   1.00 104.38 ? 172  ILE A CG1 1 
ATOM   744  C  CG2 . ILE A 1  99  ? 31.232 181.816 5.334   1.00 129.55 ? 172  ILE A CG2 1 
ATOM   745  C  CD1 . ILE A 1  99  ? 30.989 180.064 2.927   1.00 127.98 ? 172  ILE A CD1 1 
ATOM   746  N  N   . ALA A 1  100 ? 29.210 181.234 8.083   1.00 119.98 ? 173  ALA A N   1 
ATOM   747  C  CA  . ALA A 1  100 ? 28.851 182.256 9.057   1.00 128.80 ? 173  ALA A CA  1 
ATOM   748  C  C   . ALA A 1  100 ? 29.102 181.779 10.485  1.00 108.28 ? 173  ALA A C   1 
ATOM   749  O  O   . ALA A 1  100 ? 28.946 182.544 11.439  1.00 149.68 ? 173  ALA A O   1 
ATOM   750  C  CB  . ALA A 1  100 ? 27.394 182.663 8.883   1.00 126.22 ? 173  ALA A CB  1 
ATOM   751  N  N   . SER A 1  101 ? 29.496 180.517 10.630  1.00 127.28 ? 174  SER A N   1 
ATOM   752  C  CA  . SER A 1  101 ? 29.730 179.948 11.950  1.00 133.48 ? 174  SER A CA  1 
ATOM   753  C  C   . SER A 1  101 ? 31.066 180.393 12.541  1.00 147.49 ? 174  SER A C   1 
ATOM   754  O  O   . SER A 1  101 ? 31.250 180.361 13.757  1.00 165.17 ? 174  SER A O   1 
ATOM   755  C  CB  . SER A 1  101 ? 29.669 178.421 11.889  1.00 112.39 ? 174  SER A CB  1 
ATOM   756  O  OG  . SER A 1  101 ? 28.367 177.978 11.548  1.00 121.84 ? 174  SER A OG  1 
ATOM   757  N  N   . TYR A 1  102 ? 31.993 180.814 11.685  1.00 138.77 ? 175  TYR A N   1 
ATOM   758  C  CA  . TYR A 1  102 ? 33.329 181.182 12.147  1.00 143.41 ? 175  TYR A CA  1 
ATOM   759  C  C   . TYR A 1  102 ? 33.798 182.533 11.610  1.00 145.15 ? 175  TYR A C   1 
ATOM   760  O  O   . TYR A 1  102 ? 34.683 183.162 12.190  1.00 171.31 ? 175  TYR A O   1 
ATOM   761  C  CB  . TYR A 1  102 ? 34.340 180.097 11.759  1.00 150.78 ? 175  TYR A CB  1 
ATOM   762  C  CG  . TYR A 1  102 ? 34.580 179.964 10.269  1.00 136.33 ? 175  TYR A CG  1 
ATOM   763  C  CD1 . TYR A 1  102 ? 33.783 179.137 9.488   1.00 130.49 ? 175  TYR A CD1 1 
ATOM   764  C  CD2 . TYR A 1  102 ? 35.612 180.655 9.647   1.00 145.20 ? 175  TYR A CD2 1 
ATOM   765  C  CE1 . TYR A 1  102 ? 34.003 179.009 8.127   1.00 128.14 ? 175  TYR A CE1 1 
ATOM   766  C  CE2 . TYR A 1  102 ? 35.838 180.535 8.289   1.00 131.87 ? 175  TYR A CE2 1 
ATOM   767  C  CZ  . TYR A 1  102 ? 35.031 179.711 7.534   1.00 122.06 ? 175  TYR A CZ  1 
ATOM   768  O  OH  . TYR A 1  102 ? 35.255 179.588 6.183   1.00 132.95 ? 175  TYR A OH  1 
ATOM   769  N  N   . TYR A 1  103 ? 33.208 182.974 10.504  1.00 123.50 ? 176  TYR A N   1 
ATOM   770  C  CA  . TYR A 1  103 ? 33.652 184.197 9.841   1.00 121.81 ? 176  TYR A CA  1 
ATOM   771  C  C   . TYR A 1  103 ? 33.381 185.442 10.685  1.00 136.53 ? 176  TYR A C   1 
ATOM   772  O  O   . TYR A 1  103 ? 34.048 186.464 10.528  1.00 148.99 ? 176  TYR A O   1 
ATOM   773  C  CB  . TYR A 1  103 ? 32.979 184.338 8.473   1.00 121.47 ? 176  TYR A CB  1 
ATOM   774  C  CG  . TYR A 1  103 ? 33.575 185.427 7.609   1.00 116.88 ? 176  TYR A CG  1 
ATOM   775  C  CD1 . TYR A 1  103 ? 34.695 185.182 6.826   1.00 109.72 ? 176  TYR A CD1 1 
ATOM   776  C  CD2 . TYR A 1  103 ? 33.019 186.700 7.575   1.00 153.49 ? 176  TYR A CD2 1 
ATOM   777  C  CE1 . TYR A 1  103 ? 35.246 186.172 6.036   1.00 109.23 ? 176  TYR A CE1 1 
ATOM   778  C  CE2 . TYR A 1  103 ? 33.563 187.696 6.789   1.00 163.55 ? 176  TYR A CE2 1 
ATOM   779  C  CZ  . TYR A 1  103 ? 34.676 187.427 6.022   1.00 152.20 ? 176  TYR A CZ  1 
ATOM   780  O  OH  . TYR A 1  103 ? 35.222 188.414 5.237   1.00 162.36 ? 176  TYR A OH  1 
ATOM   781  N  N   . ASN A 1  104 ? 32.406 185.351 11.583  1.00 138.66 ? 177  ASN A N   1 
ATOM   782  C  CA  . ASN A 1  104 ? 32.023 186.491 12.409  1.00 150.03 ? 177  ASN A CA  1 
ATOM   783  C  C   . ASN A 1  104 ? 32.752 186.495 13.751  1.00 148.39 ? 177  ASN A C   1 
ATOM   784  O  O   . ASN A 1  104 ? 32.876 187.539 14.394  1.00 174.24 ? 177  ASN A O   1 
ATOM   785  C  CB  . ASN A 1  104 ? 30.510 186.499 12.632  1.00 150.57 ? 177  ASN A CB  1 
ATOM   786  C  CG  . ASN A 1  104 ? 29.733 186.689 11.343  1.00 145.36 ? 177  ASN A CG  1 
ATOM   787  O  OD1 . ASN A 1  104 ? 29.423 187.815 10.951  1.00 170.97 ? 177  ASN A OD1 1 
ATOM   788  N  ND2 . ASN A 1  104 ? 29.413 185.586 10.677  1.00 139.85 ? 177  ASN A ND2 1 
ATOM   789  N  N   . THR A 1  105 ? 33.235 185.329 14.167  1.00 131.48 ? 178  THR A N   1 
ATOM   790  C  CA  . THR A 1  105 ? 33.945 185.207 15.435  1.00 130.19 ? 178  THR A CA  1 
ATOM   791  C  C   . THR A 1  105 ? 35.305 185.893 15.369  1.00 127.98 ? 178  THR A C   1 
ATOM   792  O  O   . THR A 1  105 ? 35.841 186.329 16.387  1.00 134.67 ? 178  THR A O   1 
ATOM   793  C  CB  . THR A 1  105 ? 34.139 183.735 15.836  1.00 110.31 ? 178  THR A CB  1 
ATOM   794  O  OG1 . THR A 1  105 ? 34.858 183.047 14.805  1.00 111.44 ? 178  THR A OG1 1 
ATOM   795  C  CG2 . THR A 1  105 ? 32.794 183.063 16.042  1.00 133.76 ? 178  THR A CG2 1 
ATOM   796  N  N   . ILE A 1  106 ? 35.859 185.984 14.165  1.00 112.67 ? 179  ILE A N   1 
ATOM   797  C  CA  . ILE A 1  106 ? 37.116 186.691 13.952  1.00 116.21 ? 179  ILE A CA  1 
ATOM   798  C  C   . ILE A 1  106 ? 36.894 188.176 14.211  1.00 135.12 ? 179  ILE A C   1 
ATOM   799  O  O   . ILE A 1  106 ? 37.686 188.832 14.896  1.00 160.06 ? 179  ILE A O   1 
ATOM   800  C  CB  . ILE A 1  106 ? 37.659 186.447 12.537  1.00 101.33 ? 179  ILE A CB  1 
ATOM   801  C  CG1 . ILE A 1  106 ? 37.722 184.946 12.247  1.00 96.81  ? 179  ILE A CG1 1 
ATOM   802  C  CG2 . ILE A 1  106 ? 39.032 187.078 12.380  1.00 105.05 ? 179  ILE A CG2 1 
ATOM   803  C  CD1 . ILE A 1  106 ? 38.160 184.611 10.837  1.00 111.47 ? 179  ILE A CD1 1 
ATOM   804  N  N   . MET A 1  107 ? 35.801 188.696 13.663  1.00 133.64 ? 180  MET A N   1 
ATOM   805  C  CA  . MET A 1  107 ? 35.401 190.074 13.908  1.00 151.85 ? 180  MET A CA  1 
ATOM   806  C  C   . MET A 1  107 ? 35.044 190.272 15.375  1.00 141.22 ? 180  MET A C   1 
ATOM   807  O  O   . MET A 1  107 ? 35.131 191.381 15.894  1.00 156.86 ? 180  MET A O   1 
ATOM   808  C  CB  . MET A 1  107 ? 34.215 190.464 13.026  1.00 177.57 ? 180  MET A CB  1 
ATOM   809  C  CG  . MET A 1  107 ? 34.543 190.620 11.554  1.00 168.91 ? 180  MET A CG  1 
ATOM   810  S  SD  . MET A 1  107 ? 33.124 191.226 10.621  1.00 162.57 ? 180  MET A SD  1 
ATOM   811  C  CE  . MET A 1  107 ? 31.957 189.890 10.866  1.00 153.75 ? 180  MET A CE  1 
ATOM   812  N  N   . ALA A 1  108 ? 34.620 189.197 16.033  1.00 115.33 ? 181  ALA A N   1 
ATOM   813  C  CA  . ALA A 1  108 ? 34.322 189.251 17.459  1.00 107.40 ? 181  ALA A CA  1 
ATOM   814  C  C   . ALA A 1  108 ? 35.614 189.410 18.246  1.00 140.90 ? 181  ALA A C   1 
ATOM   815  O  O   . ALA A 1  108 ? 35.659 190.121 19.250  1.00 148.32 ? 181  ALA A O   1 
ATOM   816  C  CB  . ALA A 1  108 ? 33.572 188.005 17.902  1.00 106.10 ? 181  ALA A CB  1 
ATOM   817  N  N   . TRP A 1  109 ? 36.664 188.741 17.781  1.00 121.45 ? 182  TRP A N   1 
ATOM   818  C  CA  . TRP A 1  109 ? 37.987 188.883 18.373  1.00 124.94 ? 182  TRP A CA  1 
ATOM   819  C  C   . TRP A 1  109 ? 38.489 190.309 18.178  1.00 141.26 ? 182  TRP A C   1 
ATOM   820  O  O   . TRP A 1  109 ? 38.966 190.943 19.118  1.00 150.32 ? 182  TRP A O   1 
ATOM   821  C  CB  . TRP A 1  109 ? 38.971 187.885 17.758  1.00 98.04  ? 182  TRP A CB  1 
ATOM   822  C  CG  . TRP A 1  109 ? 38.580 186.452 17.946  1.00 120.80 ? 182  TRP A CG  1 
ATOM   823  C  CD1 . TRP A 1  109 ? 37.710 185.952 18.870  1.00 127.67 ? 182  TRP A CD1 1 
ATOM   824  C  CD2 . TRP A 1  109 ? 39.043 185.331 17.183  1.00 92.41  ? 182  TRP A CD2 1 
ATOM   825  N  NE1 . TRP A 1  109 ? 37.605 184.589 18.733  1.00 107.10 ? 182  TRP A NE1 1 
ATOM   826  C  CE2 . TRP A 1  109 ? 38.412 184.184 17.705  1.00 91.39  ? 182  TRP A CE2 1 
ATOM   827  C  CE3 . TRP A 1  109 ? 39.929 185.187 16.112  1.00 90.58  ? 182  TRP A CE3 1 
ATOM   828  C  CZ2 . TRP A 1  109 ? 38.640 182.909 17.190  1.00 98.75  ? 182  TRP A CZ2 1 
ATOM   829  C  CZ3 . TRP A 1  109 ? 40.153 183.921 15.603  1.00 87.87  ? 182  TRP A CZ3 1 
ATOM   830  C  CH2 . TRP A 1  109 ? 39.512 182.799 16.142  1.00 109.37 ? 182  TRP A CH2 1 
ATOM   831  N  N   . ALA A 1  110 ? 38.368 190.808 16.951  1.00 131.14 ? 183  ALA A N   1 
ATOM   832  C  CA  . ALA A 1  110 ? 38.816 192.159 16.625  1.00 107.77 ? 183  ALA A CA  1 
ATOM   833  C  C   . ALA A 1  110 ? 38.026 193.211 17.401  1.00 127.60 ? 183  ALA A C   1 
ATOM   834  O  O   . ALA A 1  110 ? 38.542 194.282 17.717  1.00 158.60 ? 183  ALA A O   1 
ATOM   835  C  CB  . ALA A 1  110 ? 38.700 192.408 15.130  1.00 107.66 ? 183  ALA A CB  1 
ATOM   836  N  N   . LEU A 1  111 ? 36.772 192.894 17.704  1.00 129.75 ? 184  LEU A N   1 
ATOM   837  C  CA  . LEU A 1  111 ? 35.906 193.797 18.448  1.00 158.07 ? 184  LEU A CA  1 
ATOM   838  C  C   . LEU A 1  111 ? 36.274 193.784 19.923  1.00 150.34 ? 184  LEU A C   1 
ATOM   839  O  O   . LEU A 1  111 ? 36.278 194.824 20.581  1.00 131.91 ? 184  LEU A O   1 
ATOM   840  C  CB  . LEU A 1  111 ? 34.437 193.412 18.262  1.00 165.49 ? 184  LEU A CB  1 
ATOM   841  C  CG  . LEU A 1  111 ? 33.410 194.242 19.035  1.00 141.78 ? 184  LEU A CG  1 
ATOM   842  C  CD1 . LEU A 1  111 ? 33.510 195.713 18.660  1.00 127.71 ? 184  LEU A CD1 1 
ATOM   843  C  CD2 . LEU A 1  111 ? 32.005 193.716 18.789  1.00 126.96 ? 184  LEU A CD2 1 
ATOM   844  N  N   . TYR A 1  112 ? 36.587 192.599 20.437  1.00 135.84 ? 185  TYR A N   1 
ATOM   845  C  CA  . TYR A 1  112 ? 37.031 192.463 21.817  1.00 137.20 ? 185  TYR A CA  1 
ATOM   846  C  C   . TYR A 1  112 ? 38.372 193.166 21.988  1.00 125.70 ? 185  TYR A C   1 
ATOM   847  O  O   . TYR A 1  112 ? 38.697 193.652 23.070  1.00 117.67 ? 185  TYR A O   1 
ATOM   848  C  CB  . TYR A 1  112 ? 37.137 190.989 22.218  1.00 132.36 ? 185  TYR A CB  1 
ATOM   849  C  CG  . TYR A 1  112 ? 37.310 190.774 23.706  1.00 128.87 ? 185  TYR A CG  1 
ATOM   850  C  CD1 . TYR A 1  112 ? 36.213 190.761 24.557  1.00 135.80 ? 185  TYR A CD1 1 
ATOM   851  C  CD2 . TYR A 1  112 ? 38.570 190.583 24.258  1.00 135.13 ? 185  TYR A CD2 1 
ATOM   852  C  CE1 . TYR A 1  112 ? 36.366 190.567 25.917  1.00 176.87 ? 185  TYR A CE1 1 
ATOM   853  C  CE2 . TYR A 1  112 ? 38.732 190.387 25.617  1.00 135.29 ? 185  TYR A CE2 1 
ATOM   854  C  CZ  . TYR A 1  112 ? 37.627 190.379 26.441  1.00 163.98 ? 185  TYR A CZ  1 
ATOM   855  O  OH  . TYR A 1  112 ? 37.782 190.185 27.795  1.00 171.39 ? 185  TYR A OH  1 
ATOM   856  N  N   . TYR A 1  113 ? 39.145 193.220 20.907  1.00 116.41 ? 186  TYR A N   1 
ATOM   857  C  CA  . TYR A 1  113 ? 40.403 193.955 20.898  1.00 139.37 ? 186  TYR A CA  1 
ATOM   858  C  C   . TYR A 1  113 ? 40.148 195.457 20.820  1.00 143.90 ? 186  TYR A C   1 
ATOM   859  O  O   . TYR A 1  113 ? 40.882 196.250 21.408  1.00 139.94 ? 186  TYR A O   1 
ATOM   860  C  CB  . TYR A 1  113 ? 41.282 193.509 19.727  1.00 139.67 ? 186  TYR A CB  1 
ATOM   861  C  CG  . TYR A 1  113 ? 42.280 192.428 20.077  1.00 128.02 ? 186  TYR A CG  1 
ATOM   862  C  CD1 . TYR A 1  113 ? 41.913 191.090 20.084  1.00 122.54 ? 186  TYR A CD1 1 
ATOM   863  C  CD2 . TYR A 1  113 ? 43.593 192.748 20.395  1.00 133.64 ? 186  TYR A CD2 1 
ATOM   864  C  CE1 . TYR A 1  113 ? 42.823 190.101 20.401  1.00 127.69 ? 186  TYR A CE1 1 
ATOM   865  C  CE2 . TYR A 1  113 ? 44.511 191.767 20.711  1.00 148.70 ? 186  TYR A CE2 1 
ATOM   866  C  CZ  . TYR A 1  113 ? 44.121 190.445 20.714  1.00 146.24 ? 186  TYR A CZ  1 
ATOM   867  O  OH  . TYR A 1  113 ? 45.034 189.466 21.030  1.00 140.44 ? 186  TYR A OH  1 
ATOM   868  N  N   . LEU A 1  114 ? 39.103 195.838 20.093  1.00 120.73 ? 187  LEU A N   1 
ATOM   869  C  CA  . LEU A 1  114 ? 38.767 197.246 19.910  1.00 125.49 ? 187  LEU A CA  1 
ATOM   870  C  C   . LEU A 1  114 ? 38.260 197.869 21.207  1.00 139.31 ? 187  LEU A C   1 
ATOM   871  O  O   . LEU A 1  114 ? 38.646 198.983 21.562  1.00 137.09 ? 187  LEU A O   1 
ATOM   872  C  CB  . LEU A 1  114 ? 37.721 197.411 18.806  1.00 133.76 ? 187  LEU A CB  1 
ATOM   873  C  CG  . LEU A 1  114 ? 37.230 198.839 18.548  1.00 131.81 ? 187  LEU A CG  1 
ATOM   874  C  CD1 . LEU A 1  114 ? 38.377 199.735 18.104  1.00 139.19 ? 187  LEU A CD1 1 
ATOM   875  C  CD2 . LEU A 1  114 ? 36.107 198.850 17.521  1.00 132.72 ? 187  LEU A CD2 1 
ATOM   876  N  N   . ILE A 1  115 ? 37.397 197.145 21.912  1.00 129.05 ? 188  ILE A N   1 
ATOM   877  C  CA  . ILE A 1  115 ? 36.827 197.642 23.158  1.00 142.63 ? 188  ILE A CA  1 
ATOM   878  C  C   . ILE A 1  115 ? 37.874 197.621 24.266  1.00 150.89 ? 188  ILE A C   1 
ATOM   879  O  O   . ILE A 1  115 ? 37.735 198.312 25.275  1.00 187.13 ? 188  ILE A O   1 
ATOM   880  C  CB  . ILE A 1  115 ? 35.581 196.835 23.568  1.00 142.44 ? 188  ILE A CB  1 
ATOM   881  C  CG1 . ILE A 1  115 ? 35.954 195.380 23.860  1.00 150.27 ? 188  ILE A CG1 1 
ATOM   882  C  CG2 . ILE A 1  115 ? 34.517 196.909 22.484  1.00 157.78 ? 188  ILE A CG2 1 
ATOM   883  C  CD1 . ILE A 1  115 ? 34.782 194.528 24.300  1.00 155.24 ? 188  ILE A CD1 1 
ATOM   884  N  N   . SER A 1  116 ? 38.921 196.826 24.074  1.00 152.79 ? 189  SER A N   1 
ATOM   885  C  CA  . SER A 1  116 ? 40.007 196.751 25.042  1.00 165.56 ? 189  SER A CA  1 
ATOM   886  C  C   . SER A 1  116 ? 41.124 197.719 24.668  1.00 177.26 ? 189  SER A C   1 
ATOM   887  O  O   . SER A 1  116 ? 42.174 197.750 25.309  1.00 177.10 ? 189  SER A O   1 
ATOM   888  C  CB  . SER A 1  116 ? 40.552 195.325 25.135  1.00 129.29 ? 189  SER A CB  1 
ATOM   889  O  OG  . SER A 1  116 ? 39.531 194.413 25.502  1.00 129.56 ? 189  SER A OG  1 
ATOM   890  N  N   . SER A 1  117 ? 40.887 198.509 23.627  1.00 183.98 ? 190  SER A N   1 
ATOM   891  C  CA  . SER A 1  117 ? 41.879 199.462 23.146  1.00 185.48 ? 190  SER A CA  1 
ATOM   892  C  C   . SER A 1  117 ? 41.472 200.899 23.460  1.00 195.33 ? 190  SER A C   1 
ATOM   893  O  O   . SER A 1  117 ? 41.900 201.834 22.786  1.00 209.87 ? 190  SER A O   1 
ATOM   894  C  CB  . SER A 1  117 ? 42.093 199.296 21.641  1.00 180.09 ? 190  SER A CB  1 
ATOM   895  O  OG  . SER A 1  117 ? 43.058 200.214 21.158  1.00 204.77 ? 190  SER A OG  1 
ATOM   896  N  N   . PHE A 1  118 ? 40.643 201.068 24.485  1.00 182.81 ? 191  PHE A N   1 
ATOM   897  C  CA  . PHE A 1  118 ? 40.202 202.396 24.900  1.00 181.58 ? 191  PHE A CA  1 
ATOM   898  C  C   . PHE A 1  118 ? 40.925 202.842 26.167  1.00 181.79 ? 191  PHE A C   1 
ATOM   899  O  O   . PHE A 1  118 ? 40.669 203.926 26.692  1.00 208.62 ? 191  PHE A O   1 
ATOM   900  C  CB  . PHE A 1  118 ? 38.688 202.418 25.122  1.00 178.80 ? 191  PHE A CB  1 
ATOM   901  C  CG  . PHE A 1  118 ? 37.885 202.314 23.855  1.00 174.22 ? 191  PHE A CG  1 
ATOM   902  C  CD1 . PHE A 1  118 ? 38.451 202.630 22.631  1.00 167.82 ? 191  PHE A CD1 1 
ATOM   903  C  CD2 . PHE A 1  118 ? 36.562 201.906 23.890  1.00 163.43 ? 191  PHE A CD2 1 
ATOM   904  C  CE1 . PHE A 1  118 ? 37.715 202.537 21.465  1.00 148.20 ? 191  PHE A CE1 1 
ATOM   905  C  CE2 . PHE A 1  118 ? 35.820 201.811 22.727  1.00 157.29 ? 191  PHE A CE2 1 
ATOM   906  C  CZ  . PHE A 1  118 ? 36.398 202.127 21.513  1.00 148.76 ? 191  PHE A CZ  1 
ATOM   907  N  N   . THR A 1  119 ? 41.828 201.998 26.653  1.00 174.93 ? 192  THR A N   1 
ATOM   908  C  CA  . THR A 1  119 ? 42.602 202.304 27.851  1.00 183.11 ? 192  THR A CA  1 
ATOM   909  C  C   . THR A 1  119 ? 43.880 203.049 27.471  1.00 185.37 ? 192  THR A C   1 
ATOM   910  O  O   . THR A 1  119 ? 44.437 202.826 26.396  1.00 194.52 ? 192  THR A O   1 
ATOM   911  C  CB  . THR A 1  119 ? 42.959 201.022 28.632  1.00 202.20 ? 192  THR A CB  1 
ATOM   912  O  OG1 . THR A 1  119 ? 41.808 200.171 28.706  1.00 221.93 ? 192  THR A OG1 1 
ATOM   913  C  CG2 . THR A 1  119 ? 43.414 201.359 30.044  1.00 199.92 ? 192  THR A CG2 1 
ATOM   914  N  N   . ASP A 1  120 ? 44.335 203.937 28.351  1.00 229.23 ? 193  ASP A N   1 
ATOM   915  C  CA  . ASP A 1  120 ? 45.555 204.702 28.113  1.00 229.60 ? 193  ASP A CA  1 
ATOM   916  C  C   . ASP A 1  120 ? 46.769 203.782 28.006  1.00 234.29 ? 193  ASP A C   1 
ATOM   917  O  O   . ASP A 1  120 ? 47.723 204.079 27.287  1.00 242.94 ? 193  ASP A O   1 
ATOM   918  C  CB  . ASP A 1  120 ? 45.771 205.731 29.225  1.00 244.86 ? 193  ASP A CB  1 
ATOM   919  C  CG  . ASP A 1  120 ? 45.887 205.093 30.595  1.00 250.56 ? 193  ASP A CG  1 
ATOM   920  O  OD1 . ASP A 1  120 ? 45.249 204.044 30.820  1.00 262.76 ? 193  ASP A OD1 1 
ATOM   921  O  OD2 . ASP A 1  120 ? 46.617 205.642 31.448  1.00 241.20 ? 193  ASP A OD2 1 
ATOM   922  N  N   . GLN A 1  121 ? 46.725 202.665 28.726  1.00 220.93 ? 194  GLN A N   1 
ATOM   923  C  CA  . GLN A 1  121 ? 47.780 201.661 28.653  1.00 178.96 ? 194  GLN A CA  1 
ATOM   924  C  C   . GLN A 1  121 ? 47.223 200.350 28.110  1.00 150.13 ? 194  GLN A C   1 
ATOM   925  O  O   . GLN A 1  121 ? 46.369 199.720 28.735  1.00 140.51 ? 194  GLN A O   1 
ATOM   926  C  CB  . GLN A 1  121 ? 48.420 201.445 30.025  1.00 187.95 ? 194  GLN A CB  1 
ATOM   927  C  CG  . GLN A 1  121 ? 49.167 202.659 30.560  1.00 215.92 ? 194  GLN A CG  1 
ATOM   928  C  CD  . GLN A 1  121 ? 50.376 203.023 29.718  1.00 225.66 ? 194  GLN A CD  1 
ATOM   929  O  OE1 . GLN A 1  121 ? 50.927 202.185 29.004  1.00 232.65 ? 194  GLN A OE1 1 
ATOM   930  N  NE2 . GLN A 1  121 ? 50.793 204.281 29.798  1.00 225.85 ? 194  GLN A NE2 1 
ATOM   931  N  N   . LEU A 1  122 ? 47.714 199.948 26.942  1.00 151.36 ? 195  LEU A N   1 
ATOM   932  C  CA  . LEU A 1  122 ? 47.212 198.765 26.252  1.00 149.43 ? 195  LEU A CA  1 
ATOM   933  C  C   . LEU A 1  122 ? 47.558 197.489 27.019  1.00 154.40 ? 195  LEU A C   1 
ATOM   934  O  O   . LEU A 1  122 ? 48.672 197.346 27.524  1.00 174.83 ? 195  LEU A O   1 
ATOM   935  C  CB  . LEU A 1  122 ? 47.769 198.698 24.824  1.00 126.99 ? 195  LEU A CB  1 
ATOM   936  C  CG  . LEU A 1  122 ? 47.457 199.882 23.898  1.00 130.20 ? 195  LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1  122 ? 48.471 201.006 24.062  1.00 183.98 ? 195  LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1  122 ? 47.382 199.443 22.445  1.00 127.26 ? 195  LEU A CD2 1 
ATOM   939  N  N   . PRO A 1  123 ? 46.591 196.561 27.109  1.00 139.65 ? 196  PRO A N   1 
ATOM   940  C  CA  . PRO A 1  123 ? 46.703 195.318 27.884  1.00 150.84 ? 196  PRO A CA  1 
ATOM   941  C  C   . PRO A 1  123 ? 47.866 194.413 27.475  1.00 140.10 ? 196  PRO A C   1 
ATOM   942  O  O   . PRO A 1  123 ? 48.538 193.862 28.348  1.00 156.22 ? 196  PRO A O   1 
ATOM   943  C  CB  . PRO A 1  123 ? 45.367 194.620 27.612  1.00 150.04 ? 196  PRO A CB  1 
ATOM   944  C  CG  . PRO A 1  123 ? 44.428 195.722 27.271  1.00 141.38 ? 196  PRO A CG  1 
ATOM   945  C  CD  . PRO A 1  123 ? 45.254 196.711 26.508  1.00 141.80 ? 196  PRO A CD  1 
ATOM   946  N  N   . TRP A 1  124 ? 48.098 194.260 26.175  1.00 126.39 ? 197  TRP A N   1 
ATOM   947  C  CA  . TRP A 1  124 ? 49.127 193.341 25.690  1.00 111.11 ? 197  TRP A CA  1 
ATOM   948  C  C   . TRP A 1  124 ? 50.547 193.900 25.731  1.00 112.35 ? 197  TRP A C   1 
ATOM   949  O  O   . TRP A 1  124 ? 51.451 193.365 25.088  1.00 110.11 ? 197  TRP A O   1 
ATOM   950  C  CB  . TRP A 1  124 ? 48.751 192.798 24.308  1.00 108.31 ? 197  TRP A CB  1 
ATOM   951  C  CG  . TRP A 1  124 ? 48.616 193.848 23.247  1.00 123.47 ? 197  TRP A CG  1 
ATOM   952  C  CD1 . TRP A 1  124 ? 49.605 194.330 22.439  1.00 137.74 ? 197  TRP A CD1 1 
ATOM   953  C  CD2 . TRP A 1  124 ? 47.418 194.537 22.869  1.00 112.22 ? 197  TRP A CD2 1 
ATOM   954  N  NE1 . TRP A 1  124 ? 49.098 195.281 21.586  1.00 141.36 ? 197  TRP A NE1 1 
ATOM   955  C  CE2 . TRP A 1  124 ? 47.758 195.425 21.829  1.00 113.70 ? 197  TRP A CE2 1 
ATOM   956  C  CE3 . TRP A 1  124 ? 46.092 194.490 23.310  1.00 122.19 ? 197  TRP A CE3 1 
ATOM   957  C  CZ2 . TRP A 1  124 ? 46.820 196.258 21.224  1.00 116.11 ? 197  TRP A CZ2 1 
ATOM   958  C  CZ3 . TRP A 1  124 ? 45.163 195.320 22.708  1.00 122.28 ? 197  TRP A CZ3 1 
ATOM   959  C  CH2 . TRP A 1  124 ? 45.532 196.193 21.679  1.00 125.83 ? 197  TRP A CH2 1 
ATOM   960  N  N   . THR A 1  125 ? 50.742 194.970 26.494  1.00 116.19 ? 198  THR A N   1 
ATOM   961  C  CA  . THR A 1  125 ? 52.048 195.608 26.587  1.00 118.01 ? 198  THR A CA  1 
ATOM   962  C  C   . THR A 1  125 ? 52.794 195.146 27.833  1.00 126.81 ? 198  THR A C   1 
ATOM   963  O  O   . THR A 1  125 ? 53.994 194.877 27.788  1.00 123.93 ? 198  THR A O   1 
ATOM   964  C  CB  . THR A 1  125 ? 51.918 197.143 26.609  1.00 122.71 ? 198  THR A CB  1 
ATOM   965  O  OG1 . THR A 1  125 ? 51.194 197.580 25.453  1.00 122.90 ? 198  THR A OG1 1 
ATOM   966  C  CG2 . THR A 1  125 ? 53.294 197.795 26.612  1.00 171.18 ? 198  THR A CG2 1 
ATOM   967  N  N   . SER A 1  126 ? 52.071 195.046 28.944  1.00 132.83 ? 199  SER A N   1 
ATOM   968  C  CA  . SER A 1  126 ? 52.667 194.642 30.211  1.00 163.17 ? 199  SER A CA  1 
ATOM   969  C  C   . SER A 1  126 ? 52.334 193.192 30.549  1.00 148.20 ? 199  SER A C   1 
ATOM   970  O  O   . SER A 1  126 ? 51.364 192.632 30.040  1.00 129.67 ? 199  SER A O   1 
ATOM   971  C  CB  . SER A 1  126 ? 52.199 195.564 31.339  1.00 196.33 ? 199  SER A CB  1 
ATOM   972  O  OG  . SER A 1  126 ? 52.613 196.900 31.112  1.00 224.13 ? 199  SER A OG  1 
ATOM   973  N  N   . CYS A 1  127 ? 53.148 192.590 31.412  1.00 159.06 ? 200  CYS A N   1 
ATOM   974  C  CA  . CYS A 1  127 ? 52.931 191.214 31.848  1.00 144.17 ? 200  CYS A CA  1 
ATOM   975  C  C   . CYS A 1  127 ? 52.180 191.161 33.172  1.00 142.60 ? 200  CYS A C   1 
ATOM   976  O  O   . CYS A 1  127 ? 51.811 190.086 33.641  1.00 128.36 ? 200  CYS A O   1 
ATOM   977  C  CB  . CYS A 1  127 ? 54.263 190.472 31.984  1.00 147.75 ? 200  CYS A CB  1 
ATOM   978  S  SG  . CYS A 1  127 ? 55.017 189.967 30.425  1.00 198.44 ? 200  CYS A SG  1 
ATOM   979  N  N   . LYS A 1  128 ? 51.961 192.324 33.774  1.00 162.16 ? 201  LYS A N   1 
ATOM   980  C  CA  . LYS A 1  128 ? 51.273 192.399 35.057  1.00 169.47 ? 201  LYS A CA  1 
ATOM   981  C  C   . LYS A 1  128 ? 49.760 192.343 34.872  1.00 179.03 ? 201  LYS A C   1 
ATOM   982  O  O   . LYS A 1  128 ? 49.065 193.341 35.064  1.00 210.29 ? 201  LYS A O   1 
ATOM   983  C  CB  . LYS A 1  128 ? 51.668 193.675 35.802  1.00 182.47 ? 201  LYS A CB  1 
ATOM   984  N  N   . ASN A 1  129 ? 49.256 191.172 34.495  1.00 151.63 ? 202  ASN A N   1 
ATOM   985  C  CA  . ASN A 1  129 ? 47.822 190.978 34.308  1.00 136.08 ? 202  ASN A CA  1 
ATOM   986  C  C   . ASN A 1  129 ? 47.344 189.726 35.037  1.00 135.04 ? 202  ASN A C   1 
ATOM   987  O  O   . ASN A 1  129 ? 48.124 189.050 35.707  1.00 179.15 ? 202  ASN A O   1 
ATOM   988  C  CB  . ASN A 1  129 ? 47.479 190.887 32.820  1.00 129.66 ? 202  ASN A CB  1 
ATOM   989  C  CG  . ASN A 1  129 ? 47.900 192.122 32.048  1.00 142.86 ? 202  ASN A CG  1 
ATOM   990  O  OD1 . ASN A 1  129 ? 47.157 193.101 31.964  1.00 133.04 ? 202  ASN A OD1 1 
ATOM   991  N  ND2 . ASN A 1  129 ? 49.098 192.083 31.476  1.00 149.14 ? 202  ASN A ND2 1 
ATOM   992  N  N   . SER A 1  130 ? 46.058 189.421 34.899  1.00 127.94 ? 203  SER A N   1 
ATOM   993  C  CA  . SER A 1  130 ? 45.466 188.281 35.590  1.00 136.63 ? 203  SER A CA  1 
ATOM   994  C  C   . SER A 1  130 ? 45.407 187.041 34.703  1.00 146.85 ? 203  SER A C   1 
ATOM   995  O  O   . SER A 1  130 ? 44.865 186.008 35.100  1.00 162.97 ? 203  SER A O   1 
ATOM   996  C  CB  . SER A 1  130 ? 44.062 188.633 36.087  1.00 160.20 ? 203  SER A CB  1 
ATOM   997  O  OG  . SER A 1  130 ? 43.209 188.979 35.009  1.00 145.28 ? 203  SER A OG  1 
ATOM   998  N  N   . TRP A 1  131 ? 45.969 187.148 33.503  1.00 149.37 ? 204  TRP A N   1 
ATOM   999  C  CA  . TRP A 1  131 ? 45.960 186.036 32.561  1.00 137.08 ? 204  TRP A CA  1 
ATOM   1000 C  C   . TRP A 1  131 ? 47.372 185.631 32.143  1.00 137.08 ? 204  TRP A C   1 
ATOM   1001 O  O   . TRP A 1  131 ? 47.572 184.547 31.600  1.00 139.92 ? 204  TRP A O   1 
ATOM   1002 C  CB  . TRP A 1  131 ? 45.125 186.390 31.326  1.00 124.53 ? 204  TRP A CB  1 
ATOM   1003 C  CG  . TRP A 1  131 ? 45.537 187.670 30.664  1.00 116.89 ? 204  TRP A CG  1 
ATOM   1004 C  CD1 . TRP A 1  131 ? 46.548 187.840 29.764  1.00 103.77 ? 204  TRP A CD1 1 
ATOM   1005 C  CD2 . TRP A 1  131 ? 44.943 188.961 30.849  1.00 108.84 ? 204  TRP A CD2 1 
ATOM   1006 N  NE1 . TRP A 1  131 ? 46.624 189.157 29.380  1.00 106.15 ? 204  TRP A NE1 1 
ATOM   1007 C  CE2 . TRP A 1  131 ? 45.649 189.866 30.031  1.00 109.31 ? 204  TRP A CE2 1 
ATOM   1008 C  CE3 . TRP A 1  131 ? 43.886 189.439 31.628  1.00 111.98 ? 204  TRP A CE3 1 
ATOM   1009 C  CZ2 . TRP A 1  131 ? 45.330 191.221 29.970  1.00 112.81 ? 204  TRP A CZ2 1 
ATOM   1010 C  CZ3 . TRP A 1  131 ? 43.571 190.785 31.566  1.00 145.29 ? 204  TRP A CZ3 1 
ATOM   1011 C  CH2 . TRP A 1  131 ? 44.291 191.660 30.743  1.00 135.43 ? 204  TRP A CH2 1 
ATOM   1012 N  N   . ASN A 1  132 ? 48.345 186.499 32.398  1.00 122.20 ? 205  ASN A N   1 
ATOM   1013 C  CA  . ASN A 1  132 ? 49.734 186.212 32.060  1.00 105.30 ? 205  ASN A CA  1 
ATOM   1014 C  C   . ASN A 1  132 ? 50.322 185.157 32.989  1.00 106.90 ? 205  ASN A C   1 
ATOM   1015 O  O   . ASN A 1  132 ? 49.801 184.909 34.077  1.00 116.62 ? 205  ASN A O   1 
ATOM   1016 C  CB  . ASN A 1  132 ? 50.574 187.489 32.117  1.00 112.01 ? 205  ASN A CB  1 
ATOM   1017 C  CG  . ASN A 1  132 ? 50.325 188.404 30.933  1.00 132.80 ? 205  ASN A CG  1 
ATOM   1018 O  OD1 . ASN A 1  132 ? 49.376 189.188 30.922  1.00 150.11 ? 205  ASN A OD1 1 
ATOM   1019 N  ND2 . ASN A 1  132 ? 51.186 188.311 29.930  1.00 161.20 ? 205  ASN A ND2 1 
ATOM   1020 N  N   . THR A 1  133 ? 51.411 184.536 32.551  1.00 99.73  ? 206  THR A N   1 
ATOM   1021 C  CA  . THR A 1  133 ? 52.067 183.503 33.338  1.00 99.13  ? 206  THR A CA  1 
ATOM   1022 C  C   . THR A 1  133 ? 53.489 183.921 33.695  1.00 100.45 ? 206  THR A C   1 
ATOM   1023 O  O   . THR A 1  133 ? 53.914 185.037 33.387  1.00 101.97 ? 206  THR A O   1 
ATOM   1024 C  CB  . THR A 1  133 ? 52.152 182.173 32.565  1.00 126.43 ? 206  THR A CB  1 
ATOM   1025 O  OG1 . THR A 1  133 ? 52.914 182.363 31.367  1.00 94.72  ? 206  THR A OG1 1 
ATOM   1026 C  CG2 . THR A 1  133 ? 50.762 181.675 32.201  1.00 128.96 ? 206  THR A CG2 1 
ATOM   1027 N  N   . GLY A 1  134 ? 54.220 183.016 34.341  1.00 113.95 ? 207  GLY A N   1 
ATOM   1028 C  CA  . GLY A 1  134 ? 55.600 183.268 34.719  1.00 111.42 ? 207  GLY A CA  1 
ATOM   1029 C  C   . GLY A 1  134 ? 56.554 183.374 33.541  1.00 107.90 ? 207  GLY A C   1 
ATOM   1030 O  O   . GLY A 1  134 ? 57.656 183.920 33.651  1.00 137.61 ? 207  GLY A O   1 
ATOM   1031 N  N   . ASN A 1  135 ? 56.123 182.849 32.403  1.00 103.94 ? 208  ASN A N   1 
ATOM   1032 C  CA  . ASN A 1  135 ? 56.929 182.882 31.198  1.00 96.64  ? 208  ASN A CA  1 
ATOM   1033 C  C   . ASN A 1  135 ? 56.919 184.254 30.533  1.00 118.70 ? 208  ASN A C   1 
ATOM   1034 O  O   . ASN A 1  135 ? 57.787 184.570 29.718  1.00 97.97  ? 208  ASN A O   1 
ATOM   1035 C  CB  . ASN A 1  135 ? 56.415 181.840 30.212  1.00 93.72  ? 208  ASN A CB  1 
ATOM   1036 C  CG  . ASN A 1  135 ? 56.803 180.425 30.594  1.00 97.53  ? 208  ASN A CG  1 
ATOM   1037 O  OD1 . ASN A 1  135 ? 57.923 180.174 31.046  1.00 93.57  ? 208  ASN A OD1 1 
ATOM   1038 N  ND2 . ASN A 1  135 ? 55.873 179.489 30.412  1.00 142.22 ? 208  ASN A ND2 1 
ATOM   1039 N  N   . CYS A 1  136 ? 55.851 185.009 30.896  1.00 138.75 ? 209  CYS A N   1 
ATOM   1040 C  CA  . CYS A 1  136 ? 55.626 186.294 30.239  1.00 137.50 ? 209  CYS A CA  1 
ATOM   1041 C  C   . CYS A 1  136 ? 56.823 187.229 30.398  1.00 160.10 ? 209  CYS A C   1 
ATOM   1042 O  O   . CYS A 1  136 ? 57.215 187.575 31.513  1.00 168.57 ? 209  CYS A O   1 
ATOM   1043 C  CB  . CYS A 1  136 ? 54.366 186.967 30.787  1.00 154.95 ? 209  CYS A CB  1 
ATOM   1044 S  SG  . CYS A 1  136 ? 53.775 188.382 29.816  1.00 167.24 ? 209  CYS A SG  1 
ATOM   1045 N  N   . THR A 1  137 ? 57.290 187.656 29.336  1.00 152.59 ? 210  THR A N   1 
ATOM   1046 C  CA  . THR A 1  137 ? 58.389 188.599 29.316  1.00 147.32 ? 210  THR A CA  1 
ATOM   1047 C  C   . THR A 1  137 ? 58.156 189.695 28.285  1.00 143.16 ? 210  THR A C   1 
ATOM   1048 O  O   . THR A 1  137 ? 58.007 189.398 27.119  1.00 133.37 ? 210  THR A O   1 
ATOM   1049 C  CB  . THR A 1  137 ? 59.670 187.868 28.938  1.00 124.10 ? 210  THR A CB  1 
ATOM   1050 O  OG1 . THR A 1  137 ? 59.624 187.550 27.549  1.00 117.43 ? 210  THR A OG1 1 
ATOM   1051 C  CG2 . THR A 1  137 ? 59.770 186.582 29.703  1.00 110.15 ? 210  THR A CG2 1 
ATOM   1052 N  N   . ASN A 1  138 ? 58.189 190.954 28.699  1.00 168.25 ? 211  ASN A N   1 
ATOM   1053 C  CA  . ASN A 1  138 ? 57.894 192.075 27.824  1.00 178.64 ? 211  ASN A CA  1 
ATOM   1054 C  C   . ASN A 1  138 ? 59.130 192.953 27.676  1.00 182.91 ? 211  ASN A C   1 
ATOM   1055 O  O   . ASN A 1  138 ? 60.205 192.655 28.201  1.00 199.74 ? 211  ASN A O   1 
ATOM   1056 C  CB  . ASN A 1  138 ? 56.710 192.882 28.363  1.00 197.61 ? 211  ASN A CB  1 
ATOM   1057 C  CG  . ASN A 1  138 ? 57.030 193.587 29.665  1.00 223.80 ? 211  ASN A CG  1 
ATOM   1058 O  OD1 . ASN A 1  138 ? 57.817 193.095 30.476  1.00 236.00 ? 211  ASN A OD1 1 
ATOM   1059 N  ND2 . ASN A 1  138 ? 56.421 194.748 29.876  1.00 228.01 ? 211  ASN A ND2 1 
ATOM   1060 N  N   . TYR A 1  139 ? 58.965 194.052 26.945  1.00 188.65 ? 212  TYR A N   1 
ATOM   1061 C  CA  . TYR A 1  139 ? 60.019 195.037 26.785  1.00 204.12 ? 212  TYR A CA  1 
ATOM   1062 C  C   . TYR A 1  139 ? 59.766 196.216 27.722  1.00 222.35 ? 212  TYR A C   1 
ATOM   1063 O  O   . TYR A 1  139 ? 58.814 196.222 28.510  1.00 224.40 ? 212  TYR A O   1 
ATOM   1064 C  CB  . TYR A 1  139 ? 60.131 195.462 25.321  1.00 200.49 ? 212  TYR A CB  1 
ATOM   1065 C  CG  . TYR A 1  139 ? 60.873 194.442 24.485  1.00 207.46 ? 212  TYR A CG  1 
ATOM   1066 C  CD1 . TYR A 1  139 ? 60.236 193.298 24.023  1.00 217.61 ? 212  TYR A CD1 1 
ATOM   1067 C  CD2 . TYR A 1  139 ? 62.218 194.612 24.181  1.00 201.65 ? 212  TYR A CD2 1 
ATOM   1068 C  CE1 . TYR A 1  139 ? 60.913 192.358 23.269  1.00 212.84 ? 212  TYR A CE1 1 
ATOM   1069 C  CE2 . TYR A 1  139 ? 62.903 193.679 23.426  1.00 201.26 ? 212  TYR A CE2 1 
ATOM   1070 C  CZ  . TYR A 1  139 ? 62.246 192.553 22.972  1.00 205.33 ? 212  TYR A CZ  1 
ATOM   1071 O  OH  . TYR A 1  139 ? 62.924 191.620 22.221  1.00 214.17 ? 212  TYR A OH  1 
ATOM   1072 N  N   . PHE A 1  140 ? 60.639 197.221 27.639  1.00 229.20 ? 213  PHE A N   1 
ATOM   1073 C  CA  . PHE A 1  140 ? 60.804 198.221 28.697  1.00 223.38 ? 213  PHE A CA  1 
ATOM   1074 C  C   . PHE A 1  140 ? 61.168 197.542 30.016  1.00 212.23 ? 213  PHE A C   1 
ATOM   1075 O  O   . PHE A 1  140 ? 60.883 198.054 31.102  1.00 223.68 ? 213  PHE A O   1 
ATOM   1076 C  CB  . PHE A 1  140 ? 59.558 199.102 28.852  1.00 211.78 ? 213  PHE A CB  1 
ATOM   1077 C  CG  . PHE A 1  140 ? 59.808 200.383 29.601  1.00 205.67 ? 213  PHE A CG  1 
ATOM   1078 C  CD1 . PHE A 1  140 ? 60.606 201.375 29.056  1.00 211.81 ? 213  PHE A CD1 1 
ATOM   1079 C  CD2 . PHE A 1  140 ? 59.237 200.598 30.847  1.00 197.40 ? 213  PHE A CD2 1 
ATOM   1080 C  CE1 . PHE A 1  140 ? 60.838 202.552 29.740  1.00 212.19 ? 213  PHE A CE1 1 
ATOM   1081 C  CE2 . PHE A 1  140 ? 59.466 201.775 31.535  1.00 198.40 ? 213  PHE A CE2 1 
ATOM   1082 C  CZ  . PHE A 1  140 ? 60.268 202.754 30.979  1.00 203.11 ? 213  PHE A CZ  1 
ATOM   1083 N  N   . SER A 1  141 ? 61.799 196.380 29.911  1.00 196.03 ? 214  SER A N   1 
ATOM   1084 C  CA  . SER A 1  141 ? 62.242 195.557 31.024  1.00 206.02 ? 214  SER A CA  1 
ATOM   1085 C  C   . SER A 1  141 ? 63.767 195.478 31.001  1.00 239.83 ? 214  SER A C   1 
ATOM   1086 O  O   . SER A 1  141 ? 64.434 196.185 30.238  1.00 250.39 ? 214  SER A O   1 
ATOM   1087 C  CB  . SER A 1  141 ? 61.597 194.170 30.957  1.00 180.02 ? 214  SER A CB  1 
ATOM   1088 O  OG  . SER A 1  141 ? 62.043 193.346 32.020  1.00 164.29 ? 214  SER A OG  1 
ATOM   1089 N  N   . GLU A 1  142 ? 64.317 194.630 31.868  1.00 267.65 ? 215  GLU A N   1 
ATOM   1090 C  CA  . GLU A 1  142 ? 65.757 194.410 31.908  1.00 285.39 ? 215  GLU A CA  1 
ATOM   1091 C  C   . GLU A 1  142 ? 66.284 194.033 30.529  1.00 281.90 ? 215  GLU A C   1 
ATOM   1092 O  O   . GLU A 1  142 ? 65.617 193.341 29.758  1.00 279.54 ? 215  GLU A O   1 
ATOM   1093 C  CB  . GLU A 1  142 ? 66.088 193.308 32.916  1.00 292.54 ? 215  GLU A CB  1 
ATOM   1094 C  CG  . GLU A 1  142 ? 65.342 192.003 32.662  1.00 295.26 ? 215  GLU A CG  1 
ATOM   1095 C  CD  . GLU A 1  142 ? 65.717 190.908 33.638  1.00 298.97 ? 215  GLU A CD  1 
ATOM   1096 O  OE1 . GLU A 1  142 ? 66.609 191.138 34.482  1.00 305.51 ? 215  GLU A OE1 1 
ATOM   1097 O  OE2 . GLU A 1  142 ? 65.118 189.815 33.564  1.00 294.19 ? 215  GLU A OE2 1 
ATOM   1098 N  N   . ASP A 1  143 ? 67.481 194.519 30.212  1.00 280.82 ? 216  ASP A N   1 
ATOM   1099 C  CA  . ASP A 1  143 ? 68.130 194.183 28.955  1.00 267.88 ? 216  ASP A CA  1 
ATOM   1100 C  C   . ASP A 1  143 ? 68.789 192.808 29.072  1.00 271.32 ? 216  ASP A C   1 
ATOM   1101 O  O   . ASP A 1  143 ? 68.647 192.108 30.079  1.00 256.88 ? 216  ASP A O   1 
ATOM   1102 C  CB  . ASP A 1  143 ? 69.133 195.270 28.576  1.00 250.90 ? 216  ASP A CB  1 
ATOM   1103 C  CG  . ASP A 1  143 ? 69.506 195.241 27.105  1.00 233.89 ? 216  ASP A CG  1 
ATOM   1104 O  OD1 . ASP A 1  143 ? 68.877 194.474 26.346  1.00 236.85 ? 216  ASP A OD1 1 
ATOM   1105 O  OD2 . ASP A 1  143 ? 70.422 195.990 26.707  1.00 233.65 ? 216  ASP A OD2 1 
ATOM   1106 N  N   . ASN A 1  144 ? 69.502 192.402 28.019  1.00 296.32 ? 217  ASN A N   1 
ATOM   1107 C  CA  . ASN A 1  144 ? 70.257 191.156 27.923  1.00 313.40 ? 217  ASN A CA  1 
ATOM   1108 C  C   . ASN A 1  144 ? 69.354 189.924 27.862  1.00 277.67 ? 217  ASN A C   1 
ATOM   1109 O  O   . ASN A 1  144 ? 69.862 188.809 27.666  1.00 293.21 ? 217  ASN A O   1 
ATOM   1110 C  CB  . ASN A 1  144 ? 71.283 191.019 29.066  1.00 365.73 ? 217  ASN A CB  1 
ATOM   1111 C  CG  . ASN A 1  144 ? 71.015 189.832 29.983  1.00 407.89 ? 217  ASN A CG  1 
ATOM   1112 O  OD1 . ASN A 1  144 ? 70.041 189.817 30.739  1.00 412.14 ? 217  ASN A OD1 1 
ATOM   1113 N  ND2 . ASN A 1  144 ? 71.893 188.834 29.918  1.00 442.60 ? 217  ASN A ND2 1 
ATOM   1114 N  N   . ILE A 1  145 ? 68.022 190.112 27.997  1.00 222.30 ? 218  ILE A N   1 
ATOM   1115 C  CA  . ILE A 1  145 ? 67.103 188.983 28.104  1.00 187.30 ? 218  ILE A CA  1 
ATOM   1116 C  C   . ILE A 1  145 ? 67.280 188.035 26.926  1.00 159.05 ? 218  ILE A C   1 
ATOM   1117 O  O   . ILE A 1  145 ? 67.568 188.452 25.797  1.00 140.36 ? 218  ILE A O   1 
ATOM   1118 C  CB  . ILE A 1  145 ? 65.644 189.470 28.202  1.00 172.47 ? 218  ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1  145 ? 65.241 190.264 26.951  1.00 139.21 ? 218  ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1  145 ? 65.441 190.259 29.482  1.00 191.86 ? 218  ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1  145 ? 63.764 190.607 26.848  1.00 155.62 ? 218  ILE A CD1 1 
ATOM   1122 N  N   . THR A 1  146 ? 67.166 186.786 27.269  1.00 157.59 ? 219  THR A N   1 
ATOM   1123 C  CA  . THR A 1  146 ? 67.316 185.754 26.251  1.00 107.30 ? 219  THR A CA  1 
ATOM   1124 C  C   . THR A 1  146 ? 66.086 184.860 26.233  1.00 103.94 ? 219  THR A C   1 
ATOM   1125 O  O   . THR A 1  146 ? 65.646 184.382 27.284  1.00 103.46 ? 219  THR A O   1 
ATOM   1126 C  CB  . THR A 1  146 ? 68.574 184.916 26.488  1.00 108.33 ? 219  THR A CB  1 
ATOM   1127 O  OG1 . THR A 1  146 ? 68.440 184.187 27.712  1.00 134.70 ? 219  THR A OG1 1 
ATOM   1128 C  CG2 . THR A 1  146 ? 69.792 185.819 26.575  1.00 113.12 ? 219  THR A CG2 1 
ATOM   1129 N  N   . TRP A 1  147 ? 65.647 184.610 24.955  1.00 103.35 ? 220  TRP A N   1 
ATOM   1130 C  CA  . TRP A 1  147 ? 64.387 183.889 24.818  1.00 108.36 ? 220  TRP A CA  1 
ATOM   1131 C  C   . TRP A 1  147 ? 64.563 182.401 25.104  1.00 122.51 ? 220  TRP A C   1 
ATOM   1132 O  O   . TRP A 1  147 ? 65.602 181.815 24.799  1.00 126.11 ? 220  TRP A O   1 
ATOM   1133 C  CB  . TRP A 1  147 ? 63.801 184.092 23.420  1.00 116.81 ? 220  TRP A CB  1 
ATOM   1134 C  CG  . TRP A 1  147 ? 62.310 183.949 23.373  1.00 130.76 ? 220  TRP A CG  1 
ATOM   1135 C  CD1 . TRP A 1  147 ? 61.601 182.858 22.960  1.00 134.57 ? 220  TRP A CD1 1 
ATOM   1136 C  CD2 . TRP A 1  147 ? 61.343 184.933 23.759  1.00 138.76 ? 220  TRP A CD2 1 
ATOM   1137 N  NE1 . TRP A 1  147 ? 60.252 183.104 23.063  1.00 136.76 ? 220  TRP A NE1 1 
ATOM   1138 C  CE2 . TRP A 1  147 ? 60.068 184.371 23.551  1.00 139.03 ? 220  TRP A CE2 1 
ATOM   1139 C  CE3 . TRP A 1  147 ? 61.432 186.235 24.260  1.00 144.93 ? 220  TRP A CE3 1 
ATOM   1140 C  CZ2 . TRP A 1  147 ? 58.892 185.066 23.826  1.00 146.92 ? 220  TRP A CZ2 1 
ATOM   1141 C  CZ3 . TRP A 1  147 ? 60.264 186.923 24.532  1.00 146.37 ? 220  TRP A CZ3 1 
ATOM   1142 C  CH2 . TRP A 1  147 ? 59.011 186.338 24.315  1.00 145.85 ? 220  TRP A CH2 1 
ATOM   1143 N  N   . THR A 1  148 ? 63.535 181.802 25.695  1.00 108.54 ? 221  THR A N   1 
ATOM   1144 C  CA  . THR A 1  148 ? 63.564 180.392 26.057  1.00 102.50 ? 221  THR A CA  1 
ATOM   1145 C  C   . THR A 1  148 ? 62.463 179.650 25.301  1.00 105.38 ? 221  THR A C   1 
ATOM   1146 O  O   . THR A 1  148 ? 61.528 180.269 24.794  1.00 120.10 ? 221  THR A O   1 
ATOM   1147 C  CB  . THR A 1  148 ? 63.387 180.205 27.579  1.00 122.90 ? 221  THR A CB  1 
ATOM   1148 O  OG1 . THR A 1  148 ? 64.067 181.260 28.270  1.00 126.06 ? 221  THR A OG1 1 
ATOM   1149 C  CG2 . THR A 1  148 ? 63.963 178.876 28.033  1.00 95.28  ? 221  THR A CG2 1 
ATOM   1150 N  N   . LEU A 1  149 ? 62.582 178.328 25.220  1.00 90.66  ? 222  LEU A N   1 
ATOM   1151 C  CA  . LEU A 1  149 ? 61.603 177.499 24.521  1.00 111.96 ? 222  LEU A CA  1 
ATOM   1152 C  C   . LEU A 1  149 ? 60.204 177.620 25.117  1.00 126.70 ? 222  LEU A C   1 
ATOM   1153 O  O   . LEU A 1  149 ? 59.206 177.446 24.417  1.00 142.55 ? 222  LEU A O   1 
ATOM   1154 C  CB  . LEU A 1  149 ? 62.039 176.033 24.538  1.00 100.97 ? 222  LEU A CB  1 
ATOM   1155 C  CG  . LEU A 1  149 ? 63.178 175.628 23.604  1.00 88.62  ? 222  LEU A CG  1 
ATOM   1156 C  CD1 . LEU A 1  149 ? 63.575 174.182 23.850  1.00 88.77  ? 222  LEU A CD1 1 
ATOM   1157 C  CD2 . LEU A 1  149 ? 62.768 175.830 22.157  1.00 90.02  ? 222  LEU A CD2 1 
ATOM   1158 N  N   . HIS A 1  150 ? 60.135 177.914 26.411  1.00 101.00 ? 223  HIS A N   1 
ATOM   1159 C  CA  . HIS A 1  150 ? 58.855 177.999 27.105  1.00 104.66 ? 223  HIS A CA  1 
ATOM   1160 C  C   . HIS A 1  150 ? 58.382 179.440 27.259  1.00 143.79 ? 223  HIS A C   1 
ATOM   1161 O  O   . HIS A 1  150 ? 57.234 179.686 27.626  1.00 163.85 ? 223  HIS A O   1 
ATOM   1162 C  CB  . HIS A 1  150 ? 58.951 177.335 28.480  1.00 118.14 ? 223  HIS A CB  1 
ATOM   1163 C  CG  . HIS A 1  150 ? 59.319 175.884 28.426  1.00 130.20 ? 223  HIS A CG  1 
ATOM   1164 N  ND1 . HIS A 1  150 ? 58.544 174.944 27.783  1.00 125.83 ? 223  HIS A ND1 1 
ATOM   1165 C  CD2 . HIS A 1  150 ? 60.376 175.214 28.941  1.00 132.74 ? 223  HIS A CD2 1 
ATOM   1166 C  CE1 . HIS A 1  150 ? 59.110 173.755 27.901  1.00 135.22 ? 223  HIS A CE1 1 
ATOM   1167 N  NE2 . HIS A 1  150 ? 60.222 173.891 28.599  1.00 131.01 ? 223  HIS A NE2 1 
ATOM   1168 N  N   . SER A 1  151 ? 59.268 180.389 26.975  1.00 90.53  ? 224  SER A N   1 
ATOM   1169 C  CA  . SER A 1  151 ? 58.946 181.803 27.133  1.00 92.09  ? 224  SER A CA  1 
ATOM   1170 C  C   . SER A 1  151 ? 57.899 182.262 26.122  1.00 112.54 ? 224  SER A C   1 
ATOM   1171 O  O   . SER A 1  151 ? 57.823 181.741 25.010  1.00 121.50 ? 224  SER A O   1 
ATOM   1172 C  CB  . SER A 1  151 ? 60.210 182.655 27.004  1.00 94.20  ? 224  SER A CB  1 
ATOM   1173 O  OG  . SER A 1  151 ? 61.080 182.443 28.103  1.00 166.19 ? 224  SER A OG  1 
ATOM   1174 N  N   . THR A 1  152 ? 57.088 183.238 26.525  1.00 115.12 ? 225  THR A N   1 
ATOM   1175 C  CA  . THR A 1  152 ? 56.057 183.799 25.658  1.00 117.34 ? 225  THR A CA  1 
ATOM   1176 C  C   . THR A 1  152 ? 56.028 185.323 25.752  1.00 119.41 ? 225  THR A C   1 
ATOM   1177 O  O   . THR A 1  152 ? 56.560 185.907 26.696  1.00 128.05 ? 225  THR A O   1 
ATOM   1178 C  CB  . THR A 1  152 ? 54.658 183.252 26.006  1.00 132.83 ? 225  THR A CB  1 
ATOM   1179 O  OG1 . THR A 1  152 ? 54.418 183.401 27.411  1.00 157.11 ? 225  THR A OG1 1 
ATOM   1180 C  CG2 . THR A 1  152 ? 54.539 181.784 25.623  1.00 144.57 ? 225  THR A CG2 1 
ATOM   1181 N  N   . SER A 1  153 ? 55.400 185.959 24.768  1.00 102.67 ? 226  SER A N   1 
ATOM   1182 C  CA  . SER A 1  153 ? 55.286 187.414 24.732  1.00 114.95 ? 226  SER A CA  1 
ATOM   1183 C  C   . SER A 1  153 ? 53.924 187.857 25.268  1.00 122.95 ? 226  SER A C   1 
ATOM   1184 O  O   . SER A 1  153 ? 52.949 187.112 25.166  1.00 139.11 ? 226  SER A O   1 
ATOM   1185 C  CB  . SER A 1  153 ? 55.499 187.930 23.304  1.00 114.33 ? 226  SER A CB  1 
ATOM   1186 O  OG  . SER A 1  153 ? 54.548 187.380 22.411  1.00 135.41 ? 226  SER A OG  1 
ATOM   1187 N  N   . PRO A 1  154 ? 53.854 189.071 25.845  1.00 106.66 ? 227  PRO A N   1 
ATOM   1188 C  CA  . PRO A 1  154 ? 52.607 189.583 26.431  1.00 106.04 ? 227  PRO A CA  1 
ATOM   1189 C  C   . PRO A 1  154 ? 51.450 189.655 25.436  1.00 112.84 ? 227  PRO A C   1 
ATOM   1190 O  O   . PRO A 1  154 ? 50.294 189.512 25.835  1.00 109.23 ? 227  PRO A O   1 
ATOM   1191 C  CB  . PRO A 1  154 ? 52.995 190.988 26.911  1.00 113.87 ? 227  PRO A CB  1 
ATOM   1192 C  CG  . PRO A 1  154 ? 54.221 191.339 26.138  1.00 125.35 ? 227  PRO A CG  1 
ATOM   1193 C  CD  . PRO A 1  154 ? 54.950 190.046 25.970  1.00 108.61 ? 227  PRO A CD  1 
ATOM   1194 N  N   . ALA A 1  155 ? 51.759 189.878 24.163  1.00 127.83 ? 228  ALA A N   1 
ATOM   1195 C  CA  . ALA A 1  155 ? 50.738 189.887 23.123  1.00 108.97 ? 228  ALA A CA  1 
ATOM   1196 C  C   . ALA A 1  155 ? 50.231 188.471 22.875  1.00 112.28 ? 228  ALA A C   1 
ATOM   1197 O  O   . ALA A 1  155 ? 49.026 188.240 22.762  1.00 149.70 ? 228  ALA A O   1 
ATOM   1198 C  CB  . ALA A 1  155 ? 51.286 190.492 21.841  1.00 101.64 ? 228  ALA A CB  1 
ATOM   1199 N  N   . GLU A 1  156 ? 51.165 187.528 22.793  1.00 104.59 ? 229  GLU A N   1 
ATOM   1200 C  CA  . GLU A 1  156 ? 50.837 186.116 22.626  1.00 106.37 ? 229  GLU A CA  1 
ATOM   1201 C  C   . GLU A 1  156 ? 50.055 185.607 23.832  1.00 102.07 ? 229  GLU A C   1 
ATOM   1202 O  O   . GLU A 1  156 ? 49.146 184.788 23.698  1.00 110.13 ? 229  GLU A O   1 
ATOM   1203 C  CB  . GLU A 1  156 ? 52.111 185.291 22.429  1.00 146.31 ? 229  GLU A CB  1 
ATOM   1204 C  CG  . GLU A 1  156 ? 51.887 183.792 22.314  1.00 162.89 ? 229  GLU A CG  1 
ATOM   1205 C  CD  . GLU A 1  156 ? 53.187 183.018 22.196  1.00 162.01 ? 229  GLU A CD  1 
ATOM   1206 O  OE1 . GLU A 1  156 ? 54.258 183.657 22.141  1.00 143.34 ? 229  GLU A OE1 1 
ATOM   1207 O  OE2 . GLU A 1  156 ? 53.137 181.770 22.159  1.00 168.04 ? 229  GLU A OE2 1 
ATOM   1208 N  N   . GLU A 1  157 ? 50.420 186.056 25.012  1.00 96.23  ? 230  GLU A N   1 
ATOM   1209 C  CA  . GLU A 1  157 ? 49.634 185.679 26.161  1.00 108.57 ? 230  GLU A CA  1 
ATOM   1210 C  C   . GLU A 1  157 ? 48.246 186.279 26.089  1.00 108.81 ? 230  GLU A C   1 
ATOM   1211 O  O   . GLU A 1  157 ? 47.259 185.608 26.357  1.00 108.22 ? 230  GLU A O   1 
ATOM   1212 C  CB  . GLU A 1  157 ? 50.331 186.095 27.445  1.00 124.72 ? 230  GLU A CB  1 
ATOM   1213 C  CG  . GLU A 1  157 ? 51.735 185.551 27.581  1.00 126.42 ? 230  GLU A CG  1 
ATOM   1214 C  CD  . GLU A 1  157 ? 51.862 184.614 28.749  1.00 134.65 ? 230  GLU A CD  1 
ATOM   1215 O  OE1 . GLU A 1  157 ? 51.613 185.055 29.885  1.00 147.11 ? 230  GLU A OE1 1 
ATOM   1216 O  OE2 . GLU A 1  157 ? 52.206 183.442 28.527  1.00 127.56 ? 230  GLU A OE2 1 
ATOM   1217 N  N   . PHE A 1  158 ? 48.170 187.545 25.704  1.00 108.83 ? 231  PHE A N   1 
ATOM   1218 C  CA  . PHE A 1  158 ? 46.885 188.232 25.669  1.00 122.44 ? 231  PHE A CA  1 
ATOM   1219 C  C   . PHE A 1  158 ? 45.919 187.565 24.696  1.00 114.81 ? 231  PHE A C   1 
ATOM   1220 O  O   . PHE A 1  158 ? 44.742 187.388 25.004  1.00 126.04 ? 231  PHE A O   1 
ATOM   1221 C  CB  . PHE A 1  158 ? 47.073 189.703 25.294  1.00 141.17 ? 231  PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1  158 ? 45.797 190.496 25.291  1.00 132.44 ? 231  PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1  158 ? 45.190 190.858 26.482  1.00 140.04 ? 231  PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1  158 ? 45.207 190.884 24.099  1.00 135.96 ? 231  PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1  158 ? 44.015 191.588 26.485  1.00 141.73 ? 231  PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1  158 ? 44.033 191.615 24.096  1.00 139.54 ? 231  PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1  158 ? 43.437 191.967 25.291  1.00 143.67 ? 231  PHE A CZ  1 
ATOM   1228 N  N   . TYR A 1  159 ? 46.417 187.197 23.520  1.00 117.34 ? 232  TYR A N   1 
ATOM   1229 C  CA  . TYR A 1  159 ? 45.582 186.521 22.536  1.00 112.09 ? 232  TYR A CA  1 
ATOM   1230 C  C   . TYR A 1  159 ? 45.265 185.100 22.990  1.00 112.12 ? 232  TYR A C   1 
ATOM   1231 O  O   . TYR A 1  159 ? 44.127 184.646 22.892  1.00 139.97 ? 232  TYR A O   1 
ATOM   1232 C  CB  . TYR A 1  159 ? 46.264 186.494 21.165  1.00 127.42 ? 232  TYR A CB  1 
ATOM   1233 C  CG  . TYR A 1  159 ? 45.406 185.899 20.067  1.00 136.25 ? 232  TYR A CG  1 
ATOM   1234 C  CD1 . TYR A 1  159 ? 44.021 186.011 20.101  1.00 114.44 ? 232  TYR A CD1 1 
ATOM   1235 C  CD2 . TYR A 1  159 ? 45.980 185.216 19.003  1.00 140.34 ? 232  TYR A CD2 1 
ATOM   1236 C  CE1 . TYR A 1  159 ? 43.235 185.465 19.105  1.00 114.77 ? 232  TYR A CE1 1 
ATOM   1237 C  CE2 . TYR A 1  159 ? 45.202 184.667 18.002  1.00 113.76 ? 232  TYR A CE2 1 
ATOM   1238 C  CZ  . TYR A 1  159 ? 43.831 184.795 18.059  1.00 114.31 ? 232  TYR A CZ  1 
ATOM   1239 O  OH  . TYR A 1  159 ? 43.051 184.251 17.065  1.00 158.04 ? 232  TYR A OH  1 
ATOM   1240 N  N   . THR A 1  160 ? 46.279 184.411 23.498  1.00 113.21 ? 233  THR A N   1 
ATOM   1241 C  CA  . THR A 1  160 ? 46.162 182.998 23.837  1.00 110.73 ? 233  THR A CA  1 
ATOM   1242 C  C   . THR A 1  160 ? 45.302 182.738 25.073  1.00 126.93 ? 233  THR A C   1 
ATOM   1243 O  O   . THR A 1  160 ? 44.414 181.886 25.049  1.00 112.95 ? 233  THR A O   1 
ATOM   1244 C  CB  . THR A 1  160 ? 47.554 182.373 24.070  1.00 119.06 ? 233  THR A CB  1 
ATOM   1245 O  OG1 . THR A 1  160 ? 48.344 182.503 22.882  1.00 130.43 ? 233  THR A OG1 1 
ATOM   1246 C  CG2 . THR A 1  160 ? 47.430 180.902 24.432  1.00 134.80 ? 233  THR A CG2 1 
ATOM   1247 N  N   . ARG A 1  161 ? 45.562 183.475 26.148  1.00 135.35 ? 234  ARG A N   1 
ATOM   1248 C  CA  . ARG A 1  161 ? 44.987 183.141 27.448  1.00 92.88  ? 234  ARG A CA  1 
ATOM   1249 C  C   . ARG A 1  161 ? 43.833 184.041 27.891  1.00 113.82 ? 234  ARG A C   1 
ATOM   1250 O  O   . ARG A 1  161 ? 43.154 183.735 28.871  1.00 96.97  ? 234  ARG A O   1 
ATOM   1251 C  CB  . ARG A 1  161 ? 46.081 183.167 28.518  1.00 96.94  ? 234  ARG A CB  1 
ATOM   1252 C  CG  . ARG A 1  161 ? 47.207 182.176 28.273  1.00 109.58 ? 234  ARG A CG  1 
ATOM   1253 C  CD  . ARG A 1  161 ? 48.194 182.166 29.428  1.00 113.23 ? 234  ARG A CD  1 
ATOM   1254 N  NE  . ARG A 1  161 ? 47.544 181.852 30.696  1.00 103.18 ? 234  ARG A NE  1 
ATOM   1255 C  CZ  . ARG A 1  161 ? 47.345 180.618 31.147  1.00 103.50 ? 234  ARG A CZ  1 
ATOM   1256 N  NH1 . ARG A 1  161 ? 46.745 180.425 32.314  1.00 133.62 ? 234  ARG A NH1 1 
ATOM   1257 N  NH2 . ARG A 1  161 ? 47.745 179.576 30.432  1.00 116.27 ? 234  ARG A NH2 1 
ATOM   1258 N  N   . HIS A 1  162 ? 43.605 185.144 27.185  1.00 97.01  ? 235  HIS A N   1 
ATOM   1259 C  CA  . HIS A 1  162 ? 42.545 186.065 27.584  1.00 100.83 ? 235  HIS A CA  1 
ATOM   1260 C  C   . HIS A 1  162 ? 41.343 186.010 26.644  1.00 115.95 ? 235  HIS A C   1 
ATOM   1261 O  O   . HIS A 1  162 ? 40.308 185.438 26.987  1.00 126.88 ? 235  HIS A O   1 
ATOM   1262 C  CB  . HIS A 1  162 ? 43.077 187.497 27.666  1.00 111.81 ? 235  HIS A CB  1 
ATOM   1263 C  CG  . HIS A 1  162 ? 42.086 188.478 28.212  1.00 110.31 ? 235  HIS A CG  1 
ATOM   1264 N  ND1 . HIS A 1  162 ? 41.575 188.385 29.489  1.00 114.70 ? 235  HIS A ND1 1 
ATOM   1265 C  CD2 . HIS A 1  162 ? 41.511 189.569 27.655  1.00 115.68 ? 235  HIS A CD2 1 
ATOM   1266 C  CE1 . HIS A 1  162 ? 40.729 189.379 29.695  1.00 138.25 ? 235  HIS A CE1 1 
ATOM   1267 N  NE2 . HIS A 1  162 ? 40.672 190.112 28.598  1.00 135.05 ? 235  HIS A NE2 1 
ATOM   1268 N  N   . VAL A 1  163 ? 41.479 186.608 25.464  1.00 101.08 ? 236  VAL A N   1 
ATOM   1269 C  CA  . VAL A 1  163 ? 40.364 186.705 24.528  1.00 111.63 ? 236  VAL A CA  1 
ATOM   1270 C  C   . VAL A 1  163 ? 39.968 185.328 23.994  1.00 97.17  ? 236  VAL A C   1 
ATOM   1271 O  O   . VAL A 1  163 ? 38.823 184.909 24.150  1.00 123.25 ? 236  VAL A O   1 
ATOM   1272 C  CB  . VAL A 1  163 ? 40.688 187.680 23.372  1.00 114.18 ? 236  VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1  163 ? 41.864 187.178 22.549  1.00 97.50  ? 236  VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1  163 ? 39.463 187.897 22.494  1.00 153.08 ? 236  VAL A CG2 1 
ATOM   1275 N  N   . LEU A 1  164 ? 40.910 184.621 23.379  1.00 94.23  ? 237  LEU A N   1 
ATOM   1276 C  CA  . LEU A 1  164 ? 40.620 183.299 22.837  1.00 92.03  ? 237  LEU A CA  1 
ATOM   1277 C  C   . LEU A 1  164 ? 40.452 182.286 23.965  1.00 109.23 ? 237  LEU A C   1 
ATOM   1278 O  O   . LEU A 1  164 ? 39.578 181.420 23.902  1.00 100.76 ? 237  LEU A O   1 
ATOM   1279 C  CB  . LEU A 1  164 ? 41.725 182.853 21.878  1.00 89.07  ? 237  LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1  164 ? 41.496 181.543 21.122  1.00 121.56 ? 237  LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1  164 ? 40.193 181.595 20.340  1.00 133.07 ? 237  LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1  164 ? 42.666 181.252 20.196  1.00 127.95 ? 237  LEU A CD2 1 
ATOM   1283 N  N   . GLN A 1  165 ? 41.289 182.417 24.993  1.00 112.41 ? 238  GLN A N   1 
ATOM   1284 C  CA  . GLN A 1  165 ? 41.271 181.528 26.155  1.00 114.82 ? 238  GLN A CA  1 
ATOM   1285 C  C   . GLN A 1  165 ? 41.380 180.071 25.712  1.00 112.10 ? 238  GLN A C   1 
ATOM   1286 O  O   . GLN A 1  165 ? 40.581 179.222 26.108  1.00 110.86 ? 238  GLN A O   1 
ATOM   1287 C  CB  . GLN A 1  165 ? 40.003 181.753 26.986  1.00 125.50 ? 238  GLN A CB  1 
ATOM   1288 C  CG  . GLN A 1  165 ? 40.112 181.309 28.438  1.00 165.72 ? 238  GLN A CG  1 
ATOM   1289 C  CD  . GLN A 1  165 ? 38.918 181.738 29.268  1.00 161.85 ? 238  GLN A CD  1 
ATOM   1290 O  OE1 . GLN A 1  165 ? 37.980 182.351 28.758  1.00 144.26 ? 238  GLN A OE1 1 
ATOM   1291 N  NE2 . GLN A 1  165 ? 38.949 181.419 30.557  1.00 140.77 ? 238  GLN A NE2 1 
ATOM   1292 N  N   . ILE A 1  166 ? 42.384 179.796 24.885  1.00 111.10 ? 239  ILE A N   1 
ATOM   1293 C  CA  . ILE A 1  166 ? 42.529 178.497 24.241  1.00 105.99 ? 239  ILE A CA  1 
ATOM   1294 C  C   . ILE A 1  166 ? 43.258 177.511 25.152  1.00 111.69 ? 239  ILE A C   1 
ATOM   1295 O  O   . ILE A 1  166 ? 43.307 176.313 24.874  1.00 148.23 ? 239  ILE A O   1 
ATOM   1296 C  CB  . ILE A 1  166 ? 43.256 178.645 22.891  1.00 98.43  ? 239  ILE A CB  1 
ATOM   1297 C  CG1 . ILE A 1  166 ? 42.941 177.468 21.968  1.00 93.12  ? 239  ILE A CG1 1 
ATOM   1298 C  CG2 . ILE A 1  166 ? 44.757 178.772 23.104  1.00 115.52 ? 239  ILE A CG2 1 
ATOM   1299 C  CD1 . ILE A 1  166 ? 43.527 177.620 20.582  1.00 110.42 ? 239  ILE A CD1 1 
ATOM   1300 N  N   . HIS A 1  167 ? 43.816 178.019 26.246  1.00 102.09 ? 240  HIS A N   1 
ATOM   1301 C  CA  . HIS A 1  167 ? 44.545 177.181 27.191  1.00 89.89  ? 240  HIS A CA  1 
ATOM   1302 C  C   . HIS A 1  167 ? 43.589 176.359 28.050  1.00 91.43  ? 240  HIS A C   1 
ATOM   1303 O  O   . HIS A 1  167 ? 44.004 175.429 28.741  1.00 98.61  ? 240  HIS A O   1 
ATOM   1304 C  CB  . HIS A 1  167 ? 45.442 178.035 28.087  1.00 107.28 ? 240  HIS A CB  1 
ATOM   1305 C  CG  . HIS A 1  167 ? 44.686 178.877 29.066  1.00 94.12  ? 240  HIS A CG  1 
ATOM   1306 N  ND1 . HIS A 1  167 ? 44.188 180.122 28.749  1.00 98.00  ? 240  HIS A ND1 1 
ATOM   1307 C  CD2 . HIS A 1  167 ? 44.339 178.650 30.355  1.00 97.25  ? 240  HIS A CD2 1 
ATOM   1308 C  CE1 . HIS A 1  167 ? 43.568 180.627 29.801  1.00 122.58 ? 240  HIS A CE1 1 
ATOM   1309 N  NE2 . HIS A 1  167 ? 43.645 179.754 30.788  1.00 106.22 ? 240  HIS A NE2 1 
ATOM   1310 N  N   . ARG A 1  168 ? 42.309 176.710 28.003  1.00 100.11 ? 241  ARG A N   1 
ATOM   1311 C  CA  . ARG A 1  168 ? 41.299 176.036 28.808  1.00 106.45 ? 241  ARG A CA  1 
ATOM   1312 C  C   . ARG A 1  168 ? 40.720 174.838 28.058  1.00 111.77 ? 241  ARG A C   1 
ATOM   1313 O  O   . ARG A 1  168 ? 39.817 174.160 28.548  1.00 129.07 ? 241  ARG A O   1 
ATOM   1314 C  CB  . ARG A 1  168 ? 40.190 177.017 29.196  1.00 109.79 ? 241  ARG A CB  1 
ATOM   1315 C  CG  . ARG A 1  168 ? 39.458 176.663 30.480  1.00 124.67 ? 241  ARG A CG  1 
ATOM   1316 C  CD  . ARG A 1  168 ? 38.737 177.875 31.048  1.00 123.42 ? 241  ARG A CD  1 
ATOM   1317 N  NE  . ARG A 1  168 ? 38.113 177.589 32.336  1.00 142.93 ? 241  ARG A NE  1 
ATOM   1318 C  CZ  . ARG A 1  168 ? 37.626 178.519 33.152  1.00 174.28 ? 241  ARG A CZ  1 
ATOM   1319 N  NH1 . ARG A 1  168 ? 37.697 179.800 32.816  1.00 157.52 ? 241  ARG A NH1 1 
ATOM   1320 N  NH2 . ARG A 1  168 ? 37.074 178.170 34.306  1.00 212.09 ? 241  ARG A NH2 1 
ATOM   1321 N  N   . SER A 1  169 ? 41.253 174.580 26.867  1.00 106.29 ? 242  SER A N   1 
ATOM   1322 C  CA  . SER A 1  169 ? 40.808 173.454 26.055  1.00 100.73 ? 242  SER A CA  1 
ATOM   1323 C  C   . SER A 1  169 ? 41.987 172.574 25.655  1.00 95.43  ? 242  SER A C   1 
ATOM   1324 O  O   . SER A 1  169 ? 43.086 173.068 25.406  1.00 117.65 ? 242  SER A O   1 
ATOM   1325 C  CB  . SER A 1  169 ? 40.075 173.949 24.807  1.00 107.11 ? 242  SER A CB  1 
ATOM   1326 O  OG  . SER A 1  169 ? 40.940 174.699 23.973  1.00 107.43 ? 242  SER A OG  1 
ATOM   1327 N  N   . LYS A 1  170 ? 41.751 171.267 25.593  1.00 106.29 ? 243  LYS A N   1 
ATOM   1328 C  CA  . LYS A 1  170 ? 42.799 170.322 25.229  1.00 116.81 ? 243  LYS A CA  1 
ATOM   1329 C  C   . LYS A 1  170 ? 42.796 170.040 23.731  1.00 116.82 ? 243  LYS A C   1 
ATOM   1330 O  O   . LYS A 1  170 ? 43.601 169.251 23.237  1.00 98.14  ? 243  LYS A O   1 
ATOM   1331 C  CB  . LYS A 1  170 ? 42.636 169.016 26.008  1.00 140.24 ? 243  LYS A CB  1 
ATOM   1332 C  CG  . LYS A 1  170 ? 42.782 169.172 27.512  1.00 169.15 ? 243  LYS A CG  1 
ATOM   1333 C  CD  . LYS A 1  170 ? 42.728 167.827 28.214  1.00 174.27 ? 243  LYS A CD  1 
ATOM   1334 C  CE  . LYS A 1  170 ? 41.395 167.136 27.985  1.00 164.01 ? 243  LYS A CE  1 
ATOM   1335 N  NZ  . LYS A 1  170 ? 41.337 165.817 28.672  1.00 158.72 ? 243  LYS A NZ  1 
ATOM   1336 N  N   . GLY A 1  171 ? 41.885 170.689 23.012  1.00 122.37 ? 244  GLY A N   1 
ATOM   1337 C  CA  . GLY A 1  171 ? 41.783 170.512 21.576  1.00 126.58 ? 244  GLY A CA  1 
ATOM   1338 C  C   . GLY A 1  171 ? 40.362 170.293 21.093  1.00 129.67 ? 244  GLY A C   1 
ATOM   1339 O  O   . GLY A 1  171 ? 39.409 170.784 21.697  1.00 154.33 ? 244  GLY A O   1 
ATOM   1340 N  N   . LEU A 1  172 ? 40.223 169.551 19.998  1.00 110.23 ? 245  LEU A N   1 
ATOM   1341 C  CA  . LEU A 1  172 ? 38.913 169.251 19.431  1.00 84.78  ? 245  LEU A CA  1 
ATOM   1342 C  C   . LEU A 1  172 ? 38.104 168.348 20.356  1.00 110.59 ? 245  LEU A C   1 
ATOM   1343 O  O   . LEU A 1  172 ? 36.873 168.378 20.348  1.00 159.03 ? 245  LEU A O   1 
ATOM   1344 C  CB  . LEU A 1  172 ? 39.057 168.593 18.057  1.00 77.70  ? 245  LEU A CB  1 
ATOM   1345 C  CG  . LEU A 1  172 ? 39.639 169.442 16.925  1.00 76.60  ? 245  LEU A CG  1 
ATOM   1346 C  CD1 . LEU A 1  172 ? 39.644 168.661 15.620  1.00 76.03  ? 245  LEU A CD1 1 
ATOM   1347 C  CD2 . LEU A 1  172 ? 38.862 170.737 16.771  1.00 77.33  ? 245  LEU A CD2 1 
ATOM   1348 N  N   . GLN A 1  173 ? 38.807 167.545 21.148  1.00 129.93 ? 246  GLN A N   1 
ATOM   1349 C  CA  . GLN A 1  173 ? 38.168 166.625 22.081  1.00 141.64 ? 246  GLN A CA  1 
ATOM   1350 C  C   . GLN A 1  173 ? 37.403 167.304 23.212  1.00 170.87 ? 246  GLN A C   1 
ATOM   1351 O  O   . GLN A 1  173 ? 36.198 167.103 23.371  1.00 205.14 ? 246  GLN A O   1 
ATOM   1352 C  CB  . GLN A 1  173 ? 39.207 165.716 22.744  1.00 146.69 ? 246  GLN A CB  1 
ATOM   1353 C  CG  . GLN A 1  173 ? 40.034 164.882 21.774  1.00 174.99 ? 246  GLN A CG  1 
ATOM   1354 C  CD  . GLN A 1  173 ? 41.185 165.658 21.160  1.00 177.68 ? 246  GLN A CD  1 
ATOM   1355 O  OE1 . GLN A 1  173 ? 41.439 166.807 21.524  1.00 164.26 ? 246  GLN A OE1 1 
ATOM   1356 N  NE2 . GLN A 1  173 ? 41.888 165.032 20.224  1.00 178.69 ? 246  GLN A NE2 1 
ATOM   1357 N  N   . ASP A 1  174 ? 38.112 168.109 23.995  1.00 161.67 ? 247  ASP A N   1 
ATOM   1358 C  CA  . ASP A 1  174 ? 37.492 168.912 25.041  1.00 160.90 ? 247  ASP A CA  1 
ATOM   1359 C  C   . ASP A 1  174 ? 37.718 170.396 24.777  1.00 163.53 ? 247  ASP A C   1 
ATOM   1360 O  O   . ASP A 1  174 ? 38.829 170.899 24.937  1.00 184.18 ? 247  ASP A O   1 
ATOM   1361 C  CB  . ASP A 1  174 ? 38.044 168.528 26.413  1.00 169.35 ? 247  ASP A CB  1 
ATOM   1362 C  CG  . ASP A 1  174 ? 37.405 169.316 27.538  1.00 187.53 ? 247  ASP A CG  1 
ATOM   1363 O  OD1 . ASP A 1  174 ? 36.337 168.894 28.028  1.00 198.27 ? 247  ASP A OD1 1 
ATOM   1364 O  OD2 . ASP A 1  174 ? 37.971 170.357 27.933  1.00 193.89 ? 247  ASP A OD2 1 
ATOM   1365 N  N   . LEU A 1  175 ? 36.661 171.093 24.375  1.00 134.30 ? 248  LEU A N   1 
ATOM   1366 C  CA  . LEU A 1  175 ? 36.771 172.506 24.031  1.00 115.68 ? 248  LEU A CA  1 
ATOM   1367 C  C   . LEU A 1  175 ? 35.787 173.373 24.814  1.00 133.72 ? 248  LEU A C   1 
ATOM   1368 O  O   . LEU A 1  175 ? 35.978 174.583 24.933  1.00 129.21 ? 248  LEU A O   1 
ATOM   1369 C  CB  . LEU A 1  175 ? 36.569 172.698 22.522  1.00 105.43 ? 248  LEU A CB  1 
ATOM   1370 C  CG  . LEU A 1  175 ? 35.436 171.939 21.823  1.00 85.06  ? 248  LEU A CG  1 
ATOM   1371 C  CD1 . LEU A 1  175 ? 34.096 172.641 21.995  1.00 134.30 ? 248  LEU A CD1 1 
ATOM   1372 C  CD2 . LEU A 1  175 ? 35.754 171.745 20.347  1.00 83.34  ? 248  LEU A CD2 1 
ATOM   1373 N  N   . GLY A 1  176 ? 34.729 172.762 25.320  1.00 157.19 ? 249  GLY A N   1 
ATOM   1374 C  CA  . GLY A 1  176 ? 33.730 173.499 26.066  1.00 149.08 ? 249  GLY A CA  1 
ATOM   1375 C  C   . GLY A 1  176 ? 34.458 173.903 27.311  1.00 134.53 ? 249  GLY A C   1 
ATOM   1376 O  O   . GLY A 1  176 ? 35.447 173.269 27.633  1.00 138.90 ? 249  GLY A O   1 
ATOM   1377 N  N   . GLY A 1  177 ? 34.052 174.976 27.976  1.00 143.04 ? 250  GLY A N   1 
ATOM   1378 C  CA  . GLY A 1  177 ? 32.789 175.661 27.776  1.00 144.89 ? 250  GLY A CA  1 
ATOM   1379 C  C   . GLY A 1  177 ? 32.810 176.795 26.784  1.00 121.11 ? 250  GLY A C   1 
ATOM   1380 O  O   . GLY A 1  177 ? 33.690 176.873 25.945  1.00 116.75 ? 250  GLY A O   1 
ATOM   1381 N  N   . ILE A 1  178 ? 31.807 177.657 26.875  1.00 114.68 ? 251  ILE A N   1 
ATOM   1382 C  CA  . ILE A 1  178 ? 31.645 178.778 25.972  1.00 110.20 ? 251  ILE A CA  1 
ATOM   1383 C  C   . ILE A 1  178 ? 31.974 180.092 26.640  1.00 135.62 ? 251  ILE A C   1 
ATOM   1384 O  O   . ILE A 1  178 ? 31.613 180.310 27.780  1.00 150.86 ? 251  ILE A O   1 
ATOM   1385 C  CB  . ILE A 1  178 ? 30.199 178.876 25.511  1.00 117.02 ? 251  ILE A CB  1 
ATOM   1386 C  CG1 . ILE A 1  178 ? 29.661 177.486 25.197  1.00 131.25 ? 251  ILE A CG1 1 
ATOM   1387 C  CG2 . ILE A 1  178 ? 30.100 179.797 24.317  1.00 103.83 ? 251  ILE A CG2 1 
ATOM   1388 C  CD1 . ILE A 1  178 ? 28.426 177.484 24.331  1.00 113.63 ? 251  ILE A CD1 1 
ATOM   1389 N  N   . SER A 1  179 ? 32.670 180.966 25.933  1.00 102.56 ? 252  SER A N   1 
ATOM   1390 C  CA  . SER A 1  179 ? 33.020 182.270 26.483  1.00 108.03 ? 252  SER A CA  1 
ATOM   1391 C  C   . SER A 1  179 ? 31.909 183.274 26.197  1.00 133.78 ? 252  SER A C   1 
ATOM   1392 O  O   . SER A 1  179 ? 31.475 183.422 25.054  1.00 137.14 ? 252  SER A O   1 
ATOM   1393 C  CB  . SER A 1  179 ? 34.346 182.763 25.902  1.00 110.89 ? 252  SER A CB  1 
ATOM   1394 O  OG  . SER A 1  179 ? 35.394 181.853 26.182  1.00 165.61 ? 252  SER A OG  1 
ATOM   1395 N  N   . TRP A 1  180 ? 31.455 183.965 27.238  1.00 127.73 ? 253  TRP A N   1 
ATOM   1396 C  CA  . TRP A 1  180 ? 30.324 184.879 27.115  1.00 133.77 ? 253  TRP A CA  1 
ATOM   1397 C  C   . TRP A 1  180 ? 30.719 186.231 26.523  1.00 170.94 ? 253  TRP A C   1 
ATOM   1398 O  O   . TRP A 1  180 ? 29.890 186.917 25.924  1.00 209.71 ? 253  TRP A O   1 
ATOM   1399 C  CB  . TRP A 1  180 ? 29.657 185.082 28.478  1.00 145.08 ? 253  TRP A CB  1 
ATOM   1400 C  CG  . TRP A 1  180 ? 30.594 185.521 29.564  1.00 147.31 ? 253  TRP A CG  1 
ATOM   1401 C  CD1 . TRP A 1  180 ? 31.301 184.717 30.411  1.00 160.44 ? 253  TRP A CD1 1 
ATOM   1402 C  CD2 . TRP A 1  180 ? 30.919 186.869 29.926  1.00 147.35 ? 253  TRP A CD2 1 
ATOM   1403 N  NE1 . TRP A 1  180 ? 32.049 185.481 31.275  1.00 179.84 ? 253  TRP A NE1 1 
ATOM   1404 C  CE2 . TRP A 1  180 ? 31.832 186.805 30.998  1.00 159.85 ? 253  TRP A CE2 1 
ATOM   1405 C  CE3 . TRP A 1  180 ? 30.529 188.123 29.446  1.00 164.16 ? 253  TRP A CE3 1 
ATOM   1406 C  CZ2 . TRP A 1  180 ? 32.360 187.947 31.598  1.00 168.55 ? 253  TRP A CZ2 1 
ATOM   1407 C  CZ3 . TRP A 1  180 ? 31.055 189.255 30.043  1.00 159.85 ? 253  TRP A CZ3 1 
ATOM   1408 C  CH2 . TRP A 1  180 ? 31.960 189.159 31.107  1.00 157.32 ? 253  TRP A CH2 1 
ATOM   1409 N  N   . GLN A 1  181 ? 31.982 186.609 26.689  1.00 154.55 ? 254  GLN A N   1 
ATOM   1410 C  CA  . GLN A 1  181 ? 32.475 187.883 26.172  1.00 147.75 ? 254  GLN A CA  1 
ATOM   1411 C  C   . GLN A 1  181 ? 32.373 187.934 24.650  1.00 135.39 ? 254  GLN A C   1 
ATOM   1412 O  O   . GLN A 1  181 ? 31.766 188.847 24.082  1.00 159.64 ? 254  GLN A O   1 
ATOM   1413 C  CB  . GLN A 1  181 ? 33.924 188.120 26.606  1.00 169.17 ? 254  GLN A CB  1 
ATOM   1414 C  CG  . GLN A 1  181 ? 34.140 188.179 28.112  1.00 173.15 ? 254  GLN A CG  1 
ATOM   1415 C  CD  . GLN A 1  181 ? 34.309 186.808 28.740  1.00 176.97 ? 254  GLN A CD  1 
ATOM   1416 O  OE1 . GLN A 1  181 ? 33.935 185.792 28.153  1.00 190.03 ? 254  GLN A OE1 1 
ATOM   1417 N  NE2 . GLN A 1  181 ? 34.880 186.773 29.938  1.00 182.94 ? 254  GLN A NE2 1 
ATOM   1418 N  N   . LEU A 1  182 ? 32.968 186.942 23.996  1.00 138.19 ? 255  LEU A N   1 
ATOM   1419 C  CA  . LEU A 1  182 ? 32.944 186.852 22.541  1.00 136.08 ? 255  LEU A CA  1 
ATOM   1420 C  C   . LEU A 1  182 ? 31.529 186.595 22.039  1.00 123.97 ? 255  LEU A C   1 
ATOM   1421 O  O   . LEU A 1  182 ? 31.209 186.884 20.887  1.00 118.82 ? 255  LEU A O   1 
ATOM   1422 C  CB  . LEU A 1  182 ? 33.889 185.753 22.046  1.00 124.11 ? 255  LEU A CB  1 
ATOM   1423 C  CG  . LEU A 1  182 ? 35.388 186.071 22.018  1.00 109.35 ? 255  LEU A CG  1 
ATOM   1424 C  CD1 . LEU A 1  182 ? 35.645 187.385 21.292  1.00 116.02 ? 255  LEU A CD1 1 
ATOM   1425 C  CD2 . LEU A 1  182 ? 35.982 186.099 23.417  1.00 119.07 ? 255  LEU A CD2 1 
ATOM   1426 N  N   . ALA A 1  183 ? 30.686 186.046 22.907  1.00 123.01 ? 256  ALA A N   1 
ATOM   1427 C  CA  . ALA A 1  183 ? 29.279 185.849 22.583  1.00 141.29 ? 256  ALA A CA  1 
ATOM   1428 C  C   . ALA A 1  183 ? 28.578 187.200 22.500  1.00 146.08 ? 256  ALA A C   1 
ATOM   1429 O  O   . ALA A 1  183 ? 27.787 187.445 21.590  1.00 151.76 ? 256  ALA A O   1 
ATOM   1430 C  CB  . ALA A 1  183 ? 28.609 184.956 23.614  1.00 150.48 ? 256  ALA A CB  1 
ATOM   1431 N  N   . LEU A 1  184 ? 28.878 188.075 23.454  1.00 143.99 ? 257  LEU A N   1 
ATOM   1432 C  CA  . LEU A 1  184 ? 28.328 189.426 23.449  1.00 152.28 ? 257  LEU A CA  1 
ATOM   1433 C  C   . LEU A 1  184 ? 28.855 190.219 22.255  1.00 162.73 ? 257  LEU A C   1 
ATOM   1434 O  O   . LEU A 1  184 ? 28.102 190.946 21.602  1.00 161.11 ? 257  LEU A O   1 
ATOM   1435 C  CB  . LEU A 1  184 ? 28.659 190.151 24.757  1.00 149.45 ? 257  LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1  184 ? 27.587 190.140 25.851  1.00 146.53 ? 257  LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1  184 ? 27.187 188.721 26.230  1.00 143.25 ? 257  LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1  184 ? 28.065 190.908 27.076  1.00 174.87 ? 257  LEU A CD2 1 
ATOM   1439 N  N   . CYS A 1  185 ? 30.147 190.074 21.972  1.00 161.13 ? 258  CYS A N   1 
ATOM   1440 C  CA  . CYS A 1  185 ? 30.758 190.748 20.829  1.00 136.65 ? 258  CYS A CA  1 
ATOM   1441 C  C   . CYS A 1  185 ? 30.105 190.314 19.519  1.00 146.27 ? 258  CYS A C   1 
ATOM   1442 O  O   . CYS A 1  185 ? 29.699 191.149 18.703  1.00 170.06 ? 258  CYS A O   1 
ATOM   1443 C  CB  . CYS A 1  185 ? 32.262 190.471 20.779  1.00 124.60 ? 258  CYS A CB  1 
ATOM   1444 S  SG  . CYS A 1  185 ? 33.193 191.099 22.196  1.00 135.82 ? 258  CYS A SG  1 
ATOM   1445 N  N   . ILE A 1  186 ? 29.994 189.002 19.330  1.00 128.88 ? 259  ILE A N   1 
ATOM   1446 C  CA  . ILE A 1  186 ? 29.429 188.451 18.107  1.00 128.89 ? 259  ILE A CA  1 
ATOM   1447 C  C   . ILE A 1  186 ? 27.932 188.746 18.042  1.00 148.29 ? 259  ILE A C   1 
ATOM   1448 O  O   . ILE A 1  186 ? 27.339 188.723 16.965  1.00 136.19 ? 259  ILE A O   1 
ATOM   1449 C  CB  . ILE A 1  186 ? 29.708 186.937 17.992  1.00 122.72 ? 259  ILE A CB  1 
ATOM   1450 C  CG1 . ILE A 1  186 ? 29.584 186.480 16.537  1.00 116.53 ? 259  ILE A CG1 1 
ATOM   1451 C  CG2 . ILE A 1  186 ? 28.758 186.140 18.869  1.00 130.74 ? 259  ILE A CG2 1 
ATOM   1452 C  CD1 . ILE A 1  186 ? 29.756 184.992 16.353  1.00 105.69 ? 259  ILE A CD1 1 
ATOM   1453 N  N   . MET A 1  187 ? 27.324 189.028 19.192  1.00 153.68 ? 260  MET A N   1 
ATOM   1454 C  CA  . MET A 1  187 ? 25.927 189.450 19.223  1.00 137.67 ? 260  MET A CA  1 
ATOM   1455 C  C   . MET A 1  187 ? 25.799 190.883 18.719  1.00 143.89 ? 260  MET A C   1 
ATOM   1456 O  O   . MET A 1  187 ? 24.891 191.202 17.949  1.00 155.57 ? 260  MET A O   1 
ATOM   1457 C  CB  . MET A 1  187 ? 25.347 189.330 20.633  1.00 134.18 ? 260  MET A CB  1 
ATOM   1458 C  CG  . MET A 1  187 ? 24.732 187.974 20.936  1.00 140.56 ? 260  MET A CG  1 
ATOM   1459 S  SD  . MET A 1  187 ? 24.040 187.867 22.596  1.00 160.21 ? 260  MET A SD  1 
ATOM   1460 C  CE  . MET A 1  187 ? 22.780 189.139 22.521  1.00 179.77 ? 260  MET A CE  1 
ATOM   1461 N  N   . LEU A 1  188 ? 26.715 191.741 19.161  1.00 154.97 ? 261  LEU A N   1 
ATOM   1462 C  CA  . LEU A 1  188 ? 26.753 193.125 18.700  1.00 151.34 ? 261  LEU A CA  1 
ATOM   1463 C  C   . LEU A 1  188 ? 27.006 193.177 17.198  1.00 153.10 ? 261  LEU A C   1 
ATOM   1464 O  O   . LEU A 1  188 ? 26.445 194.014 16.489  1.00 181.72 ? 261  LEU A O   1 
ATOM   1465 C  CB  . LEU A 1  188 ? 27.830 193.914 19.446  1.00 163.13 ? 261  LEU A CB  1 
ATOM   1466 C  CG  . LEU A 1  188 ? 28.039 195.365 19.005  1.00 164.23 ? 261  LEU A CG  1 
ATOM   1467 C  CD1 . LEU A 1  188 ? 26.748 196.156 19.132  1.00 173.12 ? 261  LEU A CD1 1 
ATOM   1468 C  CD2 . LEU A 1  188 ? 29.153 196.016 19.810  1.00 187.02 ? 261  LEU A CD2 1 
ATOM   1469 N  N   . ILE A 1  189 ? 27.853 192.272 16.719  1.00 127.48 ? 262  ILE A N   1 
ATOM   1470 C  CA  . ILE A 1  189 ? 28.162 192.194 15.298  1.00 138.17 ? 262  ILE A CA  1 
ATOM   1471 C  C   . ILE A 1  189 ? 26.967 191.654 14.520  1.00 153.80 ? 262  ILE A C   1 
ATOM   1472 O  O   . ILE A 1  189 ? 26.650 192.139 13.436  1.00 160.98 ? 262  ILE A O   1 
ATOM   1473 C  CB  . ILE A 1  189 ? 29.410 191.340 15.062  1.00 120.19 ? 262  ILE A CB  1 
ATOM   1474 C  CG1 . ILE A 1  189 ? 30.615 192.006 15.719  1.00 133.38 ? 262  ILE A CG1 1 
ATOM   1475 C  CG2 . ILE A 1  189 ? 29.655 191.138 13.574  1.00 118.19 ? 262  ILE A CG2 1 
ATOM   1476 C  CD1 . ILE A 1  189 ? 31.854 191.182 15.657  1.00 129.82 ? 262  ILE A CD1 1 
ATOM   1477 N  N   . PHE A 1  190 ? 26.296 190.656 15.084  1.00 146.32 ? 263  PHE A N   1 
ATOM   1478 C  CA  . PHE A 1  190 ? 25.101 190.100 14.462  1.00 149.24 ? 263  PHE A CA  1 
ATOM   1479 C  C   . PHE A 1  190 ? 23.947 191.098 14.509  1.00 159.02 ? 263  PHE A C   1 
ATOM   1480 O  O   . PHE A 1  190 ? 22.932 190.922 13.835  1.00 134.03 ? 263  PHE A O   1 
ATOM   1481 C  CB  . PHE A 1  190 ? 24.703 188.788 15.141  1.00 130.93 ? 263  PHE A CB  1 
ATOM   1482 C  CG  . PHE A 1  190 ? 25.494 187.603 14.669  1.00 123.45 ? 263  PHE A CG  1 
ATOM   1483 C  CD1 . PHE A 1  190 ? 26.009 187.570 13.385  1.00 122.68 ? 263  PHE A CD1 1 
ATOM   1484 C  CD2 . PHE A 1  190 ? 25.725 186.525 15.505  1.00 148.15 ? 263  PHE A CD2 1 
ATOM   1485 C  CE1 . PHE A 1  190 ? 26.737 186.485 12.942  1.00 136.47 ? 263  PHE A CE1 1 
ATOM   1486 C  CE2 . PHE A 1  190 ? 26.456 185.439 15.067  1.00 149.40 ? 263  PHE A CE2 1 
ATOM   1487 C  CZ  . PHE A 1  190 ? 26.961 185.418 13.784  1.00 125.94 ? 263  PHE A CZ  1 
ATOM   1488 N  N   . THR A 1  191 ? 24.112 192.147 15.307  1.00 155.24 ? 264  THR A N   1 
ATOM   1489 C  CA  . THR A 1  191 ? 23.132 193.222 15.371  1.00 141.20 ? 264  THR A CA  1 
ATOM   1490 C  C   . THR A 1  191 ? 23.476 194.317 14.363  1.00 162.89 ? 264  THR A C   1 
ATOM   1491 O  O   . THR A 1  191 ? 22.589 194.917 13.756  1.00 183.01 ? 264  THR A O   1 
ATOM   1492 C  CB  . THR A 1  191 ? 23.052 193.828 16.784  1.00 144.48 ? 264  THR A CB  1 
ATOM   1493 O  OG1 . THR A 1  191 ? 22.772 192.792 17.733  1.00 162.88 ? 264  THR A OG1 1 
ATOM   1494 C  CG2 . THR A 1  191 ? 21.955 194.879 16.857  1.00 151.01 ? 264  THR A CG2 1 
ATOM   1495 N  N   . VAL A 1  192 ? 24.770 194.566 14.179  1.00 139.93 ? 265  VAL A N   1 
ATOM   1496 C  CA  . VAL A 1  192 ? 25.216 195.625 13.283  1.00 141.48 ? 265  VAL A CA  1 
ATOM   1497 C  C   . VAL A 1  192 ? 25.086 195.186 11.825  1.00 139.51 ? 265  VAL A C   1 
ATOM   1498 O  O   . VAL A 1  192 ? 25.100 196.019 10.918  1.00 141.64 ? 265  VAL A O   1 
ATOM   1499 C  CB  . VAL A 1  192 ? 26.665 196.060 13.604  1.00 139.46 ? 265  VAL A CB  1 
ATOM   1500 C  CG1 . VAL A 1  192 ? 27.669 195.094 12.998  1.00 133.60 ? 265  VAL A CG1 1 
ATOM   1501 C  CG2 . VAL A 1  192 ? 26.919 197.481 13.121  1.00 143.25 ? 265  VAL A CG2 1 
ATOM   1502 N  N   . ILE A 1  193 ? 24.953 193.881 11.599  1.00 153.26 ? 266  ILE A N   1 
ATOM   1503 C  CA  . ILE A 1  193 ? 24.740 193.374 10.248  1.00 165.94 ? 266  ILE A CA  1 
ATOM   1504 C  C   . ILE A 1  193 ? 23.246 193.248 9.987   1.00 157.20 ? 266  ILE A C   1 
ATOM   1505 O  O   . ILE A 1  193 ? 22.810 193.168 8.838   1.00 186.43 ? 266  ILE A O   1 
ATOM   1506 C  CB  . ILE A 1  193 ? 25.454 192.027 10.014  1.00 170.61 ? 266  ILE A CB  1 
ATOM   1507 C  CG1 . ILE A 1  193 ? 24.835 190.926 10.875  1.00 182.65 ? 266  ILE A CG1 1 
ATOM   1508 C  CG2 . ILE A 1  193 ? 26.945 192.150 10.286  1.00 139.84 ? 266  ILE A CG2 1 
ATOM   1509 C  CD1 . ILE A 1  193 ? 25.377 189.551 10.571  1.00 158.85 ? 266  ILE A CD1 1 
ATOM   1510 N  N   . TYR A 1  194 ? 22.465 193.233 11.062  1.00 161.20 ? 267  TYR A N   1 
ATOM   1511 C  CA  . TYR A 1  194 ? 21.016 193.147 10.956  1.00 188.89 ? 267  TYR A CA  1 
ATOM   1512 C  C   . TYR A 1  194 ? 20.443 194.453 10.416  1.00 170.59 ? 267  TYR A C   1 
ATOM   1513 O  O   . TYR A 1  194 ? 19.608 194.449 9.512   1.00 166.23 ? 267  TYR A O   1 
ATOM   1514 C  CB  . TYR A 1  194 ? 20.398 192.819 12.317  1.00 220.17 ? 267  TYR A CB  1 
ATOM   1515 C  CG  . TYR A 1  194 ? 18.904 192.587 12.281  1.00 225.85 ? 267  TYR A CG  1 
ATOM   1516 C  CD1 . TYR A 1  194 ? 18.281 192.102 11.137  1.00 212.17 ? 267  TYR A CD1 1 
ATOM   1517 C  CD2 . TYR A 1  194 ? 18.114 192.861 13.390  1.00 242.48 ? 267  TYR A CD2 1 
ATOM   1518 C  CE1 . TYR A 1  194 ? 16.916 191.893 11.101  1.00 224.71 ? 267  TYR A CE1 1 
ATOM   1519 C  CE2 . TYR A 1  194 ? 16.749 192.655 13.363  1.00 255.21 ? 267  TYR A CE2 1 
ATOM   1520 C  CZ  . TYR A 1  194 ? 16.156 192.171 12.217  1.00 250.39 ? 267  TYR A CZ  1 
ATOM   1521 O  OH  . TYR A 1  194 ? 14.795 191.964 12.187  1.00 264.51 ? 267  TYR A OH  1 
ATOM   1522 N  N   . PHE A 1  195 ? 20.906 195.569 10.970  1.00 181.76 ? 268  PHE A N   1 
ATOM   1523 C  CA  . PHE A 1  195 ? 20.403 196.886 10.588  1.00 184.78 ? 268  PHE A CA  1 
ATOM   1524 C  C   . PHE A 1  195 ? 20.962 197.364 9.250   1.00 192.39 ? 268  PHE A C   1 
ATOM   1525 O  O   . PHE A 1  195 ? 20.657 198.469 8.799   1.00 224.08 ? 268  PHE A O   1 
ATOM   1526 C  CB  . PHE A 1  195 ? 20.613 197.887 11.727  1.00 179.22 ? 268  PHE A CB  1 
ATOM   1527 C  CG  . PHE A 1  195 ? 19.867 197.541 12.985  1.00 181.13 ? 268  PHE A CG  1 
ATOM   1528 C  CD1 . PHE A 1  195 ? 18.714 196.774 12.936  1.00 182.05 ? 268  PHE A CD1 1 
ATOM   1529 C  CD2 . PHE A 1  195 ? 20.320 197.982 14.217  1.00 185.50 ? 268  PHE A CD2 1 
ATOM   1530 C  CE1 . PHE A 1  195 ? 18.027 196.454 14.092  1.00 194.73 ? 268  PHE A CE1 1 
ATOM   1531 C  CE2 . PHE A 1  195 ? 19.637 197.665 15.377  1.00 200.31 ? 268  PHE A CE2 1 
ATOM   1532 C  CZ  . PHE A 1  195 ? 18.489 196.900 15.314  1.00 206.06 ? 268  PHE A CZ  1 
ATOM   1533 N  N   . SER A 1  196 ? 21.778 196.527 8.619   1.00 168.56 ? 269  SER A N   1 
ATOM   1534 C  CA  . SER A 1  196 ? 22.362 196.851 7.324   1.00 150.16 ? 269  SER A CA  1 
ATOM   1535 C  C   . SER A 1  196 ? 21.741 196.051 6.183   1.00 162.16 ? 269  SER A C   1 
ATOM   1536 O  O   . SER A 1  196 ? 21.875 196.415 5.015   1.00 176.14 ? 269  SER A O   1 
ATOM   1537 C  CB  . SER A 1  196 ? 23.882 196.760 7.472   1.00 145.76 ? 269  SER A CB  1 
ATOM   1538 O  OG  . SER A 1  196 ? 24.344 197.596 8.518   1.00 172.50 ? 269  SER A OG  1 
ATOM   1539 N  N   . ILE A 1  197 ? 21.066 194.961 6.532   1.00 160.08 ? 270  ILE A N   1 
ATOM   1540 C  CA  . ILE A 1  197 ? 20.472 194.070 5.541   1.00 169.89 ? 270  ILE A CA  1 
ATOM   1541 C  C   . ILE A 1  197 ? 18.944 194.017 5.567   1.00 191.83 ? 270  ILE A C   1 
ATOM   1542 O  O   . ILE A 1  197 ? 18.303 193.812 4.534   1.00 200.17 ? 270  ILE A O   1 
ATOM   1543 C  CB  . ILE A 1  197 ? 21.081 192.671 5.801   1.00 152.95 ? 270  ILE A CB  1 
ATOM   1544 C  CG1 . ILE A 1  197 ? 22.596 192.693 5.591   1.00 163.64 ? 270  ILE A CG1 1 
ATOM   1545 C  CG2 . ILE A 1  197 ? 20.450 191.621 4.899   1.00 169.92 ? 270  ILE A CG2 1 
ATOM   1546 C  CD1 . ILE A 1  197 ? 23.011 193.001 4.168   1.00 183.04 ? 270  ILE A CD1 1 
ATOM   1547 N  N   . TRP A 1  198 ? 18.367 194.226 6.749   1.00 171.77 ? 271  TRP A N   1 
ATOM   1548 C  CA  . TRP A 1  198 ? 16.929 194.051 6.963   1.00 173.12 ? 271  TRP A CA  1 
ATOM   1549 C  C   . TRP A 1  198 ? 16.057 194.924 6.058   1.00 210.74 ? 271  TRP A C   1 
ATOM   1550 O  O   . TRP A 1  198 ? 14.943 194.536 5.705   1.00 222.86 ? 271  TRP A O   1 
ATOM   1551 C  CB  . TRP A 1  198 ? 16.569 194.325 8.429   1.00 172.13 ? 271  TRP A CB  1 
ATOM   1552 C  CG  . TRP A 1  198 ? 16.684 195.765 8.851   1.00 191.64 ? 271  TRP A CG  1 
ATOM   1553 C  CD1 . TRP A 1  198 ? 17.637 196.665 8.465   1.00 196.81 ? 271  TRP A CD1 1 
ATOM   1554 C  CD2 . TRP A 1  198 ? 15.805 196.471 9.738   1.00 183.96 ? 271  TRP A CD2 1 
ATOM   1555 N  NE1 . TRP A 1  198 ? 17.408 197.882 9.059   1.00 192.12 ? 271  TRP A NE1 1 
ATOM   1556 C  CE2 . TRP A 1  198 ? 16.290 197.790 9.844   1.00 187.53 ? 271  TRP A CE2 1 
ATOM   1557 C  CE3 . TRP A 1  198 ? 14.657 196.113 10.452  1.00 182.67 ? 271  TRP A CE3 1 
ATOM   1558 C  CZ2 . TRP A 1  198 ? 15.665 198.752 10.636  1.00 199.06 ? 271  TRP A CZ2 1 
ATOM   1559 C  CZ3 . TRP A 1  198 ? 14.040 197.071 11.238  1.00 193.75 ? 271  TRP A CZ3 1 
ATOM   1560 C  CH2 . TRP A 1  198 ? 14.545 198.374 11.323  1.00 206.12 ? 271  TRP A CH2 1 
ATOM   1561 N  N   . LYS A 1  199 ? 16.559 196.096 5.684   1.00 216.70 ? 272  LYS A N   1 
ATOM   1562 C  CA  . LYS A 1  199 ? 15.807 196.997 4.818   1.00 210.30 ? 272  LYS A CA  1 
ATOM   1563 C  C   . LYS A 1  199 ? 16.065 196.682 3.348   1.00 202.36 ? 272  LYS A C   1 
ATOM   1564 O  O   . LYS A 1  199 ? 15.617 197.406 2.460   1.00 212.69 ? 272  LYS A O   1 
ATOM   1565 C  CB  . LYS A 1  199 ? 16.157 198.457 5.117   1.00 212.70 ? 272  LYS A CB  1 
ATOM   1566 C  CG  . LYS A 1  199 ? 15.578 198.980 6.423   1.00 219.48 ? 272  LYS A CG  1 
ATOM   1567 C  CD  . LYS A 1  199 ? 15.823 200.473 6.582   1.00 222.68 ? 272  LYS A CD  1 
ATOM   1568 C  CE  . LYS A 1  199 ? 15.228 201.258 5.423   1.00 203.90 ? 272  LYS A CE  1 
ATOM   1569 N  NZ  . LYS A 1  199 ? 15.485 202.719 5.545   1.00 198.65 ? 272  LYS A NZ  1 
ATOM   1570 N  N   . GLY A 1  200 ? 16.790 195.597 3.101   1.00 182.23 ? 273  GLY A N   1 
ATOM   1571 C  CA  . GLY A 1  200 ? 17.052 195.149 1.747   1.00 175.74 ? 273  GLY A CA  1 
ATOM   1572 C  C   . GLY A 1  200 ? 18.346 195.667 1.152   1.00 186.43 ? 273  GLY A C   1 
ATOM   1573 O  O   . GLY A 1  200 ? 19.364 195.767 1.838   1.00 204.79 ? 273  GLY A O   1 
ATOM   1574 N  N   . VAL A 1  201 ? 18.301 196.000 -0.133  1.00 174.51 ? 274  VAL A N   1 
ATOM   1575 C  CA  . VAL A 1  201 ? 19.480 196.466 -0.850  1.00 178.56 ? 274  VAL A CA  1 
ATOM   1576 C  C   . VAL A 1  201 ? 19.631 197.977 -0.724  1.00 187.64 ? 274  VAL A C   1 
ATOM   1577 O  O   . VAL A 1  201 ? 20.580 198.561 -1.249  1.00 185.84 ? 274  VAL A O   1 
ATOM   1578 C  CB  . VAL A 1  201 ? 19.425 196.049 -2.328  1.00 185.60 ? 274  VAL A CB  1 
ATOM   1579 C  CG1 . VAL A 1  201 ? 19.441 194.533 -2.451  1.00 169.90 ? 274  VAL A CG1 1 
ATOM   1580 C  CG2 . VAL A 1  201 ? 18.191 196.632 -2.999  1.00 217.30 ? 274  VAL A CG2 1 
ATOM   1581 N  N   . LYS A 1  202 ? 18.692 198.606 -0.025  1.00 197.19 ? 275  LYS A N   1 
ATOM   1582 C  CA  . LYS A 1  202 ? 18.726 200.049 0.179   1.00 203.79 ? 275  LYS A CA  1 
ATOM   1583 C  C   . LYS A 1  202 ? 19.796 200.433 1.195   1.00 210.14 ? 275  LYS A C   1 
ATOM   1584 O  O   . LYS A 1  202 ? 20.579 201.356 0.968   1.00 217.00 ? 275  LYS A O   1 
ATOM   1585 C  CB  . LYS A 1  202 ? 17.358 200.558 0.636   1.00 212.58 ? 275  LYS A CB  1 
ATOM   1586 N  N   . THR A 1  203 ? 19.825 199.720 2.316   1.00 196.73 ? 276  THR A N   1 
ATOM   1587 C  CA  . THR A 1  203 ? 20.789 199.998 3.374   1.00 191.87 ? 276  THR A CA  1 
ATOM   1588 C  C   . THR A 1  203 ? 22.118 199.293 3.125   1.00 187.31 ? 276  THR A C   1 
ATOM   1589 O  O   . THR A 1  203 ? 23.175 199.804 3.493   1.00 206.27 ? 276  THR A O   1 
ATOM   1590 C  CB  . THR A 1  203 ? 20.249 199.577 4.753   1.00 187.24 ? 276  THR A CB  1 
ATOM   1591 O  OG1 . THR A 1  203 ? 19.692 198.259 4.673   1.00 188.97 ? 276  THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1  203 ? 19.182 200.551 5.225   1.00 197.13 ? 276  THR A CG2 1 
ATOM   1593 N  N   . SER A 1  204 ? 22.064 198.125 2.491   1.00 160.86 ? 277  SER A N   1 
ATOM   1594 C  CA  . SER A 1  204 ? 23.274 197.359 2.204   1.00 161.56 ? 277  SER A CA  1 
ATOM   1595 C  C   . SER A 1  204 ? 24.156 198.095 1.201   1.00 177.97 ? 277  SER A C   1 
ATOM   1596 O  O   . SER A 1  204 ? 25.345 197.804 1.074   1.00 201.19 ? 277  SER A O   1 
ATOM   1597 C  CB  . SER A 1  204 ? 22.924 195.967 1.676   1.00 183.70 ? 277  SER A CB  1 
ATOM   1598 O  OG  . SER A 1  204 ? 22.403 196.034 0.361   1.00 211.49 ? 277  SER A OG  1 
ATOM   1599 N  N   . GLY A 1  205 ? 23.564 199.045 0.486   1.00 165.61 ? 278  GLY A N   1 
ATOM   1600 C  CA  . GLY A 1  205 ? 24.309 199.891 -0.425  1.00 175.25 ? 278  GLY A CA  1 
ATOM   1601 C  C   . GLY A 1  205 ? 24.644 201.232 0.196   1.00 165.39 ? 278  GLY A C   1 
ATOM   1602 O  O   . GLY A 1  205 ? 25.397 202.021 -0.374  1.00 164.66 ? 278  GLY A O   1 
ATOM   1603 N  N   . LYS A 1  206 ? 24.081 201.490 1.373   1.00 168.38 ? 279  LYS A N   1 
ATOM   1604 C  CA  . LYS A 1  206 ? 24.320 202.742 2.084   1.00 187.73 ? 279  LYS A CA  1 
ATOM   1605 C  C   . LYS A 1  206 ? 25.316 202.554 3.223   1.00 221.41 ? 279  LYS A C   1 
ATOM   1606 O  O   . LYS A 1  206 ? 26.183 203.400 3.444   1.00 245.39 ? 279  LYS A O   1 
ATOM   1607 C  CB  . LYS A 1  206 ? 23.006 203.311 2.625   1.00 191.74 ? 279  LYS A CB  1 
ATOM   1608 C  CG  . LYS A 1  206 ? 22.469 204.493 1.834   1.00 200.19 ? 279  LYS A CG  1 
ATOM   1609 C  CD  . LYS A 1  206 ? 22.280 204.142 0.368   1.00 193.97 ? 279  LYS A CD  1 
ATOM   1610 C  CE  . LYS A 1  206 ? 21.792 205.343 -0.426  1.00 205.86 ? 279  LYS A CE  1 
ATOM   1611 N  NZ  . LYS A 1  206 ? 21.626 205.024 -1.871  1.00 218.68 ? 279  LYS A NZ  1 
ATOM   1612 N  N   . VAL A 1  207 ? 25.185 201.448 3.947   1.00 193.23 ? 280  VAL A N   1 
ATOM   1613 C  CA  . VAL A 1  207 ? 26.105 201.131 5.032   1.00 161.00 ? 280  VAL A CA  1 
ATOM   1614 C  C   . VAL A 1  207 ? 27.477 200.812 4.449   1.00 163.36 ? 280  VAL A C   1 
ATOM   1615 O  O   . VAL A 1  207 ? 28.507 201.149 5.038   1.00 181.94 ? 280  VAL A O   1 
ATOM   1616 C  CB  . VAL A 1  207 ? 25.579 199.966 5.892   1.00 155.23 ? 280  VAL A CB  1 
ATOM   1617 C  CG1 . VAL A 1  207 ? 26.569 199.626 6.996   1.00 151.03 ? 280  VAL A CG1 1 
ATOM   1618 C  CG2 . VAL A 1  207 ? 24.222 200.317 6.487   1.00 173.62 ? 280  VAL A CG2 1 
ATOM   1619 N  N   . VAL A 1  208 ? 27.473 200.176 3.280   1.00 152.06 ? 281  VAL A N   1 
ATOM   1620 C  CA  . VAL A 1  208 ? 28.696 199.803 2.577   1.00 148.32 ? 281  VAL A CA  1 
ATOM   1621 C  C   . VAL A 1  208 ? 29.619 201.009 2.411   1.00 146.45 ? 281  VAL A C   1 
ATOM   1622 O  O   . VAL A 1  208 ? 30.839 200.881 2.540   1.00 169.12 ? 281  VAL A O   1 
ATOM   1623 C  CB  . VAL A 1  208 ? 28.365 199.150 1.210   1.00 175.18 ? 281  VAL A CB  1 
ATOM   1624 C  CG1 . VAL A 1  208 ? 29.627 198.864 0.406   1.00 193.21 ? 281  VAL A CG1 1 
ATOM   1625 C  CG2 . VAL A 1  208 ? 27.572 197.869 1.415   1.00 179.61 ? 281  VAL A CG2 1 
ATOM   1626 N  N   . TRP A 1  209 ? 29.024 202.177 2.161   1.00 153.71 ? 282  TRP A N   1 
ATOM   1627 C  CA  . TRP A 1  209 ? 29.762 203.432 2.013   1.00 165.34 ? 282  TRP A CA  1 
ATOM   1628 C  C   . TRP A 1  209 ? 30.788 203.650 3.119   1.00 155.84 ? 282  TRP A C   1 
ATOM   1629 O  O   . TRP A 1  209 ? 31.849 204.226 2.885   1.00 168.70 ? 282  TRP A O   1 
ATOM   1630 C  CB  . TRP A 1  209 ? 28.795 204.618 1.988   1.00 200.04 ? 282  TRP A CB  1 
ATOM   1631 C  CG  . TRP A 1  209 ? 28.267 204.949 0.630   1.00 209.13 ? 282  TRP A CG  1 
ATOM   1632 C  CD1 . TRP A 1  209 ? 27.168 204.415 0.025   1.00 206.40 ? 282  TRP A CD1 1 
ATOM   1633 C  CD2 . TRP A 1  209 ? 28.810 205.901 -0.292  1.00 221.21 ? 282  TRP A CD2 1 
ATOM   1634 N  NE1 . TRP A 1  209 ? 26.995 204.972 -1.219  1.00 223.80 ? 282  TRP A NE1 1 
ATOM   1635 C  CE2 . TRP A 1  209 ? 27.990 205.887 -1.437  1.00 234.93 ? 282  TRP A CE2 1 
ATOM   1636 C  CE3 . TRP A 1  209 ? 29.912 206.761 -0.260  1.00 225.52 ? 282  TRP A CE3 1 
ATOM   1637 C  CZ2 . TRP A 1  209 ? 28.238 206.701 -2.540  1.00 250.91 ? 282  TRP A CZ2 1 
ATOM   1638 C  CZ3 . TRP A 1  209 ? 30.155 207.568 -1.356  1.00 246.89 ? 282  TRP A CZ3 1 
ATOM   1639 C  CH2 . TRP A 1  209 ? 29.322 207.532 -2.481  1.00 257.76 ? 282  TRP A CH2 1 
ATOM   1640 N  N   . VAL A 1  210 ? 30.468 203.183 4.321   1.00 153.07 ? 283  VAL A N   1 
ATOM   1641 C  CA  . VAL A 1  210 ? 31.363 203.346 5.457   1.00 152.06 ? 283  VAL A CA  1 
ATOM   1642 C  C   . VAL A 1  210 ? 32.302 202.151 5.591   1.00 145.66 ? 283  VAL A C   1 
ATOM   1643 O  O   . VAL A 1  210 ? 33.475 202.309 5.930   1.00 144.21 ? 283  VAL A O   1 
ATOM   1644 C  CB  . VAL A 1  210 ? 30.568 203.557 6.759   1.00 154.75 ? 283  VAL A CB  1 
ATOM   1645 C  CG1 . VAL A 1  210 ? 31.510 203.853 7.916   1.00 162.77 ? 283  VAL A CG1 1 
ATOM   1646 C  CG2 . VAL A 1  210 ? 29.560 204.683 6.586   1.00 161.42 ? 283  VAL A CG2 1 
ATOM   1647 N  N   . THR A 1  211 ? 31.790 200.958 5.309   1.00 146.40 ? 284  THR A N   1 
ATOM   1648 C  CA  . THR A 1  211 ? 32.536 199.734 5.585   1.00 139.50 ? 284  THR A CA  1 
ATOM   1649 C  C   . THR A 1  211 ? 33.571 199.409 4.509   1.00 152.76 ? 284  THR A C   1 
ATOM   1650 O  O   . THR A 1  211 ? 34.500 198.637 4.750   1.00 178.96 ? 284  THR A O   1 
ATOM   1651 C  CB  . THR A 1  211 ? 31.586 198.528 5.739   1.00 149.33 ? 284  THR A CB  1 
ATOM   1652 O  OG1 . THR A 1  211 ? 30.870 198.323 4.516   1.00 172.86 ? 284  THR A OG1 1 
ATOM   1653 C  CG2 . THR A 1  211 ? 30.593 198.767 6.870   1.00 136.85 ? 284  THR A CG2 1 
ATOM   1654 N  N   . ALA A 1  212 ? 33.420 200.003 3.330   1.00 144.21 ? 285  ALA A N   1 
ATOM   1655 C  CA  . ALA A 1  212 ? 34.295 199.680 2.206   1.00 140.35 ? 285  ALA A CA  1 
ATOM   1656 C  C   . ALA A 1  212 ? 35.353 200.754 1.957   1.00 158.54 ? 285  ALA A C   1 
ATOM   1657 O  O   . ALA A 1  212 ? 36.331 200.515 1.248   1.00 159.47 ? 285  ALA A O   1 
ATOM   1658 C  CB  . ALA A 1  212 ? 33.468 199.460 0.949   1.00 142.98 ? 285  ALA A CB  1 
ATOM   1659 N  N   . THR A 1  213 ? 35.159 201.931 2.542   1.00 162.27 ? 286  THR A N   1 
ATOM   1660 C  CA  . THR A 1  213 ? 36.061 203.053 2.307   1.00 167.67 ? 286  THR A CA  1 
ATOM   1661 C  C   . THR A 1  213 ? 37.061 203.245 3.448   1.00 173.52 ? 286  THR A C   1 
ATOM   1662 O  O   . THR A 1  213 ? 38.194 203.666 3.222   1.00 175.65 ? 286  THR A O   1 
ATOM   1663 C  CB  . THR A 1  213 ? 35.276 204.363 2.099   1.00 149.29 ? 286  THR A CB  1 
ATOM   1664 O  OG1 . THR A 1  213 ? 34.394 204.576 3.208   1.00 175.10 ? 286  THR A OG1 1 
ATOM   1665 C  CG2 . THR A 1  213 ? 34.462 204.295 0.815   1.00 150.48 ? 286  THR A CG2 1 
ATOM   1666 N  N   . PHE A 1  214 ? 36.635 202.934 4.669   1.00 178.67 ? 287  PHE A N   1 
ATOM   1667 C  CA  . PHE A 1  214 ? 37.488 203.068 5.853   1.00 179.72 ? 287  PHE A CA  1 
ATOM   1668 C  C   . PHE A 1  214 ? 38.780 202.227 5.822   1.00 170.75 ? 287  PHE A C   1 
ATOM   1669 O  O   . PHE A 1  214 ? 39.844 202.733 6.198   1.00 165.42 ? 287  PHE A O   1 
ATOM   1670 C  CB  . PHE A 1  214 ? 36.685 202.728 7.117   1.00 174.45 ? 287  PHE A CB  1 
ATOM   1671 C  CG  . PHE A 1  214 ? 37.479 202.836 8.390   1.00 180.15 ? 287  PHE A CG  1 
ATOM   1672 C  CD1 . PHE A 1  214 ? 37.705 204.070 8.977   1.00 196.95 ? 287  PHE A CD1 1 
ATOM   1673 C  CD2 . PHE A 1  214 ? 37.991 201.705 9.005   1.00 176.95 ? 287  PHE A CD2 1 
ATOM   1674 C  CE1 . PHE A 1  214 ? 38.432 204.175 10.148  1.00 203.97 ? 287  PHE A CE1 1 
ATOM   1675 C  CE2 . PHE A 1  214 ? 38.719 201.804 10.176  1.00 169.04 ? 287  PHE A CE2 1 
ATOM   1676 C  CZ  . PHE A 1  214 ? 38.939 203.041 10.748  1.00 189.09 ? 287  PHE A CZ  1 
ATOM   1677 N  N   . PRO A 1  215 ? 38.700 200.945 5.397   1.00 153.02 ? 288  PRO A N   1 
ATOM   1678 C  CA  . PRO A 1  215 ? 39.937 200.151 5.392   1.00 144.23 ? 288  PRO A CA  1 
ATOM   1679 C  C   . PRO A 1  215 ? 41.068 200.736 4.546   1.00 154.46 ? 288  PRO A C   1 
ATOM   1680 O  O   . PRO A 1  215 ? 42.229 200.501 4.864   1.00 126.53 ? 288  PRO A O   1 
ATOM   1681 C  CB  . PRO A 1  215 ? 39.482 198.807 4.814   1.00 123.31 ? 288  PRO A CB  1 
ATOM   1682 C  CG  . PRO A 1  215 ? 38.057 198.710 5.194   1.00 124.59 ? 288  PRO A CG  1 
ATOM   1683 C  CD  . PRO A 1  215 ? 37.529 200.107 5.070   1.00 147.14 ? 288  PRO A CD  1 
ATOM   1684 N  N   . TYR A 1  216 ? 40.739 201.483 3.497   1.00 159.04 ? 289  TYR A N   1 
ATOM   1685 C  CA  . TYR A 1  216 ? 41.765 202.080 2.648   1.00 159.93 ? 289  TYR A CA  1 
ATOM   1686 C  C   . TYR A 1  216 ? 42.447 203.254 3.345   1.00 165.07 ? 289  TYR A C   1 
ATOM   1687 O  O   . TYR A 1  216 ? 43.658 203.448 3.216   1.00 180.51 ? 289  TYR A O   1 
ATOM   1688 C  CB  . TYR A 1  216 ? 41.163 202.524 1.315   1.00 135.31 ? 289  TYR A CB  1 
ATOM   1689 C  CG  . TYR A 1  216 ? 40.834 201.369 0.399   1.00 131.67 ? 289  TYR A CG  1 
ATOM   1690 C  CD1 . TYR A 1  216 ? 39.605 200.727 0.471   1.00 147.08 ? 289  TYR A CD1 1 
ATOM   1691 C  CD2 . TYR A 1  216 ? 41.759 200.911 -0.529  1.00 129.64 ? 289  TYR A CD2 1 
ATOM   1692 C  CE1 . TYR A 1  216 ? 39.304 199.665 -0.362  1.00 127.47 ? 289  TYR A CE1 1 
ATOM   1693 C  CE2 . TYR A 1  216 ? 41.468 199.852 -1.365  1.00 126.59 ? 289  TYR A CE2 1 
ATOM   1694 C  CZ  . TYR A 1  216 ? 40.239 199.233 -1.277  1.00 125.51 ? 289  TYR A CZ  1 
ATOM   1695 O  OH  . TYR A 1  216 ? 39.944 198.177 -2.108  1.00 163.61 ? 289  TYR A OH  1 
ATOM   1696 N  N   . ILE A 1  217 ? 41.663 204.030 4.085   1.00 140.08 ? 290  ILE A N   1 
ATOM   1697 C  CA  . ILE A 1  217 ? 42.200 205.134 4.869   1.00 143.92 ? 290  ILE A CA  1 
ATOM   1698 C  C   . ILE A 1  217 ? 43.110 204.581 5.959   1.00 140.96 ? 290  ILE A C   1 
ATOM   1699 O  O   . ILE A 1  217 ? 44.226 205.072 6.167   1.00 142.10 ? 290  ILE A O   1 
ATOM   1700 C  CB  . ILE A 1  217 ? 41.072 205.992 5.471   1.00 169.88 ? 290  ILE A CB  1 
ATOM   1701 C  CG1 . ILE A 1  217 ? 40.188 206.565 4.362   1.00 167.99 ? 290  ILE A CG1 1 
ATOM   1702 C  CG2 . ILE A 1  217 ? 41.649 207.108 6.330   1.00 162.16 ? 290  ILE A CG2 1 
ATOM   1703 C  CD1 . ILE A 1  217 ? 39.030 207.398 4.870   1.00 156.66 ? 290  ILE A CD1 1 
ATOM   1704 N  N   . ALA A 1  218 ? 42.630 203.547 6.645   1.00 155.35 ? 291  ALA A N   1 
ATOM   1705 C  CA  . ALA A 1  218 ? 43.405 202.904 7.700   1.00 144.39 ? 291  ALA A CA  1 
ATOM   1706 C  C   . ALA A 1  218 ? 44.703 202.315 7.151   1.00 138.07 ? 291  ALA A C   1 
ATOM   1707 O  O   . ALA A 1  218 ? 45.759 202.438 7.772   1.00 162.39 ? 291  ALA A O   1 
ATOM   1708 C  CB  . ALA A 1  218 ? 42.578 201.826 8.381   1.00 132.46 ? 291  ALA A CB  1 
ATOM   1709 N  N   . LEU A 1  219 ? 44.619 201.683 5.984   1.00 129.00 ? 292  LEU A N   1 
ATOM   1710 C  CA  . LEU A 1  219 ? 45.793 201.106 5.334   1.00 126.38 ? 292  LEU A CA  1 
ATOM   1711 C  C   . LEU A 1  219 ? 46.769 202.191 4.895   1.00 129.89 ? 292  LEU A C   1 
ATOM   1712 O  O   . LEU A 1  219 ? 47.978 201.967 4.849   1.00 148.22 ? 292  LEU A O   1 
ATOM   1713 C  CB  . LEU A 1  219 ? 45.384 200.255 4.130   1.00 123.78 ? 292  LEU A CB  1 
ATOM   1714 C  CG  . LEU A 1  219 ? 44.833 198.855 4.411   1.00 140.54 ? 292  LEU A CG  1 
ATOM   1715 C  CD1 . LEU A 1  219 ? 44.457 198.163 3.111   1.00 117.57 ? 292  LEU A CD1 1 
ATOM   1716 C  CD2 . LEU A 1  219 ? 45.833 198.022 5.196   1.00 138.53 ? 292  LEU A CD2 1 
ATOM   1717 N  N   . SER A 1  220 ? 46.238 203.364 4.564   1.00 134.47 ? 293  SER A N   1 
ATOM   1718 C  CA  . SER A 1  220 ? 47.076 204.495 4.186   1.00 138.51 ? 293  SER A CA  1 
ATOM   1719 C  C   . SER A 1  220 ? 47.847 205.014 5.397   1.00 155.53 ? 293  SER A C   1 
ATOM   1720 O  O   . SER A 1  220 ? 49.059 205.238 5.325   1.00 173.14 ? 293  SER A O   1 
ATOM   1721 C  CB  . SER A 1  220 ? 46.230 205.614 3.575   1.00 154.04 ? 293  SER A CB  1 
ATOM   1722 O  OG  . SER A 1  220 ? 47.042 206.702 3.168   1.00 187.20 ? 293  SER A OG  1 
ATOM   1723 N  N   . VAL A 1  221 ? 47.135 205.197 6.506   1.00 141.05 ? 294  VAL A N   1 
ATOM   1724 C  CA  . VAL A 1  221 ? 47.747 205.661 7.747   1.00 142.71 ? 294  VAL A CA  1 
ATOM   1725 C  C   . VAL A 1  221 ? 48.816 204.680 8.217   1.00 146.63 ? 294  VAL A C   1 
ATOM   1726 O  O   . VAL A 1  221 ? 49.939 205.074 8.538   1.00 155.69 ? 294  VAL A O   1 
ATOM   1727 C  CB  . VAL A 1  221 ? 46.688 205.875 8.842   1.00 152.28 ? 294  VAL A CB  1 
ATOM   1728 C  CG1 . VAL A 1  221 ? 47.353 206.255 10.157  1.00 174.74 ? 294  VAL A CG1 1 
ATOM   1729 C  CG2 . VAL A 1  221 ? 45.696 206.943 8.415   1.00 149.02 ? 294  VAL A CG2 1 
ATOM   1730 N  N   . LEU A 1  222 ? 48.461 203.399 8.247   1.00 133.73 ? 295  LEU A N   1 
ATOM   1731 C  CA  . LEU A 1  222 ? 49.392 202.355 8.661   1.00 153.10 ? 295  LEU A CA  1 
ATOM   1732 C  C   . LEU A 1  222 ? 50.539 202.208 7.665   1.00 162.53 ? 295  LEU A C   1 
ATOM   1733 O  O   . LEU A 1  222 ? 51.612 201.716 8.011   1.00 182.50 ? 295  LEU A O   1 
ATOM   1734 C  CB  . LEU A 1  222 ? 48.663 201.020 8.821   1.00 146.80 ? 295  LEU A CB  1 
ATOM   1735 C  CG  . LEU A 1  222 ? 47.621 200.939 9.937   1.00 136.56 ? 295  LEU A CG  1 
ATOM   1736 C  CD1 . LEU A 1  222 ? 46.928 199.585 9.926   1.00 130.66 ? 295  LEU A CD1 1 
ATOM   1737 C  CD2 . LEU A 1  222 ? 48.262 201.207 11.291  1.00 164.80 ? 295  LEU A CD2 1 
ATOM   1738 N  N   . LEU A 1  223 ? 50.306 202.635 6.428   1.00 149.95 ? 296  LEU A N   1 
ATOM   1739 C  CA  . LEU A 1  223 ? 51.326 202.555 5.389   1.00 130.52 ? 296  LEU A CA  1 
ATOM   1740 C  C   . LEU A 1  223 ? 52.371 203.645 5.571   1.00 134.62 ? 296  LEU A C   1 
ATOM   1741 O  O   . LEU A 1  223 ? 53.569 203.383 5.483   1.00 134.79 ? 296  LEU A O   1 
ATOM   1742 C  CB  . LEU A 1  223 ? 50.696 202.659 3.999   1.00 131.13 ? 296  LEU A CB  1 
ATOM   1743 C  CG  . LEU A 1  223 ? 51.676 202.624 2.823   1.00 131.44 ? 296  LEU A CG  1 
ATOM   1744 C  CD1 . LEU A 1  223 ? 52.497 201.342 2.839   1.00 127.12 ? 296  LEU A CD1 1 
ATOM   1745 C  CD2 . LEU A 1  223 ? 50.935 202.774 1.504   1.00 170.71 ? 296  LEU A CD2 1 
ATOM   1746 N  N   . VAL A 1  224 ? 51.916 204.870 5.816   1.00 139.15 ? 297  VAL A N   1 
ATOM   1747 C  CA  . VAL A 1  224 ? 52.830 205.974 6.078   1.00 165.03 ? 297  VAL A CA  1 
ATOM   1748 C  C   . VAL A 1  224 ? 53.585 205.698 7.372   1.00 154.27 ? 297  VAL A C   1 
ATOM   1749 O  O   . VAL A 1  224 ? 54.812 205.817 7.426   1.00 170.04 ? 297  VAL A O   1 
ATOM   1750 C  CB  . VAL A 1  224 ? 52.087 207.319 6.144   1.00 163.39 ? 297  VAL A CB  1 
ATOM   1751 C  CG1 . VAL A 1  224 ? 53.062 208.450 6.430   1.00 163.75 ? 297  VAL A CG1 1 
ATOM   1752 C  CG2 . VAL A 1  224 ? 51.336 207.576 4.845   1.00 150.12 ? 297  VAL A CG2 1 
ATOM   1753 N  N   . ARG A 1  225 ? 52.839 205.316 8.406   1.00 147.69 ? 298  ARG A N   1 
ATOM   1754 C  CA  . ARG A 1  225 ? 53.413 204.970 9.702   1.00 150.96 ? 298  ARG A CA  1 
ATOM   1755 C  C   . ARG A 1  225 ? 54.483 203.890 9.575   1.00 135.90 ? 298  ARG A C   1 
ATOM   1756 O  O   . ARG A 1  225 ? 55.588 204.039 10.092  1.00 136.92 ? 298  ARG A O   1 
ATOM   1757 C  CB  . ARG A 1  225 ? 52.316 204.506 10.663  1.00 145.12 ? 298  ARG A CB  1 
ATOM   1758 C  CG  . ARG A 1  225 ? 52.825 203.911 11.974  1.00 173.59 ? 298  ARG A CG  1 
ATOM   1759 C  CD  . ARG A 1  225 ? 53.430 204.965 12.894  1.00 188.37 ? 298  ARG A CD  1 
ATOM   1760 N  NE  . ARG A 1  225 ? 54.820 205.269 12.565  1.00 186.35 ? 298  ARG A NE  1 
ATOM   1761 C  CZ  . ARG A 1  225 ? 55.564 206.158 13.214  1.00 182.67 ? 298  ARG A CZ  1 
ATOM   1762 N  NH1 . ARG A 1  225 ? 55.052 206.837 14.232  1.00 168.46 ? 298  ARG A NH1 1 
ATOM   1763 N  NH2 . ARG A 1  225 ? 56.820 206.370 12.846  1.00 186.63 ? 298  ARG A NH2 1 
ATOM   1764 N  N   . GLY A 1  226 ? 54.148 202.807 8.882   1.00 142.65 ? 299  GLY A N   1 
ATOM   1765 C  CA  . GLY A 1  226 ? 55.076 201.709 8.685   1.00 149.27 ? 299  GLY A CA  1 
ATOM   1766 C  C   . GLY A 1  226 ? 56.260 202.082 7.815   1.00 158.19 ? 299  GLY A C   1 
ATOM   1767 O  O   . GLY A 1  226 ? 57.347 201.520 7.952   1.00 159.24 ? 299  GLY A O   1 
ATOM   1768 N  N   . ALA A 1  227 ? 56.046 203.037 6.917   1.00 142.75 ? 300  ALA A N   1 
ATOM   1769 C  CA  . ALA A 1  227 ? 57.098 203.499 6.022   1.00 135.97 ? 300  ALA A CA  1 
ATOM   1770 C  C   . ALA A 1  227 ? 58.105 204.358 6.776   1.00 169.64 ? 300  ALA A C   1 
ATOM   1771 O  O   . ALA A 1  227 ? 59.297 204.343 6.471   1.00 162.54 ? 300  ALA A O   1 
ATOM   1772 C  CB  . ALA A 1  227 ? 56.502 204.273 4.859   1.00 138.71 ? 300  ALA A CB  1 
ATOM   1773 N  N   . THR A 1  228 ? 57.623 205.106 7.764   1.00 181.64 ? 301  THR A N   1 
ATOM   1774 C  CA  . THR A 1  228 ? 58.503 205.955 8.562   1.00 164.26 ? 301  THR A CA  1 
ATOM   1775 C  C   . THR A 1  228 ? 59.305 205.139 9.577   1.00 161.22 ? 301  THR A C   1 
ATOM   1776 O  O   . THR A 1  228 ? 60.295 205.623 10.125  1.00 157.42 ? 301  THR A O   1 
ATOM   1777 C  CB  . THR A 1  228 ? 57.715 207.053 9.310   1.00 168.23 ? 301  THR A CB  1 
ATOM   1778 O  OG1 . THR A 1  228 ? 56.670 206.457 10.089  1.00 180.66 ? 301  THR A OG1 1 
ATOM   1779 C  CG2 . THR A 1  228 ? 57.111 208.047 8.328   1.00 173.82 ? 301  THR A CG2 1 
ATOM   1780 N  N   . LEU A 1  229 ? 58.880 203.903 9.821   1.00 166.88 ? 302  LEU A N   1 
ATOM   1781 C  CA  . LEU A 1  229 ? 59.553 203.038 10.786  1.00 154.52 ? 302  LEU A CA  1 
ATOM   1782 C  C   . LEU A 1  229 ? 60.940 202.621 10.297  1.00 166.03 ? 302  LEU A C   1 
ATOM   1783 O  O   . LEU A 1  229 ? 61.123 202.326 9.117   1.00 177.16 ? 302  LEU A O   1 
ATOM   1784 C  CB  . LEU A 1  229 ? 58.703 201.799 11.077  1.00 144.16 ? 302  LEU A CB  1 
ATOM   1785 C  CG  . LEU A 1  229 ? 57.375 202.048 11.796  1.00 142.60 ? 302  LEU A CG  1 
ATOM   1786 C  CD1 . LEU A 1  229 ? 56.598 200.752 11.977  1.00 175.04 ? 302  LEU A CD1 1 
ATOM   1787 C  CD2 . LEU A 1  229 ? 57.604 202.731 13.136  1.00 151.87 ? 302  LEU A CD2 1 
ATOM   1788 N  N   . PRO A 1  230 ? 61.923 202.598 11.212  1.00 166.39 ? 303  PRO A N   1 
ATOM   1789 C  CA  . PRO A 1  230 ? 63.306 202.242 10.875  1.00 166.29 ? 303  PRO A CA  1 
ATOM   1790 C  C   . PRO A 1  230 ? 63.481 200.762 10.542  1.00 162.45 ? 303  PRO A C   1 
ATOM   1791 O  O   . PRO A 1  230 ? 62.884 199.906 11.194  1.00 143.02 ? 303  PRO A O   1 
ATOM   1792 C  CB  . PRO A 1  230 ? 64.077 202.605 12.147  1.00 170.56 ? 303  PRO A CB  1 
ATOM   1793 C  CG  . PRO A 1  230 ? 63.073 202.475 13.237  1.00 157.01 ? 303  PRO A CG  1 
ATOM   1794 C  CD  . PRO A 1  230 ? 61.771 202.928 12.640  1.00 157.10 ? 303  PRO A CD  1 
ATOM   1795 N  N   . GLY A 1  231 ? 64.297 200.474 9.533   1.00 177.18 ? 304  GLY A N   1 
ATOM   1796 C  CA  . GLY A 1  231 ? 64.564 199.107 9.128   1.00 170.47 ? 304  GLY A CA  1 
ATOM   1797 C  C   . GLY A 1  231 ? 63.371 198.404 8.511   1.00 144.99 ? 304  GLY A C   1 
ATOM   1798 O  O   . GLY A 1  231 ? 63.285 197.177 8.532   1.00 134.14 ? 304  GLY A O   1 
ATOM   1799 N  N   . ALA A 1  232 ? 62.451 199.185 7.954   1.00 153.41 ? 305  ALA A N   1 
ATOM   1800 C  CA  . ALA A 1  232 ? 61.246 198.637 7.342   1.00 147.07 ? 305  ALA A CA  1 
ATOM   1801 C  C   . ALA A 1  232 ? 61.532 198.099 5.944   1.00 142.28 ? 305  ALA A C   1 
ATOM   1802 O  O   . ALA A 1  232 ? 60.670 197.484 5.317   1.00 137.68 ? 305  ALA A O   1 
ATOM   1803 C  CB  . ALA A 1  232 ? 60.153 199.692 7.289   1.00 150.78 ? 305  ALA A CB  1 
ATOM   1804 N  N   . TRP A 1  233 ? 62.748 198.334 5.462   1.00 124.64 ? 306  TRP A N   1 
ATOM   1805 C  CA  . TRP A 1  233 ? 63.143 197.900 4.128   1.00 152.96 ? 306  TRP A CA  1 
ATOM   1806 C  C   . TRP A 1  233 ? 63.417 196.399 4.081   1.00 156.84 ? 306  TRP A C   1 
ATOM   1807 O  O   . TRP A 1  233 ? 63.501 195.811 3.003   1.00 169.13 ? 306  TRP A O   1 
ATOM   1808 C  CB  . TRP A 1  233 ? 64.379 198.672 3.659   1.00 150.23 ? 306  TRP A CB  1 
ATOM   1809 C  CG  . TRP A 1  233 ? 65.577 198.479 4.537   1.00 134.15 ? 306  TRP A CG  1 
ATOM   1810 C  CD1 . TRP A 1  233 ? 65.948 199.250 5.600   1.00 137.69 ? 306  TRP A CD1 1 
ATOM   1811 C  CD2 . TRP A 1  233 ? 66.563 197.446 4.427   1.00 137.09 ? 306  TRP A CD2 1 
ATOM   1812 N  NE1 . TRP A 1  233 ? 67.104 198.761 6.159   1.00 164.57 ? 306  TRP A NE1 1 
ATOM   1813 C  CE2 . TRP A 1  233 ? 67.502 197.654 5.457   1.00 143.54 ? 306  TRP A CE2 1 
ATOM   1814 C  CE3 . TRP A 1  233 ? 66.744 196.366 3.558   1.00 137.95 ? 306  TRP A CE3 1 
ATOM   1815 C  CZ2 . TRP A 1  233 ? 68.604 196.821 5.642   1.00 139.38 ? 306  TRP A CZ2 1 
ATOM   1816 C  CZ3 . TRP A 1  233 ? 67.838 195.540 3.744   1.00 137.00 ? 306  TRP A CZ3 1 
ATOM   1817 C  CH2 . TRP A 1  233 ? 68.754 195.773 4.777   1.00 138.68 ? 306  TRP A CH2 1 
ATOM   1818 N  N   . ARG A 1  234 ? 63.559 195.784 5.250   1.00 144.39 ? 307  ARG A N   1 
ATOM   1819 C  CA  . ARG A 1  234 ? 63.837 194.354 5.330   1.00 140.42 ? 307  ARG A CA  1 
ATOM   1820 C  C   . ARG A 1  234 ? 62.604 193.537 4.963   1.00 136.51 ? 307  ARG A C   1 
ATOM   1821 O  O   . ARG A 1  234 ? 62.700 192.534 4.255   1.00 148.53 ? 307  ARG A O   1 
ATOM   1822 C  CB  . ARG A 1  234 ? 64.321 193.975 6.731   1.00 170.87 ? 307  ARG A CB  1 
ATOM   1823 C  CG  . ARG A 1  234 ? 65.574 194.710 7.165   1.00 172.20 ? 307  ARG A CG  1 
ATOM   1824 C  CD  . ARG A 1  234 ? 66.108 194.169 8.478   1.00 169.21 ? 307  ARG A CD  1 
ATOM   1825 N  NE  . ARG A 1  234 ? 67.274 194.919 8.935   1.00 168.98 ? 307  ARG A NE  1 
ATOM   1826 C  CZ  . ARG A 1  234 ? 68.521 194.670 8.549   1.00 177.57 ? 307  ARG A CZ  1 
ATOM   1827 N  NH1 . ARG A 1  234 ? 68.770 193.687 7.695   1.00 189.76 ? 307  ARG A NH1 1 
ATOM   1828 N  NH2 . ARG A 1  234 ? 69.520 195.406 9.017   1.00 174.96 ? 307  ARG A NH2 1 
ATOM   1829 N  N   . GLY A 1  235 ? 61.448 193.973 5.451   1.00 158.91 ? 308  GLY A N   1 
ATOM   1830 C  CA  . GLY A 1  235 ? 60.197 193.309 5.145   1.00 168.47 ? 308  GLY A CA  1 
ATOM   1831 C  C   . GLY A 1  235 ? 59.768 193.516 3.707   1.00 151.86 ? 308  GLY A C   1 
ATOM   1832 O  O   . GLY A 1  235 ? 59.151 192.641 3.102   1.00 167.44 ? 308  GLY A O   1 
ATOM   1833 N  N   . VAL A 1  236 ? 60.096 194.681 3.157   1.00 130.22 ? 309  VAL A N   1 
ATOM   1834 C  CA  . VAL A 1  236 ? 59.779 194.984 1.768   1.00 136.89 ? 309  VAL A CA  1 
ATOM   1835 C  C   . VAL A 1  236 ? 60.709 194.196 0.854   1.00 144.30 ? 309  VAL A C   1 
ATOM   1836 O  O   . VAL A 1  236 ? 60.297 193.704 -0.197  1.00 167.66 ? 309  VAL A O   1 
ATOM   1837 C  CB  . VAL A 1  236 ? 59.874 196.494 1.487   1.00 129.68 ? 309  VAL A CB  1 
ATOM   1838 C  CG1 . VAL A 1  236 ? 59.465 196.797 0.054   1.00 124.41 ? 309  VAL A CG1 1 
ATOM   1839 C  CG2 . VAL A 1  236 ? 59.009 197.270 2.468   1.00 125.58 ? 309  VAL A CG2 1 
ATOM   1840 N  N   . LEU A 1  237 ? 61.967 194.077 1.268   1.00 123.12 ? 310  LEU A N   1 
ATOM   1841 C  CA  . LEU A 1  237 ? 62.954 193.297 0.530   1.00 127.98 ? 310  LEU A CA  1 
ATOM   1842 C  C   . LEU A 1  237 ? 62.551 191.829 0.495   1.00 125.00 ? 310  LEU A C   1 
ATOM   1843 O  O   . LEU A 1  237 ? 62.452 191.230 -0.573  1.00 144.28 ? 310  LEU A O   1 
ATOM   1844 C  CB  . LEU A 1  237 ? 64.341 193.449 1.157   1.00 149.42 ? 310  LEU A CB  1 
ATOM   1845 C  CG  . LEU A 1  237 ? 65.466 192.623 0.529   1.00 160.09 ? 310  LEU A CG  1 
ATOM   1846 C  CD1 . LEU A 1  237 ? 65.675 193.015 -0.926  1.00 164.36 ? 310  LEU A CD1 1 
ATOM   1847 C  CD2 . LEU A 1  237 ? 66.755 192.782 1.322   1.00 147.31 ? 310  LEU A CD2 1 
ATOM   1848 N  N   . PHE A 1  238 ? 62.311 191.263 1.673   1.00 117.27 ? 311  PHE A N   1 
ATOM   1849 C  CA  . PHE A 1  238 ? 61.869 189.878 1.799   1.00 126.08 ? 311  PHE A CA  1 
ATOM   1850 C  C   . PHE A 1  238 ? 60.524 189.665 1.106   1.00 113.49 ? 311  PHE A C   1 
ATOM   1851 O  O   . PHE A 1  238 ? 60.205 188.560 0.667   1.00 106.66 ? 311  PHE A O   1 
ATOM   1852 C  CB  . PHE A 1  238 ? 61.779 189.490 3.278   1.00 134.68 ? 311  PHE A CB  1 
ATOM   1853 C  CG  . PHE A 1  238 ? 61.195 188.128 3.518   1.00 128.50 ? 311  PHE A CG  1 
ATOM   1854 C  CD1 . PHE A 1  238 ? 61.979 186.993 3.395   1.00 136.89 ? 311  PHE A CD1 1 
ATOM   1855 C  CD2 . PHE A 1  238 ? 59.865 187.983 3.879   1.00 114.64 ? 311  PHE A CD2 1 
ATOM   1856 C  CE1 . PHE A 1  238 ? 61.445 185.739 3.618   1.00 143.02 ? 311  PHE A CE1 1 
ATOM   1857 C  CE2 . PHE A 1  238 ? 59.325 186.732 4.103   1.00 120.59 ? 311  PHE A CE2 1 
ATOM   1858 C  CZ  . PHE A 1  238 ? 60.116 185.609 3.972   1.00 136.00 ? 311  PHE A CZ  1 
ATOM   1859 N  N   . TYR A 1  239 ? 59.748 190.740 1.005   1.00 104.02 ? 312  TYR A N   1 
ATOM   1860 C  CA  . TYR A 1  239 ? 58.416 190.698 0.414   1.00 110.72 ? 312  TYR A CA  1 
ATOM   1861 C  C   . TYR A 1  239 ? 58.464 190.782 -1.110  1.00 133.21 ? 312  TYR A C   1 
ATOM   1862 O  O   . TYR A 1  239 ? 57.522 190.376 -1.791  1.00 102.90 ? 312  TYR A O   1 
ATOM   1863 C  CB  . TYR A 1  239 ? 57.561 191.836 0.986   1.00 104.11 ? 312  TYR A CB  1 
ATOM   1864 C  CG  . TYR A 1  239 ? 56.227 192.045 0.302   1.00 105.02 ? 312  TYR A CG  1 
ATOM   1865 C  CD1 . TYR A 1  239 ? 55.240 191.069 0.342   1.00 107.09 ? 312  TYR A CD1 1 
ATOM   1866 C  CD2 . TYR A 1  239 ? 55.949 193.231 -0.367  1.00 119.81 ? 312  TYR A CD2 1 
ATOM   1867 C  CE1 . TYR A 1  239 ? 54.017 191.263 -0.276  1.00 114.81 ? 312  TYR A CE1 1 
ATOM   1868 C  CE2 . TYR A 1  239 ? 54.729 193.434 -0.987  1.00 106.90 ? 312  TYR A CE2 1 
ATOM   1869 C  CZ  . TYR A 1  239 ? 53.767 192.447 -0.939  1.00 117.46 ? 312  TYR A CZ  1 
ATOM   1870 O  OH  . TYR A 1  239 ? 52.553 192.647 -1.555  1.00 104.18 ? 312  TYR A OH  1 
ATOM   1871 N  N   . LEU A 1  240 ? 59.566 191.297 -1.645  1.00 142.88 ? 313  LEU A N   1 
ATOM   1872 C  CA  . LEU A 1  240 ? 59.682 191.494 -3.087  1.00 119.48 ? 313  LEU A CA  1 
ATOM   1873 C  C   . LEU A 1  240 ? 60.896 190.795 -3.699  1.00 121.82 ? 313  LEU A C   1 
ATOM   1874 O  O   . LEU A 1  240 ? 61.099 190.857 -4.912  1.00 111.04 ? 313  LEU A O   1 
ATOM   1875 C  CB  . LEU A 1  240 ? 59.735 192.990 -3.412  1.00 113.21 ? 313  LEU A CB  1 
ATOM   1876 C  CG  . LEU A 1  240 ? 58.497 193.818 -3.061  1.00 123.66 ? 313  LEU A CG  1 
ATOM   1877 C  CD1 . LEU A 1  240 ? 58.704 195.278 -3.436  1.00 118.12 ? 313  LEU A CD1 1 
ATOM   1878 C  CD2 . LEU A 1  240 ? 57.260 193.257 -3.745  1.00 135.62 ? 313  LEU A CD2 1 
ATOM   1879 N  N   . LYS A 1  241 ? 61.698 190.134 -2.868  1.00 148.24 ? 314  LYS A N   1 
ATOM   1880 C  CA  . LYS A 1  241 ? 62.893 189.442 -3.349  1.00 160.84 ? 314  LYS A CA  1 
ATOM   1881 C  C   . LYS A 1  241 ? 62.529 188.307 -4.301  1.00 169.52 ? 314  LYS A C   1 
ATOM   1882 O  O   . LYS A 1  241 ? 61.860 187.351 -3.907  1.00 188.13 ? 314  LYS A O   1 
ATOM   1883 C  CB  . LYS A 1  241 ? 63.713 188.896 -2.179  1.00 183.92 ? 314  LYS A CB  1 
ATOM   1884 C  CG  . LYS A 1  241 ? 65.025 188.250 -2.591  1.00 190.65 ? 314  LYS A CG  1 
ATOM   1885 C  CD  . LYS A 1  241 ? 65.806 187.771 -1.380  1.00 194.04 ? 314  LYS A CD  1 
ATOM   1886 C  CE  . LYS A 1  241 ? 67.120 187.129 -1.790  1.00 183.02 ? 314  LYS A CE  1 
ATOM   1887 N  NZ  . LYS A 1  241 ? 67.893 186.658 -0.608  1.00 187.60 ? 314  LYS A NZ  1 
ATOM   1888 N  N   . PRO A 1  242 ? 62.973 188.412 -5.562  1.00 164.27 ? 315  PRO A N   1 
ATOM   1889 C  CA  . PRO A 1  242 ? 62.655 187.426 -6.601  1.00 163.24 ? 315  PRO A CA  1 
ATOM   1890 C  C   . PRO A 1  242 ? 63.291 186.060 -6.354  1.00 166.66 ? 315  PRO A C   1 
ATOM   1891 O  O   . PRO A 1  242 ? 64.508 185.960 -6.208  1.00 183.45 ? 315  PRO A O   1 
ATOM   1892 C  CB  . PRO A 1  242 ? 63.227 188.061 -7.877  1.00 168.61 ? 315  PRO A CB  1 
ATOM   1893 C  CG  . PRO A 1  242 ? 63.404 189.512 -7.550  1.00 185.29 ? 315  PRO A CG  1 
ATOM   1894 C  CD  . PRO A 1  242 ? 63.753 189.539 -6.099  1.00 182.62 ? 315  PRO A CD  1 
ATOM   1895 N  N   . ASN A 1  243 ? 62.461 185.023 -6.308  1.00 145.21 ? 316  ASN A N   1 
ATOM   1896 C  CA  . ASN A 1  243 ? 62.941 183.650 -6.214  1.00 123.88 ? 316  ASN A CA  1 
ATOM   1897 C  C   . ASN A 1  243 ? 62.323 182.813 -7.327  1.00 117.31 ? 316  ASN A C   1 
ATOM   1898 O  O   . ASN A 1  243 ? 61.398 182.034 -7.093  1.00 117.88 ? 316  ASN A O   1 
ATOM   1899 C  CB  . ASN A 1  243 ? 62.617 183.048 -4.845  1.00 127.97 ? 316  ASN A CB  1 
ATOM   1900 C  CG  . ASN A 1  243 ? 63.390 181.770 -4.568  1.00 149.10 ? 316  ASN A CG  1 
ATOM   1901 O  OD1 . ASN A 1  243 ? 63.799 181.062 -5.488  1.00 166.85 ? 316  ASN A OD1 1 
ATOM   1902 N  ND2 . ASN A 1  243 ? 63.593 181.470 -3.290  1.00 158.58 ? 316  ASN A ND2 1 
ATOM   1903 N  N   . TRP A 1  244 ? 62.845 182.983 -8.538  1.00 109.63 ? 317  TRP A N   1 
ATOM   1904 C  CA  . TRP A 1  244 ? 62.242 182.421 -9.744  1.00 138.45 ? 317  TRP A CA  1 
ATOM   1905 C  C   . TRP A 1  244 ? 62.193 180.897 -9.720  1.00 154.23 ? 317  TRP A C   1 
ATOM   1906 O  O   . TRP A 1  244 ? 61.352 180.290 -10.384 1.00 162.36 ? 317  TRP A O   1 
ATOM   1907 C  CB  . TRP A 1  244 ? 63.002 182.902 -10.981 1.00 159.86 ? 317  TRP A CB  1 
ATOM   1908 C  CG  . TRP A 1  244 ? 63.067 184.392 -11.091 1.00 156.44 ? 317  TRP A CG  1 
ATOM   1909 C  CD1 . TRP A 1  244 ? 64.097 185.197 -10.703 1.00 151.39 ? 317  TRP A CD1 1 
ATOM   1910 C  CD2 . TRP A 1  244 ? 62.056 185.259 -11.619 1.00 158.57 ? 317  TRP A CD2 1 
ATOM   1911 N  NE1 . TRP A 1  244 ? 63.792 186.512 -10.960 1.00 157.44 ? 317  TRP A NE1 1 
ATOM   1912 C  CE2 . TRP A 1  244 ? 62.545 186.577 -11.522 1.00 156.69 ? 317  TRP A CE2 1 
ATOM   1913 C  CE3 . TRP A 1  244 ? 60.787 185.049 -12.165 1.00 165.18 ? 317  TRP A CE3 1 
ATOM   1914 C  CZ2 . TRP A 1  244 ? 61.809 187.679 -11.951 1.00 161.36 ? 317  TRP A CZ2 1 
ATOM   1915 C  CZ3 . TRP A 1  244 ? 60.058 186.144 -12.590 1.00 155.97 ? 317  TRP A CZ3 1 
ATOM   1916 C  CH2 . TRP A 1  244 ? 60.571 187.442 -12.481 1.00 160.18 ? 317  TRP A CH2 1 
ATOM   1917 N  N   . GLN A 1  245 ? 63.090 180.287 -8.949  1.00 160.60 ? 318  GLN A N   1 
ATOM   1918 C  CA  . GLN A 1  245 ? 63.130 178.832 -8.813  1.00 165.94 ? 318  GLN A CA  1 
ATOM   1919 C  C   . GLN A 1  245 ? 61.788 178.285 -8.328  1.00 152.86 ? 318  GLN A C   1 
ATOM   1920 O  O   . GLN A 1  245 ? 61.370 177.196 -8.724  1.00 150.67 ? 318  GLN A O   1 
ATOM   1921 C  CB  . GLN A 1  245 ? 64.245 178.415 -7.851  1.00 190.79 ? 318  GLN A CB  1 
ATOM   1922 C  CG  . GLN A 1  245 ? 65.626 178.910 -8.244  1.00 208.71 ? 318  GLN A CG  1 
ATOM   1923 C  CD  . GLN A 1  245 ? 66.131 178.284 -9.527  1.00 213.32 ? 318  GLN A CD  1 
ATOM   1924 O  OE1 . GLN A 1  245 ? 65.724 177.184 -9.901  1.00 208.25 ? 318  GLN A OE1 1 
ATOM   1925 N  NE2 . GLN A 1  245 ? 67.026 178.985 -10.211 1.00 218.76 ? 318  GLN A NE2 1 
ATOM   1926 N  N   . LYS A 1  246 ? 61.120 179.059 -7.476  1.00 121.25 ? 319  LYS A N   1 
ATOM   1927 C  CA  . LYS A 1  246 ? 59.795 178.712 -6.968  1.00 114.53 ? 319  LYS A CA  1 
ATOM   1928 C  C   . LYS A 1  246 ? 58.793 178.444 -8.089  1.00 124.12 ? 319  LYS A C   1 
ATOM   1929 O  O   . LYS A 1  246 ? 57.898 177.613 -7.941  1.00 140.36 ? 319  LYS A O   1 
ATOM   1930 C  CB  . LYS A 1  246 ? 59.263 179.825 -6.061  1.00 112.77 ? 319  LYS A CB  1 
ATOM   1931 C  CG  . LYS A 1  246 ? 59.896 179.866 -4.681  1.00 109.49 ? 319  LYS A CG  1 
ATOM   1932 C  CD  . LYS A 1  246 ? 59.553 178.620 -3.881  1.00 126.64 ? 319  LYS A CD  1 
ATOM   1933 C  CE  . LYS A 1  246 ? 60.123 178.693 -2.474  1.00 130.47 ? 319  LYS A CE  1 
ATOM   1934 N  NZ  . LYS A 1  246 ? 59.736 177.513 -1.653  1.00 142.61 ? 319  LYS A NZ  1 
ATOM   1935 N  N   . LEU A 1  247 ? 58.948 179.147 -9.207  1.00 110.93 ? 320  LEU A N   1 
ATOM   1936 C  CA  . LEU A 1  247 ? 58.043 178.994 -10.344 1.00 114.03 ? 320  LEU A CA  1 
ATOM   1937 C  C   . LEU A 1  247 ? 58.172 177.619 -11.003 1.00 117.65 ? 320  LEU A C   1 
ATOM   1938 O  O   . LEU A 1  247 ? 57.287 177.196 -11.746 1.00 118.05 ? 320  LEU A O   1 
ATOM   1939 C  CB  . LEU A 1  247 ? 58.292 180.098 -11.378 1.00 116.39 ? 320  LEU A CB  1 
ATOM   1940 C  CG  . LEU A 1  247 ? 57.884 181.514 -10.958 1.00 129.35 ? 320  LEU A CG  1 
ATOM   1941 C  CD1 . LEU A 1  247 ? 58.102 182.506 -12.091 1.00 135.82 ? 320  LEU A CD1 1 
ATOM   1942 C  CD2 . LEU A 1  247 ? 56.434 181.537 -10.494 1.00 143.08 ? 320  LEU A CD2 1 
ATOM   1943 N  N   . LEU A 1  248 ? 59.272 176.923 -10.727 1.00 120.51 ? 321  LEU A N   1 
ATOM   1944 C  CA  . LEU A 1  248 ? 59.477 175.578 -11.259 1.00 136.52 ? 321  LEU A CA  1 
ATOM   1945 C  C   . LEU A 1  248 ? 58.637 174.553 -10.500 1.00 145.42 ? 321  LEU A C   1 
ATOM   1946 O  O   . LEU A 1  248 ? 58.324 173.484 -11.024 1.00 163.79 ? 321  LEU A O   1 
ATOM   1947 C  CB  . LEU A 1  248 ? 60.960 175.198 -11.204 1.00 120.75 ? 321  LEU A CB  1 
ATOM   1948 C  CG  . LEU A 1  248 ? 61.893 176.039 -12.081 1.00 129.73 ? 321  LEU A CG  1 
ATOM   1949 C  CD1 . LEU A 1  248 ? 63.324 175.520 -12.019 1.00 148.19 ? 321  LEU A CD1 1 
ATOM   1950 C  CD2 . LEU A 1  248 ? 61.394 176.077 -13.519 1.00 131.48 ? 321  LEU A CD2 1 
ATOM   1951 N  N   . GLU A 1  249 ? 58.271 174.886 -9.266  1.00 129.91 ? 322  GLU A N   1 
ATOM   1952 C  CA  . GLU A 1  249 ? 57.420 174.018 -8.460  1.00 124.80 ? 322  GLU A CA  1 
ATOM   1953 C  C   . GLU A 1  249 ? 55.970 174.109 -8.922  1.00 126.73 ? 322  GLU A C   1 
ATOM   1954 O  O   . GLU A 1  249 ? 55.441 175.202 -9.127  1.00 128.95 ? 322  GLU A O   1 
ATOM   1955 C  CB  . GLU A 1  249 ? 57.528 174.383 -6.979  1.00 130.20 ? 322  GLU A CB  1 
ATOM   1956 C  CG  . GLU A 1  249 ? 58.945 174.336 -6.437  1.00 161.95 ? 322  GLU A CG  1 
ATOM   1957 C  CD  . GLU A 1  249 ? 59.022 174.725 -4.974  1.00 182.83 ? 322  GLU A CD  1 
ATOM   1958 O  OE1 . GLU A 1  249 ? 57.958 174.932 -4.354  1.00 185.31 ? 322  GLU A OE1 1 
ATOM   1959 O  OE2 . GLU A 1  249 ? 60.149 174.825 -4.445  1.00 188.20 ? 322  GLU A OE2 1 
ATOM   1960 N  N   . THR A 1  250 ? 55.329 172.955 -9.077  1.00 129.84 ? 323  THR A N   1 
ATOM   1961 C  CA  . THR A 1  250 ? 53.953 172.901 -9.558  1.00 131.53 ? 323  THR A CA  1 
ATOM   1962 C  C   . THR A 1  250 ? 52.954 173.303 -8.475  1.00 122.48 ? 323  THR A C   1 
ATOM   1963 O  O   . THR A 1  250 ? 51.750 173.355 -8.721  1.00 131.66 ? 323  THR A O   1 
ATOM   1964 C  CB  . THR A 1  250 ? 53.595 171.491 -10.067 1.00 161.20 ? 323  THR A CB  1 
ATOM   1965 O  OG1 . THR A 1  250 ? 52.233 171.471 -10.512 1.00 170.20 ? 323  THR A OG1 1 
ATOM   1966 C  CG2 . THR A 1  250 ? 53.781 170.461 -8.962  1.00 180.39 ? 323  THR A CG2 1 
ATOM   1967 N  N   . GLY A 1  251 ? 53.460 173.591 -7.280  1.00 133.12 ? 324  GLY A N   1 
ATOM   1968 C  CA  . GLY A 1  251 ? 52.609 173.919 -6.152  1.00 124.23 ? 324  GLY A CA  1 
ATOM   1969 C  C   . GLY A 1  251 ? 52.208 175.378 -6.048  1.00 113.55 ? 324  GLY A C   1 
ATOM   1970 O  O   . GLY A 1  251 ? 51.055 175.686 -5.747  1.00 144.33 ? 324  GLY A O   1 
ATOM   1971 N  N   . VAL A 1  252 ? 53.156 176.276 -6.299  1.00 99.42  ? 325  VAL A N   1 
ATOM   1972 C  CA  . VAL A 1  252 ? 52.919 177.709 -6.137  1.00 99.78  ? 325  VAL A CA  1 
ATOM   1973 C  C   . VAL A 1  252 ? 51.856 178.217 -7.109  1.00 112.09 ? 325  VAL A C   1 
ATOM   1974 O  O   . VAL A 1  252 ? 51.146 179.179 -6.812  1.00 118.08 ? 325  VAL A O   1 
ATOM   1975 C  CB  . VAL A 1  252 ? 54.228 178.508 -6.300  1.00 102.96 ? 325  VAL A CB  1 
ATOM   1976 C  CG1 . VAL A 1  252 ? 55.237 178.093 -5.240  1.00 118.01 ? 325  VAL A CG1 1 
ATOM   1977 C  CG2 . VAL A 1  252 ? 54.802 178.318 -7.694  1.00 126.81 ? 325  VAL A CG2 1 
ATOM   1978 N  N   . TRP A 1  253 ? 51.743 177.567 -8.264  1.00 113.94 ? 326  TRP A N   1 
ATOM   1979 C  CA  . TRP A 1  253 ? 50.727 177.929 -9.246  1.00 124.69 ? 326  TRP A CA  1 
ATOM   1980 C  C   . TRP A 1  253 ? 49.341 177.587 -8.715  1.00 123.46 ? 326  TRP A C   1 
ATOM   1981 O  O   . TRP A 1  253 ? 48.391 178.355 -8.876  1.00 115.86 ? 326  TRP A O   1 
ATOM   1982 C  CB  . TRP A 1  253 ? 50.981 177.215 -10.576 1.00 123.11 ? 326  TRP A CB  1 
ATOM   1983 C  CG  . TRP A 1  253 ? 52.199 177.706 -11.293 1.00 118.38 ? 326  TRP A CG  1 
ATOM   1984 C  CD1 . TRP A 1  253 ? 53.488 177.304 -11.091 1.00 94.54  ? 326  TRP A CD1 1 
ATOM   1985 C  CD2 . TRP A 1  253 ? 52.244 178.692 -12.332 1.00 123.13 ? 326  TRP A CD2 1 
ATOM   1986 N  NE1 . TRP A 1  253 ? 54.332 177.980 -11.939 1.00 95.04  ? 326  TRP A NE1 1 
ATOM   1987 C  CE2 . TRP A 1  253 ? 53.593 178.838 -12.711 1.00 120.53 ? 326  TRP A CE2 1 
ATOM   1988 C  CE3 . TRP A 1  253 ? 51.275 179.465 -12.978 1.00 116.59 ? 326  TRP A CE3 1 
ATOM   1989 C  CZ2 . TRP A 1  253 ? 53.997 179.726 -13.706 1.00 135.07 ? 326  TRP A CZ2 1 
ATOM   1990 C  CZ3 . TRP A 1  253 ? 51.677 180.345 -13.966 1.00 115.42 ? 326  TRP A CZ3 1 
ATOM   1991 C  CH2 . TRP A 1  253 ? 53.026 180.468 -14.320 1.00 127.67 ? 326  TRP A CH2 1 
ATOM   1992 N  N   . ILE A 1  254 ? 49.240 176.426 -8.076  1.00 128.55 ? 327  ILE A N   1 
ATOM   1993 C  CA  . ILE A 1  254 ? 47.995 175.987 -7.461  1.00 131.02 ? 327  ILE A CA  1 
ATOM   1994 C  C   . ILE A 1  254 ? 47.639 176.917 -6.307  1.00 129.74 ? 327  ILE A C   1 
ATOM   1995 O  O   . ILE A 1  254 ? 46.475 177.279 -6.121  1.00 138.77 ? 327  ILE A O   1 
ATOM   1996 C  CB  . ILE A 1  254 ? 48.101 174.530 -6.988  1.00 129.33 ? 327  ILE A CB  1 
ATOM   1997 C  CG1 . ILE A 1  254 ? 48.479 173.621 -8.160  1.00 153.85 ? 327  ILE A CG1 1 
ATOM   1998 C  CG2 . ILE A 1  254 ? 46.796 174.081 -6.352  1.00 133.69 ? 327  ILE A CG2 1 
ATOM   1999 C  CD1 . ILE A 1  254 ? 48.816 172.204 -7.755  1.00 163.83 ? 327  ILE A CD1 1 
ATOM   2000 N  N   . ASP A 1  255 ? 48.654 177.302 -5.539  1.00 122.02 ? 328  ASP A N   1 
ATOM   2001 C  CA  . ASP A 1  255 ? 48.479 178.228 -4.426  1.00 120.03 ? 328  ASP A CA  1 
ATOM   2002 C  C   . ASP A 1  255 ? 47.929 179.567 -4.909  1.00 135.74 ? 328  ASP A C   1 
ATOM   2003 O  O   . ASP A 1  255 ? 47.002 180.121 -4.314  1.00 150.75 ? 328  ASP A O   1 
ATOM   2004 C  CB  . ASP A 1  255 ? 49.805 178.438 -3.692  1.00 127.66 ? 328  ASP A CB  1 
ATOM   2005 C  CG  . ASP A 1  255 ? 50.289 177.183 -2.991  1.00 156.50 ? 328  ASP A CG  1 
ATOM   2006 O  OD1 . ASP A 1  255 ? 49.763 176.091 -3.291  1.00 178.98 ? 328  ASP A OD1 1 
ATOM   2007 O  OD2 . ASP A 1  255 ? 51.199 177.288 -2.142  1.00 150.90 ? 328  ASP A OD2 1 
ATOM   2008 N  N   . ALA A 1  256 ? 48.504 180.078 -5.994  1.00 130.40 ? 329  ALA A N   1 
ATOM   2009 C  CA  . ALA A 1  256 ? 48.063 181.341 -6.573  1.00 113.70 ? 329  ALA A CA  1 
ATOM   2010 C  C   . ALA A 1  256 ? 46.641 181.227 -7.115  1.00 121.70 ? 329  ALA A C   1 
ATOM   2011 O  O   . ALA A 1  256 ? 45.834 182.145 -6.959  1.00 116.20 ? 329  ALA A O   1 
ATOM   2012 C  CB  . ALA A 1  256 ? 49.016 181.782 -7.673  1.00 108.17 ? 329  ALA A CB  1 
ATOM   2013 N  N   . ALA A 1  257 ? 46.343 180.096 -7.748  1.00 109.44 ? 330  ALA A N   1 
ATOM   2014 C  CA  . ALA A 1  257 ? 45.019 179.853 -8.314  1.00 101.72 ? 330  ALA A CA  1 
ATOM   2015 C  C   . ALA A 1  257 ? 43.945 179.850 -7.228  1.00 95.11  ? 330  ALA A C   1 
ATOM   2016 O  O   . ALA A 1  257 ? 42.936 180.557 -7.332  1.00 131.95 ? 330  ALA A O   1 
ATOM   2017 C  CB  . ALA A 1  257 ? 45.007 178.538 -9.075  1.00 113.68 ? 330  ALA A CB  1 
ATOM   2018 N  N   . ALA A 1  258 ? 44.168 179.052 -6.189  1.00 84.47  ? 331  ALA A N   1 
ATOM   2019 C  CA  . ALA A 1  258 ? 43.250 178.996 -5.058  1.00 83.55  ? 331  ALA A CA  1 
ATOM   2020 C  C   . ALA A 1  258 ? 43.125 180.367 -4.403  1.00 84.38  ? 331  ALA A C   1 
ATOM   2021 O  O   . ALA A 1  258 ? 42.035 180.780 -4.001  1.00 92.09  ? 331  ALA A O   1 
ATOM   2022 C  CB  . ALA A 1  258 ? 43.716 177.961 -4.046  1.00 82.22  ? 331  ALA A CB  1 
ATOM   2023 N  N   . GLN A 1  259 ? 44.249 181.073 -4.313  1.00 95.07  ? 332  GLN A N   1 
ATOM   2024 C  CA  . GLN A 1  259 ? 44.283 182.392 -3.694  1.00 100.81 ? 332  GLN A CA  1 
ATOM   2025 C  C   . GLN A 1  259 ? 43.395 183.391 -4.433  1.00 91.49  ? 332  GLN A C   1 
ATOM   2026 O  O   . GLN A 1  259 ? 42.586 184.086 -3.814  1.00 98.16  ? 332  GLN A O   1 
ATOM   2027 C  CB  . GLN A 1  259 ? 45.721 182.914 -3.631  1.00 114.60 ? 332  GLN A CB  1 
ATOM   2028 C  CG  . GLN A 1  259 ? 45.860 184.304 -3.019  1.00 91.43  ? 332  GLN A CG  1 
ATOM   2029 C  CD  . GLN A 1  259 ? 45.488 184.342 -1.547  1.00 86.88  ? 332  GLN A CD  1 
ATOM   2030 O  OE1 . GLN A 1  259 ? 45.542 183.326 -0.853  1.00 123.83 ? 332  GLN A OE1 1 
ATOM   2031 N  NE2 . GLN A 1  259 ? 45.108 185.519 -1.064  1.00 115.58 ? 332  GLN A NE2 1 
ATOM   2032 N  N   . ILE A 1  260 ? 43.537 183.456 -5.754  1.00 105.65 ? 333  ILE A N   1 
ATOM   2033 C  CA  . ILE A 1  260 ? 42.773 184.420 -6.535  1.00 108.63 ? 333  ILE A CA  1 
ATOM   2034 C  C   . ILE A 1  260 ? 41.301 184.005 -6.596  1.00 121.96 ? 333  ILE A C   1 
ATOM   2035 O  O   . ILE A 1  260 ? 40.408 184.862 -6.569  1.00 116.74 ? 333  ILE A O   1 
ATOM   2036 C  CB  . ILE A 1  260 ? 43.377 184.609 -7.952  1.00 101.87 ? 333  ILE A CB  1 
ATOM   2037 C  CG1 . ILE A 1  260 ? 42.694 185.771 -8.678  1.00 112.04 ? 333  ILE A CG1 1 
ATOM   2038 C  CG2 . ILE A 1  260 ? 43.286 183.334 -8.777  1.00 109.14 ? 333  ILE A CG2 1 
ATOM   2039 C  CD1 . ILE A 1  260 ? 42.967 187.122 -8.053  1.00 126.77 ? 333  ILE A CD1 1 
ATOM   2040 N  N   . PHE A 1  261 ? 41.043 182.699 -6.650  1.00 103.65 ? 334  PHE A N   1 
ATOM   2041 C  CA  . PHE A 1  261 ? 39.666 182.207 -6.663  1.00 99.95  ? 334  PHE A CA  1 
ATOM   2042 C  C   . PHE A 1  261 ? 38.934 182.592 -5.383  1.00 97.34  ? 334  PHE A C   1 
ATOM   2043 O  O   . PHE A 1  261 ? 37.836 183.147 -5.432  1.00 111.20 ? 334  PHE A O   1 
ATOM   2044 C  CB  . PHE A 1  261 ? 39.621 180.690 -6.842  1.00 98.65  ? 334  PHE A CB  1 
ATOM   2045 C  CG  . PHE A 1  261 ? 38.261 180.097 -6.592  1.00 106.20 ? 334  PHE A CG  1 
ATOM   2046 C  CD1 . PHE A 1  261 ? 37.269 180.177 -7.555  1.00 120.91 ? 334  PHE A CD1 1 
ATOM   2047 C  CD2 . PHE A 1  261 ? 37.970 179.470 -5.390  1.00 112.28 ? 334  PHE A CD2 1 
ATOM   2048 C  CE1 . PHE A 1  261 ? 36.015 179.638 -7.327  1.00 118.79 ? 334  PHE A CE1 1 
ATOM   2049 C  CE2 . PHE A 1  261 ? 36.717 178.932 -5.155  1.00 110.00 ? 334  PHE A CE2 1 
ATOM   2050 C  CZ  . PHE A 1  261 ? 35.740 179.014 -6.126  1.00 99.81  ? 334  PHE A CZ  1 
ATOM   2051 N  N   . PHE A 1  262 ? 39.567 182.329 -4.263  1.00 94.95  ? 335  PHE A N   1 
ATOM   2052 C  CA  . PHE A 1  262 ? 39.027 182.730 -2.989  1.00 88.44  ? 335  PHE A CA  1 
ATOM   2053 C  C   . PHE A 1  262 ? 38.956 184.226 -2.805  1.00 90.62  ? 335  PHE A C   1 
ATOM   2054 O  O   . PHE A 1  262 ? 38.026 184.713 -2.200  1.00 123.38 ? 335  PHE A O   1 
ATOM   2055 C  CB  . PHE A 1  262 ? 39.761 182.051 -1.850  1.00 141.62 ? 335  PHE A CB  1 
ATOM   2056 C  CG  . PHE A 1  262 ? 39.288 180.662 -1.599  1.00 90.14  ? 335  PHE A CG  1 
ATOM   2057 C  CD1 . PHE A 1  262 ? 39.832 179.609 -2.279  1.00 88.87  ? 335  PHE A CD1 1 
ATOM   2058 C  CD2 . PHE A 1  262 ? 38.276 180.423 -0.714  1.00 110.14 ? 335  PHE A CD2 1 
ATOM   2059 C  CE1 . PHE A 1  262 ? 39.389 178.332 -2.066  1.00 85.17  ? 335  PHE A CE1 1 
ATOM   2060 C  CE2 . PHE A 1  262 ? 37.824 179.150 -0.492  1.00 110.09 ? 335  PHE A CE2 1 
ATOM   2061 C  CZ  . PHE A 1  262 ? 38.383 178.101 -1.168  1.00 83.25  ? 335  PHE A CZ  1 
ATOM   2062 N  N   . SER A 1  263 ? 39.930 184.963 -3.291  1.00 124.53 ? 336  SER A N   1 
ATOM   2063 C  CA  . SER A 1  263 ? 39.795 186.394 -3.145  1.00 148.92 ? 336  SER A CA  1 
ATOM   2064 C  C   . SER A 1  263 ? 38.641 186.979 -3.936  1.00 175.45 ? 336  SER A C   1 
ATOM   2065 O  O   . SER A 1  263 ? 37.932 187.831 -3.416  1.00 185.14 ? 336  SER A O   1 
ATOM   2066 C  CB  . SER A 1  263 ? 41.073 187.146 -3.444  1.00 139.10 ? 336  SER A CB  1 
ATOM   2067 O  OG  . SER A 1  263 ? 40.814 188.530 -3.315  1.00 151.83 ? 336  SER A OG  1 
ATOM   2068 N  N   . LEU A 1  264 ? 38.438 186.537 -5.179  1.00 159.30 ? 337  LEU A N   1 
ATOM   2069 C  CA  . LEU A 1  264 ? 37.305 187.055 -5.939  1.00 146.67 ? 337  LEU A CA  1 
ATOM   2070 C  C   . LEU A 1  264 ? 35.998 186.433 -5.448  1.00 133.84 ? 337  LEU A C   1 
ATOM   2071 O  O   . LEU A 1  264 ? 34.956 187.089 -5.427  1.00 106.29 ? 337  LEU A O   1 
ATOM   2072 C  CB  . LEU A 1  264 ? 37.499 186.798 -7.435  1.00 141.73 ? 337  LEU A CB  1 
ATOM   2073 C  CG  . LEU A 1  264 ? 38.789 187.363 -8.042  1.00 128.59 ? 337  LEU A CG  1 
ATOM   2074 C  CD1 . LEU A 1  264 ? 38.822 187.160 -9.548  1.00 152.40 ? 337  LEU A CD1 1 
ATOM   2075 C  CD2 . LEU A 1  264 ? 38.959 188.835 -7.694  1.00 124.10 ? 337  LEU A CD2 1 
ATOM   2076 N  N   . GLY A 1  265 ? 36.017 185.184 -4.992  1.00 156.88 ? 338  GLY A N   1 
ATOM   2077 C  CA  . GLY A 1  265 ? 34.815 184.597 -4.401  1.00 155.19 ? 338  GLY A CA  1 
ATOM   2078 C  C   . GLY A 1  265 ? 33.551 184.530 -5.255  1.00 138.84 ? 338  GLY A C   1 
ATOM   2079 O  O   . GLY A 1  265 ? 32.439 184.803 -4.805  1.00 127.39 ? 338  GLY A O   1 
ATOM   2080 N  N   . PRO A 1  266 ? 33.760 184.165 -6.508  1.00 138.19 ? 339  PRO A N   1 
ATOM   2081 C  CA  . PRO A 1  266 ? 32.752 183.943 -7.529  1.00 147.63 ? 339  PRO A CA  1 
ATOM   2082 C  C   . PRO A 1  266 ? 32.062 182.642 -7.262  1.00 144.62 ? 339  PRO A C   1 
ATOM   2083 O  O   . PRO A 1  266 ? 32.550 181.889 -6.453  1.00 127.75 ? 339  PRO A O   1 
ATOM   2084 C  CB  . PRO A 1  266 ? 33.577 183.805 -8.800  1.00 136.03 ? 339  PRO A CB  1 
ATOM   2085 C  CG  . PRO A 1  266 ? 35.005 183.861 -8.378  1.00 125.42 ? 339  PRO A CG  1 
ATOM   2086 C  CD  . PRO A 1  266 ? 35.033 184.581 -7.080  1.00 121.06 ? 339  PRO A CD  1 
ATOM   2087 N  N   . GLY A 1  267 ? 31.006 182.307 -7.998  1.00 153.48 ? 340  GLY A N   1 
ATOM   2088 C  CA  . GLY A 1  267 ? 30.376 180.997 -7.859  1.00 135.52 ? 340  GLY A CA  1 
ATOM   2089 C  C   . GLY A 1  267 ? 29.821 180.630 -6.491  1.00 133.99 ? 340  GLY A C   1 
ATOM   2090 O  O   . GLY A 1  267 ? 29.957 179.499 -6.020  1.00 142.81 ? 340  GLY A O   1 
ATOM   2091 N  N   . PHE A 1  268 ? 29.193 181.613 -5.860  1.00 145.98 ? 341  PHE A N   1 
ATOM   2092 C  CA  . PHE A 1  268 ? 28.538 181.490 -4.564  1.00 144.97 ? 341  PHE A CA  1 
ATOM   2093 C  C   . PHE A 1  268 ? 27.154 182.128 -4.611  1.00 145.00 ? 341  PHE A C   1 
ATOM   2094 O  O   . PHE A 1  268 ? 26.319 181.892 -3.740  1.00 145.08 ? 341  PHE A O   1 
ATOM   2095 C  CB  . PHE A 1  268 ? 29.388 182.132 -3.465  1.00 144.01 ? 341  PHE A CB  1 
ATOM   2096 C  CG  . PHE A 1  268 ? 28.945 181.780 -2.073  1.00 161.46 ? 341  PHE A CG  1 
ATOM   2097 C  CD1 . PHE A 1  268 ? 29.330 180.582 -1.493  1.00 138.71 ? 341  PHE A CD1 1 
ATOM   2098 C  CD2 . PHE A 1  268 ? 28.148 182.646 -1.344  1.00 183.91 ? 341  PHE A CD2 1 
ATOM   2099 C  CE1 . PHE A 1  268 ? 28.925 180.255 -0.215  1.00 142.13 ? 341  PHE A CE1 1 
ATOM   2100 C  CE2 . PHE A 1  268 ? 27.740 182.324 -0.065  1.00 176.20 ? 341  PHE A CE2 1 
ATOM   2101 C  CZ  . PHE A 1  268 ? 28.129 181.127 0.501   1.00 146.08 ? 341  PHE A CZ  1 
ATOM   2102 N  N   . GLY A 1  269 ? 26.918 182.936 -5.638  1.00 141.72 ? 342  GLY A N   1 
ATOM   2103 C  CA  . GLY A 1  269 ? 25.623 183.562 -5.827  1.00 160.53 ? 342  GLY A CA  1 
ATOM   2104 C  C   . GLY A 1  269 ? 25.506 184.944 -5.216  1.00 149.50 ? 342  GLY A C   1 
ATOM   2105 O  O   . GLY A 1  269 ? 24.463 185.589 -5.318  1.00 167.50 ? 342  GLY A O   1 
ATOM   2106 N  N   . VAL A 1  270 ? 26.575 185.398 -4.573  1.00 132.60 ? 343  VAL A N   1 
ATOM   2107 C  CA  . VAL A 1  270 ? 26.607 186.739 -4.008  1.00 150.26 ? 343  VAL A CA  1 
ATOM   2108 C  C   . VAL A 1  270 ? 26.649 187.765 -5.132  1.00 146.70 ? 343  VAL A C   1 
ATOM   2109 O  O   . VAL A 1  270 ? 25.871 188.721 -5.145  1.00 128.34 ? 343  VAL A O   1 
ATOM   2110 C  CB  . VAL A 1  270 ? 27.799 186.920 -3.059  1.00 153.25 ? 343  VAL A CB  1 
ATOM   2111 C  CG1 . VAL A 1  270 ? 27.996 188.389 -2.746  1.00 166.71 ? 343  VAL A CG1 1 
ATOM   2112 C  CG2 . VAL A 1  270 ? 27.583 186.125 -1.783  1.00 137.74 ? 343  VAL A CG2 1 
ATOM   2113 N  N   . LEU A 1  271 ? 27.560 187.557 -6.077  1.00 143.35 ? 344  LEU A N   1 
ATOM   2114 C  CA  . LEU A 1  271 ? 27.667 188.414 -7.252  1.00 125.25 ? 344  LEU A CA  1 
ATOM   2115 C  C   . LEU A 1  271 ? 26.386 188.335 -8.071  1.00 145.48 ? 344  LEU A C   1 
ATOM   2116 O  O   . LEU A 1  271 ? 25.979 189.303 -8.714  1.00 167.96 ? 344  LEU A O   1 
ATOM   2117 C  CB  . LEU A 1  271 ? 28.866 188.005 -8.109  1.00 126.10 ? 344  LEU A CB  1 
ATOM   2118 C  CG  . LEU A 1  271 ? 30.186 187.797 -7.368  1.00 137.14 ? 344  LEU A CG  1 
ATOM   2119 C  CD1 . LEU A 1  271 ? 31.261 187.312 -8.326  1.00 120.13 ? 344  LEU A CD1 1 
ATOM   2120 C  CD2 . LEU A 1  271 ? 30.616 189.080 -6.676  1.00 136.97 ? 344  LEU A CD2 1 
ATOM   2121 N  N   . LEU A 1  272 ? 25.760 187.164 -8.037  1.00 157.69 ? 345  LEU A N   1 
ATOM   2122 C  CA  . LEU A 1  272 ? 24.499 186.930 -8.723  1.00 145.84 ? 345  LEU A CA  1 
ATOM   2123 C  C   . LEU A 1  272 ? 23.405 187.815 -8.132  1.00 153.21 ? 345  LEU A C   1 
ATOM   2124 O  O   . LEU A 1  272 ? 22.659 188.472 -8.861  1.00 171.72 ? 345  LEU A O   1 
ATOM   2125 C  CB  . LEU A 1  272 ? 24.104 185.456 -8.616  1.00 133.57 ? 345  LEU A CB  1 
ATOM   2126 C  CG  . LEU A 1  272 ? 23.252 184.848 -9.730  1.00 139.41 ? 345  LEU A CG  1 
ATOM   2127 C  CD1 . LEU A 1  272 ? 24.104 184.563 -10.956 1.00 138.55 ? 345  LEU A CD1 1 
ATOM   2128 C  CD2 . LEU A 1  272 ? 22.568 183.582 -9.242  1.00 142.71 ? 345  LEU A CD2 1 
ATOM   2129 N  N   . ALA A 1  273 ? 23.325 187.830 -6.805  1.00 124.77 ? 346  ALA A N   1 
ATOM   2130 C  CA  . ALA A 1  273 ? 22.315 188.610 -6.101  1.00 128.55 ? 346  ALA A CA  1 
ATOM   2131 C  C   . ALA A 1  273 ? 22.564 190.108 -6.248  1.00 154.78 ? 346  ALA A C   1 
ATOM   2132 O  O   . ALA A 1  273 ? 21.626 190.882 -6.428  1.00 155.25 ? 346  ALA A O   1 
ATOM   2133 C  CB  . ALA A 1  273 ? 22.279 188.224 -4.632  1.00 154.25 ? 346  ALA A CB  1 
ATOM   2134 N  N   . PHE A 1  274 ? 23.828 190.513 -6.168  1.00 155.15 ? 347  PHE A N   1 
ATOM   2135 C  CA  . PHE A 1  274 ? 24.183 191.921 -6.321  1.00 148.01 ? 347  PHE A CA  1 
ATOM   2136 C  C   . PHE A 1  274 ? 23.936 192.403 -7.744  1.00 152.74 ? 347  PHE A C   1 
ATOM   2137 O  O   . PHE A 1  274 ? 23.627 193.574 -7.969  1.00 147.00 ? 347  PHE A O   1 
ATOM   2138 C  CB  . PHE A 1  274 ? 25.644 192.157 -5.937  1.00 144.81 ? 347  PHE A CB  1 
ATOM   2139 C  CG  . PHE A 1  274 ? 25.849 192.416 -4.475  1.00 155.42 ? 347  PHE A CG  1 
ATOM   2140 C  CD1 . PHE A 1  274 ? 24.764 192.543 -3.624  1.00 175.38 ? 347  PHE A CD1 1 
ATOM   2141 C  CD2 . PHE A 1  274 ? 27.123 192.546 -3.952  1.00 148.61 ? 347  PHE A CD2 1 
ATOM   2142 C  CE1 . PHE A 1  274 ? 24.945 192.786 -2.279  1.00 171.37 ? 347  PHE A CE1 1 
ATOM   2143 C  CE2 . PHE A 1  274 ? 27.310 192.790 -2.608  1.00 144.50 ? 347  PHE A CE2 1 
ATOM   2144 C  CZ  . PHE A 1  274 ? 26.219 192.910 -1.770  1.00 142.61 ? 347  PHE A CZ  1 
ATOM   2145 N  N   . ALA A 1  275 ? 24.076 191.496 -8.704  1.00 133.06 ? 348  ALA A N   1 
ATOM   2146 C  CA  . ALA A 1  275 ? 23.827 191.827 -10.100 1.00 163.57 ? 348  ALA A CA  1 
ATOM   2147 C  C   . ALA A 1  275 ? 22.332 191.802 -10.398 1.00 174.05 ? 348  ALA A C   1 
ATOM   2148 O  O   . ALA A 1  275 ? 21.871 192.429 -11.351 1.00 152.19 ? 348  ALA A O   1 
ATOM   2149 C  CB  . ALA A 1  275 ? 24.570 190.868 -11.015 1.00 138.81 ? 348  ALA A CB  1 
ATOM   2150 N  N   . SER A 1  276 ? 21.580 191.081 -9.571  1.00 191.32 ? 349  SER A N   1 
ATOM   2151 C  CA  . SER A 1  276 ? 20.137 190.947 -9.755  1.00 193.86 ? 349  SER A CA  1 
ATOM   2152 C  C   . SER A 1  276 ? 19.418 192.290 -9.655  1.00 213.73 ? 349  SER A C   1 
ATOM   2153 O  O   . SER A 1  276 ? 18.425 192.522 -10.344 1.00 231.63 ? 349  SER A O   1 
ATOM   2154 C  CB  . SER A 1  276 ? 19.556 189.970 -8.731  1.00 193.32 ? 349  SER A CB  1 
ATOM   2155 O  OG  . SER A 1  276 ? 18.149 189.872 -8.861  1.00 210.95 ? 349  SER A OG  1 
ATOM   2156 N  N   . TYR A 1  277 ? 19.921 193.169 -8.796  1.00 208.31 ? 350  TYR A N   1 
ATOM   2157 C  CA  . TYR A 1  277 ? 19.314 194.482 -8.610  1.00 197.38 ? 350  TYR A CA  1 
ATOM   2158 C  C   . TYR A 1  277 ? 20.285 195.383 -9.368  1.00 185.35 ? 350  TYR A C   1 
ATOM   2159 O  O   . TYR A 1  277 ? 21.242 195.898 -8.792  1.00 192.68 ? 350  TYR A O   1 
ATOM   2160 C  CB  . TYR A 1  277 ? 19.205 194.819 -7.122  1.00 192.39 ? 350  TYR A CB  1 
ATOM   2161 C  CG  . TYR A 1  277 ? 18.547 193.743 -6.289  1.00 190.60 ? 350  TYR A CG  1 
ATOM   2162 C  CD1 . TYR A 1  277 ? 17.165 193.671 -6.179  1.00 210.22 ? 350  TYR A CD1 1 
ATOM   2163 C  CD2 . TYR A 1  277 ? 19.309 192.804 -5.608  1.00 188.77 ? 350  TYR A CD2 1 
ATOM   2164 C  CE1 . TYR A 1  277 ? 16.560 192.690 -5.416  1.00 214.36 ? 350  TYR A CE1 1 
ATOM   2165 C  CE2 . TYR A 1  277 ? 18.713 191.819 -4.843  1.00 187.92 ? 350  TYR A CE2 1 
ATOM   2166 C  CZ  . TYR A 1  277 ? 17.339 191.767 -4.751  1.00 199.44 ? 350  TYR A CZ  1 
ATOM   2167 O  OH  . TYR A 1  277 ? 16.741 190.789 -3.990  1.00 188.45 ? 350  TYR A OH  1 
ATOM   2168 N  N   . ASN A 1  278 ? 20.034 195.574 -10.658 1.00 176.04 ? 351  ASN A N   1 
ATOM   2169 C  CA  . ASN A 1  278 ? 20.764 196.555 -11.451 1.00 188.31 ? 351  ASN A CA  1 
ATOM   2170 C  C   . ASN A 1  278 ? 20.095 196.764 -12.807 1.00 199.03 ? 351  ASN A C   1 
ATOM   2171 O  O   . ASN A 1  278 ? 19.209 196.001 -13.194 1.00 182.44 ? 351  ASN A O   1 
ATOM   2172 C  CB  . ASN A 1  278 ? 22.224 196.130 -11.636 1.00 180.26 ? 351  ASN A CB  1 
ATOM   2173 C  CG  . ASN A 1  278 ? 23.119 197.281 -12.048 1.00 208.63 ? 351  ASN A CG  1 
ATOM   2174 O  OD1 . ASN A 1  278 ? 23.529 197.379 -13.203 1.00 233.60 ? 351  ASN A OD1 1 
ATOM   2175 N  ND2 . ASN A 1  278 ? 23.426 198.160 -11.101 1.00 207.65 ? 351  ASN A ND2 1 
ATOM   2176 N  N   . LYS A 1  279 ? 20.521 197.802 -13.521 1.00 204.12 ? 352  LYS A N   1 
ATOM   2177 C  CA  . LYS A 1  279 ? 19.963 198.118 -14.832 1.00 212.84 ? 352  LYS A CA  1 
ATOM   2178 C  C   . LYS A 1  279 ? 20.262 197.002 -15.829 1.00 206.62 ? 352  LYS A C   1 
ATOM   2179 O  O   . LYS A 1  279 ? 21.282 196.323 -15.723 1.00 197.19 ? 352  LYS A O   1 
ATOM   2180 C  CB  . LYS A 1  279 ? 20.517 199.450 -15.342 1.00 221.71 ? 352  LYS A CB  1 
ATOM   2181 C  CG  . LYS A 1  279 ? 20.405 200.592 -14.344 1.00 222.44 ? 352  LYS A CG  1 
ATOM   2182 C  CD  . LYS A 1  279 ? 21.117 201.838 -14.846 1.00 225.33 ? 352  LYS A CD  1 
ATOM   2183 C  CE  . LYS A 1  279 ? 20.459 202.385 -16.102 1.00 219.76 ? 352  LYS A CE  1 
ATOM   2184 N  NZ  . LYS A 1  279 ? 19.057 202.814 -15.843 1.00 218.16 ? 352  LYS A NZ  1 
ATOM   2185 N  N   . PHE A 1  280 ? 19.370 196.815 -16.796 1.00 209.13 ? 353  PHE A N   1 
ATOM   2186 C  CA  . PHE A 1  280 ? 19.521 195.738 -17.768 1.00 201.86 ? 353  PHE A CA  1 
ATOM   2187 C  C   . PHE A 1  280 ? 20.546 196.097 -18.840 1.00 198.64 ? 353  PHE A C   1 
ATOM   2188 O  O   . PHE A 1  280 ? 21.331 195.250 -19.269 1.00 161.13 ? 353  PHE A O   1 
ATOM   2189 C  CB  . PHE A 1  280 ? 18.175 195.407 -18.416 1.00 215.83 ? 353  PHE A CB  1 
ATOM   2190 C  CG  . PHE A 1  280 ? 18.162 194.097 -19.153 1.00 204.50 ? 353  PHE A CG  1 
ATOM   2191 C  CD1 . PHE A 1  280 ? 17.839 192.922 -18.494 1.00 186.52 ? 353  PHE A CD1 1 
ATOM   2192 C  CD2 . PHE A 1  280 ? 18.473 194.040 -20.502 1.00 208.89 ? 353  PHE A CD2 1 
ATOM   2193 C  CE1 . PHE A 1  280 ? 17.825 191.714 -19.167 1.00 188.08 ? 353  PHE A CE1 1 
ATOM   2194 C  CE2 . PHE A 1  280 ? 18.462 192.834 -21.180 1.00 193.92 ? 353  PHE A CE2 1 
ATOM   2195 C  CZ  . PHE A 1  280 ? 18.137 191.671 -20.511 1.00 187.40 ? 353  PHE A CZ  1 
ATOM   2196 N  N   . ASN A 1  281 ? 20.536 197.355 -19.270 1.00 202.01 ? 354  ASN A N   1 
ATOM   2197 C  CA  . ASN A 1  281 ? 21.484 197.831 -20.272 1.00 199.15 ? 354  ASN A CA  1 
ATOM   2198 C  C   . ASN A 1  281 ? 22.795 198.271 -19.632 1.00 193.65 ? 354  ASN A C   1 
ATOM   2199 O  O   . ASN A 1  281 ? 23.676 198.807 -20.304 1.00 189.92 ? 354  ASN A O   1 
ATOM   2200 C  CB  . ASN A 1  281 ? 20.883 198.984 -21.079 1.00 209.68 ? 354  ASN A CB  1 
ATOM   2201 C  CG  . ASN A 1  281 ? 20.274 198.523 -22.388 1.00 214.87 ? 354  ASN A CG  1 
ATOM   2202 O  OD1 . ASN A 1  281 ? 19.103 198.149 -22.445 1.00 221.19 ? 354  ASN A OD1 1 
ATOM   2203 N  ND2 . ASN A 1  281 ? 21.071 198.550 -23.451 1.00 214.46 ? 354  ASN A ND2 1 
ATOM   2204 N  N   . ASN A 1  282 ? 22.917 198.043 -18.329 1.00 164.75 ? 355  ASN A N   1 
ATOM   2205 C  CA  . ASN A 1  282 ? 24.122 198.403 -17.594 1.00 180.98 ? 355  ASN A CA  1 
ATOM   2206 C  C   . ASN A 1  282 ? 25.288 197.500 -17.986 1.00 171.75 ? 355  ASN A C   1 
ATOM   2207 O  O   . ASN A 1  282 ? 25.098 196.323 -18.295 1.00 154.33 ? 355  ASN A O   1 
ATOM   2208 C  CB  . ASN A 1  282 ? 23.893 198.334 -16.096 1.00 194.66 ? 355  ASN A CB  1 
ATOM   2209 C  CG  . ASN A 1  282 ? 25.174 198.391 -15.334 1.00 194.20 ? 355  ASN A CG  1 
ATOM   2210 O  OD1 . ASN A 1  282 ? 25.644 197.385 -14.804 1.00 171.56 ? 355  ASN A OD1 1 
ATOM   2211 N  ND2 . ASN A 1  282 ? 25.776 199.573 -15.288 1.00 199.85 ? 355  ASN A ND2 1 
ATOM   2212 N  N   . ASN A 1  283 ? 26.493 198.060 -17.972 1.00 172.28 ? 356  ASN A N   1 
ATOM   2213 C  CA  . ASN A 1  283 ? 27.692 197.323 -18.353 1.00 158.34 ? 356  ASN A CA  1 
ATOM   2214 C  C   . ASN A 1  283 ? 28.140 196.379 -17.240 1.00 185.08 ? 356  ASN A C   1 
ATOM   2215 O  O   . ASN A 1  283 ? 27.966 196.670 -16.057 1.00 208.95 ? 356  ASN A O   1 
ATOM   2216 C  CB  . ASN A 1  283 ? 28.822 198.293 -18.708 1.00 158.51 ? 356  ASN A CB  1 
ATOM   2217 C  CG  . ASN A 1  283 ? 30.037 197.591 -19.280 1.00 162.56 ? 356  ASN A CG  1 
ATOM   2218 O  OD1 . ASN A 1  283 ? 30.928 197.169 -18.544 1.00 180.11 ? 356  ASN A OD1 1 
ATOM   2219 N  ND2 . ASN A 1  283 ? 30.079 197.464 -20.602 1.00 151.80 ? 356  ASN A ND2 1 
ATOM   2220 N  N   . CYS A 1  284 ? 28.719 195.247 -17.629 1.00 202.90 ? 357  CYS A N   1 
ATOM   2221 C  CA  . CYS A 1  284 ? 29.200 194.259 -16.672 1.00 182.61 ? 357  CYS A CA  1 
ATOM   2222 C  C   . CYS A 1  284 ? 30.713 194.092 -16.781 1.00 184.76 ? 357  CYS A C   1 
ATOM   2223 O  O   . CYS A 1  284 ? 31.388 193.757 -15.806 1.00 213.46 ? 357  CYS A O   1 
ATOM   2224 C  CB  . CYS A 1  284 ? 28.506 192.914 -16.897 1.00 184.92 ? 357  CYS A CB  1 
ATOM   2225 S  SG  . CYS A 1  284 ? 26.710 193.018 -17.060 1.00 238.59 ? 357  CYS A SG  1 
ATOM   2226 N  N   . TYR A 1  285 ? 31.231 194.330 -17.982 1.00 164.83 ? 358  TYR A N   1 
ATOM   2227 C  CA  . TYR A 1  285 ? 32.653 194.188 -18.279 1.00 171.74 ? 358  TYR A CA  1 
ATOM   2228 C  C   . TYR A 1  285 ? 33.509 195.121 -17.421 1.00 197.26 ? 358  TYR A C   1 
ATOM   2229 O  O   . TYR A 1  285 ? 34.353 194.671 -16.634 1.00 212.58 ? 358  TYR A O   1 
ATOM   2230 C  CB  . TYR A 1  285 ? 32.894 194.468 -19.766 1.00 178.67 ? 358  TYR A CB  1 
ATOM   2231 C  CG  . TYR A 1  285 ? 34.238 194.021 -20.294 1.00 177.17 ? 358  TYR A CG  1 
ATOM   2232 C  CD1 . TYR A 1  285 ? 34.408 192.748 -20.821 1.00 183.13 ? 358  TYR A CD1 1 
ATOM   2233 C  CD2 . TYR A 1  285 ? 35.332 194.877 -20.284 1.00 177.74 ? 358  TYR A CD2 1 
ATOM   2234 C  CE1 . TYR A 1  285 ? 35.631 192.336 -21.313 1.00 189.68 ? 358  TYR A CE1 1 
ATOM   2235 C  CE2 . TYR A 1  285 ? 36.559 194.473 -20.774 1.00 174.32 ? 358  TYR A CE2 1 
ATOM   2236 C  CZ  . TYR A 1  285 ? 36.703 193.202 -21.286 1.00 185.06 ? 358  TYR A CZ  1 
ATOM   2237 O  OH  . TYR A 1  285 ? 37.923 192.797 -21.774 1.00 204.96 ? 358  TYR A OH  1 
ATOM   2238 N  N   . GLN A 1  286 ? 33.275 196.421 -17.583 1.00 198.12 ? 359  GLN A N   1 
ATOM   2239 C  CA  . GLN A 1  286 ? 34.009 197.454 -16.860 1.00 195.52 ? 359  GLN A CA  1 
ATOM   2240 C  C   . GLN A 1  286 ? 33.878 197.282 -15.350 1.00 204.53 ? 359  GLN A C   1 
ATOM   2241 O  O   . GLN A 1  286 ? 34.850 197.449 -14.612 1.00 219.84 ? 359  GLN A O   1 
ATOM   2242 C  CB  . GLN A 1  286 ? 33.515 198.843 -17.277 1.00 207.31 ? 359  GLN A CB  1 
ATOM   2243 C  CG  . GLN A 1  286 ? 34.236 200.002 -16.606 1.00 208.98 ? 359  GLN A CG  1 
ATOM   2244 C  CD  . GLN A 1  286 ? 33.684 201.351 -17.027 1.00 229.82 ? 359  GLN A CD  1 
ATOM   2245 O  OE1 . GLN A 1  286 ? 32.693 201.430 -17.754 1.00 252.09 ? 359  GLN A OE1 1 
ATOM   2246 N  NE2 . GLN A 1  286 ? 34.325 202.422 -16.572 1.00 230.21 ? 359  GLN A NE2 1 
ATOM   2247 N  N   . ASP A 1  287 ? 32.672 196.944 -14.902 1.00 190.61 ? 360  ASP A N   1 
ATOM   2248 C  CA  . ASP A 1  287 ? 32.407 196.727 -13.485 1.00 183.04 ? 360  ASP A CA  1 
ATOM   2249 C  C   . ASP A 1  287 ? 33.287 195.633 -12.892 1.00 185.27 ? 360  ASP A C   1 
ATOM   2250 O  O   . ASP A 1  287 ? 34.068 195.884 -11.975 1.00 176.82 ? 360  ASP A O   1 
ATOM   2251 C  CB  . ASP A 1  287 ? 30.941 196.353 -13.263 1.00 180.09 ? 360  ASP A CB  1 
ATOM   2252 C  CG  . ASP A 1  287 ? 29.989 197.452 -13.689 1.00 208.61 ? 360  ASP A CG  1 
ATOM   2253 O  OD1 . ASP A 1  287 ? 30.344 198.230 -14.598 1.00 222.15 ? 360  ASP A OD1 1 
ATOM   2254 O  OD2 . ASP A 1  287 ? 28.884 197.537 -13.113 1.00 219.59 ? 360  ASP A OD2 1 
ATOM   2255 N  N   . ALA A 1  288 ? 33.157 194.425 -13.433 1.00 128.63 ? 361  ALA A N   1 
ATOM   2256 C  CA  . ALA A 1  288 ? 33.938 193.274 -12.987 1.00 123.99 ? 361  ALA A CA  1 
ATOM   2257 C  C   . ALA A 1  288 ? 35.438 193.545 -13.055 1.00 176.23 ? 361  ALA A C   1 
ATOM   2258 O  O   . ALA A 1  288 ? 36.174 193.265 -12.101 1.00 193.84 ? 361  ALA A O   1 
ATOM   2259 C  CB  . ALA A 1  288 ? 33.586 192.049 -13.819 1.00 122.29 ? 361  ALA A CB  1 
ATOM   2260 N  N   . LEU A 1  289 ? 35.881 194.097 -14.183 1.00 154.63 ? 362  LEU A N   1 
ATOM   2261 C  CA  . LEU A 1  289 ? 37.294 194.407 -14.382 1.00 160.91 ? 362  LEU A CA  1 
ATOM   2262 C  C   . LEU A 1  289 ? 37.813 195.335 -13.283 1.00 162.51 ? 362  LEU A C   1 
ATOM   2263 O  O   . LEU A 1  289 ? 38.764 194.997 -12.569 1.00 173.86 ? 362  LEU A O   1 
ATOM   2264 C  CB  . LEU A 1  289 ? 37.509 195.036 -15.762 1.00 165.91 ? 362  LEU A CB  1 
ATOM   2265 C  CG  . LEU A 1  289 ? 38.937 195.143 -16.307 1.00 169.86 ? 362  LEU A CG  1 
ATOM   2266 C  CD1 . LEU A 1  289 ? 38.929 195.007 -17.822 1.00 186.50 ? 362  LEU A CD1 1 
ATOM   2267 C  CD2 . LEU A 1  289 ? 39.591 196.456 -15.901 1.00 160.50 ? 362  LEU A CD2 1 
ATOM   2268 N  N   . VAL A 1  290 ? 37.173 196.494 -13.147 1.00 148.65 ? 363  VAL A N   1 
ATOM   2269 C  CA  . VAL A 1  290 ? 37.571 197.494 -12.161 1.00 140.65 ? 363  VAL A CA  1 
ATOM   2270 C  C   . VAL A 1  290 ? 37.580 196.912 -10.751 1.00 166.36 ? 363  VAL A C   1 
ATOM   2271 O  O   . VAL A 1  290 ? 38.575 197.033 -10.038 1.00 159.54 ? 363  VAL A O   1 
ATOM   2272 C  CB  . VAL A 1  290 ? 36.656 198.732 -12.226 1.00 147.92 ? 363  VAL A CB  1 
ATOM   2273 C  CG1 . VAL A 1  290 ? 36.838 199.594 -10.986 1.00 153.93 ? 363  VAL A CG1 1 
ATOM   2274 C  CG2 . VAL A 1  290 ? 36.955 199.542 -13.478 1.00 186.02 ? 363  VAL A CG2 1 
ATOM   2275 N  N   . THR A 1  291 ? 36.479 196.277 -10.359 1.00 181.06 ? 364  THR A N   1 
ATOM   2276 C  CA  . THR A 1  291 ? 36.358 195.698 -9.022  1.00 165.11 ? 364  THR A CA  1 
ATOM   2277 C  C   . THR A 1  291 ? 37.478 194.703 -8.726  1.00 143.47 ? 364  THR A C   1 
ATOM   2278 O  O   . THR A 1  291 ? 38.112 194.764 -7.668  1.00 148.06 ? 364  THR A O   1 
ATOM   2279 C  CB  . THR A 1  291 ? 35.003 194.991 -8.834  1.00 145.14 ? 364  THR A CB  1 
ATOM   2280 O  OG1 . THR A 1  291 ? 34.839 193.987 -9.843  1.00 146.64 ? 364  THR A OG1 1 
ATOM   2281 C  CG2 . THR A 1  291 ? 33.862 195.991 -8.924  1.00 148.76 ? 364  THR A CG2 1 
ATOM   2282 N  N   . SER A 1  292 ? 37.723 193.794 -9.666  1.00 130.91 ? 365  SER A N   1 
ATOM   2283 C  CA  . SER A 1  292 ? 38.765 192.786 -9.491  1.00 119.22 ? 365  SER A CA  1 
ATOM   2284 C  C   . SER A 1  292 ? 40.146 193.423 -9.354  1.00 126.23 ? 365  SER A C   1 
ATOM   2285 O  O   . SER A 1  292 ? 40.918 193.068 -8.456  1.00 135.74 ? 365  SER A O   1 
ATOM   2286 C  CB  . SER A 1  292 ? 38.754 191.804 -10.660 1.00 131.38 ? 365  SER A CB  1 
ATOM   2287 O  OG  . SER A 1  292 ? 37.507 191.138 -10.752 1.00 131.73 ? 365  SER A OG  1 
ATOM   2288 N  N   . VAL A 1  293 ? 40.450 194.365 -10.245 1.00 128.72 ? 366  VAL A N   1 
ATOM   2289 C  CA  . VAL A 1  293 ? 41.728 195.071 -10.200 1.00 137.38 ? 366  VAL A CA  1 
ATOM   2290 C  C   . VAL A 1  293 ? 41.906 195.777 -8.854  1.00 146.87 ? 366  VAL A C   1 
ATOM   2291 O  O   . VAL A 1  293 ? 42.994 195.765 -8.278  1.00 145.55 ? 366  VAL A O   1 
ATOM   2292 C  CB  . VAL A 1  293 ? 41.852 196.070 -11.368 1.00 151.96 ? 366  VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1  293 ? 43.081 196.952 -11.197 1.00 155.06 ? 366  VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1  293 ? 41.916 195.329 -12.694 1.00 150.16 ? 366  VAL A CG2 1 
ATOM   2295 N  N   . VAL A 1  294 ? 40.833 196.292 -8.283  1.00 154.06 ? 367  VAL A N   1 
ATOM   2296 C  CA  . VAL A 1  294 ? 40.941 196.823 -6.930  1.00 158.08 ? 367  VAL A CA  1 
ATOM   2297 C  C   . VAL A 1  294 ? 41.246 195.788 -5.836  1.00 151.75 ? 367  VAL A C   1 
ATOM   2298 O  O   . VAL A 1  294 ? 42.122 195.983 -4.994  1.00 166.73 ? 367  VAL A O   1 
ATOM   2299 C  CB  . VAL A 1  294 ? 39.662 197.566 -6.555  1.00 123.93 ? 367  VAL A CB  1 
ATOM   2300 C  CG1 . VAL A 1  294 ? 39.781 198.144 -5.160  1.00 124.60 ? 367  VAL A CG1 1 
ATOM   2301 C  CG2 . VAL A 1  294 ? 39.405 198.660 -7.567  1.00 128.42 ? 367  VAL A CG2 1 
ATOM   2302 N  N   . ASN A 1  295 ? 40.540 194.671 -5.877  1.00 141.98 ? 368  ASN A N   1 
ATOM   2303 C  CA  . ASN A 1  295 ? 40.733 193.587 -4.920  1.00 130.83 ? 368  ASN A CA  1 
ATOM   2304 C  C   . ASN A 1  295 ? 42.178 193.104 -4.871  1.00 134.58 ? 368  ASN A C   1 
ATOM   2305 O  O   . ASN A 1  295 ? 42.735 192.909 -3.791  1.00 150.91 ? 368  ASN A O   1 
ATOM   2306 C  CB  . ASN A 1  295 ? 39.809 192.413 -5.248  1.00 137.03 ? 368  ASN A CB  1 
ATOM   2307 C  CG  . ASN A 1  295 ? 40.104 191.186 -4.406  1.00 149.03 ? 368  ASN A CG  1 
ATOM   2308 O  OD1 . ASN A 1  295 ? 39.665 191.084 -3.260  1.00 167.28 ? 368  ASN A OD1 1 
ATOM   2309 N  ND2 . ASN A 1  295 ? 40.853 190.244 -4.972  1.00 159.64 ? 368  ASN A ND2 1 
ATOM   2310 N  N   . CYS A 1  296 ? 42.750 192.914 -6.046  1.00 122.88 ? 369  CYS A N   1 
ATOM   2311 C  CA  . CYS A 1  296 ? 44.158 192.625 -6.150  1.00 131.94 ? 369  CYS A CA  1 
ATOM   2312 C  C   . CYS A 1  296 ? 45.119 193.734 -5.763  1.00 144.03 ? 369  CYS A C   1 
ATOM   2313 O  O   . CYS A 1  296 ? 46.059 193.496 -5.012  1.00 153.14 ? 369  CYS A O   1 
ATOM   2314 C  CB  . CYS A 1  296 ? 44.450 192.154 -7.552  1.00 125.73 ? 369  CYS A CB  1 
ATOM   2315 S  SG  . CYS A 1  296 ? 43.199 190.966 -8.019  1.00 115.76 ? 369  CYS A SG  1 
ATOM   2316 N  N   . MET A 1  297 ? 44.882 194.948 -6.236  1.00 183.12 ? 370  MET A N   1 
ATOM   2317 C  CA  . MET A 1  297 ? 45.825 196.015 -5.952  1.00 187.93 ? 370  MET A CA  1 
ATOM   2318 C  C   . MET A 1  297 ? 45.808 196.225 -4.464  1.00 183.85 ? 370  MET A C   1 
ATOM   2319 O  O   . MET A 1  297 ? 46.835 196.338 -3.806  1.00 185.35 ? 370  MET A O   1 
ATOM   2320 C  CB  . MET A 1  297 ? 45.425 197.288 -6.671  1.00 196.25 ? 370  MET A CB  1 
ATOM   2321 C  CG  . MET A 1  297 ? 45.875 197.321 -8.114  1.00 204.49 ? 370  MET A CG  1 
ATOM   2322 S  SD  . MET A 1  297 ? 47.502 196.585 -8.296  1.00 213.04 ? 370  MET A SD  1 
ATOM   2323 C  CE  . MET A 1  297 ? 48.478 198.023 -8.715  1.00 199.98 ? 370  MET A CE  1 
ATOM   2324 N  N   . THR A 1  298 ? 44.603 196.219 -3.936  1.00 146.30 ? 371  THR A N   1 
ATOM   2325 C  CA  . THR A 1  298 ? 44.385 196.398 -2.505  1.00 139.66 ? 371  THR A CA  1 
ATOM   2326 C  C   . THR A 1  298 ? 45.207 195.376 -1.727  1.00 142.62 ? 371  THR A C   1 
ATOM   2327 O  O   . THR A 1  298 ? 45.842 195.707 -0.720  1.00 127.50 ? 371  THR A O   1 
ATOM   2328 C  CB  . THR A 1  298 ? 42.898 196.256 -2.129  1.00 119.51 ? 371  THR A CB  1 
ATOM   2329 O  OG1 . THR A 1  298 ? 42.121 197.188 -2.891  1.00 122.25 ? 371  THR A OG1 1 
ATOM   2330 C  CG2 . THR A 1  298 ? 42.694 196.523 -0.644  1.00 143.06 ? 371  THR A CG2 1 
ATOM   2331 N  N   . SER A 1  299 ? 45.201 194.133 -2.204  1.00 133.31 ? 372  SER A N   1 
ATOM   2332 C  CA  . SER A 1  299 ? 46.050 193.103 -1.609  1.00 125.13 ? 372  SER A CA  1 
ATOM   2333 C  C   . SER A 1  299 ? 47.524 193.493 -1.721  1.00 113.08 ? 372  SER A C   1 
ATOM   2334 O  O   . SER A 1  299 ? 48.302 193.311 -0.779  1.00 138.10 ? 372  SER A O   1 
ATOM   2335 C  CB  . SER A 1  299 ? 45.815 191.748 -2.281  1.00 131.19 ? 372  SER A CB  1 
ATOM   2336 O  OG  . SER A 1  299 ? 44.479 191.308 -2.110  1.00 121.10 ? 372  SER A OG  1 
ATOM   2337 N  N   . PHE A 1  300 ? 47.892 194.042 -2.877  1.00 114.32 ? 373  PHE A N   1 
ATOM   2338 C  CA  . PHE A 1  300 ? 49.281 194.393 -3.161  1.00 124.09 ? 373  PHE A CA  1 
ATOM   2339 C  C   . PHE A 1  300 ? 49.817 195.467 -2.219  1.00 136.14 ? 373  PHE A C   1 
ATOM   2340 O  O   . PHE A 1  300 ? 50.932 195.348 -1.708  1.00 141.58 ? 373  PHE A O   1 
ATOM   2341 C  CB  . PHE A 1  300 ? 49.424 194.857 -4.612  1.00 154.51 ? 373  PHE A CB  1 
ATOM   2342 C  CG  . PHE A 1  300 ? 50.843 195.135 -5.023  1.00 152.43 ? 373  PHE A CG  1 
ATOM   2343 C  CD1 . PHE A 1  300 ? 51.752 194.099 -5.165  1.00 141.31 ? 373  PHE A CD1 1 
ATOM   2344 C  CD2 . PHE A 1  300 ? 51.265 196.429 -5.280  1.00 145.05 ? 373  PHE A CD2 1 
ATOM   2345 C  CE1 . PHE A 1  300 ? 53.056 194.348 -5.546  1.00 137.82 ? 373  PHE A CE1 1 
ATOM   2346 C  CE2 . PHE A 1  300 ? 52.568 196.685 -5.664  1.00 143.06 ? 373  PHE A CE2 1 
ATOM   2347 C  CZ  . PHE A 1  300 ? 53.465 195.643 -5.796  1.00 145.64 ? 373  PHE A CZ  1 
ATOM   2348 N  N   . VAL A 1  301 ? 49.030 196.515 -1.993  1.00 142.65 ? 374  VAL A N   1 
ATOM   2349 C  CA  . VAL A 1  301 ? 49.451 197.581 -1.089  1.00 139.35 ? 374  VAL A CA  1 
ATOM   2350 C  C   . VAL A 1  301 ? 49.341 197.115 0.362   1.00 141.79 ? 374  VAL A C   1 
ATOM   2351 O  O   . VAL A 1  301 ? 50.109 197.550 1.228   1.00 153.91 ? 374  VAL A O   1 
ATOM   2352 C  CB  . VAL A 1  301 ? 48.639 198.870 -1.325  1.00 128.37 ? 374  VAL A CB  1 
ATOM   2353 C  CG1 . VAL A 1  301 ? 48.885 199.396 -2.731  1.00 155.18 ? 374  VAL A CG1 1 
ATOM   2354 C  CG2 . VAL A 1  301 ? 47.156 198.624 -1.102  1.00 127.98 ? 374  VAL A CG2 1 
ATOM   2355 N  N   . SER A 1  302 ? 48.390 196.221 0.619   1.00 111.48 ? 375  SER A N   1 
ATOM   2356 C  CA  . SER A 1  302 ? 48.242 195.625 1.940   1.00 109.22 ? 375  SER A CA  1 
ATOM   2357 C  C   . SER A 1  302 ? 49.508 194.861 2.305   1.00 139.80 ? 375  SER A C   1 
ATOM   2358 O  O   . SER A 1  302 ? 49.904 194.813 3.473   1.00 106.44 ? 375  SER A O   1 
ATOM   2359 C  CB  . SER A 1  302 ? 47.026 194.699 1.986   1.00 155.01 ? 375  SER A CB  1 
ATOM   2360 O  OG  . SER A 1  302 ? 45.834 195.413 1.711   1.00 152.04 ? 375  SER A OG  1 
ATOM   2361 N  N   . GLY A 1  303 ? 50.140 194.268 1.295   1.00 135.77 ? 376  GLY A N   1 
ATOM   2362 C  CA  . GLY A 1  303 ? 51.419 193.607 1.476   1.00 108.39 ? 376  GLY A CA  1 
ATOM   2363 C  C   . GLY A 1  303 ? 52.479 194.535 2.037   1.00 116.96 ? 376  GLY A C   1 
ATOM   2364 O  O   . GLY A 1  303 ? 53.234 194.163 2.938   1.00 132.68 ? 376  GLY A O   1 
ATOM   2365 N  N   . PHE A 1  304 ? 52.530 195.752 1.505   1.00 152.76 ? 377  PHE A N   1 
ATOM   2366 C  CA  . PHE A 1  304 ? 53.466 196.759 1.989   1.00 148.43 ? 377  PHE A CA  1 
ATOM   2367 C  C   . PHE A 1  304 ? 53.095 197.212 3.394   1.00 133.84 ? 377  PHE A C   1 
ATOM   2368 O  O   . PHE A 1  304 ? 53.967 197.376 4.248   1.00 134.23 ? 377  PHE A O   1 
ATOM   2369 C  CB  . PHE A 1  304 ? 53.508 197.960 1.043   1.00 147.60 ? 377  PHE A CB  1 
ATOM   2370 C  CG  . PHE A 1  304 ? 54.172 197.672 -0.270  1.00 131.67 ? 377  PHE A CG  1 
ATOM   2371 C  CD1 . PHE A 1  304 ? 55.550 197.734 -0.393  1.00 131.22 ? 377  PHE A CD1 1 
ATOM   2372 C  CD2 . PHE A 1  304 ? 53.420 197.338 -1.382  1.00 142.27 ? 377  PHE A CD2 1 
ATOM   2373 C  CE1 . PHE A 1  304 ? 56.165 197.468 -1.601  1.00 140.85 ? 377  PHE A CE1 1 
ATOM   2374 C  CE2 . PHE A 1  304 ? 54.029 197.071 -2.591  1.00 153.93 ? 377  PHE A CE2 1 
ATOM   2375 C  CZ  . PHE A 1  304 ? 55.403 197.136 -2.702  1.00 142.68 ? 377  PHE A CZ  1 
ATOM   2376 N  N   . VAL A 1  305 ? 51.799 197.409 3.626   1.00 127.42 ? 378  VAL A N   1 
ATOM   2377 C  CA  . VAL A 1  305 ? 51.312 197.821 4.939   1.00 122.70 ? 378  VAL A CA  1 
ATOM   2378 C  C   . VAL A 1  305 ? 51.735 196.817 6.008   1.00 124.32 ? 378  VAL A C   1 
ATOM   2379 O  O   . VAL A 1  305 ? 52.113 197.197 7.117   1.00 113.87 ? 378  VAL A O   1 
ATOM   2380 C  CB  . VAL A 1  305 ? 49.782 198.000 4.935   1.00 127.19 ? 378  VAL A CB  1 
ATOM   2381 C  CG1 . VAL A 1  305 ? 49.281 198.340 6.330   1.00 130.35 ? 378  VAL A CG1 1 
ATOM   2382 C  CG2 . VAL A 1  305 ? 49.380 199.084 3.948   1.00 154.21 ? 378  VAL A CG2 1 
ATOM   2383 N  N   . ILE A 1  306 ? 51.686 195.534 5.665   1.00 138.67 ? 379  ILE A N   1 
ATOM   2384 C  CA  . ILE A 1  306 ? 52.068 194.482 6.600   1.00 137.02 ? 379  ILE A CA  1 
ATOM   2385 C  C   . ILE A 1  306 ? 53.582 194.399 6.764   1.00 114.71 ? 379  ILE A C   1 
ATOM   2386 O  O   . ILE A 1  306 ? 54.094 194.432 7.884   1.00 105.58 ? 379  ILE A O   1 
ATOM   2387 C  CB  . ILE A 1  306 ? 51.503 193.120 6.159   1.00 131.25 ? 379  ILE A CB  1 
ATOM   2388 C  CG1 . ILE A 1  306 ? 49.980 193.105 6.294   1.00 140.16 ? 379  ILE A CG1 1 
ATOM   2389 C  CG2 . ILE A 1  306 ? 52.121 191.995 6.976   1.00 102.33 ? 379  ILE A CG2 1 
ATOM   2390 C  CD1 . ILE A 1  306 ? 49.492 193.305 7.710   1.00 135.54 ? 379  ILE A CD1 1 
ATOM   2391 N  N   . PHE A 1  307 ? 54.298 194.301 5.648   1.00 132.38 ? 380  PHE A N   1 
ATOM   2392 C  CA  . PHE A 1  307 ? 55.729 194.010 5.693   1.00 123.46 ? 380  PHE A CA  1 
ATOM   2393 C  C   . PHE A 1  307 ? 56.608 195.212 6.031   1.00 141.70 ? 380  PHE A C   1 
ATOM   2394 O  O   . PHE A 1  307 ? 57.805 195.054 6.263   1.00 120.08 ? 380  PHE A O   1 
ATOM   2395 C  CB  . PHE A 1  307 ? 56.182 193.399 4.367   1.00 117.71 ? 380  PHE A CB  1 
ATOM   2396 C  CG  . PHE A 1  307 ? 55.996 191.913 4.299   1.00 120.73 ? 380  PHE A CG  1 
ATOM   2397 C  CD1 . PHE A 1  307 ? 56.962 191.060 4.806   1.00 149.87 ? 380  PHE A CD1 1 
ATOM   2398 C  CD2 . PHE A 1  307 ? 54.854 191.367 3.743   1.00 113.92 ? 380  PHE A CD2 1 
ATOM   2399 C  CE1 . PHE A 1  307 ? 56.796 189.691 4.753   1.00 137.99 ? 380  PHE A CE1 1 
ATOM   2400 C  CE2 . PHE A 1  307 ? 54.683 189.998 3.687   1.00 113.54 ? 380  PHE A CE2 1 
ATOM   2401 C  CZ  . PHE A 1  307 ? 55.654 189.161 4.194   1.00 133.54 ? 380  PHE A CZ  1 
ATOM   2402 N  N   . THR A 1  308 ? 56.032 196.408 6.059   1.00 160.03 ? 381  THR A N   1 
ATOM   2403 C  CA  . THR A 1  308 ? 56.774 197.559 6.562   1.00 156.23 ? 381  THR A CA  1 
ATOM   2404 C  C   . THR A 1  308 ? 56.857 197.457 8.080   1.00 161.88 ? 381  THR A C   1 
ATOM   2405 O  O   . THR A 1  308 ? 57.913 197.669 8.679   1.00 160.37 ? 381  THR A O   1 
ATOM   2406 C  CB  . THR A 1  308 ? 56.123 198.897 6.162   1.00 168.34 ? 381  THR A CB  1 
ATOM   2407 O  OG1 . THR A 1  308 ? 54.699 198.802 6.292   1.00 190.67 ? 381  THR A OG1 1 
ATOM   2408 C  CG2 . THR A 1  308 ? 56.487 199.266 4.730   1.00 175.58 ? 381  THR A CG2 1 
ATOM   2409 N  N   . VAL A 1  309 ? 55.730 197.108 8.691   1.00 157.80 ? 382  VAL A N   1 
ATOM   2410 C  CA  . VAL A 1  309 ? 55.648 196.962 10.136  1.00 138.29 ? 382  VAL A CA  1 
ATOM   2411 C  C   . VAL A 1  309 ? 56.380 195.699 10.581  1.00 126.20 ? 382  VAL A C   1 
ATOM   2412 O  O   . VAL A 1  309 ? 57.015 195.682 11.634  1.00 135.00 ? 382  VAL A O   1 
ATOM   2413 C  CB  . VAL A 1  309 ? 54.183 196.948 10.602  1.00 127.65 ? 382  VAL A CB  1 
ATOM   2414 C  CG1 . VAL A 1  309 ? 54.107 196.970 12.117  1.00 115.81 ? 382  VAL A CG1 1 
ATOM   2415 C  CG2 . VAL A 1  309 ? 53.433 198.132 10.013  1.00 150.42 ? 382  VAL A CG2 1 
ATOM   2416 N  N   . LEU A 1  310 ? 56.292 194.643 9.777   1.00 109.26 ? 383  LEU A N   1 
ATOM   2417 C  CA  . LEU A 1  310 ? 57.010 193.404 10.071  1.00 104.50 ? 383  LEU A CA  1 
ATOM   2418 C  C   . LEU A 1  310 ? 58.500 193.566 9.800   1.00 106.18 ? 383  LEU A C   1 
ATOM   2419 O  O   . LEU A 1  310 ? 59.327 192.865 10.385  1.00 105.12 ? 383  LEU A O   1 
ATOM   2420 C  CB  . LEU A 1  310 ? 56.451 192.240 9.251   1.00 101.31 ? 383  LEU A CB  1 
ATOM   2421 C  CG  . LEU A 1  310 ? 55.596 191.236 10.026  1.00 98.38  ? 383  LEU A CG  1 
ATOM   2422 C  CD1 . LEU A 1  310 ? 54.393 191.923 10.652  1.00 115.46 ? 383  LEU A CD1 1 
ATOM   2423 C  CD2 . LEU A 1  310 ? 55.160 190.099 9.118   1.00 136.54 ? 383  LEU A CD2 1 
ATOM   2424 N  N   . GLY A 1  311 ? 58.834 194.487 8.902   1.00 127.79 ? 384  GLY A N   1 
ATOM   2425 C  CA  . GLY A 1  311 ? 60.220 194.826 8.642   1.00 132.45 ? 384  GLY A CA  1 
ATOM   2426 C  C   . GLY A 1  311 ? 60.792 195.586 9.820   1.00 144.70 ? 384  GLY A C   1 
ATOM   2427 O  O   . GLY A 1  311 ? 61.933 195.365 10.227  1.00 114.28 ? 384  GLY A O   1 
ATOM   2428 N  N   . TYR A 1  312 ? 59.982 196.487 10.370  1.00 144.60 ? 385  TYR A N   1 
ATOM   2429 C  CA  . TYR A 1  312 ? 60.342 197.210 11.584  1.00 151.70 ? 385  TYR A CA  1 
ATOM   2430 C  C   . TYR A 1  312 ? 60.480 196.250 12.760  1.00 135.83 ? 385  TYR A C   1 
ATOM   2431 O  O   . TYR A 1  312 ? 61.332 196.432 13.631  1.00 143.67 ? 385  TYR A O   1 
ATOM   2432 C  CB  . TYR A 1  312 ? 59.295 198.284 11.892  1.00 171.79 ? 385  TYR A CB  1 
ATOM   2433 C  CG  . TYR A 1  312 ? 59.292 198.761 13.329  1.00 167.35 ? 385  TYR A CG  1 
ATOM   2434 C  CD1 . TYR A 1  312 ? 60.261 199.641 13.792  1.00 149.68 ? 385  TYR A CD1 1 
ATOM   2435 C  CD2 . TYR A 1  312 ? 58.309 198.342 14.217  1.00 171.63 ? 385  TYR A CD2 1 
ATOM   2436 C  CE1 . TYR A 1  312 ? 60.258 200.082 15.103  1.00 142.88 ? 385  TYR A CE1 1 
ATOM   2437 C  CE2 . TYR A 1  312 ? 58.298 198.778 15.529  1.00 171.48 ? 385  TYR A CE2 1 
ATOM   2438 C  CZ  . TYR A 1  312 ? 59.274 199.648 15.966  1.00 154.01 ? 385  TYR A CZ  1 
ATOM   2439 O  OH  . TYR A 1  312 ? 59.266 200.085 17.271  1.00 140.60 ? 385  TYR A OH  1 
ATOM   2440 N  N   . MET A 1  313 ? 59.635 195.224 12.773  1.00 172.14 ? 386  MET A N   1 
ATOM   2441 C  CA  . MET A 1  313 ? 59.645 194.227 13.834  1.00 164.61 ? 386  MET A CA  1 
ATOM   2442 C  C   . MET A 1  313 ? 60.904 193.371 13.749  1.00 146.48 ? 386  MET A C   1 
ATOM   2443 O  O   . MET A 1  313 ? 61.523 193.058 14.765  1.00 155.56 ? 386  MET A O   1 
ATOM   2444 C  CB  . MET A 1  313 ? 58.397 193.347 13.753  1.00 170.64 ? 386  MET A CB  1 
ATOM   2445 C  CG  . MET A 1  313 ? 58.044 192.643 15.051  1.00 163.49 ? 386  MET A CG  1 
ATOM   2446 S  SD  . MET A 1  313 ? 57.566 193.799 16.348  1.00 181.59 ? 386  MET A SD  1 
ATOM   2447 C  CE  . MET A 1  313 ? 57.074 192.669 17.647  1.00 188.49 ? 386  MET A CE  1 
ATOM   2448 N  N   . ALA A 1  314 ? 61.277 192.997 12.529  1.00 157.68 ? 387  ALA A N   1 
ATOM   2449 C  CA  . ALA A 1  314 ? 62.481 192.207 12.304  1.00 147.99 ? 387  ALA A CA  1 
ATOM   2450 C  C   . ALA A 1  314 ? 63.725 193.037 12.596  1.00 129.76 ? 387  ALA A C   1 
ATOM   2451 O  O   . ALA A 1  314 ? 64.744 192.511 13.043  1.00 138.76 ? 387  ALA A O   1 
ATOM   2452 C  CB  . ALA A 1  314 ? 62.513 191.678 10.879  1.00 172.49 ? 387  ALA A CB  1 
ATOM   2453 N  N   . GLU A 1  315 ? 63.634 194.338 12.338  1.00 158.70 ? 388  GLU A N   1 
ATOM   2454 C  CA  . GLU A 1  315 ? 64.728 195.256 12.633  1.00 172.37 ? 388  GLU A CA  1 
ATOM   2455 C  C   . GLU A 1  315 ? 64.905 195.403 14.140  1.00 148.92 ? 388  GLU A C   1 
ATOM   2456 O  O   . GLU A 1  315 ? 66.027 195.447 14.642  1.00 153.64 ? 388  GLU A O   1 
ATOM   2457 C  CB  . GLU A 1  315 ? 64.474 196.624 11.995  1.00 187.44 ? 388  GLU A CB  1 
ATOM   2458 C  CG  . GLU A 1  315 ? 65.543 197.667 12.297  1.00 169.35 ? 388  GLU A CG  1 
ATOM   2459 C  CD  . GLU A 1  315 ? 66.831 197.433 11.529  1.00 158.31 ? 388  GLU A CD  1 
ATOM   2460 O  OE1 . GLU A 1  315 ? 67.854 198.061 11.876  1.00 153.49 ? 388  GLU A OE1 1 
ATOM   2461 O  OE2 . GLU A 1  315 ? 66.820 196.629 10.574  1.00 165.88 ? 388  GLU A OE2 1 
ATOM   2462 N  N   . MET A 1  316 ? 63.786 195.473 14.855  1.00 185.63 ? 389  MET A N   1 
ATOM   2463 C  CA  . MET A 1  316 ? 63.809 195.626 16.305  1.00 199.76 ? 389  MET A CA  1 
ATOM   2464 C  C   . MET A 1  316 ? 64.271 194.334 16.977  1.00 183.20 ? 389  MET A C   1 
ATOM   2465 O  O   . MET A 1  316 ? 64.784 194.354 18.096  1.00 184.33 ? 389  MET A O   1 
ATOM   2466 C  CB  . MET A 1  316 ? 62.426 196.040 16.820  1.00 212.25 ? 389  MET A CB  1 
ATOM   2467 C  CG  . MET A 1  316 ? 62.404 196.509 18.267  1.00 195.89 ? 389  MET A CG  1 
ATOM   2468 S  SD  . MET A 1  316 ? 60.840 197.281 18.735  1.00 195.56 ? 389  MET A SD  1 
ATOM   2469 C  CE  . MET A 1  316 ? 59.688 195.949 18.409  1.00 184.57 ? 389  MET A CE  1 
ATOM   2470 N  N   . ARG A 1  317 ? 64.088 193.213 16.285  1.00 188.54 ? 390  ARG A N   1 
ATOM   2471 C  CA  . ARG A 1  317 ? 64.546 191.917 16.777  1.00 163.56 ? 390  ARG A CA  1 
ATOM   2472 C  C   . ARG A 1  317 ? 65.891 191.554 16.146  1.00 141.33 ? 390  ARG A C   1 
ATOM   2473 O  O   . ARG A 1  317 ? 66.912 192.161 16.468  1.00 128.69 ? 390  ARG A O   1 
ATOM   2474 C  CB  . ARG A 1  317 ? 63.497 190.836 16.495  1.00 165.18 ? 390  ARG A CB  1 
ATOM   2475 C  CG  . ARG A 1  317 ? 62.222 191.000 17.317  1.00 148.41 ? 390  ARG A CG  1 
ATOM   2476 C  CD  . ARG A 1  317 ? 61.062 190.169 16.778  1.00 148.78 ? 390  ARG A CD  1 
ATOM   2477 N  NE  . ARG A 1  317 ? 61.347 188.737 16.764  1.00 152.12 ? 390  ARG A NE  1 
ATOM   2478 C  CZ  . ARG A 1  317 ? 60.421 187.794 16.622  1.00 168.21 ? 390  ARG A CZ  1 
ATOM   2479 N  NH1 . ARG A 1  317 ? 59.144 188.128 16.493  1.00 167.68 ? 390  ARG A NH1 1 
ATOM   2480 N  NH2 . ARG A 1  317 ? 60.769 186.515 16.618  1.00 184.93 ? 390  ARG A NH2 1 
ATOM   2481 N  N   . ASN A 1  318 ? 65.895 190.572 15.248  1.00 158.81 ? 391  ASN A N   1 
ATOM   2482 C  CA  . ASN A 1  318 ? 67.128 190.181 14.568  1.00 158.17 ? 391  ASN A CA  1 
ATOM   2483 C  C   . ASN A 1  318 ? 66.886 189.589 13.182  1.00 182.71 ? 391  ASN A C   1 
ATOM   2484 O  O   . ASN A 1  318 ? 67.200 188.426 12.930  1.00 170.78 ? 391  ASN A O   1 
ATOM   2485 C  CB  . ASN A 1  318 ? 67.917 189.186 15.423  1.00 153.11 ? 391  ASN A CB  1 
ATOM   2486 C  CG  . ASN A 1  318 ? 68.972 189.864 16.277  1.00 162.89 ? 391  ASN A CG  1 
ATOM   2487 O  OD1 . ASN A 1  318 ? 69.482 190.928 15.923  1.00 159.60 ? 391  ASN A OD1 1 
ATOM   2488 N  ND2 . ASN A 1  318 ? 69.307 189.249 17.405  1.00 181.15 ? 391  ASN A ND2 1 
ATOM   2489 N  N   . GLU A 1  319 ? 66.319 190.406 12.297  1.00 203.97 ? 392  GLU A N   1 
ATOM   2490 C  CA  . GLU A 1  319 ? 66.216 190.103 10.870  1.00 197.39 ? 392  GLU A CA  1 
ATOM   2491 C  C   . GLU A 1  319 ? 65.488 188.797 10.550  1.00 182.06 ? 392  GLU A C   1 
ATOM   2492 O  O   . GLU A 1  319 ? 64.848 188.197 11.415  1.00 167.58 ? 392  GLU A O   1 
ATOM   2493 C  CB  . GLU A 1  319 ? 67.613 190.072 10.244  1.00 193.63 ? 392  GLU A CB  1 
ATOM   2494 C  CG  . GLU A 1  319 ? 67.684 190.689 8.857   1.00 208.42 ? 392  GLU A CG  1 
ATOM   2495 C  CD  . GLU A 1  319 ? 69.033 190.491 8.207   1.00 233.03 ? 392  GLU A CD  1 
ATOM   2496 O  OE1 . GLU A 1  319 ? 70.028 190.327 8.944   1.00 219.42 ? 392  GLU A OE1 1 
ATOM   2497 O  OE2 . GLU A 1  319 ? 69.097 190.492 6.959   1.00 255.99 ? 392  GLU A OE2 1 
ATOM   2498 N  N   . ASP A 1  320 ? 65.727 188.270 9.356   1.00 183.02 ? 393  ASP A N   1 
ATOM   2499 C  CA  . ASP A 1  320 ? 65.168 186.975 9.033   1.00 166.15 ? 393  ASP A CA  1 
ATOM   2500 C  C   . ASP A 1  320 ? 63.669 186.986 9.181   1.00 158.73 ? 393  ASP A C   1 
ATOM   2501 O  O   . ASP A 1  320 ? 63.087 186.202 9.916   1.00 155.18 ? 393  ASP A O   1 
ATOM   2502 C  CB  . ASP A 1  320 ? 65.795 185.896 9.902   1.00 180.93 ? 393  ASP A CB  1 
ATOM   2503 N  N   . VAL A 1  321 ? 63.045 187.899 8.462   1.00 162.24 ? 394  VAL A N   1 
ATOM   2504 C  CA  . VAL A 1  321 ? 61.666 188.265 8.675   1.00 167.05 ? 394  VAL A CA  1 
ATOM   2505 C  C   . VAL A 1  321 ? 60.806 187.042 8.780   1.00 163.07 ? 394  VAL A C   1 
ATOM   2506 O  O   . VAL A 1  321 ? 59.837 187.015 9.530   1.00 181.16 ? 394  VAL A O   1 
ATOM   2507 C  CB  . VAL A 1  321 ? 61.140 189.053 7.478   1.00 151.79 ? 394  VAL A CB  1 
ATOM   2508 C  CG1 . VAL A 1  321 ? 59.890 189.815 7.859   1.00 146.57 ? 394  VAL A CG1 1 
ATOM   2509 C  CG2 . VAL A 1  321 ? 62.212 189.984 6.954   1.00 151.49 ? 394  VAL A CG2 1 
ATOM   2510 N  N   . SER A 1  322 ? 61.182 185.999 8.060   1.00 143.53 ? 395  SER A N   1 
ATOM   2511 C  CA  . SER A 1  322 ? 60.362 184.815 7.947   1.00 142.10 ? 395  SER A CA  1 
ATOM   2512 C  C   . SER A 1  322 ? 60.145 184.334 9.354   1.00 155.47 ? 395  SER A C   1 
ATOM   2513 O  O   . SER A 1  322 ? 59.087 183.852 9.723   1.00 173.30 ? 395  SER A O   1 
ATOM   2514 C  CB  . SER A 1  322 ? 61.120 183.761 7.153   1.00 138.83 ? 395  SER A CB  1 
ATOM   2515 O  OG  . SER A 1  322 ? 60.766 182.444 7.531   1.00 157.09 ? 395  SER A OG  1 
ATOM   2516 N  N   . GLU A 1  323 ? 61.179 184.486 10.142  1.00 152.23 ? 396  GLU A N   1 
ATOM   2517 C  CA  . GLU A 1  323 ? 61.112 184.077 11.541  1.00 152.52 ? 396  GLU A CA  1 
ATOM   2518 C  C   . GLU A 1  323 ? 59.961 184.761 12.270  1.00 147.68 ? 396  GLU A C   1 
ATOM   2519 O  O   . GLU A 1  323 ? 59.171 184.107 12.951  1.00 150.78 ? 396  GLU A O   1 
ATOM   2520 C  CB  . GLU A 1  323 ? 62.432 184.380 12.251  1.00 170.91 ? 396  GLU A CB  1 
ATOM   2521 C  CG  . GLU A 1  323 ? 63.629 183.669 11.652  1.00 192.25 ? 396  GLU A CG  1 
ATOM   2522 C  CD  . GLU A 1  323 ? 63.488 182.161 11.689  1.00 212.61 ? 396  GLU A CD  1 
ATOM   2523 O  OE1 . GLU A 1  323 ? 63.100 181.625 12.748  1.00 217.09 ? 396  GLU A OE1 1 
ATOM   2524 O  OE2 . GLU A 1  323 ? 63.760 181.511 10.657  1.00 224.11 ? 396  GLU A OE2 1 
ATOM   2525 N  N   . VAL A 1  324 ? 59.873 186.079 12.127  1.00 129.71 ? 397  VAL A N   1 
ATOM   2526 C  CA  . VAL A 1  324 ? 58.826 186.850 12.787  1.00 126.13 ? 397  VAL A CA  1 
ATOM   2527 C  C   . VAL A 1  324 ? 57.473 186.540 12.149  1.00 118.38 ? 397  VAL A C   1 
ATOM   2528 O  O   . VAL A 1  324 ? 56.433 186.615 12.805  1.00 105.83 ? 397  VAL A O   1 
ATOM   2529 C  CB  . VAL A 1  324 ? 59.141 188.365 12.748  1.00 114.36 ? 397  VAL A CB  1 
ATOM   2530 C  CG1 . VAL A 1  324 ? 59.254 188.861 11.316  1.00 140.88 ? 397  VAL A CG1 1 
ATOM   2531 C  CG2 . VAL A 1  324 ? 58.093 189.160 13.517  1.00 115.90 ? 397  VAL A CG2 1 
ATOM   2532 N  N   . ALA A 1  325 ? 57.492 186.172 10.872  1.00 114.54 ? 398  ALA A N   1 
ATOM   2533 C  CA  . ALA A 1  325 ? 56.267 185.824 10.163  1.00 104.12 ? 398  ALA A CA  1 
ATOM   2534 C  C   . ALA A 1  325 ? 56.165 184.317 9.958   1.00 133.75 ? 398  ALA A C   1 
ATOM   2535 O  O   . ALA A 1  325 ? 55.685 183.855 8.923   1.00 154.70 ? 398  ALA A O   1 
ATOM   2536 C  CB  . ALA A 1  325 ? 56.200 186.546 8.826   1.00 102.50 ? 398  ALA A CB  1 
ATOM   2537 N  N   . LYS A 1  326 ? 56.625 183.555 10.946  1.00 132.99 ? 399  LYS A N   1 
ATOM   2538 C  CA  . LYS A 1  326 ? 56.518 182.101 10.898  1.00 138.56 ? 399  LYS A CA  1 
ATOM   2539 C  C   . LYS A 1  326 ? 55.058 181.671 10.947  1.00 175.40 ? 399  LYS A C   1 
ATOM   2540 O  O   . LYS A 1  326 ? 54.617 180.840 10.154  1.00 153.23 ? 399  LYS A O   1 
ATOM   2541 C  CB  . LYS A 1  326 ? 57.291 181.459 12.053  1.00 151.24 ? 399  LYS A CB  1 
ATOM   2542 C  CG  . LYS A 1  326 ? 58.669 180.947 11.673  1.00 172.91 ? 399  LYS A CG  1 
ATOM   2543 C  CD  . LYS A 1  326 ? 59.319 180.219 12.837  1.00 169.56 ? 399  LYS A CD  1 
ATOM   2544 C  CE  . LYS A 1  326 ? 60.623 179.565 12.419  1.00 155.87 ? 399  LYS A CE  1 
ATOM   2545 N  NZ  . LYS A 1  326 ? 61.276 178.863 13.558  1.00 137.73 ? 399  LYS A NZ  1 
ATOM   2546 N  N   . ASP A 1  327 ? 54.328 182.264 11.889  1.00 210.34 ? 400  ASP A N   1 
ATOM   2547 C  CA  . ASP A 1  327 ? 52.910 181.988 12.021  1.00 213.24 ? 400  ASP A CA  1 
ATOM   2548 C  C   . ASP A 1  327 ? 52.239 182.470 10.750  1.00 200.29 ? 400  ASP A C   1 
ATOM   2549 O  O   . ASP A 1  327 ? 52.523 183.565 10.261  1.00 202.75 ? 400  ASP A O   1 
ATOM   2550 C  CB  . ASP A 1  327 ? 52.278 182.684 13.247  1.00 206.34 ? 400  ASP A CB  1 
ATOM   2551 C  CG  . ASP A 1  327 ? 53.301 183.327 14.178  1.00 200.62 ? 400  ASP A CG  1 
ATOM   2552 O  OD1 . ASP A 1  327 ? 54.362 183.762 13.687  1.00 204.56 ? 400  ASP A OD1 1 
ATOM   2553 O  OD2 . ASP A 1  327 ? 53.036 183.401 15.397  1.00 197.13 ? 400  ASP A OD2 1 
ATOM   2554 N  N   . ALA A 1  328 ? 51.341 181.653 10.217  1.00 162.44 ? 401  ALA A N   1 
ATOM   2555 C  CA  . ALA A 1  328 ? 50.551 182.067 9.064   1.00 141.97 ? 401  ALA A CA  1 
ATOM   2556 C  C   . ALA A 1  328 ? 49.059 182.039 9.373   1.00 113.30 ? 401  ALA A C   1 
ATOM   2557 O  O   . ALA A 1  328 ? 48.352 181.111 8.983   1.00 110.49 ? 401  ALA A O   1 
ATOM   2558 C  CB  . ALA A 1  328 ? 50.856 181.180 7.872   1.00 161.87 ? 401  ALA A CB  1 
ATOM   2559 N  N   . GLY A 1  329 ? 48.586 183.063 10.074  1.00 114.96 ? 402  GLY A N   1 
ATOM   2560 C  CA  . GLY A 1  329 ? 47.183 183.159 10.426  1.00 114.59 ? 402  GLY A CA  1 
ATOM   2561 C  C   . GLY A 1  329 ? 46.834 184.474 11.091  1.00 127.09 ? 402  GLY A C   1 
ATOM   2562 O  O   . GLY A 1  329 ? 47.538 185.468 10.912  1.00 149.97 ? 402  GLY A O   1 
ATOM   2563 N  N   . PRO A 1  330 ? 45.739 184.488 11.865  1.00 114.53 ? 403  PRO A N   1 
ATOM   2564 C  CA  . PRO A 1  330 ? 45.311 185.671 12.621  1.00 133.23 ? 403  PRO A CA  1 
ATOM   2565 C  C   . PRO A 1  330 ? 46.366 186.133 13.621  1.00 130.10 ? 403  PRO A C   1 
ATOM   2566 O  O   . PRO A 1  330 ? 46.368 187.296 14.025  1.00 141.96 ? 403  PRO A O   1 
ATOM   2567 C  CB  . PRO A 1  330 ? 44.050 185.188 13.344  1.00 153.15 ? 403  PRO A CB  1 
ATOM   2568 C  CG  . PRO A 1  330 ? 43.556 184.049 12.522  1.00 135.21 ? 403  PRO A CG  1 
ATOM   2569 C  CD  . PRO A 1  330 ? 44.786 183.374 12.000  1.00 115.04 ? 403  PRO A CD  1 
ATOM   2570 N  N   . SER A 1  331 ? 47.256 185.224 14.008  1.00 101.07 ? 404  SER A N   1 
ATOM   2571 C  CA  . SER A 1  331 ? 48.323 185.536 14.951  1.00 100.46 ? 404  SER A CA  1 
ATOM   2572 C  C   . SER A 1  331 ? 49.287 186.566 14.372  1.00 104.82 ? 404  SER A C   1 
ATOM   2573 O  O   . SER A 1  331 ? 49.980 187.265 15.108  1.00 122.44 ? 404  SER A O   1 
ATOM   2574 C  CB  . SER A 1  331 ? 49.080 184.266 15.338  1.00 122.88 ? 404  SER A CB  1 
ATOM   2575 O  OG  . SER A 1  331 ? 48.187 183.268 15.800  1.00 130.04 ? 404  SER A OG  1 
ATOM   2576 N  N   . LEU A 1  332 ? 49.323 186.654 13.047  1.00 112.17 ? 405  LEU A N   1 
ATOM   2577 C  CA  . LEU A 1  332 ? 50.164 187.631 12.370  1.00 125.93 ? 405  LEU A CA  1 
ATOM   2578 C  C   . LEU A 1  332 ? 49.606 189.036 12.579  1.00 114.40 ? 405  LEU A C   1 
ATOM   2579 O  O   . LEU A 1  332 ? 50.331 190.025 12.471  1.00 149.43 ? 405  LEU A O   1 
ATOM   2580 C  CB  . LEU A 1  332 ? 50.269 187.302 10.878  1.00 88.30  ? 405  LEU A CB  1 
ATOM   2581 C  CG  . LEU A 1  332 ? 51.357 187.999 10.057  1.00 89.78  ? 405  LEU A CG  1 
ATOM   2582 C  CD1 . LEU A 1  332 ? 51.913 187.051 9.006   1.00 88.15  ? 405  LEU A CD1 1 
ATOM   2583 C  CD2 . LEU A 1  332 ? 50.821 189.261 9.399   1.00 92.23  ? 405  LEU A CD2 1 
ATOM   2584 N  N   . LEU A 1  333 ? 48.316 189.117 12.888  1.00 115.90 ? 406  LEU A N   1 
ATOM   2585 C  CA  . LEU A 1  333 ? 47.657 190.401 13.105  1.00 144.77 ? 406  LEU A CA  1 
ATOM   2586 C  C   . LEU A 1  333 ? 47.354 190.650 14.579  1.00 162.69 ? 406  LEU A C   1 
ATOM   2587 O  O   . LEU A 1  333 ? 47.525 191.763 15.076  1.00 178.95 ? 406  LEU A O   1 
ATOM   2588 C  CB  . LEU A 1  333 ? 46.363 190.479 12.294  1.00 129.94 ? 406  LEU A CB  1 
ATOM   2589 C  CG  . LEU A 1  333 ? 46.506 190.429 10.773  1.00 136.60 ? 406  LEU A CG  1 
ATOM   2590 C  CD1 . LEU A 1  333 ? 45.143 190.523 10.110  1.00 141.87 ? 406  LEU A CD1 1 
ATOM   2591 C  CD2 . LEU A 1  333 ? 47.421 191.542 10.286  1.00 174.13 ? 406  LEU A CD2 1 
ATOM   2592 N  N   . PHE A 1  334 ? 46.900 189.612 15.274  1.00 140.79 ? 407  PHE A N   1 
ATOM   2593 C  CA  . PHE A 1  334 ? 46.478 189.753 16.664  1.00 95.74  ? 407  PHE A CA  1 
ATOM   2594 C  C   . PHE A 1  334 ? 47.646 189.707 17.647  1.00 127.76 ? 407  PHE A C   1 
ATOM   2595 O  O   . PHE A 1  334 ? 47.518 190.148 18.789  1.00 121.11 ? 407  PHE A O   1 
ATOM   2596 C  CB  . PHE A 1  334 ? 45.462 188.667 17.024  1.00 93.97  ? 407  PHE A CB  1 
ATOM   2597 C  CG  . PHE A 1  334 ? 44.100 188.889 16.429  1.00 123.67 ? 407  PHE A CG  1 
ATOM   2598 C  CD1 . PHE A 1  334 ? 43.236 189.824 16.972  1.00 140.28 ? 407  PHE A CD1 1 
ATOM   2599 C  CD2 . PHE A 1  334 ? 43.682 188.157 15.332  1.00 116.56 ? 407  PHE A CD2 1 
ATOM   2600 C  CE1 . PHE A 1  334 ? 41.982 190.028 16.429  1.00 128.48 ? 407  PHE A CE1 1 
ATOM   2601 C  CE2 . PHE A 1  334 ? 42.430 188.355 14.784  1.00 94.04  ? 407  PHE A CE2 1 
ATOM   2602 C  CZ  . PHE A 1  334 ? 41.579 189.292 15.334  1.00 118.00 ? 407  PHE A CZ  1 
ATOM   2603 N  N   . ILE A 1  335 ? 48.782 189.174 17.209  1.00 104.25 ? 408  ILE A N   1 
ATOM   2604 C  CA  . ILE A 1  335 ? 49.943 189.069 18.085  1.00 94.22  ? 408  ILE A CA  1 
ATOM   2605 C  C   . ILE A 1  335 ? 51.102 189.909 17.566  1.00 130.82 ? 408  ILE A C   1 
ATOM   2606 O  O   . ILE A 1  335 ? 51.473 190.906 18.182  1.00 171.22 ? 408  ILE A O   1 
ATOM   2607 C  CB  . ILE A 1  335 ? 50.378 187.605 18.264  1.00 91.28  ? 408  ILE A CB  1 
ATOM   2608 C  CG1 . ILE A 1  335 ? 49.248 186.785 18.889  1.00 98.62  ? 408  ILE A CG1 1 
ATOM   2609 C  CG2 . ILE A 1  335 ? 51.631 187.523 19.123  1.00 100.54 ? 408  ILE A CG2 1 
ATOM   2610 C  CD1 . ILE A 1  335 ? 49.605 185.331 19.118  1.00 93.28  ? 408  ILE A CD1 1 
ATOM   2611 N  N   . THR A 1  336 ? 51.668 189.503 16.434  1.00 104.03 ? 409  THR A N   1 
ATOM   2612 C  CA  . THR A 1  336 ? 52.847 190.160 15.875  1.00 115.62 ? 409  THR A CA  1 
ATOM   2613 C  C   . THR A 1  336 ? 52.596 191.633 15.557  1.00 124.91 ? 409  THR A C   1 
ATOM   2614 O  O   . THR A 1  336 ? 53.300 192.514 16.058  1.00 143.25 ? 409  THR A O   1 
ATOM   2615 C  CB  . THR A 1  336 ? 53.325 189.450 14.594  1.00 111.72 ? 409  THR A CB  1 
ATOM   2616 O  OG1 . THR A 1  336 ? 53.721 188.109 14.908  1.00 134.42 ? 409  THR A OG1 1 
ATOM   2617 C  CG2 . THR A 1  336 ? 54.503 190.190 13.981  1.00 119.56 ? 409  THR A CG2 1 
ATOM   2618 N  N   . TYR A 1  337 ? 51.591 191.893 14.727  1.00 99.76  ? 410  TYR A N   1 
ATOM   2619 C  CA  . TYR A 1  337 ? 51.270 193.255 14.314  1.00 115.15 ? 410  TYR A CA  1 
ATOM   2620 C  C   . TYR A 1  337 ? 50.810 194.094 15.504  1.00 126.28 ? 410  TYR A C   1 
ATOM   2621 O  O   . TYR A 1  337 ? 51.120 195.281 15.593  1.00 108.49 ? 410  TYR A O   1 
ATOM   2622 C  CB  . TYR A 1  337 ? 50.192 193.246 13.227  1.00 102.10 ? 410  TYR A CB  1 
ATOM   2623 C  CG  . TYR A 1  337 ? 50.197 194.474 12.342  1.00 112.31 ? 410  TYR A CG  1 
ATOM   2624 C  CD1 . TYR A 1  337 ? 49.620 195.664 12.766  1.00 118.75 ? 410  TYR A CD1 1 
ATOM   2625 C  CD2 . TYR A 1  337 ? 50.773 194.440 11.078  1.00 108.50 ? 410  TYR A CD2 1 
ATOM   2626 C  CE1 . TYR A 1  337 ? 49.622 196.786 11.960  1.00 123.70 ? 410  TYR A CE1 1 
ATOM   2627 C  CE2 . TYR A 1  337 ? 50.778 195.556 10.265  1.00 118.84 ? 410  TYR A CE2 1 
ATOM   2628 C  CZ  . TYR A 1  337 ? 50.201 196.726 10.710  1.00 133.98 ? 410  TYR A CZ  1 
ATOM   2629 O  OH  . TYR A 1  337 ? 50.203 197.841 9.903   1.00 141.98 ? 410  TYR A OH  1 
ATOM   2630 N  N   . ALA A 1  338 ? 50.071 193.467 16.414  1.00 121.59 ? 411  ALA A N   1 
ATOM   2631 C  CA  . ALA A 1  338 ? 49.574 194.149 17.604  1.00 119.60 ? 411  ALA A CA  1 
ATOM   2632 C  C   . ALA A 1  338 ? 50.723 194.541 18.526  1.00 120.17 ? 411  ALA A C   1 
ATOM   2633 O  O   . ALA A 1  338 ? 50.782 195.670 19.017  1.00 135.78 ? 411  ALA A O   1 
ATOM   2634 C  CB  . ALA A 1  338 ? 48.578 193.270 18.342  1.00 104.73 ? 411  ALA A CB  1 
ATOM   2635 N  N   . GLU A 1  339 ? 51.635 193.600 18.755  1.00 132.46 ? 412  GLU A N   1 
ATOM   2636 C  CA  . GLU A 1  339 ? 52.804 193.849 19.590  1.00 144.05 ? 412  GLU A CA  1 
ATOM   2637 C  C   . GLU A 1  339 ? 53.693 194.904 18.944  1.00 146.11 ? 412  GLU A C   1 
ATOM   2638 O  O   . GLU A 1  339 ? 54.374 195.664 19.632  1.00 167.63 ? 412  GLU A O   1 
ATOM   2639 C  CB  . GLU A 1  339 ? 53.590 192.557 19.818  1.00 155.51 ? 412  GLU A CB  1 
ATOM   2640 C  CG  . GLU A 1  339 ? 54.671 192.657 20.879  1.00 179.38 ? 412  GLU A CG  1 
ATOM   2641 C  CD  . GLU A 1  339 ? 55.363 191.330 21.124  1.00 182.03 ? 412  GLU A CD  1 
ATOM   2642 O  OE1 . GLU A 1  339 ? 56.076 191.209 22.143  1.00 183.70 ? 412  GLU A OE1 1 
ATOM   2643 O  OE2 . GLU A 1  339 ? 55.195 190.408 20.298  1.00 181.14 ? 412  GLU A OE2 1 
ATOM   2644 N  N   . ALA A 1  340 ? 53.678 194.945 17.616  1.00 126.27 ? 413  ALA A N   1 
ATOM   2645 C  CA  . ALA A 1  340 ? 54.424 195.953 16.876  1.00 111.57 ? 413  ALA A CA  1 
ATOM   2646 C  C   . ALA A 1  340 ? 53.781 197.327 17.039  1.00 130.71 ? 413  ALA A C   1 
ATOM   2647 O  O   . ALA A 1  340 ? 54.473 198.343 17.087  1.00 161.14 ? 413  ALA A O   1 
ATOM   2648 C  CB  . ALA A 1  340 ? 54.512 195.576 15.409  1.00 109.90 ? 413  ALA A CB  1 
ATOM   2649 N  N   . ILE A 1  341 ? 52.455 197.351 17.126  1.00 118.22 ? 414  ILE A N   1 
ATOM   2650 C  CA  . ILE A 1  341 ? 51.718 198.596 17.310  1.00 133.34 ? 414  ILE A CA  1 
ATOM   2651 C  C   . ILE A 1  341 ? 51.944 199.140 18.717  1.00 141.92 ? 414  ILE A C   1 
ATOM   2652 O  O   . ILE A 1  341 ? 52.108 200.346 18.909  1.00 150.40 ? 414  ILE A O   1 
ATOM   2653 C  CB  . ILE A 1  341 ? 50.213 198.401 17.029  1.00 128.15 ? 414  ILE A CB  1 
ATOM   2654 C  CG1 . ILE A 1  341 ? 49.966 198.228 15.529  1.00 136.40 ? 414  ILE A CG1 1 
ATOM   2655 C  CG2 . ILE A 1  341 ? 49.400 199.571 17.567  1.00 127.10 ? 414  ILE A CG2 1 
ATOM   2656 C  CD1 . ILE A 1  341 ? 48.505 198.061 15.169  1.00 129.62 ? 414  ILE A CD1 1 
ATOM   2657 N  N   . ALA A 1  342 ? 51.968 198.239 19.696  1.00 133.58 ? 415  ALA A N   1 
ATOM   2658 C  CA  . ALA A 1  342 ? 52.108 198.620 21.099  1.00 134.51 ? 415  ALA A CA  1 
ATOM   2659 C  C   . ALA A 1  342 ? 53.412 199.368 21.378  1.00 170.67 ? 415  ALA A C   1 
ATOM   2660 O  O   . ALA A 1  342 ? 53.485 200.171 22.308  1.00 187.52 ? 415  ALA A O   1 
ATOM   2661 C  CB  . ALA A 1  342 ? 52.012 197.388 21.986  1.00 150.52 ? 415  ALA A CB  1 
ATOM   2662 N  N   . ASN A 1  343 ? 54.436 199.105 20.571  1.00 181.91 ? 416  ASN A N   1 
ATOM   2663 C  CA  . ASN A 1  343 ? 55.737 199.740 20.759  1.00 195.23 ? 416  ASN A CA  1 
ATOM   2664 C  C   . ASN A 1  343 ? 55.897 200.979 19.883  1.00 190.84 ? 416  ASN A C   1 
ATOM   2665 O  O   . ASN A 1  343 ? 57.013 201.357 19.527  1.00 192.66 ? 416  ASN A O   1 
ATOM   2666 C  CB  . ASN A 1  343 ? 56.863 198.746 20.466  1.00 198.02 ? 416  ASN A CB  1 
ATOM   2667 C  CG  . ASN A 1  343 ? 56.878 197.581 21.435  1.00 194.60 ? 416  ASN A CG  1 
ATOM   2668 O  OD1 . ASN A 1  343 ? 56.806 196.421 21.030  1.00 190.14 ? 416  ASN A OD1 1 
ATOM   2669 N  ND2 . ASN A 1  343 ? 56.970 197.886 22.724  1.00 185.09 ? 416  ASN A ND2 1 
ATOM   2670 N  N   . MET A 1  344 ? 54.778 201.608 19.541  1.00 180.45 ? 417  MET A N   1 
ATOM   2671 C  CA  . MET A 1  344 ? 54.796 202.821 18.732  1.00 185.48 ? 417  MET A CA  1 
ATOM   2672 C  C   . MET A 1  344 ? 54.056 203.951 19.440  1.00 197.70 ? 417  MET A C   1 
ATOM   2673 O  O   . MET A 1  344 ? 53.143 203.699 20.226  1.00 198.36 ? 417  MET A O   1 
ATOM   2674 C  CB  . MET A 1  344 ? 54.172 202.561 17.357  1.00 181.40 ? 417  MET A CB  1 
ATOM   2675 C  CG  . MET A 1  344 ? 54.910 201.532 16.519  1.00 182.90 ? 417  MET A CG  1 
ATOM   2676 S  SD  . MET A 1  344 ? 54.366 201.527 14.800  1.00 184.45 ? 417  MET A SD  1 
ATOM   2677 C  CE  . MET A 1  344 ? 52.597 201.335 15.001  1.00 182.76 ? 417  MET A CE  1 
ATOM   2678 N  N   . PRO A 1  345 ? 54.456 205.206 19.171  1.00 180.46 ? 418  PRO A N   1 
ATOM   2679 C  CA  . PRO A 1  345 ? 53.752 206.363 19.734  1.00 176.09 ? 418  PRO A CA  1 
ATOM   2680 C  C   . PRO A 1  345 ? 52.299 206.425 19.274  1.00 176.08 ? 418  PRO A C   1 
ATOM   2681 O  O   . PRO A 1  345 ? 52.008 206.037 18.141  1.00 169.80 ? 418  PRO A O   1 
ATOM   2682 C  CB  . PRO A 1  345 ? 54.551 207.558 19.200  1.00 190.35 ? 418  PRO A CB  1 
ATOM   2683 C  CG  . PRO A 1  345 ? 55.280 207.033 18.005  1.00 184.37 ? 418  PRO A CG  1 
ATOM   2684 C  CD  . PRO A 1  345 ? 55.602 205.611 18.340  1.00 176.07 ? 418  PRO A CD  1 
ATOM   2685 N  N   . ALA A 1  346 ? 51.415 206.907 20.145  1.00 210.52 ? 419  ALA A N   1 
ATOM   2686 C  CA  . ALA A 1  346 ? 49.976 206.923 19.889  1.00 211.39 ? 419  ALA A CA  1 
ATOM   2687 C  C   . ALA A 1  346 ? 49.483 205.522 19.542  1.00 207.91 ? 419  ALA A C   1 
ATOM   2688 O  O   . ALA A 1  346 ? 48.725 205.335 18.591  1.00 199.04 ? 419  ALA A O   1 
ATOM   2689 C  CB  . ALA A 1  346 ? 49.635 207.907 18.776  1.00 214.25 ? 419  ALA A CB  1 
ATOM   2690 N  N   . SER A 1  347 ? 49.925 204.544 20.328  1.00 204.81 ? 420  SER A N   1 
ATOM   2691 C  CA  . SER A 1  347 ? 49.600 203.141 20.095  1.00 191.96 ? 420  SER A CA  1 
ATOM   2692 C  C   . SER A 1  347 ? 48.102 202.864 20.199  1.00 170.06 ? 420  SER A C   1 
ATOM   2693 O  O   . SER A 1  347 ? 47.578 201.983 19.514  1.00 165.53 ? 420  SER A O   1 
ATOM   2694 C  CB  . SER A 1  347 ? 50.366 202.258 21.081  1.00 203.51 ? 420  SER A CB  1 
ATOM   2695 O  OG  . SER A 1  347 ? 50.409 202.854 22.366  1.00 205.49 ? 420  SER A OG  1 
ATOM   2696 N  N   . THR A 1  348 ? 47.421 203.615 21.057  1.00 141.22 ? 421  THR A N   1 
ATOM   2697 C  CA  . THR A 1  348 ? 45.975 203.491 21.208  1.00 155.65 ? 421  THR A CA  1 
ATOM   2698 C  C   . THR A 1  348 ? 45.278 203.804 19.887  1.00 185.96 ? 421  THR A C   1 
ATOM   2699 O  O   . THR A 1  348 ? 44.374 203.085 19.463  1.00 198.73 ? 421  THR A O   1 
ATOM   2700 C  CB  . THR A 1  348 ? 45.439 204.427 22.310  1.00 148.93 ? 421  THR A CB  1 
ATOM   2701 O  OG1 . THR A 1  348 ? 46.008 204.057 23.572  1.00 162.70 ? 421  THR A OG1 1 
ATOM   2702 C  CG2 . THR A 1  348 ? 43.924 204.341 22.399  1.00 153.44 ? 421  THR A CG2 1 
ATOM   2703 N  N   . PHE A 1  349 ? 45.721 204.877 19.240  1.00 176.51 ? 422  PHE A N   1 
ATOM   2704 C  CA  . PHE A 1  349 ? 45.189 205.291 17.945  1.00 160.44 ? 422  PHE A CA  1 
ATOM   2705 C  C   . PHE A 1  349 ? 45.373 204.205 16.886  1.00 155.89 ? 422  PHE A C   1 
ATOM   2706 O  O   . PHE A 1  349 ? 44.400 203.724 16.290  1.00 139.98 ? 422  PHE A O   1 
ATOM   2707 C  CB  . PHE A 1  349 ? 45.866 206.592 17.500  1.00 159.28 ? 422  PHE A CB  1 
ATOM   2708 C  CG  . PHE A 1  349 ? 45.610 206.958 16.066  1.00 179.81 ? 422  PHE A CG  1 
ATOM   2709 C  CD1 . PHE A 1  349 ? 44.414 207.544 15.688  1.00 183.48 ? 422  PHE A CD1 1 
ATOM   2710 C  CD2 . PHE A 1  349 ? 46.576 206.733 15.098  1.00 175.40 ? 422  PHE A CD2 1 
ATOM   2711 C  CE1 . PHE A 1  349 ? 44.180 207.886 14.370  1.00 191.77 ? 422  PHE A CE1 1 
ATOM   2712 C  CE2 . PHE A 1  349 ? 46.348 207.074 13.779  1.00 173.59 ? 422  PHE A CE2 1 
ATOM   2713 C  CZ  . PHE A 1  349 ? 45.149 207.651 13.414  1.00 190.31 ? 422  PHE A CZ  1 
ATOM   2714 N  N   . PHE A 1  350 ? 46.626 203.813 16.670  1.00 150.87 ? 423  PHE A N   1 
ATOM   2715 C  CA  . PHE A 1  350 ? 46.967 202.830 15.648  1.00 140.19 ? 423  PHE A CA  1 
ATOM   2716 C  C   . PHE A 1  350 ? 46.401 201.448 15.957  1.00 158.19 ? 423  PHE A C   1 
ATOM   2717 O  O   . PHE A 1  350 ? 46.350 200.587 15.083  1.00 159.32 ? 423  PHE A O   1 
ATOM   2718 C  CB  . PHE A 1  350 ? 48.486 202.744 15.477  1.00 133.43 ? 423  PHE A CB  1 
ATOM   2719 C  CG  . PHE A 1  350 ? 49.093 203.965 14.851  1.00 137.56 ? 423  PHE A CG  1 
ATOM   2720 C  CD1 . PHE A 1  350 ? 49.052 204.147 13.478  1.00 137.66 ? 423  PHE A CD1 1 
ATOM   2721 C  CD2 . PHE A 1  350 ? 49.704 204.931 15.632  1.00 164.72 ? 423  PHE A CD2 1 
ATOM   2722 C  CE1 . PHE A 1  350 ? 49.608 205.270 12.897  1.00 163.47 ? 423  PHE A CE1 1 
ATOM   2723 C  CE2 . PHE A 1  350 ? 50.262 206.057 15.057  1.00 182.50 ? 423  PHE A CE2 1 
ATOM   2724 C  CZ  . PHE A 1  350 ? 50.214 206.227 13.688  1.00 178.24 ? 423  PHE A CZ  1 
ATOM   2725 N  N   . ALA A 1  351 ? 45.982 201.237 17.200  1.00 154.38 ? 424  ALA A N   1 
ATOM   2726 C  CA  . ALA A 1  351 ? 45.333 199.987 17.577  1.00 154.59 ? 424  ALA A CA  1 
ATOM   2727 C  C   . ALA A 1  351 ? 43.844 200.048 17.249  1.00 165.27 ? 424  ALA A C   1 
ATOM   2728 O  O   . ALA A 1  351 ? 43.285 199.118 16.657  1.00 178.05 ? 424  ALA A O   1 
ATOM   2729 C  CB  . ALA A 1  351 ? 45.544 199.700 19.054  1.00 150.16 ? 424  ALA A CB  1 
ATOM   2730 N  N   . ILE A 1  352 ? 43.213 201.154 17.633  1.00 149.68 ? 425  ILE A N   1 
ATOM   2731 C  CA  . ILE A 1  352 ? 41.790 201.363 17.393  1.00 157.88 ? 425  ILE A CA  1 
ATOM   2732 C  C   . ILE A 1  352 ? 41.482 201.338 15.902  1.00 179.54 ? 425  ILE A C   1 
ATOM   2733 O  O   . ILE A 1  352 ? 40.541 200.668 15.469  1.00 195.78 ? 425  ILE A O   1 
ATOM   2734 C  CB  . ILE A 1  352 ? 41.310 202.684 18.025  1.00 140.13 ? 425  ILE A CB  1 
ATOM   2735 C  CG1 . ILE A 1  352 ? 41.265 202.562 19.549  1.00 151.65 ? 425  ILE A CG1 1 
ATOM   2736 C  CG2 . ILE A 1  352 ? 39.944 203.077 17.481  1.00 145.51 ? 425  ILE A CG2 1 
ATOM   2737 C  CD1 . ILE A 1  352 ? 40.871 203.843 20.250  1.00 147.13 ? 425  ILE A CD1 1 
ATOM   2738 N  N   . ILE A 1  353 ? 42.277 202.057 15.115  1.00 200.82 ? 426  ILE A N   1 
ATOM   2739 C  CA  . ILE A 1  353 ? 42.041 202.114 13.676  1.00 207.67 ? 426  ILE A CA  1 
ATOM   2740 C  C   . ILE A 1  353 ? 42.328 200.760 13.029  1.00 202.35 ? 426  ILE A C   1 
ATOM   2741 O  O   . ILE A 1  353 ? 41.775 200.436 11.978  1.00 218.77 ? 426  ILE A O   1 
ATOM   2742 C  CB  . ILE A 1  353 ? 42.876 203.226 13.012  1.00 210.96 ? 426  ILE A CB  1 
ATOM   2743 C  CG1 . ILE A 1  353 ? 44.370 202.916 13.113  1.00 221.39 ? 426  ILE A CG1 1 
ATOM   2744 C  CG2 . ILE A 1  353 ? 42.564 204.574 13.644  1.00 222.08 ? 426  ILE A CG2 1 
ATOM   2745 C  CD1 . ILE A 1  353 ? 45.251 203.934 12.427  1.00 220.06 ? 426  ILE A CD1 1 
ATOM   2746 N  N   . PHE A 1  354 ? 43.184 199.967 13.668  1.00 159.99 ? 427  PHE A N   1 
ATOM   2747 C  CA  . PHE A 1  354 ? 43.555 198.656 13.145  1.00 139.80 ? 427  PHE A CA  1 
ATOM   2748 C  C   . PHE A 1  354 ? 42.433 197.645 13.349  1.00 147.82 ? 427  PHE A C   1 
ATOM   2749 O  O   . PHE A 1  354 ? 41.990 196.997 12.401  1.00 162.63 ? 427  PHE A O   1 
ATOM   2750 C  CB  . PHE A 1  354 ? 44.842 198.158 13.808  1.00 157.17 ? 427  PHE A CB  1 
ATOM   2751 C  CG  . PHE A 1  354 ? 45.337 196.844 13.272  1.00 137.73 ? 427  PHE A CG  1 
ATOM   2752 C  CD1 . PHE A 1  354 ? 45.962 196.776 12.039  1.00 135.23 ? 427  PHE A CD1 1 
ATOM   2753 C  CD2 . PHE A 1  354 ? 45.190 195.681 14.007  1.00 145.01 ? 427  PHE A CD2 1 
ATOM   2754 C  CE1 . PHE A 1  354 ? 46.420 195.569 11.544  1.00 132.70 ? 427  PHE A CE1 1 
ATOM   2755 C  CE2 . PHE A 1  354 ? 45.648 194.472 13.519  1.00 139.70 ? 427  PHE A CE2 1 
ATOM   2756 C  CZ  . PHE A 1  354 ? 46.265 194.417 12.286  1.00 113.56 ? 427  PHE A CZ  1 
ATOM   2757 N  N   . PHE A 1  355 ? 41.975 197.514 14.589  1.00 163.31 ? 428  PHE A N   1 
ATOM   2758 C  CA  . PHE A 1  355 ? 40.913 196.562 14.904  1.00 164.95 ? 428  PHE A CA  1 
ATOM   2759 C  C   . PHE A 1  355 ? 39.597 196.992 14.266  1.00 135.67 ? 428  PHE A C   1 
ATOM   2760 O  O   . PHE A 1  355 ? 38.843 196.163 13.749  1.00 117.58 ? 428  PHE A O   1 
ATOM   2761 C  CB  . PHE A 1  355 ? 40.761 196.420 16.417  1.00 172.87 ? 428  PHE A CB  1 
ATOM   2762 C  CG  . PHE A 1  355 ? 42.031 196.026 17.110  1.00 172.42 ? 428  PHE A CG  1 
ATOM   2763 C  CD1 . PHE A 1  355 ? 42.883 195.093 16.540  1.00 140.61 ? 428  PHE A CD1 1 
ATOM   2764 C  CD2 . PHE A 1  355 ? 42.385 196.600 18.318  1.00 201.14 ? 428  PHE A CD2 1 
ATOM   2765 C  CE1 . PHE A 1  355 ? 44.057 194.731 17.168  1.00 138.74 ? 428  PHE A CE1 1 
ATOM   2766 C  CE2 . PHE A 1  355 ? 43.559 196.242 18.949  1.00 200.88 ? 428  PHE A CE2 1 
ATOM   2767 C  CZ  . PHE A 1  355 ? 44.397 195.308 18.373  1.00 173.35 ? 428  PHE A CZ  1 
ATOM   2768 N  N   . LEU A 1  356 ? 39.333 198.295 14.297  1.00 124.14 ? 429  LEU A N   1 
ATOM   2769 C  CA  . LEU A 1  356 ? 38.161 198.848 13.632  1.00 153.28 ? 429  LEU A CA  1 
ATOM   2770 C  C   . LEU A 1  356 ? 38.265 198.603 12.130  1.00 133.51 ? 429  LEU A C   1 
ATOM   2771 O  O   . LEU A 1  356 ? 37.263 198.340 11.461  1.00 125.61 ? 429  LEU A O   1 
ATOM   2772 C  CB  . LEU A 1  356 ? 38.022 200.342 13.928  1.00 150.64 ? 429  LEU A CB  1 
ATOM   2773 C  CG  . LEU A 1  356 ? 36.743 201.020 13.434  1.00 136.72 ? 429  LEU A CG  1 
ATOM   2774 C  CD1 . LEU A 1  356 ? 35.517 200.363 14.049  1.00 136.57 ? 429  LEU A CD1 1 
ATOM   2775 C  CD2 . LEU A 1  356 ? 36.771 202.508 13.746  1.00 180.52 ? 429  LEU A CD2 1 
ATOM   2776 N  N   . MET A 1  357 ? 39.488 198.682 11.610  1.00 137.80 ? 430  MET A N   1 
ATOM   2777 C  CA  . MET A 1  357 ? 39.744 198.379 10.207  1.00 133.53 ? 430  MET A CA  1 
ATOM   2778 C  C   . MET A 1  357 ? 39.378 196.933 9.901   1.00 122.66 ? 430  MET A C   1 
ATOM   2779 O  O   . MET A 1  357 ? 38.760 196.653 8.881   1.00 133.48 ? 430  MET A O   1 
ATOM   2780 C  CB  . MET A 1  357 ? 41.209 198.636 9.845   1.00 145.22 ? 430  MET A CB  1 
ATOM   2781 C  CG  . MET A 1  357 ? 41.558 198.271 8.408   1.00 139.45 ? 430  MET A CG  1 
ATOM   2782 S  SD  . MET A 1  357 ? 43.329 198.286 8.068   1.00 153.56 ? 430  MET A SD  1 
ATOM   2783 C  CE  . MET A 1  357 ? 43.891 196.955 9.125   1.00 143.93 ? 430  MET A CE  1 
ATOM   2784 N  N   . LEU A 1  358 ? 39.762 196.023 10.792  1.00 130.11 ? 431  LEU A N   1 
ATOM   2785 C  CA  . LEU A 1  358 ? 39.430 194.607 10.641  1.00 126.86 ? 431  LEU A CA  1 
ATOM   2786 C  C   . LEU A 1  358 ? 37.917 194.389 10.621  1.00 136.59 ? 431  LEU A C   1 
ATOM   2787 O  O   . LEU A 1  358 ? 37.381 193.705 9.735   1.00 154.96 ? 431  LEU A O   1 
ATOM   2788 C  CB  . LEU A 1  358 ? 40.062 193.787 11.770  1.00 135.92 ? 431  LEU A CB  1 
ATOM   2789 C  CG  . LEU A 1  358 ? 41.414 193.118 11.505  1.00 144.43 ? 431  LEU A CG  1 
ATOM   2790 C  CD1 . LEU A 1  358 ? 42.445 194.119 11.009  1.00 140.60 ? 431  LEU A CD1 1 
ATOM   2791 C  CD2 . LEU A 1  358 ? 41.911 192.415 12.761  1.00 142.74 ? 431  LEU A CD2 1 
ATOM   2792 N  N   . ILE A 1  359 ? 37.237 194.979 11.600  1.00 128.41 ? 432  ILE A N   1 
ATOM   2793 C  CA  . ILE A 1  359 ? 35.788 194.862 11.707  1.00 134.53 ? 432  ILE A CA  1 
ATOM   2794 C  C   . ILE A 1  359 ? 35.116 195.354 10.430  1.00 157.49 ? 432  ILE A C   1 
ATOM   2795 O  O   . ILE A 1  359 ? 34.304 194.644 9.837   1.00 158.52 ? 432  ILE A O   1 
ATOM   2796 C  CB  . ILE A 1  359 ? 35.256 195.625 12.930  1.00 133.69 ? 432  ILE A CB  1 
ATOM   2797 C  CG1 . ILE A 1  359 ? 35.863 195.061 14.215  1.00 118.53 ? 432  ILE A CG1 1 
ATOM   2798 C  CG2 . ILE A 1  359 ? 33.737 195.549 12.983  1.00 146.31 ? 432  ILE A CG2 1 
ATOM   2799 C  CD1 . ILE A 1  359 ? 35.471 195.827 15.455  1.00 122.24 ? 432  ILE A CD1 1 
ATOM   2800 N  N   . THR A 1  360 ? 35.472 196.560 9.998   1.00 162.02 ? 433  THR A N   1 
ATOM   2801 C  CA  . THR A 1  360 ? 34.903 197.134 8.780   1.00 152.46 ? 433  THR A CA  1 
ATOM   2802 C  C   . THR A 1  360 ? 35.299 196.334 7.539   1.00 149.89 ? 433  THR A C   1 
ATOM   2803 O  O   . THR A 1  360 ? 34.629 196.400 6.508   1.00 160.78 ? 433  THR A O   1 
ATOM   2804 C  CB  . THR A 1  360 ? 35.335 198.600 8.590   1.00 139.85 ? 433  THR A CB  1 
ATOM   2805 O  OG1 . THR A 1  360 ? 36.765 198.688 8.621   1.00 148.87 ? 433  THR A OG1 1 
ATOM   2806 C  CG2 . THR A 1  360 ? 34.750 199.475 9.687   1.00 149.29 ? 433  THR A CG2 1 
ATOM   2807 N  N   . LEU A 1  361 ? 36.389 195.582 7.646   1.00 142.26 ? 434  LEU A N   1 
ATOM   2808 C  CA  . LEU A 1  361 ? 36.862 194.746 6.549   1.00 137.38 ? 434  LEU A CA  1 
ATOM   2809 C  C   . LEU A 1  361 ? 36.014 193.490 6.410   1.00 137.63 ? 434  LEU A C   1 
ATOM   2810 O  O   . LEU A 1  361 ? 35.804 192.995 5.305   1.00 129.54 ? 434  LEU A O   1 
ATOM   2811 C  CB  . LEU A 1  361 ? 38.328 194.364 6.754   1.00 130.44 ? 434  LEU A CB  1 
ATOM   2812 C  CG  . LEU A 1  361 ? 39.377 195.281 6.127   1.00 140.70 ? 434  LEU A CG  1 
ATOM   2813 C  CD1 . LEU A 1  361 ? 40.726 195.055 6.783   1.00 133.27 ? 434  LEU A CD1 1 
ATOM   2814 C  CD2 . LEU A 1  361 ? 39.461 195.046 4.629   1.00 141.92 ? 434  LEU A CD2 1 
ATOM   2815 N  N   . GLY A 1  362 ? 35.531 192.973 7.535   1.00 134.95 ? 435  GLY A N   1 
ATOM   2816 C  CA  . GLY A 1  362 ? 34.697 191.784 7.504   1.00 117.38 ? 435  GLY A CA  1 
ATOM   2817 C  C   . GLY A 1  362 ? 33.206 192.043 7.351   1.00 121.17 ? 435  GLY A C   1 
ATOM   2818 O  O   . GLY A 1  362 ? 32.475 191.218 6.788   1.00 129.05 ? 435  GLY A O   1 
ATOM   2819 N  N   . LEU A 1  363 ? 32.758 193.192 7.851   1.00 124.89 ? 436  LEU A N   1 
ATOM   2820 C  CA  . LEU A 1  363 ? 31.333 193.517 7.911   1.00 132.55 ? 436  LEU A CA  1 
ATOM   2821 C  C   . LEU A 1  363 ? 30.634 193.490 6.552   1.00 146.70 ? 436  LEU A C   1 
ATOM   2822 O  O   . LEU A 1  363 ? 29.594 192.856 6.409   1.00 128.42 ? 436  LEU A O   1 
ATOM   2823 C  CB  . LEU A 1  363 ? 31.130 194.890 8.558   1.00 123.68 ? 436  LEU A CB  1 
ATOM   2824 C  CG  . LEU A 1  363 ? 31.170 194.916 10.088  1.00 133.99 ? 436  LEU A CG  1 
ATOM   2825 C  CD1 . LEU A 1  363 ? 30.844 196.305 10.617  1.00 149.94 ? 436  LEU A CD1 1 
ATOM   2826 C  CD2 . LEU A 1  363 ? 30.222 193.878 10.667  1.00 123.19 ? 436  LEU A CD2 1 
ATOM   2827 N  N   . ASP A 1  364 ? 31.199 194.178 5.564   1.00 156.31 ? 437  ASP A N   1 
ATOM   2828 C  CA  . ASP A 1  364 ? 30.596 194.231 4.233   1.00 162.25 ? 437  ASP A CA  1 
ATOM   2829 C  C   . ASP A 1  364 ? 30.563 192.853 3.574   1.00 166.22 ? 437  ASP A C   1 
ATOM   2830 O  O   . ASP A 1  364 ? 29.584 192.490 2.912   1.00 191.74 ? 437  ASP A O   1 
ATOM   2831 C  CB  . ASP A 1  364 ? 31.347 195.222 3.343   1.00 168.14 ? 437  ASP A CB  1 
ATOM   2832 C  CG  . ASP A 1  364 ? 32.765 195.471 3.815   1.00 183.73 ? 437  ASP A CG  1 
ATOM   2833 O  OD1 . ASP A 1  364 ? 33.264 194.686 4.648   1.00 193.97 ? 437  ASP A OD1 1 
ATOM   2834 O  OD2 . ASP A 1  364 ? 33.382 196.453 3.351   1.00 172.93 ? 437  ASP A OD2 1 
ATOM   2835 N  N   . SER A 1  365 ? 31.635 192.090 3.763   1.00 137.87 ? 438  SER A N   1 
ATOM   2836 C  CA  . SER A 1  365 ? 31.710 190.732 3.240   1.00 138.50 ? 438  SER A CA  1 
ATOM   2837 C  C   . SER A 1  365 ? 30.619 189.864 3.857   1.00 138.51 ? 438  SER A C   1 
ATOM   2838 O  O   . SER A 1  365 ? 30.062 188.989 3.194   1.00 148.32 ? 438  SER A O   1 
ATOM   2839 C  CB  . SER A 1  365 ? 33.088 190.124 3.508   1.00 152.23 ? 438  SER A CB  1 
ATOM   2840 O  OG  . SER A 1  365 ? 34.100 190.840 2.823   1.00 169.76 ? 438  SER A OG  1 
ATOM   2841 N  N   . SER A 1  366 ? 30.314 190.116 5.126   1.00 167.15 ? 439  SER A N   1 
ATOM   2842 C  CA  . SER A 1  366 ? 29.216 189.419 5.787   1.00 177.09 ? 439  SER A CA  1 
ATOM   2843 C  C   . SER A 1  366 ? 27.872 189.866 5.209   1.00 177.43 ? 439  SER A C   1 
ATOM   2844 O  O   . SER A 1  366 ? 26.983 189.039 4.971   1.00 180.58 ? 439  SER A O   1 
ATOM   2845 C  CB  . SER A 1  366 ? 29.255 189.660 7.296   1.00 207.32 ? 439  SER A CB  1 
ATOM   2846 O  OG  . SER A 1  366 ? 28.262 188.896 7.959   1.00 222.15 ? 439  SER A OG  1 
ATOM   2847 N  N   . PHE A 1  367 ? 27.740 191.174 4.988   1.00 161.63 ? 440  PHE A N   1 
ATOM   2848 C  CA  . PHE A 1  367 ? 26.539 191.762 4.394   1.00 126.39 ? 440  PHE A CA  1 
ATOM   2849 C  C   . PHE A 1  367 ? 26.190 191.055 3.097   1.00 141.04 ? 440  PHE A C   1 
ATOM   2850 O  O   . PHE A 1  367 ? 25.056 190.629 2.891   1.00 174.36 ? 440  PHE A O   1 
ATOM   2851 C  CB  . PHE A 1  367 ? 26.725 193.257 4.102   1.00 130.21 ? 440  PHE A CB  1 
ATOM   2852 C  CG  . PHE A 1  367 ? 26.924 194.112 5.321   1.00 129.47 ? 440  PHE A CG  1 
ATOM   2853 C  CD1 . PHE A 1  367 ? 26.595 193.652 6.583   1.00 129.09 ? 440  PHE A CD1 1 
ATOM   2854 C  CD2 . PHE A 1  367 ? 27.431 195.395 5.193   1.00 132.20 ? 440  PHE A CD2 1 
ATOM   2855 C  CE1 . PHE A 1  367 ? 26.783 194.454 7.693   1.00 190.08 ? 440  PHE A CE1 1 
ATOM   2856 C  CE2 . PHE A 1  367 ? 27.619 196.198 6.299   1.00 147.27 ? 440  PHE A CE2 1 
ATOM   2857 C  CZ  . PHE A 1  367 ? 27.294 195.728 7.551   1.00 170.62 ? 440  PHE A CZ  1 
ATOM   2858 N  N   . ALA A 1  368 ? 27.183 190.946 2.222   1.00 139.76 ? 441  ALA A N   1 
ATOM   2859 C  CA  . ALA A 1  368 ? 26.989 190.330 0.917   1.00 154.45 ? 441  ALA A CA  1 
ATOM   2860 C  C   . ALA A 1  368 ? 26.782 188.824 1.036   1.00 135.24 ? 441  ALA A C   1 
ATOM   2861 O  O   . ALA A 1  368 ? 25.907 188.254 0.378   1.00 139.32 ? 441  ALA A O   1 
ATOM   2862 C  CB  . ALA A 1  368 ? 28.166 190.630 0.026   1.00 160.85 ? 441  ALA A CB  1 
ATOM   2863 N  N   . GLY A 1  369 ? 27.596 188.190 1.877   1.00 121.30 ? 442  GLY A N   1 
ATOM   2864 C  CA  . GLY A 1  369 ? 27.515 186.759 2.102   1.00 113.54 ? 442  GLY A CA  1 
ATOM   2865 C  C   . GLY A 1  369 ? 26.131 186.293 2.506   1.00 114.34 ? 442  GLY A C   1 
ATOM   2866 O  O   . GLY A 1  369 ? 25.627 185.296 1.990   1.00 115.00 ? 442  GLY A O   1 
ATOM   2867 N  N   . LEU A 1  370 ? 25.511 187.018 3.431   1.00 119.90 ? 443  LEU A N   1 
ATOM   2868 C  CA  . LEU A 1  370 ? 24.141 186.714 3.826   1.00 136.27 ? 443  LEU A CA  1 
ATOM   2869 C  C   . LEU A 1  370 ? 23.159 187.206 2.769   1.00 144.23 ? 443  LEU A C   1 
ATOM   2870 O  O   . LEU A 1  370 ? 22.114 186.594 2.544   1.00 152.06 ? 443  LEU A O   1 
ATOM   2871 C  CB  . LEU A 1  370 ? 23.815 187.344 5.181   1.00 152.49 ? 443  LEU A CB  1 
ATOM   2872 C  CG  . LEU A 1  370 ? 24.558 186.773 6.387   1.00 132.26 ? 443  LEU A CG  1 
ATOM   2873 C  CD1 . LEU A 1  370 ? 24.186 187.535 7.647   1.00 143.72 ? 443  LEU A CD1 1 
ATOM   2874 C  CD2 . LEU A 1  370 ? 24.256 185.291 6.544   1.00 114.15 ? 443  LEU A CD2 1 
ATOM   2875 N  N   . GLU A 1  371 ? 23.514 188.311 2.121   1.00 162.00 ? 444  GLU A N   1 
ATOM   2876 C  CA  . GLU A 1  371 ? 22.644 188.964 1.148   1.00 155.19 ? 444  GLU A CA  1 
ATOM   2877 C  C   . GLU A 1  371 ? 22.301 188.041 -0.015  1.00 147.92 ? 444  GLU A C   1 
ATOM   2878 O  O   . GLU A 1  371 ? 21.163 188.022 -0.487  1.00 128.42 ? 444  GLU A O   1 
ATOM   2879 C  CB  . GLU A 1  371 ? 23.301 190.243 0.623   1.00 135.18 ? 444  GLU A CB  1 
ATOM   2880 C  CG  . GLU A 1  371 ? 22.381 191.123 -0.203  1.00 141.03 ? 444  GLU A CG  1 
ATOM   2881 C  CD  . GLU A 1  371 ? 21.271 191.742 0.625   1.00 171.35 ? 444  GLU A CD  1 
ATOM   2882 O  OE1 . GLU A 1  371 ? 20.193 191.121 0.736   1.00 185.33 ? 444  GLU A OE1 1 
ATOM   2883 O  OE2 . GLU A 1  371 ? 21.478 192.849 1.164   1.00 171.74 ? 444  GLU A OE2 1 
ATOM   2884 N  N   . GLY A 1  372 ? 23.289 187.279 -0.474  1.00 158.32 ? 445  GLY A N   1 
ATOM   2885 C  CA  . GLY A 1  372 ? 23.078 186.339 -1.559  1.00 162.05 ? 445  GLY A CA  1 
ATOM   2886 C  C   . GLY A 1  372 ? 22.077 185.251 -1.217  1.00 163.34 ? 445  GLY A C   1 
ATOM   2887 O  O   . GLY A 1  372 ? 21.186 184.935 -2.008  1.00 175.95 ? 445  GLY A O   1 
ATOM   2888 N  N   . VAL A 1  373 ? 22.224 184.683 -0.025  1.00 138.55 ? 446  VAL A N   1 
ATOM   2889 C  CA  . VAL A 1  373 ? 21.349 183.611 0.431   1.00 118.36 ? 446  VAL A CA  1 
ATOM   2890 C  C   . VAL A 1  373 ? 19.934 184.130 0.653   1.00 154.55 ? 446  VAL A C   1 
ATOM   2891 O  O   . VAL A 1  373 ? 18.959 183.500 0.237   1.00 168.10 ? 446  VAL A O   1 
ATOM   2892 C  CB  . VAL A 1  373 ? 21.897 182.962 1.712   1.00 115.61 ? 446  VAL A CB  1 
ATOM   2893 C  CG1 . VAL A 1  373 ? 20.986 181.834 2.168   1.00 116.09 ? 446  VAL A CG1 1 
ATOM   2894 C  CG2 . VAL A 1  373 ? 23.309 182.455 1.481   1.00 156.98 ? 446  VAL A CG2 1 
ATOM   2895 N  N   . ILE A 1  374 ? 19.828 185.282 1.310   1.00 153.92 ? 447  ILE A N   1 
ATOM   2896 C  CA  . ILE A 1  374 ? 18.534 185.900 1.578   1.00 154.96 ? 447  ILE A CA  1 
ATOM   2897 C  C   . ILE A 1  374 ? 17.812 186.201 0.270   1.00 152.38 ? 447  ILE A C   1 
ATOM   2898 O  O   . ILE A 1  374 ? 16.627 185.898 0.120   1.00 136.69 ? 447  ILE A O   1 
ATOM   2899 C  CB  . ILE A 1  374 ? 18.696 187.173 2.427   1.00 150.58 ? 447  ILE A CB  1 
ATOM   2900 C  CG1 . ILE A 1  374 ? 19.217 186.814 3.820   1.00 148.43 ? 447  ILE A CG1 1 
ATOM   2901 C  CG2 . ILE A 1  374 ? 17.377 187.925 2.524   1.00 138.54 ? 447  ILE A CG2 1 
ATOM   2902 C  CD1 . ILE A 1  374 ? 19.629 188.009 4.648   1.00 152.49 ? 447  ILE A CD1 1 
ATOM   2903 N  N   . THR A 1  375 ? 18.538 186.789 -0.677  1.00 149.08 ? 448  THR A N   1 
ATOM   2904 C  CA  . THR A 1  375 ? 17.993 187.078 -1.999  1.00 139.71 ? 448  THR A CA  1 
ATOM   2905 C  C   . THR A 1  375 ? 17.526 185.794 -2.682  1.00 134.06 ? 448  THR A C   1 
ATOM   2906 O  O   . THR A 1  375 ? 16.461 185.760 -3.300  1.00 141.39 ? 448  THR A O   1 
ATOM   2907 C  CB  . THR A 1  375 ? 19.030 187.788 -2.892  1.00 146.88 ? 448  THR A CB  1 
ATOM   2908 O  OG1 . THR A 1  375 ? 19.385 189.048 -2.309  1.00 153.10 ? 448  THR A OG1 1 
ATOM   2909 C  CG2 . THR A 1  375 ? 18.473 188.019 -4.287  1.00 144.06 ? 448  THR A CG2 1 
ATOM   2910 N  N   . ALA A 1  376 ? 18.327 184.755 -2.657  1.00 137.75 ? 449  ALA A N   1 
ATOM   2911 C  CA  . ALA A 1  376 ? 17.880 183.572 -3.347  1.00 132.81 ? 449  ALA A CA  1 
ATOM   2912 C  C   . ALA A 1  376 ? 16.639 182.990 -2.712  1.00 131.40 ? 449  ALA A C   1 
ATOM   2913 O  O   . ALA A 1  376 ? 15.704 182.632 -3.395  1.00 154.03 ? 449  ALA A O   1 
ATOM   2914 C  CB  . ALA A 1  376 ? 18.982 182.538 -3.391  1.00 164.19 ? 449  ALA A CB  1 
ATOM   2915 N  N   . VAL A 1  377 ? 16.621 182.902 -1.397  1.00 132.34 ? 450  VAL A N   1 
ATOM   2916 C  CA  . VAL A 1  377 ? 15.543 182.195 -0.725  1.00 145.14 ? 450  VAL A CA  1 
ATOM   2917 C  C   . VAL A 1  377 ? 14.200 182.880 -0.940  1.00 150.60 ? 450  VAL A C   1 
ATOM   2918 O  O   . VAL A 1  377 ? 13.175 182.247 -1.163  1.00 140.98 ? 450  VAL A O   1 
ATOM   2919 C  CB  . VAL A 1  377 ? 15.848 182.020 0.767   1.00 139.33 ? 450  VAL A CB  1 
ATOM   2920 C  CG1 . VAL A 1  377 ? 14.644 181.460 1.495   1.00 154.56 ? 450  VAL A CG1 1 
ATOM   2921 C  CG2 . VAL A 1  377 ? 17.070 181.145 0.962   1.00 132.31 ? 450  VAL A CG2 1 
ATOM   2922 N  N   . LEU A 1  378 ? 14.241 184.195 -0.873  1.00 140.84 ? 451  LEU A N   1 
ATOM   2923 C  CA  . LEU A 1  378 ? 13.102 185.070 -1.131  1.00 168.65 ? 451  LEU A CA  1 
ATOM   2924 C  C   . LEU A 1  378 ? 12.640 184.972 -2.584  1.00 182.70 ? 451  LEU A C   1 
ATOM   2925 O  O   . LEU A 1  378 ? 11.447 185.085 -2.873  1.00 180.02 ? 451  LEU A O   1 
ATOM   2926 C  CB  . LEU A 1  378 ? 13.443 186.521 -0.784  1.00 148.37 ? 451  LEU A CB  1 
ATOM   2927 C  CG  . LEU A 1  378 ? 13.548 186.849 0.707   1.00 171.96 ? 451  LEU A CG  1 
ATOM   2928 C  CD1 . LEU A 1  378 ? 13.800 188.335 0.915   1.00 151.25 ? 451  LEU A CD1 1 
ATOM   2929 C  CD2 . LEU A 1  378 ? 12.294 186.404 1.446   1.00 152.06 ? 451  LEU A CD2 1 
ATOM   2930 N  N   . ASP A 1  379 ? 13.585 184.755 -3.494  1.00 189.52 ? 452  ASP A N   1 
ATOM   2931 C  CA  . ASP A 1  379 ? 13.260 184.612 -4.909  1.00 184.00 ? 452  ASP A CA  1 
ATOM   2932 C  C   . ASP A 1  379 ? 12.747 183.210 -5.227  1.00 173.27 ? 452  ASP A C   1 
ATOM   2933 O  O   . ASP A 1  379 ? 12.168 182.977 -6.289  1.00 178.19 ? 452  ASP A O   1 
ATOM   2934 C  CB  . ASP A 1  379 ? 14.478 184.930 -5.779  1.00 198.98 ? 452  ASP A CB  1 
ATOM   2935 C  CG  . ASP A 1  379 ? 14.787 186.414 -5.830  1.00 210.29 ? 452  ASP A CG  1 
ATOM   2936 O  OD1 . ASP A 1  379 ? 14.478 187.120 -4.847  1.00 215.79 ? 452  ASP A OD1 1 
ATOM   2937 O  OD2 . ASP A 1  379 ? 15.337 186.873 -6.854  1.00 197.63 ? 452  ASP A OD2 1 
ATOM   2938 N  N   . GLU A 1  380 ? 13.120 182.236 -4.417  1.00 195.81 ? 453  GLU A N   1 
ATOM   2939 C  CA  . GLU A 1  380 ? 12.659 180.867 -4.605  1.00 197.59 ? 453  GLU A CA  1 
ATOM   2940 C  C   . GLU A 1  380 ? 11.294 180.620 -3.981  1.00 200.85 ? 453  GLU A C   1 
ATOM   2941 O  O   . GLU A 1  380 ? 10.496 179.857 -4.535  1.00 226.60 ? 453  GLU A O   1 
ATOM   2942 C  CB  . GLU A 1  380 ? 13.673 179.884 -4.015  1.00 217.62 ? 453  GLU A CB  1 
ATOM   2943 C  CG  . GLU A 1  380 ? 13.265 178.425 -4.113  1.00 219.15 ? 453  GLU A CG  1 
ATOM   2944 C  CD  . GLU A 1  380 ? 12.901 178.017 -5.525  1.00 221.29 ? 453  GLU A CD  1 
ATOM   2945 O  OE1 . GLU A 1  380 ? 11.964 177.208 -5.692  1.00 237.47 ? 453  GLU A OE1 1 
ATOM   2946 O  OE2 . GLU A 1  380 ? 13.554 178.506 -6.472  1.00 206.88 ? 453  GLU A OE2 1 
ATOM   2947 N  N   . PHE A 1  381 ? 11.118 181.317 -2.861  1.00 199.56 ? 454  PHE A N   1 
ATOM   2948 C  CA  . PHE A 1  381 ? 9.816  181.197 -2.210  1.00 201.33 ? 454  PHE A CA  1 
ATOM   2949 C  C   . PHE A 1  381 ? 9.154  182.570 -2.164  1.00 206.80 ? 454  PHE A C   1 
ATOM   2950 O  O   . PHE A 1  381 ? 8.968  183.147 -1.084  1.00 205.06 ? 454  PHE A O   1 
ATOM   2951 C  CB  . PHE A 1  381 ? 9.957  180.614 -0.804  1.00 203.63 ? 454  PHE A CB  1 
ATOM   2952 C  CG  . PHE A 1  381 ? 10.205 179.128 -0.775  1.00 200.37 ? 454  PHE A CG  1 
ATOM   2953 C  CD1 . PHE A 1  381 ? 11.370 178.592 -1.296  1.00 194.59 ? 454  PHE A CD1 1 
ATOM   2954 C  CD2 . PHE A 1  381 ? 9.276  178.269 -0.206  1.00 201.67 ? 454  PHE A CD2 1 
ATOM   2955 C  CE1 . PHE A 1  381 ? 11.600 177.227 -1.266  1.00 188.79 ? 454  PHE A CE1 1 
ATOM   2956 C  CE2 . PHE A 1  381 ? 9.502  176.904 -0.170  1.00 198.12 ? 454  PHE A CE2 1 
ATOM   2957 C  CZ  . PHE A 1  381 ? 10.666 176.383 -0.700  1.00 190.75 ? 454  PHE A CZ  1 
ATOM   2958 N  N   . PRO A 1  382 ? 8.783  183.128 -3.304  1.00 221.86 ? 455  PRO A N   1 
ATOM   2959 C  CA  . PRO A 1  382 ? 8.331  184.513 -3.290  1.00 214.19 ? 455  PRO A CA  1 
ATOM   2960 C  C   . PRO A 1  382 ? 6.942  184.613 -2.737  1.00 212.47 ? 455  PRO A C   1 
ATOM   2961 O  O   . PRO A 1  382 ? 6.027  183.982 -3.243  1.00 202.36 ? 455  PRO A O   1 
ATOM   2962 C  CB  . PRO A 1  382 ? 8.238  184.826 -4.766  1.00 209.38 ? 455  PRO A CB  1 
ATOM   2963 C  CG  . PRO A 1  382 ? 7.697  183.550 -5.327  1.00 216.32 ? 455  PRO A CG  1 
ATOM   2964 C  CD  . PRO A 1  382 ? 8.257  182.425 -4.483  1.00 218.73 ? 455  PRO A CD  1 
ATOM   2965 N  N   . HIS A 1  383 ? 6.802  185.374 -1.669  1.00 249.26 ? 456  HIS A N   1 
ATOM   2966 C  CA  . HIS A 1  383 ? 5.528  185.915 -1.240  1.00 272.19 ? 456  HIS A CA  1 
ATOM   2967 C  C   . HIS A 1  383 ? 4.621  184.834 -0.691  1.00 268.19 ? 456  HIS A C   1 
ATOM   2968 O  O   . HIS A 1  383 ? 3.457  185.063 -0.383  1.00 260.51 ? 456  HIS A O   1 
ATOM   2969 C  CB  . HIS A 1  383 ? 4.866  186.708 -2.357  1.00 280.12 ? 456  HIS A CB  1 
ATOM   2970 C  CG  . HIS A 1  383 ? 5.164  188.173 -2.303  1.00 275.91 ? 456  HIS A CG  1 
ATOM   2971 N  ND1 . HIS A 1  383 ? 5.795  188.842 -3.328  1.00 270.48 ? 456  HIS A ND1 1 
ATOM   2972 C  CD2 . HIS A 1  383 ? 4.925  189.095 -1.342  1.00 273.71 ? 456  HIS A CD2 1 
ATOM   2973 C  CE1 . HIS A 1  383 ? 5.927  190.115 -3.003  1.00 270.25 ? 456  HIS A CE1 1 
ATOM   2974 N  NE2 . HIS A 1  383 ? 5.408  190.295 -1.803  1.00 272.20 ? 456  HIS A NE2 1 
ATOM   2975 N  N   . VAL A 1  384 ? 5.161  183.631 -0.650  1.00 270.82 ? 457  VAL A N   1 
ATOM   2976 C  CA  . VAL A 1  384 ? 5.276  182.777 0.480   1.00 271.04 ? 457  VAL A CA  1 
ATOM   2977 C  C   . VAL A 1  384 ? 6.224  183.502 1.423   1.00 262.95 ? 457  VAL A C   1 
ATOM   2978 O  O   . VAL A 1  384 ? 6.057  183.479 2.630   1.00 262.67 ? 457  VAL A O   1 
ATOM   2979 C  CB  . VAL A 1  384 ? 5.865  181.430 0.085   1.00 260.97 ? 457  VAL A CB  1 
ATOM   2980 C  CG1 . VAL A 1  384 ? 7.250  181.635 -0.498  1.00 262.74 ? 457  VAL A CG1 1 
ATOM   2981 C  CG2 . VAL A 1  384 ? 5.888  180.502 1.285   1.00 240.68 ? 457  VAL A CG2 1 
ATOM   2982 N  N   . TRP A 1  385 ? 7.226  184.149 0.838   1.00 235.01 ? 458  TRP A N   1 
ATOM   2983 C  CA  . TRP A 1  385 ? 8.242  184.876 1.578   1.00 223.51 ? 458  TRP A CA  1 
ATOM   2984 C  C   . TRP A 1  385 ? 8.291  186.311 1.113   1.00 235.00 ? 458  TRP A C   1 
ATOM   2985 O  O   . TRP A 1  385 ? 7.791  186.648 0.047   1.00 241.60 ? 458  TRP A O   1 
ATOM   2986 C  CB  . TRP A 1  385 ? 9.618  184.235 1.407   1.00 219.16 ? 458  TRP A CB  1 
ATOM   2987 C  CG  . TRP A 1  385 ? 9.957  183.349 2.531   1.00 214.57 ? 458  TRP A CG  1 
ATOM   2988 C  CD1 . TRP A 1  385 ? 10.113 182.004 2.492   1.00 208.78 ? 458  TRP A CD1 1 
ATOM   2989 C  CD2 . TRP A 1  385 ? 10.145 183.736 3.882   1.00 205.99 ? 458  TRP A CD2 1 
ATOM   2990 N  NE1 . TRP A 1  385 ? 10.394 181.526 3.737   1.00 189.83 ? 458  TRP A NE1 1 
ATOM   2991 C  CE2 . TRP A 1  385 ? 10.420 182.576 4.612   1.00 197.40 ? 458  TRP A CE2 1 
ATOM   2992 C  CE3 . TRP A 1  385 ? 10.111 184.955 4.546   1.00 209.16 ? 458  TRP A CE3 1 
ATOM   2993 C  CZ2 . TRP A 1  385 ? 10.660 182.597 5.972   1.00 208.99 ? 458  TRP A CZ2 1 
ATOM   2994 C  CZ3 . TRP A 1  385 ? 10.352 184.975 5.892   1.00 202.86 ? 458  TRP A CZ3 1 
ATOM   2995 C  CH2 . TRP A 1  385 ? 10.622 183.806 6.595   1.00 208.91 ? 458  TRP A CH2 1 
ATOM   2996 N  N   . ALA A 1  386 ? 8.978  187.159 1.854   1.00 248.25 ? 459  ALA A N   1 
ATOM   2997 C  CA  . ALA A 1  386 ? 9.040  188.548 1.448   1.00 262.04 ? 459  ALA A CA  1 
ATOM   2998 C  C   . ALA A 1  386 ? 7.856  189.298 2.007   1.00 268.98 ? 459  ALA A C   1 
ATOM   2999 O  O   . ALA A 1  386 ? 7.648  190.465 1.692   1.00 269.55 ? 459  ALA A O   1 
ATOM   3000 C  CB  . ALA A 1  386 ? 9.047  188.646 -0.069  1.00 259.32 ? 459  ALA A CB  1 
ATOM   3001 N  N   . LYS A 1  387 ? 7.082  188.633 2.853   1.00 278.16 ? 460  LYS A N   1 
ATOM   3002 C  CA  . LYS A 1  387 ? 5.961  189.289 3.491   1.00 285.39 ? 460  LYS A CA  1 
ATOM   3003 C  C   . LYS A 1  387 ? 6.564  190.417 4.292   1.00 278.46 ? 460  LYS A C   1 
ATOM   3004 O  O   . LYS A 1  387 ? 6.049  191.528 4.320   1.00 280.09 ? 460  LYS A O   1 
ATOM   3005 C  CB  . LYS A 1  387 ? 5.260  188.317 4.425   1.00 279.38 ? 460  LYS A CB  1 
ATOM   3006 C  CG  . LYS A 1  387 ? 6.149  187.829 5.549   1.00 254.71 ? 460  LYS A CG  1 
ATOM   3007 C  CD  . LYS A 1  387 ? 5.393  186.866 6.440   1.00 250.55 ? 460  LYS A CD  1 
ATOM   3008 C  CE  . LYS A 1  387 ? 5.082  185.570 5.713   1.00 259.03 ? 460  LYS A CE  1 
ATOM   3009 N  NZ  . LYS A 1  387 ? 4.338  184.603 6.565   1.00 271.73 ? 460  LYS A NZ  1 
ATOM   3010 N  N   . ARG A 1  388 ? 7.666  190.192 5.048   1.00 271.98 ? 461  ARG A N   1 
ATOM   3011 C  CA  . ARG A 1  388 ? 8.526  191.175 5.690   1.00 263.20 ? 461  ARG A CA  1 
ATOM   3012 C  C   . ARG A 1  388 ? 9.951  190.645 5.557   1.00 248.16 ? 461  ARG A C   1 
ATOM   3013 O  O   . ARG A 1  388 ? 10.174 189.438 5.657   1.00 237.74 ? 461  ARG A O   1 
ATOM   3014 C  CB  . ARG A 1  388 ? 8.156  191.382 7.163   1.00 261.24 ? 461  ARG A CB  1 
ATOM   3015 C  CG  . ARG A 1  388 ? 6.740  191.884 7.408   1.00 261.69 ? 461  ARG A CG  1 
ATOM   3016 C  CD  . ARG A 1  388 ? 6.534  193.285 6.854   1.00 262.31 ? 461  ARG A CD  1 
ATOM   3017 N  NE  . ARG A 1  388 ? 5.158  193.738 7.031   1.00 266.72 ? 461  ARG A NE  1 
ATOM   3018 C  CZ  . ARG A 1  388 ? 4.652  194.832 6.472   1.00 277.56 ? 461  ARG A CZ  1 
ATOM   3019 N  NH1 . ARG A 1  388 ? 5.407  195.590 5.689   1.00 273.07 ? 461  ARG A NH1 1 
ATOM   3020 N  NH2 . ARG A 1  388 ? 3.387  195.165 6.690   1.00 291.63 ? 461  ARG A NH2 1 
ATOM   3021 N  N   . ARG A 1  389 ? 10.913 191.529 5.321   1.00 234.34 ? 462  ARG A N   1 
ATOM   3022 C  CA  . ARG A 1  389 ? 12.290 191.090 5.118   1.00 198.55 ? 462  ARG A CA  1 
ATOM   3023 C  C   . ARG A 1  389 ? 13.016 190.911 6.447   1.00 206.42 ? 462  ARG A C   1 
ATOM   3024 O  O   . ARG A 1  389 ? 13.817 189.988 6.608   1.00 205.77 ? 462  ARG A O   1 
ATOM   3025 C  CB  . ARG A 1  389 ? 13.048 192.081 4.230   1.00 164.92 ? 462  ARG A CB  1 
ATOM   3026 C  CG  . ARG A 1  389 ? 14.476 191.661 3.920   1.00 157.96 ? 462  ARG A CG  1 
ATOM   3027 C  CD  . ARG A 1  389 ? 14.977 192.277 2.623   1.00 157.79 ? 462  ARG A CD  1 
ATOM   3028 N  NE  . ARG A 1  389 ? 16.334 191.840 2.304   1.00 197.30 ? 462  ARG A NE  1 
ATOM   3029 C  CZ  . ARG A 1  389 ? 16.898 191.962 1.107   1.00 184.22 ? 462  ARG A CZ  1 
ATOM   3030 N  NH1 . ARG A 1  389 ? 16.223 192.505 0.104   1.00 167.88 ? 462  ARG A NH1 1 
ATOM   3031 N  NH2 . ARG A 1  389 ? 18.138 191.537 0.911   1.00 179.22 ? 462  ARG A NH2 1 
ATOM   3032 N  N   . GLU A 1  390 ? 12.716 191.851 7.456   1.00 261.12 ? 463  GLU A N   1 
ATOM   3033 C  CA  . GLU A 1  390 ? 13.363 191.794 8.765   1.00 272.18 ? 463  GLU A CA  1 
ATOM   3034 C  C   . GLU A 1  390 ? 13.085 190.478 9.492   1.00 280.77 ? 463  GLU A C   1 
ATOM   3035 O  O   . GLU A 1  390 ? 13.836 190.084 10.384  1.00 296.65 ? 463  GLU A O   1 
ATOM   3036 C  CB  . GLU A 1  390 ? 12.911 192.968 9.634   1.00 281.02 ? 463  GLU A CB  1 
ATOM   3037 N  N   . ARG A 1  391 ? 12.005 189.832 9.149   1.00 217.92 ? 464  ARG A N   1 
ATOM   3038 C  CA  . ARG A 1  391 ? 11.684 188.575 9.815   1.00 190.26 ? 464  ARG A CA  1 
ATOM   3039 C  C   . ARG A 1  391 ? 12.618 187.459 9.355   1.00 205.39 ? 464  ARG A C   1 
ATOM   3040 O  O   . ARG A 1  391 ? 13.183 186.732 10.174  1.00 225.40 ? 464  ARG A O   1 
ATOM   3041 C  CB  . ARG A 1  391 ? 10.227 188.187 9.554   1.00 177.21 ? 464  ARG A CB  1 
ATOM   3042 N  N   . PHE A 1  392 ? 12.782 187.333 8.041   1.00 204.66 ? 465  PHE A N   1 
ATOM   3043 C  CA  . PHE A 1  392 ? 13.649 186.303 7.479   1.00 174.64 ? 465  PHE A CA  1 
ATOM   3044 C  C   . PHE A 1  392 ? 15.117 186.581 7.792   1.00 161.33 ? 465  PHE A C   1 
ATOM   3045 O  O   . PHE A 1  392 ? 15.860 185.669 8.160   1.00 157.98 ? 465  PHE A O   1 
ATOM   3046 C  CB  . PHE A 1  392 ? 13.446 186.191 5.967   1.00 161.89 ? 465  PHE A CB  1 
ATOM   3047 C  CG  . PHE A 1  392 ? 14.327 185.164 5.314   1.00 156.23 ? 465  PHE A CG  1 
ATOM   3048 C  CD1 . PHE A 1  392 ? 14.008 183.818 5.377   1.00 141.17 ? 465  PHE A CD1 1 
ATOM   3049 C  CD2 . PHE A 1  392 ? 15.476 185.543 4.639   1.00 164.68 ? 465  PHE A CD2 1 
ATOM   3050 C  CE1 . PHE A 1  392 ? 14.817 182.870 4.780   1.00 136.52 ? 465  PHE A CE1 1 
ATOM   3051 C  CE2 . PHE A 1  392 ? 16.288 184.600 4.041   1.00 156.87 ? 465  PHE A CE2 1 
ATOM   3052 C  CZ  . PHE A 1  392 ? 15.959 183.263 4.112   1.00 142.00 ? 465  PHE A CZ  1 
ATOM   3053 N  N   . VAL A 1  393 ? 15.529 187.837 7.642   1.00 157.58 ? 466  VAL A N   1 
ATOM   3054 C  CA  . VAL A 1  393 ? 16.905 188.236 7.928   1.00 154.33 ? 466  VAL A CA  1 
ATOM   3055 C  C   . VAL A 1  393 ? 17.252 187.924 9.380   1.00 164.43 ? 466  VAL A C   1 
ATOM   3056 O  O   . VAL A 1  393 ? 18.303 187.348 9.665   1.00 190.95 ? 466  VAL A O   1 
ATOM   3057 C  CB  . VAL A 1  393 ? 17.133 189.730 7.620   1.00 162.96 ? 466  VAL A CB  1 
ATOM   3058 C  CG1 . VAL A 1  393 ? 18.516 190.163 8.081   1.00 169.26 ? 466  VAL A CG1 1 
ATOM   3059 C  CG2 . VAL A 1  393 ? 16.962 189.998 6.133   1.00 160.41 ? 466  VAL A CG2 1 
ATOM   3060 N  N   . LEU A 1  394 ? 16.359 188.297 10.292  1.00 166.80 ? 467  LEU A N   1 
ATOM   3061 C  CA  . LEU A 1  394 ? 16.540 188.013 11.713  1.00 178.45 ? 467  LEU A CA  1 
ATOM   3062 C  C   . LEU A 1  394 ? 16.577 186.506 11.965  1.00 186.62 ? 467  LEU A C   1 
ATOM   3063 O  O   . LEU A 1  394 ? 17.376 186.018 12.772  1.00 202.42 ? 467  LEU A O   1 
ATOM   3064 C  CB  . LEU A 1  394 ? 15.424 188.670 12.533  1.00 158.25 ? 467  LEU A CB  1 
ATOM   3065 C  CG  . LEU A 1  394 ? 15.388 188.442 14.046  1.00 157.44 ? 467  LEU A CG  1 
ATOM   3066 C  CD1 . LEU A 1  394 ? 15.093 189.745 14.771  1.00 178.60 ? 467  LEU A CD1 1 
ATOM   3067 C  CD2 . LEU A 1  394 ? 14.350 187.391 14.409  1.00 154.22 ? 467  LEU A CD2 1 
ATOM   3068 N  N   . ALA A 1  395 ? 15.714 185.777 11.262  1.00 171.23 ? 468  ALA A N   1 
ATOM   3069 C  CA  . ALA A 1  395 ? 15.638 184.325 11.394  1.00 161.55 ? 468  ALA A CA  1 
ATOM   3070 C  C   . ALA A 1  395 ? 16.938 183.657 10.955  1.00 172.08 ? 468  ALA A C   1 
ATOM   3071 O  O   . ALA A 1  395 ? 17.305 182.599 11.466  1.00 193.85 ? 468  ALA A O   1 
ATOM   3072 C  CB  . ALA A 1  395 ? 14.468 183.782 10.590  1.00 176.50 ? 468  ALA A CB  1 
ATOM   3073 N  N   . VAL A 1  396 ? 17.628 184.278 10.004  1.00 160.15 ? 469  VAL A N   1 
ATOM   3074 C  CA  . VAL A 1  396 ? 18.915 183.775 9.542   1.00 126.67 ? 469  VAL A CA  1 
ATOM   3075 C  C   . VAL A 1  396 ? 20.014 184.145 10.536  1.00 144.15 ? 469  VAL A C   1 
ATOM   3076 O  O   . VAL A 1  396 ? 20.849 183.310 10.890  1.00 160.40 ? 469  VAL A O   1 
ATOM   3077 C  CB  . VAL A 1  396 ? 19.245 184.304 8.132   1.00 126.16 ? 469  VAL A CB  1 
ATOM   3078 C  CG1 . VAL A 1  396 ? 20.669 183.939 7.742   1.00 158.68 ? 469  VAL A CG1 1 
ATOM   3079 C  CG2 . VAL A 1  396 ? 18.257 183.753 7.115   1.00 127.74 ? 469  VAL A CG2 1 
ATOM   3080 N  N   . VAL A 1  397 ? 19.998 185.396 10.989  1.00 127.39 ? 470  VAL A N   1 
ATOM   3081 C  CA  . VAL A 1  397 ? 21.009 185.908 11.911  1.00 126.05 ? 470  VAL A CA  1 
ATOM   3082 C  C   . VAL A 1  397 ? 21.042 185.114 13.216  1.00 148.13 ? 470  VAL A C   1 
ATOM   3083 O  O   . VAL A 1  397 ? 22.115 184.732 13.689  1.00 145.24 ? 470  VAL A O   1 
ATOM   3084 C  CB  . VAL A 1  397 ? 20.781 187.406 12.195  1.00 130.21 ? 470  VAL A CB  1 
ATOM   3085 C  CG1 . VAL A 1  397 ? 21.624 187.862 13.374  1.00 142.86 ? 470  VAL A CG1 1 
ATOM   3086 C  CG2 . VAL A 1  397 ? 21.105 188.234 10.961  1.00 130.53 ? 470  VAL A CG2 1 
ATOM   3087 N  N   . ILE A 1  398 ? 19.868 184.864 13.791  1.00 150.53 ? 471  ILE A N   1 
ATOM   3088 C  CA  . ILE A 1  398 ? 19.777 184.123 15.047  1.00 152.55 ? 471  ILE A CA  1 
ATOM   3089 C  C   . ILE A 1  398 ? 20.312 182.700 14.883  1.00 160.10 ? 471  ILE A C   1 
ATOM   3090 O  O   . ILE A 1  398 ? 21.077 182.209 15.722  1.00 185.22 ? 471  ILE A O   1 
ATOM   3091 C  CB  . ILE A 1  398 ? 18.330 184.108 15.573  1.00 147.49 ? 471  ILE A CB  1 
ATOM   3092 C  CG1 . ILE A 1  398 ? 17.903 185.515 15.996  1.00 164.68 ? 471  ILE A CG1 1 
ATOM   3093 C  CG2 . ILE A 1  398 ? 18.188 183.134 16.731  1.00 144.64 ? 471  ILE A CG2 1 
ATOM   3094 C  CD1 . ILE A 1  398 ? 16.560 185.562 16.690  1.00 188.39 ? 471  ILE A CD1 1 
ATOM   3095 N  N   . THR A 1  399 ? 19.910 182.048 13.796  1.00 143.84 ? 472  THR A N   1 
ATOM   3096 C  CA  . THR A 1  399 ? 20.362 180.695 13.494  1.00 146.26 ? 472  THR A CA  1 
ATOM   3097 C  C   . THR A 1  399 ? 21.880 180.655 13.345  1.00 148.48 ? 472  THR A C   1 
ATOM   3098 O  O   . THR A 1  399 ? 22.536 179.723 13.814  1.00 165.04 ? 472  THR A O   1 
ATOM   3099 C  CB  . THR A 1  399 ? 19.707 180.157 12.207  1.00 128.20 ? 472  THR A CB  1 
ATOM   3100 O  OG1 . THR A 1  399 ? 18.281 180.243 12.323  1.00 143.63 ? 472  THR A OG1 1 
ATOM   3101 C  CG2 . THR A 1  399 ? 20.105 178.708 11.970  1.00 130.45 ? 472  THR A CG2 1 
ATOM   3102 N  N   . CYS A 1  400 ? 22.431 181.676 12.696  1.00 146.35 ? 473  CYS A N   1 
ATOM   3103 C  CA  . CYS A 1  400 ? 23.876 181.794 12.541  1.00 132.88 ? 473  CYS A CA  1 
ATOM   3104 C  C   . CYS A 1  400 ? 24.551 182.013 13.890  1.00 139.42 ? 473  CYS A C   1 
ATOM   3105 O  O   . CYS A 1  400 ? 25.686 181.584 14.101  1.00 150.77 ? 473  CYS A O   1 
ATOM   3106 C  CB  . CYS A 1  400 ? 24.228 182.938 11.586  1.00 131.85 ? 473  CYS A CB  1 
ATOM   3107 S  SG  . CYS A 1  400 ? 23.792 182.636 9.858   1.00 157.56 ? 473  CYS A SG  1 
ATOM   3108 N  N   . PHE A 1  401 ? 23.851 182.683 14.801  1.00 127.08 ? 474  PHE A N   1 
ATOM   3109 C  CA  . PHE A 1  401 ? 24.386 182.920 16.136  1.00 119.45 ? 474  PHE A CA  1 
ATOM   3110 C  C   . PHE A 1  401 ? 24.461 181.625 16.931  1.00 136.89 ? 474  PHE A C   1 
ATOM   3111 O  O   . PHE A 1  401 ? 25.470 181.345 17.580  1.00 150.68 ? 474  PHE A O   1 
ATOM   3112 C  CB  . PHE A 1  401 ? 23.544 183.947 16.893  1.00 119.20 ? 474  PHE A CB  1 
ATOM   3113 C  CG  . PHE A 1  401 ? 23.899 184.055 18.348  1.00 119.15 ? 474  PHE A CG  1 
ATOM   3114 C  CD1 . PHE A 1  401 ? 25.111 184.597 18.738  1.00 138.58 ? 474  PHE A CD1 1 
ATOM   3115 C  CD2 . PHE A 1  401 ? 23.025 183.608 19.324  1.00 121.57 ? 474  PHE A CD2 1 
ATOM   3116 C  CE1 . PHE A 1  401 ? 25.446 184.692 20.072  1.00 131.71 ? 474  PHE A CE1 1 
ATOM   3117 C  CE2 . PHE A 1  401 ? 23.353 183.704 20.663  1.00 141.38 ? 474  PHE A CE2 1 
ATOM   3118 C  CZ  . PHE A 1  401 ? 24.565 184.247 21.037  1.00 133.78 ? 474  PHE A CZ  1 
ATOM   3119 N  N   . PHE A 1  402 ? 23.391 180.838 16.884  1.00 138.35 ? 475  PHE A N   1 
ATOM   3120 C  CA  . PHE A 1  402 ? 23.386 179.548 17.563  1.00 135.46 ? 475  PHE A CA  1 
ATOM   3121 C  C   . PHE A 1  402 ? 24.356 178.582 16.890  1.00 130.07 ? 475  PHE A C   1 
ATOM   3122 O  O   . PHE A 1  402 ? 24.851 177.645 17.518  1.00 139.14 ? 475  PHE A O   1 
ATOM   3123 C  CB  . PHE A 1  402 ? 21.977 178.954 17.593  1.00 137.89 ? 475  PHE A CB  1 
ATOM   3124 C  CG  . PHE A 1  402 ? 21.097 179.542 18.658  1.00 161.61 ? 475  PHE A CG  1 
ATOM   3125 C  CD1 . PHE A 1  402 ? 21.291 179.214 19.990  1.00 155.94 ? 475  PHE A CD1 1 
ATOM   3126 C  CD2 . PHE A 1  402 ? 20.076 180.418 18.331  1.00 181.83 ? 475  PHE A CD2 1 
ATOM   3127 C  CE1 . PHE A 1  402 ? 20.485 179.751 20.976  1.00 189.71 ? 475  PHE A CE1 1 
ATOM   3128 C  CE2 . PHE A 1  402 ? 19.266 180.957 19.314  1.00 182.16 ? 475  PHE A CE2 1 
ATOM   3129 C  CZ  . PHE A 1  402 ? 19.471 180.623 20.637  1.00 187.81 ? 475  PHE A CZ  1 
ATOM   3130 N  N   . GLY A 1  403 ? 24.629 178.820 15.611  1.00 126.15 ? 476  GLY A N   1 
ATOM   3131 C  CA  . GLY A 1  403 ? 25.573 178.005 14.870  1.00 133.25 ? 476  GLY A CA  1 
ATOM   3132 C  C   . GLY A 1  403 ? 27.016 178.399 15.114  1.00 123.83 ? 476  GLY A C   1 
ATOM   3133 O  O   . GLY A 1  403 ? 27.939 177.676 14.740  1.00 127.86 ? 476  GLY A O   1 
ATOM   3134 N  N   . SER A 1  404 ? 27.211 179.552 15.747  1.00 119.35 ? 477  SER A N   1 
ATOM   3135 C  CA  . SER A 1  404 ? 28.551 180.052 16.032  1.00 99.66  ? 477  SER A CA  1 
ATOM   3136 C  C   . SER A 1  404 ? 28.953 179.783 17.478  1.00 117.37 ? 477  SER A C   1 
ATOM   3137 O  O   . SER A 1  404 ? 30.071 180.095 17.886  1.00 117.12 ? 477  SER A O   1 
ATOM   3138 C  CB  . SER A 1  404 ? 28.641 181.550 15.739  1.00 124.55 ? 477  SER A CB  1 
ATOM   3139 O  OG  . SER A 1  404 ? 28.403 181.818 14.368  1.00 161.94 ? 477  SER A OG  1 
ATOM   3140 N  N   . LEU A 1  405 ? 28.038 179.204 18.250  1.00 145.28 ? 478  LEU A N   1 
ATOM   3141 C  CA  . LEU A 1  405 ? 28.307 178.890 19.649  1.00 141.28 ? 478  LEU A CA  1 
ATOM   3142 C  C   . LEU A 1  405 ? 29.382 177.816 19.774  1.00 126.87 ? 478  LEU A C   1 
ATOM   3143 O  O   . LEU A 1  405 ? 30.067 177.723 20.793  1.00 109.65 ? 478  LEU A O   1 
ATOM   3144 C  CB  . LEU A 1  405 ? 27.027 178.439 20.355  1.00 124.09 ? 478  LEU A CB  1 
ATOM   3145 C  CG  . LEU A 1  405 ? 25.919 179.487 20.474  1.00 130.45 ? 478  LEU A CG  1 
ATOM   3146 C  CD1 . LEU A 1  405 ? 24.721 178.918 21.217  1.00 162.00 ? 478  LEU A CD1 1 
ATOM   3147 C  CD2 . LEU A 1  405 ? 26.437 180.739 21.164  1.00 135.12 ? 478  LEU A CD2 1 
ATOM   3148 N  N   . VAL A 1  406 ? 29.522 177.006 18.730  1.00 130.03 ? 479  VAL A N   1 
ATOM   3149 C  CA  . VAL A 1  406 ? 30.553 175.977 18.685  1.00 128.19 ? 479  VAL A CA  1 
ATOM   3150 C  C   . VAL A 1  406 ? 31.918 176.639 18.538  1.00 131.75 ? 479  VAL A C   1 
ATOM   3151 O  O   . VAL A 1  406 ? 32.931 176.122 19.009  1.00 101.71 ? 479  VAL A O   1 
ATOM   3152 C  CB  . VAL A 1  406 ? 30.294 174.982 17.538  1.00 99.00  ? 479  VAL A CB  1 
ATOM   3153 C  CG1 . VAL A 1  406 ? 31.294 173.835 17.582  1.00 94.80  ? 479  VAL A CG1 1 
ATOM   3154 C  CG2 . VAL A 1  406 ? 28.869 174.457 17.604  1.00 142.36 ? 479  VAL A CG2 1 
ATOM   3155 N  N   . THR A 1  407 ? 31.928 177.797 17.888  1.00 130.90 ? 480  THR A N   1 
ATOM   3156 C  CA  . THR A 1  407 ? 33.159 178.530 17.630  1.00 116.45 ? 480  THR A CA  1 
ATOM   3157 C  C   . THR A 1  407 ? 33.519 179.438 18.805  1.00 122.21 ? 480  THR A C   1 
ATOM   3158 O  O   . THR A 1  407 ? 34.690 179.743 19.034  1.00 137.37 ? 480  THR A O   1 
ATOM   3159 C  CB  . THR A 1  407 ? 33.040 179.374 16.350  1.00 126.53 ? 480  THR A CB  1 
ATOM   3160 O  OG1 . THR A 1  407 ? 32.451 178.583 15.311  1.00 173.96 ? 480  THR A OG1 1 
ATOM   3161 C  CG2 . THR A 1  407 ? 34.404 179.846 15.896  1.00 131.81 ? 480  THR A CG2 1 
ATOM   3162 N  N   . LEU A 1  408 ? 32.505 179.860 19.553  1.00 114.31 ? 481  LEU A N   1 
ATOM   3163 C  CA  . LEU A 1  408 ? 32.707 180.763 20.682  1.00 105.57 ? 481  LEU A CA  1 
ATOM   3164 C  C   . LEU A 1  408 ? 33.284 180.044 21.900  1.00 97.95  ? 481  LEU A C   1 
ATOM   3165 O  O   . LEU A 1  408 ? 33.529 180.664 22.935  1.00 115.27 ? 481  LEU A O   1 
ATOM   3166 C  CB  . LEU A 1  408 ? 31.389 181.447 21.056  1.00 133.05 ? 481  LEU A CB  1 
ATOM   3167 C  CG  . LEU A 1  408 ? 30.812 182.413 20.020  1.00 124.63 ? 481  LEU A CG  1 
ATOM   3168 C  CD1 . LEU A 1  408 ? 29.421 182.868 20.429  1.00 140.58 ? 481  LEU A CD1 1 
ATOM   3169 C  CD2 . LEU A 1  408 ? 31.735 183.606 19.829  1.00 104.37 ? 481  LEU A CD2 1 
ATOM   3170 N  N   . THR A 1  409 ? 33.503 178.739 21.774  1.00 93.46  ? 482  THR A N   1 
ATOM   3171 C  CA  . THR A 1  409 ? 34.066 177.950 22.864  1.00 106.90 ? 482  THR A CA  1 
ATOM   3172 C  C   . THR A 1  409 ? 35.537 178.291 23.086  1.00 116.93 ? 482  THR A C   1 
ATOM   3173 O  O   . THR A 1  409 ? 36.121 179.072 22.335  1.00 104.79 ? 482  THR A O   1 
ATOM   3174 C  CB  . THR A 1  409 ? 33.931 176.438 22.597  1.00 114.99 ? 482  THR A CB  1 
ATOM   3175 O  OG1 . THR A 1  409 ? 34.588 176.105 21.368  1.00 98.36  ? 482  THR A OG1 1 
ATOM   3176 C  CG2 . THR A 1  409 ? 32.466 176.041 22.507  1.00 151.39 ? 482  THR A CG2 1 
ATOM   3177 N  N   . PHE A 1  410 ? 36.130 177.705 24.121  1.00 130.85 ? 483  PHE A N   1 
ATOM   3178 C  CA  . PHE A 1  410 ? 37.535 177.944 24.429  1.00 115.81 ? 483  PHE A CA  1 
ATOM   3179 C  C   . PHE A 1  410 ? 38.423 177.397 23.319  1.00 126.19 ? 483  PHE A C   1 
ATOM   3180 O  O   . PHE A 1  410 ? 39.386 178.043 22.904  1.00 149.26 ? 483  PHE A O   1 
ATOM   3181 C  CB  . PHE A 1  410 ? 37.911 177.314 25.771  1.00 120.13 ? 483  PHE A CB  1 
ATOM   3182 C  CG  . PHE A 1  410 ? 37.088 177.813 26.924  1.00 127.99 ? 483  PHE A CG  1 
ATOM   3183 C  CD1 . PHE A 1  410 ? 37.210 179.121 27.362  1.00 131.84 ? 483  PHE A CD1 1 
ATOM   3184 C  CD2 . PHE A 1  410 ? 36.196 176.976 27.571  1.00 130.64 ? 483  PHE A CD2 1 
ATOM   3185 C  CE1 . PHE A 1  410 ? 36.454 179.585 28.421  1.00 134.92 ? 483  PHE A CE1 1 
ATOM   3186 C  CE2 . PHE A 1  410 ? 35.439 177.434 28.633  1.00 133.67 ? 483  PHE A CE2 1 
ATOM   3187 C  CZ  . PHE A 1  410 ? 35.568 178.740 29.058  1.00 139.42 ? 483  PHE A CZ  1 
ATOM   3188 N  N   . GLY A 1  411 ? 38.091 176.204 22.840  1.00 110.04 ? 484  GLY A N   1 
ATOM   3189 C  CA  . GLY A 1  411 ? 38.791 175.616 21.714  1.00 116.85 ? 484  GLY A CA  1 
ATOM   3190 C  C   . GLY A 1  411 ? 37.999 175.921 20.459  1.00 106.18 ? 484  GLY A C   1 
ATOM   3191 O  O   . GLY A 1  411 ? 37.395 175.032 19.860  1.00 89.28  ? 484  GLY A O   1 
ATOM   3192 N  N   . GLY A 1  412 ? 38.005 177.189 20.061  1.00 118.40 ? 485  GLY A N   1 
ATOM   3193 C  CA  . GLY A 1  412 ? 37.213 177.639 18.932  1.00 132.17 ? 485  GLY A CA  1 
ATOM   3194 C  C   . GLY A 1  412 ? 38.044 177.819 17.678  1.00 128.27 ? 485  GLY A C   1 
ATOM   3195 O  O   . GLY A 1  412 ? 37.590 177.497 16.581  1.00 154.86 ? 485  GLY A O   1 
ATOM   3196 N  N   . ALA A 1  413 ? 39.259 178.335 17.838  1.00 96.50  ? 486  ALA A N   1 
ATOM   3197 C  CA  . ALA A 1  413 ? 40.146 178.591 16.705  1.00 91.51  ? 486  ALA A CA  1 
ATOM   3198 C  C   . ALA A 1  413 ? 40.460 177.301 15.949  1.00 116.82 ? 486  ALA A C   1 
ATOM   3199 O  O   . ALA A 1  413 ? 40.643 177.308 14.727  1.00 151.05 ? 486  ALA A O   1 
ATOM   3200 C  CB  . ALA A 1  413 ? 41.428 179.258 17.176  1.00 104.21 ? 486  ALA A CB  1 
ATOM   3201 N  N   . TYR A 1  414 ? 40.514 176.197 16.688  1.00 93.23  ? 487  TYR A N   1 
ATOM   3202 C  CA  . TYR A 1  414 ? 40.713 174.881 16.098  1.00 96.18  ? 487  TYR A CA  1 
ATOM   3203 C  C   . TYR A 1  414 ? 39.600 174.575 15.102  1.00 112.21 ? 487  TYR A C   1 
ATOM   3204 O  O   . TYR A 1  414 ? 39.849 174.085 13.998  1.00 129.52 ? 487  TYR A O   1 
ATOM   3205 C  CB  . TYR A 1  414 ? 40.760 173.806 17.185  1.00 118.28 ? 487  TYR A CB  1 
ATOM   3206 C  CG  . TYR A 1  414 ? 41.890 173.972 18.177  1.00 128.45 ? 487  TYR A CG  1 
ATOM   3207 C  CD1 . TYR A 1  414 ? 43.113 174.500 17.786  1.00 100.09 ? 487  TYR A CD1 1 
ATOM   3208 C  CD2 . TYR A 1  414 ? 41.731 173.602 19.506  1.00 134.18 ? 487  TYR A CD2 1 
ATOM   3209 C  CE1 . TYR A 1  414 ? 44.148 174.651 18.690  1.00 90.28  ? 487  TYR A CE1 1 
ATOM   3210 C  CE2 . TYR A 1  414 ? 42.759 173.751 20.418  1.00 113.81 ? 487  TYR A CE2 1 
ATOM   3211 C  CZ  . TYR A 1  414 ? 43.965 174.274 20.005  1.00 91.69  ? 487  TYR A CZ  1 
ATOM   3212 O  OH  . TYR A 1  414 ? 44.990 174.424 20.911  1.00 109.32 ? 487  TYR A OH  1 
ATOM   3213 N  N   . VAL A 1  415 ? 38.372 174.884 15.503  1.00 106.17 ? 488  VAL A N   1 
ATOM   3214 C  CA  . VAL A 1  415 ? 37.202 174.654 14.667  1.00 83.92  ? 488  VAL A CA  1 
ATOM   3215 C  C   . VAL A 1  415 ? 37.191 175.633 13.494  1.00 91.41  ? 488  VAL A C   1 
ATOM   3216 O  O   . VAL A 1  415 ? 36.664 175.325 12.425  1.00 138.03 ? 488  VAL A O   1 
ATOM   3217 C  CB  . VAL A 1  415 ? 35.907 174.762 15.494  1.00 97.84  ? 488  VAL A CB  1 
ATOM   3218 C  CG1 . VAL A 1  415 ? 34.715 174.259 14.695  1.00 115.80 ? 488  VAL A CG1 1 
ATOM   3219 C  CG2 . VAL A 1  415 ? 36.046 173.987 16.796  1.00 99.82  ? 488  VAL A CG2 1 
ATOM   3220 N  N   . VAL A 1  416 ? 37.776 176.811 13.697  1.00 83.94  ? 489  VAL A N   1 
ATOM   3221 C  CA  . VAL A 1  416 ? 37.891 177.799 12.629  1.00 81.80  ? 489  VAL A CA  1 
ATOM   3222 C  C   . VAL A 1  416 ? 38.795 177.261 11.529  1.00 79.06  ? 489  VAL A C   1 
ATOM   3223 O  O   . VAL A 1  416 ? 38.443 177.295 10.349  1.00 89.01  ? 489  VAL A O   1 
ATOM   3224 C  CB  . VAL A 1  416 ? 38.422 179.145 13.150  1.00 90.38  ? 489  VAL A CB  1 
ATOM   3225 C  CG1 . VAL A 1  416 ? 38.555 180.140 12.007  1.00 82.49  ? 489  VAL A CG1 1 
ATOM   3226 C  CG2 . VAL A 1  416 ? 37.513 179.694 14.227  1.00 83.83  ? 489  VAL A CG2 1 
ATOM   3227 N  N   . LYS A 1  417 ? 39.966 176.771 11.925  1.00 82.60  ? 490  LYS A N   1 
ATOM   3228 C  CA  . LYS A 1  417 ? 40.896 176.160 10.981  1.00 84.31  ? 490  LYS A CA  1 
ATOM   3229 C  C   . LYS A 1  417 ? 40.265 174.957 10.284  1.00 86.56  ? 490  LYS A C   1 
ATOM   3230 O  O   . LYS A 1  417 ? 40.277 174.862 9.053   1.00 111.32 ? 490  LYS A O   1 
ATOM   3231 C  CB  . LYS A 1  417 ? 42.181 175.737 11.696  1.00 90.43  ? 490  LYS A CB  1 
ATOM   3232 C  CG  . LYS A 1  417 ? 43.335 176.718 11.570  1.00 117.06 ? 490  LYS A CG  1 
ATOM   3233 C  CD  . LYS A 1  417 ? 44.044 176.560 10.235  1.00 139.81 ? 490  LYS A CD  1 
ATOM   3234 C  CE  . LYS A 1  417 ? 45.320 177.385 10.182  1.00 157.07 ? 490  LYS A CE  1 
ATOM   3235 N  NZ  . LYS A 1  417 ? 46.075 177.156 8.918   1.00 174.68 ? 490  LYS A NZ  1 
ATOM   3236 N  N   . LEU A 1  418 ? 39.709 174.050 11.082  1.00 96.99  ? 491  LEU A N   1 
ATOM   3237 C  CA  . LEU A 1  418 ? 39.137 172.806 10.571  1.00 75.76  ? 491  LEU A CA  1 
ATOM   3238 C  C   . LEU A 1  418 ? 38.014 173.051 9.566   1.00 79.69  ? 491  LEU A C   1 
ATOM   3239 O  O   . LEU A 1  418 ? 37.999 172.463 8.486   1.00 131.03 ? 491  LEU A O   1 
ATOM   3240 C  CB  . LEU A 1  418 ? 38.617 171.953 11.729  1.00 76.09  ? 491  LEU A CB  1 
ATOM   3241 C  CG  . LEU A 1  418 ? 38.007 170.597 11.370  1.00 106.65 ? 491  LEU A CG  1 
ATOM   3242 C  CD1 . LEU A 1  418 ? 39.035 169.704 10.698  1.00 103.09 ? 491  LEU A CD1 1 
ATOM   3243 C  CD2 . LEU A 1  418 ? 37.445 169.929 12.611  1.00 146.42 ? 491  LEU A CD2 1 
ATOM   3244 N  N   . LEU A 1  419 ? 37.079 173.922 9.929   1.00 93.97  ? 492  LEU A N   1 
ATOM   3245 C  CA  . LEU A 1  419 ? 35.943 174.234 9.069   1.00 118.06 ? 492  LEU A CA  1 
ATOM   3246 C  C   . LEU A 1  419 ? 36.363 175.042 7.846   1.00 139.10 ? 492  LEU A C   1 
ATOM   3247 O  O   . LEU A 1  419 ? 35.820 174.862 6.756   1.00 167.52 ? 492  LEU A O   1 
ATOM   3248 C  CB  . LEU A 1  419 ? 34.874 175.000 9.853   1.00 97.53  ? 492  LEU A CB  1 
ATOM   3249 C  CG  . LEU A 1  419 ? 33.709 174.194 10.431  1.00 95.61  ? 492  LEU A CG  1 
ATOM   3250 C  CD1 . LEU A 1  419 ? 34.202 173.022 11.266  1.00 117.21 ? 492  LEU A CD1 1 
ATOM   3251 C  CD2 . LEU A 1  419 ? 32.802 175.096 11.255  1.00 98.47  ? 492  LEU A CD2 1 
ATOM   3252 N  N   . GLU A 1  420 ? 37.333 175.930 8.033   1.00 137.75 ? 493  GLU A N   1 
ATOM   3253 C  CA  . GLU A 1  420 ? 37.749 176.835 6.970   1.00 139.68 ? 493  GLU A CA  1 
ATOM   3254 C  C   . GLU A 1  420 ? 38.596 176.131 5.912   1.00 133.29 ? 493  GLU A C   1 
ATOM   3255 O  O   . GLU A 1  420 ? 38.609 176.537 4.750   1.00 137.94 ? 493  GLU A O   1 
ATOM   3256 C  CB  . GLU A 1  420 ? 38.526 178.019 7.555   1.00 164.07 ? 493  GLU A CB  1 
ATOM   3257 C  CG  . GLU A 1  420 ? 38.832 179.121 6.552   1.00 169.46 ? 493  GLU A CG  1 
ATOM   3258 C  CD  . GLU A 1  420 ? 39.629 180.260 7.156   1.00 192.63 ? 493  GLU A CD  1 
ATOM   3259 O  OE1 . GLU A 1  420 ? 39.811 181.288 6.471   1.00 203.60 ? 493  GLU A OE1 1 
ATOM   3260 O  OE2 . GLU A 1  420 ? 40.076 180.127 8.315   1.00 194.64 ? 493  GLU A OE2 1 
ATOM   3261 N  N   . GLU A 1  421 ? 39.295 175.072 6.307   1.00 106.00 ? 494  GLU A N   1 
ATOM   3262 C  CA  . GLU A 1  421 ? 40.250 174.442 5.400   1.00 92.73  ? 494  GLU A CA  1 
ATOM   3263 C  C   . GLU A 1  421 ? 39.850 173.032 4.964   1.00 88.69  ? 494  GLU A C   1 
ATOM   3264 O  O   . GLU A 1  421 ? 40.159 172.615 3.849   1.00 108.02 ? 494  GLU A O   1 
ATOM   3265 C  CB  . GLU A 1  421 ? 41.635 174.411 6.048   1.00 118.53 ? 494  GLU A CB  1 
ATOM   3266 C  CG  . GLU A 1  421 ? 42.760 174.050 5.094   1.00 137.96 ? 494  GLU A CG  1 
ATOM   3267 C  CD  . GLU A 1  421 ? 44.110 174.527 5.588   1.00 155.62 ? 494  GLU A CD  1 
ATOM   3268 O  OE1 . GLU A 1  421 ? 44.142 175.426 6.455   1.00 153.60 ? 494  GLU A OE1 1 
ATOM   3269 O  OE2 . GLU A 1  421 ? 45.139 174.005 5.114   1.00 164.56 ? 494  GLU A OE2 1 
ATOM   3270 N  N   . TYR A 1  422 ? 39.162 172.300 5.835   1.00 80.06  ? 495  TYR A N   1 
ATOM   3271 C  CA  . TYR A 1  422 ? 38.801 170.917 5.534   1.00 83.83  ? 495  TYR A CA  1 
ATOM   3272 C  C   . TYR A 1  422 ? 37.342 170.752 5.112   1.00 111.94 ? 495  TYR A C   1 
ATOM   3273 O  O   . TYR A 1  422 ? 36.969 169.720 4.554   1.00 121.85 ? 495  TYR A O   1 
ATOM   3274 C  CB  . TYR A 1  422 ? 39.082 170.017 6.741   1.00 92.81  ? 495  TYR A CB  1 
ATOM   3275 C  CG  . TYR A 1  422 ? 40.503 169.504 6.820   1.00 88.97  ? 495  TYR A CG  1 
ATOM   3276 C  CD1 . TYR A 1  422 ? 41.434 169.824 5.842   1.00 91.18  ? 495  TYR A CD1 1 
ATOM   3277 C  CD2 . TYR A 1  422 ? 40.907 168.685 7.867   1.00 119.37 ? 495  TYR A CD2 1 
ATOM   3278 C  CE1 . TYR A 1  422 ? 42.732 169.351 5.911   1.00 95.58  ? 495  TYR A CE1 1 
ATOM   3279 C  CE2 . TYR A 1  422 ? 42.200 168.207 7.943   1.00 125.70 ? 495  TYR A CE2 1 
ATOM   3280 C  CZ  . TYR A 1  422 ? 43.109 168.543 6.963   1.00 98.47  ? 495  TYR A CZ  1 
ATOM   3281 O  OH  . TYR A 1  422 ? 44.398 168.068 7.038   1.00 96.38  ? 495  TYR A OH  1 
ATOM   3282 N  N   . ALA A 1  423 ? 36.519 171.762 5.373   1.00 97.53  ? 496  ALA A N   1 
ATOM   3283 C  CA  . ALA A 1  423 ? 35.088 171.648 5.111   1.00 99.77  ? 496  ALA A CA  1 
ATOM   3284 C  C   . ALA A 1  423 ? 34.607 172.587 4.008   1.00 123.13 ? 496  ALA A C   1 
ATOM   3285 O  O   . ALA A 1  423 ? 34.295 172.147 2.901   1.00 137.04 ? 496  ALA A O   1 
ATOM   3286 C  CB  . ALA A 1  423 ? 34.304 171.901 6.389   1.00 98.93  ? 496  ALA A CB  1 
ATOM   3287 N  N   . THR A 1  424 ? 34.549 173.878 4.319   1.00 98.77  ? 497  THR A N   1 
ATOM   3288 C  CA  . THR A 1  424 ? 33.952 174.869 3.426   1.00 104.16 ? 497  THR A CA  1 
ATOM   3289 C  C   . THR A 1  424 ? 34.676 174.999 2.085   1.00 129.49 ? 497  THR A C   1 
ATOM   3290 O  O   . THR A 1  424 ? 34.037 175.056 1.033   1.00 152.07 ? 497  THR A O   1 
ATOM   3291 C  CB  . THR A 1  424 ? 33.907 176.258 4.094   1.00 102.98 ? 497  THR A CB  1 
ATOM   3292 O  OG1 . THR A 1  424 ? 35.233 176.655 4.465   1.00 117.68 ? 497  THR A OG1 1 
ATOM   3293 C  CG2 . THR A 1  424 ? 33.029 176.223 5.335   1.00 93.73  ? 497  THR A CG2 1 
ATOM   3294 N  N   . GLY A 1  425 ? 36.010 174.984 2.110   1.00 80.74  ? 498  GLY A N   1 
ATOM   3295 C  CA  . GLY A 1  425 ? 36.819 175.255 0.924   1.00 80.71  ? 498  GLY A CA  1 
ATOM   3296 C  C   . GLY A 1  425 ? 36.775 174.356 -0.308  1.00 105.70 ? 498  GLY A C   1 
ATOM   3297 O  O   . GLY A 1  425 ? 36.687 174.859 -1.425  1.00 127.36 ? 498  GLY A O   1 
ATOM   3298 N  N   . PRO A 1  426 ? 36.816 173.042 -0.122  1.00 112.09 ? 499  PRO A N   1 
ATOM   3299 C  CA  . PRO A 1  426 ? 36.600 172.084 -1.212  1.00 128.19 ? 499  PRO A CA  1 
ATOM   3300 C  C   . PRO A 1  426 ? 35.139 171.984 -1.642  1.00 137.75 ? 499  PRO A C   1 
ATOM   3301 O  O   . PRO A 1  426 ? 34.858 171.572 -2.767  1.00 161.74 ? 499  PRO A O   1 
ATOM   3302 C  CB  . PRO A 1  426 ? 37.080 170.756 -0.613  1.00 116.19 ? 499  PRO A CB  1 
ATOM   3303 C  CG  . PRO A 1  426 ? 36.997 170.951 0.861   1.00 114.26 ? 499  PRO A CG  1 
ATOM   3304 C  CD  . PRO A 1  426 ? 37.354 172.386 1.081   1.00 107.02 ? 499  PRO A CD  1 
ATOM   3305 N  N   . ALA A 1  427 ? 34.226 172.359 -0.754  1.00 102.23 ? 500  ALA A N   1 
ATOM   3306 C  CA  . ALA A 1  427 ? 32.803 172.311 -1.060  1.00 109.79 ? 500  ALA A CA  1 
ATOM   3307 C  C   . ALA A 1  427 ? 32.393 173.492 -1.934  1.00 119.00 ? 500  ALA A C   1 
ATOM   3308 O  O   . ALA A 1  427 ? 31.606 173.340 -2.867  1.00 153.36 ? 500  ALA A O   1 
ATOM   3309 C  CB  . ALA A 1  427 ? 31.989 172.288 0.218   1.00 98.14  ? 500  ALA A CB  1 
ATOM   3310 N  N   . VAL A 1  428 ? 32.932 174.668 -1.626  1.00 94.97  ? 501  VAL A N   1 
ATOM   3311 C  CA  . VAL A 1  428 ? 32.660 175.863 -2.416  1.00 105.88 ? 501  VAL A CA  1 
ATOM   3312 C  C   . VAL A 1  428 ? 33.342 175.742 -3.772  1.00 105.67 ? 501  VAL A C   1 
ATOM   3313 O  O   . VAL A 1  428 ? 32.776 176.118 -4.800  1.00 117.80 ? 501  VAL A O   1 
ATOM   3314 C  CB  . VAL A 1  428 ? 33.110 177.138 -1.680  1.00 87.43  ? 501  VAL A CB  1 
ATOM   3315 C  CG1 . VAL A 1  428 ? 33.041 178.345 -2.604  1.00 89.16  ? 501  VAL A CG1 1 
ATOM   3316 C  CG2 . VAL A 1  428 ? 32.247 177.366 -0.454  1.00 88.20  ? 501  VAL A CG2 1 
ATOM   3317 N  N   . LEU A 1  429 ? 34.559 175.209 -3.773  1.00 109.30 ? 502  LEU A N   1 
ATOM   3318 C  CA  . LEU A 1  429 ? 35.259 174.938 -5.023  1.00 116.42 ? 502  LEU A CA  1 
ATOM   3319 C  C   . LEU A 1  429 ? 34.502 173.903 -5.853  1.00 112.08 ? 502  LEU A C   1 
ATOM   3320 O  O   . LEU A 1  429 ? 34.418 174.014 -7.078  1.00 94.63  ? 502  LEU A O   1 
ATOM   3321 C  CB  . LEU A 1  429 ? 36.683 174.458 -4.746  1.00 83.81  ? 502  LEU A CB  1 
ATOM   3322 C  CG  . LEU A 1  429 ? 37.761 175.534 -4.645  1.00 88.53  ? 502  LEU A CG  1 
ATOM   3323 C  CD1 . LEU A 1  429 ? 38.910 175.038 -3.800  1.00 101.90 ? 502  LEU A CD1 1 
ATOM   3324 C  CD2 . LEU A 1  429 ? 38.251 175.912 -6.031  1.00 119.43 ? 502  LEU A CD2 1 
ATOM   3325 N  N   . THR A 1  430 ? 33.945 172.906 -5.173  1.00 99.56  ? 503  THR A N   1 
ATOM   3326 C  CA  . THR A 1  430 ? 33.195 171.845 -5.836  1.00 90.40  ? 503  THR A CA  1 
ATOM   3327 C  C   . THR A 1  430 ? 31.926 172.385 -6.490  1.00 104.11 ? 503  THR A C   1 
ATOM   3328 O  O   . THR A 1  430 ? 31.697 172.172 -7.679  1.00 114.37 ? 503  THR A O   1 
ATOM   3329 C  CB  . THR A 1  430 ? 32.812 170.722 -4.852  1.00 110.32 ? 503  THR A CB  1 
ATOM   3330 O  OG1 . THR A 1  430 ? 33.999 170.120 -4.321  1.00 109.11 ? 503  THR A OG1 1 
ATOM   3331 C  CG2 . THR A 1  430 ? 31.979 169.659 -5.556  1.00 128.11 ? 503  THR A CG2 1 
ATOM   3332 N  N   . VAL A 1  431 ? 31.108 173.088 -5.711  1.00 103.35 ? 504  VAL A N   1 
ATOM   3333 C  CA  . VAL A 1  431 ? 29.852 173.626 -6.220  1.00 101.69 ? 504  VAL A CA  1 
ATOM   3334 C  C   . VAL A 1  431 ? 30.133 174.674 -7.295  1.00 93.80  ? 504  VAL A C   1 
ATOM   3335 O  O   . VAL A 1  431 ? 29.356 174.836 -8.236  1.00 106.27 ? 504  VAL A O   1 
ATOM   3336 C  CB  . VAL A 1  431 ? 28.980 174.204 -5.078  1.00 93.58  ? 504  VAL A CB  1 
ATOM   3337 C  CG1 . VAL A 1  431 ? 29.618 175.444 -4.468  1.00 92.89  ? 504  VAL A CG1 1 
ATOM   3338 C  CG2 . VAL A 1  431 ? 27.579 174.509 -5.578  1.00 159.65 ? 504  VAL A CG2 1 
ATOM   3339 N  N   . ALA A 1  432 ? 31.260 175.369 -7.162  1.00 92.48  ? 505  ALA A N   1 
ATOM   3340 C  CA  . ALA A 1  432 ? 31.678 176.340 -8.163  1.00 93.48  ? 505  ALA A CA  1 
ATOM   3341 C  C   . ALA A 1  432 ? 32.064 175.619 -9.448  1.00 93.74  ? 505  ALA A C   1 
ATOM   3342 O  O   . ALA A 1  432 ? 31.894 176.149 -10.546 1.00 95.48  ? 505  ALA A O   1 
ATOM   3343 C  CB  . ALA A 1  432 ? 32.836 177.177 -7.649  1.00 119.96 ? 505  ALA A CB  1 
ATOM   3344 N  N   . LEU A 1  433 ? 32.584 174.404 -9.302  1.00 113.89 ? 506  LEU A N   1 
ATOM   3345 C  CA  . LEU A 1  433 ? 32.929 173.578 -10.451 1.00 110.15 ? 506  LEU A CA  1 
ATOM   3346 C  C   . LEU A 1  433 ? 31.655 173.096 -11.137 1.00 110.33 ? 506  LEU A C   1 
ATOM   3347 O  O   . LEU A 1  433 ? 31.576 173.068 -12.367 1.00 96.42  ? 506  LEU A O   1 
ATOM   3348 C  CB  . LEU A 1  433 ? 33.803 172.392 -10.022 1.00 95.71  ? 506  LEU A CB  1 
ATOM   3349 C  CG  . LEU A 1  433 ? 34.492 171.533 -11.088 1.00 91.30  ? 506  LEU A CG  1 
ATOM   3350 C  CD1 . LEU A 1  433 ? 33.588 170.412 -11.589 1.00 92.73  ? 506  LEU A CD1 1 
ATOM   3351 C  CD2 . LEU A 1  433 ? 34.973 172.398 -12.245 1.00 96.70  ? 506  LEU A CD2 1 
ATOM   3352 N  N   . ILE A 1  434 ? 30.658 172.724 -10.338 1.00 119.73 ? 507  ILE A N   1 
ATOM   3353 C  CA  . ILE A 1  434 ? 29.383 172.264 -10.876 1.00 126.64 ? 507  ILE A CA  1 
ATOM   3354 C  C   . ILE A 1  434 ? 28.693 173.403 -11.617 1.00 121.54 ? 507  ILE A C   1 
ATOM   3355 O  O   . ILE A 1  434 ? 28.049 173.186 -12.642 1.00 104.19 ? 507  ILE A O   1 
ATOM   3356 C  CB  . ILE A 1  434 ? 28.470 171.701 -9.772  1.00 107.15 ? 507  ILE A CB  1 
ATOM   3357 C  CG1 . ILE A 1  434 ? 29.227 170.689 -8.916  1.00 100.56 ? 507  ILE A CG1 1 
ATOM   3358 C  CG2 . ILE A 1  434 ? 27.255 171.025 -10.386 1.00 113.51 ? 507  ILE A CG2 1 
ATOM   3359 C  CD1 . ILE A 1  434 ? 29.710 169.491 -9.691  1.00 116.27 ? 507  ILE A CD1 1 
ATOM   3360 N  N   . GLU A 1  435 ? 28.830 174.617 -11.095 1.00 116.23 ? 508  GLU A N   1 
ATOM   3361 C  CA  . GLU A 1  435 ? 28.265 175.787 -11.757 1.00 119.04 ? 508  GLU A CA  1 
ATOM   3362 C  C   . GLU A 1  435 ? 29.007 176.091 -13.055 1.00 115.91 ? 508  GLU A C   1 
ATOM   3363 O  O   . GLU A 1  435 ? 28.388 176.331 -14.092 1.00 113.98 ? 508  GLU A O   1 
ATOM   3364 C  CB  . GLU A 1  435 ? 28.303 177.006 -10.834 1.00 157.81 ? 508  GLU A CB  1 
ATOM   3365 C  CG  . GLU A 1  435 ? 27.386 176.901 -9.629  1.00 171.28 ? 508  GLU A CG  1 
ATOM   3366 C  CD  . GLU A 1  435 ? 27.331 178.185 -8.828  1.00 186.70 ? 508  GLU A CD  1 
ATOM   3367 O  OE1 . GLU A 1  435 ? 27.715 179.241 -9.373  1.00 210.01 ? 508  GLU A OE1 1 
ATOM   3368 O  OE2 . GLU A 1  435 ? 26.907 178.138 -7.655  1.00 185.69 ? 508  GLU A OE2 1 
ATOM   3369 N  N   . ALA A 1  436 ? 30.335 176.072 -12.989 1.00 143.41 ? 509  ALA A N   1 
ATOM   3370 C  CA  . ALA A 1  436 ? 31.173 176.375 -14.145 1.00 166.14 ? 509  ALA A CA  1 
ATOM   3371 C  C   . ALA A 1  436 ? 30.933 175.389 -15.283 1.00 146.69 ? 509  ALA A C   1 
ATOM   3372 O  O   . ALA A 1  436 ? 30.974 175.759 -16.456 1.00 149.78 ? 509  ALA A O   1 
ATOM   3373 C  CB  . ALA A 1  436 ? 32.641 176.375 -13.747 1.00 190.37 ? 509  ALA A CB  1 
ATOM   3374 N  N   . VAL A 1  437 ? 30.682 174.132 -14.930 1.00 133.58 ? 510  VAL A N   1 
ATOM   3375 C  CA  . VAL A 1  437 ? 30.393 173.106 -15.923 1.00 134.64 ? 510  VAL A CA  1 
ATOM   3376 C  C   . VAL A 1  437 ? 28.959 173.252 -16.428 1.00 140.09 ? 510  VAL A C   1 
ATOM   3377 O  O   . VAL A 1  437 ? 28.689 173.104 -17.622 1.00 179.88 ? 510  VAL A O   1 
ATOM   3378 C  CB  . VAL A 1  437 ? 30.638 171.696 -15.349 1.00 145.87 ? 510  VAL A CB  1 
ATOM   3379 C  CG1 . VAL A 1  437 ? 30.086 170.629 -16.281 1.00 143.48 ? 510  VAL A CG1 1 
ATOM   3380 C  CG2 . VAL A 1  437 ? 32.124 171.474 -15.110 1.00 153.13 ? 510  VAL A CG2 1 
ATOM   3381 N  N   . ALA A 1  438 ? 28.049 173.564 -15.511 1.00 127.92 ? 511  ALA A N   1 
ATOM   3382 C  CA  . ALA A 1  438 ? 26.625 173.641 -15.822 1.00 142.41 ? 511  ALA A CA  1 
ATOM   3383 C  C   . ALA A 1  438 ? 26.289 174.792 -16.768 1.00 126.41 ? 511  ALA A C   1 
ATOM   3384 O  O   . ALA A 1  438 ? 25.444 174.649 -17.648 1.00 113.65 ? 511  ALA A O   1 
ATOM   3385 C  CB  . ALA A 1  438 ? 25.821 173.770 -14.540 1.00 147.45 ? 511  ALA A CB  1 
ATOM   3386 N  N   . VAL A 1  439 ? 26.942 175.934 -16.584 1.00 149.80 ? 512  VAL A N   1 
ATOM   3387 C  CA  . VAL A 1  439 ? 26.654 177.102 -17.408 1.00 119.16 ? 512  VAL A CA  1 
ATOM   3388 C  C   . VAL A 1  439 ? 27.275 176.958 -18.796 1.00 129.74 ? 512  VAL A C   1 
ATOM   3389 O  O   . VAL A 1  439 ? 26.676 177.351 -19.799 1.00 184.83 ? 512  VAL A O   1 
ATOM   3390 C  CB  . VAL A 1  439 ? 27.142 178.395 -16.724 1.00 135.48 ? 512  VAL A CB  1 
ATOM   3391 C  CG1 . VAL A 1  439 ? 26.892 179.602 -17.616 1.00 128.11 ? 512  VAL A CG1 1 
ATOM   3392 C  CG2 . VAL A 1  439 ? 26.453 178.574 -15.382 1.00 155.50 ? 512  VAL A CG2 1 
ATOM   3393 N  N   . SER A 1  440 ? 28.469 176.378 -18.851 1.00 147.23 ? 513  SER A N   1 
ATOM   3394 C  CA  . SER A 1  440 ? 29.232 176.321 -20.093 1.00 168.38 ? 513  SER A CA  1 
ATOM   3395 C  C   . SER A 1  440 ? 28.873 175.130 -20.980 1.00 175.00 ? 513  SER A C   1 
ATOM   3396 O  O   . SER A 1  440 ? 28.960 175.219 -22.205 1.00 188.18 ? 513  SER A O   1 
ATOM   3397 C  CB  . SER A 1  440 ? 30.731 176.291 -19.784 1.00 162.20 ? 513  SER A CB  1 
ATOM   3398 O  OG  . SER A 1  440 ? 31.496 176.210 -20.974 1.00 165.83 ? 513  SER A OG  1 
ATOM   3399 N  N   . TRP A 1  441 ? 28.471 174.019 -20.370 1.00 171.57 ? 514  TRP A N   1 
ATOM   3400 C  CA  . TRP A 1  441 ? 28.291 172.779 -21.123 1.00 190.76 ? 514  TRP A CA  1 
ATOM   3401 C  C   . TRP A 1  441 ? 26.839 172.304 -21.205 1.00 192.39 ? 514  TRP A C   1 
ATOM   3402 O  O   . TRP A 1  441 ? 26.509 171.459 -22.037 1.00 199.31 ? 514  TRP A O   1 
ATOM   3403 C  CB  . TRP A 1  441 ? 29.161 171.673 -20.517 1.00 202.16 ? 514  TRP A CB  1 
ATOM   3404 C  CG  . TRP A 1  441 ? 30.633 171.911 -20.695 1.00 197.34 ? 514  TRP A CG  1 
ATOM   3405 C  CD1 . TRP A 1  441 ? 31.220 172.922 -21.399 1.00 197.03 ? 514  TRP A CD1 1 
ATOM   3406 C  CD2 . TRP A 1  441 ? 31.703 171.122 -20.160 1.00 192.99 ? 514  TRP A CD2 1 
ATOM   3407 N  NE1 . TRP A 1  441 ? 32.588 172.812 -21.336 1.00 198.97 ? 514  TRP A NE1 1 
ATOM   3408 C  CE2 . TRP A 1  441 ? 32.910 171.715 -20.581 1.00 190.06 ? 514  TRP A CE2 1 
ATOM   3409 C  CE3 . TRP A 1  441 ? 31.758 169.971 -19.367 1.00 188.63 ? 514  TRP A CE3 1 
ATOM   3410 C  CZ2 . TRP A 1  441 ? 34.157 171.198 -20.236 1.00 177.76 ? 514  TRP A CZ2 1 
ATOM   3411 C  CZ3 . TRP A 1  441 ? 32.998 169.460 -19.025 1.00 185.34 ? 514  TRP A CZ3 1 
ATOM   3412 C  CH2 . TRP A 1  441 ? 34.179 170.073 -19.459 1.00 176.15 ? 514  TRP A CH2 1 
ATOM   3413 N  N   . PHE A 1  442 ? 25.975 172.839 -20.349 1.00 182.12 ? 515  PHE A N   1 
ATOM   3414 C  CA  . PHE A 1  442 ? 24.564 172.461 -20.368 1.00 175.66 ? 515  PHE A CA  1 
ATOM   3415 C  C   . PHE A 1  442 ? 23.675 173.536 -20.986 1.00 185.99 ? 515  PHE A C   1 
ATOM   3416 O  O   . PHE A 1  442 ? 22.942 173.274 -21.940 1.00 216.92 ? 515  PHE A O   1 
ATOM   3417 C  CB  . PHE A 1  442 ? 24.064 172.164 -18.953 1.00 166.26 ? 515  PHE A CB  1 
ATOM   3418 C  CG  . PHE A 1  442 ? 24.181 170.720 -18.557 1.00 160.49 ? 515  PHE A CG  1 
ATOM   3419 C  CD1 . PHE A 1  442 ? 25.399 170.191 -18.161 1.00 158.56 ? 515  PHE A CD1 1 
ATOM   3420 C  CD2 . PHE A 1  442 ? 23.070 169.892 -18.573 1.00 162.35 ? 515  PHE A CD2 1 
ATOM   3421 C  CE1 . PHE A 1  442 ? 25.506 168.861 -17.795 1.00 158.22 ? 515  PHE A CE1 1 
ATOM   3422 C  CE2 . PHE A 1  442 ? 23.171 168.563 -18.207 1.00 161.12 ? 515  PHE A CE2 1 
ATOM   3423 C  CZ  . PHE A 1  442 ? 24.390 168.047 -17.818 1.00 158.97 ? 515  PHE A CZ  1 
ATOM   3424 N  N   . TYR A 1  443 ? 23.784 174.758 -20.475 1.00 191.97 ? 516  TYR A N   1 
ATOM   3425 C  CA  . TYR A 1  443 ? 22.980 175.870 -20.970 1.00 190.55 ? 516  TYR A CA  1 
ATOM   3426 C  C   . TYR A 1  443 ? 23.538 176.319 -22.316 1.00 190.14 ? 516  TYR A C   1 
ATOM   3427 O  O   . TYR A 1  443 ? 22.824 176.898 -23.136 1.00 233.67 ? 516  TYR A O   1 
ATOM   3428 C  CB  . TYR A 1  443 ? 22.985 177.034 -19.977 1.00 183.11 ? 516  TYR A CB  1 
ATOM   3429 C  CG  . TYR A 1  443 ? 22.333 178.295 -20.500 1.00 185.17 ? 516  TYR A CG  1 
ATOM   3430 C  CD1 . TYR A 1  443 ? 20.961 178.356 -20.706 1.00 207.31 ? 516  TYR A CD1 1 
ATOM   3431 C  CD2 . TYR A 1  443 ? 23.089 179.426 -20.780 1.00 176.95 ? 516  TYR A CD2 1 
ATOM   3432 C  CE1 . TYR A 1  443 ? 20.360 179.507 -21.182 1.00 216.40 ? 516  TYR A CE1 1 
ATOM   3433 C  CE2 . TYR A 1  443 ? 22.497 180.582 -21.256 1.00 190.16 ? 516  TYR A CE2 1 
ATOM   3434 C  CZ  . TYR A 1  443 ? 21.133 180.616 -21.454 1.00 207.90 ? 516  TYR A CZ  1 
ATOM   3435 O  OH  . TYR A 1  443 ? 20.540 181.764 -21.927 1.00 215.68 ? 516  TYR A OH  1 
ATOM   3436 N  N   . GLY A 1  444 ? 24.818 176.041 -22.539 1.00 157.50 ? 517  GLY A N   1 
ATOM   3437 C  CA  . GLY A 1  444 ? 25.475 176.425 -23.773 1.00 186.92 ? 517  GLY A CA  1 
ATOM   3438 C  C   . GLY A 1  444 ? 26.194 177.752 -23.649 1.00 174.32 ? 517  GLY A C   1 
ATOM   3439 O  O   . GLY A 1  444 ? 25.624 178.736 -23.178 1.00 159.12 ? 517  GLY A O   1 
ATOM   3440 N  N   . ILE A 1  445 ? 27.453 177.780 -24.069 1.00 171.38 ? 518  ILE A N   1 
ATOM   3441 C  CA  . ILE A 1  445 ? 28.251 178.993 -23.981 1.00 151.72 ? 518  ILE A CA  1 
ATOM   3442 C  C   . ILE A 1  445 ? 27.851 179.950 -25.101 1.00 153.61 ? 518  ILE A C   1 
ATOM   3443 O  O   . ILE A 1  445 ? 27.984 181.168 -24.969 1.00 135.47 ? 518  ILE A O   1 
ATOM   3444 C  CB  . ILE A 1  445 ? 29.759 178.672 -24.019 1.00 153.91 ? 518  ILE A CB  1 
ATOM   3445 C  CG1 . ILE A 1  445 ? 30.577 179.923 -23.700 1.00 134.88 ? 518  ILE A CG1 1 
ATOM   3446 C  CG2 . ILE A 1  445 ? 30.157 178.083 -25.366 1.00 183.87 ? 518  ILE A CG2 1 
ATOM   3447 C  CD1 . ILE A 1  445 ? 30.177 180.581 -22.401 1.00 129.08 ? 518  ILE A CD1 1 
ATOM   3448 N  N   . THR A 1  446 ? 27.344 179.392 -26.195 1.00 158.25 ? 519  THR A N   1 
ATOM   3449 C  CA  . THR A 1  446 ? 26.912 180.187 -27.338 1.00 169.55 ? 519  THR A CA  1 
ATOM   3450 C  C   . THR A 1  446 ? 25.700 181.040 -26.980 1.00 167.32 ? 519  THR A C   1 
ATOM   3451 O  O   . THR A 1  446 ? 25.642 182.227 -27.308 1.00 177.86 ? 519  THR A O   1 
ATOM   3452 C  CB  . THR A 1  446 ? 26.567 179.296 -28.544 1.00 183.58 ? 519  THR A CB  1 
ATOM   3453 O  OG1 . THR A 1  446 ? 25.499 178.407 -28.193 1.00 193.01 ? 519  THR A OG1 1 
ATOM   3454 C  CG2 . THR A 1  446 ? 27.780 178.481 -28.966 1.00 179.35 ? 519  THR A CG2 1 
ATOM   3455 N  N   . GLN A 1  447 ? 24.735 180.427 -26.302 1.00 134.71 ? 520  GLN A N   1 
ATOM   3456 C  CA  . GLN A 1  447 ? 23.538 181.137 -25.869 1.00 155.90 ? 520  GLN A CA  1 
ATOM   3457 C  C   . GLN A 1  447 ? 23.893 182.170 -24.805 1.00 149.65 ? 520  GLN A C   1 
ATOM   3458 O  O   . GLN A 1  447 ? 23.258 183.220 -24.711 1.00 145.02 ? 520  GLN A O   1 
ATOM   3459 C  CB  . GLN A 1  447 ? 22.490 180.155 -25.337 1.00 136.95 ? 520  GLN A CB  1 
ATOM   3460 C  CG  . GLN A 1  447 ? 21.155 180.796 -24.985 1.00 140.87 ? 520  GLN A CG  1 
ATOM   3461 C  CD  . GLN A 1  447 ? 20.483 181.452 -26.179 1.00 176.50 ? 520  GLN A CD  1 
ATOM   3462 O  OE1 . GLN A 1  447 ? 20.653 181.019 -27.319 1.00 172.35 ? 520  GLN A OE1 1 
ATOM   3463 N  NE2 . GLN A 1  447 ? 19.716 182.505 -25.920 1.00 171.14 ? 520  GLN A NE2 1 
ATOM   3464 N  N   . PHE A 1  448 ? 24.915 181.867 -24.009 1.00 175.86 ? 521  PHE A N   1 
ATOM   3465 C  CA  . PHE A 1  448 ? 25.410 182.804 -23.008 1.00 162.56 ? 521  PHE A CA  1 
ATOM   3466 C  C   . PHE A 1  448 ? 25.994 184.039 -23.683 1.00 165.73 ? 521  PHE A C   1 
ATOM   3467 O  O   . PHE A 1  448 ? 25.705 185.170 -23.291 1.00 164.14 ? 521  PHE A O   1 
ATOM   3468 C  CB  . PHE A 1  448 ? 26.460 182.138 -22.115 1.00 153.25 ? 521  PHE A CB  1 
ATOM   3469 C  CG  . PHE A 1  448 ? 27.137 183.085 -21.165 1.00 168.72 ? 521  PHE A CG  1 
ATOM   3470 C  CD1 . PHE A 1  448 ? 26.497 183.507 -20.012 1.00 165.80 ? 521  PHE A CD1 1 
ATOM   3471 C  CD2 . PHE A 1  448 ? 28.416 183.550 -21.422 1.00 173.81 ? 521  PHE A CD2 1 
ATOM   3472 C  CE1 . PHE A 1  448 ? 27.119 184.378 -19.136 1.00 159.85 ? 521  PHE A CE1 1 
ATOM   3473 C  CE2 . PHE A 1  448 ? 29.043 184.420 -20.550 1.00 167.01 ? 521  PHE A CE2 1 
ATOM   3474 C  CZ  . PHE A 1  448 ? 28.393 184.834 -19.406 1.00 166.34 ? 521  PHE A CZ  1 
ATOM   3475 N  N   . CYS A 1  449 ? 26.812 183.812 -24.707 1.00 174.95 ? 522  CYS A N   1 
ATOM   3476 C  CA  . CYS A 1  449 ? 27.393 184.902 -25.481 1.00 192.02 ? 522  CYS A CA  1 
ATOM   3477 C  C   . CYS A 1  449 ? 26.308 185.671 -26.230 1.00 208.73 ? 522  CYS A C   1 
ATOM   3478 O  O   . CYS A 1  449 ? 26.471 186.851 -26.538 1.00 225.18 ? 522  CYS A O   1 
ATOM   3479 C  CB  . CYS A 1  449 ? 28.439 184.369 -26.463 1.00 195.18 ? 522  CYS A CB  1 
ATOM   3480 S  SG  . CYS A 1  449 ? 29.883 183.610 -25.680 1.00 176.10 ? 522  CYS A SG  1 
ATOM   3481 N  N   . ARG A 1  450 ? 25.200 184.994 -26.520 1.00 204.05 ? 523  ARG A N   1 
ATOM   3482 C  CA  . ARG A 1  450 ? 24.059 185.635 -27.163 1.00 212.34 ? 523  ARG A CA  1 
ATOM   3483 C  C   . ARG A 1  450 ? 23.343 186.544 -26.166 1.00 211.21 ? 523  ARG A C   1 
ATOM   3484 O  O   . ARG A 1  450 ? 22.848 187.612 -26.527 1.00 222.57 ? 523  ARG A O   1 
ATOM   3485 C  CB  . ARG A 1  450 ? 23.099 184.582 -27.728 1.00 207.85 ? 523  ARG A CB  1 
ATOM   3486 C  CG  . ARG A 1  450 ? 22.047 185.125 -28.690 1.00 197.36 ? 523  ARG A CG  1 
ATOM   3487 C  CD  . ARG A 1  450 ? 20.754 185.494 -27.976 1.00 204.09 ? 523  ARG A CD  1 
ATOM   3488 N  NE  . ARG A 1  450 ? 19.765 186.057 -28.890 1.00 228.34 ? 523  ARG A NE  1 
ATOM   3489 C  CZ  . ARG A 1  450 ? 18.558 186.473 -28.521 1.00 237.36 ? 523  ARG A CZ  1 
ATOM   3490 N  NH1 . ARG A 1  450 ? 18.186 186.390 -27.251 1.00 243.63 ? 523  ARG A NH1 1 
ATOM   3491 N  NH2 . ARG A 1  450 ? 17.722 186.973 -29.421 1.00 228.01 ? 523  ARG A NH2 1 
ATOM   3492 N  N   . ASP A 1  451 ? 23.294 186.110 -24.910 1.00 195.91 ? 524  ASP A N   1 
ATOM   3493 C  CA  . ASP A 1  451 ? 22.668 186.892 -23.850 1.00 193.70 ? 524  ASP A CA  1 
ATOM   3494 C  C   . ASP A 1  451 ? 23.504 188.125 -23.527 1.00 194.16 ? 524  ASP A C   1 
ATOM   3495 O  O   . ASP A 1  451 ? 22.968 189.219 -23.333 1.00 205.98 ? 524  ASP A O   1 
ATOM   3496 C  CB  . ASP A 1  451 ? 22.475 186.038 -22.595 1.00 191.96 ? 524  ASP A CB  1 
ATOM   3497 C  CG  . ASP A 1  451 ? 21.538 184.869 -22.826 1.00 209.33 ? 524  ASP A CG  1 
ATOM   3498 O  OD1 . ASP A 1  451 ? 20.644 184.985 -23.691 1.00 213.68 ? 524  ASP A OD1 1 
ATOM   3499 O  OD2 . ASP A 1  451 ? 21.697 183.834 -22.146 1.00 216.26 ? 524  ASP A OD2 1 
ATOM   3500 N  N   . VAL A 1  452 ? 24.819 187.939 -23.470 1.00 202.24 ? 525  VAL A N   1 
ATOM   3501 C  CA  . VAL A 1  452 ? 25.738 189.052 -23.273 1.00 198.15 ? 525  VAL A CA  1 
ATOM   3502 C  C   . VAL A 1  452 ? 25.641 189.987 -24.473 1.00 205.29 ? 525  VAL A C   1 
ATOM   3503 O  O   . VAL A 1  452 ? 25.747 191.207 -24.338 1.00 224.05 ? 525  VAL A O   1 
ATOM   3504 C  CB  . VAL A 1  452 ? 27.182 188.557 -23.060 1.00 186.47 ? 525  VAL A CB  1 
ATOM   3505 C  CG1 . VAL A 1  452 ? 28.132 189.731 -22.882 1.00 182.16 ? 525  VAL A CG1 1 
ATOM   3506 C  CG2 . VAL A 1  452 ? 27.252 187.627 -21.858 1.00 173.99 ? 525  VAL A CG2 1 
ATOM   3507 N  N   . LYS A 1  453 ? 25.421 189.403 -25.648 1.00 176.12 ? 526  LYS A N   1 
ATOM   3508 C  CA  . LYS A 1  453 ? 25.230 190.174 -26.870 1.00 172.46 ? 526  LYS A CA  1 
ATOM   3509 C  C   . LYS A 1  453 ? 23.937 190.982 -26.793 1.00 178.08 ? 526  LYS A C   1 
ATOM   3510 O  O   . LYS A 1  453 ? 23.819 192.042 -27.404 1.00 179.91 ? 526  LYS A O   1 
ATOM   3511 C  CB  . LYS A 1  453 ? 25.212 189.248 -28.090 1.00 174.40 ? 526  LYS A CB  1 
ATOM   3512 C  CG  . LYS A 1  453 ? 25.137 189.970 -29.428 1.00 210.62 ? 526  LYS A CG  1 
ATOM   3513 C  CD  . LYS A 1  453 ? 25.145 188.988 -30.590 1.00 216.71 ? 526  LYS A CD  1 
ATOM   3514 C  CE  . LYS A 1  453 ? 23.957 188.042 -30.525 1.00 233.11 ? 526  LYS A CE  1 
ATOM   3515 N  NZ  . LYS A 1  453 ? 23.949 187.078 -31.660 1.00 234.21 ? 526  LYS A NZ  1 
ATOM   3516 N  N   . GLU A 1  454 ? 22.971 190.474 -26.034 1.00 189.10 ? 527  GLU A N   1 
ATOM   3517 C  CA  . GLU A 1  454 ? 21.704 191.172 -25.841 1.00 187.07 ? 527  GLU A CA  1 
ATOM   3518 C  C   . GLU A 1  454 ? 21.850 192.330 -24.857 1.00 186.32 ? 527  GLU A C   1 
ATOM   3519 O  O   . GLU A 1  454 ? 21.375 193.437 -25.115 1.00 203.22 ? 527  GLU A O   1 
ATOM   3520 C  CB  . GLU A 1  454 ? 20.625 190.201 -25.352 1.00 175.13 ? 527  GLU A CB  1 
ATOM   3521 C  CG  . GLU A 1  454 ? 19.366 190.878 -24.827 1.00 187.19 ? 527  GLU A CG  1 
ATOM   3522 C  CD  . GLU A 1  454 ? 18.658 191.709 -25.882 1.00 221.32 ? 527  GLU A CD  1 
ATOM   3523 O  OE1 . GLU A 1  454 ? 18.030 192.726 -25.516 1.00 221.40 ? 527  GLU A OE1 1 
ATOM   3524 O  OE2 . GLU A 1  454 ? 18.720 191.343 -27.075 1.00 233.46 ? 527  GLU A OE2 1 
ATOM   3525 N  N   . MET A 1  455 ? 22.509 192.072 -23.732 1.00 185.12 ? 528  MET A N   1 
ATOM   3526 C  CA  . MET A 1  455 ? 22.671 193.089 -22.697 1.00 188.88 ? 528  MET A CA  1 
ATOM   3527 C  C   . MET A 1  455 ? 23.633 194.199 -23.115 1.00 182.27 ? 528  MET A C   1 
ATOM   3528 O  O   . MET A 1  455 ? 23.262 195.372 -23.150 1.00 183.81 ? 528  MET A O   1 
ATOM   3529 C  CB  . MET A 1  455 ? 23.158 192.453 -21.393 1.00 206.35 ? 528  MET A CB  1 
ATOM   3530 C  CG  . MET A 1  455 ? 22.127 191.579 -20.702 1.00 217.35 ? 528  MET A CG  1 
ATOM   3531 S  SD  . MET A 1  455 ? 22.696 190.997 -19.094 1.00 209.73 ? 528  MET A SD  1 
ATOM   3532 C  CE  . MET A 1  455 ? 22.984 192.551 -18.251 1.00 206.37 ? 528  MET A CE  1 
ATOM   3533 N  N   . LEU A 1  456 ? 24.869 193.823 -23.429 1.00 158.65 ? 529  LEU A N   1 
ATOM   3534 C  CA  . LEU A 1  456 ? 25.910 194.797 -23.746 1.00 158.45 ? 529  LEU A CA  1 
ATOM   3535 C  C   . LEU A 1  456 ? 25.784 195.336 -25.168 1.00 189.75 ? 529  LEU A C   1 
ATOM   3536 O  O   . LEU A 1  456 ? 26.374 196.363 -25.504 1.00 183.59 ? 529  LEU A O   1 
ATOM   3537 C  CB  . LEU A 1  456 ? 27.299 194.182 -23.546 1.00 153.88 ? 529  LEU A CB  1 
ATOM   3538 C  CG  . LEU A 1  456 ? 27.878 194.159 -22.128 1.00 160.19 ? 529  LEU A CG  1 
ATOM   3539 C  CD1 . LEU A 1  456 ? 27.120 193.202 -21.217 1.00 145.64 ? 529  LEU A CD1 1 
ATOM   3540 C  CD2 . LEU A 1  456 ? 29.359 193.808 -22.164 1.00 156.61 ? 529  LEU A CD2 1 
ATOM   3541 N  N   . GLY A 1  457 ? 25.016 194.642 -26.002 1.00 208.08 ? 530  GLY A N   1 
ATOM   3542 C  CA  . GLY A 1  457 ? 24.833 195.055 -27.381 1.00 221.18 ? 530  GLY A CA  1 
ATOM   3543 C  C   . GLY A 1  457 ? 25.827 194.416 -28.331 1.00 218.92 ? 530  GLY A C   1 
ATOM   3544 O  O   . GLY A 1  457 ? 25.705 194.542 -29.549 1.00 245.64 ? 530  GLY A O   1 
ATOM   3545 N  N   . PHE A 1  458 ? 26.816 193.728 -27.768 1.00 195.09 ? 531  PHE A N   1 
ATOM   3546 C  CA  . PHE A 1  458 ? 27.834 193.053 -28.566 1.00 193.99 ? 531  PHE A CA  1 
ATOM   3547 C  C   . PHE A 1  458 ? 28.264 191.742 -27.911 1.00 211.71 ? 531  PHE A C   1 
ATOM   3548 O  O   . PHE A 1  458 ? 28.347 191.648 -26.686 1.00 220.26 ? 531  PHE A O   1 
ATOM   3549 C  CB  . PHE A 1  458 ? 29.048 193.965 -28.778 1.00 195.26 ? 531  PHE A CB  1 
ATOM   3550 C  CG  . PHE A 1  458 ? 29.685 194.447 -27.501 1.00 198.57 ? 531  PHE A CG  1 
ATOM   3551 C  CD1 . PHE A 1  458 ? 29.239 195.603 -26.881 1.00 198.52 ? 531  PHE A CD1 1 
ATOM   3552 C  CD2 . PHE A 1  458 ? 30.739 193.752 -26.930 1.00 201.40 ? 531  PHE A CD2 1 
ATOM   3553 C  CE1 . PHE A 1  458 ? 29.825 196.051 -25.710 1.00 205.87 ? 531  PHE A CE1 1 
ATOM   3554 C  CE2 . PHE A 1  458 ? 31.329 194.195 -25.759 1.00 208.72 ? 531  PHE A CE2 1 
ATOM   3555 C  CZ  . PHE A 1  458 ? 30.871 195.346 -25.149 1.00 211.85 ? 531  PHE A CZ  1 
ATOM   3556 N  N   . SER A 1  459 ? 28.532 190.733 -28.734 1.00 202.57 ? 532  SER A N   1 
ATOM   3557 C  CA  . SER A 1  459 ? 28.955 189.426 -28.241 1.00 186.12 ? 532  SER A CA  1 
ATOM   3558 C  C   . SER A 1  459 ? 30.360 189.495 -27.649 1.00 188.76 ? 532  SER A C   1 
ATOM   3559 O  O   . SER A 1  459 ? 31.232 190.174 -28.192 1.00 184.71 ? 532  SER A O   1 
ATOM   3560 C  CB  . SER A 1  459 ? 28.906 188.389 -29.367 1.00 188.37 ? 532  SER A CB  1 
ATOM   3561 O  OG  . SER A 1  459 ? 29.284 187.105 -28.900 1.00 190.08 ? 532  SER A OG  1 
ATOM   3562 N  N   . PRO A 1  460 ? 30.581 188.793 -26.525 1.00 188.90 ? 533  PRO A N   1 
ATOM   3563 C  CA  . PRO A 1  460 ? 31.895 188.767 -25.872 1.00 179.17 ? 533  PRO A CA  1 
ATOM   3564 C  C   . PRO A 1  460 ? 32.973 188.152 -26.759 1.00 176.85 ? 533  PRO A C   1 
ATOM   3565 O  O   . PRO A 1  460 ? 32.679 187.267 -27.564 1.00 163.87 ? 533  PRO A O   1 
ATOM   3566 C  CB  . PRO A 1  460 ? 31.654 187.908 -24.626 1.00 156.46 ? 533  PRO A CB  1 
ATOM   3567 C  CG  . PRO A 1  460 ? 30.454 187.088 -24.954 1.00 157.38 ? 533  PRO A CG  1 
ATOM   3568 C  CD  . PRO A 1  460 ? 29.595 187.966 -25.809 1.00 171.66 ? 533  PRO A CD  1 
ATOM   3569 N  N   . GLY A 1  461 ? 34.206 188.623 -26.606 1.00 171.70 ? 534  GLY A N   1 
ATOM   3570 C  CA  . GLY A 1  461 ? 35.308 188.183 -27.441 1.00 170.17 ? 534  GLY A CA  1 
ATOM   3571 C  C   . GLY A 1  461 ? 35.645 186.709 -27.332 1.00 161.50 ? 534  GLY A C   1 
ATOM   3572 O  O   . GLY A 1  461 ? 35.165 186.012 -26.437 1.00 168.05 ? 534  GLY A O   1 
ATOM   3573 N  N   . TRP A 1  462 ? 36.476 186.237 -28.256 1.00 188.12 ? 535  TRP A N   1 
ATOM   3574 C  CA  . TRP A 1  462 ? 36.916 184.848 -28.271 1.00 193.73 ? 535  TRP A CA  1 
ATOM   3575 C  C   . TRP A 1  462 ? 37.780 184.535 -27.055 1.00 191.32 ? 535  TRP A C   1 
ATOM   3576 O  O   . TRP A 1  462 ? 37.813 183.399 -26.579 1.00 170.66 ? 535  TRP A O   1 
ATOM   3577 C  CB  . TRP A 1  462 ? 37.687 184.549 -29.559 1.00 202.81 ? 535  TRP A CB  1 
ATOM   3578 C  CG  . TRP A 1  462 ? 38.767 185.548 -29.857 1.00 219.72 ? 535  TRP A CG  1 
ATOM   3579 C  CD1 . TRP A 1  462 ? 38.639 186.704 -30.572 1.00 227.84 ? 535  TRP A CD1 1 
ATOM   3580 C  CD2 . TRP A 1  462 ? 40.138 185.480 -29.447 1.00 229.50 ? 535  TRP A CD2 1 
ATOM   3581 N  NE1 . TRP A 1  462 ? 39.845 187.360 -30.633 1.00 236.86 ? 535  TRP A NE1 1 
ATOM   3582 C  CE2 . TRP A 1  462 ? 40.783 186.629 -29.950 1.00 237.15 ? 535  TRP A CE2 1 
ATOM   3583 C  CE3 . TRP A 1  462 ? 40.885 184.560 -28.705 1.00 216.27 ? 535  TRP A CE3 1 
ATOM   3584 C  CZ2 . TRP A 1  462 ? 42.136 186.882 -29.734 1.00 228.70 ? 535  TRP A CZ2 1 
ATOM   3585 C  CZ3 . TRP A 1  462 ? 42.228 184.813 -28.491 1.00 199.84 ? 535  TRP A CZ3 1 
ATOM   3586 C  CH2 . TRP A 1  462 ? 42.839 185.964 -29.004 1.00 202.27 ? 535  TRP A CH2 1 
ATOM   3587 N  N   . PHE A 1  463 ? 38.475 185.555 -26.561 1.00 184.12 ? 536  PHE A N   1 
ATOM   3588 C  CA  . PHE A 1  463 ? 39.337 185.420 -25.393 1.00 158.65 ? 536  PHE A CA  1 
ATOM   3589 C  C   . PHE A 1  463 ? 38.555 184.980 -24.159 1.00 134.21 ? 536  PHE A C   1 
ATOM   3590 O  O   . PHE A 1  463 ? 39.042 184.185 -23.359 1.00 126.34 ? 536  PHE A O   1 
ATOM   3591 C  CB  . PHE A 1  463 ? 40.059 186.740 -25.112 1.00 166.48 ? 536  PHE A CB  1 
ATOM   3592 C  CG  . PHE A 1  463 ? 40.624 186.839 -23.723 1.00 169.11 ? 536  PHE A CG  1 
ATOM   3593 C  CD1 . PHE A 1  463 ? 41.768 186.143 -23.375 1.00 155.82 ? 536  PHE A CD1 1 
ATOM   3594 C  CD2 . PHE A 1  463 ? 40.011 187.634 -22.768 1.00 182.69 ? 536  PHE A CD2 1 
ATOM   3595 C  CE1 . PHE A 1  463 ? 42.288 186.233 -22.099 1.00 144.44 ? 536  PHE A CE1 1 
ATOM   3596 C  CE2 . PHE A 1  463 ? 40.526 187.728 -21.491 1.00 159.55 ? 536  PHE A CE2 1 
ATOM   3597 C  CZ  . PHE A 1  463 ? 41.666 187.027 -21.156 1.00 135.62 ? 536  PHE A CZ  1 
ATOM   3598 N  N   . TRP A 1  464 ? 37.342 185.501 -24.011 1.00 145.23 ? 537  TRP A N   1 
ATOM   3599 C  CA  . TRP A 1  464 ? 36.508 185.175 -22.861 1.00 134.47 ? 537  TRP A CA  1 
ATOM   3600 C  C   . TRP A 1  464 ? 35.769 183.859 -23.071 1.00 132.13 ? 537  TRP A C   1 
ATOM   3601 O  O   . TRP A 1  464 ? 35.618 183.066 -22.139 1.00 130.49 ? 537  TRP A O   1 
ATOM   3602 C  CB  . TRP A 1  464 ? 35.514 186.303 -22.587 1.00 140.52 ? 537  TRP A CB  1 
ATOM   3603 C  CG  . TRP A 1  464 ? 36.178 187.613 -22.321 1.00 150.51 ? 537  TRP A CG  1 
ATOM   3604 C  CD1 . TRP A 1  464 ? 36.299 188.662 -23.185 1.00 205.62 ? 537  TRP A CD1 1 
ATOM   3605 C  CD2 . TRP A 1  464 ? 36.833 188.011 -21.112 1.00 149.41 ? 537  TRP A CD2 1 
ATOM   3606 N  NE1 . TRP A 1  464 ? 36.981 189.692 -22.585 1.00 219.11 ? 537  TRP A NE1 1 
ATOM   3607 C  CE2 . TRP A 1  464 ? 37.320 189.318 -21.311 1.00 177.90 ? 537  TRP A CE2 1 
ATOM   3608 C  CE3 . TRP A 1  464 ? 37.050 187.391 -19.878 1.00 161.13 ? 537  TRP A CE3 1 
ATOM   3609 C  CZ2 . TRP A 1  464 ? 38.013 190.015 -20.324 1.00 165.16 ? 537  TRP A CZ2 1 
ATOM   3610 C  CZ3 . TRP A 1  464 ? 37.737 188.085 -18.900 1.00 156.39 ? 537  TRP A CZ3 1 
ATOM   3611 C  CH2 . TRP A 1  464 ? 38.210 189.383 -19.128 1.00 162.69 ? 537  TRP A CH2 1 
ATOM   3612 N  N   . ARG A 1  465 ? 35.314 183.634 -24.299 1.00 140.62 ? 538  ARG A N   1 
ATOM   3613 C  CA  . ARG A 1  465 ? 34.601 182.410 -24.641 1.00 149.90 ? 538  ARG A CA  1 
ATOM   3614 C  C   . ARG A 1  465 ? 35.490 181.190 -24.437 1.00 144.56 ? 538  ARG A C   1 
ATOM   3615 O  O   . ARG A 1  465 ? 35.063 180.191 -23.858 1.00 144.14 ? 538  ARG A O   1 
ATOM   3616 C  CB  . ARG A 1  465 ? 34.103 182.464 -26.087 1.00 159.21 ? 538  ARG A CB  1 
ATOM   3617 N  N   . ILE A 1  466 ? 36.732 181.283 -24.901 1.00 117.88 ? 539  ILE A N   1 
ATOM   3618 C  CA  . ILE A 1  466 ? 37.668 180.171 -24.797 1.00 133.09 ? 539  ILE A CA  1 
ATOM   3619 C  C   . ILE A 1  466 ? 38.032 179.926 -23.333 1.00 137.03 ? 539  ILE A C   1 
ATOM   3620 O  O   . ILE A 1  466 ? 38.454 178.831 -22.963 1.00 110.67 ? 539  ILE A O   1 
ATOM   3621 C  CB  . ILE A 1  466 ? 38.927 180.419 -25.654 1.00 138.85 ? 539  ILE A CB  1 
ATOM   3622 C  CG1 . ILE A 1  466 ? 39.679 179.109 -25.893 1.00 130.09 ? 539  ILE A CG1 1 
ATOM   3623 C  CG2 . ILE A 1  466 ? 39.840 181.443 -24.994 1.00 147.65 ? 539  ILE A CG2 1 
ATOM   3624 C  CD1 . ILE A 1  466 ? 40.891 179.258 -26.785 1.00 134.47 ? 539  ILE A CD1 1 
ATOM   3625 N  N   . CYS A 1  467 ? 37.857 180.949 -22.501 1.00 156.55 ? 540  CYS A N   1 
ATOM   3626 C  CA  . CYS A 1  467 ? 38.107 180.819 -21.072 1.00 153.13 ? 540  CYS A CA  1 
ATOM   3627 C  C   . CYS A 1  467 ? 36.936 180.131 -20.382 1.00 148.62 ? 540  CYS A C   1 
ATOM   3628 O  O   . CYS A 1  467 ? 37.127 179.282 -19.513 1.00 158.78 ? 540  CYS A O   1 
ATOM   3629 C  CB  . CYS A 1  467 ? 38.363 182.188 -20.438 1.00 153.11 ? 540  CYS A CB  1 
ATOM   3630 S  SG  . CYS A 1  467 ? 40.034 182.829 -20.693 1.00 160.27 ? 540  CYS A SG  1 
ATOM   3631 N  N   . TRP A 1  468 ? 35.723 180.500 -20.779 1.00 139.24 ? 541  TRP A N   1 
ATOM   3632 C  CA  . TRP A 1  468 ? 34.521 179.916 -20.200 1.00 137.01 ? 541  TRP A CA  1 
ATOM   3633 C  C   . TRP A 1  468 ? 34.357 178.457 -20.612 1.00 149.56 ? 541  TRP A C   1 
ATOM   3634 O  O   . TRP A 1  468 ? 33.833 177.644 -19.851 1.00 153.35 ? 541  TRP A O   1 
ATOM   3635 C  CB  . TRP A 1  468 ? 33.287 180.713 -20.616 1.00 153.26 ? 541  TRP A CB  1 
ATOM   3636 C  CG  . TRP A 1  468 ? 33.311 182.138 -20.170 1.00 156.84 ? 541  TRP A CG  1 
ATOM   3637 C  CD1 . TRP A 1  468 ? 33.816 182.624 -19.000 1.00 140.12 ? 541  TRP A CD1 1 
ATOM   3638 C  CD2 . TRP A 1  468 ? 32.817 183.271 -20.895 1.00 151.16 ? 541  TRP A CD2 1 
ATOM   3639 N  NE1 . TRP A 1  468 ? 33.661 183.988 -18.948 1.00 150.62 ? 541  TRP A NE1 1 
ATOM   3640 C  CE2 . TRP A 1  468 ? 33.052 184.409 -20.100 1.00 143.37 ? 541  TRP A CE2 1 
ATOM   3641 C  CE3 . TRP A 1  468 ? 32.200 183.431 -22.139 1.00 164.82 ? 541  TRP A CE3 1 
ATOM   3642 C  CZ2 . TRP A 1  468 ? 32.689 185.689 -20.509 1.00 152.64 ? 541  TRP A CZ2 1 
ATOM   3643 C  CZ3 . TRP A 1  468 ? 31.840 184.702 -22.542 1.00 189.76 ? 541  TRP A CZ3 1 
ATOM   3644 C  CH2 . TRP A 1  468 ? 32.085 185.815 -21.729 1.00 184.65 ? 541  TRP A CH2 1 
ATOM   3645 N  N   . VAL A 1  469 ? 34.808 178.132 -21.819 1.00 146.95 ? 542  VAL A N   1 
ATOM   3646 C  CA  . VAL A 1  469 ? 34.627 176.791 -22.361 1.00 138.84 ? 542  VAL A CA  1 
ATOM   3647 C  C   . VAL A 1  469 ? 35.534 175.770 -21.680 1.00 148.79 ? 542  VAL A C   1 
ATOM   3648 O  O   . VAL A 1  469 ? 35.073 174.706 -21.266 1.00 157.40 ? 542  VAL A O   1 
ATOM   3649 C  CB  . VAL A 1  469 ? 34.855 176.777 -23.885 1.00 123.28 ? 542  VAL A CB  1 
ATOM   3650 C  CG1 . VAL A 1  469 ? 35.023 175.352 -24.387 1.00 128.05 ? 542  VAL A CG1 1 
ATOM   3651 C  CG2 . VAL A 1  469 ? 33.692 177.447 -24.597 1.00 128.23 ? 542  VAL A CG2 1 
ATOM   3652 N  N   . ALA A 1  470 ? 36.819 176.089 -21.553 1.00 152.47 ? 543  ALA A N   1 
ATOM   3653 C  CA  . ALA A 1  470 ? 37.783 175.099 -21.083 1.00 167.87 ? 543  ALA A CA  1 
ATOM   3654 C  C   . ALA A 1  470 ? 38.751 175.549 -19.989 1.00 174.78 ? 543  ALA A C   1 
ATOM   3655 O  O   . ALA A 1  470 ? 39.141 174.752 -19.137 1.00 193.29 ? 543  ALA A O   1 
ATOM   3656 C  CB  . ALA A 1  470 ? 38.658 174.645 -22.245 1.00 174.36 ? 543  ALA A CB  1 
ATOM   3657 N  N   . ILE A 1  471 ? 39.135 176.821 -20.017 1.00 154.01 ? 544  ILE A N   1 
ATOM   3658 C  CA  . ILE A 1  471 ? 40.155 177.320 -19.097 1.00 123.31 ? 544  ILE A CA  1 
ATOM   3659 C  C   . ILE A 1  471 ? 39.677 177.368 -17.645 1.00 124.98 ? 544  ILE A C   1 
ATOM   3660 O  O   . ILE A 1  471 ? 40.409 176.983 -16.735 1.00 151.98 ? 544  ILE A O   1 
ATOM   3661 C  CB  . ILE A 1  471 ? 40.652 178.706 -19.539 1.00 129.00 ? 544  ILE A CB  1 
ATOM   3662 C  CG1 . ILE A 1  471 ? 41.101 178.667 -21.000 1.00 137.52 ? 544  ILE A CG1 1 
ATOM   3663 C  CG2 . ILE A 1  471 ? 41.798 179.167 -18.657 1.00 107.79 ? 544  ILE A CG2 1 
ATOM   3664 C  CD1 . ILE A 1  471 ? 42.239 177.707 -21.260 1.00 132.48 ? 544  ILE A CD1 1 
ATOM   3665 N  N   . SER A 1  472 ? 38.453 177.839 -17.429 1.00 134.91 ? 545  SER A N   1 
ATOM   3666 C  CA  . SER A 1  472 ? 37.921 177.984 -16.074 1.00 122.16 ? 545  SER A CA  1 
ATOM   3667 C  C   . SER A 1  472 ? 37.532 176.654 -15.398 1.00 142.68 ? 545  SER A C   1 
ATOM   3668 O  O   . SER A 1  472 ? 37.864 176.446 -14.225 1.00 154.55 ? 545  SER A O   1 
ATOM   3669 C  CB  . SER A 1  472 ? 36.721 178.939 -16.080 1.00 127.64 ? 545  SER A CB  1 
ATOM   3670 O  OG  . SER A 1  472 ? 37.109 180.239 -16.489 1.00 137.39 ? 545  SER A OG  1 
ATOM   3671 N  N   . PRO A 1  473 ? 36.822 175.755 -16.115 1.00 128.07 ? 546  PRO A N   1 
ATOM   3672 C  CA  . PRO A 1  473 ? 36.523 174.475 -15.459 1.00 121.85 ? 546  PRO A CA  1 
ATOM   3673 C  C   . PRO A 1  473 ? 37.778 173.690 -15.084 1.00 116.00 ? 546  PRO A C   1 
ATOM   3674 O  O   . PRO A 1  473 ? 37.814 173.060 -14.026 1.00 103.57 ? 546  PRO A O   1 
ATOM   3675 C  CB  . PRO A 1  473 ? 35.709 173.722 -16.516 1.00 133.26 ? 546  PRO A CB  1 
ATOM   3676 C  CG  . PRO A 1  473 ? 35.100 174.789 -17.348 1.00 132.34 ? 546  PRO A CG  1 
ATOM   3677 C  CD  . PRO A 1  473 ? 36.142 175.861 -17.421 1.00 120.78 ? 546  PRO A CD  1 
ATOM   3678 N  N   . LEU A 1  474 ? 38.793 173.734 -15.942 1.00 125.71 ? 547  LEU A N   1 
ATOM   3679 C  CA  . LEU A 1  474 ? 40.068 173.089 -15.651 1.00 105.39 ? 547  LEU A CA  1 
ATOM   3680 C  C   . LEU A 1  474 ? 40.818 173.865 -14.576 1.00 100.77 ? 547  LEU A C   1 
ATOM   3681 O  O   . LEU A 1  474 ? 41.633 173.305 -13.842 1.00 140.60 ? 547  LEU A O   1 
ATOM   3682 C  CB  . LEU A 1  474 ? 40.920 172.977 -16.917 1.00 122.37 ? 547  LEU A CB  1 
ATOM   3683 C  CG  . LEU A 1  474 ? 40.380 172.059 -18.015 1.00 155.87 ? 547  LEU A CG  1 
ATOM   3684 C  CD1 . LEU A 1  474 ? 41.291 172.088 -19.232 1.00 178.84 ? 547  LEU A CD1 1 
ATOM   3685 C  CD2 . LEU A 1  474 ? 40.219 170.639 -17.496 1.00 150.45 ? 547  LEU A CD2 1 
ATOM   3686 N  N   . PHE A 1  475 ? 40.534 175.161 -14.492 1.00 95.06  ? 548  PHE A N   1 
ATOM   3687 C  CA  . PHE A 1  475 ? 41.136 176.023 -13.485 1.00 104.93 ? 548  PHE A CA  1 
ATOM   3688 C  C   . PHE A 1  475 ? 40.682 175.610 -12.089 1.00 108.05 ? 548  PHE A C   1 
ATOM   3689 O  O   . PHE A 1  475 ? 41.498 175.477 -11.177 1.00 117.25 ? 548  PHE A O   1 
ATOM   3690 C  CB  . PHE A 1  475 ? 40.784 177.489 -13.756 1.00 100.58 ? 548  PHE A CB  1 
ATOM   3691 C  CG  . PHE A 1  475 ? 41.185 178.427 -12.654 1.00 99.09  ? 548  PHE A CG  1 
ATOM   3692 C  CD1 . PHE A 1  475 ? 42.480 178.909 -12.574 1.00 112.38 ? 548  PHE A CD1 1 
ATOM   3693 C  CD2 . PHE A 1  475 ? 40.262 178.837 -11.704 1.00 97.21  ? 548  PHE A CD2 1 
ATOM   3694 C  CE1 . PHE A 1  475 ? 42.850 179.776 -11.564 1.00 106.39 ? 548  PHE A CE1 1 
ATOM   3695 C  CE2 . PHE A 1  475 ? 40.626 179.702 -10.691 1.00 95.90  ? 548  PHE A CE2 1 
ATOM   3696 C  CZ  . PHE A 1  475 ? 41.922 180.172 -10.621 1.00 108.58 ? 548  PHE A CZ  1 
ATOM   3697 N  N   . LEU A 1  476 ? 39.378 175.409 -11.925 1.00 99.49  ? 549  LEU A N   1 
ATOM   3698 C  CA  . LEU A 1  476 ? 38.843 174.940 -10.649 1.00 88.45  ? 549  LEU A CA  1 
ATOM   3699 C  C   . LEU A 1  476 ? 39.207 173.476 -10.424 1.00 87.43  ? 549  LEU A C   1 
ATOM   3700 O  O   . LEU A 1  476 ? 39.457 173.041 -9.292  1.00 90.33  ? 549  LEU A O   1 
ATOM   3701 C  CB  . LEU A 1  476 ? 37.326 175.117 -10.601 1.00 127.31 ? 549  LEU A CB  1 
ATOM   3702 C  CG  . LEU A 1  476 ? 36.818 176.545 -10.791 1.00 114.63 ? 549  LEU A CG  1 
ATOM   3703 C  CD1 . LEU A 1  476 ? 35.305 176.597 -10.651 1.00 96.95  ? 549  LEU A CD1 1 
ATOM   3704 C  CD2 . LEU A 1  476 ? 37.488 177.475 -9.797  1.00 92.44  ? 549  LEU A CD2 1 
ATOM   3705 N  N   . LEU A 1  477 ? 39.236 172.727 -11.520 1.00 104.16 ? 550  LEU A N   1 
ATOM   3706 C  CA  . LEU A 1  477 ? 39.531 171.302 -11.491 1.00 101.29 ? 550  LEU A CA  1 
ATOM   3707 C  C   . LEU A 1  477 ? 40.928 171.037 -10.939 1.00 97.11  ? 550  LEU A C   1 
ATOM   3708 O  O   . LEU A 1  477 ? 41.136 170.087 -10.184 1.00 104.14 ? 550  LEU A O   1 
ATOM   3709 C  CB  . LEU A 1  477 ? 39.401 170.709 -12.894 1.00 98.94  ? 550  LEU A CB  1 
ATOM   3710 C  CG  . LEU A 1  477 ? 39.198 169.199 -12.988 1.00 108.27 ? 550  LEU A CG  1 
ATOM   3711 C  CD1 . LEU A 1  477 ? 37.769 168.841 -12.618 1.00 100.31 ? 550  LEU A CD1 1 
ATOM   3712 C  CD2 . LEU A 1  477 ? 39.540 168.702 -14.381 1.00 129.51 ? 550  LEU A CD2 1 
ATOM   3713 N  N   . PHE A 1  478 ? 41.878 171.885 -11.321 1.00 111.40 ? 551  PHE A N   1 
ATOM   3714 C  CA  . PHE A 1  478 ? 43.260 171.750 -10.874 1.00 110.91 ? 551  PHE A CA  1 
ATOM   3715 C  C   . PHE A 1  478 ? 43.352 171.921 -9.361  1.00 101.32 ? 551  PHE A C   1 
ATOM   3716 O  O   . PHE A 1  478 ? 44.087 171.199 -8.686  1.00 115.51 ? 551  PHE A O   1 
ATOM   3717 C  CB  . PHE A 1  478 ? 44.154 172.776 -11.576 1.00 125.67 ? 551  PHE A CB  1 
ATOM   3718 C  CG  . PHE A 1  478 ? 45.604 172.378 -11.647 1.00 164.99 ? 551  PHE A CG  1 
ATOM   3719 C  CD1 . PHE A 1  478 ? 46.024 171.139 -11.191 1.00 178.72 ? 551  PHE A CD1 1 
ATOM   3720 C  CD2 . PHE A 1  478 ? 46.548 173.247 -12.171 1.00 177.84 ? 551  PHE A CD2 1 
ATOM   3721 C  CE1 . PHE A 1  478 ? 47.356 170.775 -11.257 1.00 186.75 ? 551  PHE A CE1 1 
ATOM   3722 C  CE2 . PHE A 1  478 ? 47.881 172.889 -12.239 1.00 186.92 ? 551  PHE A CE2 1 
ATOM   3723 C  CZ  . PHE A 1  478 ? 48.286 171.651 -11.781 1.00 193.72 ? 551  PHE A CZ  1 
ATOM   3724 N  N   . ILE A 1  479 ? 42.595 172.877 -8.835  1.00 84.22  ? 552  ILE A N   1 
ATOM   3725 C  CA  . ILE A 1  479 ? 42.613 173.177 -7.410  1.00 88.12  ? 552  ILE A CA  1 
ATOM   3726 C  C   . ILE A 1  479 ? 41.949 172.057 -6.617  1.00 113.92 ? 552  ILE A C   1 
ATOM   3727 O  O   . ILE A 1  479 ? 42.509 171.570 -5.629  1.00 111.70 ? 552  ILE A O   1 
ATOM   3728 C  CB  . ILE A 1  479 ? 41.933 174.524 -7.124  1.00 84.79  ? 552  ILE A CB  1 
ATOM   3729 C  CG1 . ILE A 1  479 ? 42.528 175.616 -8.014  1.00 84.26  ? 552  ILE A CG1 1 
ATOM   3730 C  CG2 . ILE A 1  479 ? 42.082 174.894 -5.659  1.00 81.64  ? 552  ILE A CG2 1 
ATOM   3731 C  CD1 . ILE A 1  479 ? 41.857 176.963 -7.859  1.00 102.28 ? 552  ILE A CD1 1 
ATOM   3732 N  N   . ILE A 1  480 ? 40.758 171.652 -7.052  1.00 143.41 ? 553  ILE A N   1 
ATOM   3733 C  CA  . ILE A 1  480 ? 40.027 170.577 -6.386  1.00 126.67 ? 553  ILE A CA  1 
ATOM   3734 C  C   . ILE A 1  480 ? 40.853 169.294 -6.375  1.00 115.52 ? 553  ILE A C   1 
ATOM   3735 O  O   . ILE A 1  480 ? 41.019 168.663 -5.329  1.00 98.02  ? 553  ILE A O   1 
ATOM   3736 C  CB  . ILE A 1  480 ? 38.653 170.345 -7.046  1.00 124.19 ? 553  ILE A CB  1 
ATOM   3737 C  CG1 . ILE A 1  480 ? 37.621 171.322 -6.485  1.00 109.35 ? 553  ILE A CG1 1 
ATOM   3738 C  CG2 . ILE A 1  480 ? 38.177 168.920 -6.818  1.00 138.10 ? 553  ILE A CG2 1 
ATOM   3739 C  CD1 . ILE A 1  480 ? 37.189 170.987 -5.072  1.00 116.92 ? 553  ILE A CD1 1 
ATOM   3740 N  N   . ALA A 1  481 ? 41.383 168.925 -7.537  1.00 124.26 ? 554  ALA A N   1 
ATOM   3741 C  CA  . ALA A 1  481 ? 42.192 167.718 -7.666  1.00 83.49  ? 554  ALA A CA  1 
ATOM   3742 C  C   . ALA A 1  481 ? 43.454 167.806 -6.817  1.00 82.37  ? 554  ALA A C   1 
ATOM   3743 O  O   . ALA A 1  481 ? 43.855 166.832 -6.180  1.00 102.69 ? 554  ALA A O   1 
ATOM   3744 C  CB  . ALA A 1  481 ? 42.553 167.478 -9.119  1.00 85.25  ? 554  ALA A CB  1 
ATOM   3745 N  N   . SER A 1  482 ? 44.076 168.981 -6.816  1.00 82.26  ? 555  SER A N   1 
ATOM   3746 C  CA  . SER A 1  482 ? 45.295 169.205 -6.050  1.00 84.45  ? 555  SER A CA  1 
ATOM   3747 C  C   . SER A 1  482 ? 45.056 169.026 -4.556  1.00 89.43  ? 555  SER A C   1 
ATOM   3748 O  O   . SER A 1  482 ? 45.876 168.432 -3.856  1.00 106.58 ? 555  SER A O   1 
ATOM   3749 C  CB  . SER A 1  482 ? 45.849 170.601 -6.325  1.00 98.14  ? 555  SER A CB  1 
ATOM   3750 O  OG  . SER A 1  482 ? 46.952 170.882 -5.480  1.00 153.27 ? 555  SER A OG  1 
ATOM   3751 N  N   . PHE A 1  483 ? 43.932 169.544 -4.071  1.00 79.09  ? 556  PHE A N   1 
ATOM   3752 C  CA  . PHE A 1  483 ? 43.593 169.424 -2.657  1.00 78.40  ? 556  PHE A CA  1 
ATOM   3753 C  C   . PHE A 1  483 ? 43.222 167.995 -2.283  1.00 85.11  ? 556  PHE A C   1 
ATOM   3754 O  O   . PHE A 1  483 ? 43.718 167.456 -1.293  1.00 118.26 ? 556  PHE A O   1 
ATOM   3755 C  CB  . PHE A 1  483 ? 42.444 170.365 -2.299  1.00 100.11 ? 556  PHE A CB  1 
ATOM   3756 C  CG  . PHE A 1  483 ? 41.940 170.201 -0.892  1.00 99.93  ? 556  PHE A CG  1 
ATOM   3757 C  CD1 . PHE A 1  483 ? 42.625 170.761 0.173   1.00 112.44 ? 556  PHE A CD1 1 
ATOM   3758 C  CD2 . PHE A 1  483 ? 40.776 169.493 -0.636  1.00 92.17  ? 556  PHE A CD2 1 
ATOM   3759 C  CE1 . PHE A 1  483 ? 42.163 170.613 1.468   1.00 88.18  ? 556  PHE A CE1 1 
ATOM   3760 C  CE2 . PHE A 1  483 ? 40.309 169.342 0.657   1.00 89.08  ? 556  PHE A CE2 1 
ATOM   3761 C  CZ  . PHE A 1  483 ? 41.003 169.903 1.710   1.00 108.14 ? 556  PHE A CZ  1 
ATOM   3762 N  N   . LEU A 1  484 ? 42.341 167.388 -3.073  1.00 98.41  ? 557  LEU A N   1 
ATOM   3763 C  CA  . LEU A 1  484 ? 41.871 166.035 -2.794  1.00 110.40 ? 557  LEU A CA  1 
ATOM   3764 C  C   . LEU A 1  484 ? 43.007 165.018 -2.859  1.00 111.09 ? 557  LEU A C   1 
ATOM   3765 O  O   . LEU A 1  484 ? 43.004 164.028 -2.127  1.00 106.98 ? 557  LEU A O   1 
ATOM   3766 C  CB  . LEU A 1  484 ? 40.758 165.642 -3.769  1.00 115.65 ? 557  LEU A CB  1 
ATOM   3767 C  CG  . LEU A 1  484 ? 39.437 166.407 -3.653  1.00 104.09 ? 557  LEU A CG  1 
ATOM   3768 C  CD1 . LEU A 1  484 ? 38.424 165.879 -4.657  1.00 138.79 ? 557  LEU A CD1 1 
ATOM   3769 C  CD2 . LEU A 1  484 ? 38.886 166.329 -2.237  1.00 100.84 ? 557  LEU A CD2 1 
ATOM   3770 N  N   . MET A 1  485 ? 43.978 165.267 -3.732  1.00 114.62 ? 558  MET A N   1 
ATOM   3771 C  CA  . MET A 1  485 ? 45.118 164.368 -3.881  1.00 113.03 ? 558  MET A CA  1 
ATOM   3772 C  C   . MET A 1  485 ? 46.076 164.458 -2.696  1.00 122.69 ? 558  MET A C   1 
ATOM   3773 O  O   . MET A 1  485 ? 46.723 163.474 -2.339  1.00 133.29 ? 558  MET A O   1 
ATOM   3774 C  CB  . MET A 1  485 ? 45.872 164.664 -5.179  1.00 114.86 ? 558  MET A CB  1 
ATOM   3775 C  CG  . MET A 1  485 ? 45.321 163.941 -6.396  1.00 104.03 ? 558  MET A CG  1 
ATOM   3776 S  SD  . MET A 1  485 ? 45.329 162.147 -6.197  1.00 87.38  ? 558  MET A SD  1 
ATOM   3777 C  CE  . MET A 1  485 ? 44.814 161.621 -7.831  1.00 115.52 ? 558  MET A CE  1 
ATOM   3778 N  N   . SER A 1  486 ? 46.170 165.639 -2.092  1.00 142.92 ? 559  SER A N   1 
ATOM   3779 C  CA  . SER A 1  486 ? 47.064 165.835 -0.955  1.00 129.50 ? 559  SER A CA  1 
ATOM   3780 C  C   . SER A 1  486 ? 46.562 166.920 -0.005  1.00 113.82 ? 559  SER A C   1 
ATOM   3781 O  O   . SER A 1  486 ? 47.004 168.066 -0.081  1.00 111.53 ? 559  SER A O   1 
ATOM   3782 C  CB  . SER A 1  486 ? 48.474 166.186 -1.439  1.00 146.43 ? 559  SER A CB  1 
ATOM   3783 O  OG  . SER A 1  486 ? 49.041 165.123 -2.183  1.00 192.64 ? 559  SER A OG  1 
ATOM   3784 N  N   . PRO A 1  487 ? 45.633 166.557 0.893   1.00 110.56 ? 560  PRO A N   1 
ATOM   3785 C  CA  . PRO A 1  487 ? 45.157 167.480 1.929   1.00 77.28  ? 560  PRO A CA  1 
ATOM   3786 C  C   . PRO A 1  487 ? 46.279 167.891 2.878   1.00 74.59  ? 560  PRO A C   1 
ATOM   3787 O  O   . PRO A 1  487 ? 46.988 167.027 3.394   1.00 141.73 ? 560  PRO A O   1 
ATOM   3788 C  CB  . PRO A 1  487 ? 44.089 166.665 2.665   1.00 83.07  ? 560  PRO A CB  1 
ATOM   3789 C  CG  . PRO A 1  487 ? 43.665 165.619 1.687   1.00 110.08 ? 560  PRO A CG  1 
ATOM   3790 C  CD  . PRO A 1  487 ? 44.904 165.278 0.921   1.00 119.36 ? 560  PRO A CD  1 
ATOM   3791 N  N   . PRO A 1  488 ? 46.439 169.202 3.103   1.00 74.14  ? 561  PRO A N   1 
ATOM   3792 C  CA  . PRO A 1  488 ? 47.522 169.739 3.935   1.00 113.91 ? 561  PRO A CA  1 
ATOM   3793 C  C   . PRO A 1  488 ? 47.382 169.390 5.414   1.00 112.41 ? 561  PRO A C   1 
ATOM   3794 O  O   . PRO A 1  488 ? 46.271 169.378 5.945   1.00 112.42 ? 561  PRO A O   1 
ATOM   3795 C  CB  . PRO A 1  488 ? 47.403 171.252 3.725   1.00 108.24 ? 561  PRO A CB  1 
ATOM   3796 C  CG  . PRO A 1  488 ? 45.976 171.468 3.364   1.00 93.96  ? 561  PRO A CG  1 
ATOM   3797 C  CD  . PRO A 1  488 ? 45.578 170.267 2.560   1.00 96.24  ? 561  PRO A CD  1 
ATOM   3798 N  N   . GLN A 1  489 ? 48.506 169.107 6.065   1.00 129.00 ? 562  GLN A N   1 
ATOM   3799 C  CA  . GLN A 1  489 ? 48.521 168.832 7.497   1.00 108.63 ? 562  GLN A CA  1 
ATOM   3800 C  C   . GLN A 1  489 ? 48.231 170.111 8.275   1.00 99.19  ? 562  GLN A C   1 
ATOM   3801 O  O   . GLN A 1  489 ? 48.882 171.134 8.063   1.00 132.11 ? 562  GLN A O   1 
ATOM   3802 C  CB  . GLN A 1  489 ? 49.869 168.245 7.922   1.00 120.75 ? 562  GLN A CB  1 
ATOM   3803 C  CG  . GLN A 1  489 ? 49.957 167.886 9.397   1.00 136.75 ? 562  GLN A CG  1 
ATOM   3804 C  CD  . GLN A 1  489 ? 49.137 166.662 9.750   1.00 153.43 ? 562  GLN A CD  1 
ATOM   3805 O  OE1 . GLN A 1  489 ? 49.001 165.738 8.948   1.00 180.57 ? 562  GLN A OE1 1 
ATOM   3806 N  NE2 . GLN A 1  489 ? 48.581 166.650 10.957  1.00 128.72 ? 562  GLN A NE2 1 
ATOM   3807 N  N   . LEU A 1  490 ? 47.255 170.051 9.174   1.00 93.89  ? 563  LEU A N   1 
ATOM   3808 C  CA  . LEU A 1  490 ? 46.844 171.231 9.926   1.00 78.70  ? 563  LEU A CA  1 
ATOM   3809 C  C   . LEU A 1  490 ? 47.628 171.388 11.226  1.00 98.66  ? 563  LEU A C   1 
ATOM   3810 O  O   . LEU A 1  490 ? 47.933 170.407 11.904  1.00 104.00 ? 563  LEU A O   1 
ATOM   3811 C  CB  . LEU A 1  490 ? 45.346 171.175 10.228  1.00 79.63  ? 563  LEU A CB  1 
ATOM   3812 C  CG  . LEU A 1  490 ? 44.409 171.145 9.021   1.00 72.53  ? 563  LEU A CG  1 
ATOM   3813 C  CD1 . LEU A 1  490 ? 42.964 171.317 9.461   1.00 72.99  ? 563  LEU A CD1 1 
ATOM   3814 C  CD2 . LEU A 1  490 ? 44.800 172.216 8.021   1.00 82.38  ? 563  LEU A CD2 1 
ATOM   3815 N  N   . ARG A 1  491 ? 47.945 172.634 11.564  1.00 90.43  ? 564  ARG A N   1 
ATOM   3816 C  CA  . ARG A 1  491 ? 48.663 172.949 12.794  1.00 93.33  ? 564  ARG A CA  1 
ATOM   3817 C  C   . ARG A 1  491 ? 48.305 174.352 13.277  1.00 98.01  ? 564  ARG A C   1 
ATOM   3818 O  O   . ARG A 1  491 ? 48.216 175.287 12.480  1.00 131.05 ? 564  ARG A O   1 
ATOM   3819 C  CB  . ARG A 1  491 ? 50.175 172.830 12.583  1.00 136.20 ? 564  ARG A CB  1 
ATOM   3820 C  CG  . ARG A 1  491 ? 51.005 173.267 13.780  1.00 138.20 ? 564  ARG A CG  1 
ATOM   3821 C  CD  . ARG A 1  491 ? 52.492 173.213 13.479  1.00 129.36 ? 564  ARG A CD  1 
ATOM   3822 N  NE  . ARG A 1  491 ? 53.289 173.746 14.580  1.00 140.07 ? 564  ARG A NE  1 
ATOM   3823 C  CZ  . ARG A 1  491 ? 53.710 173.026 15.616  1.00 150.21 ? 564  ARG A CZ  1 
ATOM   3824 N  NH1 . ARG A 1  491 ? 54.431 173.595 16.572  1.00 172.91 ? 564  ARG A NH1 1 
ATOM   3825 N  NH2 . ARG A 1  491 ? 53.408 171.737 15.696  1.00 149.89 ? 564  ARG A NH2 1 
ATOM   3826 N  N   . LEU A 1  492 ? 48.096 174.493 14.583  1.00 81.44  ? 565  LEU A N   1 
ATOM   3827 C  CA  . LEU A 1  492 ? 47.743 175.783 15.166  1.00 86.95  ? 565  LEU A CA  1 
ATOM   3828 C  C   . LEU A 1  492 ? 48.147 175.865 16.635  1.00 94.01  ? 565  LEU A C   1 
ATOM   3829 O  O   . LEU A 1  492 ? 47.734 175.035 17.444  1.00 119.45 ? 565  LEU A O   1 
ATOM   3830 C  CB  . LEU A 1  492 ? 46.241 176.039 15.026  1.00 76.96  ? 565  LEU A CB  1 
ATOM   3831 C  CG  . LEU A 1  492 ? 45.723 177.349 15.621  1.00 76.15  ? 565  LEU A CG  1 
ATOM   3832 C  CD1 . LEU A 1  492 ? 46.306 178.542 14.881  1.00 99.40  ? 565  LEU A CD1 1 
ATOM   3833 C  CD2 . LEU A 1  492 ? 44.204 177.389 15.600  1.00 79.72  ? 565  LEU A CD2 1 
ATOM   3834 N  N   . PHE A 1  493 ? 48.954 176.873 16.964  1.00 93.75  ? 566  PHE A N   1 
ATOM   3835 C  CA  . PHE A 1  493 ? 49.382 177.134 18.340  1.00 124.15 ? 566  PHE A CA  1 
ATOM   3836 C  C   . PHE A 1  493 ? 50.035 175.924 18.999  1.00 135.89 ? 566  PHE A C   1 
ATOM   3837 O  O   . PHE A 1  493 ? 49.569 175.449 20.036  1.00 145.31 ? 566  PHE A O   1 
ATOM   3838 C  CB  . PHE A 1  493 ? 48.196 177.601 19.187  1.00 121.87 ? 566  PHE A CB  1 
ATOM   3839 C  CG  . PHE A 1  493 ? 47.761 179.006 18.896  1.00 124.63 ? 566  PHE A CG  1 
ATOM   3840 C  CD1 . PHE A 1  493 ? 48.679 179.952 18.471  1.00 133.85 ? 566  PHE A CD1 1 
ATOM   3841 C  CD2 . PHE A 1  493 ? 46.437 179.381 19.044  1.00 131.39 ? 566  PHE A CD2 1 
ATOM   3842 C  CE1 . PHE A 1  493 ? 48.284 181.247 18.202  1.00 157.15 ? 566  PHE A CE1 1 
ATOM   3843 C  CE2 . PHE A 1  493 ? 46.036 180.675 18.775  1.00 137.70 ? 566  PHE A CE2 1 
ATOM   3844 C  CZ  . PHE A 1  493 ? 46.961 181.610 18.354  1.00 155.76 ? 566  PHE A CZ  1 
ATOM   3845 N  N   . GLN A 1  494 ? 51.113 175.438 18.388  1.00 126.71 ? 567  GLN A N   1 
ATOM   3846 C  CA  . GLN A 1  494 ? 51.882 174.309 18.910  1.00 135.47 ? 567  GLN A CA  1 
ATOM   3847 C  C   . GLN A 1  494 ? 51.007 173.075 19.133  1.00 124.22 ? 567  GLN A C   1 
ATOM   3848 O  O   . GLN A 1  494 ? 51.285 172.256 20.011  1.00 125.21 ? 567  GLN A O   1 
ATOM   3849 C  CB  . GLN A 1  494 ? 52.584 174.697 20.217  1.00 159.24 ? 567  GLN A CB  1 
ATOM   3850 C  CG  . GLN A 1  494 ? 53.240 176.074 20.197  1.00 174.76 ? 567  GLN A CG  1 
ATOM   3851 C  CD  . GLN A 1  494 ? 54.318 176.205 19.137  1.00 202.69 ? 567  GLN A CD  1 
ATOM   3852 O  OE1 . GLN A 1  494 ? 54.978 175.229 18.781  1.00 219.09 ? 567  GLN A OE1 1 
ATOM   3853 N  NE2 . GLN A 1  494 ? 54.501 177.418 18.628  1.00 200.83 ? 567  GLN A NE2 1 
ATOM   3854 N  N   . TYR A 1  495 ? 49.952 172.947 18.334  1.00 119.96 ? 568  TYR A N   1 
ATOM   3855 C  CA  . TYR A 1  495 ? 49.028 171.824 18.451  1.00 100.90 ? 568  TYR A CA  1 
ATOM   3856 C  C   . TYR A 1  495 ? 48.754 171.190 17.093  1.00 94.66  ? 568  TYR A C   1 
ATOM   3857 O  O   . TYR A 1  495 ? 48.150 171.812 16.218  1.00 111.37 ? 568  TYR A O   1 
ATOM   3858 C  CB  . TYR A 1  495 ? 47.713 172.274 19.097  1.00 102.70 ? 568  TYR A CB  1 
ATOM   3859 C  CG  . TYR A 1  495 ? 46.590 171.265 18.980  1.00 101.63 ? 568  TYR A CG  1 
ATOM   3860 C  CD1 . TYR A 1  495 ? 46.551 170.141 19.795  1.00 146.81 ? 568  TYR A CD1 1 
ATOM   3861 C  CD2 . TYR A 1  495 ? 45.564 171.443 18.061  1.00 100.57 ? 568  TYR A CD2 1 
ATOM   3862 C  CE1 . TYR A 1  495 ? 45.525 169.219 19.692  1.00 158.87 ? 568  TYR A CE1 1 
ATOM   3863 C  CE2 . TYR A 1  495 ? 44.535 170.526 17.951  1.00 101.97 ? 568  TYR A CE2 1 
ATOM   3864 C  CZ  . TYR A 1  495 ? 44.520 169.417 18.769  1.00 124.45 ? 568  TYR A CZ  1 
ATOM   3865 O  OH  . TYR A 1  495 ? 43.497 168.503 18.663  1.00 107.91 ? 568  TYR A OH  1 
ATOM   3866 N  N   . ASN A 1  496 ? 49.201 169.950 16.924  1.00 94.22  ? 569  ASN A N   1 
ATOM   3867 C  CA  . ASN A 1  496 ? 48.978 169.222 15.681  1.00 101.12 ? 569  ASN A CA  1 
ATOM   3868 C  C   . ASN A 1  496 ? 47.613 168.546 15.690  1.00 107.95 ? 569  ASN A C   1 
ATOM   3869 O  O   . ASN A 1  496 ? 47.196 167.974 16.699  1.00 86.18  ? 569  ASN A O   1 
ATOM   3870 C  CB  . ASN A 1  496 ? 50.082 168.187 15.458  1.00 117.16 ? 569  ASN A CB  1 
ATOM   3871 C  CG  . ASN A 1  496 ? 51.448 168.821 15.292  1.00 133.14 ? 569  ASN A CG  1 
ATOM   3872 O  OD1 . ASN A 1  496 ? 51.836 169.207 14.190  1.00 144.35 ? 569  ASN A OD1 1 
ATOM   3873 N  ND2 . ASN A 1  496 ? 52.186 168.931 16.390  1.00 162.96 ? 569  ASN A ND2 1 
ATOM   3874 N  N   . TYR A 1  497 ? 46.920 168.617 14.559  1.00 72.73  ? 570  TYR A N   1 
ATOM   3875 C  CA  . TYR A 1  497 ? 45.579 168.061 14.443  1.00 72.95  ? 570  TYR A CA  1 
ATOM   3876 C  C   . TYR A 1  497 ? 45.610 166.545 14.324  1.00 92.60  ? 570  TYR A C   1 
ATOM   3877 O  O   . TYR A 1  497 ? 46.515 165.984 13.705  1.00 96.03  ? 570  TYR A O   1 
ATOM   3878 C  CB  . TYR A 1  497 ? 44.855 168.667 13.240  1.00 72.72  ? 570  TYR A CB  1 
ATOM   3879 C  CG  . TYR A 1  497 ? 44.347 170.068 13.481  1.00 73.73  ? 570  TYR A CG  1 
ATOM   3880 C  CD1 . TYR A 1  497 ? 45.228 171.115 13.717  1.00 96.47  ? 570  TYR A CD1 1 
ATOM   3881 C  CD2 . TYR A 1  497 ? 42.987 170.347 13.469  1.00 73.30  ? 570  TYR A CD2 1 
ATOM   3882 C  CE1 . TYR A 1  497 ? 44.771 172.395 13.937  1.00 95.44  ? 570  TYR A CE1 1 
ATOM   3883 C  CE2 . TYR A 1  497 ? 42.520 171.627 13.688  1.00 93.68  ? 570  TYR A CE2 1 
ATOM   3884 C  CZ  . TYR A 1  497 ? 43.418 172.646 13.921  1.00 76.46  ? 570  TYR A CZ  1 
ATOM   3885 O  OH  . TYR A 1  497 ? 42.966 173.923 14.139  1.00 78.21  ? 570  TYR A OH  1 
ATOM   3886 N  N   . PRO A 1  498 ? 44.616 165.876 14.928  1.00 88.69  ? 571  PRO A N   1 
ATOM   3887 C  CA  . PRO A 1  498 ? 44.483 164.418 14.857  1.00 86.07  ? 571  PRO A CA  1 
ATOM   3888 C  C   . PRO A 1  498 ? 44.319 163.919 13.425  1.00 106.22 ? 571  PRO A C   1 
ATOM   3889 O  O   . PRO A 1  498 ? 43.942 164.687 12.540  1.00 126.98 ? 571  PRO A O   1 
ATOM   3890 C  CB  . PRO A 1  498 ? 43.222 164.142 15.678  1.00 87.67  ? 571  PRO A CB  1 
ATOM   3891 C  CG  . PRO A 1  498 ? 43.100 165.312 16.594  1.00 88.52  ? 571  PRO A CG  1 
ATOM   3892 C  CD  . PRO A 1  498 ? 43.594 166.479 15.800  1.00 91.26  ? 571  PRO A CD  1 
ATOM   3893 N  N   . TYR A 1  499 ? 44.597 162.638 13.209  1.00 116.21 ? 572  TYR A N   1 
ATOM   3894 C  CA  . TYR A 1  499 ? 44.533 162.050 11.878  1.00 111.96 ? 572  TYR A CA  1 
ATOM   3895 C  C   . TYR A 1  499 ? 43.101 161.989 11.352  1.00 103.72 ? 572  TYR A C   1 
ATOM   3896 O  O   . TYR A 1  499 ? 42.877 162.008 10.142  1.00 125.97 ? 572  TYR A O   1 
ATOM   3897 C  CB  . TYR A 1  499 ? 45.154 160.650 11.886  1.00 142.93 ? 572  TYR A CB  1 
ATOM   3898 C  CG  . TYR A 1  499 ? 44.523 159.693 12.875  1.00 157.92 ? 572  TYR A CG  1 
ATOM   3899 C  CD1 . TYR A 1  499 ? 44.933 159.662 14.203  1.00 175.95 ? 572  TYR A CD1 1 
ATOM   3900 C  CD2 . TYR A 1  499 ? 43.525 158.813 12.479  1.00 139.89 ? 572  TYR A CD2 1 
ATOM   3901 C  CE1 . TYR A 1  499 ? 44.360 158.788 15.108  1.00 167.78 ? 572  TYR A CE1 1 
ATOM   3902 C  CE2 . TYR A 1  499 ? 42.948 157.936 13.375  1.00 142.19 ? 572  TYR A CE2 1 
ATOM   3903 C  CZ  . TYR A 1  499 ? 43.368 157.927 14.688  1.00 140.80 ? 572  TYR A CZ  1 
ATOM   3904 O  OH  . TYR A 1  499 ? 42.795 157.053 15.583  1.00 142.37 ? 572  TYR A OH  1 
ATOM   3905 N  N   . TRP A 1  500 ? 42.136 161.927 12.265  1.00 103.58 ? 573  TRP A N   1 
ATOM   3906 C  CA  . TRP A 1  500 ? 40.732 161.794 11.887  1.00 82.59  ? 573  TRP A CA  1 
ATOM   3907 C  C   . TRP A 1  500 ? 40.081 163.133 11.554  1.00 77.75  ? 573  TRP A C   1 
ATOM   3908 O  O   . TRP A 1  500 ? 38.903 163.181 11.196  1.00 107.01 ? 573  TRP A O   1 
ATOM   3909 C  CB  . TRP A 1  500 ? 39.941 161.102 13.002  1.00 82.15  ? 573  TRP A CB  1 
ATOM   3910 C  CG  . TRP A 1  500 ? 40.115 161.729 14.354  1.00 86.28  ? 573  TRP A CG  1 
ATOM   3911 C  CD1 . TRP A 1  500 ? 40.955 161.313 15.345  1.00 93.16  ? 573  TRP A CD1 1 
ATOM   3912 C  CD2 . TRP A 1  500 ? 39.430 162.882 14.866  1.00 78.26  ? 573  TRP A CD2 1 
ATOM   3913 N  NE1 . TRP A 1  500 ? 40.836 162.132 16.441  1.00 105.36 ? 573  TRP A NE1 1 
ATOM   3914 C  CE2 . TRP A 1  500 ? 39.909 163.103 16.172  1.00 78.22  ? 573  TRP A CE2 1 
ATOM   3915 C  CE3 . TRP A 1  500 ? 38.461 163.745 14.347  1.00 113.55 ? 573  TRP A CE3 1 
ATOM   3916 C  CZ2 . TRP A 1  500 ? 39.452 164.154 16.966  1.00 78.21  ? 573  TRP A CZ2 1 
ATOM   3917 C  CZ3 . TRP A 1  500 ? 38.010 164.789 15.137  1.00 98.28  ? 573  TRP A CZ3 1 
ATOM   3918 C  CH2 . TRP A 1  500 ? 38.505 164.983 16.432  1.00 82.48  ? 573  TRP A CH2 1 
ATOM   3919 N  N   . SER A 1  501 ? 40.844 164.214 11.678  1.00 88.89  ? 574  SER A N   1 
ATOM   3920 C  CA  . SER A 1  501 ? 40.330 165.553 11.409  1.00 76.34  ? 574  SER A CA  1 
ATOM   3921 C  C   . SER A 1  501 ? 39.776 165.657 9.992   1.00 75.56  ? 574  SER A C   1 
ATOM   3922 O  O   . SER A 1  501 ? 38.686 166.191 9.777   1.00 108.54 ? 574  SER A O   1 
ATOM   3923 C  CB  . SER A 1  501 ? 41.424 166.600 11.621  1.00 93.80  ? 574  SER A CB  1 
ATOM   3924 O  OG  . SER A 1  501 ? 41.907 166.571 12.953  1.00 104.48 ? 574  SER A OG  1 
ATOM   3925 N  N   . ILE A 1  502 ? 40.528 165.125 9.034   1.00 91.00  ? 575  ILE A N   1 
ATOM   3926 C  CA  . ILE A 1  502 ? 40.130 165.148 7.633   1.00 94.80  ? 575  ILE A CA  1 
ATOM   3927 C  C   . ILE A 1  502 ? 38.833 164.364 7.443   1.00 111.22 ? 575  ILE A C   1 
ATOM   3928 O  O   . ILE A 1  502 ? 38.049 164.651 6.538   1.00 108.28 ? 575  ILE A O   1 
ATOM   3929 C  CB  . ILE A 1  502 ? 41.256 164.602 6.728   1.00 92.92  ? 575  ILE A CB  1 
ATOM   3930 C  CG1 . ILE A 1  502 ? 40.903 164.788 5.250   1.00 76.10  ? 575  ILE A CG1 1 
ATOM   3931 C  CG2 . ILE A 1  502 ? 41.545 163.138 7.040   1.00 84.89  ? 575  ILE A CG2 1 
ATOM   3932 C  CD1 . ILE A 1  502 ? 40.694 166.231 4.853   1.00 75.56  ? 575  ILE A CD1 1 
ATOM   3933 N  N   . ILE A 1  503 ? 38.605 163.384 8.312   1.00 123.40 ? 576  ILE A N   1 
ATOM   3934 C  CA  . ILE A 1  503 ? 37.385 162.593 8.268   1.00 102.40 ? 576  ILE A CA  1 
ATOM   3935 C  C   . ILE A 1  503 ? 36.208 163.461 8.686   1.00 91.92  ? 576  ILE A C   1 
ATOM   3936 O  O   . ILE A 1  503 ? 35.115 163.350 8.133   1.00 97.68  ? 576  ILE A O   1 
ATOM   3937 C  CB  . ILE A 1  503 ? 37.492 161.349 9.162   1.00 91.01  ? 576  ILE A CB  1 
ATOM   3938 C  CG1 . ILE A 1  503 ? 38.773 160.578 8.847   1.00 119.81 ? 576  ILE A CG1 1 
ATOM   3939 C  CG2 . ILE A 1  503 ? 36.279 160.452 8.978   1.00 91.63  ? 576  ILE A CG2 1 
ATOM   3940 C  CD1 . ILE A 1  503 ? 39.000 159.391 9.750   1.00 137.18 ? 576  ILE A CD1 1 
ATOM   3941 N  N   . LEU A 1  504 ? 36.442 164.332 9.662   1.00 89.46  ? 577  LEU A N   1 
ATOM   3942 C  CA  . LEU A 1  504 ? 35.392 165.207 10.168  1.00 106.39 ? 577  LEU A CA  1 
ATOM   3943 C  C   . LEU A 1  504 ? 35.032 166.270 9.137   1.00 79.51  ? 577  LEU A C   1 
ATOM   3944 O  O   . LEU A 1  504 ? 33.866 166.414 8.766   1.00 80.83  ? 577  LEU A O   1 
ATOM   3945 C  CB  . LEU A 1  504 ? 35.823 165.861 11.482  1.00 79.02  ? 577  LEU A CB  1 
ATOM   3946 C  CG  . LEU A 1  504 ? 34.815 166.791 12.161  1.00 80.02  ? 577  LEU A CG  1 
ATOM   3947 C  CD1 . LEU A 1  504 ? 33.443 166.141 12.239  1.00 117.12 ? 577  LEU A CD1 1 
ATOM   3948 C  CD2 . LEU A 1  504 ? 35.301 167.169 13.549  1.00 79.75  ? 577  LEU A CD2 1 
ATOM   3949 N  N   . GLY A 1  505 ? 36.042 167.004 8.677   1.00 104.53 ? 578  GLY A N   1 
ATOM   3950 C  CA  . GLY A 1  505 ? 35.856 168.040 7.675   1.00 78.19  ? 578  GLY A CA  1 
ATOM   3951 C  C   . GLY A 1  505 ? 35.113 167.563 6.442   1.00 94.35  ? 578  GLY A C   1 
ATOM   3952 O  O   . GLY A 1  505 ? 34.119 168.170 6.038   1.00 115.64 ? 578  GLY A O   1 
ATOM   3953 N  N   . TYR A 1  506 ? 35.592 166.470 5.852   1.00 93.97  ? 579  TYR A N   1 
ATOM   3954 C  CA  . TYR A 1  506 ? 34.918 165.847 4.718   1.00 93.48  ? 579  TYR A CA  1 
ATOM   3955 C  C   . TYR A 1  506 ? 33.471 165.525 5.065   1.00 92.60  ? 579  TYR A C   1 
ATOM   3956 O  O   . TYR A 1  506 ? 32.567 165.744 4.258   1.00 100.23 ? 579  TYR A O   1 
ATOM   3957 C  CB  . TYR A 1  506 ? 35.643 164.572 4.283   1.00 106.57 ? 579  TYR A CB  1 
ATOM   3958 C  CG  . TYR A 1  506 ? 36.816 164.804 3.358   1.00 105.19 ? 579  TYR A CG  1 
ATOM   3959 C  CD1 . TYR A 1  506 ? 37.137 166.080 2.917   1.00 106.54 ? 579  TYR A CD1 1 
ATOM   3960 C  CD2 . TYR A 1  506 ? 37.594 163.742 2.915   1.00 89.35  ? 579  TYR A CD2 1 
ATOM   3961 C  CE1 . TYR A 1  506 ? 38.207 166.295 2.068   1.00 103.44 ? 579  TYR A CE1 1 
ATOM   3962 C  CE2 . TYR A 1  506 ? 38.664 163.946 2.065   1.00 102.80 ? 579  TYR A CE2 1 
ATOM   3963 C  CZ  . TYR A 1  506 ? 38.966 165.223 1.645   1.00 104.42 ? 579  TYR A CZ  1 
ATOM   3964 O  OH  . TYR A 1  506 ? 40.031 165.430 0.799   1.00 104.00 ? 579  TYR A OH  1 
ATOM   3965 N  N   . ALA A 1  507 ? 33.263 165.014 6.275   1.00 110.18 ? 580  ALA A N   1 
ATOM   3966 C  CA  . ALA A 1  507 ? 31.927 164.675 6.749   1.00 109.05 ? 580  ALA A CA  1 
ATOM   3967 C  C   . ALA A 1  507 ? 31.038 165.910 6.765   1.00 101.61 ? 580  ALA A C   1 
ATOM   3968 O  O   . ALA A 1  507 ? 29.842 165.828 6.487   1.00 122.38 ? 580  ALA A O   1 
ATOM   3969 C  CB  . ALA A 1  507 ? 31.995 164.052 8.131   1.00 107.49 ? 580  ALA A CB  1 
ATOM   3970 N  N   . ILE A 1  508 ? 31.630 167.055 7.088   1.00 96.99  ? 581  ILE A N   1 
ATOM   3971 C  CA  . ILE A 1  508 ? 30.899 168.312 7.086   1.00 84.60  ? 581  ILE A CA  1 
ATOM   3972 C  C   . ILE A 1  508 ? 30.800 168.814 5.652   1.00 99.06  ? 581  ILE A C   1 
ATOM   3973 O  O   . ILE A 1  508 ? 29.823 169.461 5.271   1.00 125.11 ? 581  ILE A O   1 
ATOM   3974 C  CB  . ILE A 1  508 ? 31.568 169.351 8.004   1.00 83.59  ? 581  ILE A CB  1 
ATOM   3975 C  CG1 . ILE A 1  508 ? 31.726 168.785 9.417   1.00 83.45  ? 581  ILE A CG1 1 
ATOM   3976 C  CG2 . ILE A 1  508 ? 30.759 170.639 8.039   1.00 85.03  ? 581  ILE A CG2 1 
ATOM   3977 C  CD1 . ILE A 1  508 ? 32.380 169.740 10.389  1.00 82.69  ? 581  ILE A CD1 1 
ATOM   3978 N  N   . GLY A 1  509 ? 31.814 168.496 4.854   1.00 116.00 ? 582  GLY A N   1 
ATOM   3979 C  CA  . GLY A 1  509 ? 31.851 168.920 3.468   1.00 128.84 ? 582  GLY A CA  1 
ATOM   3980 C  C   . GLY A 1  509 ? 30.813 168.229 2.608   1.00 126.39 ? 582  GLY A C   1 
ATOM   3981 O  O   . GLY A 1  509 ? 30.028 168.883 1.923   1.00 134.57 ? 582  GLY A O   1 
ATOM   3982 N  N   . THR A 1  510 ? 30.806 166.900 2.652   1.00 127.19 ? 583  THR A N   1 
ATOM   3983 C  CA  . THR A 1  510 ? 29.892 166.105 1.839   1.00 107.77 ? 583  THR A CA  1 
ATOM   3984 C  C   . THR A 1  510 ? 28.438 166.316 2.247   1.00 134.75 ? 583  THR A C   1 
ATOM   3985 O  O   . THR A 1  510 ? 27.544 166.284 1.404   1.00 162.40 ? 583  THR A O   1 
ATOM   3986 C  CB  . THR A 1  510 ? 30.222 164.604 1.928   1.00 111.83 ? 583  THR A CB  1 
ATOM   3987 O  OG1 . THR A 1  510 ? 30.084 164.163 3.285   1.00 142.14 ? 583  THR A OG1 1 
ATOM   3988 C  CG2 . THR A 1  510 ? 31.643 164.342 1.455   1.00 111.83 ? 583  THR A CG2 1 
ATOM   3989 N  N   . SER A 1  511 ? 28.208 166.543 3.537   1.00 111.31 ? 584  SER A N   1 
ATOM   3990 C  CA  . SER A 1  511 ? 26.852 166.690 4.061   1.00 105.61 ? 584  SER A CA  1 
ATOM   3991 C  C   . SER A 1  511 ? 26.217 168.022 3.668   1.00 115.05 ? 584  SER A C   1 
ATOM   3992 O  O   . SER A 1  511 ? 25.073 168.300 4.025   1.00 147.24 ? 584  SER A O   1 
ATOM   3993 C  CB  . SER A 1  511 ? 26.850 166.547 5.584   1.00 101.08 ? 584  SER A CB  1 
ATOM   3994 O  OG  . SER A 1  511 ? 27.604 167.580 6.194   1.00 118.39 ? 584  SER A OG  1 
ATOM   3995 N  N   . SER A 1  512 ? 26.962 168.842 2.936   1.00 134.17 ? 585  SER A N   1 
ATOM   3996 C  CA  . SER A 1  512 ? 26.457 170.131 2.483   1.00 134.09 ? 585  SER A CA  1 
ATOM   3997 C  C   . SER A 1  512 ? 25.777 170.010 1.124   1.00 144.52 ? 585  SER A C   1 
ATOM   3998 O  O   . SER A 1  512 ? 24.686 170.543 0.918   1.00 154.70 ? 585  SER A O   1 
ATOM   3999 C  CB  . SER A 1  512 ? 27.590 171.154 2.412   1.00 151.13 ? 585  SER A CB  1 
ATOM   4000 O  OG  . SER A 1  512 ? 28.563 170.769 1.456   1.00 173.10 ? 585  SER A OG  1 
ATOM   4001 N  N   . PHE A 1  513 ? 26.424 169.310 0.199   1.00 155.16 ? 586  PHE A N   1 
ATOM   4002 C  CA  . PHE A 1  513 ? 25.873 169.137 -1.140  1.00 159.10 ? 586  PHE A CA  1 
ATOM   4003 C  C   . PHE A 1  513 ? 25.013 167.894 -1.369  1.00 178.18 ? 586  PHE A C   1 
ATOM   4004 O  O   . PHE A 1  513 ? 24.663 167.573 -2.502  1.00 195.13 ? 586  PHE A O   1 
ATOM   4005 C  CB  . PHE A 1  513 ? 26.955 169.355 -2.208  1.00 134.93 ? 586  PHE A CB  1 
ATOM   4006 C  CG  . PHE A 1  513 ? 28.206 168.545 -1.996  1.00 127.99 ? 586  PHE A CG  1 
ATOM   4007 C  CD1 . PHE A 1  513 ? 28.339 167.286 -2.560  1.00 136.11 ? 586  PHE A CD1 1 
ATOM   4008 C  CD2 . PHE A 1  513 ? 29.259 169.053 -1.253  1.00 125.31 ? 586  PHE A CD2 1 
ATOM   4009 C  CE1 . PHE A 1  513 ? 29.488 166.544 -2.372  1.00 151.24 ? 586  PHE A CE1 1 
ATOM   4010 C  CE2 . PHE A 1  513 ? 30.412 168.315 -1.064  1.00 127.33 ? 586  PHE A CE2 1 
ATOM   4011 C  CZ  . PHE A 1  513 ? 30.524 167.059 -1.624  1.00 137.20 ? 586  PHE A CZ  1 
ATOM   4012 N  N   . ILE A 1  514 ? 24.671 167.203 -0.287  1.00 175.80 ? 587  ILE A N   1 
ATOM   4013 C  CA  . ILE A 1  514 ? 23.754 166.071 -0.366  1.00 183.81 ? 587  ILE A CA  1 
ATOM   4014 C  C   . ILE A 1  514 ? 22.424 166.339 -1.056  1.00 192.76 ? 587  ILE A C   1 
ATOM   4015 O  O   . ILE A 1  514 ? 21.700 165.411 -1.413  1.00 223.16 ? 587  ILE A O   1 
ATOM   4016 C  CB  . ILE A 1  514 ? 23.521 165.444 1.023   1.00 194.67 ? 587  ILE A CB  1 
ATOM   4017 C  CG1 . ILE A 1  514 ? 23.026 166.501 2.013   1.00 217.80 ? 587  ILE A CG1 1 
ATOM   4018 C  CG2 . ILE A 1  514 ? 24.782 164.758 1.524   1.00 189.95 ? 587  ILE A CG2 1 
ATOM   4019 C  CD1 . ILE A 1  514 ? 22.729 165.955 3.393   1.00 227.62 ? 587  ILE A CD1 1 
ATOM   4020 N  N   . CYS A 1  515 ? 22.112 167.617 -1.245  1.00 181.24 ? 588  CYS A N   1 
ATOM   4021 C  CA  . CYS A 1  515 ? 20.821 168.022 -1.786  1.00 196.57 ? 588  CYS A CA  1 
ATOM   4022 C  C   . CYS A 1  515 ? 20.790 168.019 -3.311  1.00 182.73 ? 588  CYS A C   1 
ATOM   4023 O  O   . CYS A 1  515 ? 19.724 167.889 -3.912  1.00 180.43 ? 588  CYS A O   1 
ATOM   4024 C  CB  . CYS A 1  515 ? 20.451 169.412 -1.266  1.00 199.13 ? 588  CYS A CB  1 
ATOM   4025 S  SG  . CYS A 1  515 ? 21.734 170.658 -1.515  1.00 179.41 ? 588  CYS A SG  1 
ATOM   4026 N  N   . ILE A 1  516 ? 21.953 168.163 -3.937  1.00 148.50 ? 589  ILE A N   1 
ATOM   4027 C  CA  . ILE A 1  516 ? 22.013 168.231 -5.394  1.00 152.30 ? 589  ILE A CA  1 
ATOM   4028 C  C   . ILE A 1  516 ? 21.883 166.847 -6.056  1.00 144.82 ? 589  ILE A C   1 
ATOM   4029 O  O   . ILE A 1  516 ? 21.128 166.710 -7.018  1.00 143.12 ? 589  ILE A O   1 
ATOM   4030 C  CB  . ILE A 1  516 ? 23.296 168.977 -5.867  1.00 121.91 ? 589  ILE A CB  1 
ATOM   4031 C  CG1 . ILE A 1  516 ? 23.295 169.183 -7.384  1.00 135.63 ? 589  ILE A CG1 1 
ATOM   4032 C  CG2 . ILE A 1  516 ? 24.557 168.275 -5.376  1.00 107.56 ? 589  ILE A CG2 1 
ATOM   4033 C  CD1 . ILE A 1  516 ? 24.343 170.161 -7.867  1.00 148.57 ? 589  ILE A CD1 1 
ATOM   4034 N  N   . PRO A 1  517 ? 22.592 165.812 -5.556  1.00 137.09 ? 590  PRO A N   1 
ATOM   4035 C  CA  . PRO A 1  517 ? 22.351 164.524 -6.217  1.00 148.08 ? 590  PRO A CA  1 
ATOM   4036 C  C   . PRO A 1  517 ? 20.974 163.955 -5.895  1.00 194.81 ? 590  PRO A C   1 
ATOM   4037 O  O   . PRO A 1  517 ? 20.329 163.361 -6.761  1.00 223.91 ? 590  PRO A O   1 
ATOM   4038 C  CB  . PRO A 1  517 ? 23.455 163.621 -5.651  1.00 146.70 ? 590  PRO A CB  1 
ATOM   4039 C  CG  . PRO A 1  517 ? 24.469 164.552 -5.078  1.00 172.52 ? 590  PRO A CG  1 
ATOM   4040 C  CD  . PRO A 1  517 ? 23.678 165.707 -4.568  1.00 158.79 ? 590  PRO A CD  1 
ATOM   4041 N  N   . THR A 1  518 ? 20.532 164.142 -4.656  1.00 183.39 ? 591  THR A N   1 
ATOM   4042 C  CA  . THR A 1  518 ? 19.224 163.659 -4.231  1.00 178.06 ? 591  THR A CA  1 
ATOM   4043 C  C   . THR A 1  518 ? 18.107 164.473 -4.878  1.00 195.24 ? 591  THR A C   1 
ATOM   4044 O  O   . THR A 1  518 ? 16.979 163.999 -5.005  1.00 214.22 ? 591  THR A O   1 
ATOM   4045 C  CB  . THR A 1  518 ? 19.073 163.710 -2.700  1.00 167.54 ? 591  THR A CB  1 
ATOM   4046 O  OG1 . THR A 1  518 ? 19.371 165.031 -2.231  1.00 172.07 ? 591  THR A OG1 1 
ATOM   4047 C  CG2 . THR A 1  518 ? 20.015 162.715 -2.039  1.00 185.83 ? 591  THR A CG2 1 
ATOM   4048 N  N   . TYR A 1  519 ? 18.427 165.697 -5.288  1.00 175.78 ? 592  TYR A N   1 
ATOM   4049 C  CA  . TYR A 1  519 ? 17.458 166.544 -5.973  1.00 161.98 ? 592  TYR A CA  1 
ATOM   4050 C  C   . TYR A 1  519 ? 17.398 166.185 -7.454  1.00 146.32 ? 592  TYR A C   1 
ATOM   4051 O  O   . TYR A 1  519 ? 16.335 166.246 -8.075  1.00 171.22 ? 592  TYR A O   1 
ATOM   4052 C  CB  . TYR A 1  519 ? 17.802 168.023 -5.797  1.00 161.12 ? 592  TYR A CB  1 
ATOM   4053 C  CG  . TYR A 1  519 ? 16.716 168.951 -6.290  1.00 155.01 ? 592  TYR A CG  1 
ATOM   4054 C  CD1 . TYR A 1  519 ? 15.644 169.292 -5.475  1.00 169.22 ? 592  TYR A CD1 1 
ATOM   4055 C  CD2 . TYR A 1  519 ? 16.757 169.482 -7.571  1.00 152.69 ? 592  TYR A CD2 1 
ATOM   4056 C  CE1 . TYR A 1  519 ? 14.646 170.137 -5.921  1.00 182.66 ? 592  TYR A CE1 1 
ATOM   4057 C  CE2 . TYR A 1  519 ? 15.765 170.326 -8.025  1.00 157.55 ? 592  TYR A CE2 1 
ATOM   4058 C  CZ  . TYR A 1  519 ? 14.712 170.651 -7.198  1.00 176.11 ? 592  TYR A CZ  1 
ATOM   4059 O  OH  . TYR A 1  519 ? 13.724 171.494 -7.652  1.00 176.84 ? 592  TYR A OH  1 
ATOM   4060 N  N   . ILE A 1  520 ? 18.547 165.819 -8.014  1.00 125.28 ? 593  ILE A N   1 
ATOM   4061 C  CA  . ILE A 1  520 ? 18.600 165.296 -9.373  1.00 128.60 ? 593  ILE A CA  1 
ATOM   4062 C  C   . ILE A 1  520 ? 17.782 164.013 -9.421  1.00 139.47 ? 593  ILE A C   1 
ATOM   4063 O  O   . ILE A 1  520 ? 17.034 163.773 -10.368 1.00 137.45 ? 593  ILE A O   1 
ATOM   4064 C  CB  . ILE A 1  520 ? 20.052 165.055 -9.835  1.00 114.77 ? 593  ILE A CB  1 
ATOM   4065 C  CG1 . ILE A 1  520 ? 20.757 166.387 -10.099 1.00 140.62 ? 593  ILE A CG1 1 
ATOM   4066 C  CG2 . ILE A 1  520 ? 20.086 164.181 -11.080 1.00 116.36 ? 593  ILE A CG2 1 
ATOM   4067 C  CD1 . ILE A 1  520 ? 22.196 166.238 -10.543 1.00 128.57 ? 593  ILE A CD1 1 
ATOM   4068 N  N   . ALA A 1  521 ? 17.920 163.199 -8.380  1.00 144.45 ? 594  ALA A N   1 
ATOM   4069 C  CA  . ALA A 1  521 ? 17.143 161.972 -8.259  1.00 156.75 ? 594  ALA A CA  1 
ATOM   4070 C  C   . ALA A 1  521 ? 15.672 162.287 -7.999  1.00 185.77 ? 594  ALA A C   1 
ATOM   4071 O  O   . ALA A 1  521 ? 14.790 161.506 -8.354  1.00 208.01 ? 594  ALA A O   1 
ATOM   4072 C  CB  . ALA A 1  521 ? 17.703 161.096 -7.150  1.00 157.37 ? 594  ALA A CB  1 
ATOM   4073 N  N   . TYR A 1  522 ? 15.416 163.436 -7.380  1.00 187.69 ? 595  TYR A N   1 
ATOM   4074 C  CA  . TYR A 1  522 ? 14.051 163.861 -7.087  1.00 196.62 ? 595  TYR A CA  1 
ATOM   4075 C  C   . TYR A 1  522 ? 13.306 164.220 -8.367  1.00 200.72 ? 595  TYR A C   1 
ATOM   4076 O  O   . TYR A 1  522 ? 12.185 163.766 -8.590  1.00 207.99 ? 595  TYR A O   1 
ATOM   4077 C  CB  . TYR A 1  522 ? 14.046 165.052 -6.126  1.00 202.68 ? 595  TYR A CB  1 
ATOM   4078 C  CG  . TYR A 1  522 ? 12.672 165.640 -5.882  1.00 221.76 ? 595  TYR A CG  1 
ATOM   4079 C  CD1 . TYR A 1  522 ? 11.794 165.053 -4.981  1.00 218.52 ? 595  TYR A CD1 1 
ATOM   4080 C  CD2 . TYR A 1  522 ? 12.255 166.785 -6.551  1.00 226.37 ? 595  TYR A CD2 1 
ATOM   4081 C  CE1 . TYR A 1  522 ? 10.538 165.586 -4.754  1.00 217.97 ? 595  TYR A CE1 1 
ATOM   4082 C  CE2 . TYR A 1  522 ? 11.002 167.325 -6.331  1.00 214.21 ? 595  TYR A CE2 1 
ATOM   4083 C  CZ  . TYR A 1  522 ? 10.148 166.722 -5.431  1.00 218.70 ? 595  TYR A CZ  1 
ATOM   4084 O  OH  . TYR A 1  522 ? 8.900  167.256 -5.208  1.00 228.12 ? 595  TYR A OH  1 
ATOM   4085 N  N   . ARG A 1  523 ? 13.910 165.073 -9.174  1.00 191.43 ? 596  ARG A N   1 
ATOM   4086 C  CA  . ARG A 1  523 ? 13.311 165.418 -10.441 1.00 198.81 ? 596  ARG A CA  1 
ATOM   4087 C  C   . ARG A 1  523 ? 13.250 164.196 -11.339 1.00 221.36 ? 596  ARG A C   1 
ATOM   4088 O  O   . ARG A 1  523 ? 12.244 163.943 -11.985 1.00 219.25 ? 596  ARG A O   1 
ATOM   4089 C  CB  . ARG A 1  523 ? 14.119 166.511 -11.113 1.00 198.24 ? 596  ARG A CB  1 
ATOM   4090 C  CG  . ARG A 1  523 ? 13.609 166.860 -12.492 1.00 217.68 ? 596  ARG A CG  1 
ATOM   4091 C  CD  . ARG A 1  523 ? 12.402 167.766 -12.398 1.00 223.60 ? 596  ARG A CD  1 
ATOM   4092 N  NE  . ARG A 1  523 ? 12.537 168.725 -11.312 1.00 217.04 ? 596  ARG A NE  1 
ATOM   4093 C  CZ  . ARG A 1  523 ? 12.461 170.039 -11.472 1.00 208.24 ? 596  ARG A CZ  1 
ATOM   4094 N  NH1 . ARG A 1  523 ? 12.591 170.842 -10.429 1.00 212.74 ? 596  ARG A NH1 1 
ATOM   4095 N  NH2 . ARG A 1  523 ? 12.255 170.549 -12.675 1.00 196.90 ? 596  ARG A NH2 1 
ATOM   4096 N  N   . LEU A 1  524 ? 14.332 163.428 -11.354 1.00 222.43 ? 597  LEU A N   1 
ATOM   4097 C  CA  . LEU A 1  524 ? 14.451 162.280 -12.244 1.00 204.96 ? 597  LEU A CA  1 
ATOM   4098 C  C   . LEU A 1  524 ? 13.484 161.175 -11.833 1.00 196.05 ? 597  LEU A C   1 
ATOM   4099 O  O   . LEU A 1  524 ? 13.202 160.263 -12.610 1.00 194.99 ? 597  LEU A O   1 
ATOM   4100 C  CB  . LEU A 1  524 ? 15.886 161.752 -12.254 1.00 183.11 ? 597  LEU A CB  1 
ATOM   4101 N  N   . ILE A 1  525 ? 12.979 161.264 -10.607 1.00 192.65 ? 598  ILE A N   1 
ATOM   4102 C  CA  . ILE A 1  525 ? 12.036 160.279 -10.093 1.00 192.52 ? 598  ILE A CA  1 
ATOM   4103 C  C   . ILE A 1  525 ? 10.623 160.853 -10.082 1.00 188.44 ? 598  ILE A C   1 
ATOM   4104 O  O   . ILE A 1  525 ? 9.651  160.131 -9.858  1.00 173.53 ? 598  ILE A O   1 
ATOM   4105 C  CB  . ILE A 1  525 ? 12.441 159.803 -8.687  1.00 172.17 ? 598  ILE A CB  1 
ATOM   4106 N  N   . ILE A 1  526 ? 10.516 162.154 -10.328 1.00 185.03 ? 599  ILE A N   1 
ATOM   4107 C  CA  . ILE A 1  526 ? 9.227  162.832 -10.318 1.00 164.36 ? 599  ILE A CA  1 
ATOM   4108 C  C   . ILE A 1  526 ? 8.671  162.950 -11.733 1.00 179.38 ? 599  ILE A C   1 
ATOM   4109 O  O   . ILE A 1  526 ? 7.482  162.730 -11.960 1.00 183.85 ? 599  ILE A O   1 
ATOM   4110 C  CB  . ILE A 1  526 ? 9.334  164.218 -9.660  1.00 145.94 ? 599  ILE A CB  1 
ATOM   4111 N  N   . THR A 1  527 ? 9.537  163.298 -12.679 1.00 224.56 ? 600  THR A N   1 
ATOM   4112 C  CA  . THR A 1  527 ? 9.127  163.475 -14.068 1.00 247.32 ? 600  THR A CA  1 
ATOM   4113 C  C   . THR A 1  527 ? 8.810  162.110 -14.671 1.00 257.57 ? 600  THR A C   1 
ATOM   4114 O  O   . THR A 1  527 ? 9.623  161.188 -14.594 1.00 237.38 ? 600  THR A O   1 
ATOM   4115 C  CB  . THR A 1  527 ? 10.200 164.224 -14.881 1.00 233.59 ? 600  THR A CB  1 
ATOM   4116 N  N   . PRO A 1  528 ? 7.619  161.978 -15.275 1.00 292.08 ? 601  PRO A N   1 
ATOM   4117 C  CA  . PRO A 1  528 ? 7.164  160.732 -15.904 1.00 303.91 ? 601  PRO A CA  1 
ATOM   4118 C  C   . PRO A 1  528 ? 7.838  160.520 -17.257 1.00 303.00 ? 601  PRO A C   1 
ATOM   4119 O  O   . PRO A 1  528 ? 8.741  161.271 -17.628 1.00 311.81 ? 601  PRO A O   1 
ATOM   4120 C  CB  . PRO A 1  528 ? 5.654  160.946 -16.084 1.00 310.72 ? 601  PRO A CB  1 
ATOM   4121 C  CG  . PRO A 1  528 ? 5.292  162.034 -15.124 1.00 307.39 ? 601  PRO A CG  1 
ATOM   4122 C  CD  . PRO A 1  528 ? 6.494  162.916 -15.066 1.00 300.17 ? 601  PRO A CD  1 
ATOM   4123 N  N   . GLY A 1  529 ? 7.393  159.502 -17.986 1.00 273.60 ? 602  GLY A N   1 
ATOM   4124 C  CA  . GLY A 1  529 ? 7.942  159.202 -19.295 1.00 253.48 ? 602  GLY A CA  1 
ATOM   4125 C  C   . GLY A 1  529 ? 9.305  158.543 -19.232 1.00 248.49 ? 602  GLY A C   1 
ATOM   4126 O  O   . GLY A 1  529 ? 9.707  158.025 -18.191 1.00 244.50 ? 602  GLY A O   1 
ATOM   4127 N  N   . THR A 1  530 ? 10.018 158.562 -20.353 1.00 263.70 ? 603  THR A N   1 
ATOM   4128 C  CA  . THR A 1  530 ? 11.349 157.972 -20.419 1.00 260.56 ? 603  THR A CA  1 
ATOM   4129 C  C   . THR A 1  530 ? 12.358 158.827 -19.661 1.00 266.98 ? 603  THR A C   1 
ATOM   4130 O  O   . THR A 1  530 ? 12.109 160.002 -19.389 1.00 272.61 ? 603  THR A O   1 
ATOM   4131 C  CB  . THR A 1  530 ? 11.822 157.801 -21.875 1.00 254.64 ? 603  THR A CB  1 
ATOM   4132 N  N   . PHE A 1  531 ? 13.495 158.230 -19.321 1.00 252.18 ? 604  PHE A N   1 
ATOM   4133 C  CA  . PHE A 1  531 ? 14.551 158.938 -18.607 1.00 233.24 ? 604  PHE A CA  1 
ATOM   4134 C  C   . PHE A 1  531 ? 15.156 160.030 -19.483 1.00 222.77 ? 604  PHE A C   1 
ATOM   4135 O  O   . PHE A 1  531 ? 15.616 161.057 -18.983 1.00 229.66 ? 604  PHE A O   1 
ATOM   4136 C  CB  . PHE A 1  531 ? 15.639 157.963 -18.150 1.00 224.84 ? 604  PHE A CB  1 
ATOM   4137 N  N   . LYS A 1  532 ? 15.150 159.799 -20.791 1.00 203.93 ? 605  LYS A N   1 
ATOM   4138 C  CA  . LYS A 1  532 ? 15.665 160.772 -21.746 1.00 200.40 ? 605  LYS A CA  1 
ATOM   4139 C  C   . LYS A 1  532 ? 14.740 161.981 -21.830 1.00 211.59 ? 605  LYS A C   1 
ATOM   4140 O  O   . LYS A 1  532 ? 15.187 163.100 -22.078 1.00 209.48 ? 605  LYS A O   1 
ATOM   4141 C  CB  . LYS A 1  532 ? 15.835 160.135 -23.127 1.00 191.03 ? 605  LYS A CB  1 
ATOM   4142 N  N   . GLU A 1  533 ? 13.448 161.745 -21.623 1.00 234.86 ? 606  GLU A N   1 
ATOM   4143 C  CA  . GLU A 1  533 ? 12.461 162.818 -21.633 1.00 244.31 ? 606  GLU A CA  1 
ATOM   4144 C  C   . GLU A 1  533 ? 12.558 163.643 -20.355 1.00 240.97 ? 606  GLU A C   1 
ATOM   4145 O  O   . GLU A 1  533 ? 12.447 164.870 -20.384 1.00 251.84 ? 606  GLU A O   1 
ATOM   4146 C  CB  . GLU A 1  533 ? 11.049 162.251 -21.794 1.00 242.61 ? 606  GLU A CB  1 
ATOM   4147 N  N   . ARG A 1  534 ? 12.765 162.958 -19.235 1.00 214.54 ? 607  ARG A N   1 
ATOM   4148 C  CA  . ARG A 1  534 ? 12.919 163.621 -17.946 1.00 208.56 ? 607  ARG A CA  1 
ATOM   4149 C  C   . ARG A 1  534 ? 14.198 164.448 -17.924 1.00 214.41 ? 607  ARG A C   1 
ATOM   4150 O  O   . ARG A 1  534 ? 14.219 165.562 -17.404 1.00 217.99 ? 607  ARG A O   1 
ATOM   4151 C  CB  . ARG A 1  534 ? 12.931 162.597 -16.810 1.00 223.66 ? 607  ARG A CB  1 
ATOM   4152 N  N   . ILE A 1  535 ? 15.262 163.894 -18.498 1.00 195.89 ? 608  ILE A N   1 
ATOM   4153 C  CA  . ILE A 1  535 ? 16.541 164.587 -18.580 1.00 165.93 ? 608  ILE A CA  1 
ATOM   4154 C  C   . ILE A 1  535 ? 16.460 165.705 -19.611 1.00 185.68 ? 608  ILE A C   1 
ATOM   4155 O  O   . ILE A 1  535 ? 17.200 166.686 -19.536 1.00 177.44 ? 608  ILE A O   1 
ATOM   4156 C  CB  . ILE A 1  535 ? 17.682 163.612 -18.916 1.00 137.54 ? 608  ILE A CB  1 
ATOM   4157 N  N   . ILE A 1  536 ? 15.557 165.550 -20.575 1.00 188.43 ? 609  ILE A N   1 
ATOM   4158 C  CA  . ILE A 1  536 ? 15.347 166.563 -21.601 1.00 176.08 ? 609  ILE A CA  1 
ATOM   4159 C  C   . ILE A 1  536 ? 14.626 167.759 -20.995 1.00 169.84 ? 609  ILE A C   1 
ATOM   4160 O  O   . ILE A 1  536 ? 14.911 168.906 -21.335 1.00 143.38 ? 609  ILE A O   1 
ATOM   4161 C  CB  . ILE A 1  536 ? 14.564 165.996 -22.797 1.00 145.59 ? 609  ILE A CB  1 
ATOM   4162 N  N   . LYS A 1  537 ? 13.688 167.482 -20.094 1.00 192.56 ? 610  LYS A N   1 
ATOM   4163 C  CA  . LYS A 1  537 ? 12.981 168.538 -19.380 1.00 194.93 ? 610  LYS A CA  1 
ATOM   4164 C  C   . LYS A 1  537 ? 13.854 169.087 -18.257 1.00 195.85 ? 610  LYS A C   1 
ATOM   4165 O  O   . LYS A 1  537 ? 13.572 170.145 -17.695 1.00 214.31 ? 610  LYS A O   1 
ATOM   4166 C  CB  . LYS A 1  537 ? 11.656 168.019 -18.820 1.00 199.77 ? 610  LYS A CB  1 
ATOM   4167 N  N   . SER A 1  538 ? 14.918 168.357 -17.938 1.00 178.55 ? 611  SER A N   1 
ATOM   4168 C  CA  . SER A 1  538 ? 15.854 168.768 -16.900 1.00 160.72 ? 611  SER A CA  1 
ATOM   4169 C  C   . SER A 1  538 ? 17.026 169.540 -17.495 1.00 178.56 ? 611  SER A C   1 
ATOM   4170 O  O   . SER A 1  538 ? 17.809 170.154 -16.771 1.00 219.04 ? 611  SER A O   1 
ATOM   4171 C  CB  . SER A 1  538 ? 16.366 167.552 -16.129 1.00 147.29 ? 611  SER A CB  1 
ATOM   4172 N  N   . ILE A 1  539 ? 17.142 169.501 -18.818 1.00 168.66 ? 612  ILE A N   1 
ATOM   4173 C  CA  . ILE A 1  539 ? 18.203 170.218 -19.513 1.00 178.98 ? 612  ILE A CA  1 
ATOM   4174 C  C   . ILE A 1  539 ? 17.638 171.472 -20.170 1.00 205.73 ? 612  ILE A C   1 
ATOM   4175 O  O   . ILE A 1  539 ? 18.297 172.511 -20.217 1.00 213.56 ? 612  ILE A O   1 
ATOM   4176 C  CB  . ILE A 1  539 ? 18.897 169.320 -20.550 1.00 177.66 ? 612  ILE A CB  1 
ATOM   4177 N  N   . THR A 1  540 ? 16.414 171.367 -20.676 1.00 202.81 ? 613  THR A N   1 
ATOM   4178 C  CA  . THR A 1  540 ? 15.751 172.500 -21.311 1.00 184.72 ? 613  THR A CA  1 
ATOM   4179 C  C   . THR A 1  540 ? 15.156 173.434 -20.262 1.00 159.73 ? 613  THR A C   1 
ATOM   4180 O  O   . THR A 1  540 ? 14.549 172.977 -19.292 1.00 160.45 ? 613  THR A O   1 
ATOM   4181 C  CB  . THR A 1  540 ? 14.637 172.041 -22.272 1.00 178.16 ? 613  THR A CB  1 
ATOM   4182 N  N   . PRO A 1  541 ? 15.307 174.710 -20.545 1.00 165.99 ? 614  PRO A N   1 
ATOM   4183 C  CA  . PRO A 1  541 ? 14.808 175.785 -19.715 1.00 175.34 ? 614  PRO A CA  1 
ATOM   4184 C  C   . PRO A 1  541 ? 13.315 175.749 -19.826 1.00 209.89 ? 614  PRO A C   1 
ATOM   4185 O  O   . PRO A 1  541 ? 12.755 175.041 -20.652 1.00 241.84 ? 614  PRO A O   1 
ATOM   4186 C  CB  . PRO A 1  541 ? 15.347 177.034 -20.401 1.00 173.68 ? 614  PRO A CB  1 
ATOM   4187 C  CG  . PRO A 1  541 ? 16.446 176.570 -21.304 1.00 185.26 ? 614  PRO A CG  1 
ATOM   4188 C  CD  . PRO A 1  541 ? 16.551 175.079 -21.222 1.00 177.75 ? 614  PRO A CD  1 
ATOM   4189 N  N   . GLU A 1  542 ? 12.668 176.458 -18.931 1.00 212.15 ? 615  GLU A N   1 
ATOM   4190 C  CA  . GLU A 1  542 ? 11.244 176.297 -18.700 1.00 256.46 ? 615  GLU A CA  1 
ATOM   4191 C  C   . GLU A 1  542 ? 10.471 176.946 -19.844 1.00 300.78 ? 615  GLU A C   1 
ATOM   4192 O  O   . GLU A 1  542 ? 10.677 178.118 -20.154 1.00 308.22 ? 615  GLU A O   1 
ATOM   4193 C  CB  . GLU A 1  542 ? 10.848 176.931 -17.369 1.00 244.98 ? 615  GLU A CB  1 
ATOM   4194 N  N   . THR A 1  543 ? 9.581  176.177 -20.462 1.00 165.25 ? 616  THR A N   1 
ATOM   4195 C  CA  . THR A 1  543 ? 8.813  176.654 -21.601 1.00 178.59 ? 616  THR A CA  1 
ATOM   4196 C  C   . THR A 1  543 ? 8.248  178.043 -21.340 1.00 190.66 ? 616  THR A C   1 
ATOM   4197 O  O   . THR A 1  543 ? 8.865  179.047 -21.692 1.00 191.89 ? 616  THR A O   1 
ATOM   4198 C  CB  . THR A 1  543 ? 7.673  175.673 -21.932 1.00 179.12 ? 616  THR A CB  1 
ATOM   4199 N  N   . GLU B 2  1   ? 52.114 174.889 33.892  1.00 166.97 ? 20   GLU B N   1 
ATOM   4200 C  CA  . GLU B 2  1   ? 51.619 173.533 34.091  1.00 151.49 ? 20   GLU B CA  1 
ATOM   4201 C  C   . GLU B 2  1   ? 52.259 172.892 35.318  1.00 124.76 ? 20   GLU B C   1 
ATOM   4202 O  O   . GLU B 2  1   ? 52.509 171.687 35.340  1.00 138.16 ? 20   GLU B O   1 
ATOM   4203 C  CB  . GLU B 2  1   ? 51.884 172.677 32.851  1.00 157.05 ? 20   GLU B CB  1 
ATOM   4204 N  N   . VAL B 2  2   ? 52.523 173.706 36.335  1.00 152.80 ? 21   VAL B N   1 
ATOM   4205 C  CA  . VAL B 2  2   ? 53.123 173.219 37.570  1.00 115.23 ? 21   VAL B CA  1 
ATOM   4206 C  C   . VAL B 2  2   ? 52.125 172.358 38.334  1.00 109.69 ? 21   VAL B C   1 
ATOM   4207 O  O   . VAL B 2  2   ? 51.142 172.864 38.874  1.00 144.45 ? 21   VAL B O   1 
ATOM   4208 C  CB  . VAL B 2  2   ? 53.618 174.382 38.446  1.00 115.44 ? 21   VAL B CB  1 
ATOM   4209 C  CG1 . VAL B 2  2   ? 54.210 173.852 39.742  1.00 106.59 ? 21   VAL B CG1 1 
ATOM   4210 C  CG2 . VAL B 2  2   ? 54.638 175.218 37.688  1.00 141.01 ? 21   VAL B CG2 1 
ATOM   4211 N  N   . GLN B 2  3   ? 52.382 171.055 38.375  1.00 128.58 ? 22   GLN B N   1 
ATOM   4212 C  CA  . GLN B 2  3   ? 51.481 170.125 39.043  1.00 131.82 ? 22   GLN B CA  1 
ATOM   4213 C  C   . GLN B 2  3   ? 52.195 169.311 40.117  1.00 115.28 ? 22   GLN B C   1 
ATOM   4214 O  O   . GLN B 2  3   ? 53.320 168.845 39.922  1.00 101.76 ? 22   GLN B O   1 
ATOM   4215 C  CB  . GLN B 2  3   ? 50.833 169.185 38.024  1.00 134.61 ? 22   GLN B CB  1 
ATOM   4216 C  CG  . GLN B 2  3   ? 49.985 169.891 36.981  1.00 178.52 ? 22   GLN B CG  1 
ATOM   4217 C  CD  . GLN B 2  3   ? 49.275 168.923 36.056  1.00 199.76 ? 22   GLN B CD  1 
ATOM   4218 O  OE1 . GLN B 2  3   ? 49.244 167.717 36.306  1.00 208.99 ? 22   GLN B OE1 1 
ATOM   4219 N  NE2 . GLN B 2  3   ? 48.701 169.446 34.979  1.00 200.55 ? 22   GLN B NE2 1 
ATOM   4220 N  N   . LEU B 2  4   ? 51.524 169.148 41.253  1.00 100.50 ? 23   LEU B N   1 
ATOM   4221 C  CA  . LEU B 2  4   ? 52.034 168.340 42.354  1.00 106.58 ? 23   LEU B CA  1 
ATOM   4222 C  C   . LEU B 2  4   ? 51.022 167.255 42.714  1.00 105.93 ? 23   LEU B C   1 
ATOM   4223 O  O   . LEU B 2  4   ? 49.999 167.534 43.340  1.00 106.66 ? 23   LEU B O   1 
ATOM   4224 C  CB  . LEU B 2  4   ? 52.333 169.212 43.576  1.00 111.21 ? 23   LEU B CB  1 
ATOM   4225 C  CG  . LEU B 2  4   ? 53.239 170.426 43.361  1.00 103.65 ? 23   LEU B CG  1 
ATOM   4226 C  CD1 . LEU B 2  4   ? 53.434 171.186 44.664  1.00 83.05  ? 23   LEU B CD1 1 
ATOM   4227 C  CD2 . LEU B 2  4   ? 54.577 170.009 42.780  1.00 86.54  ? 23   LEU B CD2 1 
ATOM   4228 N  N   . GLN B 2  5   ? 51.310 166.021 42.315  1.00 99.86  ? 24   GLN B N   1 
ATOM   4229 C  CA  . GLN B 2  5   ? 50.393 164.908 42.537  1.00 115.41 ? 24   GLN B CA  1 
ATOM   4230 C  C   . GLN B 2  5   ? 50.833 164.041 43.715  1.00 118.13 ? 24   GLN B C   1 
ATOM   4231 O  O   . GLN B 2  5   ? 51.884 163.403 43.668  1.00 138.83 ? 24   GLN B O   1 
ATOM   4232 C  CB  . GLN B 2  5   ? 50.279 164.055 41.271  1.00 133.90 ? 24   GLN B CB  1 
ATOM   4233 C  CG  . GLN B 2  5   ? 49.190 162.994 41.327  1.00 166.49 ? 24   GLN B CG  1 
ATOM   4234 C  CD  . GLN B 2  5   ? 47.794 163.580 41.227  1.00 173.88 ? 24   GLN B CD  1 
ATOM   4235 O  OE1 . GLN B 2  5   ? 47.620 164.743 40.862  1.00 170.37 ? 24   GLN B OE1 1 
ATOM   4236 N  NE2 . GLN B 2  5   ? 46.790 162.774 41.550  1.00 169.83 ? 24   GLN B NE2 1 
ATOM   4237 N  N   . GLN B 2  6   ? 50.020 164.018 44.766  1.00 109.01 ? 25   GLN B N   1 
ATOM   4238 C  CA  . GLN B 2  6   ? 50.318 163.222 45.953  1.00 99.14  ? 25   GLN B CA  1 
ATOM   4239 C  C   . GLN B 2  6   ? 49.755 161.809 45.823  1.00 124.99 ? 25   GLN B C   1 
ATOM   4240 O  O   . GLN B 2  6   ? 49.313 161.404 44.747  1.00 123.87 ? 25   GLN B O   1 
ATOM   4241 C  CB  . GLN B 2  6   ? 49.755 163.895 47.208  1.00 84.79  ? 25   GLN B CB  1 
ATOM   4242 C  CG  . GLN B 2  6   ? 50.017 165.388 47.284  1.00 94.46  ? 25   GLN B CG  1 
ATOM   4243 C  CD  . GLN B 2  6   ? 49.571 165.993 48.600  1.00 99.88  ? 25   GLN B CD  1 
ATOM   4244 O  OE1 . GLN B 2  6   ? 49.426 167.209 48.720  1.00 86.73  ? 25   GLN B OE1 1 
ATOM   4245 N  NE2 . GLN B 2  6   ? 49.355 165.145 49.599  1.00 112.26 ? 25   GLN B NE2 1 
ATOM   4246 N  N   . SER B 2  7   ? 49.772 161.064 46.924  1.00 133.91 ? 26   SER B N   1 
ATOM   4247 C  CA  . SER B 2  7   ? 49.237 159.707 46.940  1.00 156.50 ? 26   SER B CA  1 
ATOM   4248 C  C   . SER B 2  7   ? 47.789 159.697 47.426  1.00 183.74 ? 26   SER B C   1 
ATOM   4249 O  O   . SER B 2  7   ? 47.265 160.720 47.865  1.00 164.20 ? 26   SER B O   1 
ATOM   4250 C  CB  . SER B 2  7   ? 50.096 158.799 47.823  1.00 127.77 ? 26   SER B CB  1 
ATOM   4251 O  OG  . SER B 2  7   ? 50.129 159.267 49.161  1.00 150.79 ? 26   SER B OG  1 
ATOM   4252 N  N   . GLY B 2  8   ? 47.150 158.534 47.347  1.00 209.85 ? 27   GLY B N   1 
ATOM   4253 C  CA  . GLY B 2  8   ? 45.765 158.396 47.759  1.00 209.33 ? 27   GLY B CA  1 
ATOM   4254 C  C   . GLY B 2  8   ? 45.572 158.350 49.262  1.00 194.31 ? 27   GLY B C   1 
ATOM   4255 O  O   . GLY B 2  8   ? 46.523 158.542 50.020  1.00 192.36 ? 27   GLY B O   1 
ATOM   4256 N  N   . PRO B 2  9   ? 44.332 158.092 49.705  1.00 170.80 ? 28   PRO B N   1 
ATOM   4257 C  CA  . PRO B 2  9   ? 43.993 158.016 51.130  1.00 172.96 ? 28   PRO B CA  1 
ATOM   4258 C  C   . PRO B 2  9   ? 44.626 156.808 51.813  1.00 173.71 ? 28   PRO B C   1 
ATOM   4259 O  O   . PRO B 2  9   ? 44.817 155.772 51.177  1.00 180.40 ? 28   PRO B O   1 
ATOM   4260 C  CB  . PRO B 2  9   ? 42.467 157.901 51.120  1.00 185.00 ? 28   PRO B CB  1 
ATOM   4261 C  CG  . PRO B 2  9   ? 42.153 157.275 49.810  1.00 187.53 ? 28   PRO B CG  1 
ATOM   4262 C  CD  . PRO B 2  9   ? 43.164 157.829 48.847  1.00 181.07 ? 28   PRO B CD  1 
ATOM   4263 N  N   . GLU B 2  10  ? 44.945 156.945 53.096  1.00 146.89 ? 29   GLU B N   1 
ATOM   4264 C  CA  . GLU B 2  10  ? 45.599 155.874 53.838  1.00 159.39 ? 29   GLU B CA  1 
ATOM   4265 C  C   . GLU B 2  10  ? 44.900 155.590 55.161  1.00 183.16 ? 29   GLU B C   1 
ATOM   4266 O  O   . GLU B 2  10  ? 44.802 156.463 56.020  1.00 185.43 ? 29   GLU B O   1 
ATOM   4267 C  CB  . GLU B 2  10  ? 47.067 156.222 54.096  1.00 158.88 ? 29   GLU B CB  1 
ATOM   4268 C  CG  . GLU B 2  10  ? 47.922 156.305 52.843  1.00 169.83 ? 29   GLU B CG  1 
ATOM   4269 C  CD  . GLU B 2  10  ? 48.192 154.946 52.228  1.00 188.85 ? 29   GLU B CD  1 
ATOM   4270 O  OE1 . GLU B 2  10  ? 48.026 153.927 52.931  1.00 201.61 ? 29   GLU B OE1 1 
ATOM   4271 O  OE2 . GLU B 2  10  ? 48.573 154.896 51.039  1.00 192.13 ? 29   GLU B OE2 1 
ATOM   4272 N  N   . LEU B 2  11  ? 44.417 154.364 55.319  1.00 180.65 ? 30   LEU B N   1 
ATOM   4273 C  CA  . LEU B 2  11  ? 43.842 153.927 56.584  1.00 167.40 ? 30   LEU B CA  1 
ATOM   4274 C  C   . LEU B 2  11  ? 44.823 153.010 57.300  1.00 154.96 ? 30   LEU B C   1 
ATOM   4275 O  O   . LEU B 2  11  ? 45.145 151.929 56.808  1.00 158.07 ? 30   LEU B O   1 
ATOM   4276 C  CB  . LEU B 2  11  ? 42.510 153.213 56.361  1.00 170.07 ? 30   LEU B CB  1 
ATOM   4277 C  CG  . LEU B 2  11  ? 41.899 152.562 57.602  1.00 157.63 ? 30   LEU B CG  1 
ATOM   4278 C  CD1 . LEU B 2  11  ? 41.663 153.596 58.691  1.00 137.47 ? 30   LEU B CD1 1 
ATOM   4279 C  CD2 . LEU B 2  11  ? 40.607 151.845 57.249  1.00 170.32 ? 30   LEU B CD2 1 
ATOM   4280 N  N   . VAL B 2  12  ? 45.301 153.443 58.461  1.00 143.84 ? 31   VAL B N   1 
ATOM   4281 C  CA  . VAL B 2  12  ? 46.318 152.688 59.183  1.00 156.50 ? 31   VAL B CA  1 
ATOM   4282 C  C   . VAL B 2  12  ? 45.993 152.585 60.668  1.00 170.77 ? 31   VAL B C   1 
ATOM   4283 O  O   . VAL B 2  12  ? 45.443 153.512 61.260  1.00 157.97 ? 31   VAL B O   1 
ATOM   4284 C  CB  . VAL B 2  12  ? 47.706 153.312 58.979  1.00 154.79 ? 31   VAL B CB  1 
ATOM   4285 C  CG1 . VAL B 2  12  ? 48.271 152.913 57.624  1.00 160.20 ? 31   VAL B CG1 1 
ATOM   4286 C  CG2 . VAL B 2  12  ? 47.618 154.822 59.091  1.00 158.65 ? 31   VAL B CG2 1 
ATOM   4287 N  N   . LYS B 2  13  ? 46.337 151.448 61.264  1.00 198.91 ? 32   LYS B N   1 
ATOM   4288 C  CA  . LYS B 2  13  ? 46.126 151.235 62.690  1.00 186.20 ? 32   LYS B CA  1 
ATOM   4289 C  C   . LYS B 2  13  ? 47.123 152.045 63.511  1.00 170.83 ? 32   LYS B C   1 
ATOM   4290 O  O   . LYS B 2  13  ? 48.268 152.224 63.098  1.00 178.70 ? 32   LYS B O   1 
ATOM   4291 C  CB  . LYS B 2  13  ? 46.245 149.749 63.037  1.00 187.76 ? 32   LYS B CB  1 
ATOM   4292 C  CG  . LYS B 2  13  ? 45.097 148.896 62.530  1.00 189.42 ? 32   LYS B CG  1 
ATOM   4293 C  CD  . LYS B 2  13  ? 45.201 147.475 63.057  1.00 196.96 ? 32   LYS B CD  1 
ATOM   4294 C  CE  . LYS B 2  13  ? 44.006 146.639 62.633  1.00 208.41 ? 32   LYS B CE  1 
ATOM   4295 N  NZ  . LYS B 2  13  ? 44.077 145.259 63.186  1.00 220.36 ? 32   LYS B NZ  1 
ATOM   4296 N  N   . PRO B 2  14  ? 46.683 152.545 64.676  1.00 162.90 ? 33   PRO B N   1 
ATOM   4297 C  CA  . PRO B 2  14  ? 47.538 153.312 65.588  1.00 165.15 ? 33   PRO B CA  1 
ATOM   4298 C  C   . PRO B 2  14  ? 48.808 152.566 65.988  1.00 149.84 ? 33   PRO B C   1 
ATOM   4299 O  O   . PRO B 2  14  ? 48.766 151.362 66.238  1.00 156.95 ? 33   PRO B O   1 
ATOM   4300 C  CB  . PRO B 2  14  ? 46.636 153.534 66.805  1.00 143.68 ? 33   PRO B CB  1 
ATOM   4301 C  CG  . PRO B 2  14  ? 45.258 153.507 66.250  1.00 154.78 ? 33   PRO B CG  1 
ATOM   4302 C  CD  . PRO B 2  14  ? 45.289 152.485 65.151  1.00 167.68 ? 33   PRO B CD  1 
ATOM   4303 N  N   . GLY B 2  15  ? 49.924 153.286 66.042  1.00 134.48 ? 34   GLY B N   1 
ATOM   4304 C  CA  . GLY B 2  15  ? 51.198 152.693 66.402  1.00 169.90 ? 34   GLY B CA  1 
ATOM   4305 C  C   . GLY B 2  15  ? 52.036 152.311 65.199  1.00 179.14 ? 34   GLY B C   1 
ATOM   4306 O  O   . GLY B 2  15  ? 53.240 152.081 65.316  1.00 173.55 ? 34   GLY B O   1 
ATOM   4307 N  N   . ALA B 2  16  ? 51.396 152.246 64.037  1.00 189.01 ? 35   ALA B N   1 
ATOM   4308 C  CA  . ALA B 2  16  ? 52.083 151.878 62.805  1.00 205.08 ? 35   ALA B CA  1 
ATOM   4309 C  C   . ALA B 2  16  ? 52.687 153.105 62.133  1.00 188.49 ? 35   ALA B C   1 
ATOM   4310 O  O   . ALA B 2  16  ? 52.752 154.183 62.725  1.00 184.02 ? 35   ALA B O   1 
ATOM   4311 C  CB  . ALA B 2  16  ? 51.124 151.188 61.848  1.00 218.29 ? 35   ALA B CB  1 
ATOM   4312 N  N   . SER B 2  17  ? 53.128 152.932 60.891  1.00 182.44 ? 36   SER B N   1 
ATOM   4313 C  CA  . SER B 2  17  ? 53.736 154.017 60.131  1.00 185.83 ? 36   SER B CA  1 
ATOM   4314 C  C   . SER B 2  17  ? 53.064 154.181 58.772  1.00 183.55 ? 36   SER B C   1 
ATOM   4315 O  O   . SER B 2  17  ? 52.384 153.273 58.295  1.00 190.27 ? 36   SER B O   1 
ATOM   4316 C  CB  . SER B 2  17  ? 55.233 153.751 59.956  1.00 198.87 ? 36   SER B CB  1 
ATOM   4317 O  OG  . SER B 2  17  ? 55.882 153.648 61.211  1.00 201.53 ? 36   SER B OG  1 
ATOM   4318 N  N   . VAL B 2  18  ? 53.256 155.342 58.152  1.00 173.54 ? 37   VAL B N   1 
ATOM   4319 C  CA  . VAL B 2  18  ? 52.656 155.609 56.849  1.00 160.09 ? 37   VAL B CA  1 
ATOM   4320 C  C   . VAL B 2  18  ? 53.555 156.531 56.024  1.00 174.83 ? 37   VAL B C   1 
ATOM   4321 O  O   . VAL B 2  18  ? 54.149 157.470 56.552  1.00 196.97 ? 37   VAL B O   1 
ATOM   4322 C  CB  . VAL B 2  18  ? 51.235 156.202 57.006  1.00 141.48 ? 37   VAL B CB  1 
ATOM   4323 C  CG1 . VAL B 2  18  ? 51.273 157.509 57.790  1.00 137.35 ? 37   VAL B CG1 1 
ATOM   4324 C  CG2 . VAL B 2  18  ? 50.573 156.397 55.648  1.00 135.22 ? 37   VAL B CG2 1 
ATOM   4325 N  N   . LYS B 2  19  ? 53.666 156.249 54.728  1.00 155.73 ? 38   LYS B N   1 
ATOM   4326 C  CA  . LYS B 2  19  ? 54.486 157.062 53.834  1.00 145.99 ? 38   LYS B CA  1 
ATOM   4327 C  C   . LYS B 2  19  ? 53.641 157.719 52.743  1.00 155.69 ? 38   LYS B C   1 
ATOM   4328 O  O   . LYS B 2  19  ? 52.822 157.064 52.099  1.00 177.43 ? 38   LYS B O   1 
ATOM   4329 C  CB  . LYS B 2  19  ? 55.594 156.216 53.201  1.00 155.82 ? 38   LYS B CB  1 
ATOM   4330 C  CG  . LYS B 2  19  ? 56.478 156.980 52.226  1.00 177.72 ? 38   LYS B CG  1 
ATOM   4331 C  CD  . LYS B 2  19  ? 57.577 156.096 51.651  1.00 188.79 ? 38   LYS B CD  1 
ATOM   4332 C  CE  . LYS B 2  19  ? 58.522 155.606 52.738  1.00 182.64 ? 38   LYS B CE  1 
ATOM   4333 N  NZ  . LYS B 2  19  ? 59.631 154.782 52.182  1.00 179.47 ? 38   LYS B NZ  1 
ATOM   4334 N  N   . ILE B 2  20  ? 53.850 159.017 52.544  1.00 136.49 ? 39   ILE B N   1 
ATOM   4335 C  CA  . ILE B 2  20  ? 53.116 159.777 51.539  1.00 124.34 ? 39   ILE B CA  1 
ATOM   4336 C  C   . ILE B 2  20  ? 54.084 160.324 50.493  1.00 140.65 ? 39   ILE B C   1 
ATOM   4337 O  O   . ILE B 2  20  ? 55.146 160.849 50.833  1.00 162.44 ? 39   ILE B O   1 
ATOM   4338 C  CB  . ILE B 2  20  ? 52.304 160.915 52.187  1.00 92.98  ? 39   ILE B CB  1 
ATOM   4339 C  CG1 . ILE B 2  20  ? 51.404 160.366 53.296  1.00 96.30  ? 39   ILE B CG1 1 
ATOM   4340 C  CG2 . ILE B 2  20  ? 51.476 161.647 51.141  1.00 97.04  ? 39   ILE B CG2 1 
ATOM   4341 C  CD1 . ILE B 2  20  ? 50.594 161.426 54.007  1.00 105.80 ? 39   ILE B CD1 1 
ATOM   4342 N  N   . SER B 2  21  ? 53.715 160.198 49.221  1.00 136.12 ? 40   SER B N   1 
ATOM   4343 C  CA  . SER B 2  21  ? 54.566 160.650 48.124  1.00 129.51 ? 40   SER B CA  1 
ATOM   4344 C  C   . SER B 2  21  ? 54.152 162.029 47.614  1.00 128.60 ? 40   SER B C   1 
ATOM   4345 O  O   . SER B 2  21  ? 53.163 162.602 48.073  1.00 147.23 ? 40   SER B O   1 
ATOM   4346 C  CB  . SER B 2  21  ? 54.539 159.639 46.976  1.00 137.82 ? 40   SER B CB  1 
ATOM   4347 O  OG  . SER B 2  21  ? 53.225 159.470 46.474  1.00 160.27 ? 40   SER B OG  1 
ATOM   4348 N  N   . CYS B 2  22  ? 54.917 162.550 46.658  1.00 105.81 ? 41   CYS B N   1 
ATOM   4349 C  CA  . CYS B 2  22  ? 54.679 163.878 46.104  1.00 102.22 ? 41   CYS B CA  1 
ATOM   4350 C  C   . CYS B 2  22  ? 55.421 164.019 44.775  1.00 125.62 ? 41   CYS B C   1 
ATOM   4351 O  O   . CYS B 2  22  ? 56.547 164.516 44.732  1.00 154.39 ? 41   CYS B O   1 
ATOM   4352 C  CB  . CYS B 2  22  ? 55.104 164.961 47.100  1.00 107.97 ? 41   CYS B CB  1 
ATOM   4353 S  SG  . CYS B 2  22  ? 54.632 166.655 46.658  1.00 110.88 ? 41   CYS B SG  1 
ATOM   4354 N  N   . LYS B 2  23  ? 54.756 163.769 43.679  1.00 134.59 ? 42   LYS B N   1 
ATOM   4355 C  CA  . LYS B 2  23  ? 55.341 163.914 42.350  1.00 116.31 ? 42   LYS B CA  1 
ATOM   4356 C  C   . LYS B 2  23  ? 55.234 165.341 41.822  1.00 112.19 ? 42   LYS B C   1 
ATOM   4357 O  O   . LYS B 2  23  ? 54.141 165.897 41.731  1.00 122.45 ? 42   LYS B O   1 
ATOM   4358 C  CB  . LYS B 2  23  ? 54.671 162.940 41.377  1.00 122.36 ? 42   LYS B CB  1 
ATOM   4359 C  CG  . LYS B 2  23  ? 55.084 163.115 39.923  1.00 128.44 ? 42   LYS B CG  1 
ATOM   4360 C  CD  . LYS B 2  23  ? 56.560 162.814 39.719  1.00 141.14 ? 42   LYS B CD  1 
ATOM   4361 C  CE  . LYS B 2  23  ? 56.950 162.957 38.256  1.00 158.81 ? 42   LYS B CE  1 
ATOM   4362 N  NZ  . LYS B 2  23  ? 58.389 162.651 38.028  1.00 187.19 ? 42   LYS B NZ  1 
ATOM   4363 N  N   . ALA B 2  24  ? 56.373 165.928 41.472  1.00 99.45  ? 43   ALA B N   1 
ATOM   4364 C  CA  . ALA B 2  24  ? 56.406 167.307 40.999  1.00 120.10 ? 43   ALA B CA  1 
ATOM   4365 C  C   . ALA B 2  24  ? 56.615 167.375 39.491  1.00 133.21 ? 43   ALA B C   1 
ATOM   4366 O  O   . ALA B 2  24  ? 57.321 166.548 38.915  1.00 116.46 ? 43   ALA B O   1 
ATOM   4367 C  CB  . ALA B 2  24  ? 57.495 168.084 41.717  1.00 116.20 ? 43   ALA B CB  1 
ATOM   4368 N  N   . SER B 2  25  ? 55.997 168.367 38.858  1.00 150.85 ? 44   SER B N   1 
ATOM   4369 C  CA  . SER B 2  25  ? 56.153 168.570 37.422  1.00 121.53 ? 44   SER B CA  1 
ATOM   4370 C  C   . SER B 2  25  ? 55.845 170.011 37.032  1.00 120.52 ? 44   SER B C   1 
ATOM   4371 O  O   . SER B 2  25  ? 55.201 170.743 37.782  1.00 154.81 ? 44   SER B O   1 
ATOM   4372 C  CB  . SER B 2  25  ? 55.248 167.612 36.645  1.00 122.91 ? 44   SER B CB  1 
ATOM   4373 O  OG  . SER B 2  25  ? 53.886 167.820 36.973  1.00 143.69 ? 44   SER B OG  1 
ATOM   4374 N  N   . GLY B 2  26  ? 56.311 170.412 35.854  1.00 116.02 ? 45   GLY B N   1 
ATOM   4375 C  CA  . GLY B 2  26  ? 56.016 171.732 35.327  1.00 112.65 ? 45   GLY B CA  1 
ATOM   4376 C  C   . GLY B 2  26  ? 57.031 172.799 35.686  1.00 119.85 ? 45   GLY B C   1 
ATOM   4377 O  O   . GLY B 2  26  ? 56.880 173.962 35.312  1.00 133.14 ? 45   GLY B O   1 
ATOM   4378 N  N   . TYR B 2  27  ? 58.071 172.405 36.412  1.00 123.36 ? 46   TYR B N   1 
ATOM   4379 C  CA  . TYR B 2  27  ? 59.106 173.344 36.823  1.00 117.43 ? 46   TYR B CA  1 
ATOM   4380 C  C   . TYR B 2  27  ? 60.417 172.621 37.097  1.00 115.29 ? 46   TYR B C   1 
ATOM   4381 O  O   . TYR B 2  27  ? 60.459 171.392 37.159  1.00 121.10 ? 46   TYR B O   1 
ATOM   4382 C  CB  . TYR B 2  27  ? 58.664 174.121 38.066  1.00 97.46  ? 46   TYR B CB  1 
ATOM   4383 C  CG  . TYR B 2  27  ? 58.659 173.295 39.334  1.00 126.15 ? 46   TYR B CG  1 
ATOM   4384 C  CD1 . TYR B 2  27  ? 57.591 172.463 39.642  1.00 136.61 ? 46   TYR B CD1 1 
ATOM   4385 C  CD2 . TYR B 2  27  ? 59.724 173.349 40.223  1.00 117.50 ? 46   TYR B CD2 1 
ATOM   4386 C  CE1 . TYR B 2  27  ? 57.585 171.707 40.800  1.00 108.12 ? 46   TYR B CE1 1 
ATOM   4387 C  CE2 . TYR B 2  27  ? 59.730 172.595 41.379  1.00 107.80 ? 46   TYR B CE2 1 
ATOM   4388 C  CZ  . TYR B 2  27  ? 58.657 171.779 41.664  1.00 103.12 ? 46   TYR B CZ  1 
ATOM   4389 O  OH  . TYR B 2  27  ? 58.661 171.030 42.818  1.00 105.47 ? 46   TYR B OH  1 
ATOM   4390 N  N   . THR B 2  28  ? 61.487 173.390 37.266  1.00 131.08 ? 47   THR B N   1 
ATOM   4391 C  CA  . THR B 2  28  ? 62.782 172.821 37.611  1.00 125.19 ? 47   THR B CA  1 
ATOM   4392 C  C   . THR B 2  28  ? 62.767 172.361 39.064  1.00 129.41 ? 47   THR B C   1 
ATOM   4393 O  O   . THR B 2  28  ? 62.797 173.177 39.984  1.00 117.49 ? 47   THR B O   1 
ATOM   4394 C  CB  . THR B 2  28  ? 63.921 173.831 37.395  1.00 132.36 ? 47   THR B CB  1 
ATOM   4395 O  OG1 . THR B 2  28  ? 63.909 174.285 36.036  1.00 138.14 ? 47   THR B OG1 1 
ATOM   4396 C  CG2 . THR B 2  28  ? 65.266 173.189 37.695  1.00 139.74 ? 47   THR B CG2 1 
ATOM   4397 N  N   . PHE B 2  29  ? 62.720 171.046 39.257  1.00 138.13 ? 48   PHE B N   1 
ATOM   4398 C  CA  . PHE B 2  29  ? 62.557 170.452 40.580  1.00 110.55 ? 48   PHE B CA  1 
ATOM   4399 C  C   . PHE B 2  29  ? 63.672 170.829 41.551  1.00 90.80  ? 48   PHE B C   1 
ATOM   4400 O  O   . PHE B 2  29  ? 63.439 170.962 42.752  1.00 103.34 ? 48   PHE B O   1 
ATOM   4401 C  CB  . PHE B 2  29  ? 62.474 168.928 40.460  1.00 93.77  ? 48   PHE B CB  1 
ATOM   4402 C  CG  . PHE B 2  29  ? 62.256 168.228 41.770  1.00 92.31  ? 48   PHE B CG  1 
ATOM   4403 C  CD1 . PHE B 2  29  ? 60.995 168.171 42.336  1.00 100.59 ? 48   PHE B CD1 1 
ATOM   4404 C  CD2 . PHE B 2  29  ? 63.310 167.620 42.431  1.00 117.29 ? 48   PHE B CD2 1 
ATOM   4405 C  CE1 . PHE B 2  29  ? 60.787 167.526 43.539  1.00 104.46 ? 48   PHE B CE1 1 
ATOM   4406 C  CE2 . PHE B 2  29  ? 63.109 166.973 43.636  1.00 99.25  ? 48   PHE B CE2 1 
ATOM   4407 C  CZ  . PHE B 2  29  ? 61.845 166.926 44.190  1.00 99.03  ? 48   PHE B CZ  1 
ATOM   4408 N  N   . THR B 2  30  ? 64.881 171.005 41.028  1.00 108.83 ? 49   THR B N   1 
ATOM   4409 C  CA  . THR B 2  30  ? 66.041 171.277 41.869  1.00 122.36 ? 49   THR B CA  1 
ATOM   4410 C  C   . THR B 2  30  ? 66.193 172.761 42.193  1.00 126.79 ? 49   THR B C   1 
ATOM   4411 O  O   . THR B 2  30  ? 67.231 173.188 42.699  1.00 149.10 ? 49   THR B O   1 
ATOM   4412 C  CB  . THR B 2  30  ? 67.339 170.783 41.203  1.00 157.11 ? 49   THR B CB  1 
ATOM   4413 O  OG1 . THR B 2  30  ? 67.555 171.496 39.979  1.00 194.51 ? 49   THR B OG1 1 
ATOM   4414 C  CG2 . THR B 2  30  ? 67.253 169.293 40.908  1.00 135.59 ? 49   THR B CG2 1 
ATOM   4415 N  N   . ASP B 2  31  ? 65.157 173.544 41.908  1.00 117.42 ? 50   ASP B N   1 
ATOM   4416 C  CA  . ASP B 2  31  ? 65.212 174.987 42.125  1.00 116.85 ? 50   ASP B CA  1 
ATOM   4417 C  C   . ASP B 2  31  ? 64.525 175.422 43.416  1.00 103.22 ? 50   ASP B C   1 
ATOM   4418 O  O   . ASP B 2  31  ? 64.858 176.465 43.977  1.00 110.14 ? 50   ASP B O   1 
ATOM   4419 C  CB  . ASP B 2  31  ? 64.586 175.731 40.942  1.00 140.25 ? 50   ASP B CB  1 
ATOM   4420 C  CG  . ASP B 2  31  ? 65.602 176.099 39.878  1.00 161.95 ? 50   ASP B CG  1 
ATOM   4421 O  OD1 . ASP B 2  31  ? 66.814 176.053 40.169  1.00 166.83 ? 50   ASP B OD1 1 
ATOM   4422 O  OD2 . ASP B 2  31  ? 65.187 176.450 38.753  1.00 171.54 ? 50   ASP B OD2 1 
ATOM   4423 N  N   . TYR B 2  32  ? 63.570 174.630 43.891  1.00 94.93  ? 51   TYR B N   1 
ATOM   4424 C  CA  . TYR B 2  32  ? 62.747 175.059 45.017  1.00 85.08  ? 51   TYR B CA  1 
ATOM   4425 C  C   . TYR B 2  32  ? 62.688 174.056 46.169  1.00 98.92  ? 51   TYR B C   1 
ATOM   4426 O  O   . TYR B 2  32  ? 62.750 172.843 45.966  1.00 83.30  ? 51   TYR B O   1 
ATOM   4427 C  CB  . TYR B 2  32  ? 61.325 175.354 44.537  1.00 108.26 ? 51   TYR B CB  1 
ATOM   4428 C  CG  . TYR B 2  32  ? 61.238 176.377 43.426  1.00 87.25  ? 51   TYR B CG  1 
ATOM   4429 C  CD1 . TYR B 2  32  ? 61.170 177.734 43.710  1.00 96.65  ? 51   TYR B CD1 1 
ATOM   4430 C  CD2 . TYR B 2  32  ? 61.212 175.985 42.094  1.00 96.25  ? 51   TYR B CD2 1 
ATOM   4431 C  CE1 . TYR B 2  32  ? 61.086 178.672 42.699  1.00 99.30  ? 51   TYR B CE1 1 
ATOM   4432 C  CE2 . TYR B 2  32  ? 61.129 176.917 41.076  1.00 101.89 ? 51   TYR B CE2 1 
ATOM   4433 C  CZ  . TYR B 2  32  ? 61.066 178.259 41.385  1.00 103.58 ? 51   TYR B CZ  1 
ATOM   4434 O  OH  . TYR B 2  32  ? 60.982 179.191 40.376  1.00 136.59 ? 51   TYR B OH  1 
ATOM   4435 N  N   . TYR B 2  33  ? 62.568 174.591 47.381  1.00 108.21 ? 52   TYR B N   1 
ATOM   4436 C  CA  . TYR B 2  33  ? 62.324 173.805 48.587  1.00 97.89  ? 52   TYR B CA  1 
ATOM   4437 C  C   . TYR B 2  33  ? 61.003 173.051 48.506  1.00 95.41  ? 52   TYR B C   1 
ATOM   4438 O  O   . TYR B 2  33  ? 60.003 173.588 48.011  1.00 76.21  ? 52   TYR B O   1 
ATOM   4439 C  CB  . TYR B 2  33  ? 62.305 174.711 49.822  1.00 86.72  ? 52   TYR B CB  1 
ATOM   4440 C  CG  . TYR B 2  33  ? 63.658 175.011 50.419  1.00 97.02  ? 52   TYR B CG  1 
ATOM   4441 C  CD1 . TYR B 2  33  ? 64.627 174.026 50.526  1.00 106.29 ? 52   TYR B CD1 1 
ATOM   4442 C  CD2 . TYR B 2  33  ? 63.962 176.283 50.888  1.00 102.70 ? 52   TYR B CD2 1 
ATOM   4443 C  CE1 . TYR B 2  33  ? 65.863 174.299 51.078  1.00 138.33 ? 52   TYR B CE1 1 
ATOM   4444 C  CE2 . TYR B 2  33  ? 65.195 176.565 51.441  1.00 110.47 ? 52   TYR B CE2 1 
ATOM   4445 C  CZ  . TYR B 2  33  ? 66.142 175.569 51.533  1.00 121.70 ? 52   TYR B CZ  1 
ATOM   4446 O  OH  . TYR B 2  33  ? 67.374 175.841 52.082  1.00 134.05 ? 52   TYR B OH  1 
ATOM   4447 N  N   . MET B 2  34  ? 60.988 171.820 49.013  1.00 111.19 ? 53   MET B N   1 
ATOM   4448 C  CA  . MET B 2  34  ? 59.734 171.071 49.092  1.00 113.88 ? 53   MET B CA  1 
ATOM   4449 C  C   . MET B 2  34  ? 59.224 171.028 50.529  1.00 127.50 ? 53   MET B C   1 
ATOM   4450 O  O   . MET B 2  34  ? 59.957 170.672 51.444  1.00 159.48 ? 53   MET B O   1 
ATOM   4451 C  CB  . MET B 2  34  ? 59.907 169.653 48.548  1.00 119.48 ? 53   MET B CB  1 
ATOM   4452 C  CG  . MET B 2  34  ? 58.602 168.881 48.450  1.00 134.59 ? 53   MET B CG  1 
ATOM   4453 S  SD  . MET B 2  34  ? 57.392 169.688 47.381  1.00 130.27 ? 53   MET B SD  1 
ATOM   4454 C  CE  . MET B 2  34  ? 58.251 169.654 45.811  1.00 133.45 ? 53   MET B CE  1 
ATOM   4455 N  N   . ASN B 2  35  ? 57.958 171.382 50.722  1.00 107.93 ? 54   ASN B N   1 
ATOM   4456 C  CA  . ASN B 2  35  ? 57.403 171.530 52.065  1.00 90.98  ? 54   ASN B CA  1 
ATOM   4457 C  C   . ASN B 2  35  ? 56.238 170.581 52.317  1.00 94.64  ? 54   ASN B C   1 
ATOM   4458 O  O   . ASN B 2  35  ? 55.614 170.086 51.379  1.00 121.41 ? 54   ASN B O   1 
ATOM   4459 C  CB  . ASN B 2  35  ? 56.942 172.973 52.290  1.00 92.93  ? 54   ASN B CB  1 
ATOM   4460 C  CG  . ASN B 2  35  ? 58.074 173.972 52.183  1.00 97.06  ? 54   ASN B CG  1 
ATOM   4461 O  OD1 . ASN B 2  35  ? 58.533 174.518 53.186  1.00 101.04 ? 54   ASN B OD1 1 
ATOM   4462 N  ND2 . ASN B 2  35  ? 58.531 174.217 50.964  1.00 97.70  ? 54   ASN B ND2 1 
ATOM   4463 N  N   . TRP B 2  36  ? 55.945 170.336 53.591  1.00 106.96 ? 55   TRP B N   1 
ATOM   4464 C  CA  . TRP B 2  36  ? 54.761 169.563 53.954  1.00 103.83 ? 55   TRP B CA  1 
ATOM   4465 C  C   . TRP B 2  36  ? 53.940 170.285 55.021  1.00 101.89 ? 55   TRP B C   1 
ATOM   4466 O  O   . TRP B 2  36  ? 54.475 170.717 56.042  1.00 104.15 ? 55   TRP B O   1 
ATOM   4467 C  CB  . TRP B 2  36  ? 55.154 168.164 54.435  1.00 92.57  ? 55   TRP B CB  1 
ATOM   4468 C  CG  . TRP B 2  36  ? 55.633 167.276 53.324  1.00 98.38  ? 55   TRP B CG  1 
ATOM   4469 C  CD1 . TRP B 2  36  ? 56.898 167.207 52.819  1.00 104.15 ? 55   TRP B CD1 1 
ATOM   4470 C  CD2 . TRP B 2  36  ? 54.849 166.340 52.571  1.00 106.40 ? 55   TRP B CD2 1 
ATOM   4471 N  NE1 . TRP B 2  36  ? 56.953 166.283 51.804  1.00 131.39 ? 55   TRP B NE1 1 
ATOM   4472 C  CE2 . TRP B 2  36  ? 55.709 165.737 51.632  1.00 117.36 ? 55   TRP B CE2 1 
ATOM   4473 C  CE3 . TRP B 2  36  ? 53.506 165.951 52.603  1.00 96.16  ? 55   TRP B CE3 1 
ATOM   4474 C  CZ2 . TRP B 2  36  ? 55.270 164.767 50.732  1.00 119.88 ? 55   TRP B CZ2 1 
ATOM   4475 C  CZ3 . TRP B 2  36  ? 53.073 164.988 51.708  1.00 115.00 ? 55   TRP B CZ3 1 
ATOM   4476 C  CH2 . TRP B 2  36  ? 53.952 164.407 50.786  1.00 125.49 ? 55   TRP B CH2 1 
ATOM   4477 N  N   . VAL B 2  37  ? 52.640 170.416 54.773  1.00 115.09 ? 56   VAL B N   1 
ATOM   4478 C  CA  . VAL B 2  37  ? 51.748 171.122 55.686  1.00 120.28 ? 56   VAL B CA  1 
ATOM   4479 C  C   . VAL B 2  37  ? 50.638 170.202 56.183  1.00 118.94 ? 56   VAL B C   1 
ATOM   4480 O  O   . VAL B 2  37  ? 49.929 169.583 55.391  1.00 123.95 ? 56   VAL B O   1 
ATOM   4481 C  CB  . VAL B 2  37  ? 51.147 172.374 55.018  1.00 115.76 ? 56   VAL B CB  1 
ATOM   4482 C  CG1 . VAL B 2  37  ? 50.185 173.071 55.967  1.00 132.00 ? 56   VAL B CG1 1 
ATOM   4483 C  CG2 . VAL B 2  37  ? 52.248 173.324 54.576  1.00 120.52 ? 56   VAL B CG2 1 
ATOM   4484 N  N   . LYS B 2  38  ? 50.492 170.122 57.501  1.00 102.50 ? 57   LYS B N   1 
ATOM   4485 C  CA  . LYS B 2  38  ? 49.445 169.314 58.114  1.00 98.50  ? 57   LYS B CA  1 
ATOM   4486 C  C   . LYS B 2  38  ? 48.220 170.162 58.433  1.00 108.16 ? 57   LYS B C   1 
ATOM   4487 O  O   . LYS B 2  38  ? 48.331 171.228 59.038  1.00 110.01 ? 57   LYS B O   1 
ATOM   4488 C  CB  . LYS B 2  38  ? 49.964 168.640 59.386  1.00 129.27 ? 57   LYS B CB  1 
ATOM   4489 C  CG  . LYS B 2  38  ? 48.888 167.958 60.217  1.00 141.27 ? 57   LYS B CG  1 
ATOM   4490 C  CD  . LYS B 2  38  ? 49.462 167.388 61.506  1.00 136.13 ? 57   LYS B CD  1 
ATOM   4491 C  CE  . LYS B 2  38  ? 48.370 166.801 62.386  1.00 157.09 ? 57   LYS B CE  1 
ATOM   4492 N  NZ  . LYS B 2  38  ? 48.910 166.278 63.671  1.00 166.03 ? 57   LYS B NZ  1 
ATOM   4493 N  N   . GLN B 2  39  ? 47.050 169.685 58.022  1.00 124.85 ? 58   GLN B N   1 
ATOM   4494 C  CA  . GLN B 2  39  ? 45.803 170.375 58.318  1.00 135.75 ? 58   GLN B CA  1 
ATOM   4495 C  C   . GLN B 2  39  ? 44.791 169.423 58.941  1.00 151.28 ? 58   GLN B C   1 
ATOM   4496 O  O   . GLN B 2  39  ? 44.327 168.482 58.294  1.00 117.76 ? 58   GLN B O   1 
ATOM   4497 C  CB  . GLN B 2  39  ? 45.218 171.007 57.054  1.00 101.07 ? 58   GLN B CB  1 
ATOM   4498 C  CG  . GLN B 2  39  ? 43.962 171.823 57.308  1.00 101.85 ? 58   GLN B CG  1 
ATOM   4499 C  CD  . GLN B 2  39  ? 43.355 172.373 56.034  1.00 122.29 ? 58   GLN B CD  1 
ATOM   4500 O  OE1 . GLN B 2  39  ? 43.660 171.908 54.936  1.00 116.55 ? 58   GLN B OE1 1 
ATOM   4501 N  NE2 . GLN B 2  39  ? 42.491 173.372 56.174  1.00 117.53 ? 58   GLN B NE2 1 
ATOM   4502 N  N   . SER B 2  40  ? 44.455 169.671 60.202  1.00 157.47 ? 59   SER B N   1 
ATOM   4503 C  CA  . SER B 2  40  ? 43.482 168.850 60.909  1.00 151.31 ? 59   SER B CA  1 
ATOM   4504 C  C   . SER B 2  40  ? 42.066 169.228 60.495  1.00 192.87 ? 59   SER B C   1 
ATOM   4505 O  O   . SER B 2  40  ? 41.839 170.304 59.940  1.00 215.50 ? 59   SER B O   1 
ATOM   4506 C  CB  . SER B 2  40  ? 43.652 168.997 62.422  1.00 151.90 ? 59   SER B CB  1 
ATOM   4507 O  OG  . SER B 2  40  ? 44.960 168.626 62.823  1.00 184.37 ? 59   SER B OG  1 
ATOM   4508 N  N   . HIS B 2  41  ? 41.118 168.337 60.764  1.00 200.31 ? 60   HIS B N   1 
ATOM   4509 C  CA  . HIS B 2  41  ? 39.728 168.562 60.389  1.00 214.97 ? 60   HIS B CA  1 
ATOM   4510 C  C   . HIS B 2  41  ? 39.129 169.739 61.152  1.00 218.68 ? 60   HIS B C   1 
ATOM   4511 O  O   . HIS B 2  41  ? 38.902 169.658 62.359  1.00 206.22 ? 60   HIS B O   1 
ATOM   4512 C  CB  . HIS B 2  41  ? 38.897 167.302 60.634  1.00 211.85 ? 60   HIS B CB  1 
ATOM   4513 C  CG  . HIS B 2  41  ? 37.453 167.454 60.274  1.00 211.62 ? 60   HIS B CG  1 
ATOM   4514 N  ND1 . HIS B 2  41  ? 37.033 167.772 59.000  1.00 210.90 ? 60   HIS B ND1 1 
ATOM   4515 C  CD2 . HIS B 2  41  ? 36.330 167.336 61.021  1.00 206.35 ? 60   HIS B CD2 1 
ATOM   4516 C  CE1 . HIS B 2  41  ? 35.714 167.841 58.978  1.00 205.85 ? 60   HIS B CE1 1 
ATOM   4517 N  NE2 . HIS B 2  41  ? 35.262 167.581 60.192  1.00 201.86 ? 60   HIS B NE2 1 
ATOM   4518 N  N   . GLY B 2  42  ? 38.878 170.831 60.438  1.00 227.17 ? 61   GLY B N   1 
ATOM   4519 C  CA  . GLY B 2  42  ? 38.293 172.017 61.035  1.00 228.03 ? 61   GLY B CA  1 
ATOM   4520 C  C   . GLY B 2  42  ? 39.319 172.964 61.624  1.00 217.54 ? 61   GLY B C   1 
ATOM   4521 O  O   . GLY B 2  42  ? 38.991 174.082 62.022  1.00 203.35 ? 61   GLY B O   1 
ATOM   4522 N  N   . LYS B 2  43  ? 40.569 172.516 61.678  1.00 224.22 ? 62   LYS B N   1 
ATOM   4523 C  CA  . LYS B 2  43  ? 41.642 173.324 62.242  1.00 217.07 ? 62   LYS B CA  1 
ATOM   4524 C  C   . LYS B 2  43  ? 42.387 174.088 61.155  1.00 190.59 ? 62   LYS B C   1 
ATOM   4525 O  O   . LYS B 2  43  ? 41.969 174.111 59.997  1.00 186.77 ? 62   LYS B O   1 
ATOM   4526 C  CB  . LYS B 2  43  ? 42.629 172.444 63.008  1.00 220.74 ? 62   LYS B CB  1 
ATOM   4527 C  CG  . LYS B 2  43  ? 42.031 171.770 64.230  1.00 224.53 ? 62   LYS B CG  1 
ATOM   4528 C  CD  . LYS B 2  43  ? 41.515 172.795 65.227  1.00 228.56 ? 62   LYS B CD  1 
ATOM   4529 C  CE  . LYS B 2  43  ? 40.914 172.121 66.449  1.00 236.42 ? 62   LYS B CE  1 
ATOM   4530 N  NZ  . LYS B 2  43  ? 40.392 173.112 67.430  1.00 244.98 ? 62   LYS B NZ  1 
ATOM   4531 N  N   . SER B 2  44  ? 43.495 174.711 61.537  1.00 158.35 ? 63   SER B N   1 
ATOM   4532 C  CA  . SER B 2  44  ? 44.267 175.534 60.618  1.00 131.96 ? 63   SER B CA  1 
ATOM   4533 C  C   . SER B 2  44  ? 45.446 174.782 60.016  1.00 136.65 ? 63   SER B C   1 
ATOM   4534 O  O   . SER B 2  44  ? 45.663 173.606 60.306  1.00 163.79 ? 63   SER B O   1 
ATOM   4535 C  CB  . SER B 2  44  ? 44.761 176.789 61.338  1.00 131.14 ? 63   SER B CB  1 
ATOM   4536 O  OG  . SER B 2  44  ? 45.530 177.604 60.472  1.00 126.82 ? 63   SER B OG  1 
ATOM   4537 N  N   . LEU B 2  45  ? 46.207 175.476 59.176  1.00 115.59 ? 64   LEU B N   1 
ATOM   4538 C  CA  . LEU B 2  45  ? 47.376 174.892 58.532  1.00 108.45 ? 64   LEU B CA  1 
ATOM   4539 C  C   . LEU B 2  45  ? 48.556 174.856 59.495  1.00 121.72 ? 64   LEU B C   1 
ATOM   4540 O  O   . LEU B 2  45  ? 48.713 175.746 60.331  1.00 108.05 ? 64   LEU B O   1 
ATOM   4541 C  CB  . LEU B 2  45  ? 47.744 175.680 57.274  1.00 114.85 ? 64   LEU B CB  1 
ATOM   4542 C  CG  . LEU B 2  45  ? 46.656 175.785 56.203  1.00 113.82 ? 64   LEU B CG  1 
ATOM   4543 C  CD1 . LEU B 2  45  ? 47.144 176.615 55.027  1.00 109.30 ? 64   LEU B CD1 1 
ATOM   4544 C  CD2 . LEU B 2  45  ? 46.223 174.402 55.745  1.00 126.05 ? 64   LEU B CD2 1 
ATOM   4545 N  N   . GLU B 2  46  ? 49.385 173.826 59.371  1.00 136.38 ? 65   GLU B N   1 
ATOM   4546 C  CA  . GLU B 2  46  ? 50.511 173.646 60.278  1.00 130.82 ? 65   GLU B CA  1 
ATOM   4547 C  C   . GLU B 2  46  ? 51.754 173.177 59.526  1.00 155.09 ? 65   GLU B C   1 
ATOM   4548 O  O   . GLU B 2  46  ? 51.816 172.040 59.057  1.00 167.31 ? 65   GLU B O   1 
ATOM   4549 C  CB  . GLU B 2  46  ? 50.143 172.651 61.379  1.00 146.10 ? 65   GLU B CB  1 
ATOM   4550 C  CG  . GLU B 2  46  ? 50.912 172.837 62.672  1.00 168.38 ? 65   GLU B CG  1 
ATOM   4551 C  CD  . GLU B 2  46  ? 50.315 172.043 63.817  1.00 177.28 ? 65   GLU B CD  1 
ATOM   4552 O  OE1 . GLU B 2  46  ? 49.625 171.036 63.550  1.00 184.30 ? 65   GLU B OE1 1 
ATOM   4553 O  OE2 . GLU B 2  46  ? 50.529 172.431 64.984  1.00 167.77 ? 65   GLU B OE2 1 
ATOM   4554 N  N   . TRP B 2  47  ? 52.740 174.063 59.416  1.00 155.49 ? 66   TRP B N   1 
ATOM   4555 C  CA  . TRP B 2  47  ? 53.971 173.772 58.685  1.00 115.11 ? 66   TRP B CA  1 
ATOM   4556 C  C   . TRP B 2  47  ? 54.810 172.714 59.395  1.00 100.14 ? 66   TRP B C   1 
ATOM   4557 O  O   . TRP B 2  47  ? 55.344 172.952 60.478  1.00 137.21 ? 66   TRP B O   1 
ATOM   4558 C  CB  . TRP B 2  47  ? 54.791 175.052 58.494  1.00 111.37 ? 66   TRP B CB  1 
ATOM   4559 C  CG  . TRP B 2  47  ? 56.049 174.865 57.695  1.00 117.75 ? 66   TRP B CG  1 
ATOM   4560 C  CD1 . TRP B 2  47  ? 56.143 174.677 56.346  1.00 129.28 ? 66   TRP B CD1 1 
ATOM   4561 C  CD2 . TRP B 2  47  ? 57.394 174.868 58.193  1.00 112.77 ? 66   TRP B CD2 1 
ATOM   4562 N  NE1 . TRP B 2  47  ? 57.460 174.553 55.975  1.00 94.62  ? 66   TRP B NE1 1 
ATOM   4563 C  CE2 . TRP B 2  47  ? 58.248 174.667 57.090  1.00 98.57  ? 66   TRP B CE2 1 
ATOM   4564 C  CE3 . TRP B 2  47  ? 57.957 175.016 59.464  1.00 129.03 ? 66   TRP B CE3 1 
ATOM   4565 C  CZ2 . TRP B 2  47  ? 59.635 174.611 57.221  1.00 108.54 ? 66   TRP B CZ2 1 
ATOM   4566 C  CZ3 . TRP B 2  47  ? 59.335 174.959 59.590  1.00 113.80 ? 66   TRP B CZ3 1 
ATOM   4567 C  CH2 . TRP B 2  47  ? 60.157 174.759 58.476  1.00 113.81 ? 66   TRP B CH2 1 
ATOM   4568 N  N   . ILE B 2  48  ? 54.919 171.544 58.773  1.00 106.31 ? 67   ILE B N   1 
ATOM   4569 C  CA  . ILE B 2  48  ? 55.717 170.455 59.320  1.00 115.38 ? 67   ILE B CA  1 
ATOM   4570 C  C   . ILE B 2  48  ? 57.196 170.730 59.094  1.00 125.26 ? 67   ILE B C   1 
ATOM   4571 O  O   . ILE B 2  48  ? 57.973 170.817 60.043  1.00 136.87 ? 67   ILE B O   1 
ATOM   4572 C  CB  . ILE B 2  48  ? 55.319 169.103 58.701  1.00 110.03 ? 67   ILE B CB  1 
ATOM   4573 C  CG1 . ILE B 2  48  ? 53.840 168.810 58.954  1.00 107.70 ? 67   ILE B CG1 1 
ATOM   4574 C  CG2 . ILE B 2  48  ? 56.195 167.986 59.252  1.00 92.05  ? 67   ILE B CG2 1 
ATOM   4575 C  CD1 . ILE B 2  48  ? 53.360 167.526 58.319  1.00 92.50  ? 67   ILE B CD1 1 
ATOM   4576 N  N   . GLY B 2  49  ? 57.580 170.861 57.828  1.00 123.99 ? 68   GLY B N   1 
ATOM   4577 C  CA  . GLY B 2  49  ? 58.964 171.114 57.482  1.00 122.40 ? 68   GLY B CA  1 
ATOM   4578 C  C   . GLY B 2  49  ? 59.245 171.158 55.994  1.00 120.21 ? 68   GLY B C   1 
ATOM   4579 O  O   . GLY B 2  49  ? 58.361 170.902 55.167  1.00 143.13 ? 68   GLY B O   1 
ATOM   4580 N  N   . ASN B 2  50  ? 60.488 171.489 55.656  1.00 109.21 ? 69   ASN B N   1 
ATOM   4581 C  CA  . ASN B 2  50  ? 60.918 171.555 54.267  1.00 102.12 ? 69   ASN B CA  1 
ATOM   4582 C  C   . ASN B 2  50  ? 62.126 170.661 54.024  1.00 103.79 ? 69   ASN B C   1 
ATOM   4583 O  O   . ASN B 2  50  ? 62.712 170.114 54.960  1.00 108.12 ? 69   ASN B O   1 
ATOM   4584 C  CB  . ASN B 2  50  ? 61.250 172.995 53.869  1.00 98.82  ? 69   ASN B CB  1 
ATOM   4585 C  CG  . ASN B 2  50  ? 62.467 173.539 54.597  1.00 94.73  ? 69   ASN B CG  1 
ATOM   4586 O  OD1 . ASN B 2  50  ? 62.349 174.125 55.673  1.00 129.74 ? 69   ASN B OD1 1 
ATOM   4587 N  ND2 . ASN B 2  50  ? 63.643 173.354 54.008  1.00 89.18  ? 69   ASN B ND2 1 
ATOM   4588 N  N   . ILE B 2  51  ? 62.495 170.531 52.756  1.00 106.66 ? 70   ILE B N   1 
ATOM   4589 C  CA  . ILE B 2  51  ? 63.636 169.730 52.359  1.00 113.04 ? 70   ILE B CA  1 
ATOM   4590 C  C   . ILE B 2  51  ? 64.236 170.317 51.085  1.00 111.26 ? 70   ILE B C   1 
ATOM   4591 O  O   . ILE B 2  51  ? 63.513 170.758 50.175  1.00 113.49 ? 70   ILE B O   1 
ATOM   4592 C  CB  . ILE B 2  51  ? 63.249 168.242 52.180  1.00 87.00  ? 70   ILE B CB  1 
ATOM   4593 C  CG1 . ILE B 2  51  ? 64.456 167.417 51.730  1.00 90.19  ? 70   ILE B CG1 1 
ATOM   4594 C  CG2 . ILE B 2  51  ? 62.087 168.093 51.207  1.00 112.60 ? 70   ILE B CG2 1 
ATOM   4595 C  CD1 . ILE B 2  51  ? 64.180 165.934 51.633  1.00 105.69 ? 70   ILE B CD1 1 
ATOM   4596 N  N   . ASN B 2  52  ? 65.566 170.350 51.062  1.00 120.91 ? 71   ASN B N   1 
ATOM   4597 C  CA  . ASN B 2  52  ? 66.342 170.790 49.913  1.00 111.80 ? 71   ASN B CA  1 
ATOM   4598 C  C   . ASN B 2  52  ? 66.641 169.585 49.033  1.00 122.07 ? 71   ASN B C   1 
ATOM   4599 O  O   . ASN B 2  52  ? 67.379 168.687 49.442  1.00 164.85 ? 71   ASN B O   1 
ATOM   4600 C  CB  . ASN B 2  52  ? 67.641 171.464 50.368  1.00 121.06 ? 71   ASN B CB  1 
ATOM   4601 C  CG  . ASN B 2  52  ? 68.314 172.256 49.263  1.00 121.68 ? 71   ASN B CG  1 
ATOM   4602 O  OD1 . ASN B 2  52  ? 68.181 171.938 48.081  1.00 142.85 ? 71   ASN B OD1 1 
ATOM   4603 N  ND2 . ASN B 2  52  ? 69.043 173.299 49.645  1.00 124.87 ? 71   ASN B ND2 1 
ATOM   4604 N  N   . PRO B 2  53  ? 66.059 169.562 47.824  1.00 117.97 ? 72   PRO B N   1 
ATOM   4605 C  CA  . PRO B 2  53  ? 66.179 168.450 46.873  1.00 98.38  ? 72   PRO B CA  1 
ATOM   4606 C  C   . PRO B 2  53  ? 67.603 168.226 46.368  1.00 115.10 ? 72   PRO B C   1 
ATOM   4607 O  O   . PRO B 2  53  ? 67.935 167.118 45.946  1.00 133.30 ? 72   PRO B O   1 
ATOM   4608 C  CB  . PRO B 2  53  ? 65.265 168.879 45.716  1.00 101.58 ? 72   PRO B CB  1 
ATOM   4609 C  CG  . PRO B 2  53  ? 64.349 169.905 46.301  1.00 83.97  ? 72   PRO B CG  1 
ATOM   4610 C  CD  . PRO B 2  53  ? 65.175 170.623 47.316  1.00 115.65 ? 72   PRO B CD  1 
ATOM   4611 N  N   . ASN B 2  54  ? 68.428 169.267 46.411  1.00 122.05 ? 73   ASN B N   1 
ATOM   4612 C  CA  . ASN B 2  54  ? 69.791 169.194 45.892  1.00 128.51 ? 73   ASN B CA  1 
ATOM   4613 C  C   . ASN B 2  54  ? 70.674 168.261 46.717  1.00 126.03 ? 73   ASN B C   1 
ATOM   4614 O  O   . ASN B 2  54  ? 71.544 167.578 46.175  1.00 133.00 ? 73   ASN B O   1 
ATOM   4615 C  CB  . ASN B 2  54  ? 70.418 170.589 45.842  1.00 147.73 ? 73   ASN B CB  1 
ATOM   4616 C  CG  . ASN B 2  54  ? 69.640 171.547 44.961  1.00 146.54 ? 73   ASN B CG  1 
ATOM   4617 O  OD1 . ASN B 2  54  ? 68.971 171.132 44.015  1.00 129.30 ? 73   ASN B OD1 1 
ATOM   4618 N  ND2 . ASN B 2  54  ? 69.726 172.836 45.267  1.00 158.25 ? 73   ASN B ND2 1 
ATOM   4619 N  N   . ASN B 2  55  ? 70.450 168.236 48.027  1.00 130.63 ? 74   ASN B N   1 
ATOM   4620 C  CA  . ASN B 2  55  ? 71.249 167.407 48.922  1.00 119.87 ? 74   ASN B CA  1 
ATOM   4621 C  C   . ASN B 2  55  ? 70.389 166.787 50.017  1.00 124.13 ? 74   ASN B C   1 
ATOM   4622 O  O   . ASN B 2  55  ? 70.899 166.105 50.907  1.00 130.63 ? 74   ASN B O   1 
ATOM   4623 C  CB  . ASN B 2  55  ? 72.394 168.221 49.527  1.00 147.00 ? 74   ASN B CB  1 
ATOM   4624 C  CG  . ASN B 2  55  ? 71.901 169.339 50.426  1.00 139.10 ? 74   ASN B CG  1 
ATOM   4625 O  OD1 . ASN B 2  55  ? 70.805 169.867 50.238  1.00 110.19 ? 74   ASN B OD1 1 
ATOM   4626 N  ND2 . ASN B 2  55  ? 72.712 169.707 51.411  1.00 164.54 ? 74   ASN B ND2 1 
ATOM   4627 N  N   . GLY B 2  56  ? 69.085 167.028 49.949  1.00 129.41 ? 75   GLY B N   1 
ATOM   4628 C  CA  . GLY B 2  56  ? 68.169 166.538 50.961  1.00 125.30 ? 75   GLY B CA  1 
ATOM   4629 C  C   . GLY B 2  56  ? 68.295 167.322 52.252  1.00 102.24 ? 75   GLY B C   1 
ATOM   4630 O  O   . GLY B 2  56  ? 68.182 166.764 53.344  1.00 103.87 ? 75   GLY B O   1 
ATOM   4631 N  N   . GLY B 2  57  ? 68.532 168.624 52.123  1.00 136.17 ? 76   GLY B N   1 
ATOM   4632 C  CA  . GLY B 2  57  ? 68.688 169.490 53.278  1.00 135.52 ? 76   GLY B CA  1 
ATOM   4633 C  C   . GLY B 2  57  ? 67.335 169.628 53.945  1.00 132.54 ? 76   GLY B C   1 
ATOM   4634 O  O   . GLY B 2  57  ? 66.467 170.361 53.470  1.00 168.86 ? 76   GLY B O   1 
ATOM   4635 N  N   . THR B 2  58  ? 67.158 168.922 55.056  1.00 121.86 ? 77   THR B N   1 
ATOM   4636 C  CA  . THR B 2  58  ? 65.876 168.891 55.748  1.00 124.35 ? 77   THR B CA  1 
ATOM   4637 C  C   . THR B 2  58  ? 65.860 169.983 56.812  1.00 140.62 ? 77   THR B C   1 
ATOM   4638 O  O   . THR B 2  58  ? 66.892 170.317 57.396  1.00 137.11 ? 77   THR B O   1 
ATOM   4639 C  CB  . THR B 2  58  ? 65.588 167.541 56.428  1.00 126.66 ? 77   THR B CB  1 
ATOM   4640 O  OG1 . THR B 2  58  ? 66.654 167.222 57.331  1.00 153.80 ? 77   THR B OG1 1 
ATOM   4641 C  CG2 . THR B 2  58  ? 65.461 166.438 55.390  1.00 130.66 ? 77   THR B CG2 1 
ATOM   4642 N  N   . SER B 2  59  ? 64.675 170.534 57.053  1.00 138.79 ? 78   SER B N   1 
ATOM   4643 C  CA  . SER B 2  59  ? 64.473 171.513 58.112  1.00 138.66 ? 78   SER B CA  1 
ATOM   4644 C  C   . SER B 2  59  ? 63.081 171.326 58.705  1.00 132.43 ? 78   SER B C   1 
ATOM   4645 O  O   . SER B 2  59  ? 62.078 171.682 58.084  1.00 155.72 ? 78   SER B O   1 
ATOM   4646 C  CB  . SER B 2  59  ? 64.651 172.937 57.583  1.00 121.32 ? 78   SER B CB  1 
ATOM   4647 O  OG  . SER B 2  59  ? 64.486 173.893 58.616  1.00 121.61 ? 78   SER B OG  1 
ATOM   4648 N  N   . TYR B 2  60  ? 63.027 170.758 59.906  1.00 113.67 ? 79   TYR B N   1 
ATOM   4649 C  CA  . TYR B 2  60  ? 61.758 170.410 60.535  1.00 114.56 ? 79   TYR B CA  1 
ATOM   4650 C  C   . TYR B 2  60  ? 61.296 171.466 61.532  1.00 140.52 ? 79   TYR B C   1 
ATOM   4651 O  O   . TYR B 2  60  ? 62.023 172.411 61.840  1.00 170.23 ? 79   TYR B O   1 
ATOM   4652 C  CB  . TYR B 2  60  ? 61.866 169.058 61.243  1.00 121.85 ? 79   TYR B CB  1 
ATOM   4653 C  CG  . TYR B 2  60  ? 62.398 167.941 60.377  1.00 123.02 ? 79   TYR B CG  1 
ATOM   4654 C  CD1 . TYR B 2  60  ? 61.547 167.193 59.574  1.00 119.33 ? 79   TYR B CD1 1 
ATOM   4655 C  CD2 . TYR B 2  60  ? 63.751 167.626 60.370  1.00 130.15 ? 79   TYR B CD2 1 
ATOM   4656 C  CE1 . TYR B 2  60  ? 62.030 166.167 58.783  1.00 119.23 ? 79   TYR B CE1 1 
ATOM   4657 C  CE2 . TYR B 2  60  ? 64.242 166.603 59.583  1.00 147.38 ? 79   TYR B CE2 1 
ATOM   4658 C  CZ  . TYR B 2  60  ? 63.378 165.877 58.791  1.00 136.37 ? 79   TYR B CZ  1 
ATOM   4659 O  OH  . TYR B 2  60  ? 63.864 164.857 58.006  1.00 146.15 ? 79   TYR B OH  1 
ATOM   4660 N  N   . ASN B 2  61  ? 60.078 171.289 62.032  1.00 116.35 ? 80   ASN B N   1 
ATOM   4661 C  CA  . ASN B 2  61  ? 59.543 172.132 63.092  1.00 134.38 ? 80   ASN B CA  1 
ATOM   4662 C  C   . ASN B 2  61  ? 59.795 171.456 64.434  1.00 174.52 ? 80   ASN B C   1 
ATOM   4663 O  O   . ASN B 2  61  ? 59.845 170.229 64.515  1.00 179.34 ? 80   ASN B O   1 
ATOM   4664 C  CB  . ASN B 2  61  ? 58.046 172.381 62.884  1.00 113.13 ? 80   ASN B CB  1 
ATOM   4665 C  CG  . ASN B 2  61  ? 57.498 173.473 63.787  1.00 114.57 ? 80   ASN B CG  1 
ATOM   4666 O  OD1 . ASN B 2  61  ? 58.090 173.809 64.813  1.00 152.14 ? 80   ASN B OD1 1 
ATOM   4667 N  ND2 . ASN B 2  61  ? 56.353 174.029 63.409  1.00 115.66 ? 80   ASN B ND2 1 
ATOM   4668 N  N   . GLN B 2  62  ? 59.950 172.258 65.483  1.00 204.98 ? 81   GLN B N   1 
ATOM   4669 C  CA  . GLN B 2  62  ? 60.197 171.732 66.822  1.00 219.64 ? 81   GLN B CA  1 
ATOM   4670 C  C   . GLN B 2  62  ? 59.023 170.881 67.303  1.00 209.01 ? 81   GLN B C   1 
ATOM   4671 O  O   . GLN B 2  62  ? 59.192 169.967 68.111  1.00 222.36 ? 81   GLN B O   1 
ATOM   4672 C  CB  . GLN B 2  62  ? 60.459 172.877 67.805  1.00 238.73 ? 81   GLN B CB  1 
ATOM   4673 C  CG  . GLN B 2  62  ? 60.876 172.425 69.197  1.00 248.13 ? 81   GLN B CG  1 
ATOM   4674 C  CD  . GLN B 2  62  ? 61.097 173.587 70.145  1.00 264.17 ? 81   GLN B CD  1 
ATOM   4675 O  OE1 . GLN B 2  62  ? 60.888 174.746 69.785  1.00 264.22 ? 81   GLN B OE1 1 
ATOM   4676 N  NE2 . GLN B 2  62  ? 61.522 173.282 71.365  1.00 286.67 ? 81   GLN B NE2 1 
ATOM   4677 N  N   . LYS B 2  63  ? 57.834 171.181 66.789  1.00 172.26 ? 82   LYS B N   1 
ATOM   4678 C  CA  . LYS B 2  63  ? 56.627 170.454 67.163  1.00 157.48 ? 82   LYS B CA  1 
ATOM   4679 C  C   . LYS B 2  63  ? 56.558 169.101 66.455  1.00 144.95 ? 82   LYS B C   1 
ATOM   4680 O  O   . LYS B 2  63  ? 55.796 168.219 66.853  1.00 146.81 ? 82   LYS B O   1 
ATOM   4681 C  CB  . LYS B 2  63  ? 55.383 171.288 66.840  1.00 155.56 ? 82   LYS B CB  1 
ATOM   4682 C  CG  . LYS B 2  63  ? 54.095 170.778 67.469  1.00 185.33 ? 82   LYS B CG  1 
ATOM   4683 C  CD  . LYS B 2  63  ? 52.913 171.666 67.110  1.00 197.32 ? 82   LYS B CD  1 
ATOM   4684 C  CE  . LYS B 2  63  ? 51.628 171.166 67.752  1.00 208.49 ? 82   LYS B CE  1 
ATOM   4685 N  NZ  . LYS B 2  63  ? 50.459 172.015 67.388  1.00 210.24 ? 82   LYS B NZ  1 
ATOM   4686 N  N   . PHE B 2  64  ? 57.364 168.938 65.410  1.00 133.23 ? 83   PHE B N   1 
ATOM   4687 C  CA  . PHE B 2  64  ? 57.345 167.711 64.620  1.00 127.63 ? 83   PHE B CA  1 
ATOM   4688 C  C   . PHE B 2  64  ? 58.697 167.000 64.613  1.00 148.27 ? 83   PHE B C   1 
ATOM   4689 O  O   . PHE B 2  64  ? 58.911 166.073 63.832  1.00 163.51 ? 83   PHE B O   1 
ATOM   4690 C  CB  . PHE B 2  64  ? 56.911 168.011 63.183  1.00 124.03 ? 83   PHE B CB  1 
ATOM   4691 C  CG  . PHE B 2  64  ? 55.505 168.532 63.068  1.00 136.25 ? 83   PHE B CG  1 
ATOM   4692 C  CD1 . PHE B 2  64  ? 55.246 169.891 63.134  1.00 154.57 ? 83   PHE B CD1 1 
ATOM   4693 C  CD2 . PHE B 2  64  ? 54.442 167.661 62.887  1.00 108.97 ? 83   PHE B CD2 1 
ATOM   4694 C  CE1 . PHE B 2  64  ? 53.955 170.372 63.026  1.00 134.70 ? 83   PHE B CE1 1 
ATOM   4695 C  CE2 . PHE B 2  64  ? 53.148 168.136 62.778  1.00 109.90 ? 83   PHE B CE2 1 
ATOM   4696 C  CZ  . PHE B 2  64  ? 52.905 169.493 62.848  1.00 111.76 ? 83   PHE B CZ  1 
ATOM   4697 N  N   . LYS B 2  65  ? 59.607 167.435 65.481  1.00 154.97 ? 84   LYS B N   1 
ATOM   4698 C  CA  . LYS B 2  65  ? 60.917 166.799 65.590  1.00 164.52 ? 84   LYS B CA  1 
ATOM   4699 C  C   . LYS B 2  65  ? 60.786 165.380 66.131  1.00 167.47 ? 84   LYS B C   1 
ATOM   4700 O  O   . LYS B 2  65  ? 60.392 165.177 67.279  1.00 182.47 ? 84   LYS B O   1 
ATOM   4701 C  CB  . LYS B 2  65  ? 61.849 167.619 66.486  1.00 182.16 ? 84   LYS B CB  1 
ATOM   4702 C  CG  . LYS B 2  65  ? 62.404 168.873 65.828  1.00 189.41 ? 84   LYS B CG  1 
ATOM   4703 C  CD  . LYS B 2  65  ? 63.352 169.617 66.756  1.00 197.05 ? 84   LYS B CD  1 
ATOM   4704 C  CE  . LYS B 2  65  ? 63.912 170.864 66.090  1.00 185.79 ? 84   LYS B CE  1 
ATOM   4705 N  NZ  . LYS B 2  65  ? 64.849 171.598 66.984  1.00 181.42 ? 84   LYS B NZ  1 
ATOM   4706 N  N   . GLY B 2  66  ? 61.119 164.401 65.295  1.00 137.89 ? 85   GLY B N   1 
ATOM   4707 C  CA  . GLY B 2  66  ? 61.017 163.005 65.678  1.00 169.99 ? 85   GLY B CA  1 
ATOM   4708 C  C   . GLY B 2  66  ? 59.657 162.407 65.376  1.00 149.35 ? 85   GLY B C   1 
ATOM   4709 O  O   . GLY B 2  66  ? 59.367 161.273 65.759  1.00 142.76 ? 85   GLY B O   1 
ATOM   4710 N  N   . LYS B 2  67  ? 58.820 163.174 64.686  1.00 162.48 ? 86   LYS B N   1 
ATOM   4711 C  CA  . LYS B 2  67  ? 57.480 162.723 64.328  1.00 166.23 ? 86   LYS B CA  1 
ATOM   4712 C  C   . LYS B 2  67  ? 57.377 162.434 62.834  1.00 148.87 ? 86   LYS B C   1 
ATOM   4713 O  O   . LYS B 2  67  ? 56.780 161.438 62.423  1.00 145.91 ? 86   LYS B O   1 
ATOM   4714 C  CB  . LYS B 2  67  ? 56.437 163.767 64.735  1.00 166.32 ? 86   LYS B CB  1 
ATOM   4715 C  CG  . LYS B 2  67  ? 55.017 163.423 64.313  1.00 154.27 ? 86   LYS B CG  1 
ATOM   4716 C  CD  . LYS B 2  67  ? 54.578 162.089 64.892  1.00 154.95 ? 86   LYS B CD  1 
ATOM   4717 C  CE  . LYS B 2  67  ? 53.198 161.701 64.393  1.00 171.00 ? 86   LYS B CE  1 
ATOM   4718 N  NZ  . LYS B 2  67  ? 52.764 160.383 64.933  1.00 187.68 ? 86   LYS B NZ  1 
ATOM   4719 N  N   . ALA B 2  68  ? 57.965 163.311 62.026  1.00 128.73 ? 87   ALA B N   1 
ATOM   4720 C  CA  . ALA B 2  68  ? 57.930 163.162 60.576  1.00 98.73  ? 87   ALA B CA  1 
ATOM   4721 C  C   . ALA B 2  68  ? 59.337 163.036 60.002  1.00 143.12 ? 87   ALA B C   1 
ATOM   4722 O  O   . ALA B 2  68  ? 60.291 163.595 60.544  1.00 182.55 ? 87   ALA B O   1 
ATOM   4723 C  CB  . ALA B 2  68  ? 57.204 164.337 59.942  1.00 99.33  ? 87   ALA B CB  1 
ATOM   4724 N  N   . THR B 2  69  ? 59.459 162.300 58.901  1.00 125.09 ? 88   THR B N   1 
ATOM   4725 C  CA  . THR B 2  69  ? 60.742 162.135 58.228  1.00 108.50 ? 88   THR B CA  1 
ATOM   4726 C  C   . THR B 2  69  ? 60.613 162.445 56.739  1.00 103.11 ? 88   THR B C   1 
ATOM   4727 O  O   . THR B 2  69  ? 59.887 161.761 56.016  1.00 141.65 ? 88   THR B O   1 
ATOM   4728 C  CB  . THR B 2  69  ? 61.296 160.709 58.406  1.00 108.64 ? 88   THR B CB  1 
ATOM   4729 O  OG1 . THR B 2  69  ? 61.508 160.446 59.799  1.00 155.40 ? 88   THR B OG1 1 
ATOM   4730 C  CG2 . THR B 2  69  ? 62.611 160.547 57.659  1.00 120.01 ? 88   THR B CG2 1 
ATOM   4731 N  N   . LEU B 2  70  ? 61.320 163.476 56.285  1.00 101.30 ? 89   LEU B N   1 
ATOM   4732 C  CA  . LEU B 2  70  ? 61.252 163.896 54.889  1.00 89.24  ? 89   LEU B CA  1 
ATOM   4733 C  C   . LEU B 2  70  ? 62.404 163.327 54.066  1.00 118.95 ? 89   LEU B C   1 
ATOM   4734 O  O   . LEU B 2  70  ? 63.562 163.380 54.479  1.00 128.83 ? 89   LEU B O   1 
ATOM   4735 C  CB  . LEU B 2  70  ? 61.255 165.423 54.788  1.00 99.46  ? 89   LEU B CB  1 
ATOM   4736 C  CG  . LEU B 2  70  ? 60.162 166.170 55.554  1.00 102.07 ? 89   LEU B CG  1 
ATOM   4737 C  CD1 . LEU B 2  70  ? 60.229 167.664 55.273  1.00 84.46  ? 89   LEU B CD1 1 
ATOM   4738 C  CD2 . LEU B 2  70  ? 58.794 165.615 55.205  1.00 119.34 ? 89   LEU B CD2 1 
ATOM   4739 N  N   . THR B 2  71  ? 62.074 162.784 52.899  1.00 126.86 ? 90   THR B N   1 
ATOM   4740 C  CA  . THR B 2  71  ? 63.082 162.300 51.962  1.00 134.93 ? 90   THR B CA  1 
ATOM   4741 C  C   . THR B 2  71  ? 62.768 162.810 50.560  1.00 121.08 ? 90   THR B C   1 
ATOM   4742 O  O   . THR B 2  71  ? 61.697 163.370 50.323  1.00 143.20 ? 90   THR B O   1 
ATOM   4743 C  CB  . THR B 2  71  ? 63.163 160.762 51.948  1.00 157.45 ? 90   THR B CB  1 
ATOM   4744 O  OG1 . THR B 2  71  ? 61.848 160.211 51.810  1.00 143.92 ? 90   THR B OG1 1 
ATOM   4745 C  CG2 . THR B 2  71  ? 63.794 160.245 53.233  1.00 170.30 ? 90   THR B CG2 1 
ATOM   4746 N  N   . VAL B 2  72  ? 63.699 162.618 49.631  1.00 97.78  ? 91   VAL B N   1 
ATOM   4747 C  CA  . VAL B 2  72  ? 63.523 163.123 48.276  1.00 97.80  ? 91   VAL B CA  1 
ATOM   4748 C  C   . VAL B 2  72  ? 64.242 162.232 47.263  1.00 120.82 ? 91   VAL B C   1 
ATOM   4749 O  O   . VAL B 2  72  ? 65.220 161.559 47.592  1.00 127.49 ? 91   VAL B O   1 
ATOM   4750 C  CB  . VAL B 2  72  ? 64.008 164.589 48.176  1.00 120.19 ? 91   VAL B CB  1 
ATOM   4751 C  CG1 . VAL B 2  72  ? 65.529 164.662 48.230  1.00 133.41 ? 91   VAL B CG1 1 
ATOM   4752 C  CG2 . VAL B 2  72  ? 63.464 165.262 46.921  1.00 106.44 ? 91   VAL B CG2 1 
ATOM   4753 N  N   . ASP B 2  73  ? 63.736 162.221 46.033  1.00 135.21 ? 92   ASP B N   1 
ATOM   4754 C  CA  . ASP B 2  73  ? 64.345 161.466 44.944  1.00 147.53 ? 92   ASP B CA  1 
ATOM   4755 C  C   . ASP B 2  73  ? 64.427 162.324 43.685  1.00 148.32 ? 92   ASP B C   1 
ATOM   4756 O  O   . ASP B 2  73  ? 63.403 162.741 43.140  1.00 168.27 ? 92   ASP B O   1 
ATOM   4757 C  CB  . ASP B 2  73  ? 63.552 160.187 44.664  1.00 146.95 ? 92   ASP B CB  1 
ATOM   4758 C  CG  . ASP B 2  73  ? 64.140 159.374 43.527  1.00 167.16 ? 92   ASP B CG  1 
ATOM   4759 O  OD1 . ASP B 2  73  ? 65.380 159.363 43.380  1.00 202.51 ? 92   ASP B OD1 1 
ATOM   4760 O  OD2 . ASP B 2  73  ? 63.361 158.746 42.780  1.00 151.88 ? 92   ASP B OD2 1 
ATOM   4761 N  N   . LYS B 2  74  ? 65.649 162.586 43.229  1.00 149.57 ? 93   LYS B N   1 
ATOM   4762 C  CA  . LYS B 2  74  ? 65.870 163.432 42.061  1.00 145.62 ? 93   LYS B CA  1 
ATOM   4763 C  C   . LYS B 2  74  ? 65.692 162.661 40.758  1.00 167.78 ? 93   LYS B C   1 
ATOM   4764 O  O   . LYS B 2  74  ? 65.414 163.249 39.713  1.00 179.08 ? 93   LYS B O   1 
ATOM   4765 C  CB  . LYS B 2  74  ? 67.267 164.052 42.106  1.00 155.53 ? 93   LYS B CB  1 
ATOM   4766 C  CG  . LYS B 2  74  ? 67.536 164.908 43.330  1.00 144.59 ? 93   LYS B CG  1 
ATOM   4767 C  CD  . LYS B 2  74  ? 68.886 165.599 43.225  1.00 142.27 ? 93   LYS B CD  1 
ATOM   4768 C  CE  . LYS B 2  74  ? 70.012 164.594 43.041  1.00 152.79 ? 93   LYS B CE  1 
ATOM   4769 N  NZ  . LYS B 2  74  ? 71.333 165.265 42.896  1.00 157.26 ? 93   LYS B NZ  1 
ATOM   4770 N  N   . SER B 2  75  ? 65.857 161.343 40.825  1.00 178.39 ? 94   SER B N   1 
ATOM   4771 C  CA  . SER B 2  75  ? 65.749 160.495 39.642  1.00 190.77 ? 94   SER B CA  1 
ATOM   4772 C  C   . SER B 2  75  ? 64.330 160.490 39.082  1.00 185.39 ? 94   SER B C   1 
ATOM   4773 O  O   . SER B 2  75  ? 64.123 160.238 37.895  1.00 205.04 ? 94   SER B O   1 
ATOM   4774 C  CB  . SER B 2  75  ? 66.189 159.066 39.968  1.00 226.53 ? 94   SER B CB  1 
ATOM   4775 O  OG  . SER B 2  75  ? 67.542 159.033 40.387  1.00 241.69 ? 94   SER B OG  1 
ATOM   4776 N  N   . SER B 2  76  ? 63.357 160.770 39.943  1.00 169.28 ? 95   SER B N   1 
ATOM   4777 C  CA  . SER B 2  76  ? 61.959 160.810 39.532  1.00 165.58 ? 95   SER B CA  1 
ATOM   4778 C  C   . SER B 2  76  ? 61.285 162.095 40.003  1.00 115.72 ? 95   SER B C   1 
ATOM   4779 O  O   . SER B 2  76  ? 60.088 162.289 39.788  1.00 110.40 ? 95   SER B O   1 
ATOM   4780 C  CB  . SER B 2  76  ? 61.206 159.593 40.072  1.00 196.04 ? 95   SER B CB  1 
ATOM   4781 O  OG  . SER B 2  76  ? 59.845 159.616 39.676  1.00 205.79 ? 95   SER B OG  1 
ATOM   4782 N  N   . THR B 2  77  ? 62.070 162.965 40.637  1.00 129.77 ? 96   THR B N   1 
ATOM   4783 C  CA  . THR B 2  77  ? 61.585 164.237 41.177  1.00 120.99 ? 96   THR B CA  1 
ATOM   4784 C  C   . THR B 2  77  ? 60.366 164.039 42.074  1.00 116.22 ? 96   THR B C   1 
ATOM   4785 O  O   . THR B 2  77  ? 59.295 164.587 41.812  1.00 109.37 ? 96   THR B O   1 
ATOM   4786 C  CB  . THR B 2  77  ? 61.227 165.238 40.056  1.00 98.46  ? 96   THR B CB  1 
ATOM   4787 O  OG1 . THR B 2  77  ? 60.077 164.772 39.339  1.00 111.91 ? 96   THR B OG1 1 
ATOM   4788 C  CG2 . THR B 2  77  ? 62.392 165.396 39.090  1.00 95.34  ? 96   THR B CG2 1 
ATOM   4789 N  N   . THR B 2  78  ? 60.536 163.254 43.134  1.00 135.52 ? 97   THR B N   1 
ATOM   4790 C  CA  . THR B 2  78  ? 59.429 162.929 44.027  1.00 133.41 ? 97   THR B CA  1 
ATOM   4791 C  C   . THR B 2  78  ? 59.835 163.043 45.494  1.00 134.41 ? 97   THR B C   1 
ATOM   4792 O  O   . THR B 2  78  ? 60.855 162.494 45.909  1.00 124.71 ? 97   THR B O   1 
ATOM   4793 C  CB  . THR B 2  78  ? 58.897 161.507 43.760  1.00 133.09 ? 97   THR B CB  1 
ATOM   4794 O  OG1 . THR B 2  78  ? 58.552 161.376 42.375  1.00 137.24 ? 97   THR B OG1 1 
ATOM   4795 C  CG2 . THR B 2  78  ? 57.668 161.227 44.611  1.00 139.22 ? 97   THR B CG2 1 
ATOM   4796 N  N   . ALA B 2  79  ? 59.030 163.758 46.274  1.00 133.37 ? 98   ALA B N   1 
ATOM   4797 C  CA  . ALA B 2  79  ? 59.293 163.919 47.700  1.00 129.62 ? 98   ALA B CA  1 
ATOM   4798 C  C   . ALA B 2  79  ? 58.480 162.922 48.518  1.00 122.82 ? 98   ALA B C   1 
ATOM   4799 O  O   . ALA B 2  79  ? 57.436 162.449 48.074  1.00 141.07 ? 98   ALA B O   1 
ATOM   4800 C  CB  . ALA B 2  79  ? 58.985 165.338 48.138  1.00 107.62 ? 98   ALA B CB  1 
ATOM   4801 N  N   . TYR B 2  80  ? 58.963 162.605 49.715  1.00 104.48 ? 99   TYR B N   1 
ATOM   4802 C  CA  . TYR B 2  80  ? 58.280 161.646 50.577  1.00 116.71 ? 99   TYR B CA  1 
ATOM   4803 C  C   . TYR B 2  80  ? 58.248 162.112 52.029  1.00 117.15 ? 99   TYR B C   1 
ATOM   4804 O  O   . TYR B 2  80  ? 59.192 162.741 52.512  1.00 121.23 ? 99   TYR B O   1 
ATOM   4805 C  CB  . TYR B 2  80  ? 58.953 160.273 50.490  1.00 130.45 ? 99   TYR B CB  1 
ATOM   4806 C  CG  . TYR B 2  80  ? 58.950 159.660 49.107  1.00 117.95 ? 99   TYR B CG  1 
ATOM   4807 C  CD1 . TYR B 2  80  ? 57.884 158.884 48.672  1.00 125.24 ? 99   TYR B CD1 1 
ATOM   4808 C  CD2 . TYR B 2  80  ? 60.019 159.849 48.240  1.00 122.92 ? 99   TYR B CD2 1 
ATOM   4809 C  CE1 . TYR B 2  80  ? 57.879 158.318 47.411  1.00 150.03 ? 99   TYR B CE1 1 
ATOM   4810 C  CE2 . TYR B 2  80  ? 60.023 159.287 46.977  1.00 137.56 ? 99   TYR B CE2 1 
ATOM   4811 C  CZ  . TYR B 2  80  ? 58.951 158.522 46.568  1.00 152.15 ? 99   TYR B CZ  1 
ATOM   4812 O  OH  . TYR B 2  80  ? 58.949 157.960 45.311  1.00 155.64 ? 99   TYR B OH  1 
ATOM   4813 N  N   . MET B 2  81  ? 57.154 161.800 52.717  1.00 99.82  ? 100  MET B N   1 
ATOM   4814 C  CA  . MET B 2  81  ? 57.031 162.082 54.144  1.00 115.20 ? 100  MET B CA  1 
ATOM   4815 C  C   . MET B 2  81  ? 56.553 160.842 54.892  1.00 125.77 ? 100  MET B C   1 
ATOM   4816 O  O   . MET B 2  81  ? 55.518 160.268 54.553  1.00 140.62 ? 100  MET B O   1 
ATOM   4817 C  CB  . MET B 2  81  ? 56.068 163.245 54.393  1.00 113.36 ? 100  MET B CB  1 
ATOM   4818 C  CG  . MET B 2  81  ? 55.868 163.563 55.868  1.00 118.41 ? 100  MET B CG  1 
ATOM   4819 S  SD  . MET B 2  81  ? 54.638 164.849 56.166  1.00 148.46 ? 100  MET B SD  1 
ATOM   4820 C  CE  . MET B 2  81  ? 53.150 164.035 55.590  1.00 152.24 ? 100  MET B CE  1 
ATOM   4821 N  N   . GLU B 2  82  ? 57.305 160.433 55.909  1.00 121.65 ? 101  GLU B N   1 
ATOM   4822 C  CA  . GLU B 2  82  ? 56.953 159.244 56.679  1.00 128.65 ? 101  GLU B CA  1 
ATOM   4823 C  C   . GLU B 2  82  ? 56.579 159.598 58.117  1.00 143.94 ? 101  GLU B C   1 
ATOM   4824 O  O   . GLU B 2  82  ? 57.229 160.429 58.755  1.00 166.80 ? 101  GLU B O   1 
ATOM   4825 C  CB  . GLU B 2  82  ? 58.105 158.234 56.663  1.00 140.17 ? 101  GLU B CB  1 
ATOM   4826 C  CG  . GLU B 2  82  ? 57.773 156.897 57.313  1.00 145.94 ? 101  GLU B CG  1 
ATOM   4827 C  CD  . GLU B 2  82  ? 58.867 155.865 57.121  1.00 177.34 ? 101  GLU B CD  1 
ATOM   4828 O  OE1 . GLU B 2  82  ? 58.764 154.770 57.714  1.00 176.28 ? 101  GLU B OE1 1 
ATOM   4829 O  OE2 . GLU B 2  82  ? 59.829 156.146 56.375  1.00 194.41 ? 101  GLU B OE2 1 
ATOM   4830 N  N   . LEU B 2  83  ? 55.524 158.958 58.614  1.00 143.28 ? 102  LEU B N   1 
ATOM   4831 C  CA  . LEU B 2  83  ? 55.032 159.185 59.967  1.00 140.94 ? 102  LEU B CA  1 
ATOM   4832 C  C   . LEU B 2  83  ? 55.021 157.885 60.767  1.00 162.14 ? 102  LEU B C   1 
ATOM   4833 O  O   . LEU B 2  83  ? 54.464 156.878 60.321  1.00 171.66 ? 102  LEU B O   1 
ATOM   4834 C  CB  . LEU B 2  83  ? 53.624 159.786 59.932  1.00 112.77 ? 102  LEU B CB  1 
ATOM   4835 C  CG  . LEU B 2  83  ? 53.435 161.083 59.144  1.00 109.31 ? 102  LEU B CG  1 
ATOM   4836 C  CD1 . LEU B 2  83  ? 51.964 161.467 59.081  1.00 93.33  ? 102  LEU B CD1 1 
ATOM   4837 C  CD2 . LEU B 2  83  ? 54.254 162.203 59.758  1.00 107.15 ? 102  LEU B CD2 1 
ATOM   4838 N  N   . ARG B 2  84  ? 55.638 157.912 61.945  1.00 153.39 ? 103  ARG B N   1 
ATOM   4839 C  CA  . ARG B 2  84  ? 55.634 156.759 62.840  1.00 165.41 ? 103  ARG B CA  1 
ATOM   4840 C  C   . ARG B 2  84  ? 54.895 157.100 64.130  1.00 171.66 ? 103  ARG B C   1 
ATOM   4841 O  O   . ARG B 2  84  ? 54.646 158.274 64.412  1.00 145.25 ? 103  ARG B O   1 
ATOM   4842 C  CB  . ARG B 2  84  ? 57.061 156.301 63.154  1.00 161.02 ? 103  ARG B CB  1 
ATOM   4843 C  CG  . ARG B 2  84  ? 57.790 157.167 64.172  1.00 164.21 ? 103  ARG B CG  1 
ATOM   4844 C  CD  . ARG B 2  84  ? 59.084 156.506 64.630  1.00 169.23 ? 103  ARG B CD  1 
ATOM   4845 N  NE  . ARG B 2  84  ? 59.696 157.210 65.754  1.00 181.95 ? 103  ARG B NE  1 
ATOM   4846 C  CZ  . ARG B 2  84  ? 60.666 158.112 65.636  1.00 189.42 ? 103  ARG B CZ  1 
ATOM   4847 N  NH1 . ARG B 2  84  ? 61.142 158.424 64.438  1.00 189.89 ? 103  ARG B NH1 1 
ATOM   4848 N  NH2 . ARG B 2  84  ? 61.162 158.700 66.716  1.00 188.09 ? 103  ARG B NH2 1 
ATOM   4849 N  N   . SER B 2  85  ? 54.555 156.071 64.904  1.00 192.17 ? 104  SER B N   1 
ATOM   4850 C  CA  . SER B 2  85  ? 53.806 156.230 66.150  1.00 200.62 ? 104  SER B CA  1 
ATOM   4851 C  C   . SER B 2  85  ? 52.512 157.002 65.911  1.00 184.42 ? 104  SER B C   1 
ATOM   4852 O  O   . SER B 2  85  ? 52.294 158.066 66.490  1.00 198.10 ? 104  SER B O   1 
ATOM   4853 C  CB  . SER B 2  85  ? 54.657 156.934 67.211  1.00 216.81 ? 104  SER B CB  1 
ATOM   4854 O  OG  . SER B 2  85  ? 55.822 156.185 67.509  1.00 216.66 ? 104  SER B OG  1 
ATOM   4855 N  N   . LEU B 2  86  ? 51.660 156.453 65.053  1.00 147.97 ? 105  LEU B N   1 
ATOM   4856 C  CA  . LEU B 2  86  ? 50.442 157.134 64.631  1.00 139.47 ? 105  LEU B CA  1 
ATOM   4857 C  C   . LEU B 2  86  ? 49.352 157.100 65.696  1.00 129.45 ? 105  LEU B C   1 
ATOM   4858 O  O   . LEU B 2  86  ? 49.100 156.065 66.312  1.00 130.86 ? 105  LEU B O   1 
ATOM   4859 C  CB  . LEU B 2  86  ? 49.924 156.515 63.332  1.00 117.66 ? 105  LEU B CB  1 
ATOM   4860 C  CG  . LEU B 2  86  ? 50.820 156.745 62.116  1.00 141.76 ? 105  LEU B CG  1 
ATOM   4861 C  CD1 . LEU B 2  86  ? 50.478 155.770 61.006  1.00 160.48 ? 105  LEU B CD1 1 
ATOM   4862 C  CD2 . LEU B 2  86  ? 50.693 158.180 61.630  1.00 124.18 ? 105  LEU B CD2 1 
ATOM   4863 N  N   . THR B 2  87  ? 48.713 158.246 65.907  1.00 132.58 ? 106  THR B N   1 
ATOM   4864 C  CA  . THR B 2  87  ? 47.610 158.356 66.853  1.00 135.00 ? 106  THR B CA  1 
ATOM   4865 C  C   . THR B 2  87  ? 46.403 158.997 66.178  1.00 144.97 ? 106  THR B C   1 
ATOM   4866 O  O   . THR B 2  87  ? 46.447 159.325 64.993  1.00 135.22 ? 106  THR B O   1 
ATOM   4867 C  CB  . THR B 2  87  ? 47.999 159.185 68.093  1.00 139.23 ? 106  THR B CB  1 
ATOM   4868 O  OG1 . THR B 2  87  ? 48.356 160.513 67.691  1.00 158.33 ? 106  THR B OG1 1 
ATOM   4869 C  CG2 . THR B 2  87  ? 49.174 158.546 68.819  1.00 141.24 ? 106  THR B CG2 1 
ATOM   4870 N  N   . SER B 2  88  ? 45.329 159.181 66.940  1.00 153.31 ? 107  SER B N   1 
ATOM   4871 C  CA  . SER B 2  88  ? 44.105 159.770 66.409  1.00 159.21 ? 107  SER B CA  1 
ATOM   4872 C  C   . SER B 2  88  ? 44.314 161.222 65.980  1.00 151.97 ? 107  SER B C   1 
ATOM   4873 O  O   . SER B 2  88  ? 43.576 161.742 65.144  1.00 152.94 ? 107  SER B O   1 
ATOM   4874 C  CB  . SER B 2  88  ? 42.982 159.688 67.445  1.00 190.24 ? 107  SER B CB  1 
ATOM   4875 O  OG  . SER B 2  88  ? 43.338 160.363 68.638  1.00 219.78 ? 107  SER B OG  1 
ATOM   4876 N  N   . GLU B 2  89  ? 45.323 161.869 66.555  1.00 149.09 ? 108  GLU B N   1 
ATOM   4877 C  CA  . GLU B 2  89  ? 45.644 163.251 66.215  1.00 150.30 ? 108  GLU B CA  1 
ATOM   4878 C  C   . GLU B 2  89  ? 46.229 163.352 64.811  1.00 142.44 ? 108  GLU B C   1 
ATOM   4879 O  O   . GLU B 2  89  ? 46.065 164.365 64.131  1.00 143.16 ? 108  GLU B O   1 
ATOM   4880 C  CB  . GLU B 2  89  ? 46.623 163.844 67.230  1.00 168.97 ? 108  GLU B CB  1 
ATOM   4881 C  CG  . GLU B 2  89  ? 46.050 164.018 68.627  1.00 190.99 ? 108  GLU B CG  1 
ATOM   4882 C  CD  . GLU B 2  89  ? 45.032 165.140 68.709  1.00 203.06 ? 108  GLU B CD  1 
ATOM   4883 O  OE1 . GLU B 2  89  ? 45.014 166.000 67.804  1.00 218.70 ? 108  GLU B OE1 1 
ATOM   4884 O  OE2 . GLU B 2  89  ? 44.249 165.162 69.682  1.00 189.58 ? 108  GLU B OE2 1 
ATOM   4885 N  N   . ASP B 2  90  ? 46.911 162.295 64.384  1.00 143.83 ? 109  ASP B N   1 
ATOM   4886 C  CA  . ASP B 2  90  ? 47.555 162.275 63.076  1.00 142.72 ? 109  ASP B CA  1 
ATOM   4887 C  C   . ASP B 2  90  ? 46.539 162.091 61.955  1.00 157.23 ? 109  ASP B C   1 
ATOM   4888 O  O   . ASP B 2  90  ? 46.856 162.279 60.781  1.00 168.59 ? 109  ASP B O   1 
ATOM   4889 C  CB  . ASP B 2  90  ? 48.608 161.168 63.020  1.00 130.07 ? 109  ASP B CB  1 
ATOM   4890 C  CG  . ASP B 2  90  ? 49.700 161.353 64.053  1.00 138.19 ? 109  ASP B CG  1 
ATOM   4891 O  OD1 . ASP B 2  90  ? 49.989 162.514 64.412  1.00 129.21 ? 109  ASP B OD1 1 
ATOM   4892 O  OD2 . ASP B 2  90  ? 50.267 160.340 64.510  1.00 148.68 ? 109  ASP B OD2 1 
ATOM   4893 N  N   . SER B 2  91  ? 45.317 161.719 62.323  1.00 159.73 ? 110  SER B N   1 
ATOM   4894 C  CA  . SER B 2  91  ? 44.243 161.572 61.350  1.00 155.38 ? 110  SER B CA  1 
ATOM   4895 C  C   . SER B 2  91  ? 43.951 162.979 60.839  1.00 140.70 ? 110  SER B C   1 
ATOM   4896 O  O   . SER B 2  91  ? 43.095 163.679 61.376  1.00 129.42 ? 110  SER B O   1 
ATOM   4897 C  CB  . SER B 2  91  ? 43.031 160.883 61.981  1.00 158.00 ? 110  SER B CB  1 
ATOM   4898 O  OG  . SER B 2  91  ? 43.359 159.579 62.429  1.00 135.96 ? 110  SER B OG  1 
ATOM   4899 N  N   . ALA B 2  92  ? 44.494 163.347 59.719  1.00 124.27 ? 111  ALA B N   1 
ATOM   4900 C  CA  . ALA B 2  92  ? 44.339 164.692 59.180  1.00 109.20 ? 111  ALA B CA  1 
ATOM   4901 C  C   . ALA B 2  92  ? 44.657 164.688 57.688  1.00 98.74  ? 111  ALA B C   1 
ATOM   4902 O  O   . ALA B 2  92  ? 44.983 163.648 57.116  1.00 98.73  ? 111  ALA B O   1 
ATOM   4903 C  CB  . ALA B 2  92  ? 45.158 165.754 59.892  1.00 82.56  ? 111  ALA B CB  1 
ATOM   4904 N  N   . VAL B 2  93  ? 44.559 165.859 57.065  1.00 95.62  ? 112  VAL B N   1 
ATOM   4905 C  CA  . VAL B 2  93  ? 44.854 165.998 55.645  1.00 102.94 ? 112  VAL B CA  1 
ATOM   4906 C  C   . VAL B 2  93  ? 46.223 166.639 55.461  1.00 126.16 ? 112  VAL B C   1 
ATOM   4907 O  O   . VAL B 2  93  ? 46.478 167.734 55.959  1.00 127.51 ? 112  VAL B O   1 
ATOM   4908 C  CB  . VAL B 2  93  ? 43.769 166.816 54.926  1.00 119.36 ? 112  VAL B CB  1 
ATOM   4909 C  CG1 . VAL B 2  93  ? 44.103 166.956 53.449  1.00 109.71 ? 112  VAL B CG1 1 
ATOM   4910 C  CG2 . VAL B 2  93  ? 42.407 166.165 55.111  1.00 160.95 ? 112  VAL B CG2 1 
ATOM   4911 N  N   . TYR B 2  94  ? 47.101 165.951 54.738  1.00 111.32 ? 113  TYR B N   1 
ATOM   4912 C  CA  . TYR B 2  94  ? 48.468 166.419 54.548  1.00 86.03  ? 113  TYR B CA  1 
ATOM   4913 C  C   . TYR B 2  94  ? 48.711 166.906 53.121  1.00 103.90 ? 113  TYR B C   1 
ATOM   4914 O  O   . TYR B 2  94  ? 48.271 166.281 52.156  1.00 109.38 ? 113  TYR B O   1 
ATOM   4915 C  CB  . TYR B 2  94  ? 49.462 165.309 54.899  1.00 97.85  ? 113  TYR B CB  1 
ATOM   4916 C  CG  . TYR B 2  94  ? 49.391 164.860 56.342  1.00 121.51 ? 113  TYR B CG  1 
ATOM   4917 C  CD1 . TYR B 2  94  ? 48.537 163.836 56.731  1.00 110.56 ? 113  TYR B CD1 1 
ATOM   4918 C  CD2 . TYR B 2  94  ? 50.176 165.463 57.315  1.00 132.34 ? 113  TYR B CD2 1 
ATOM   4919 C  CE1 . TYR B 2  94  ? 48.469 163.425 58.049  1.00 121.22 ? 113  TYR B CE1 1 
ATOM   4920 C  CE2 . TYR B 2  94  ? 50.116 165.058 58.634  1.00 112.24 ? 113  TYR B CE2 1 
ATOM   4921 C  CZ  . TYR B 2  94  ? 49.260 164.039 58.995  1.00 116.12 ? 113  TYR B CZ  1 
ATOM   4922 O  OH  . TYR B 2  94  ? 49.197 163.634 60.308  1.00 131.80 ? 113  TYR B OH  1 
ATOM   4923 N  N   . TYR B 2  95  ? 49.413 168.029 53.002  1.00 97.10  ? 114  TYR B N   1 
ATOM   4924 C  CA  . TYR B 2  95  ? 49.754 168.605 51.706  1.00 91.21  ? 114  TYR B CA  1 
ATOM   4925 C  C   . TYR B 2  95  ? 51.264 168.687 51.521  1.00 94.50  ? 114  TYR B C   1 
ATOM   4926 O  O   . TYR B 2  95  ? 52.015 168.744 52.493  1.00 96.01  ? 114  TYR B O   1 
ATOM   4927 C  CB  . TYR B 2  95  ? 49.153 170.005 51.555  1.00 96.28  ? 114  TYR B CB  1 
ATOM   4928 C  CG  . TYR B 2  95  ? 47.645 170.057 51.603  1.00 109.68 ? 114  TYR B CG  1 
ATOM   4929 C  CD1 . TYR B 2  95  ? 46.975 170.212 52.809  1.00 113.09 ? 114  TYR B CD1 1 
ATOM   4930 C  CD2 . TYR B 2  95  ? 46.892 169.967 50.441  1.00 120.15 ? 114  TYR B CD2 1 
ATOM   4931 C  CE1 . TYR B 2  95  ? 45.596 170.265 52.857  1.00 124.71 ? 114  TYR B CE1 1 
ATOM   4932 C  CE2 . TYR B 2  95  ? 45.512 170.020 50.479  1.00 139.18 ? 114  TYR B CE2 1 
ATOM   4933 C  CZ  . TYR B 2  95  ? 44.870 170.169 51.689  1.00 151.54 ? 114  TYR B CZ  1 
ATOM   4934 O  OH  . TYR B 2  95  ? 43.496 170.223 51.731  1.00 174.36 ? 114  TYR B OH  1 
ATOM   4935 N  N   . CYS B 2  96  ? 51.706 168.697 50.269  1.00 96.03  ? 115  CYS B N   1 
ATOM   4936 C  CA  . CYS B 2  96  ? 53.101 168.984 49.961  1.00 96.47  ? 115  CYS B CA  1 
ATOM   4937 C  C   . CYS B 2  96  ? 53.158 170.175 49.012  1.00 100.08 ? 115  CYS B C   1 
ATOM   4938 O  O   . CYS B 2  96  ? 52.644 170.120 47.896  1.00 141.10 ? 115  CYS B O   1 
ATOM   4939 C  CB  . CYS B 2  96  ? 53.803 167.762 49.359  1.00 121.52 ? 115  CYS B CB  1 
ATOM   4940 S  SG  . CYS B 2  96  ? 53.052 167.067 47.866  1.00 158.29 ? 115  CYS B SG  1 
ATOM   4941 N  N   . THR B 2  97  ? 53.773 171.262 49.466  1.00 78.66  ? 116  THR B N   1 
ATOM   4942 C  CA  . THR B 2  97  ? 53.760 172.502 48.700  1.00 97.30  ? 116  THR B CA  1 
ATOM   4943 C  C   . THR B 2  97  ? 55.161 173.007 48.358  1.00 98.63  ? 116  THR B C   1 
ATOM   4944 O  O   . THR B 2  97  ? 56.080 172.938 49.173  1.00 99.16  ? 116  THR B O   1 
ATOM   4945 C  CB  . THR B 2  97  ? 52.996 173.609 49.455  1.00 97.74  ? 116  THR B CB  1 
ATOM   4946 O  OG1 . THR B 2  97  ? 53.166 174.860 48.777  1.00 126.34 ? 116  THR B OG1 1 
ATOM   4947 C  CG2 . THR B 2  97  ? 53.494 173.730 50.888  1.00 86.80  ? 116  THR B CG2 1 
ATOM   4948 N  N   . ARG B 2  98  ? 55.308 173.514 47.138  1.00 95.69  ? 117  ARG B N   1 
ATOM   4949 C  CA  . ARG B 2  98  ? 56.571 174.072 46.670  1.00 101.46 ? 117  ARG B CA  1 
ATOM   4950 C  C   . ARG B 2  98  ? 56.811 175.442 47.295  1.00 103.64 ? 117  ARG B C   1 
ATOM   4951 O  O   . ARG B 2  98  ? 55.863 176.196 47.517  1.00 105.17 ? 117  ARG B O   1 
ATOM   4952 C  CB  . ARG B 2  98  ? 56.569 174.186 45.144  1.00 106.34 ? 117  ARG B CB  1 
ATOM   4953 C  CG  . ARG B 2  98  ? 57.930 174.473 44.540  1.00 109.65 ? 117  ARG B CG  1 
ATOM   4954 C  CD  . ARG B 2  98  ? 57.830 174.893 43.081  1.00 105.42 ? 117  ARG B CD  1 
ATOM   4955 N  NE  . ARG B 2  98  ? 57.505 176.308 42.930  1.00 107.35 ? 117  ARG B NE  1 
ATOM   4956 C  CZ  . ARG B 2  98  ? 57.462 176.942 41.763  1.00 118.88 ? 117  ARG B CZ  1 
ATOM   4957 N  NH1 . ARG B 2  98  ? 57.724 176.286 40.640  1.00 109.64 ? 117  ARG B NH1 1 
ATOM   4958 N  NH2 . ARG B 2  98  ? 57.158 178.232 41.717  1.00 137.28 ? 117  ARG B NH2 1 
ATOM   4959 N  N   . SER B 2  99  ? 58.069 175.770 47.581  1.00 81.08  ? 118  SER B N   1 
ATOM   4960 C  CA  . SER B 2  99  ? 58.382 177.102 48.098  1.00 76.40  ? 118  SER B CA  1 
ATOM   4961 C  C   . SER B 2  99  ? 59.806 177.533 47.772  1.00 84.95  ? 118  SER B C   1 
ATOM   4962 O  O   . SER B 2  99  ? 60.738 176.746 47.899  1.00 107.62 ? 118  SER B O   1 
ATOM   4963 C  CB  . SER B 2  99  ? 58.165 177.154 49.611  1.00 87.23  ? 118  SER B CB  1 
ATOM   4964 O  OG  . SER B 2  99  ? 59.094 176.326 50.286  1.00 122.55 ? 118  SER B OG  1 
ATOM   4965 N  N   . PRO B 2  100 ? 59.978 178.797 47.357  1.00 78.29  ? 119  PRO B N   1 
ATOM   4966 C  CA  . PRO B 2  100 ? 61.312 179.335 47.072  1.00 81.91  ? 119  PRO B CA  1 
ATOM   4967 C  C   . PRO B 2  100 ? 62.109 179.603 48.345  1.00 115.31 ? 119  PRO B C   1 
ATOM   4968 O  O   . PRO B 2  100 ? 61.645 179.288 49.441  1.00 143.94 ? 119  PRO B O   1 
ATOM   4969 C  CB  . PRO B 2  100 ? 61.010 180.638 46.330  1.00 79.86  ? 119  PRO B CB  1 
ATOM   4970 C  CG  . PRO B 2  100 ? 59.684 181.058 46.855  1.00 80.14  ? 119  PRO B CG  1 
ATOM   4971 C  CD  . PRO B 2  100 ? 58.917 179.788 47.108  1.00 78.51  ? 119  PRO B CD  1 
ATOM   4972 N  N   . VAL B 2  101 ? 63.296 180.180 48.197  1.00 93.45  ? 120  VAL B N   1 
ATOM   4973 C  CA  . VAL B 2  101 ? 64.133 180.499 49.345  1.00 91.72  ? 120  VAL B CA  1 
ATOM   4974 C  C   . VAL B 2  101 ? 63.664 181.802 49.980  1.00 103.93 ? 120  VAL B C   1 
ATOM   4975 O  O   . VAL B 2  101 ? 63.528 181.894 51.200  1.00 108.60 ? 120  VAL B O   1 
ATOM   4976 C  CB  . VAL B 2  101 ? 65.616 180.587 48.948  1.00 104.37 ? 120  VAL B CB  1 
ATOM   4977 C  CG1 . VAL B 2  101 ? 66.484 180.798 50.179  1.00 131.68 ? 120  VAL B CG1 1 
ATOM   4978 C  CG2 . VAL B 2  101 ? 66.038 179.334 48.199  1.00 99.85  ? 120  VAL B CG2 1 
ATOM   4979 N  N   . ARG B 2  102 ? 63.414 182.805 49.144  1.00 117.54 ? 121  ARG B N   1 
ATOM   4980 C  CA  . ARG B 2  102 ? 62.978 184.114 49.618  1.00 129.23 ? 121  ARG B CA  1 
ATOM   4981 C  C   . ARG B 2  102 ? 62.306 184.909 48.500  1.00 136.60 ? 121  ARG B C   1 
ATOM   4982 O  O   . ARG B 2  102 ? 62.869 185.053 47.415  1.00 178.73 ? 121  ARG B O   1 
ATOM   4983 C  CB  . ARG B 2  102 ? 64.165 184.896 50.187  1.00 145.00 ? 121  ARG B CB  1 
ATOM   4984 C  CG  . ARG B 2  102 ? 63.867 186.351 50.510  1.00 157.62 ? 121  ARG B CG  1 
ATOM   4985 C  CD  . ARG B 2  102 ? 65.004 187.001 51.292  1.00 175.95 ? 121  ARG B CD  1 
ATOM   4986 N  NE  . ARG B 2  102 ? 66.288 186.920 50.599  1.00 186.87 ? 121  ARG B NE  1 
ATOM   4987 C  CZ  . ARG B 2  102 ? 67.243 186.042 50.893  1.00 198.39 ? 121  ARG B CZ  1 
ATOM   4988 N  NH1 . ARG B 2  102 ? 67.061 185.163 51.869  1.00 205.30 ? 121  ARG B NH1 1 
ATOM   4989 N  NH2 . ARG B 2  102 ? 68.380 186.041 50.209  1.00 204.79 ? 121  ARG B NH2 1 
ATOM   4990 N  N   . PRO B 2  103 ? 61.092 185.427 48.760  1.00 104.54 ? 122  PRO B N   1 
ATOM   4991 C  CA  . PRO B 2  103 ? 60.345 185.268 50.014  1.00 105.85 ? 122  PRO B CA  1 
ATOM   4992 C  C   . PRO B 2  103 ? 59.700 183.892 50.143  1.00 103.06 ? 122  PRO B C   1 
ATOM   4993 O  O   . PRO B 2  103 ? 59.341 183.283 49.136  1.00 102.41 ? 122  PRO B O   1 
ATOM   4994 C  CB  . PRO B 2  103 ? 59.282 186.364 49.925  1.00 107.27 ? 122  PRO B CB  1 
ATOM   4995 C  CG  . PRO B 2  103 ? 59.057 186.537 48.469  1.00 100.80 ? 122  PRO B CG  1 
ATOM   4996 C  CD  . PRO B 2  103 ? 60.389 186.308 47.810  1.00 99.03  ? 122  PRO B CD  1 
ATOM   4997 N  N   . TYR B 2  104 ? 59.556 183.416 51.375  1.00 112.80 ? 123  TYR B N   1 
ATOM   4998 C  CA  . TYR B 2  104 ? 59.121 182.048 51.623  1.00 108.41 ? 123  TYR B CA  1 
ATOM   4999 C  C   . TYR B 2  104 ? 57.602 181.897 51.582  1.00 113.76 ? 123  TYR B C   1 
ATOM   5000 O  O   . TYR B 2  104 ? 56.956 181.762 52.621  1.00 124.28 ? 123  TYR B O   1 
ATOM   5001 C  CB  . TYR B 2  104 ? 59.652 181.568 52.973  1.00 111.55 ? 123  TYR B CB  1 
ATOM   5002 C  CG  . TYR B 2  104 ? 59.904 180.082 53.034  1.00 104.83 ? 123  TYR B CG  1 
ATOM   5003 C  CD1 . TYR B 2  104 ? 58.880 179.195 53.333  1.00 105.40 ? 123  TYR B CD1 1 
ATOM   5004 C  CD2 . TYR B 2  104 ? 61.170 179.565 52.792  1.00 103.99 ? 123  TYR B CD2 1 
ATOM   5005 C  CE1 . TYR B 2  104 ? 59.109 177.834 53.389  1.00 111.40 ? 123  TYR B CE1 1 
ATOM   5006 C  CE2 . TYR B 2  104 ? 61.409 178.208 52.845  1.00 99.66  ? 123  TYR B CE2 1 
ATOM   5007 C  CZ  . TYR B 2  104 ? 60.375 177.347 53.144  1.00 107.49 ? 123  TYR B CZ  1 
ATOM   5008 O  OH  . TYR B 2  104 ? 60.610 175.995 53.198  1.00 102.34 ? 123  TYR B OH  1 
ATOM   5009 N  N   . TYR B 2  105 ? 57.037 181.912 50.379  1.00 133.36 ? 124  TYR B N   1 
ATOM   5010 C  CA  . TYR B 2  105 ? 55.605 181.693 50.210  1.00 114.41 ? 124  TYR B CA  1 
ATOM   5011 C  C   . TYR B 2  105 ? 55.337 180.319 49.605  1.00 108.09 ? 124  TYR B C   1 
ATOM   5012 O  O   . TYR B 2  105 ? 56.231 179.702 49.028  1.00 119.23 ? 124  TYR B O   1 
ATOM   5013 C  CB  . TYR B 2  105 ? 54.983 182.790 49.337  1.00 94.66  ? 124  TYR B CB  1 
ATOM   5014 C  CG  . TYR B 2  105 ? 55.668 183.003 48.003  1.00 94.70  ? 124  TYR B CG  1 
ATOM   5015 C  CD1 . TYR B 2  105 ? 55.486 182.111 46.952  1.00 113.69 ? 124  TYR B CD1 1 
ATOM   5016 C  CD2 . TYR B 2  105 ? 56.482 184.106 47.789  1.00 97.29  ? 124  TYR B CD2 1 
ATOM   5017 C  CE1 . TYR B 2  105 ? 56.105 182.305 45.734  1.00 118.99 ? 124  TYR B CE1 1 
ATOM   5018 C  CE2 . TYR B 2  105 ? 57.105 184.309 46.571  1.00 97.86  ? 124  TYR B CE2 1 
ATOM   5019 C  CZ  . TYR B 2  105 ? 56.912 183.404 45.548  1.00 97.36  ? 124  TYR B CZ  1 
ATOM   5020 O  OH  . TYR B 2  105 ? 57.527 183.596 44.332  1.00 97.57  ? 124  TYR B OH  1 
ATOM   5021 N  N   . PHE B 2  106 ? 54.102 179.846 49.739  1.00 113.52 ? 125  PHE B N   1 
ATOM   5022 C  CA  . PHE B 2  106 ? 53.713 178.556 49.180  1.00 120.20 ? 125  PHE B CA  1 
ATOM   5023 C  C   . PHE B 2  106 ? 52.890 178.754 47.909  1.00 134.23 ? 125  PHE B C   1 
ATOM   5024 O  O   . PHE B 2  106 ? 51.668 178.886 47.963  1.00 142.26 ? 125  PHE B O   1 
ATOM   5025 C  CB  . PHE B 2  106 ? 52.927 177.741 50.209  1.00 117.55 ? 125  PHE B CB  1 
ATOM   5026 C  CG  . PHE B 2  106 ? 53.700 177.437 51.463  1.00 112.41 ? 125  PHE B CG  1 
ATOM   5027 C  CD1 . PHE B 2  106 ? 55.081 177.324 51.433  1.00 114.72 ? 125  PHE B CD1 1 
ATOM   5028 C  CD2 . PHE B 2  106 ? 53.046 177.268 52.672  1.00 127.53 ? 125  PHE B CD2 1 
ATOM   5029 C  CE1 . PHE B 2  106 ? 55.794 177.047 52.584  1.00 103.71 ? 125  PHE B CE1 1 
ATOM   5030 C  CE2 . PHE B 2  106 ? 53.755 176.991 53.827  1.00 115.35 ? 125  PHE B CE2 1 
ATOM   5031 C  CZ  . PHE B 2  106 ? 55.130 176.880 53.783  1.00 107.83 ? 125  PHE B CZ  1 
ATOM   5032 N  N   . ASP B 2  107 ? 53.571 178.772 46.768  1.00 131.61 ? 126  ASP B N   1 
ATOM   5033 C  CA  . ASP B 2  107 ? 52.932 179.077 45.492  1.00 128.98 ? 126  ASP B CA  1 
ATOM   5034 C  C   . ASP B 2  107 ? 52.049 177.941 44.975  1.00 118.63 ? 126  ASP B C   1 
ATOM   5035 O  O   . ASP B 2  107 ? 50.901 178.168 44.591  1.00 149.54 ? 126  ASP B O   1 
ATOM   5036 C  CB  . ASP B 2  107 ? 53.993 179.428 44.444  1.00 118.13 ? 126  ASP B CB  1 
ATOM   5037 C  CG  . ASP B 2  107 ? 55.210 178.526 44.519  1.00 117.35 ? 126  ASP B CG  1 
ATOM   5038 O  OD1 . ASP B 2  107 ? 55.071 177.365 44.960  1.00 138.70 ? 126  ASP B OD1 1 
ATOM   5039 O  OD2 . ASP B 2  107 ? 56.309 178.979 44.135  1.00 112.53 ? 126  ASP B OD2 1 
ATOM   5040 N  N   . TYR B 2  108 ? 52.582 176.724 44.962  1.00 113.33 ? 127  TYR B N   1 
ATOM   5041 C  CA  . TYR B 2  108 ? 51.841 175.584 44.430  1.00 106.78 ? 127  TYR B CA  1 
ATOM   5042 C  C   . TYR B 2  108 ? 51.660 174.487 45.476  1.00 97.87  ? 127  TYR B C   1 
ATOM   5043 O  O   . TYR B 2  108 ? 52.610 174.098 46.152  1.00 141.44 ? 127  TYR B O   1 
ATOM   5044 C  CB  . TYR B 2  108 ? 52.546 175.022 43.193  1.00 105.40 ? 127  TYR B CB  1 
ATOM   5045 C  CG  . TYR B 2  108 ? 52.698 176.030 42.076  1.00 100.27 ? 127  TYR B CG  1 
ATOM   5046 C  CD1 . TYR B 2  108 ? 51.675 176.242 41.161  1.00 96.80  ? 127  TYR B CD1 1 
ATOM   5047 C  CD2 . TYR B 2  108 ? 53.863 176.772 41.938  1.00 134.76 ? 127  TYR B CD2 1 
ATOM   5048 C  CE1 . TYR B 2  108 ? 51.809 177.165 40.139  1.00 122.83 ? 127  TYR B CE1 1 
ATOM   5049 C  CE2 . TYR B 2  108 ? 54.007 177.696 40.921  1.00 142.63 ? 127  TYR B CE2 1 
ATOM   5050 C  CZ  . TYR B 2  108 ? 52.977 177.889 40.024  1.00 130.60 ? 127  TYR B CZ  1 
ATOM   5051 O  OH  . TYR B 2  108 ? 53.117 178.808 39.010  1.00 122.69 ? 127  TYR B OH  1 
ATOM   5052 N  N   . TRP B 2  109 ? 50.431 173.994 45.597  1.00 107.59 ? 128  TRP B N   1 
ATOM   5053 C  CA  . TRP B 2  109 ? 50.101 172.961 46.573  1.00 105.52 ? 128  TRP B CA  1 
ATOM   5054 C  C   . TRP B 2  109 ? 49.708 171.654 45.894  1.00 96.11  ? 128  TRP B C   1 
ATOM   5055 O  O   . TRP B 2  109 ? 49.348 171.639 44.717  1.00 115.48 ? 128  TRP B O   1 
ATOM   5056 C  CB  . TRP B 2  109 ? 48.960 173.425 47.483  1.00 110.66 ? 128  TRP B CB  1 
ATOM   5057 C  CG  . TRP B 2  109 ? 49.317 174.559 48.393  1.00 95.48  ? 128  TRP B CG  1 
ATOM   5058 C  CD1 . TRP B 2  109 ? 49.617 175.839 48.029  1.00 101.26 ? 128  TRP B CD1 1 
ATOM   5059 C  CD2 . TRP B 2  109 ? 49.389 174.521 49.822  1.00 85.80  ? 128  TRP B CD2 1 
ATOM   5060 N  NE1 . TRP B 2  109 ? 49.883 176.598 49.143  1.00 83.59  ? 128  TRP B NE1 1 
ATOM   5061 C  CE2 . TRP B 2  109 ? 49.748 175.811 50.258  1.00 85.05  ? 128  TRP B CE2 1 
ATOM   5062 C  CE3 . TRP B 2  109 ? 49.189 173.518 50.777  1.00 95.87  ? 128  TRP B CE3 1 
ATOM   5063 C  CZ2 . TRP B 2  109 ? 49.912 176.126 51.604  1.00 102.47 ? 128  TRP B CZ2 1 
ATOM   5064 C  CZ3 . TRP B 2  109 ? 49.352 173.833 52.112  1.00 101.51 ? 128  TRP B CZ3 1 
ATOM   5065 C  CH2 . TRP B 2  109 ? 49.710 175.125 52.514  1.00 112.23 ? 128  TRP B CH2 1 
ATOM   5066 N  N   . GLY B 2  110 ? 49.779 170.559 46.645  1.00 97.46  ? 129  GLY B N   1 
ATOM   5067 C  CA  . GLY B 2  110 ? 49.277 169.281 46.177  1.00 90.25  ? 129  GLY B CA  1 
ATOM   5068 C  C   . GLY B 2  110 ? 47.793 169.169 46.466  1.00 108.32 ? 129  GLY B C   1 
ATOM   5069 O  O   . GLY B 2  110 ? 47.234 170.020 47.154  1.00 95.12  ? 129  GLY B O   1 
ATOM   5070 N  N   . GLN B 2  111 ? 47.150 168.125 45.953  1.00 115.68 ? 130  GLN B N   1 
ATOM   5071 C  CA  . GLN B 2  111 ? 45.708 167.974 46.124  1.00 108.69 ? 130  GLN B CA  1 
ATOM   5072 C  C   . GLN B 2  111 ? 45.352 167.527 47.539  1.00 107.75 ? 130  GLN B C   1 
ATOM   5073 O  O   . GLN B 2  111 ? 44.198 167.630 47.958  1.00 137.14 ? 130  GLN B O   1 
ATOM   5074 C  CB  . GLN B 2  111 ? 45.141 166.980 45.106  1.00 141.62 ? 130  GLN B CB  1 
ATOM   5075 C  CG  . GLN B 2  111 ? 45.413 165.519 45.425  1.00 146.20 ? 130  GLN B CG  1 
ATOM   5076 C  CD  . GLN B 2  111 ? 46.806 165.074 45.027  1.00 145.31 ? 130  GLN B CD  1 
ATOM   5077 O  OE1 . GLN B 2  111 ? 47.637 165.881 44.611  1.00 135.89 ? 130  GLN B OE1 1 
ATOM   5078 N  NE2 . GLN B 2  111 ? 47.065 163.777 45.147  1.00 154.69 ? 130  GLN B NE2 1 
ATOM   5079 N  N   . GLY B 2  112 ? 46.343 167.031 48.273  1.00 107.79 ? 131  GLY B N   1 
ATOM   5080 C  CA  . GLY B 2  112 ? 46.136 166.609 49.646  1.00 79.91  ? 131  GLY B CA  1 
ATOM   5081 C  C   . GLY B 2  112 ? 46.058 165.106 49.828  1.00 98.93  ? 131  GLY B C   1 
ATOM   5082 O  O   . GLY B 2  112 ? 45.852 164.363 48.869  1.00 128.05 ? 131  GLY B O   1 
ATOM   5083 N  N   . THR B 2  113 ? 46.222 164.659 51.069  1.00 92.40  ? 132  THR B N   1 
ATOM   5084 C  CA  . THR B 2  113 ? 46.160 163.237 51.386  1.00 119.32 ? 132  THR B CA  1 
ATOM   5085 C  C   . THR B 2  113 ? 45.399 162.998 52.686  1.00 148.29 ? 132  THR B C   1 
ATOM   5086 O  O   . THR B 2  113 ? 45.839 163.411 53.759  1.00 135.05 ? 132  THR B O   1 
ATOM   5087 C  CB  . THR B 2  113 ? 47.566 162.623 51.505  1.00 120.96 ? 132  THR B CB  1 
ATOM   5088 O  OG1 . THR B 2  113 ? 48.255 162.755 50.255  1.00 125.06 ? 132  THR B OG1 1 
ATOM   5089 C  CG2 . THR B 2  113 ? 47.472 161.150 51.874  1.00 137.01 ? 132  THR B CG2 1 
ATOM   5090 N  N   . THR B 2  114 ? 44.256 162.328 52.581  1.00 160.91 ? 133  THR B N   1 
ATOM   5091 C  CA  . THR B 2  114 ? 43.426 162.039 53.743  1.00 146.58 ? 133  THR B CA  1 
ATOM   5092 C  C   . THR B 2  114 ? 43.957 160.838 54.517  1.00 144.87 ? 133  THR B C   1 
ATOM   5093 O  O   . THR B 2  114 ? 43.862 159.699 54.058  1.00 138.61 ? 133  THR B O   1 
ATOM   5094 C  CB  . THR B 2  114 ? 41.965 161.768 53.341  1.00 153.11 ? 133  THR B CB  1 
ATOM   5095 O  OG1 . THR B 2  114 ? 41.427 162.921 52.683  1.00 166.10 ? 133  THR B OG1 1 
ATOM   5096 C  CG2 . THR B 2  114 ? 41.123 161.454 54.568  1.00 145.88 ? 133  THR B CG2 1 
ATOM   5097 N  N   . LEU B 2  115 ? 44.518 161.101 55.691  1.00 143.52 ? 134  LEU B N   1 
ATOM   5098 C  CA  . LEU B 2  115 ? 45.033 160.039 56.544  1.00 128.65 ? 134  LEU B CA  1 
ATOM   5099 C  C   . LEU B 2  115 ? 44.051 159.724 57.665  1.00 159.48 ? 134  LEU B C   1 
ATOM   5100 O  O   . LEU B 2  115 ? 43.551 160.625 58.337  1.00 151.37 ? 134  LEU B O   1 
ATOM   5101 C  CB  . LEU B 2  115 ? 46.391 160.427 57.131  1.00 126.21 ? 134  LEU B CB  1 
ATOM   5102 C  CG  . LEU B 2  115 ? 47.007 159.408 58.094  1.00 122.53 ? 134  LEU B CG  1 
ATOM   5103 C  CD1 . LEU B 2  115 ? 47.291 158.098 57.378  1.00 125.04 ? 134  LEU B CD1 1 
ATOM   5104 C  CD2 . LEU B 2  115 ? 48.271 159.956 58.735  1.00 100.80 ? 134  LEU B CD2 1 
ATOM   5105 N  N   . THR B 2  116 ? 43.774 158.440 57.858  1.00 185.07 ? 135  THR B N   1 
ATOM   5106 C  CA  . THR B 2  116 ? 42.909 158.005 58.943  1.00 168.22 ? 135  THR B CA  1 
ATOM   5107 C  C   . THR B 2  116 ? 43.619 156.969 59.802  1.00 152.77 ? 135  THR B C   1 
ATOM   5108 O  O   . THR B 2  116 ? 43.955 155.878 59.336  1.00 135.64 ? 135  THR B O   1 
ATOM   5109 C  CB  . THR B 2  116 ? 41.589 157.416 58.424  1.00 154.13 ? 135  THR B CB  1 
ATOM   5110 O  OG1 . THR B 2  116 ? 40.929 158.378 57.593  1.00 151.24 ? 135  THR B OG1 1 
ATOM   5111 C  CG2 . THR B 2  116 ? 40.681 157.056 59.590  1.00 135.13 ? 135  THR B CG2 1 
ATOM   5112 N  N   . VAL B 2  117 ? 43.852 157.324 61.060  1.00 147.42 ? 136  VAL B N   1 
ATOM   5113 C  CA  . VAL B 2  117 ? 44.518 156.432 61.993  1.00 166.04 ? 136  VAL B CA  1 
ATOM   5114 C  C   . VAL B 2  117 ? 43.494 155.811 62.932  1.00 170.37 ? 136  VAL B C   1 
ATOM   5115 O  O   . VAL B 2  117 ? 43.048 156.444 63.890  1.00 176.10 ? 136  VAL B O   1 
ATOM   5116 C  CB  . VAL B 2  117 ? 45.611 157.165 62.780  1.00 169.87 ? 136  VAL B CB  1 
ATOM   5117 C  CG1 . VAL B 2  117 ? 46.291 156.214 63.749  1.00 148.67 ? 136  VAL B CG1 1 
ATOM   5118 C  CG2 . VAL B 2  117 ? 46.625 157.779 61.827  1.00 190.40 ? 136  VAL B CG2 1 
ATOM   5119 N  N   . SER B 2  118 ? 43.122 154.569 62.646  1.00 154.73 ? 137  SER B N   1 
ATOM   5120 C  CA  . SER B 2  118 ? 42.136 153.862 63.450  1.00 149.46 ? 137  SER B CA  1 
ATOM   5121 C  C   . SER B 2  118 ? 42.260 152.356 63.256  1.00 178.09 ? 137  SER B C   1 
ATOM   5122 O  O   . SER B 2  118 ? 42.708 151.889 62.209  1.00 184.76 ? 137  SER B O   1 
ATOM   5123 C  CB  . SER B 2  118 ? 40.722 154.325 63.096  1.00 144.81 ? 137  SER B CB  1 
ATOM   5124 O  OG  . SER B 2  118 ? 39.751 153.616 63.846  1.00 159.40 ? 137  SER B OG  1 
ATOM   5125 N  N   . SER B 2  119 ? 41.859 151.601 64.273  1.00 203.36 ? 138  SER B N   1 
ATOM   5126 C  CA  . SER B 2  119 ? 41.917 150.146 64.217  1.00 210.88 ? 138  SER B CA  1 
ATOM   5127 C  C   . SER B 2  119 ? 40.629 149.571 63.638  1.00 196.41 ? 138  SER B C   1 
ATOM   5128 O  O   . SER B 2  119 ? 40.464 148.354 63.558  1.00 208.83 ? 138  SER B O   1 
ATOM   5129 C  CB  . SER B 2  119 ? 42.173 149.565 65.608  1.00 218.29 ? 138  SER B CB  1 
ATOM   5130 O  OG  . SER B 2  119 ? 43.401 150.031 66.139  1.00 223.96 ? 138  SER B OG  1 
ATOM   5131 N  N   . ALA B 2  120 ? 39.720 150.454 63.236  1.00 219.76 ? 139  ALA B N   1 
ATOM   5132 C  CA  . ALA B 2  120 ? 38.434 150.035 62.693  1.00 195.77 ? 139  ALA B CA  1 
ATOM   5133 C  C   . ALA B 2  120 ? 38.603 149.351 61.340  1.00 201.03 ? 139  ALA B C   1 
ATOM   5134 O  O   . ALA B 2  120 ? 39.439 149.750 60.529  1.00 194.19 ? 139  ALA B O   1 
ATOM   5135 C  CB  . ALA B 2  120 ? 37.497 151.226 62.572  1.00 179.32 ? 139  ALA B CB  1 
ATOM   5136 N  N   . LYS B 2  121 ? 37.801 148.317 61.108  1.00 221.66 ? 140  LYS B N   1 
ATOM   5137 C  CA  . LYS B 2  121 ? 37.870 147.540 59.877  1.00 225.52 ? 140  LYS B CA  1 
ATOM   5138 C  C   . LYS B 2  121 ? 37.439 148.401 58.692  1.00 215.34 ? 140  LYS B C   1 
ATOM   5139 O  O   . LYS B 2  121 ? 36.604 149.293 58.833  1.00 210.53 ? 140  LYS B O   1 
ATOM   5140 C  CB  . LYS B 2  121 ? 37.045 146.258 60.017  1.00 228.32 ? 140  LYS B CB  1 
ATOM   5141 C  CG  . LYS B 2  121 ? 37.088 145.342 58.805  1.00 236.30 ? 140  LYS B CG  1 
ATOM   5142 C  CD  . LYS B 2  121 ? 38.499 144.847 58.534  1.00 243.39 ? 140  LYS B CD  1 
ATOM   5143 C  CE  . LYS B 2  121 ? 38.531 143.904 57.343  1.00 250.91 ? 140  LYS B CE  1 
ATOM   5144 N  NZ  . LYS B 2  121 ? 39.903 143.390 57.081  1.00 262.79 ? 140  LYS B NZ  1 
ATOM   5145 N  N   . THR B 2  122 ? 38.020 148.130 57.527  1.00 208.66 ? 141  THR B N   1 
ATOM   5146 C  CA  . THR B 2  122 ? 37.649 148.828 56.302  1.00 210.10 ? 141  THR B CA  1 
ATOM   5147 C  C   . THR B 2  122 ? 36.304 148.281 55.834  1.00 212.12 ? 141  THR B C   1 
ATOM   5148 O  O   . THR B 2  122 ? 36.232 147.197 55.255  1.00 217.03 ? 141  THR B O   1 
ATOM   5149 C  CB  . THR B 2  122 ? 38.695 148.636 55.189  1.00 216.25 ? 141  THR B CB  1 
ATOM   5150 O  OG1 . THR B 2  122 ? 39.984 149.044 55.664  1.00 233.95 ? 141  THR B OG1 1 
ATOM   5151 C  CG2 . THR B 2  122 ? 38.328 149.462 53.968  1.00 186.87 ? 141  THR B CG2 1 
ATOM   5152 N  N   . THR B 2  123 ? 35.243 149.038 56.089  1.00 230.42 ? 142  THR B N   1 
ATOM   5153 C  CA  . THR B 2  123 ? 33.888 148.593 55.784  1.00 232.01 ? 142  THR B CA  1 
ATOM   5154 C  C   . THR B 2  123 ? 33.412 149.100 54.426  1.00 235.58 ? 142  THR B C   1 
ATOM   5155 O  O   . THR B 2  123 ? 33.481 150.297 54.147  1.00 236.02 ? 142  THR B O   1 
ATOM   5156 C  CB  . THR B 2  123 ? 32.895 149.056 56.869  1.00 241.00 ? 142  THR B CB  1 
ATOM   5157 O  OG1 . THR B 2  123 ? 33.294 148.531 58.141  1.00 253.72 ? 142  THR B OG1 1 
ATOM   5158 C  CG2 . THR B 2  123 ? 31.485 148.582 56.549  1.00 246.43 ? 142  THR B CG2 1 
ATOM   5159 N  N   . PRO B 2  124 ? 32.931 148.183 53.572  1.00 223.61 ? 143  PRO B N   1 
ATOM   5160 C  CA  . PRO B 2  124 ? 32.364 148.548 52.269  1.00 214.40 ? 143  PRO B CA  1 
ATOM   5161 C  C   . PRO B 2  124 ? 31.038 149.290 52.406  1.00 196.87 ? 143  PRO B C   1 
ATOM   5162 O  O   . PRO B 2  124 ? 30.222 148.929 53.254  1.00 193.27 ? 143  PRO B O   1 
ATOM   5163 C  CB  . PRO B 2  124 ? 32.167 147.195 51.581  1.00 203.43 ? 143  PRO B CB  1 
ATOM   5164 C  CG  . PRO B 2  124 ? 32.020 146.224 52.701  1.00 196.79 ? 143  PRO B CG  1 
ATOM   5165 C  CD  . PRO B 2  124 ? 32.928 146.725 53.785  1.00 209.75 ? 143  PRO B CD  1 
ATOM   5166 N  N   . PRO B 2  125 ? 30.824 150.321 51.574  1.00 182.47 ? 144  PRO B N   1 
ATOM   5167 C  CA  . PRO B 2  125 ? 29.620 151.156 51.633  1.00 168.53 ? 144  PRO B CA  1 
ATOM   5168 C  C   . PRO B 2  125 ? 28.374 150.466 51.083  1.00 178.18 ? 144  PRO B C   1 
ATOM   5169 O  O   . PRO B 2  125 ? 28.459 149.717 50.110  1.00 196.95 ? 144  PRO B O   1 
ATOM   5170 C  CB  . PRO B 2  125 ? 29.995 152.360 50.767  1.00 183.56 ? 144  PRO B CB  1 
ATOM   5171 C  CG  . PRO B 2  125 ? 30.965 151.812 49.782  1.00 199.48 ? 144  PRO B CG  1 
ATOM   5172 C  CD  . PRO B 2  125 ? 31.755 150.768 50.524  1.00 191.23 ? 144  PRO B CD  1 
ATOM   5173 N  N   . SER B 2  126 ? 27.229 150.723 51.709  1.00 181.50 ? 145  SER B N   1 
ATOM   5174 C  CA  . SER B 2  126 ? 25.957 150.183 51.243  1.00 182.93 ? 145  SER B CA  1 
ATOM   5175 C  C   . SER B 2  126 ? 25.265 151.186 50.327  1.00 209.35 ? 145  SER B C   1 
ATOM   5176 O  O   . SER B 2  126 ? 24.842 152.254 50.770  1.00 201.12 ? 145  SER B O   1 
ATOM   5177 C  CB  . SER B 2  126 ? 25.052 149.831 52.425  1.00 171.33 ? 145  SER B CB  1 
ATOM   5178 O  OG  . SER B 2  126 ? 25.660 148.867 53.266  1.00 166.03 ? 145  SER B OG  1 
ATOM   5179 N  N   . VAL B 2  127 ? 25.153 150.835 49.050  1.00 245.98 ? 146  VAL B N   1 
ATOM   5180 C  CA  . VAL B 2  127 ? 24.593 151.741 48.056  1.00 258.83 ? 146  VAL B CA  1 
ATOM   5181 C  C   . VAL B 2  127 ? 23.120 151.442 47.809  1.00 245.42 ? 146  VAL B C   1 
ATOM   5182 O  O   . VAL B 2  127 ? 22.774 150.439 47.183  1.00 247.07 ? 146  VAL B O   1 
ATOM   5183 C  CB  . VAL B 2  127 ? 25.384 151.671 46.740  1.00 272.52 ? 146  VAL B CB  1 
ATOM   5184 C  CG1 . VAL B 2  127 ? 24.916 152.757 45.784  1.00 270.92 ? 146  VAL B CG1 1 
ATOM   5185 C  CG2 . VAL B 2  127 ? 26.874 151.794 47.014  1.00 274.43 ? 146  VAL B CG2 1 
ATOM   5186 N  N   . TYR B 2  128 ? 22.257 152.324 48.303  1.00 217.46 ? 147  TYR B N   1 
ATOM   5187 C  CA  . TYR B 2  128 ? 20.817 152.180 48.125  1.00 215.44 ? 147  TYR B CA  1 
ATOM   5188 C  C   . TYR B 2  128 ? 20.247 153.390 47.395  1.00 217.61 ? 147  TYR B C   1 
ATOM   5189 O  O   . TYR B 2  128 ? 20.333 154.512 47.890  1.00 189.46 ? 147  TYR B O   1 
ATOM   5190 C  CB  . TYR B 2  128 ? 20.123 152.004 49.476  1.00 210.99 ? 147  TYR B CB  1 
ATOM   5191 C  CG  . TYR B 2  128 ? 20.590 150.794 50.253  1.00 216.76 ? 147  TYR B CG  1 
ATOM   5192 C  CD1 . TYR B 2  128 ? 20.910 149.608 49.604  1.00 230.76 ? 147  TYR B CD1 1 
ATOM   5193 C  CD2 . TYR B 2  128 ? 20.717 150.839 51.634  1.00 189.86 ? 147  TYR B CD2 1 
ATOM   5194 C  CE1 . TYR B 2  128 ? 21.339 148.501 50.309  1.00 225.19 ? 147  TYR B CE1 1 
ATOM   5195 C  CE2 . TYR B 2  128 ? 21.145 149.737 52.349  1.00 189.62 ? 147  TYR B CE2 1 
ATOM   5196 C  CZ  . TYR B 2  128 ? 21.455 148.571 51.681  1.00 216.42 ? 147  TYR B CZ  1 
ATOM   5197 O  OH  . TYR B 2  128 ? 21.882 147.471 52.388  1.00 225.02 ? 147  TYR B OH  1 
ATOM   5198 N  N   . PRO B 2  129 ? 19.657 153.163 46.212  1.00 254.74 ? 148  PRO B N   1 
ATOM   5199 C  CA  . PRO B 2  129 ? 19.117 154.246 45.381  1.00 261.68 ? 148  PRO B CA  1 
ATOM   5200 C  C   . PRO B 2  129 ? 17.947 154.974 46.037  1.00 265.11 ? 148  PRO B C   1 
ATOM   5201 O  O   . PRO B 2  129 ? 17.235 154.390 46.852  1.00 255.95 ? 148  PRO B O   1 
ATOM   5202 C  CB  . PRO B 2  129 ? 18.661 153.517 44.112  1.00 264.11 ? 148  PRO B CB  1 
ATOM   5203 C  CG  . PRO B 2  129 ? 18.400 152.119 44.555  1.00 269.38 ? 148  PRO B CG  1 
ATOM   5204 C  CD  . PRO B 2  129 ? 19.426 151.838 45.611  1.00 264.64 ? 148  PRO B CD  1 
ATOM   5205 N  N   . LEU B 2  130 ? 17.761 156.242 45.682  1.00 281.53 ? 149  LEU B N   1 
ATOM   5206 C  CA  . LEU B 2  130 ? 16.659 157.036 46.214  1.00 309.41 ? 149  LEU B CA  1 
ATOM   5207 C  C   . LEU B 2  130 ? 15.824 157.621 45.080  1.00 344.25 ? 149  LEU B C   1 
ATOM   5208 O  O   . LEU B 2  130 ? 16.059 158.746 44.640  1.00 327.49 ? 149  LEU B O   1 
ATOM   5209 C  CB  . LEU B 2  130 ? 17.186 158.156 47.114  1.00 302.82 ? 149  LEU B CB  1 
ATOM   5210 C  CG  . LEU B 2  130 ? 18.023 157.726 48.320  1.00 303.39 ? 149  LEU B CG  1 
ATOM   5211 C  CD1 . LEU B 2  130 ? 18.483 158.940 49.112  1.00 300.44 ? 149  LEU B CD1 1 
ATOM   5212 C  CD2 . LEU B 2  130 ? 17.241 156.768 49.205  1.00 300.12 ? 149  LEU B CD2 1 
ATOM   5213 N  N   . ALA B 2  131 ? 14.849 156.848 44.612  1.00 401.06 ? 150  ALA B N   1 
ATOM   5214 C  CA  . ALA B 2  131 ? 14.014 157.263 43.492  1.00 425.60 ? 150  ALA B CA  1 
ATOM   5215 C  C   . ALA B 2  131 ? 12.715 157.904 43.966  1.00 429.99 ? 150  ALA B C   1 
ATOM   5216 O  O   . ALA B 2  131 ? 12.109 157.444 44.934  1.00 436.92 ? 150  ALA B O   1 
ATOM   5217 C  CB  . ALA B 2  131 ? 13.716 156.075 42.590  1.00 441.51 ? 150  ALA B CB  1 
ATOM   5218 N  N   . PRO B 2  132 ? 12.287 158.977 43.283  1.00 410.80 ? 151  PRO B N   1 
ATOM   5219 C  CA  . PRO B 2  132 ? 11.013 159.642 43.577  1.00 393.68 ? 151  PRO B CA  1 
ATOM   5220 C  C   . PRO B 2  132 ? 9.822  158.708 43.389  1.00 382.47 ? 151  PRO B C   1 
ATOM   5221 O  O   . PRO B 2  132 ? 9.883  157.794 42.565  1.00 393.05 ? 151  PRO B O   1 
ATOM   5222 C  CB  . PRO B 2  132 ? 10.970 160.789 42.562  1.00 395.69 ? 151  PRO B CB  1 
ATOM   5223 C  CG  . PRO B 2  132 ? 12.393 161.024 42.190  1.00 394.60 ? 151  PRO B CG  1 
ATOM   5224 C  CD  . PRO B 2  132 ? 13.040 159.674 42.227  1.00 403.57 ? 151  PRO B CD  1 
ATOM   5225 N  N   . GLY B 2  133 ? 8.754  158.938 44.144  1.00 342.37 ? 152  GLY B N   1 
ATOM   5226 C  CA  . GLY B 2  133 ? 7.567  158.108 44.058  1.00 328.38 ? 152  GLY B CA  1 
ATOM   5227 C  C   . GLY B 2  133 ? 6.824  158.244 42.743  1.00 311.13 ? 152  GLY B C   1 
ATOM   5228 O  O   . GLY B 2  133 ? 7.090  159.155 41.959  1.00 310.14 ? 152  GLY B O   1 
ATOM   5229 N  N   . CYS B 2  134 ? 5.887  157.333 42.503  1.00 300.21 ? 153  CYS B N   1 
ATOM   5230 C  CA  . CYS B 2  134 ? 5.088  157.353 41.284  1.00 293.57 ? 153  CYS B CA  1 
ATOM   5231 C  C   . CYS B 2  134 ? 3.808  158.159 41.483  1.00 284.16 ? 153  CYS B C   1 
ATOM   5232 O  O   . CYS B 2  134 ? 2.940  158.190 40.610  1.00 292.50 ? 153  CYS B O   1 
ATOM   5233 C  CB  . CYS B 2  134 ? 4.750  155.929 40.837  1.00 300.52 ? 153  CYS B CB  1 
ATOM   5234 S  SG  . CYS B 2  134 ? 3.699  154.991 41.979  1.00 305.29 ? 153  CYS B SG  1 
ATOM   5235 N  N   . GLY B 2  135 ? 3.698  158.809 42.638  1.00 272.99 ? 154  GLY B N   1 
ATOM   5236 C  CA  . GLY B 2  135 ? 2.542  159.631 42.946  1.00 272.32 ? 154  GLY B CA  1 
ATOM   5237 C  C   . GLY B 2  135 ? 2.889  161.096 43.128  1.00 276.55 ? 154  GLY B C   1 
ATOM   5238 O  O   . GLY B 2  135 ? 2.036  161.907 43.489  1.00 258.06 ? 154  GLY B O   1 
ATOM   5239 N  N   . ASP B 2  136 ? 4.150  161.434 42.875  1.00 289.22 ? 155  ASP B N   1 
ATOM   5240 C  CA  . ASP B 2  136 ? 4.619  162.808 43.012  1.00 302.13 ? 155  ASP B CA  1 
ATOM   5241 C  C   . ASP B 2  136 ? 4.174  163.662 41.828  1.00 329.46 ? 155  ASP B C   1 
ATOM   5242 O  O   . ASP B 2  136 ? 3.826  163.138 40.769  1.00 331.54 ? 155  ASP B O   1 
ATOM   5243 C  CB  . ASP B 2  136 ? 6.144  162.843 43.141  1.00 284.08 ? 155  ASP B CB  1 
ATOM   5244 C  CG  . ASP B 2  136 ? 6.646  162.059 44.339  1.00 285.28 ? 155  ASP B CG  1 
ATOM   5245 O  OD1 . ASP B 2  136 ? 5.977  161.083 44.737  1.00 284.61 ? 155  ASP B OD1 1 
ATOM   5246 O  OD2 . ASP B 2  136 ? 7.712  162.420 44.883  1.00 284.24 ? 155  ASP B OD2 1 
ATOM   5247 N  N   . THR B 2  137 ? 4.185  164.978 42.013  1.00 368.62 ? 156  THR B N   1 
ATOM   5248 C  CA  . THR B 2  137 ? 3.796  165.902 40.954  1.00 386.02 ? 156  THR B CA  1 
ATOM   5249 C  C   . THR B 2  137 ? 5.010  166.330 40.136  1.00 387.64 ? 156  THR B C   1 
ATOM   5250 O  O   . THR B 2  137 ? 5.840  167.111 40.601  1.00 383.66 ? 156  THR B O   1 
ATOM   5251 C  CB  . THR B 2  137 ? 3.099  167.153 41.521  1.00 380.56 ? 156  THR B CB  1 
ATOM   5252 O  OG1 . THR B 2  137 ? 1.937  166.762 42.262  1.00 382.25 ? 156  THR B OG1 1 
ATOM   5253 C  CG2 . THR B 2  137 ? 2.684  168.089 40.395  1.00 385.31 ? 156  THR B CG2 1 
ATOM   5254 N  N   . THR B 2  138 ? 5.108  165.811 38.917  1.00 387.90 ? 157  THR B N   1 
ATOM   5255 C  CA  . THR B 2  138 ? 6.223  166.136 38.035  1.00 367.28 ? 157  THR B CA  1 
ATOM   5256 C  C   . THR B 2  138 ? 6.106  167.570 37.529  1.00 355.85 ? 157  THR B C   1 
ATOM   5257 O  O   . THR B 2  138 ? 5.370  167.848 36.582  1.00 371.81 ? 157  THR B O   1 
ATOM   5258 C  CB  . THR B 2  138 ? 6.296  165.174 36.833  1.00 368.49 ? 157  THR B CB  1 
ATOM   5259 O  OG1 . THR B 2  138 ? 6.367  163.823 37.304  1.00 368.30 ? 157  THR B OG1 1 
ATOM   5260 C  CG2 . THR B 2  138 ? 7.523  165.472 35.986  1.00 358.92 ? 157  THR B CG2 1 
ATOM   5261 N  N   . GLY B 2  139 ? 6.833  168.477 38.172  1.00 297.75 ? 158  GLY B N   1 
ATOM   5262 C  CA  . GLY B 2  139 ? 6.806  169.878 37.799  1.00 268.28 ? 158  GLY B CA  1 
ATOM   5263 C  C   . GLY B 2  139 ? 7.802  170.224 36.711  1.00 257.69 ? 158  GLY B C   1 
ATOM   5264 O  O   . GLY B 2  139 ? 8.009  169.449 35.776  1.00 240.22 ? 158  GLY B O   1 
ATOM   5265 N  N   . SER B 2  140 ? 8.421  171.393 36.834  1.00 272.78 ? 159  SER B N   1 
ATOM   5266 C  CA  . SER B 2  140 ? 9.404  171.843 35.857  1.00 283.26 ? 159  SER B CA  1 
ATOM   5267 C  C   . SER B 2  140 ? 10.735 171.124 36.052  1.00 267.29 ? 159  SER B C   1 
ATOM   5268 O  O   . SER B 2  140 ? 11.561 171.072 35.141  1.00 267.96 ? 159  SER B O   1 
ATOM   5269 C  CB  . SER B 2  140 ? 9.604  173.357 35.955  1.00 282.55 ? 159  SER B CB  1 
ATOM   5270 O  OG  . SER B 2  140 ? 10.071 173.727 37.241  1.00 262.06 ? 159  SER B OG  1 
ATOM   5271 N  N   . SER B 2  141 ? 10.935 170.571 37.243  1.00 257.86 ? 160  SER B N   1 
ATOM   5272 C  CA  . SER B 2  141 ? 12.172 169.865 37.555  1.00 248.03 ? 160  SER B CA  1 
ATOM   5273 C  C   . SER B 2  141 ? 11.955 168.784 38.609  1.00 245.99 ? 160  SER B C   1 
ATOM   5274 O  O   . SER B 2  141 ? 11.207 168.973 39.569  1.00 219.14 ? 160  SER B O   1 
ATOM   5275 C  CB  . SER B 2  141 ? 13.243 170.849 38.030  1.00 227.80 ? 160  SER B CB  1 
ATOM   5276 O  OG  . SER B 2  141 ? 12.827 171.531 39.201  1.00 204.30 ? 160  SER B OG  1 
ATOM   5277 N  N   . VAL B 2  142 ? 12.618 167.649 38.416  1.00 271.24 ? 161  VAL B N   1 
ATOM   5278 C  CA  . VAL B 2  142 ? 12.557 166.539 39.355  1.00 274.54 ? 161  VAL B CA  1 
ATOM   5279 C  C   . VAL B 2  142 ? 13.903 166.396 40.061  1.00 278.03 ? 161  VAL B C   1 
ATOM   5280 O  O   . VAL B 2  142 ? 14.960 166.593 39.454  1.00 294.38 ? 161  VAL B O   1 
ATOM   5281 C  CB  . VAL B 2  142 ? 12.162 165.230 38.643  1.00 278.83 ? 161  VAL B CB  1 
ATOM   5282 C  CG1 . VAL B 2  142 ? 11.884 164.127 39.656  1.00 274.86 ? 161  VAL B CG1 1 
ATOM   5283 C  CG2 . VAL B 2  142 ? 10.954 165.457 37.747  1.00 303.97 ? 161  VAL B CG2 1 
ATOM   5284 N  N   . THR B 2  143 ? 13.858 166.062 41.347  1.00 248.47 ? 162  THR B N   1 
ATOM   5285 C  CA  . THR B 2  143 ? 15.070 165.879 42.137  1.00 215.25 ? 162  THR B CA  1 
ATOM   5286 C  C   . THR B 2  143 ? 15.328 164.398 42.401  1.00 225.88 ? 162  THR B C   1 
ATOM   5287 O  O   . THR B 2  143 ? 14.457 163.683 42.895  1.00 224.45 ? 162  THR B O   1 
ATOM   5288 C  CB  . THR B 2  143 ? 14.988 166.629 43.479  1.00 191.23 ? 162  THR B CB  1 
ATOM   5289 O  OG1 . THR B 2  143 ? 14.766 168.024 43.235  1.00 183.43 ? 162  THR B OG1 1 
ATOM   5290 C  CG2 . THR B 2  143 ? 16.279 166.457 44.266  1.00 198.03 ? 162  THR B CG2 1 
ATOM   5291 N  N   . LEU B 2  144 ? 16.532 163.948 42.065  1.00 244.62 ? 163  LEU B N   1 
ATOM   5292 C  CA  . LEU B 2  144 ? 16.919 162.555 42.248  1.00 264.84 ? 163  LEU B CA  1 
ATOM   5293 C  C   . LEU B 2  144 ? 17.993 162.452 43.326  1.00 258.93 ? 163  LEU B C   1 
ATOM   5294 O  O   . LEU B 2  144 ? 18.344 163.451 43.953  1.00 253.47 ? 163  LEU B O   1 
ATOM   5295 C  CB  . LEU B 2  144 ? 17.424 161.959 40.932  1.00 277.74 ? 163  LEU B CB  1 
ATOM   5296 C  CG  . LEU B 2  144 ? 16.675 162.352 39.654  1.00 285.97 ? 163  LEU B CG  1 
ATOM   5297 C  CD1 . LEU B 2  144 ? 17.285 161.661 38.442  1.00 293.23 ? 163  LEU B CD1 1 
ATOM   5298 C  CD2 . LEU B 2  144 ? 15.185 162.047 39.756  1.00 292.63 ? 163  LEU B CD2 1 
ATOM   5299 N  N   . GLY B 2  145 ? 18.517 161.249 43.539  1.00 265.55 ? 164  GLY B N   1 
ATOM   5300 C  CA  . GLY B 2  145 ? 19.567 161.053 44.522  1.00 259.46 ? 164  GLY B CA  1 
ATOM   5301 C  C   . GLY B 2  145 ? 19.859 159.608 44.879  1.00 255.01 ? 164  GLY B C   1 
ATOM   5302 O  O   . GLY B 2  145 ? 19.105 158.702 44.522  1.00 265.36 ? 164  GLY B O   1 
ATOM   5303 N  N   . CYS B 2  146 ? 20.965 159.395 45.586  1.00 215.13 ? 165  CYS B N   1 
ATOM   5304 C  CA  . CYS B 2  146 ? 21.353 158.062 46.035  1.00 190.64 ? 165  CYS B CA  1 
ATOM   5305 C  C   . CYS B 2  146 ? 21.882 158.111 47.468  1.00 193.15 ? 165  CYS B C   1 
ATOM   5306 O  O   . CYS B 2  146 ? 22.334 159.157 47.938  1.00 192.26 ? 165  CYS B O   1 
ATOM   5307 C  CB  . CYS B 2  146 ? 22.397 157.457 45.090  1.00 166.44 ? 165  CYS B CB  1 
ATOM   5308 S  SG  . CYS B 2  146 ? 21.741 156.996 43.460  1.00 193.62 ? 165  CYS B SG  1 
ATOM   5309 N  N   . LEU B 2  147 ? 21.819 156.975 48.155  1.00 198.50 ? 166  LEU B N   1 
ATOM   5310 C  CA  . LEU B 2  147 ? 22.171 156.905 49.570  1.00 199.08 ? 166  LEU B CA  1 
ATOM   5311 C  C   . LEU B 2  147 ? 23.322 155.939 49.834  1.00 218.84 ? 166  LEU B C   1 
ATOM   5312 O  O   . LEU B 2  147 ? 23.344 154.822 49.315  1.00 241.98 ? 166  LEU B O   1 
ATOM   5313 C  CB  . LEU B 2  147 ? 20.950 156.493 50.396  1.00 201.76 ? 166  LEU B CB  1 
ATOM   5314 C  CG  . LEU B 2  147 ? 21.151 156.290 51.900  1.00 209.50 ? 166  LEU B CG  1 
ATOM   5315 C  CD1 . LEU B 2  147 ? 21.546 157.593 52.577  1.00 208.15 ? 166  LEU B CD1 1 
ATOM   5316 C  CD2 . LEU B 2  147 ? 19.896 155.710 52.535  1.00 204.55 ? 166  LEU B CD2 1 
ATOM   5317 N  N   . VAL B 2  148 ? 24.275 156.380 50.650  1.00 199.24 ? 167  VAL B N   1 
ATOM   5318 C  CA  . VAL B 2  148 ? 25.409 155.552 51.040  1.00 196.19 ? 167  VAL B CA  1 
ATOM   5319 C  C   . VAL B 2  148 ? 25.394 155.346 52.550  1.00 203.76 ? 167  VAL B C   1 
ATOM   5320 O  O   . VAL B 2  148 ? 25.456 156.309 53.316  1.00 202.45 ? 167  VAL B O   1 
ATOM   5321 C  CB  . VAL B 2  148 ? 26.738 156.173 50.584  1.00 196.62 ? 167  VAL B CB  1 
ATOM   5322 C  CG1 . VAL B 2  148 ? 27.907 155.317 51.041  1.00 201.42 ? 167  VAL B CG1 1 
ATOM   5323 C  CG2 . VAL B 2  148 ? 26.753 156.343 49.073  1.00 196.74 ? 167  VAL B CG2 1 
ATOM   5324 N  N   . LYS B 2  149 ? 25.317 154.088 52.974  1.00 204.28 ? 168  LYS B N   1 
ATOM   5325 C  CA  . LYS B 2  149 ? 25.190 153.773 54.392  1.00 181.37 ? 168  LYS B CA  1 
ATOM   5326 C  C   . LYS B 2  149 ? 26.238 152.769 54.869  1.00 193.78 ? 168  LYS B C   1 
ATOM   5327 O  O   . LYS B 2  149 ? 26.375 151.683 54.307  1.00 204.69 ? 168  LYS B O   1 
ATOM   5328 C  CB  . LYS B 2  149 ? 23.786 153.237 54.685  1.00 158.09 ? 168  LYS B CB  1 
ATOM   5329 C  CG  . LYS B 2  149 ? 23.572 152.777 56.119  1.00 188.97 ? 168  LYS B CG  1 
ATOM   5330 C  CD  . LYS B 2  149 ? 23.510 151.259 56.212  1.00 205.18 ? 168  LYS B CD  1 
ATOM   5331 C  CE  . LYS B 2  149 ? 23.258 150.803 57.640  1.00 202.77 ? 168  LYS B CE  1 
ATOM   5332 N  NZ  . LYS B 2  149 ? 23.174 149.320 57.743  1.00 194.18 ? 168  LYS B NZ  1 
ATOM   5333 N  N   . GLY B 2  150 ? 26.970 153.145 55.914  1.00 209.24 ? 169  GLY B N   1 
ATOM   5334 C  CA  . GLY B 2  150 ? 27.919 152.250 56.552  1.00 210.01 ? 169  GLY B CA  1 
ATOM   5335 C  C   . GLY B 2  150 ? 29.200 151.992 55.783  1.00 224.17 ? 169  GLY B C   1 
ATOM   5336 O  O   . GLY B 2  150 ? 29.262 151.088 54.950  1.00 242.82 ? 169  GLY B O   1 
ATOM   5337 N  N   . TYR B 2  151 ? 30.227 152.787 56.069  1.00 200.02 ? 170  TYR B N   1 
ATOM   5338 C  CA  . TYR B 2  151 ? 31.542 152.595 55.465  1.00 177.27 ? 170  TYR B CA  1 
ATOM   5339 C  C   . TYR B 2  151 ? 32.625 153.269 56.303  1.00 172.20 ? 170  TYR B C   1 
ATOM   5340 O  O   . TYR B 2  151 ? 32.331 154.115 57.147  1.00 167.47 ? 170  TYR B O   1 
ATOM   5341 C  CB  . TYR B 2  151 ? 31.568 153.134 54.032  1.00 169.08 ? 170  TYR B CB  1 
ATOM   5342 C  CG  . TYR B 2  151 ? 31.386 154.630 53.922  1.00 172.12 ? 170  TYR B CG  1 
ATOM   5343 C  CD1 . TYR B 2  151 ? 30.119 155.198 53.936  1.00 162.22 ? 170  TYR B CD1 1 
ATOM   5344 C  CD2 . TYR B 2  151 ? 32.481 155.474 53.791  1.00 182.01 ? 170  TYR B CD2 1 
ATOM   5345 C  CE1 . TYR B 2  151 ? 29.948 156.566 53.831  1.00 161.79 ? 170  TYR B CE1 1 
ATOM   5346 C  CE2 . TYR B 2  151 ? 32.320 156.842 53.686  1.00 175.94 ? 170  TYR B CE2 1 
ATOM   5347 C  CZ  . TYR B 2  151 ? 31.052 157.382 53.706  1.00 162.40 ? 170  TYR B CZ  1 
ATOM   5348 O  OH  . TYR B 2  151 ? 30.888 158.744 53.601  1.00 140.94 ? 170  TYR B OH  1 
ATOM   5349 N  N   . PHE B 2  152 ? 33.876 152.889 56.064  1.00 177.69 ? 171  PHE B N   1 
ATOM   5350 C  CA  . PHE B 2  152 ? 34.999 153.425 56.824  1.00 166.84 ? 171  PHE B CA  1 
ATOM   5351 C  C   . PHE B 2  152 ? 36.298 153.315 56.028  1.00 179.07 ? 171  PHE B C   1 
ATOM   5352 O  O   . PHE B 2  152 ? 36.559 152.288 55.402  1.00 185.03 ? 171  PHE B O   1 
ATOM   5353 C  CB  . PHE B 2  152 ? 35.133 152.692 58.164  1.00 158.99 ? 171  PHE B CB  1 
ATOM   5354 C  CG  . PHE B 2  152 ? 36.119 153.322 59.107  1.00 162.71 ? 171  PHE B CG  1 
ATOM   5355 C  CD1 . PHE B 2  152 ? 35.727 154.340 59.960  1.00 163.27 ? 171  PHE B CD1 1 
ATOM   5356 C  CD2 . PHE B 2  152 ? 37.436 152.897 59.141  1.00 174.82 ? 171  PHE B CD2 1 
ATOM   5357 C  CE1 . PHE B 2  152 ? 36.629 154.923 60.828  1.00 166.02 ? 171  PHE B CE1 1 
ATOM   5358 C  CE2 . PHE B 2  152 ? 38.344 153.477 60.006  1.00 184.19 ? 171  PHE B CE2 1 
ATOM   5359 C  CZ  . PHE B 2  152 ? 37.939 154.491 60.851  1.00 174.24 ? 171  PHE B CZ  1 
ATOM   5360 N  N   . PRO B 2  153 ? 37.120 154.378 56.049  1.00 184.15 ? 172  PRO B N   1 
ATOM   5361 C  CA  . PRO B 2  153 ? 36.848 155.647 56.730  1.00 192.38 ? 172  PRO B CA  1 
ATOM   5362 C  C   . PRO B 2  153 ? 36.105 156.649 55.852  1.00 190.10 ? 172  PRO B C   1 
ATOM   5363 O  O   . PRO B 2  153 ? 35.278 156.257 55.029  1.00 179.88 ? 172  PRO B O   1 
ATOM   5364 C  CB  . PRO B 2  153 ? 38.248 156.159 57.062  1.00 200.49 ? 172  PRO B CB  1 
ATOM   5365 C  CG  . PRO B 2  153 ? 39.079 155.661 55.934  1.00 198.80 ? 172  PRO B CG  1 
ATOM   5366 C  CD  . PRO B 2  153 ? 38.497 154.325 55.530  1.00 184.50 ? 172  PRO B CD  1 
ATOM   5367 N  N   . GLU B 2  154 ? 36.410 157.931 56.027  1.00 221.49 ? 173  GLU B N   1 
ATOM   5368 C  CA  . GLU B 2  154 ? 35.762 158.989 55.260  1.00 224.56 ? 173  GLU B CA  1 
ATOM   5369 C  C   . GLU B 2  154 ? 36.427 159.066 53.888  1.00 219.47 ? 173  GLU B C   1 
ATOM   5370 O  O   . GLU B 2  154 ? 37.085 160.051 53.556  1.00 228.45 ? 173  GLU B O   1 
ATOM   5371 C  CB  . GLU B 2  154 ? 35.889 160.327 55.992  1.00 239.32 ? 173  GLU B CB  1 
ATOM   5372 C  CG  . GLU B 2  154 ? 37.288 160.627 56.505  1.00 259.20 ? 173  GLU B CG  1 
ATOM   5373 C  CD  . GLU B 2  154 ? 37.385 161.992 57.152  1.00 264.23 ? 173  GLU B CD  1 
ATOM   5374 O  OE1 . GLU B 2  154 ? 36.332 162.639 57.335  1.00 260.60 ? 173  GLU B OE1 1 
ATOM   5375 O  OE2 . GLU B 2  154 ? 38.513 162.420 57.475  1.00 265.85 ? 173  GLU B OE2 1 
ATOM   5376 N  N   . SER B 2  155 ? 36.244 158.019 53.092  1.00 199.49 ? 174  SER B N   1 
ATOM   5377 C  CA  . SER B 2  155 ? 36.823 157.960 51.757  1.00 209.36 ? 174  SER B CA  1 
ATOM   5378 C  C   . SER B 2  155 ? 35.795 157.365 50.803  1.00 209.84 ? 174  SER B C   1 
ATOM   5379 O  O   . SER B 2  155 ? 35.739 156.151 50.615  1.00 207.97 ? 174  SER B O   1 
ATOM   5380 C  CB  . SER B 2  155 ? 38.125 157.160 51.702  1.00 217.32 ? 174  SER B CB  1 
ATOM   5381 O  OG  . SER B 2  155 ? 39.111 157.732 52.543  1.00 212.50 ? 174  SER B OG  1 
ATOM   5382 N  N   . VAL B 2  156 ? 34.978 158.227 50.207  1.00 199.56 ? 175  VAL B N   1 
ATOM   5383 C  CA  . VAL B 2  156 ? 33.952 157.788 49.271  1.00 194.40 ? 175  VAL B CA  1 
ATOM   5384 C  C   . VAL B 2  156 ? 33.743 158.860 48.204  1.00 212.85 ? 175  VAL B C   1 
ATOM   5385 O  O   . VAL B 2  156 ? 33.949 160.048 48.458  1.00 224.31 ? 175  VAL B O   1 
ATOM   5386 C  CB  . VAL B 2  156 ? 32.633 157.457 50.005  1.00 180.53 ? 175  VAL B CB  1 
ATOM   5387 C  CG1 . VAL B 2  156 ? 31.961 158.725 50.510  1.00 173.69 ? 175  VAL B CG1 1 
ATOM   5388 C  CG2 . VAL B 2  156 ? 31.696 156.659 49.107  1.00 183.43 ? 175  VAL B CG2 1 
ATOM   5389 N  N   . THR B 2  157 ? 33.351 158.438 47.006  1.00 226.60 ? 176  THR B N   1 
ATOM   5390 C  CA  . THR B 2  157 ? 33.132 159.369 45.905  1.00 226.12 ? 176  THR B CA  1 
ATOM   5391 C  C   . THR B 2  157 ? 31.911 158.979 45.077  1.00 229.99 ? 176  THR B C   1 
ATOM   5392 O  O   . THR B 2  157 ? 31.884 157.917 44.458  1.00 248.10 ? 176  THR B O   1 
ATOM   5393 C  CB  . THR B 2  157 ? 34.361 159.446 44.980  1.00 227.31 ? 176  THR B CB  1 
ATOM   5394 O  OG1 . THR B 2  157 ? 35.501 159.880 45.732  1.00 228.61 ? 176  THR B OG1 1 
ATOM   5395 C  CG2 . THR B 2  157 ? 34.108 160.420 43.840  1.00 225.21 ? 176  THR B CG2 1 
ATOM   5396 N  N   . VAL B 2  158 ? 30.906 159.849 45.065  1.00 215.22 ? 177  VAL B N   1 
ATOM   5397 C  CA  . VAL B 2  158 ? 29.680 159.591 44.321  1.00 207.84 ? 177  VAL B CA  1 
ATOM   5398 C  C   . VAL B 2  158 ? 29.595 160.495 43.096  1.00 199.93 ? 177  VAL B C   1 
ATOM   5399 O  O   . VAL B 2  158 ? 29.454 161.712 43.220  1.00 198.65 ? 177  VAL B O   1 
ATOM   5400 C  CB  . VAL B 2  158 ? 28.441 159.772 45.214  1.00 194.10 ? 177  VAL B CB  1 
ATOM   5401 C  CG1 . VAL B 2  158 ? 27.174 159.451 44.436  1.00 192.08 ? 177  VAL B CG1 1 
ATOM   5402 C  CG2 . VAL B 2  158 ? 28.551 158.900 46.455  1.00 198.77 ? 177  VAL B CG2 1 
ATOM   5403 N  N   . THR B 2  159 ? 29.678 159.894 41.914  1.00 182.53 ? 178  THR B N   1 
ATOM   5404 C  CA  . THR B 2  159 ? 29.604 160.644 40.665  1.00 188.02 ? 178  THR B CA  1 
ATOM   5405 C  C   . THR B 2  159 ? 28.276 160.392 39.955  1.00 202.20 ? 178  THR B C   1 
ATOM   5406 O  O   . THR B 2  159 ? 27.520 159.496 40.333  1.00 199.11 ? 178  THR B O   1 
ATOM   5407 C  CB  . THR B 2  159 ? 30.764 160.281 39.718  1.00 202.38 ? 178  THR B CB  1 
ATOM   5408 O  OG1 . THR B 2  159 ? 30.684 158.894 39.367  1.00 204.94 ? 178  THR B OG1 1 
ATOM   5409 C  CG2 . THR B 2  159 ? 32.103 160.551 40.389  1.00 197.71 ? 178  THR B CG2 1 
ATOM   5410 N  N   . TRP B 2  160 ? 27.998 161.187 38.925  1.00 234.50 ? 179  TRP B N   1 
ATOM   5411 C  CA  . TRP B 2  160 ? 26.754 161.063 38.173  1.00 256.90 ? 179  TRP B CA  1 
ATOM   5412 C  C   . TRP B 2  160 ? 26.994 161.094 36.666  1.00 280.55 ? 179  TRP B C   1 
ATOM   5413 O  O   . TRP B 2  160 ? 27.330 162.138 36.105  1.00 272.58 ? 179  TRP B O   1 
ATOM   5414 C  CB  . TRP B 2  160 ? 25.779 162.176 38.564  1.00 241.81 ? 179  TRP B CB  1 
ATOM   5415 C  CG  . TRP B 2  160 ? 25.255 162.052 39.960  1.00 232.50 ? 179  TRP B CG  1 
ATOM   5416 C  CD1 . TRP B 2  160 ? 25.841 162.516 41.100  1.00 229.98 ? 179  TRP B CD1 1 
ATOM   5417 C  CD2 . TRP B 2  160 ? 24.032 161.424 40.364  1.00 239.15 ? 179  TRP B CD2 1 
ATOM   5418 N  NE1 . TRP B 2  160 ? 25.061 162.214 42.190  1.00 230.65 ? 179  TRP B NE1 1 
ATOM   5419 C  CE2 . TRP B 2  160 ? 23.945 161.544 41.765  1.00 230.82 ? 179  TRP B CE2 1 
ATOM   5420 C  CE3 . TRP B 2  160 ? 23.004 160.771 39.677  1.00 250.27 ? 179  TRP B CE3 1 
ATOM   5421 C  CZ2 . TRP B 2  160 ? 22.870 161.035 42.492  1.00 223.60 ? 179  TRP B CZ2 1 
ATOM   5422 C  CZ3 . TRP B 2  160 ? 21.938 160.266 40.401  1.00 247.41 ? 179  TRP B CZ3 1 
ATOM   5423 C  CH2 . TRP B 2  160 ? 21.880 160.402 41.793  1.00 229.94 ? 179  TRP B CH2 1 
ATOM   5424 N  N   . ASN B 2  161 ? 26.814 159.940 36.025  1.00 299.47 ? 180  ASN B N   1 
ATOM   5425 C  CA  . ASN B 2  161 ? 26.934 159.803 34.573  1.00 311.81 ? 180  ASN B CA  1 
ATOM   5426 C  C   . ASN B 2  161 ? 28.280 160.298 34.045  1.00 314.50 ? 180  ASN B C   1 
ATOM   5427 O  O   . ASN B 2  161 ? 28.331 161.060 33.079  1.00 321.57 ? 180  ASN B O   1 
ATOM   5428 C  CB  . ASN B 2  161 ? 25.795 160.550 33.873  1.00 312.50 ? 180  ASN B CB  1 
ATOM   5429 C  CG  . ASN B 2  161 ? 24.426 160.069 34.312  1.00 308.11 ? 180  ASN B CG  1 
ATOM   5430 O  OD1 . ASN B 2  161 ? 24.248 158.904 34.666  1.00 306.04 ? 180  ASN B OD1 1 
ATOM   5431 N  ND2 . ASN B 2  161 ? 23.448 160.968 34.292  1.00 306.58 ? 180  ASN B ND2 1 
ATOM   5432 N  N   . SER B 2  162 ? 29.358 159.859 34.691  1.00 312.52 ? 181  SER B N   1 
ATOM   5433 C  CA  . SER B 2  162 ? 30.723 160.212 34.302  1.00 306.05 ? 181  SER B CA  1 
ATOM   5434 C  C   . SER B 2  162 ? 30.953 161.723 34.282  1.00 303.05 ? 181  SER B C   1 
ATOM   5435 O  O   . SER B 2  162 ? 31.761 162.226 33.501  1.00 311.07 ? 181  SER B O   1 
ATOM   5436 C  CB  . SER B 2  162 ? 31.062 159.615 32.932  1.00 306.74 ? 181  SER B CB  1 
ATOM   5437 O  OG  . SER B 2  162 ? 32.391 159.928 32.553  1.00 302.34 ? 181  SER B OG  1 
ATOM   5438 N  N   . GLY B 2  163 ? 30.239 162.440 35.145  1.00 284.84 ? 182  GLY B N   1 
ATOM   5439 C  CA  . GLY B 2  163 ? 30.402 163.877 35.265  1.00 277.91 ? 182  GLY B CA  1 
ATOM   5440 C  C   . GLY B 2  163 ? 29.741 164.691 34.169  1.00 284.86 ? 182  GLY B C   1 
ATOM   5441 O  O   . GLY B 2  163 ? 30.268 165.724 33.753  1.00 285.56 ? 182  GLY B O   1 
ATOM   5442 N  N   . SER B 2  164 ? 28.649 164.190 33.667  1.00 295.97 ? 183  SER B N   1 
ATOM   5443 C  CA  . SER B 2  164 ? 27.893 164.922 32.655  1.00 300.42 ? 183  SER B CA  1 
ATOM   5444 C  C   . SER B 2  164 ? 26.431 164.482 32.624  1.00 299.37 ? 183  SER B C   1 
ATOM   5445 O  O   . SER B 2  164 ? 26.125 163.362 32.214  1.00 306.79 ? 183  SER B O   1 
ATOM   5446 C  CB  . SER B 2  164 ? 28.526 164.736 31.273  1.00 303.80 ? 183  SER B CB  1 
ATOM   5447 O  OG  . SER B 2  164 ? 28.523 163.372 30.889  1.00 307.12 ? 183  SER B OG  1 
ATOM   5448 N  N   . LEU B 2  165 ? 25.530 165.362 33.053  1.00 296.08 ? 184  LEU B N   1 
ATOM   5449 C  CA  . LEU B 2  165 ? 25.901 166.688 33.539  1.00 284.83 ? 184  LEU B CA  1 
ATOM   5450 C  C   . LEU B 2  165 ? 25.692 166.798 35.046  1.00 271.56 ? 184  LEU B C   1 
ATOM   5451 O  O   . LEU B 2  165 ? 24.954 166.012 35.640  1.00 267.39 ? 184  LEU B O   1 
ATOM   5452 C  CB  . LEU B 2  165 ? 25.102 167.772 32.805  1.00 289.00 ? 184  LEU B CB  1 
ATOM   5453 C  CG  . LEU B 2  165 ? 23.590 167.583 32.637  1.00 292.73 ? 184  LEU B CG  1 
ATOM   5454 C  CD1 . LEU B 2  165 ? 22.815 168.030 33.873  1.00 293.76 ? 184  LEU B CD1 1 
ATOM   5455 C  CD2 . LEU B 2  165 ? 23.095 168.316 31.397  1.00 284.16 ? 184  LEU B CD2 1 
ATOM   5456 N  N   . SER B 2  166 ? 26.270 167.810 35.713  1.00 267.98 ? 185  SER B N   1 
ATOM   5457 C  CA  . SER B 2  166 ? 26.176 167.999 37.155  1.00 256.08 ? 185  SER B CA  1 
ATOM   5458 C  C   . SER B 2  166 ? 26.166 169.481 37.515  1.00 246.59 ? 185  SER B C   1 
ATOM   5459 O  O   . SER B 2  166 ? 27.015 169.950 38.273  1.00 237.58 ? 185  SER B O   1 
ATOM   5460 C  CB  . SER B 2  166 ? 27.333 167.292 37.863  1.00 252.88 ? 185  SER B CB  1 
ATOM   5461 O  OG  . SER B 2  166 ? 28.583 167.787 37.415  1.00 259.83 ? 185  SER B OG  1 
ATOM   5462 N  N   . SER B 2  167 ? 25.286 170.185 36.810  1.00 248.40 ? 186  SER B N   1 
ATOM   5463 C  CA  . SER B 2  167 ? 24.907 171.565 37.056  1.00 245.35 ? 186  SER B CA  1 
ATOM   5464 C  C   . SER B 2  167 ? 24.135 171.760 38.348  1.00 242.05 ? 186  SER B C   1 
ATOM   5465 O  O   . SER B 2  167 ? 24.330 172.746 39.048  1.00 238.14 ? 186  SER B O   1 
ATOM   5466 C  CB  . SER B 2  167 ? 24.067 172.084 35.893  1.00 248.62 ? 186  SER B CB  1 
ATOM   5467 O  OG  . SER B 2  167 ? 22.857 171.356 35.793  1.00 247.33 ? 186  SER B OG  1 
ATOM   5468 N  N   . SER B 2  168 ? 23.234 170.830 38.648  1.00 239.23 ? 187  SER B N   1 
ATOM   5469 C  CA  . SER B 2  168 ? 22.328 171.001 39.777  1.00 236.25 ? 187  SER B CA  1 
ATOM   5470 C  C   . SER B 2  168 ? 22.290 170.020 40.931  1.00 230.42 ? 187  SER B C   1 
ATOM   5471 O  O   . SER B 2  168 ? 21.233 169.753 41.498  1.00 217.82 ? 187  SER B O   1 
ATOM   5472 C  CB  . SER B 2  168 ? 20.903 171.293 39.287  1.00 245.63 ? 187  SER B CB  1 
ATOM   5473 O  OG  . SER B 2  168 ? 20.804 172.531 38.599  1.00 255.63 ? 187  SER B OG  1 
ATOM   5474 N  N   . VAL B 2  169 ? 23.465 169.548 41.336  1.00 231.07 ? 188  VAL B N   1 
ATOM   5475 C  CA  . VAL B 2  169 ? 23.585 168.496 42.346  1.00 223.80 ? 188  VAL B CA  1 
ATOM   5476 C  C   . VAL B 2  169 ? 24.115 168.937 43.714  1.00 215.22 ? 188  VAL B C   1 
ATOM   5477 O  O   . VAL B 2  169 ? 24.931 169.845 43.827  1.00 223.86 ? 188  VAL B O   1 
ATOM   5478 C  CB  . VAL B 2  169 ? 24.454 167.335 41.847  1.00 214.03 ? 188  VAL B CB  1 
ATOM   5479 C  CG1 . VAL B 2  169 ? 25.868 167.821 41.587  1.00 212.18 ? 188  VAL B CG1 1 
ATOM   5480 C  CG2 . VAL B 2  169 ? 24.449 166.201 42.856  1.00 214.61 ? 188  VAL B CG2 1 
ATOM   5481 N  N   . HIS B 2  170 ? 23.620 168.261 44.744  1.00 181.24 ? 189  HIS B N   1 
ATOM   5482 C  CA  . HIS B 2  170 ? 23.850 168.573 46.150  1.00 180.73 ? 189  HIS B CA  1 
ATOM   5483 C  C   . HIS B 2  170 ? 24.346 167.343 46.906  1.00 177.20 ? 189  HIS B C   1 
ATOM   5484 O  O   . HIS B 2  170 ? 23.620 166.361 47.055  1.00 175.40 ? 189  HIS B O   1 
ATOM   5485 C  CB  . HIS B 2  170 ? 22.572 169.109 46.799  1.00 192.56 ? 189  HIS B CB  1 
ATOM   5486 C  CG  . HIS B 2  170 ? 22.100 170.408 46.223  1.00 187.53 ? 189  HIS B CG  1 
ATOM   5487 N  ND1 . HIS B 2  170 ? 22.443 171.629 46.761  1.00 167.39 ? 189  HIS B ND1 1 
ATOM   5488 C  CD2 . HIS B 2  170 ? 21.309 170.675 45.156  1.00 194.55 ? 189  HIS B CD2 1 
ATOM   5489 C  CE1 . HIS B 2  170 ? 21.886 172.594 46.050  1.00 164.10 ? 189  HIS B CE1 1 
ATOM   5490 N  NE2 . HIS B 2  170 ? 21.193 172.042 45.071  1.00 186.46 ? 189  HIS B NE2 1 
ATOM   5491 N  N   . THR B 2  171 ? 25.588 167.403 47.376  1.00 179.05 ? 190  THR B N   1 
ATOM   5492 C  CA  . THR B 2  171 ? 26.177 166.304 48.133  1.00 183.08 ? 190  THR B CA  1 
ATOM   5493 C  C   . THR B 2  171 ? 26.173 166.624 49.624  1.00 183.39 ? 190  THR B C   1 
ATOM   5494 O  O   . THR B 2  171 ? 26.600 167.703 50.035  1.00 182.84 ? 190  THR B O   1 
ATOM   5495 C  CB  . THR B 2  171 ? 27.618 166.009 47.675  1.00 199.66 ? 190  THR B CB  1 
ATOM   5496 O  OG1 . THR B 2  171 ? 27.621 165.686 46.278  1.00 208.22 ? 190  THR B OG1 1 
ATOM   5497 C  CG2 . THR B 2  171 ? 28.204 164.845 48.459  1.00 210.41 ? 190  THR B CG2 1 
ATOM   5498 N  N   . PHE B 2  172 ? 25.688 165.686 50.432  1.00 187.16 ? 191  PHE B N   1 
ATOM   5499 C  CA  . PHE B 2  172 ? 25.583 165.909 51.870  1.00 177.62 ? 191  PHE B CA  1 
ATOM   5500 C  C   . PHE B 2  172 ? 26.731 165.241 52.624  1.00 170.51 ? 191  PHE B C   1 
ATOM   5501 O  O   . PHE B 2  172 ? 27.067 164.087 52.354  1.00 174.75 ? 191  PHE B O   1 
ATOM   5502 C  CB  . PHE B 2  172 ? 24.235 165.403 52.385  1.00 165.20 ? 191  PHE B CB  1 
ATOM   5503 C  CG  . PHE B 2  172 ? 23.056 166.016 51.685  1.00 187.55 ? 191  PHE B CG  1 
ATOM   5504 C  CD1 . PHE B 2  172 ? 22.571 167.255 52.070  1.00 213.00 ? 191  PHE B CD1 1 
ATOM   5505 C  CD2 . PHE B 2  172 ? 22.438 165.357 50.635  1.00 186.61 ? 191  PHE B CD2 1 
ATOM   5506 C  CE1 . PHE B 2  172 ? 21.489 167.823 51.423  1.00 217.00 ? 191  PHE B CE1 1 
ATOM   5507 C  CE2 . PHE B 2  172 ? 21.356 165.921 49.984  1.00 195.79 ? 191  PHE B CE2 1 
ATOM   5508 C  CZ  . PHE B 2  172 ? 20.880 167.154 50.380  1.00 204.70 ? 191  PHE B CZ  1 
ATOM   5509 N  N   . PRO B 2  173 ? 27.339 165.977 53.570  1.00 149.83 ? 192  PRO B N   1 
ATOM   5510 C  CA  . PRO B 2  173 ? 28.495 165.530 54.356  1.00 161.68 ? 192  PRO B CA  1 
ATOM   5511 C  C   . PRO B 2  173 ? 28.261 164.209 55.082  1.00 165.20 ? 192  PRO B C   1 
ATOM   5512 O  O   . PRO B 2  173 ? 27.149 163.931 55.530  1.00 142.29 ? 192  PRO B O   1 
ATOM   5513 C  CB  . PRO B 2  173 ? 28.693 166.668 55.361  1.00 154.62 ? 192  PRO B CB  1 
ATOM   5514 C  CG  . PRO B 2  173 ? 28.125 167.863 54.685  1.00 131.20 ? 192  PRO B CG  1 
ATOM   5515 C  CD  . PRO B 2  173 ? 26.942 167.352 53.918  1.00 139.32 ? 192  PRO B CD  1 
ATOM   5516 N  N   . ALA B 2  174 ? 29.315 163.407 55.194  1.00 193.84 ? 193  ALA B N   1 
ATOM   5517 C  CA  . ALA B 2  174 ? 29.228 162.107 55.844  1.00 189.07 ? 193  ALA B CA  1 
ATOM   5518 C  C   . ALA B 2  174 ? 29.046 162.254 57.349  1.00 168.77 ? 193  ALA B C   1 
ATOM   5519 O  O   . ALA B 2  174 ? 29.709 163.069 57.989  1.00 167.28 ? 193  ALA B O   1 
ATOM   5520 C  CB  . ALA B 2  174 ? 30.468 161.282 55.542  1.00 195.18 ? 193  ALA B CB  1 
ATOM   5521 N  N   . LEU B 2  175 ? 28.139 161.460 57.907  1.00 160.18 ? 194  LEU B N   1 
ATOM   5522 C  CA  . LEU B 2  175 ? 27.909 161.456 59.346  1.00 161.55 ? 194  LEU B CA  1 
ATOM   5523 C  C   . LEU B 2  175 ? 28.424 160.157 59.956  1.00 178.81 ? 194  LEU B C   1 
ATOM   5524 O  O   . LEU B 2  175 ? 27.991 159.068 59.579  1.00 181.16 ? 194  LEU B O   1 
ATOM   5525 C  CB  . LEU B 2  175 ? 26.423 161.643 59.657  1.00 162.23 ? 194  LEU B CB  1 
ATOM   5526 C  CG  . LEU B 2  175 ? 25.790 162.944 59.155  1.00 178.96 ? 194  LEU B CG  1 
ATOM   5527 C  CD1 . LEU B 2  175 ? 24.332 163.033 59.579  1.00 192.64 ? 194  LEU B CD1 1 
ATOM   5528 C  CD2 . LEU B 2  175 ? 26.571 164.152 59.649  1.00 157.98 ? 194  LEU B CD2 1 
ATOM   5529 N  N   . LEU B 2  176 ? 29.356 160.281 60.895  1.00 215.21 ? 195  LEU B N   1 
ATOM   5530 C  CA  . LEU B 2  176 ? 29.958 159.118 61.535  1.00 237.87 ? 195  LEU B CA  1 
ATOM   5531 C  C   . LEU B 2  176 ? 29.103 158.626 62.697  1.00 248.74 ? 195  LEU B C   1 
ATOM   5532 O  O   . LEU B 2  176 ? 28.687 159.408 63.550  1.00 239.38 ? 195  LEU B O   1 
ATOM   5533 C  CB  . LEU B 2  176 ? 31.371 159.444 62.022  1.00 246.04 ? 195  LEU B CB  1 
ATOM   5534 C  CG  . LEU B 2  176 ? 32.140 158.300 62.686  1.00 250.07 ? 195  LEU B CG  1 
ATOM   5535 C  CD1 . LEU B 2  176 ? 32.263 157.117 61.738  1.00 255.42 ? 195  LEU B CD1 1 
ATOM   5536 C  CD2 . LEU B 2  176 ? 33.512 158.769 63.144  1.00 244.88 ? 195  LEU B CD2 1 
ATOM   5537 N  N   . GLN B 2  177 ? 28.846 157.323 62.720  1.00 260.11 ? 196  GLN B N   1 
ATOM   5538 C  CA  . GLN B 2  177 ? 28.044 156.715 63.774  1.00 263.63 ? 196  GLN B CA  1 
ATOM   5539 C  C   . GLN B 2  177 ? 28.356 155.228 63.900  1.00 262.82 ? 196  GLN B C   1 
ATOM   5540 O  O   . GLN B 2  177 ? 28.390 154.505 62.902  1.00 271.13 ? 196  GLN B O   1 
ATOM   5541 C  CB  . GLN B 2  177 ? 26.553 156.929 63.504  1.00 270.30 ? 196  GLN B CB  1 
ATOM   5542 C  CG  . GLN B 2  177 ? 26.119 156.577 62.091  1.00 271.98 ? 196  GLN B CG  1 
ATOM   5543 C  CD  . GLN B 2  177 ? 24.656 156.880 61.840  1.00 281.04 ? 196  GLN B CD  1 
ATOM   5544 O  OE1 . GLN B 2  177 ? 23.940 157.324 62.738  1.00 294.80 ? 196  GLN B OE1 1 
ATOM   5545 N  NE2 . GLN B 2  177 ? 24.204 156.643 60.614  1.00 274.21 ? 196  GLN B NE2 1 
ATOM   5546 N  N   . SER B 2  178 ? 28.589 154.786 65.134  1.00 234.38 ? 197  SER B N   1 
ATOM   5547 C  CA  . SER B 2  178 ? 28.938 153.398 65.435  1.00 233.07 ? 197  SER B CA  1 
ATOM   5548 C  C   . SER B 2  178 ? 30.153 152.930 64.636  1.00 238.67 ? 197  SER B C   1 
ATOM   5549 O  O   . SER B 2  178 ? 30.256 151.757 64.276  1.00 226.03 ? 197  SER B O   1 
ATOM   5550 C  CB  . SER B 2  178 ? 27.747 152.469 65.172  1.00 227.67 ? 197  SER B CB  1 
ATOM   5551 O  OG  . SER B 2  178 ? 27.461 152.374 63.787  1.00 232.06 ? 197  SER B OG  1 
ATOM   5552 N  N   . GLY B 2  179 ? 31.068 153.854 64.362  1.00 261.55 ? 198  GLY B N   1 
ATOM   5553 C  CA  . GLY B 2  179 ? 32.282 153.537 63.632  1.00 257.22 ? 198  GLY B CA  1 
ATOM   5554 C  C   . GLY B 2  179 ? 32.120 153.517 62.124  1.00 253.25 ? 198  GLY B C   1 
ATOM   5555 O  O   . GLY B 2  179 ? 33.084 153.286 61.395  1.00 273.45 ? 198  GLY B O   1 
ATOM   5556 N  N   . LEU B 2  180 ? 30.900 153.761 61.654  1.00 214.51 ? 199  LEU B N   1 
ATOM   5557 C  CA  . LEU B 2  180 ? 30.618 153.745 60.222  1.00 180.82 ? 199  LEU B CA  1 
ATOM   5558 C  C   . LEU B 2  180 ? 30.024 155.067 59.748  1.00 168.74 ? 199  LEU B C   1 
ATOM   5559 O  O   . LEU B 2  180 ? 29.139 155.628 60.392  1.00 168.18 ? 199  LEU B O   1 
ATOM   5560 C  CB  . LEU B 2  180 ? 29.668 152.596 59.876  1.00 147.48 ? 199  LEU B CB  1 
ATOM   5561 C  CG  . LEU B 2  180 ? 30.148 151.188 60.228  1.00 168.30 ? 199  LEU B CG  1 
ATOM   5562 C  CD1 . LEU B 2  180 ? 29.176 150.145 59.701  1.00 188.95 ? 199  LEU B CD1 1 
ATOM   5563 C  CD2 . LEU B 2  180 ? 31.547 150.947 59.687  1.00 154.05 ? 199  LEU B CD2 1 
ATOM   5564 N  N   . TYR B 2  181 ? 30.515 155.556 58.614  1.00 168.31 ? 200  TYR B N   1 
ATOM   5565 C  CA  . TYR B 2  181 ? 30.025 156.804 58.042  1.00 169.33 ? 200  TYR B CA  1 
ATOM   5566 C  C   . TYR B 2  181 ? 28.757 156.572 57.224  1.00 173.99 ? 200  TYR B C   1 
ATOM   5567 O  O   . TYR B 2  181 ? 28.502 155.461 56.757  1.00 194.33 ? 200  TYR B O   1 
ATOM   5568 C  CB  . TYR B 2  181 ? 31.102 157.454 57.170  1.00 174.34 ? 200  TYR B CB  1 
ATOM   5569 C  CG  . TYR B 2  181 ? 32.327 157.911 57.931  1.00 168.27 ? 200  TYR B CG  1 
ATOM   5570 C  CD1 . TYR B 2  181 ? 33.393 157.049 58.153  1.00 177.69 ? 200  TYR B CD1 1 
ATOM   5571 C  CD2 . TYR B 2  181 ? 32.420 159.207 58.421  1.00 170.17 ? 200  TYR B CD2 1 
ATOM   5572 C  CE1 . TYR B 2  181 ? 34.516 157.464 58.847  1.00 196.35 ? 200  TYR B CE1 1 
ATOM   5573 C  CE2 . TYR B 2  181 ? 33.538 159.631 59.115  1.00 189.98 ? 200  TYR B CE2 1 
ATOM   5574 C  CZ  . TYR B 2  181 ? 34.583 158.756 59.325  1.00 205.16 ? 200  TYR B CZ  1 
ATOM   5575 O  OH  . TYR B 2  181 ? 35.698 159.174 60.015  1.00 212.20 ? 200  TYR B OH  1 
ATOM   5576 N  N   . THR B 2  182 ? 27.964 157.626 57.059  1.00 165.04 ? 201  THR B N   1 
ATOM   5577 C  CA  . THR B 2  182 ? 26.733 157.550 56.278  1.00 167.12 ? 201  THR B CA  1 
ATOM   5578 C  C   . THR B 2  182 ? 26.416 158.896 55.633  1.00 160.24 ? 201  THR B C   1 
ATOM   5579 O  O   . THR B 2  182 ? 26.271 159.904 56.325  1.00 134.39 ? 201  THR B O   1 
ATOM   5580 C  CB  . THR B 2  182 ? 25.537 157.110 57.145  1.00 168.27 ? 201  THR B CB  1 
ATOM   5581 O  OG1 . THR B 2  182 ? 25.779 155.799 57.671  1.00 187.05 ? 201  THR B OG1 1 
ATOM   5582 C  CG2 . THR B 2  182 ? 24.258 157.092 56.320  1.00 141.44 ? 201  THR B CG2 1 
ATOM   5583 N  N   . MET B 2  183 ? 26.309 158.906 54.308  1.00 167.83 ? 202  MET B N   1 
ATOM   5584 C  CA  . MET B 2  183 ? 26.041 160.141 53.576  1.00 161.38 ? 202  MET B CA  1 
ATOM   5585 C  C   . MET B 2  183 ? 25.011 159.927 52.472  1.00 163.96 ? 202  MET B C   1 
ATOM   5586 O  O   . MET B 2  183 ? 24.580 158.802 52.221  1.00 141.23 ? 202  MET B O   1 
ATOM   5587 C  CB  . MET B 2  183 ? 27.340 160.704 52.990  1.00 170.46 ? 202  MET B CB  1 
ATOM   5588 C  CG  . MET B 2  183 ? 28.112 159.736 52.101  1.00 190.92 ? 202  MET B CG  1 
ATOM   5589 S  SD  . MET B 2  183 ? 27.553 159.720 50.386  1.00 188.04 ? 202  MET B SD  1 
ATOM   5590 C  CE  . MET B 2  183 ? 27.790 161.439 49.939  1.00 145.96 ? 202  MET B CE  1 
ATOM   5591 N  N   . SER B 2  184 ? 24.626 161.015 51.812  1.00 195.93 ? 203  SER B N   1 
ATOM   5592 C  CA  . SER B 2  184 ? 23.639 160.952 50.740  1.00 221.46 ? 203  SER B CA  1 
ATOM   5593 C  C   . SER B 2  184 ? 23.880 162.039 49.694  1.00 215.80 ? 203  SER B C   1 
ATOM   5594 O  O   . SER B 2  184 ? 24.548 163.040 49.964  1.00 214.82 ? 203  SER B O   1 
ATOM   5595 C  CB  . SER B 2  184 ? 22.225 161.078 51.310  1.00 227.74 ? 203  SER B CB  1 
ATOM   5596 O  OG  . SER B 2  184 ? 22.070 162.292 52.024  1.00 218.26 ? 203  SER B OG  1 
ATOM   5597 N  N   . SER B 2  185 ? 23.329 161.835 48.500  1.00 218.42 ? 204  SER B N   1 
ATOM   5598 C  CA  . SER B 2  185 ? 23.491 162.790 47.407  1.00 201.38 ? 204  SER B CA  1 
ATOM   5599 C  C   . SER B 2  185 ? 22.191 162.987 46.628  1.00 203.98 ? 204  SER B C   1 
ATOM   5600 O  O   . SER B 2  185 ? 21.341 162.096 46.582  1.00 177.68 ? 204  SER B O   1 
ATOM   5601 C  CB  . SER B 2  185 ? 24.603 162.331 46.460  1.00 190.96 ? 204  SER B CB  1 
ATOM   5602 O  OG  . SER B 2  185 ? 24.786 163.254 45.401  1.00 176.50 ? 204  SER B OG  1 
ATOM   5603 N  N   . SER B 2  186 ? 22.048 164.159 46.016  1.00 210.09 ? 205  SER B N   1 
ATOM   5604 C  CA  . SER B 2  186 ? 20.862 164.489 45.232  1.00 218.03 ? 205  SER B CA  1 
ATOM   5605 C  C   . SER B 2  186 ? 21.246 165.273 43.980  1.00 231.45 ? 205  SER B C   1 
ATOM   5606 O  O   . SER B 2  186 ? 22.352 165.802 43.889  1.00 242.29 ? 205  SER B O   1 
ATOM   5607 C  CB  . SER B 2  186 ? 19.868 165.292 46.074  1.00 215.35 ? 205  SER B CB  1 
ATOM   5608 O  OG  . SER B 2  186 ? 20.426 166.529 46.483  1.00 212.89 ? 205  SER B OG  1 
ATOM   5609 N  N   . VAL B 2  187 ? 20.331 165.349 43.018  1.00 226.61 ? 206  VAL B N   1 
ATOM   5610 C  CA  . VAL B 2  187 ? 20.595 166.061 41.772  1.00 220.84 ? 206  VAL B CA  1 
ATOM   5611 C  C   . VAL B 2  187 ? 19.258 166.570 41.234  1.00 223.17 ? 206  VAL B C   1 
ATOM   5612 O  O   . VAL B 2  187 ? 18.283 165.825 41.151  1.00 203.41 ? 206  VAL B O   1 
ATOM   5613 C  CB  . VAL B 2  187 ? 21.396 165.177 40.791  1.00 221.59 ? 206  VAL B CB  1 
ATOM   5614 C  CG1 . VAL B 2  187 ? 20.594 163.943 40.397  1.00 208.63 ? 206  VAL B CG1 1 
ATOM   5615 C  CG2 . VAL B 2  187 ? 21.798 165.975 39.560  1.00 234.68 ? 206  VAL B CG2 1 
ATOM   5616 N  N   . THR B 2  188 ? 19.219 167.847 40.868  1.00 237.71 ? 207  THR B N   1 
ATOM   5617 C  CA  . THR B 2  188 ? 18.004 168.451 40.334  1.00 257.33 ? 207  THR B CA  1 
ATOM   5618 C  C   . THR B 2  188 ? 18.102 168.514 38.812  1.00 265.74 ? 207  THR B C   1 
ATOM   5619 O  O   . THR B 2  188 ? 18.846 169.326 38.262  1.00 268.91 ? 207  THR B O   1 
ATOM   5620 C  CB  . THR B 2  188 ? 17.752 169.868 40.883  1.00 264.67 ? 207  THR B CB  1 
ATOM   5621 O  OG1 . THR B 2  188 ? 17.637 169.817 42.310  1.00 268.88 ? 207  THR B OG1 1 
ATOM   5622 C  CG2 . THR B 2  188 ? 16.473 170.447 40.297  1.00 269.08 ? 207  THR B CG2 1 
ATOM   5623 N  N   . VAL B 2  189 ? 17.347 167.654 38.136  1.00 264.76 ? 208  VAL B N   1 
ATOM   5624 C  CA  . VAL B 2  189 ? 17.347 167.624 36.677  1.00 263.91 ? 208  VAL B CA  1 
ATOM   5625 C  C   . VAL B 2  189 ? 15.945 167.912 36.156  1.00 275.75 ? 208  VAL B C   1 
ATOM   5626 O  O   . VAL B 2  189 ? 14.963 167.496 36.764  1.00 263.56 ? 208  VAL B O   1 
ATOM   5627 C  CB  . VAL B 2  189 ? 17.869 166.274 36.144  1.00 266.24 ? 208  VAL B CB  1 
ATOM   5628 C  CG1 . VAL B 2  189 ? 19.367 166.158 36.371  1.00 249.82 ? 208  VAL B CG1 1 
ATOM   5629 C  CG2 . VAL B 2  189 ? 17.134 165.119 36.806  1.00 270.54 ? 208  VAL B CG2 1 
ATOM   5630 N  N   . PRO B 2  190 ? 15.846 168.628 35.024  1.00 285.23 ? 209  PRO B N   1 
ATOM   5631 C  CA  . PRO B 2  190 ? 14.543 168.988 34.451  1.00 280.58 ? 209  PRO B CA  1 
ATOM   5632 C  C   . PRO B 2  190 ? 13.679 167.774 34.112  1.00 269.77 ? 209  PRO B C   1 
ATOM   5633 O  O   . PRO B 2  190 ? 14.181 166.652 34.059  1.00 268.58 ? 209  PRO B O   1 
ATOM   5634 C  CB  . PRO B 2  190 ? 14.918 169.761 33.180  1.00 289.87 ? 209  PRO B CB  1 
ATOM   5635 C  CG  . PRO B 2  190 ? 16.318 169.342 32.870  1.00 297.01 ? 209  PRO B CG  1 
ATOM   5636 C  CD  . PRO B 2  190 ? 16.962 169.120 34.200  1.00 294.79 ? 209  PRO B CD  1 
ATOM   5637 N  N   . SER B 2  191 ? 12.390 168.005 33.884  1.00 258.66 ? 210  SER B N   1 
ATOM   5638 C  CA  . SER B 2  191 ? 11.455 166.922 33.599  1.00 259.88 ? 210  SER B CA  1 
ATOM   5639 C  C   . SER B 2  191 ? 11.537 166.470 32.144  1.00 281.76 ? 210  SER B C   1 
ATOM   5640 O  O   . SER B 2  191 ? 10.750 165.635 31.700  1.00 262.89 ? 210  SER B O   1 
ATOM   5641 C  CB  . SER B 2  191 ? 10.025 167.351 33.930  1.00 250.48 ? 210  SER B CB  1 
ATOM   5642 O  OG  . SER B 2  191 ? 9.902  167.707 35.296  1.00 243.66 ? 210  SER B OG  1 
ATOM   5643 N  N   . SER B 2  192 ? 12.493 167.026 31.406  1.00 333.90 ? 211  SER B N   1 
ATOM   5644 C  CA  . SER B 2  192 ? 12.673 166.687 30.001  1.00 363.81 ? 211  SER B CA  1 
ATOM   5645 C  C   . SER B 2  192 ? 13.884 165.781 29.798  1.00 370.58 ? 211  SER B C   1 
ATOM   5646 O  O   . SER B 2  192 ? 14.403 165.666 28.688  1.00 372.97 ? 211  SER B O   1 
ATOM   5647 C  CB  . SER B 2  192 ? 12.820 167.956 29.160  1.00 373.91 ? 211  SER B CB  1 
ATOM   5648 O  OG  . SER B 2  192 ? 13.923 168.732 29.596  1.00 369.37 ? 211  SER B OG  1 
ATOM   5649 N  N   . THR B 2  193 ? 14.330 165.140 30.874  1.00 368.29 ? 212  THR B N   1 
ATOM   5650 C  CA  . THR B 2  193 ? 15.469 164.231 30.801  1.00 364.09 ? 212  THR B CA  1 
ATOM   5651 C  C   . THR B 2  193 ? 15.286 163.018 31.709  1.00 358.90 ? 212  THR B C   1 
ATOM   5652 O  O   . THR B 2  193 ? 16.197 162.203 31.864  1.00 361.32 ? 212  THR B O   1 
ATOM   5653 C  CB  . THR B 2  193 ? 16.796 164.962 31.090  1.00 351.74 ? 212  THR B CB  1 
ATOM   5654 O  OG1 . THR B 2  193 ? 17.887 164.038 30.990  1.00 353.21 ? 212  THR B OG1 1 
ATOM   5655 C  CG2 . THR B 2  193 ? 16.781 165.571 32.483  1.00 332.12 ? 212  THR B CG2 1 
ATOM   5656 N  N   . TRP B 2  194 ? 14.102 162.902 32.304  1.00 345.99 ? 213  TRP B N   1 
ATOM   5657 C  CA  . TRP B 2  194 ? 13.802 161.799 33.210  1.00 326.01 ? 213  TRP B CA  1 
ATOM   5658 C  C   . TRP B 2  194 ? 12.330 161.399 33.140  1.00 310.51 ? 213  TRP B C   1 
ATOM   5659 O  O   . TRP B 2  194 ? 11.452 162.262 33.108  1.00 312.61 ? 213  TRP B O   1 
ATOM   5660 C  CB  . TRP B 2  194 ? 14.170 162.209 34.639  1.00 310.90 ? 213  TRP B CB  1 
ATOM   5661 C  CG  . TRP B 2  194 ? 13.961 161.123 35.652  1.00 302.30 ? 213  TRP B CG  1 
ATOM   5662 C  CD1 . TRP B 2  194 ? 14.875 160.194 36.058  1.00 291.82 ? 213  TRP B CD1 1 
ATOM   5663 C  CD2 . TRP B 2  194 ? 12.759 160.850 36.386  1.00 299.99 ? 213  TRP B CD2 1 
ATOM   5664 N  NE1 . TRP B 2  194 ? 14.318 159.362 36.999  1.00 284.73 ? 213  TRP B NE1 1 
ATOM   5665 C  CE2 . TRP B 2  194 ? 13.021 159.743 37.217  1.00 289.03 ? 213  TRP B CE2 1 
ATOM   5666 C  CE3 . TRP B 2  194 ? 11.490 161.435 36.419  1.00 306.41 ? 213  TRP B CE3 1 
ATOM   5667 C  CZ2 . TRP B 2  194 ? 12.059 159.209 38.073  1.00 287.89 ? 213  TRP B CZ2 1 
ATOM   5668 C  CZ3 . TRP B 2  194 ? 10.537 160.903 37.270  1.00 302.80 ? 213  TRP B CZ3 1 
ATOM   5669 C  CH2 . TRP B 2  194 ? 10.827 159.801 38.085  1.00 294.69 ? 213  TRP B CH2 1 
ATOM   5670 N  N   . PRO B 2  195 ? 12.054 160.085 33.117  1.00 293.98 ? 214  PRO B N   1 
ATOM   5671 C  CA  . PRO B 2  195 ? 13.052 159.011 33.095  1.00 291.92 ? 214  PRO B CA  1 
ATOM   5672 C  C   . PRO B 2  195 ? 13.410 158.563 31.680  1.00 307.83 ? 214  PRO B C   1 
ATOM   5673 O  O   . PRO B 2  195 ? 13.489 157.362 31.420  1.00 289.23 ? 214  PRO B O   1 
ATOM   5674 C  CB  . PRO B 2  195 ? 12.353 157.887 33.856  1.00 282.09 ? 214  PRO B CB  1 
ATOM   5675 C  CG  . PRO B 2  195 ? 10.914 158.063 33.487  1.00 280.22 ? 214  PRO B CG  1 
ATOM   5676 C  CD  . PRO B 2  195 ? 10.692 159.553 33.305  1.00 284.33 ? 214  PRO B CD  1 
ATOM   5677 N  N   . SER B 2  196 ? 13.622 159.520 30.783  1.00 337.50 ? 215  SER B N   1 
ATOM   5678 C  CA  . SER B 2  196 ? 13.929 159.214 29.391  1.00 361.45 ? 215  SER B CA  1 
ATOM   5679 C  C   . SER B 2  196 ? 15.328 158.648 29.163  1.00 363.55 ? 215  SER B C   1 
ATOM   5680 O  O   . SER B 2  196 ? 15.483 157.543 28.643  1.00 379.43 ? 215  SER B O   1 
ATOM   5681 C  CB  . SER B 2  196 ? 13.795 160.470 28.528  1.00 367.15 ? 215  SER B CB  1 
ATOM   5682 O  OG  . SER B 2  196 ? 14.667 161.492 28.977  1.00 354.22 ? 215  SER B OG  1 
ATOM   5683 N  N   . GLN B 2  197 ? 16.343 159.412 29.556  1.00 355.78 ? 216  GLN B N   1 
ATOM   5684 C  CA  . GLN B 2  197 ? 17.730 159.011 29.347  1.00 353.78 ? 216  GLN B CA  1 
ATOM   5685 C  C   . GLN B 2  197 ? 18.183 158.104 30.489  1.00 339.79 ? 216  GLN B C   1 
ATOM   5686 O  O   . GLN B 2  197 ? 17.385 157.713 31.341  1.00 344.89 ? 216  GLN B O   1 
ATOM   5687 C  CB  . GLN B 2  197 ? 18.655 160.228 29.253  1.00 354.17 ? 216  GLN B CB  1 
ATOM   5688 C  CG  . GLN B 2  197 ? 18.383 161.127 28.057  1.00 364.54 ? 216  GLN B CG  1 
ATOM   5689 C  CD  . GLN B 2  197 ? 19.350 162.293 27.973  1.00 360.37 ? 216  GLN B CD  1 
ATOM   5690 O  OE1 . GLN B 2  197 ? 20.224 162.452 28.825  1.00 352.83 ? 216  GLN B OE1 1 
ATOM   5691 N  NE2 . GLN B 2  197 ? 19.199 163.114 26.941  1.00 368.55 ? 216  GLN B NE2 1 
ATOM   5692 N  N   . THR B 2  198 ? 19.471 157.776 30.494  1.00 331.71 ? 217  THR B N   1 
ATOM   5693 C  CA  . THR B 2  198 ? 20.040 156.903 31.514  1.00 311.32 ? 217  THR B CA  1 
ATOM   5694 C  C   . THR B 2  198 ? 20.781 157.706 32.578  1.00 304.33 ? 217  THR B C   1 
ATOM   5695 O  O   . THR B 2  198 ? 21.825 158.299 32.308  1.00 296.47 ? 217  THR B O   1 
ATOM   5696 C  CB  . THR B 2  198 ? 21.004 155.871 30.896  1.00 293.19 ? 217  THR B CB  1 
ATOM   5697 O  OG1 . THR B 2  198 ? 20.280 155.008 30.011  1.00 296.42 ? 217  THR B OG1 1 
ATOM   5698 C  CG2 . THR B 2  198 ? 21.667 155.038 31.983  1.00 285.61 ? 217  THR B CG2 1 
ATOM   5699 N  N   . VAL B 2  199 ? 20.231 157.722 33.788  1.00 314.33 ? 218  VAL B N   1 
ATOM   5700 C  CA  . VAL B 2  199 ? 20.853 158.422 34.903  1.00 328.92 ? 218  VAL B CA  1 
ATOM   5701 C  C   . VAL B 2  199 ? 21.283 157.415 35.963  1.00 353.88 ? 218  VAL B C   1 
ATOM   5702 O  O   . VAL B 2  199 ? 20.446 156.791 36.616  1.00 348.72 ? 218  VAL B O   1 
ATOM   5703 C  CB  . VAL B 2  199 ? 19.908 159.478 35.499  1.00 314.19 ? 218  VAL B CB  1 
ATOM   5704 C  CG1 . VAL B 2  199 ? 20.585 160.207 36.649  1.00 299.35 ? 218  VAL B CG1 1 
ATOM   5705 C  CG2 . VAL B 2  199 ? 19.467 160.460 34.424  1.00 314.36 ? 218  VAL B CG2 1 
ATOM   5706 N  N   . THR B 2  200 ? 22.592 157.260 36.128  1.00 388.11 ? 219  THR B N   1 
ATOM   5707 C  CA  . THR B 2  200 ? 23.138 156.275 37.054  1.00 401.29 ? 219  THR B CA  1 
ATOM   5708 C  C   . THR B 2  200 ? 24.131 156.908 38.022  1.00 389.41 ? 219  THR B C   1 
ATOM   5709 O  O   . THR B 2  200 ? 25.070 157.584 37.605  1.00 394.35 ? 219  THR B O   1 
ATOM   5710 C  CB  . THR B 2  200 ? 23.836 155.126 36.298  1.00 416.16 ? 219  THR B CB  1 
ATOM   5711 O  OG1 . THR B 2  200 ? 22.898 154.486 35.424  1.00 427.89 ? 219  THR B OG1 1 
ATOM   5712 C  CG2 . THR B 2  200 ? 24.395 154.102 37.274  1.00 419.53 ? 219  THR B CG2 1 
ATOM   5713 N  N   . CYS B 2  201 ? 23.920 156.687 39.317  1.00 332.19 ? 220  CYS B N   1 
ATOM   5714 C  CA  . CYS B 2  201 ? 24.838 157.195 40.329  1.00 285.40 ? 220  CYS B CA  1 
ATOM   5715 C  C   . CYS B 2  201 ? 25.928 156.168 40.620  1.00 255.05 ? 220  CYS B C   1 
ATOM   5716 O  O   . CYS B 2  201 ? 25.661 154.968 40.695  1.00 260.13 ? 220  CYS B O   1 
ATOM   5717 C  CB  . CYS B 2  201 ? 24.090 157.560 41.616  1.00 276.38 ? 220  CYS B CB  1 
ATOM   5718 S  SG  . CYS B 2  201 ? 23.321 156.170 42.485  1.00 280.99 ? 220  CYS B SG  1 
ATOM   5719 N  N   . SER B 2  202 ? 27.158 156.648 40.775  1.00 227.56 ? 221  SER B N   1 
ATOM   5720 C  CA  . SER B 2  202 ? 28.293 155.772 41.040  1.00 203.93 ? 221  SER B CA  1 
ATOM   5721 C  C   . SER B 2  202 ? 28.883 156.043 42.420  1.00 201.08 ? 221  SER B C   1 
ATOM   5722 O  O   . SER B 2  202 ? 29.107 157.194 42.795  1.00 193.32 ? 221  SER B O   1 
ATOM   5723 C  CB  . SER B 2  202 ? 29.367 155.946 39.964  1.00 183.53 ? 221  SER B CB  1 
ATOM   5724 O  OG  . SER B 2  202 ? 30.475 155.096 40.207  1.00 180.52 ? 221  SER B OG  1 
ATOM   5725 N  N   . VAL B 2  203 ? 29.128 154.977 43.175  1.00 203.81 ? 222  VAL B N   1 
ATOM   5726 C  CA  . VAL B 2  203 ? 29.698 155.100 44.510  1.00 185.53 ? 222  VAL B CA  1 
ATOM   5727 C  C   . VAL B 2  203 ? 31.004 154.321 44.601  1.00 200.41 ? 222  VAL B C   1 
ATOM   5728 O  O   . VAL B 2  203 ? 31.009 153.091 44.572  1.00 192.88 ? 222  VAL B O   1 
ATOM   5729 C  CB  . VAL B 2  203 ? 28.707 154.626 45.585  1.00 190.58 ? 222  VAL B CB  1 
ATOM   5730 C  CG1 . VAL B 2  203 ? 29.344 154.703 46.963  1.00 198.58 ? 222  VAL B CG1 1 
ATOM   5731 C  CG2 . VAL B 2  203 ? 27.432 155.453 45.534  1.00 196.80 ? 222  VAL B CG2 1 
ATOM   5732 N  N   . ALA B 2  204 ? 32.112 155.047 44.714  1.00 221.97 ? 223  ALA B N   1 
ATOM   5733 C  CA  . ALA B 2  204 ? 33.429 154.429 44.789  1.00 231.77 ? 223  ALA B CA  1 
ATOM   5734 C  C   . ALA B 2  204 ? 34.014 154.548 46.192  1.00 234.21 ? 223  ALA B C   1 
ATOM   5735 O  O   . ALA B 2  204 ? 33.887 155.585 46.845  1.00 228.72 ? 223  ALA B O   1 
ATOM   5736 C  CB  . ALA B 2  204 ? 34.367 155.056 43.768  1.00 227.19 ? 223  ALA B CB  1 
ATOM   5737 N  N   . HIS B 2  205 ? 34.656 153.477 46.645  1.00 229.49 ? 224  HIS B N   1 
ATOM   5738 C  CA  . HIS B 2  205 ? 35.285 153.450 47.959  1.00 205.75 ? 224  HIS B CA  1 
ATOM   5739 C  C   . HIS B 2  205 ? 36.734 152.993 47.822  1.00 213.86 ? 224  HIS B C   1 
ATOM   5740 O  O   . HIS B 2  205 ? 37.007 151.793 47.765  1.00 202.92 ? 224  HIS B O   1 
ATOM   5741 C  CB  . HIS B 2  205 ? 34.514 152.529 48.906  1.00 191.31 ? 224  HIS B CB  1 
ATOM   5742 C  CG  . HIS B 2  205 ? 34.762 152.802 50.356  1.00 204.79 ? 224  HIS B CG  1 
ATOM   5743 N  ND1 . HIS B 2  205 ? 35.773 152.192 51.068  1.00 226.27 ? 224  HIS B ND1 1 
ATOM   5744 C  CD2 . HIS B 2  205 ? 34.124 153.614 51.232  1.00 181.51 ? 224  HIS B CD2 1 
ATOM   5745 C  CE1 . HIS B 2  205 ? 35.750 152.620 52.317  1.00 202.45 ? 224  HIS B CE1 1 
ATOM   5746 N  NE2 . HIS B 2  205 ? 34.759 153.484 52.443  1.00 172.18 ? 224  HIS B NE2 1 
ATOM   5747 N  N   . PRO B 2  206 ? 37.667 153.956 47.759  1.00 221.66 ? 225  PRO B N   1 
ATOM   5748 C  CA  . PRO B 2  206 ? 39.093 153.689 47.535  1.00 226.64 ? 225  PRO B CA  1 
ATOM   5749 C  C   . PRO B 2  206 ? 39.753 152.907 48.668  1.00 222.39 ? 225  PRO B C   1 
ATOM   5750 O  O   . PRO B 2  206 ? 40.708 152.169 48.424  1.00 250.04 ? 225  PRO B O   1 
ATOM   5751 C  CB  . PRO B 2  206 ? 39.698 155.093 47.426  1.00 224.11 ? 225  PRO B CB  1 
ATOM   5752 C  CG  . PRO B 2  206 ? 38.757 155.968 48.176  1.00 221.50 ? 225  PRO B CG  1 
ATOM   5753 C  CD  . PRO B 2  206 ? 37.397 155.395 47.918  1.00 226.49 ? 225  PRO B CD  1 
ATOM   5754 N  N   . ALA B 2  207 ? 39.251 153.071 49.887  1.00 177.63 ? 226  ALA B N   1 
ATOM   5755 C  CA  . ALA B 2  207 ? 39.802 152.363 51.037  1.00 209.47 ? 226  ALA B CA  1 
ATOM   5756 C  C   . ALA B 2  207 ? 39.536 150.866 50.924  1.00 204.29 ? 226  ALA B C   1 
ATOM   5757 O  O   . ALA B 2  207 ? 40.396 150.046 51.248  1.00 199.99 ? 226  ALA B O   1 
ATOM   5758 C  CB  . ALA B 2  207 ? 39.221 152.911 52.326  1.00 224.79 ? 226  ALA B CB  1 
ATOM   5759 N  N   . SER B 2  208 ? 38.339 150.519 50.464  1.00 203.52 ? 227  SER B N   1 
ATOM   5760 C  CA  . SER B 2  208 ? 37.977 149.125 50.242  1.00 208.86 ? 227  SER B CA  1 
ATOM   5761 C  C   . SER B 2  208 ? 38.063 148.790 48.757  1.00 204.80 ? 227  SER B C   1 
ATOM   5762 O  O   . SER B 2  208 ? 37.912 147.633 48.363  1.00 203.57 ? 227  SER B O   1 
ATOM   5763 C  CB  . SER B 2  208 ? 36.571 148.840 50.772  1.00 208.63 ? 227  SER B CB  1 
ATOM   5764 O  OG  . SER B 2  208 ? 35.607 149.653 50.125  1.00 208.24 ? 227  SER B OG  1 
ATOM   5765 N  N   . SER B 2  209 ? 38.308 149.819 47.947  1.00 212.01 ? 228  SER B N   1 
ATOM   5766 C  CA  . SER B 2  209 ? 38.418 149.688 46.495  1.00 244.54 ? 228  SER B CA  1 
ATOM   5767 C  C   . SER B 2  209 ? 37.182 149.027 45.889  1.00 247.89 ? 228  SER B C   1 
ATOM   5768 O  O   . SER B 2  209 ? 37.294 148.127 45.057  1.00 245.12 ? 228  SER B O   1 
ATOM   5769 C  CB  . SER B 2  209 ? 39.675 148.898 46.119  1.00 261.70 ? 228  SER B CB  1 
ATOM   5770 O  OG  . SER B 2  209 ? 40.844 149.545 46.591  1.00 264.48 ? 228  SER B OG  1 
ATOM   5771 N  N   . THR B 2  210 ? 36.006 149.479 46.312  1.00 249.20 ? 229  THR B N   1 
ATOM   5772 C  CA  . THR B 2  210 ? 34.752 148.917 45.823  1.00 243.03 ? 229  THR B CA  1 
ATOM   5773 C  C   . THR B 2  210 ? 33.919 149.970 45.099  1.00 231.14 ? 229  THR B C   1 
ATOM   5774 O  O   . THR B 2  210 ? 33.535 150.982 45.684  1.00 227.03 ? 229  THR B O   1 
ATOM   5775 C  CB  . THR B 2  210 ? 33.919 148.317 46.971  1.00 244.87 ? 229  THR B CB  1 
ATOM   5776 O  OG1 . THR B 2  210 ? 33.650 149.328 47.950  1.00 236.76 ? 229  THR B OG1 1 
ATOM   5777 C  CG2 . THR B 2  210 ? 34.667 147.167 47.628  1.00 250.30 ? 229  THR B CG2 1 
ATOM   5778 N  N   . THR B 2  211 ? 33.642 149.723 43.822  1.00 224.61 ? 230  THR B N   1 
ATOM   5779 C  CA  . THR B 2  211 ? 32.849 150.646 43.018  1.00 217.94 ? 230  THR B CA  1 
ATOM   5780 C  C   . THR B 2  211 ? 31.492 150.040 42.670  1.00 221.19 ? 230  THR B C   1 
ATOM   5781 O  O   . THR B 2  211 ? 31.401 149.133 41.842  1.00 222.82 ? 230  THR B O   1 
ATOM   5782 C  CB  . THR B 2  211 ? 33.579 151.037 41.718  1.00 232.36 ? 230  THR B CB  1 
ATOM   5783 O  OG1 . THR B 2  211 ? 34.839 151.641 42.038  1.00 243.39 ? 230  THR B OG1 1 
ATOM   5784 C  CG2 . THR B 2  211 ? 32.742 152.018 40.911  1.00 226.41 ? 230  THR B CG2 1 
ATOM   5785 N  N   . VAL B 2  212 ? 30.442 150.546 43.308  1.00 230.49 ? 231  VAL B N   1 
ATOM   5786 C  CA  . VAL B 2  212 ? 29.088 150.064 43.065  1.00 225.10 ? 231  VAL B CA  1 
ATOM   5787 C  C   . VAL B 2  212 ? 28.269 151.135 42.354  1.00 221.42 ? 231  VAL B C   1 
ATOM   5788 O  O   . VAL B 2  212 ? 28.153 152.263 42.833  1.00 193.11 ? 231  VAL B O   1 
ATOM   5789 C  CB  . VAL B 2  212 ? 28.405 149.637 44.376  1.00 186.86 ? 231  VAL B CB  1 
ATOM   5790 C  CG1 . VAL B 2  212 ? 26.977 149.185 44.109  1.00 182.27 ? 231  VAL B CG1 1 
ATOM   5791 C  CG2 . VAL B 2  212 ? 29.202 148.533 45.054  1.00 183.87 ? 231  VAL B CG2 1 
ATOM   5792 N  N   . ASP B 2  213 ? 27.702 150.774 41.207  1.00 237.87 ? 232  ASP B N   1 
ATOM   5793 C  CA  . ASP B 2  213 ? 26.902 151.705 40.420  1.00 242.52 ? 232  ASP B CA  1 
ATOM   5794 C  C   . ASP B 2  213 ? 25.429 151.309 40.438  1.00 271.22 ? 232  ASP B C   1 
ATOM   5795 O  O   . ASP B 2  213 ? 25.088 150.147 40.218  1.00 273.48 ? 232  ASP B O   1 
ATOM   5796 C  CB  . ASP B 2  213 ? 27.413 151.766 38.980  1.00 241.54 ? 232  ASP B CB  1 
ATOM   5797 C  CG  . ASP B 2  213 ? 28.898 152.057 38.901  1.00 247.69 ? 232  ASP B CG  1 
ATOM   5798 O  OD1 . ASP B 2  213 ? 29.432 152.686 39.838  1.00 245.43 ? 232  ASP B OD1 1 
ATOM   5799 O  OD2 . ASP B 2  213 ? 29.532 151.658 37.901  1.00 249.67 ? 232  ASP B OD2 1 
ATOM   5800 N  N   . LYS B 2  214 ? 24.560 152.280 40.700  1.00 297.93 ? 233  LYS B N   1 
ATOM   5801 C  CA  . LYS B 2  214 ? 23.125 152.028 40.745  1.00 315.42 ? 233  LYS B CA  1 
ATOM   5802 C  C   . LYS B 2  214 ? 22.357 153.027 39.885  1.00 317.70 ? 233  LYS B C   1 
ATOM   5803 O  O   . LYS B 2  214 ? 22.518 154.240 40.030  1.00 307.52 ? 233  LYS B O   1 
ATOM   5804 C  CB  . LYS B 2  214 ? 22.616 152.078 42.188  1.00 309.05 ? 233  LYS B CB  1 
ATOM   5805 C  CG  . LYS B 2  214 ? 23.184 150.993 43.090  1.00 305.44 ? 233  LYS B CG  1 
ATOM   5806 C  CD  . LYS B 2  214 ? 22.796 149.607 42.603  1.00 314.22 ? 233  LYS B CD  1 
ATOM   5807 C  CE  . LYS B 2  214 ? 23.372 148.526 43.503  1.00 318.25 ? 233  LYS B CE  1 
ATOM   5808 N  NZ  . LYS B 2  214 ? 22.982 147.162 43.050  1.00 332.71 ? 233  LYS B NZ  1 
ATOM   5809 N  N   . LYS B 2  215 ? 21.527 152.509 38.986  1.00 324.49 ? 234  LYS B N   1 
ATOM   5810 C  CA  . LYS B 2  215 ? 20.696 153.351 38.134  1.00 307.95 ? 234  LYS B CA  1 
ATOM   5811 C  C   . LYS B 2  215 ? 19.352 153.613 38.806  1.00 286.31 ? 234  LYS B C   1 
ATOM   5812 O  O   . LYS B 2  215 ? 18.790 152.730 39.453  1.00 295.03 ? 234  LYS B O   1 
ATOM   5813 C  CB  . LYS B 2  215 ? 20.489 152.702 36.763  1.00 314.55 ? 234  LYS B CB  1 
ATOM   5814 C  CG  . LYS B 2  215 ? 19.677 153.545 35.792  1.00 319.45 ? 234  LYS B CG  1 
ATOM   5815 C  CD  . LYS B 2  215 ? 19.506 152.849 34.452  1.00 331.00 ? 234  LYS B CD  1 
ATOM   5816 C  CE  . LYS B 2  215 ? 18.645 153.677 33.511  1.00 330.44 ? 234  LYS B CE  1 
ATOM   5817 N  NZ  . LYS B 2  215 ? 18.494 153.028 32.179  1.00 332.10 ? 234  LYS B NZ  1 
ATOM   5818 N  N   . LEU B 2  216 ? 18.843 154.831 38.651  1.00 252.33 ? 235  LEU B N   1 
ATOM   5819 C  CA  . LEU B 2  216 ? 17.583 155.212 39.275  1.00 230.62 ? 235  LEU B CA  1 
ATOM   5820 C  C   . LEU B 2  216 ? 16.390 154.729 38.457  1.00 256.30 ? 235  LEU B C   1 
ATOM   5821 O  O   . LEU B 2  216 ? 16.357 154.886 37.237  1.00 247.73 ? 235  LEU B O   1 
ATOM   5822 C  CB  . LEU B 2  216 ? 17.512 156.728 39.452  1.00 198.98 ? 235  LEU B CB  1 
ATOM   5823 C  CG  . LEU B 2  216 ? 16.602 157.197 40.586  1.00 188.39 ? 235  LEU B CG  1 
ATOM   5824 C  CD1 . LEU B 2  216 ? 17.316 157.060 41.923  1.00 180.10 ? 235  LEU B CD1 1 
ATOM   5825 C  CD2 . LEU B 2  216 ? 16.138 158.621 40.358  1.00 186.36 ? 235  LEU B CD2 1 
ATOM   5826 N  N   . GLU B 2  217 ? 15.412 154.140 39.138  1.00 282.63 ? 236  GLU B N   1 
ATOM   5827 C  CA  . GLU B 2  217 ? 14.203 153.654 38.482  1.00 312.44 ? 236  GLU B CA  1 
ATOM   5828 C  C   . GLU B 2  217 ? 12.956 154.062 39.262  1.00 312.09 ? 236  GLU B C   1 
ATOM   5829 O  O   . GLU B 2  217 ? 12.835 153.757 40.449  1.00 300.82 ? 236  GLU B O   1 
ATOM   5830 C  CB  . GLU B 2  217 ? 14.247 152.131 38.324  1.00 331.69 ? 236  GLU B CB  1 
ATOM   5831 C  CG  . GLU B 2  217 ? 15.386 151.622 37.452  1.00 338.70 ? 236  GLU B CG  1 
ATOM   5832 C  CD  . GLU B 2  217 ? 15.266 152.071 36.007  1.00 349.79 ? 236  GLU B CD  1 
ATOM   5833 O  OE1 . GLU B 2  217 ? 14.129 152.301 35.544  1.00 355.75 ? 236  GLU B OE1 1 
ATOM   5834 O  OE2 . GLU B 2  217 ? 16.311 152.194 35.335  1.00 353.53 ? 236  GLU B OE2 1 
ATOM   5835 N  N   . PRO B 2  218 ? 12.022 154.754 38.592  1.00 312.03 ? 237  PRO B N   1 
ATOM   5836 C  CA  . PRO B 2  218 ? 10.779 155.210 39.223  1.00 302.59 ? 237  PRO B CA  1 
ATOM   5837 C  C   . PRO B 2  218 ? 9.836  154.060 39.564  1.00 295.81 ? 237  PRO B C   1 
ATOM   5838 O  O   . PRO B 2  218 ? 9.231  154.083 40.635  1.00 279.21 ? 237  PRO B O   1 
ATOM   5839 C  CB  . PRO B 2  218 ? 10.163 156.121 38.158  1.00 308.34 ? 237  PRO B CB  1 
ATOM   5840 C  CG  . PRO B 2  218 ? 10.695 155.597 36.871  1.00 319.71 ? 237  PRO B CG  1 
ATOM   5841 C  CD  . PRO B 2  218 ? 12.093 155.138 37.172  1.00 319.02 ? 237  PRO B CD  1 
ATOM   5842 N  N   . ASP C 3  1   ? 58.708 181.189 69.067  1.00 185.27 ? 21   ASP C N   1 
ATOM   5843 C  CA  . ASP C 3  1   ? 57.992 181.098 67.800  1.00 159.33 ? 21   ASP C CA  1 
ATOM   5844 C  C   . ASP C 3  1   ? 57.067 182.294 67.602  1.00 132.82 ? 21   ASP C C   1 
ATOM   5845 O  O   . ASP C 3  1   ? 57.059 183.226 68.405  1.00 142.27 ? 21   ASP C O   1 
ATOM   5846 C  CB  . ASP C 3  1   ? 57.194 179.795 67.728  1.00 168.59 ? 21   ASP C CB  1 
ATOM   5847 C  CG  . ASP C 3  1   ? 58.084 178.570 67.682  1.00 166.84 ? 21   ASP C CG  1 
ATOM   5848 O  OD1 . ASP C 3  1   ? 59.235 178.651 68.160  1.00 165.47 ? 21   ASP C OD1 1 
ATOM   5849 O  OD2 . ASP C 3  1   ? 57.633 177.525 67.167  1.00 147.39 ? 21   ASP C OD2 1 
ATOM   5850 N  N   . ILE C 3  2   ? 56.287 182.259 66.526  1.00 209.22 ? 22   ILE C N   1 
ATOM   5851 C  CA  . ILE C 3  2   ? 55.408 183.367 66.178  1.00 160.76 ? 22   ILE C CA  1 
ATOM   5852 C  C   . ILE C 3  2   ? 53.954 182.909 66.166  1.00 155.32 ? 22   ILE C C   1 
ATOM   5853 O  O   . ILE C 3  2   ? 53.638 181.830 65.667  1.00 144.18 ? 22   ILE C O   1 
ATOM   5854 C  CB  . ILE C 3  2   ? 55.807 183.975 64.820  1.00 106.23 ? 22   ILE C CB  1 
ATOM   5855 C  CG1 . ILE C 3  2   ? 57.278 184.395 64.840  1.00 143.41 ? 22   ILE C CG1 1 
ATOM   5856 C  CG2 . ILE C 3  2   ? 54.919 185.159 64.475  1.00 102.93 ? 22   ILE C CG2 1 
ATOM   5857 C  CD1 . ILE C 3  2   ? 57.625 185.353 65.958  1.00 135.73 ? 22   ILE C CD1 1 
ATOM   5858 N  N   . VAL C 3  3   ? 53.071 183.732 66.722  1.00 154.82 ? 23   VAL C N   1 
ATOM   5859 C  CA  . VAL C 3  3   ? 51.652 183.407 66.775  1.00 153.69 ? 23   VAL C CA  1 
ATOM   5860 C  C   . VAL C 3  3   ? 50.842 184.391 65.940  1.00 161.71 ? 23   VAL C C   1 
ATOM   5861 O  O   . VAL C 3  3   ? 50.738 185.569 66.279  1.00 151.91 ? 23   VAL C O   1 
ATOM   5862 C  CB  . VAL C 3  3   ? 51.142 183.383 68.225  1.00 164.36 ? 23   VAL C CB  1 
ATOM   5863 C  CG1 . VAL C 3  3   ? 49.651 183.088 68.257  1.00 173.96 ? 23   VAL C CG1 1 
ATOM   5864 C  CG2 . VAL C 3  3   ? 51.913 182.357 69.041  1.00 166.06 ? 23   VAL C CG2 1 
ATOM   5865 N  N   . MET C 3  4   ? 50.269 183.899 64.847  1.00 161.43 ? 24   MET C N   1 
ATOM   5866 C  CA  . MET C 3  4   ? 49.413 184.717 63.995  1.00 141.42 ? 24   MET C CA  1 
ATOM   5867 C  C   . MET C 3  4   ? 47.961 184.596 64.445  1.00 170.95 ? 24   MET C C   1 
ATOM   5868 O  O   . MET C 3  4   ? 47.338 183.547 64.288  1.00 130.66 ? 24   MET C O   1 
ATOM   5869 C  CB  . MET C 3  4   ? 49.555 184.305 62.530  1.00 111.92 ? 24   MET C CB  1 
ATOM   5870 C  CG  . MET C 3  4   ? 50.992 184.272 62.036  1.00 125.10 ? 24   MET C CG  1 
ATOM   5871 S  SD  . MET C 3  4   ? 51.816 185.869 62.177  1.00 141.21 ? 24   MET C SD  1 
ATOM   5872 C  CE  . MET C 3  4   ? 50.884 186.840 60.998  1.00 122.23 ? 24   MET C CE  1 
ATOM   5873 N  N   . THR C 3  5   ? 47.427 185.677 65.005  1.00 179.23 ? 25   THR C N   1 
ATOM   5874 C  CA  . THR C 3  5   ? 46.093 185.655 65.592  1.00 160.78 ? 25   THR C CA  1 
ATOM   5875 C  C   . THR C 3  5   ? 45.041 186.288 64.685  1.00 150.32 ? 25   THR C C   1 
ATOM   5876 O  O   . THR C 3  5   ? 45.148 187.456 64.314  1.00 151.12 ? 25   THR C O   1 
ATOM   5877 C  CB  . THR C 3  5   ? 46.071 186.383 66.951  1.00 161.60 ? 25   THR C CB  1 
ATOM   5878 O  OG1 . THR C 3  5   ? 47.029 185.783 67.832  1.00 167.57 ? 25   THR C OG1 1 
ATOM   5879 C  CG2 . THR C 3  5   ? 44.689 186.300 67.580  1.00 187.55 ? 25   THR C CG2 1 
ATOM   5880 N  N   . GLN C 3  6   ? 44.026 185.505 64.333  1.00 148.70 ? 26   GLN C N   1 
ATOM   5881 C  CA  . GLN C 3  6   ? 42.879 186.018 63.595  1.00 158.36 ? 26   GLN C CA  1 
ATOM   5882 C  C   . GLN C 3  6   ? 41.662 186.064 64.512  1.00 223.00 ? 26   GLN C C   1 
ATOM   5883 O  O   . GLN C 3  6   ? 41.083 185.029 64.842  1.00 233.77 ? 26   GLN C O   1 
ATOM   5884 C  CB  . GLN C 3  6   ? 42.588 185.157 62.364  1.00 157.31 ? 26   GLN C CB  1 
ATOM   5885 C  CG  . GLN C 3  6   ? 43.738 185.076 61.374  1.00 168.42 ? 26   GLN C CG  1 
ATOM   5886 C  CD  . GLN C 3  6   ? 43.356 184.351 60.098  1.00 153.99 ? 26   GLN C CD  1 
ATOM   5887 O  OE1 . GLN C 3  6   ? 44.192 183.712 59.460  1.00 122.84 ? 26   GLN C OE1 1 
ATOM   5888 N  NE2 . GLN C 3  6   ? 42.088 184.452 59.718  1.00 164.02 ? 26   GLN C NE2 1 
ATOM   5889 N  N   . SER C 3  7   ? 41.283 187.270 64.922  1.00 258.69 ? 27   SER C N   1 
ATOM   5890 C  CA  . SER C 3  7   ? 40.201 187.457 65.883  1.00 272.01 ? 27   SER C CA  1 
ATOM   5891 C  C   . SER C 3  7   ? 38.855 186.986 65.340  1.00 277.02 ? 27   SER C C   1 
ATOM   5892 O  O   . SER C 3  7   ? 38.113 186.283 66.025  1.00 295.99 ? 27   SER C O   1 
ATOM   5893 C  CB  . SER C 3  7   ? 40.108 188.928 66.295  1.00 286.73 ? 27   SER C CB  1 
ATOM   5894 O  OG  . SER C 3  7   ? 39.888 189.760 65.170  1.00 291.24 ? 27   SER C OG  1 
ATOM   5895 N  N   . HIS C 3  8   ? 38.545 187.376 64.108  1.00 230.51 ? 28   HIS C N   1 
ATOM   5896 C  CA  . HIS C 3  8   ? 37.265 187.031 63.500  1.00 197.82 ? 28   HIS C CA  1 
ATOM   5897 C  C   . HIS C 3  8   ? 37.325 185.684 62.789  1.00 178.75 ? 28   HIS C C   1 
ATOM   5898 O  O   . HIS C 3  8   ? 37.903 185.565 61.708  1.00 180.66 ? 28   HIS C O   1 
ATOM   5899 C  CB  . HIS C 3  8   ? 36.830 188.123 62.520  1.00 193.34 ? 28   HIS C CB  1 
ATOM   5900 C  CG  . HIS C 3  8   ? 36.639 189.463 63.158  1.00 205.67 ? 28   HIS C CG  1 
ATOM   5901 N  ND1 . HIS C 3  8   ? 35.467 189.828 63.786  1.00 216.06 ? 28   HIS C ND1 1 
ATOM   5902 C  CD2 . HIS C 3  8   ? 37.470 190.526 63.267  1.00 204.33 ? 28   HIS C CD2 1 
ATOM   5903 C  CE1 . HIS C 3  8   ? 35.585 191.058 64.254  1.00 227.16 ? 28   HIS C CE1 1 
ATOM   5904 N  NE2 . HIS C 3  8   ? 36.791 191.504 63.952  1.00 223.79 ? 28   HIS C NE2 1 
ATOM   5905 N  N   . LYS C 3  9   ? 36.721 184.671 63.403  1.00 193.35 ? 29   LYS C N   1 
ATOM   5906 C  CA  . LYS C 3  9   ? 36.673 183.336 62.819  1.00 187.92 ? 29   LYS C CA  1 
ATOM   5907 C  C   . LYS C 3  9   ? 35.701 183.298 61.645  1.00 188.20 ? 29   LYS C C   1 
ATOM   5908 O  O   . LYS C 3  9   ? 35.882 182.530 60.700  1.00 192.13 ? 29   LYS C O   1 
ATOM   5909 C  CB  . LYS C 3  9   ? 36.271 182.302 63.873  1.00 192.06 ? 29   LYS C CB  1 
ATOM   5910 C  CG  . LYS C 3  9   ? 37.189 182.257 65.085  1.00 193.65 ? 29   LYS C CG  1 
ATOM   5911 C  CD  . LYS C 3  9   ? 38.594 181.822 64.703  1.00 199.23 ? 29   LYS C CD  1 
ATOM   5912 C  CE  . LYS C 3  9   ? 38.601 180.409 64.143  1.00 209.43 ? 29   LYS C CE  1 
ATOM   5913 N  NZ  . LYS C 3  9   ? 39.975 179.961 63.785  1.00 210.22 ? 29   LYS C NZ  1 
ATOM   5914 N  N   . PHE C 3  10  ? 34.669 184.132 61.715  1.00 184.71 ? 30   PHE C N   1 
ATOM   5915 C  CA  . PHE C 3  10  ? 33.663 184.204 60.661  1.00 189.53 ? 30   PHE C CA  1 
ATOM   5916 C  C   . PHE C 3  10  ? 33.349 185.654 60.305  1.00 191.63 ? 30   PHE C C   1 
ATOM   5917 O  O   . PHE C 3  10  ? 33.294 186.518 61.180  1.00 221.19 ? 30   PHE C O   1 
ATOM   5918 C  CB  . PHE C 3  10  ? 32.379 183.485 61.089  1.00 198.40 ? 30   PHE C CB  1 
ATOM   5919 C  CG  . PHE C 3  10  ? 32.573 182.029 61.408  1.00 194.95 ? 30   PHE C CG  1 
ATOM   5920 C  CD1 . PHE C 3  10  ? 32.452 181.066 60.420  1.00 195.91 ? 30   PHE C CD1 1 
ATOM   5921 C  CD2 . PHE C 3  10  ? 32.867 181.622 62.700  1.00 206.03 ? 30   PHE C CD2 1 
ATOM   5922 C  CE1 . PHE C 3  10  ? 32.627 179.726 60.711  1.00 194.88 ? 30   PHE C CE1 1 
ATOM   5923 C  CE2 . PHE C 3  10  ? 33.043 180.283 62.997  1.00 203.20 ? 30   PHE C CE2 1 
ATOM   5924 C  CZ  . PHE C 3  10  ? 32.922 179.334 62.002  1.00 194.32 ? 30   PHE C CZ  1 
ATOM   5925 N  N   . MET C 3  11  ? 33.146 185.916 59.018  1.00 184.95 ? 31   MET C N   1 
ATOM   5926 C  CA  . MET C 3  11  ? 32.753 187.244 58.560  1.00 190.44 ? 31   MET C CA  1 
ATOM   5927 C  C   . MET C 3  11  ? 31.659 187.155 57.502  1.00 203.01 ? 31   MET C C   1 
ATOM   5928 O  O   . MET C 3  11  ? 31.714 186.313 56.606  1.00 187.07 ? 31   MET C O   1 
ATOM   5929 C  CB  . MET C 3  11  ? 33.956 188.010 58.005  1.00 181.41 ? 31   MET C CB  1 
ATOM   5930 C  CG  . MET C 3  11  ? 34.915 188.519 59.067  1.00 194.02 ? 31   MET C CG  1 
ATOM   5931 S  SD  . MET C 3  11  ? 36.087 189.719 58.409  1.00 200.85 ? 31   MET C SD  1 
ATOM   5932 C  CE  . MET C 3  11  ? 34.970 190.985 57.810  1.00 189.60 ? 31   MET C CE  1 
ATOM   5933 N  N   . SER C 3  12  ? 30.667 188.031 57.614  1.00 222.05 ? 32   SER C N   1 
ATOM   5934 C  CA  . SER C 3  12  ? 29.544 188.041 56.685  1.00 208.60 ? 32   SER C CA  1 
ATOM   5935 C  C   . SER C 3  12  ? 29.614 189.240 55.745  1.00 212.67 ? 32   SER C C   1 
ATOM   5936 O  O   . SER C 3  12  ? 29.963 190.346 56.157  1.00 238.09 ? 32   SER C O   1 
ATOM   5937 C  CB  . SER C 3  12  ? 28.218 188.051 57.448  1.00 228.12 ? 32   SER C CB  1 
ATOM   5938 O  OG  . SER C 3  12  ? 28.104 186.915 58.287  1.00 228.85 ? 32   SER C OG  1 
ATOM   5939 N  N   . THR C 3  13  ? 29.280 189.010 54.480  1.00 225.06 ? 33   THR C N   1 
ATOM   5940 C  CA  . THR C 3  13  ? 29.273 190.071 53.481  1.00 233.30 ? 33   THR C CA  1 
ATOM   5941 C  C   . THR C 3  13  ? 28.319 189.723 52.346  1.00 247.26 ? 33   THR C C   1 
ATOM   5942 O  O   . THR C 3  13  ? 27.903 188.574 52.205  1.00 242.97 ? 33   THR C O   1 
ATOM   5943 C  CB  . THR C 3  13  ? 30.680 190.321 52.906  1.00 220.92 ? 33   THR C CB  1 
ATOM   5944 O  OG1 . THR C 3  13  ? 30.641 191.437 52.009  1.00 223.57 ? 33   THR C OG1 1 
ATOM   5945 C  CG2 . THR C 3  13  ? 31.174 189.094 52.157  1.00 220.67 ? 33   THR C CG2 1 
ATOM   5946 N  N   . SER C 3  14  ? 27.971 190.719 51.538  1.00 266.87 ? 34   SER C N   1 
ATOM   5947 C  CA  . SER C 3  14  ? 27.066 190.505 50.417  1.00 277.35 ? 34   SER C CA  1 
ATOM   5948 C  C   . SER C 3  14  ? 27.818 190.551 49.091  1.00 291.52 ? 34   SER C C   1 
ATOM   5949 O  O   . SER C 3  14  ? 28.969 190.984 49.035  1.00 287.72 ? 34   SER C O   1 
ATOM   5950 C  CB  . SER C 3  14  ? 25.944 191.546 50.427  1.00 294.32 ? 34   SER C CB  1 
ATOM   5951 O  OG  . SER C 3  14  ? 25.188 191.468 51.623  1.00 276.93 ? 34   SER C OG  1 
ATOM   5952 N  N   . VAL C 3  15  ? 27.157 190.089 48.048  1.00 288.56 ? 35   VAL C N   1 
ATOM   5953 C  CA  . VAL C 3  15  ? 27.787 190.154 46.775  1.00 273.36 ? 35   VAL C CA  1 
ATOM   5954 C  C   . VAL C 3  15  ? 27.995 191.628 46.609  1.00 275.56 ? 35   VAL C C   1 
ATOM   5955 O  O   . VAL C 3  15  ? 27.127 192.429 46.904  1.00 300.19 ? 35   VAL C O   1 
ATOM   5956 C  CB  . VAL C 3  15  ? 26.866 189.672 45.659  1.00 275.81 ? 35   VAL C CB  1 
ATOM   5957 C  CG1 . VAL C 3  15  ? 27.465 190.022 44.309  1.00 275.27 ? 35   VAL C CG1 1 
ATOM   5958 C  CG2 . VAL C 3  15  ? 26.626 188.179 45.780  1.00 271.41 ? 35   VAL C CG2 1 
ATOM   5959 N  N   . GLY C 3  16  ? 29.178 191.977 46.163  1.00 234.55 ? 36   GLY C N   1 
ATOM   5960 C  CA  . GLY C 3  16  ? 29.478 193.316 45.690  1.00 238.87 ? 36   GLY C CA  1 
ATOM   5961 C  C   . GLY C 3  16  ? 29.941 194.258 46.785  1.00 238.01 ? 36   GLY C C   1 
ATOM   5962 O  O   . GLY C 3  16  ? 30.344 195.389 46.512  1.00 240.63 ? 36   GLY C O   1 
ATOM   5963 N  N   . ASP C 3  17  ? 29.884 193.791 48.028  1.00 234.74 ? 37   ASP C N   1 
ATOM   5964 C  CA  . ASP C 3  17  ? 30.295 194.600 49.170  1.00 234.18 ? 37   ASP C CA  1 
ATOM   5965 C  C   . ASP C 3  17  ? 31.807 194.570 49.360  1.00 245.98 ? 37   ASP C C   1 
ATOM   5966 O  O   . ASP C 3  17  ? 32.484 193.652 48.900  1.00 213.11 ? 37   ASP C O   1 
ATOM   5967 C  CB  . ASP C 3  17  ? 29.601 194.120 50.446  1.00 236.30 ? 37   ASP C CB  1 
ATOM   5968 C  CG  . ASP C 3  17  ? 28.096 194.285 50.390  1.00 249.41 ? 37   ASP C CG  1 
ATOM   5969 O  OD1 . ASP C 3  17  ? 27.534 194.241 49.276  1.00 266.48 ? 37   ASP C OD1 1 
ATOM   5970 O  OD2 . ASP C 3  17  ? 27.476 194.458 51.460  1.00 254.58 ? 37   ASP C OD2 1 
ATOM   5971 N  N   . ARG C 3  18  ? 32.327 195.584 50.044  1.00 248.98 ? 38   ARG C N   1 
ATOM   5972 C  CA  . ARG C 3  18  ? 33.752 195.665 50.340  1.00 237.08 ? 38   ARG C CA  1 
ATOM   5973 C  C   . ARG C 3  18  ? 34.063 194.953 51.652  1.00 229.02 ? 38   ARG C C   1 
ATOM   5974 O  O   . ARG C 3  18  ? 33.590 195.359 52.713  1.00 242.02 ? 38   ARG C O   1 
ATOM   5975 C  CB  . ARG C 3  18  ? 34.201 197.125 50.408  1.00 256.83 ? 38   ARG C CB  1 
ATOM   5976 C  CG  . ARG C 3  18  ? 35.663 197.315 50.770  1.00 247.63 ? 38   ARG C CG  1 
ATOM   5977 C  CD  . ARG C 3  18  ? 36.001 198.790 50.902  1.00 259.46 ? 38   ARG C CD  1 
ATOM   5978 N  NE  . ARG C 3  18  ? 37.402 199.006 51.249  1.00 257.56 ? 38   ARG C NE  1 
ATOM   5979 C  CZ  . ARG C 3  18  ? 38.374 199.178 50.359  1.00 261.20 ? 38   ARG C CZ  1 
ATOM   5980 N  NH1 . ARG C 3  18  ? 38.098 199.160 49.062  1.00 266.66 ? 38   ARG C NH1 1 
ATOM   5981 N  NH2 . ARG C 3  18  ? 39.622 199.368 50.765  1.00 259.23 ? 38   ARG C NH2 1 
ATOM   5982 N  N   . VAL C 3  19  ? 34.859 193.890 51.577  1.00 213.93 ? 39   VAL C N   1 
ATOM   5983 C  CA  . VAL C 3  19  ? 35.175 193.101 52.762  1.00 198.06 ? 39   VAL C CA  1 
ATOM   5984 C  C   . VAL C 3  19  ? 36.677 193.141 53.041  1.00 194.90 ? 39   VAL C C   1 
ATOM   5985 O  O   . VAL C 3  19  ? 37.488 193.203 52.118  1.00 200.06 ? 39   VAL C O   1 
ATOM   5986 C  CB  . VAL C 3  19  ? 34.667 191.646 52.609  1.00 187.15 ? 39   VAL C CB  1 
ATOM   5987 C  CG1 . VAL C 3  19  ? 35.406 190.926 51.490  1.00 179.58 ? 39   VAL C CG1 1 
ATOM   5988 C  CG2 . VAL C 3  19  ? 34.787 190.885 53.924  1.00 199.84 ? 39   VAL C CG2 1 
ATOM   5989 N  N   . SER C 3  20  ? 37.042 193.127 54.320  1.00 195.37 ? 40   SER C N   1 
ATOM   5990 C  CA  . SER C 3  20  ? 38.447 193.144 54.717  1.00 170.31 ? 40   SER C CA  1 
ATOM   5991 C  C   . SER C 3  20  ? 38.685 192.266 55.941  1.00 180.96 ? 40   SER C C   1 
ATOM   5992 O  O   . SER C 3  20  ? 37.922 192.307 56.906  1.00 195.33 ? 40   SER C O   1 
ATOM   5993 C  CB  . SER C 3  20  ? 38.907 194.576 55.000  1.00 174.07 ? 40   SER C CB  1 
ATOM   5994 O  OG  . SER C 3  20  ? 38.814 195.382 53.839  1.00 178.41 ? 40   SER C OG  1 
ATOM   5995 N  N   . ILE C 3  21  ? 39.751 191.473 55.894  1.00 156.86 ? 41   ILE C N   1 
ATOM   5996 C  CA  . ILE C 3  21  ? 40.101 190.583 56.994  1.00 152.44 ? 41   ILE C CA  1 
ATOM   5997 C  C   . ILE C 3  21  ? 41.385 191.070 57.657  1.00 177.92 ? 41   ILE C C   1 
ATOM   5998 O  O   . ILE C 3  21  ? 42.328 191.474 56.976  1.00 177.09 ? 41   ILE C O   1 
ATOM   5999 C  CB  . ILE C 3  21  ? 40.245 189.130 56.508  1.00 146.05 ? 41   ILE C CB  1 
ATOM   6000 C  CG1 . ILE C 3  21  ? 39.003 188.706 55.723  1.00 150.55 ? 41   ILE C CG1 1 
ATOM   6001 C  CG2 . ILE C 3  21  ? 40.473 188.190 57.683  1.00 189.48 ? 41   ILE C CG2 1 
ATOM   6002 C  CD1 . ILE C 3  21  ? 39.065 187.288 55.203  1.00 145.20 ? 41   ILE C CD1 1 
ATOM   6003 N  N   . THR C 3  22  ? 41.417 191.033 58.985  1.00 190.13 ? 42   THR C N   1 
ATOM   6004 C  CA  . THR C 3  22  ? 42.585 191.487 59.732  1.00 194.41 ? 42   THR C CA  1 
ATOM   6005 C  C   . THR C 3  22  ? 43.428 190.317 60.229  1.00 195.63 ? 42   THR C C   1 
ATOM   6006 O  O   . THR C 3  22  ? 42.903 189.261 60.584  1.00 204.16 ? 42   THR C O   1 
ATOM   6007 C  CB  . THR C 3  22  ? 42.181 192.359 60.935  1.00 195.63 ? 42   THR C CB  1 
ATOM   6008 O  OG1 . THR C 3  22  ? 41.333 191.607 61.812  1.00 215.22 ? 42   THR C OG1 1 
ATOM   6009 C  CG2 . THR C 3  22  ? 41.444 193.604 60.466  1.00 204.72 ? 42   THR C CG2 1 
ATOM   6010 N  N   . CYS C 3  23  ? 44.741 190.520 60.252  1.00 180.74 ? 43   CYS C N   1 
ATOM   6011 C  CA  . CYS C 3  23  ? 45.678 189.509 60.720  1.00 163.59 ? 43   CYS C CA  1 
ATOM   6012 C  C   . CYS C 3  23  ? 46.608 190.113 61.766  1.00 175.41 ? 43   CYS C C   1 
ATOM   6013 O  O   . CYS C 3  23  ? 47.336 191.068 61.485  1.00 179.24 ? 43   CYS C O   1 
ATOM   6014 C  CB  . CYS C 3  23  ? 46.487 188.942 59.552  1.00 173.21 ? 43   CYS C CB  1 
ATOM   6015 S  SG  . CYS C 3  23  ? 47.506 187.494 59.936  1.00 206.30 ? 43   CYS C SG  1 
ATOM   6016 N  N   . LYS C 3  24  ? 46.573 189.558 62.973  1.00 184.12 ? 44   LYS C N   1 
ATOM   6017 C  CA  . LYS C 3  24  ? 47.409 190.043 64.065  1.00 187.24 ? 44   LYS C CA  1 
ATOM   6018 C  C   . LYS C 3  24  ? 48.564 189.085 64.336  1.00 179.68 ? 44   LYS C C   1 
ATOM   6019 O  O   . LYS C 3  24  ? 48.366 187.876 64.449  1.00 173.32 ? 44   LYS C O   1 
ATOM   6020 C  CB  . LYS C 3  24  ? 46.578 190.235 65.336  1.00 188.11 ? 44   LYS C CB  1 
ATOM   6021 C  CG  . LYS C 3  24  ? 47.377 190.727 66.532  1.00 183.08 ? 44   LYS C CG  1 
ATOM   6022 C  CD  . LYS C 3  24  ? 46.514 190.811 67.781  1.00 201.10 ? 44   LYS C CD  1 
ATOM   6023 C  CE  . LYS C 3  24  ? 45.358 191.779 67.592  1.00 211.30 ? 44   LYS C CE  1 
ATOM   6024 N  NZ  . LYS C 3  24  ? 44.514 191.879 68.815  1.00 209.83 ? 44   LYS C NZ  1 
ATOM   6025 N  N   . ALA C 3  25  ? 49.770 189.634 64.441  1.00 170.95 ? 45   ALA C N   1 
ATOM   6026 C  CA  . ALA C 3  25  ? 50.959 188.827 64.682  1.00 159.81 ? 45   ALA C CA  1 
ATOM   6027 C  C   . ALA C 3  25  ? 51.482 189.024 66.100  1.00 176.45 ? 45   ALA C C   1 
ATOM   6028 O  O   . ALA C 3  25  ? 51.050 189.932 66.810  1.00 200.68 ? 45   ALA C O   1 
ATOM   6029 C  CB  . ALA C 3  25  ? 52.038 189.165 63.670  1.00 136.42 ? 45   ALA C CB  1 
ATOM   6030 N  N   . SER C 3  26  ? 52.413 188.167 66.506  1.00 161.30 ? 46   SER C N   1 
ATOM   6031 C  CA  . SER C 3  26  ? 53.016 188.261 67.831  1.00 140.27 ? 46   SER C CA  1 
ATOM   6032 C  C   . SER C 3  26  ? 53.968 189.448 67.926  1.00 139.08 ? 46   SER C C   1 
ATOM   6033 O  O   . SER C 3  26  ? 53.728 190.390 68.681  1.00 147.73 ? 46   SER C O   1 
ATOM   6034 C  CB  . SER C 3  26  ? 53.770 186.975 68.174  1.00 169.21 ? 46   SER C CB  1 
ATOM   6035 O  OG  . SER C 3  26  ? 54.868 186.778 67.300  1.00 177.48 ? 46   SER C OG  1 
ATOM   6036 N  N   . GLN C 3  27  ? 55.051 189.395 67.156  1.00 158.56 ? 47   GLN C N   1 
ATOM   6037 C  CA  . GLN C 3  27  ? 56.019 190.486 67.116  1.00 151.52 ? 47   GLN C CA  1 
ATOM   6038 C  C   . GLN C 3  27  ? 55.905 191.222 65.785  1.00 132.77 ? 47   GLN C C   1 
ATOM   6039 O  O   . GLN C 3  27  ? 55.012 190.938 64.986  1.00 130.30 ? 47   GLN C O   1 
ATOM   6040 C  CB  . GLN C 3  27  ? 57.445 189.969 67.321  1.00 156.03 ? 47   GLN C CB  1 
ATOM   6041 C  CG  . GLN C 3  27  ? 57.953 189.072 66.202  1.00 136.12 ? 47   GLN C CG  1 
ATOM   6042 C  CD  . GLN C 3  27  ? 59.330 188.504 66.489  1.00 130.14 ? 47   GLN C CD  1 
ATOM   6043 O  OE1 . GLN C 3  27  ? 59.680 188.245 67.640  1.00 146.65 ? 47   GLN C OE1 1 
ATOM   6044 N  NE2 . GLN C 3  27  ? 60.121 188.310 65.440  1.00 117.02 ? 47   GLN C NE2 1 
ATOM   6045 N  N   . ASP C 3  28  ? 56.808 192.170 65.553  1.00 145.81 ? 48   ASP C N   1 
ATOM   6046 C  CA  . ASP C 3  28  ? 56.815 192.929 64.307  1.00 126.19 ? 48   ASP C CA  1 
ATOM   6047 C  C   . ASP C 3  28  ? 57.183 192.019 63.139  1.00 134.93 ? 48   ASP C C   1 
ATOM   6048 O  O   . ASP C 3  28  ? 58.006 191.118 63.282  1.00 171.10 ? 48   ASP C O   1 
ATOM   6049 C  CB  . ASP C 3  28  ? 57.787 194.106 64.393  1.00 147.83 ? 48   ASP C CB  1 
ATOM   6050 C  CG  . ASP C 3  28  ? 57.633 195.075 63.237  1.00 152.57 ? 48   ASP C CG  1 
ATOM   6051 O  OD1 . ASP C 3  28  ? 58.281 194.864 62.191  1.00 126.45 ? 48   ASP C OD1 1 
ATOM   6052 O  OD2 . ASP C 3  28  ? 56.863 196.048 63.375  1.00 187.96 ? 48   ASP C OD2 1 
ATOM   6053 N  N   . VAL C 3  29  ? 56.548 192.205 61.997  1.00 151.40 ? 49   VAL C N   1 
ATOM   6054 C  CA  . VAL C 3  29  ? 56.880 191.374 60.857  1.00 134.05 ? 49   VAL C CA  1 
ATOM   6055 C  C   . VAL C 3  29  ? 57.326 192.178 59.660  1.00 120.68 ? 49   VAL C C   1 
ATOM   6056 O  O   . VAL C 3  29  ? 57.826 191.644 58.695  1.00 116.27 ? 49   VAL C O   1 
ATOM   6057 C  CB  . VAL C 3  29  ? 55.691 190.507 60.475  1.00 105.44 ? 49   VAL C CB  1 
ATOM   6058 C  CG1 . VAL C 3  29  ? 56.035 189.663 59.275  1.00 126.71 ? 49   VAL C CG1 1 
ATOM   6059 C  CG2 . VAL C 3  29  ? 55.310 189.623 61.642  1.00 106.18 ? 49   VAL C CG2 1 
ATOM   6060 N  N   . SER C 3  30  ? 57.129 193.477 59.724  1.00 146.36 ? 50   SER C N   1 
ATOM   6061 C  CA  . SER C 3  30  ? 57.440 194.324 58.596  1.00 160.25 ? 50   SER C CA  1 
ATOM   6062 C  C   . SER C 3  30  ? 56.682 193.840 57.360  1.00 172.62 ? 50   SER C C   1 
ATOM   6063 O  O   . SER C 3  30  ? 55.504 193.553 57.434  1.00 194.30 ? 50   SER C O   1 
ATOM   6064 C  CB  . SER C 3  30  ? 58.942 194.375 58.352  1.00 134.58 ? 50   SER C CB  1 
ATOM   6065 O  OG  . SER C 3  30  ? 59.175 194.836 57.038  1.00 142.49 ? 50   SER C OG  1 
ATOM   6066 N  N   . THR C 3  31  ? 57.363 193.726 56.234  1.00 139.43 ? 51   THR C N   1 
ATOM   6067 C  CA  . THR C 3  31  ? 56.753 193.364 54.974  1.00 137.35 ? 51   THR C CA  1 
ATOM   6068 C  C   . THR C 3  31  ? 56.126 191.985 54.897  1.00 153.35 ? 51   THR C C   1 
ATOM   6069 O  O   . THR C 3  31  ? 55.161 191.801 54.178  1.00 167.83 ? 51   THR C O   1 
ATOM   6070 C  CB  . THR C 3  31  ? 57.770 193.461 53.854  1.00 160.63 ? 51   THR C CB  1 
ATOM   6071 O  OG1 . THR C 3  31  ? 58.678 192.362 53.965  1.00 150.75 ? 51   THR C OG1 1 
ATOM   6072 C  CG2 . THR C 3  31  ? 58.528 194.749 53.987  1.00 162.81 ? 51   THR C CG2 1 
ATOM   6073 N  N   . ALA C 3  32  ? 56.703 190.992 55.559  1.00 136.62 ? 52   ALA C N   1 
ATOM   6074 C  CA  . ALA C 3  32  ? 56.351 189.610 55.249  1.00 124.68 ? 52   ALA C CA  1 
ATOM   6075 C  C   . ALA C 3  32  ? 55.115 189.012 55.908  1.00 125.03 ? 52   ALA C C   1 
ATOM   6076 O  O   . ALA C 3  32  ? 55.145 188.493 57.005  1.00 139.07 ? 52   ALA C O   1 
ATOM   6077 C  CB  . ALA C 3  32  ? 57.542 188.705 55.493  1.00 127.98 ? 52   ALA C CB  1 
ATOM   6078 N  N   . VAL C 3  33  ? 54.045 189.049 55.141  1.00 144.76 ? 53   VAL C N   1 
ATOM   6079 C  CA  . VAL C 3  33  ? 52.773 188.369 55.361  1.00 142.01 ? 53   VAL C CA  1 
ATOM   6080 C  C   . VAL C 3  33  ? 52.163 187.927 54.035  1.00 141.22 ? 53   VAL C C   1 
ATOM   6081 O  O   . VAL C 3  33  ? 52.078 188.709 53.088  1.00 174.70 ? 53   VAL C O   1 
ATOM   6082 C  CB  . VAL C 3  33  ? 51.792 189.265 56.141  1.00 161.14 ? 53   VAL C CB  1 
ATOM   6083 C  CG1 . VAL C 3  33  ? 50.406 188.638 56.177  1.00 167.18 ? 53   VAL C CG1 1 
ATOM   6084 C  CG2 . VAL C 3  33  ? 52.302 189.498 57.551  1.00 160.39 ? 53   VAL C CG2 1 
ATOM   6085 N  N   . ALA C 3  34  ? 51.742 186.668 53.976  1.00 124.97 ? 54   ALA C N   1 
ATOM   6086 C  CA  . ALA C 3  34  ? 51.129 186.114 52.777  1.00 131.12 ? 54   ALA C CA  1 
ATOM   6087 C  C   . ALA C 3  34  ? 49.686 185.695 53.044  1.00 168.91 ? 54   ALA C C   1 
ATOM   6088 O  O   . ALA C 3  34  ? 49.366 185.181 54.115  1.00 205.79 ? 54   ALA C O   1 
ATOM   6089 C  CB  . ALA C 3  34  ? 51.938 184.931 52.268  1.00 122.71 ? 54   ALA C CB  1 
ATOM   6090 N  N   . TRP C 3  35  ? 48.820 185.921 52.062  1.00 127.93 ? 55   TRP C N   1 
ATOM   6091 C  CA  . TRP C 3  35  ? 47.416 185.552 52.169  1.00 118.46 ? 55   TRP C CA  1 
ATOM   6092 C  C   . TRP C 3  35  ? 47.076 184.404 51.222  1.00 110.97 ? 55   TRP C C   1 
ATOM   6093 O  O   . TRP C 3  35  ? 47.321 184.488 50.012  1.00 143.84 ? 55   TRP C O   1 
ATOM   6094 C  CB  . TRP C 3  35  ? 46.523 186.758 51.879  1.00 119.53 ? 55   TRP C CB  1 
ATOM   6095 C  CG  . TRP C 3  35  ? 46.684 187.871 52.869  1.00 120.21 ? 55   TRP C CG  1 
ATOM   6096 C  CD1 . TRP C 3  35  ? 47.576 188.903 52.807  1.00 134.39 ? 55   TRP C CD1 1 
ATOM   6097 C  CD2 . TRP C 3  35  ? 45.930 188.064 54.071  1.00 120.68 ? 55   TRP C CD2 1 
ATOM   6098 N  NE1 . TRP C 3  35  ? 47.422 189.727 53.896  1.00 132.43 ? 55   TRP C NE1 1 
ATOM   6099 C  CE2 . TRP C 3  35  ? 46.417 189.234 54.688  1.00 136.72 ? 55   TRP C CE2 1 
ATOM   6100 C  CE3 . TRP C 3  35  ? 44.888 187.362 54.686  1.00 122.24 ? 55   TRP C CE3 1 
ATOM   6101 C  CZ2 . TRP C 3  35  ? 45.900 189.717 55.887  1.00 162.85 ? 55   TRP C CZ2 1 
ATOM   6102 C  CZ3 . TRP C 3  35  ? 44.376 187.844 55.876  1.00 143.80 ? 55   TRP C CZ3 1 
ATOM   6103 C  CH2 . TRP C 3  35  ? 44.882 189.009 56.463  1.00 167.40 ? 55   TRP C CH2 1 
ATOM   6104 N  N   . TYR C 3  36  ? 46.511 183.341 51.790  1.00 104.62 ? 56   TYR C N   1 
ATOM   6105 C  CA  . TYR C 3  36  ? 46.137 182.147 51.040  1.00 106.73 ? 56   TYR C CA  1 
ATOM   6106 C  C   . TYR C 3  36  ? 44.623 181.950 51.022  1.00 109.10 ? 56   TYR C C   1 
ATOM   6107 O  O   . TYR C 3  36  ? 43.932 182.280 51.988  1.00 117.71 ? 56   TYR C O   1 
ATOM   6108 C  CB  . TYR C 3  36  ? 46.809 180.905 51.635  1.00 95.91  ? 56   TYR C CB  1 
ATOM   6109 C  CG  . TYR C 3  36  ? 48.318 180.910 51.556  1.00 88.58  ? 56   TYR C CG  1 
ATOM   6110 C  CD1 . TYR C 3  36  ? 49.080 181.566 52.514  1.00 103.98 ? 56   TYR C CD1 1 
ATOM   6111 C  CD2 . TYR C 3  36  ? 48.981 180.248 50.532  1.00 112.35 ? 56   TYR C CD2 1 
ATOM   6112 C  CE1 . TYR C 3  36  ? 50.461 181.571 52.448  1.00 99.89  ? 56   TYR C CE1 1 
ATOM   6113 C  CE2 . TYR C 3  36  ? 50.361 180.246 50.459  1.00 135.88 ? 56   TYR C CE2 1 
ATOM   6114 C  CZ  . TYR C 3  36  ? 51.096 180.910 51.419  1.00 120.82 ? 56   TYR C CZ  1 
ATOM   6115 O  OH  . TYR C 3  36  ? 52.470 180.912 51.351  1.00 121.57 ? 56   TYR C OH  1 
ATOM   6116 N  N   . GLN C 3  37  ? 44.120 181.400 49.921  1.00 120.44 ? 57   GLN C N   1 
ATOM   6117 C  CA  . GLN C 3  37  ? 42.699 181.099 49.778  1.00 114.79 ? 57   GLN C CA  1 
ATOM   6118 C  C   . GLN C 3  37  ? 42.474 179.598 49.645  1.00 127.99 ? 57   GLN C C   1 
ATOM   6119 O  O   . GLN C 3  37  ? 43.090 178.944 48.804  1.00 167.32 ? 57   GLN C O   1 
ATOM   6120 C  CB  . GLN C 3  37  ? 42.114 181.820 48.563  1.00 114.63 ? 57   GLN C CB  1 
ATOM   6121 C  CG  . GLN C 3  37  ? 40.686 181.417 48.234  1.00 121.05 ? 57   GLN C CG  1 
ATOM   6122 C  CD  . GLN C 3  37  ? 40.240 181.905 46.870  1.00 125.22 ? 57   GLN C CD  1 
ATOM   6123 O  OE1 . GLN C 3  37  ? 41.040 182.421 46.090  1.00 130.30 ? 57   GLN C OE1 1 
ATOM   6124 N  NE2 . GLN C 3  37  ? 38.956 181.741 46.574  1.00 153.55 ? 57   GLN C NE2 1 
ATOM   6125 N  N   . GLN C 3  38  ? 41.587 179.054 50.472  1.00 119.24 ? 58   GLN C N   1 
ATOM   6126 C  CA  . GLN C 3  38  ? 41.283 177.629 50.419  1.00 119.04 ? 58   GLN C CA  1 
ATOM   6127 C  C   . GLN C 3  38  ? 39.784 177.385 50.283  1.00 130.47 ? 58   GLN C C   1 
ATOM   6128 O  O   . GLN C 3  38  ? 39.024 177.570 51.234  1.00 142.63 ? 58   GLN C O   1 
ATOM   6129 C  CB  . GLN C 3  38  ? 41.818 176.916 51.663  1.00 115.40 ? 58   GLN C CB  1 
ATOM   6130 C  CG  . GLN C 3  38  ? 41.620 175.406 51.642  1.00 113.39 ? 58   GLN C CG  1 
ATOM   6131 C  CD  . GLN C 3  38  ? 42.167 174.725 52.883  1.00 118.29 ? 58   GLN C CD  1 
ATOM   6132 O  OE1 . GLN C 3  38  ? 42.531 175.382 53.858  1.00 111.27 ? 58   GLN C OE1 1 
ATOM   6133 N  NE2 . GLN C 3  38  ? 42.227 173.398 52.850  1.00 114.97 ? 58   GLN C NE2 1 
ATOM   6134 N  N   . LYS C 3  39  ? 39.366 176.971 49.091  1.00 159.42 ? 59   LYS C N   1 
ATOM   6135 C  CA  . LYS C 3  39  ? 37.970 176.634 48.844  1.00 166.48 ? 59   LYS C CA  1 
ATOM   6136 C  C   . LYS C 3  39  ? 37.655 175.281 49.473  1.00 169.70 ? 59   LYS C C   1 
ATOM   6137 O  O   . LYS C 3  39  ? 38.529 174.417 49.557  1.00 169.96 ? 59   LYS C O   1 
ATOM   6138 C  CB  . LYS C 3  39  ? 37.671 176.642 47.343  1.00 169.27 ? 59   LYS C CB  1 
ATOM   6139 C  CG  . LYS C 3  39  ? 37.833 178.005 46.687  1.00 172.70 ? 59   LYS C CG  1 
ATOM   6140 C  CD  . LYS C 3  39  ? 37.456 177.962 45.215  1.00 175.54 ? 59   LYS C CD  1 
ATOM   6141 C  CE  . LYS C 3  39  ? 37.581 179.334 44.573  1.00 167.07 ? 59   LYS C CE  1 
ATOM   6142 N  NZ  . LYS C 3  39  ? 37.207 179.308 43.132  1.00 193.70 ? 59   LYS C NZ  1 
ATOM   6143 N  N   . PRO C 3  40  ? 36.403 175.097 49.928  1.00 147.96 ? 60   PRO C N   1 
ATOM   6144 C  CA  . PRO C 3  40  ? 35.958 173.858 50.575  1.00 152.16 ? 60   PRO C CA  1 
ATOM   6145 C  C   . PRO C 3  40  ? 36.163 172.626 49.696  1.00 156.91 ? 60   PRO C C   1 
ATOM   6146 O  O   . PRO C 3  40  ? 35.489 172.476 48.677  1.00 176.46 ? 60   PRO C O   1 
ATOM   6147 C  CB  . PRO C 3  40  ? 34.467 174.108 50.814  1.00 163.07 ? 60   PRO C CB  1 
ATOM   6148 C  CG  . PRO C 3  40  ? 34.357 175.585 50.942  1.00 179.80 ? 60   PRO C CG  1 
ATOM   6149 C  CD  . PRO C 3  40  ? 35.365 176.145 49.982  1.00 164.97 ? 60   PRO C CD  1 
ATOM   6150 N  N   . GLY C 3  41  ? 37.090 171.760 50.093  1.00 139.49 ? 61   GLY C N   1 
ATOM   6151 C  CA  . GLY C 3  41  ? 37.371 170.546 49.350  1.00 138.24 ? 61   GLY C CA  1 
ATOM   6152 C  C   . GLY C 3  41  ? 38.610 170.641 48.480  1.00 146.89 ? 61   GLY C C   1 
ATOM   6153 O  O   . GLY C 3  41  ? 39.042 169.651 47.890  1.00 141.70 ? 61   GLY C O   1 
ATOM   6154 N  N   . GLN C 3  42  ? 39.182 171.838 48.401  1.00 159.38 ? 62   GLN C N   1 
ATOM   6155 C  CA  . GLN C 3  42  ? 40.370 172.064 47.586  1.00 150.58 ? 62   GLN C CA  1 
ATOM   6156 C  C   . GLN C 3  42  ? 41.590 172.386 48.441  1.00 145.84 ? 62   GLN C C   1 
ATOM   6157 O  O   . GLN C 3  42  ? 41.489 172.539 49.659  1.00 136.95 ? 62   GLN C O   1 
ATOM   6158 C  CB  . GLN C 3  42  ? 40.128 173.200 46.588  1.00 133.35 ? 62   GLN C CB  1 
ATOM   6159 C  CG  . GLN C 3  42  ? 39.042 172.922 45.565  1.00 143.59 ? 62   GLN C CG  1 
ATOM   6160 C  CD  . GLN C 3  42  ? 38.884 174.054 44.569  1.00 171.41 ? 62   GLN C CD  1 
ATOM   6161 O  OE1 . GLN C 3  42  ? 39.602 175.052 44.628  1.00 153.00 ? 62   GLN C OE1 1 
ATOM   6162 N  NE2 . GLN C 3  42  ? 37.941 173.904 43.646  1.00 208.14 ? 62   GLN C NE2 1 
ATOM   6163 N  N   . SER C 3  43  ? 42.742 172.487 47.788  1.00 142.93 ? 63   SER C N   1 
ATOM   6164 C  CA  . SER C 3  43  ? 43.978 172.872 48.454  1.00 126.37 ? 63   SER C CA  1 
ATOM   6165 C  C   . SER C 3  43  ? 44.081 174.391 48.525  1.00 122.20 ? 63   SER C C   1 
ATOM   6166 O  O   . SER C 3  43  ? 43.512 175.089 47.685  1.00 124.71 ? 63   SER C O   1 
ATOM   6167 C  CB  . SER C 3  43  ? 45.186 172.290 47.719  1.00 149.72 ? 63   SER C CB  1 
ATOM   6168 O  OG  . SER C 3  43  ? 45.232 172.741 46.377  1.00 181.50 ? 63   SER C OG  1 
ATOM   6169 N  N   . PRO C 3  44  ? 44.799 174.908 49.535  1.00 96.31  ? 64   PRO C N   1 
ATOM   6170 C  CA  . PRO C 3  44  ? 45.009 176.355 49.661  1.00 93.36  ? 64   PRO C CA  1 
ATOM   6171 C  C   . PRO C 3  44  ? 45.658 176.964 48.422  1.00 108.51 ? 64   PRO C C   1 
ATOM   6172 O  O   . PRO C 3  44  ? 46.528 176.343 47.812  1.00 121.78 ? 64   PRO C O   1 
ATOM   6173 C  CB  . PRO C 3  44  ? 45.939 176.468 50.873  1.00 90.11  ? 64   PRO C CB  1 
ATOM   6174 C  CG  . PRO C 3  44  ? 45.652 175.249 51.676  1.00 90.36  ? 64   PRO C CG  1 
ATOM   6175 C  CD  . PRO C 3  44  ? 45.368 174.168 50.676  1.00 102.88 ? 64   PRO C CD  1 
ATOM   6176 N  N   . LYS C 3  45  ? 45.228 178.167 48.056  1.00 105.09 ? 65   LYS C N   1 
ATOM   6177 C  CA  . LYS C 3  45  ? 45.778 178.859 46.898  1.00 106.13 ? 65   LYS C CA  1 
ATOM   6178 C  C   . LYS C 3  45  ? 46.389 180.194 47.308  1.00 101.23 ? 65   LYS C C   1 
ATOM   6179 O  O   . LYS C 3  45  ? 45.747 180.999 47.983  1.00 113.74 ? 65   LYS C O   1 
ATOM   6180 C  CB  . LYS C 3  45  ? 44.697 179.076 45.836  1.00 124.52 ? 65   LYS C CB  1 
ATOM   6181 C  CG  . LYS C 3  45  ? 45.176 179.837 44.610  1.00 137.99 ? 65   LYS C CG  1 
ATOM   6182 C  CD  . LYS C 3  45  ? 44.053 180.022 43.601  1.00 145.34 ? 65   LYS C CD  1 
ATOM   6183 C  CE  . LYS C 3  45  ? 44.531 180.787 42.378  1.00 150.47 ? 65   LYS C CE  1 
ATOM   6184 N  NZ  . LYS C 3  45  ? 43.445 180.962 41.373  1.00 166.30 ? 65   LYS C NZ  1 
ATOM   6185 N  N   . LEU C 3  46  ? 47.632 180.422 46.898  1.00 95.17  ? 66   LEU C N   1 
ATOM   6186 C  CA  . LEU C 3  46  ? 48.330 181.659 47.222  1.00 96.36  ? 66   LEU C CA  1 
ATOM   6187 C  C   . LEU C 3  46  ? 47.729 182.848 46.481  1.00 105.90 ? 66   LEU C C   1 
ATOM   6188 O  O   . LEU C 3  46  ? 47.608 182.831 45.256  1.00 139.97 ? 66   LEU C O   1 
ATOM   6189 C  CB  . LEU C 3  46  ? 49.817 181.539 46.889  1.00 108.73 ? 66   LEU C CB  1 
ATOM   6190 C  CG  . LEU C 3  46  ? 50.644 182.812 47.076  1.00 106.18 ? 66   LEU C CG  1 
ATOM   6191 C  CD1 . LEU C 3  46  ? 50.682 183.218 48.539  1.00 105.42 ? 66   LEU C CD1 1 
ATOM   6192 C  CD2 . LEU C 3  46  ? 52.047 182.626 46.530  1.00 107.99 ? 66   LEU C CD2 1 
ATOM   6193 N  N   . LEU C 3  47  ? 47.354 183.878 47.230  1.00 96.55  ? 67   LEU C N   1 
ATOM   6194 C  CA  . LEU C 3  47  ? 46.813 185.094 46.636  1.00 107.00 ? 67   LEU C CA  1 
ATOM   6195 C  C   . LEU C 3  47  ? 47.776 186.261 46.806  1.00 109.61 ? 67   LEU C C   1 
ATOM   6196 O  O   . LEU C 3  47  ? 48.102 186.953 45.842  1.00 119.83 ? 67   LEU C O   1 
ATOM   6197 C  CB  . LEU C 3  47  ? 45.458 185.448 47.254  1.00 108.11 ? 67   LEU C CB  1 
ATOM   6198 C  CG  . LEU C 3  47  ? 44.293 184.488 47.011  1.00 111.00 ? 67   LEU C CG  1 
ATOM   6199 C  CD1 . LEU C 3  47  ? 42.990 185.120 47.474  1.00 118.57 ? 67   LEU C CD1 1 
ATOM   6200 C  CD2 . LEU C 3  47  ? 44.213 184.093 45.545  1.00 111.18 ? 67   LEU C CD2 1 
ATOM   6201 N  N   . ILE C 3  48  ? 48.230 186.476 48.037  1.00 121.06 ? 68   ILE C N   1 
ATOM   6202 C  CA  . ILE C 3  48  ? 49.079 187.624 48.336  1.00 122.88 ? 68   ILE C CA  1 
ATOM   6203 C  C   . ILE C 3  48  ? 50.403 187.176 48.947  1.00 128.88 ? 68   ILE C C   1 
ATOM   6204 O  O   . ILE C 3  48  ? 50.449 186.221 49.716  1.00 116.91 ? 68   ILE C O   1 
ATOM   6205 C  CB  . ILE C 3  48  ? 48.344 188.617 49.266  1.00 109.49 ? 68   ILE C CB  1 
ATOM   6206 C  CG1 . ILE C 3  48  ? 47.081 189.150 48.587  1.00 111.66 ? 68   ILE C CG1 1 
ATOM   6207 C  CG2 . ILE C 3  48  ? 49.250 189.773 49.665  1.00 105.48 ? 68   ILE C CG2 1 
ATOM   6208 C  CD1 . ILE C 3  48  ? 47.355 189.923 47.315  1.00 113.10 ? 68   ILE C CD1 1 
ATOM   6209 N  N   . TYR C 3  49  ? 51.486 187.854 48.580  1.00 125.76 ? 69   TYR C N   1 
ATOM   6210 C  CA  . TYR C 3  49  ? 52.774 187.637 49.225  1.00 115.21 ? 69   TYR C CA  1 
ATOM   6211 C  C   . TYR C 3  49  ? 53.416 188.986 49.530  1.00 113.83 ? 69   TYR C C   1 
ATOM   6212 O  O   . TYR C 3  49  ? 53.237 189.946 48.779  1.00 105.49 ? 69   TYR C O   1 
ATOM   6213 C  CB  . TYR C 3  49  ? 53.693 186.779 48.349  1.00 111.21 ? 69   TYR C CB  1 
ATOM   6214 C  CG  . TYR C 3  49  ? 54.226 187.479 47.119  1.00 110.32 ? 69   TYR C CG  1 
ATOM   6215 C  CD1 . TYR C 3  49  ? 53.461 187.577 45.965  1.00 129.92 ? 69   TYR C CD1 1 
ATOM   6216 C  CD2 . TYR C 3  49  ? 55.501 188.031 47.108  1.00 103.51 ? 69   TYR C CD2 1 
ATOM   6217 C  CE1 . TYR C 3  49  ? 53.946 188.214 44.838  1.00 136.51 ? 69   TYR C CE1 1 
ATOM   6218 C  CE2 . TYR C 3  49  ? 55.994 188.670 45.987  1.00 115.90 ? 69   TYR C CE2 1 
ATOM   6219 C  CZ  . TYR C 3  49  ? 55.213 188.758 44.854  1.00 141.85 ? 69   TYR C CZ  1 
ATOM   6220 O  OH  . TYR C 3  49  ? 55.700 189.392 43.735  1.00 163.67 ? 69   TYR C OH  1 
ATOM   6221 N  N   . SER C 3  50  ? 54.150 189.050 50.639  1.00 104.11 ? 70   SER C N   1 
ATOM   6222 C  CA  . SER C 3  50  ? 54.799 190.281 51.088  1.00 98.47  ? 70   SER C CA  1 
ATOM   6223 C  C   . SER C 3  50  ? 53.804 191.432 51.234  1.00 103.54 ? 70   SER C C   1 
ATOM   6224 O  O   . SER C 3  50  ? 53.875 192.421 50.503  1.00 121.23 ? 70   SER C O   1 
ATOM   6225 C  CB  . SER C 3  50  ? 55.925 190.679 50.129  1.00 110.20 ? 70   SER C CB  1 
ATOM   6226 O  OG  . SER C 3  50  ? 56.943 189.694 50.100  1.00 100.10 ? 70   SER C OG  1 
ATOM   6227 N  N   . ALA C 3  51  ? 52.874 191.275 52.173  1.00 115.05 ? 71   ALA C N   1 
ATOM   6228 C  CA  . ALA C 3  51  ? 51.907 192.311 52.536  1.00 140.95 ? 71   ALA C CA  1 
ATOM   6229 C  C   . ALA C 3  51  ? 50.975 192.726 51.394  1.00 136.60 ? 71   ALA C C   1 
ATOM   6230 O  O   . ALA C 3  51  ? 49.769 192.489 51.460  1.00 121.80 ? 71   ALA C O   1 
ATOM   6231 C  CB  . ALA C 3  51  ? 52.635 193.537 53.084  1.00 169.49 ? 71   ALA C CB  1 
ATOM   6232 N  N   . SER C 3  52  ? 51.528 193.346 50.355  1.00 142.78 ? 72   SER C N   1 
ATOM   6233 C  CA  . SER C 3  52  ? 50.702 193.974 49.325  1.00 132.62 ? 72   SER C CA  1 
ATOM   6234 C  C   . SER C 3  52  ? 50.796 193.316 47.947  1.00 126.44 ? 72   SER C C   1 
ATOM   6235 O  O   . SER C 3  52  ? 49.834 193.346 47.179  1.00 141.22 ? 72   SER C O   1 
ATOM   6236 C  CB  . SER C 3  52  ? 51.070 195.454 49.201  1.00 138.53 ? 72   SER C CB  1 
ATOM   6237 O  OG  . SER C 3  52  ? 52.438 195.612 48.866  1.00 134.98 ? 72   SER C OG  1 
ATOM   6238 N  N   . TYR C 3  53  ? 51.948 192.732 47.633  1.00 127.24 ? 73   TYR C N   1 
ATOM   6239 C  CA  . TYR C 3  53  ? 52.187 192.180 46.300  1.00 122.32 ? 73   TYR C CA  1 
ATOM   6240 C  C   . TYR C 3  53  ? 51.253 191.021 45.960  1.00 115.75 ? 73   TYR C C   1 
ATOM   6241 O  O   . TYR C 3  53  ? 50.947 190.183 46.808  1.00 100.40 ? 73   TYR C O   1 
ATOM   6242 C  CB  . TYR C 3  53  ? 53.641 191.723 46.166  1.00 106.12 ? 73   TYR C CB  1 
ATOM   6243 C  CG  . TYR C 3  53  ? 54.640 192.855 46.164  1.00 147.28 ? 73   TYR C CG  1 
ATOM   6244 C  CD1 . TYR C 3  53  ? 54.966 193.514 44.986  1.00 179.16 ? 73   TYR C CD1 1 
ATOM   6245 C  CD2 . TYR C 3  53  ? 55.257 193.266 47.338  1.00 138.07 ? 73   TYR C CD2 1 
ATOM   6246 C  CE1 . TYR C 3  53  ? 55.878 194.551 44.977  1.00 177.16 ? 73   TYR C CE1 1 
ATOM   6247 C  CE2 . TYR C 3  53  ? 56.171 194.303 47.339  1.00 146.93 ? 73   TYR C CE2 1 
ATOM   6248 C  CZ  . TYR C 3  53  ? 56.478 194.941 46.156  1.00 162.63 ? 73   TYR C CZ  1 
ATOM   6249 O  OH  . TYR C 3  53  ? 57.387 195.974 46.151  1.00 176.79 ? 73   TYR C OH  1 
ATOM   6250 N  N   . ARG C 3  54  ? 50.806 190.984 44.708  1.00 119.89 ? 74   ARG C N   1 
ATOM   6251 C  CA  . ARG C 3  54  ? 49.944 189.912 44.225  1.00 111.05 ? 74   ARG C CA  1 
ATOM   6252 C  C   . ARG C 3  54  ? 50.759 188.866 43.473  1.00 113.06 ? 74   ARG C C   1 
ATOM   6253 O  O   . ARG C 3  54  ? 51.756 189.191 42.829  1.00 142.79 ? 74   ARG C O   1 
ATOM   6254 C  CB  . ARG C 3  54  ? 48.847 190.463 43.310  1.00 131.33 ? 74   ARG C CB  1 
ATOM   6255 C  CG  . ARG C 3  54  ? 48.058 191.626 43.885  1.00 148.08 ? 74   ARG C CG  1 
ATOM   6256 C  CD  . ARG C 3  54  ? 46.942 192.034 42.935  1.00 145.74 ? 74   ARG C CD  1 
ATOM   6257 N  NE  . ARG C 3  54  ? 46.277 193.265 43.349  1.00 182.62 ? 74   ARG C NE  1 
ATOM   6258 C  CZ  . ARG C 3  54  ? 46.594 194.473 42.894  1.00 199.26 ? 74   ARG C CZ  1 
ATOM   6259 N  NH1 . ARG C 3  54  ? 47.569 194.614 42.007  1.00 199.52 ? 74   ARG C NH1 1 
ATOM   6260 N  NH2 . ARG C 3  54  ? 45.936 195.541 43.324  1.00 200.46 ? 74   ARG C NH2 1 
ATOM   6261 N  N   . TYR C 3  55  ? 50.328 187.612 43.552  1.00 112.72 ? 75   TYR C N   1 
ATOM   6262 C  CA  . TYR C 3  55  ? 50.995 186.533 42.834  1.00 118.70 ? 75   TYR C CA  1 
ATOM   6263 C  C   . TYR C 3  55  ? 50.418 186.414 41.425  1.00 136.13 ? 75   TYR C C   1 
ATOM   6264 O  O   . TYR C 3  55  ? 49.322 186.903 41.155  1.00 140.34 ? 75   TYR C O   1 
ATOM   6265 C  CB  . TYR C 3  55  ? 50.852 185.210 43.592  1.00 103.14 ? 75   TYR C CB  1 
ATOM   6266 C  CG  . TYR C 3  55  ? 51.745 184.103 43.077  1.00 88.02  ? 75   TYR C CG  1 
ATOM   6267 C  CD1 . TYR C 3  55  ? 53.099 184.080 43.380  1.00 90.40  ? 75   TYR C CD1 1 
ATOM   6268 C  CD2 . TYR C 3  55  ? 51.233 183.077 42.292  1.00 123.31 ? 75   TYR C CD2 1 
ATOM   6269 C  CE1 . TYR C 3  55  ? 53.921 183.071 42.913  1.00 89.72  ? 75   TYR C CE1 1 
ATOM   6270 C  CE2 . TYR C 3  55  ? 52.046 182.064 41.821  1.00 130.13 ? 75   TYR C CE2 1 
ATOM   6271 C  CZ  . TYR C 3  55  ? 53.389 182.065 42.134  1.00 114.00 ? 75   TYR C CZ  1 
ATOM   6272 O  OH  . TYR C 3  55  ? 54.202 181.059 41.667  1.00 138.58 ? 75   TYR C OH  1 
ATOM   6273 N  N   . THR C 3  56  ? 51.164 185.775 40.530  1.00 160.73 ? 76   THR C N   1 
ATOM   6274 C  CA  . THR C 3  56  ? 50.729 185.611 39.147  1.00 168.04 ? 76   THR C CA  1 
ATOM   6275 C  C   . THR C 3  56  ? 49.497 184.715 39.055  1.00 155.42 ? 76   THR C C   1 
ATOM   6276 O  O   . THR C 3  56  ? 49.413 183.687 39.727  1.00 136.04 ? 76   THR C O   1 
ATOM   6277 C  CB  . THR C 3  56  ? 51.849 185.020 38.269  1.00 165.59 ? 76   THR C CB  1 
ATOM   6278 O  OG1 . THR C 3  56  ? 52.241 183.741 38.783  1.00 149.36 ? 76   THR C OG1 1 
ATOM   6279 C  CG2 . THR C 3  56  ? 53.055 185.947 38.249  1.00 177.56 ? 76   THR C CG2 1 
ATOM   6280 N  N   . GLY C 3  57  ? 48.543 185.114 38.220  1.00 192.85 ? 77   GLY C N   1 
ATOM   6281 C  CA  . GLY C 3  57  ? 47.313 184.361 38.050  1.00 204.95 ? 77   GLY C CA  1 
ATOM   6282 C  C   . GLY C 3  57  ? 46.250 184.723 39.068  1.00 203.17 ? 77   GLY C C   1 
ATOM   6283 O  O   . GLY C 3  57  ? 45.366 183.922 39.370  1.00 214.67 ? 77   GLY C O   1 
ATOM   6284 N  N   . VAL C 3  58  ? 46.340 185.939 39.599  1.00 154.65 ? 78   VAL C N   1 
ATOM   6285 C  CA  . VAL C 3  58  ? 45.393 186.420 40.597  1.00 144.95 ? 78   VAL C CA  1 
ATOM   6286 C  C   . VAL C 3  58  ? 44.684 187.671 40.086  1.00 146.06 ? 78   VAL C C   1 
ATOM   6287 O  O   . VAL C 3  58  ? 45.335 188.613 39.633  1.00 152.99 ? 78   VAL C O   1 
ATOM   6288 C  CB  . VAL C 3  58  ? 46.096 186.697 41.942  1.00 164.66 ? 78   VAL C CB  1 
ATOM   6289 C  CG1 . VAL C 3  58  ? 45.126 187.307 42.942  1.00 160.97 ? 78   VAL C CG1 1 
ATOM   6290 C  CG2 . VAL C 3  58  ? 46.705 185.417 42.496  1.00 174.58 ? 78   VAL C CG2 1 
ATOM   6291 N  N   . PRO C 3  59  ? 43.342 187.678 40.150  1.00 154.76 ? 79   PRO C N   1 
ATOM   6292 C  CA  . PRO C 3  59  ? 42.514 188.813 39.720  1.00 157.57 ? 79   PRO C CA  1 
ATOM   6293 C  C   . PRO C 3  59  ? 42.867 190.123 40.424  1.00 165.32 ? 79   PRO C C   1 
ATOM   6294 O  O   . PRO C 3  59  ? 43.552 190.113 41.446  1.00 169.40 ? 79   PRO C O   1 
ATOM   6295 C  CB  . PRO C 3  59  ? 41.096 188.368 40.089  1.00 180.79 ? 79   PRO C CB  1 
ATOM   6296 C  CG  . PRO C 3  59  ? 41.154 186.882 40.061  1.00 183.60 ? 79   PRO C CG  1 
ATOM   6297 C  CD  . PRO C 3  59  ? 42.521 186.529 40.570  1.00 159.17 ? 79   PRO C CD  1 
ATOM   6298 N  N   . ASP C 3  60  ? 42.390 191.237 39.878  1.00 213.49 ? 80   ASP C N   1 
ATOM   6299 C  CA  . ASP C 3  60  ? 42.719 192.554 40.410  1.00 229.76 ? 80   ASP C CA  1 
ATOM   6300 C  C   . ASP C 3  60  ? 41.839 192.928 41.600  1.00 214.61 ? 80   ASP C C   1 
ATOM   6301 O  O   . ASP C 3  60  ? 42.079 193.935 42.266  1.00 212.87 ? 80   ASP C O   1 
ATOM   6302 C  CB  . ASP C 3  60  ? 42.588 193.615 39.315  1.00 253.66 ? 80   ASP C CB  1 
ATOM   6303 C  CG  . ASP C 3  60  ? 43.417 193.290 38.088  1.00 245.98 ? 80   ASP C CG  1 
ATOM   6304 O  OD1 . ASP C 3  60  ? 44.593 193.705 38.036  1.00 230.52 ? 80   ASP C OD1 1 
ATOM   6305 O  OD2 . ASP C 3  60  ? 42.891 192.619 37.175  1.00 247.02 ? 80   ASP C OD2 1 
ATOM   6306 N  N   . ARG C 3  61  ? 40.823 192.114 41.866  1.00 199.70 ? 81   ARG C N   1 
ATOM   6307 C  CA  . ARG C 3  61  ? 39.880 192.400 42.943  1.00 180.99 ? 81   ARG C CA  1 
ATOM   6308 C  C   . ARG C 3  61  ? 40.443 192.028 44.313  1.00 172.04 ? 81   ARG C C   1 
ATOM   6309 O  O   . ARG C 3  61  ? 39.852 192.353 45.342  1.00 197.03 ? 81   ARG C O   1 
ATOM   6310 C  CB  . ARG C 3  61  ? 38.557 191.667 42.705  1.00 181.22 ? 81   ARG C CB  1 
ATOM   6311 C  CG  . ARG C 3  61  ? 38.686 190.156 42.603  1.00 179.98 ? 81   ARG C CG  1 
ATOM   6312 C  CD  . ARG C 3  61  ? 37.323 189.499 42.440  1.00 171.92 ? 81   ARG C CD  1 
ATOM   6313 N  NE  . ARG C 3  61  ? 37.427 188.049 42.297  1.00 166.97 ? 81   ARG C NE  1 
ATOM   6314 C  CZ  . ARG C 3  61  ? 37.508 187.418 41.130  1.00 173.66 ? 81   ARG C CZ  1 
ATOM   6315 N  NH1 . ARG C 3  61  ? 37.495 188.109 39.998  1.00 207.55 ? 81   ARG C NH1 1 
ATOM   6316 N  NH2 . ARG C 3  61  ? 37.600 186.096 41.093  1.00 164.52 ? 81   ARG C NH2 1 
ATOM   6317 N  N   . PHE C 3  62  ? 41.585 191.347 44.322  1.00 154.56 ? 82   PHE C N   1 
ATOM   6318 C  CA  . PHE C 3  62  ? 42.234 190.962 45.572  1.00 141.95 ? 82   PHE C CA  1 
ATOM   6319 C  C   . PHE C 3  62  ? 43.412 191.880 45.880  1.00 138.94 ? 82   PHE C C   1 
ATOM   6320 O  O   . PHE C 3  62  ? 44.362 191.964 45.102  1.00 135.30 ? 82   PHE C O   1 
ATOM   6321 C  CB  . PHE C 3  62  ? 42.706 189.508 45.510  1.00 134.34 ? 82   PHE C CB  1 
ATOM   6322 C  CG  . PHE C 3  62  ? 41.610 188.526 45.215  1.00 137.15 ? 82   PHE C CG  1 
ATOM   6323 C  CD1 . PHE C 3  62  ? 40.773 188.077 46.223  1.00 142.66 ? 82   PHE C CD1 1 
ATOM   6324 C  CD2 . PHE C 3  62  ? 41.421 188.045 43.930  1.00 163.74 ? 82   PHE C CD2 1 
ATOM   6325 C  CE1 . PHE C 3  62  ? 39.764 187.171 45.954  1.00 161.67 ? 82   PHE C CE1 1 
ATOM   6326 C  CE2 . PHE C 3  62  ? 40.414 187.138 43.654  1.00 179.81 ? 82   PHE C CE2 1 
ATOM   6327 C  CZ  . PHE C 3  62  ? 39.585 186.701 44.667  1.00 180.61 ? 82   PHE C CZ  1 
ATOM   6328 N  N   . THR C 3  63  ? 43.348 192.567 47.017  1.00 159.16 ? 83   THR C N   1 
ATOM   6329 C  CA  . THR C 3  63  ? 44.418 193.478 47.414  1.00 166.09 ? 83   THR C CA  1 
ATOM   6330 C  C   . THR C 3  63  ? 44.897 193.200 48.835  1.00 162.27 ? 83   THR C C   1 
ATOM   6331 O  O   . THR C 3  63  ? 44.194 192.575 49.629  1.00 173.32 ? 83   THR C O   1 
ATOM   6332 C  CB  . THR C 3  63  ? 43.973 194.951 47.319  1.00 171.63 ? 83   THR C CB  1 
ATOM   6333 O  OG1 . THR C 3  63  ? 42.793 195.149 48.107  1.00 180.57 ? 83   THR C OG1 1 
ATOM   6334 C  CG2 . THR C 3  63  ? 43.686 195.333 45.875  1.00 186.81 ? 83   THR C CG2 1 
ATOM   6335 N  N   . GLY C 3  64  ? 46.101 193.670 49.146  1.00 148.28 ? 84   GLY C N   1 
ATOM   6336 C  CA  . GLY C 3  64  ? 46.672 193.504 50.469  1.00 139.01 ? 84   GLY C CA  1 
ATOM   6337 C  C   . GLY C 3  64  ? 47.333 194.769 50.980  1.00 153.34 ? 84   GLY C C   1 
ATOM   6338 O  O   . GLY C 3  64  ? 47.833 195.578 50.198  1.00 168.33 ? 84   GLY C O   1 
ATOM   6339 N  N   . SER C 3  65  ? 47.335 194.940 52.297  1.00 155.06 ? 85   SER C N   1 
ATOM   6340 C  CA  . SER C 3  65  ? 47.918 196.124 52.914  1.00 166.12 ? 85   SER C CA  1 
ATOM   6341 C  C   . SER C 3  65  ? 48.345 195.840 54.349  1.00 181.99 ? 85   SER C C   1 
ATOM   6342 O  O   . SER C 3  65  ? 48.019 194.793 54.909  1.00 196.50 ? 85   SER C O   1 
ATOM   6343 C  CB  . SER C 3  65  ? 46.926 197.288 52.882  1.00 192.66 ? 85   SER C CB  1 
ATOM   6344 O  OG  . SER C 3  65  ? 45.738 196.962 53.582  1.00 213.04 ? 85   SER C OG  1 
ATOM   6345 N  N   . GLY C 3  66  ? 49.074 196.780 54.940  1.00 182.07 ? 86   GLY C N   1 
ATOM   6346 C  CA  . GLY C 3  66  ? 49.545 196.636 56.304  1.00 175.65 ? 86   GLY C CA  1 
ATOM   6347 C  C   . GLY C 3  66  ? 51.056 196.583 56.405  1.00 171.45 ? 86   GLY C C   1 
ATOM   6348 O  O   . GLY C 3  66  ? 51.731 196.106 55.493  1.00 147.91 ? 86   GLY C O   1 
ATOM   6349 N  N   . SER C 3  67  ? 51.589 197.076 57.517  1.00 182.45 ? 87   SER C N   1 
ATOM   6350 C  CA  . SER C 3  67  ? 53.031 197.087 57.733  1.00 182.46 ? 87   SER C CA  1 
ATOM   6351 C  C   . SER C 3  67  ? 53.367 197.113 59.220  1.00 168.37 ? 87   SER C C   1 
ATOM   6352 O  O   . SER C 3  67  ? 53.326 198.165 59.858  1.00 178.89 ? 87   SER C O   1 
ATOM   6353 C  CB  . SER C 3  67  ? 53.669 198.286 57.030  1.00 198.88 ? 87   SER C CB  1 
ATOM   6354 O  OG  . SER C 3  67  ? 55.070 198.312 57.239  1.00 203.65 ? 87   SER C OG  1 
ATOM   6355 N  N   . GLY C 3  68  ? 53.701 195.948 59.766  1.00 145.90 ? 88   GLY C N   1 
ATOM   6356 C  CA  . GLY C 3  68  ? 54.043 195.835 61.172  1.00 162.64 ? 88   GLY C CA  1 
ATOM   6357 C  C   . GLY C 3  68  ? 53.543 194.551 61.805  1.00 163.77 ? 88   GLY C C   1 
ATOM   6358 O  O   . GLY C 3  68  ? 54.141 193.489 61.634  1.00 163.74 ? 88   GLY C O   1 
ATOM   6359 N  N   . THR C 3  69  ? 52.441 194.651 62.542  1.00 170.10 ? 89   THR C N   1 
ATOM   6360 C  CA  . THR C 3  69  ? 51.844 193.489 63.190  1.00 173.17 ? 89   THR C CA  1 
ATOM   6361 C  C   . THR C 3  69  ? 50.426 193.251 62.682  1.00 171.27 ? 89   THR C C   1 
ATOM   6362 O  O   . THR C 3  69  ? 50.023 192.112 62.448  1.00 171.78 ? 89   THR C O   1 
ATOM   6363 C  CB  . THR C 3  69  ? 51.813 193.649 64.721  1.00 200.65 ? 89   THR C CB  1 
ATOM   6364 O  OG1 . THR C 3  69  ? 51.059 194.817 65.067  1.00 219.34 ? 89   THR C OG1 1 
ATOM   6365 C  CG2 . THR C 3  69  ? 53.224 193.779 65.273  1.00 196.04 ? 89   THR C CG2 1 
ATOM   6366 N  N   . ASP C 3  70  ? 49.674 194.335 62.517  1.00 176.04 ? 90   ASP C N   1 
ATOM   6367 C  CA  . ASP C 3  70  ? 48.310 194.252 62.006  1.00 176.43 ? 90   ASP C CA  1 
ATOM   6368 C  C   . ASP C 3  70  ? 48.300 194.390 60.489  1.00 161.47 ? 90   ASP C C   1 
ATOM   6369 O  O   . ASP C 3  70  ? 48.855 195.342 59.941  1.00 173.82 ? 90   ASP C O   1 
ATOM   6370 C  CB  . ASP C 3  70  ? 47.430 195.332 62.639  1.00 197.59 ? 90   ASP C CB  1 
ATOM   6371 C  CG  . ASP C 3  70  ? 47.436 195.276 64.153  1.00 199.99 ? 90   ASP C CG  1 
ATOM   6372 O  OD1 . ASP C 3  70  ? 47.607 194.171 64.708  1.00 202.65 ? 90   ASP C OD1 1 
ATOM   6373 O  OD2 . ASP C 3  70  ? 47.271 196.339 64.787  1.00 197.51 ? 90   ASP C OD2 1 
ATOM   6374 N  N   . PHE C 3  71  ? 47.667 193.437 59.812  1.00 161.20 ? 91   PHE C N   1 
ATOM   6375 C  CA  . PHE C 3  71  ? 47.611 193.459 58.355  1.00 161.91 ? 91   PHE C CA  1 
ATOM   6376 C  C   . PHE C 3  71  ? 46.176 193.308 57.859  1.00 201.51 ? 91   PHE C C   1 
ATOM   6377 O  O   . PHE C 3  71  ? 45.313 192.810 58.579  1.00 217.32 ? 91   PHE C O   1 
ATOM   6378 C  CB  . PHE C 3  71  ? 48.505 192.362 57.774  1.00 151.52 ? 91   PHE C CB  1 
ATOM   6379 C  CG  . PHE C 3  71  ? 49.969 192.575 58.041  1.00 159.05 ? 91   PHE C CG  1 
ATOM   6380 C  CD1 . PHE C 3  71  ? 50.537 192.166 59.236  1.00 168.21 ? 91   PHE C CD1 1 
ATOM   6381 C  CD2 . PHE C 3  71  ? 50.775 193.193 57.100  1.00 153.37 ? 91   PHE C CD2 1 
ATOM   6382 C  CE1 . PHE C 3  71  ? 51.882 192.368 59.487  1.00 163.62 ? 91   PHE C CE1 1 
ATOM   6383 C  CE2 . PHE C 3  71  ? 52.121 193.395 57.344  1.00 145.53 ? 91   PHE C CE2 1 
ATOM   6384 C  CZ  . PHE C 3  71  ? 52.675 192.982 58.538  1.00 150.73 ? 91   PHE C CZ  1 
ATOM   6385 N  N   . THR C 3  72  ? 45.925 193.744 56.628  1.00 216.82 ? 92   THR C N   1 
ATOM   6386 C  CA  . THR C 3  72  ? 44.567 193.760 56.095  1.00 218.76 ? 92   THR C CA  1 
ATOM   6387 C  C   . THR C 3  72  ? 44.483 193.208 54.673  1.00 203.69 ? 92   THR C C   1 
ATOM   6388 O  O   . THR C 3  72  ? 45.190 193.664 53.774  1.00 205.73 ? 92   THR C O   1 
ATOM   6389 C  CB  . THR C 3  72  ? 43.984 195.188 56.106  1.00 219.41 ? 92   THR C CB  1 
ATOM   6390 O  OG1 . THR C 3  72  ? 44.004 195.705 57.443  1.00 224.53 ? 92   THR C OG1 1 
ATOM   6391 C  CG2 . THR C 3  72  ? 42.553 195.187 55.591  1.00 236.42 ? 92   THR C CG2 1 
ATOM   6392 N  N   . PHE C 3  73  ? 43.611 192.222 54.483  1.00 187.62 ? 93   PHE C N   1 
ATOM   6393 C  CA  . PHE C 3  73  ? 43.330 191.670 53.161  1.00 169.90 ? 93   PHE C CA  1 
ATOM   6394 C  C   . PHE C 3  73  ? 41.989 192.197 52.665  1.00 192.80 ? 93   PHE C C   1 
ATOM   6395 O  O   . PHE C 3  73  ? 40.967 192.029 53.330  1.00 210.93 ? 93   PHE C O   1 
ATOM   6396 C  CB  . PHE C 3  73  ? 43.326 190.141 53.206  1.00 147.90 ? 93   PHE C CB  1 
ATOM   6397 C  CG  . PHE C 3  73  ? 42.952 189.493 51.902  1.00 142.36 ? 93   PHE C CG  1 
ATOM   6398 C  CD1 . PHE C 3  73  ? 43.845 189.468 50.844  1.00 127.06 ? 93   PHE C CD1 1 
ATOM   6399 C  CD2 . PHE C 3  73  ? 41.712 188.895 51.742  1.00 135.63 ? 93   PHE C CD2 1 
ATOM   6400 C  CE1 . PHE C 3  73  ? 43.504 188.868 49.646  1.00 133.32 ? 93   PHE C CE1 1 
ATOM   6401 C  CE2 . PHE C 3  73  ? 41.366 188.292 50.548  1.00 135.34 ? 93   PHE C CE2 1 
ATOM   6402 C  CZ  . PHE C 3  73  ? 42.263 188.279 49.498  1.00 132.84 ? 93   PHE C CZ  1 
ATOM   6403 N  N   . THR C 3  74  ? 41.990 192.831 51.498  1.00 184.39 ? 94   THR C N   1 
ATOM   6404 C  CA  . THR C 3  74  ? 40.798 193.526 51.025  1.00 185.63 ? 94   THR C CA  1 
ATOM   6405 C  C   . THR C 3  74  ? 40.261 192.983 49.701  1.00 171.72 ? 94   THR C C   1 
ATOM   6406 O  O   . THR C 3  74  ? 41.005 192.816 48.731  1.00 162.26 ? 94   THR C O   1 
ATOM   6407 C  CB  . THR C 3  74  ? 41.070 195.035 50.863  1.00 209.45 ? 94   THR C CB  1 
ATOM   6408 O  OG1 . THR C 3  74  ? 41.604 195.559 52.086  1.00 214.29 ? 94   THR C OG1 1 
ATOM   6409 C  CG2 . THR C 3  74  ? 39.788 195.778 50.521  1.00 229.93 ? 94   THR C CG2 1 
ATOM   6410 N  N   . ILE C 3  75  ? 38.960 192.707 49.683  1.00 166.35 ? 95   ILE C N   1 
ATOM   6411 C  CA  . ILE C 3  75  ? 38.245 192.349 48.465  1.00 168.59 ? 95   ILE C CA  1 
ATOM   6412 C  C   . ILE C 3  75  ? 37.177 193.404 48.200  1.00 215.32 ? 95   ILE C C   1 
ATOM   6413 O  O   . ILE C 3  75  ? 36.341 193.687 49.063  1.00 250.22 ? 95   ILE C O   1 
ATOM   6414 C  CB  . ILE C 3  75  ? 37.619 190.948 48.561  1.00 166.80 ? 95   ILE C CB  1 
ATOM   6415 C  CG1 . ILE C 3  75  ? 38.694 189.893 48.822  1.00 160.08 ? 95   ILE C CG1 1 
ATOM   6416 C  CG2 . ILE C 3  75  ? 36.848 190.621 47.292  1.00 171.29 ? 95   ILE C CG2 1 
ATOM   6417 C  CD1 . ILE C 3  75  ? 38.146 188.486 48.940  1.00 155.23 ? 95   ILE C CD1 1 
ATOM   6418 N  N   . SER C 3  76  ? 37.210 193.985 47.005  1.00 192.93 ? 96   SER C N   1 
ATOM   6419 C  CA  . SER C 3  76  ? 36.274 195.043 46.639  1.00 218.33 ? 96   SER C CA  1 
ATOM   6420 C  C   . SER C 3  76  ? 34.955 194.474 46.125  1.00 227.80 ? 96   SER C C   1 
ATOM   6421 O  O   . SER C 3  76  ? 33.888 194.782 46.656  1.00 227.04 ? 96   SER C O   1 
ATOM   6422 C  CB  . SER C 3  76  ? 36.895 195.963 45.586  1.00 227.73 ? 96   SER C CB  1 
ATOM   6423 O  OG  . SER C 3  76  ? 37.257 195.237 44.424  1.00 230.93 ? 96   SER C OG  1 
ATOM   6424 N  N   . SER C 3  77  ? 35.032 193.646 45.088  1.00 249.49 ? 97   SER C N   1 
ATOM   6425 C  CA  . SER C 3  77  ? 33.840 193.048 44.497  1.00 258.87 ? 97   SER C CA  1 
ATOM   6426 C  C   . SER C 3  77  ? 33.753 191.560 44.816  1.00 249.82 ? 97   SER C C   1 
ATOM   6427 O  O   . SER C 3  77  ? 34.411 190.738 44.178  1.00 254.23 ? 97   SER C O   1 
ATOM   6428 C  CB  . SER C 3  77  ? 33.827 193.261 42.981  1.00 264.83 ? 97   SER C CB  1 
ATOM   6429 O  OG  . SER C 3  77  ? 32.677 192.677 42.394  1.00 273.36 ? 97   SER C OG  1 
ATOM   6430 N  N   . VAL C 3  78  ? 32.935 191.220 45.807  1.00 225.56 ? 98   VAL C N   1 
ATOM   6431 C  CA  . VAL C 3  78  ? 32.768 189.832 46.217  1.00 212.66 ? 98   VAL C CA  1 
ATOM   6432 C  C   . VAL C 3  78  ? 31.904 189.078 45.214  1.00 222.95 ? 98   VAL C C   1 
ATOM   6433 O  O   . VAL C 3  78  ? 30.741 189.419 45.002  1.00 261.03 ? 98   VAL C O   1 
ATOM   6434 C  CB  . VAL C 3  78  ? 32.161 189.737 47.627  1.00 211.46 ? 98   VAL C CB  1 
ATOM   6435 C  CG1 . VAL C 3  78  ? 31.939 188.282 48.012  1.00 207.62 ? 98   VAL C CG1 1 
ATOM   6436 C  CG2 . VAL C 3  78  ? 33.060 190.429 48.638  1.00 210.33 ? 98   VAL C CG2 1 
ATOM   6437 N  N   . GLN C 3  79  ? 32.481 188.052 44.596  1.00 199.38 ? 99   GLN C N   1 
ATOM   6438 C  CA  . GLN C 3  79  ? 31.742 187.211 43.663  1.00 209.81 ? 99   GLN C CA  1 
ATOM   6439 C  C   . GLN C 3  79  ? 31.233 185.959 44.369  1.00 197.69 ? 99   GLN C C   1 
ATOM   6440 O  O   . GLN C 3  79  ? 31.630 185.669 45.497  1.00 192.04 ? 99   GLN C O   1 
ATOM   6441 C  CB  . GLN C 3  79  ? 32.615 186.831 42.466  1.00 208.56 ? 99   GLN C CB  1 
ATOM   6442 C  CG  . GLN C 3  79  ? 33.050 188.013 41.613  1.00 213.42 ? 99   GLN C CG  1 
ATOM   6443 C  CD  . GLN C 3  79  ? 33.865 187.593 40.405  1.00 205.96 ? 99   GLN C CD  1 
ATOM   6444 O  OE1 . GLN C 3  79  ? 34.155 186.411 40.218  1.00 196.35 ? 99   GLN C OE1 1 
ATOM   6445 N  NE2 . GLN C 3  79  ? 34.238 188.561 39.576  1.00 192.99 ? 99   GLN C NE2 1 
ATOM   6446 N  N   . ALA C 3  80  ? 30.354 185.222 43.699  1.00 209.51 ? 100  ALA C N   1 
ATOM   6447 C  CA  . ALA C 3  80  ? 29.784 184.007 44.267  1.00 204.47 ? 100  ALA C CA  1 
ATOM   6448 C  C   . ALA C 3  80  ? 30.847 182.924 44.417  1.00 204.41 ? 100  ALA C C   1 
ATOM   6449 O  O   . ALA C 3  80  ? 30.747 182.060 45.286  1.00 212.04 ? 100  ALA C O   1 
ATOM   6450 C  CB  . ALA C 3  80  ? 28.634 183.507 43.407  1.00 223.96 ? 100  ALA C CB  1 
ATOM   6451 N  N   . GLU C 3  81  ? 31.867 182.982 43.567  1.00 203.22 ? 101  GLU C N   1 
ATOM   6452 C  CA  . GLU C 3  81  ? 32.940 181.995 43.587  1.00 207.93 ? 101  GLU C CA  1 
ATOM   6453 C  C   . GLU C 3  81  ? 34.079 182.420 44.510  1.00 209.88 ? 101  GLU C C   1 
ATOM   6454 O  O   . GLU C 3  81  ? 35.130 181.780 44.550  1.00 213.31 ? 101  GLU C O   1 
ATOM   6455 C  CB  . GLU C 3  81  ? 33.469 181.754 42.171  1.00 225.75 ? 101  GLU C CB  1 
ATOM   6456 C  CG  . GLU C 3  81  ? 33.903 183.016 41.442  1.00 239.72 ? 101  GLU C CG  1 
ATOM   6457 C  CD  . GLU C 3  81  ? 34.375 182.737 40.028  1.00 248.44 ? 101  GLU C CD  1 
ATOM   6458 O  OE1 . GLU C 3  81  ? 34.496 181.548 39.665  1.00 250.23 ? 101  GLU C OE1 1 
ATOM   6459 O  OE2 . GLU C 3  81  ? 34.621 183.705 39.279  1.00 253.37 ? 101  GLU C OE2 1 
ATOM   6460 N  N   . ASP C 3  82  ? 33.865 183.503 45.252  1.00 201.79 ? 102  ASP C N   1 
ATOM   6461 C  CA  . ASP C 3  82  ? 34.849 183.974 46.221  1.00 183.07 ? 102  ASP C CA  1 
ATOM   6462 C  C   . ASP C 3  82  ? 34.579 183.374 47.596  1.00 179.01 ? 102  ASP C C   1 
ATOM   6463 O  O   . ASP C 3  82  ? 35.124 183.826 48.602  1.00 175.89 ? 102  ASP C O   1 
ATOM   6464 C  CB  . ASP C 3  82  ? 34.843 185.501 46.302  1.00 177.07 ? 102  ASP C CB  1 
ATOM   6465 C  CG  . ASP C 3  82  ? 35.373 186.153 45.041  1.00 175.88 ? 102  ASP C CG  1 
ATOM   6466 O  OD1 . ASP C 3  82  ? 36.213 185.532 44.357  1.00 166.41 ? 102  ASP C OD1 1 
ATOM   6467 O  OD2 . ASP C 3  82  ? 34.952 187.288 44.736  1.00 207.92 ? 102  ASP C OD2 1 
ATOM   6468 N  N   . LEU C 3  83  ? 33.730 182.353 47.627  1.00 164.99 ? 103  LEU C N   1 
ATOM   6469 C  CA  . LEU C 3  83  ? 33.389 181.668 48.866  1.00 164.45 ? 103  LEU C CA  1 
ATOM   6470 C  C   . LEU C 3  83  ? 34.476 180.673 49.258  1.00 178.32 ? 103  LEU C C   1 
ATOM   6471 O  O   . LEU C 3  83  ? 34.557 179.579 48.699  1.00 197.09 ? 103  LEU C O   1 
ATOM   6472 C  CB  . LEU C 3  83  ? 32.047 180.950 48.722  1.00 172.01 ? 103  LEU C CB  1 
ATOM   6473 C  CG  . LEU C 3  83  ? 31.582 180.105 49.908  1.00 186.56 ? 103  LEU C CG  1 
ATOM   6474 C  CD1 . LEU C 3  83  ? 31.107 180.985 51.052  1.00 200.19 ? 103  LEU C CD1 1 
ATOM   6475 C  CD2 . LEU C 3  83  ? 30.491 179.150 49.470  1.00 191.89 ? 103  LEU C CD2 1 
ATOM   6476 N  N   . ALA C 3  84  ? 35.309 181.058 50.221  1.00 169.80 ? 104  ALA C N   1 
ATOM   6477 C  CA  . ALA C 3  84  ? 36.404 180.205 50.672  1.00 170.80 ? 104  ALA C CA  1 
ATOM   6478 C  C   . ALA C 3  84  ? 36.923 180.633 52.041  1.00 165.22 ? 104  ALA C C   1 
ATOM   6479 O  O   . ALA C 3  84  ? 36.533 181.676 52.566  1.00 183.86 ? 104  ALA C O   1 
ATOM   6480 C  CB  . ALA C 3  84  ? 37.536 180.217 49.656  1.00 182.00 ? 104  ALA C CB  1 
ATOM   6481 N  N   . VAL C 3  85  ? 37.804 179.818 52.612  1.00 149.66 ? 105  VAL C N   1 
ATOM   6482 C  CA  . VAL C 3  85  ? 38.429 180.133 53.890  1.00 129.51 ? 105  VAL C CA  1 
ATOM   6483 C  C   . VAL C 3  85  ? 39.782 180.788 53.642  1.00 132.53 ? 105  VAL C C   1 
ATOM   6484 O  O   . VAL C 3  85  ? 40.630 180.233 52.943  1.00 172.32 ? 105  VAL C O   1 
ATOM   6485 C  CB  . VAL C 3  85  ? 38.577 178.879 54.767  1.00 126.67 ? 105  VAL C CB  1 
ATOM   6486 C  CG1 . VAL C 3  85  ? 39.177 179.243 56.118  1.00 124.99 ? 105  VAL C CG1 1 
ATOM   6487 C  CG2 . VAL C 3  85  ? 37.232 178.191 54.940  1.00 149.68 ? 105  VAL C CG2 1 
ATOM   6488 N  N   . TYR C 3  86  ? 39.981 181.969 54.218  1.00 125.57 ? 106  TYR C N   1 
ATOM   6489 C  CA  . TYR C 3  86  ? 41.203 182.734 53.986  1.00 121.29 ? 106  TYR C CA  1 
ATOM   6490 C  C   . TYR C 3  86  ? 42.167 182.636 55.163  1.00 147.58 ? 106  TYR C C   1 
ATOM   6491 O  O   . TYR C 3  86  ? 41.769 182.778 56.320  1.00 145.19 ? 106  TYR C O   1 
ATOM   6492 C  CB  . TYR C 3  86  ? 40.865 184.200 53.701  1.00 126.39 ? 106  TYR C CB  1 
ATOM   6493 C  CG  . TYR C 3  86  ? 40.102 184.408 52.411  1.00 130.45 ? 106  TYR C CG  1 
ATOM   6494 C  CD1 . TYR C 3  86  ? 38.724 184.238 52.360  1.00 150.14 ? 106  TYR C CD1 1 
ATOM   6495 C  CD2 . TYR C 3  86  ? 40.761 184.772 51.244  1.00 127.96 ? 106  TYR C CD2 1 
ATOM   6496 C  CE1 . TYR C 3  86  ? 38.024 184.424 51.183  1.00 147.66 ? 106  TYR C CE1 1 
ATOM   6497 C  CE2 . TYR C 3  86  ? 40.069 184.960 50.062  1.00 132.20 ? 106  TYR C CE2 1 
ATOM   6498 C  CZ  . TYR C 3  86  ? 38.701 184.785 50.038  1.00 139.22 ? 106  TYR C CZ  1 
ATOM   6499 O  OH  . TYR C 3  86  ? 38.007 184.972 48.865  1.00 160.30 ? 106  TYR C OH  1 
ATOM   6500 N  N   . TYR C 3  87  ? 43.439 182.395 54.859  1.00 141.84 ? 107  TYR C N   1 
ATOM   6501 C  CA  . TYR C 3  87  ? 44.468 182.284 55.888  1.00 113.29 ? 107  TYR C CA  1 
ATOM   6502 C  C   . TYR C 3  87  ? 45.563 183.328 55.693  1.00 125.83 ? 107  TYR C C   1 
ATOM   6503 O  O   . TYR C 3  87  ? 45.822 183.763 54.571  1.00 136.07 ? 107  TYR C O   1 
ATOM   6504 C  CB  . TYR C 3  87  ? 45.086 180.883 55.884  1.00 114.91 ? 107  TYR C CB  1 
ATOM   6505 C  CG  . TYR C 3  87  ? 44.129 179.769 56.242  1.00 124.84 ? 107  TYR C CG  1 
ATOM   6506 C  CD1 . TYR C 3  87  ? 43.919 179.407 57.566  1.00 159.20 ? 107  TYR C CD1 1 
ATOM   6507 C  CD2 . TYR C 3  87  ? 43.445 179.069 55.256  1.00 122.96 ? 107  TYR C CD2 1 
ATOM   6508 C  CE1 . TYR C 3  87  ? 43.050 178.385 57.899  1.00 172.24 ? 107  TYR C CE1 1 
ATOM   6509 C  CE2 . TYR C 3  87  ? 42.573 178.045 55.580  1.00 123.73 ? 107  TYR C CE2 1 
ATOM   6510 C  CZ  . TYR C 3  87  ? 42.380 177.707 56.902  1.00 146.90 ? 107  TYR C CZ  1 
ATOM   6511 O  OH  . TYR C 3  87  ? 41.513 176.689 57.229  1.00 160.65 ? 107  TYR C OH  1 
ATOM   6512 N  N   . CYS C 3  88  ? 46.201 183.728 56.789  1.00 160.85 ? 108  CYS C N   1 
ATOM   6513 C  CA  . CYS C 3  88  ? 47.362 184.609 56.717  1.00 168.03 ? 108  CYS C CA  1 
ATOM   6514 C  C   . CYS C 3  88  ? 48.561 183.945 57.389  1.00 159.80 ? 108  CYS C C   1 
ATOM   6515 O  O   . CYS C 3  88  ? 48.426 183.314 58.437  1.00 178.78 ? 108  CYS C O   1 
ATOM   6516 C  CB  . CYS C 3  88  ? 47.066 185.971 57.355  1.00 177.92 ? 108  CYS C CB  1 
ATOM   6517 S  SG  . CYS C 3  88  ? 46.512 185.943 59.078  1.00 189.91 ? 108  CYS C SG  1 
ATOM   6518 N  N   . GLN C 3  89  ? 49.732 184.087 56.775  1.00 126.82 ? 109  GLN C N   1 
ATOM   6519 C  CA  . GLN C 3  89  ? 50.925 183.379 57.227  1.00 137.14 ? 109  GLN C CA  1 
ATOM   6520 C  C   . GLN C 3  89  ? 52.176 184.252 57.164  1.00 147.43 ? 109  GLN C C   1 
ATOM   6521 O  O   . GLN C 3  89  ? 52.441 184.899 56.153  1.00 154.64 ? 109  GLN C O   1 
ATOM   6522 C  CB  . GLN C 3  89  ? 51.125 182.113 56.388  1.00 119.82 ? 109  GLN C CB  1 
ATOM   6523 C  CG  . GLN C 3  89  ? 52.470 181.429 56.571  1.00 132.33 ? 109  GLN C CG  1 
ATOM   6524 C  CD  . GLN C 3  89  ? 53.362 181.563 55.351  1.00 122.22 ? 109  GLN C CD  1 
ATOM   6525 O  OE1 . GLN C 3  89  ? 53.986 182.601 55.133  1.00 125.79 ? 109  GLN C OE1 1 
ATOM   6526 N  NE2 . GLN C 3  89  ? 53.423 180.509 54.544  1.00 112.42 ? 109  GLN C NE2 1 
ATOM   6527 N  N   . GLN C 3  90  ? 52.943 184.264 58.251  1.00 148.17 ? 110  GLN C N   1 
ATOM   6528 C  CA  . GLN C 3  90  ? 54.207 184.992 58.291  1.00 131.98 ? 110  GLN C CA  1 
ATOM   6529 C  C   . GLN C 3  90  ? 55.315 184.160 57.656  1.00 132.28 ? 110  GLN C C   1 
ATOM   6530 O  O   . GLN C 3  90  ? 55.274 182.931 57.695  1.00 158.85 ? 110  GLN C O   1 
ATOM   6531 C  CB  . GLN C 3  90  ? 54.574 185.362 59.731  1.00 139.87 ? 110  GLN C CB  1 
ATOM   6532 C  CG  . GLN C 3  90  ? 54.673 184.179 60.690  1.00 152.08 ? 110  GLN C CG  1 
ATOM   6533 C  CD  . GLN C 3  90  ? 56.068 183.580 60.757  1.00 158.34 ? 110  GLN C CD  1 
ATOM   6534 O  OE1 . GLN C 3  90  ? 57.012 184.104 60.166  1.00 153.05 ? 110  GLN C OE1 1 
ATOM   6535 N  NE2 . GLN C 3  90  ? 56.203 182.476 61.483  1.00 164.76 ? 110  GLN C NE2 1 
ATOM   6536 N  N   . HIS C 3  91  ? 56.306 184.828 57.075  1.00 143.48 ? 111  HIS C N   1 
ATOM   6537 C  CA  . HIS C 3  91  ? 57.410 184.121 56.434  1.00 175.44 ? 111  HIS C CA  1 
ATOM   6538 C  C   . HIS C 3  91  ? 58.761 184.802 56.643  1.00 193.00 ? 111  HIS C C   1 
ATOM   6539 O  O   . HIS C 3  91  ? 59.465 185.118 55.684  1.00 201.59 ? 111  HIS C O   1 
ATOM   6540 C  CB  . HIS C 3  91  ? 57.132 183.945 54.936  1.00 158.76 ? 111  HIS C CB  1 
ATOM   6541 C  CG  . HIS C 3  91  ? 56.930 185.231 54.195  1.00 138.78 ? 111  HIS C CG  1 
ATOM   6542 N  ND1 . HIS C 3  91  ? 57.978 186.040 53.811  1.00 137.61 ? 111  HIS C ND1 1 
ATOM   6543 C  CD2 . HIS C 3  91  ? 55.803 185.844 53.761  1.00 132.56 ? 111  HIS C CD2 1 
ATOM   6544 C  CE1 . HIS C 3  91  ? 57.505 187.097 53.175  1.00 131.23 ? 111  HIS C CE1 1 
ATOM   6545 N  NE2 . HIS C 3  91  ? 56.189 187.003 53.132  1.00 121.95 ? 111  HIS C NE2 1 
ATOM   6546 N  N   . TYR C 3  92  ? 59.128 185.016 57.901  1.00 197.13 ? 112  TYR C N   1 
ATOM   6547 C  CA  . TYR C 3  92  ? 60.427 185.600 58.212  1.00 183.78 ? 112  TYR C CA  1 
ATOM   6548 C  C   . TYR C 3  92  ? 61.230 184.734 59.178  1.00 178.80 ? 112  TYR C C   1 
ATOM   6549 O  O   . TYR C 3  92  ? 62.406 184.461 58.941  1.00 208.55 ? 112  TYR C O   1 
ATOM   6550 C  CB  . TYR C 3  92  ? 60.246 187.013 58.781  1.00 201.48 ? 112  TYR C CB  1 
ATOM   6551 C  CG  . TYR C 3  92  ? 59.424 187.101 60.048  1.00 228.70 ? 112  TYR C CG  1 
ATOM   6552 C  CD1 . TYR C 3  92  ? 58.037 187.090 60.001  1.00 241.55 ? 112  TYR C CD1 1 
ATOM   6553 C  CD2 . TYR C 3  92  ? 60.036 187.218 61.290  1.00 248.44 ? 112  TYR C CD2 1 
ATOM   6554 C  CE1 . TYR C 3  92  ? 57.283 187.177 61.154  1.00 251.54 ? 112  TYR C CE1 1 
ATOM   6555 C  CE2 . TYR C 3  92  ? 59.289 187.306 62.449  1.00 259.36 ? 112  TYR C CE2 1 
ATOM   6556 C  CZ  . TYR C 3  92  ? 57.913 187.286 62.373  1.00 256.57 ? 112  TYR C CZ  1 
ATOM   6557 O  OH  . TYR C 3  92  ? 57.159 187.375 63.519  1.00 258.12 ? 112  TYR C OH  1 
ATOM   6558 N  N   . SER C 3  93  ? 60.592 184.288 60.255  1.00 131.16 ? 113  SER C N   1 
ATOM   6559 C  CA  . SER C 3  93  ? 61.282 183.504 61.271  1.00 134.18 ? 113  SER C CA  1 
ATOM   6560 C  C   . SER C 3  93  ? 60.868 182.038 61.232  1.00 140.11 ? 113  SER C C   1 
ATOM   6561 O  O   . SER C 3  93  ? 59.733 181.709 60.888  1.00 144.12 ? 113  SER C O   1 
ATOM   6562 C  CB  . SER C 3  93  ? 61.021 184.083 62.664  1.00 156.21 ? 113  SER C CB  1 
ATOM   6563 O  OG  . SER C 3  93  ? 61.724 183.357 63.658  1.00 165.89 ? 113  SER C OG  1 
ATOM   6564 N  N   . ILE C 3  94  ? 61.804 181.165 61.585  1.00 129.99 ? 114  ILE C N   1 
ATOM   6565 C  CA  . ILE C 3  94  ? 61.547 179.734 61.658  1.00 137.54 ? 114  ILE C CA  1 
ATOM   6566 C  C   . ILE C 3  94  ? 60.965 179.407 63.029  1.00 149.99 ? 114  ILE C C   1 
ATOM   6567 O  O   . ILE C 3  94  ? 61.510 179.826 64.050  1.00 159.96 ? 114  ILE C O   1 
ATOM   6568 C  CB  . ILE C 3  94  ? 62.834 178.928 61.384  1.00 145.03 ? 114  ILE C CB  1 
ATOM   6569 C  CG1 . ILE C 3  94  ? 63.400 179.285 60.007  1.00 118.92 ? 114  ILE C CG1 1 
ATOM   6570 C  CG2 . ILE C 3  94  ? 62.580 177.431 61.489  1.00 147.55 ? 114  ILE C CG2 1 
ATOM   6571 C  CD1 . ILE C 3  94  ? 64.668 178.537 59.656  1.00 155.54 ? 114  ILE C CD1 1 
ATOM   6572 N  N   . PRO C 3  95  ? 59.852 178.655 63.063  1.00 142.35 ? 115  PRO C N   1 
ATOM   6573 C  CA  . PRO C 3  95  ? 59.137 178.093 61.913  1.00 105.85 ? 115  PRO C CA  1 
ATOM   6574 C  C   . PRO C 3  95  ? 58.066 179.016 61.339  1.00 148.76 ? 115  PRO C C   1 
ATOM   6575 O  O   . PRO C 3  95  ? 57.708 180.017 61.960  1.00 166.98 ? 115  PRO C O   1 
ATOM   6576 C  CB  . PRO C 3  95  ? 58.496 176.839 62.500  1.00 113.14 ? 115  PRO C CB  1 
ATOM   6577 C  CG  . PRO C 3  95  ? 58.182 177.235 63.902  1.00 133.31 ? 115  PRO C CG  1 
ATOM   6578 C  CD  . PRO C 3  95  ? 59.283 178.180 64.337  1.00 155.87 ? 115  PRO C CD  1 
ATOM   6579 N  N   . ARG C 3  96  ? 57.561 178.668 60.159  1.00 145.37 ? 116  ARG C N   1 
ATOM   6580 C  CA  . ARG C 3  96  ? 56.473 179.411 59.535  1.00 123.80 ? 116  ARG C CA  1 
ATOM   6581 C  C   . ARG C 3  96  ? 55.140 179.011 60.158  1.00 133.84 ? 116  ARG C C   1 
ATOM   6582 O  O   . ARG C 3  96  ? 54.792 177.831 60.195  1.00 126.09 ? 116  ARG C O   1 
ATOM   6583 C  CB  . ARG C 3  96  ? 56.439 179.170 58.022  1.00 108.23 ? 116  ARG C CB  1 
ATOM   6584 C  CG  . ARG C 3  96  ? 57.509 179.910 57.225  1.00 143.45 ? 116  ARG C CG  1 
ATOM   6585 C  CD  . ARG C 3  96  ? 58.867 179.227 57.306  1.00 162.28 ? 116  ARG C CD  1 
ATOM   6586 N  NE  . ARG C 3  96  ? 59.848 179.856 56.426  1.00 147.42 ? 116  ARG C NE  1 
ATOM   6587 C  CZ  . ARG C 3  96  ? 60.613 180.886 56.774  1.00 148.79 ? 116  ARG C CZ  1 
ATOM   6588 N  NH1 . ARG C 3  96  ? 60.512 181.410 57.988  1.00 170.64 ? 116  ARG C NH1 1 
ATOM   6589 N  NH2 . ARG C 3  96  ? 61.479 181.393 55.907  1.00 125.14 ? 116  ARG C NH2 1 
ATOM   6590 N  N   . THR C 3  97  ? 54.396 179.997 60.649  1.00 119.28 ? 117  THR C N   1 
ATOM   6591 C  CA  . THR C 3  97  ? 53.119 179.730 61.300  1.00 128.80 ? 117  THR C CA  1 
ATOM   6592 C  C   . THR C 3  97  ? 51.962 180.387 60.554  1.00 134.56 ? 117  THR C C   1 
ATOM   6593 O  O   . THR C 3  97  ? 52.144 181.386 59.858  1.00 114.01 ? 117  THR C O   1 
ATOM   6594 C  CB  . THR C 3  97  ? 53.122 180.217 62.761  1.00 154.20 ? 117  THR C CB  1 
ATOM   6595 O  OG1 . THR C 3  97  ? 53.444 181.613 62.803  1.00 156.05 ? 117  THR C OG1 1 
ATOM   6596 C  CG2 . THR C 3  97  ? 54.145 179.440 63.577  1.00 156.25 ? 117  THR C CG2 1 
ATOM   6597 N  N   . PHE C 3  98  ? 50.771 179.815 60.706  1.00 147.88 ? 118  PHE C N   1 
ATOM   6598 C  CA  . PHE C 3  98  ? 49.578 180.326 60.040  1.00 122.11 ? 118  PHE C CA  1 
ATOM   6599 C  C   . PHE C 3  98  ? 48.627 180.993 61.029  1.00 116.95 ? 118  PHE C C   1 
ATOM   6600 O  O   . PHE C 3  98  ? 48.932 181.116 62.216  1.00 112.52 ? 118  PHE C O   1 
ATOM   6601 C  CB  . PHE C 3  98  ? 48.852 179.199 59.302  1.00 93.40  ? 118  PHE C CB  1 
ATOM   6602 C  CG  . PHE C 3  98  ? 49.617 178.646 58.135  1.00 96.50  ? 118  PHE C CG  1 
ATOM   6603 C  CD1 . PHE C 3  98  ? 50.565 177.654 58.317  1.00 134.77 ? 118  PHE C CD1 1 
ATOM   6604 C  CD2 . PHE C 3  98  ? 49.382 179.114 56.854  1.00 96.15  ? 118  PHE C CD2 1 
ATOM   6605 C  CE1 . PHE C 3  98  ? 51.269 177.143 57.243  1.00 145.60 ? 118  PHE C CE1 1 
ATOM   6606 C  CE2 . PHE C 3  98  ? 50.082 178.608 55.775  1.00 94.84  ? 118  PHE C CE2 1 
ATOM   6607 C  CZ  . PHE C 3  98  ? 51.027 177.621 55.970  1.00 97.61  ? 118  PHE C CZ  1 
ATOM   6608 N  N   . GLY C 3  99  ? 47.472 181.420 60.529  1.00 115.81 ? 119  GLY C N   1 
ATOM   6609 C  CA  . GLY C 3  99  ? 46.450 182.021 61.365  1.00 136.94 ? 119  GLY C CA  1 
ATOM   6610 C  C   . GLY C 3  99  ? 45.284 181.082 61.601  1.00 145.50 ? 119  GLY C C   1 
ATOM   6611 O  O   . GLY C 3  99  ? 45.282 179.951 61.115  1.00 116.78 ? 119  GLY C O   1 
ATOM   6612 N  N   . GLY C 3  100 ? 44.290 181.550 62.349  1.00 184.55 ? 120  GLY C N   1 
ATOM   6613 C  CA  . GLY C 3  100 ? 43.126 180.740 62.659  1.00 193.68 ? 120  GLY C CA  1 
ATOM   6614 C  C   . GLY C 3  100 ? 42.273 180.406 61.451  1.00 163.38 ? 120  GLY C C   1 
ATOM   6615 O  O   . GLY C 3  100 ? 41.758 179.295 61.330  1.00 154.11 ? 120  GLY C O   1 
ATOM   6616 N  N   . GLY C 3  101 ? 42.126 181.373 60.550  1.00 120.45 ? 121  GLY C N   1 
ATOM   6617 C  CA  . GLY C 3  101 ? 41.316 181.191 59.361  1.00 121.88 ? 121  GLY C CA  1 
ATOM   6618 C  C   . GLY C 3  101 ? 39.963 181.867 59.463  1.00 159.21 ? 121  GLY C C   1 
ATOM   6619 O  O   . GLY C 3  101 ? 39.248 181.700 60.452  1.00 175.47 ? 121  GLY C O   1 
ATOM   6620 N  N   . THR C 3  102 ? 39.609 182.633 58.436  1.00 153.21 ? 122  THR C N   1 
ATOM   6621 C  CA  . THR C 3  102 ? 38.340 183.350 58.418  1.00 158.69 ? 122  THR C CA  1 
ATOM   6622 C  C   . THR C 3  102 ? 37.424 182.825 57.316  1.00 166.78 ? 122  THR C C   1 
ATOM   6623 O  O   . THR C 3  102 ? 37.664 183.059 56.131  1.00 192.89 ? 122  THR C O   1 
ATOM   6624 C  CB  . THR C 3  102 ? 38.551 184.863 58.220  1.00 146.77 ? 122  THR C CB  1 
ATOM   6625 O  OG1 . THR C 3  102 ? 39.389 185.372 59.266  1.00 140.98 ? 122  THR C OG1 1 
ATOM   6626 C  CG2 . THR C 3  102 ? 37.219 185.595 58.245  1.00 154.82 ? 122  THR C CG2 1 
ATOM   6627 N  N   . LYS C 3  103 ? 36.376 182.111 57.714  1.00 148.28 ? 123  LYS C N   1 
ATOM   6628 C  CA  . LYS C 3  103 ? 35.410 181.574 56.762  1.00 150.28 ? 123  LYS C CA  1 
ATOM   6629 C  C   . LYS C 3  103 ? 34.454 182.668 56.302  1.00 159.95 ? 123  LYS C C   1 
ATOM   6630 O  O   . LYS C 3  103 ? 33.559 183.077 57.042  1.00 193.75 ? 123  LYS C O   1 
ATOM   6631 C  CB  . LYS C 3  103 ? 34.632 180.411 57.379  1.00 155.32 ? 123  LYS C CB  1 
ATOM   6632 C  CG  . LYS C 3  103 ? 33.672 179.726 56.420  1.00 158.27 ? 123  LYS C CG  1 
ATOM   6633 C  CD  . LYS C 3  103 ? 33.018 178.516 57.067  1.00 158.67 ? 123  LYS C CD  1 
ATOM   6634 C  CE  . LYS C 3  103 ? 32.108 177.790 56.091  1.00 176.56 ? 123  LYS C CE  1 
ATOM   6635 N  NZ  . LYS C 3  103 ? 31.492 176.579 56.701  1.00 171.46 ? 123  LYS C NZ  1 
ATOM   6636 N  N   . LEU C 3  104 ? 34.650 183.138 55.076  1.00 160.39 ? 124  LEU C N   1 
ATOM   6637 C  CA  . LEU C 3  104 ? 33.862 184.241 54.540  1.00 171.56 ? 124  LEU C CA  1 
ATOM   6638 C  C   . LEU C 3  104 ? 32.528 183.759 53.982  1.00 205.64 ? 124  LEU C C   1 
ATOM   6639 O  O   . LEU C 3  104 ? 32.456 183.275 52.854  1.00 196.81 ? 124  LEU C O   1 
ATOM   6640 C  CB  . LEU C 3  104 ? 34.648 184.976 53.453  1.00 163.30 ? 124  LEU C CB  1 
ATOM   6641 C  CG  . LEU C 3  104 ? 33.999 186.240 52.888  1.00 171.47 ? 124  LEU C CG  1 
ATOM   6642 C  CD1 . LEU C 3  104 ? 33.826 187.280 53.982  1.00 215.58 ? 124  LEU C CD1 1 
ATOM   6643 C  CD2 . LEU C 3  104 ? 34.823 186.796 51.738  1.00 168.21 ? 124  LEU C CD2 1 
ATOM   6644 N  N   . GLU C 3  105 ? 31.473 183.897 54.779  1.00 233.90 ? 125  GLU C N   1 
ATOM   6645 C  CA  . GLU C 3  105 ? 30.132 183.517 54.349  1.00 236.57 ? 125  GLU C CA  1 
ATOM   6646 C  C   . GLU C 3  105 ? 29.456 184.673 53.618  1.00 228.56 ? 125  GLU C C   1 
ATOM   6647 O  O   . GLU C 3  105 ? 29.644 185.838 53.972  1.00 235.86 ? 125  GLU C O   1 
ATOM   6648 C  CB  . GLU C 3  105 ? 29.289 183.070 55.546  1.00 240.07 ? 125  GLU C CB  1 
ATOM   6649 C  CG  . GLU C 3  105 ? 29.273 184.058 56.700  1.00 252.35 ? 125  GLU C CG  1 
ATOM   6650 C  CD  . GLU C 3  105 ? 28.531 183.526 57.911  1.00 269.81 ? 125  GLU C CD  1 
ATOM   6651 O  OE1 . GLU C 3  105 ? 27.949 182.425 57.816  1.00 281.64 ? 125  GLU C OE1 1 
ATOM   6652 O  OE2 . GLU C 3  105 ? 28.532 184.208 58.957  1.00 272.14 ? 125  GLU C OE2 1 
ATOM   6653 N  N   . ILE C 3  106 ? 28.670 184.345 52.598  1.00 219.01 ? 126  ILE C N   1 
ATOM   6654 C  CA  . ILE C 3  106 ? 28.038 185.358 51.761  1.00 218.19 ? 126  ILE C CA  1 
ATOM   6655 C  C   . ILE C 3  106 ? 26.590 185.596 52.183  1.00 203.04 ? 126  ILE C C   1 
ATOM   6656 O  O   . ILE C 3  106 ? 25.826 184.652 52.382  1.00 169.96 ? 126  ILE C O   1 
ATOM   6657 C  CB  . ILE C 3  106 ? 28.118 184.966 50.273  1.00 162.56 ? 126  ILE C CB  1 
ATOM   6658 C  CG1 . ILE C 3  106 ? 29.576 184.763 49.856  1.00 161.79 ? 126  ILE C CG1 1 
ATOM   6659 C  CG2 . ILE C 3  106 ? 27.460 186.024 49.402  1.00 180.00 ? 126  ILE C CG2 1 
ATOM   6660 C  CD1 . ILE C 3  106 ? 29.748 184.391 48.399  1.00 179.68 ? 126  ILE C CD1 1 
ATOM   6661 N  N   . LYS C 3  107 ? 26.223 186.868 52.317  1.00 207.97 ? 127  LYS C N   1 
ATOM   6662 C  CA  . LYS C 3  107 ? 24.873 187.250 52.717  1.00 209.40 ? 127  LYS C CA  1 
ATOM   6663 C  C   . LYS C 3  107 ? 24.029 187.647 51.509  1.00 224.02 ? 127  LYS C C   1 
ATOM   6664 O  O   . LYS C 3  107 ? 24.459 188.445 50.676  1.00 235.35 ? 127  LYS C O   1 
ATOM   6665 C  CB  . LYS C 3  107 ? 24.924 188.403 53.724  1.00 214.07 ? 127  LYS C CB  1 
ATOM   6666 C  CG  . LYS C 3  107 ? 23.562 188.910 54.173  1.00 217.20 ? 127  LYS C CG  1 
ATOM   6667 C  CD  . LYS C 3  107 ? 22.796 187.844 54.938  1.00 234.45 ? 127  LYS C CD  1 
ATOM   6668 C  CE  . LYS C 3  107 ? 21.455 188.368 55.425  1.00 244.20 ? 127  LYS C CE  1 
ATOM   6669 N  NZ  . LYS C 3  107 ? 21.612 189.532 56.341  1.00 237.35 ? 127  LYS C NZ  1 
ATOM   6670 N  N   . ARG C 3  108 ? 22.827 187.086 51.418  1.00 234.64 ? 128  ARG C N   1 
ATOM   6671 C  CA  . ARG C 3  108 ? 21.913 187.408 50.326  1.00 233.84 ? 128  ARG C CA  1 
ATOM   6672 C  C   . ARG C 3  108 ? 20.465 187.445 50.807  1.00 243.09 ? 128  ARG C C   1 
ATOM   6673 O  O   . ARG C 3  108 ? 20.200 187.458 52.009  1.00 239.90 ? 128  ARG C O   1 
ATOM   6674 C  CB  . ARG C 3  108 ? 22.055 186.397 49.186  1.00 208.16 ? 128  ARG C CB  1 
ATOM   6675 C  CG  . ARG C 3  108 ? 21.751 184.963 49.587  1.00 199.21 ? 128  ARG C CG  1 
ATOM   6676 C  CD  . ARG C 3  108 ? 21.285 184.147 48.393  1.00 198.30 ? 128  ARG C CD  1 
ATOM   6677 N  NE  . ARG C 3  108 ? 20.024 184.648 47.855  1.00 209.34 ? 128  ARG C NE  1 
ATOM   6678 C  CZ  . ARG C 3  108 ? 19.385 184.112 46.820  1.00 197.20 ? 128  ARG C CZ  1 
ATOM   6679 N  NH1 . ARG C 3  108 ? 19.888 183.052 46.203  1.00 178.48 ? 128  ARG C NH1 1 
ATOM   6680 N  NH2 . ARG C 3  108 ? 18.241 184.637 46.401  1.00 192.67 ? 128  ARG C NH2 1 
ATOM   6681 N  N   . ALA C 3  109 ? 19.534 187.460 49.859  1.00 251.02 ? 129  ALA C N   1 
ATOM   6682 C  CA  . ALA C 3  109 ? 18.112 187.473 50.180  1.00 253.29 ? 129  ALA C CA  1 
ATOM   6683 C  C   . ALA C 3  109 ? 17.639 186.084 50.596  1.00 242.39 ? 129  ALA C C   1 
ATOM   6684 O  O   . ALA C 3  109 ? 18.351 185.096 50.418  1.00 244.29 ? 129  ALA C O   1 
ATOM   6685 C  CB  . ALA C 3  109 ? 17.303 187.978 48.996  1.00 256.78 ? 129  ALA C CB  1 
ATOM   6686 N  N   . ASP C 3  110 ? 16.434 186.016 51.150  1.00 210.54 ? 130  ASP C N   1 
ATOM   6687 C  CA  . ASP C 3  110 ? 15.871 184.751 51.607  1.00 199.52 ? 130  ASP C CA  1 
ATOM   6688 C  C   . ASP C 3  110 ? 15.429 183.885 50.431  1.00 197.42 ? 130  ASP C C   1 
ATOM   6689 O  O   . ASP C 3  110 ? 15.155 184.391 49.343  1.00 192.56 ? 130  ASP C O   1 
ATOM   6690 C  CB  . ASP C 3  110 ? 14.692 185.002 52.550  1.00 200.84 ? 130  ASP C CB  1 
ATOM   6691 C  CG  . ASP C 3  110 ? 15.093 185.785 53.787  1.00 217.90 ? 130  ASP C CG  1 
ATOM   6692 O  OD1 . ASP C 3  110 ? 16.266 185.681 54.203  1.00 205.21 ? 130  ASP C OD1 1 
ATOM   6693 O  OD2 . ASP C 3  110 ? 14.235 186.503 54.343  1.00 247.41 ? 130  ASP C OD2 1 
ATOM   6694 N  N   . ALA C 3  111 ? 15.363 182.576 50.657  1.00 198.07 ? 131  ALA C N   1 
ATOM   6695 C  CA  . ALA C 3  111 ? 14.952 181.638 49.619  1.00 199.15 ? 131  ALA C CA  1 
ATOM   6696 C  C   . ALA C 3  111 ? 14.080 180.529 50.198  1.00 196.25 ? 131  ALA C C   1 
ATOM   6697 O  O   . ALA C 3  111 ? 14.322 180.052 51.307  1.00 198.09 ? 131  ALA C O   1 
ATOM   6698 C  CB  . ALA C 3  111 ? 16.169 181.049 48.924  1.00 209.77 ? 131  ALA C CB  1 
ATOM   6699 N  N   . ALA C 3  112 ? 13.067 180.122 49.440  1.00 192.02 ? 132  ALA C N   1 
ATOM   6700 C  CA  . ALA C 3  112 ? 12.147 179.081 49.883  1.00 199.82 ? 132  ALA C CA  1 
ATOM   6701 C  C   . ALA C 3  112 ? 12.705 177.667 49.750  1.00 178.75 ? 132  ALA C C   1 
ATOM   6702 O  O   . ALA C 3  112 ? 12.907 177.177 48.637  1.00 169.46 ? 132  ALA C O   1 
ATOM   6703 C  CB  . ALA C 3  112 ? 10.851 179.149 49.092  1.00 211.58 ? 132  ALA C CB  1 
ATOM   6704 N  N   . PRO C 3  113 ? 12.954 177.006 50.890  1.00 186.91 ? 133  PRO C N   1 
ATOM   6705 C  CA  . PRO C 3  113 ? 13.504 175.646 50.921  1.00 191.58 ? 133  PRO C CA  1 
ATOM   6706 C  C   . PRO C 3  113 ? 12.619 174.634 50.198  1.00 206.99 ? 133  PRO C C   1 
ATOM   6707 O  O   . PRO C 3  113 ? 11.543 174.291 50.688  1.00 226.18 ? 133  PRO C O   1 
ATOM   6708 C  CB  . PRO C 3  113 ? 13.616 175.353 52.421  1.00 201.08 ? 133  PRO C CB  1 
ATOM   6709 C  CG  . PRO C 3  113 ? 12.566 176.199 53.051  1.00 208.74 ? 133  PRO C CG  1 
ATOM   6710 C  CD  . PRO C 3  113 ? 12.501 177.448 52.224  1.00 199.55 ? 133  PRO C CD  1 
ATOM   6711 N  N   . THR C 3  114 ? 13.075 174.161 49.043  1.00 171.27 ? 134  THR C N   1 
ATOM   6712 C  CA  . THR C 3  114 ? 12.391 173.089 48.331  1.00 173.63 ? 134  THR C CA  1 
ATOM   6713 C  C   . THR C 3  114 ? 12.600 171.766 49.059  1.00 192.04 ? 134  THR C C   1 
ATOM   6714 O  O   . THR C 3  114 ? 13.721 171.261 49.145  1.00 207.80 ? 134  THR C O   1 
ATOM   6715 C  CB  . THR C 3  114 ? 12.885 172.963 46.879  1.00 170.39 ? 134  THR C CB  1 
ATOM   6716 O  OG1 . THR C 3  114 ? 12.634 174.188 46.179  1.00 168.95 ? 134  THR C OG1 1 
ATOM   6717 C  CG2 . THR C 3  114 ? 12.170 171.823 46.169  1.00 173.79 ? 134  THR C CG2 1 
ATOM   6718 N  N   . VAL C 3  115 ? 11.513 171.214 49.589  1.00 181.45 ? 135  VAL C N   1 
ATOM   6719 C  CA  . VAL C 3  115 ? 11.571 169.979 50.360  1.00 189.16 ? 135  VAL C CA  1 
ATOM   6720 C  C   . VAL C 3  115 ? 11.096 168.803 49.515  1.00 187.98 ? 135  VAL C C   1 
ATOM   6721 O  O   . VAL C 3  115 ? 10.065 168.885 48.847  1.00 206.47 ? 135  VAL C O   1 
ATOM   6722 C  CB  . VAL C 3  115 ? 10.740 170.096 51.652  1.00 190.22 ? 135  VAL C CB  1 
ATOM   6723 C  CG1 . VAL C 3  115 ? 10.852 168.824 52.478  1.00 194.16 ? 135  VAL C CG1 1 
ATOM   6724 C  CG2 . VAL C 3  115 ? 11.185 171.305 52.460  1.00 201.66 ? 135  VAL C CG2 1 
ATOM   6725 N  N   . SER C 3  116 ? 11.851 167.709 49.546  1.00 223.62 ? 136  SER C N   1 
ATOM   6726 C  CA  . SER C 3  116 ? 11.495 166.513 48.789  1.00 235.78 ? 136  SER C CA  1 
ATOM   6727 C  C   . SER C 3  116 ? 11.688 165.253 49.629  1.00 247.91 ? 136  SER C C   1 
ATOM   6728 O  O   . SER C 3  116 ? 12.801 164.943 50.051  1.00 234.32 ? 136  SER C O   1 
ATOM   6729 C  CB  . SER C 3  116 ? 12.325 166.424 47.506  1.00 230.67 ? 136  SER C CB  1 
ATOM   6730 O  OG  . SER C 3  116 ? 12.098 167.547 46.671  1.00 235.02 ? 136  SER C OG  1 
ATOM   6731 N  N   . ILE C 3  117 ? 10.597 164.531 49.867  1.00 262.05 ? 137  ILE C N   1 
ATOM   6732 C  CA  . ILE C 3  117 ? 10.640 163.324 50.684  1.00 263.15 ? 137  ILE C CA  1 
ATOM   6733 C  C   . ILE C 3  117 ? 10.772 162.090 49.790  1.00 261.05 ? 137  ILE C C   1 
ATOM   6734 O  O   . ILE C 3  117 ? 10.170 162.019 48.717  1.00 266.28 ? 137  ILE C O   1 
ATOM   6735 C  CB  . ILE C 3  117 ? 9.399  163.237 51.604  1.00 268.65 ? 137  ILE C CB  1 
ATOM   6736 C  CG1 . ILE C 3  117 ? 9.508  162.048 52.561  1.00 272.27 ? 137  ILE C CG1 1 
ATOM   6737 C  CG2 . ILE C 3  117 ? 8.116  163.163 50.783  1.00 277.33 ? 137  ILE C CG2 1 
ATOM   6738 C  CD1 . ILE C 3  117 ? 8.495  162.079 53.685  1.00 282.81 ? 137  ILE C CD1 1 
ATOM   6739 N  N   . PHE C 3  118 ? 11.576 161.127 50.230  1.00 257.07 ? 138  PHE C N   1 
ATOM   6740 C  CA  . PHE C 3  118 ? 11.843 159.928 49.442  1.00 256.47 ? 138  PHE C CA  1 
ATOM   6741 C  C   . PHE C 3  118 ? 11.647 158.652 50.258  1.00 269.02 ? 138  PHE C C   1 
ATOM   6742 O  O   . PHE C 3  118 ? 12.106 158.561 51.400  1.00 252.07 ? 138  PHE C O   1 
ATOM   6743 C  CB  . PHE C 3  118 ? 13.264 159.968 48.874  1.00 238.35 ? 138  PHE C CB  1 
ATOM   6744 C  CG  . PHE C 3  118 ? 13.477 161.040 47.841  1.00 235.82 ? 138  PHE C CG  1 
ATOM   6745 C  CD1 . PHE C 3  118 ? 13.870 162.314 48.215  1.00 224.55 ? 138  PHE C CD1 1 
ATOM   6746 C  CD2 . PHE C 3  118 ? 13.288 160.770 46.495  1.00 231.44 ? 138  PHE C CD2 1 
ATOM   6747 C  CE1 . PHE C 3  118 ? 14.068 163.302 47.266  1.00 205.44 ? 138  PHE C CE1 1 
ATOM   6748 C  CE2 . PHE C 3  118 ? 13.484 161.754 45.542  1.00 215.71 ? 138  PHE C CE2 1 
ATOM   6749 C  CZ  . PHE C 3  118 ? 13.874 163.020 45.929  1.00 204.73 ? 138  PHE C CZ  1 
ATOM   6750 N  N   . PRO C 3  119 ? 10.959 157.662 49.665  1.00 312.99 ? 139  PRO C N   1 
ATOM   6751 C  CA  . PRO C 3  119 ? 10.712 156.349 50.270  1.00 321.89 ? 139  PRO C CA  1 
ATOM   6752 C  C   . PRO C 3  119 ? 11.889 155.391 50.103  1.00 319.30 ? 139  PRO C C   1 
ATOM   6753 O  O   . PRO C 3  119 ? 12.664 155.541 49.158  1.00 328.83 ? 139  PRO C O   1 
ATOM   6754 C  CB  . PRO C 3  119 ? 9.492  155.844 49.499  1.00 334.46 ? 139  PRO C CB  1 
ATOM   6755 C  CG  . PRO C 3  119 ? 9.651  156.445 48.149  1.00 329.88 ? 139  PRO C CG  1 
ATOM   6756 C  CD  . PRO C 3  119 ? 10.280 157.801 48.364  1.00 317.12 ? 139  PRO C CD  1 
ATOM   6757 N  N   . PRO C 3  120 ? 12.022 154.418 51.017  1.00 272.38 ? 140  PRO C N   1 
ATOM   6758 C  CA  . PRO C 3  120 ? 13.070 153.392 50.942  1.00 258.25 ? 140  PRO C CA  1 
ATOM   6759 C  C   . PRO C 3  120 ? 12.964 152.538 49.681  1.00 324.88 ? 140  PRO C C   1 
ATOM   6760 O  O   . PRO C 3  120 ? 11.869 152.105 49.322  1.00 310.98 ? 140  PRO C O   1 
ATOM   6761 C  CB  . PRO C 3  120 ? 12.820 152.545 52.194  1.00 254.63 ? 140  PRO C CB  1 
ATOM   6762 C  CG  . PRO C 3  120 ? 12.094 153.454 53.126  1.00 253.83 ? 140  PRO C CG  1 
ATOM   6763 C  CD  . PRO C 3  120 ? 11.229 154.303 52.252  1.00 252.03 ? 140  PRO C CD  1 
ATOM   6764 N  N   . SER C 3  121 ? 14.094 152.301 49.022  1.00 413.56 ? 141  SER C N   1 
ATOM   6765 C  CA  . SER C 3  121 ? 14.112 151.519 47.791  1.00 425.41 ? 141  SER C CA  1 
ATOM   6766 C  C   . SER C 3  121 ? 13.996 150.026 48.077  1.00 425.84 ? 141  SER C C   1 
ATOM   6767 O  O   . SER C 3  121 ? 14.121 149.592 49.221  1.00 433.64 ? 141  SER C O   1 
ATOM   6768 C  CB  . SER C 3  121 ? 15.388 151.800 46.996  1.00 426.32 ? 141  SER C CB  1 
ATOM   6769 O  OG  . SER C 3  121 ? 16.543 151.480 47.752  1.00 427.11 ? 141  SER C OG  1 
ATOM   6770 N  N   . SER C 3  122 ? 13.761 149.247 47.026  1.00 392.74 ? 142  SER C N   1 
ATOM   6771 C  CA  . SER C 3  122 ? 13.610 147.802 47.157  1.00 370.37 ? 142  SER C CA  1 
ATOM   6772 C  C   . SER C 3  122 ? 14.936 147.132 47.501  1.00 363.95 ? 142  SER C C   1 
ATOM   6773 O  O   . SER C 3  122 ? 14.961 146.089 48.155  1.00 367.56 ? 142  SER C O   1 
ATOM   6774 C  CB  . SER C 3  122 ? 13.040 147.206 45.868  1.00 360.59 ? 142  SER C CB  1 
ATOM   6775 O  OG  . SER C 3  122 ? 13.892 147.465 44.766  1.00 352.14 ? 142  SER C OG  1 
ATOM   6776 N  N   . GLU C 3  123 ? 16.035 147.734 47.058  1.00 364.15 ? 143  GLU C N   1 
ATOM   6777 C  CA  . GLU C 3  123 ? 17.364 147.200 47.336  1.00 368.86 ? 143  GLU C CA  1 
ATOM   6778 C  C   . GLU C 3  123 ? 17.680 147.279 48.826  1.00 356.36 ? 143  GLU C C   1 
ATOM   6779 O  O   . GLU C 3  123 ? 18.388 146.428 49.366  1.00 360.69 ? 143  GLU C O   1 
ATOM   6780 C  CB  . GLU C 3  123 ? 18.429 147.949 46.531  1.00 366.06 ? 143  GLU C CB  1 
ATOM   6781 C  CG  . GLU C 3  123 ? 18.281 147.814 45.024  1.00 367.74 ? 143  GLU C CG  1 
ATOM   6782 C  CD  . GLU C 3  123 ? 19.445 148.424 44.268  1.00 357.18 ? 143  GLU C CD  1 
ATOM   6783 O  OE1 . GLU C 3  123 ? 19.372 148.503 43.024  1.00 362.37 ? 143  GLU C OE1 1 
ATOM   6784 O  OE2 . GLU C 3  123 ? 20.435 148.821 44.918  1.00 341.61 ? 143  GLU C OE2 1 
ATOM   6785 N  N   . GLN C 3  124 ? 17.152 148.305 49.484  1.00 316.26 ? 144  GLN C N   1 
ATOM   6786 C  CA  . GLN C 3  124 ? 17.342 148.470 50.920  1.00 299.81 ? 144  GLN C CA  1 
ATOM   6787 C  C   . GLN C 3  124 ? 16.401 147.546 51.685  1.00 316.82 ? 144  GLN C C   1 
ATOM   6788 O  O   . GLN C 3  124 ? 16.738 147.053 52.762  1.00 316.38 ? 144  GLN C O   1 
ATOM   6789 C  CB  . GLN C 3  124 ? 17.114 149.926 51.332  1.00 294.19 ? 144  GLN C CB  1 
ATOM   6790 C  CG  . GLN C 3  124 ? 17.413 150.212 52.795  1.00 294.60 ? 144  GLN C CG  1 
ATOM   6791 C  CD  . GLN C 3  124 ? 17.274 151.680 53.142  1.00 283.14 ? 144  GLN C CD  1 
ATOM   6792 O  OE1 . GLN C 3  124 ? 16.926 152.501 52.294  1.00 291.29 ? 144  GLN C OE1 1 
ATOM   6793 N  NE2 . GLN C 3  124 ? 17.549 152.020 54.397  1.00 265.66 ? 144  GLN C NE2 1 
ATOM   6794 N  N   . LEU C 3  125 ? 15.221 147.312 51.118  1.00 340.12 ? 145  LEU C N   1 
ATOM   6795 C  CA  . LEU C 3  125 ? 14.250 146.404 51.717  1.00 356.32 ? 145  LEU C CA  1 
ATOM   6796 C  C   . LEU C 3  125 ? 14.731 144.961 51.620  1.00 362.07 ? 145  LEU C C   1 
ATOM   6797 O  O   . LEU C 3  125 ? 14.352 144.114 52.429  1.00 374.79 ? 145  LEU C O   1 
ATOM   6798 C  CB  . LEU C 3  125 ? 12.884 146.552 51.044  1.00 366.73 ? 145  LEU C CB  1 
ATOM   6799 C  CG  . LEU C 3  125 ? 12.185 147.904 51.199  1.00 360.43 ? 145  LEU C CG  1 
ATOM   6800 C  CD1 . LEU C 3  125 ? 10.856 147.909 50.459  1.00 364.81 ? 145  LEU C CD1 1 
ATOM   6801 C  CD2 . LEU C 3  125 ? 11.987 148.242 52.669  1.00 359.30 ? 145  LEU C CD2 1 
ATOM   6802 N  N   . THR C 3  126 ? 15.567 144.687 50.623  1.00 353.62 ? 146  THR C N   1 
ATOM   6803 C  CA  . THR C 3  126 ? 16.132 143.356 50.438  1.00 352.72 ? 146  THR C CA  1 
ATOM   6804 C  C   . THR C 3  126 ? 17.082 143.019 51.583  1.00 351.78 ? 146  THR C C   1 
ATOM   6805 O  O   . THR C 3  126 ? 17.083 141.899 52.094  1.00 347.37 ? 146  THR C O   1 
ATOM   6806 C  CB  . THR C 3  126 ? 16.884 143.239 49.097  1.00 344.60 ? 146  THR C CB  1 
ATOM   6807 O  OG1 . THR C 3  126 ? 16.002 143.579 48.020  1.00 353.49 ? 146  THR C OG1 1 
ATOM   6808 C  CG2 . THR C 3  126 ? 17.400 141.822 48.894  1.00 344.17 ? 146  THR C CG2 1 
ATOM   6809 N  N   . SER C 3  127 ? 17.885 143.999 51.983  1.00 355.64 ? 147  SER C N   1 
ATOM   6810 C  CA  . SER C 3  127 ? 18.839 143.814 53.070  1.00 357.67 ? 147  SER C CA  1 
ATOM   6811 C  C   . SER C 3  127 ? 18.124 143.686 54.412  1.00 351.75 ? 147  SER C C   1 
ATOM   6812 O  O   . SER C 3  127 ? 18.537 142.909 55.273  1.00 359.49 ? 147  SER C O   1 
ATOM   6813 C  CB  . SER C 3  127 ? 19.835 144.974 53.112  1.00 346.94 ? 147  SER C CB  1 
ATOM   6814 O  OG  . SER C 3  127 ? 20.567 145.062 51.901  1.00 341.88 ? 147  SER C OG  1 
ATOM   6815 N  N   . GLY C 3  128 ? 17.052 144.452 54.585  1.00 324.69 ? 148  GLY C N   1 
ATOM   6816 C  CA  . GLY C 3  128 ? 16.274 144.408 55.809  1.00 298.93 ? 148  GLY C CA  1 
ATOM   6817 C  C   . GLY C 3  128 ? 16.224 145.727 56.555  1.00 306.16 ? 148  GLY C C   1 
ATOM   6818 O  O   . GLY C 3  128 ? 16.241 145.754 57.785  1.00 291.54 ? 148  GLY C O   1 
ATOM   6819 N  N   . GLY C 3  129 ? 16.161 146.825 55.808  1.00 321.79 ? 149  GLY C N   1 
ATOM   6820 C  CA  . GLY C 3  129 ? 16.092 148.149 56.399  1.00 319.11 ? 149  GLY C CA  1 
ATOM   6821 C  C   . GLY C 3  129 ? 15.242 149.104 55.584  1.00 331.08 ? 149  GLY C C   1 
ATOM   6822 O  O   . GLY C 3  129 ? 14.912 148.818 54.433  1.00 340.73 ? 149  GLY C O   1 
ATOM   6823 N  N   . ALA C 3  130 ? 14.886 150.240 56.176  1.00 325.83 ? 150  ALA C N   1 
ATOM   6824 C  CA  . ALA C 3  130 ? 14.052 151.218 55.484  1.00 326.08 ? 150  ALA C CA  1 
ATOM   6825 C  C   . ALA C 3  130 ? 14.252 152.624 56.039  1.00 305.76 ? 150  ALA C C   1 
ATOM   6826 O  O   . ALA C 3  130 ? 13.890 152.910 57.179  1.00 314.12 ? 150  ALA C O   1 
ATOM   6827 C  CB  . ALA C 3  130 ? 12.592 150.817 55.576  1.00 337.33 ? 150  ALA C CB  1 
ATOM   6828 N  N   . SER C 3  131 ? 14.820 153.503 55.220  1.00 278.41 ? 151  SER C N   1 
ATOM   6829 C  CA  . SER C 3  131 ? 15.102 154.868 55.647  1.00 263.20 ? 151  SER C CA  1 
ATOM   6830 C  C   . SER C 3  131 ? 14.351 155.894 54.805  1.00 268.22 ? 151  SER C C   1 
ATOM   6831 O  O   . SER C 3  131 ? 14.602 156.034 53.608  1.00 274.52 ? 151  SER C O   1 
ATOM   6832 C  CB  . SER C 3  131 ? 16.606 155.142 55.584  1.00 242.10 ? 151  SER C CB  1 
ATOM   6833 O  OG  . SER C 3  131 ? 17.324 154.238 56.406  1.00 239.40 ? 151  SER C OG  1 
ATOM   6834 N  N   . VAL C 3  132 ? 13.427 156.608 55.440  1.00 284.51 ? 152  VAL C N   1 
ATOM   6835 C  CA  . VAL C 3  132 ? 12.707 157.690 54.782  1.00 294.21 ? 152  VAL C CA  1 
ATOM   6836 C  C   . VAL C 3  132 ? 13.576 158.941 54.787  1.00 298.28 ? 152  VAL C C   1 
ATOM   6837 O  O   . VAL C 3  132 ? 14.117 159.326 55.825  1.00 295.89 ? 152  VAL C O   1 
ATOM   6838 C  CB  . VAL C 3  132 ? 11.352 157.956 55.458  1.00 296.48 ? 152  VAL C CB  1 
ATOM   6839 C  CG1 . VAL C 3  132 ? 10.626 159.098 54.763  1.00 289.20 ? 152  VAL C CG1 1 
ATOM   6840 C  CG2 . VAL C 3  132 ? 10.502 156.696 55.453  1.00 315.84 ? 152  VAL C CG2 1 
ATOM   6841 N  N   . VAL C 3  133 ? 13.711 159.571 53.624  1.00 294.53 ? 153  VAL C N   1 
ATOM   6842 C  CA  . VAL C 3  133 ? 14.597 160.721 53.486  1.00 282.39 ? 153  VAL C CA  1 
ATOM   6843 C  C   . VAL C 3  133 ? 13.792 162.006 53.308  1.00 279.88 ? 153  VAL C C   1 
ATOM   6844 O  O   . VAL C 3  133 ? 12.699 161.989 52.747  1.00 299.49 ? 153  VAL C O   1 
ATOM   6845 C  CB  . VAL C 3  133 ? 15.575 160.518 52.312  1.00 281.14 ? 153  VAL C CB  1 
ATOM   6846 C  CG1 . VAL C 3  133 ? 16.760 161.460 52.433  1.00 281.42 ? 153  VAL C CG1 1 
ATOM   6847 C  CG2 . VAL C 3  133 ? 16.041 159.070 52.254  1.00 286.03 ? 153  VAL C CG2 1 
ATOM   6848 N  N   . CYS C 3  134 ? 14.334 163.118 53.796  1.00 257.76 ? 154  CYS C N   1 
ATOM   6849 C  CA  . CYS C 3  134 ? 13.693 164.421 53.652  1.00 259.90 ? 154  CYS C CA  1 
ATOM   6850 C  C   . CYS C 3  134 ? 14.733 165.470 53.264  1.00 246.37 ? 154  CYS C C   1 
ATOM   6851 O  O   . CYS C 3  134 ? 15.465 165.976 54.115  1.00 233.46 ? 154  CYS C O   1 
ATOM   6852 C  CB  . CYS C 3  134 ? 12.986 164.824 54.949  1.00 267.42 ? 154  CYS C CB  1 
ATOM   6853 S  SG  . CYS C 3  134 ? 11.818 166.207 54.818  1.00 272.26 ? 154  CYS C SG  1 
ATOM   6854 N  N   . PHE C 3  135 ? 14.798 165.785 51.974  1.00 241.09 ? 155  PHE C N   1 
ATOM   6855 C  CA  . PHE C 3  135 ? 15.783 166.731 51.461  1.00 220.02 ? 155  PHE C CA  1 
ATOM   6856 C  C   . PHE C 3  135 ? 15.281 168.170 51.508  1.00 218.58 ? 155  PHE C C   1 
ATOM   6857 O  O   . PHE C 3  135 ? 14.115 168.445 51.221  1.00 231.91 ? 155  PHE C O   1 
ATOM   6858 C  CB  . PHE C 3  135 ? 16.175 166.371 50.025  1.00 218.18 ? 155  PHE C CB  1 
ATOM   6859 C  CG  . PHE C 3  135 ? 17.135 165.220 49.926  1.00 226.20 ? 155  PHE C CG  1 
ATOM   6860 C  CD1 . PHE C 3  135 ? 17.950 164.885 50.995  1.00 237.08 ? 155  PHE C CD1 1 
ATOM   6861 C  CD2 . PHE C 3  135 ? 17.227 164.475 48.761  1.00 216.94 ? 155  PHE C CD2 1 
ATOM   6862 C  CE1 . PHE C 3  135 ? 18.836 163.828 50.905  1.00 235.30 ? 155  PHE C CE1 1 
ATOM   6863 C  CE2 . PHE C 3  135 ? 18.111 163.417 48.666  1.00 217.80 ? 155  PHE C CE2 1 
ATOM   6864 C  CZ  . PHE C 3  135 ? 18.916 163.093 49.739  1.00 226.75 ? 155  PHE C CZ  1 
ATOM   6865 N  N   . LEU C 3  136 ? 16.178 169.082 51.870  1.00 228.16 ? 156  LEU C N   1 
ATOM   6866 C  CA  . LEU C 3  136 ? 15.872 170.507 51.901  1.00 227.88 ? 156  LEU C CA  1 
ATOM   6867 C  C   . LEU C 3  136 ? 16.903 171.263 51.070  1.00 227.24 ? 156  LEU C C   1 
ATOM   6868 O  O   . LEU C 3  136 ? 18.052 171.418 51.486  1.00 239.98 ? 156  LEU C O   1 
ATOM   6869 C  CB  . LEU C 3  136 ? 15.854 171.037 53.339  1.00 234.31 ? 156  LEU C CB  1 
ATOM   6870 C  CG  . LEU C 3  136 ? 14.836 170.467 54.332  1.00 241.00 ? 156  LEU C CG  1 
ATOM   6871 C  CD1 . LEU C 3  136 ? 15.305 169.148 54.933  1.00 246.31 ? 156  LEU C CD1 1 
ATOM   6872 C  CD2 . LEU C 3  136 ? 14.549 171.477 55.428  1.00 239.53 ? 156  LEU C CD2 1 
ATOM   6873 N  N   . ASN C 3  137 ? 16.492 171.730 49.895  1.00 211.05 ? 157  ASN C N   1 
ATOM   6874 C  CA  . ASN C 3  137 ? 17.422 172.361 48.964  1.00 200.76 ? 157  ASN C CA  1 
ATOM   6875 C  C   . ASN C 3  137 ? 17.113 173.838 48.729  1.00 193.22 ? 157  ASN C C   1 
ATOM   6876 O  O   . ASN C 3  137 ? 15.955 174.253 48.760  1.00 216.53 ? 157  ASN C O   1 
ATOM   6877 C  CB  . ASN C 3  137 ? 17.415 171.616 47.627  1.00 199.42 ? 157  ASN C CB  1 
ATOM   6878 C  CG  . ASN C 3  137 ? 17.775 170.150 47.774  1.00 207.72 ? 157  ASN C CG  1 
ATOM   6879 O  OD1 . ASN C 3  137 ? 18.515 169.769 48.680  1.00 223.21 ? 157  ASN C OD1 1 
ATOM   6880 N  ND2 . ASN C 3  137 ? 17.253 169.320 46.878  1.00 199.73 ? 157  ASN C ND2 1 
ATOM   6881 N  N   . ASN C 3  138 ? 18.169 174.616 48.499  1.00 183.37 ? 158  ASN C N   1 
ATOM   6882 C  CA  . ASN C 3  138 ? 18.064 176.027 48.128  1.00 178.69 ? 158  ASN C CA  1 
ATOM   6883 C  C   . ASN C 3  138 ? 17.291 176.866 49.143  1.00 173.88 ? 158  ASN C C   1 
ATOM   6884 O  O   . ASN C 3  138 ? 16.099 177.124 48.970  1.00 205.67 ? 158  ASN C O   1 
ATOM   6885 C  CB  . ASN C 3  138 ? 17.417 176.161 46.747  1.00 182.35 ? 158  ASN C CB  1 
ATOM   6886 C  CG  . ASN C 3  138 ? 18.171 175.397 45.675  1.00 198.21 ? 158  ASN C CG  1 
ATOM   6887 O  OD1 . ASN C 3  138 ? 17.889 174.226 45.417  1.00 183.96 ? 158  ASN C OD1 1 
ATOM   6888 N  ND2 . ASN C 3  138 ? 19.139 176.055 45.049  1.00 217.62 ? 158  ASN C ND2 1 
ATOM   6889 N  N   . PHE C 3  139 ? 17.978 177.294 50.197  1.00 159.20 ? 159  PHE C N   1 
ATOM   6890 C  CA  . PHE C 3  139 ? 17.386 178.186 51.188  1.00 166.30 ? 159  PHE C CA  1 
ATOM   6891 C  C   . PHE C 3  139 ? 18.462 178.992 51.908  1.00 162.46 ? 159  PHE C C   1 
ATOM   6892 O  O   . PHE C 3  139 ? 19.652 178.703 51.791  1.00 160.00 ? 159  PHE C O   1 
ATOM   6893 C  CB  . PHE C 3  139 ? 16.546 177.398 52.200  1.00 182.27 ? 159  PHE C CB  1 
ATOM   6894 C  CG  . PHE C 3  139 ? 17.322 176.366 52.972  1.00 174.32 ? 159  PHE C CG  1 
ATOM   6895 C  CD1 . PHE C 3  139 ? 17.458 175.076 52.486  1.00 173.21 ? 159  PHE C CD1 1 
ATOM   6896 C  CD2 . PHE C 3  139 ? 17.898 176.680 54.192  1.00 167.47 ? 159  PHE C CD2 1 
ATOM   6897 C  CE1 . PHE C 3  139 ? 18.164 174.123 53.197  1.00 164.50 ? 159  PHE C CE1 1 
ATOM   6898 C  CE2 . PHE C 3  139 ? 18.605 175.732 54.907  1.00 179.59 ? 159  PHE C CE2 1 
ATOM   6899 C  CZ  . PHE C 3  139 ? 18.738 174.451 54.408  1.00 172.85 ? 159  PHE C CZ  1 
ATOM   6900 N  N   . TYR C 3  140 ? 18.031 180.006 52.652  1.00 176.27 ? 160  TYR C N   1 
ATOM   6901 C  CA  . TYR C 3  140 ? 18.951 180.882 53.366  1.00 201.73 ? 160  TYR C CA  1 
ATOM   6902 C  C   . TYR C 3  140 ? 18.221 181.602 54.497  1.00 221.38 ? 160  TYR C C   1 
ATOM   6903 O  O   . TYR C 3  140 ? 17.109 182.090 54.303  1.00 227.76 ? 160  TYR C O   1 
ATOM   6904 C  CB  . TYR C 3  140 ? 19.582 181.891 52.403  1.00 204.85 ? 160  TYR C CB  1 
ATOM   6905 C  CG  . TYR C 3  140 ? 20.747 182.654 52.989  1.00 206.84 ? 160  TYR C CG  1 
ATOM   6906 C  CD1 . TYR C 3  140 ? 22.033 182.132 52.947  1.00 207.63 ? 160  TYR C CD1 1 
ATOM   6907 C  CD2 . TYR C 3  140 ? 20.561 183.893 53.586  1.00 215.49 ? 160  TYR C CD2 1 
ATOM   6908 C  CE1 . TYR C 3  140 ? 23.101 182.824 53.483  1.00 217.83 ? 160  TYR C CE1 1 
ATOM   6909 C  CE2 . TYR C 3  140 ? 21.623 184.592 54.124  1.00 228.50 ? 160  TYR C CE2 1 
ATOM   6910 C  CZ  . TYR C 3  140 ? 22.891 184.053 54.070  1.00 229.19 ? 160  TYR C CZ  1 
ATOM   6911 O  OH  . TYR C 3  140 ? 23.953 184.745 54.605  1.00 228.56 ? 160  TYR C OH  1 
ATOM   6912 N  N   . PRO C 3  141 ? 18.848 181.680 55.683  1.00 237.36 ? 161  PRO C N   1 
ATOM   6913 C  CA  . PRO C 3  141 ? 20.186 181.163 55.987  1.00 246.42 ? 161  PRO C CA  1 
ATOM   6914 C  C   . PRO C 3  141 ? 20.204 179.696 56.412  1.00 257.78 ? 161  PRO C C   1 
ATOM   6915 O  O   . PRO C 3  141 ? 19.325 178.922 56.033  1.00 250.71 ? 161  PRO C O   1 
ATOM   6916 C  CB  . PRO C 3  141 ? 20.638 182.058 57.139  1.00 238.24 ? 161  PRO C CB  1 
ATOM   6917 C  CG  . PRO C 3  141 ? 19.374 182.357 57.867  1.00 238.28 ? 161  PRO C CG  1 
ATOM   6918 C  CD  . PRO C 3  141 ? 18.286 182.435 56.818  1.00 241.18 ? 161  PRO C CD  1 
ATOM   6919 N  N   . LYS C 3  142 ? 21.210 179.332 57.201  1.00 273.89 ? 162  LYS C N   1 
ATOM   6920 C  CA  . LYS C 3  142 ? 21.401 177.954 57.641  1.00 278.07 ? 162  LYS C CA  1 
ATOM   6921 C  C   . LYS C 3  142 ? 20.363 177.537 58.680  1.00 280.30 ? 162  LYS C C   1 
ATOM   6922 O  O   . LYS C 3  142 ? 19.905 176.395 58.687  1.00 289.98 ? 162  LYS C O   1 
ATOM   6923 C  CB  . LYS C 3  142 ? 22.812 177.777 58.210  1.00 272.88 ? 162  LYS C CB  1 
ATOM   6924 C  CG  . LYS C 3  142 ? 23.117 176.378 58.720  1.00 269.23 ? 162  LYS C CG  1 
ATOM   6925 C  CD  . LYS C 3  142 ? 24.515 176.304 59.310  1.00 264.33 ? 162  LYS C CD  1 
ATOM   6926 C  CE  . LYS C 3  142 ? 24.814 174.916 59.852  1.00 265.21 ? 162  LYS C CE  1 
ATOM   6927 N  NZ  . LYS C 3  142 ? 26.183 174.833 60.429  1.00 269.01 ? 162  LYS C NZ  1 
ATOM   6928 N  N   . ASP C 3  143 ? 19.997 178.470 59.553  1.00 256.84 ? 163  ASP C N   1 
ATOM   6929 C  CA  . ASP C 3  143 ? 19.058 178.189 60.634  1.00 232.94 ? 163  ASP C CA  1 
ATOM   6930 C  C   . ASP C 3  143 ? 17.670 177.837 60.107  1.00 233.71 ? 163  ASP C C   1 
ATOM   6931 O  O   . ASP C 3  143 ? 17.008 178.659 59.474  1.00 237.78 ? 163  ASP C O   1 
ATOM   6932 C  CB  . ASP C 3  143 ? 18.965 179.386 61.582  1.00 242.05 ? 163  ASP C CB  1 
ATOM   6933 C  CG  . ASP C 3  143 ? 20.292 179.711 62.240  1.00 263.78 ? 163  ASP C CG  1 
ATOM   6934 O  OD1 . ASP C 3  143 ? 21.105 178.782 62.431  1.00 264.70 ? 163  ASP C OD1 1 
ATOM   6935 O  OD2 . ASP C 3  143 ? 20.522 180.894 62.566  1.00 279.59 ? 163  ASP C OD2 1 
ATOM   6936 N  N   . ILE C 3  144 ? 17.239 176.609 60.378  1.00 253.02 ? 164  ILE C N   1 
ATOM   6937 C  CA  . ILE C 3  144 ? 15.929 176.137 59.948  1.00 263.04 ? 164  ILE C CA  1 
ATOM   6938 C  C   . ILE C 3  144 ? 15.519 174.922 60.777  1.00 263.78 ? 164  ILE C C   1 
ATOM   6939 O  O   . ILE C 3  144 ? 16.334 174.040 61.049  1.00 262.33 ? 164  ILE C O   1 
ATOM   6940 C  CB  . ILE C 3  144 ? 15.921 175.816 58.437  1.00 265.13 ? 164  ILE C CB  1 
ATOM   6941 C  CG1 . ILE C 3  144 ? 14.571 175.232 58.013  1.00 275.23 ? 164  ILE C CG1 1 
ATOM   6942 C  CG2 . ILE C 3  144 ? 17.063 174.878 58.078  1.00 262.18 ? 164  ILE C CG2 1 
ATOM   6943 C  CD1 . ILE C 3  144 ? 14.466 174.955 56.531  1.00 267.83 ? 164  ILE C CD1 1 
ATOM   6944 N  N   . ASN C 3  145 ? 14.256 174.887 61.188  1.00 262.54 ? 165  ASN C N   1 
ATOM   6945 C  CA  . ASN C 3  145 ? 13.747 173.778 61.986  1.00 251.85 ? 165  ASN C CA  1 
ATOM   6946 C  C   . ASN C 3  145 ? 13.239 172.652 61.092  1.00 247.57 ? 165  ASN C C   1 
ATOM   6947 O  O   . ASN C 3  145 ? 12.672 172.899 60.029  1.00 217.75 ? 165  ASN C O   1 
ATOM   6948 C  CB  . ASN C 3  145 ? 12.632 174.256 62.919  1.00 254.84 ? 165  ASN C CB  1 
ATOM   6949 C  CG  . ASN C 3  145 ? 12.096 173.147 63.803  1.00 264.79 ? 165  ASN C CG  1 
ATOM   6950 O  OD1 . ASN C 3  145 ? 11.109 172.492 63.468  1.00 247.69 ? 165  ASN C OD1 1 
ATOM   6951 N  ND2 . ASN C 3  145 ? 12.748 172.930 64.940  1.00 280.74 ? 165  ASN C ND2 1 
ATOM   6952 N  N   . VAL C 3  146 ? 13.455 171.414 61.522  1.00 258.45 ? 166  VAL C N   1 
ATOM   6953 C  CA  . VAL C 3  146 ? 12.980 170.252 60.780  1.00 268.76 ? 166  VAL C CA  1 
ATOM   6954 C  C   . VAL C 3  146 ? 12.212 169.324 61.712  1.00 280.65 ? 166  VAL C C   1 
ATOM   6955 O  O   . VAL C 3  146 ? 12.762 168.823 62.693  1.00 294.13 ? 166  VAL C O   1 
ATOM   6956 C  CB  . VAL C 3  146 ? 14.141 169.502 60.102  1.00 265.83 ? 166  VAL C CB  1 
ATOM   6957 C  CG1 . VAL C 3  146 ? 13.632 168.231 59.440  1.00 264.11 ? 166  VAL C CG1 1 
ATOM   6958 C  CG2 . VAL C 3  146 ? 14.832 170.396 59.084  1.00 265.27 ? 166  VAL C CG2 1 
ATOM   6959 N  N   . LYS C 3  147 ? 10.939 169.096 61.404  1.00 269.82 ? 167  LYS C N   1 
ATOM   6960 C  CA  . LYS C 3  147 ? 10.101 168.240 62.236  1.00 255.98 ? 167  LYS C CA  1 
ATOM   6961 C  C   . LYS C 3  147 ? 9.608  167.020 61.464  1.00 245.51 ? 167  LYS C C   1 
ATOM   6962 O  O   . LYS C 3  147 ? 9.124  167.136 60.335  1.00 234.38 ? 167  LYS C O   1 
ATOM   6963 C  CB  . LYS C 3  147 ? 8.914  169.030 62.792  1.00 268.32 ? 167  LYS C CB  1 
ATOM   6964 C  CG  . LYS C 3  147 ? 8.055  168.245 63.770  1.00 288.97 ? 167  LYS C CG  1 
ATOM   6965 C  CD  . LYS C 3  147 ? 7.018  169.135 64.435  1.00 295.94 ? 167  LYS C CD  1 
ATOM   6966 C  CE  . LYS C 3  147 ? 7.676  170.243 65.241  1.00 292.99 ? 167  LYS C CE  1 
ATOM   6967 N  NZ  . LYS C 3  147 ? 6.672  171.112 65.912  1.00 289.00 ? 167  LYS C NZ  1 
ATOM   6968 N  N   . TRP C 3  148 ? 9.735  165.851 62.085  1.00 247.77 ? 168  TRP C N   1 
ATOM   6969 C  CA  . TRP C 3  148 ? 9.323  164.595 61.467  1.00 250.19 ? 168  TRP C CA  1 
ATOM   6970 C  C   . TRP C 3  148 ? 7.978  164.109 61.993  1.00 276.88 ? 168  TRP C C   1 
ATOM   6971 O  O   . TRP C 3  148 ? 7.620  164.355 63.144  1.00 283.70 ? 168  TRP C O   1 
ATOM   6972 C  CB  . TRP C 3  148 ? 10.381 163.515 61.694  1.00 239.07 ? 168  TRP C CB  1 
ATOM   6973 C  CG  . TRP C 3  148 ? 11.488 163.541 60.693  1.00 237.22 ? 168  TRP C CG  1 
ATOM   6974 C  CD1 . TRP C 3  148 ? 12.651 164.245 60.777  1.00 240.88 ? 168  TRP C CD1 1 
ATOM   6975 C  CD2 . TRP C 3  148 ? 11.538 162.827 59.452  1.00 235.16 ? 168  TRP C CD2 1 
ATOM   6976 N  NE1 . TRP C 3  148 ? 13.425 164.014 59.666  1.00 236.70 ? 168  TRP C NE1 1 
ATOM   6977 C  CE2 . TRP C 3  148 ? 12.763 163.148 58.837  1.00 237.59 ? 168  TRP C CE2 1 
ATOM   6978 C  CE3 . TRP C 3  148 ? 10.665 161.950 58.802  1.00 233.51 ? 168  TRP C CE3 1 
ATOM   6979 C  CZ2 . TRP C 3  148 ? 13.139 162.620 57.604  1.00 240.10 ? 168  TRP C CZ2 1 
ATOM   6980 C  CZ3 . TRP C 3  148 ? 11.040 161.427 57.577  1.00 234.37 ? 168  TRP C CZ3 1 
ATOM   6981 C  CH2 . TRP C 3  148 ? 12.265 161.765 56.991  1.00 242.44 ? 168  TRP C CH2 1 
ATOM   6982 N  N   . LYS C 3  149 ? 7.246  163.408 61.133  1.00 289.25 ? 169  LYS C N   1 
ATOM   6983 C  CA  . LYS C 3  149 ? 5.930  162.872 61.463  1.00 301.54 ? 169  LYS C CA  1 
ATOM   6984 C  C   . LYS C 3  149 ? 5.704  161.534 60.762  1.00 303.33 ? 169  LYS C C   1 
ATOM   6985 O  O   . LYS C 3  149 ? 5.517  161.484 59.543  1.00 306.50 ? 169  LYS C O   1 
ATOM   6986 C  CB  . LYS C 3  149 ? 4.824  163.858 61.071  1.00 313.89 ? 169  LYS C CB  1 
ATOM   6987 C  CG  . LYS C 3  149 ? 4.774  165.130 61.905  1.00 317.81 ? 169  LYS C CG  1 
ATOM   6988 C  CD  . LYS C 3  149 ? 3.706  166.084 61.393  1.00 324.46 ? 169  LYS C CD  1 
ATOM   6989 C  CE  . LYS C 3  149 ? 3.682  167.372 62.201  1.00 326.08 ? 169  LYS C CE  1 
ATOM   6990 N  NZ  . LYS C 3  149 ? 2.661  168.328 61.691  1.00 330.30 ? 169  LYS C NZ  1 
ATOM   6991 N  N   . ILE C 3  150 ? 5.816  160.428 61.510  1.00 298.47 ? 170  ILE C N   1 
ATOM   6992 C  CA  . ILE C 3  150 ? 5.501  159.082 60.973  1.00 307.96 ? 170  ILE C CA  1 
ATOM   6993 C  C   . ILE C 3  150 ? 4.022  158.756 60.666  1.00 323.70 ? 170  ILE C C   1 
ATOM   6994 O  O   . ILE C 3  150 ? 3.702  158.274 59.578  1.00 331.28 ? 170  ILE C O   1 
ATOM   6995 C  CB  . ILE C 3  150 ? 6.091  157.932 61.836  1.00 307.78 ? 170  ILE C CB  1 
ATOM   6996 C  CG1 . ILE C 3  150 ? 7.623  157.922 61.812  1.00 295.73 ? 170  ILE C CG1 1 
ATOM   6997 C  CG2 . ILE C 3  150 ? 5.544  156.587 61.382  1.00 326.71 ? 170  ILE C CG2 1 
ATOM   6998 C  CD1 . ILE C 3  150 ? 8.237  156.993 62.839  1.00 306.59 ? 170  ILE C CD1 1 
ATOM   6999 N  N   . ASP C 3  151 ? 3.125  159.061 61.605  1.00 326.88 ? 171  ASP C N   1 
ATOM   7000 C  CA  . ASP C 3  151 ? 1.687  158.984 61.371  1.00 320.67 ? 171  ASP C CA  1 
ATOM   7001 C  C   . ASP C 3  151 ? 0.958  160.025 62.212  1.00 326.55 ? 171  ASP C C   1 
ATOM   7002 O  O   . ASP C 3  151 ? 0.058  159.694 62.984  1.00 347.27 ? 171  ASP C O   1 
ATOM   7003 C  CB  . ASP C 3  151 ? 1.145  157.586 61.679  1.00 329.98 ? 171  ASP C CB  1 
ATOM   7004 C  CG  . ASP C 3  151 ? 1.571  156.556 60.653  1.00 322.62 ? 171  ASP C CG  1 
ATOM   7005 O  OD1 . ASP C 3  151 ? 1.656  156.903 59.456  1.00 312.21 ? 171  ASP C OD1 1 
ATOM   7006 O  OD2 . ASP C 3  151 ? 1.820  155.396 61.043  1.00 327.56 ? 171  ASP C OD2 1 
ATOM   7007 N  N   . GLY C 3  152 ? 1.352  161.285 62.059  1.00 301.02 ? 172  GLY C N   1 
ATOM   7008 C  CA  . GLY C 3  152 ? 0.752  162.369 62.815  1.00 303.61 ? 172  GLY C CA  1 
ATOM   7009 C  C   . GLY C 3  152 ? 1.500  162.676 64.098  1.00 309.93 ? 172  GLY C C   1 
ATOM   7010 O  O   . GLY C 3  152 ? 1.392  163.773 64.645  1.00 301.91 ? 172  GLY C O   1 
ATOM   7011 N  N   . SER C 3  153 ? 2.262  161.698 64.578  1.00 329.45 ? 173  SER C N   1 
ATOM   7012 C  CA  . SER C 3  153 ? 3.050  161.865 65.793  1.00 349.11 ? 173  SER C CA  1 
ATOM   7013 C  C   . SER C 3  153 ? 4.445  162.387 65.467  1.00 343.91 ? 173  SER C C   1 
ATOM   7014 O  O   . SER C 3  153 ? 5.084  161.926 64.522  1.00 325.85 ? 173  SER C O   1 
ATOM   7015 C  CB  . SER C 3  153 ? 3.146  160.542 66.557  1.00 356.51 ? 173  SER C CB  1 
ATOM   7016 O  OG  . SER C 3  153 ? 3.930  160.685 67.728  1.00 360.63 ? 173  SER C OG  1 
ATOM   7017 N  N   . GLU C 3  154 ? 4.910  163.353 66.254  1.00 344.64 ? 174  GLU C N   1 
ATOM   7018 C  CA  . GLU C 3  154 ? 6.222  163.951 66.037  1.00 340.36 ? 174  GLU C CA  1 
ATOM   7019 C  C   . GLU C 3  154 ? 7.339  162.962 66.350  1.00 351.22 ? 174  GLU C C   1 
ATOM   7020 O  O   . GLU C 3  154 ? 7.636  162.693 67.515  1.00 358.67 ? 174  GLU C O   1 
ATOM   7021 C  CB  . GLU C 3  154 ? 6.385  165.213 66.887  1.00 345.94 ? 174  GLU C CB  1 
ATOM   7022 C  CG  . GLU C 3  154 ? 7.743  165.884 66.744  1.00 345.82 ? 174  GLU C CG  1 
ATOM   7023 C  CD  . GLU C 3  154 ? 7.881  167.116 67.617  1.00 348.43 ? 174  GLU C CD  1 
ATOM   7024 O  OE1 . GLU C 3  154 ? 6.872  167.532 68.225  1.00 357.97 ? 174  GLU C OE1 1 
ATOM   7025 O  OE2 . GLU C 3  154 ? 8.998  167.669 67.696  1.00 337.23 ? 174  GLU C OE2 1 
ATOM   7026 N  N   . ARG C 3  155 ? 7.953  162.421 65.304  1.00 347.02 ? 175  ARG C N   1 
ATOM   7027 C  CA  . ARG C 3  155 ? 9.067  161.496 65.469  1.00 348.19 ? 175  ARG C CA  1 
ATOM   7028 C  C   . ARG C 3  155 ? 10.358 162.267 65.708  1.00 338.78 ? 175  ARG C C   1 
ATOM   7029 O  O   . ARG C 3  155 ? 10.641 163.248 65.020  1.00 323.51 ? 175  ARG C O   1 
ATOM   7030 C  CB  . ARG C 3  155 ? 9.206  160.591 64.245  1.00 341.96 ? 175  ARG C CB  1 
ATOM   7031 C  CG  . ARG C 3  155 ? 10.270 159.517 64.391  1.00 330.52 ? 175  ARG C CG  1 
ATOM   7032 C  CD  . ARG C 3  155 ? 10.003 158.650 65.610  1.00 336.46 ? 175  ARG C CD  1 
ATOM   7033 N  NE  . ARG C 3  155 ? 10.972 157.565 65.732  1.00 340.54 ? 175  ARG C NE  1 
ATOM   7034 C  CZ  . ARG C 3  155 ? 10.952 156.652 66.697  1.00 359.04 ? 175  ARG C CZ  1 
ATOM   7035 N  NH1 . ARG C 3  155 ? 10.011 156.691 67.631  1.00 371.71 ? 175  ARG C NH1 1 
ATOM   7036 N  NH2 . ARG C 3  155 ? 11.874 155.700 66.730  1.00 362.78 ? 175  ARG C NH2 1 
ATOM   7037 N  N   . GLN C 3  156 ? 11.140 161.821 66.685  1.00 345.59 ? 176  GLN C N   1 
ATOM   7038 C  CA  . GLN C 3  156 ? 12.368 162.517 67.045  1.00 352.53 ? 176  GLN C CA  1 
ATOM   7039 C  C   . GLN C 3  156 ? 13.559 161.563 67.079  1.00 359.47 ? 176  GLN C C   1 
ATOM   7040 O  O   . GLN C 3  156 ? 14.711 161.993 67.024  1.00 347.11 ? 176  GLN C O   1 
ATOM   7041 C  CB  . GLN C 3  156 ? 12.208 163.208 68.399  1.00 362.91 ? 176  GLN C CB  1 
ATOM   7042 C  CG  . GLN C 3  156 ? 13.143 164.385 68.610  1.00 365.46 ? 176  GLN C CG  1 
ATOM   7043 C  CD  . GLN C 3  156 ? 12.748 165.598 67.789  1.00 360.58 ? 176  GLN C CD  1 
ATOM   7044 O  OE1 . GLN C 3  156 ? 11.636 165.675 67.266  1.00 352.66 ? 176  GLN C OE1 1 
ATOM   7045 N  NE2 . GLN C 3  156 ? 13.662 166.555 67.672  1.00 360.55 ? 176  GLN C NE2 1 
ATOM   7046 N  N   . ASN C 3  157 ? 13.274 160.269 67.171  1.00 374.41 ? 177  ASN C N   1 
ATOM   7047 C  CA  . ASN C 3  157 ? 14.324 159.257 67.213  1.00 375.54 ? 177  ASN C CA  1 
ATOM   7048 C  C   . ASN C 3  157 ? 14.685 158.771 65.813  1.00 378.48 ? 177  ASN C C   1 
ATOM   7049 O  O   . ASN C 3  157 ? 13.812 158.579 64.967  1.00 380.13 ? 177  ASN C O   1 
ATOM   7050 C  CB  . ASN C 3  157 ? 13.894 158.075 68.084  1.00 389.48 ? 177  ASN C CB  1 
ATOM   7051 C  CG  . ASN C 3  157 ? 13.812 158.435 69.553  1.00 401.08 ? 177  ASN C CG  1 
ATOM   7052 O  OD1 . ASN C 3  157 ? 13.870 159.608 69.919  1.00 400.29 ? 177  ASN C OD1 1 
ATOM   7053 N  ND2 . ASN C 3  157 ? 13.677 157.425 70.405  1.00 412.66 ? 177  ASN C ND2 1 
ATOM   7054 N  N   . GLY C 3  158 ? 15.978 158.574 65.579  1.00 372.68 ? 178  GLY C N   1 
ATOM   7055 C  CA  . GLY C 3  158 ? 16.458 158.097 64.296  1.00 361.13 ? 178  GLY C CA  1 
ATOM   7056 C  C   . GLY C 3  158 ? 16.528 159.178 63.236  1.00 338.73 ? 178  GLY C C   1 
ATOM   7057 O  O   . GLY C 3  158 ? 16.527 158.888 62.041  1.00 341.96 ? 178  GLY C O   1 
ATOM   7058 N  N   . VAL C 3  159 ? 16.592 160.430 63.677  1.00 293.46 ? 179  VAL C N   1 
ATOM   7059 C  CA  . VAL C 3  159 ? 16.645 161.564 62.763  1.00 256.68 ? 179  VAL C CA  1 
ATOM   7060 C  C   . VAL C 3  159 ? 18.039 162.179 62.752  1.00 257.73 ? 179  VAL C C   1 
ATOM   7061 O  O   . VAL C 3  159 ? 18.588 162.514 63.802  1.00 236.27 ? 179  VAL C O   1 
ATOM   7062 C  CB  . VAL C 3  159 ? 15.590 162.622 63.134  1.00 230.52 ? 179  VAL C CB  1 
ATOM   7063 C  CG1 . VAL C 3  159 ? 15.736 163.851 62.251  1.00 213.40 ? 179  VAL C CG1 1 
ATOM   7064 C  CG2 . VAL C 3  159 ? 14.191 162.037 63.021  1.00 228.28 ? 179  VAL C CG2 1 
ATOM   7065 N  N   . LEU C 3  160 ? 18.609 162.327 61.559  1.00 276.59 ? 180  LEU C N   1 
ATOM   7066 C  CA  . LEU C 3  160 ? 19.926 162.938 61.414  1.00 274.26 ? 180  LEU C CA  1 
ATOM   7067 C  C   . LEU C 3  160 ? 19.890 164.119 60.449  1.00 257.82 ? 180  LEU C C   1 
ATOM   7068 O  O   . LEU C 3  160 ? 19.561 163.963 59.274  1.00 257.52 ? 180  LEU C O   1 
ATOM   7069 C  CB  . LEU C 3  160 ? 20.949 161.904 60.938  1.00 273.69 ? 180  LEU C CB  1 
ATOM   7070 C  CG  . LEU C 3  160 ? 21.282 160.776 61.915  1.00 267.42 ? 180  LEU C CG  1 
ATOM   7071 C  CD1 . LEU C 3  160 ? 22.323 159.840 61.321  1.00 266.84 ? 180  LEU C CD1 1 
ATOM   7072 C  CD2 . LEU C 3  160 ? 21.761 161.341 63.243  1.00 261.59 ? 180  LEU C CD2 1 
ATOM   7073 N  N   . ASN C 3  161 ? 20.229 165.300 60.955  1.00 241.21 ? 181  ASN C N   1 
ATOM   7074 C  CA  . ASN C 3  161 ? 20.277 166.502 60.130  1.00 224.58 ? 181  ASN C CA  1 
ATOM   7075 C  C   . ASN C 3  161 ? 21.697 166.768 59.644  1.00 220.28 ? 181  ASN C C   1 
ATOM   7076 O  O   . ASN C 3  161 ? 22.642 166.774 60.432  1.00 210.11 ? 181  ASN C O   1 
ATOM   7077 C  CB  . ASN C 3  161 ? 19.752 167.712 60.906  1.00 226.16 ? 181  ASN C CB  1 
ATOM   7078 C  CG  . ASN C 3  161 ? 18.262 167.632 61.171  1.00 242.25 ? 181  ASN C CG  1 
ATOM   7079 O  OD1 . ASN C 3  161 ? 17.510 167.056 60.386  1.00 230.00 ? 181  ASN C OD1 1 
ATOM   7080 N  ND2 . ASN C 3  161 ? 17.827 168.215 62.283  1.00 261.96 ? 181  ASN C ND2 1 
ATOM   7081 N  N   . SER C 3  162 ? 21.841 166.988 58.341  1.00 222.26 ? 182  SER C N   1 
ATOM   7082 C  CA  . SER C 3  162 ? 23.149 167.240 57.751  1.00 211.49 ? 182  SER C CA  1 
ATOM   7083 C  C   . SER C 3  162 ? 23.147 168.523 56.924  1.00 193.09 ? 182  SER C C   1 
ATOM   7084 O  O   . SER C 3  162 ? 22.546 168.580 55.850  1.00 199.88 ? 182  SER C O   1 
ATOM   7085 C  CB  . SER C 3  162 ? 23.581 166.057 56.883  1.00 198.85 ? 182  SER C CB  1 
ATOM   7086 O  OG  . SER C 3  162 ? 24.857 166.284 56.310  1.00 191.49 ? 182  SER C OG  1 
ATOM   7087 N  N   . TRP C 3  163 ? 23.821 169.548 57.436  1.00 189.03 ? 183  TRP C N   1 
ATOM   7088 C  CA  . TRP C 3  163 ? 23.945 170.818 56.729  1.00 187.95 ? 183  TRP C CA  1 
ATOM   7089 C  C   . TRP C 3  163 ? 25.210 170.850 55.881  1.00 190.14 ? 183  TRP C C   1 
ATOM   7090 O  O   . TRP C 3  163 ? 26.305 170.579 56.374  1.00 202.83 ? 183  TRP C O   1 
ATOM   7091 C  CB  . TRP C 3  163 ? 23.954 171.991 57.713  1.00 187.28 ? 183  TRP C CB  1 
ATOM   7092 C  CG  . TRP C 3  163 ? 22.637 172.245 58.380  1.00 211.37 ? 183  TRP C CG  1 
ATOM   7093 C  CD1 . TRP C 3  163 ? 21.544 172.848 57.830  1.00 209.17 ? 183  TRP C CD1 1 
ATOM   7094 C  CD2 . TRP C 3  163 ? 22.280 171.921 59.729  1.00 234.85 ? 183  TRP C CD2 1 
ATOM   7095 N  NE1 . TRP C 3  163 ? 20.525 172.911 58.748  1.00 200.23 ? 183  TRP C NE1 1 
ATOM   7096 C  CE2 . TRP C 3  163 ? 20.952 172.349 59.924  1.00 225.53 ? 183  TRP C CE2 1 
ATOM   7097 C  CE3 . TRP C 3  163 ? 22.953 171.307 60.790  1.00 234.89 ? 183  TRP C CE3 1 
ATOM   7098 C  CZ2 . TRP C 3  163 ? 20.283 172.183 61.134  1.00 230.00 ? 183  TRP C CZ2 1 
ATOM   7099 C  CZ3 . TRP C 3  163 ? 22.287 171.143 61.992  1.00 239.00 ? 183  TRP C CZ3 1 
ATOM   7100 C  CH2 . TRP C 3  163 ? 20.966 171.580 62.154  1.00 242.68 ? 183  TRP C CH2 1 
ATOM   7101 N  N   . THR C 3  164 ? 25.055 171.184 54.605  1.00 181.15 ? 184  THR C N   1 
ATOM   7102 C  CA  . THR C 3  164 ? 26.200 171.339 53.717  1.00 165.09 ? 184  THR C CA  1 
ATOM   7103 C  C   . THR C 3  164 ? 26.777 172.740 53.861  1.00 186.74 ? 184  THR C C   1 
ATOM   7104 O  O   . THR C 3  164 ? 26.193 173.595 54.526  1.00 199.01 ? 184  THR C O   1 
ATOM   7105 C  CB  . THR C 3  164 ? 25.823 171.097 52.243  1.00 149.37 ? 184  THR C CB  1 
ATOM   7106 O  OG1 . THR C 3  164 ? 25.011 172.179 51.772  1.00 149.34 ? 184  THR C OG1 1 
ATOM   7107 C  CG2 . THR C 3  164 ? 25.052 169.798 52.096  1.00 151.29 ? 184  THR C CG2 1 
ATOM   7108 N  N   . ASP C 3  165 ? 27.927 172.973 53.238  1.00 223.91 ? 185  ASP C N   1 
ATOM   7109 C  CA  . ASP C 3  165 ? 28.515 174.305 53.216  1.00 239.04 ? 185  ASP C CA  1 
ATOM   7110 C  C   . ASP C 3  165 ? 27.734 175.192 52.254  1.00 219.50 ? 185  ASP C C   1 
ATOM   7111 O  O   . ASP C 3  165 ? 26.900 174.704 51.491  1.00 215.84 ? 185  ASP C O   1 
ATOM   7112 C  CB  . ASP C 3  165 ? 29.991 174.244 52.815  1.00 253.42 ? 185  ASP C CB  1 
ATOM   7113 C  CG  . ASP C 3  165 ? 30.843 173.517 53.838  1.00 263.56 ? 185  ASP C CG  1 
ATOM   7114 O  OD1 . ASP C 3  165 ? 30.510 173.576 55.040  1.00 269.34 ? 185  ASP C OD1 1 
ATOM   7115 O  OD2 . ASP C 3  165 ? 31.846 172.888 53.440  1.00 260.05 ? 185  ASP C OD2 1 
ATOM   7116 N  N   . GLN C 3  166 ? 28.002 176.493 52.294  1.00 195.58 ? 186  GLN C N   1 
ATOM   7117 C  CA  . GLN C 3  166 ? 27.312 177.443 51.428  1.00 176.58 ? 186  GLN C CA  1 
ATOM   7118 C  C   . GLN C 3  166 ? 27.643 177.161 49.964  1.00 169.91 ? 186  GLN C C   1 
ATOM   7119 O  O   . GLN C 3  166 ? 28.664 176.545 49.660  1.00 179.73 ? 186  GLN C O   1 
ATOM   7120 C  CB  . GLN C 3  166 ? 27.688 178.879 51.804  1.00 178.56 ? 186  GLN C CB  1 
ATOM   7121 C  CG  . GLN C 3  166 ? 26.745 179.942 51.261  1.00 152.26 ? 186  GLN C CG  1 
ATOM   7122 C  CD  . GLN C 3  166 ? 27.071 181.329 51.777  1.00 155.68 ? 186  GLN C CD  1 
ATOM   7123 O  OE1 . GLN C 3  166 ? 28.019 181.513 52.540  1.00 177.70 ? 186  GLN C OE1 1 
ATOM   7124 N  NE2 . GLN C 3  166 ? 26.284 182.314 51.362  1.00 157.41 ? 186  GLN C NE2 1 
ATOM   7125 N  N   . ASP C 3  167 ? 26.772 177.601 49.061  1.00 177.51 ? 187  ASP C N   1 
ATOM   7126 C  CA  . ASP C 3  167 ? 26.969 177.367 47.635  1.00 180.67 ? 187  ASP C CA  1 
ATOM   7127 C  C   . ASP C 3  167 ? 27.811 178.479 47.014  1.00 190.79 ? 187  ASP C C   1 
ATOM   7128 O  O   . ASP C 3  167 ? 27.863 179.594 47.535  1.00 193.28 ? 187  ASP C O   1 
ATOM   7129 C  CB  . ASP C 3  167 ? 25.620 177.255 46.921  1.00 186.77 ? 187  ASP C CB  1 
ATOM   7130 C  CG  . ASP C 3  167 ? 25.739 176.624 45.548  1.00 204.33 ? 187  ASP C CG  1 
ATOM   7131 O  OD1 . ASP C 3  167 ? 25.981 177.363 44.573  1.00 215.90 ? 187  ASP C OD1 1 
ATOM   7132 O  OD2 . ASP C 3  167 ? 25.590 175.388 45.445  1.00 212.60 ? 187  ASP C OD2 1 
ATOM   7133 N  N   . SER C 3  168 ? 28.467 178.172 45.899  1.00 203.25 ? 188  SER C N   1 
ATOM   7134 C  CA  . SER C 3  168 ? 29.365 179.124 45.254  1.00 209.60 ? 188  SER C CA  1 
ATOM   7135 C  C   . SER C 3  168 ? 28.795 179.661 43.943  1.00 214.22 ? 188  SER C C   1 
ATOM   7136 O  O   . SER C 3  168 ? 29.512 180.274 43.153  1.00 230.56 ? 188  SER C O   1 
ATOM   7137 C  CB  . SER C 3  168 ? 30.729 178.478 45.001  1.00 212.49 ? 188  SER C CB  1 
ATOM   7138 O  OG  . SER C 3  168 ? 30.611 177.356 44.144  1.00 200.19 ? 188  SER C OG  1 
ATOM   7139 N  N   . LYS C 3  169 ? 27.506 179.430 43.718  1.00 209.01 ? 189  LYS C N   1 
ATOM   7140 C  CA  . LYS C 3  169 ? 26.845 179.904 42.506  1.00 202.11 ? 189  LYS C CA  1 
ATOM   7141 C  C   . LYS C 3  169 ? 25.760 180.924 42.840  1.00 205.08 ? 189  LYS C C   1 
ATOM   7142 O  O   . LYS C 3  169 ? 25.766 182.042 42.323  1.00 200.68 ? 189  LYS C O   1 
ATOM   7143 C  CB  . LYS C 3  169 ? 26.242 178.733 41.726  1.00 188.82 ? 189  LYS C CB  1 
ATOM   7144 C  CG  . LYS C 3  169 ? 27.238 177.638 41.374  1.00 199.98 ? 189  LYS C CG  1 
ATOM   7145 C  CD  . LYS C 3  169 ? 26.567 176.452 40.686  1.00 200.53 ? 189  LYS C CD  1 
ATOM   7146 C  CE  . LYS C 3  169 ? 25.852 175.535 41.676  1.00 182.28 ? 189  LYS C CE  1 
ATOM   7147 N  NZ  . LYS C 3  169 ? 24.546 176.073 42.155  1.00 174.13 ? 189  LYS C NZ  1 
ATOM   7148 N  N   . ASP C 3  170 ? 24.831 180.531 43.705  1.00 223.32 ? 190  ASP C N   1 
ATOM   7149 C  CA  . ASP C 3  170 ? 23.742 181.410 44.117  1.00 225.56 ? 190  ASP C CA  1 
ATOM   7150 C  C   . ASP C 3  170 ? 23.743 181.614 45.629  1.00 217.10 ? 190  ASP C C   1 
ATOM   7151 O  O   . ASP C 3  170 ? 22.872 182.297 46.170  1.00 218.84 ? 190  ASP C O   1 
ATOM   7152 C  CB  . ASP C 3  170 ? 22.394 180.846 43.661  1.00 238.60 ? 190  ASP C CB  1 
ATOM   7153 C  CG  . ASP C 3  170 ? 22.133 179.452 44.198  1.00 243.68 ? 190  ASP C CG  1 
ATOM   7154 O  OD1 . ASP C 3  170 ? 23.111 178.714 44.441  1.00 243.86 ? 190  ASP C OD1 1 
ATOM   7155 O  OD2 . ASP C 3  170 ? 20.950 179.094 44.374  1.00 245.44 ? 190  ASP C OD2 1 
ATOM   7156 N  N   . SER C 3  171 ? 24.728 181.015 46.296  1.00 195.94 ? 191  SER C N   1 
ATOM   7157 C  CA  . SER C 3  171 ? 24.897 181.126 47.745  1.00 171.40 ? 191  SER C CA  1 
ATOM   7158 C  C   . SER C 3  171 ? 23.652 180.687 48.514  1.00 178.18 ? 191  SER C C   1 
ATOM   7159 O  O   . SER C 3  171 ? 23.050 181.478 49.241  1.00 200.10 ? 191  SER C O   1 
ATOM   7160 C  CB  . SER C 3  171 ? 25.271 182.560 48.133  1.00 162.91 ? 191  SER C CB  1 
ATOM   7161 O  OG  . SER C 3  171 ? 26.479 182.961 47.510  1.00 169.03 ? 191  SER C OG  1 
ATOM   7162 N  N   . THR C 3  172 ? 23.271 179.423 48.351  1.00 183.56 ? 192  THR C N   1 
ATOM   7163 C  CA  . THR C 3  172 ? 22.121 178.869 49.058  1.00 190.27 ? 192  THR C CA  1 
ATOM   7164 C  C   . THR C 3  172 ? 22.482 177.561 49.754  1.00 185.35 ? 192  THR C C   1 
ATOM   7165 O  O   . THR C 3  172 ? 22.995 176.635 49.126  1.00 178.42 ? 192  THR C O   1 
ATOM   7166 C  CB  . THR C 3  172 ? 20.933 178.619 48.107  1.00 178.50 ? 192  THR C CB  1 
ATOM   7167 O  OG1 . THR C 3  172 ? 21.348 177.767 47.031  1.00 166.53 ? 192  THR C OG1 1 
ATOM   7168 C  CG2 . THR C 3  172 ? 20.410 179.931 47.542  1.00 188.49 ? 192  THR C CG2 1 
ATOM   7169 N  N   . TYR C 3  173 ? 22.209 177.489 51.053  1.00 167.93 ? 193  TYR C N   1 
ATOM   7170 C  CA  . TYR C 3  173 ? 22.512 176.295 51.835  1.00 158.88 ? 193  TYR C CA  1 
ATOM   7171 C  C   . TYR C 3  173 ? 21.574 175.142 51.489  1.00 167.50 ? 193  TYR C C   1 
ATOM   7172 O  O   . TYR C 3  173 ? 20.543 175.336 50.844  1.00 186.77 ? 193  TYR C O   1 
ATOM   7173 C  CB  . TYR C 3  173 ? 22.432 176.601 53.333  1.00 161.29 ? 193  TYR C CB  1 
ATOM   7174 C  CG  . TYR C 3  173 ? 23.567 177.457 53.850  1.00 159.48 ? 193  TYR C CG  1 
ATOM   7175 C  CD1 . TYR C 3  173 ? 23.473 178.843 53.853  1.00 177.67 ? 193  TYR C CD1 1 
ATOM   7176 C  CD2 . TYR C 3  173 ? 24.731 176.878 54.338  1.00 175.18 ? 193  TYR C CD2 1 
ATOM   7177 C  CE1 . TYR C 3  173 ? 24.509 179.629 54.327  1.00 185.48 ? 193  TYR C CE1 1 
ATOM   7178 C  CE2 . TYR C 3  173 ? 25.772 177.655 54.813  1.00 184.59 ? 193  TYR C CE2 1 
ATOM   7179 C  CZ  . TYR C 3  173 ? 25.655 179.029 54.806  1.00 194.45 ? 193  TYR C CZ  1 
ATOM   7180 O  OH  . TYR C 3  173 ? 26.689 179.806 55.278  1.00 216.72 ? 193  TYR C OH  1 
ATOM   7181 N  N   . SER C 3  174 ? 21.945 173.941 51.920  1.00 161.67 ? 194  SER C N   1 
ATOM   7182 C  CA  . SER C 3  174 ? 21.134 172.749 51.699  1.00 157.96 ? 194  SER C CA  1 
ATOM   7183 C  C   . SER C 3  174 ? 21.385 171.737 52.811  1.00 197.54 ? 194  SER C C   1 
ATOM   7184 O  O   . SER C 3  174 ? 22.519 171.566 53.257  1.00 230.28 ? 194  SER C O   1 
ATOM   7185 C  CB  . SER C 3  174 ? 21.440 172.125 50.335  1.00 153.40 ? 194  SER C CB  1 
ATOM   7186 O  OG  . SER C 3  174 ? 21.178 173.037 49.283  1.00 152.04 ? 194  SER C OG  1 
ATOM   7187 N  N   . MET C 3  175 ? 20.327 171.070 53.261  1.00 196.32 ? 195  MET C N   1 
ATOM   7188 C  CA  . MET C 3  175 ? 20.459 170.090 54.334  1.00 198.79 ? 195  MET C CA  1 
ATOM   7189 C  C   . MET C 3  175 ? 19.643 168.835 54.056  1.00 199.65 ? 195  MET C C   1 
ATOM   7190 O  O   . MET C 3  175 ? 18.733 168.843 53.225  1.00 201.85 ? 195  MET C O   1 
ATOM   7191 C  CB  . MET C 3  175 ? 20.034 170.695 55.672  1.00 215.87 ? 195  MET C CB  1 
ATOM   7192 C  CG  . MET C 3  175 ? 18.556 171.030 55.761  1.00 236.24 ? 195  MET C CG  1 
ATOM   7193 S  SD  . MET C 3  175 ? 18.056 171.478 57.433  1.00 254.91 ? 195  MET C SD  1 
ATOM   7194 C  CE  . MET C 3  175 ? 18.492 169.988 58.324  1.00 236.18 ? 195  MET C CE  1 
ATOM   7195 N  N   . SER C 3  176 ? 19.975 167.759 54.760  1.00 169.50 ? 196  SER C N   1 
ATOM   7196 C  CA  . SER C 3  176 ? 19.267 166.495 54.602  1.00 180.91 ? 196  SER C CA  1 
ATOM   7197 C  C   . SER C 3  176 ? 18.853 165.924 55.953  1.00 211.78 ? 196  SER C C   1 
ATOM   7198 O  O   . SER C 3  176 ? 19.683 165.756 56.847  1.00 212.77 ? 196  SER C O   1 
ATOM   7199 C  CB  . SER C 3  176 ? 20.133 165.483 53.852  1.00 172.02 ? 196  SER C CB  1 
ATOM   7200 O  OG  . SER C 3  176 ? 21.325 165.206 54.565  1.00 208.33 ? 196  SER C OG  1 
ATOM   7201 N  N   . SER C 3  177 ? 17.565 165.631 56.094  1.00 249.26 ? 197  SER C N   1 
ATOM   7202 C  CA  . SER C 3  177 ? 17.052 165.007 57.305  1.00 254.60 ? 197  SER C CA  1 
ATOM   7203 C  C   . SER C 3  177 ? 16.767 163.532 57.041  1.00 257.28 ? 197  SER C C   1 
ATOM   7204 O  O   . SER C 3  177 ? 15.918 163.196 56.217  1.00 267.29 ? 197  SER C O   1 
ATOM   7205 C  CB  . SER C 3  177 ? 15.790 165.722 57.790  1.00 254.11 ? 197  SER C CB  1 
ATOM   7206 O  OG  . SER C 3  177 ? 15.339 165.186 59.020  1.00 256.91 ? 197  SER C OG  1 
ATOM   7207 N  N   . THR C 3  178 ? 17.482 162.656 57.738  1.00 239.46 ? 198  THR C N   1 
ATOM   7208 C  CA  . THR C 3  178 ? 17.375 161.221 57.499  1.00 244.14 ? 198  THR C CA  1 
ATOM   7209 C  C   . THR C 3  178 ? 16.645 160.504 58.631  1.00 256.40 ? 198  THR C C   1 
ATOM   7210 O  O   . THR C 3  178 ? 16.979 160.675 59.805  1.00 250.33 ? 198  THR C O   1 
ATOM   7211 C  CB  . THR C 3  178 ? 18.765 160.580 57.319  1.00 238.27 ? 198  THR C CB  1 
ATOM   7212 O  OG1 . THR C 3  178 ? 19.459 161.230 56.247  1.00 251.05 ? 198  THR C OG1 1 
ATOM   7213 C  CG2 . THR C 3  178 ? 18.636 159.096 57.005  1.00 233.95 ? 198  THR C CG2 1 
ATOM   7214 N  N   . LEU C 3  179 ? 15.648 159.703 58.268  1.00 274.12 ? 199  LEU C N   1 
ATOM   7215 C  CA  . LEU C 3  179 ? 14.929 158.883 59.236  1.00 278.23 ? 199  LEU C CA  1 
ATOM   7216 C  C   . LEU C 3  179 ? 15.172 157.402 58.962  1.00 289.59 ? 199  LEU C C   1 
ATOM   7217 O  O   . LEU C 3  179 ? 14.511 156.802 58.116  1.00 267.64 ? 199  LEU C O   1 
ATOM   7218 C  CB  . LEU C 3  179 ? 13.430 159.188 59.202  1.00 277.64 ? 199  LEU C CB  1 
ATOM   7219 C  CG  . LEU C 3  179 ? 12.573 158.402 60.197  1.00 287.71 ? 199  LEU C CG  1 
ATOM   7220 C  CD1 . LEU C 3  179 ? 12.943 158.761 61.629  1.00 289.52 ? 199  LEU C CD1 1 
ATOM   7221 C  CD2 . LEU C 3  179 ? 11.092 158.634 59.944  1.00 287.72 ? 199  LEU C CD2 1 
ATOM   7222 N  N   . THR C 3  180 ? 16.126 156.820 59.680  1.00 318.16 ? 200  THR C N   1 
ATOM   7223 C  CA  . THR C 3  180 ? 16.475 155.417 59.492  1.00 336.31 ? 200  THR C CA  1 
ATOM   7224 C  C   . THR C 3  180 ? 15.651 154.518 60.408  1.00 332.76 ? 200  THR C C   1 
ATOM   7225 O  O   . THR C 3  180 ? 15.687 154.661 61.629  1.00 328.72 ? 200  THR C O   1 
ATOM   7226 C  CB  . THR C 3  180 ? 17.973 155.171 59.753  1.00 347.83 ? 200  THR C CB  1 
ATOM   7227 O  OG1 . THR C 3  180 ? 18.753 155.965 58.851  1.00 348.22 ? 200  THR C OG1 1 
ATOM   7228 C  CG2 . THR C 3  180 ? 18.315 153.703 59.556  1.00 355.69 ? 200  THR C CG2 1 
ATOM   7229 N  N   . LEU C 3  181 ? 14.907 153.593 59.809  1.00 320.76 ? 201  LEU C N   1 
ATOM   7230 C  CA  . LEU C 3  181 ? 14.063 152.678 60.570  1.00 311.89 ? 201  LEU C CA  1 
ATOM   7231 C  C   . LEU C 3  181 ? 14.185 151.242 60.064  1.00 311.71 ? 201  LEU C C   1 
ATOM   7232 O  O   . LEU C 3  181 ? 14.746 150.989 58.995  1.00 287.87 ? 201  LEU C O   1 
ATOM   7233 C  CB  . LEU C 3  181 ? 12.600 153.127 60.515  1.00 306.70 ? 201  LEU C CB  1 
ATOM   7234 C  CG  . LEU C 3  181 ? 12.248 154.438 61.222  1.00 297.99 ? 201  LEU C CG  1 
ATOM   7235 C  CD1 . LEU C 3  181 ? 10.781 154.784 61.017  1.00 302.30 ? 201  LEU C CD1 1 
ATOM   7236 C  CD2 . LEU C 3  181 ? 12.579 154.354 62.704  1.00 298.40 ? 201  LEU C CD2 1 
ATOM   7237 N  N   . THR C 3  182 ? 13.654 150.306 60.844  1.00 332.07 ? 202  THR C N   1 
ATOM   7238 C  CA  . THR C 3  182 ? 13.676 148.896 60.476  1.00 360.93 ? 202  THR C CA  1 
ATOM   7239 C  C   . THR C 3  182 ? 12.588 148.588 59.453  1.00 396.25 ? 202  THR C C   1 
ATOM   7240 O  O   . THR C 3  182 ? 11.669 149.382 59.252  1.00 390.67 ? 202  THR C O   1 
ATOM   7241 C  CB  . THR C 3  182 ? 13.486 147.987 61.706  1.00 353.51 ? 202  THR C CB  1 
ATOM   7242 O  OG1 . THR C 3  182 ? 12.212 148.249 62.306  1.00 357.15 ? 202  THR C OG1 1 
ATOM   7243 C  CG2 . THR C 3  182 ? 14.584 148.236 62.728  1.00 333.78 ? 202  THR C CG2 1 
ATOM   7244 N  N   . LYS C 3  183 ? 12.700 147.431 58.809  1.00 444.71 ? 203  LYS C N   1 
ATOM   7245 C  CA  . LYS C 3  183 ? 11.732 147.015 57.800  1.00 466.46 ? 203  LYS C CA  1 
ATOM   7246 C  C   . LYS C 3  183 ? 10.402 146.627 58.440  1.00 470.14 ? 203  LYS C C   1 
ATOM   7247 O  O   . LYS C 3  183 ? 9.332  146.930 57.906  1.00 483.03 ? 203  LYS C O   1 
ATOM   7248 C  CB  . LYS C 3  183 ? 12.289 145.847 56.983  1.00 486.72 ? 203  LYS C CB  1 
ATOM   7249 C  CG  . LYS C 3  183 ? 11.346 145.322 55.912  1.00 508.29 ? 203  LYS C CG  1 
ATOM   7250 C  CD  . LYS C 3  183 ? 11.987 144.190 55.124  1.00 521.60 ? 203  LYS C CD  1 
ATOM   7251 C  CE  . LYS C 3  183 ? 12.399 143.046 56.037  1.00 535.76 ? 203  LYS C CE  1 
ATOM   7252 N  NZ  . LYS C 3  183 ? 13.064 141.945 55.286  1.00 543.75 ? 203  LYS C NZ  1 
ATOM   7253 N  N   . ASP C 3  184 ? 10.479 145.961 59.589  1.00 454.96 ? 204  ASP C N   1 
ATOM   7254 C  CA  . ASP C 3  184 ? 9.291  145.508 60.306  1.00 448.21 ? 204  ASP C CA  1 
ATOM   7255 C  C   . ASP C 3  184 ? 8.415  146.680 60.736  1.00 422.56 ? 204  ASP C C   1 
ATOM   7256 O  O   . ASP C 3  184 ? 7.190  146.617 60.643  1.00 440.21 ? 204  ASP C O   1 
ATOM   7257 C  CB  . ASP C 3  184 ? 9.688  144.678 61.529  1.00 450.03 ? 204  ASP C CB  1 
ATOM   7258 C  CG  . ASP C 3  184 ? 10.498 143.451 61.163  1.00 449.72 ? 204  ASP C CG  1 
ATOM   7259 O  OD1 . ASP C 3  184 ? 10.293 142.909 60.057  1.00 455.51 ? 204  ASP C OD1 1 
ATOM   7260 O  OD2 . ASP C 3  184 ? 11.341 143.028 61.983  1.00 444.47 ? 204  ASP C OD2 1 
ATOM   7261 N  N   . GLU C 3  185 ? 9.051  147.748 61.206  1.00 373.58 ? 205  GLU C N   1 
ATOM   7262 C  CA  . GLU C 3  185 ? 8.328  148.938 61.633  1.00 342.92 ? 205  GLU C CA  1 
ATOM   7263 C  C   . GLU C 3  185 ? 7.853  149.735 60.422  1.00 339.64 ? 205  GLU C C   1 
ATOM   7264 O  O   . GLU C 3  185 ? 6.848  150.442 60.485  1.00 330.21 ? 205  GLU C O   1 
ATOM   7265 C  CB  . GLU C 3  185 ? 9.207  149.806 62.538  1.00 319.07 ? 205  GLU C CB  1 
ATOM   7266 C  CG  . GLU C 3  185 ? 8.476  150.968 63.195  1.00 314.26 ? 205  GLU C CG  1 
ATOM   7267 C  CD  . GLU C 3  185 ? 9.344  151.719 64.186  1.00 307.41 ? 205  GLU C CD  1 
ATOM   7268 O  OE1 . GLU C 3  185 ? 10.515 151.325 64.372  1.00 310.02 ? 205  GLU C OE1 1 
ATOM   7269 O  OE2 . GLU C 3  185 ? 8.856  152.702 64.782  1.00 306.74 ? 205  GLU C OE2 1 
ATOM   7270 N  N   . TYR C 3  186 ? 8.580  149.608 59.316  1.00 346.36 ? 206  TYR C N   1 
ATOM   7271 C  CA  . TYR C 3  186 ? 8.225  150.299 58.080  1.00 352.54 ? 206  TYR C CA  1 
ATOM   7272 C  C   . TYR C 3  186 ? 6.984  149.688 57.440  1.00 376.98 ? 206  TYR C C   1 
ATOM   7273 O  O   . TYR C 3  186 ? 6.187  150.392 56.819  1.00 381.78 ? 206  TYR C O   1 
ATOM   7274 C  CB  . TYR C 3  186 ? 9.393  150.267 57.093  1.00 339.37 ? 206  TYR C CB  1 
ATOM   7275 C  CG  . TYR C 3  186 ? 9.068  150.841 55.731  1.00 335.27 ? 206  TYR C CG  1 
ATOM   7276 C  CD1 . TYR C 3  186 ? 8.987  152.214 55.535  1.00 327.93 ? 206  TYR C CD1 1 
ATOM   7277 C  CD2 . TYR C 3  186 ? 8.851  150.010 54.639  1.00 341.01 ? 206  TYR C CD2 1 
ATOM   7278 C  CE1 . TYR C 3  186 ? 8.692  152.743 54.292  1.00 323.97 ? 206  TYR C CE1 1 
ATOM   7279 C  CE2 . TYR C 3  186 ? 8.556  150.531 53.391  1.00 335.09 ? 206  TYR C CE2 1 
ATOM   7280 C  CZ  . TYR C 3  186 ? 8.478  151.897 53.224  1.00 324.65 ? 206  TYR C CZ  1 
ATOM   7281 O  OH  . TYR C 3  186 ? 8.185  152.419 51.985  1.00 317.69 ? 206  TYR C OH  1 
ATOM   7282 N  N   . GLU C 3  187 ? 6.823  148.378 57.594  1.00 389.02 ? 207  GLU C N   1 
ATOM   7283 C  CA  . GLU C 3  187 ? 5.674  147.685 57.020  1.00 400.74 ? 207  GLU C CA  1 
ATOM   7284 C  C   . GLU C 3  187 ? 4.472  147.706 57.962  1.00 404.57 ? 207  GLU C C   1 
ATOM   7285 O  O   . GLU C 3  187 ? 3.536  146.922 57.803  1.00 422.83 ? 207  GLU C O   1 
ATOM   7286 C  CB  . GLU C 3  187 ? 6.038  146.241 56.667  1.00 417.62 ? 207  GLU C CB  1 
ATOM   7287 C  CG  . GLU C 3  187 ? 7.054  146.117 55.543  1.00 418.74 ? 207  GLU C CG  1 
ATOM   7288 C  CD  . GLU C 3  187 ? 7.255  144.683 55.096  1.00 436.31 ? 207  GLU C CD  1 
ATOM   7289 O  OE1 . GLU C 3  187 ? 6.610  143.783 55.674  1.00 450.06 ? 207  GLU C OE1 1 
ATOM   7290 O  OE2 . GLU C 3  187 ? 8.057  144.455 54.166  1.00 436.56 ? 207  GLU C OE2 1 
ATOM   7291 N  N   . ARG C 3  188 ? 4.504  148.605 58.940  1.00 392.71 ? 208  ARG C N   1 
ATOM   7292 C  CA  . ARG C 3  188 ? 3.381  148.779 59.855  1.00 392.18 ? 208  ARG C CA  1 
ATOM   7293 C  C   . ARG C 3  188 ? 2.859  150.211 59.800  1.00 373.51 ? 208  ARG C C   1 
ATOM   7294 O  O   . ARG C 3  188 ? 1.981  150.593 60.574  1.00 390.46 ? 208  ARG C O   1 
ATOM   7295 C  CB  . ARG C 3  188 ? 3.784  148.415 61.286  1.00 394.83 ? 208  ARG C CB  1 
ATOM   7296 C  CG  . ARG C 3  188 ? 4.032  146.930 61.499  1.00 401.51 ? 208  ARG C CG  1 
ATOM   7297 C  CD  . ARG C 3  188 ? 4.133  146.588 62.978  1.00 401.91 ? 208  ARG C CD  1 
ATOM   7298 N  NE  . ARG C 3  188 ? 5.317  147.168 63.604  1.00 390.39 ? 208  ARG C NE  1 
ATOM   7299 C  CZ  . ARG C 3  188 ? 6.470  146.525 63.758  1.00 389.56 ? 208  ARG C CZ  1 
ATOM   7300 N  NH1 . ARG C 3  188 ? 6.596  145.276 63.332  1.00 393.75 ? 208  ARG C NH1 1 
ATOM   7301 N  NH2 . ARG C 3  188 ? 7.496  147.130 64.341  1.00 385.14 ? 208  ARG C NH2 1 
ATOM   7302 N  N   . HIS C 3  189 ? 3.406  150.997 58.879  1.00 351.31 ? 209  HIS C N   1 
ATOM   7303 C  CA  . HIS C 3  189 ? 2.970  152.375 58.682  1.00 328.19 ? 209  HIS C CA  1 
ATOM   7304 C  C   . HIS C 3  189 ? 2.923  152.703 57.190  1.00 344.01 ? 209  HIS C C   1 
ATOM   7305 O  O   . HIS C 3  189 ? 3.730  152.195 56.411  1.00 323.05 ? 209  HIS C O   1 
ATOM   7306 C  CB  . HIS C 3  189 ? 3.895  153.344 59.422  1.00 317.49 ? 209  HIS C CB  1 
ATOM   7307 C  CG  . HIS C 3  189 ? 3.963  153.104 60.900  1.00 323.18 ? 209  HIS C CG  1 
ATOM   7308 N  ND1 . HIS C 3  189 ? 2.962  153.494 61.763  1.00 330.69 ? 209  HIS C ND1 1 
ATOM   7309 C  CD2 . HIS C 3  189 ? 4.910  152.512 61.665  1.00 322.95 ? 209  HIS C CD2 1 
ATOM   7310 C  CE1 . HIS C 3  189 ? 3.290  153.153 62.997  1.00 334.95 ? 209  HIS C CE1 1 
ATOM   7311 N  NE2 . HIS C 3  189 ? 4.467  152.556 62.965  1.00 330.28 ? 209  HIS C NE2 1 
ATOM   7312 N  N   . ASN C 3  190 ? 1.976  153.549 56.797  1.00 361.53 ? 210  ASN C N   1 
ATOM   7313 C  CA  . ASN C 3  190 ? 1.754  153.845 55.384  1.00 357.74 ? 210  ASN C CA  1 
ATOM   7314 C  C   . ASN C 3  190 ? 2.184  155.193 54.809  1.00 342.23 ? 210  ASN C C   1 
ATOM   7315 O  O   . ASN C 3  190 ? 3.000  155.255 53.890  1.00 345.23 ? 210  ASN C O   1 
ATOM   7316 C  CB  . ASN C 3  190 ? 0.260  153.760 55.054  1.00 371.99 ? 210  ASN C CB  1 
ATOM   7317 C  CG  . ASN C 3  190 ? -0.022 153.923 53.572  1.00 367.97 ? 210  ASN C CG  1 
ATOM   7318 O  OD1 . ASN C 3  190 ? 0.839  153.666 52.731  1.00 361.85 ? 210  ASN C OD1 1 
ATOM   7319 N  ND2 . ASN C 3  190 ? -1.236 154.352 53.244  1.00 368.09 ? 210  ASN C ND2 1 
ATOM   7320 N  N   . SER C 3  191 ? 1.628  156.269 55.356  1.00 318.05 ? 211  SER C N   1 
ATOM   7321 C  CA  . SER C 3  191 ? 1.857  157.610 54.826  1.00 303.16 ? 211  SER C CA  1 
ATOM   7322 C  C   . SER C 3  191 ? 2.835  158.303 55.771  1.00 299.04 ? 211  SER C C   1 
ATOM   7323 O  O   . SER C 3  191 ? 2.525  158.526 56.940  1.00 297.09 ? 211  SER C O   1 
ATOM   7324 C  CB  . SER C 3  191 ? 0.587  158.453 54.692  1.00 298.62 ? 211  SER C CB  1 
ATOM   7325 O  OG  . SER C 3  191 ? -0.102 158.535 55.927  1.00 304.00 ? 211  SER C OG  1 
ATOM   7326 N  N   . TYR C 3  192 ? 4.011  158.648 55.254  1.00 290.96 ? 212  TYR C N   1 
ATOM   7327 C  CA  . TYR C 3  192 ? 4.998  159.399 56.024  1.00 266.40 ? 212  TYR C CA  1 
ATOM   7328 C  C   . TYR C 3  192 ? 4.924  160.886 55.687  1.00 277.81 ? 212  TYR C C   1 
ATOM   7329 O  O   . TYR C 3  192 ? 4.503  161.264 54.589  1.00 256.86 ? 212  TYR C O   1 
ATOM   7330 C  CB  . TYR C 3  192 ? 6.410  158.868 55.765  1.00 260.00 ? 212  TYR C CB  1 
ATOM   7331 C  CG  . TYR C 3  192 ? 6.678  157.500 56.352  1.00 266.91 ? 212  TYR C CG  1 
ATOM   7332 C  CD1 . TYR C 3  192 ? 7.150  157.362 57.651  1.00 270.81 ? 212  TYR C CD1 1 
ATOM   7333 C  CD2 . TYR C 3  192 ? 6.466  156.348 55.606  1.00 272.73 ? 212  TYR C CD2 1 
ATOM   7334 C  CE1 . TYR C 3  192 ? 7.400  156.115 58.193  1.00 274.85 ? 212  TYR C CE1 1 
ATOM   7335 C  CE2 . TYR C 3  192 ? 6.713  155.096 56.140  1.00 279.70 ? 212  TYR C CE2 1 
ATOM   7336 C  CZ  . TYR C 3  192 ? 7.180  154.986 57.433  1.00 280.61 ? 212  TYR C CZ  1 
ATOM   7337 O  OH  . TYR C 3  192 ? 7.427  153.742 57.969  1.00 287.90 ? 212  TYR C OH  1 
ATOM   7338 N  N   . THR C 3  193 ? 5.342  161.723 56.634  1.00 301.69 ? 213  THR C N   1 
ATOM   7339 C  CA  . THR C 3  193 ? 5.237  163.171 56.478  1.00 324.97 ? 213  THR C CA  1 
ATOM   7340 C  C   . THR C 3  193 ? 6.367  163.917 57.181  1.00 351.28 ? 213  THR C C   1 
ATOM   7341 O  O   . THR C 3  193 ? 6.497  163.841 58.398  1.00 341.17 ? 213  THR C O   1 
ATOM   7342 C  CB  . THR C 3  193 ? 3.896  163.690 57.034  1.00 330.55 ? 213  THR C CB  1 
ATOM   7343 O  OG1 . THR C 3  193 ? 2.812  163.160 56.261  1.00 336.15 ? 213  THR C OG1 1 
ATOM   7344 C  CG2 . THR C 3  193 ? 3.853  165.209 56.999  1.00 325.94 ? 213  THR C CG2 1 
ATOM   7345 N  N   . CYS C 3  194 ? 7.180  164.646 56.422  1.00 407.82 ? 214  CYS C N   1 
ATOM   7346 C  CA  . CYS C 3  194 ? 8.199  165.499 57.026  1.00 413.37 ? 214  CYS C CA  1 
ATOM   7347 C  C   . CYS C 3  194 ? 7.930  166.965 56.695  1.00 400.20 ? 214  CYS C C   1 
ATOM   7348 O  O   . CYS C 3  194 ? 7.554  167.302 55.570  1.00 403.35 ? 214  CYS C O   1 
ATOM   7349 C  CB  . CYS C 3  194 ? 9.606  165.090 56.571  1.00 418.93 ? 214  CYS C CB  1 
ATOM   7350 S  SG  . CYS C 3  194 ? 9.987  165.322 54.814  1.00 417.52 ? 214  CYS C SG  1 
ATOM   7351 N  N   . GLU C 3  195 ? 8.112  167.831 57.688  1.00 329.19 ? 215  GLU C N   1 
ATOM   7352 C  CA  . GLU C 3  195 ? 7.854  169.256 57.510  1.00 266.08 ? 215  GLU C CA  1 
ATOM   7353 C  C   . GLU C 3  195 ? 9.039  170.095 57.974  1.00 230.42 ? 215  GLU C C   1 
ATOM   7354 O  O   . GLU C 3  195 ? 9.871  169.635 58.757  1.00 221.85 ? 215  GLU C O   1 
ATOM   7355 C  CB  . GLU C 3  195 ? 6.592  169.673 58.265  1.00 260.15 ? 215  GLU C CB  1 
ATOM   7356 C  CG  . GLU C 3  195 ? 6.704  169.562 59.775  1.00 268.18 ? 215  GLU C CG  1 
ATOM   7357 C  CD  . GLU C 3  195 ? 5.485  170.110 60.489  1.00 273.54 ? 215  GLU C CD  1 
ATOM   7358 O  OE1 . GLU C 3  195 ? 5.476  170.114 61.737  1.00 264.69 ? 215  GLU C OE1 1 
ATOM   7359 O  OE2 . GLU C 3  195 ? 4.535  170.539 59.800  1.00 242.76 ? 215  GLU C OE2 1 
ATOM   7360 N  N   . ALA C 3  196 ? 9.105  171.331 57.490  1.00 229.31 ? 216  ALA C N   1 
ATOM   7361 C  CA  . ALA C 3  196 ? 10.208 172.222 57.825  1.00 246.70 ? 216  ALA C CA  1 
ATOM   7362 C  C   . ALA C 3  196 ? 9.715  173.632 58.136  1.00 238.77 ? 216  ALA C C   1 
ATOM   7363 O  O   . ALA C 3  196 ? 8.896  174.190 57.407  1.00 220.76 ? 216  ALA C O   1 
ATOM   7364 C  CB  . ALA C 3  196 ? 11.219 172.256 56.692  1.00 257.48 ? 216  ALA C CB  1 
ATOM   7365 N  N   . THR C 3  197 ? 10.225 174.200 59.223  1.00 255.71 ? 217  THR C N   1 
ATOM   7366 C  CA  . THR C 3  197 ? 9.876  175.558 59.619  1.00 256.28 ? 217  THR C CA  1 
ATOM   7367 C  C   . THR C 3  197 ? 11.029 176.515 59.330  1.00 246.16 ? 217  THR C C   1 
ATOM   7368 O  O   . THR C 3  197 ? 12.119 176.375 59.887  1.00 238.95 ? 217  THR C O   1 
ATOM   7369 C  CB  . THR C 3  197 ? 9.512  175.636 61.112  1.00 261.20 ? 217  THR C CB  1 
ATOM   7370 O  OG1 . THR C 3  197 ? 8.416  174.754 61.385  1.00 255.09 ? 217  THR C OG1 1 
ATOM   7371 C  CG2 . THR C 3  197 ? 9.120  177.055 61.492  1.00 268.89 ? 217  THR C CG2 1 
ATOM   7372 N  N   . HIS C 3  198 ? 10.778 177.486 58.457  1.00 261.32 ? 218  HIS C N   1 
ATOM   7373 C  CA  . HIS C 3  198 ? 11.792 178.462 58.075  1.00 261.08 ? 218  HIS C CA  1 
ATOM   7374 C  C   . HIS C 3  198 ? 11.281 179.880 58.326  1.00 266.29 ? 218  HIS C C   1 
ATOM   7375 O  O   . HIS C 3  198 ? 10.141 180.068 58.750  1.00 290.13 ? 218  HIS C O   1 
ATOM   7376 C  CB  . HIS C 3  198 ? 12.183 178.279 56.606  1.00 261.98 ? 218  HIS C CB  1 
ATOM   7377 C  CG  . HIS C 3  198 ? 13.510 178.875 56.253  1.00 268.70 ? 218  HIS C CG  1 
ATOM   7378 N  ND1 . HIS C 3  198 ? 13.633 180.085 55.604  1.00 274.15 ? 218  HIS C ND1 1 
ATOM   7379 C  CD2 . HIS C 3  198 ? 14.772 178.430 56.460  1.00 267.84 ? 218  HIS C CD2 1 
ATOM   7380 C  CE1 . HIS C 3  198 ? 14.913 180.358 55.426  1.00 270.69 ? 218  HIS C CE1 1 
ATOM   7381 N  NE2 . HIS C 3  198 ? 15.625 179.370 55.936  1.00 266.26 ? 218  HIS C NE2 1 
ATOM   7382 N  N   . LYS C 3  199 ? 12.124 180.874 58.064  1.00 244.85 ? 219  LYS C N   1 
ATOM   7383 C  CA  . LYS C 3  199 ? 11.765 182.267 58.314  1.00 239.25 ? 219  LYS C CA  1 
ATOM   7384 C  C   . LYS C 3  199 ? 11.157 182.934 57.083  1.00 229.96 ? 219  LYS C C   1 
ATOM   7385 O  O   . LYS C 3  199 ? 10.646 184.051 57.165  1.00 246.94 ? 219  LYS C O   1 
ATOM   7386 C  CB  . LYS C 3  199 ? 12.987 183.060 58.782  1.00 231.48 ? 219  LYS C CB  1 
ATOM   7387 C  CG  . LYS C 3  199 ? 14.078 183.201 57.734  1.00 238.77 ? 219  LYS C CG  1 
ATOM   7388 C  CD  . LYS C 3  199 ? 15.198 184.102 58.225  1.00 239.06 ? 219  LYS C CD  1 
ATOM   7389 C  CE  . LYS C 3  199 ? 14.673 185.480 58.599  1.00 219.51 ? 219  LYS C CE  1 
ATOM   7390 N  NZ  . LYS C 3  199 ? 13.998 186.149 57.453  1.00 211.37 ? 219  LYS C NZ  1 
ATOM   7391 N  N   . THR C 3  200 ? 11.218 182.252 55.944  1.00 216.00 ? 220  THR C N   1 
ATOM   7392 C  CA  . THR C 3  200 ? 10.636 182.777 54.712  1.00 222.69 ? 220  THR C CA  1 
ATOM   7393 C  C   . THR C 3  200 ? 9.116  182.820 54.813  1.00 236.04 ? 220  THR C C   1 
ATOM   7394 O  O   . THR C 3  200 ? 8.480  183.775 54.366  1.00 249.83 ? 220  THR C O   1 
ATOM   7395 C  CB  . THR C 3  200 ? 11.039 181.937 53.486  1.00 223.15 ? 220  THR C CB  1 
ATOM   7396 O  OG1 . THR C 3  200 ? 10.725 180.558 53.721  1.00 229.01 ? 220  THR C OG1 1 
ATOM   7397 C  CG2 . THR C 3  200 ? 12.527 182.078 53.207  1.00 219.93 ? 220  THR C CG2 1 
ATOM   7398 N  N   . SER C 3  201 ? 8.542  181.779 55.405  1.00 236.90 ? 221  SER C N   1 
ATOM   7399 C  CA  . SER C 3  201 ? 7.101  181.705 55.603  1.00 246.16 ? 221  SER C CA  1 
ATOM   7400 C  C   . SER C 3  201 ? 6.781  181.141 56.983  1.00 265.82 ? 221  SER C C   1 
ATOM   7401 O  O   . SER C 3  201 ? 7.515  180.303 57.506  1.00 259.59 ? 221  SER C O   1 
ATOM   7402 C  CB  . SER C 3  201 ? 6.449  180.848 54.516  1.00 252.81 ? 221  SER C CB  1 
ATOM   7403 O  OG  . SER C 3  201 ? 5.044  180.791 54.685  1.00 269.87 ? 221  SER C OG  1 
ATOM   7404 N  N   . THR C 3  202 ? 5.683  181.608 57.568  1.00 284.41 ? 222  THR C N   1 
ATOM   7405 C  CA  . THR C 3  202 ? 5.274  181.162 58.895  1.00 295.11 ? 222  THR C CA  1 
ATOM   7406 C  C   . THR C 3  202 ? 4.781  179.719 58.868  1.00 294.52 ? 222  THR C C   1 
ATOM   7407 O  O   . THR C 3  202 ? 4.962  178.974 59.831  1.00 300.71 ? 222  THR C O   1 
ATOM   7408 C  CB  . THR C 3  202 ? 4.166  182.061 59.475  1.00 299.66 ? 222  THR C CB  1 
ATOM   7409 O  OG1 . THR C 3  202 ? 3.022  182.030 58.613  1.00 296.34 ? 222  THR C OG1 1 
ATOM   7410 C  CG2 . THR C 3  202 ? 4.657  183.494 59.607  1.00 301.14 ? 222  THR C CG2 1 
ATOM   7411 N  N   . SER C 3  203 ? 4.158  179.331 57.760  1.00 287.95 ? 223  SER C N   1 
ATOM   7412 C  CA  . SER C 3  203 ? 3.630  177.980 57.611  1.00 291.74 ? 223  SER C CA  1 
ATOM   7413 C  C   . SER C 3  203 ? 4.722  177.005 57.182  1.00 277.67 ? 223  SER C C   1 
ATOM   7414 O  O   . SER C 3  203 ? 5.314  177.162 56.114  1.00 292.71 ? 223  SER C O   1 
ATOM   7415 C  CB  . SER C 3  203 ? 2.482  177.962 56.599  1.00 306.26 ? 223  SER C CB  1 
ATOM   7416 O  OG  . SER C 3  203 ? 1.423  178.806 57.015  1.00 324.98 ? 223  SER C OG  1 
ATOM   7417 N  N   . PRO C 3  204 ? 4.992  175.993 58.021  1.00 266.46 ? 224  PRO C N   1 
ATOM   7418 C  CA  . PRO C 3  204 ? 6.000  174.967 57.730  1.00 271.59 ? 224  PRO C CA  1 
ATOM   7419 C  C   . PRO C 3  204 ? 5.666  174.161 56.479  1.00 272.31 ? 224  PRO C C   1 
ATOM   7420 O  O   . PRO C 3  204 ? 4.533  173.704 56.326  1.00 251.09 ? 224  PRO C O   1 
ATOM   7421 C  CB  . PRO C 3  204 ? 5.964  174.074 58.975  1.00 271.89 ? 224  PRO C CB  1 
ATOM   7422 C  CG  . PRO C 3  204 ? 5.379  174.932 60.047  1.00 263.60 ? 224  PRO C CG  1 
ATOM   7423 C  CD  . PRO C 3  204 ? 4.385  175.804 59.349  1.00 254.90 ? 224  PRO C CD  1 
ATOM   7424 N  N   . ILE C 3  205 ? 6.645  173.994 55.595  1.00 279.20 ? 225  ILE C N   1 
ATOM   7425 C  CA  . ILE C 3  205 ? 6.449  173.227 54.373  1.00 289.23 ? 225  ILE C CA  1 
ATOM   7426 C  C   . ILE C 3  205 ? 6.265  171.754 54.716  1.00 294.83 ? 225  ILE C C   1 
ATOM   7427 O  O   . ILE C 3  205 ? 7.099  171.154 55.396  1.00 299.76 ? 225  ILE C O   1 
ATOM   7428 C  CB  . ILE C 3  205 ? 7.618  173.431 53.396  1.00 285.45 ? 225  ILE C CB  1 
ATOM   7429 C  CG1 . ILE C 3  205 ? 7.745  174.912 53.032  1.00 270.89 ? 225  ILE C CG1 1 
ATOM   7430 C  CG2 . ILE C 3  205 ? 7.423  172.587 52.146  1.00 292.29 ? 225  ILE C CG2 1 
ATOM   7431 C  CD1 . ILE C 3  205 ? 8.851  175.211 52.048  1.00 258.08 ? 225  ILE C CD1 1 
ATOM   7432 N  N   . VAL C 3  206 ? 5.166  171.178 54.240  1.00 302.42 ? 226  VAL C N   1 
ATOM   7433 C  CA  . VAL C 3  206 ? 4.795  169.813 54.589  1.00 319.96 ? 226  VAL C CA  1 
ATOM   7434 C  C   . VAL C 3  206 ? 4.843  168.894 53.373  1.00 321.24 ? 226  VAL C C   1 
ATOM   7435 O  O   . VAL C 3  206 ? 4.255  169.195 52.334  1.00 326.44 ? 226  VAL C O   1 
ATOM   7436 C  CB  . VAL C 3  206 ? 3.398  169.780 55.236  1.00 344.60 ? 226  VAL C CB  1 
ATOM   7437 C  CG1 . VAL C 3  206 ? 2.950  168.349 55.470  1.00 357.50 ? 226  VAL C CG1 1 
ATOM   7438 C  CG2 . VAL C 3  206 ? 3.399  170.564 56.539  1.00 351.98 ? 226  VAL C CG2 1 
ATOM   7439 N  N   . LYS C 3  207 ? 5.545  167.773 53.509  1.00 303.33 ? 227  LYS C N   1 
ATOM   7440 C  CA  . LYS C 3  207 ? 5.598  166.771 52.450  1.00 295.79 ? 227  LYS C CA  1 
ATOM   7441 C  C   . LYS C 3  207 ? 5.172  165.402 52.976  1.00 289.06 ? 227  LYS C C   1 
ATOM   7442 O  O   . LYS C 3  207 ? 5.486  165.040 54.109  1.00 286.22 ? 227  LYS C O   1 
ATOM   7443 C  CB  . LYS C 3  207 ? 7.003  166.697 51.847  1.00 289.35 ? 227  LYS C CB  1 
ATOM   7444 C  CG  . LYS C 3  207 ? 7.355  167.880 50.957  1.00 278.33 ? 227  LYS C CG  1 
ATOM   7445 C  CD  . LYS C 3  207 ? 6.413  167.967 49.765  1.00 268.88 ? 227  LYS C CD  1 
ATOM   7446 C  CE  . LYS C 3  207 ? 6.760  169.141 48.863  1.00 253.22 ? 227  LYS C CE  1 
ATOM   7447 N  NZ  . LYS C 3  207 ? 6.648  170.445 49.574  1.00 252.68 ? 227  LYS C NZ  1 
ATOM   7448 N  N   . SER C 3  208 ? 4.455  164.647 52.150  1.00 290.43 ? 228  SER C N   1 
ATOM   7449 C  CA  . SER C 3  208 ? 3.931  163.347 52.557  1.00 311.88 ? 228  SER C CA  1 
ATOM   7450 C  C   . SER C 3  208 ? 3.919  162.352 51.401  1.00 331.13 ? 228  SER C C   1 
ATOM   7451 O  O   . SER C 3  208 ? 3.920  162.746 50.235  1.00 315.61 ? 228  SER C O   1 
ATOM   7452 C  CB  . SER C 3  208 ? 2.514  163.496 53.117  1.00 307.92 ? 228  SER C CB  1 
ATOM   7453 O  OG  . SER C 3  208 ? 2.471  164.453 54.160  1.00 297.36 ? 228  SER C OG  1 
ATOM   7454 N  N   . PHE C 3  209 ? 3.906  161.063 51.729  1.00 383.13 ? 229  PHE C N   1 
ATOM   7455 C  CA  . PHE C 3  209 ? 3.747  160.027 50.710  1.00 387.82 ? 229  PHE C CA  1 
ATOM   7456 C  C   . PHE C 3  209 ? 3.122  158.766 51.299  1.00 381.75 ? 229  PHE C C   1 
ATOM   7457 O  O   . PHE C 3  209 ? 3.051  158.607 52.518  1.00 394.16 ? 229  PHE C O   1 
ATOM   7458 C  CB  . PHE C 3  209 ? 5.092  159.694 50.049  1.00 394.47 ? 229  PHE C CB  1 
ATOM   7459 C  CG  . PHE C 3  209 ? 6.025  158.893 50.917  1.00 403.83 ? 229  PHE C CG  1 
ATOM   7460 C  CD1 . PHE C 3  209 ? 6.905  159.526 51.778  1.00 397.40 ? 229  PHE C CD1 1 
ATOM   7461 C  CD2 . PHE C 3  209 ? 6.037  157.507 50.856  1.00 413.03 ? 229  PHE C CD2 1 
ATOM   7462 C  CE1 . PHE C 3  209 ? 7.769  158.793 52.570  1.00 396.24 ? 229  PHE C CE1 1 
ATOM   7463 C  CE2 . PHE C 3  209 ? 6.895  156.771 51.649  1.00 411.25 ? 229  PHE C CE2 1 
ATOM   7464 C  CZ  . PHE C 3  209 ? 7.763  157.414 52.506  1.00 402.52 ? 229  PHE C CZ  1 
ATOM   7465 N  N   . ASN C 3  210 ? 2.672  157.871 50.425  1.00 358.12 ? 230  ASN C N   1 
ATOM   7466 C  CA  . ASN C 3  210 ? 2.058  156.620 50.853  1.00 351.81 ? 230  ASN C CA  1 
ATOM   7467 C  C   . ASN C 3  210 ? 2.959  155.431 50.536  1.00 345.30 ? 230  ASN C C   1 
ATOM   7468 O  O   . ASN C 3  210 ? 3.655  155.420 49.521  1.00 336.15 ? 230  ASN C O   1 
ATOM   7469 C  CB  . ASN C 3  210 ? 0.693  156.437 50.188  1.00 345.55 ? 230  ASN C CB  1 
ATOM   7470 C  CG  . ASN C 3  210 ? -0.262 157.573 50.495  1.00 335.64 ? 230  ASN C CG  1 
ATOM   7471 O  OD1 . ASN C 3  210 ? -0.162 158.218 51.538  1.00 326.40 ? 230  ASN C OD1 1 
ATOM   7472 N  ND2 . ASN C 3  210 ? -1.196 157.823 49.585  1.00 340.42 ? 230  ASN C ND2 1 
ATOM   7473 N  N   . ARG C 3  211 ? 2.939  154.432 51.412  1.00 355.38 ? 231  ARG C N   1 
ATOM   7474 C  CA  . ARG C 3  211 ? 3.744  153.231 51.224  1.00 356.41 ? 231  ARG C CA  1 
ATOM   7475 C  C   . ARG C 3  211 ? 3.068  152.280 50.241  1.00 356.13 ? 231  ARG C C   1 
ATOM   7476 O  O   . ARG C 3  211 ? 3.718  151.423 49.642  1.00 357.65 ? 231  ARG C O   1 
ATOM   7477 C  CB  . ARG C 3  211 ? 3.980  152.529 52.563  1.00 366.68 ? 231  ARG C CB  1 
ATOM   7478 C  CG  . ARG C 3  211 ? 4.974  151.380 52.501  1.00 370.99 ? 231  ARG C CG  1 
ATOM   7479 C  CD  . ARG C 3  211 ? 4.907  150.524 53.754  1.00 378.20 ? 231  ARG C CD  1 
ATOM   7480 N  NE  . ARG C 3  211 ? 3.575  149.960 53.953  1.00 394.46 ? 231  ARG C NE  1 
ATOM   7481 C  CZ  . ARG C 3  211 ? 3.153  148.827 53.400  1.00 408.19 ? 231  ARG C CZ  1 
ATOM   7482 N  NH1 . ARG C 3  211 ? 3.958  148.133 52.608  1.00 408.39 ? 231  ARG C NH1 1 
ATOM   7483 N  NH2 . ARG C 3  211 ? 1.924  148.389 53.637  1.00 420.16 ? 231  ARG C NH2 1 
ATOM   7484 N  N   . ASN C 3  212 ? 1.760  152.445 50.070  1.00 363.78 ? 232  ASN C N   1 
ATOM   7485 C  CA  . ASN C 3  212 ? 0.974  151.567 49.208  1.00 378.67 ? 232  ASN C CA  1 
ATOM   7486 C  C   . ASN C 3  212 ? 1.349  151.716 47.735  1.00 386.83 ? 232  ASN C C   1 
ATOM   7487 O  O   . ASN C 3  212 ? 0.523  152.121 46.915  1.00 375.90 ? 232  ASN C O   1 
ATOM   7488 C  CB  . ASN C 3  212 ? -0.520 151.841 49.392  1.00 371.10 ? 232  ASN C CB  1 
ATOM   7489 N  N   . GLU C 3  213 ? 2.597  151.377 47.415  1.00 418.03 ? 233  GLU C N   1 
ATOM   7490 C  CA  . GLU C 3  213 ? 3.121  151.435 46.053  1.00 428.47 ? 233  GLU C CA  1 
ATOM   7491 C  C   . GLU C 3  213 ? 2.899  152.806 45.416  1.00 427.25 ? 233  GLU C C   1 
ATOM   7492 O  O   . GLU C 3  213 ? 2.359  152.902 44.313  1.00 431.04 ? 233  GLU C O   1 
ATOM   7493 C  CB  . GLU C 3  213 ? 2.486  150.340 45.189  1.00 439.64 ? 233  GLU C CB  1 
ATOM   7494 C  CG  . GLU C 3  213 ? 3.316  149.939 43.976  1.00 436.16 ? 233  GLU C CG  1 
ATOM   7495 C  CD  . GLU C 3  213 ? 4.638  149.299 44.357  1.00 431.82 ? 233  GLU C CD  1 
ATOM   7496 O  OE1 . GLU C 3  213 ? 4.719  148.700 45.450  1.00 434.93 ? 233  GLU C OE1 1 
ATOM   7497 O  OE2 . GLU C 3  213 ? 5.597  149.397 43.562  1.00 424.93 ? 233  GLU C OE2 1 
ATOM   7498 N  N   . CYS C 3  214 ? 3.332  153.849 46.125  1.00 415.64 ? 234  CYS C N   1 
ATOM   7499 C  CA  . CYS C 3  214 ? 3.225  155.250 45.696  1.00 405.76 ? 234  CYS C CA  1 
ATOM   7500 C  C   . CYS C 3  214 ? 1.949  155.569 44.915  1.00 408.38 ? 234  CYS C C   1 
ATOM   7501 O  O   . CYS C 3  214 ? 1.231  156.514 45.240  1.00 405.64 ? 234  CYS C O   1 
ATOM   7502 C  CB  . CYS C 3  214 ? 4.452  155.649 44.863  1.00 394.01 ? 234  CYS C CB  1 
ATOM   7503 S  SG  . CYS C 3  214 ? 4.927  154.517 43.526  1.00 400.72 ? 234  CYS C SG  1 
HETATM 7504 C  C10 . 68P D 4  .   ? 30.931 184.363 2.955   1.00 134.17 ? 701  68P A C10 1 
HETATM 7505 C  C13 . 68P D 4  .   ? 33.695 182.430 3.059   1.00 161.89 ? 701  68P A C13 1 
HETATM 7506 C  C15 . 68P D 4  .   ? 29.787 183.415 2.572   1.00 156.77 ? 701  68P A C15 1 
HETATM 7507 C  C17 . 68P D 4  .   ? 34.320 181.085 2.718   1.00 142.19 ? 701  68P A C17 1 
HETATM 7508 C  C20 . 68P D 4  .   ? 29.604 184.991 5.168   1.00 141.67 ? 701  68P A C20 1 
HETATM 7509 C  C21 . 68P D 4  .   ? 28.467 184.041 4.781   1.00 151.12 ? 701  68P A C21 1 
HETATM 7510 C  C22 . 68P D 4  .   ? 36.137 187.498 -0.142  1.00 148.05 ? 701  68P A C22 1 
HETATM 7511 C  C24 . 68P D 4  .   ? 34.784 179.146 1.046   1.00 166.26 ? 701  68P A C24 1 
HETATM 7512 F  F01 . 68P D 4  .   ? 27.395 183.901 5.581   1.00 180.75 ? 701  68P A F01 1 
HETATM 7513 O  O02 . 68P D 4  .   ? 31.699 184.812 0.739   1.00 134.42 ? 701  68P A O02 1 
HETATM 7514 N  N03 . 68P D 4  .   ? 34.746 187.055 -0.425  1.00 151.09 ? 701  68P A N03 1 
HETATM 7515 N  N04 . 68P D 4  .   ? 35.276 178.116 0.834   1.00 168.53 ? 701  68P A N04 1 
HETATM 7516 C  C05 . 68P D 4  .   ? 32.132 184.517 2.064   1.00 141.99 ? 701  68P A C05 1 
HETATM 7517 C  C06 . 68P D 4  .   ? 33.052 185.628 2.625   1.00 143.10 ? 701  68P A C06 1 
HETATM 7518 C  C07 . 68P D 4  .   ? 32.868 183.199 2.007   1.00 140.34 ? 701  68P A C07 1 
HETATM 7519 C  C08 . 68P D 4  .   ? 32.668 182.620 0.661   1.00 152.80 ? 701  68P A C08 1 
HETATM 7520 C  C09 . 68P D 4  .   ? 34.242 185.880 1.673   1.00 141.83 ? 701  68P A C09 1 
HETATM 7521 C  C11 . 68P D 4  .   ? 31.864 183.585 -0.100  1.00 152.65 ? 701  68P A C11 1 
HETATM 7522 C  C12 . 68P D 4  .   ? 33.934 187.077 0.773   1.00 140.65 ? 701  68P A C12 1 
HETATM 7523 C  C14 . 68P D 4  .   ? 33.307 181.247 0.314   1.00 150.99 ? 701  68P A C14 1 
HETATM 7524 C  C16 . 68P D 4  .   ? 30.831 185.150 4.251   1.00 140.78 ? 701  68P A C16 1 
HETATM 7525 C  C18 . 68P D 4  .   ? 34.141 180.501 1.353   1.00 146.41 ? 701  68P A C18 1 
HETATM 7526 C  C19 . 68P D 4  .   ? 28.557 183.255 3.486   1.00 160.53 ? 701  68P A C19 1 
HETATM 7527 C  C23 . 68P D 4  .   ? 34.728 185.751 -1.043  1.00 167.28 ? 701  68P A C23 1 
HETATM 7528 C  C1  . NAG E 5  .   ? 56.108 178.104 30.731  1.00 82.27  ? 702  NAG A C1  1 
HETATM 7529 C  C2  . NAG E 5  .   ? 55.619 177.733 32.137  1.00 101.23 ? 702  NAG A C2  1 
HETATM 7530 C  C3  . NAG E 5  .   ? 55.882 176.255 32.398  1.00 102.52 ? 702  NAG A C3  1 
HETATM 7531 C  C4  . NAG E 5  .   ? 55.323 175.381 31.283  1.00 104.47 ? 702  NAG A C4  1 
HETATM 7532 C  C5  . NAG E 5  .   ? 55.834 175.866 29.932  1.00 109.74 ? 702  NAG A C5  1 
HETATM 7533 C  C6  . NAG E 5  .   ? 55.202 175.135 28.769  1.00 122.45 ? 702  NAG A C6  1 
HETATM 7534 C  C7  . NAG E 5  .   ? 55.717 178.734 34.371  1.00 137.45 ? 702  NAG A C7  1 
HETATM 7535 C  C8  . NAG E 5  .   ? 56.503 179.611 35.297  1.00 149.35 ? 702  NAG A C8  1 
HETATM 7536 N  N2  . NAG E 5  .   ? 56.246 178.542 33.161  1.00 112.52 ? 702  NAG A N2  1 
HETATM 7537 O  O3  . NAG E 5  .   ? 55.293 175.871 33.634  1.00 92.48  ? 702  NAG A O3  1 
HETATM 7538 O  O4  . NAG E 5  .   ? 55.704 174.026 31.479  1.00 111.45 ? 702  NAG A O4  1 
HETATM 7539 O  O5  . NAG E 5  .   ? 55.509 177.254 29.769  1.00 112.07 ? 702  NAG A O5  1 
HETATM 7540 O  O6  . NAG E 5  .   ? 54.815 176.019 27.724  1.00 154.73 ? 702  NAG A O6  1 
HETATM 7541 O  O7  . NAG E 5  .   ? 54.642 178.238 34.692  1.00 143.71 ? 702  NAG A O7  1 
HETATM 7542 C  C1  . CLR F 6  .   ? 37.673 159.276 16.759  1.00 206.05 ? 703  CLR A C1  1 
HETATM 7543 C  C2  . CLR F 6  .   ? 38.141 158.923 18.162  1.00 215.71 ? 703  CLR A C2  1 
HETATM 7544 C  C3  . CLR F 6  .   ? 38.454 160.211 18.906  1.00 233.69 ? 703  CLR A C3  1 
HETATM 7545 C  C4  . CLR F 6  .   ? 37.215 161.088 18.994  1.00 212.18 ? 703  CLR A C4  1 
HETATM 7546 C  C5  . CLR F 6  .   ? 36.519 161.214 17.664  1.00 202.65 ? 703  CLR A C5  1 
HETATM 7547 C  C6  . CLR F 6  .   ? 36.044 162.403 17.287  1.00 187.03 ? 703  CLR A C6  1 
HETATM 7548 C  C7  . CLR F 6  .   ? 35.627 162.687 15.868  1.00 185.86 ? 703  CLR A C7  1 
HETATM 7549 C  C8  . CLR F 6  .   ? 34.902 161.476 15.335  1.00 182.72 ? 703  CLR A C8  1 
HETATM 7550 C  C9  . CLR F 6  .   ? 35.849 160.291 15.374  1.00 174.22 ? 703  CLR A C9  1 
HETATM 7551 C  C10 . CLR F 6  .   ? 36.338 159.990 16.801  1.00 200.82 ? 703  CLR A C10 1 
HETATM 7552 C  C11 . CLR F 6  .   ? 35.222 159.070 14.685  1.00 165.96 ? 703  CLR A C11 1 
HETATM 7553 C  C12 . CLR F 6  .   ? 34.565 159.375 13.332  1.00 175.60 ? 703  CLR A C12 1 
HETATM 7554 C  C13 . CLR F 6  .   ? 33.576 160.510 13.476  1.00 193.44 ? 703  CLR A C13 1 
HETATM 7555 C  C14 . CLR F 6  .   ? 34.394 161.692 13.929  1.00 201.17 ? 703  CLR A C14 1 
HETATM 7556 C  C15 . CLR F 6  .   ? 33.509 162.900 13.719  1.00 196.51 ? 703  CLR A C15 1 
HETATM 7557 C  C16 . CLR F 6  .   ? 32.703 162.539 12.481  1.00 190.52 ? 703  CLR A C16 1 
HETATM 7558 C  C17 . CLR F 6  .   ? 32.891 161.050 12.224  1.00 195.70 ? 703  CLR A C17 1 
HETATM 7559 C  C18 . CLR F 6  .   ? 32.544 160.099 14.518  1.00 203.64 ? 703  CLR A C18 1 
HETATM 7560 C  C19 . CLR F 6  .   ? 35.361 159.095 17.535  1.00 200.08 ? 703  CLR A C19 1 
HETATM 7561 C  C20 . CLR F 6  .   ? 31.545 160.431 11.869  1.00 171.02 ? 703  CLR A C20 1 
HETATM 7562 C  C21 . CLR F 6  .   ? 31.709 158.977 11.468  1.00 168.21 ? 703  CLR A C21 1 
HETATM 7563 C  C22 . CLR F 6  .   ? 30.830 161.221 10.780  1.00 197.02 ? 703  CLR A C22 1 
HETATM 7564 C  C23 . CLR F 6  .   ? 29.679 162.028 11.375  1.00 211.86 ? 703  CLR A C23 1 
HETATM 7565 C  C24 . CLR F 6  .   ? 29.462 163.354 10.649  1.00 211.98 ? 703  CLR A C24 1 
HETATM 7566 C  C25 . CLR F 6  .   ? 28.006 163.810 10.697  1.00 201.78 ? 703  CLR A C25 1 
HETATM 7567 C  C26 . CLR F 6  .   ? 27.906 165.330 10.657  1.00 195.90 ? 703  CLR A C26 1 
HETATM 7568 C  C27 . CLR F 6  .   ? 27.196 163.195 9.565   1.00 173.87 ? 703  CLR A C27 1 
HETATM 7569 O  O1  . CLR F 6  .   ? 38.887 159.894 20.230  1.00 227.09 ? 703  CLR A O1  1 
HETATM 7570 C  C01 . C14 G 7  .   ? 32.294 165.905 -5.295  0.50 106.71 ? 704  C14 A C01 1 
HETATM 7571 C  C02 . C14 G 7  .   ? 33.543 165.376 -4.638  0.50 104.04 ? 704  C14 A C02 1 
HETATM 7572 C  C03 . C14 G 7  .   ? 33.334 165.220 -3.144  0.50 108.40 ? 704  C14 A C03 1 
HETATM 7573 C  C04 . C14 G 7  .   ? 34.467 165.880 -2.385  0.50 109.89 ? 704  C14 A C04 1 
HETATM 7574 C  C05 . C14 G 7  .   ? 34.037 166.200 -0.965  0.50 103.71 ? 704  C14 A C05 1 
HETATM 7575 C  C06 . C14 G 7  .   ? 34.474 165.100 -0.014  0.50 103.40 ? 704  C14 A C06 1 
HETATM 7576 C  C07 . C14 G 7  .   ? 34.108 163.724 -0.548  0.50 104.44 ? 704  C14 A C07 1 
HETATM 7577 C  C08 . C14 G 7  .   ? 34.114 162.681 0.565   0.50 104.36 ? 704  C14 A C08 1 
HETATM 7578 C  C09 . C14 G 7  .   ? 34.476 161.305 0.027   0.50 103.32 ? 704  C14 A C09 1 
HETATM 7579 C  C10 . C14 G 7  .   ? 34.033 160.203 0.972   0.50 103.45 ? 704  C14 A C10 1 
HETATM 7580 C  C11 . C14 G 7  .   ? 34.460 160.515 2.394   0.50 109.85 ? 704  C14 A C11 1 
HETATM 7581 C  C12 . C14 G 7  .   ? 33.339 161.204 3.144   0.50 108.37 ? 704  C14 A C12 1 
HETATM 7582 C  C13 . C14 G 7  .   ? 33.540 161.058 4.640   0.50 103.33 ? 704  C14 A C13 1 
HETATM 7583 C  C14 . C14 G 7  .   ? 32.299 160.500 5.288   0.50 106.83 ? 704  C14 A C14 1 
HETATM 7584 C  C10 . 68P H 4  .   ? 42.213 175.832 0.482   1.00 151.24 ? 705  68P A C10 1 
HETATM 7585 C  C13 . 68P H 4  .   ? 43.728 178.850 -0.127  1.00 173.95 ? 705  68P A C13 1 
HETATM 7586 C  C15 . 68P H 4  .   ? 41.213 174.736 0.869   1.00 146.18 ? 705  68P A C15 1 
HETATM 7587 C  C17 . 68P H 4  .   ? 43.641 180.336 -0.454  1.00 181.51 ? 705  68P A C17 1 
HETATM 7588 C  C20 . 68P H 4  .   ? 42.245 174.884 -1.997  1.00 146.31 ? 705  68P A C20 1 
HETATM 7589 C  C21 . 68P H 4  .   ? 41.246 173.797 -1.603  1.00 137.60 ? 705  68P A C21 1 
HETATM 7590 C  C22 . 68P H 4  .   ? 47.533 178.527 3.372   1.00 211.79 ? 705  68P A C22 1 
HETATM 7591 C  C24 . 68P H 4  .   ? 42.579 182.706 -0.034  1.00 203.97 ? 705  68P A C24 1 
HETATM 7592 F  F01 . 68P H 4  .   ? 40.823 172.912 -2.520  1.00 172.03 ? 705  68P A F01 1 
HETATM 7593 O  O02 . 68P H 4  .   ? 41.669 176.850 2.536   1.00 163.57 ? 705  68P A O02 1 
HETATM 7594 N  N03 . 68P H 4  .   ? 47.242 177.071 3.385   1.00 210.28 ? 705  68P A N03 1 
HETATM 7595 N  N04 . 68P H 4  .   ? 42.505 183.842 -0.277  1.00 222.28 ? 705  68P A N04 1 
HETATM 7596 C  C05 . 68P H 4  .   ? 42.673 176.810 1.525   1.00 163.44 ? 705  68P A C05 1 
HETATM 7597 C  C06 . 68P H 4  .   ? 43.986 176.273 2.145   1.00 209.47 ? 705  68P A C06 1 
HETATM 7598 C  C07 . 68P H 4  .   ? 42.827 178.221 0.971   1.00 173.74 ? 705  68P A C07 1 
HETATM 7599 C  C08 . 68P H 4  .   ? 41.875 179.089 1.697   1.00 165.73 ? 705  68P A C08 1 
HETATM 7600 C  C09 . 68P H 4  .   ? 44.910 177.397 2.669   1.00 218.18 ? 705  68P A C09 1 
HETATM 7601 C  C11 . 68P H 4  .   ? 41.163 178.246 2.665   1.00 162.65 ? 705  68P A C11 1 
HETATM 7602 C  C12 . 68P H 4  .   ? 45.858 176.827 3.727   1.00 206.26 ? 705  68P A C12 1 
HETATM 7603 C  C14 . 68P H 4  .   ? 41.784 180.601 1.368   1.00 176.74 ? 705  68P A C14 1 
HETATM 7604 C  C16 . 68P H 4  .   ? 42.727 175.896 -0.946  1.00 145.68 ? 705  68P A C16 1 
HETATM 7605 C  C18 . 68P H 4  .   ? 42.674 181.210 0.288   1.00 186.32 ? 705  68P A C18 1 
HETATM 7606 C  C19 . 68P H 4  .   ? 40.729 173.719 -0.178  1.00 134.10 ? 705  68P A C19 1 
HETATM 7607 C  C23 . 68P H 4  .   ? 47.568 176.473 2.112   1.00 213.19 ? 705  68P A C23 1 
HETATM 7608 C  C1  . NAG I 5  .   ? 71.817 187.623 30.701  1.00 294.28 ? 706  NAG A C1  1 
HETATM 7609 C  C2  . NAG I 5  .   ? 71.935 187.830 32.210  1.00 287.56 ? 706  NAG A C2  1 
HETATM 7610 C  C3  . NAG I 5  .   ? 71.968 186.480 32.925  1.00 277.88 ? 706  NAG A C3  1 
HETATM 7611 C  C4  . NAG I 5  .   ? 70.777 185.627 32.509  1.00 276.79 ? 706  NAG A C4  1 
HETATM 7612 C  C5  . NAG I 5  .   ? 70.700 185.524 30.988  1.00 281.47 ? 706  NAG A C5  1 
HETATM 7613 C  C6  . NAG I 5  .   ? 69.467 184.796 30.506  1.00 278.37 ? 706  NAG A C6  1 
HETATM 7614 C  C7  . NAG I 5  .   ? 73.194 189.387 33.631  1.00 280.18 ? 706  NAG A C7  1 
HETATM 7615 C  C8  . NAG I 5  .   ? 74.485 190.127 33.817  1.00 279.55 ? 706  NAG A C8  1 
HETATM 7616 N  N2  . NAG I 5  .   ? 73.114 188.612 32.543  1.00 280.93 ? 706  NAG A N2  1 
HETATM 7617 O  O3  . NAG I 5  .   ? 71.949 186.687 34.332  1.00 266.91 ? 706  NAG A O3  1 
HETATM 7618 O  O4  . NAG I 5  .   ? 70.899 184.321 33.061  1.00 274.42 ? 706  NAG A O4  1 
HETATM 7619 O  O5  . NAG I 5  .   ? 70.659 186.838 30.411  1.00 291.11 ? 706  NAG A O5  1 
HETATM 7620 O  O6  . NAG I 5  .   ? 69.513 183.416 30.844  1.00 279.01 ? 706  NAG A O6  1 
HETATM 7621 O  O7  . NAG I 5  .   ? 72.267 189.483 34.429  1.00 283.24 ? 706  NAG A O7  1 
HETATM 7622 NA NA  . NA  J 8  .   ? 39.220 188.814 -1.766  1.00 260.53 ? 707  NA  A NA  1 
HETATM 7623 NA NA  . NA  K 8  .   ? 34.523 193.207 3.294   1.00 130.75 ? 708  NA  A NA  1 
HETATM 7624 C  C1  . ACA L 9  .   ? 30.226 168.738 26.705  1.00 204.51 ? 709  ACA A C1  1 
HETATM 7625 O  O1  . ACA L 9  .   ? 29.259 167.929 26.677  1.00 199.38 ? 709  ACA A O1  1 
HETATM 7626 O  O2  . ACA L 9  .   ? 30.754 169.052 27.808  1.00 199.92 ? 709  ACA A O2  1 
HETATM 7627 C  C2  . ACA L 9  .   ? 30.762 169.336 25.402  1.00 191.64 ? 709  ACA A C2  1 
HETATM 7628 C  C3  . ACA L 9  .   ? 32.289 169.267 25.398  1.00 158.96 ? 709  ACA A C3  1 
HETATM 7629 C  C4  . ACA L 9  .   ? 32.746 168.018 24.645  1.00 139.35 ? 709  ACA A C4  1 
HETATM 7630 C  C5  . ACA L 9  .   ? 33.693 167.210 25.531  1.00 144.38 ? 709  ACA A C5  1 
HETATM 7631 C  C6  . ACA L 9  .   ? 32.911 166.587 26.687  1.00 142.56 ? 709  ACA A C6  1 
HETATM 7632 N  N6  . ACA L 9  .   ? 33.824 165.911 27.592  1.00 118.03 ? 709  ACA A N6  1 
HETATM 7633 O  O   . HOH M 10 .   ? 35.693 195.283 3.129   1.00 145.04 ? 1001 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 4   ? 2.6912 4.3015 3.2220 1.1431  -0.5823 0.0294  77  GLY A N   
2    C CA  . GLY A 4   ? 2.7194 4.2693 3.2302 1.1260  -0.6095 0.0624  77  GLY A CA  
3    C C   . GLY A 4   ? 2.6588 4.0877 3.1304 1.0964  -0.6085 0.0699  77  GLY A C   
4    O O   . GLY A 4   ? 2.6724 4.1115 3.1305 1.0446  -0.6032 0.0784  77  GLY A O   
5    N N   . GLU A 5   ? 2.5035 3.8178 2.9551 1.1291  -0.6138 0.0667  78  GLU A N   
6    C CA  . GLU A 5   ? 2.3167 3.5098 2.7298 1.1047  -0.6157 0.0767  78  GLU A CA  
7    C C   . GLU A 5   ? 2.4141 3.5479 2.8155 1.1104  -0.5917 0.0488  78  GLU A C   
8    O O   . GLU A 5   ? 2.3758 3.5561 2.7966 1.1372  -0.5752 0.0216  78  GLU A O   
9    C CB  . GLU A 5   ? 2.2535 3.3480 2.6447 1.1289  -0.6466 0.1036  78  GLU A CB  
10   C CG  . GLU A 5   ? 2.1979 3.2596 2.5977 1.1912  -0.6553 0.0932  78  GLU A CG  
11   C CD  . GLU A 5   ? 2.3701 3.3430 2.7495 1.2132  -0.6883 0.1232  78  GLU A CD  
12   O OE1 . GLU A 5   ? 2.5712 3.5079 2.9285 1.1785  -0.7040 0.1527  78  GLU A OE1 
13   O OE2 . GLU A 5   ? 2.3782 3.3173 2.7616 1.2651  -0.6990 0.1176  78  GLU A OE2 
14   N N   . ARG A 6   ? 2.5629 3.5963 2.9314 1.0845  -0.5903 0.0562  79  ARG A N   
15   C CA  . ARG A 6   ? 2.5462 3.5131 2.8998 1.0857  -0.5702 0.0330  79  ARG A CA  
16   C C   . ARG A 6   ? 2.6781 3.5192 3.0050 1.1194  -0.5852 0.0371  79  ARG A C   
17   O O   . ARG A 6   ? 2.9728 3.7842 3.2956 1.1452  -0.6104 0.0567  79  ARG A O   
18   C CB  . ARG A 6   ? 2.4366 3.3802 2.7724 1.0326  -0.5561 0.0362  79  ARG A CB  
19   N N   . GLU A 7   ? 2.5367 3.3037 2.8440 1.1174  -0.5706 0.0193  80  GLU A N   
20   C CA  . GLU A 7   ? 2.4183 3.0627 2.6962 1.1452  -0.5833 0.0205  80  GLU A CA  
21   C C   . GLU A 7   ? 2.0781 2.6194 2.3200 1.1122  -0.5955 0.0475  80  GLU A C   
22   O O   . GLU A 7   ? 2.0672 2.6334 2.3070 1.0707  -0.5940 0.0645  80  GLU A O   
23   C CB  . GLU A 7   ? 2.3152 2.9328 2.5880 1.1615  -0.5629 -0.0140 80  GLU A CB  
24   C CG  . GLU A 7   ? 2.5471 3.2549 2.8495 1.2011  -0.5523 -0.0418 80  GLU A CG  
25   C CD  . GLU A 7   ? 2.7622 3.4531 3.0672 1.2549  -0.5746 -0.0378 80  GLU A CD  
26   O OE1 . GLU A 7   ? 2.7209 3.5083 3.0565 1.2852  -0.5713 -0.0507 80  GLU A OE1 
27   O OE2 . GLU A 7   ? 2.9211 3.5030 3.1970 1.2667  -0.5956 -0.0213 80  GLU A OE2 
28   N N   . THR A 8   ? 2.0582 2.4843 2.2694 1.1306  -0.6078 0.0511  81  THR A N   
29   C CA  . THR A 8   ? 2.3260 2.6489 2.4997 1.1008  -0.6199 0.0772  81  THR A CA  
30   C C   . THR A 8   ? 2.3820 2.5965 2.5252 1.1058  -0.6150 0.0629  81  THR A C   
31   O O   . THR A 8   ? 2.1499 2.3743 2.3010 1.1279  -0.5999 0.0313  81  THR A O   
32   C CB  . THR A 8   ? 2.3920 2.6760 2.5517 1.1128  -0.6516 0.1115  81  THR A CB  
33   O OG1 . THR A 8   ? 2.6501 2.8350 2.7702 1.0812  -0.6621 0.1370  81  THR A OG1 
34   C CG2 . THR A 8   ? 2.1807 2.4264 2.3389 1.1676  -0.6667 0.1032  81  THR A CG2 
35   N N   . TRP A 9   ? 2.4545 2.5676 2.5609 1.0837  -0.6283 0.0866  82  TRP A N   
36   C CA  . TRP A 9   ? 2.1080 2.1127 2.1813 1.0830  -0.6267 0.0767  82  TRP A CA  
37   C C   . TRP A 9   ? 2.3560 2.2836 2.4085 1.1260  -0.6487 0.0768  82  TRP A C   
38   O O   . TRP A 9   ? 2.4166 2.3370 2.4664 1.1422  -0.6717 0.1004  82  TRP A O   
39   C CB  . TRP A 9   ? 2.0872 2.0208 2.1291 1.0358  -0.6299 0.1021  82  TRP A CB  
40   N N   . GLY A 10  ? 2.4194 2.2885 2.4554 1.1443  -0.6428 0.0504  83  GLY A N   
41   C CA  . GLY A 10  ? 2.3960 2.1811 2.4063 1.1849  -0.6635 0.0469  83  GLY A CA  
42   C C   . GLY A 10  ? 2.5861 2.2562 2.5528 1.1653  -0.6877 0.0798  83  GLY A C   
43   O O   . GLY A 10  ? 2.9980 2.6091 2.9455 1.1949  -0.7121 0.0912  83  GLY A O   
44   N N   . LYS A 11  ? 2.3843 2.0238 2.3345 1.1148  -0.6811 0.0956  84  LYS A N   
45   C CA  . LYS A 11  ? 2.4373 1.9746 2.3447 1.0878  -0.7018 0.1288  84  LYS A CA  
46   C C   . LYS A 11  ? 2.7456 2.2954 2.6498 1.0316  -0.6895 0.1471  84  LYS A C   
47   O O   . LYS A 11  ? 2.7382 2.3394 2.6625 1.0137  -0.6646 0.1278  84  LYS A O   
48   C CB  . LYS A 11  ? 2.5249 1.9419 2.3901 1.0981  -0.7122 0.1169  84  LYS A CB  
49   C CG  . LYS A 11  ? 2.5924 1.8984 2.4092 1.0695  -0.7354 0.1509  84  LYS A CG  
50   C CD  . LYS A 11  ? 2.7078 1.8974 2.4826 1.0919  -0.7535 0.1398  84  LYS A CD  
51   C CE  . LYS A 11  ? 3.1138 2.3025 2.8936 1.1492  -0.7717 0.1339  84  LYS A CE  
52   N NZ  . LYS A 11  ? 3.2178 2.2834 2.9507 1.1712  -0.7927 0.1251  84  LYS A NZ  
53   N N   . LYS A 12  ? 2.5345 2.0380 2.4120 1.0038  -0.7066 0.1842  85  LYS A N   
54   C CA  . LYS A 12  ? 2.4971 2.0271 2.3743 0.9546  -0.6949 0.2016  85  LYS A CA  
55   C C   . LYS A 12  ? 2.7653 2.2546 2.6317 0.9309  -0.6769 0.1831  85  LYS A C   
56   O O   . LYS A 12  ? 3.0407 2.5845 2.9260 0.9049  -0.6552 0.1757  85  LYS A O   
57   C CB  . LYS A 12  ? 2.5873 2.0610 2.4288 0.9267  -0.7167 0.2443  85  LYS A CB  
58   C CG  . LYS A 12  ? 2.6815 2.1808 2.5186 0.8765  -0.7048 0.2622  85  LYS A CG  
59   C CD  . LYS A 12  ? 2.6617 2.2817 2.5385 0.8745  -0.6904 0.2566  85  LYS A CD  
60   C CE  . LYS A 12  ? 2.5424 2.1813 2.4079 0.8268  -0.6826 0.2768  85  LYS A CE  
61   N NZ  . LYS A 12  ? 2.4993 2.2510 2.4002 0.8221  -0.6666 0.2657  85  LYS A NZ  
62   N N   . VAL A 13  ? 2.7341 2.1277 2.5696 0.9403  -0.6866 0.1747  86  VAL A N   
63   C CA  . VAL A 13  ? 2.3870 1.7325 2.2068 0.9132  -0.6739 0.1623  86  VAL A CA  
64   C C   . VAL A 13  ? 2.2260 1.6476 2.0819 0.9195  -0.6455 0.1275  86  VAL A C   
65   O O   . VAL A 13  ? 2.1568 1.5909 2.0171 0.8856  -0.6285 0.1261  86  VAL A O   
66   C CB  . VAL A 13  ? 2.4800 1.7112 2.2590 0.9263  -0.6917 0.1556  86  VAL A CB  
67   C CG1 . VAL A 13  ? 2.3920 1.5790 2.1566 0.9004  -0.6791 0.1398  86  VAL A CG1 
68   C CG2 . VAL A 13  ? 2.6857 1.8344 2.4239 0.9107  -0.7197 0.1932  86  VAL A CG2 
69   N N   . ASP A 14  ? 2.3599 1.8362 2.2419 0.9617  -0.6401 0.1006  87  ASP A N   
70   C CA  . ASP A 14  ? 2.4922 2.0259 2.4003 0.9680  -0.6148 0.0658  87  ASP A CA  
71   C C   . ASP A 14  ? 2.3890 2.0059 2.3258 0.9347  -0.5937 0.0707  87  ASP A C   
72   O O   . ASP A 14  ? 2.3978 2.0172 2.3376 0.9109  -0.5760 0.0592  87  ASP A O   
73   C CB  . ASP A 14  ? 2.4777 2.0757 2.4125 1.0173  -0.6119 0.0397  87  ASP A CB  
74   C CG  . ASP A 14  ? 2.4295 1.9480 2.3365 1.0563  -0.6312 0.0290  87  ASP A CG  
75   O OD1 . ASP A 14  ? 2.4748 1.8850 2.3401 1.0431  -0.6485 0.0429  87  ASP A OD1 
76   O OD2 . ASP A 14  ? 2.3712 1.9361 2.2971 1.0999  -0.6295 0.0063  87  ASP A OD2 
77   N N   . PHE A 15  ? 2.4950 2.1764 2.4503 0.9318  -0.5971 0.0891  88  PHE A N   
78   C CA  . PHE A 15  ? 2.4117 2.1628 2.3874 0.8983  -0.5803 0.0961  88  PHE A CA  
79   C C   . PHE A 15  ? 2.3747 2.0592 2.3215 0.8560  -0.5828 0.1200  88  PHE A C   
80   O O   . PHE A 15  ? 2.6301 2.3373 2.5854 0.8278  -0.5646 0.1156  88  PHE A O   
81   C CB  . PHE A 15  ? 2.4470 2.2826 2.4457 0.9046  -0.5855 0.1093  88  PHE A CB  
82   C CG  . PHE A 15  ? 2.5321 2.4696 2.5706 0.9312  -0.5715 0.0820  88  PHE A CG  
83   C CD1 . PHE A 15  ? 2.5151 2.4533 2.5619 0.9586  -0.5611 0.0497  88  PHE A CD1 
84   C CD2 . PHE A 15  ? 2.5279 2.5618 2.5928 0.9273  -0.5694 0.0885  88  PHE A CD2 
85   C CE1 . PHE A 15  ? 2.3673 2.4030 2.4490 0.9813  -0.5477 0.0255  88  PHE A CE1 
86   C CE2 . PHE A 15  ? 2.5233 2.6543 2.6238 0.9486  -0.5568 0.0646  88  PHE A CE2 
87   C CZ  . PHE A 15  ? 2.4222 2.5553 2.5316 0.9756  -0.5454 0.0335  88  PHE A CZ  
88   N N   . LEU A 16  ? 2.1094 1.7106 2.0210 0.8518  -0.6058 0.1454  89  LEU A N   
89   C CA  . LEU A 16  ? 2.3027 1.8454 2.1853 0.8098  -0.6095 0.1714  89  LEU A CA  
90   C C   . LEU A 16  ? 2.0976 1.6006 1.9742 0.7934  -0.5952 0.1540  89  LEU A C   
91   O O   . LEU A 16  ? 1.9764 1.4918 1.8557 0.7600  -0.5818 0.1603  89  LEU A O   
92   C CB  . LEU A 16  ? 2.4635 1.9158 2.3058 0.8094  -0.6375 0.1988  89  LEU A CB  
93   C CG  . LEU A 16  ? 2.3748 1.7488 2.1798 0.7661  -0.6435 0.2239  89  LEU A CG  
94   C CD1 . LEU A 16  ? 2.3344 1.7473 2.1368 0.7351  -0.6435 0.2536  89  LEU A CD1 
95   C CD2 . LEU A 16  ? 2.2563 1.5257 2.0191 0.7712  -0.6701 0.2395  89  LEU A CD2 
96   N N   . LEU A 17  ? 2.2234 1.6812 2.0917 0.8178  -0.5983 0.1313  90  LEU A N   
97   C CA  . LEU A 17  ? 2.0867 1.5145 1.9507 0.8039  -0.5851 0.1125  90  LEU A CA  
98   C C   . LEU A 17  ? 1.9308 1.4534 1.8350 0.8039  -0.5578 0.0891  90  LEU A C   
99   O O   . LEU A 17  ? 2.1023 1.6339 2.0124 0.7750  -0.5427 0.0886  90  LEU A O   
100  C CB  . LEU A 17  ? 2.0829 1.4480 1.9277 0.8340  -0.5952 0.0899  90  LEU A CB  
101  C CG  . LEU A 17  ? 2.4452 1.6924 2.2412 0.8218  -0.6202 0.1093  90  LEU A CG  
102  C CD1 . LEU A 17  ? 2.8407 2.0700 2.6228 0.8289  -0.6418 0.1380  90  LEU A CD1 
103  C CD2 . LEU A 17  ? 2.2519 1.4366 2.0268 0.8494  -0.6282 0.0818  90  LEU A CD2 
104  N N   . SER A 18  ? 1.9659 1.5623 1.8980 0.8360  -0.5525 0.0714  91  SER A N   
105  C CA  . SER A 18  ? 1.9029 1.5915 1.8720 0.8404  -0.5278 0.0455  91  SER A CA  
106  C C   . SER A 18  ? 1.9399 1.6717 1.9229 0.8022  -0.5122 0.0577  91  SER A C   
107  O O   . SER A 18  ? 2.1557 1.9188 2.1546 0.7900  -0.4925 0.0409  91  SER A O   
108  C CB  . SER A 18  ? 2.1396 1.9116 2.1367 0.8746  -0.5270 0.0333  91  SER A CB  
109  O OG  . SER A 18  ? 2.3085 2.1644 2.3373 0.8802  -0.5041 0.0057  91  SER A OG  
110  N N   . VAL A 19  ? 1.7969 1.5294 1.7718 0.7840  -0.5219 0.0869  92  VAL A N   
111  C CA  . VAL A 19  ? 1.8481 1.6163 1.8311 0.7497  -0.5092 0.0992  92  VAL A CA  
112  C C   . VAL A 19  ? 1.9504 1.6500 1.9135 0.7198  -0.5053 0.1069  92  VAL A C   
113  O O   . VAL A 19  ? 1.6673 1.3972 1.6440 0.6982  -0.4876 0.1028  92  VAL A O   
114  C CB  . VAL A 19  ? 1.6641 1.4492 1.6380 0.7391  -0.5226 0.1283  92  VAL A CB  
115  C CG1 . VAL A 19  ? 1.7462 1.4409 1.6819 0.7349  -0.5471 0.1556  92  VAL A CG1 
116  C CG2 . VAL A 19  ? 1.5967 1.4169 1.5744 0.7060  -0.5098 0.1386  92  VAL A CG2 
117  N N   . ILE A 20  ? 2.2648 1.8726 2.1954 0.7185  -0.5227 0.1183  93  ILE A N   
118  C CA  . ILE A 20  ? 1.7321 1.2725 1.6424 0.6899  -0.5217 0.1260  93  ILE A CA  
119  C C   . ILE A 20  ? 1.8793 1.4315 1.8056 0.6976  -0.5055 0.0950  93  ILE A C   
120  O O   . ILE A 20  ? 1.6593 1.2086 1.5901 0.6727  -0.4933 0.0950  93  ILE A O   
121  C CB  . ILE A 20  ? 1.8263 1.2650 1.6947 0.6854  -0.5466 0.1453  93  ILE A CB  
122  C CG1 . ILE A 20  ? 2.1879 1.6154 2.0377 0.6723  -0.5625 0.1795  93  ILE A CG1 
123  C CG2 . ILE A 20  ? 1.8353 1.2081 1.6836 0.6550  -0.5464 0.1512  93  ILE A CG2 
124  C CD1 . ILE A 20  ? 1.9514 1.2796 1.7577 0.6637  -0.5878 0.2017  93  ILE A CD1 
125  N N   . GLY A 21  ? 2.0322 1.5997 1.9666 0.7328  -0.5060 0.0691  94  GLY A N   
126  C CA  . GLY A 21  ? 2.1858 1.7735 2.1343 0.7436  -0.4910 0.0378  94  GLY A CA  
127  C C   . GLY A 21  ? 1.9891 1.6666 1.9734 0.7317  -0.4664 0.0278  94  GLY A C   
128  O O   . GLY A 21  ? 1.7382 1.4244 1.7314 0.7232  -0.4525 0.0121  94  GLY A O   
129  N N   . TYR A 22  ? 1.9720 1.7152 1.9748 0.7305  -0.4625 0.0374  95  TYR A N   
130  C CA  . TYR A 22  ? 1.4860 1.3107 1.5185 0.7160  -0.4414 0.0309  95  TYR A CA  
131  C C   . TYR A 22  ? 1.7201 1.5184 1.7463 0.6797  -0.4351 0.0488  95  TYR A C   
132  O O   . TYR A 22  ? 1.9077 1.7340 1.9505 0.6670  -0.4178 0.0376  95  TYR A O   
133  C CB  . TYR A 22  ? 1.8048 1.7029 1.8538 0.7235  -0.4422 0.0369  95  TYR A CB  
134  C CG  . TYR A 22  ? 1.3887 1.3532 1.4575 0.7007  -0.4257 0.0391  95  TYR A CG  
135  C CD1 . TYR A 22  ? 1.3326 1.3637 1.4283 0.7002  -0.4056 0.0161  95  TYR A CD1 
136  C CD2 . TYR A 22  ? 1.7261 1.6860 1.7836 0.6798  -0.4312 0.0641  95  TYR A CD2 
137  C CE1 . TYR A 22  ? 1.2697 1.3578 1.3811 0.6796  -0.3917 0.0178  95  TYR A CE1 
138  C CE2 . TYR A 22  ? 1.5254 1.5424 1.5970 0.6600  -0.4161 0.0642  95  TYR A CE2 
139  C CZ  . TYR A 22  ? 1.2629 1.3419 1.3615 0.6558  -0.3941 0.0410  95  TYR A CZ  
140  O OH  . TYR A 22  ? 1.2086 1.3375 1.3179 0.6183  -0.3695 0.0411  95  TYR A OH  
141  N N   . ALA A 23  ? 1.5922 1.3381 1.5940 0.6636  -0.4498 0.0775  96  ALA A N   
142  C CA  . ALA A 23  ? 1.7337 1.4598 1.7285 0.6301  -0.4451 0.0977  96  ALA A CA  
143  C C   . ALA A 23  ? 1.9016 1.5735 1.8888 0.6142  -0.4417 0.0951  96  ALA A C   
144  O O   . ALA A 23  ? 1.7866 1.4797 1.7876 0.5896  -0.4236 0.0955  96  ALA A O   
145  C CB  . ALA A 23  ? 1.7058 1.3897 1.6724 0.6167  -0.4634 0.1301  96  ALA A CB  
146  N N   . VAL A 24  ? 1.8834 1.4880 1.8484 0.6230  -0.4563 0.0924  97  VAL A N   
147  C CA  . VAL A 24  ? 1.7221 1.2687 1.6743 0.6063  -0.4577 0.0917  97  VAL A CA  
148  C C   . VAL A 24  ? 1.8536 1.4332 1.8261 0.6204  -0.4430 0.0597  97  VAL A C   
149  O O   . VAL A 24  ? 1.8372 1.4348 1.8135 0.6504  -0.4435 0.0365  97  VAL A O   
150  C CB  . VAL A 24  ? 1.9536 1.4070 1.8668 0.6069  -0.4821 0.1026  97  VAL A CB  
151  C CG1 . VAL A 24  ? 2.0487 1.4428 1.9467 0.5873  -0.4858 0.1017  97  VAL A CG1 
152  C CG2 . VAL A 24  ? 2.3298 1.7511 2.2206 0.5893  -0.4973 0.1369  97  VAL A CG2 
153  N N   . ASP A 25  ? 2.2964 1.8753 2.2778 0.5956  -0.4324 0.0630  98  ASP A N   
154  C CA  . ASP A 25  ? 2.2460 1.8595 2.2468 0.6033  -0.4178 0.0363  98  ASP A CA  
155  C C   . ASP A 25  ? 2.1439 1.7277 2.1427 0.5721  -0.4121 0.0425  98  ASP A C   
156  O O   . ASP A 25  ? 2.2259 1.7443 2.2012 0.5497  -0.4252 0.0635  98  ASP A O   
157  C CB  . ASP A 25  ? 2.3624 2.0716 2.3985 0.6064  -0.3953 0.0249  98  ASP A CB  
158  C CG  . ASP A 25  ? 2.4793 2.2178 2.5281 0.5634  -0.3743 0.0455  98  ASP A CG  
159  O OD1 . ASP A 25  ? 2.6379 2.3289 2.6726 0.5346  -0.3770 0.0672  98  ASP A OD1 
160  O OD2 . ASP A 25  ? 2.4427 2.2523 2.5144 0.5582  -0.3552 0.0394  98  ASP A OD2 
161  N N   . LEU A 26  ? 2.0226 1.6566 2.0444 0.5688  -0.3922 0.0236  99  LEU A N   
162  C CA  . LEU A 26  ? 1.7957 1.4099 1.8177 0.5365  -0.3843 0.0287  99  LEU A CA  
163  C C   . LEU A 26  ? 1.4694 1.0980 1.5025 0.4948  -0.3695 0.0566  99  LEU A C   
164  O O   . LEU A 26  ? 1.4362 1.0244 1.4590 0.4667  -0.3736 0.0736  99  LEU A O   
165  C CB  . LEU A 26  ? 1.6288 1.2962 1.6721 0.5413  -0.3665 0.0035  99  LEU A CB  
166  C CG  . LEU A 26  ? 2.0250 1.6876 2.0586 0.5826  -0.3773 -0.0276 99  LEU A CG  
167  C CD1 . LEU A 26  ? 2.0559 1.7840 2.1119 0.5821  -0.3567 -0.0498 99  LEU A CD1 
168  C CD2 . LEU A 26  ? 2.0961 1.6670 2.0933 0.5892  -0.4019 -0.0298 99  LEU A CD2 
169  N N   . GLY A 27  ? 1.4064 1.0944 1.4597 0.4909  -0.3523 0.0606  100 GLY A N   
170  C CA  . GLY A 27  ? 1.5014 1.2073 1.5645 0.4562  -0.3361 0.0838  100 GLY A CA  
171  C C   . GLY A 27  ? 1.6831 1.3323 1.7220 0.4382  -0.3516 0.1115  100 GLY A C   
172  O O   . GLY A 27  ? 1.6955 1.3412 1.7381 0.4059  -0.3424 0.1308  100 GLY A O   
173  N N   . ASN A 28  ? 1.8342 1.4407 1.8480 0.4597  -0.3758 0.1142  101 ASN A N   
174  C CA  . ASN A 28  ? 1.7704 1.3145 1.7546 0.4437  -0.3955 0.1413  101 ASN A CA  
175  C C   . ASN A 28  ? 1.8039 1.2903 1.7724 0.4227  -0.4068 0.1493  101 ASN A C   
176  O O   . ASN A 28  ? 2.1898 1.6434 2.1428 0.3919  -0.4134 0.1762  101 ASN A O   
177  C CB  . ASN A 28  ? 2.0302 1.5333 1.9884 0.4763  -0.4227 0.1402  101 ASN A CB  
178  C CG  . ASN A 28  ? 2.3283 1.8774 2.2931 0.4839  -0.4171 0.1466  101 ASN A CG  
179  O OD1 . ASN A 28  ? 2.3401 1.9464 2.3255 0.5070  -0.4069 0.1267  101 ASN A OD1 
180  N ND2 . ASN A 28  ? 2.5749 2.1012 2.5204 0.4621  -0.4243 0.1751  101 ASN A ND2 
181  N N   . VAL A 29  ? 1.9559 1.4332 1.9272 0.4375  -0.4090 0.1260  102 VAL A N   
182  C CA  . VAL A 29  ? 2.0321 1.4499 1.9837 0.4204  -0.4234 0.1296  102 VAL A CA  
183  C C   . VAL A 29  ? 2.0924 1.5445 2.0668 0.3824  -0.4035 0.1407  102 VAL A C   
184  O O   . VAL A 29  ? 2.2909 1.7088 2.2523 0.3498  -0.4117 0.1639  102 VAL A O   
185  C CB  . VAL A 29  ? 1.9309 1.3216 1.8710 0.4536  -0.4354 0.0981  102 VAL A CB  
186  C CG1 . VAL A 29  ? 1.9997 1.3234 1.9139 0.4336  -0.4520 0.1009  102 VAL A CG1 
187  C CG2 . VAL A 29  ? 2.4512 1.8089 2.3703 0.4960  -0.4560 0.0872  102 VAL A CG2 
188  N N   . TRP A 30  ? 1.7050 1.2256 1.7131 0.3858  -0.3783 0.1256  103 TRP A N   
189  C CA  . TRP A 30  ? 1.6260 1.1777 1.6566 0.3552  -0.3612 0.1341  103 TRP A CA  
190  C C   . TRP A 30  ? 1.8542 1.4700 1.9146 0.3395  -0.3341 0.1469  103 TRP A C   
191  O O   . TRP A 30  ? 2.2650 1.8993 2.3408 0.3114  -0.3227 0.1635  103 TRP A O   
192  C CB  . TRP A 30  ? 1.6521 1.2238 1.6943 0.3670  -0.3551 0.1082  103 TRP A CB  
193  C CG  . TRP A 30  ? 1.6739 1.3058 1.7380 0.3920  -0.3374 0.0858  103 TRP A CG  
194  C CD1 . TRP A 30  ? 2.0220 1.6557 2.0783 0.4277  -0.3446 0.0615  103 TRP A CD1 
195  C CD2 . TRP A 30  ? 1.5000 1.1995 1.5965 0.3822  -0.3104 0.0863  103 TRP A CD2 
196  N NE1 . TRP A 30  ? 1.9333 1.6361 2.0157 0.4371  -0.3237 0.0480  103 TRP A NE1 
197  C CE2 . TRP A 30  ? 1.4914 1.2304 1.5964 0.4088  -0.3032 0.0627  103 TRP A CE2 
198  C CE3 . TRP A 30  ? 1.6687 1.3986 1.7869 0.3543  -0.2922 0.1042  103 TRP A CE3 
199  C CZ2 . TRP A 30  ? 1.4012 1.2028 1.5320 0.4044  -0.2798 0.0575  103 TRP A CZ2 
200  C CZ3 . TRP A 30  ? 1.8937 1.6814 2.0373 0.3544  -0.2687 0.0977  103 TRP A CZ3 
201  C CH2 . TRP A 30  ? 1.7465 1.5667 1.8944 0.3773  -0.2634 0.0749  103 TRP A CH2 
202  N N   . ARG A 31  ? 1.6064 1.2564 1.6743 0.3580  -0.3244 0.1390  104 ARG A N   
203  C CA  . ARG A 31  ? 1.5807 1.2887 1.6734 0.3460  -0.2979 0.1458  104 ARG A CA  
204  C C   . ARG A 31  ? 1.4977 1.1982 1.5830 0.3220  -0.2961 0.1742  104 ARG A C   
205  O O   . ARG A 31  ? 1.7959 1.5266 1.8994 0.3001  -0.2776 0.1871  104 ARG A O   
206  C CB  . ARG A 31  ? 1.9647 1.7117 2.0644 0.3702  -0.2894 0.1275  104 ARG A CB  
207  C CG  . ARG A 31  ? 1.7662 1.5728 1.8925 0.3616  -0.2612 0.1227  104 ARG A CG  
208  C CD  . ARG A 31  ? 1.8820 1.7258 2.0182 0.3834  -0.2555 0.0968  104 ARG A CD  
209  N NE  . ARG A 31  ? 1.8900 1.7800 2.0485 0.3719  -0.2312 0.0918  104 ARG A NE  
210  C CZ  . ARG A 31  ? 1.9534 1.8815 2.1226 0.3821  -0.2230 0.0720  104 ARG A CZ  
211  N NH1 . ARG A 31  ? 2.2207 2.1816 2.4060 0.3686  -0.2027 0.0703  104 ARG A NH1 
212  N NH2 . ARG A 31  ? 1.9083 1.8420 2.0711 0.4058  -0.2355 0.0544  104 ARG A NH2 
213  N N   . PHE A 32  ? 1.3486 1.0102 1.4065 0.3271  -0.3153 0.1841  105 PHE A N   
214  C CA  . PHE A 32  ? 1.3501 1.0034 1.3957 0.3029  -0.3158 0.2122  105 PHE A CA  
215  C C   . PHE A 32  ? 1.4594 1.0950 1.5043 0.2695  -0.3184 0.2348  105 PHE A C   
216  O O   . PHE A 32  ? 1.8919 1.5583 1.9467 0.2462  -0.3025 0.2537  105 PHE A O   
217  C CB  . PHE A 32  ? 1.4220 1.0287 1.4340 0.3149  -0.3409 0.2199  105 PHE A CB  
218  C CG  . PHE A 32  ? 1.3808 0.9733 1.3741 0.2870  -0.3449 0.2509  105 PHE A CG  
219  C CD1 . PHE A 32  ? 1.5894 1.2301 1.5909 0.2771  -0.3240 0.2593  105 PHE A CD1 
220  C CD2 . PHE A 32  ? 1.5398 1.0702 1.5043 0.2690  -0.3697 0.2716  105 PHE A CD2 
221  C CE1 . PHE A 32  ? 1.7315 1.3645 1.7144 0.2504  -0.3264 0.2877  105 PHE A CE1 
222  C CE2 . PHE A 32  ? 1.6901 1.2112 1.6360 0.2400  -0.3734 0.3020  105 PHE A CE2 
223  C CZ  . PHE A 32  ? 1.8277 1.4033 1.7837 0.2311  -0.3510 0.3100  105 PHE A CZ  
224  N N   . PRO A 33  ? 1.5590 1.1474 1.5912 0.2666  -0.3384 0.2328  106 PRO A N   
225  C CA  . PRO A 33  ? 1.6493 1.2269 1.6815 0.2309  -0.3416 0.2559  106 PRO A CA  
226  C C   . PRO A 33  ? 1.5269 1.1688 1.5980 0.2159  -0.3140 0.2589  106 PRO A C   
227  O O   . PRO A 33  ? 1.7461 1.4086 1.8251 0.1873  -0.3064 0.2831  106 PRO A O   
228  C CB  . PRO A 33  ? 1.4888 1.0058 1.4997 0.2347  -0.3670 0.2459  106 PRO A CB  
229  C CG  . PRO A 33  ? 1.4736 0.9507 1.4606 0.2694  -0.3840 0.2277  106 PRO A CG  
230  C CD  . PRO A 33  ? 1.4769 1.0148 1.4884 0.2929  -0.3614 0.2125  106 PRO A CD  
231  N N   . TYR A 34  ? 1.2360 0.9101 1.3304 0.2352  -0.2997 0.2355  107 TYR A N   
232  C CA  . TYR A 34  ? 1.3322 1.0616 1.4621 0.2248  -0.2756 0.2375  107 TYR A CA  
233  C C   . TYR A 34  ? 1.6151 1.3930 1.7615 0.2206  -0.2505 0.2471  107 TYR A C   
234  O O   . TYR A 34  ? 1.8668 1.6739 2.0293 0.1994  -0.2384 0.2666  107 TYR A O   
235  C CB  . TYR A 34  ? 1.5354 1.2838 1.6815 0.2461  -0.2679 0.2106  107 TYR A CB  
236  C CG  . TYR A 34  ? 1.6794 1.4800 1.8603 0.2382  -0.2447 0.2128  107 TYR A CG  
237  C CD1 . TYR A 34  ? 2.3054 2.1093 2.4986 0.2203  -0.2486 0.2225  107 TYR A CD1 
238  C CD2 . TYR A 34  ? 1.7941 1.6377 1.9935 0.2484  -0.2205 0.2057  107 TYR A CD2 
239  C CE1 . TYR A 34  ? 2.4891 2.3400 2.7147 0.2156  -0.2291 0.2262  107 TYR A CE1 
240  C CE2 . TYR A 34  ? 2.0675 1.9516 2.2963 0.2437  -0.2008 0.2080  107 TYR A CE2 
241  C CZ  . TYR A 34  ? 2.3903 2.2787 2.6332 0.2287  -0.2054 0.2188  107 TYR A CZ  
242  O OH  . TYR A 34  ? 2.4477 2.3759 2.7204 0.2265  -0.1875 0.2227  107 TYR A OH  
243  N N   . ILE A 35  ? 1.5012 1.2895 1.6426 0.2411  -0.2429 0.2327  108 ILE A N   
244  C CA  . ILE A 35  ? 1.4479 1.2777 1.5992 0.2392  -0.2191 0.2369  108 ILE A CA  
245  C C   . ILE A 35  ? 1.6376 1.4617 1.7739 0.2171  -0.2220 0.2635  108 ILE A C   
246  O O   . ILE A 35  ? 1.8232 1.6860 1.9707 0.2073  -0.2006 0.2731  108 ILE A O   
247  C CB  . ILE A 35  ? 1.3861 1.2240 1.5296 0.2627  -0.2150 0.2163  108 ILE A CB  
248  C CG1 . ILE A 35  ? 1.6086 1.4888 1.7615 0.2602  -0.1884 0.2163  108 ILE A CG1 
249  C CG2 . ILE A 35  ? 1.4022 1.2001 1.5141 0.2705  -0.2387 0.2192  108 ILE A CG2 
250  C CD1 . ILE A 35  ? 1.8873 1.7785 2.0309 0.2781  -0.1847 0.1975  108 ILE A CD1 
251  N N   . CYS A 36  ? 1.6439 1.4181 1.7525 0.2089  -0.2488 0.2753  109 CYS A N   
252  C CA  . CYS A 36  ? 1.2078 0.9716 1.2976 0.1831  -0.2554 0.3036  109 CYS A CA  
253  C C   . CYS A 36  ? 1.5790 1.3641 1.6866 0.1542  -0.2498 0.3242  109 CYS A C   
254  O O   . CYS A 36  ? 1.5851 1.4001 1.6951 0.1326  -0.2385 0.3455  109 CYS A O   
255  C CB  . CYS A 36  ? 1.4376 1.1330 1.4884 0.1833  -0.2889 0.3105  109 CYS A CB  
256  S SG  . CYS A 36  ? 1.6469 1.3202 1.6685 0.1452  -0.3024 0.3492  109 CYS A SG  
257  N N   . ALA A 37  ? 1.6393 1.4140 1.7597 0.1536  -0.2575 0.3178  110 ALA A N   
258  C CA  . ALA A 37  ? 1.5578 1.3522 1.6951 0.1252  -0.2567 0.3380  110 ALA A CA  
259  C C   . ALA A 37  ? 1.4967 1.3633 1.6753 0.1263  -0.2250 0.3388  110 ALA A C   
260  O O   . ALA A 37  ? 1.6230 1.5266 1.8171 0.1028  -0.2164 0.3613  110 ALA A O   
261  C CB  . ALA A 37  ? 1.5059 1.2615 1.6383 0.1232  -0.2780 0.3306  110 ALA A CB  
262  N N   . GLN A 38  ? 1.2961 1.1831 1.4920 0.1536  -0.2082 0.3146  111 GLN A N   
263  C CA  . GLN A 38  ? 1.4156 1.3610 1.6483 0.1584  -0.1802 0.3133  111 GLN A CA  
264  C C   . GLN A 38  ? 1.4151 1.3964 1.6501 0.1631  -0.1555 0.3151  111 GLN A C   
265  O O   . GLN A 38  ? 1.3251 1.3538 1.5876 0.1668  -0.1313 0.3165  111 GLN A O   
266  C CB  . GLN A 38  ? 1.3714 1.3188 1.6192 0.1820  -0.1746 0.2882  111 GLN A CB  
267  C CG  . GLN A 38  ? 1.4678 1.4089 1.7039 0.2060  -0.1663 0.2649  111 GLN A CG  
268  C CD  . GLN A 38  ? 1.6130 1.5698 1.8682 0.2240  -0.1548 0.2442  111 GLN A CD  
269  O OE1 . GLN A 38  ? 1.5184 1.4892 1.7953 0.2201  -0.1533 0.2475  111 GLN A OE1 
270  N NE2 . GLN A 38  ? 1.8084 1.7640 2.0542 0.2416  -0.1478 0.2242  111 GLN A NE2 
271  N N   . ASN A 39  ? 1.7910 1.7486 1.9956 0.1639  -0.1621 0.3147  112 ASN A N   
272  C CA  . ASN A 39  ? 1.8229 1.8112 2.0231 0.1668  -0.1401 0.3149  112 ASN A CA  
273  C C   . ASN A 39  ? 1.6801 1.6627 1.8583 0.1400  -0.1502 0.3418  112 ASN A C   
274  O O   . ASN A 39  ? 1.7747 1.7214 1.9198 0.1382  -0.1665 0.3441  112 ASN A O   
275  C CB  . ASN A 39  ? 1.6374 1.6070 1.8192 0.1892  -0.1396 0.2914  112 ASN A CB  
276  C CG  . ASN A 39  ? 1.6559 1.6374 1.8583 0.2111  -0.1269 0.2667  112 ASN A CG  
277  O OD1 . ASN A 39  ? 1.9392 1.9522 2.1693 0.2128  -0.1089 0.2665  112 ASN A OD1 
278  N ND2 . ASN A 39  ? 1.5184 1.4765 1.7073 0.2279  -0.1369 0.2469  112 ASN A ND2 
279  N N   . GLY A 40  ? 1.5979 1.6185 1.7943 0.1185  -0.1413 0.3635  113 GLY A N   
280  C CA  . GLY A 40  ? 1.6935 1.7201 1.8707 0.0887  -0.1474 0.3915  113 GLY A CA  
281  C C   . GLY A 40  ? 1.7861 1.7602 1.9348 0.0631  -0.1815 0.4116  113 GLY A C   
282  O O   . GLY A 40  ? 1.9884 1.9701 2.1213 0.0332  -0.1867 0.4382  113 GLY A O   
283  N N   . GLY A 41  ? 1.8755 1.7948 2.0152 0.0739  -0.2050 0.3988  114 GLY A N   
284  C CA  . GLY A 41  ? 2.0511 1.9070 2.1581 0.0538  -0.2396 0.4138  114 GLY A CA  
285  C C   . GLY A 41  ? 2.0017 1.8165 2.0669 0.0519  -0.2545 0.4209  114 GLY A C   
286  O O   . GLY A 41  ? 2.0679 1.8740 2.1246 0.0795  -0.2503 0.4013  114 GLY A O   
287  N N   . GLY A 42  ? 1.8321 1.6232 1.8703 0.0175  -0.2729 0.4506  115 GLY A N   
288  C CA  . GLY A 42  ? 1.6282 1.3779 1.6235 0.0113  -0.2899 0.4629  115 GLY A CA  
289  C C   . GLY A 42  ? 1.5689 1.3678 1.5656 0.0204  -0.2642 0.4599  115 GLY A C   
290  O O   . GLY A 42  ? 1.5801 1.3481 1.5466 0.0309  -0.2751 0.4581  115 GLY A O   
291  N N   . ALA A 43  ? 1.6634 1.5385 1.6942 0.0176  -0.2305 0.4587  116 ALA A N   
292  C CA  . ALA A 43  ? 1.6682 1.5925 1.7006 0.0271  -0.2026 0.4520  116 ALA A CA  
293  C C   . ALA A 43  ? 1.6666 1.5724 1.6955 0.0650  -0.2001 0.4207  116 ALA A C   
294  O O   . ALA A 43  ? 1.8429 1.7588 1.8532 0.0712  -0.1919 0.4167  116 ALA A O   
295  C CB  . ALA A 43  ? 1.5664 1.5703 1.6389 0.0249  -0.1670 0.4509  116 ALA A CB  
296  N N   . PHE A 44  ? 1.3281 1.2096 1.3739 0.0882  -0.2078 0.3992  117 PHE A N   
297  C CA  . PHE A 44  ? 1.3707 1.2392 1.4161 0.1225  -0.2066 0.3696  117 PHE A CA  
298  C C   . PHE A 44  ? 1.5082 1.3293 1.5141 0.1285  -0.2314 0.3726  117 PHE A C   
299  O O   . PHE A 44  ? 1.7001 1.5220 1.7016 0.1529  -0.2291 0.3525  117 PHE A O   
300  C CB  . PHE A 44  ? 1.6744 1.5239 1.7413 0.1416  -0.2140 0.3497  117 PHE A CB  
301  C CG  . PHE A 44  ? 1.4983 1.3441 1.5683 0.1744  -0.2111 0.3197  117 PHE A CG  
302  C CD1 . PHE A 44  ? 1.2951 1.1867 1.3861 0.1875  -0.1825 0.3017  117 PHE A CD1 
303  C CD2 . PHE A 44  ? 1.6145 1.4114 1.6651 0.1919  -0.2374 0.3097  117 PHE A CD2 
304  C CE1 . PHE A 44  ? 1.3576 1.2485 1.4499 0.2128  -0.1807 0.2758  117 PHE A CE1 
305  C CE2 . PHE A 44  ? 1.4418 1.2450 1.4972 0.2205  -0.2344 0.2832  117 PHE A CE2 
306  C CZ  . PHE A 44  ? 1.4203 1.2715 1.4964 0.2285  -0.2063 0.2671  117 PHE A CZ  
307  N N   . LEU A 45  ? 1.6244 1.4047 1.6011 0.1053  -0.2563 0.3991  118 LEU A N   
308  C CA  . LEU A 45  ? 1.4308 1.1628 1.3676 0.1099  -0.2824 0.4068  118 LEU A CA  
309  C C   . LEU A 45  ? 1.5690 1.3379 1.4912 0.1070  -0.2665 0.4105  118 LEU A C   
310  O O   . LEU A 45  ? 1.7384 1.4827 1.6355 0.1211  -0.2821 0.4078  118 LEU A O   
311  C CB  . LEU A 45  ? 1.5402 1.2165 1.4454 0.0810  -0.3127 0.4376  118 LEU A CB  
312  C CG  . LEU A 45  ? 1.5597 1.1772 1.4638 0.0853  -0.3381 0.4333  118 LEU A CG  
313  C CD1 . LEU A 45  ? 1.7862 1.3451 1.6527 0.0512  -0.3682 0.4660  118 LEU A CD1 
314  C CD2 . LEU A 45  ? 1.5601 1.1377 1.4593 0.1272  -0.3540 0.4058  118 LEU A CD2 
315  N N   . LEU A 46  ? 1.4746 1.3038 1.4118 0.0897  -0.2359 0.4161  119 LEU A N   
316  C CA  . LEU A 46  ? 1.6084 1.4748 1.5286 0.0840  -0.2184 0.4188  119 LEU A CA  
317  C C   . LEU A 46  ? 1.8457 1.7329 1.7750 0.1149  -0.2030 0.3868  119 LEU A C   
318  O O   . LEU A 46  ? 1.5259 1.4033 1.4285 0.1214  -0.2125 0.3853  119 LEU A O   
319  C CB  . LEU A 46  ? 1.5001 1.4272 1.4331 0.0583  -0.1886 0.4325  119 LEU A CB  
320  C CG  . LEU A 46  ? 1.4240 1.3924 1.3353 0.0483  -0.1684 0.4364  119 LEU A CG  
321  C CD1 . LEU A 46  ? 1.4647 1.4624 1.3638 0.0096  -0.1624 0.4689  119 LEU A CD1 
322  C CD2 . LEU A 46  ? 1.6507 1.6698 1.5862 0.0692  -0.1320 0.4068  119 LEU A CD2 
323  N N   . PRO A 47  ? 2.0208 1.9362 1.9860 0.1323  -0.1810 0.3623  120 PRO A N   
324  C CA  . PRO A 47  ? 1.7660 1.6974 1.7342 0.1566  -0.1688 0.3340  120 PRO A CA  
325  C C   . PRO A 47  ? 1.6081 1.5007 1.5721 0.1812  -0.1948 0.3197  120 PRO A C   
326  O O   . PRO A 47  ? 1.7539 1.6580 1.7128 0.1975  -0.1916 0.3012  120 PRO A O   
327  C CB  . PRO A 47  ? 1.6923 1.6600 1.6976 0.1652  -0.1396 0.3155  120 PRO A CB  
328  C CG  . PRO A 47  ? 1.6872 1.6413 1.7136 0.1573  -0.1488 0.3277  120 PRO A CG  
329  C CD  . PRO A 47  ? 1.8498 1.7860 1.8516 0.1297  -0.1663 0.3598  120 PRO A CD  
330  N N   . TYR A 48  ? 1.5393 1.3886 1.5045 0.1834  -0.2200 0.3277  121 TYR A N   
331  C CA  . TYR A 48  ? 1.6756 1.4891 1.6378 0.2100  -0.2444 0.3132  121 TYR A CA  
332  C C   . TYR A 48  ? 1.7965 1.5882 1.7246 0.2158  -0.2664 0.3217  121 TYR A C   
333  O O   . TYR A 48  ? 1.7860 1.5751 1.7137 0.2415  -0.2767 0.3045  121 TYR A O   
334  C CB  . TYR A 48  ? 1.6076 1.3748 1.5738 0.2100  -0.2660 0.3194  121 TYR A CB  
335  C CG  . TYR A 48  ? 1.4970 1.2247 1.4575 0.2397  -0.2916 0.3039  121 TYR A CG  
336  C CD1 . TYR A 48  ? 1.5066 1.2548 1.4922 0.2647  -0.2828 0.2749  121 TYR A CD1 
337  C CD2 . TYR A 48  ? 1.5355 1.2056 1.4645 0.2432  -0.3248 0.3186  121 TYR A CD2 
338  C CE1 . TYR A 48  ? 1.5968 1.3170 1.5786 0.2934  -0.3044 0.2595  121 TYR A CE1 
339  C CE2 . TYR A 48  ? 1.5698 1.2054 1.4942 0.2750  -0.3475 0.3027  121 TYR A CE2 
340  C CZ  . TYR A 48  ? 1.5458 1.2104 1.4978 0.3005  -0.3362 0.2726  121 TYR A CZ  
341  O OH  . TYR A 48  ? 1.5965 1.2346 1.5452 0.3336  -0.3569 0.2556  121 TYR A OH  
342  N N   . THR A 49  ? 1.5596 1.3395 1.4596 0.1911  -0.2739 0.3497  122 THR A N   
343  C CA  . THR A 49  ? 1.6179 1.3753 1.4824 0.1934  -0.2968 0.3629  122 THR A CA  
344  C C   . THR A 49  ? 1.6440 1.4507 1.5011 0.1925  -0.2771 0.3543  122 THR A C   
345  O O   . THR A 49  ? 1.9965 1.8007 1.8386 0.2087  -0.2917 0.3492  122 THR A O   
346  C CB  . THR A 49  ? 1.4944 1.2153 1.3263 0.1635  -0.3154 0.3993  122 THR A CB  
347  O OG1 . THR A 49  ? 1.8092 1.5735 1.6451 0.1320  -0.2880 0.4120  122 THR A OG1 
348  C CG2 . THR A 49  ? 1.5247 1.1852 1.3555 0.1637  -0.3407 0.4078  122 THR A CG2 
349  N N   . ILE A 50  ? 1.5581 1.4100 1.4248 0.1740  -0.2445 0.3524  123 ILE A N   
350  C CA  . ILE A 50  ? 1.4862 1.3822 1.3420 0.1704  -0.2230 0.3423  123 ILE A CA  
351  C C   . ILE A 50  ? 1.6167 1.5286 1.4879 0.1974  -0.2191 0.3112  123 ILE A C   
352  O O   . ILE A 50  ? 1.7328 1.6603 1.5851 0.2011  -0.2220 0.3054  123 ILE A O   
353  C CB  . ILE A 50  ? 1.3540 1.2932 1.2206 0.1509  -0.1866 0.3416  123 ILE A CB  
354  C CG1 . ILE A 50  ? 1.3936 1.3277 1.2434 0.1203  -0.1902 0.3746  123 ILE A CG1 
355  C CG2 . ILE A 50  ? 1.3738 1.3527 1.2260 0.1494  -0.1635 0.3261  123 ILE A CG2 
356  C CD1 . ILE A 50  ? 1.4119 1.3959 1.2744 0.1031  -0.1542 0.3753  123 ILE A CD1 
357  N N   . MET A 51  ? 1.6373 1.5475 1.5417 0.2138  -0.2137 0.2926  124 MET A N   
358  C CA  . MET A 51  ? 1.6513 1.5786 1.5719 0.2367  -0.2104 0.2642  124 MET A CA  
359  C C   . MET A 51  ? 1.9301 1.8343 1.8420 0.2586  -0.2428 0.2636  124 MET A C   
360  O O   . MET A 51  ? 1.8733 1.7994 1.7922 0.2755  -0.2440 0.2438  124 MET A O   
361  C CB  . MET A 51  ? 1.3945 1.3273 1.3512 0.2457  -0.1956 0.2467  124 MET A CB  
362  C CG  . MET A 51  ? 1.4552 1.4176 1.4247 0.2316  -0.1616 0.2418  124 MET A CG  
363  S SD  . MET A 51  ? 1.4390 1.4384 1.3913 0.2275  -0.1382 0.2239  124 MET A SD  
364  C CE  . MET A 51  ? 1.8365 1.8591 1.8054 0.2168  -0.1007 0.2197  124 MET A CE  
365  N N   . ALA A 52  ? 1.3306 1.1909 1.2266 0.2581  -0.2697 0.2855  125 ALA A N   
366  C CA  . ALA A 52  ? 1.3623 1.1949 1.2478 0.2826  -0.3025 0.2868  125 ALA A CA  
367  C C   . ALA A 52  ? 1.6999 1.5416 1.5538 0.2779  -0.3147 0.3002  125 ALA A C   
368  O O   . ALA A 52  ? 1.5784 1.4427 1.4330 0.2968  -0.3231 0.2877  125 ALA A O   
369  C CB  . ALA A 52  ? 1.4030 1.1747 1.2806 0.2855  -0.3282 0.3035  125 ALA A CB  
370  N N   . ILE A 53  ? 1.9118 1.7402 1.7380 0.2507  -0.3158 0.3268  126 ILE A N   
371  C CA  . ILE A 53  ? 1.5631 1.3961 1.3540 0.2414  -0.3291 0.3447  126 ILE A CA  
372  C C   . ILE A 53  ? 1.7372 1.6269 1.5275 0.2397  -0.3091 0.3260  126 ILE A C   
373  O O   . ILE A 53  ? 1.9967 1.8978 1.7706 0.2490  -0.3260 0.3278  126 ILE A O   
374  C CB  . ILE A 53  ? 1.6533 1.4703 1.4153 0.2062  -0.3274 0.3759  126 ILE A CB  
375  C CG1 . ILE A 53  ? 1.7845 1.5396 1.5414 0.2037  -0.3514 0.3966  126 ILE A CG1 
376  C CG2 . ILE A 53  ? 2.1681 1.9924 1.8905 0.1938  -0.3405 0.3952  126 ILE A CG2 
377  C CD1 . ILE A 53  ? 1.8496 1.5911 1.5787 0.1651  -0.3510 0.4295  126 ILE A CD1 
378  N N   . PHE A 54  ? 1.5471 1.4706 1.3543 0.2281  -0.2743 0.3083  127 PHE A N   
379  C CA  . PHE A 54  ? 1.4906 1.4607 1.2917 0.2219  -0.2534 0.2898  127 PHE A CA  
380  C C   . PHE A 54  ? 1.5350 1.5275 1.3635 0.2447  -0.2504 0.2603  127 PHE A C   
381  O O   . PHE A 54  ? 1.8105 1.8357 1.6299 0.2444  -0.2475 0.2475  127 PHE A O   
382  C CB  . PHE A 54  ? 1.4592 1.4510 1.2595 0.1984  -0.2170 0.2854  127 PHE A CB  
383  C CG  . PHE A 54  ? 1.6089 1.5934 1.3806 0.1721  -0.2156 0.3135  127 PHE A CG  
384  C CD1 . PHE A 54  ? 1.5146 1.4816 1.2527 0.1649  -0.2432 0.3388  127 PHE A CD1 
385  C CD2 . PHE A 54  ? 1.5203 1.5186 1.2988 0.1545  -0.1872 0.3157  127 PHE A CD2 
386  C CE1 . PHE A 54  ? 1.5070 1.4689 1.2163 0.1371  -0.2424 0.3665  127 PHE A CE1 
387  C CE2 . PHE A 54  ? 1.6200 1.6196 1.3727 0.1283  -0.1849 0.3422  127 PHE A CE2 
388  C CZ  . PHE A 54  ? 1.5554 1.5362 1.2722 0.1177  -0.2125 0.3679  127 PHE A CZ  
389  N N   . GLY A 55  ? 1.3880 1.3649 1.2483 0.2617  -0.2516 0.2501  128 GLY A N   
390  C CA  . GLY A 55  ? 1.3466 1.3476 1.2338 0.2802  -0.2464 0.2228  128 GLY A CA  
391  C C   . GLY A 55  ? 1.4512 1.4430 1.3570 0.3107  -0.2711 0.2159  128 GLY A C   
392  O O   . GLY A 55  ? 1.6820 1.7073 1.6007 0.3241  -0.2722 0.1969  128 GLY A O   
393  N N   . GLY A 56  ? 1.4540 1.4010 1.3599 0.3211  -0.2911 0.2307  129 GLY A N   
394  C CA  . GLY A 56  ? 1.4719 1.4036 1.3941 0.3528  -0.3133 0.2221  129 GLY A CA  
395  C C   . GLY A 56  ? 1.8850 1.8077 1.7871 0.3706  -0.3450 0.2350  129 GLY A C   
396  O O   . GLY A 56  ? 2.0167 1.9673 1.9309 0.3960  -0.3566 0.2211  129 GLY A O   
397  N N   . ILE A 57  ? 2.0072 1.8934 1.8788 0.3571  -0.3595 0.2627  130 ILE A N   
398  C CA  . ILE A 57  ? 1.5969 1.4649 1.4453 0.3735  -0.3929 0.2798  130 ILE A CA  
399  C C   . ILE A 57  ? 1.7611 1.6863 1.6053 0.3770  -0.3942 0.2734  130 ILE A C   
400  O O   . ILE A 57  ? 1.7091 1.6436 1.5573 0.4070  -0.4184 0.2712  130 ILE A O   
401  C CB  . ILE A 57  ? 1.5953 1.4139 1.4072 0.3503  -0.4064 0.3139  130 ILE A CB  
402  C CG1 . ILE A 57  ? 1.5171 1.2840 1.3325 0.3408  -0.4046 0.3213  130 ILE A CG1 
403  C CG2 . ILE A 57  ? 1.7810 1.5687 1.5683 0.3709  -0.4453 0.3333  130 ILE A CG2 
404  C CD1 . ILE A 57  ? 1.5321 1.2567 1.3605 0.3745  -0.4265 0.3115  130 ILE A CD1 
405  N N   . PRO A 58  ? 1.8042 1.7684 1.6393 0.3473  -0.3690 0.2701  131 PRO A N   
406  C CA  . PRO A 58  ? 1.6308 1.6476 1.4588 0.3483  -0.3728 0.2638  131 PRO A CA  
407  C C   . PRO A 58  ? 1.6419 1.7046 1.5030 0.3725  -0.3714 0.2365  131 PRO A C   
408  O O   . PRO A 58  ? 1.9623 2.0630 1.8226 0.3858  -0.3879 0.2351  131 PRO A O   
409  C CB  . PRO A 58  ? 1.6305 1.6723 1.4414 0.3108  -0.3421 0.2607  131 PRO A CB  
410  C CG  . PRO A 58  ? 1.6349 1.6339 1.4344 0.2914  -0.3319 0.2774  131 PRO A CG  
411  C CD  . PRO A 58  ? 1.5650 1.5274 1.3914 0.3127  -0.3394 0.2735  131 PRO A CD  
412  N N   . LEU A 59  ? 1.7412 1.8042 1.6309 0.3767  -0.3525 0.2163  132 LEU A N   
413  C CA  . LEU A 59  ? 1.7068 1.8143 1.6277 0.3970  -0.3499 0.1909  132 LEU A CA  
414  C C   . LEU A 59  ? 1.6729 1.7676 1.6084 0.4382  -0.3785 0.1910  132 LEU A C   
415  O O   . LEU A 59  ? 1.6121 1.7550 1.5656 0.4603  -0.3876 0.1777  132 LEU A O   
416  C CB  . LEU A 59  ? 1.6001 1.7101 1.5436 0.3862  -0.3207 0.1711  132 LEU A CB  
417  C CG  . LEU A 59  ? 1.6820 1.8129 1.6156 0.3519  -0.2906 0.1634  132 LEU A CG  
418  C CD1 . LEU A 59  ? 1.6235 1.7478 1.5799 0.3457  -0.2656 0.1472  132 LEU A CD1 
419  C CD2 . LEU A 59  ? 1.6949 1.8829 1.6236 0.3449  -0.2903 0.1519  132 LEU A CD2 
420  N N   . PHE A 60  ? 1.5993 1.6294 1.5260 0.4483  -0.3926 0.2055  133 PHE A N   
421  C CA  . PHE A 60  ? 1.6117 1.6149 1.5460 0.4893  -0.4207 0.2052  133 PHE A CA  
422  C C   . PHE A 60  ? 1.9992 2.0144 1.9182 0.5093  -0.4507 0.2202  133 PHE A C   
423  O O   . PHE A 60  ? 2.2749 2.3168 2.2112 0.5466  -0.4679 0.2098  133 PHE A O   
424  C CB  . PHE A 60  ? 1.6159 1.5381 1.5369 0.4891  -0.4296 0.2189  133 PHE A CB  
425  C CG  . PHE A 60  ? 1.6845 1.5709 1.6137 0.5311  -0.4534 0.2114  133 PHE A CG  
426  C CD1 . PHE A 60  ? 2.4019 2.2491 2.3104 0.5579  -0.4881 0.2281  133 PHE A CD1 
427  C CD2 . PHE A 60  ? 1.6585 1.5477 1.6135 0.5445  -0.4416 0.1873  133 PHE A CD2 
428  C CE1 . PHE A 60  ? 2.6047 2.4137 2.5180 0.5999  -0.5100 0.2188  133 PHE A CE1 
429  C CE2 . PHE A 60  ? 1.9209 1.7760 1.8801 0.5842  -0.4623 0.1777  133 PHE A CE2 
430  C CZ  . PHE A 60  ? 2.1536 1.9671 2.0917 0.6131  -0.4963 0.1924  133 PHE A CZ  
431  N N   . TYR A 61  ? 2.0941 2.0931 1.9807 0.4845  -0.4566 0.2450  134 TYR A N   
432  C CA  . TYR A 61  ? 2.0962 2.1025 1.9632 0.4987  -0.4864 0.2642  134 TYR A CA  
433  C C   . TYR A 61  ? 1.9848 2.0775 1.8643 0.4976  -0.4815 0.2519  134 TYR A C   
434  O O   . TYR A 61  ? 2.0379 2.1610 1.9240 0.5279  -0.5063 0.2543  134 TYR A O   
435  C CB  . TYR A 61  ? 2.4693 2.4313 2.2943 0.4674  -0.4932 0.2960  134 TYR A CB  
436  C CG  . TYR A 61  ? 2.6432 2.6148 2.4429 0.4746  -0.5227 0.3191  134 TYR A CG  
437  C CD1 . TYR A 61  ? 2.7485 2.6930 2.5472 0.5169  -0.5596 0.3293  134 TYR A CD1 
438  C CD2 . TYR A 61  ? 2.5460 2.5518 2.3208 0.4398  -0.5144 0.3308  134 TYR A CD2 
439  C CE1 . TYR A 61  ? 2.4908 2.4442 2.2667 0.5246  -0.5886 0.3526  134 TYR A CE1 
440  C CE2 . TYR A 61  ? 2.6097 2.6261 2.3598 0.4444  -0.5426 0.3535  134 TYR A CE2 
441  C CZ  . TYR A 61  ? 2.5441 2.5350 2.2959 0.4869  -0.5802 0.3655  134 TYR A CZ  
442  O OH  . TYR A 61  ? 2.6455 2.6472 2.3730 0.4928  -0.6102 0.3901  134 TYR A OH  
443  N N   . MET A 62  ? 1.7593 1.8910 1.6415 0.4627  -0.4502 0.2388  135 MET A N   
444  C CA  . MET A 62  ? 1.5552 1.7658 1.4454 0.4538  -0.4434 0.2258  135 MET A CA  
445  C C   . MET A 62  ? 1.8046 2.0657 1.7350 0.4856  -0.4455 0.2018  135 MET A C   
446  O O   . MET A 62  ? 1.7100 2.0362 1.6507 0.4962  -0.4570 0.1975  135 MET A O   
447  C CB  . MET A 62  ? 1.5531 1.7800 1.4329 0.4093  -0.4087 0.2153  135 MET A CB  
448  C CG  . MET A 62  ? 1.4421 1.7400 1.3179 0.3906  -0.4027 0.2049  135 MET A CG  
449  S SD  . MET A 62  ? 1.7519 2.1132 1.6681 0.3968  -0.3862 0.1716  135 MET A SD  
450  C CE  . MET A 62  ? 2.0466 2.3634 1.9672 0.3740  -0.3494 0.1573  135 MET A CE  
451  N N   . GLU A 63  ? 2.5240 2.7589 2.4765 0.4993  -0.4345 0.1867  136 GLU A N   
452  C CA  . GLU A 63  ? 2.6458 2.9253 2.6353 0.5303  -0.4353 0.1635  136 GLU A CA  
453  C C   . GLU A 63  ? 2.4431 2.7148 2.4395 0.5801  -0.4691 0.1703  136 GLU A C   
454  O O   . GLU A 63  ? 2.4069 2.7416 2.4296 0.6088  -0.4776 0.1568  136 GLU A O   
455  C CB  . GLU A 63  ? 2.6382 2.8885 2.6449 0.5276  -0.4131 0.1462  136 GLU A CB  
456  C CG  . GLU A 63  ? 2.4885 2.7707 2.5292 0.5636  -0.4161 0.1239  136 GLU A CG  
457  C CD  . GLU A 63  ? 2.5744 2.9487 2.6388 0.5565  -0.4038 0.1047  136 GLU A CD  
458  O OE1 . GLU A 63  ? 2.7105 3.1138 2.7639 0.5188  -0.3888 0.1058  136 GLU A OE1 
459  O OE2 . GLU A 63  ? 2.5067 2.9246 2.5989 0.5875  -0.4090 0.0882  136 GLU A OE2 
460  N N   . LEU A 64  ? 1.9282 2.1226 1.8997 0.5901  -0.4887 0.1918  137 LEU A N   
461  C CA  . LEU A 64  ? 1.7802 1.9464 1.7527 0.6396  -0.5222 0.1989  137 LEU A CA  
462  C C   . LEU A 64  ? 1.9892 2.1943 1.9527 0.6541  -0.5493 0.2164  137 LEU A C   
463  O O   . LEU A 64  ? 1.5624 1.7713 1.5393 0.6909  -0.5686 0.2162  137 LEU A O   
464  C CB  . LEU A 64  ? 1.5361 1.5963 1.4805 0.6408  -0.5349 0.2168  137 LEU A CB  
465  C CG  . LEU A 64  ? 1.6209 1.6304 1.5693 0.6797  -0.5551 0.2158  137 LEU A CG  
466  C CD1 . LEU A 64  ? 1.5587 1.5996 1.5449 0.7005  -0.5367 0.1818  137 LEU A CD1 
467  C CD2 . LEU A 64  ? 1.6434 1.5472 1.5590 0.6668  -0.5643 0.2356  137 LEU A CD2 
468  N N   . ALA A 65  ? 2.2268 2.4594 2.1703 0.6144  -0.5422 0.2298  138 ALA A N   
469  C CA  . ALA A 65  ? 1.9197 2.1896 1.8503 0.6215  -0.5681 0.2492  138 ALA A CA  
470  C C   . ALA A 65  ? 1.7360 2.1132 1.6998 0.6349  -0.5675 0.2315  138 ALA A C   
471  O O   . ALA A 65  ? 1.5552 1.9685 1.5297 0.6720  -0.5956 0.2388  138 ALA A O   
472  C CB  . ALA A 65  ? 1.5665 1.8232 1.4580 0.5716  -0.5610 0.2702  138 ALA A CB  
473  N N   . LEU A 66  ? 1.7085 2.1367 1.6881 0.6041  -0.5360 0.2094  139 LEU A N   
474  C CA  . LEU A 66  ? 1.4391 1.9722 1.4477 0.6062  -0.5324 0.1928  139 LEU A CA  
475  C C   . LEU A 66  ? 1.7272 2.2993 1.7752 0.6620  -0.5469 0.1785  139 LEU A C   
476  O O   . LEU A 66  ? 2.1859 2.8371 2.2555 0.6765  -0.5584 0.1765  139 LEU A O   
477  C CB  . LEU A 66  ? 1.3673 1.9301 1.3828 0.5629  -0.4956 0.1709  139 LEU A CB  
478  C CG  . LEU A 66  ? 1.4129 1.9512 1.3913 0.5083  -0.4775 0.1794  139 LEU A CG  
479  C CD1 . LEU A 66  ? 1.3108 1.8667 1.2974 0.4735  -0.4423 0.1558  139 LEU A CD1 
480  C CD2 . LEU A 66  ? 1.7640 2.3527 1.7222 0.4918  -0.4942 0.1946  139 LEU A CD2 
481  N N   . GLY A 67  ? 1.8541 2.3670 1.9117 0.6857  -0.5413 0.1674  140 GLY A N   
482  C CA  . GLY A 67  ? 1.8807 2.4064 1.9733 0.7177  -0.5377 0.1491  140 GLY A CA  
483  C C   . GLY A 67  ? 1.8743 2.3816 1.9671 0.7456  -0.5617 0.1644  140 GLY A C   
484  O O   . GLY A 67  ? 1.5536 2.1159 1.6767 0.7702  -0.5630 0.1524  140 GLY A O   
485  N N   . GLN A 68  ? 2.1694 2.6006 2.2274 0.7417  -0.5810 0.1918  141 GLN A N   
486  C CA  . GLN A 68  ? 2.2478 2.6513 2.3021 0.7671  -0.6061 0.2102  141 GLN A CA  
487  C C   . GLN A 68  ? 2.2431 2.7168 2.2949 0.7583  -0.6240 0.2284  141 GLN A C   
488  O O   . GLN A 68  ? 2.4341 2.9095 2.4909 0.7807  -0.6452 0.2425  141 GLN A O   
489  C CB  . GLN A 68  ? 2.4128 2.7002 2.4286 0.7637  -0.6198 0.2337  141 GLN A CB  
490  C CG  . GLN A 68  ? 2.6997 2.9348 2.7161 0.7980  -0.6391 0.2428  141 GLN A CG  
491  C CD  . GLN A 68  ? 3.0024 3.1191 2.9861 0.7947  -0.6443 0.2549  141 GLN A CD  
492  O OE1 . GLN A 68  ? 3.2707 3.3474 3.2380 0.7696  -0.6304 0.2522  141 GLN A OE1 
493  N NE2 . GLN A 68  ? 3.0008 3.0614 2.9741 0.8194  -0.6647 0.2687  141 GLN A NE2 
494  N N   . TYR A 69  ? 1.8775 2.4093 1.9201 0.7251  -0.6157 0.2280  142 TYR A N   
495  C CA  . TYR A 69  ? 1.7967 2.4018 1.8337 0.7107  -0.6312 0.2432  142 TYR A CA  
496  C C   . TYR A 69  ? 1.7165 2.4338 1.7967 0.7176  -0.6227 0.2221  142 TYR A C   
497  O O   . TYR A 69  ? 2.0519 2.8134 2.1494 0.7353  -0.6395 0.2298  142 TYR A O   
498  C CB  . TYR A 69  ? 1.8315 2.4439 1.8287 0.6685  -0.6277 0.2544  142 TYR A CB  
499  C CG  . TYR A 69  ? 2.0482 2.7311 2.0312 0.6483  -0.6442 0.2713  142 TYR A CG  
500  C CD1 . TYR A 69  ? 2.1502 2.7984 2.1062 0.6506  -0.6723 0.3027  142 TYR A CD1 
501  C CD2 . TYR A 69  ? 2.2314 3.0153 2.2264 0.6232  -0.6322 0.2568  142 TYR A CD2 
502  C CE1 . TYR A 69  ? 2.2891 3.0019 2.2304 0.6298  -0.6880 0.3184  142 TYR A CE1 
503  C CE2 . TYR A 69  ? 2.3084 3.1565 2.2880 0.6000  -0.6472 0.2718  142 TYR A CE2 
504  C CZ  . TYR A 69  ? 2.2145 3.0272 2.1675 0.6040  -0.6749 0.3022  142 TYR A CZ  
505  O OH  . TYR A 69  ? 2.1854 3.0615 2.1216 0.5788  -0.6902 0.3173  142 TYR A OH  
506  N N   . HIS A 70  ? 1.9377 2.7020 2.0347 0.7025  -0.5970 0.1969  143 HIS A N   
507  C CA  . HIS A 70  ? 1.8400 2.7150 1.9747 0.7011  -0.5870 0.1776  143 HIS A CA  
508  C C   . HIS A 70  ? 1.7267 2.6109 1.9007 0.7415  -0.5803 0.1582  143 HIS A C   
509  O O   . HIS A 70  ? 1.6667 2.6389 1.8722 0.7510  -0.5796 0.1487  143 HIS A O   
510  C CB  . HIS A 70  ? 1.6982 2.6211 1.8329 0.6651  -0.5630 0.1597  143 HIS A CB  
511  C CG  . HIS A 70  ? 1.8652 2.8064 1.9624 0.6232  -0.5678 0.1746  143 HIS A CG  
512  N ND1 . HIS A 70  ? 2.0625 2.9094 2.1180 0.5967  -0.5606 0.1869  143 HIS A ND1 
513  C CD2 . HIS A 70  ? 1.8221 2.8475 1.9146 0.5881  -0.5691 0.1765  143 HIS A CD2 
514  C CE1 . HIS A 70  ? 1.9166 2.7830 1.9430 0.5461  -0.5535 0.1936  143 HIS A CE1 
515  N NE2 . HIS A 70  ? 1.8167 2.7872 1.8630 0.5390  -0.5591 0.1874  143 HIS A NE2 
516  N N   . ARG A 71  ? 1.9194 2.7139 2.0887 0.7636  -0.5751 0.1523  144 ARG A N   
517  C CA  . ARG A 71  ? 1.9075 2.6985 2.1057 0.8019  -0.5671 0.1318  144 ARG A CA  
518  C C   . ARG A 71  ? 1.9255 2.8110 2.1573 0.7963  -0.5432 0.1036  144 ARG A C   
519  O O   . ARG A 71  ? 1.6172 2.5571 1.8784 0.8237  -0.5411 0.0901  144 ARG A O   
520  C CB  . ARG A 71  ? 1.6457 2.4426 1.8549 0.8383  -0.5900 0.1436  144 ARG A CB  
521  C CG  . ARG A 71  ? 1.7593 2.4637 1.9353 0.8442  -0.6159 0.1740  144 ARG A CG  
522  C CD  . ARG A 71  ? 1.8279 2.5125 2.0164 0.8899  -0.6344 0.1792  144 ARG A CD  
523  N NE  . ARG A 71  ? 2.0752 2.8674 2.2977 0.9052  -0.6397 0.1749  144 ARG A NE  
524  C CZ  . ARG A 71  ? 2.2264 3.0571 2.4477 0.9022  -0.6633 0.1990  144 ARG A CZ  
525  N NH1 . ARG A 71  ? 2.2553 3.1877 2.5100 0.9159  -0.6667 0.1934  144 ARG A NH1 
526  N NH2 . ARG A 71  ? 2.4002 3.1698 2.5854 0.8840  -0.6839 0.2295  144 ARG A NH2 
527  N N   . ASN A 72  ? 2.0485 2.9540 2.2743 0.7604  -0.5256 0.0953  145 ASN A N   
528  C CA  . ASN A 72  ? 1.9805 2.9729 2.2343 0.7479  -0.5030 0.0709  145 ASN A CA  
529  C C   . ASN A 72  ? 2.0095 2.9532 2.2599 0.7408  -0.4812 0.0534  145 ASN A C   
530  O O   . ASN A 72  ? 1.8758 2.7256 2.1005 0.7381  -0.4832 0.0618  145 ASN A O   
531  C CB  . ASN A 72  ? 1.7775 2.8580 2.0298 0.7060  -0.5024 0.0764  145 ASN A CB  
532  N N   . GLY A 73  ? 2.1566 3.1665 2.4325 0.7361  -0.4610 0.0304  146 GLY A N   
533  C CA  . GLY A 73  ? 2.1048 3.0789 2.3803 0.7284  -0.4403 0.0134  146 GLY A CA  
534  C C   . GLY A 73  ? 2.0821 3.0476 2.3402 0.6875  -0.4328 0.0187  146 GLY A C   
535  O O   . GLY A 73  ? 1.9364 2.9071 2.1755 0.6666  -0.4447 0.0365  146 GLY A O   
536  N N   . CYS A 74  ? 2.5339 3.4871 2.7970 0.6766  -0.4133 0.0029  147 CYS A N   
537  C CA  . CYS A 74  ? 2.6181 3.5465 2.8624 0.6312  -0.3988 0.0058  147 CYS A CA  
538  C C   . CYS A 74  ? 2.4823 3.4987 2.7319 0.5864  -0.3877 0.0021  147 CYS A C   
539  O O   . CYS A 74  ? 2.5091 3.4962 2.7342 0.5367  -0.3729 0.0065  147 CYS A O   
540  C CB  . CYS A 74  ? 2.7739 3.6483 3.0198 0.6269  -0.3778 -0.0087 147 CYS A CB  
541  S SG  . CYS A 74  ? 3.1226 3.9068 3.3659 0.6805  -0.3905 -0.0106 147 CYS A SG  
542  N N   . ILE A 75  ? 2.1659 3.2905 2.4464 0.6042  -0.3952 -0.0063 148 ILE A N   
543  C CA  . ILE A 75  ? 1.7405 2.9572 2.0278 0.5605  -0.3860 -0.0106 148 ILE A CA  
544  C C   . ILE A 75  ? 1.8206 3.1011 2.1061 0.5570  -0.4076 0.0045  148 ILE A C   
545  O O   . ILE A 75  ? 1.8898 3.1831 2.1530 0.5067  -0.4034 0.0114  148 ILE A O   
546  C CB  . ILE A 75  ? 1.2702 2.5786 1.5944 0.5729  -0.3764 -0.0305 148 ILE A CB  
547  C CG1 . ILE A 75  ? 1.5534 2.7977 1.8788 0.5824  -0.3581 -0.0449 148 ILE A CG1 
548  C CG2 . ILE A 75  ? 1.2753 2.6678 1.6011 0.5177  -0.3651 -0.0338 148 ILE A CG2 
549  C CD1 . ILE A 75  ? 1.1039 2.4206 1.4581 0.5922  -0.3444 -0.0648 148 ILE A CD1 
550  N N   . SER A 76  ? 1.9756 3.2689 2.2763 0.5997  -0.4227 0.0090  149 SER A N   
551  C CA  . SER A 76  ? 1.9939 3.3457 2.2958 0.5957  -0.4401 0.0231  149 SER A CA  
552  C C   . SER A 76  ? 1.8910 3.1884 2.1583 0.5867  -0.4596 0.0461  149 SER A C   
553  O O   . SER A 76  ? 2.1109 3.4563 2.3719 0.5725  -0.4747 0.0597  149 SER A O   
554  C CB  . SER A 76  ? 1.8878 3.2564 2.2144 0.6425  -0.4466 0.0203  149 SER A CB  
555  O OG  . SER A 76  ? 1.9353 3.2006 2.2514 0.6825  -0.4541 0.0241  149 SER A OG  
556  N N   . ILE A 77  ? 1.3455 2.5446 1.5887 0.5934  -0.4594 0.0511  150 ILE A N   
557  C CA  . ILE A 77  ? 1.3325 2.4619 1.5361 0.5770  -0.4706 0.0729  150 ILE A CA  
558  C C   . ILE A 77  ? 1.5405 2.6729 1.7142 0.5094  -0.4536 0.0735  150 ILE A C   
559  O O   . ILE A 77  ? 1.2070 2.3201 1.3490 0.4868  -0.4634 0.0901  150 ILE A O   
560  C CB  . ILE A 77  ? 1.4415 2.4465 1.6249 0.5954  -0.4682 0.0784  150 ILE A CB  
561  C CG1 . ILE A 77  ? 1.3600 2.3052 1.5066 0.5898  -0.4864 0.1044  150 ILE A CG1 
562  C CG2 . ILE A 77  ? 1.1772 2.1245 1.3478 0.5576  -0.4364 0.0654  150 ILE A CG2 
563  C CD1 . ILE A 77  ? 1.2773 2.1046 1.4019 0.6035  -0.4864 0.1132  150 ILE A CD1 
564  N N   . TRP A 78  ? 1.7811 2.9359 1.9619 0.4769  -0.4288 0.0552  151 TRP A N   
565  C CA  . TRP A 78  ? 1.8806 3.0327 2.0310 0.4136  -0.4123 0.0528  151 TRP A CA  
566  C C   . TRP A 78  ? 1.9178 3.1768 2.0726 0.3896  -0.4251 0.0557  151 TRP A C   
567  O O   . TRP A 78  ? 1.8709 3.1260 1.9915 0.3420  -0.4223 0.0600  151 TRP A O   
568  C CB  . TRP A 78  ? 1.8767 3.0063 2.0301 0.3872  -0.3831 0.0340  151 TRP A CB  
569  C CG  . TRP A 78  ? 1.7116 2.7317 1.8519 0.3962  -0.3683 0.0330  151 TRP A CG  
570  C CD1 . TRP A 78  ? 1.7997 2.7907 1.9630 0.4292  -0.3617 0.0240  151 TRP A CD1 
571  C CD2 . TRP A 78  ? 1.7778 2.7074 1.8788 0.3710  -0.3584 0.0414  151 TRP A CD2 
572  N NE1 . TRP A 78  ? 1.9506 2.8396 2.0924 0.4243  -0.3495 0.0277  151 TRP A NE1 
573  C CE2 . TRP A 78  ? 1.9461 2.7985 2.0512 0.3898  -0.3467 0.0385  151 TRP A CE2 
574  C CE3 . TRP A 78  ? 1.9799 2.8895 2.0418 0.3340  -0.3579 0.0505  151 TRP A CE3 
575  C CZ2 . TRP A 78  ? 2.0563 2.8187 2.1315 0.3734  -0.3344 0.0455  151 TRP A CZ2 
576  C CZ3 . TRP A 78  ? 2.2130 3.0312 2.2436 0.3196  -0.3444 0.0558  151 TRP A CZ3 
577  C CH2 . TRP A 78  ? 2.2248 2.9733 2.2640 0.3394  -0.3328 0.0539  151 TRP A CH2 
578  N N   . ARG A 79  ? 2.0342 3.3906 2.2308 0.4229  -0.4393 0.0527  152 ARG A N   
579  C CA  . ARG A 79  ? 2.0667 3.5379 2.2737 0.4046  -0.4547 0.0575  152 ARG A CA  
580  C C   . ARG A 79  ? 2.0588 3.5230 2.2413 0.4063  -0.4796 0.0798  152 ARG A C   
581  O O   . ARG A 79  ? 2.1126 3.6432 2.2835 0.3715  -0.4900 0.0866  152 ARG A O   
582  C CB  . ARG A 79  ? 1.9789 3.5512 2.2388 0.4466  -0.4625 0.0501  152 ARG A CB  
583  C CG  . ARG A 79  ? 1.9559 3.6355 2.2279 0.4170  -0.4670 0.0524  152 ARG A CG  
584  C CD  . ARG A 79  ? 2.1340 3.8706 2.4496 0.4579  -0.4646 0.0463  152 ARG A CD  
585  N NE  . ARG A 79  ? 2.0912 3.8356 2.4311 0.4708  -0.4426 0.0257  152 ARG A NE  
586  C CZ  . ARG A 79  ? 2.0012 3.7946 2.3755 0.5047  -0.4353 0.0155  152 ARG A CZ  
587  N NH1 . ARG A 79  ? 1.8494 3.6890 2.2407 0.5312  -0.4488 0.0240  152 ARG A NH1 
588  N NH2 . ARG A 79  ? 1.9681 3.7660 2.3584 0.5123  -0.4148 -0.0032 152 ARG A NH2 
589  N N   . LYS A 80  ? 1.6667 3.0489 1.8388 0.4443  -0.4900 0.0920  153 LYS A N   
590  C CA  . LYS A 80  ? 1.6275 2.9932 1.7738 0.4489  -0.5149 0.1158  153 LYS A CA  
591  C C   . LYS A 80  ? 1.8173 3.0854 1.9086 0.4040  -0.5016 0.1220  153 LYS A C   
592  O O   . LYS A 80  ? 1.8586 3.1062 1.9198 0.3977  -0.5188 0.1417  153 LYS A O   
593  C CB  . LYS A 80  ? 1.5665 2.8969 1.7303 0.5154  -0.5364 0.1280  153 LYS A CB  
594  C CG  . LYS A 80  ? 1.5976 2.9697 1.8106 0.5532  -0.5314 0.1149  153 LYS A CG  
595  C CD  . LYS A 80  ? 2.0153 3.4986 2.2495 0.5367  -0.5371 0.1153  153 LYS A CD  
596  C CE  . LYS A 80  ? 1.9096 3.4380 2.1903 0.5775  -0.5314 0.1024  153 LYS A CE  
597  N NZ  . LYS A 80  ? 1.6196 3.1471 1.9191 0.5814  -0.5056 0.0781  153 LYS A NZ  
598  N N   . ILE A 81  ? 1.8708 3.0810 1.9489 0.3742  -0.4712 0.1056  154 ILE A N   
599  C CA  . ILE A 81  ? 1.8318 2.9524 1.8604 0.3341  -0.4547 0.1081  154 ILE A CA  
600  C C   . ILE A 81  ? 1.8912 3.0275 1.8998 0.2754  -0.4319 0.0913  154 ILE A C   
601  O O   . ILE A 81  ? 2.1465 3.3124 2.1250 0.2358  -0.4373 0.0950  154 ILE A O   
602  C CB  . ILE A 81  ? 1.8229 2.8390 1.8483 0.3558  -0.4398 0.1067  154 ILE A CB  
603  C CG1 . ILE A 81  ? 1.9446 2.9354 1.9836 0.4113  -0.4646 0.1240  154 ILE A CG1 
604  C CG2 . ILE A 81  ? 1.6038 2.5371 1.5808 0.3159  -0.4213 0.1091  154 ILE A CG2 
605  C CD1 . ILE A 81  ? 1.9129 2.8970 1.9218 0.4095  -0.4890 0.1489  154 ILE A CD1 
606  N N   . CYS A 82  ? 1.9971 3.1098 2.0196 0.2694  -0.4078 0.0731  155 CYS A N   
607  C CA  . CYS A 82  ? 1.9794 3.0976 1.9829 0.2162  -0.3866 0.0569  155 CYS A CA  
608  C C   . CYS A 82  ? 1.9853 3.1606 2.0290 0.2220  -0.3782 0.0418  155 CYS A C   
609  O O   . CYS A 82  ? 2.1836 3.3114 2.2414 0.2365  -0.3610 0.0323  155 CYS A O   
610  C CB  . CYS A 82  ? 2.0421 3.0525 2.0090 0.1931  -0.3611 0.0509  155 CYS A CB  
611  S SG  . CYS A 82  ? 2.0578 3.0038 1.9728 0.1802  -0.3663 0.0670  155 CYS A SG  
612  N N   . PRO A 83  ? 1.7327 3.0148 1.7947 0.2091  -0.3908 0.0405  156 PRO A N   
613  C CA  . PRO A 83  ? 1.8042 3.1632 1.9074 0.2156  -0.3861 0.0283  156 PRO A CA  
614  C C   . PRO A 83  ? 1.8424 3.1559 1.9354 0.1823  -0.3583 0.0120  156 PRO A C   
615  O O   . PRO A 83  ? 2.1131 3.4478 2.2393 0.2026  -0.3497 0.0027  156 PRO A O   
616  C CB  . PRO A 83  ? 1.8810 3.3554 1.9892 0.1875  -0.4032 0.0324  156 PRO A CB  
617  C CG  . PRO A 83  ? 1.7649 3.2018 1.8220 0.1487  -0.4092 0.0413  156 PRO A CG  
618  C CD  . PRO A 83  ? 1.7161 3.0566 1.7572 0.1820  -0.4102 0.0512  156 PRO A CD  
619  N N   . ILE A 84  ? 1.4696 2.7201 1.5159 0.1333  -0.3450 0.0086  157 ILE A N   
620  C CA  . ILE A 84  ? 1.5633 2.7621 1.5953 0.1013  -0.3202 -0.0054 157 ILE A CA  
621  C C   . ILE A 84  ? 1.7948 2.9144 1.8413 0.1375  -0.3052 -0.0087 157 ILE A C   
622  O O   . ILE A 84  ? 1.9105 3.0172 1.9683 0.1309  -0.2893 -0.0190 157 ILE A O   
623  C CB  . ILE A 84  ? 1.6190 2.7558 1.5937 0.0472  -0.3100 -0.0092 157 ILE A CB  
624  C CG1 . ILE A 84  ? 1.6049 2.6844 1.5497 0.0580  -0.3159 0.0013  157 ILE A CG1 
625  C CG2 . ILE A 84  ? 1.5838 2.7973 1.5434 -0.0034 -0.3190 -0.0119 157 ILE A CG2 
626  C CD1 . ILE A 84  ? 1.6987 2.7117 1.5845 0.0100  -0.3038 -0.0049 157 ILE A CD1 
627  N N   . PHE A 85  ? 1.7284 2.7962 1.7729 0.1735  -0.3114 0.0014  158 PHE A N   
628  C CA  . PHE A 85  ? 1.6509 2.6443 1.7078 0.2072  -0.3001 0.0003  158 PHE A CA  
629  C C   . PHE A 85  ? 1.5779 2.6196 1.6821 0.2571  -0.3104 -0.0007 158 PHE A C   
630  O O   . PHE A 85  ? 1.8283 2.8154 1.9448 0.2904  -0.3059 -0.0007 158 PHE A O   
631  C CB  . PHE A 85  ? 1.5511 2.4660 1.5818 0.2196  -0.3024 0.0126  158 PHE A CB  
632  C CG  . PHE A 85  ? 1.5973 2.4525 1.5806 0.1761  -0.2872 0.0104  158 PHE A CG  
633  C CD1 . PHE A 85  ? 1.4985 2.3328 1.4668 0.1390  -0.2672 -0.0035 158 PHE A CD1 
634  C CD2 . PHE A 85  ? 1.7432 2.5617 1.6946 0.1729  -0.2933 0.0220  158 PHE A CD2 
635  C CE1 . PHE A 85  ? 1.5844 2.3597 1.5071 0.1029  -0.2530 -0.0078 158 PHE A CE1 
636  C CE2 . PHE A 85  ? 1.6449 2.4103 1.5509 0.1351  -0.2777 0.0174  158 PHE A CE2 
637  C CZ  . PHE A 85  ? 1.6319 2.3742 1.5237 0.1017  -0.2574 0.0015  158 PHE A CZ  
638  N N   . LYS A 86  ? 1.4230 2.5691 1.5525 0.2615  -0.3241 -0.0023 159 LYS A N   
639  C CA  . LYS A 86  ? 1.4068 2.6115 1.5816 0.3106  -0.3336 -0.0060 159 LYS A CA  
640  C C   . LYS A 86  ? 1.4475 2.6317 1.6391 0.3146  -0.3140 -0.0202 159 LYS A C   
641  O O   . LYS A 86  ? 1.8402 3.0259 2.0596 0.3604  -0.3168 -0.0247 159 LYS A O   
642  C CB  . LYS A 86  ? 1.3388 2.6715 1.5378 0.3081  -0.3491 -0.0059 159 LYS A CB  
643  C CG  . LYS A 86  ? 1.5653 2.9662 1.8104 0.3672  -0.3628 -0.0086 159 LYS A CG  
644  C CD  . LYS A 86  ? 1.6051 3.1402 1.8748 0.3640  -0.3788 -0.0064 159 LYS A CD  
645  C CE  . LYS A 86  ? 1.5718 3.1771 1.8880 0.4293  -0.3927 -0.0098 159 LYS A CE  
646  N NZ  . LYS A 86  ? 1.5426 3.2604 1.8797 0.4214  -0.4001 -0.0072 159 LYS A NZ  
647  N N   . GLY A 87  ? 1.1219 2.2827 1.2933 0.2664  -0.2950 -0.0270 160 GLY A N   
648  C CA  . GLY A 87  ? 1.3166 2.4493 1.4977 0.2633  -0.2762 -0.0381 160 GLY A CA  
649  C C   . GLY A 87  ? 1.2542 2.2944 1.4360 0.2977  -0.2705 -0.0367 160 GLY A C   
650  O O   . GLY A 87  ? 1.2524 2.2841 1.4531 0.3150  -0.2617 -0.0452 160 GLY A O   
651  N N   . ILE A 88  ? 1.2262 2.1993 1.3855 0.3048  -0.2759 -0.0254 161 ILE A N   
652  C CA  . ILE A 88  ? 1.1001 1.9896 1.2587 0.3367  -0.2744 -0.0207 161 ILE A CA  
653  C C   . ILE A 88  ? 1.3390 2.2587 1.5316 0.3884  -0.2861 -0.0252 161 ILE A C   
654  O O   . ILE A 88  ? 1.4014 2.2830 1.6046 0.4053  -0.2775 -0.0319 161 ILE A O   
655  C CB  . ILE A 88  ? 1.1836 2.0192 1.3151 0.3387  -0.2838 -0.0053 161 ILE A CB  
656  C CG1 . ILE A 88  ? 1.3295 2.1103 1.4242 0.2931  -0.2665 -0.0041 161 ILE A CG1 
657  C CG2 . ILE A 88  ? 1.0223 1.7927 1.1589 0.3792  -0.2906 0.0024  161 ILE A CG2 
658  C CD1 . ILE A 88  ? 1.1700 1.9040 1.2350 0.2909  -0.2733 0.0103  161 ILE A CD1 
659  N N   . GLY A 89  ? 1.5565 2.5465 1.7653 0.4137  -0.3062 -0.0221 162 GLY A N   
660  C CA  . GLY A 89  ? 1.3207 2.3449 1.5607 0.4675  -0.3190 -0.0280 162 GLY A CA  
661  C C   . GLY A 89  ? 1.2904 2.3567 1.5553 0.4716  -0.3052 -0.0460 162 GLY A C   
662  O O   . GLY A 89  ? 1.3377 2.3948 1.6204 0.5137  -0.3084 -0.0543 162 GLY A O   
663  N N   . TYR A 90  ? 1.4056 2.5150 1.6681 0.4261  -0.2904 -0.0520 163 TYR A N   
664  C CA  . TYR A 90  ? 1.5091 2.6572 1.7904 0.4212  -0.2759 -0.0670 163 TYR A CA  
665  C C   . TYR A 90  ? 1.3460 2.3989 1.6123 0.4097  -0.2588 -0.0692 163 TYR A C   
666  O O   . TYR A 90  ? 1.2832 2.3299 1.5645 0.4329  -0.2533 -0.0796 163 TYR A O   
667  C CB  . TYR A 90  ? 1.5432 2.7747 1.8253 0.3734  -0.2688 -0.0702 163 TYR A CB  
668  C CG  . TYR A 90  ? 1.5146 2.8668 1.8224 0.3876  -0.2839 -0.0712 163 TYR A CG  
669  C CD1 . TYR A 90  ? 1.4720 2.8646 1.8089 0.4476  -0.2984 -0.0752 163 TYR A CD1 
670  C CD2 . TYR A 90  ? 1.5329 2.9589 1.8354 0.3412  -0.2846 -0.0682 163 TYR A CD2 
671  C CE1 . TYR A 90  ? 1.6591 3.1683 2.0229 0.4642  -0.3125 -0.0757 163 TYR A CE1 
672  C CE2 . TYR A 90  ? 1.6728 3.2179 2.0016 0.3530  -0.2991 -0.0677 163 TYR A CE2 
673  C CZ  . TYR A 90  ? 1.8029 3.3923 2.1643 0.4162  -0.3126 -0.0713 163 TYR A CZ  
674  O OH  . TYR A 90  ? 2.0242 3.7313 2.4127 0.4299  -0.3255 -0.0703 163 TYR A OH  
675  N N   . ALA A 91  ? 1.4217 2.4030 1.6580 0.3748  -0.2508 -0.0598 164 ALA A N   
676  C CA  . ALA A 91  ? 1.1343 2.0289 1.3565 0.3607  -0.2344 -0.0597 164 ALA A CA  
677  C C   . ALA A 91  ? 1.1606 2.0010 1.3925 0.4043  -0.2391 -0.0604 164 ALA A C   
678  O O   . ALA A 91  ? 1.3712 2.1959 1.6120 0.4097  -0.2295 -0.0687 164 ALA A O   
679  C CB  . ALA A 91  ? 1.1535 1.9803 1.3428 0.3279  -0.2279 -0.0490 164 ALA A CB  
680  N N   . ILE A 92  ? 1.1657 1.9772 1.3929 0.4333  -0.2551 -0.0510 165 ILE A N   
681  C CA  . ILE A 92  ? 1.1861 1.9428 1.4180 0.4751  -0.2643 -0.0502 165 ILE A CA  
682  C C   . ILE A 92  ? 1.2104 2.0112 1.4676 0.5054  -0.2646 -0.0672 165 ILE A C   
683  O O   . ILE A 92  ? 1.9044 2.6562 2.1621 0.5167  -0.2590 -0.0727 165 ILE A O   
684  C CB  . ILE A 92  ? 1.2698 2.0127 1.4952 0.5041  -0.2865 -0.0379 165 ILE A CB  
685  C CG1 . ILE A 92  ? 1.5828 2.2735 1.7790 0.4739  -0.2847 -0.0209 165 ILE A CG1 
686  C CG2 . ILE A 92  ? 1.3233 2.0123 1.5522 0.5491  -0.2990 -0.0385 165 ILE A CG2 
687  C CD1 . ILE A 92  ? 2.0182 2.6940 2.2037 0.4969  -0.3071 -0.0058 165 ILE A CD1 
688  N N   . CYS A 93  ? 0.9348 1.8322 1.2123 0.5173  -0.2708 -0.0759 166 CYS A N   
689  C CA  . CYS A 93  ? 1.3133 2.2691 1.6158 0.5464  -0.2695 -0.0941 166 CYS A CA  
690  C C   . CYS A 93  ? 1.2123 2.1521 1.5134 0.5202  -0.2491 -0.1029 166 CYS A C   
691  O O   . CYS A 93  ? 1.4043 2.3096 1.7086 0.5443  -0.2473 -0.1123 166 CYS A O   
692  C CB  . CYS A 93  ? 1.4784 2.5558 1.8036 0.5493  -0.2744 -0.1005 166 CYS A CB  
693  S SG  . CYS A 93  ? 1.3466 2.4599 1.6815 0.5939  -0.3019 -0.0923 166 CYS A SG  
694  N N   . ILE A 94  ? 1.0085 1.9680 1.3016 0.4699  -0.2353 -0.0992 167 ILE A N   
695  C CA  . ILE A 94  ? 1.2823 2.2246 1.5713 0.4406  -0.2172 -0.1043 167 ILE A CA  
696  C C   . ILE A 94  ? 1.3947 2.2309 1.6697 0.4478  -0.2140 -0.0988 167 ILE A C   
697  O O   . ILE A 94  ? 1.0640 1.8827 1.3434 0.4558  -0.2074 -0.1072 167 ILE A O   
698  C CB  . ILE A 94  ? 1.2909 2.2502 1.5660 0.3843  -0.2057 -0.0978 167 ILE A CB  
699  C CG1 . ILE A 94  ? 1.1770 2.2479 1.4658 0.3729  -0.2102 -0.1023 167 ILE A CG1 
700  C CG2 . ILE A 94  ? 1.0130 1.9450 1.2816 0.3555  -0.1890 -0.1005 167 ILE A CG2 
701  C CD1 . ILE A 94  ? 1.4146 2.5007 1.6852 0.3146  -0.2014 -0.0964 167 ILE A CD1 
702  N N   . ILE A 95  ? 1.5757 2.3461 1.8336 0.4441  -0.2191 -0.0845 168 ILE A N   
703  C CA  . ILE A 95  ? 1.1622 1.8366 1.4072 0.4495  -0.2176 -0.0764 168 ILE A CA  
704  C C   . ILE A 95  ? 1.0794 1.7355 1.3339 0.4924  -0.2271 -0.0855 168 ILE A C   
705  O O   . ILE A 95  ? 1.2602 1.8728 1.5125 0.4912  -0.2203 -0.0884 168 ILE A O   
706  C CB  . ILE A 95  ? 1.2648 1.8866 1.4913 0.4457  -0.2248 -0.0598 168 ILE A CB  
707  C CG1 . ILE A 95  ? 1.2308 1.8484 1.4412 0.4003  -0.2116 -0.0527 168 ILE A CG1 
708  C CG2 . ILE A 95  ? 1.1360 1.6699 1.3528 0.4592  -0.2276 -0.0512 168 ILE A CG2 
709  C CD1 . ILE A 95  ? 1.1319 1.7037 1.3358 0.3739  -0.1937 -0.0518 168 ILE A CD1 
710  N N   . ALA A 96  ? 1.2283 1.9185 1.4921 0.5306  -0.2436 -0.0905 169 ALA A N   
711  C CA  . ALA A 96  ? 0.9453 1.6141 1.2142 0.5761  -0.2550 -0.1012 169 ALA A CA  
712  C C   . ALA A 96  ? 0.9311 1.6311 1.2109 0.5772  -0.2430 -0.1194 169 ALA A C   
713  O O   . ALA A 96  ? 1.2792 1.9253 1.5526 0.5925  -0.2441 -0.1252 169 ALA A O   
714  C CB  . ALA A 96  ? 1.0137 1.7301 1.2936 0.6179  -0.2737 -0.1057 169 ALA A CB  
715  N N   . PHE A 97  ? 0.9514 1.7381 1.2451 0.5571  -0.2319 -0.1274 170 PHE A N   
716  C CA  . PHE A 97  ? 0.9607 1.7906 1.2641 0.5550  -0.2200 -0.1442 170 PHE A CA  
717  C C   . PHE A 97  ? 0.9353 1.6948 1.2249 0.5294  -0.2087 -0.1396 170 PHE A C   
718  O O   . PHE A 97  ? 1.0436 1.8012 1.3344 0.5402  -0.2046 -0.1525 170 PHE A O   
719  C CB  . PHE A 97  ? 1.0804 2.0120 1.3971 0.5260  -0.2096 -0.1482 170 PHE A CB  
720  C CG  . PHE A 97  ? 1.1239 2.0974 1.4462 0.5121  -0.1954 -0.1612 170 PHE A CG  
721  C CD1 . PHE A 97  ? 1.3227 2.3413 1.6576 0.5502  -0.1967 -0.1817 170 PHE A CD1 
722  C CD2 . PHE A 97  ? 0.9430 1.9087 1.2555 0.4616  -0.1810 -0.1530 170 PHE A CD2 
723  C CE1 . PHE A 97  ? 1.1000 2.1604 1.4376 0.5357  -0.1832 -0.1936 170 PHE A CE1 
724  C CE2 . PHE A 97  ? 0.9622 1.9659 1.2775 0.4466  -0.1692 -0.1627 170 PHE A CE2 
725  C CZ  . PHE A 97  ? 0.8383 1.8918 1.1660 0.4824  -0.1698 -0.1828 170 PHE A CZ  
726  N N   . TYR A 98  ? 1.3956 2.0994 1.6717 0.4962  -0.2039 -0.1215 171 TYR A N   
727  C CA  . TYR A 98  ? 1.0605 1.6976 1.3255 0.4734  -0.1943 -0.1143 171 TYR A CA  
728  C C   . TYR A 98  ? 0.9444 1.5017 1.2004 0.5006  -0.2054 -0.1114 171 TYR A C   
729  O O   . TYR A 98  ? 1.1160 1.6401 1.3684 0.5024  -0.2028 -0.1160 171 TYR A O   
730  C CB  . TYR A 98  ? 1.0811 1.6890 1.3352 0.4320  -0.1847 -0.0973 171 TYR A CB  
731  C CG  . TYR A 98  ? 1.1263 1.8006 1.3831 0.3985  -0.1744 -0.0994 171 TYR A CG  
732  C CD1 . TYR A 98  ? 1.0788 1.8215 1.3464 0.3946  -0.1689 -0.1125 171 TYR A CD1 
733  C CD2 . TYR A 98  ? 1.6199 2.2881 1.8655 0.3689  -0.1705 -0.0884 171 TYR A CD2 
734  C CE1 . TYR A 98  ? 1.2534 2.0564 1.5210 0.3596  -0.1608 -0.1125 171 TYR A CE1 
735  C CE2 . TYR A 98  ? 1.7490 2.4718 1.9926 0.3350  -0.1630 -0.0900 171 TYR A CE2 
736  C CZ  . TYR A 98  ? 1.4521 2.2422 1.7069 0.3292  -0.1587 -0.1010 171 TYR A CZ  
737  O OH  . TYR A 98  ? 1.2154 2.0596 1.4659 0.2911  -0.1524 -0.1007 171 TYR A OH  
738  N N   . ILE A 99  ? 1.0524 1.5801 1.3028 0.5200  -0.2191 -0.1031 172 ILE A N   
739  C CA  . ILE A 99  ? 1.0950 1.5413 1.3325 0.5408  -0.2319 -0.0963 172 ILE A CA  
740  C C   . ILE A 99  ? 1.1655 1.6069 1.4038 0.5767  -0.2406 -0.1147 172 ILE A C   
741  O O   . ILE A 99  ? 1.5570 1.9373 1.7844 0.5777  -0.2428 -0.1143 172 ILE A O   
742  C CB  . ILE A 99  ? 1.2832 1.7078 1.5129 0.5553  -0.2469 -0.0837 172 ILE A CB  
743  C CG1 . ILE A 99  ? 1.1121 1.5202 1.3338 0.5183  -0.2377 -0.0650 172 ILE A CG1 
744  C CG2 . ILE A 99  ? 1.4534 1.8005 1.6685 0.5817  -0.2640 -0.0792 172 ILE A CG2 
745  C CD1 . ILE A 99  ? 1.4207 1.8102 1.6317 0.5278  -0.2516 -0.0513 172 ILE A CD1 
746  N N   . ALA A 100 ? 1.2663 1.7753 1.5170 0.6060  -0.2452 -0.1318 173 ALA A N   
747  C CA  . ALA A 100 ? 1.3780 1.8877 1.6282 0.6460  -0.2531 -0.1531 173 ALA A CA  
748  C C   . ALA A 100 ? 1.1116 1.6392 1.3632 0.6300  -0.2382 -0.1663 173 ALA A C   
749  O O   . ALA A 100 ? 1.6388 2.1624 1.8859 0.6583  -0.2420 -0.1858 173 ALA A O   
750  C CB  . ALA A 100 ? 1.3140 1.9017 1.5802 0.6837  -0.2605 -0.1680 173 ALA A CB  
751  N N   . SER A 101 ? 1.3455 1.8898 1.6007 0.5849  -0.2220 -0.1559 174 SER A N   
752  C CA  . SER A 101 ? 1.4174 1.9812 1.6729 0.5651  -0.2084 -0.1649 174 SER A CA  
753  C C   . SER A 101 ? 1.6286 2.1076 1.8677 0.5593  -0.2113 -0.1599 174 SER A C   
754  O O   . SER A 101 ? 1.8517 2.3373 2.0869 0.5552  -0.2056 -0.1712 174 SER A O   
755  C CB  . SER A 101 ? 1.1339 1.7400 1.3964 0.5188  -0.1922 -0.1539 174 SER A CB  
756  O OG  . SER A 101 ? 1.2196 1.9136 1.4963 0.5196  -0.1894 -0.1603 174 SER A OG  
757  N N   . TYR A 102 ? 1.5468 1.9501 1.7756 0.5571  -0.2206 -0.1422 175 TYR A N   
758  C CA  . TYR A 102 ? 1.6360 1.9625 1.8505 0.5462  -0.2240 -0.1338 175 TYR A CA  
759  C C   . TYR A 102 ? 1.6885 1.9401 1.8865 0.5721  -0.2437 -0.1299 175 TYR A C   
760  O O   . TYR A 102 ? 2.0448 2.2365 2.2278 0.5716  -0.2507 -0.1293 175 TYR A O   
761  C CB  . TYR A 102 ? 1.7358 2.0403 1.9529 0.5041  -0.2125 -0.1106 175 TYR A CB  
762  C CG  . TYR A 102 ? 1.5607 1.8419 1.7772 0.4973  -0.2153 -0.0918 175 TYR A CG  
763  C CD1 . TYR A 102 ? 1.4666 1.7993 1.6920 0.4876  -0.2080 -0.0895 175 TYR A CD1 
764  C CD2 . TYR A 102 ? 1.7010 1.9102 1.9058 0.4977  -0.2252 -0.0760 175 TYR A CD2 
765  C CE1 . TYR A 102 ? 1.4452 1.7570 1.6667 0.4803  -0.2102 -0.0735 175 TYR A CE1 
766  C CE2 . TYR A 102 ? 1.5390 1.7304 1.7411 0.4902  -0.2268 -0.0588 175 TYR A CE2 
767  C CZ  . TYR A 102 ? 1.3953 1.6374 1.6051 0.4824  -0.2190 -0.0584 175 TYR A CZ  
768  O OH  . TYR A 102 ? 1.5410 1.7657 1.7448 0.4740  -0.2203 -0.0425 175 TYR A OH  
769  N N   . TYR A 103 ? 1.4133 1.6671 1.6120 0.5926  -0.2540 -0.1259 176 TYR A N   
770  C CA  . TYR A 103 ? 1.4230 1.6018 1.6035 0.6135  -0.2744 -0.1176 176 TYR A CA  
771  C C   . TYR A 103 ? 1.6247 1.7728 1.7900 0.6517  -0.2890 -0.1391 176 TYR A C   
772  O O   . TYR A 103 ? 1.8166 1.8844 1.9598 0.6615  -0.3060 -0.1331 176 TYR A O   
773  C CB  . TYR A 103 ? 1.4123 1.6066 1.5963 0.6270  -0.2829 -0.1079 176 TYR A CB  
774  C CG  . TYR A 103 ? 1.3884 1.5013 1.5512 0.6386  -0.3035 -0.0921 176 TYR A CG  
775  C CD1 . TYR A 103 ? 1.3161 1.3822 1.4707 0.6064  -0.3018 -0.0665 176 TYR A CD1 
776  C CD2 . TYR A 103 ? 1.8667 1.9494 2.0156 0.6788  -0.3234 -0.1020 176 TYR A CD2 
777  C CE1 . TYR A 103 ? 1.3408 1.3355 1.4741 0.6128  -0.3208 -0.0500 176 TYR A CE1 
778  C CE2 . TYR A 103 ? 2.0287 2.0322 2.1532 0.6796  -0.3406 -0.0846 176 TYR A CE2 
779  C CZ  . TYR A 103 ? 1.9012 1.8623 2.0193 0.6529  -0.3435 -0.0588 176 TYR A CZ  
780  O OH  . TYR A 103 ? 2.0635 1.9493 2.1562 0.6515  -0.3614 -0.0400 176 TYR A OH  
781  N N   . ASN A 104 ? 1.6272 1.8388 1.8023 0.6723  -0.2823 -0.1644 177 ASN A N   
782  C CA  . ASN A 104 ? 1.7837 1.9731 1.9437 0.7134  -0.2943 -0.1895 177 ASN A CA  
783  C C   . ASN A 104 ? 1.7758 1.9399 1.9225 0.6978  -0.2882 -0.2003 177 ASN A C   
784  O O   . ASN A 104 ? 2.1278 2.2409 2.2516 0.7234  -0.3007 -0.2169 177 ASN A O   
785  C CB  . ASN A 104 ? 1.7571 2.0324 1.9315 0.7417  -0.2877 -0.2115 177 ASN A CB  
786  C CG  . ASN A 104 ? 1.6834 1.9760 1.8634 0.7495  -0.2931 -0.1994 177 ASN A CG  
787  O OD1 . ASN A 104 ? 2.0287 2.2764 2.1909 0.7733  -0.3066 -0.2011 177 ASN A OD1 
788  N ND2 . ASN A 104 ? 1.5842 1.9415 1.7879 0.7297  -0.2840 -0.1872 177 ASN A ND2 
789  N N   . THR A 105 ? 1.5467 1.7434 1.7054 0.6559  -0.2702 -0.1906 178 THR A N   
790  C CA  . THR A 105 ? 1.5397 1.7195 1.6873 0.6368  -0.2643 -0.1976 178 THR A CA  
791  C C   . THR A 105 ? 1.5524 1.6332 1.6771 0.6229  -0.2782 -0.1824 178 THR A C   
792  O O   . THR A 105 ? 1.6549 1.7010 1.7610 0.6196  -0.2822 -0.1925 178 THR A O   
793  C CB  . THR A 105 ? 1.2628 1.4996 1.4287 0.5947  -0.2434 -0.1874 178 THR A CB  
794  O OG1 . THR A 105 ? 1.2811 1.4969 1.4561 0.5647  -0.2401 -0.1585 178 THR A OG1 
795  C CG2 . THR A 105 ? 1.5200 1.8570 1.7052 0.6030  -0.2302 -0.2028 178 THR A CG2 
796  N N   . ILE A 106 ? 1.3723 1.4112 1.4973 0.6125  -0.2857 -0.1576 179 ILE A N   
797  C CA  . ILE A 106 ? 1.4541 1.4034 1.5578 0.5980  -0.3002 -0.1403 179 ILE A CA  
798  C C   . ILE A 106 ? 1.7248 1.6106 1.7985 0.6346  -0.3223 -0.1577 179 ILE A C   
799  O O   . ILE A 106 ? 2.0695 1.8933 2.1187 0.6270  -0.3328 -0.1603 179 ILE A O   
800  C CB  . ILE A 106 ? 1.2706 1.1983 1.3811 0.5796  -0.3020 -0.1104 179 ILE A CB  
801  C CG1 . ILE A 106 ? 1.1834 1.1738 1.3211 0.5490  -0.2796 -0.0975 179 ILE A CG1 
802  C CG2 . ILE A 106 ? 1.3516 1.1974 1.4425 0.5581  -0.3148 -0.0902 179 ILE A CG2 
803  C CD1 . ILE A 106 ? 1.3715 1.3490 1.5150 0.5325  -0.2784 -0.0715 179 ILE A CD1 
804  N N   . MET A 107 ? 1.7007 1.6017 1.7753 0.6746  -0.3304 -0.1697 180 MET A N   
805  C CA  . MET A 107 ? 1.9598 1.8038 2.0060 0.7175  -0.3514 -0.1897 180 MET A CA  
806  C C   . MET A 107 ? 1.8224 1.6849 1.8584 0.7341  -0.3461 -0.2226 180 MET A C   
807  O O   . MET A 107 ? 2.0535 1.8493 2.0572 0.7585  -0.3626 -0.2398 180 MET A O   
808  C CB  . MET A 107 ? 2.2744 2.1466 2.3260 0.7460  -0.3539 -0.1928 180 MET A CB  
809  C CG  . MET A 107 ? 2.1770 2.0140 2.2269 0.7308  -0.3627 -0.1617 180 MET A CG  
810  S SD  . MET A 107 ? 2.0864 1.9525 2.1381 0.7616  -0.3669 -0.1654 180 MET A SD  
811  C CE  . MET A 107 ? 1.9160 1.9165 2.0094 0.7652  -0.3427 -0.1792 180 MET A CE  
812  N N   . ALA A 108 ? 1.4566 1.4082 1.5171 0.7203  -0.3234 -0.2315 181 ALA A N   
813  C CA  . ALA A 108 ? 1.3502 1.3293 1.4013 0.7298  -0.3155 -0.2610 181 ALA A CA  
814  C C   . ALA A 108 ? 1.8040 1.7186 1.8310 0.6962  -0.3198 -0.2546 181 ALA A C   
815  O O   . ALA A 108 ? 1.9182 1.8001 1.9173 0.7107  -0.3264 -0.2785 181 ALA A O   
816  C CB  . ALA A 108 ? 1.2856 1.3778 1.3678 0.7173  -0.2908 -0.2676 181 ALA A CB  
817  N N   . TRP A 109 ? 1.5594 1.4582 1.5970 0.6516  -0.3162 -0.2226 182 TRP A N   
818  C CA  . TRP A 109 ? 1.6295 1.4696 1.6482 0.6170  -0.3223 -0.2107 182 TRP A CA  
819  C C   . TRP A 109 ? 1.8838 1.6191 1.8644 0.6315  -0.3485 -0.2122 182 TRP A C   
820  O O   . TRP A 109 ? 2.0249 1.7113 1.9752 0.6280  -0.3582 -0.2255 182 TRP A O   
821  C CB  . TRP A 109 ? 1.2780 1.1275 1.3196 0.5716  -0.3130 -0.1749 182 TRP A CB  
822  C CG  . TRP A 109 ? 1.5256 1.4648 1.5994 0.5535  -0.2893 -0.1713 182 TRP A CG  
823  C CD1 . TRP A 109 ? 1.5872 1.5956 1.6681 0.5620  -0.2758 -0.1939 182 TRP A CD1 
824  C CD2 . TRP A 109 ? 1.1481 1.1148 1.2484 0.5229  -0.2767 -0.1435 182 TRP A CD2 
825  N NE1 . TRP A 109 ? 1.2958 1.3692 1.4044 0.5359  -0.2571 -0.1801 182 TRP A NE1 
826  C CE2 . TRP A 109 ? 1.1019 1.1482 1.2222 0.5133  -0.2574 -0.1503 182 TRP A CE2 
827  C CE3 . TRP A 109 ? 1.1344 1.0660 1.2413 0.5026  -0.2797 -0.1141 182 TRP A CE3 
828  C CZ2 . TRP A 109 ? 1.1749 1.2580 1.3191 0.4852  -0.2425 -0.1294 182 TRP A CZ2 
829  C CZ3 . TRP A 109 ? 1.0775 1.0511 1.2100 0.4774  -0.2629 -0.0952 182 TRP A CZ3 
830  C CH2 . TRP A 109 ? 1.3205 1.3649 1.4702 0.4694  -0.2452 -0.1032 182 TRP A CH2 
831  N N   . ALA A 110 ? 1.7679 1.4672 1.7474 0.6461  -0.3611 -0.1980 183 ALA A N   
832  C CA  . ALA A 110 ? 1.5198 1.1141 1.4610 0.6580  -0.3883 -0.1955 183 ALA A CA  
833  C C   . ALA A 110 ? 1.7926 1.3537 1.7022 0.7050  -0.4005 -0.2333 183 ALA A C   
834  O O   . ALA A 110 ? 2.2299 1.6981 2.0980 0.7083  -0.4218 -0.2393 183 ALA A O   
835  C CB  . ALA A 110 ? 1.5239 1.0957 1.4710 0.6658  -0.3985 -0.1724 183 ALA A CB  
836  N N   . LEU A 111 ? 1.7878 1.4261 1.7161 0.7408  -0.3870 -0.2590 184 LEU A N   
837  C CA  . LEU A 111 ? 2.1600 1.7827 2.0631 0.7912  -0.3948 -0.2981 184 LEU A CA  
838  C C   . LEU A 111 ? 2.0698 1.6906 1.9519 0.7773  -0.3882 -0.3206 184 LEU A C   
839  O O   . LEU A 111 ? 1.8731 1.4253 1.7136 0.8011  -0.4033 -0.3458 184 LEU A O   
840  C CB  . LEU A 111 ? 2.2109 1.9325 2.1446 0.8283  -0.3794 -0.3155 184 LEU A CB  
841  C CG  . LEU A 111 ? 1.9146 1.6458 1.8267 0.8705  -0.3785 -0.3535 184 LEU A CG  
842  C CD1 . LEU A 111 ? 1.7866 1.4106 1.6553 0.8872  -0.4022 -0.3543 184 LEU A CD1 
843  C CD2 . LEU A 111 ? 1.6772 1.5225 1.6243 0.8908  -0.3593 -0.3623 184 LEU A CD2 
844  N N   . TYR A 112 ? 1.8533 1.5466 1.7614 0.7382  -0.3667 -0.3112 185 TYR A N   
845  C CA  . TYR A 112 ? 1.8755 1.5724 1.7650 0.7175  -0.3603 -0.3271 185 TYR A CA  
846  C C   . TYR A 112 ? 1.7772 1.3689 1.6300 0.6867  -0.3809 -0.3130 185 TYR A C   
847  O O   . TYR A 112 ? 1.6992 1.2543 1.5175 0.6826  -0.3869 -0.3332 185 TYR A O   
848  C CB  . TYR A 112 ? 1.7701 1.5630 1.6958 0.6792  -0.3352 -0.3138 185 TYR A CB  
849  C CG  . TYR A 112 ? 1.7238 1.5402 1.6326 0.6638  -0.3265 -0.3337 185 TYR A CG  
850  C CD1 . TYR A 112 ? 1.7910 1.6718 1.6971 0.6948  -0.3138 -0.3694 185 TYR A CD1 
851  C CD2 . TYR A 112 ? 1.8198 1.5990 1.7154 0.6178  -0.3310 -0.3161 185 TYR A CD2 
852  C CE1 . TYR A 112 ? 2.3095 2.2137 2.1970 0.6790  -0.3057 -0.3874 185 TYR A CE1 
853  C CE2 . TYR A 112 ? 1.8203 1.6216 1.6984 0.6021  -0.3244 -0.3330 185 TYR A CE2 
854  C CZ  . TYR A 112 ? 2.1652 2.0275 2.0378 0.6322  -0.3116 -0.3688 185 TYR A CZ  
855  O OH  . TYR A 112 ? 2.2578 2.1441 2.1101 0.6150  -0.3048 -0.3854 185 TYR A OH  
856  N N   . TYR A 113 ? 1.6726 1.2186 1.5318 0.6633  -0.3918 -0.2781 186 TYR A N   
857  C CA  . TYR A 113 ? 2.0075 1.4548 1.8330 0.6328  -0.4134 -0.2609 186 TYR A CA  
858  C C   . TYR A 113 ? 2.1153 1.4605 1.8918 0.6693  -0.4401 -0.2809 186 TYR A C   
859  O O   . TYR A 113 ? 2.1070 1.3698 1.8403 0.6541  -0.4582 -0.2862 186 TYR A O   
860  C CB  . TYR A 113 ? 2.0059 1.4457 1.8551 0.5962  -0.4148 -0.2168 186 TYR A CB  
861  C CG  . TYR A 113 ? 1.8348 1.3200 1.7093 0.5448  -0.4002 -0.1925 186 TYR A CG  
862  C CD1 . TYR A 113 ? 1.7184 1.3015 1.6362 0.5365  -0.3745 -0.1869 186 TYR A CD1 
863  C CD2 . TYR A 113 ? 1.9312 1.3606 1.7857 0.5043  -0.4134 -0.1742 186 TYR A CD2 
864  C CE1 . TYR A 113 ? 1.7641 1.3837 1.7040 0.4931  -0.3625 -0.1643 186 TYR A CE1 
865  C CE2 . TYR A 113 ? 2.0986 1.5725 1.9786 0.4609  -0.4010 -0.1511 186 TYR A CE2 
866  C CZ  . TYR A 113 ? 2.0224 1.5892 1.9449 0.4573  -0.3756 -0.1465 186 TYR A CZ  
867  O OH  . TYR A 113 ? 1.9277 1.5339 1.8744 0.4174  -0.3646 -0.1232 186 TYR A OH  
868  N N   . LEU A 114 ? 1.8184 1.1680 1.6007 0.7171  -0.4437 -0.2914 187 LEU A N   
869  C CA  . LEU A 114 ? 1.9268 1.1774 1.6638 0.7580  -0.4703 -0.3093 187 LEU A CA  
870  C C   . LEU A 114 ? 2.1205 1.3513 1.8213 0.7909  -0.4721 -0.3552 187 LEU A C   
871  O O   . LEU A 114 ? 2.1460 1.2695 1.7933 0.7975  -0.4957 -0.3682 187 LEU A O   
872  C CB  . LEU A 114 ? 2.0166 1.2920 1.7736 0.7993  -0.4712 -0.3066 187 LEU A CB  
873  C CG  . LEU A 114 ? 2.0310 1.2312 1.7460 0.8255  -0.4890 -0.3178 187 LEU A CG  
874  C CD1 . LEU A 114 ? 2.1798 1.2563 1.8523 0.7950  -0.5174 -0.2935 187 LEU A CD1 
875  C CD2 . LEU A 114 ? 2.0139 1.2724 1.7563 0.8495  -0.4803 -0.3105 187 LEU A CD2 
876  N N   . ILE A 115 ? 1.9473 1.2813 1.6748 0.8100  -0.4471 -0.3800 188 ILE A N   
877  C CA  . ILE A 115 ? 2.1304 1.4623 1.8265 0.8431  -0.4445 -0.4260 188 ILE A CA  
878  C C   . ILE A 115 ? 2.2570 1.5539 1.9221 0.7971  -0.4463 -0.4284 188 ILE A C   
879  O O   . ILE A 115 ? 2.7443 2.0000 2.3657 0.8162  -0.4523 -0.4641 188 ILE A O   
880  C CB  . ILE A 115 ? 2.0711 1.5346 1.8064 0.8735  -0.4162 -0.4496 188 ILE A CB  
881  C CG1 . ILE A 115 ? 2.1235 1.6859 1.9003 0.8215  -0.3911 -0.4278 188 ILE A CG1 
882  C CG2 . ILE A 115 ? 2.2413 1.7473 2.0064 0.9110  -0.4141 -0.4440 188 ILE A CG2 
883  C CD1 . ILE A 115 ? 2.1309 1.8238 1.9437 0.8423  -0.3637 -0.4479 188 ILE A CD1 
884  N N   . SER A 116 ? 2.2678 1.5827 1.9551 0.7375  -0.4414 -0.3909 189 SER A N   
885  C CA  . SER A 116 ? 2.4471 1.7338 2.1096 0.6894  -0.4448 -0.3868 189 SER A CA  
886  C C   . SER A 116 ? 2.6507 1.8128 2.2716 0.6627  -0.4752 -0.3673 189 SER A C   
887  O O   . SER A 116 ? 2.6668 1.7960 2.2661 0.6173  -0.4828 -0.3576 189 SER A O   
888  C CB  . SER A 116 ? 1.9411 1.3202 1.6511 0.6403  -0.4231 -0.3570 189 SER A CB  
889  O OG  . SER A 116 ? 1.8955 1.3871 1.6402 0.6596  -0.3964 -0.3732 189 SER A OG  
890  N N   . SER A 117 ? 2.7620 1.8570 2.3712 0.6894  -0.4935 -0.3602 190 SER A N   
891  C CA  . SER A 117 ? 2.8348 1.8096 2.4031 0.6635  -0.5239 -0.3389 190 SER A CA  
892  C C   . SER A 117 ? 3.0191 1.8800 2.5227 0.7052  -0.5495 -0.3731 190 SER A C   
893  O O   . SER A 117 ? 3.2503 2.0050 2.7189 0.7014  -0.5774 -0.3582 190 SER A O   
894  C CB  . SER A 117 ? 2.7572 1.7300 2.3555 0.6536  -0.5287 -0.2983 190 SER A CB  
895  O OG  . SER A 117 ? 3.1207 1.9811 2.6787 0.6248  -0.5582 -0.2752 190 SER A OG  
896  N N   . PHE A 118 ? 2.8593 1.7414 2.3451 0.7450  -0.5402 -0.4190 191 PHE A N   
897  C CA  . PHE A 118 ? 2.9006 1.6762 2.3225 0.7902  -0.5624 -0.4576 191 PHE A CA  
898  C C   . PHE A 118 ? 2.9419 1.6568 2.3084 0.7608  -0.5721 -0.4786 191 PHE A C   
899  O O   . PHE A 118 ? 3.3339 1.9537 2.6390 0.7928  -0.5904 -0.5144 191 PHE A O   
900  C CB  . PHE A 118 ? 2.8353 1.6844 2.2741 0.8556  -0.5433 -0.4943 191 PHE A CB  
901  C CG  . PHE A 118 ? 2.7436 1.6487 2.2272 0.8766  -0.5356 -0.4707 191 PHE A CG  
902  C CD1 . PHE A 118 ? 2.6806 1.5298 2.1658 0.8515  -0.5532 -0.4295 191 PHE A CD1 
903  C CD2 . PHE A 118 ? 2.5572 1.5730 2.0793 0.9183  -0.5111 -0.4895 191 PHE A CD2 
904  C CE1 . PHE A 118 ? 2.4032 1.3026 1.9254 0.8684  -0.5464 -0.4094 191 PHE A CE1 
905  C CE2 . PHE A 118 ? 2.4502 1.5158 2.0104 0.9340  -0.5055 -0.4682 191 PHE A CE2 
906  C CZ  . PHE A 118 ? 2.3624 1.3681 1.9216 0.9095  -0.5231 -0.4290 191 PHE A CZ  
907  N N   . THR A 119 ? 2.8302 1.5992 2.2170 0.7003  -0.5606 -0.4565 192 THR A N   
908  C CA  . THR A 119 ? 2.9654 1.6882 2.3036 0.6641  -0.5697 -0.4712 192 THR A CA  
909  C C   . THR A 119 ? 3.0462 1.6528 2.3442 0.6138  -0.6021 -0.4408 192 THR A C   
910  O O   . THR A 119 ? 3.1523 1.7583 2.4801 0.5863  -0.6077 -0.3971 192 THR A O   
911  C CB  . THR A 119 ? 3.1543 1.9952 2.5332 0.6229  -0.5432 -0.4611 192 THR A CB  
912  O OG1 . THR A 119 ? 3.3484 2.3084 2.7755 0.6616  -0.5125 -0.4776 192 THR A OG1 
913  C CG2 . THR A 119 ? 3.1544 1.9614 2.4802 0.6002  -0.5494 -0.4883 192 THR A CG2 
914  N N   . ASP A 120 ? 3.6572 2.1670 2.8855 0.6005  -0.6233 -0.4643 193 ASP A N   
915  C CA  . ASP A 120 ? 3.7147 2.1114 2.8977 0.5481  -0.6560 -0.4375 193 ASP A CA  
916  C C   . ASP A 120 ? 3.7376 2.2012 2.9634 0.4752  -0.6493 -0.3892 193 ASP A C   
917  O O   . ASP A 120 ? 3.8664 2.2774 3.0868 0.4318  -0.6692 -0.3501 193 ASP A O   
918  C CB  . ASP A 120 ? 3.9723 2.2609 3.0703 0.5453  -0.6781 -0.4760 193 ASP A CB  
919  C CG  . ASP A 120 ? 4.0196 2.3829 3.1175 0.5255  -0.6592 -0.4982 193 ASP A CG  
920  O OD1 . ASP A 120 ? 4.1125 2.6043 3.2667 0.5443  -0.6265 -0.5039 193 ASP A OD1 
921  O OD2 . ASP A 120 ? 3.9444 2.2367 2.9833 0.4887  -0.6781 -0.5090 193 ASP A OD2 
922  N N   . GLN A 121 ? 3.5151 2.0963 2.7830 0.4626  -0.6214 -0.3914 194 GLN A N   
923  C CA  . GLN A 121 ? 2.9421 1.5998 2.2578 0.4014  -0.6118 -0.3470 194 GLN A CA  
924  C C   . GLN A 121 ? 2.5068 1.2952 1.9022 0.4178  -0.5787 -0.3307 194 GLN A C   
925  O O   . GLN A 121 ? 2.3517 1.2200 1.7671 0.4470  -0.5547 -0.3572 194 GLN A O   
926  C CB  . GLN A 121 ? 3.0581 1.7335 2.3498 0.3615  -0.6120 -0.3576 194 GLN A CB  
927  C CG  . GLN A 121 ? 3.4813 2.0291 2.6935 0.3319  -0.6465 -0.3679 194 GLN A CG  
928  C CD  . GLN A 121 ? 3.6246 2.1153 2.8342 0.2786  -0.6709 -0.3203 194 GLN A CD  
929  O OE1 . GLN A 121 ? 3.6680 2.2329 2.9387 0.2507  -0.6594 -0.2769 194 GLN A OE1 
930  N NE2 . GLN A 121 ? 3.6955 2.0534 2.8323 0.2636  -0.7048 -0.3286 194 GLN A NE2 
931  N N   . LEU A 122 ? 2.5013 1.3104 1.9392 0.3970  -0.5778 -0.2873 195 LEU A N   
932  C CA  . LEU A 122 ? 2.4165 1.3358 1.9254 0.4116  -0.5491 -0.2700 195 LEU A CA  
933  C C   . LEU A 122 ? 2.4300 1.4565 1.9799 0.3815  -0.5257 -0.2602 195 LEU A C   
934  O O   . LEU A 122 ? 2.6921 1.7150 2.2358 0.3311  -0.5338 -0.2401 195 LEU A O   
935  C CB  . LEU A 122 ? 2.1265 1.0343 1.6641 0.3926  -0.5553 -0.2259 195 LEU A CB  
936  C CG  . LEU A 122 ? 2.2138 1.0184 1.7148 0.4191  -0.5794 -0.2277 195 LEU A CG  
937  C CD1 . LEU A 122 ? 2.9541 1.6413 2.3949 0.3810  -0.6134 -0.2182 195 LEU A CD1 
938  C CD2 . LEU A 122 ? 2.1498 0.9890 1.6964 0.4225  -0.5719 -0.1939 195 LEU A CD2 
939  N N   . PRO A 123 ? 2.1977 1.3199 1.7884 0.4116  -0.4978 -0.2732 196 PRO A N   
940  C CA  . PRO A 123 ? 2.2935 1.5178 1.9201 0.3897  -0.4748 -0.2677 196 PRO A CA  
941  C C   . PRO A 123 ? 2.1286 1.3960 1.7984 0.3393  -0.4703 -0.2197 196 PRO A C   
942  O O   . PRO A 123 ? 2.3193 1.6229 1.9935 0.3040  -0.4672 -0.2105 196 PRO A O   
943  C CB  . PRO A 123 ? 2.2438 1.5497 1.9072 0.4344  -0.4491 -0.2848 196 PRO A CB  
944  C CG  . PRO A 123 ? 2.1663 1.4090 1.7964 0.4868  -0.4602 -0.3165 196 PRO A CG  
945  C CD  . PRO A 123 ? 2.2169 1.3529 1.8180 0.4705  -0.4885 -0.2959 196 PRO A CD  
946  N N   . TRP A 124 ? 1.9453 1.2111 1.6459 0.3371  -0.4701 -0.1897 197 TRP A N   
947  C CA  . TRP A 124 ? 1.7204 1.0349 1.4663 0.2960  -0.4626 -0.1457 197 TRP A CA  
948  C C   . TRP A 124 ? 1.7614 1.0206 1.4868 0.2477  -0.4855 -0.1186 197 TRP A C   
949  O O   . TRP A 124 ? 1.7116 0.9997 1.4723 0.2171  -0.4826 -0.0803 197 TRP A O   
950  C CB  . TRP A 124 ? 1.6589 1.0081 1.4484 0.3133  -0.4488 -0.1262 197 TRP A CB  
951  C CG  . TRP A 124 ? 1.8845 1.1558 1.6510 0.3300  -0.4667 -0.1231 197 TRP A CG  
952  C CD1 . TRP A 124 ? 2.0836 1.3053 1.8445 0.3003  -0.4832 -0.0912 197 TRP A CD1 
953  C CD2 . TRP A 124 ? 1.7603 0.9970 1.5065 0.3802  -0.4706 -0.1514 197 TRP A CD2 
954  N NE1 . TRP A 124 ? 2.1608 1.3140 1.8961 0.3270  -0.4980 -0.0971 197 TRP A NE1 
955  C CE2 . TRP A 124 ? 1.8111 0.9712 1.5378 0.3779  -0.4911 -0.1339 197 TRP A CE2 
956  C CE3 . TRP A 124 ? 1.8774 1.1444 1.6208 0.4269  -0.4590 -0.1890 197 TRP A CE3 
957  C CZ2 . TRP A 124 ? 1.8665 0.9748 1.5704 0.4223  -0.5017 -0.1520 197 TRP A CZ2 
958  C CZ3 . TRP A 124 ? 1.9004 1.1216 1.6242 0.4727  -0.4684 -0.2081 197 TRP A CZ3 
959  C CH2 . TRP A 124 ? 1.9790 1.1190 1.6829 0.4709  -0.4903 -0.1893 197 TRP A CH2 
960  N N   . THR A 125 ? 1.8550 1.0369 1.5228 0.2406  -0.5082 -0.1391 198 THR A N   
961  C CA  . THR A 125 ? 1.9059 1.0303 1.5476 0.1919  -0.5330 -0.1152 198 THR A CA  
962  C C   . THR A 125 ? 2.0053 1.1679 1.6449 0.1539  -0.5335 -0.1114 198 THR A C   
963  O O   . THR A 125 ? 1.9566 1.1378 1.6142 0.1080  -0.5404 -0.0760 198 THR A O   
964  C CB  . THR A 125 ? 2.0294 1.0315 1.6017 0.2008  -0.5623 -0.1371 198 THR A CB  
965  O OG1 . THR A 125 ? 2.0433 1.0093 1.6169 0.2382  -0.5635 -0.1393 198 THR A OG1 
966  C CG2 . THR A 125 ? 2.6718 1.6152 2.2169 0.1445  -0.5894 -0.1085 198 THR A CG2 
967  N N   . SER A 126 ? 2.0830 1.2625 1.7014 0.1734  -0.5260 -0.1474 199 SER A N   
968  C CA  . SER A 126 ? 2.4583 1.6728 2.0687 0.1394  -0.5273 -0.1471 199 SER A CA  
969  C C   . SER A 126 ? 2.2138 1.5399 1.8771 0.1448  -0.4987 -0.1402 199 SER A C   
970  O O   . SER A 126 ? 1.9547 1.3242 1.6481 0.1817  -0.4775 -0.1493 199 SER A O   
971  C CB  . SER A 126 ? 2.9216 2.0745 2.4635 0.1509  -0.5406 -0.1919 199 SER A CB  
972  O OG  . SER A 126 ? 3.3296 2.3700 2.8164 0.1402  -0.5702 -0.1968 199 SER A OG  
973  N N   . CYS A 127 ? 2.3334 1.7041 2.0060 0.1062  -0.4998 -0.1229 200 CYS A N   
974  C CA  . CYS A 127 ? 2.0972 1.5666 1.8141 0.1061  -0.4761 -0.1139 200 CYS A CA  
975  C C   . CYS A 127 ? 2.0819 1.5709 1.7655 0.1171  -0.4701 -0.1508 200 CYS A C   
976  O O   . CYS A 127 ? 1.8662 1.4331 1.5778 0.1193  -0.4508 -0.1486 200 CYS A O   
977  C CB  . CYS A 127 ? 2.1157 1.6305 1.8675 0.0597  -0.4802 -0.0696 200 CYS A CB  
978  S SG  . CYS A 127 ? 2.7306 2.2669 2.5423 0.0520  -0.4744 -0.0232 200 CYS A SG  
979  N N   . LYS A 128 ? 2.3746 1.7910 1.9956 0.1232  -0.4870 -0.1847 201 LYS A N   
980  C CA  . LYS A 128 ? 2.4755 1.9060 2.0576 0.1338  -0.4819 -0.2234 201 LYS A CA  
981  C C   . LYS A 128 ? 2.5879 2.0416 2.1727 0.1892  -0.4609 -0.2595 201 LYS A C   
982  O O   . LYS A 128 ? 3.0190 2.4145 2.5568 0.2208  -0.4673 -0.2994 201 LYS A O   
983  C CB  . LYS A 128 ? 2.6944 2.0346 2.2040 0.1183  -0.5085 -0.2477 201 LYS A CB  
984  N N   . ASN A 129 ? 2.1943 1.7332 1.8335 0.2009  -0.4365 -0.2453 202 ASN A N   
985  C CA  . ASN A 129 ? 1.9814 1.5589 1.6301 0.2491  -0.4154 -0.2753 202 ASN A CA  
986  C C   . ASN A 129 ? 1.9258 1.6045 1.6007 0.2426  -0.3925 -0.2740 202 ASN A C   
987  O O   . ASN A 129 ? 2.4706 2.1829 2.1534 0.2029  -0.3943 -0.2506 202 ASN A O   
988  C CB  . ASN A 129 ? 1.8882 1.4618 1.5764 0.2750  -0.4091 -0.2601 202 ASN A CB  
989  C CG  . ASN A 129 ? 2.0982 1.5709 1.7588 0.2810  -0.4324 -0.2593 202 ASN A CG  
990  O OD1 . ASN A 129 ? 2.0040 1.4221 1.6288 0.3183  -0.4391 -0.2930 202 ASN A OD1 
991  N ND2 . ASN A 129 ? 2.1805 1.6286 1.8574 0.2444  -0.4453 -0.2199 202 ASN A ND2 
992  N N   . SER A 130 ? 1.8150 1.5433 1.5029 0.2807  -0.3721 -0.2976 203 SER A N   
993  C CA  . SER A 130 ? 1.8863 1.7104 1.5944 0.2748  -0.3503 -0.2988 203 SER A CA  
994  C C   . SER A 130 ? 1.9756 1.8594 1.7447 0.2691  -0.3346 -0.2640 203 SER A C   
995  O O   . SER A 130 ? 2.1471 2.1086 1.9364 0.2637  -0.3165 -0.2609 203 SER A O   
996  C CB  . SER A 130 ? 2.1827 2.0371 1.8671 0.3165  -0.3363 -0.3463 203 SER A CB  
997  O OG  . SER A 130 ? 1.9906 1.8364 1.6930 0.3606  -0.3304 -0.3581 203 SER A OG  
998  N N   . TRP A 131 ? 2.0116 1.8569 1.8068 0.2687  -0.3419 -0.2379 204 TRP A N   
999  C CA  . TRP A 131 ? 1.8223 1.7146 1.6716 0.2648  -0.3278 -0.2065 204 TRP A CA  
1000 C C   . TRP A 131 ? 1.8202 1.6942 1.6940 0.2285  -0.3379 -0.1625 204 TRP A C   
1001 O O   . TRP A 131 ? 1.8282 1.7440 1.7443 0.2182  -0.3264 -0.1339 204 TRP A O   
1002 C CB  . TRP A 131 ? 1.6625 1.5420 1.5271 0.3044  -0.3221 -0.2168 204 TRP A CB  
1003 C CG  . TRP A 131 ? 1.6031 1.3936 1.4446 0.3168  -0.3422 -0.2208 204 TRP A CG  
1004 C CD1 . TRP A 131 ? 1.4471 1.1928 1.3029 0.2989  -0.3543 -0.1891 204 TRP A CD1 
1005 C CD2 . TRP A 131 ? 1.5346 1.2686 1.3322 0.3497  -0.3532 -0.2584 204 TRP A CD2 
1006 N NE1 . TRP A 131 ? 1.5159 1.1792 1.3381 0.3148  -0.3732 -0.2027 204 TRP A NE1 
1007 C CE2 . TRP A 131 ? 1.5726 1.2228 1.3579 0.3475  -0.3735 -0.2454 204 TRP A CE2 
1008 C CE3 . TRP A 131 ? 1.5805 1.3269 1.3472 0.3817  -0.3477 -0.3019 204 TRP A CE3 
1009 C CZ2 . TRP A 131 ? 1.6583 1.2291 1.3990 0.3757  -0.3903 -0.2737 204 TRP A CZ2 
1010 C CZ3 . TRP A 131 ? 2.0419 1.7121 1.7664 0.4137  -0.3630 -0.3321 204 TRP A CZ3 
1011 C CH2 . TRP A 131 ? 1.9519 1.5313 1.6626 0.4103  -0.3849 -0.3174 204 TRP A CH2 
1012 N N   . ASN A 132 ? 1.6614 1.4739 1.5077 0.2092  -0.3595 -0.1577 205 ASN A N   
1013 C CA  . ASN A 132 ? 1.4438 1.2443 1.3128 0.1740  -0.3703 -0.1164 205 ASN A CA  
1014 C C   . ASN A 132 ? 1.4405 1.2968 1.3243 0.1409  -0.3668 -0.0944 205 ASN A C   
1015 O O   . ASN A 132 ? 1.5595 1.4488 1.4226 0.1384  -0.3615 -0.1133 205 ASN A O   
1016 C CB  . ASN A 132 ? 1.5678 1.2885 1.3996 0.1593  -0.3961 -0.1177 205 ASN A CB  
1017 C CG  . ASN A 132 ? 1.8535 1.5132 1.6792 0.1845  -0.4029 -0.1241 205 ASN A CG  
1018 O OD1 . ASN A 132 ? 2.0940 1.7201 1.8894 0.2181  -0.4039 -0.1591 205 ASN A OD1 
1019 N ND2 . ASN A 132 ? 2.2080 1.8547 2.0623 0.1690  -0.4078 -0.0897 205 ASN A ND2 
1020 N N   . THR A 133 ? 1.3337 1.2025 1.2533 0.1162  -0.3699 -0.0540 206 THR A N   
1021 C CA  . THR A 133 ? 1.3034 1.2224 1.2409 0.0864  -0.3687 -0.0281 206 THR A CA  
1022 C C   . THR A 133 ? 1.3303 1.2249 1.2614 0.0508  -0.3909 -0.0034 206 THR A C   
1023 O O   . THR A 133 ? 1.3764 1.2131 1.2847 0.0469  -0.4073 -0.0086 206 THR A O   
1024 C CB  . THR A 133 ? 1.6154 1.5817 1.6065 0.0891  -0.3517 0.0017  206 THR A CB  
1025 O OG1 . THR A 133 ? 1.2133 1.1541 1.2316 0.0894  -0.3554 0.0252  206 THR A OG1 
1026 C CG2 . THR A 133 ? 1.6353 1.6308 1.6337 0.1190  -0.3305 -0.0197 206 THR A CG2 
1027 N N   . GLY A 134 ? 1.4798 1.4192 1.4307 0.0240  -0.3927 0.0247  207 GLY A N   
1028 C CA  . GLY A 134 ? 1.4505 1.3814 1.4016 -0.0116 -0.4137 0.0523  207 GLY A CA  
1029 C C   . GLY A 134 ? 1.3983 1.3158 1.3854 -0.0164 -0.4181 0.0830  207 GLY A C   
1030 O O   . GLY A 134 ? 1.7818 1.6821 1.7645 -0.0444 -0.4376 0.1019  207 GLY A O   
1031 N N   . ASN A 135 ? 1.3330 1.2615 1.3546 0.0094  -0.3998 0.0880  208 ASN A N   
1032 C CA  . ASN A 135 ? 1.2315 1.1528 1.2877 0.0080  -0.4003 0.1154  208 ASN A CA  
1033 C C   . ASN A 135 ? 1.5421 1.3980 1.5701 0.0116  -0.4126 0.1012  208 ASN A C   
1034 O O   . ASN A 135 ? 1.2778 1.1213 1.3234 -0.0002 -0.4196 0.1250  208 ASN A O   
1035 C CB  . ASN A 135 ? 1.1702 1.1230 1.2676 0.0341  -0.3762 0.1231  208 ASN A CB  
1036 C CG  . ASN A 135 ? 1.1873 1.1978 1.3205 0.0265  -0.3669 0.1491  208 ASN A CG  
1037 O OD1 . ASN A 135 ? 1.1248 1.1570 1.2736 0.0021  -0.3783 0.1773  208 ASN A OD1 
1038 N ND2 . ASN A 135 ? 1.7409 1.7763 1.8865 0.0471  -0.3473 0.1406  208 ASN A ND2 
1039 N N   . CYS A 136 ? 1.8238 1.6408 1.8074 0.0304  -0.4140 0.0616  209 CYS A N   
1040 C CA  . CYS A 136 ? 1.8415 1.5886 1.7941 0.0413  -0.4253 0.0442  209 CYS A CA  
1041 C C   . CYS A 136 ? 2.1492 1.8537 2.0801 0.0052  -0.4515 0.0606  209 CYS A C   
1042 O O   . CYS A 136 ? 2.2700 1.9651 2.1698 -0.0196 -0.4672 0.0551  209 CYS A O   
1043 C CB  . CYS A 136 ? 2.0893 1.8028 1.9954 0.0680  -0.4246 -0.0019 209 CYS A CB  
1044 S SG  . CYS A 136 ? 2.2849 1.9126 2.1570 0.0955  -0.4347 -0.0259 209 CYS A SG  
1045 N N   . THR A 137 ? 2.0588 1.7376 2.0013 0.0021  -0.4563 0.0775  210 THR A N   
1046 C CA  . THR A 137 ? 2.0131 1.6496 1.9347 -0.0339 -0.4815 0.0948  210 THR A CA  
1047 C C   . THR A 137 ? 1.9927 1.5570 1.8897 -0.0233 -0.4909 0.0870  210 THR A C   
1048 O O   . THR A 137 ? 1.8543 1.4309 1.7825 -0.0062 -0.4777 0.0993  210 THR A O   
1049 C CB  . THR A 137 ? 1.6823 1.3772 1.6555 -0.0615 -0.4800 0.1407  210 THR A CB  
1050 O OG1 . THR A 137 ? 1.5815 1.2889 1.5915 -0.0433 -0.4648 0.1559  210 THR A OG1 
1051 C CG2 . THR A 137 ? 1.4697 1.2390 1.4763 -0.0623 -0.4669 0.1514  210 THR A CG2 
1052 N N   . ASN A 138 ? 2.3556 1.8422 2.1948 -0.0358 -0.5149 0.0686  211 ASN A N   
1053 C CA  . ASN A 138 ? 2.5249 1.9309 2.3317 -0.0246 -0.5271 0.0591  211 ASN A CA  
1054 C C   . ASN A 138 ? 2.6012 1.9625 2.3862 -0.0720 -0.5546 0.0849  211 ASN A C   
1055 O O   . ASN A 138 ? 2.7961 2.1969 2.5962 -0.1118 -0.5626 0.1106  211 ASN A O   
1056 C CB  . ASN A 138 ? 2.8057 2.1460 2.5566 0.0079  -0.5326 0.0111  211 ASN A CB  
1057 C CG  . ASN A 138 ? 3.1702 2.4670 2.8661 -0.0177 -0.5544 -0.0073 211 ASN A CG  
1058 O OD1 . ASN A 138 ? 3.3059 2.6483 3.0129 -0.0516 -0.5578 0.0092  211 ASN A OD1 
1059 N ND2 . ASN A 138 ? 3.2742 2.4808 2.9084 -0.0009 -0.5701 -0.0419 211 ASN A ND2 
1060 N N   . TYR A 139 ? 2.7135 1.9922 2.4621 -0.0685 -0.5702 0.0791  212 TYR A N   
1061 C CA  . TYR A 139 ? 2.9387 2.1611 2.6559 -0.1150 -0.5991 0.1007  212 TYR A CA  
1062 C C   . TYR A 139 ? 3.2276 2.3535 2.8670 -0.1226 -0.6255 0.0676  212 TYR A C   
1063 O O   . TYR A 139 ? 3.2670 2.3785 2.8808 -0.0906 -0.6194 0.0282  212 TYR A O   
1064 C CB  . TYR A 139 ? 2.8998 2.0923 2.6254 -0.1128 -0.6012 0.1216  212 TYR A CB  
1065 C CG  . TYR A 139 ? 2.9335 2.2194 2.7295 -0.1247 -0.5818 0.1624  212 TYR A CG  
1066 C CD1 . TYR A 139 ? 3.0218 2.3773 2.8693 -0.0865 -0.5505 0.1603  212 TYR A CD1 
1067 C CD2 . TYR A 139 ? 2.8485 2.1548 2.6584 -0.1746 -0.5947 0.2024  212 TYR A CD2 
1068 C CE1 . TYR A 139 ? 2.9143 2.3502 2.8226 -0.0947 -0.5324 0.1947  212 TYR A CE1 
1069 C CE2 . TYR A 139 ? 2.7926 2.1875 2.6670 -0.1818 -0.5756 0.2376  212 TYR A CE2 
1070 C CZ  . TYR A 139 ? 2.8077 2.2641 2.7299 -0.1403 -0.5443 0.2326  212 TYR A CZ  
1071 O OH  . TYR A 139 ? 2.8717 2.4112 2.8547 -0.1448 -0.5249 0.2651  212 TYR A OH  
1072 N N   . PHE A 140 ? 3.3496 2.4096 2.9494 -0.1667 -0.6552 0.0836  213 PHE A N   
1073 C CA  . PHE A 140 ? 3.3273 2.3056 2.8545 -0.1915 -0.6838 0.0605  213 PHE A CA  
1074 C C   . PHE A 140 ? 3.1613 2.2047 2.6979 -0.2112 -0.6800 0.0572  213 PHE A C   
1075 O O   . PHE A 140 ? 3.3409 2.3359 2.8220 -0.2135 -0.6930 0.0246  213 PHE A O   
1076 C CB  . PHE A 140 ? 3.2338 2.1131 2.6998 -0.1459 -0.6899 0.0114  213 PHE A CB  
1077 C CG  . PHE A 140 ? 3.2221 1.9893 2.6033 -0.1730 -0.7242 -0.0096 213 PHE A CG  
1078 C CD1 . PHE A 140 ? 3.3386 2.0265 2.6829 -0.2152 -0.7542 0.0134  213 PHE A CD1 
1079 C CD2 . PHE A 140 ? 3.1420 1.8813 2.4769 -0.1577 -0.7267 -0.0529 213 PHE A CD2 
1080 C CE1 . PHE A 140 ? 3.4079 1.9850 2.6693 -0.2424 -0.7874 -0.0063 213 PHE A CE1 
1081 C CE2 . PHE A 140 ? 3.2184 1.8491 2.4706 -0.1822 -0.7584 -0.0746 213 PHE A CE2 
1082 C CZ  . PHE A 140 ? 3.3189 1.8650 2.5333 -0.2250 -0.7895 -0.0514 213 PHE A CZ  
1083 N N   . SER A 141 ? 2.8965 2.0493 2.5023 -0.2244 -0.6625 0.0910  214 SER A N   
1084 C CA  . SER A 141 ? 2.9906 2.2197 2.6176 -0.2436 -0.6578 0.0974  214 SER A CA  
1085 C C   . SER A 141 ? 3.3960 2.6688 3.0477 -0.3026 -0.6739 0.1443  214 SER A C   
1086 O O   . SER A 141 ? 3.5452 2.7807 3.1877 -0.3315 -0.6906 0.1673  214 SER A O   
1087 C CB  . SER A 141 ? 2.6098 1.9319 2.2983 -0.2032 -0.6229 0.0963  214 SER A CB  
1088 O OG  . SER A 141 ? 2.3797 1.7741 2.0883 -0.2224 -0.6197 0.1056  214 SER A OG  
1089 N N   . GLU A 142 ? 3.7111 3.0651 3.3931 -0.3215 -0.6700 0.1593  215 GLU A N   
1090 C CA  . GLU A 142 ? 3.9050 3.3190 3.6197 -0.3736 -0.6833 0.2053  215 GLU A CA  
1091 C C   . GLU A 142 ? 3.8252 3.2861 3.5996 -0.3721 -0.6705 0.2429  215 GLU A C   
1092 O O   . GLU A 142 ? 3.7723 3.2624 3.5865 -0.3279 -0.6430 0.2394  215 GLU A O   
1093 C CB  . GLU A 142 ? 3.9525 3.4593 3.7034 -0.3799 -0.6748 0.2165  215 GLU A CB  
1094 C CG  . GLU A 142 ? 3.9450 3.5211 3.7523 -0.3297 -0.6397 0.2130  215 GLU A CG  
1095 C CD  . GLU A 142 ? 3.9517 3.6149 3.7929 -0.3380 -0.6338 0.2280  215 GLU A CD  
1096 O OE1 . GLU A 142 ? 4.0348 3.7125 3.8607 -0.3827 -0.6567 0.2435  215 GLU A OE1 
1097 O OE2 . GLU A 142 ? 3.8603 3.5760 3.7417 -0.3011 -0.6075 0.2252  215 GLU A OE2 
1098 N N   . ASP A 143 ? 3.8079 3.2762 3.5859 -0.4225 -0.6908 0.2783  216 ASP A N   
1099 C CA  . ASP A 143 ? 3.6072 3.1296 3.4416 -0.4273 -0.6795 0.3167  216 ASP A CA  
1100 C C   . ASP A 143 ? 3.5823 3.2314 3.4955 -0.4238 -0.6599 0.3478  216 ASP A C   
1101 O O   . ASP A 143 ? 3.3826 3.0719 3.3057 -0.4152 -0.6549 0.3394  216 ASP A O   
1102 C CB  . ASP A 143 ? 3.4147 2.8982 3.2200 -0.4846 -0.7091 0.3428  216 ASP A CB  
1103 C CG  . ASP A 143 ? 3.1779 2.6871 3.0218 -0.4845 -0.6981 0.3728  216 ASP A CG  
1104 O OD1 . ASP A 143 ? 3.1902 2.7331 3.0759 -0.4367 -0.6681 0.3682  216 ASP A OD1 
1105 O OD2 . ASP A 143 ? 3.1838 2.6800 3.0139 -0.5344 -0.7196 0.4009  216 ASP A OD2 
1106 N N   . ASN A 144 ? 3.8592 3.5714 3.8281 -0.4288 -0.6482 0.3839  217 ASN A N   
1107 C CA  . ASN A 144 ? 4.0099 3.8412 4.0566 -0.4243 -0.6301 0.4172  217 ASN A CA  
1108 C C   . ASN A 144 ? 3.5325 3.4007 3.6169 -0.3665 -0.5975 0.4005  217 ASN A C   
1109 O O   . ASN A 144 ? 3.6777 3.6366 3.8264 -0.3542 -0.5796 0.4255  217 ASN A O   
1110 C CB  . ASN A 144 ? 4.6521 4.5377 4.7062 -0.4672 -0.6506 0.4392  217 ASN A CB  
1111 C CG  . ASN A 144 ? 5.1561 5.1011 5.2408 -0.4404 -0.6365 0.4335  217 ASN A CG  
1112 O OD1 . ASN A 144 ? 5.2381 5.1366 5.2848 -0.4191 -0.6348 0.3979  217 ASN A OD1 
1113 N ND2 . ASN A 144 ? 5.5381 5.5876 5.6912 -0.4414 -0.6268 0.4695  217 ASN A ND2 
1114 N N   . ILE A 145 ? 2.8675 2.6666 2.9124 -0.3307 -0.5898 0.3587  218 ILE A N   
1115 C CA  . ILE A 145 ? 2.4042 2.2353 2.4771 -0.2816 -0.5619 0.3409  218 ILE A CA  
1116 C C   . ILE A 145 ? 2.0039 1.8983 2.1411 -0.2556 -0.5346 0.3631  218 ILE A C   
1117 O O   . ILE A 145 ? 1.7675 1.6526 1.9128 -0.2605 -0.5325 0.3768  218 ILE A O   
1118 C CB  . ILE A 145 ? 2.2606 2.0100 2.2823 -0.2478 -0.5577 0.2942  218 ILE A CB  
1119 C CG1 . ILE A 145 ? 1.8658 1.5542 1.8695 -0.2360 -0.5567 0.2877  218 ILE A CG1 
1120 C CG2 . ILE A 145 ? 2.5459 2.2392 2.5047 -0.2685 -0.5815 0.2687  218 ILE A CG2 
1121 C CD1 . ILE A 145 ? 2.1090 1.7297 2.0743 -0.1939 -0.5488 0.2446  218 ILE A CD1 
1122 N N   . THR A 146 ? 1.9507 1.9079 2.1293 -0.2319 -0.5161 0.3673  219 THR A N   
1123 C CA  . THR A 146 ? 1.2739 1.2908 1.5121 -0.2042 -0.4891 0.3857  219 THR A CA  
1124 C C   . THR A 146 ? 1.2308 1.2438 1.4748 -0.1576 -0.4649 0.3593  219 THR A C   
1125 O O   . THR A 146 ? 1.2258 1.2451 1.4600 -0.1509 -0.4653 0.3456  219 THR A O   
1126 C CB  . THR A 146 ? 1.2375 1.3465 1.5321 -0.2196 -0.4884 0.4248  219 THR A CB  
1127 O OG1 . THR A 146 ? 1.5617 1.6967 1.8595 -0.2155 -0.4907 0.4208  219 THR A OG1 
1128 C CG2 . THR A 146 ? 1.2963 1.4166 1.5851 -0.2703 -0.5140 0.4520  219 THR A CG2 
1129 N N   . TRP A 147 ? 1.2182 1.2279 1.4807 -0.1294 -0.4439 0.3566  220 TRP A N   
1130 C CA  . TRP A 147 ? 1.2853 1.2844 1.5475 -0.0878 -0.4223 0.3298  220 TRP A CA  
1131 C C   . TRP A 147 ? 1.4265 1.4926 1.7356 -0.0705 -0.4045 0.3434  220 TRP A C   
1132 O O   . TRP A 147 ? 1.4379 1.5617 1.7920 -0.0770 -0.3999 0.3749  220 TRP A O   
1133 C CB  . TRP A 147 ? 1.4011 1.3734 1.6637 -0.0645 -0.4073 0.3213  220 TRP A CB  
1134 C CG  . TRP A 147 ? 1.5980 1.5333 1.8372 -0.0297 -0.3951 0.2855  220 TRP A CG  
1135 C CD1 . TRP A 147 ? 1.6290 1.5909 1.8932 0.0029  -0.3705 0.2777  220 TRP A CD1 
1136 C CD2 . TRP A 147 ? 1.7398 1.6070 1.9254 -0.0242 -0.4074 0.2526  220 TRP A CD2 
1137 N NE1 . TRP A 147 ? 1.6811 1.6021 1.9129 0.0262  -0.3668 0.2435  220 TRP A NE1 
1138 C CE2 . TRP A 147 ? 1.7445 1.6087 1.9294 0.0127  -0.3886 0.2270  220 TRP A CE2 
1139 C CE3 . TRP A 147 ? 1.8543 1.6614 1.9911 -0.0463 -0.4330 0.2417  220 TRP A CE3 
1140 C CZ2 . TRP A 147 ? 1.8764 1.6880 2.0179 0.0305  -0.3935 0.1916  220 TRP A CZ2 
1141 C CZ3 . TRP A 147 ? 1.9080 1.6546 1.9987 -0.0265 -0.4379 0.2049  220 TRP A CZ3 
1142 C CH2 . TRP A 147 ? 1.8977 1.6507 1.9931 0.0129  -0.4177 0.1804  220 TRP A CH2 
1143 N N   . THR A 148 ? 1.2564 1.3143 1.5533 -0.0481 -0.3951 0.3198  221 THR A N   
1144 C CA  . THR A 148 ? 1.1509 1.2603 1.4835 -0.0323 -0.3804 0.3305  221 THR A CA  
1145 C C   . THR A 148 ? 1.1878 1.2891 1.5272 0.0045  -0.3555 0.3119  221 THR A C   
1146 O O   . THR A 148 ? 1.3984 1.4554 1.7096 0.0173  -0.3520 0.2864  221 THR A O   
1147 C CB  . THR A 148 ? 1.4146 1.5291 1.7259 -0.0452 -0.3932 0.3233  221 THR A CB  
1148 O OG1 . THR A 148 ? 1.4689 1.5677 1.7533 -0.0809 -0.4193 0.3283  221 THR A OG1 
1149 C CG2 . THR A 148 ? 1.0311 1.2052 1.3837 -0.0414 -0.3869 0.3491  221 THR A CG2 
1150 N N   . LEU A 149 ? 0.9754 1.1182 1.3511 0.0211  -0.3394 0.3253  222 LEU A N   
1151 C CA  . LEU A 149 ? 1.2447 1.3822 1.6272 0.0525  -0.3163 0.3100  222 LEU A CA  
1152 C C   . LEU A 149 ? 1.4548 1.5608 1.7986 0.0617  -0.3152 0.2764  222 LEU A C   
1153 O O   . LEU A 149 ? 1.6636 1.7524 2.0003 0.0836  -0.3004 0.2568  222 LEU A O   
1154 C CB  . LEU A 149 ? 1.0775 1.2588 1.5000 0.0655  -0.3030 0.3309  222 LEU A CB  
1155 C CG  . LEU A 149 ? 0.8942 1.1118 1.3613 0.0710  -0.2942 0.3593  222 LEU A CG  
1156 C CD1 . LEU A 149 ? 0.8724 1.1268 1.3738 0.0862  -0.2843 0.3778  222 LEU A CD1 
1157 C CD2 . LEU A 149 ? 0.9179 1.1168 1.3857 0.0884  -0.2775 0.3485  222 LEU A CD2 
1158 N N   . HIS A 150 ? 1.1385 1.2415 1.4574 0.0444  -0.3307 0.2697  223 HIS A N   
1159 C CA  . HIS A 150 ? 1.2036 1.2865 1.4865 0.0522  -0.3290 0.2380  223 HIS A CA  
1160 C C   . HIS A 150 ? 1.7296 1.7651 1.9688 0.0471  -0.3426 0.2118  223 HIS A C   
1161 O O   . HIS A 150 ? 1.9999 2.0169 2.2086 0.0595  -0.3395 0.1813  223 HIS A O   
1162 C CB  . HIS A 150 ? 1.3667 1.4771 1.6450 0.0382  -0.3358 0.2444  223 HIS A CB  
1163 C CG  . HIS A 150 ? 1.4940 1.6430 1.8100 0.0454  -0.3244 0.2690  223 HIS A CG  
1164 N ND1 . HIS A 150 ? 1.4338 1.5856 1.7616 0.0684  -0.3041 0.2623  223 HIS A ND1 
1165 C CD2 . HIS A 150 ? 1.5056 1.6894 1.8486 0.0331  -0.3318 0.3004  223 HIS A CD2 
1166 C CE1 . HIS A 150 ? 1.5333 1.7136 1.8910 0.0706  -0.2994 0.2876  223 HIS A CE1 
1167 N NE2 . HIS A 150 ? 1.4691 1.6706 1.8381 0.0512  -0.3159 0.3114  223 HIS A NE2 
1168 N N   . SER A 151 ? 1.0628 1.0790 1.2981 0.0292  -0.3578 0.2238  224 SER A N   
1169 C CA  . SER A 151 ? 1.1159 1.0772 1.3058 0.0222  -0.3740 0.2011  224 SER A CA  
1170 C C   . SER A 151 ? 1.3917 1.3163 1.5679 0.0502  -0.3639 0.1773  224 SER A C   
1171 O O   . SER A 151 ? 1.4910 1.4295 1.6959 0.0663  -0.3481 0.1867  224 SER A O   
1172 C CB  . SER A 151 ? 1.1472 1.0959 1.3361 -0.0082 -0.3940 0.2239  224 SER A CB  
1173 O OG  . SER A 151 ? 2.0477 2.0262 2.2404 -0.0363 -0.4080 0.2417  224 SER A OG  
1174 N N   . THR A 152 ? 1.4550 1.3330 1.5860 0.0570  -0.3735 0.1459  225 THR A N   
1175 C CA  . THR A 152 ? 1.5010 1.3419 1.6155 0.0851  -0.3675 0.1222  225 THR A CA  
1176 C C   . THR A 152 ? 1.5659 1.3376 1.6335 0.0793  -0.3894 0.1055  225 THR A C   
1177 O O   . THR A 152 ? 1.6910 1.4428 1.7316 0.0553  -0.4079 0.1041  225 THR A O   
1178 C CB  . THR A 152 ? 1.6936 1.5524 1.8010 0.1129  -0.3518 0.0931  225 THR A CB  
1179 O OG1 . THR A 152 ? 2.0100 1.8711 2.0885 0.1038  -0.3599 0.0754  225 THR A OG1 
1180 C CG2 . THR A 152 ? 1.8097 1.7239 1.9594 0.1213  -0.3299 0.1084  225 THR A CG2 
1181 N N   . SER A 153 ? 1.3709 1.1033 1.4266 0.1011  -0.3885 0.0933  226 SER A N   
1182 C CA  . SER A 153 ? 1.5675 1.2242 1.5759 0.1001  -0.4100 0.0771  226 SER A CA  
1183 C C   . SER A 153 ? 1.6894 1.3197 1.6623 0.1320  -0.4090 0.0348  226 SER A C   
1184 O O   . SER A 153 ? 1.8751 1.5450 1.8655 0.1591  -0.3894 0.0208  226 SER A O   
1185 C CB  . SER A 153 ? 1.5682 1.1935 1.5823 0.1034  -0.4127 0.0925  226 SER A CB  
1186 O OG  . SER A 153 ? 1.8212 1.4678 1.8560 0.1367  -0.3930 0.0842  226 SER A OG  
1187 N N   . PRO A 154 ? 1.5223 1.0862 1.4439 0.1288  -0.4303 0.0138  227 PRO A N   
1188 C CA  . PRO A 154 ? 1.5354 1.0734 1.4203 0.1617  -0.4301 -0.0291 227 PRO A CA  
1189 C C   . PRO A 154 ? 1.6206 1.1538 1.5129 0.2041  -0.4186 -0.0447 227 PRO A C   
1190 O O   . PRO A 154 ? 1.5706 1.1238 1.4557 0.2355  -0.4076 -0.0752 227 PRO A O   
1191 C CB  . PRO A 154 ? 1.6824 1.1342 1.5099 0.1477  -0.4584 -0.0422 227 PRO A CB  
1192 C CG  . PRO A 154 ? 1.8339 1.2590 1.6700 0.1138  -0.4729 -0.0053 227 PRO A CG  
1193 C CD  . PRO A 154 ? 1.5749 1.0835 1.4683 0.0937  -0.4562 0.0287  227 PRO A CD  
1194 N N   . ALA A 155 ? 1.8130 1.3244 1.7195 0.2039  -0.4213 -0.0233 228 ALA A N   
1195 C CA  . ALA A 155 ? 1.5708 1.0822 1.4872 0.2411  -0.4114 -0.0333 228 ALA A CA  
1196 C C   . ALA A 155 ? 1.5687 1.1650 1.5324 0.2521  -0.3837 -0.0279 228 ALA A C   
1197 O O   . ALA A 155 ? 2.0335 1.6537 2.0007 0.2852  -0.3716 -0.0507 228 ALA A O   
1198 C CB  . ALA A 155 ? 1.4933 0.9593 1.4092 0.2329  -0.4227 -0.0091 228 ALA A CB  
1199 N N   . GLU A 156 ? 1.4445 1.0857 1.4435 0.2239  -0.3747 0.0025  229 GLU A N   
1200 C CA  . GLU A 156 ? 1.4289 1.1434 1.4694 0.2293  -0.3503 0.0102  229 GLU A CA  
1201 C C   . GLU A 156 ? 1.3638 1.1165 1.3977 0.2381  -0.3414 -0.0142 229 GLU A C   
1202 O O   . GLU A 156 ? 1.4443 1.2438 1.4964 0.2561  -0.3234 -0.0237 229 GLU A O   
1203 C CB  . GLU A 156 ? 1.9121 1.6596 1.9874 0.1984  -0.3452 0.0470  229 GLU A CB  
1204 C CG  . GLU A 156 ? 2.0868 1.9010 2.2013 0.2022  -0.3218 0.0563  229 GLU A CG  
1205 C CD  . GLU A 156 ? 2.0546 1.8988 2.2023 0.1760  -0.3180 0.0913  229 GLU A CD  
1206 O OE1 . GLU A 156 ? 1.8274 1.6479 1.9709 0.1537  -0.3328 0.1097  229 GLU A OE1 
1207 O OE2 . GLU A 156 ? 2.1053 1.9968 2.2827 0.1778  -0.3008 0.1008  229 GLU A OE2 
1208 N N   . GLU A 157 ? 1.3047 1.0405 1.3113 0.2224  -0.3541 -0.0233 230 GLU A N   
1209 C CA  . GLU A 157 ? 1.4530 1.2243 1.4479 0.2306  -0.3461 -0.0483 230 GLU A CA  
1210 C C   . GLU A 157 ? 1.4673 1.2270 1.4399 0.2699  -0.3431 -0.0853 230 GLU A C   
1211 O O   . GLU A 157 ? 1.4388 1.2512 1.4218 0.2865  -0.3266 -0.1010 230 GLU A O   
1212 C CB  . GLU A 157 ? 1.6731 1.4268 1.6388 0.2045  -0.3613 -0.0515 230 GLU A CB  
1213 C CG  . GLU A 157 ? 1.6814 1.4516 1.6703 0.1661  -0.3665 -0.0139 230 GLU A CG  
1214 C CD  . GLU A 157 ? 1.7653 1.5892 1.7618 0.1486  -0.3599 -0.0099 230 GLU A CD  
1215 O OE1 . GLU A 157 ? 1.9380 1.7530 1.8985 0.1442  -0.3678 -0.0323 230 GLU A OE1 
1216 O OE2 . GLU A 157 ? 1.6462 1.5186 1.6819 0.1397  -0.3474 0.0155  230 GLU A OE2 
1217 N N   . PHE A 158 ? 1.5007 1.1919 1.4425 0.2847  -0.3598 -0.0980 231 PHE A N   
1218 C CA  . PHE A 158 ? 1.6860 1.3615 1.6046 0.3264  -0.3596 -0.1342 231 PHE A CA  
1219 C C   . PHE A 158 ? 1.5624 1.2856 1.5144 0.3527  -0.3415 -0.1341 231 PHE A C   
1220 O O   . PHE A 158 ? 1.6915 1.4547 1.6430 0.3802  -0.3301 -0.1605 231 PHE A O   
1221 C CB  . PHE A 158 ? 1.9672 1.5502 1.8463 0.3373  -0.3834 -0.1432 231 PHE A CB  
1222 C CG  . PHE A 158 ? 1.8729 1.4332 1.7259 0.3847  -0.3855 -0.1811 231 PHE A CG  
1223 C CD1 . PHE A 158 ? 1.9792 1.5415 1.8004 0.4009  -0.3856 -0.2173 231 PHE A CD1 
1224 C CD2 . PHE A 158 ? 1.9222 1.4615 1.7822 0.4143  -0.3876 -0.1806 231 PHE A CD2 
1225 C CE1 . PHE A 158 ? 2.0133 1.5592 1.8124 0.4488  -0.3867 -0.2534 231 PHE A CE1 
1226 C CE2 . PHE A 158 ? 1.9806 1.5021 1.8190 0.4614  -0.3906 -0.2146 231 PHE A CE2 
1227 C CZ  . PHE A 158 ? 2.0414 1.5670 1.8504 0.4801  -0.3897 -0.2516 231 PHE A CZ  
1228 N N   . TYR A 159 ? 1.5853 1.3077 1.5653 0.3430  -0.3389 -0.1046 232 TYR A N   
1229 C CA  . TYR A 159 ? 1.4943 1.2603 1.5043 0.3633  -0.3227 -0.1023 232 TYR A CA  
1230 C C   . TYR A 159 ? 1.4584 1.3040 1.4977 0.3527  -0.3011 -0.0986 232 TYR A C   
1231 O O   . TYR A 159 ? 1.7920 1.6849 1.8416 0.3737  -0.2877 -0.1146 232 TYR A O   
1232 C CB  . TYR A 159 ? 1.6900 1.4329 1.7184 0.3532  -0.3252 -0.0719 232 TYR A CB  
1233 C CG  . TYR A 159 ? 1.7808 1.5614 1.8346 0.3735  -0.3108 -0.0703 232 TYR A CG  
1234 C CD1 . TYR A 159 ? 1.4973 1.3040 1.5469 0.4078  -0.3054 -0.0982 232 TYR A CD1 
1235 C CD2 . TYR A 159 ? 1.8191 1.6129 1.9005 0.3581  -0.3025 -0.0416 232 TYR A CD2 
1236 C CE1 . TYR A 159 ? 1.4815 1.3258 1.5535 0.4234  -0.2937 -0.0958 232 TYR A CE1 
1237 C CE2 . TYR A 159 ? 1.4652 1.2914 1.5657 0.3742  -0.2900 -0.0409 232 TYR A CE2 
1238 C CZ  . TYR A 159 ? 1.4654 1.3166 1.5611 0.4054  -0.2865 -0.0674 232 TYR A CZ  
1239 O OH  . TYR A 159 ? 2.0015 1.8879 2.1155 0.4186  -0.2756 -0.0659 232 TYR A OH  
1240 N N   . THR A 160 ? 1.4632 1.3233 1.5149 0.3191  -0.2990 -0.0763 233 THR A N   
1241 C CA  . THR A 160 ? 1.4010 1.3265 1.4798 0.3049  -0.2808 -0.0661 233 THR A CA  
1242 C C   . THR A 160 ? 1.5967 1.5645 1.6616 0.3099  -0.2740 -0.0915 233 THR A C   
1243 O O   . THR A 160 ? 1.3963 1.4190 1.4763 0.3167  -0.2581 -0.0977 233 THR A O   
1244 C CB  . THR A 160 ? 1.5004 1.4272 1.5961 0.2698  -0.2828 -0.0336 233 THR A CB  
1245 O OG1 . THR A 160 ? 1.6481 1.5475 1.7601 0.2645  -0.2859 -0.0092 233 THR A OG1 
1246 C CG2 . THR A 160 ? 1.6717 1.6579 1.7921 0.2568  -0.2659 -0.0223 233 THR A CG2 
1247 N N   . ARG A 161 ? 1.7219 1.6652 1.7556 0.3045  -0.2862 -0.1062 234 ARG A N   
1248 C CA  . ARG A 161 ? 1.1743 1.1612 1.1934 0.3012  -0.2795 -0.1260 234 ARG A CA  
1249 C C   . ARG A 161 ? 1.4500 1.4354 1.4392 0.3347  -0.2805 -0.1671 234 ARG A C   
1250 O O   . ARG A 161 ? 1.2243 1.2573 1.2029 0.3362  -0.2714 -0.1866 234 ARG A O   
1251 C CB  . ARG A 161 ? 1.2358 1.2078 1.2395 0.2685  -0.2907 -0.1142 234 ARG A CB  
1252 C CG  . ARG A 161 ? 1.3810 1.3662 1.4164 0.2373  -0.2889 -0.0740 234 ARG A CG  
1253 C CD  . ARG A 161 ? 1.4335 1.4142 1.4545 0.2057  -0.3006 -0.0627 234 ARG A CD  
1254 N NE  . ARG A 161 ? 1.2994 1.3206 1.3003 0.2015  -0.2950 -0.0822 234 ARG A NE  
1255 C CZ  . ARG A 161 ? 1.2790 1.3564 1.2971 0.1872  -0.2825 -0.0699 234 ARG A CZ  
1256 N NH1 . ARG A 161 ? 1.6557 1.7699 1.6514 0.1814  -0.2783 -0.0879 234 ARG A NH1 
1257 N NH2 . ARG A 161 ? 1.4224 1.5175 1.4776 0.1783  -0.2745 -0.0398 234 ARG A NH2 
1258 N N   . HIS A 162 ? 1.2597 1.1920 1.2344 0.3623  -0.2914 -0.1801 235 HIS A N   
1259 C CA  . HIS A 162 ? 1.3201 1.2455 1.2657 0.3995  -0.2937 -0.2202 235 HIS A CA  
1260 C C   . HIS A 162 ? 1.4943 1.4518 1.4595 0.4359  -0.2837 -0.2316 235 HIS A C   
1261 O O   . HIS A 162 ? 1.6053 1.6345 1.5812 0.4481  -0.2676 -0.2476 235 HIS A O   
1262 C CB  . HIS A 162 ? 1.5029 1.3369 1.4084 0.4080  -0.3168 -0.2319 235 HIS A CB  
1263 C CG  . HIS A 162 ? 1.5009 1.3195 1.3710 0.4480  -0.3204 -0.2755 235 HIS A CG  
1264 N ND1 . HIS A 162 ? 1.5497 1.4089 1.3995 0.4511  -0.3121 -0.3033 235 HIS A ND1 
1265 C CD2 . HIS A 162 ? 1.5924 1.3598 1.4430 0.4883  -0.3312 -0.2963 235 HIS A CD2 
1266 C CE1 . HIS A 162 ? 1.8658 1.7013 1.6858 0.4935  -0.3165 -0.3413 235 HIS A CE1 
1267 N NE2 . HIS A 162 ? 1.8445 1.6221 1.6646 0.5178  -0.3288 -0.3376 235 HIS A NE2 
1268 N N   . VAL A 163 ? 1.3214 1.2288 1.2904 0.4511  -0.2939 -0.2221 236 VAL A N   
1269 C CA  . VAL A 163 ? 1.4419 1.3733 1.4262 0.4873  -0.2883 -0.2325 236 VAL A CA  
1270 C C   . VAL A 163 ? 1.2197 1.2275 1.2448 0.4739  -0.2685 -0.2146 236 VAL A C   
1271 O O   . VAL A 163 ? 1.5238 1.5993 1.5600 0.4913  -0.2552 -0.2318 236 VAL A O   
1272 C CB  . VAL A 163 ? 1.5028 1.3573 1.4782 0.5030  -0.3062 -0.2229 236 VAL A CB  
1273 C CG1 . VAL A 163 ? 1.2924 1.1245 1.2877 0.4673  -0.3083 -0.1828 236 VAL A CG1 
1274 C CG2 . VAL A 163 ? 1.9834 1.8623 1.9707 0.5443  -0.3031 -0.2361 236 VAL A CG2 
1275 N N   . LEU A 164 ? 1.1789 1.1768 1.2248 0.4428  -0.2668 -0.1805 237 LEU A N   
1276 C CA  . LEU A 164 ? 1.1196 1.1781 1.1993 0.4286  -0.2493 -0.1632 237 LEU A CA  
1277 C C   . LEU A 164 ? 1.3155 1.4348 1.4000 0.4062  -0.2358 -0.1655 237 LEU A C   
1278 O O   . LEU A 164 ? 1.1810 1.3651 1.2822 0.4063  -0.2211 -0.1687 237 LEU A O   
1279 C CB  . LEU A 164 ? 1.0863 1.1137 1.1842 0.4043  -0.2509 -0.1281 237 LEU A CB  
1280 C CG  . LEU A 164 ? 1.4715 1.5467 1.6004 0.3917  -0.2343 -0.1102 237 LEU A CG  
1281 C CD1 . LEU A 164 ? 1.6037 1.7125 1.7399 0.4198  -0.2290 -0.1251 237 LEU A CD1 
1282 C CD2 . LEU A 164 ? 1.5596 1.5992 1.7027 0.3721  -0.2362 -0.0786 237 LEU A CD2 
1283 N N   . GLN A 165 ? 1.3687 1.4663 1.4362 0.3851  -0.2423 -0.1626 238 GLN A N   
1284 C CA  . GLN A 165 ? 1.3825 1.5305 1.4497 0.3606  -0.2326 -0.1620 238 GLN A CA  
1285 C C   . GLN A 165 ? 1.3244 1.5127 1.4221 0.3364  -0.2191 -0.1352 238 GLN A C   
1286 O O   . GLN A 165 ? 1.2860 1.5359 1.3903 0.3299  -0.2059 -0.1405 238 GLN A O   
1287 C CB  . GLN A 165 ? 1.5056 1.7057 1.5573 0.3816  -0.2249 -0.1967 238 GLN A CB  
1288 C CG  . GLN A 165 ? 2.0085 2.2436 2.0444 0.3577  -0.2206 -0.2020 238 GLN A CG  
1289 C CD  . GLN A 165 ? 1.9499 2.2334 1.9661 0.3815  -0.2135 -0.2397 238 GLN A CD  
1290 O OE1 . GLN A 165 ? 1.7235 2.0171 1.7406 0.4186  -0.2117 -0.2622 238 GLN A OE1 
1291 N NE2 . GLN A 165 ? 1.6779 1.9947 1.6761 0.3611  -0.2094 -0.2466 238 GLN A NE2 
1292 N N   . ILE A 166 ? 1.3185 1.4702 1.4328 0.3226  -0.2226 -0.1067 239 ILE A N   
1293 C CA  . ILE A 166 ? 1.2363 1.4130 1.3777 0.3053  -0.2106 -0.0825 239 ILE A CA  
1294 C C   . ILE A 166 ? 1.3019 1.4946 1.4473 0.2728  -0.2079 -0.0630 239 ILE A C   
1295 O O   . ILE A 166 ? 1.7513 1.9663 1.9144 0.2572  -0.1979 -0.0449 239 ILE A O   
1296 C CB  . ILE A 166 ? 1.1498 1.2835 1.3066 0.3082  -0.2142 -0.0623 239 ILE A CB  
1297 C CG1 . ILE A 166 ? 1.0655 1.2271 1.2454 0.3024  -0.2000 -0.0484 239 ILE A CG1 
1298 C CG2 . ILE A 166 ? 1.3791 1.4724 1.5376 0.2875  -0.2240 -0.0388 239 ILE A CG2 
1299 C CD1 . ILE A 166 ? 1.2924 1.4179 1.4850 0.3074  -0.2014 -0.0318 239 ILE A CD1 
1300 N N   . HIS A 167 ? 1.1914 1.3699 1.3178 0.2628  -0.2180 -0.0666 240 HIS A N   
1301 C CA  . HIS A 167 ? 1.0315 1.2244 1.1594 0.2323  -0.2184 -0.0471 240 HIS A CA  
1302 C C   . HIS A 167 ? 1.0335 1.2858 1.1546 0.2225  -0.2074 -0.0571 240 HIS A C   
1303 O O   . HIS A 167 ? 1.1176 1.3878 1.2411 0.1964  -0.2060 -0.0385 240 HIS A O   
1304 C CB  . HIS A 167 ? 1.2696 1.4297 1.3767 0.2223  -0.2345 -0.0478 240 HIS A CB  
1305 C CG  . HIS A 167 ? 1.1107 1.2806 1.1849 0.2335  -0.2379 -0.0813 240 HIS A CG  
1306 N ND1 . HIS A 167 ? 1.1759 1.3158 1.2319 0.2623  -0.2440 -0.1081 240 HIS A ND1 
1307 C CD2 . HIS A 167 ? 1.1450 1.3509 1.1991 0.2208  -0.2358 -0.0930 240 HIS A CD2 
1308 C CE1 . HIS A 167 ? 1.4914 1.6480 1.5182 0.2695  -0.2448 -0.1368 240 HIS A CE1 
1309 N NE2 . HIS A 167 ? 1.2705 1.4698 1.2954 0.2435  -0.2392 -0.1285 240 HIS A NE2 
1310 N N   . ARG A 168 ? 1.1355 1.4201 1.2481 0.2433  -0.2002 -0.0852 241 ARG A N   
1311 C CA  . ARG A 168 ? 1.1969 1.5460 1.3016 0.2338  -0.1891 -0.0968 241 ARG A CA  
1312 C C   . ARG A 168 ? 1.2464 1.6282 1.3722 0.2251  -0.1764 -0.0835 241 ARG A C   
1313 O O   . ARG A 168 ? 1.4480 1.8863 1.5697 0.2137  -0.1666 -0.0898 241 ARG A O   
1314 C CB  . ARG A 168 ? 1.2365 1.6131 1.3221 0.2615  -0.1870 -0.1350 241 ARG A CB  
1315 C CG  . ARG A 168 ? 1.4099 1.8495 1.4773 0.2485  -0.1792 -0.1500 241 ARG A CG  
1316 C CD  . ARG A 168 ? 1.3983 1.8497 1.4412 0.2785  -0.1803 -0.1891 241 ARG A CD  
1317 N NE  . ARG A 168 ? 1.6312 2.1455 1.6540 0.2651  -0.1721 -0.2044 241 ARG A NE  
1318 C CZ  . ARG A 168 ? 2.0327 2.5613 2.0280 0.2853  -0.1722 -0.2384 241 ARG A CZ  
1319 N NH1 . ARG A 168 ? 1.8414 2.3187 1.8250 0.3203  -0.1817 -0.2604 241 ARG A NH1 
1320 N NH2 . ARG A 168 ? 2.4964 3.0884 2.4735 0.2701  -0.1631 -0.2507 241 ARG A NH2 
1321 N N   . SER A 169 ? 1.1821 1.5281 1.3282 0.2285  -0.1767 -0.0651 242 SER A N   
1322 C CA  . SER A 169 ? 1.0996 1.4653 1.2623 0.2196  -0.1659 -0.0524 242 SER A CA  
1323 C C   . SER A 169 ? 1.0402 1.3681 1.2175 0.2011  -0.1672 -0.0198 242 SER A C   
1324 O O   . SER A 169 ? 1.3344 1.6178 1.5179 0.2054  -0.1757 -0.0081 242 SER A O   
1325 C CB  . SER A 169 ? 1.1771 1.5431 1.3493 0.2464  -0.1626 -0.0659 242 SER A CB  
1326 O OG  . SER A 169 ? 1.1980 1.5071 1.3769 0.2614  -0.1710 -0.0587 242 SER A OG  
1327 N N   . LYS A 170 ? 1.1700 1.5163 1.3521 0.1807  -0.1592 -0.0052 243 LYS A N   
1328 C CA  . LYS A 170 ? 1.3106 1.6218 1.5057 0.1665  -0.1595 0.0244  243 LYS A CA  
1329 C C   . LYS A 170 ? 1.3133 1.6018 1.5234 0.1783  -0.1529 0.0292  243 LYS A C   
1330 O O   . LYS A 170 ? 1.0829 1.3418 1.3042 0.1715  -0.1509 0.0508  243 LYS A O   
1331 C CB  . LYS A 170 ? 1.6030 1.9351 1.7902 0.1372  -0.1564 0.0394  243 LYS A CB  
1332 C CG  . LYS A 170 ? 1.9676 2.3210 2.1383 0.1212  -0.1635 0.0393  243 LYS A CG  
1333 C CD  . LYS A 170 ? 2.0309 2.3980 2.1927 0.0902  -0.1624 0.0593  243 LYS A CD  
1334 C CE  . LYS A 170 ? 1.8905 2.2972 2.0437 0.0789  -0.1520 0.0497  243 LYS A CE  
1335 N NZ  . LYS A 170 ? 1.8256 2.2396 1.9655 0.0450  -0.1527 0.0710  243 LYS A NZ  
1336 N N   . GLY A 171 ? 1.3787 1.6824 1.5883 0.1973  -0.1496 0.0086  244 GLY A N   
1337 C CA  . GLY A 171 ? 1.4344 1.7204 1.6548 0.2081  -0.1440 0.0111  244 GLY A CA  
1338 C C   . GLY A 171 ? 1.4611 1.7885 1.6772 0.2108  -0.1367 -0.0056 244 GLY A C   
1339 O O   . GLY A 171 ? 1.7617 2.1325 1.9696 0.2164  -0.1372 -0.0253 244 GLY A O   
1340 N N   . LEU A 172 ? 1.2169 1.5336 1.4379 0.2069  -0.1300 0.0018  245 LEU A N   
1341 C CA  . LEU A 172 ? 0.8824 1.2392 1.0996 0.2056  -0.1240 -0.0114 245 LEU A CA  
1342 C C   . LEU A 172 ? 1.1977 1.6004 1.4038 0.1790  -0.1199 -0.0126 245 LEU A C   
1343 O O   . LEU A 172 ? 1.7945 2.2509 1.9970 0.1777  -0.1167 -0.0278 245 LEU A O   
1344 C CB  . LEU A 172 ? 0.8009 1.1297 1.0216 0.2036  -0.1183 -0.0021 245 LEU A CB  
1345 C CG  . LEU A 172 ? 0.7959 1.0888 1.0257 0.2276  -0.1210 -0.0014 245 LEU A CG  
1346 C CD1 . LEU A 172 ? 0.7956 1.0687 1.0244 0.2222  -0.1136 0.0057  245 LEU A CD1 
1347 C CD2 . LEU A 172 ? 0.7965 1.1147 1.0270 0.2526  -0.1273 -0.0212 245 LEU A CD2 
1348 N N   . GLN A 173 ? 1.4508 1.8346 1.6515 0.1570  -0.1207 0.0048  246 GLN A N   
1349 C CA  . GLN A 173 ? 1.5914 2.0121 1.7780 0.1269  -0.1183 0.0082  246 GLN A CA  
1350 C C   . GLN A 173 ? 1.9442 2.4242 2.1239 0.1281  -0.1195 -0.0097 246 GLN A C   
1351 O O   . GLN A 173 ? 2.3606 2.8996 2.5342 0.1183  -0.1146 -0.0218 246 GLN A O   
1352 C CB  . GLN A 173 ? 1.6702 2.0518 1.8517 0.1060  -0.1215 0.0330  246 GLN A CB  
1353 C CG  . GLN A 173 ? 2.0465 2.3692 2.2331 0.1049  -0.1193 0.0514  246 GLN A CG  
1354 C CD  . GLN A 173 ? 2.0885 2.3695 2.2929 0.1317  -0.1218 0.0557  246 GLN A CD  
1355 O OE1 . GLN A 173 ? 1.9138 2.2028 2.1247 0.1482  -0.1272 0.0470  246 GLN A OE1 
1356 N NE2 . GLN A 173 ? 2.1143 2.3503 2.3247 0.1352  -0.1180 0.0687  246 GLN A NE2 
1357 N N   . ASP A 174 ? 1.8323 2.2987 2.0118 0.1395  -0.1258 -0.0117 247 ASP A N   
1358 C CA  . ASP A 174 ? 1.8091 2.3247 1.9796 0.1462  -0.1269 -0.0323 247 ASP A CA  
1359 C C   . ASP A 174 ? 1.8467 2.3441 2.0228 0.1828  -0.1326 -0.0504 247 ASP A C   
1360 O O   . ASP A 174 ? 2.1238 2.5729 2.3012 0.1896  -0.1405 -0.0423 247 ASP A O   
1361 C CB  . ASP A 174 ? 1.9202 2.4373 2.0770 0.1223  -0.1309 -0.0204 247 ASP A CB  
1362 C CG  . ASP A 174 ? 2.1375 2.7071 2.2808 0.1278  -0.1307 -0.0434 247 ASP A CG  
1363 O OD1 . ASP A 174 ? 2.2553 2.8888 2.3894 0.1121  -0.1236 -0.0520 247 ASP A OD1 
1364 O OD2 . ASP A 174 ? 2.2264 2.7739 2.3666 0.1468  -0.1376 -0.0532 247 ASP A OD2 
1365 N N   . LEU A 175 ? 1.4626 1.9986 1.6415 0.2057  -0.1297 -0.0739 248 LEU A N   
1366 C CA  . LEU A 175 ? 1.2337 1.7467 1.4149 0.2425  -0.1366 -0.0913 248 LEU A CA  
1367 C C   . LEU A 175 ? 1.4475 2.0141 1.6190 0.2625  -0.1356 -0.1213 248 LEU A C   
1368 O O   . LEU A 175 ? 1.4008 1.9423 1.5662 0.2908  -0.1432 -0.1374 248 LEU A O   
1369 C CB  . LEU A 175 ? 1.1057 1.5994 1.3006 0.2610  -0.1366 -0.0904 248 LEU A CB  
1370 C CG  . LEU A 175 ? 0.8289 1.3725 1.0305 0.2530  -0.1281 -0.0926 248 LEU A CG  
1371 C CD1 . LEU A 175 ? 1.4297 2.0407 1.6322 0.2759  -0.1262 -0.1197 248 LEU A CD1 
1372 C CD2 . LEU A 175 ? 0.8172 1.3204 1.0288 0.2581  -0.1286 -0.0804 248 LEU A CD2 
1373 N N   . GLY A 176 ? 1.7214 2.3609 1.8901 0.2480  -0.1264 -0.1292 249 GLY A N   
1374 C CA  . GLY A 176 ? 1.6005 2.3024 1.7616 0.2678  -0.1229 -0.1587 249 GLY A CA  
1375 C C   . GLY A 176 ? 1.4298 2.1102 1.5715 0.2622  -0.1276 -0.1622 249 GLY A C   
1376 O O   . GLY A 176 ? 1.4995 2.1411 1.6370 0.2345  -0.1312 -0.1386 249 GLY A O   
1377 N N   . GLY A 177 ? 1.5353 2.2351 1.6644 0.2897  -0.1288 -0.1911 250 GLY A N   
1378 C CA  . GLY A 177 ? 1.5378 2.2956 1.6718 0.3242  -0.1235 -0.2206 250 GLY A CA  
1379 C C   . GLY A 177 ? 1.2499 1.9608 1.3910 0.3677  -0.1328 -0.2325 250 GLY A C   
1380 O O   . GLY A 177 ? 1.2163 1.8562 1.3634 0.3669  -0.1415 -0.2140 250 GLY A O   
1381 N N   . ILE A 178 ? 1.1542 1.9085 1.2944 0.4061  -0.1308 -0.2631 251 ILE A N   
1382 C CA  . ILE A 178 ? 1.1089 1.8243 1.2538 0.4513  -0.1407 -0.2762 251 ILE A CA  
1383 C C   . ILE A 178 ? 1.4552 2.1228 1.5751 0.4829  -0.1503 -0.3009 251 ILE A C   
1384 O O   . ILE A 178 ? 1.6407 2.3474 1.7437 0.4871  -0.1444 -0.3229 251 ILE A O   
1385 C CB  . ILE A 178 ? 1.1617 1.9600 1.3245 0.4787  -0.1337 -0.2941 251 ILE A CB  
1386 C CG1 . ILE A 178 ? 1.3133 2.1791 1.4946 0.4405  -0.1222 -0.2747 251 ILE A CG1 
1387 C CG2 . ILE A 178 ? 1.0069 1.7598 1.1782 0.5191  -0.1458 -0.2979 251 ILE A CG2 
1388 C CD1 . ILE A 178 ? 1.0596 1.9942 1.2634 0.4616  -0.1188 -0.2827 251 ILE A CD1 
1389 N N   . SER A 179 ? 1.0673 1.6481 1.1815 0.5034  -0.1654 -0.2971 252 SER A N   
1390 C CA  . SER A 179 ? 1.1658 1.6875 1.2514 0.5325  -0.1774 -0.3200 252 SER A CA  
1391 C C   . SER A 179 ? 1.4846 2.0288 1.5697 0.5879  -0.1798 -0.3514 252 SER A C   
1392 O O   . SER A 179 ? 1.5208 2.0649 1.6249 0.6086  -0.1839 -0.3456 252 SER A O   
1393 C CB  . SER A 179 ? 1.2409 1.6554 1.3172 0.5244  -0.1944 -0.2993 252 SER A CB  
1394 O OG  . SER A 179 ? 1.9384 2.3362 2.0177 0.4772  -0.1924 -0.2704 252 SER A OG  
1395 N N   . TRP A 180 ? 1.4091 1.9727 1.4715 0.6130  -0.1775 -0.3851 253 TRP A N   
1396 C CA  . TRP A 180 ? 1.4753 2.0702 1.5373 0.6701  -0.1780 -0.4184 253 TRP A CA  
1397 C C   . TRP A 180 ? 1.9873 2.4782 2.0296 0.7096  -0.1993 -0.4271 253 TRP A C   
1398 O O   . TRP A 180 ? 2.4726 2.9731 2.5223 0.7574  -0.2043 -0.4432 253 TRP A O   
1399 C CB  . TRP A 180 ? 1.6032 2.2628 1.6466 0.6841  -0.1656 -0.4536 253 TRP A CB  
1400 C CG  . TRP A 180 ? 1.6661 2.2614 1.6695 0.6691  -0.1718 -0.4630 253 TRP A CG  
1401 C CD1 . TRP A 180 ? 1.8329 2.4366 1.8265 0.6181  -0.1658 -0.4471 253 TRP A CD1 
1402 C CD2 . TRP A 180 ? 1.7075 2.2185 1.6727 0.7043  -0.1865 -0.4900 253 TRP A CD2 
1403 N NE1 . TRP A 180 ? 2.1150 2.6500 2.0681 0.6182  -0.1759 -0.4622 253 TRP A NE1 
1404 C CE2 . TRP A 180 ? 1.8883 2.3633 1.8218 0.6697  -0.1885 -0.4894 253 TRP A CE2 
1405 C CE3 . TRP A 180 ? 1.9420 2.4008 1.8944 0.7614  -0.1996 -0.5140 253 TRP A CE3 
1406 C CZ2 . TRP A 180 ? 2.0421 2.4315 1.9304 0.6877  -0.2028 -0.5130 253 TRP A CZ2 
1407 C CZ3 . TRP A 180 ? 1.9330 2.3012 1.8393 0.7808  -0.2140 -0.5375 253 TRP A CZ3 
1408 C CH2 . TRP A 180 ? 1.9229 2.2574 1.7970 0.7428  -0.2153 -0.5374 253 TRP A CH2 
1409 N N   . GLN A 181 ? 1.8210 2.2134 1.8378 0.6886  -0.2131 -0.4149 254 GLN A N   
1410 C CA  . GLN A 181 ? 1.7791 2.0634 1.7715 0.7180  -0.2354 -0.4199 254 GLN A CA  
1411 C C   . GLN A 181 ? 1.6218 1.8838 1.6385 0.7296  -0.2443 -0.3974 254 GLN A C   
1412 O O   . GLN A 181 ? 1.9382 2.1770 1.9505 0.7772  -0.2552 -0.4125 254 GLN A O   
1413 C CB  . GLN A 181 ? 2.0907 2.2829 2.0542 0.6824  -0.2481 -0.4052 254 GLN A CB  
1414 C CG  . GLN A 181 ? 2.1480 2.3499 2.0811 0.6690  -0.2429 -0.4268 254 GLN A CG  
1415 C CD  . GLN A 181 ? 2.1647 2.4430 2.1163 0.6206  -0.2251 -0.4087 254 GLN A CD  
1416 O OE1 . GLN A 181 ? 2.2970 2.6386 2.2848 0.6049  -0.2131 -0.3884 254 GLN A OE1 
1417 N NE2 . GLN A 181 ? 2.2525 2.5216 2.1766 0.5956  -0.2247 -0.4155 254 GLN A NE2 
1418 N N   . LEU A 182 ? 1.6470 1.9158 1.6876 0.6868  -0.2398 -0.3613 255 LEU A N   
1419 C CA  . LEU A 182 ? 1.6188 1.8707 1.6811 0.6907  -0.2464 -0.3376 255 LEU A CA  
1420 C C   . LEU A 182 ? 1.4262 1.7682 1.5160 0.7206  -0.2371 -0.3490 255 LEU A C   
1421 O O   . LEU A 182 ? 1.3612 1.6903 1.4631 0.7410  -0.2460 -0.3396 255 LEU A O   
1422 C CB  . LEU A 182 ? 1.4633 1.7087 1.5436 0.6380  -0.2409 -0.2995 255 LEU A CB  
1423 C CG  . LEU A 182 ? 1.3144 1.4646 1.3757 0.6102  -0.2541 -0.2785 255 LEU A CG  
1424 C CD1 . LEU A 182 ? 1.4357 1.4966 1.4761 0.6393  -0.2762 -0.2800 255 LEU A CD1 
1425 C CD2 . LEU A 182 ? 1.4490 1.5878 1.4873 0.5903  -0.2527 -0.2887 255 LEU A CD2 
1426 N N   . ALA A 183 ? 1.3791 1.8163 1.4783 0.7211  -0.2197 -0.3679 256 ALA A N   
1427 C CA  . ALA A 183 ? 1.5692 2.1045 1.6946 0.7499  -0.2105 -0.3815 256 ALA A CA  
1428 C C   . ALA A 183 ? 1.6409 2.1557 1.7539 0.8150  -0.2230 -0.4114 256 ALA A C   
1429 O O   . ALA A 183 ? 1.6971 2.2397 1.8293 0.8469  -0.2282 -0.4114 256 ALA A O   
1430 C CB  . ALA A 183 ? 1.6462 2.2895 1.7818 0.7306  -0.1890 -0.3937 256 ALA A CB  
1431 N N   . LEU A 184 ? 1.6428 2.1064 1.7216 0.8350  -0.2287 -0.4369 257 LEU A N   
1432 C CA  . LEU A 184 ? 1.7670 2.1926 1.8265 0.8988  -0.2424 -0.4672 257 LEU A CA  
1433 C C   . LEU A 184 ? 1.9389 2.2573 1.9868 0.9083  -0.2660 -0.4462 257 LEU A C   
1434 O O   . LEU A 184 ? 1.9232 2.2317 1.9667 0.9324  -0.2730 -0.4466 257 LEU A O   
1435 C CB  . LEU A 184 ? 1.7597 2.1411 1.7777 0.9111  -0.2438 -0.4985 257 LEU A CB  
1436 C CG  . LEU A 184 ? 1.6891 2.1705 1.7077 0.9399  -0.2255 -0.5373 257 LEU A CG  
1437 C CD1 . LEU A 184 ? 1.5962 2.2004 1.6464 0.8963  -0.2010 -0.5252 257 LEU A CD1 
1438 C CD2 . LEU A 184 ? 2.0844 2.5050 2.0547 0.9490  -0.2290 -0.5674 257 LEU A CD2 
1439 N N   . CYS A 185 ? 1.9496 2.1863 1.9864 0.8704  -0.2757 -0.4199 258 CYS A N   
1440 C CA  . CYS A 185 ? 1.6758 1.8142 1.7021 0.8754  -0.2981 -0.3977 258 CYS A CA  
1441 C C   . CYS A 185 ? 1.7716 1.9570 1.8289 0.8702  -0.2947 -0.3736 258 CYS A C   
1442 O O   . CYS A 185 ? 2.0897 2.2358 2.1359 0.8880  -0.3064 -0.3679 258 CYS A O   
1443 C CB  . CYS A 185 ? 1.5530 1.6156 1.5654 0.8206  -0.3035 -0.3681 258 CYS A CB  
1444 S SG  . CYS A 185 ? 1.7353 1.7240 1.7012 0.8071  -0.3099 -0.3867 258 CYS A SG  
1445 N N   . ILE A 186 ? 1.5114 1.7805 1.6051 0.8437  -0.2791 -0.3594 259 ILE A N   
1446 C CA  . ILE A 186 ? 1.4870 1.8022 1.6080 0.8326  -0.2751 -0.3365 259 ILE A CA  
1447 C C   . ILE A 186 ? 1.7051 2.0945 1.8346 0.8618  -0.2684 -0.3539 259 ILE A C   
1448 O O   . ILE A 186 ? 1.5410 1.9498 1.6837 0.8634  -0.2710 -0.3388 259 ILE A O   
1449 C CB  . ILE A 186 ? 1.3783 1.7565 1.5278 0.7854  -0.2584 -0.3155 259 ILE A CB  
1450 C CG1 . ILE A 186 ? 1.2900 1.6775 1.4601 0.7744  -0.2618 -0.2884 259 ILE A CG1 
1451 C CG2 . ILE A 186 ? 1.4351 1.9292 1.6034 0.7813  -0.2375 -0.3337 259 ILE A CG2 
1452 C CD1 . ILE A 186 ? 1.1273 1.5699 1.3185 0.7226  -0.2438 -0.2674 259 ILE A CD1 
1453 N N   . MET A 187 ? 1.7618 2.1943 1.8832 0.8851  -0.2601 -0.3856 260 MET A N   
1454 C CA  . MET A 187 ? 1.5351 2.0340 1.6618 0.9170  -0.2552 -0.4039 260 MET A CA  
1455 C C   . MET A 187 ? 1.6526 2.0635 1.7510 0.9510  -0.2750 -0.4073 260 MET A C   
1456 O O   . MET A 187 ? 1.7883 2.2262 1.8965 0.9695  -0.2785 -0.4028 260 MET A O   
1457 C CB  . MET A 187 ? 1.4665 2.0403 1.5913 0.9311  -0.2395 -0.4371 260 MET A CB  
1458 C CG  . MET A 187 ? 1.4920 2.1964 1.6521 0.9056  -0.2176 -0.4353 260 MET A CG  
1459 S SD  . MET A 187 ? 1.7112 2.5095 1.8666 0.9192  -0.1981 -0.4735 260 MET A SD  
1460 C CE  . MET A 187 ? 1.9606 2.7675 2.1024 0.9722  -0.2045 -0.4961 260 MET A CE  
1461 N N   . LEU A 188 ? 1.8402 2.1455 1.9025 0.9582  -0.2889 -0.4148 261 LEU A N   
1462 C CA  . LEU A 188 ? 1.8373 2.0450 1.8678 0.9860  -0.3101 -0.4161 261 LEU A CA  
1463 C C   . LEU A 188 ? 1.8710 2.0367 1.9096 0.9711  -0.3224 -0.3812 261 LEU A C   
1464 O O   . LEU A 188 ? 2.2450 2.3838 2.2756 0.9959  -0.3345 -0.3781 261 LEU A O   
1465 C CB  . LEU A 188 ? 2.0373 2.1355 2.0253 0.9873  -0.3237 -0.4277 261 LEU A CB  
1466 C CG  . LEU A 188 ? 2.1028 2.0855 2.0518 1.0103  -0.3482 -0.4271 261 LEU A CG  
1467 C CD1 . LEU A 188 ? 2.2063 2.2211 2.1504 1.0572  -0.3486 -0.4504 261 LEU A CD1 
1468 C CD2 . LEU A 188 ? 2.4409 2.3186 2.3464 1.0047  -0.3615 -0.4384 261 LEU A CD2 
1469 N N   . ILE A 189 ? 1.5424 1.7044 1.5968 0.9311  -0.3191 -0.3552 262 ILE A N   
1470 C CA  . ILE A 189 ? 1.6862 1.8150 1.7485 0.9128  -0.3286 -0.3217 262 ILE A CA  
1471 C C   . ILE A 189 ? 1.8417 2.0656 1.9364 0.9187  -0.3196 -0.3152 262 ILE A C   
1472 O O   . ILE A 189 ? 1.9407 2.1415 2.0344 0.9276  -0.3311 -0.2997 262 ILE A O   
1473 C CB  . ILE A 189 ? 1.4649 1.5673 1.5347 0.8696  -0.3266 -0.2973 262 ILE A CB  
1474 C CG1 . ILE A 189 ? 1.6774 1.6778 1.7127 0.8639  -0.3397 -0.3009 262 ILE A CG1 
1475 C CG2 . ILE A 189 ? 1.4427 1.5254 1.5225 0.8500  -0.3334 -0.2637 262 ILE A CG2 
1476 C CD1 . ILE A 189 ? 1.6366 1.6157 1.6801 0.8242  -0.3378 -0.2789 262 ILE A CD1 
1477 N N   . PHE A 190 ? 1.7016 2.0340 1.8240 0.9125  -0.2999 -0.3268 263 PHE A N   
1478 C CA  . PHE A 190 ? 1.6956 2.1268 1.8481 0.9162  -0.2913 -0.3226 263 PHE A CA  
1479 C C   . PHE A 190 ? 1.8156 2.2650 1.9615 0.9612  -0.2972 -0.3413 263 PHE A C   
1480 O O   . PHE A 190 ? 1.4697 1.9864 1.6366 0.9704  -0.2954 -0.3361 263 PHE A O   
1481 C CB  . PHE A 190 ? 1.4170 1.9597 1.5979 0.8948  -0.2694 -0.3302 263 PHE A CB  
1482 C CG  . PHE A 190 ? 1.3147 1.8638 1.5123 0.8509  -0.2636 -0.3056 263 PHE A CG  
1483 C CD1 . PHE A 190 ? 1.3223 1.8194 1.5197 0.8353  -0.2744 -0.2774 263 PHE A CD1 
1484 C CD2 . PHE A 190 ? 1.6029 2.2106 1.8155 0.8260  -0.2476 -0.3107 263 PHE A CD2 
1485 C CE1 . PHE A 190 ? 1.4906 1.9929 1.7019 0.7974  -0.2691 -0.2561 263 PHE A CE1 
1486 C CE2 . PHE A 190 ? 1.6127 2.2236 1.8402 0.7879  -0.2433 -0.2882 263 PHE A CE2 
1487 C CZ  . PHE A 190 ? 1.3338 1.8912 1.5602 0.7746  -0.2538 -0.2616 263 PHE A CZ  
1488 N N   . THR A 191 ? 1.7981 2.1867 1.9139 0.9896  -0.3050 -0.3632 264 THR A N   
1489 C CA  . THR A 191 ? 1.6234 2.0131 1.7283 1.0361  -0.3129 -0.3815 264 THR A CA  
1490 C C   . THR A 191 ? 1.9411 2.2251 2.0230 1.0496  -0.3367 -0.3646 264 THR A C   
1491 O O   . THR A 191 ? 2.1901 2.4876 2.2760 1.0792  -0.3450 -0.3640 264 THR A O   
1492 C CB  . THR A 191 ? 1.6763 2.0559 1.7574 1.0631  -0.3094 -0.4168 264 THR A CB  
1493 O OG1 . THR A 191 ? 1.8690 2.3491 1.9705 1.0477  -0.2871 -0.4313 264 THR A OG1 
1494 C CG2 . THR A 191 ? 1.7586 2.1483 1.8309 1.1139  -0.3163 -0.4369 264 THR A CG2 
1495 N N   . VAL A 192 ? 1.6924 1.8736 1.7505 1.0268  -0.3482 -0.3495 265 VAL A N   
1496 C CA  . VAL A 192 ? 1.7563 1.8314 1.7881 1.0346  -0.3716 -0.3322 265 VAL A CA  
1497 C C   . VAL A 192 ? 1.7173 1.8121 1.7712 1.0163  -0.3754 -0.2996 265 VAL A C   
1498 O O   . VAL A 192 ? 1.7699 1.8026 1.8091 1.0276  -0.3939 -0.2842 265 VAL A O   
1499 C CB  . VAL A 192 ? 1.7806 1.7409 1.7774 1.0133  -0.3835 -0.3263 265 VAL A CB  
1500 C CG1 . VAL A 192 ? 1.7034 1.6581 1.7147 0.9652  -0.3792 -0.2966 265 VAL A CG1 
1501 C CG2 . VAL A 192 ? 1.8788 1.7265 1.8376 1.0332  -0.4090 -0.3210 265 VAL A CG2 
1502 N N   . ILE A 193 ? 1.8518 2.0323 1.9392 0.9878  -0.3587 -0.2892 266 ILE A N   
1503 C CA  . ILE A 193 ? 1.9958 2.2051 2.1042 0.9709  -0.3613 -0.2610 266 ILE A CA  
1504 C C   . ILE A 193 ? 1.8434 2.1520 1.9777 0.9967  -0.3562 -0.2694 266 ILE A C   
1505 O O   . ILE A 193 ? 2.2025 2.5313 2.3498 0.9956  -0.3633 -0.2496 266 ILE A O   
1506 C CB  . ILE A 193 ? 2.0380 2.2789 2.1657 0.9246  -0.3484 -0.2432 266 ILE A CB  
1507 C CG1 . ILE A 193 ? 2.1443 2.4960 2.2996 0.9171  -0.3260 -0.2607 266 ILE A CG1 
1508 C CG2 . ILE A 193 ? 1.6874 1.8343 1.7915 0.8997  -0.3537 -0.2340 266 ILE A CG2 
1509 C CD1 . ILE A 193 ? 1.8231 2.2133 1.9992 0.8741  -0.3140 -0.2432 266 ILE A CD1 
1510 N N   . TYR A 194 ? 1.8701 2.2435 2.0113 1.0197  -0.3443 -0.2985 267 TYR A N   
1511 C CA  . TYR A 194 ? 2.1788 2.6535 2.3446 1.0458  -0.3386 -0.3087 267 TYR A CA  
1512 C C   . TYR A 194 ? 1.9672 2.3958 2.1187 1.0887  -0.3581 -0.3095 267 TYR A C   
1513 O O   . TYR A 194 ? 1.8900 2.3655 2.0605 1.0997  -0.3635 -0.2975 267 TYR A O   
1514 C CB  . TYR A 194 ? 2.5451 3.1010 2.7193 1.0582  -0.3203 -0.3400 267 TYR A CB  
1515 C CG  . TYR A 194 ? 2.5679 3.2432 2.7701 1.0800  -0.3120 -0.3501 267 TYR A CG  
1516 C CD1 . TYR A 194 ? 2.3674 3.0990 2.5950 1.0700  -0.3145 -0.3287 267 TYR A CD1 
1517 C CD2 . TYR A 194 ? 2.7588 3.4930 2.9613 1.1102  -0.3020 -0.3809 267 TYR A CD2 
1518 C CE1 . TYR A 194 ? 2.4803 3.3240 2.7337 1.0884  -0.3078 -0.3368 267 TYR A CE1 
1519 C CE2 . TYR A 194 ? 2.8735 3.7215 3.1019 1.1294  -0.2943 -0.3893 267 TYR A CE2 
1520 C CZ  . TYR A 194 ? 2.7856 3.6881 3.0399 1.1178  -0.2975 -0.3667 267 TYR A CZ  
1521 O OH  . TYR A 194 ? 2.9169 3.9360 3.1974 1.1354  -0.2906 -0.3741 267 TYR A OH  
1522 N N   . PHE A 195 ? 2.1514 2.4863 2.2684 1.1125  -0.3697 -0.3234 268 PHE A N   
1523 C CA  . PHE A 195 ? 2.2135 2.4950 2.3125 1.1560  -0.3892 -0.3267 268 PHE A CA  
1524 C C   . PHE A 195 ? 2.3417 2.5398 2.4284 1.1447  -0.4102 -0.2942 268 PHE A C   
1525 O O   . PHE A 195 ? 2.7673 2.9099 2.8370 1.1771  -0.4292 -0.2918 268 PHE A O   
1526 C CB  . PHE A 195 ? 2.1766 2.3922 2.2409 1.1866  -0.3940 -0.3560 268 PHE A CB  
1527 C CG  . PHE A 195 ? 2.1664 2.4729 2.2427 1.2051  -0.3745 -0.3892 268 PHE A CG  
1528 C CD1 . PHE A 195 ? 2.1213 2.5598 2.2360 1.2100  -0.3591 -0.3932 268 PHE A CD1 
1529 C CD2 . PHE A 195 ? 2.2463 2.5080 2.2938 1.2158  -0.3721 -0.4161 268 PHE A CD2 
1530 C CE1 . PHE A 195 ? 2.2491 2.7759 2.3740 1.2247  -0.3410 -0.4226 268 PHE A CE1 
1531 C CE2 . PHE A 195 ? 2.4017 2.7502 2.4589 1.2322  -0.3539 -0.4465 268 PHE A CE2 
1532 C CZ  . PHE A 195 ? 2.4168 2.8994 2.5131 1.2363  -0.3380 -0.4493 268 PHE A CZ  
1533 N N   . SER A 196 ? 2.0398 2.2303 2.1344 1.0992  -0.4069 -0.2688 269 SER A N   
1534 C CA  . SER A 196 ? 1.8339 1.9541 1.9174 1.0830  -0.4251 -0.2361 269 SER A CA  
1535 C C   . SER A 196 ? 1.9484 2.1484 2.0645 1.0692  -0.4226 -0.2140 269 SER A C   
1536 O O   . SER A 196 ? 2.1409 2.3006 2.2510 1.0657  -0.4392 -0.1883 269 SER A O   
1537 C CB  . SER A 196 ? 1.8161 1.8473 1.8750 1.0458  -0.4273 -0.2245 269 SER A CB  
1538 O OG  . SER A 196 ? 2.1898 2.1480 2.2163 1.0618  -0.4324 -0.2462 269 SER A OG  
1539 N N   . ILE A 197 ? 1.8734 2.1869 2.0221 1.0599  -0.4027 -0.2239 270 ILE A N   
1540 C CA  . ILE A 197 ? 1.9599 2.3565 2.1388 1.0426  -0.3994 -0.2051 270 ILE A CA  
1541 C C   . ILE A 197 ? 2.1928 2.6966 2.3993 1.0730  -0.3952 -0.2177 270 ILE A C   
1542 O O   . ILE A 197 ? 2.2769 2.8274 2.5014 1.0728  -0.4025 -0.2002 270 ILE A O   
1543 C CB  . ILE A 197 ? 1.7263 2.1658 1.9195 0.9966  -0.3803 -0.2013 270 ILE A CB  
1544 C CG1 . ILE A 197 ? 1.9035 2.2416 2.0724 0.9658  -0.3857 -0.1843 270 ILE A CG1 
1545 C CG2 . ILE A 197 ? 1.9004 2.4325 2.1233 0.9756  -0.3753 -0.1853 270 ILE A CG2 
1546 C CD1 . ILE A 197 ? 2.1712 2.4540 2.3297 0.9547  -0.4038 -0.1528 270 ILE A CD1 
1547 N N   . TRP A 198 ? 1.9245 2.4685 2.1334 1.0994  -0.3843 -0.2479 271 TRP A N   
1548 C CA  . TRP A 198 ? 1.8937 2.5535 2.1305 1.1254  -0.3765 -0.2626 271 TRP A CA  
1549 C C   . TRP A 198 ? 2.3681 3.0291 2.6100 1.1628  -0.3955 -0.2531 271 TRP A C   
1550 O O   . TRP A 198 ? 2.4777 3.2411 2.7489 1.1715  -0.3922 -0.2516 271 TRP A O   
1551 C CB  . TRP A 198 ? 1.8737 2.5614 2.1052 1.1516  -0.3635 -0.2978 271 TRP A CB  
1552 C CG  . TRP A 198 ? 2.1616 2.7578 2.3620 1.1956  -0.3780 -0.3134 271 TRP A CG  
1553 C CD1 . TRP A 198 ? 2.2816 2.7473 2.4489 1.1977  -0.3969 -0.3018 271 TRP A CD1 
1554 C CD2 . TRP A 198 ? 2.0543 2.6833 2.2522 1.2434  -0.3753 -0.3437 271 TRP A CD2 
1555 N NE1 . TRP A 198 ? 2.2485 2.6598 2.3913 1.2431  -0.4069 -0.3232 271 TRP A NE1 
1556 C CE2 . TRP A 198 ? 2.1517 2.6608 2.3128 1.2734  -0.3937 -0.3498 271 TRP A CE2 
1557 C CE3 . TRP A 198 ? 1.9899 2.7391 2.2116 1.2630  -0.3592 -0.3660 271 TRP A CE3 
1558 C CZ2 . TRP A 198 ? 2.3043 2.8074 2.4516 1.3244  -0.3966 -0.3788 271 TRP A CZ2 
1559 C CZ3 . TRP A 198 ? 2.1349 2.8824 2.3444 1.3140  -0.3612 -0.3944 271 TRP A CZ3 
1560 C CH2 . TRP A 198 ? 2.3451 2.9689 2.5176 1.3453  -0.3799 -0.4011 271 TRP A CH2 
1561 N N   . LYS A 199 ? 2.4906 3.0394 2.7038 1.1838  -0.4161 -0.2456 272 LYS A N   
1562 C CA  . LYS A 199 ? 2.4119 2.9509 2.6274 1.2205  -0.4365 -0.2348 272 LYS A CA  
1563 C C   . LYS A 199 ? 2.3136 2.8398 2.5353 1.1930  -0.4499 -0.1983 272 LYS A C   
1564 O O   . LYS A 199 ? 2.4514 2.9574 2.6725 1.2169  -0.4699 -0.1828 272 LYS A O   
1565 C CB  . LYS A 199 ? 2.4931 2.9164 2.6722 1.2578  -0.4541 -0.2442 272 LYS A CB  
1566 C CG  . LYS A 199 ? 2.5736 3.0184 2.7471 1.2989  -0.4453 -0.2815 272 LYS A CG  
1567 C CD  . LYS A 199 ? 2.6654 2.9941 2.8012 1.3387  -0.4659 -0.2897 272 LYS A CD  
1568 C CE  . LYS A 199 ? 2.4333 2.7414 2.5726 1.3678  -0.4893 -0.2691 272 LYS A CE  
1569 N NZ  . LYS A 199 ? 2.4198 2.6084 2.5195 1.4055  -0.5111 -0.2757 272 LYS A NZ  
1570 N N   . GLY A 200 ? 2.0530 2.5913 2.2797 1.1435  -0.4394 -0.1848 273 GLY A N   
1571 C CA  . GLY A 200 ? 1.9700 2.5055 2.2018 1.1141  -0.4500 -0.1520 273 GLY A CA  
1572 C C   . GLY A 200 ? 2.1582 2.5687 2.3565 1.0953  -0.4651 -0.1301 273 GLY A C   
1573 O O   . GLY A 200 ? 2.4216 2.7620 2.5976 1.0812  -0.4595 -0.1378 273 GLY A O   
1574 N N   . VAL A 201 ? 2.0169 2.4023 2.2113 1.0942  -0.4851 -0.1017 274 VAL A N   
1575 C CA  . VAL A 201 ? 2.1158 2.3905 2.2781 1.0733  -0.5007 -0.0767 274 VAL A CA  
1576 C C   . VAL A 201 ? 2.2749 2.4478 2.4068 1.1082  -0.5205 -0.0785 274 VAL A C   
1577 O O   . VAL A 201 ? 2.2958 2.3688 2.3965 1.0941  -0.5357 -0.0583 274 VAL A O   
1578 C CB  . VAL A 201 ? 2.1955 2.4920 2.3643 1.0511  -0.5132 -0.0435 274 VAL A CB  
1579 C CG1 . VAL A 201 ? 1.9599 2.3437 2.1518 1.0124  -0.4947 -0.0421 274 VAL A CG1 
1580 C CG2 . VAL A 201 ? 2.5773 2.9177 2.7614 1.0870  -0.5301 -0.0363 274 VAL A CG2 
1581 N N   . LYS A 202 ? 2.3847 2.5836 2.5239 1.1535  -0.5205 -0.1027 275 LYS A N   
1582 C CA  . LYS A 202 ? 2.5096 2.6145 2.6190 1.1916  -0.5394 -0.1084 275 LYS A CA  
1583 C C   . LYS A 202 ? 2.6315 2.6456 2.7073 1.1825  -0.5347 -0.1250 275 LYS A C   
1584 O O   . LYS A 202 ? 2.7684 2.6693 2.8072 1.1815  -0.5528 -0.1136 275 LYS A O   
1585 C CB  . LYS A 202 ? 2.5940 2.7608 2.7222 1.2454  -0.5401 -0.1311 275 LYS A CB  
1586 N N   . THR A 203 ? 2.4406 2.5058 2.5283 1.1744  -0.5113 -0.1510 276 THR A N   
1587 C CA  . THR A 203 ? 2.4137 2.4042 2.4721 1.1654  -0.5060 -0.1686 276 THR A CA  
1588 C C   . THR A 203 ? 2.3726 2.3230 2.4213 1.1114  -0.5006 -0.1492 276 THR A C   
1589 O O   . THR A 203 ? 2.6561 2.5099 2.6713 1.0983  -0.5071 -0.1489 276 THR A O   
1590 C CB  . THR A 203 ? 2.3260 2.3887 2.3994 1.1815  -0.4840 -0.2053 276 THR A CB  
1591 O OG1 . THR A 203 ? 2.2939 2.4786 2.4074 1.1613  -0.4640 -0.2046 276 THR A OG1 
1592 C CG2 . THR A 203 ? 2.4487 2.5218 2.5194 1.2391  -0.4911 -0.2289 276 THR A CG2 
1593 N N   . SER A 204 ? 2.0035 2.0283 2.0804 1.0804  -0.4895 -0.1331 277 SER A N   
1594 C CA  . SER A 204 ? 2.0238 2.0203 2.0946 1.0309  -0.4832 -0.1147 277 SER A CA  
1595 C C   . SER A 204 ? 2.2764 2.1700 2.3158 1.0162  -0.5054 -0.0842 277 SER A C   
1596 O O   . SER A 204 ? 2.5926 2.4351 2.6166 0.9793  -0.5040 -0.0699 277 SER A O   
1597 C CB  . SER A 204 ? 2.2581 2.3577 2.3639 1.0043  -0.4682 -0.1049 277 SER A CB  
1598 O OG  . SER A 204 ? 2.6004 2.7212 2.7142 1.0069  -0.4825 -0.0804 277 SER A OG  
1599 N N   . GLY A 205 ? 2.1322 1.9981 2.1624 1.0448  -0.5263 -0.0735 278 GLY A N   
1600 C CA  . GLY A 205 ? 2.2989 2.0641 2.2956 1.0342  -0.5497 -0.0449 278 GLY A CA  
1601 C C   . GLY A 205 ? 2.2220 1.8818 2.1801 1.0576  -0.5653 -0.0567 278 GLY A C   
1602 O O   . GLY A 205 ? 2.2567 1.8197 2.1801 1.0458  -0.5852 -0.0351 278 GLY A O   
1603 N N   . LYS A 206 ? 2.2525 1.9312 2.2140 1.0900  -0.5568 -0.0912 279 LYS A N   
1604 C CA  . LYS A 206 ? 2.5428 2.1243 2.4656 1.1157  -0.5711 -0.1077 279 LYS A CA  
1605 C C   . LYS A 206 ? 2.9892 2.5297 2.8935 1.0932  -0.5599 -0.1255 279 LYS A C   
1606 O O   . LYS A 206 ? 3.3427 2.7754 3.2056 1.0856  -0.5752 -0.1230 279 LYS A O   
1607 C CB  . LYS A 206 ? 2.5766 2.1987 2.5100 1.1723  -0.5722 -0.1353 279 LYS A CB  
1608 C CG  . LYS A 206 ? 2.7073 2.2754 2.6237 1.2070  -0.5992 -0.1220 279 LYS A CG  
1609 C CD  . LYS A 206 ? 2.6119 2.2119 2.5462 1.1900  -0.6081 -0.0852 279 LYS A CD  
1610 C CE  . LYS A 206 ? 2.7881 2.3298 2.7039 1.2236  -0.6368 -0.0694 279 LYS A CE  
1611 N NZ  . LYS A 206 ? 2.9355 2.5073 2.8662 1.2061  -0.6473 -0.0319 279 LYS A NZ  
1612 N N   . VAL A 207 ? 2.5937 2.2203 2.5277 1.0816  -0.5345 -0.1426 280 VAL A N   
1613 C CA  . VAL A 207 ? 2.1988 1.7984 2.1199 1.0589  -0.5228 -0.1582 280 VAL A CA  
1614 C C   . VAL A 207 ? 2.2527 1.7948 2.1595 1.0086  -0.5269 -0.1287 280 VAL A C   
1615 O O   . VAL A 207 ? 2.5234 1.9889 2.4007 0.9903  -0.5315 -0.1315 280 VAL A O   
1616 C CB  . VAL A 207 ? 2.0760 1.7881 2.0339 1.0580  -0.4950 -0.1813 280 VAL A CB  
1617 C CG1 . VAL A 207 ? 2.0370 1.7201 1.9815 1.0339  -0.4842 -0.1952 280 VAL A CG1 
1618 C CG2 . VAL A 207 ? 2.2843 2.0573 2.2553 1.1078  -0.4908 -0.2104 280 VAL A CG2 
1619 N N   . VAL A 208 ? 2.0900 1.6708 2.0167 0.9867  -0.5259 -0.1003 281 VAL A N   
1620 C CA  . VAL A 208 ? 2.0604 1.5988 1.9765 0.9400  -0.5289 -0.0700 281 VAL A CA  
1621 C C   . VAL A 208 ? 2.0950 1.5064 1.9631 0.9318  -0.5529 -0.0564 281 VAL A C   
1622 O O   . VAL A 208 ? 2.4052 1.7650 2.2557 0.8954  -0.5534 -0.0448 281 VAL A O   
1623 C CB  . VAL A 208 ? 2.3742 1.9686 2.3132 0.9262  -0.5289 -0.0420 281 VAL A CB  
1624 C CG1 . VAL A 208 ? 2.6234 2.1705 2.5472 0.8807  -0.5335 -0.0098 281 VAL A CG1 
1625 C CG2 . VAL A 208 ? 2.3747 2.0917 2.3581 0.9271  -0.5054 -0.0550 281 VAL A CG2 
1626 N N   . TRP A 209 ? 2.2104 1.5728 2.0570 0.9655  -0.5733 -0.0581 282 TRP A N   
1627 C CA  . TRP A 209 ? 2.4158 1.6538 2.2127 0.9610  -0.5990 -0.0467 282 TRP A CA  
1628 C C   . TRP A 209 ? 2.3266 1.4989 2.0956 0.9424  -0.5982 -0.0615 282 TRP A C   
1629 O O   . TRP A 209 ? 2.5324 1.6126 2.2649 0.9137  -0.6146 -0.0428 282 TRP A O   
1630 C CB  . TRP A 209 ? 2.8726 2.0754 2.6526 1.0103  -0.6176 -0.0583 282 TRP A CB  
1631 C CG  . TRP A 209 ? 2.9858 2.1913 2.7691 1.0190  -0.6335 -0.0300 282 TRP A CG  
1632 C CD1 . TRP A 209 ? 2.9063 2.2074 2.7285 1.0392  -0.6264 -0.0267 282 TRP A CD1 
1633 C CD2 . TRP A 209 ? 3.1839 2.2926 2.9285 1.0065  -0.6607 0.0000  282 TRP A CD2 
1634 N NE1 . TRP A 209 ? 3.1408 2.4108 2.9516 1.0414  -0.6478 0.0038  282 TRP A NE1 
1635 C CE2 . TRP A 209 ? 3.3371 2.4892 3.1001 1.0216  -0.6687 0.0208  282 TRP A CE2 
1636 C CE3 . TRP A 209 ? 3.2944 2.2850 2.9894 0.9820  -0.6800 0.0122  282 TRP A CE3 
1637 C CZ2 . TRP A 209 ? 3.5732 2.6541 3.3063 1.0139  -0.6948 0.0535  282 TRP A CZ2 
1638 C CZ3 . TRP A 209 ? 3.5985 2.5188 3.2634 0.9728  -0.7056 0.0445  282 TRP A CZ3 
1639 C CH2 . TRP A 209 ? 3.7148 2.6801 3.3987 0.9893  -0.7126 0.0649  282 TRP A CH2 
1640 N N   . VAL A 210 ? 2.2695 1.4914 2.0550 0.9573  -0.5799 -0.0942 283 VAL A N   
1641 C CA  . VAL A 210 ? 2.2836 1.4503 2.0438 0.9422  -0.5791 -0.1107 283 VAL A CA  
1642 C C   . VAL A 210 ? 2.1827 1.3878 1.9639 0.8973  -0.5610 -0.0994 283 VAL A C   
1643 O O   . VAL A 210 ? 2.1949 1.3337 1.9509 0.8659  -0.5676 -0.0918 283 VAL A O   
1644 C CB  . VAL A 210 ? 2.3084 1.5016 2.0697 0.9831  -0.5706 -0.1531 283 VAL A CB  
1645 C CG1 . VAL A 210 ? 2.4437 1.5688 2.1721 0.9684  -0.5738 -0.1698 283 VAL A CG1 
1646 C CG2 . VAL A 210 ? 2.4084 1.5720 2.1529 1.0319  -0.5873 -0.1645 283 VAL A CG2 
1647 N N   . THR A 211 ? 2.1415 1.4529 1.9682 0.8936  -0.5394 -0.0973 284 THR A N   
1648 C CA  . THR A 211 ? 2.0308 1.3886 1.8809 0.8574  -0.5199 -0.0919 284 THR A CA  
1649 C C   . THR A 211 ? 2.2092 1.5393 2.0556 0.8143  -0.5250 -0.0537 284 THR A C   
1650 O O   . THR A 211 ? 2.5353 1.8740 2.3902 0.7810  -0.5143 -0.0457 284 THR A O   
1651 C CB  . THR A 211 ? 2.0978 1.5803 1.9957 0.8682  -0.4949 -0.1054 284 THR A CB  
1652 O OG1 . THR A 211 ? 2.3744 1.9023 2.2913 0.8742  -0.4969 -0.0869 284 THR A OG1 
1653 C CG2 . THR A 211 ? 1.9256 1.4456 1.8284 0.9084  -0.4876 -0.1433 284 THR A CG2 
1654 N N   . ALA A 212 ? 2.1162 1.4139 1.9494 0.8156  -0.5417 -0.0298 285 ALA A N   
1655 C CA  . ALA A 212 ? 2.0742 1.3547 1.9037 0.7766  -0.5461 0.0072  285 ALA A CA  
1656 C C   . ALA A 212 ? 2.3585 1.5245 2.1409 0.7540  -0.5702 0.0275  285 ALA A C   
1657 O O   . ALA A 212 ? 2.3801 1.5241 2.1547 0.7155  -0.5735 0.0573  285 ALA A O   
1658 C CB  . ALA A 212 ? 2.0849 1.4158 1.9319 0.7869  -0.5480 0.0245  285 ALA A CB  
1659 N N   . THR A 213 ? 2.4406 1.5346 2.1902 0.7770  -0.5874 0.0113  286 THR A N   
1660 C CA  . THR A 213 ? 2.5635 1.5437 2.2636 0.7561  -0.6133 0.0296  286 THR A CA  
1661 C C   . THR A 213 ? 2.6641 1.5880 2.3411 0.7353  -0.6157 0.0175  286 THR A C   
1662 O O   . THR A 213 ? 2.7253 1.5770 2.3714 0.6974  -0.6305 0.0403  286 THR A O   
1663 C CB  . THR A 213 ? 2.3607 1.2808 2.0309 0.7927  -0.6362 0.0231  286 THR A CB  
1664 O OG1 . THR A 213 ? 2.6792 1.6187 2.3551 0.8360  -0.6300 -0.0166 286 THR A OG1 
1665 C CG2 . THR A 213 ? 2.3560 1.3182 2.0433 0.8068  -0.6395 0.0430  286 THR A CG2 
1666 N N   . PHE A 214 ? 2.7129 1.6719 2.4037 0.7585  -0.6019 -0.0174 287 PHE A N   
1667 C CA  . PHE A 214 ? 2.7491 1.6608 2.4188 0.7422  -0.6040 -0.0322 287 PHE A CA  
1668 C C   . PHE A 214 ? 2.6288 1.5495 2.3094 0.6920  -0.5959 -0.0096 287 PHE A C   
1669 O O   . PHE A 214 ? 2.5981 1.4420 2.2453 0.6623  -0.6109 -0.0011 287 PHE A O   
1670 C CB  . PHE A 214 ? 2.6585 1.6238 2.3460 0.7779  -0.5876 -0.0737 287 PHE A CB  
1671 C CG  . PHE A 214 ? 2.7530 1.6736 2.4183 0.7642  -0.5900 -0.0913 287 PHE A CG  
1672 C CD1 . PHE A 214 ? 3.0168 1.8362 2.6304 0.7725  -0.6129 -0.1048 287 PHE A CD1 
1673 C CD2 . PHE A 214 ? 2.6838 1.6615 2.3779 0.7431  -0.5705 -0.0944 287 PHE A CD2 
1674 C CE1 . PHE A 214 ? 3.1278 1.9042 2.7180 0.7586  -0.6167 -0.1211 287 PHE A CE1 
1675 C CE2 . PHE A 214 ? 2.6044 1.5408 2.2774 0.7305  -0.5744 -0.1096 287 PHE A CE2 
1676 C CZ  . PHE A 214 ? 2.9094 1.7453 2.5299 0.7376  -0.5976 -0.1232 287 PHE A CZ  
1677 N N   . PRO A 215 ? 2.3580 1.3718 2.0842 0.6818  -0.5730 0.0002  288 PRO A N   
1678 C CA  . PRO A 215 ? 2.2402 1.2626 1.9773 0.6370  -0.5655 0.0214  288 PRO A CA  
1679 C C   . PRO A 215 ? 2.4050 1.3532 2.1106 0.5957  -0.5852 0.0589  288 PRO A C   
1680 O O   . PRO A 215 ? 2.0608 0.9861 1.7607 0.5588  -0.5868 0.0728  288 PRO A O   
1681 C CB  . PRO A 215 ? 1.9232 1.0524 1.7097 0.6382  -0.5405 0.0272  288 PRO A CB  
1682 C CG  . PRO A 215 ? 1.9135 1.1008 1.7194 0.6833  -0.5301 -0.0035 288 PRO A CG  
1683 C CD  . PRO A 215 ? 2.2350 1.3513 2.0043 0.7093  -0.5526 -0.0102 288 PRO A CD  
1684 N N   . TYR A 216 ? 2.4813 1.3948 2.1668 0.6005  -0.6007 0.0763  289 TYR A N   
1685 C CA  . TYR A 216 ? 2.5262 1.3713 2.1792 0.5596  -0.6201 0.1132  289 TYR A CA  
1686 C C   . TYR A 216 ? 2.6434 1.3822 2.2463 0.5449  -0.6447 0.1098  289 TYR A C   
1687 O O   . TYR A 216 ? 2.8615 1.5538 2.4431 0.4989  -0.6557 0.1353  289 TYR A O   
1688 C CB  . TYR A 216 ? 2.2185 1.0592 1.8633 0.5695  -0.6303 0.1332  289 TYR A CB  
1689 C CG  . TYR A 216 ? 2.1280 1.0616 1.8134 0.5681  -0.6104 0.1471  289 TYR A CG  
1690 C CD1 . TYR A 216 ? 2.2841 1.2987 2.0057 0.6068  -0.5933 0.1245  289 TYR A CD1 
1691 C CD2 . TYR A 216 ? 2.0994 1.0410 1.7852 0.5267  -0.6091 0.1828  289 TYR A CD2 
1692 C CE1 . TYR A 216 ? 1.9973 1.0936 1.7523 0.6035  -0.5769 0.1366  289 TYR A CE1 
1693 C CE2 . TYR A 216 ? 2.0232 1.0454 1.7414 0.5260  -0.5921 0.1940  289 TYR A CE2 
1694 C CZ  . TYR A 216 ? 1.9733 1.0703 1.7251 0.5642  -0.5768 0.1704  289 TYR A CZ  
1695 O OH  . TYR A 216 ? 2.4207 1.5946 2.2011 0.5617  -0.5618 0.1809  289 TYR A OH  
1696 N N   . ILE A 217 ? 2.3456 1.0480 1.9289 0.5831  -0.6536 0.0783  290 ILE A N   
1697 C CA  . ILE A 217 ? 2.4453 1.0453 1.9779 0.5738  -0.6771 0.0690  290 ILE A CA  
1698 C C   . ILE A 217 ? 2.4047 1.0088 1.9424 0.5476  -0.6696 0.0611  290 ILE A C   
1699 O O   . ILE A 217 ? 2.4536 0.9878 1.9576 0.5063  -0.6871 0.0773  290 ILE A O   
1700 C CB  . ILE A 217 ? 2.7913 1.3595 2.3039 0.6265  -0.6857 0.0333  290 ILE A CB  
1701 C CG1 . ILE A 217 ? 2.7706 1.3333 2.2788 0.6524  -0.6954 0.0441  290 ILE A CG1 
1702 C CG2 . ILE A 217 ? 2.7489 1.2074 2.2049 0.6165  -0.7104 0.0214  290 ILE A CG2 
1703 C CD1 . ILE A 217 ? 2.6409 1.1783 2.1330 0.7074  -0.7036 0.0111  290 ILE A CD1 
1704 N N   . ALA A 218 ? 2.5448 1.2331 2.1247 0.5696  -0.6444 0.0375  291 ALA A N   
1705 C CA  . ALA A 218 ? 2.3981 1.1001 1.9880 0.5485  -0.6360 0.0294  291 ALA A CA  
1706 C C   . ALA A 218 ? 2.3115 1.0222 1.9126 0.4941  -0.6348 0.0686  291 ALA A C   
1707 O O   . ALA A 218 ? 2.6399 1.3076 2.2227 0.4592  -0.6450 0.0766  291 ALA A O   
1708 C CB  . ALA A 218 ? 2.1988 0.9988 1.8350 0.5817  -0.6082 0.0002  291 ALA A CB  
1709 N N   . LEU A 219 ? 2.1678 0.9354 1.7981 0.4867  -0.6229 0.0933  292 LEU A N   
1710 C CA  . LEU A 219 ? 2.1254 0.9088 1.7676 0.4378  -0.6203 0.1318  292 LEU A CA  
1711 C C   . LEU A 219 ? 2.2168 0.9078 1.8108 0.3956  -0.6478 0.1612  292 LEU A C   
1712 O O   . LEU A 219 ? 2.4517 1.1355 2.0444 0.3484  -0.6513 0.1888  292 LEU A O   
1713 C CB  . LEU A 219 ? 2.0547 0.9156 1.7329 0.4429  -0.6025 0.1492  292 LEU A CB  
1714 C CG  . LEU A 219 ? 2.2146 1.1793 1.9461 0.4645  -0.5728 0.1321  292 LEU A CG  
1715 C CD1 . LEU A 219 ? 1.8945 0.9213 1.6513 0.4661  -0.5600 0.1509  292 LEU A CD1 
1716 C CD2 . LEU A 219 ? 2.1740 1.1633 1.9263 0.4374  -0.5633 0.1365  292 LEU A CD2 
1717 N N   . SER A 220 ? 2.3103 0.9337 1.8651 0.4117  -0.6678 0.1565  293 SER A N   
1718 C CA  . SER A 220 ? 2.4099 0.9395 1.9134 0.3722  -0.6962 0.1820  293 SER A CA  
1719 C C   . SER A 220 ? 2.6584 1.1215 2.1296 0.3496  -0.7117 0.1710  293 SER A C   
1720 O O   . SER A 220 ? 2.8999 1.3274 2.3513 0.2958  -0.7245 0.1996  293 SER A O   
1721 C CB  . SER A 220 ? 2.6370 1.1093 2.1064 0.3996  -0.7147 0.1776  293 SER A CB  
1722 O OG  . SER A 220 ? 3.1046 1.4856 2.5225 0.3590  -0.7430 0.2036  293 SER A OG  
1723 N N   . VAL A 221 ? 2.4813 0.9313 1.9465 0.3894  -0.7105 0.1300  294 VAL A N   
1724 C CA  . VAL A 221 ? 2.5343 0.9217 1.9665 0.3729  -0.7249 0.1142  294 VAL A CA  
1725 C C   . VAL A 221 ? 2.5594 0.9918 2.0201 0.3329  -0.7138 0.1302  294 VAL A C   
1726 O O   . VAL A 221 ? 2.7010 1.0809 2.1334 0.2840  -0.7311 0.1488  294 VAL A O   
1727 C CB  . VAL A 221 ? 2.6596 1.0408 2.0854 0.4279  -0.7209 0.0649  294 VAL A CB  
1728 C CG1 . VAL A 221 ? 2.9763 1.2960 2.3672 0.4093  -0.7348 0.0478  294 VAL A CG1 
1729 C CG2 . VAL A 221 ? 2.6454 0.9763 2.0404 0.4665  -0.7348 0.0512  294 VAL A CG2 
1730 N N   . LEU A 222 ? 2.3440 0.8759 1.8613 0.3524  -0.6854 0.1243  295 LEU A N   
1731 C CA  . LEU A 222 ? 2.5608 1.1449 2.1116 0.3202  -0.6732 0.1399  295 LEU A CA  
1732 C C   . LEU A 222 ? 2.6760 1.2676 2.2316 0.2649  -0.6773 0.1894  295 LEU A C   
1733 O O   . LEU A 222 ? 2.9072 1.5438 2.4830 0.2188  -0.6653 0.2048  295 LEU A O   
1734 C CB  . LEU A 222 ? 2.4241 1.1188 2.0346 0.3547  -0.6401 0.1216  295 LEU A CB  
1735 C CG  . LEU A 222 ? 2.2905 0.9946 1.9034 0.4059  -0.6336 0.0745  295 LEU A CG  
1736 C CD1 . LEU A 222 ? 2.1542 0.9820 1.8282 0.4295  -0.5971 0.0612  295 LEU A CD1 
1737 C CD2 . LEU A 222 ? 2.6667 1.3373 2.2574 0.3842  -0.6397 0.0581  295 LEU A CD2 
1738 N N   . LEU A 223 ? 2.5234 1.1054 2.0686 0.2631  -0.6816 0.2088  296 LEU A N   
1739 C CA  . LEU A 223 ? 2.2737 0.8655 1.8200 0.2116  -0.6848 0.2557  296 LEU A CA  
1740 C C   . LEU A 223 ? 2.3716 0.8764 1.8668 0.1596  -0.7135 0.2763  296 LEU A C   
1741 O O   . LEU A 223 ? 2.3661 0.8874 1.8679 0.1066  -0.7150 0.3093  296 LEU A O   
1742 C CB  . LEU A 223 ? 2.2747 0.8843 1.8233 0.2264  -0.6809 0.2693  296 LEU A CB  
1743 C CG  . LEU A 223 ? 2.2755 0.8971 1.8214 0.1747  -0.6838 0.3176  296 LEU A CG  
1744 C CD1 . LEU A 223 ? 2.1707 0.8910 1.7682 0.1473  -0.6559 0.3337  296 LEU A CD1 
1745 C CD2 . LEU A 223 ? 2.7697 1.4034 2.3129 0.1934  -0.6818 0.3276  296 LEU A CD2 
1746 N N   . VAL A 224 ? 2.4758 0.8913 1.9202 0.1737  -0.7363 0.2575  297 VAL A N   
1747 C CA  . VAL A 224 ? 2.8516 1.1773 2.2415 0.1255  -0.7658 0.2724  297 VAL A CA  
1748 C C   . VAL A 224 ? 2.7168 1.0374 2.1073 0.1011  -0.7683 0.2643  297 VAL A C   
1749 O O   . VAL A 224 ? 2.9234 1.2339 2.3033 0.0406  -0.7790 0.2950  297 VAL A O   
1750 C CB  . VAL A 224 ? 2.8817 1.1103 2.2158 0.1525  -0.7899 0.2496  297 VAL A CB  
1751 C CG1 . VAL A 224 ? 2.9379 1.0717 2.2123 0.0995  -0.8217 0.2648  297 VAL A CG1 
1752 C CG2 . VAL A 224 ? 2.7109 0.9469 2.0461 0.1758  -0.7887 0.2605  297 VAL A CG2 
1753 N N   . ARG A 225 ? 2.6249 0.9581 2.0287 0.1471  -0.7581 0.2237  298 ARG A N   
1754 C CA  . ARG A 225 ? 2.6660 0.9978 2.0720 0.1306  -0.7594 0.2119  298 ARG A CA  
1755 C C   . ARG A 225 ? 2.4193 0.8634 1.8809 0.0835  -0.7332 0.2406  298 ARG A C   
1756 O O   . ARG A 225 ? 2.4368 0.8765 1.8890 0.0310  -0.7411 0.2562  298 ARG A O   
1757 C CB  . ARG A 225 ? 2.5776 0.9350 2.0014 0.1922  -0.7440 0.1636  298 ARG A CB  
1758 C CG  . ARG A 225 ? 2.9138 1.3238 2.3582 0.1741  -0.7283 0.1455  298 ARG A CG  
1759 C CD  . ARG A 225 ? 3.1579 1.4610 2.5385 0.1439  -0.7602 0.1379  298 ARG A CD  
1760 N NE  . ARG A 225 ? 3.1422 1.4292 2.5090 0.0709  -0.7752 0.1806  298 ARG A NE  
1761 C CZ  . ARG A 225 ? 3.1433 1.3425 2.4549 0.0293  -0.8047 0.1836  298 ARG A CZ  
1762 N NH1 . ARG A 225 ? 3.0083 1.1219 2.2704 0.0555  -0.8222 0.1445  298 ARG A NH1 
1763 N NH2 . ARG A 225 ? 3.1960 1.3946 2.5005 -0.0394 -0.8168 0.2253  298 ARG A NH2 
1764 N N   . GLY A 226 ? 2.4503 0.9996 1.9702 0.1024  -0.7010 0.2462  299 GLY A N   
1765 C CA  . GLY A 226 ? 2.4771 1.1408 2.0537 0.0657  -0.6719 0.2700  299 GLY A CA  
1766 C C   . GLY A 226 ? 2.5963 1.2530 2.1613 0.0050  -0.6834 0.3172  299 GLY A C   
1767 O O   . GLY A 226 ? 2.5754 1.3027 2.1722 -0.0381 -0.6694 0.3385  299 GLY A O   
1768 N N   . ALA A 227 ? 2.4437 1.0173 1.9629 0.0017  -0.7093 0.3345  300 ALA A N   
1769 C CA  . ALA A 227 ? 2.3682 0.9288 1.8692 -0.0576 -0.7229 0.3810  300 ALA A CA  
1770 C C   . ALA A 227 ? 2.8320 1.3238 2.2897 -0.1113 -0.7515 0.3930  300 ALA A C   
1771 O O   . ALA A 227 ? 2.7277 1.2554 2.1925 -0.1709 -0.7521 0.4292  300 ALA A O   
1772 C CB  . ALA A 227 ? 2.4405 0.9283 1.9015 -0.0446 -0.7441 0.3963  300 ALA A CB  
1773 N N   . THR A 228 ? 3.0315 1.4267 2.4434 -0.0906 -0.7752 0.3620  301 THR A N   
1774 C CA  . THR A 228 ? 2.8524 1.1725 2.2163 -0.1407 -0.8046 0.3691  301 THR A CA  
1775 C C   . THR A 228 ? 2.7690 1.1802 2.1765 -0.1665 -0.7840 0.3643  301 THR A C   
1776 O O   . THR A 228 ? 2.7390 1.1215 2.1206 -0.2210 -0.8032 0.3795  301 THR A O   
1777 C CB  . THR A 228 ? 2.9641 1.1633 2.2645 -0.1080 -0.8311 0.3294  301 THR A CB  
1778 O OG1 . THR A 228 ? 3.1082 1.3252 2.4309 -0.0435 -0.8152 0.2864  301 THR A OG1 
1779 C CG2 . THR A 228 ? 3.0678 1.2072 2.3295 -0.0915 -0.8448 0.3296  301 THR A CG2 
1780 N N   . LEU A 229 ? 2.7829 1.3029 2.2551 -0.1290 -0.7464 0.3448  302 LEU A N   
1781 C CA  . LEU A 229 ? 2.5816 1.1914 2.0982 -0.1471 -0.7259 0.3398  302 LEU A CA  
1782 C C   . LEU A 229 ? 2.6879 1.3812 2.2394 -0.2081 -0.7165 0.3847  302 LEU A C   
1783 O O   . LEU A 229 ? 2.8056 1.5455 2.3804 -0.2158 -0.7038 0.4119  302 LEU A O   
1784 C CB  . LEU A 229 ? 2.4004 1.1018 1.9751 -0.0915 -0.6889 0.3100  302 LEU A CB  
1785 C CG  . LEU A 229 ? 2.4079 1.0521 1.9581 -0.0313 -0.6932 0.2623  302 LEU A CG  
1786 C CD1 . LEU A 229 ? 2.7646 1.5108 2.3752 0.0158  -0.6556 0.2387  302 LEU A CD1 
1787 C CD2 . LEU A 229 ? 2.5638 1.1375 2.0689 -0.0454 -0.7160 0.2405  302 LEU A CD2 
1788 N N   . PRO A 230 ? 2.6837 1.3995 2.2386 -0.2513 -0.7226 0.3923  303 PRO A N   
1789 C CA  . PRO A 230 ? 2.6427 1.4436 2.2320 -0.3103 -0.7153 0.4347  303 PRO A CA  
1790 C C   . PRO A 230 ? 2.5184 1.4635 2.1904 -0.2915 -0.6718 0.4409  303 PRO A C   
1791 O O   . PRO A 230 ? 2.2460 1.2364 1.9519 -0.2488 -0.6498 0.4112  303 PRO A O   
1792 C CB  . PRO A 230 ? 2.7106 1.4910 2.2790 -0.3507 -0.7350 0.4321  303 PRO A CB  
1793 C CG  . PRO A 230 ? 2.5552 1.2987 2.1118 -0.2997 -0.7327 0.3835  303 PRO A CG  
1794 C CD  . PRO A 230 ? 2.5934 1.2575 2.1183 -0.2465 -0.7375 0.3604  303 PRO A CD  
1795 N N   . GLY A 231 ? 2.6720 1.6867 2.3734 -0.3238 -0.6599 0.4791  304 GLY A N   
1796 C CA  . GLY A 231 ? 2.5180 1.6650 2.2940 -0.3081 -0.6195 0.4869  304 GLY A CA  
1797 C C   . GLY A 231 ? 2.1821 1.3470 1.9799 -0.2466 -0.5943 0.4634  304 GLY A C   
1798 O O   . GLY A 231 ? 1.9946 1.2528 1.8493 -0.2198 -0.5611 0.4552  304 GLY A O   
1799 N N   . ALA A 232 ? 2.3347 1.4085 2.0856 -0.2249 -0.6114 0.4535  305 ALA A N   
1800 C CA  . ALA A 232 ? 2.2457 1.3305 2.0118 -0.1681 -0.5917 0.4317  305 ALA A CA  
1801 C C   . ALA A 232 ? 2.1519 1.3064 1.9476 -0.1756 -0.5699 0.4590  305 ALA A C   
1802 O O   . ALA A 232 ? 2.0783 1.2600 1.8931 -0.1342 -0.5498 0.4452  305 ALA A O   
1803 C CB  . ALA A 232 ? 2.3529 1.3172 2.0590 -0.1396 -0.6196 0.4113  305 ALA A CB  
1804 N N   . TRP A 233 ? 1.9171 1.1033 1.7154 -0.2299 -0.5739 0.4975  306 TRP A N   
1805 C CA  . TRP A 233 ? 2.2450 1.4995 2.0672 -0.2427 -0.5537 0.5253  306 TRP A CA  
1806 C C   . TRP A 233 ? 2.2287 1.6086 2.1219 -0.2229 -0.5114 0.5206  306 TRP A C   
1807 O O   . TRP A 233 ? 2.3557 1.7973 2.2730 -0.2184 -0.4880 0.5333  306 TRP A O   
1808 C CB  . TRP A 233 ? 2.2183 1.4706 2.0191 -0.3099 -0.5719 0.5688  306 TRP A CB  
1809 C CG  . TRP A 233 ? 1.9872 1.2956 1.8145 -0.3495 -0.5715 0.5824  306 TRP A CG  
1810 C CD1 . TRP A 233 ? 2.0633 1.3101 1.8582 -0.3786 -0.6012 0.5808  306 TRP A CD1 
1811 C CD2 . TRP A 233 ? 1.9596 1.3983 1.8508 -0.3636 -0.5406 0.5997  306 TRP A CD2 
1812 N NE1 . TRP A 233 ? 2.3608 1.6953 2.1968 -0.4119 -0.5916 0.5977  306 TRP A NE1 
1813 C CE2 . TRP A 233 ? 2.0343 1.4882 1.9313 -0.4016 -0.5544 0.6098  306 TRP A CE2 
1814 C CE3 . TRP A 233 ? 1.9187 1.4615 1.8613 -0.3465 -0.5031 0.6069  306 TRP A CE3 
1815 C CZ2 . TRP A 233 ? 1.9221 1.4957 1.8780 -0.4209 -0.5324 0.6283  306 TRP A CZ2 
1816 C CZ3 . TRP A 233 ? 1.8499 1.5065 1.8490 -0.3636 -0.4803 0.6232  306 TRP A CZ3 
1817 C CH2 . TRP A 233 ? 1.8630 1.5362 1.8701 -0.3996 -0.4953 0.6345  306 TRP A CH2 
1818 N N   . ARG A 234 ? 2.0493 1.4638 1.9730 -0.2113 -0.5024 0.5023  307 ARG A N   
1819 C CA  . ARG A 234 ? 1.9405 1.4656 1.9292 -0.1915 -0.4651 0.4974  307 ARG A CA  
1820 C C   . ARG A 234 ? 1.8826 1.4179 1.8864 -0.1352 -0.4424 0.4681  307 ARG A C   
1821 O O   . ARG A 234 ? 1.9963 1.6082 2.0388 -0.1211 -0.4119 0.4717  307 ARG A O   
1822 C CB  . ARG A 234 ? 2.3089 1.8618 2.3215 -0.1967 -0.4656 0.4881  307 ARG A CB  
1823 C CG  . ARG A 234 ? 2.3301 1.8819 2.3309 -0.2549 -0.4881 0.5172  307 ARG A CG  
1824 C CD  . ARG A 234 ? 2.2669 1.8636 2.2987 -0.2593 -0.4853 0.5104  307 ARG A CD  
1825 N NE  . ARG A 234 ? 2.2695 1.8638 2.2871 -0.3175 -0.5096 0.5379  307 ARG A NE  
1826 C CZ  . ARG A 234 ? 2.3378 2.0188 2.3902 -0.3551 -0.5009 0.5730  307 ARG A CZ  
1827 N NH1 . ARG A 234 ? 2.4446 2.2183 2.5469 -0.3377 -0.4674 0.5830  307 ARG A NH1 
1828 N NH2 . ARG A 234 ? 2.3116 1.9881 2.3481 -0.4104 -0.5258 0.5975  307 ARG A NH2 
1829 N N   . GLY A 235 ? 2.2024 1.6612 2.1743 -0.1033 -0.4576 0.4386  308 GLY A N   
1830 C CA  . GLY A 235 ? 2.3178 1.7830 2.3001 -0.0522 -0.4400 0.4108  308 GLY A CA  
1831 C C   . GLY A 235 ? 2.1165 1.5710 2.0825 -0.0466 -0.4375 0.4223  308 GLY A C   
1832 O O   . GLY A 235 ? 2.2912 1.7900 2.2806 -0.0164 -0.4132 0.4109  308 GLY A O   
1833 N N   . VAL A 236 ? 1.8771 1.2707 1.7999 -0.0779 -0.4640 0.4458  309 VAL A N   
1834 C CA  . VAL A 236 ? 1.9731 1.3532 1.8751 -0.0788 -0.4652 0.4616  309 VAL A CA  
1835 C C   . VAL A 236 ? 2.0226 1.4989 1.9611 -0.1021 -0.4368 0.4872  309 VAL A C   
1836 O O   . VAL A 236 ? 2.3053 1.8139 2.2512 -0.0862 -0.4189 0.4881  309 VAL A O   
1837 C CB  . VAL A 236 ? 1.9357 1.2154 1.7763 -0.1077 -0.5046 0.4812  309 VAL A CB  
1838 C CG1 . VAL A 236 ? 1.8818 1.1461 1.6989 -0.1067 -0.5073 0.4981  309 VAL A CG1 
1839 C CG2 . VAL A 236 ? 1.9283 1.1111 1.7320 -0.0816 -0.5322 0.4530  309 VAL A CG2 
1840 N N   . LEU A 237 ? 1.7309 1.2552 1.6918 -0.1393 -0.4328 0.5072  310 LEU A N   
1841 C CA  . LEU A 237 ? 1.7459 1.3707 1.7462 -0.1595 -0.4042 0.5302  310 LEU A CA  
1842 C C   . LEU A 237 ? 1.6672 1.3661 1.7160 -0.1173 -0.3669 0.5068  310 LEU A C   
1843 O O   . LEU A 237 ? 1.8921 1.6371 1.9529 -0.1076 -0.3440 0.5106  310 LEU A O   
1844 C CB  . LEU A 237 ? 1.9975 1.6633 2.0163 -0.2040 -0.4089 0.5542  310 LEU A CB  
1845 C CG  . LEU A 237 ? 2.0789 1.8592 2.1445 -0.2228 -0.3785 0.5775  310 LEU A CG  
1846 C CD1 . LEU A 237 ? 2.1369 1.9273 2.1808 -0.2462 -0.3759 0.6035  310 LEU A CD1 
1847 C CD2 . LEU A 237 ? 1.8958 1.7185 1.9827 -0.2634 -0.3858 0.5990  310 LEU A CD2 
1848 N N   . PHE A 238 ? 1.5588 1.2653 1.6315 -0.0938 -0.3620 0.4827  311 PHE A N   
1849 C CA  . PHE A 238 ? 1.6369 1.4023 1.7512 -0.0545 -0.3302 0.4593  311 PHE A CA  
1850 C C   . PHE A 238 ? 1.4926 1.2296 1.5899 -0.0174 -0.3243 0.4374  311 PHE A C   
1851 O O   . PHE A 238 ? 1.3801 1.1684 1.5042 0.0077  -0.2961 0.4252  311 PHE A O   
1852 C CB  . PHE A 238 ? 1.7395 1.5045 1.8731 -0.0401 -0.3323 0.4389  311 PHE A CB  
1853 C CG  . PHE A 238 ? 1.6339 1.4454 1.8032 -0.0003 -0.3041 0.4138  311 PHE A CG  
1854 C CD1 . PHE A 238 ? 1.6968 1.5919 1.9123 0.0011  -0.2758 0.4217  311 PHE A CD1 
1855 C CD2 . PHE A 238 ? 1.4762 1.2476 1.6320 0.0357  -0.3067 0.3826  311 PHE A CD2 
1856 C CE1 . PHE A 238 ? 1.7539 1.6827 1.9975 0.0360  -0.2518 0.3994  311 PHE A CE1 
1857 C CE2 . PHE A 238 ? 1.5280 1.3404 1.7135 0.0675  -0.2822 0.3612  311 PHE A CE2 
1858 C CZ  . PHE A 238 ? 1.6844 1.5710 1.9119 0.0669  -0.2555 0.3698  311 PHE A CZ  
1859 N N   . TYR A 239 ? 1.4157 1.0696 1.4671 -0.0143 -0.3522 0.4331  312 TYR A N   
1860 C CA  . TYR A 239 ? 1.5170 1.1401 1.5499 0.0208  -0.3522 0.4135  312 TYR A CA  
1861 C C   . TYR A 239 ? 1.8015 1.4395 1.8205 0.0098  -0.3454 0.4333  312 TYR A C   
1862 O O   . TYR A 239 ? 1.4175 1.0596 1.4327 0.0373  -0.3357 0.4195  312 TYR A O   
1863 C CB  . TYR A 239 ? 1.4792 1.0071 1.4693 0.0331  -0.3861 0.3999  312 TYR A CB  
1864 C CG  . TYR A 239 ? 1.5109 1.0021 1.4773 0.0665  -0.3924 0.3850  312 TYR A CG  
1865 C CD1 . TYR A 239 ? 1.5173 1.0448 1.5070 0.1056  -0.3720 0.3576  312 TYR A CD1 
1866 C CD2 . TYR A 239 ? 1.7376 1.1573 1.6573 0.0580  -0.4206 0.3996  312 TYR A CD2 
1867 C CE1 . TYR A 239 ? 1.6304 1.1314 1.6004 0.1352  -0.3788 0.3450  312 TYR A CE1 
1868 C CE2 . TYR A 239 ? 1.5908 0.9802 1.4905 0.0903  -0.4281 0.3875  312 TYR A CE2 
1869 C CZ  . TYR A 239 ? 1.7009 1.1347 1.6273 0.1288  -0.4068 0.3601  312 TYR A CZ  
1870 O OH  . TYR A 239 ? 1.5464 0.9572 1.4549 0.1599  -0.4151 0.3492  312 TYR A OH  
1871 N N   . LEU A 240 ? 1.9227 1.5728 1.9333 -0.0325 -0.3505 0.4664  313 LEU A N   
1872 C CA  . LEU A 240 ? 1.6284 1.2911 1.6203 -0.0485 -0.3462 0.4883  313 LEU A CA  
1873 C C   . LEU A 240 ? 1.6167 1.3712 1.6406 -0.0742 -0.3178 0.5098  313 LEU A C   
1874 O O   . LEU A 240 ? 1.4769 1.2545 1.4876 -0.0897 -0.3099 0.5282  313 LEU A O   
1875 C CB  . LEU A 240 ? 1.5942 1.1747 1.5326 -0.0780 -0.3836 0.5119  313 LEU A CB  
1876 C CG  . LEU A 240 ? 1.7720 1.2553 1.6713 -0.0499 -0.4139 0.4932  313 LEU A CG  
1877 C CD1 . LEU A 240 ? 1.7484 1.1472 1.5926 -0.0823 -0.4514 0.5203  313 LEU A CD1 
1878 C CD2 . LEU A 240 ? 1.9200 1.4125 1.8206 -0.0082 -0.4016 0.4727  313 LEU A CD2 
1879 N N   . LYS A 241 ? 1.9193 1.7282 1.9847 -0.0777 -0.3024 0.5076  314 LYS A N   
1880 C CA  . LYS A 241 ? 2.0361 1.9382 2.1369 -0.0975 -0.2748 0.5267  314 LYS A CA  
1881 C C   . LYS A 241 ? 2.1217 2.0790 2.2402 -0.0698 -0.2405 0.5133  314 LYS A C   
1882 O O   . LYS A 241 ? 2.3469 2.3144 2.4866 -0.0319 -0.2243 0.4844  314 LYS A O   
1883 C CB  . LYS A 241 ? 2.2987 2.2467 2.4428 -0.0995 -0.2666 0.5245  314 LYS A CB  
1884 C CG  . LYS A 241 ? 2.3373 2.3853 2.5212 -0.1185 -0.2400 0.5457  314 LYS A CG  
1885 C CD  . LYS A 241 ? 2.3520 2.4426 2.5782 -0.1195 -0.2360 0.5453  314 LYS A CD  
1886 C CE  . LYS A 241 ? 2.1629 2.3590 2.4321 -0.1343 -0.2097 0.5667  314 LYS A CE  
1887 N NZ  . LYS A 241 ? 2.1917 2.4325 2.5039 -0.1341 -0.2075 0.5685  314 LYS A NZ  
1888 N N   . PRO A 242 ? 2.0476 2.0397 2.1543 -0.0910 -0.2298 0.5344  315 PRO A N   
1889 C CA  . PRO A 242 ? 2.0158 2.0561 2.1306 -0.0689 -0.1984 0.5226  315 PRO A CA  
1890 C C   . PRO A 242 ? 2.0143 2.1374 2.1807 -0.0496 -0.1621 0.5107  315 PRO A C   
1891 O O   . PRO A 242 ? 2.1976 2.3807 2.3919 -0.0708 -0.1521 0.5299  315 PRO A O   
1892 C CB  . PRO A 242 ? 2.0863 2.1461 2.1739 -0.1060 -0.1992 0.5540  315 PRO A CB  
1893 C CG  . PRO A 242 ? 2.3316 2.3242 2.3842 -0.1418 -0.2387 0.5783  315 PRO A CG  
1894 C CD  . PRO A 242 ? 2.2927 2.2747 2.3711 -0.1400 -0.2491 0.5712  315 PRO A CD  
1895 N N   . ASN A 243 ? 1.7380 1.8633 1.9160 -0.0098 -0.1439 0.4798  316 ASN A N   
1896 C CA  . ASN A 243 ? 1.4310 1.6248 1.6512 0.0129  -0.1092 0.4663  316 ASN A CA  
1897 C C   . ASN A 243 ? 1.3461 1.5563 1.5546 0.0347  -0.0845 0.4488  316 ASN A C   
1898 O O   . ASN A 243 ? 1.3594 1.5498 1.5698 0.0664  -0.0770 0.4204  316 ASN A O   
1899 C CB  . ASN A 243 ? 1.4787 1.6574 1.7263 0.0390  -0.1113 0.4445  316 ASN A CB  
1900 C CG  . ASN A 243 ? 1.7077 1.9557 2.0017 0.0571  -0.0806 0.4382  316 ASN A CG  
1901 O OD1 . ASN A 243 ? 1.9123 2.2119 2.2153 0.0638  -0.0527 0.4380  316 ASN A OD1 
1902 N ND2 . ASN A 243 ? 1.8185 2.0663 2.1406 0.0663  -0.0862 0.4325  316 ASN A ND2 
1903 N N   . TRP A 244 ? 1.2411 1.4889 1.4353 0.0148  -0.0721 0.4662  317 TRP A N   
1904 C CA  . TRP A 244 ? 1.6107 1.8676 1.7822 0.0279  -0.0530 0.4528  317 TRP A CA  
1905 C C   . TRP A 244 ? 1.7888 2.0837 1.9875 0.0631  -0.0193 0.4248  317 TRP A C   
1906 O O   . TRP A 244 ? 1.9025 2.1852 2.0812 0.0815  -0.0078 0.4038  317 TRP A O   
1907 C CB  . TRP A 244 ? 1.8740 2.1734 2.0266 -0.0041 -0.0448 0.4794  317 TRP A CB  
1908 C CG  . TRP A 244 ? 1.8556 2.1123 1.9759 -0.0419 -0.0790 0.5094  317 TRP A CG  
1909 C CD1 . TRP A 244 ? 1.7835 2.0558 1.9128 -0.0769 -0.0927 0.5391  317 TRP A CD1 
1910 C CD2 . TRP A 244 ? 1.9216 2.1099 1.9935 -0.0491 -0.1058 0.5133  317 TRP A CD2 
1911 N NE1 . TRP A 244 ? 1.8950 2.1060 1.9809 -0.1066 -0.1266 0.5608  317 TRP A NE1 
1912 C CE2 . TRP A 244 ? 1.9146 2.0731 1.9657 -0.0882 -0.1353 0.5457  317 TRP A CE2 
1913 C CE3 . TRP A 244 ? 2.0275 2.1773 2.0712 -0.0267 -0.1088 0.4934  317 TRP A CE3 
1914 C CZ2 . TRP A 244 ? 2.0141 2.1005 2.0164 -0.1023 -0.1677 0.5585  317 TRP A CZ2 
1915 C CZ3 . TRP A 244 ? 1.9469 2.0333 1.9461 -0.0400 -0.1405 0.5066  317 TRP A CZ3 
1916 C CH2 . TRP A 244 ? 2.0183 2.0710 1.9968 -0.0760 -0.1697 0.5387  317 TRP A CH2 
1917 N N   . GLN A 245 ? 1.8405 2.1788 2.0828 0.0717  -0.0053 0.4251  318 GLN A N   
1918 C CA  . GLN A 245 ? 1.8893 2.2576 2.1581 0.1065  0.0247  0.4000  318 GLN A CA  
1919 C C   . GLN A 245 ? 1.7469 2.0572 2.0039 0.1337  0.0179  0.3699  318 GLN A C   
1920 O O   . GLN A 245 ? 1.7186 2.0336 1.9727 0.1578  0.0398  0.3463  318 GLN A O   
1921 C CB  . GLN A 245 ? 2.1719 2.5871 2.4903 0.1117  0.0330  0.4083  318 GLN A CB  
1922 C CG  . GLN A 245 ? 2.3699 2.8541 2.7060 0.0841  0.0402  0.4391  318 GLN A CG  
1923 C CD  . GLN A 245 ? 2.4089 2.9540 2.7425 0.0899  0.0742  0.4370  318 GLN A CD  
1924 O OE1 . GLN A 245 ? 2.3451 2.8907 2.6766 0.1216  0.0977  0.4102  318 GLN A OE1 
1925 N NE2 . GLN A 245 ? 2.4613 3.0580 2.7924 0.0577  0.0768  0.4651  318 GLN A NE2 
1926 N N   . LYS A 246 ? 1.3676 1.6237 1.6158 0.1284  -0.0127 0.3707  319 LYS A N   
1927 C CA  . LYS A 246 ? 1.3034 1.5085 1.5399 0.1506  -0.0224 0.3446  319 LYS A CA  
1928 C C   . LYS A 246 ? 1.4420 1.6307 1.6431 0.1582  -0.0159 0.3293  319 LYS A C   
1929 O O   . LYS A 246 ? 1.6549 1.8261 1.8522 0.1801  -0.0094 0.3039  319 LYS A O   
1930 C CB  . LYS A 246 ? 1.3021 1.4541 1.5284 0.1412  -0.0575 0.3502  319 LYS A CB  
1931 C CG  . LYS A 246 ? 1.2482 1.4048 1.5069 0.1401  -0.0658 0.3554  319 LYS A CG  
1932 C CD  . LYS A 246 ? 1.4556 1.6176 1.7385 0.1687  -0.0516 0.3314  319 LYS A CD  
1933 C CE  . LYS A 246 ? 1.4932 1.6585 1.8055 0.1665  -0.0623 0.3374  319 LYS A CE  
1934 N NZ  . LYS A 246 ? 1.6402 1.8060 1.9724 0.1924  -0.0512 0.3159  319 LYS A NZ  
1935 N N   . LEU A 247 ? 1.2819 1.4773 1.4555 0.1374  -0.0186 0.3461  320 LEU A N   
1936 C CA  . LEU A 247 ? 1.3377 1.5203 1.4745 0.1406  -0.0146 0.3351  320 LEU A CA  
1937 C C   . LEU A 247 ? 1.3704 1.5891 1.5105 0.1577  0.0205  0.3148  320 LEU A C   
1938 O O   . LEU A 247 ? 1.3894 1.5947 1.5014 0.1652  0.0256  0.2980  320 LEU A O   
1939 C CB  . LEU A 247 ? 1.3779 1.5613 1.4832 0.1112  -0.0265 0.3616  320 LEU A CB  
1940 C CG  . LEU A 247 ? 1.5659 1.6957 1.6530 0.0956  -0.0652 0.3792  320 LEU A CG  
1941 C CD1 . LEU A 247 ? 1.6607 1.7880 1.7118 0.0658  -0.0766 0.4063  320 LEU A CD1 
1942 C CD2 . LEU A 247 ? 1.7612 1.8392 1.8359 0.1180  -0.0838 0.3574  320 LEU A CD2 
1943 N N   . LEU A 248 ? 1.3807 1.6441 1.5539 0.1646  0.0437  0.3160  321 LEU A N   
1944 C CA  . LEU A 248 ? 1.5725 1.8651 1.7495 0.1852  0.0774  0.2950  321 LEU A CA  
1945 C C   . LEU A 248 ? 1.6940 1.9532 1.8780 0.2118  0.0796  0.2664  321 LEU A C   
1946 O O   . LEU A 248 ? 1.9310 2.1902 2.1021 0.2277  0.1005  0.2438  321 LEU A O   
1947 C CB  . LEU A 248 ? 1.3405 1.6948 1.5527 0.1873  0.1008  0.3067  321 LEU A CB  
1948 C CG  . LEU A 248 ? 1.4408 1.8421 1.6463 0.1590  0.1047  0.3347  321 LEU A CG  
1949 C CD1 . LEU A 248 ? 1.6376 2.1105 1.8824 0.1654  0.1310  0.3434  321 LEU A CD1 
1950 C CD2 . LEU A 248 ? 1.4782 1.8795 1.6381 0.1499  0.1138  0.3295  321 LEU A CD2 
1951 N N   . GLU A 249 ? 1.5017 1.7312 1.7030 0.2146  0.0575  0.2674  322 GLU A N   
1952 C CA  . GLU A 249 ? 1.4457 1.6441 1.6522 0.2353  0.0563  0.2431  322 GLU A CA  
1953 C C   . GLU A 249 ? 1.4946 1.6561 1.6646 0.2350  0.0440  0.2274  322 GLU A C   
1954 O O   . GLU A 249 ? 1.5350 1.6781 1.6865 0.2214  0.0212  0.2383  322 GLU A O   
1955 C CB  . GLU A 249 ? 1.5090 1.6933 1.7446 0.2367  0.0370  0.2499  322 GLU A CB  
1956 C CG  . GLU A 249 ? 1.8852 2.1093 2.1590 0.2353  0.0457  0.2675  322 GLU A CG  
1957 C CD  . GLU A 249 ? 2.1465 2.3553 2.4447 0.2338  0.0249  0.2742  322 GLU A CD  
1958 O OE1 . GLU A 249 ? 2.1957 2.3636 2.4817 0.2370  0.0065  0.2623  322 GLU A OE1 
1959 O OE2 . GLU A 249 ? 2.1932 2.4349 2.5227 0.2292  0.0271  0.2913  322 GLU A OE2 
1960 N N   . THR A 250 ? 1.5412 1.6916 1.7005 0.2499  0.0581  0.2023  323 THR A N   
1961 C CA  . THR A 250 ? 1.5827 1.7063 1.7084 0.2487  0.0483  0.1866  323 THR A CA  
1962 C C   . THR A 250 ? 1.4756 1.5701 1.6080 0.2521  0.0226  0.1818  323 THR A C   
1963 O O   . THR A 250 ? 1.6051 1.6824 1.7148 0.2519  0.0111  0.1702  323 THR A O   
1964 C CB  . THR A 250 ? 1.9656 2.0849 2.0743 0.2600  0.0712  0.1608  323 THR A CB  
1965 O OG1 . THR A 250 ? 2.0974 2.1955 2.1741 0.2554  0.0595  0.1471  323 THR A OG1 
1966 C CG2 . THR A 250 ? 2.2033 2.3127 2.3381 0.2768  0.0795  0.1485  323 THR A CG2 
1967 N N   . GLY A 251 ? 1.6005 1.6937 1.7638 0.2551  0.0139  0.1907  324 GLY A N   
1968 C CA  . GLY A 251 ? 1.4934 1.5627 1.6642 0.2597  -0.0078 0.1845  324 GLY A CA  
1969 C C   . GLY A 251 ? 1.3671 1.4192 1.5282 0.2511  -0.0359 0.1978  324 GLY A C   
1970 O O   . GLY A 251 ? 1.7669 1.8000 1.9171 0.2565  -0.0530 0.1876  324 GLY A O   
1971 N N   . VAL A 252 ? 1.1848 1.2437 1.3492 0.2378  -0.0411 0.2209  325 VAL A N   
1972 C CA  . VAL A 252 ? 1.2016 1.2352 1.3546 0.2286  -0.0696 0.2356  325 VAL A CA  
1973 C C   . VAL A 252 ? 1.3743 1.3916 1.4929 0.2279  -0.0822 0.2331  325 VAL A C   
1974 O O   . VAL A 252 ? 1.4638 1.4518 1.5710 0.2306  -0.1080 0.2353  325 VAL A O   
1975 C CB  . VAL A 252 ? 1.2358 1.2804 1.3957 0.2092  -0.0720 0.2630  325 VAL A CB  
1976 C CG1 . VAL A 252 ? 1.4079 1.4717 1.6041 0.2102  -0.0635 0.2671  325 VAL A CG1 
1977 C CG2 . VAL A 252 ? 1.5332 1.6067 1.6784 0.1976  -0.0536 0.2732  325 VAL A CG2 
1978 N N   . TRP A 253 ? 1.3974 1.4332 1.4985 0.2255  -0.0645 0.2278  326 TRP A N   
1979 C CA  . TRP A 253 ? 1.5481 1.5738 1.6160 0.2240  -0.0756 0.2256  326 TRP A CA  
1980 C C   . TRP A 253 ? 1.5368 1.5508 1.6034 0.2403  -0.0857 0.2035  326 TRP A C   
1981 O O   . TRP A 253 ? 1.4515 1.4489 1.5018 0.2446  -0.1083 0.2045  326 TRP A O   
1982 C CB  . TRP A 253 ? 1.5263 1.5773 1.5740 0.2160  -0.0524 0.2234  326 TRP A CB  
1983 C CG  . TRP A 253 ? 1.4618 1.5309 1.5051 0.1979  -0.0443 0.2469  326 TRP A CG  
1984 C CD1 . TRP A 253 ? 1.1427 1.2394 1.2098 0.1942  -0.0237 0.2539  326 TRP A CD1 
1985 C CD2 . TRP A 253 ? 1.5332 1.5985 1.5466 0.1799  -0.0570 0.2682  326 TRP A CD2 
1986 N NE1 . TRP A 253 ? 1.1470 1.2621 1.2019 0.1737  -0.0217 0.2776  326 TRP A NE1 
1987 C CE2 . TRP A 253 ? 1.4886 1.5822 1.5087 0.1632  -0.0423 0.2873  326 TRP A CE2 
1988 C CE3 . TRP A 253 ? 1.4685 1.5112 1.4502 0.1762  -0.0802 0.2742  326 TRP A CE3 
1989 C CZ2 . TRP A 253 ? 1.6798 1.7785 1.6736 0.1399  -0.0497 0.3125  326 TRP A CZ2 
1990 C CZ3 . TRP A 253 ? 1.4626 1.5053 1.4174 0.1550  -0.0889 0.2996  326 TRP A CZ3 
1991 C CH2 . TRP A 253 ? 1.6071 1.6770 1.5669 0.1354  -0.0735 0.3186  326 TRP A CH2 
1992 N N   . ILE A 254 ? 1.5919 1.6165 1.6760 0.2495  -0.0692 0.1844  327 ILE A N   
1993 C CA  . ILE A 254 ? 1.6241 1.6445 1.7097 0.2617  -0.0766 0.1638  327 ILE A CA  
1994 C C   . ILE A 254 ? 1.6092 1.6115 1.7089 0.2706  -0.1004 0.1662  327 ILE A C   
1995 O O   . ILE A 254 ? 1.7277 1.7251 1.8200 0.2803  -0.1173 0.1571  327 ILE A O   
1996 C CB  . ILE A 254 ? 1.5948 1.6257 1.6937 0.2659  -0.0541 0.1459  327 ILE A CB  
1997 C CG1 . ILE A 254 ? 1.9073 1.9502 1.9879 0.2594  -0.0301 0.1410  327 ILE A CG1 
1998 C CG2 . ILE A 254 ? 1.6502 1.6806 1.7490 0.2737  -0.0623 0.1264  327 ILE A CG2 
1999 C CD1 . ILE A 254 ? 2.0296 2.0744 2.1208 0.2647  -0.0074 0.1256  327 ILE A CD1 
2000 N N   . ASP A 255 ? 1.5074 1.5022 1.6268 0.2675  -0.1016 0.1780  328 ASP A N   
2001 C CA  . ASP A 255 ? 1.4860 1.4594 1.6153 0.2741  -0.1237 0.1803  328 ASP A CA  
2002 C C   . ASP A 255 ? 1.7010 1.6491 1.8074 0.2757  -0.1497 0.1902  328 ASP A C   
2003 O O   . ASP A 255 ? 1.8968 1.8300 2.0008 0.2903  -0.1686 0.1808  328 ASP A O   
2004 C CB  . ASP A 255 ? 1.5765 1.5473 1.7268 0.2652  -0.1208 0.1945  328 ASP A CB  
2005 C CG  . ASP A 255 ? 1.9262 1.9183 2.1018 0.2681  -0.0995 0.1851  328 ASP A CG  
2006 O OD1 . ASP A 255 ? 2.2074 2.2129 2.3802 0.2738  -0.0840 0.1694  328 ASP A OD1 
2007 O OD2 . ASP A 255 ? 1.8479 1.8412 2.0444 0.2639  -0.0996 0.1941  328 ASP A OD2 
2008 N N   . ALA A 256 ? 1.6407 1.5845 1.7293 0.2616  -0.1506 0.2096  329 ALA A N   
2009 C CA  . ALA A 256 ? 1.4475 1.3625 1.5102 0.2613  -0.1763 0.2228  329 ALA A CA  
2010 C C   . ALA A 256 ? 1.5521 1.4732 1.5988 0.2758  -0.1844 0.2093  329 ALA A C   
2011 O O   . ALA A 256 ? 1.4940 1.3913 1.5299 0.2895  -0.2095 0.2093  329 ALA A O   
2012 C CB  . ALA A 256 ? 1.3834 1.2980 1.4287 0.2388  -0.1733 0.2480  329 ALA A CB  
2013 N N   . ALA A 257 ? 1.3868 1.3399 1.4314 0.2732  -0.1638 0.1976  330 ALA A N   
2014 C CA  . ALA A 257 ? 1.2894 1.2564 1.3192 0.2827  -0.1699 0.1850  330 ALA A CA  
2015 C C   . ALA A 257 ? 1.1994 1.1695 1.2448 0.3035  -0.1815 0.1660  330 ALA A C   
2016 O O   . ALA A 257 ? 1.6709 1.6360 1.7068 0.3182  -0.2032 0.1643  330 ALA A O   
2017 C CB  . ALA A 257 ? 1.4330 1.4301 1.4561 0.2726  -0.1441 0.1740  330 ALA A CB  
2018 N N   . ALA A 258 ? 1.0532 1.0339 1.1222 0.3054  -0.1672 0.1523  331 ALA A N   
2019 C CA  . ALA A 258 ? 1.0337 1.0223 1.1183 0.3224  -0.1756 0.1344  331 ALA A CA  
2020 C C   . ALA A 258 ? 1.0544 1.0124 1.1391 0.3374  -0.2012 0.1401  331 ALA A C   
2021 O O   . ALA A 258 ? 1.1500 1.1134 1.2355 0.3570  -0.2167 0.1285  331 ALA A O   
2022 C CB  . ALA A 258 ? 1.0054 1.0057 1.1128 0.3182  -0.1565 0.1233  331 ALA A CB  
2023 N N   . GLN A 259 ? 1.2010 1.1275 1.2836 0.3278  -0.2058 0.1578  332 GLN A N   
2024 C CA  . GLN A 259 ? 1.2889 1.1753 1.3661 0.3385  -0.2308 0.1640  332 GLN A CA  
2025 C C   . GLN A 259 ? 1.1850 1.0524 1.2387 0.3530  -0.2553 0.1694  332 GLN A C   
2026 O O   . GLN A 259 ? 1.2746 1.1275 1.3274 0.3766  -0.2743 0.1590  332 GLN A O   
2027 C CB  . GLN A 259 ? 1.4737 1.3314 1.5492 0.3186  -0.2313 0.1852  332 GLN A CB  
2028 C CG  . GLN A 259 ? 1.2011 1.0078 1.2649 0.3249  -0.2585 0.1927  332 GLN A CG  
2029 C CD  . GLN A 259 ? 1.1399 0.9422 1.2191 0.3415  -0.2633 0.1727  332 GLN A CD  
2030 O OE1 . GLN A 259 ? 1.5891 1.4248 1.6911 0.3404  -0.2445 0.1594  332 GLN A OE1 
2031 N NE2 . GLN A 259 ? 1.5230 1.2816 1.5869 0.3571  -0.2889 0.1704  332 GLN A NE2 
2032 N N   . ILE A 260 ? 1.3705 1.2392 1.4046 0.3403  -0.2549 0.1853  333 ILE A N   
2033 C CA  . ILE A 260 ? 1.4231 1.2716 1.4328 0.3525  -0.2800 0.1946  333 ILE A CA  
2034 C C   . ILE A 260 ? 1.5776 1.4636 1.5927 0.3745  -0.2831 0.1752  333 ILE A C   
2035 O O   . ILE A 260 ? 1.5188 1.3910 1.5258 0.3987  -0.3073 0.1736  333 ILE A O   
2036 C CB  . ILE A 260 ? 1.3482 1.1899 1.3326 0.3293  -0.2791 0.2194  333 ILE A CB  
2037 C CG1 . ILE A 260 ? 1.4967 1.3072 1.4531 0.3412  -0.3098 0.2336  333 ILE A CG1 
2038 C CG2 . ILE A 260 ? 1.4237 1.3141 1.4091 0.3158  -0.2532 0.2126  333 ILE A CG2 
2039 C CD1 . ILE A 260 ? 1.7077 1.4557 1.6533 0.3505  -0.3369 0.2441  333 ILE A CD1 
2040 N N   . PHE A 261 ? 1.3255 1.2587 1.3540 0.3665  -0.2596 0.1605  334 PHE A N   
2041 C CA  . PHE A 261 ? 1.2624 1.2382 1.2971 0.3819  -0.2614 0.1424  334 PHE A CA  
2042 C C   . PHE A 261 ? 1.2220 1.2014 1.2752 0.4088  -0.2726 0.1249  334 PHE A C   
2043 O O   . PHE A 261 ? 1.3940 1.3853 1.4456 0.4330  -0.2912 0.1192  334 PHE A O   
2044 C CB  . PHE A 261 ? 1.2293 1.2472 1.2717 0.3640  -0.2340 0.1297  334 PHE A CB  
2045 C CG  . PHE A 261 ? 1.3060 1.3709 1.3582 0.3752  -0.2348 0.1099  334 PHE A CG  
2046 C CD1 . PHE A 261 ? 1.4882 1.5793 1.5263 0.3790  -0.2461 0.1114  334 PHE A CD1 
2047 C CD2 . PHE A 261 ? 1.3682 1.4546 1.4433 0.3800  -0.2251 0.0912  334 PHE A CD2 
2048 C CE1 . PHE A 261 ? 1.4412 1.5826 1.4896 0.3868  -0.2474 0.0945  334 PHE A CE1 
2049 C CE2 . PHE A 261 ? 1.3203 1.4553 1.4041 0.3868  -0.2259 0.0745  334 PHE A CE2 
2050 C CZ  . PHE A 261 ? 1.1855 1.3499 1.2570 0.3900  -0.2369 0.0761  334 PHE A CZ  
2051 N N   . PHE A 262 ? 1.1889 1.1596 1.2590 0.4053  -0.2618 0.1172  335 PHE A N   
2052 C CA  . PHE A 262 ? 1.1015 1.0726 1.1861 0.4285  -0.2710 0.1006  335 PHE A CA  
2053 C C   . PHE A 262 ? 1.1500 1.0722 1.2210 0.4508  -0.2987 0.1071  335 PHE A C   
2054 O O   . PHE A 262 ? 1.5605 1.4906 1.6367 0.4795  -0.3119 0.0922  335 PHE A O   
2055 C CB  . PHE A 262 ? 1.7680 1.7415 1.8712 0.4166  -0.2531 0.0922  335 PHE A CB  
2056 C CG  . PHE A 262 ? 1.0938 1.1186 1.2124 0.4072  -0.2321 0.0769  335 PHE A CG  
2057 C CD1 . PHE A 262 ? 1.0747 1.1109 1.1911 0.3830  -0.2119 0.0826  335 PHE A CD1 
2058 C CD2 . PHE A 262 ? 1.3306 1.3912 1.4631 0.4222  -0.2331 0.0569  335 PHE A CD2 
2059 C CE1 . PHE A 262 ? 1.0120 1.0863 1.1376 0.3730  -0.1945 0.0689  335 PHE A CE1 
2060 C CE2 . PHE A 262 ? 1.3114 1.4167 1.4546 0.4095  -0.2156 0.0449  335 PHE A CE2 
2061 C CZ  . PHE A 262 ? 0.9722 1.0802 1.1106 0.3844  -0.1971 0.0511  335 PHE A CZ  
2062 N N   . SER A 263 ? 1.6027 1.4736 1.6551 0.4381  -0.3077 0.1287  336 SER A N   
2063 C CA  . SER A 263 ? 1.9359 1.7522 1.9701 0.4589  -0.3366 0.1349  336 SER A CA  
2064 C C   . SER A 263 ? 2.2744 2.0961 2.2958 0.4841  -0.3574 0.1366  336 SER A C   
2065 O O   . SER A 263 ? 2.4047 2.2069 2.4230 0.5169  -0.3776 0.1265  336 SER A O   
2066 C CB  . SER A 263 ? 1.8384 1.5947 1.8523 0.4368  -0.3452 0.1596  336 SER A CB  
2067 O OG  . SER A 263 ? 2.0268 1.7237 2.0183 0.4581  -0.3758 0.1645  336 SER A OG  
2068 N N   . LEU A 264 ? 2.0638 1.9122 2.0767 0.4708  -0.3530 0.1486  337 LEU A N   
2069 C CA  . LEU A 264 ? 1.9037 1.7633 1.9057 0.4946  -0.3739 0.1515  337 LEU A CA  
2070 C C   . LEU A 264 ? 1.7106 1.6373 1.7373 0.5177  -0.3685 0.1262  337 LEU A C   
2071 O O   . LEU A 264 ? 1.3587 1.2939 1.3859 0.5517  -0.3889 0.1202  337 LEU A O   
2072 C CB  . LEU A 264 ? 1.8449 1.7134 1.8269 0.4706  -0.3720 0.1730  337 LEU A CB  
2073 C CG  . LEU A 264 ? 1.7056 1.5181 1.6622 0.4434  -0.3758 0.2004  337 LEU A CG  
2074 C CD1 . LEU A 264 ? 2.0097 1.8368 1.9438 0.4225  -0.3752 0.2203  337 LEU A CD1 
2075 C CD2 . LEU A 264 ? 1.6794 1.4188 1.6171 0.4611  -0.4062 0.2116  337 LEU A CD2 
2076 N N   . GLY A 265 ? 1.9790 1.9548 2.0268 0.5008  -0.3418 0.1110  338 GLY A N   
2077 C CA  . GLY A 265 ? 1.9283 1.9692 1.9991 0.5185  -0.3366 0.0876  338 GLY A CA  
2078 C C   . GLY A 265 ? 1.7043 1.7964 1.7747 0.5320  -0.3477 0.0873  338 GLY A C   
2079 O O   . GLY A 265 ? 1.5417 1.6718 1.6267 0.5628  -0.3584 0.0729  338 GLY A O   
2080 N N   . PRO A 266 ? 1.7007 1.7962 1.7536 0.5082  -0.3448 0.1036  339 PRO A N   
2081 C CA  . PRO A 266 ? 1.8061 1.9497 1.8535 0.5100  -0.3533 0.1074  339 PRO A CA  
2082 C C   . PRO A 266 ? 1.7379 1.9531 1.8038 0.4960  -0.3337 0.0886  339 PRO A C   
2083 O O   . PRO A 266 ? 1.5195 1.7369 1.5976 0.4808  -0.3126 0.0766  339 PRO A O   
2084 C CB  . PRO A 266 ? 1.6782 1.7929 1.6972 0.4789  -0.3493 0.1296  339 PRO A CB  
2085 C CG  . PRO A 266 ? 1.5636 1.6236 1.5782 0.4610  -0.3362 0.1360  339 PRO A CG  
2086 C CD  . PRO A 266 ? 1.5123 1.5453 1.5423 0.4874  -0.3451 0.1255  339 PRO A CD  
2087 N N   . GLY A 267 ? 1.8316 2.1033 1.8967 0.4960  -0.3403 0.0880  340 GLY A N   
2088 C CA  . GLY A 267 ? 1.5781 1.9158 1.6553 0.4748  -0.3223 0.0721  340 GLY A CA  
2089 C C   . GLY A 267 ? 1.5351 1.9141 1.6419 0.4869  -0.3138 0.0498  340 GLY A C   
2090 O O   . GLY A 267 ? 1.6376 2.0376 1.7510 0.4611  -0.2922 0.0383  340 GLY A O   
2091 N N   . PHE A 268 ? 1.6785 2.0670 1.8010 0.5270  -0.3316 0.0439  341 PHE A N   
2092 C CA  . PHE A 268 ? 1.6414 2.0752 1.7915 0.5454  -0.3268 0.0224  341 PHE A CA  
2093 C C   . PHE A 268 ? 1.6159 2.1113 1.7821 0.5832  -0.3474 0.0168  341 PHE A C   
2094 O O   . PHE A 268 ? 1.5876 2.1466 1.7783 0.5967  -0.3432 -0.0014 341 PHE A O   
2095 C CB  . PHE A 268 ? 1.6480 2.0225 1.8013 0.5610  -0.3247 0.0169  341 PHE A CB  
2096 C CG  . PHE A 268 ? 1.8467 2.2640 2.0241 0.5699  -0.3136 -0.0057 341 PHE A CG  
2097 C CD1 . PHE A 268 ? 1.5515 1.9841 1.7346 0.5358  -0.2896 -0.0133 341 PHE A CD1 
2098 C CD2 . PHE A 268 ? 2.1180 2.5593 2.3105 0.6129  -0.3273 -0.0194 341 PHE A CD2 
2099 C CE1 . PHE A 268 ? 1.5749 2.0480 1.7775 0.5410  -0.2799 -0.0322 341 PHE A CE1 
2100 C CE2 . PHE A 268 ? 1.9990 2.4843 2.2117 0.6198  -0.3159 -0.0406 341 PHE A CE2 
2101 C CZ  . PHE A 268 ? 1.6103 2.1123 1.8277 0.5820  -0.2924 -0.0460 341 PHE A CZ  
2102 N N   . GLY A 269 ? 1.5844 2.0636 1.7368 0.6004  -0.3699 0.0333  342 GLY A N   
2103 C CA  . GLY A 269 ? 1.7981 2.3359 1.9655 0.6387  -0.3918 0.0311  342 GLY A CA  
2104 C C   . GLY A 269 ? 1.6694 2.1692 1.8419 0.6918  -0.4119 0.0269  342 GLY A C   
2105 O O   . GLY A 269 ? 1.8835 2.4144 2.0663 0.7151  -0.4221 0.0245  342 GLY A O   
2106 N N   . VAL A 270 ? 1.4862 1.9049 1.6471 0.6927  -0.4074 0.0258  343 VAL A N   
2107 C CA  . VAL A 270 ? 1.7333 2.0879 1.8878 0.7183  -0.4152 0.0220  343 VAL A CA  
2108 C C   . VAL A 270 ? 1.7144 2.0145 1.8450 0.7279  -0.4389 0.0459  343 VAL A C   
2109 O O   . VAL A 270 ? 1.4824 1.7787 1.6152 0.7550  -0.4511 0.0443  343 VAL A O   
2110 C CB  . VAL A 270 ? 1.7983 2.0809 1.9435 0.7106  -0.4053 0.0161  343 VAL A CB  
2111 C CG1 . VAL A 270 ? 2.0014 2.2034 2.1293 0.7322  -0.4183 0.0174  343 VAL A CG1 
2112 C CG2 . VAL A 270 ? 1.5759 1.9121 1.7453 0.7073  -0.3840 -0.0091 343 VAL A CG2 
2113 N N   . LEU A 271 ? 1.6938 1.9525 1.8002 0.7060  -0.4457 0.0684  344 LEU A N   
2114 C CA  . LEU A 271 ? 1.4898 1.6998 1.5695 0.7090  -0.4689 0.0949  344 LEU A CA  
2115 C C   . LEU A 271 ? 1.7182 2.0012 1.8082 0.7202  -0.4807 0.0996  344 LEU A C   
2116 O O   . LEU A 271 ? 2.0152 2.2722 2.0942 0.7363  -0.5009 0.1147  344 LEU A O   
2117 C CB  . LEU A 271 ? 1.5248 1.6905 1.5757 0.6764  -0.4691 0.1172  344 LEU A CB  
2118 C CG  . LEU A 271 ? 1.6856 1.7940 1.7310 0.6506  -0.4491 0.1133  344 LEU A CG  
2119 C CD1 . LEU A 271 ? 1.4883 1.5665 1.5096 0.6032  -0.4369 0.1344  344 LEU A CD1 
2120 C CD2 . LEU A 271 ? 1.7140 1.7417 1.7484 0.6756  -0.4646 0.1136  344 LEU A CD2 
2121 N N   . LEU A 272 ? 1.8350 2.2106 1.9460 0.7098  -0.4687 0.0877  345 LEU A N   
2122 C CA  . LEU A 272 ? 1.6526 2.1120 1.7768 0.7156  -0.4780 0.0903  345 LEU A CA  
2123 C C   . LEU A 272 ? 1.7314 2.2118 1.8783 0.7503  -0.4828 0.0778  345 LEU A C   
2124 O O   . LEU A 272 ? 1.9625 2.4539 2.1083 0.7668  -0.5015 0.0905  345 LEU A O   
2125 C CB  . LEU A 272 ? 1.4595 2.0142 1.6012 0.6930  -0.4622 0.0773  345 LEU A CB  
2126 C CG  . LEU A 272 ? 1.5090 2.1387 1.6491 0.6732  -0.4689 0.0877  345 LEU A CG  
2127 C CD1 . LEU A 272 ? 1.5282 2.1061 1.6299 0.6314  -0.4668 0.1097  345 LEU A CD1 
2128 C CD2 . LEU A 272 ? 1.5118 2.2347 1.6758 0.6476  -0.4476 0.0683  345 LEU A CD2 
2129 N N   . ALA A 273 ? 1.3629 1.8490 1.5286 0.7622  -0.4660 0.0530  346 ALA A N   
2130 C CA  . ALA A 273 ? 1.3965 1.9060 1.5817 0.7972  -0.4674 0.0369  346 ALA A CA  
2131 C C   . ALA A 273 ? 1.7664 2.1833 1.9310 0.8236  -0.4859 0.0474  346 ALA A C   
2132 O O   . ALA A 273 ? 1.7643 2.1976 1.9369 0.8535  -0.4988 0.0478  346 ALA A O   
2133 C CB  . ALA A 273 ? 1.7073 2.2425 1.9111 0.8005  -0.4447 0.0080  346 ALA A CB  
2134 N N   . PHE A 274 ? 1.8122 2.1327 1.9499 0.8120  -0.4875 0.0562  347 PHE A N   
2135 C CA  . PHE A 274 ? 1.7618 1.9872 1.8749 0.8312  -0.5059 0.0679  347 PHE A CA  
2136 C C   . PHE A 274 ? 1.8312 2.0435 1.9286 0.8322  -0.5304 0.0978  347 PHE A C   
2137 O O   . PHE A 274 ? 1.7775 1.9439 1.8640 0.8578  -0.5488 0.1062  347 PHE A O   
2138 C CB  . PHE A 274 ? 1.7615 1.8923 1.8485 0.8116  -0.5019 0.0724  347 PHE A CB  
2139 C CG  . PHE A 274 ? 1.9015 2.0098 1.9942 0.8238  -0.4879 0.0454  347 PHE A CG  
2140 C CD1 . PHE A 274 ? 2.1277 2.2921 2.2437 0.8536  -0.4806 0.0195  347 PHE A CD1 
2141 C CD2 . PHE A 274 ? 1.8468 1.8800 1.9199 0.8052  -0.4826 0.0463  347 PHE A CD2 
2142 C CE1 . PHE A 274 ? 2.0831 2.2280 2.2002 0.8649  -0.4685 -0.0058 347 PHE A CE1 
2143 C CE2 . PHE A 274 ? 1.8006 1.8137 1.8762 0.8154  -0.4714 0.0217  347 PHE A CE2 
2144 C CZ  . PHE A 274 ? 1.7513 1.8195 1.8475 0.8456  -0.4645 -0.0048 347 PHE A CZ  
2145 N N   . ALA A 275 ? 1.5701 1.8219 1.6637 0.8044  -0.5315 0.1139  348 ALA A N   
2146 C CA  . ALA A 275 ? 1.9634 2.2118 2.0399 0.8013  -0.5549 0.1433  348 ALA A CA  
2147 C C   . ALA A 275 ? 2.0573 2.3947 2.1609 0.8234  -0.5628 0.1395  348 ALA A C   
2148 O O   . ALA A 275 ? 1.7855 2.1171 1.8799 0.8336  -0.5855 0.1612  348 ALA A O   
2149 C CB  . ALA A 275 ? 1.6539 1.9103 1.7101 0.7630  -0.5536 0.1608  348 ALA A CB  
2150 N N   . SER A 276 ? 2.2371 2.6584 2.3739 0.8295  -0.5443 0.1130  349 SER A N   
2151 C CA  . SER A 276 ? 2.2273 2.7452 2.3932 0.8476  -0.5491 0.1075  349 SER A CA  
2152 C C   . SER A 276 ? 2.4860 2.9775 2.6571 0.8911  -0.5657 0.1086  349 SER A C   
2153 O O   . SER A 276 ? 2.6918 3.2341 2.8751 0.9060  -0.5815 0.1194  349 SER A O   
2154 C CB  . SER A 276 ? 2.1798 2.7876 2.3779 0.8439  -0.5242 0.0780  349 SER A CB  
2155 O OG  . SER A 276 ? 2.3613 3.0659 2.5879 0.8605  -0.5282 0.0728  349 SER A OG  
2156 N N   . TYR A 277 ? 2.4473 2.8596 2.6078 0.9113  -0.5628 0.0972  350 TYR A N   
2157 C CA  . TYR A 277 ? 2.3203 2.6980 2.4812 0.9549  -0.5782 0.0954  350 TYR A CA  
2158 C C   . TYR A 277 ? 2.2188 2.4834 2.3401 0.9476  -0.5988 0.1236  350 TYR A C   
2159 O O   . TYR A 277 ? 2.3487 2.5251 2.4470 0.9447  -0.5953 0.1191  350 TYR A O   
2160 C CB  . TYR A 277 ? 2.2571 2.6249 2.4279 0.9804  -0.5613 0.0620  350 TYR A CB  
2161 C CG  . TYR A 277 ? 2.1881 2.6619 2.3919 0.9756  -0.5367 0.0353  350 TYR A CG  
2162 C CD1 . TYR A 277 ? 2.3939 2.9645 2.6289 1.0011  -0.5362 0.0243  350 TYR A CD1 
2163 C CD2 . TYR A 277 ? 2.1636 2.6419 2.3670 0.9449  -0.5145 0.0224  350 TYR A CD2 
2164 C CE1 . TYR A 277 ? 2.4038 3.0738 2.6670 0.9934  -0.5138 0.0015  350 TYR A CE1 
2165 C CE2 . TYR A 277 ? 2.1114 2.6856 2.3430 0.9381  -0.4928 -0.0002 350 TYR A CE2 
2166 C CZ  . TYR A 277 ? 2.2158 2.8859 2.4762 0.9611  -0.4924 -0.0104 350 TYR A CZ  
2167 O OH  . TYR A 277 ? 2.0352 2.8033 2.3217 0.9511  -0.4709 -0.0313 350 TYR A OH  
2168 N N   . ASN A 278 ? 2.1027 2.3717 2.2144 0.9424  -0.6209 0.1536  351 ASN A N   
2169 C CA  . ASN A 278 ? 2.3044 2.4725 2.3782 0.9387  -0.6438 0.1834  351 ASN A CA  
2170 C C   . ASN A 278 ? 2.4308 2.6292 2.5021 0.9409  -0.6692 0.2140  351 ASN A C   
2171 O O   . ASN A 278 ? 2.1790 2.4768 2.2760 0.9378  -0.6681 0.2128  351 ASN A O   
2172 C CB  . ASN A 278 ? 2.2336 2.3393 2.2761 0.8963  -0.6364 0.1950  351 ASN A CB  
2173 C CG  . ASN A 278 ? 2.6459 2.6341 2.6469 0.8933  -0.6553 0.2190  351 ASN A CG  
2174 O OD1 . ASN A 278 ? 2.9797 2.9417 2.9542 0.8713  -0.6716 0.2512  351 ASN A OD1 
2175 N ND2 . ASN A 278 ? 2.6602 2.5774 2.6522 0.9136  -0.6535 0.2033  351 ASN A ND2 
2176 N N   . LYS A 279 ? 2.5346 2.6476 2.5734 0.9442  -0.6928 0.2420  352 LYS A N   
2177 C CA  . LYS A 279 ? 2.6413 2.7727 2.6731 0.9456  -0.7197 0.2748  352 LYS A CA  
2178 C C   . LYS A 279 ? 2.5492 2.7306 2.5708 0.9013  -0.7191 0.2931  352 LYS A C   
2179 O O   . LYS A 279 ? 2.4432 2.6023 2.4470 0.8674  -0.7038 0.2905  352 LYS A O   
2180 C CB  . LYS A 279 ? 2.8036 2.8237 2.7964 0.9534  -0.7438 0.3023  352 LYS A CB  
2181 C CG  . LYS A 279 ? 2.8355 2.7885 2.8278 0.9942  -0.7452 0.2830  352 LYS A CG  
2182 C CD  . LYS A 279 ? 2.9269 2.7610 2.8735 0.9941  -0.7683 0.3103  352 LYS A CD  
2183 C CE  . LYS A 279 ? 2.8555 2.6991 2.7954 1.0046  -0.7982 0.3457  352 LYS A CE  
2184 N NZ  . LYS A 279 ? 2.8046 2.7035 2.7809 1.0558  -0.8069 0.3330  352 LYS A NZ  
2185 N N   . PHE A 280 ? 2.5551 2.8043 2.5864 0.9021  -0.7364 0.3110  353 PHE A N   
2186 C CA  . PHE A 280 ? 2.4491 2.7530 2.4677 0.8610  -0.7375 0.3260  353 PHE A CA  
2187 C C   . PHE A 280 ? 2.4511 2.6778 2.4183 0.8313  -0.7541 0.3624  353 PHE A C   
2188 O O   . PHE A 280 ? 1.9836 2.2125 1.9259 0.7923  -0.7455 0.3680  353 PHE A O   
2189 C CB  . PHE A 280 ? 2.5829 2.9899 2.6279 0.8694  -0.7513 0.3317  353 PHE A CB  
2190 C CG  . PHE A 280 ? 2.4172 2.8988 2.4541 0.8279  -0.7468 0.3355  353 PHE A CG  
2191 C CD1 . PHE A 280 ? 2.1532 2.7167 2.2168 0.8166  -0.7216 0.3054  353 PHE A CD1 
2192 C CD2 . PHE A 280 ? 2.4896 2.9591 2.4882 0.7987  -0.7674 0.3691  353 PHE A CD2 
2193 C CE1 . PHE A 280 ? 2.1548 2.7848 2.2067 0.7775  -0.7171 0.3075  353 PHE A CE1 
2194 C CE2 . PHE A 280 ? 2.2822 2.8185 2.2672 0.7601  -0.7628 0.3701  353 PHE A CE2 
2195 C CZ  . PHE A 280 ? 2.1643 2.7801 2.1758 0.7498  -0.7374 0.3388  353 PHE A CZ  
2196 N N   . ASN A 281 ? 2.5225 2.6815 2.4715 0.8500  -0.7776 0.3871  354 ASN A N   
2197 C CA  . ASN A 281 ? 2.5289 2.6117 2.4262 0.8223  -0.7940 0.4239  354 ASN A CA  
2198 C C   . ASN A 281 ? 2.5028 2.4825 2.3725 0.8115  -0.7818 0.4192  354 ASN A C   
2199 O O   . ASN A 281 ? 2.4954 2.4003 2.3204 0.7892  -0.7935 0.4479  354 ASN A O   
2200 C CB  . ASN A 281 ? 2.6743 2.7312 2.5612 0.8446  -0.8258 0.4555  354 ASN A CB  
2201 C CG  . ASN A 281 ? 2.7188 2.8466 2.5988 0.8257  -0.8452 0.4827  354 ASN A CG  
2202 O OD1 . ASN A 281 ? 2.7567 2.9742 2.6736 0.8420  -0.8503 0.4740  354 ASN A OD1 
2203 N ND2 . ASN A 281 ? 2.7431 2.8323 2.5733 0.7892  -0.8562 0.5158  354 ASN A ND2 
2204 N N   . ASN A 282 ? 2.1287 2.1071 2.0241 0.8253  -0.7585 0.3835  355 ASN A N   
2205 C CA  . ASN A 282 ? 2.3719 2.2591 2.2452 0.8144  -0.7463 0.3755  355 ASN A CA  
2206 C C   . ASN A 282 ? 2.2673 2.1455 2.1131 0.7666  -0.7339 0.3844  355 ASN A C   
2207 O O   . ASN A 282 ? 2.0175 1.9726 1.8736 0.7483  -0.7239 0.3786  355 ASN A O   
2208 C CB  . ASN A 282 ? 2.5308 2.4272 2.4382 0.8406  -0.7248 0.3347  355 ASN A CB  
2209 C CG  . ASN A 282 ? 2.5569 2.3774 2.4443 0.8212  -0.7094 0.3247  355 ASN A CG  
2210 O OD1 . ASN A 282 ? 2.2560 2.1076 2.1548 0.8015  -0.6864 0.3064  355 ASN A OD1 
2211 N ND2 . ASN A 282 ? 2.6731 2.3918 2.5287 0.8250  -0.7231 0.3376  355 ASN A ND2 
2212 N N   . ASN A 283 ? 2.3178 2.1016 2.1266 0.7461  -0.7352 0.3980  356 ASN A N   
2213 C CA  . ASN A 283 ? 2.1567 1.9234 1.9361 0.7011  -0.7247 0.4087  356 ASN A CA  
2214 C C   . ASN A 283 ? 2.4792 2.2696 2.2833 0.6952  -0.6955 0.3754  356 ASN A C   
2215 O O   . ASN A 283 ? 2.7771 2.5551 2.6071 0.7197  -0.6845 0.3485  356 ASN A O   
2216 C CB  . ASN A 283 ? 2.2101 1.8703 1.9422 0.6787  -0.7367 0.4361  356 ASN A CB  
2217 C CG  . ASN A 283 ? 2.2776 1.9233 1.9757 0.6300  -0.7284 0.4526  356 ASN A CG  
2218 O OD1 . ASN A 283 ? 2.5062 2.1303 2.2069 0.6142  -0.7096 0.4381  356 ASN A OD1 
2219 N ND2 . ASN A 283 ? 2.1477 1.8070 1.8128 0.6055  -0.7428 0.4837  356 ASN A ND2 
2220 N N   . CYS A 284 ? 2.6974 2.5213 2.4906 0.6630  -0.6834 0.3773  357 CYS A N   
2221 C CA  . CYS A 284 ? 2.4255 2.2734 2.2395 0.6554  -0.6562 0.3487  357 CYS A CA  
2222 C C   . CYS A 284 ? 2.4850 2.2699 2.2650 0.6185  -0.6493 0.3624  357 CYS A C   
2223 O O   . CYS A 284 ? 2.8500 2.6178 2.6429 0.6140  -0.6303 0.3434  357 CYS A O   
2224 C CB  . CYS A 284 ? 2.4134 2.3650 2.2478 0.6525  -0.6450 0.3334  357 CYS A CB  
2225 S SG  . CYS A 284 ? 3.0515 3.0912 2.9225 0.6864  -0.6563 0.3247  357 CYS A SG  
2226 N N   . TYR A 285 ? 2.2576 2.0112 1.9941 0.5906  -0.6653 0.3967  358 TYR A N   
2227 C CA  . TYR A 285 ? 2.3734 2.0756 2.0762 0.5476  -0.6574 0.4144  358 TYR A CA  
2228 C C   . TYR A 285 ? 2.7277 2.3423 2.4250 0.5483  -0.6588 0.4153  358 TYR A C   
2229 O O   . TYR A 285 ? 2.9230 2.5242 2.6299 0.5349  -0.6395 0.4016  358 TYR A O   
2230 C CB  . TYR A 285 ? 2.4806 2.1698 2.1384 0.5156  -0.6733 0.4523  358 TYR A CB  
2231 C CG  . TYR A 285 ? 2.4736 2.1508 2.1073 0.4571  -0.6474 0.4660  358 TYR A CG  
2232 C CD1 . TYR A 285 ? 2.5225 2.2731 2.1624 0.4225  -0.6131 0.4550  358 TYR A CD1 
2233 C CD2 . TYR A 285 ? 2.5189 2.1125 2.1221 0.4365  -0.6576 0.4900  358 TYR A CD2 
2234 C CE1 . TYR A 285 ? 2.6146 2.3589 2.2336 0.3732  -0.5882 0.4659  358 TYR A CE1 
2235 C CE2 . TYR A 285 ? 2.4822 2.0749 2.0662 0.3838  -0.6332 0.5030  358 TYR A CE2 
2236 C CZ  . TYR A 285 ? 2.5894 2.2593 2.1826 0.3545  -0.5978 0.4902  358 TYR A CZ  
2237 O OH  . TYR A 285 ? 2.8464 2.5195 2.4216 0.3062  -0.5722 0.5015  358 TYR A OH  
2238 N N   . GLN A 286 ? 2.7617 2.3209 2.4450 0.5605  -0.6782 0.4302  359 GLN A N   
2239 C CA  . GLN A 286 ? 2.7615 2.2338 2.4335 0.5582  -0.6810 0.4311  359 GLN A CA  
2240 C C   . GLN A 286 ? 2.8607 2.3396 2.5711 0.5832  -0.6628 0.3926  359 GLN A C   
2241 O O   . GLN A 286 ? 3.0728 2.5023 2.7777 0.5674  -0.6543 0.3876  359 GLN A O   
2242 C CB  . GLN A 286 ? 2.9358 2.3538 2.5873 0.5755  -0.7069 0.4487  359 GLN A CB  
2243 C CG  . GLN A 286 ? 2.9961 2.3166 2.6277 0.5720  -0.7141 0.4501  359 GLN A CG  
2244 C CD  . GLN A 286 ? 3.2861 2.5506 2.8954 0.5922  -0.7412 0.4660  359 GLN A CD  
2245 O OE1 . GLN A 286 ? 3.5537 2.8568 3.1679 0.6128  -0.7538 0.4751  359 GLN A OE1 
2246 N NE2 . GLN A 286 ? 3.3305 2.5026 2.9139 0.5858  -0.7517 0.4698  359 GLN A NE2 
2247 N N   . ASP A 287 ? 2.6501 2.1937 2.3985 0.6198  -0.6570 0.3663  360 ASP A N   
2248 C CA  . ASP A 287 ? 2.5362 2.0974 2.3211 0.6437  -0.6387 0.3288  360 ASP A CA  
2249 C C   . ASP A 287 ? 2.5540 2.1353 2.3503 0.6202  -0.6146 0.3155  360 ASP A C   
2250 O O   . ASP A 287 ? 2.4629 1.9969 2.2585 0.6130  -0.6063 0.3056  360 ASP A O   
2251 C CB  . ASP A 287 ? 2.4580 2.1027 2.2818 0.6803  -0.6350 0.3059  360 ASP A CB  
2252 C CG  . ASP A 287 ? 2.8262 2.4547 2.6453 0.7102  -0.6582 0.3159  360 ASP A CG  
2253 O OD1 . ASP A 287 ? 3.0288 2.6006 2.8115 0.6974  -0.6790 0.3474  360 ASP A OD1 
2254 O OD2 . ASP A 287 ? 2.9396 2.6132 2.7908 0.7463  -0.6556 0.2928  360 ASP A OD2 
2255 N N   . ALA A 288 ? 1.8107 1.4614 1.6154 0.6083  -0.6049 0.3156  361 ALA A N   
2256 C CA  . ALA A 288 ? 1.7402 1.4156 1.5552 0.5877  -0.5822 0.3037  361 ALA A CA  
2257 C C   . ALA A 288 ? 2.4322 2.0420 2.2216 0.5462  -0.5754 0.3229  361 ALA A C   
2258 O O   . ALA A 288 ? 2.6541 2.2523 2.4585 0.5350  -0.5558 0.3080  361 ALA A O   
2259 C CB  . ALA A 288 ? 1.6860 1.4490 1.5116 0.5623  -0.5598 0.3015  361 ALA A CB  
2260 N N   . LEU A 289 ? 2.1845 1.7553 1.9353 0.5223  -0.5924 0.3572  362 LEU A N   
2261 C CA  . LEU A 289 ? 2.2914 1.8066 2.0158 0.4793  -0.5878 0.3798  362 LEU A CA  
2262 C C   . LEU A 289 ? 2.3408 1.7747 2.0593 0.4924  -0.6024 0.3760  362 LEU A C   
2263 O O   . LEU A 289 ? 2.4825 1.9106 2.2128 0.4693  -0.5808 0.3675  362 LEU A O   
2264 C CB  . LEU A 289 ? 2.3805 1.8633 2.0600 0.4562  -0.6103 0.4193  362 LEU A CB  
2265 C CG  . LEU A 289 ? 2.4505 1.9017 2.1016 0.4021  -0.6008 0.4469  362 LEU A CG  
2266 C CD1 . LEU A 289 ? 2.6631 2.1397 2.2835 0.3735  -0.6042 0.4750  362 LEU A CD1 
2267 C CD2 . LEU A 289 ? 2.3763 1.7246 1.9972 0.3997  -0.6297 0.4667  362 LEU A CD2 
2268 N N   . VAL A 290 ? 2.1814 1.5743 1.8924 0.5169  -0.6201 0.3746  363 VAL A N   
2269 C CA  . VAL A 290 ? 2.1055 1.4278 1.8108 0.5218  -0.6246 0.3652  363 VAL A CA  
2270 C C   . VAL A 290 ? 2.4105 1.7586 2.1518 0.5372  -0.6032 0.3292  363 VAL A C   
2271 O O   . VAL A 290 ? 2.3394 1.6468 2.0755 0.5173  -0.5978 0.3279  363 VAL A O   
2272 C CB  . VAL A 290 ? 2.2142 1.4976 1.9085 0.5533  -0.6457 0.3637  363 VAL A CB  
2273 C CG1 . VAL A 290 ? 2.3114 1.5330 2.0043 0.5675  -0.6479 0.3426  363 VAL A CG1 
2274 C CG2 . VAL A 290 ? 2.7278 1.9616 2.3784 0.5307  -0.6691 0.4028  363 VAL A CG2 
2275 N N   . THR A 291 ? 2.5613 1.9797 2.3383 0.5700  -0.5916 0.3016  364 THR A N   
2276 C CA  . THR A 291 ? 2.3372 1.7878 2.1484 0.5851  -0.5707 0.2668  364 THR A CA  
2277 C C   . THR A 291 ? 2.0564 1.5198 1.8750 0.5546  -0.5527 0.2685  364 THR A C   
2278 O O   . THR A 291 ? 2.1209 1.5582 1.9463 0.5489  -0.5440 0.2554  364 THR A O   
2279 C CB  . THR A 291 ? 2.0428 1.5813 1.8908 0.6177  -0.5599 0.2413  364 THR A CB  
2280 O OG1 . THR A 291 ? 2.0407 1.6392 1.8919 0.6055  -0.5562 0.2536  364 THR A OG1 
2281 C CG2 . THR A 291 ? 2.0920 1.6217 1.9387 0.6525  -0.5765 0.2363  364 THR A CG2 
2282 N N   . SER A 292 ? 1.8828 1.3906 1.7007 0.5315  -0.5436 0.2836  365 SER A N   
2283 C CA  . SER A 292 ? 1.7180 1.2599 1.5518 0.4900  -0.5089 0.2812  365 SER A CA  
2284 C C   . SER A 292 ? 1.8375 1.3107 1.6480 0.4572  -0.5138 0.3022  365 SER A C   
2285 O O   . SER A 292 ? 1.9521 1.4261 1.7792 0.4424  -0.4958 0.2913  365 SER A O   
2286 C CB  . SER A 292 ? 1.8501 1.4562 1.6855 0.4628  -0.4890 0.2910  365 SER A CB  
2287 O OG  . SER A 292 ? 1.8248 1.4985 1.6820 0.4876  -0.4837 0.2714  365 SER A OG  
2288 N N   . VAL A 293 ? 1.9013 1.3171 1.6724 0.4441  -0.5394 0.3338  366 VAL A N   
2289 C CA  . VAL A 293 ? 2.0420 1.3913 1.7865 0.4092  -0.5481 0.3577  366 VAL A CA  
2290 C C   . VAL A 293 ? 2.1829 1.4706 1.9270 0.4272  -0.5613 0.3421  366 VAL A C   
2291 O O   . VAL A 293 ? 2.1718 1.4410 1.9174 0.3979  -0.5515 0.3455  366 VAL A O   
2292 C CB  . VAL A 293 ? 2.2615 1.5534 1.9588 0.3948  -0.5787 0.3952  366 VAL A CB  
2293 C CG1 . VAL A 293 ? 2.3368 1.5516 2.0032 0.3598  -0.5931 0.4199  366 VAL A CG1 
2294 C CG2 . VAL A 293 ? 2.2190 1.5732 1.9131 0.3676  -0.5620 0.4121  366 VAL A CG2 
2295 N N   . VAL A 294 ? 2.2755 1.5523 2.0258 0.4698  -0.5716 0.3184  367 VAL A N   
2296 C CA  . VAL A 294 ? 2.3368 1.5767 2.0927 0.4819  -0.5705 0.2940  367 VAL A CA  
2297 C C   . VAL A 294 ? 2.2298 1.5149 2.0210 0.4831  -0.5470 0.2702  367 VAL A C   
2298 O O   . VAL A 294 ? 2.4328 1.6819 2.2204 0.4659  -0.5460 0.2681  367 VAL A O   
2299 C CB  . VAL A 294 ? 1.9059 1.1386 1.6643 0.5253  -0.5791 0.2701  367 VAL A CB  
2300 C CG1 . VAL A 294 ? 1.9286 1.1194 1.6864 0.5375  -0.5793 0.2442  367 VAL A CG1 
2301 C CG2 . VAL A 294 ? 1.9920 1.1727 1.7148 0.5251  -0.6042 0.2943  367 VAL A CG2 
2302 N N   . ASN A 295 ? 2.0689 1.4333 1.8926 0.5011  -0.5294 0.2536  368 ASN A N   
2303 C CA  . ASN A 295 ? 1.8952 1.3191 1.7567 0.4958  -0.4982 0.2290  368 ASN A CA  
2304 C C   . ASN A 295 ? 1.9401 1.3676 1.8057 0.4472  -0.4779 0.2438  368 ASN A C   
2305 O O   . ASN A 295 ? 2.1433 1.5679 2.0229 0.4400  -0.4674 0.2310  368 ASN A O   
2306 C CB  . ASN A 295 ? 1.9322 1.4491 1.8252 0.5077  -0.4759 0.2131  368 ASN A CB  
2307 C CG  . ASN A 295 ? 2.0522 1.6295 1.9808 0.4946  -0.4423 0.1924  368 ASN A CG  
2308 O OD1 . ASN A 295 ? 2.2735 1.8627 2.2198 0.5173  -0.4387 0.1666  368 ASN A OD1 
2309 N ND2 . ASN A 295 ? 2.1708 1.7860 2.1087 0.4584  -0.4177 0.2038  368 ASN A ND2 
2310 N N   . CYS A 296 ? 1.7924 1.2305 1.6461 0.4152  -0.4727 0.2708  369 CYS A N   
2311 C CA  . CYS A 296 ? 1.9063 1.3462 1.7605 0.3701  -0.4568 0.2892  369 CYS A CA  
2312 C C   . CYS A 296 ? 2.0951 1.4561 1.9214 0.3496  -0.4785 0.3075  369 CYS A C   
2313 O O   . CYS A 296 ? 2.2049 1.5692 2.0445 0.3275  -0.4660 0.3061  369 CYS A O   
2314 C CB  . CYS A 296 ? 1.8183 1.2944 1.6646 0.3435  -0.4450 0.3117  369 CYS A CB  
2315 S SG  . CYS A 296 ? 1.6564 1.2146 1.5275 0.3674  -0.4252 0.2895  369 CYS A SG  
2316 N N   . MET A 297 ? 2.6276 1.9158 2.4143 0.3561  -0.5124 0.3250  370 MET A N   
2317 C CA  . MET A 297 ? 2.7262 1.9337 2.4805 0.3307  -0.5351 0.3450  370 MET A CA  
2318 C C   . MET A 297 ? 2.6808 1.8603 2.4445 0.3487  -0.5383 0.3184  370 MET A C   
2319 O O   . MET A 297 ? 2.7059 1.8672 2.4692 0.3197  -0.5354 0.3235  370 MET A O   
2320 C CB  . MET A 297 ? 2.8748 2.0006 2.5814 0.3394  -0.5740 0.3664  370 MET A CB  
2321 C CG  . MET A 297 ? 2.9826 2.1189 2.6682 0.3046  -0.5751 0.4026  370 MET A CG  
2322 S SD  . MET A 297 ? 3.0675 2.2571 2.7698 0.2436  -0.5436 0.4222  370 MET A SD  
2323 C CE  . MET A 297 ? 2.9529 2.0463 2.5992 0.2006  -0.5789 0.4643  370 MET A CE  
2324 N N   . THR A 298 ? 2.2000 1.3846 1.9739 0.3971  -0.5430 0.2891  371 THR A N   
2325 C CA  . THR A 298 ? 2.1202 1.2841 1.9021 0.4208  -0.5452 0.2590  371 THR A CA  
2326 C C   . THR A 298 ? 2.1265 1.3487 1.9437 0.3946  -0.5138 0.2498  371 THR A C   
2327 O O   . THR A 298 ? 1.9485 1.1358 1.7601 0.3832  -0.5183 0.2437  371 THR A O   
2328 C CB  . THR A 298 ? 1.8448 1.0495 1.6464 0.4695  -0.5371 0.2239  371 THR A CB  
2329 O OG1 . THR A 298 ? 1.8982 1.0715 1.6754 0.4866  -0.5544 0.2296  371 THR A OG1 
2330 C CG2 . THR A 298 ? 2.1465 1.3357 1.9534 0.4885  -0.5346 0.1912  371 THR A CG2 
2331 N N   . SER A 299 ? 1.9685 1.2771 1.8196 0.3849  -0.4831 0.2493  372 SER A N   
2332 C CA  . SER A 299 ? 1.8354 1.1994 1.7195 0.3593  -0.4533 0.2448  372 SER A CA  
2333 C C   . SER A 299 ? 1.6975 1.0314 1.5678 0.3128  -0.4569 0.2734  372 SER A C   
2334 O O   . SER A 299 ? 2.0089 1.3464 1.8920 0.2959  -0.4494 0.2693  372 SER A O   
2335 C CB  . SER A 299 ? 1.8725 1.3239 1.7884 0.3560  -0.4220 0.2420  372 SER A CB  
2336 O OG  . SER A 299 ? 1.7276 1.2152 1.6586 0.3940  -0.4177 0.2159  372 SER A OG  
2337 N N   . PHE A 300 ? 1.7310 1.0383 1.5745 0.2911  -0.4694 0.3035  373 PHE A N   
2338 C CA  . PHE A 300 ? 1.8651 1.1544 1.6953 0.2429  -0.4720 0.3345  373 PHE A CA  
2339 C C   . PHE A 300 ? 2.0529 1.2632 1.8565 0.2312  -0.4983 0.3371  373 PHE A C   
2340 O O   . PHE A 300 ? 2.1152 1.3358 1.9284 0.1977  -0.4911 0.3469  373 PHE A O   
2341 C CB  . PHE A 300 ? 2.2653 1.5389 2.0664 0.2230  -0.4831 0.3663  373 PHE A CB  
2342 C CG  . PHE A 300 ? 2.2443 1.5139 2.0337 0.1703  -0.4827 0.4001  373 PHE A CG  
2343 C CD1 . PHE A 300 ? 2.0654 1.4144 1.8893 0.1446  -0.4495 0.4061  373 PHE A CD1 
2344 C CD2 . PHE A 300 ? 2.1935 1.3810 1.9368 0.1466  -0.5160 0.4265  373 PHE A CD2 
2345 C CE1 . PHE A 300 ? 2.0213 1.3773 1.8378 0.0970  -0.4480 0.4374  373 PHE A CE1 
2346 C CE2 . PHE A 300 ? 2.1707 1.3614 1.9036 0.0944  -0.5157 0.4592  373 PHE A CE2 
2347 C CZ  . PHE A 300 ? 2.1609 1.4407 1.9323 0.0700  -0.4809 0.4646  373 PHE A CZ  
2348 N N   . VAL A 301 ? 2.1731 1.3046 1.9424 0.2592  -0.5294 0.3283  374 VAL A N   
2349 C CA  . VAL A 301 ? 2.1707 1.2162 1.9077 0.2506  -0.5566 0.3274  374 VAL A CA  
2350 C C   . VAL A 301 ? 2.1857 1.2531 1.9484 0.2679  -0.5439 0.2943  374 VAL A C   
2351 O O   . VAL A 301 ? 2.3560 1.3855 2.1062 0.2453  -0.5536 0.2951  374 VAL A O   
2352 C CB  . VAL A 301 ? 2.0810 1.0275 1.7691 0.2785  -0.5951 0.3273  374 VAL A CB  
2353 C CG1 . VAL A 301 ? 2.4398 1.3588 2.0975 0.2539  -0.6106 0.3651  374 VAL A CG1 
2354 C CG2 . VAL A 301 ? 2.0617 1.0344 1.7665 0.3367  -0.5886 0.2922  374 VAL A CG2 
2355 N N   . SER A 302 ? 1.7694 0.8999 1.5662 0.3051  -0.5227 0.2663  375 SER A N   
2356 C CA  . SER A 302 ? 1.7207 0.8847 1.5445 0.3199  -0.5071 0.2359  375 SER A CA  
2357 C C   . SER A 302 ? 2.0820 1.2963 1.9334 0.2782  -0.4853 0.2485  375 SER A C   
2358 O O   . SER A 302 ? 1.6587 0.8693 1.5162 0.2720  -0.4840 0.2355  375 SER A O   
2359 C CB  . SER A 302 ? 2.2668 1.4995 2.1233 0.3606  -0.4866 0.2087  375 SER A CB  
2360 O OG  . SER A 302 ? 2.2496 1.4432 2.0842 0.4024  -0.5072 0.1964  375 SER A OG  
2361 N N   . GLY A 303 ? 2.0093 1.2725 1.8769 0.2508  -0.4685 0.2736  376 GLY A N   
2362 C CA  . GLY A 303 ? 1.6374 0.9498 1.5310 0.2119  -0.4489 0.2898  376 GLY A CA  
2363 C C   . GLY A 303 ? 1.7733 1.0290 1.6416 0.1763  -0.4706 0.3067  376 GLY A C   
2364 O O   . GLY A 303 ? 1.9573 1.2387 1.8454 0.1583  -0.4617 0.3045  376 GLY A O   
2365 N N   . PHE A 304 ? 2.2684 1.4450 2.0907 0.1648  -0.5009 0.3246  377 PHE A N   
2366 C CA  . PHE A 304 ? 2.2467 1.3568 2.0361 0.1282  -0.5264 0.3414  377 PHE A CA  
2367 C C   . PHE A 304 ? 2.0840 1.1426 1.8587 0.1484  -0.5412 0.3117  377 PHE A C   
2368 O O   . PHE A 304 ? 2.0928 1.1420 1.8654 0.1192  -0.5462 0.3152  377 PHE A O   
2369 C CB  . PHE A 304 ? 2.2801 1.3096 2.0184 0.1118  -0.5574 0.3678  377 PHE A CB  
2370 C CG  . PHE A 304 ? 2.0604 1.1365 1.8060 0.0783  -0.5455 0.4028  377 PHE A CG  
2371 C CD1 . PHE A 304 ? 2.0464 1.1446 1.7948 0.0243  -0.5431 0.4332  377 PHE A CD1 
2372 C CD2 . PHE A 304 ? 2.1847 1.2871 1.9338 0.1000  -0.5366 0.4052  377 PHE A CD2 
2373 C CE1 . PHE A 304 ? 2.1499 1.2970 1.9046 -0.0059 -0.5304 0.4643  377 PHE A CE1 
2374 C CE2 . PHE A 304 ? 2.3164 1.4630 2.0691 0.0688  -0.5248 0.4359  377 PHE A CE2 
2375 C CZ  . PHE A 304 ? 2.1653 1.3350 1.9208 0.0166  -0.5208 0.4650  377 PHE A CZ  
2376 N N   . VAL A 305 ? 2.0158 1.0454 1.7802 0.1982  -0.5481 0.2823  378 VAL A N   
2377 C CA  . VAL A 305 ? 1.9761 0.9608 1.7253 0.2236  -0.5601 0.2497  378 VAL A CA  
2378 C C   . VAL A 305 ? 1.9591 1.0156 1.7490 0.2159  -0.5349 0.2349  378 VAL A C   
2379 O O   . VAL A 305 ? 1.8431 0.8657 1.6179 0.2055  -0.5457 0.2237  378 VAL A O   
2380 C CB  . VAL A 305 ? 2.0415 1.0078 1.7833 0.2832  -0.5653 0.2195  378 VAL A CB  
2381 C CG1 . VAL A 305 ? 2.0977 1.0288 1.8262 0.3112  -0.5734 0.1830  378 VAL A CG1 
2382 C CG2 . VAL A 305 ? 2.4251 1.3113 2.1230 0.2926  -0.5947 0.2353  378 VAL A CG2 
2383 N N   . ILE A 306 ? 2.0924 1.2452 1.9311 0.2198  -0.5023 0.2356  379 ILE A N   
2384 C CA  . ILE A 306 ? 2.0348 1.2579 1.9135 0.2136  -0.4779 0.2242  379 ILE A CA  
2385 C C   . ILE A 306 ? 1.7433 0.9841 1.6312 0.1626  -0.4762 0.2521  379 ILE A C   
2386 O O   . ILE A 306 ? 1.6286 0.8656 1.5172 0.1484  -0.4800 0.2452  379 ILE A O   
2387 C CB  . ILE A 306 ? 1.9165 1.2297 1.8407 0.2346  -0.4450 0.2159  379 ILE A CB  
2388 C CG1 . ILE A 306 ? 2.0318 1.3412 1.9523 0.2844  -0.4455 0.1844  379 ILE A CG1 
2389 C CG2 . ILE A 306 ? 1.5133 0.8969 1.4780 0.2211  -0.4207 0.2124  379 ILE A CG2 
2390 C CD1 . ILE A 306 ? 1.9820 1.2730 1.8950 0.3056  -0.4513 0.1528  379 ILE A CD1 
2391 N N   . PHE A 307 ? 1.9570 1.2210 1.8518 0.1345  -0.4708 0.2840  380 PHE A N   
2392 C CA  . PHE A 307 ? 1.8235 1.1290 1.7382 0.0886  -0.4630 0.3116  380 PHE A CA  
2393 C C   . PHE A 307 ? 2.0909 1.3271 1.9661 0.0483  -0.4939 0.3306  380 PHE A C   
2394 O O   . PHE A 307 ? 1.8001 1.0712 1.6912 0.0087  -0.4906 0.3523  380 PHE A O   
2395 C CB  . PHE A 307 ? 1.7230 1.0886 1.6610 0.0742  -0.4427 0.3373  380 PHE A CB  
2396 C CG  . PHE A 307 ? 1.7143 1.1703 1.7026 0.0941  -0.4067 0.3259  380 PHE A CG  
2397 C CD1 . PHE A 307 ? 2.0483 1.5704 2.0755 0.0759  -0.3876 0.3339  380 PHE A CD1 
2398 C CD2 . PHE A 307 ? 1.6200 1.0931 1.6154 0.1309  -0.3935 0.3077  380 PHE A CD2 
2399 C CE1 . PHE A 307 ? 1.8592 1.4552 1.9286 0.0951  -0.3562 0.3235  380 PHE A CE1 
2400 C CE2 . PHE A 307 ? 1.5763 1.1249 1.6129 0.1464  -0.3621 0.2972  380 PHE A CE2 
2401 C CZ  . PHE A 307 ? 1.7985 1.4047 1.8708 0.1291  -0.3436 0.3048  380 PHE A CZ  
2402 N N   . THR A 308 ? 2.3729 1.5112 2.1963 0.0579  -0.5246 0.3231  381 THR A N   
2403 C CA  . THR A 308 ? 2.3652 1.4258 2.1448 0.0207  -0.5564 0.3360  381 THR A CA  
2404 C C   . THR A 308 ? 2.4374 1.4938 2.2196 0.0241  -0.5586 0.3112  381 THR A C   
2405 O O   . THR A 308 ? 2.4194 1.4760 2.1980 -0.0176 -0.5675 0.3259  381 THR A O   
2406 C CB  . THR A 308 ? 2.5777 1.5231 2.2954 0.0320  -0.5909 0.3344  381 THR A CB  
2407 O OG1 . THR A 308 ? 2.8668 1.7954 2.5825 0.0913  -0.5880 0.2999  381 THR A OG1 
2408 C CG2 . THR A 308 ? 2.6770 1.6138 2.3804 0.0061  -0.5975 0.3710  381 THR A CG2 
2409 N N   . VAL A 309 ? 2.3828 1.4413 2.1717 0.0727  -0.5500 0.2742  382 VAL A N   
2410 C CA  . VAL A 309 ? 2.1355 1.1937 1.9253 0.0808  -0.5501 0.2471  382 VAL A CA  
2411 C C   . VAL A 309 ? 1.9292 1.0910 1.7748 0.0641  -0.5218 0.2548  382 VAL A C   
2412 O O   . VAL A 309 ? 2.0388 1.2060 1.8847 0.0422  -0.5266 0.2525  382 VAL A O   
2413 C CB  . VAL A 309 ? 2.0102 1.0481 1.7916 0.1384  -0.5478 0.2059  382 VAL A CB  
2414 C CG1 . VAL A 309 ? 1.8669 0.8944 1.6392 0.1440  -0.5512 0.1775  382 VAL A CG1 
2415 C CG2 . VAL A 309 ? 2.3477 1.2887 2.0787 0.1608  -0.5748 0.2005  382 VAL A CG2 
2416 N N   . LEU A 310 ? 1.6732 0.9146 1.5636 0.0748  -0.4934 0.2638  383 LEU A N   
2417 C CA  . LEU A 310 ? 1.5634 0.9004 1.5068 0.0618  -0.4664 0.2732  383 LEU A CA  
2418 C C   . LEU A 310 ? 1.5744 0.9340 1.5261 0.0100  -0.4710 0.3107  383 LEU A C   
2419 O O   . LEU A 310 ? 1.5288 0.9505 1.5148 -0.0084 -0.4589 0.3199  383 LEU A O   
2420 C CB  . LEU A 310 ? 1.4860 0.8935 1.4697 0.0896  -0.4354 0.2701  383 LEU A CB  
2421 C CG  . LEU A 310 ? 1.4256 0.8768 1.4357 0.1248  -0.4154 0.2397  383 LEU A CG  
2422 C CD1 . LEU A 310 ? 1.6736 1.0642 1.6490 0.1578  -0.4313 0.2066  383 LEU A CD1 
2423 C CD2 . LEU A 310 ? 1.8754 1.3915 1.9212 0.1450  -0.3867 0.2402  383 LEU A CD2 
2424 N N   . GLY A 311 ? 1.8743 1.1862 1.7949 -0.0137 -0.4891 0.3337  384 GLY A N   
2425 C CA  . GLY A 311 ? 1.9277 1.2555 1.8494 -0.0672 -0.4976 0.3704  384 GLY A CA  
2426 C C   . GLY A 311 ? 2.1087 1.3879 2.0014 -0.0971 -0.5238 0.3691  384 GLY A C   
2427 O O   . GLY A 311 ? 1.7002 1.0275 1.6144 -0.1347 -0.5227 0.3899  384 GLY A O   
2428 N N   . TYR A 312 ? 2.1558 1.3398 1.9985 -0.0792 -0.5479 0.3438  385 TYR A N   
2429 C CA  . TYR A 312 ? 2.2761 1.4037 2.0840 -0.1017 -0.5731 0.3346  385 TYR A CA  
2430 C C   . TYR A 312 ? 2.0399 1.2354 1.8857 -0.0932 -0.5554 0.3183  385 TYR A C   
2431 O O   . TYR A 312 ? 2.1397 1.3387 1.9806 -0.1285 -0.5675 0.3263  385 TYR A O   
2432 C CB  . TYR A 312 ? 2.5895 1.6014 2.3362 -0.0736 -0.5991 0.3051  385 TYR A CB  
2433 C CG  . TYR A 312 ? 2.5611 1.5223 2.2753 -0.0780 -0.6172 0.2803  385 TYR A CG  
2434 C CD1 . TYR A 312 ? 2.3681 1.2755 2.0436 -0.1297 -0.6459 0.2968  385 TYR A CD1 
2435 C CD2 . TYR A 312 ? 2.6112 1.5791 2.3308 -0.0324 -0.6060 0.2402  385 TYR A CD2 
2436 C CE1 . TYR A 312 ? 2.3095 1.1681 1.9509 -0.1351 -0.6629 0.2727  385 TYR A CE1 
2437 C CE2 . TYR A 312 ? 2.6350 1.5584 2.3219 -0.0365 -0.6216 0.2161  385 TYR A CE2 
2438 C CZ  . TYR A 312 ? 2.4459 1.3128 2.0928 -0.0874 -0.6501 0.2318  385 TYR A CZ  
2439 O OH  . TYR A 312 ? 2.3039 1.1242 1.9142 -0.0929 -0.6661 0.2065  385 TYR A OH  
2440 N N   . MET A 313 ? 2.4696 1.7190 2.3517 -0.0484 -0.5279 0.2968  386 MET A N   
2441 C CA  . MET A 313 ? 2.3410 1.6548 2.2587 -0.0371 -0.5100 0.2815  386 MET A CA  
2442 C C   . MET A 313 ? 2.0637 1.4701 2.0320 -0.0692 -0.4940 0.3132  386 MET A C   
2443 O O   . MET A 313 ? 2.1633 1.6018 2.1454 -0.0873 -0.4954 0.3152  386 MET A O   
2444 C CB  . MET A 313 ? 2.3985 1.7452 2.3399 0.0159  -0.4854 0.2532  386 MET A CB  
2445 C CG  . MET A 313 ? 2.2917 1.6720 2.2483 0.0328  -0.4751 0.2280  386 MET A CG  
2446 S SD  . MET A 313 ? 2.5720 1.8603 2.4672 0.0360  -0.5045 0.1961  386 MET A SD  
2447 C CE  . MET A 313 ? 2.6282 1.9818 2.5520 0.0583  -0.4838 0.1698  386 MET A CE  
2448 N N   . ALA A 314 ? 2.1816 1.6325 2.1770 -0.0748 -0.4788 0.3378  387 ALA A N   
2449 C CA  . ALA A 314 ? 2.0120 1.5541 2.0567 -0.1011 -0.4621 0.3684  387 ALA A CA  
2450 C C   . ALA A 314 ? 1.7910 1.3206 1.8188 -0.1566 -0.4865 0.3966  387 ALA A C   
2451 O O   . ALA A 314 ? 1.8699 1.4690 1.9333 -0.1807 -0.4806 0.4157  387 ALA A O   
2452 C CB  . ALA A 314 ? 2.2979 1.8863 2.3696 -0.0918 -0.4397 0.3847  387 ALA A CB  
2453 N N   . GLU A 315 ? 2.2060 1.6459 2.1782 -0.1773 -0.5153 0.4001  388 GLU A N   
2454 C CA  . GLU A 315 ? 2.3967 1.8101 2.3423 -0.2342 -0.5430 0.4257  388 GLU A CA  
2455 C C   . GLU A 315 ? 2.1106 1.5056 2.0421 -0.2454 -0.5586 0.4099  388 GLU A C   
2456 O O   . GLU A 315 ? 2.1539 1.5869 2.0970 -0.2887 -0.5678 0.4328  388 GLU A O   
2457 C CB  . GLU A 315 ? 2.6440 1.9517 2.5261 -0.2515 -0.5722 0.4312  388 GLU A CB  
2458 C CG  . GLU A 315 ? 2.4409 1.7076 2.2860 -0.3147 -0.6046 0.4573  388 GLU A CG  
2459 C CD  . GLU A 315 ? 2.2608 1.6125 2.1416 -0.3605 -0.5964 0.5022  388 GLU A CD  
2460 O OE1 . GLU A 315 ? 2.2072 1.5536 2.0710 -0.4164 -0.6190 0.5267  388 GLU A OE1 
2461 O OE2 . GLU A 315 ? 2.3175 1.7431 2.2421 -0.3413 -0.5674 0.5125  388 GLU A OE2 
2462 N N   . MET A 316 ? 2.6018 1.9431 2.5083 -0.2067 -0.5611 0.3709  389 MET A N   
2463 C CA  . MET A 316 ? 2.7946 2.1137 2.6815 -0.2134 -0.5750 0.3511  389 MET A CA  
2464 C C   . MET A 316 ? 2.5296 1.9547 2.4763 -0.2092 -0.5518 0.3556  389 MET A C   
2465 O O   . MET A 316 ? 2.5424 1.9768 2.4844 -0.2320 -0.5634 0.3547  389 MET A O   
2466 C CB  . MET A 316 ? 2.9940 2.2324 2.8383 -0.1692 -0.5815 0.3067  389 MET A CB  
2467 C CG  . MET A 316 ? 2.8148 2.0070 2.6210 -0.1795 -0.6014 0.2835  389 MET A CG  
2468 S SD  . MET A 316 ? 2.8664 1.9516 2.6123 -0.1295 -0.6130 0.2320  389 MET A SD  
2469 C CE  . MET A 316 ? 2.6826 1.8468 2.4835 -0.0677 -0.5734 0.2117  389 MET A CE  
2470 N N   . ARG A 317 ? 2.5540 2.0555 2.5540 -0.1804 -0.5201 0.3607  390 ARG A N   
2471 C CA  . ARG A 317 ? 2.1853 1.7858 2.2435 -0.1736 -0.4973 0.3680  390 ARG A CA  
2472 C C   . ARG A 317 ? 1.8623 1.5432 1.9644 -0.2069 -0.4896 0.4097  390 ARG A C   
2473 O O   . ARG A 317 ? 1.7048 1.3878 1.7970 -0.2538 -0.5103 0.4329  390 ARG A O   
2474 C CB  . ARG A 317 ? 2.1852 1.8179 2.2729 -0.1204 -0.4673 0.3456  390 ARG A CB  
2475 C CG  . ARG A 317 ? 2.0024 1.5797 2.0567 -0.0872 -0.4715 0.3045  390 ARG A CG  
2476 C CD  . ARG A 317 ? 1.9939 1.5910 2.0682 -0.0381 -0.4455 0.2837  390 ARG A CD  
2477 N NE  . ARG A 317 ? 1.9874 1.6741 2.1185 -0.0267 -0.4180 0.2935  390 ARG A NE  
2478 C CZ  . ARG A 317 ? 2.1756 1.8889 2.3266 0.0112  -0.3952 0.2749  390 ARG A CZ  
2479 N NH1 . ARG A 317 ? 2.1939 1.8603 2.3167 0.0415  -0.3958 0.2458  390 ARG A NH1 
2480 N NH2 . ARG A 317 ? 2.3471 2.1338 2.5457 0.0189  -0.3726 0.2856  390 ARG A NH2 
2481 N N   . ASN A 318 ? 2.0454 1.7939 2.1947 -0.1832 -0.4600 0.4189  391 ASN A N   
2482 C CA  . ASN A 318 ? 1.9951 1.8264 2.1883 -0.2087 -0.4491 0.4563  391 ASN A CA  
2483 C C   . ASN A 318 ? 2.2853 2.1522 2.5046 -0.1835 -0.4217 0.4617  391 ASN A C   
2484 O O   . ASN A 318 ? 2.0902 2.0376 2.3611 -0.1644 -0.3948 0.4688  391 ASN A O   
2485 C CB  . ASN A 318 ? 1.8855 1.8032 2.1288 -0.2115 -0.4390 0.4679  391 ASN A CB  
2486 C CG  . ASN A 318 ? 2.0112 1.9343 2.2437 -0.2622 -0.4665 0.4886  391 ASN A CG  
2487 O OD1 . ASN A 318 ? 1.9912 1.8801 2.1929 -0.3029 -0.4878 0.5060  391 ASN A OD1 
2488 N ND2 . ASN A 318 ? 2.2206 2.1861 2.4763 -0.2623 -0.4673 0.4880  391 ASN A ND2 
2489 N N   . GLU A 319 ? 2.5890 2.3915 2.7693 -0.1834 -0.4298 0.4579  392 GLU A N   
2490 C CA  . GLU A 319 ? 2.4917 2.3214 2.6868 -0.1708 -0.4093 0.4680  392 GLU A CA  
2491 C C   . GLU A 319 ? 2.2713 2.1443 2.5019 -0.1212 -0.3764 0.4486  392 GLU A C   
2492 O O   . GLU A 319 ? 2.0866 1.9562 2.3244 -0.0935 -0.3709 0.4242  392 GLU A O   
2493 C CB  . GLU A 319 ? 2.4091 2.3136 2.6345 -0.2090 -0.4041 0.5076  392 GLU A CB  
2494 C CG  . GLU A 319 ? 2.6086 2.4973 2.8133 -0.2250 -0.4044 0.5253  392 GLU A CG  
2495 C CD  . GLU A 319 ? 2.8778 2.8575 3.1189 -0.2585 -0.3934 0.5630  392 GLU A CD  
2496 O OE1 . GLU A 319 ? 2.6776 2.7127 2.9467 -0.2831 -0.3979 0.5800  392 GLU A OE1 
2497 O OE2 . GLU A 319 ? 3.1613 3.1616 3.4034 -0.2601 -0.3799 0.5757  392 GLU A OE2 
2498 N N   . ASP A 320 ? 2.2585 2.1814 2.5141 -0.1141 -0.3535 0.4620  393 ASP A N   
2499 C CA  . ASP A 320 ? 2.0195 1.9853 2.3083 -0.0714 -0.3224 0.4455  393 ASP A CA  
2500 C C   . ASP A 320 ? 1.9561 1.8586 2.2161 -0.0361 -0.3240 0.4110  393 ASP A C   
2501 O O   . ASP A 320 ? 1.9038 1.8149 2.1776 -0.0089 -0.3144 0.3895  393 ASP A O   
2502 C CB  . ASP A 320 ? 2.1678 2.2027 2.5039 -0.0638 -0.3089 0.4487  393 ASP A CB  
2503 N N   . VAL A 321 ? 2.0349 1.8754 2.2541 -0.0376 -0.3369 0.4072  394 VAL A N   
2504 C CA  . VAL A 321 ? 2.1304 1.9019 2.3149 -0.0092 -0.3466 0.3768  394 VAL A CA  
2505 C C   . VAL A 321 ? 2.0608 1.8646 2.2707 0.0316  -0.3217 0.3525  394 VAL A C   
2506 O O   . VAL A 321 ? 2.3052 2.0770 2.5011 0.0546  -0.3267 0.3254  394 VAL A O   
2507 C CB  . VAL A 321 ? 1.9646 1.6880 2.1146 -0.0085 -0.3547 0.3804  394 VAL A CB  
2508 C CG1 . VAL A 321 ? 1.9404 1.5811 2.0476 0.0142  -0.3746 0.3530  394 VAL A CG1 
2509 C CG2 . VAL A 321 ? 1.9693 1.6834 2.1032 -0.0539 -0.3712 0.4138  394 VAL A CG2 
2510 N N   . SER A 322 ? 1.7793 1.6485 2.0258 0.0397  -0.2945 0.3620  395 SER A N   
2511 C CA  . SER A 322 ? 1.7459 1.6411 2.0121 0.0756  -0.2707 0.3408  395 SER A CA  
2512 C C   . SER A 322 ? 1.9103 1.8097 2.1873 0.0854  -0.2730 0.3249  395 SER A C   
2513 O O   . SER A 322 ? 2.1413 2.0293 2.4140 0.1121  -0.2671 0.2997  395 SER A O   
2514 C CB  . SER A 322 ? 1.6680 1.6341 1.9730 0.0777  -0.2427 0.3563  395 SER A CB  
2515 O OG  . SER A 322 ? 1.8791 1.8784 2.2112 0.1046  -0.2218 0.3408  395 SER A OG  
2516 N N   . GLU A 323 ? 1.8583 1.7774 2.1484 0.0609  -0.2824 0.3415  396 GLU A N   
2517 C CA  . GLU A 323 ? 1.8569 1.7824 2.1557 0.0650  -0.2869 0.3301  396 GLU A CA  
2518 C C   . GLU A 323 ? 1.8300 1.6916 2.0893 0.0769  -0.3043 0.3018  396 GLU A C   
2519 O O   . GLU A 323 ? 1.8665 1.7328 2.1296 0.0992  -0.2968 0.2800  396 GLU A O   
2520 C CB  . GLU A 323 ? 2.0766 2.0278 2.3892 0.0312  -0.3001 0.3546  396 GLU A CB  
2521 C CG  . GLU A 323 ? 2.3075 2.3330 2.6643 0.0219  -0.2824 0.3827  396 GLU A CG  
2522 C CD  . GLU A 323 ? 2.5362 2.6114 2.9308 0.0523  -0.2556 0.3758  396 GLU A CD  
2523 O OE1 . GLU A 323 ? 2.5921 2.6657 2.9907 0.0640  -0.2570 0.3621  396 GLU A OE1 
2524 O OE2 . GLU A 323 ? 2.6614 2.7749 3.0787 0.0638  -0.2336 0.3838  396 GLU A OE2 
2525 N N   . VAL A 324 ? 1.6353 1.4373 1.8557 0.0620  -0.3277 0.3024  397 VAL A N   
2526 C CA  . VAL A 324 ? 1.6251 1.3622 1.8050 0.0757  -0.3455 0.2747  397 VAL A CA  
2527 C C   . VAL A 324 ? 1.5328 1.2591 1.7062 0.1126  -0.3332 0.2516  397 VAL A C   
2528 O O   . VAL A 324 ? 1.3873 1.0899 1.5439 0.1353  -0.3369 0.2238  397 VAL A O   
2529 C CB  . VAL A 324 ? 1.5136 1.1816 1.6500 0.0503  -0.3755 0.2825  397 VAL A CB  
2530 C CG1 . VAL A 324 ? 1.8582 1.5100 1.9845 0.0436  -0.3764 0.3000  397 VAL A CG1 
2531 C CG2 . VAL A 324 ? 1.5705 1.1693 1.6639 0.0684  -0.3940 0.2513  397 VAL A CG2 
2532 N N   . ALA A 325 ? 1.4720 1.2208 1.6591 0.1180  -0.3181 0.2631  398 ALA A N   
2533 C CA  . ALA A 325 ? 1.3428 1.0879 1.5253 0.1497  -0.3064 0.2441  398 ALA A CA  
2534 C C   . ALA A 325 ? 1.6846 1.4926 1.9048 0.1645  -0.2773 0.2414  398 ALA A C   
2535 O O   . ALA A 325 ? 1.9437 1.7658 2.1686 0.1788  -0.2626 0.2393  398 ALA A O   
2536 C CB  . ALA A 325 ? 1.3384 1.0552 1.5008 0.1458  -0.3125 0.2564  398 ALA A CB  
2537 N N   . LYS A 326 ? 1.6555 1.4980 1.8997 0.1603  -0.2702 0.2420  399 LYS A N   
2538 C CA  . LYS A 326 ? 1.6983 1.5917 1.9745 0.1748  -0.2451 0.2388  399 LYS A CA  
2539 C C   . LYS A 326 ? 2.1709 2.0569 2.4366 0.2022  -0.2381 0.2106  399 LYS A C   
2540 O O   . LYS A 326 ? 1.8793 1.7871 2.1556 0.2160  -0.2197 0.2065  399 LYS A O   
2541 C CB  . LYS A 326 ? 1.8401 1.7659 2.1405 0.1643  -0.2433 0.2466  399 LYS A CB  
2542 C CG  . LYS A 326 ? 2.0882 2.0596 2.4219 0.1490  -0.2327 0.2750  399 LYS A CG  
2543 C CD  . LYS A 326 ? 2.0260 2.0313 2.3850 0.1433  -0.2316 0.2823  399 LYS A CD  
2544 C CE  . LYS A 326 ? 1.8221 1.8809 2.2195 0.1353  -0.2185 0.3093  399 LYS A CE  
2545 N NZ  . LYS A 326 ? 1.5725 1.6650 1.9955 0.1312  -0.2196 0.3188  399 LYS A NZ  
2546 N N   . ASP A 327 ? 2.6306 2.4872 2.8741 0.2088  -0.2532 0.1911  400 ASP A N   
2547 C CA  . ASP A 327 ? 2.6714 2.5262 2.9045 0.2339  -0.2485 0.1641  400 ASP A CA  
2548 C C   . ASP A 327 ? 2.5193 2.3540 2.7369 0.2469  -0.2495 0.1608  400 ASP A C   
2549 O O   . ASP A 327 ? 2.5698 2.3663 2.7674 0.2396  -0.2654 0.1699  400 ASP A O   
2550 C CB  . ASP A 327 ? 2.6007 2.4288 2.8104 0.2402  -0.2651 0.1426  400 ASP A CB  
2551 C CG  . ASP A 327 ? 2.5369 2.3463 2.7394 0.2167  -0.2816 0.1536  400 ASP A CG  
2552 O OD1 . ASP A 327 ? 2.5888 2.3890 2.7943 0.1959  -0.2880 0.1772  400 ASP A OD1 
2553 O OD2 . ASP A 327 ? 2.4970 2.3035 2.6897 0.2173  -0.2884 0.1386  400 ASP A OD2 
2554 N N   . ALA A 328 ? 2.0294 1.8886 2.2542 0.2643  -0.2338 0.1489  401 ALA A N   
2555 C CA  . ALA A 328 ? 1.7802 1.6246 1.9895 0.2782  -0.2357 0.1440  401 ALA A CA  
2556 C C   . ALA A 328 ? 1.4194 1.2673 1.6182 0.3029  -0.2374 0.1167  401 ALA A C   
2557 O O   . ALA A 328 ? 1.3696 1.2501 1.5784 0.3121  -0.2220 0.1082  401 ALA A O   
2558 C CB  . ALA A 328 ? 2.0172 1.8907 2.2422 0.2745  -0.2159 0.1566  401 ALA A CB  
2559 N N   . GLY A 329 ? 1.4584 1.2735 1.6359 0.3132  -0.2562 0.1027  402 GLY A N   
2560 C CA  . GLY A 329 ? 1.4542 1.2773 1.6224 0.3391  -0.2587 0.0761  402 GLY A CA  
2561 C C   . GLY A 329 ? 1.6370 1.4142 1.7777 0.3526  -0.2813 0.0618  402 GLY A C   
2562 O O   . GLY A 329 ? 1.9495 1.6769 2.0719 0.3428  -0.2982 0.0741  402 GLY A O   
2563 N N   . PRO A 330 ? 1.4742 1.2674 1.6100 0.3747  -0.2818 0.0352  403 PRO A N   
2564 C CA  . PRO A 330 ? 1.7341 1.4858 1.8424 0.3928  -0.3013 0.0159  403 PRO A CA  
2565 C C   . PRO A 330 ? 1.7097 1.4276 1.8060 0.3713  -0.3119 0.0212  403 PRO A C   
2566 O O   . PRO A 330 ? 1.8882 1.5513 1.9545 0.3790  -0.3320 0.0118  403 PRO A O   
2567 C CB  . PRO A 330 ? 1.9681 1.7678 2.0829 0.4156  -0.2918 -0.0121 403 PRO A CB  
2568 C CG  . PRO A 330 ? 1.7148 1.5686 1.8541 0.4146  -0.2729 -0.0065 403 PRO A CG  
2569 C CD  . PRO A 330 ? 1.4544 1.3079 1.6089 0.3844  -0.2635 0.0212  403 PRO A CD  
2570 N N   . SER A 331 ? 1.3244 1.0733 1.4425 0.3447  -0.2993 0.0364  404 SER A N   
2571 C CA  . SER A 331 ? 1.3265 1.0534 1.4371 0.3205  -0.3088 0.0446  404 SER A CA  
2572 C C   . SER A 331 ? 1.4067 1.0768 1.4993 0.3032  -0.3272 0.0652  404 SER A C   
2573 O O   . SER A 331 ? 1.6483 1.2819 1.7219 0.2865  -0.3431 0.0676  404 SER A O   
2574 C CB  . SER A 331 ? 1.5833 1.3605 1.7252 0.2979  -0.2915 0.0603  404 SER A CB  
2575 O OG  . SER A 331 ? 1.6527 1.4795 1.8087 0.3101  -0.2753 0.0441  404 SER A OG  
2576 N N   . LEU A 332 ? 1.5007 1.1641 1.5971 0.3047  -0.3256 0.0804  405 LEU A N   
2577 C CA  . LEU A 332 ? 1.6986 1.3102 1.7760 0.2865  -0.3431 0.1020  405 LEU A CA  
2578 C C   . LEU A 332 ? 1.5908 1.1304 1.6257 0.3033  -0.3688 0.0859  405 LEU A C   
2579 O O   . LEU A 332 ? 2.0623 1.5443 2.0711 0.2845  -0.3893 0.0996  405 LEU A O   
2580 C CB  . LEU A 332 ? 1.2121 0.8402 1.3027 0.2842  -0.3332 0.1218  405 LEU A CB  
2581 C CG  . LEU A 332 ? 1.2457 0.8404 1.3251 0.2566  -0.3450 0.1516  405 LEU A CG  
2582 C CD1 . LEU A 332 ? 1.1981 0.8438 1.3074 0.2440  -0.3234 0.1733  405 LEU A CD1 
2583 C CD2 . LEU A 332 ? 1.3113 0.8399 1.3531 0.2691  -0.3679 0.1500  405 LEU A CD2 
2584 N N   . LEU A 333 ? 1.6111 1.1543 1.6382 0.3389  -0.3682 0.0568  406 LEU A N   
2585 C CA  . LEU A 333 ? 2.0123 1.4886 1.9996 0.3634  -0.3914 0.0374  406 LEU A CA  
2586 C C   . LEU A 333 ? 2.2477 1.7150 2.2189 0.3733  -0.3962 0.0091  406 LEU A C   
2587 O O   . LEU A 333 ? 2.4896 1.8873 2.4225 0.3743  -0.4185 0.0001  406 LEU A O   
2588 C CB  . LEU A 333 ? 1.8212 1.3070 1.8091 0.4016  -0.3897 0.0243  406 LEU A CB  
2589 C CG  . LEU A 333 ? 1.9035 1.3888 1.8981 0.3955  -0.3889 0.0496  406 LEU A CG  
2590 C CD1 . LEU A 333 ? 1.9660 1.4642 1.9602 0.4347  -0.3893 0.0346  406 LEU A CD1 
2591 C CD2 . LEU A 333 ? 2.4147 1.8237 2.3779 0.3733  -0.4126 0.0724  406 LEU A CD2 
2592 N N   . PHE A 334 ? 1.9389 1.4744 1.9360 0.3795  -0.3756 -0.0051 407 PHE A N   
2593 C CA  . PHE A 334 ? 1.3723 0.9106 1.3547 0.3905  -0.3771 -0.0338 407 PHE A CA  
2594 C C   . PHE A 334 ? 1.7831 1.3115 1.7597 0.3542  -0.3818 -0.0240 407 PHE A C   
2595 O O   . PHE A 334 ? 1.7138 1.2224 1.6656 0.3578  -0.3899 -0.0457 407 PHE A O   
2596 C CB  . PHE A 334 ? 1.3140 0.9325 1.3240 0.4092  -0.3540 -0.0519 407 PHE A CB  
2597 C CG  . PHE A 334 ? 1.6861 1.3172 1.6956 0.4502  -0.3526 -0.0709 407 PHE A CG  
2598 C CD1 . PHE A 334 ? 1.9158 1.5173 1.8970 0.4850  -0.3648 -0.1015 407 PHE A CD1 
2599 C CD2 . PHE A 334 ? 1.5725 1.2468 1.6093 0.4547  -0.3393 -0.0587 407 PHE A CD2 
2600 C CE1 . PHE A 334 ? 1.7593 1.3791 1.7433 0.5250  -0.3641 -0.1180 407 PHE A CE1 
2601 C CE2 . PHE A 334 ? 1.2813 0.9729 1.3190 0.4909  -0.3394 -0.0746 407 PHE A CE2 
2602 C CZ  . PHE A 334 ? 1.6011 1.2681 1.6144 0.5268  -0.3519 -0.1035 407 PHE A CZ  
2603 N N   . ILE A 335 ? 1.4723 1.0173 1.4713 0.3199  -0.3767 0.0084  408 ILE A N   
2604 C CA  . ILE A 335 ? 1.3456 0.8903 1.3442 0.2842  -0.3816 0.0216  408 ILE A CA  
2605 C C   . ILE A 335 ? 1.8328 1.3229 1.8150 0.2543  -0.4009 0.0481  408 ILE A C   
2606 O O   . ILE A 335 ? 2.3768 1.8070 2.3217 0.2424  -0.4228 0.0422  408 ILE A O   
2607 C CB  . ILE A 335 ? 1.2677 0.8900 1.3103 0.2677  -0.3586 0.0374  408 ILE A CB  
2608 C CG1 . ILE A 335 ? 1.3395 1.0138 1.3938 0.2912  -0.3415 0.0123  408 ILE A CG1 
2609 C CG2 . ILE A 335 ? 1.3836 1.0085 1.4280 0.2313  -0.3657 0.0543  408 ILE A CG2 
2610 C CD1 . ILE A 335 ? 1.2367 0.9787 1.3290 0.2757  -0.3208 0.0271  408 ILE A CD1 
2611 N N   . THR A 336 ? 1.4779 0.9892 1.4855 0.2407  -0.3928 0.0768  409 THR A N   
2612 C CA  . THR A 336 ? 1.6402 1.1151 1.6378 0.2073  -0.4082 0.1065  409 THR A CA  
2613 C C   . THR A 336 ? 1.8044 1.1887 1.7529 0.2132  -0.4354 0.1001  409 THR A C   
2614 O O   . THR A 336 ? 2.0654 1.3952 1.9821 0.1880  -0.4576 0.1053  409 THR A O   
2615 C CB  . THR A 336 ? 1.5645 1.0832 1.5971 0.1977  -0.3917 0.1350  409 THR A CB  
2616 O OG1 . THR A 336 ? 1.8126 1.4067 1.8881 0.1903  -0.3687 0.1432  409 THR A OG1 
2617 C CG2 . THR A 336 ? 1.6786 1.1645 1.6995 0.1621  -0.4075 0.1661  409 THR A CG2 
2618 N N   . TYR A 337 ? 1.4943 0.8610 1.4349 0.2458  -0.4350 0.0894  410 TYR A N   
2619 C CA  . TYR A 337 ? 1.7345 1.0121 1.6285 0.2565  -0.4615 0.0845  410 TYR A CA  
2620 C C   . TYR A 337 ? 1.9086 1.1282 1.7613 0.2723  -0.4793 0.0526  410 TYR A C   
2621 O O   . TYR A 337 ? 1.7273 0.8609 1.5342 0.2622  -0.5064 0.0534  410 TYR A O   
2622 C CB  . TYR A 337 ? 1.5667 0.8477 1.4650 0.2927  -0.4564 0.0788  410 TYR A CB  
2623 C CG  . TYR A 337 ? 1.7369 0.9346 1.5958 0.2934  -0.4823 0.0907  410 TYR A CG  
2624 C CD1 . TYR A 337 ? 1.8626 0.9756 1.6737 0.3167  -0.5077 0.0687  410 TYR A CD1 
2625 C CD2 . TYR A 337 ? 1.6843 0.8867 1.5516 0.2713  -0.4818 0.1239  410 TYR A CD2 
2626 C CE1 . TYR A 337 ? 1.9661 0.9959 1.7381 0.3174  -0.5336 0.0812  410 TYR A CE1 
2627 C CE2 . TYR A 337 ? 1.8537 0.9790 1.6825 0.2692  -0.5068 0.1374  410 TYR A CE2 
2628 C CZ  . TYR A 337 ? 2.0911 1.1276 1.8720 0.2921  -0.5335 0.1168  410 TYR A CZ  
2629 O OH  . TYR A 337 ? 2.2343 1.1868 1.9737 0.2901  -0.5607 0.1317  410 TYR A OH  
2630 N N   . ALA A 338 ? 1.8292 1.0952 1.6957 0.2961  -0.4640 0.0245  411 ALA A N   
2631 C CA  . ALA A 338 ? 1.8310 1.0535 1.6599 0.3139  -0.4766 -0.0096 411 ALA A CA  
2632 C C   . ALA A 338 ? 1.8571 1.0462 1.6628 0.2721  -0.4916 -0.0015 411 ALA A C   
2633 O O   . ALA A 338 ? 2.0995 1.2051 1.8545 0.2713  -0.5162 -0.0157 411 ALA A O   
2634 C CB  . ALA A 338 ? 1.6109 0.9048 1.4634 0.3436  -0.4539 -0.0381 411 ALA A CB  
2635 N N   . GLU A 339 ? 1.9791 1.2327 1.8212 0.2378  -0.4777 0.0215  412 GLU A N   
2636 C CA  . GLU A 339 ? 2.1365 1.3730 1.9637 0.1944  -0.4913 0.0339  412 GLU A CA  
2637 C C   . GLU A 339 ? 2.1975 1.3603 1.9939 0.1627  -0.5171 0.0589  412 GLU A C   
2638 O O   . GLU A 339 ? 2.5003 1.6092 2.2595 0.1334  -0.5393 0.0597  412 GLU A O   
2639 C CB  . GLU A 339 ? 2.2341 1.5617 2.1127 0.1681  -0.4706 0.0572  412 GLU A CB  
2640 C CG  . GLU A 339 ? 2.5402 1.8669 2.4085 0.1272  -0.4827 0.0670  412 GLU A CG  
2641 C CD  . GLU A 339 ? 2.5253 1.9443 2.4465 0.1079  -0.4623 0.0893  412 GLU A CD  
2642 O OE1 . GLU A 339 ? 2.5425 1.9763 2.4609 0.0802  -0.4691 0.0941  412 GLU A OE1 
2643 O OE2 . GLU A 339 ? 2.4814 1.9559 2.4452 0.1207  -0.4405 0.1019  412 GLU A OE2 
2644 N N   . ALA A 340 ? 1.9425 1.1033 1.7520 0.1661  -0.5148 0.0799  413 ALA A N   
2645 C CA  . ALA A 340 ? 1.7897 0.8811 1.5684 0.1363  -0.5392 0.1054  413 ALA A CA  
2646 C C   . ALA A 340 ? 2.0907 1.0702 1.8054 0.1568  -0.5676 0.0815  413 ALA A C   
2647 O O   . ALA A 340 ? 2.5170 1.4180 2.1877 0.1252  -0.5954 0.0933  413 ALA A O   
2648 C CB  . ALA A 340 ? 1.7476 0.8718 1.5563 0.1360  -0.5274 0.1332  413 ALA A CB  
2649 N N   . ILE A 341 ? 1.9367 0.9094 1.6455 0.2098  -0.5612 0.0481  414 ILE A N   
2650 C CA  . ILE A 341 ? 2.1820 1.0518 1.8324 0.2396  -0.5862 0.0210  414 ILE A CA  
2651 C C   . ILE A 341 ? 2.3205 1.1425 1.9292 0.2291  -0.6010 -0.0041 414 ILE A C   
2652 O O   . ILE A 341 ? 2.4831 1.1991 2.0324 0.2221  -0.6308 -0.0112 414 ILE A O   
2653 C CB  . ILE A 341 ? 2.1056 0.9961 1.7675 0.3023  -0.5732 -0.0081 414 ILE A CB  
2654 C CG1 . ILE A 341 ? 2.1969 1.1041 1.8818 0.3117  -0.5682 0.0164  414 ILE A CG1 
2655 C CG2 . ILE A 341 ? 2.1430 0.9388 1.7473 0.3404  -0.5957 -0.0446 414 ILE A CG2 
2656 C CD1 . ILE A 341 ? 2.0990 1.0300 1.7961 0.3707  -0.5577 -0.0087 414 ILE A CD1 
2657 N N   . ALA A 342 ? 2.1802 1.0781 1.8174 0.2263  -0.5808 -0.0168 415 ALA A N   
2658 C CA  . ALA A 342 ? 2.2149 1.0808 1.8149 0.2177  -0.5914 -0.0430 415 ALA A CA  
2659 C C   . ALA A 342 ? 2.7068 1.5084 2.2693 0.1607  -0.6186 -0.0210 415 ALA A C   
2660 O O   . ALA A 342 ? 2.9620 1.6925 2.4705 0.1542  -0.6388 -0.0439 415 ALA A O   
2661 C CB  . ALA A 342 ? 2.3690 1.3385 2.0115 0.2180  -0.5641 -0.0522 415 ALA A CB  
2662 N N   . ASN A 343 ? 2.8308 1.6599 2.4209 0.1187  -0.6191 0.0228  416 ASN A N   
2663 C CA  . ASN A 343 ? 3.0247 1.8075 2.5857 0.0592  -0.6440 0.0489  416 ASN A CA  
2664 C C   . ASN A 343 ? 3.0213 1.6965 2.5331 0.0478  -0.6737 0.0628  416 ASN A C   
2665 O O   . ASN A 343 ? 3.0545 1.7093 2.5563 -0.0052 -0.6904 0.0976  416 ASN A O   
2666 C CB  . ASN A 343 ? 3.0074 1.8893 2.6272 0.0165  -0.6280 0.0902  416 ASN A CB  
2667 C CG  . ASN A 343 ? 2.9182 1.8958 2.5801 0.0200  -0.6041 0.0806  416 ASN A CG  
2668 O OD1 . ASN A 343 ? 2.8109 1.8815 2.5322 0.0314  -0.5763 0.0931  416 ASN A OD1 
2669 N ND2 . ASN A 343 ? 2.8177 1.7693 2.4454 0.0093  -0.6158 0.0584  416 ASN A ND2 
2670 N N   . MET A 344 ? 2.9222 1.5306 2.4032 0.0974  -0.6808 0.0366  417 MET A N   
2671 C CA  . MET A 344 ? 3.0409 1.5368 2.4698 0.0927  -0.7111 0.0476  417 MET A CA  
2672 C C   . MET A 344 ? 3.2589 1.6367 2.6160 0.1253  -0.7356 0.0060  417 MET A C   
2673 O O   . MET A 344 ? 3.2601 1.6578 2.6188 0.1709  -0.7221 -0.0346 417 MET A O   
2674 C CB  . MET A 344 ? 2.9703 1.4918 2.4303 0.1237  -0.6992 0.0624  417 MET A CB  
2675 C CG  . MET A 344 ? 2.9327 1.5599 2.4569 0.0928  -0.6761 0.1032  417 MET A CG  
2676 S SD  . MET A 344 ? 2.9453 1.5762 2.4868 0.1165  -0.6713 0.1253  417 MET A SD  
2677 C CE  . MET A 344 ? 2.9200 1.5571 2.4670 0.1982  -0.6576 0.0780  417 MET A CE  
2678 N N   . PRO A 345 ? 3.1040 1.3571 2.3955 0.1014  -0.7721 0.0157  418 PRO A N   
2679 C CA  . PRO A 345 ? 3.1161 1.2416 2.3330 0.1356  -0.7981 -0.0239 418 PRO A CA  
2680 C C   . PRO A 345 ? 3.1165 1.2339 2.3397 0.2132  -0.7889 -0.0522 418 PRO A C   
2681 O O   . PRO A 345 ? 3.0089 1.1711 2.2718 0.2277  -0.7775 -0.0294 418 PRO A O   
2682 C CB  . PRO A 345 ? 3.3589 1.3606 2.5128 0.0887  -0.8382 0.0044  418 PRO A CB  
2683 C CG  . PRO A 345 ? 3.2437 1.3147 2.4466 0.0498  -0.8291 0.0570  418 PRO A CG  
2684 C CD  . PRO A 345 ? 3.0615 1.2855 2.3427 0.0399  -0.7914 0.0643  418 PRO A CD  
2685 N N   . ALA A 346 ? 3.5833 1.6478 2.7676 0.2619  -0.7936 -0.1013 419 ALA A N   
2686 C CA  . ALA A 346 ? 3.5891 1.6597 2.7830 0.3401  -0.7829 -0.1331 419 ALA A CA  
2687 C C   . ALA A 346 ? 3.4652 1.6895 2.7451 0.3607  -0.7422 -0.1269 419 ALA A C   
2688 O O   . ALA A 346 ? 3.3342 1.5859 2.6423 0.3985  -0.7340 -0.1210 419 ALA A O   
2689 C CB  . ALA A 346 ? 3.6550 1.6627 2.8228 0.3536  -0.7995 -0.1184 419 ALA A CB  
2690 N N   . SER A 347 ? 3.3807 1.7021 2.6991 0.3343  -0.7184 -0.1275 420 SER A N   
2691 C CA  . SER A 347 ? 3.1441 1.6084 2.5410 0.3450  -0.6806 -0.1194 420 SER A CA  
2692 C C   . SER A 347 ? 2.8462 1.3534 2.2617 0.4166  -0.6621 -0.1572 420 SER A C   
2693 O O   . SER A 347 ? 2.7400 1.3378 2.2116 0.4359  -0.6383 -0.1471 420 SER A O   
2694 C CB  . SER A 347 ? 3.2546 1.7989 2.6790 0.3039  -0.6634 -0.1155 420 SER A CB  
2695 O OG  . SER A 347 ? 3.3161 1.8032 2.6883 0.3021  -0.6768 -0.1487 420 SER A OG  
2696 N N   . THR A 348 ? 2.5181 0.9620 1.8855 0.4551  -0.6729 -0.2011 421 THR A N   
2697 C CA  . THR A 348 ? 2.6839 1.1656 2.0644 0.5259  -0.6575 -0.2396 421 THR A CA  
2698 C C   . THR A 348 ? 3.0711 1.5326 2.4620 0.5634  -0.6646 -0.2268 421 THR A C   
2699 O O   . THR A 348 ? 3.1865 1.7378 2.6265 0.5998  -0.6419 -0.2316 421 THR A O   
2700 C CB  . THR A 348 ? 2.6465 1.0479 1.9644 0.5621  -0.6717 -0.2896 421 THR A CB  
2701 O OG1 . THR A 348 ? 2.8137 1.2450 2.1232 0.5281  -0.6631 -0.3030 421 THR A OG1 
2702 C CG2 . THR A 348 ? 2.6831 1.1298 2.0171 0.6385  -0.6557 -0.3285 421 THR A CG2 
2703 N N   . PHE A 349 ? 3.0029 1.3557 2.3480 0.5478  -0.6948 -0.2079 422 PHE A N   
2704 C CA  . PHE A 349 ? 2.7940 1.1521 2.1501 0.5635  -0.6955 -0.1880 422 PHE A CA  
2705 C C   . PHE A 349 ? 2.6864 1.1317 2.1051 0.5475  -0.6780 -0.1511 422 PHE A C   
2706 O O   . PHE A 349 ? 2.4446 0.9691 1.9048 0.5832  -0.6577 -0.1550 422 PHE A O   
2707 C CB  . PHE A 349 ? 2.8383 1.0789 2.1348 0.5310  -0.7278 -0.1681 422 PHE A CB  
2708 C CG  . PHE A 349 ? 3.0954 1.3349 2.4017 0.5330  -0.7319 -0.1386 422 PHE A CG  
2709 C CD1 . PHE A 349 ? 3.1429 1.3839 2.4447 0.5847  -0.7298 -0.1575 422 PHE A CD1 
2710 C CD2 . PHE A 349 ? 3.0360 1.2737 2.3548 0.4821  -0.7386 -0.0914 422 PHE A CD2 
2711 C CE1 . PHE A 349 ? 3.2469 1.4841 2.5556 0.5853  -0.7352 -0.1302 422 PHE A CE1 
2712 C CE2 . PHE A 349 ? 3.0116 1.2478 2.3362 0.4826  -0.7425 -0.0651 422 PHE A CE2 
2713 C CZ  . PHE A 349 ? 3.2262 1.4598 2.5449 0.5339  -0.7415 -0.0846 422 PHE A CZ  
2714 N N   . PHE A 350 ? 2.6246 1.0581 2.0497 0.4921  -0.6858 -0.1150 423 PHE A N   
2715 C CA  . PHE A 350 ? 2.4395 0.9643 1.9226 0.4663  -0.6657 -0.0768 423 PHE A CA  
2716 C C   . PHE A 350 ? 2.6000 1.2625 2.1480 0.4835  -0.6269 -0.0897 423 PHE A C   
2717 O O   . PHE A 350 ? 2.5721 1.3131 2.1684 0.4775  -0.6079 -0.0667 423 PHE A O   
2718 C CB  . PHE A 350 ? 2.3573 0.8735 1.8388 0.3928  -0.6722 -0.0367 423 PHE A CB  
2719 C CG  . PHE A 350 ? 2.4692 0.8634 1.8939 0.3666  -0.7089 -0.0126 423 PHE A CG  
2720 C CD1 . PHE A 350 ? 2.4704 0.8586 1.9016 0.3631  -0.7141 0.0184  423 PHE A CD1 
2721 C CD2 . PHE A 350 ? 2.8679 1.1592 2.2314 0.3410  -0.7367 -0.0207 423 PHE A CD2 
2722 C CE1 . PHE A 350 ? 2.8418 1.1442 2.2251 0.3300  -0.7400 0.0406  423 PHE A CE1 
2723 C CE2 . PHE A 350 ? 3.1427 1.3365 2.4551 0.3094  -0.7663 0.0019  423 PHE A CE2 
2724 C CZ  . PHE A 350 ? 3.0807 1.2865 2.4050 0.3029  -0.7663 0.0328  423 PHE A CZ  
2725 N N   . ALA A 351 ? 2.5434 1.2328 2.0893 0.5029  -0.6158 -0.1265 424 ALA A N   
2726 C CA  . ALA A 351 ? 2.4862 1.3002 2.0874 0.5209  -0.5812 -0.1412 424 ALA A CA  
2727 C C   . ALA A 351 ? 2.6092 1.4489 2.2214 0.5868  -0.5748 -0.1675 424 ALA A C   
2728 O O   . ALA A 351 ? 2.7235 1.6557 2.3858 0.5991  -0.5525 -0.1599 424 ALA A O   
2729 C CB  . ALA A 351 ? 2.4243 1.2630 2.0183 0.5094  -0.5717 -0.1667 424 ALA A CB  
2730 N N   . ILE A 352 ? 2.4553 1.2123 2.0195 0.6292  -0.5954 -0.1985 425 ILE A N   
2731 C CA  . ILE A 352 ? 2.5422 1.3395 2.1170 0.6848  -0.5851 -0.2233 425 ILE A CA  
2732 C C   . ILE A 352 ? 2.7996 1.6229 2.3991 0.6833  -0.5823 -0.1926 425 ILE A C   
2733 O O   . ILE A 352 ? 2.9602 1.8761 2.6026 0.7084  -0.5610 -0.1965 425 ILE A O   
2734 C CB  . ILE A 352 ? 2.3630 1.0802 1.8812 0.7138  -0.6015 -0.2560 425 ILE A CB  
2735 C CG1 . ILE A 352 ? 2.5148 1.2329 2.0143 0.7266  -0.5967 -0.2956 425 ILE A CG1 
2736 C CG2 . ILE A 352 ? 2.4145 1.1701 1.9440 0.7618  -0.5934 -0.2698 425 ILE A CG2 
2737 C CD1 . ILE A 352 ? 2.5044 1.1415 1.9445 0.7532  -0.6123 -0.3293 425 ILE A CD1 
2738 N N   . ILE A 353 ? 3.1054 1.8485 2.6763 0.6513  -0.6042 -0.1617 426 ILE A N   
2739 C CA  . ILE A 353 ? 3.1810 1.9407 2.7690 0.6480  -0.6038 -0.1323 426 ILE A CA  
2740 C C   . ILE A 353 ? 3.0645 1.9154 2.7084 0.6265  -0.5826 -0.1060 426 ILE A C   
2741 O O   . ILE A 353 ? 3.2461 2.1484 2.9179 0.6351  -0.5722 -0.0916 426 ILE A O   
2742 C CB  . ILE A 353 ? 3.2745 1.9259 2.8150 0.6155  -0.6331 -0.1047 426 ILE A CB  
2743 C CG1 . ILE A 353 ? 3.4193 2.0389 2.9539 0.5580  -0.6423 -0.0752 426 ILE A CG1 
2744 C CG2 . ILE A 353 ? 3.4661 2.0236 2.9484 0.6377  -0.6548 -0.1316 426 ILE A CG2 
2745 C CD1 . ILE A 353 ? 3.4495 1.9725 2.9394 0.5184  -0.6701 -0.0443 426 ILE A CD1 
2746 N N   . PHE A 354 ? 2.5166 1.3865 2.1756 0.5990  -0.5771 -0.1001 427 PHE A N   
2747 C CA  . PHE A 354 ? 2.2143 1.1720 1.9255 0.5749  -0.5555 -0.0753 427 PHE A CA  
2748 C C   . PHE A 354 ? 2.2643 1.3312 2.0211 0.6092  -0.5274 -0.0977 427 PHE A C   
2749 O O   . PHE A 354 ? 2.4200 1.5485 2.2106 0.6147  -0.5143 -0.0837 427 PHE A O   
2750 C CB  . PHE A 354 ? 2.4269 1.3999 2.1449 0.5187  -0.5468 -0.0606 427 PHE A CB  
2751 C CG  . PHE A 354 ? 2.1314 1.1998 1.9021 0.4861  -0.5199 -0.0340 427 PHE A CG  
2752 C CD1 . PHE A 354 ? 2.0986 1.1622 1.8773 0.4585  -0.5227 0.0032  427 PHE A CD1 
2753 C CD2 . PHE A 354 ? 2.1801 1.3402 1.9896 0.4829  -0.4921 -0.0465 427 PHE A CD2 
2754 C CE1 . PHE A 354 ? 2.0230 1.1713 1.8478 0.4318  -0.4972 0.0250  427 PHE A CE1 
2755 C CE2 . PHE A 354 ? 2.0714 1.3108 1.9259 0.4554  -0.4684 -0.0232 427 PHE A CE2 
2756 C CZ  . PHE A 354 ? 1.7398 0.9729 1.6020 0.4313  -0.4705 0.0113  427 PHE A CZ  
2757 N N   . PHE A 355 ? 2.4523 1.5450 2.2078 0.6287  -0.5180 -0.1324 428 PHE A N   
2758 C CA  . PHE A 355 ? 2.4239 1.6234 2.2202 0.6572  -0.4915 -0.1543 428 PHE A CA  
2759 C C   . PHE A 355 ? 2.0454 1.2649 1.8446 0.7014  -0.4909 -0.1673 428 PHE A C   
2760 O O   . PHE A 355 ? 1.7733 1.0822 1.6122 0.7112  -0.4712 -0.1651 428 PHE A O   
2761 C CB  . PHE A 355 ? 2.5191 1.7412 2.3079 0.6631  -0.4815 -0.1876 428 PHE A CB  
2762 C CG  . PHE A 355 ? 2.5159 1.7332 2.3023 0.6088  -0.4771 -0.1732 428 PHE A CG  
2763 C CD1 . PHE A 355 ? 2.0870 1.3483 1.9071 0.5640  -0.4639 -0.1381 428 PHE A CD1 
2764 C CD2 . PHE A 355 ? 2.9081 2.0768 2.6574 0.6034  -0.4867 -0.1949 428 PHE A CD2 
2765 C CE1 . PHE A 355 ? 2.0630 1.3248 1.8838 0.5167  -0.4607 -0.1234 428 PHE A CE1 
2766 C CE2 . PHE A 355 ? 2.9055 2.0737 2.6534 0.5526  -0.4844 -0.1798 428 PHE A CE2 
2767 C CZ  . PHE A 355 ? 2.5281 1.7447 2.3136 0.5100  -0.4717 -0.1432 428 PHE A CZ  
2768 N N   . LEU A 356 ? 1.9395 1.0816 1.6958 0.7199  -0.5099 -0.1790 429 LEU A N   
2769 C CA  . LEU A 356 ? 2.3030 1.4613 2.0597 0.7540  -0.5096 -0.1865 429 LEU A CA  
2770 C C   . LEU A 356 ? 2.0412 1.2143 1.8172 0.7355  -0.5094 -0.1501 429 LEU A C   
2771 O O   . LEU A 356 ? 1.9116 1.1478 1.7131 0.7565  -0.4987 -0.1505 429 LEU A O   
2772 C CB  . LEU A 356 ? 2.3204 1.3800 2.0233 0.7746  -0.5332 -0.2026 429 LEU A CB  
2773 C CG  . LEU A 356 ? 2.1405 1.2130 1.8412 0.8171  -0.5350 -0.2149 429 LEU A CG  
2774 C CD1 . LEU A 356 ? 2.0917 1.2707 1.8267 0.8534  -0.5112 -0.2454 429 LEU A CD1 
2775 C CD2 . LEU A 356 ? 2.7507 1.7138 2.3942 0.8342  -0.5607 -0.2287 429 LEU A CD2 
2776 N N   . MET A 357 ? 2.1186 1.2354 1.8816 0.6948  -0.5218 -0.1183 430 MET A N   
2777 C CA  . MET A 357 ? 2.0542 1.1856 1.8337 0.6727  -0.5210 -0.0825 430 MET A CA  
2778 C C   . MET A 357 ? 1.8620 1.1040 1.6944 0.6702  -0.4942 -0.0780 430 MET A C   
2779 O O   . MET A 357 ? 1.9779 1.2641 1.8297 0.6770  -0.4874 -0.0664 430 MET A O   
2780 C CB  . MET A 357 ? 2.2336 1.2932 1.9909 0.6262  -0.5374 -0.0496 430 MET A CB  
2781 C CG  . MET A 357 ? 2.1491 1.2272 1.9221 0.6015  -0.5354 -0.0121 430 MET A CG  
2782 S SD  . MET A 357 ? 2.3522 1.3728 2.1094 0.5428  -0.5491 0.0280  430 MET A SD  
2783 C CE  . MET A 357 ? 2.1961 1.2818 1.9908 0.5292  -0.5291 0.0200  430 MET A CE  
2784 N N   . LEU A 358 ? 1.9355 1.2193 1.7888 0.6598  -0.4804 -0.0872 431 LEU A N   
2785 C CA  . LEU A 358 ? 1.8442 1.2307 1.7452 0.6563  -0.4552 -0.0853 431 LEU A CA  
2786 C C   . LEU A 358 ? 1.9355 1.3974 1.8569 0.6927  -0.4411 -0.1086 431 LEU A C   
2787 O O   . LEU A 358 ? 2.1380 1.6626 2.0870 0.6921  -0.4292 -0.0975 431 LEU A O   
2788 C CB  . LEU A 358 ? 1.9444 1.3599 1.8601 0.6378  -0.4430 -0.0936 431 LEU A CB  
2789 C CG  . LEU A 358 ? 2.0467 1.4665 1.9745 0.5818  -0.4332 -0.0620 431 LEU A CG  
2790 C CD1 . LEU A 358 ? 2.0416 1.3660 1.9344 0.5585  -0.4576 -0.0376 431 LEU A CD1 
2791 C CD2 . LEU A 358 ? 2.0089 1.4655 1.9491 0.5587  -0.4167 -0.0725 431 LEU A CD2 
2792 N N   . ILE A 359 ? 1.8391 1.2948 1.7452 0.7238  -0.4434 -0.1410 432 ILE A N   
2793 C CA  . ILE A 359 ? 1.8861 1.4151 1.8102 0.7596  -0.4312 -0.1645 432 ILE A CA  
2794 C C   . ILE A 359 ? 2.1780 1.7043 2.1016 0.7719  -0.4387 -0.1497 432 ILE A C   
2795 O O   . ILE A 359 ? 2.1541 1.7601 2.1090 0.7779  -0.4254 -0.1465 432 ILE A O   
2796 C CB  . ILE A 359 ? 1.8899 1.3996 1.7902 0.7926  -0.4355 -0.2012 432 ILE A CB  
2797 C CG1 . ILE A 359 ? 1.6939 1.2140 1.5956 0.7814  -0.4278 -0.2168 432 ILE A CG1 
2798 C CG2 . ILE A 359 ? 2.0162 1.6066 1.9362 0.8299  -0.4234 -0.2234 432 ILE A CG2 
2799 C CD1 . ILE A 359 ? 1.7594 1.2533 1.6320 0.8117  -0.4328 -0.2539 432 ILE A CD1 
2800 N N   . THR A 360 ? 2.2788 1.7118 2.1654 0.7739  -0.4616 -0.1397 433 THR A N   
2801 C CA  . THR A 360 ? 2.1634 1.5840 2.0454 0.7858  -0.4722 -0.1238 433 THR A CA  
2802 C C   . THR A 360 ? 2.1133 1.5646 2.0175 0.7558  -0.4665 -0.0903 433 THR A C   
2803 O O   . THR A 360 ? 2.2401 1.7156 2.1531 0.7657  -0.4691 -0.0784 433 THR A O   
2804 C CB  . THR A 360 ? 2.0582 1.3639 1.8916 0.7896  -0.4998 -0.1176 433 THR A CB  
2805 O OG1 . THR A 360 ? 2.2024 1.4392 2.0147 0.7499  -0.5099 -0.0972 433 THR A OG1 
2806 C CG2 . THR A 360 ? 2.1963 1.4712 2.0047 0.8263  -0.5066 -0.1529 433 THR A CG2 
2807 N N   . LEU A 361 ? 2.0140 1.4646 1.9265 0.7202  -0.4596 -0.0753 434 LEU A N   
2808 C CA  . LEU A 361 ? 1.9358 1.4159 1.8679 0.6915  -0.4528 -0.0453 434 LEU A CA  
2809 C C   . LEU A 361 ? 1.8892 1.4774 1.8630 0.6980  -0.4301 -0.0532 434 LEU A C   
2810 O O   . LEU A 361 ? 1.7705 1.3931 1.7584 0.6899  -0.4268 -0.0348 434 LEU A O   
2811 C CB  . LEU A 361 ? 1.8612 1.3060 1.7889 0.6529  -0.4533 -0.0270 434 LEU A CB  
2812 C CG  . LEU A 361 ? 2.0342 1.3853 1.9266 0.6284  -0.4755 0.0008  434 LEU A CG  
2813 C CD1 . LEU A 361 ? 1.9537 1.2699 1.8400 0.5959  -0.4776 0.0104  434 LEU A CD1 
2814 C CD2 . LEU A 361 ? 2.0437 1.4073 1.9415 0.6136  -0.4768 0.0313  434 LEU A CD2 
2815 N N   . GLY A 362 ? 1.8318 1.4730 1.8227 0.7112  -0.4156 -0.0804 435 GLY A N   
2816 C CA  . GLY A 362 ? 1.5624 1.3068 1.5905 0.7150  -0.3950 -0.0889 435 GLY A CA  
2817 C C   . GLY A 362 ? 1.5894 1.3874 1.6271 0.7490  -0.3935 -0.1057 435 GLY A C   
2818 O O   . GLY A 362 ? 1.6547 1.5297 1.7190 0.7487  -0.3826 -0.1028 435 GLY A O   
2819 N N   . LEU A 363 ? 1.6577 1.4148 1.6728 0.7784  -0.4056 -0.1233 436 LEU A N   
2820 C CA  . LEU A 363 ? 1.7344 1.5435 1.7586 0.8154  -0.4042 -0.1428 436 LEU A CA  
2821 C C   . LEU A 363 ? 1.8998 1.7387 1.9357 0.8206  -0.4095 -0.1243 436 LEU A C   
2822 O O   . LEU A 363 ? 1.6294 1.5573 1.6928 0.8315  -0.3984 -0.1320 436 LEU A O   
2823 C CB  . LEU A 363 ? 1.6552 1.3972 1.6467 0.8467  -0.4196 -0.1622 436 LEU A CB  
2824 C CG  . LEU A 363 ? 1.7865 1.5334 1.7711 0.8581  -0.4118 -0.1933 436 LEU A CG  
2825 C CD1 . LEU A 363 ? 2.0221 1.7031 1.9718 0.8932  -0.4281 -0.2140 436 LEU A CD1 
2826 C CD2 . LEU A 363 ? 1.5988 1.4625 1.6192 0.8667  -0.3890 -0.2125 436 LEU A CD2 
2827 N N   . ASP A 364 ? 2.0530 1.8193 2.0668 0.8116  -0.4274 -0.0993 437 ASP A N   
2828 C CA  . ASP A 364 ? 2.1188 1.9064 2.1396 0.8165  -0.4354 -0.0798 437 ASP A CA  
2829 C C   . ASP A 364 ? 2.1337 1.9978 2.1842 0.7916  -0.4205 -0.0664 437 ASP A C   
2830 O O   . ASP A 364 ? 2.4284 2.3587 2.4981 0.8020  -0.4187 -0.0643 437 ASP A O   
2831 C CB  . ASP A 364 ? 2.2369 1.9273 2.2244 0.8072  -0.4580 -0.0537 437 ASP A CB  
2832 C CG  . ASP A 364 ? 2.4693 2.0796 2.4320 0.7801  -0.4625 -0.0463 437 ASP A CG  
2833 O OD1 . ASP A 364 ? 2.5863 2.2218 2.5619 0.7641  -0.4470 -0.0564 437 ASP A OD1 
2834 O OD2 . ASP A 364 ? 2.3727 1.8955 2.3024 0.7736  -0.4826 -0.0293 437 ASP A OD2 
2835 N N   . SER A 365 ? 1.7772 1.6312 1.8302 0.7590  -0.4109 -0.0577 438 SER A N   
2836 C CA  . SER A 365 ? 1.7549 1.6749 1.8327 0.7352  -0.3964 -0.0473 438 SER A CA  
2837 C C   . SER A 365 ? 1.7110 1.7321 1.8196 0.7468  -0.3791 -0.0702 438 SER A C   
2838 O O   . SER A 365 ? 1.8057 1.8955 1.9342 0.7396  -0.3724 -0.0645 438 SER A O   
2839 C CB  . SER A 365 ? 1.9405 1.8283 2.0153 0.7022  -0.3890 -0.0365 438 SER A CB  
2840 O OG  . SER A 365 ? 2.1997 2.0032 2.2472 0.6871  -0.4048 -0.0120 438 SER A OG  
2841 N N   . SER A 366 ? 2.0701 2.1010 2.1800 0.7637  -0.3728 -0.0960 439 SER A N   
2842 C CA  . SER A 366 ? 2.1544 2.2832 2.2910 0.7759  -0.3574 -0.1185 439 SER A CA  
2843 C C   . SER A 366 ? 2.1408 2.3155 2.2853 0.8045  -0.3644 -0.1225 439 SER A C   
2844 O O   . SER A 366 ? 2.1419 2.4076 2.3118 0.8030  -0.3549 -0.1256 439 SER A O   
2845 C CB  . SER A 366 ? 2.5398 2.6654 2.6719 0.7883  -0.3501 -0.1452 439 SER A CB  
2846 O OG  . SER A 366 ? 2.6857 2.9116 2.8435 0.7956  -0.3338 -0.1652 439 SER A OG  
2847 N N   . PHE A 367 ? 1.9692 2.0805 2.0914 0.8297  -0.3820 -0.1216 440 PHE A N   
2848 C CA  . PHE A 367 ? 1.5107 1.6535 1.6382 0.8602  -0.3921 -0.1230 440 PHE A CA  
2849 C C   . PHE A 367 ? 1.6741 1.8666 1.8180 0.8448  -0.3939 -0.1010 440 PHE A C   
2850 O O   . PHE A 367 ? 2.0593 2.3391 2.2265 0.8558  -0.3893 -0.1071 440 PHE A O   
2851 C CB  . PHE A 367 ? 1.6012 1.6488 1.6974 0.8833  -0.4144 -0.1174 440 PHE A CB  
2852 C CG  . PHE A 367 ? 1.6164 1.6115 1.6914 0.9041  -0.4164 -0.1413 440 PHE A CG  
2853 C CD1 . PHE A 367 ? 1.5895 1.6385 1.6770 0.9113  -0.3993 -0.1692 440 PHE A CD1 
2854 C CD2 . PHE A 367 ? 1.6975 1.5882 1.7371 0.9160  -0.4368 -0.1358 440 PHE A CD2 
2855 C CE1 . PHE A 367 ? 2.3861 2.3856 2.4506 0.9314  -0.4025 -0.1922 440 PHE A CE1 
2856 C CE2 . PHE A 367 ? 1.9138 1.7519 1.9297 0.9352  -0.4406 -0.1589 440 PHE A CE2 
2857 C CZ  . PHE A 367 ? 2.1873 2.0800 2.2155 0.9438  -0.4234 -0.1878 440 PHE A CZ  
2858 N N   . ALA A 368 ? 1.6811 1.8185 1.8108 0.8186  -0.4014 -0.0753 441 ALA A N   
2859 C CA  . ALA A 368 ? 1.8522 2.0258 1.9905 0.8030  -0.4055 -0.0532 441 ALA A CA  
2860 C C   . ALA A 368 ? 1.5705 1.8330 1.7352 0.7802  -0.3865 -0.0584 441 ALA A C   
2861 O O   . ALA A 368 ? 1.5914 1.9288 1.7732 0.7798  -0.3863 -0.0548 441 ALA A O   
2862 C CB  . ALA A 368 ? 1.9695 2.0599 2.0822 0.7814  -0.4179 -0.0255 441 ALA A CB  
2863 N N   . GLY A 369 ? 1.3962 1.6496 1.5630 0.7604  -0.3719 -0.0661 442 GLY A N   
2864 C CA  . GLY A 369 ? 1.2653 1.5941 1.4545 0.7375  -0.3542 -0.0713 442 GLY A CA  
2865 C C   . GLY A 369 ? 1.2321 1.6653 1.4471 0.7500  -0.3453 -0.0896 442 GLY A C   
2866 O O   . GLY A 369 ? 1.2102 1.7174 1.4418 0.7343  -0.3400 -0.0855 442 GLY A O   
2867 N N   . LEU A 370 ? 1.2992 1.7405 1.5159 0.7776  -0.3441 -0.1102 443 LEU A N   
2868 C CA  . LEU A 370 ? 1.4649 2.0077 1.7050 0.7923  -0.3362 -0.1275 443 LEU A CA  
2869 C C   . LEU A 370 ? 1.5548 2.1259 1.7992 0.8114  -0.3507 -0.1177 443 LEU A C   
2870 O O   . LEU A 370 ? 1.6149 2.2815 1.8812 0.8098  -0.3462 -0.1209 443 LEU A O   
2871 C CB  . LEU A 370 ? 1.6707 2.2144 1.9088 0.8181  -0.3299 -0.1539 443 LEU A CB  
2872 C CG  . LEU A 370 ? 1.4164 1.9544 1.6543 0.8007  -0.3145 -0.1669 443 LEU A CG  
2873 C CD1 . LEU A 370 ? 1.5644 2.1008 1.7956 0.8301  -0.3111 -0.1936 443 LEU A CD1 
2874 C CD2 . LEU A 370 ? 1.1475 1.7794 1.4105 0.7716  -0.2980 -0.1679 443 LEU A CD2 
2875 N N   . GLU A 371 ? 1.8147 2.3029 2.0374 0.8274  -0.3691 -0.1045 444 GLU A N   
2876 C CA  . GLU A 371 ? 1.7233 2.2257 1.9474 0.8496  -0.3859 -0.0938 444 GLU A CA  
2877 C C   . GLU A 371 ? 1.6066 2.1705 1.8432 0.8266  -0.3884 -0.0756 444 GLU A C   
2878 O O   . GLU A 371 ? 1.3306 1.9655 1.5833 0.8394  -0.3937 -0.0748 444 GLU A O   
2879 C CB  . GLU A 371 ? 1.5167 1.9084 1.7112 0.8639  -0.4061 -0.0790 444 GLU A CB  
2880 C CG  . GLU A 371 ? 1.5891 1.9861 1.7834 0.8937  -0.4253 -0.0699 444 GLU A CG  
2881 C CD  . GLU A 371 ? 1.9552 2.3936 2.1615 0.9338  -0.4232 -0.0945 444 GLU A CD  
2882 O OE1 . GLU A 371 ? 2.0882 2.6313 2.3222 0.9388  -0.4141 -0.1044 444 GLU A OE1 
2883 O OE2 . GLU A 371 ? 1.9905 2.3577 2.1770 0.9600  -0.4309 -0.1042 444 GLU A OE2 
2884 N N   . GLY A 372 ? 1.7499 2.2876 1.9777 0.7931  -0.3852 -0.0611 445 GLY A N   
2885 C CA  . GLY A 372 ? 1.7771 2.3687 2.0113 0.7690  -0.3878 -0.0453 445 GLY A CA  
2886 C C   . GLY A 372 ? 1.7448 2.4543 2.0072 0.7578  -0.3741 -0.0588 445 GLY A C   
2887 O O   . GLY A 372 ? 1.8780 2.6562 2.1510 0.7548  -0.3811 -0.0515 445 GLY A O   
2888 N N   . VAL A 373 ? 1.4188 2.1533 1.6922 0.7493  -0.3555 -0.0776 446 VAL A N   
2889 C CA  . VAL A 373 ? 1.1176 1.9633 1.4162 0.7335  -0.3413 -0.0902 446 VAL A CA  
2890 C C   . VAL A 373 ? 1.5465 2.4634 1.8623 0.7611  -0.3435 -0.1017 446 VAL A C   
2891 O O   . VAL A 373 ? 1.6812 2.6917 2.0143 0.7498  -0.3431 -0.0999 446 VAL A O   
2892 C CB  . VAL A 373 ? 1.0796 1.9294 1.3837 0.7184  -0.3220 -0.1063 446 VAL A CB  
2893 C CG1 . VAL A 373 ? 1.0386 2.0054 1.3669 0.6975  -0.3082 -0.1172 446 VAL A CG1 
2894 C CG2 . VAL A 373 ? 1.6318 2.4121 1.9205 0.6936  -0.3201 -0.0942 446 VAL A CG2 
2895 N N   . ILE A 374 ? 1.5551 2.4282 1.8650 0.7969  -0.3463 -0.1137 447 ILE A N   
2896 C CA  . ILE A 374 ? 1.5432 2.4769 1.8678 0.8299  -0.3486 -0.1262 447 ILE A CA  
2897 C C   . ILE A 374 ? 1.5008 2.4592 1.8296 0.8388  -0.3668 -0.1079 447 ILE A C   
2898 O O   . ILE A 374 ? 1.2623 2.3187 1.6125 0.8421  -0.3657 -0.1110 447 ILE A O   
2899 C CB  . ILE A 374 ? 1.5149 2.3807 1.8259 0.8687  -0.3513 -0.1418 447 ILE A CB  
2900 C CG1 . ILE A 374 ? 1.4898 2.3510 1.7989 0.8600  -0.3327 -0.1623 447 ILE A CG1 
2901 C CG2 . ILE A 374 ? 1.3397 2.2605 1.6636 0.9084  -0.3568 -0.1527 447 ILE A CG2 
2902 C CD1 . ILE A 374 ? 1.5752 2.3549 1.8638 0.8919  -0.3364 -0.1771 447 ILE A CD1 
2903 N N   . THR A 375 ? 1.4951 2.3666 1.8027 0.8407  -0.3840 -0.0876 448 THR A N   
2904 C CA  . THR A 375 ? 1.3716 2.2576 1.6793 0.8463  -0.4036 -0.0669 448 THR A CA  
2905 C C   . THR A 375 ? 1.2645 2.2431 1.5861 0.8106  -0.4002 -0.0580 448 THR A C   
2906 O O   . THR A 375 ? 1.3282 2.3795 1.6645 0.8160  -0.4089 -0.0520 448 THR A O   
2907 C CB  . THR A 375 ? 1.5095 2.2838 1.7876 0.8460  -0.4216 -0.0443 448 THR A CB  
2908 O OG1 . THR A 375 ? 1.6218 2.3104 1.8847 0.8778  -0.4274 -0.0515 448 THR A OG1 
2909 C CG2 . THR A 375 ? 1.4679 2.2613 1.7445 0.8488  -0.4428 -0.0211 448 THR A CG2 
2910 N N   . ALA A 376 ? 1.3147 2.2891 1.6301 0.7733  -0.3897 -0.0557 449 ALA A N   
2911 C CA  . ALA A 376 ? 1.2214 2.2795 1.5454 0.7382  -0.3887 -0.0476 449 ALA A CA  
2912 C C   . ALA A 376 ? 1.1548 2.3306 1.5072 0.7337  -0.3765 -0.0632 449 ALA A C   
2913 O O   . ALA A 376 ? 1.4115 2.6660 1.7749 0.7234  -0.3834 -0.0557 449 ALA A O   
2914 C CB  . ALA A 376 ? 1.6321 2.6636 1.9430 0.7004  -0.3796 -0.0437 449 ALA A CB  
2915 N N   . VAL A 377 ? 1.1585 2.3487 1.5211 0.7398  -0.3588 -0.0841 450 VAL A N   
2916 C CA  . VAL A 377 ? 1.2741 2.5797 1.6609 0.7279  -0.3449 -0.0982 450 VAL A CA  
2917 C C   . VAL A 377 ? 1.3160 2.6866 1.7197 0.7587  -0.3531 -0.1000 450 VAL A C   
2918 O O   . VAL A 377 ? 1.1538 2.6280 1.5748 0.7412  -0.3511 -0.0988 450 VAL A O   
2919 C CB  . VAL A 377 ? 1.1995 2.5041 1.5905 0.7290  -0.3248 -0.1199 450 VAL A CB  
2920 C CG1 . VAL A 377 ? 1.3441 2.7699 1.7585 0.7207  -0.3111 -0.1340 450 VAL A CG1 
2921 C CG2 . VAL A 377 ? 1.1298 2.3884 1.5089 0.6940  -0.3163 -0.1168 450 VAL A CG2 
2922 N N   . LEU A 378 ? 1.2161 2.5220 1.6132 0.8040  -0.3632 -0.1025 451 LEU A N   
2923 C CA  . LEU A 378 ? 1.5500 2.8971 1.9607 0.8424  -0.3744 -0.1031 451 LEU A CA  
2924 C C   . LEU A 378 ? 1.7180 3.0930 2.1307 0.8323  -0.3938 -0.0791 451 LEU A C   
2925 O O   . LEU A 378 ? 1.6497 3.1082 2.0820 0.8448  -0.3994 -0.0777 451 LEU A O   
2926 C CB  . LEU A 378 ? 1.3293 2.5816 1.7264 0.8910  -0.3832 -0.1097 451 LEU A CB  
2927 C CG  . LEU A 378 ? 1.6320 2.8732 2.0284 0.9114  -0.3665 -0.1369 451 LEU A CG  
2928 C CD1 . LEU A 378 ? 1.4066 2.5540 1.7862 0.9589  -0.3787 -0.1425 451 LEU A CD1 
2929 C CD2 . LEU A 378 ? 1.3292 2.6970 1.7516 0.9155  -0.3519 -0.1544 451 LEU A CD2 
2930 N N   . ASP A 379 ? 1.8339 3.1416 2.2253 0.8093  -0.4043 -0.0601 452 ASP A N   
2931 C CA  . ASP A 379 ? 1.7581 3.0875 2.1457 0.7954  -0.4236 -0.0365 452 ASP A CA  
2932 C C   . ASP A 379 ? 1.5850 3.0162 1.9824 0.7472  -0.4163 -0.0337 452 ASP A C   
2933 O O   . ASP A 379 ? 1.6314 3.1095 2.0296 0.7328  -0.4306 -0.0174 452 ASP A O   
2934 C CB  . ASP A 379 ? 1.9946 3.2146 2.3511 0.7884  -0.4379 -0.0170 452 ASP A CB  
2935 C CG  . ASP A 379 ? 2.1736 3.2983 2.5179 0.8324  -0.4525 -0.0122 452 ASP A CG  
2936 O OD1 . ASP A 379 ? 2.2427 3.3595 2.5969 0.8665  -0.4456 -0.0305 452 ASP A OD1 
2937 O OD2 . ASP A 379 ? 2.0430 3.1008 2.3652 0.8315  -0.4714 0.0100  452 ASP A OD2 
2938 N N   . GLU A 380 ? 1.8625 3.3158 2.2616 0.7166  -0.3962 -0.0468 453 GLU A N   
2939 C CA  . GLU A 380 ? 1.8520 3.3981 2.2575 0.6663  -0.3887 -0.0454 453 GLU A CA  
2940 C C   . GLU A 380 ? 1.8448 3.5083 2.2784 0.6670  -0.3787 -0.0573 453 GLU A C   
2941 O O   . GLU A 380 ? 2.1396 3.8903 2.5800 0.6339  -0.3815 -0.0496 453 GLU A O   
2942 C CB  . GLU A 380 ? 2.1188 3.6368 2.5130 0.6305  -0.3728 -0.0526 453 GLU A CB  
2943 C CG  . GLU A 380 ? 2.1080 3.7140 2.5049 0.5737  -0.3650 -0.0522 453 GLU A CG  
2944 C CD  . GLU A 380 ? 2.1288 3.7659 2.5132 0.5458  -0.3823 -0.0332 453 GLU A CD  
2945 O OE1 . GLU A 380 ? 2.2991 4.0318 2.6919 0.5105  -0.3804 -0.0322 453 GLU A OE1 
2946 O OE2 . GLU A 380 ? 1.9772 3.5425 2.3408 0.5566  -0.3980 -0.0187 453 GLU A OE2 
2947 N N   . PHE A 381 ? 1.8268 3.4835 2.2722 0.7044  -0.3678 -0.0755 454 PHE A N   
2948 C CA  . PHE A 381 ? 1.8032 3.5723 2.2741 0.7108  -0.3576 -0.0878 454 PHE A CA  
2949 C C   . PHE A 381 ? 1.8711 3.6333 2.3530 0.7711  -0.3677 -0.0921 454 PHE A C   
2950 O O   . PHE A 381 ? 1.8468 3.6089 2.3355 0.8042  -0.3567 -0.1118 454 PHE A O   
2951 C CB  . PHE A 381 ? 1.8213 3.6184 2.2972 0.6964  -0.3334 -0.1082 454 PHE A CB  
2952 C CG  . PHE A 381 ? 1.7678 3.6065 2.2389 0.6330  -0.3231 -0.1045 454 PHE A CG  
2953 C CD1 . PHE A 381 ? 1.7262 3.4911 2.1763 0.6041  -0.3274 -0.0943 454 PHE A CD1 
2954 C CD2 . PHE A 381 ? 1.7419 3.6930 2.2276 0.6015  -0.3094 -0.1110 454 PHE A CD2 
2955 C CE1 . PHE A 381 ? 1.6432 3.4429 2.0870 0.5460  -0.3193 -0.0916 454 PHE A CE1 
2956 C CE2 . PHE A 381 ? 1.6886 3.6722 2.1668 0.5398  -0.3014 -0.1068 454 PHE A CE2 
2957 C CZ  . PHE A 381 ? 1.6280 3.5343 2.0852 0.5126  -0.3068 -0.0976 454 PHE A CZ  
2958 N N   . PRO A 382 ? 2.0638 3.8198 2.5462 0.7869  -0.3893 -0.0744 455 PRO A N   
2959 C CA  . PRO A 382 ? 1.9732 3.7023 2.4627 0.8464  -0.4013 -0.0772 455 PRO A CA  
2960 C C   . PRO A 382 ? 1.9037 3.7478 2.4214 0.8670  -0.3939 -0.0897 455 PRO A C   
2961 O O   . PRO A 382 ? 1.7369 3.6815 2.2703 0.8432  -0.3962 -0.0808 455 PRO A O   
2962 C CB  . PRO A 382 ? 1.9211 3.6301 2.4045 0.8464  -0.4271 -0.0510 455 PRO A CB  
2963 C CG  . PRO A 382 ? 1.9740 3.7805 2.4645 0.7934  -0.4246 -0.0413 455 PRO A CG  
2964 C CD  . PRO A 382 ? 2.0026 3.8211 2.4871 0.7509  -0.4014 -0.0545 455 PRO A CD  
2965 N N   . HIS A 383 ? 2.3726 4.2036 2.8946 0.9090  -0.3845 -0.1111 456 HIS A N   
2966 C CA  . HIS A 383 ? 2.6260 4.5442 3.1718 0.9478  -0.3828 -0.1229 456 HIS A CA  
2967 C C   . HIS A 383 ? 2.5234 4.5780 3.0885 0.9140  -0.3640 -0.1310 456 HIS A C   
2968 O O   . HIS A 383 ? 2.3870 4.5375 2.9738 0.9374  -0.3607 -0.1390 456 HIS A O   
2969 C CB  . HIS A 383 ? 2.7209 4.6455 3.2769 0.9788  -0.4079 -0.1048 456 HIS A CB  
2970 C CG  . HIS A 383 ? 2.7038 4.5298 3.2499 1.0378  -0.4220 -0.1087 456 HIS A CG  
2971 N ND1 . HIS A 383 ? 2.6736 4.4006 3.2029 1.0477  -0.4455 -0.0876 456 HIS A ND1 
2972 C CD2 . HIS A 383 ? 2.6809 4.4904 3.2287 1.0880  -0.4163 -0.1310 456 HIS A CD2 
2973 C CE1 . HIS A 383 ? 2.6984 4.3502 3.2197 1.1003  -0.4541 -0.0959 456 HIS A CE1 
2974 N NE2 . HIS A 383 ? 2.7039 4.4027 3.2357 1.1264  -0.4368 -0.1231 456 HIS A NE2 
2975 N N   . VAL A 384 ? 2.5569 4.6202 3.1128 0.8564  -0.3529 -0.1268 457 VAL A N   
2976 C CA  . VAL A 384 ? 2.5459 4.6514 3.1010 0.8259  -0.3290 -0.1428 457 VAL A CA  
2977 C C   . VAL A 384 ? 2.4826 4.4865 3.0216 0.8579  -0.3220 -0.1608 457 VAL A C   
2978 O O   . VAL A 384 ? 2.4677 4.5033 3.0091 0.8664  -0.3045 -0.1817 457 VAL A O   
2979 C CB  . VAL A 384 ? 2.4213 4.5291 2.9654 0.7584  -0.3245 -0.1301 457 VAL A CB  
2980 C CG1 . VAL A 384 ? 2.4956 4.4715 3.0158 0.7556  -0.3354 -0.1199 457 VAL A CG1 
2981 C CG2 . VAL A 384 ? 2.1468 4.3067 2.6913 0.7241  -0.3004 -0.1451 457 VAL A CG2 
2982 N N   . TRP A 385 ? 2.1757 4.0574 2.6962 0.8734  -0.3366 -0.1514 458 TRP A N   
2983 C CA  . TRP A 385 ? 2.0734 3.8447 2.5743 0.8998  -0.3333 -0.1649 458 TRP A CA  
2984 C C   . TRP A 385 ? 2.2479 3.9395 2.7417 0.9538  -0.3530 -0.1616 458 TRP A C   
2985 O O   . TRP A 385 ? 2.3247 4.0291 2.8260 0.9647  -0.3713 -0.1442 458 TRP A O   
2986 C CB  . TRP A 385 ? 2.0534 3.7401 2.5335 0.8605  -0.3311 -0.1560 458 TRP A CB  
2987 C CG  . TRP A 385 ? 1.9865 3.7009 2.4655 0.8297  -0.3087 -0.1708 458 TRP A CG  
2988 C CD1 . TRP A 385 ? 1.8962 3.6590 2.3774 0.7741  -0.2988 -0.1642 458 TRP A CD1 
2989 C CD2 . TRP A 385 ? 1.8845 3.5831 2.3589 0.8517  -0.2944 -0.1945 458 TRP A CD2 
2990 N NE1 . TRP A 385 ? 1.6517 3.4295 2.1315 0.7599  -0.2793 -0.1809 458 TRP A NE1 
2991 C CE2 . TRP A 385 ? 1.7615 3.5020 2.2370 0.8072  -0.2761 -0.2000 458 TRP A CE2 
2992 C CE3 . TRP A 385 ? 1.9425 3.5945 2.4101 0.9040  -0.2962 -0.2119 458 TRP A CE3 
2993 C CZ2 . TRP A 385 ? 1.9099 3.6500 2.3807 0.8132  -0.2597 -0.2212 458 TRP A CZ2 
2994 C CZ3 . TRP A 385 ? 1.8653 3.5159 2.3266 0.9101  -0.2798 -0.2345 458 TRP A CZ3 
2995 C CH2 . TRP A 385 ? 1.9261 3.6220 2.3894 0.8650  -0.2617 -0.2387 458 TRP A CH2 
2996 N N   . ALA A 386 ? 2.4518 4.0525 2.9280 0.9847  -0.3512 -0.1763 459 ALA A N   
2997 C CA  . ALA A 386 ? 2.6570 4.1760 3.1232 1.0343  -0.3709 -0.1731 459 ALA A CA  
2998 C C   . ALA A 386 ? 2.7174 4.3023 3.2002 1.0837  -0.3698 -0.1910 459 ALA A C   
2999 O O   . ALA A 386 ? 2.7425 4.2782 3.2211 1.1298  -0.3867 -0.1896 459 ALA A O   
3000 C CB  . ALA A 386 ? 2.6300 4.1268 3.0961 1.0260  -0.3935 -0.1435 459 ALA A CB  
3001 N N   . LYS A 387 ? 2.7906 4.4873 3.2910 1.0743  -0.3502 -0.2077 460 LYS A N   
3002 C CA  . LYS A 387 ? 2.8533 4.6211 3.3690 1.1213  -0.3467 -0.2271 460 LYS A CA  
3003 C C   . LYS A 387 ? 2.8078 4.4727 3.2999 1.1644  -0.3483 -0.2470 460 LYS A C   
3004 O O   . LYS A 387 ? 2.8335 4.4822 3.3264 1.2180  -0.3593 -0.2552 460 LYS A O   
3005 C CB  . LYS A 387 ? 2.7296 4.6240 3.2615 1.0967  -0.3228 -0.2427 460 LYS A CB  
3006 C CG  . LYS A 387 ? 2.4353 4.2934 2.9492 1.0720  -0.3040 -0.2590 460 LYS A CG  
3007 C CD  . LYS A 387 ? 2.3340 4.3226 2.8632 1.0455  -0.2816 -0.2719 460 LYS A CD  
3008 C CE  . LYS A 387 ? 2.4097 4.4786 2.9536 0.9874  -0.2789 -0.2506 460 LYS A CE  
3009 N NZ  . LYS A 387 ? 2.5239 4.7202 3.0803 0.9560  -0.2579 -0.2607 460 LYS A NZ  
3010 N N   . ARG A 388 ? 2.7573 4.3498 3.2267 1.1439  -0.3372 -0.2571 461 ARG A N   
3011 C CA  . ARG A 388 ? 2.6955 4.1690 3.1358 1.1732  -0.3409 -0.2718 461 ARG A CA  
3012 C C   . ARG A 388 ? 2.5427 3.9244 2.9620 1.1291  -0.3392 -0.2598 461 ARG A C   
3013 O O   . ARG A 388 ? 2.3916 3.8226 2.8189 1.0814  -0.3254 -0.2547 461 ARG A O   
3014 C CB  . ARG A 388 ? 2.6577 4.1728 3.0953 1.1975  -0.3235 -0.3051 461 ARG A CB  
3015 C CG  . ARG A 388 ? 2.6237 4.2373 3.0822 1.2431  -0.3230 -0.3196 461 ARG A CG  
3016 C CD  . ARG A 388 ? 2.6580 4.1996 3.1088 1.2994  -0.3457 -0.3176 461 ARG A CD  
3017 N NE  . ARG A 388 ? 2.6734 4.3138 3.1469 1.3449  -0.3457 -0.3303 461 ARG A NE  
3018 C CZ  . ARG A 388 ? 2.8194 4.4312 3.2956 1.3959  -0.3653 -0.3270 461 ARG A CZ  
3019 N NH1 . ARG A 388 ? 2.8114 4.2970 3.2672 1.4054  -0.3869 -0.3102 461 ARG A NH1 
3020 N NH2 . ARG A 388 ? 2.9567 4.6679 3.4560 1.4370  -0.3637 -0.3394 461 ARG A NH2 
3021 N N   . ARG A 389 ? 2.4206 3.6705 2.8127 1.1438  -0.3536 -0.2545 462 ARG A N   
3022 C CA  . ARG A 389 ? 2.0034 3.1648 2.3757 1.1038  -0.3535 -0.2412 462 ARG A CA  
3023 C C   . ARG A 389 ? 2.1184 3.2498 2.4750 1.0946  -0.3368 -0.2632 462 ARG A C   
3024 O O   . ARG A 389 ? 2.1142 3.2364 2.4678 1.0514  -0.3263 -0.2574 462 ARG A O   
3025 C CB  . ARG A 389 ? 1.6274 2.6627 1.9760 1.1179  -0.3769 -0.2227 462 ARG A CB  
3026 C CG  . ARG A 389 ? 1.5759 2.5219 1.9041 1.0769  -0.3778 -0.2066 462 ARG A CG  
3027 C CD  . ARG A 389 ? 1.6072 2.4676 1.9203 1.0776  -0.4015 -0.1786 462 ARG A CD  
3028 N NE  . ARG A 389 ? 2.1399 2.9225 2.4339 1.0378  -0.4015 -0.1626 462 ARG A NE  
3029 C CZ  . ARG A 389 ? 1.9973 2.7225 2.2796 1.0223  -0.4180 -0.1347 462 ARG A CZ  
3030 N NH1 . ARG A 389 ? 1.7853 2.5205 2.0730 1.0422  -0.4367 -0.1187 462 ARG A NH1 
3031 N NH2 . ARG A 389 ? 1.9614 2.6218 2.2264 0.9870  -0.4160 -0.1222 462 ARG A NH2 
3032 N N   . GLU A 390 ? 2.8203 3.9358 3.1654 1.1386  -0.3349 -0.2902 463 GLU A N   
3033 C CA  . GLU A 390 ? 2.9757 4.0623 3.3035 1.1338  -0.3209 -0.3127 463 GLU A CA  
3034 C C   . GLU A 390 ? 3.0420 4.2368 3.3892 1.0977  -0.2974 -0.3209 463 GLU A C   
3035 O O   . GLU A 390 ? 3.2546 4.4266 3.5900 1.0771  -0.2855 -0.3314 463 GLU A O   
3036 C CB  . GLU A 390 ? 3.0991 4.1660 3.4125 1.1879  -0.3236 -0.3405 463 GLU A CB  
3037 N N   . ARG A 391 ? 2.1975 3.5096 2.5730 1.0898  -0.2915 -0.3161 464 ARG A N   
3038 C CA  . ARG A 391 ? 1.8060 3.2243 2.1985 1.0522  -0.2702 -0.3222 464 ARG A CA  
3039 C C   . ARG A 391 ? 2.0055 3.4003 2.3981 0.9962  -0.2666 -0.3014 464 ARG A C   
3040 O O   . ARG A 391 ? 2.2580 3.6598 2.6465 0.9667  -0.2520 -0.3083 464 ARG A O   
3041 C CB  . ARG A 391 ? 1.5855 3.1405 2.0072 1.0563  -0.2657 -0.3216 464 ARG A CB  
3042 N N   . PHE A 392 ? 2.0042 3.3713 2.4007 0.9825  -0.2805 -0.2758 465 PHE A N   
3043 C CA  . PHE A 392 ? 1.6321 2.9758 2.0277 0.9322  -0.2789 -0.2555 465 PHE A CA  
3044 C C   . PHE A 392 ? 1.5130 2.7338 1.8830 0.9258  -0.2810 -0.2549 465 PHE A C   
3045 O O   . PHE A 392 ? 1.4725 2.6892 1.8410 0.8884  -0.2700 -0.2523 465 PHE A O   
3046 C CB  . PHE A 392 ? 1.4681 2.8116 1.8713 0.9225  -0.2949 -0.2293 465 PHE A CB  
3047 C CG  . PHE A 392 ? 1.4059 2.7243 1.8059 0.8735  -0.2945 -0.2092 465 PHE A CG  
3048 C CD1 . PHE A 392 ? 1.1795 2.5892 1.5953 0.8297  -0.2818 -0.2057 465 PHE A CD1 
3049 C CD2 . PHE A 392 ? 1.5578 2.7619 1.9372 0.8704  -0.3073 -0.1937 465 PHE A CD2 
3050 C CE1 . PHE A 392 ? 1.1300 2.5156 1.5414 0.7865  -0.2822 -0.1886 465 PHE A CE1 
3051 C CE2 . PHE A 392 ? 1.4671 2.6506 1.8427 0.8281  -0.3068 -0.1763 465 PHE A CE2 
3052 C CZ  . PHE A 392 ? 1.2435 2.5168 1.6351 0.7876  -0.2944 -0.1746 465 PHE A CZ  
3053 N N   . VAL A 393 ? 1.5055 2.6271 1.8548 0.9612  -0.2957 -0.2564 466 VAL A N   
3054 C CA  . VAL A 393 ? 1.5132 2.5148 1.8356 0.9563  -0.2997 -0.2553 466 VAL A CA  
3055 C C   . VAL A 393 ? 1.6388 2.6527 1.9559 0.9496  -0.2825 -0.2778 466 VAL A C   
3056 O O   . VAL A 393 ? 1.9913 2.9633 2.3006 0.9188  -0.2766 -0.2728 466 VAL A O   
3057 C CB  . VAL A 393 ? 1.6643 2.5642 1.9634 0.9969  -0.3192 -0.2552 466 VAL A CB  
3058 C CG1 . VAL A 393 ? 1.7932 2.5754 2.0627 0.9900  -0.3225 -0.2564 466 VAL A CG1 
3059 C CG2 . VAL A 393 ? 1.6380 2.5169 1.9401 0.9986  -0.3377 -0.2290 466 VAL A CG2 
3060 N N   . LEU A 394 ? 1.6472 2.7218 1.9688 0.9789  -0.2747 -0.3025 467 LEU A N   
3061 C CA  . LEU A 394 ? 1.7877 2.8880 2.1045 0.9744  -0.2581 -0.3255 467 LEU A CA  
3062 C C   . LEU A 394 ? 1.8573 3.0400 2.1934 0.9254  -0.2409 -0.3192 467 LEU A C   
3063 O O   . LEU A 394 ? 2.0662 3.2296 2.3951 0.9032  -0.2310 -0.3247 467 LEU A O   
3064 C CB  . LEU A 394 ? 1.5098 2.6740 1.8291 1.0163  -0.2532 -0.3526 467 LEU A CB  
3065 C CG  . LEU A 394 ? 1.4864 2.6949 1.8008 1.0164  -0.2358 -0.3793 467 LEU A CG  
3066 C CD1 . LEU A 394 ? 1.7732 2.9457 2.0673 1.0692  -0.2413 -0.4058 467 LEU A CD1 
3067 C CD2 . LEU A 394 ? 1.3877 2.7427 1.7292 0.9949  -0.2179 -0.3833 467 LEU A CD2 
3068 N N   . ALA A 395 ? 1.6242 2.8977 1.9840 0.9079  -0.2385 -0.3069 468 ALA A N   
3069 C CA  . ALA A 395 ? 1.4683 2.8242 1.8457 0.8588  -0.2240 -0.2991 468 ALA A CA  
3070 C C   . ALA A 395 ? 1.6283 2.9113 1.9986 0.8217  -0.2263 -0.2801 468 ALA A C   
3071 O O   . ALA A 395 ? 1.8906 3.2077 2.2671 0.7842  -0.2137 -0.2786 468 ALA A O   
3072 C CB  . ALA A 395 ? 1.6158 3.0740 2.0163 0.8473  -0.2245 -0.2881 468 ALA A CB  
3073 N N   . VAL A 396 ? 1.5144 2.6990 1.8714 0.8320  -0.2429 -0.2648 469 VAL A N   
3074 C CA  . VAL A 396 ? 1.1189 2.2274 1.4668 0.8016  -0.2463 -0.2467 469 VAL A CA  
3075 C C   . VAL A 396 ? 1.3735 2.4016 1.7021 0.8060  -0.2429 -0.2576 469 VAL A C   
3076 O O   . VAL A 396 ? 1.5828 2.5997 1.9121 0.7744  -0.2350 -0.2525 469 VAL A O   
3077 C CB  . VAL A 396 ? 1.1391 2.1764 1.4780 0.8086  -0.2653 -0.2250 469 VAL A CB  
3078 C CG1 . VAL A 396 ? 1.5844 2.5347 1.9099 0.7819  -0.2687 -0.2081 469 VAL A CG1 
3079 C CG2 . VAL A 396 ? 1.1249 2.2456 1.4831 0.7971  -0.2689 -0.2122 469 VAL A CG2 
3080 N N   . VAL A 397 ? 1.1853 2.1588 1.4961 0.8454  -0.2500 -0.2726 470 VAL A N   
3081 C CA  . VAL A 397 ? 1.2029 2.0947 1.4915 0.8524  -0.2498 -0.2840 470 VAL A CA  
3082 C C   . VAL A 397 ? 1.4593 2.4134 1.7555 0.8347  -0.2312 -0.3004 470 VAL A C   
3083 O O   . VAL A 397 ? 1.4405 2.3488 1.7292 0.8137  -0.2278 -0.2974 470 VAL A O   
3084 C CB  . VAL A 397 ? 1.2824 2.1157 1.5493 0.8995  -0.2615 -0.3002 470 VAL A CB  
3085 C CG1 . VAL A 397 ? 1.4712 2.2416 1.7151 0.9065  -0.2593 -0.3178 470 VAL A CG1 
3086 C CG2 . VAL A 397 ? 1.3198 2.0665 1.5734 0.9115  -0.2819 -0.2805 470 VAL A CG2 
3087 N N   . ILE A 398 ? 1.4490 2.5102 1.7603 0.8424  -0.2196 -0.3166 471 ILE A N   
3088 C CA  . ILE A 398 ? 1.4487 2.5807 1.7670 0.8246  -0.2016 -0.3321 471 ILE A CA  
3089 C C   . ILE A 398 ? 1.5289 2.6915 1.8627 0.7737  -0.1930 -0.3138 471 ILE A C   
3090 O O   . ILE A 398 ? 1.8516 3.0035 2.1822 0.7542  -0.1850 -0.3173 471 ILE A O   
3091 C CB  . ILE A 398 ? 1.3408 2.5906 1.6724 0.8398  -0.1910 -0.3502 471 ILE A CB  
3092 C CG1 . ILE A 398 ? 1.5754 2.7923 1.8893 0.8932  -0.1982 -0.3728 471 ILE A CG1 
3093 C CG2 . ILE A 398 ? 1.2726 2.6097 1.6135 0.8109  -0.1715 -0.3608 471 ILE A CG2 
3094 C CD1 . ILE A 398 ? 1.8339 3.1656 2.1587 0.9119  -0.1867 -0.3938 471 ILE A CD1 
3095 N N   . THR A 399 ? 1.3050 2.5055 1.6547 0.7526  -0.1959 -0.2943 472 THR A N   
3096 C CA  . THR A 399 ? 1.3222 2.5499 1.6853 0.7046  -0.1902 -0.2762 472 THR A CA  
3097 C C   . THR A 399 ? 1.3904 2.5108 1.7404 0.6938  -0.1966 -0.2639 472 THR A C   
3098 O O   . THR A 399 ? 1.5989 2.7214 1.9506 0.6583  -0.1876 -0.2577 472 THR A O   
3099 C CB  . THR A 399 ? 1.0735 2.3469 1.4507 0.6876  -0.1960 -0.2580 472 THR A CB  
3100 O OG1 . THR A 399 ? 1.2312 2.6054 1.6207 0.6983  -0.1911 -0.2682 472 THR A OG1 
3101 C CG2 . THR A 399 ? 1.0868 2.3940 1.4756 0.6364  -0.1903 -0.2418 472 THR A CG2 
3102 N N   . CYS A 400 ? 1.4026 2.4231 1.7348 0.7191  -0.2114 -0.2581 473 CYS A N   
3103 C CA  . CYS A 400 ? 1.2726 2.1869 1.5895 0.7108  -0.2185 -0.2459 473 CYS A CA  
3104 C C   . CYS A 400 ? 1.3687 2.2539 1.6747 0.7156  -0.2125 -0.2618 473 CYS A C   
3105 O O   . CYS A 400 ? 1.5380 2.3594 1.8310 0.6836  -0.2089 -0.2494 473 CYS A O   
3106 C CB  . CYS A 400 ? 1.2978 2.1163 1.5956 0.7350  -0.2362 -0.2360 473 CYS A CB  
3107 S SG  . CYS A 400 ? 1.6154 2.4491 1.9222 0.7250  -0.2461 -0.2122 473 CYS A SG  
3108 N N   . PHE A 401 ? 1.2036 2.1208 1.5041 0.7429  -0.2082 -0.2862 474 PHE A N   
3109 C CA  . PHE A 401 ? 1.1173 2.0155 1.4056 0.7494  -0.2025 -0.3047 474 PHE A CA  
3110 C C   . PHE A 401 ? 1.3127 2.2772 1.6114 0.7051  -0.1845 -0.3022 474 PHE A C   
3111 O O   . PHE A 401 ? 1.5124 2.4196 1.7933 0.6761  -0.1797 -0.2963 474 PHE A O   
3112 C CB  . PHE A 401 ? 1.1115 2.0300 1.3874 0.7891  -0.2015 -0.3328 474 PHE A CB  
3113 C CG  . PHE A 401 ? 1.1133 2.0360 1.3777 0.7941  -0.1931 -0.3554 474 PHE A CG  
3114 C CD1 . PHE A 401 ? 1.4008 2.2221 1.6424 0.7989  -0.2022 -0.3570 474 PHE A CD1 
3115 C CD2 . PHE A 401 ? 1.1043 2.1352 1.3796 0.7922  -0.1763 -0.3746 474 PHE A CD2 
3116 C CE1 . PHE A 401 ? 1.3167 2.1420 1.5456 0.8026  -0.1950 -0.3784 474 PHE A CE1 
3117 C CE2 . PHE A 401 ? 1.3568 2.3952 1.6199 0.7963  -0.1680 -0.3961 474 PHE A CE2 
3118 C CZ  . PHE A 401 ? 1.3032 2.2374 1.5426 0.8020  -0.1774 -0.3986 474 PHE A CZ  
3119 N N   . PHE A 402 ? 1.2862 2.3630 1.6073 0.6909  -0.1740 -0.3033 475 PHE A N   
3120 C CA  . PHE A 402 ? 1.2315 2.3614 1.5538 0.6365  -0.1567 -0.2957 475 PHE A CA  
3121 C C   . PHE A 402 ? 1.1884 2.2517 1.5019 0.5852  -0.1564 -0.2652 475 PHE A C   
3122 O O   . PHE A 402 ? 1.3076 2.3668 1.6122 0.5406  -0.1456 -0.2555 475 PHE A O   
3123 C CB  . PHE A 402 ? 1.2084 2.4754 1.5554 0.6307  -0.1474 -0.3023 475 PHE A CB  
3124 C CG  . PHE A 402 ? 1.4779 2.8299 1.8325 0.6671  -0.1398 -0.3330 475 PHE A CG  
3125 C CD1 . PHE A 402 ? 1.4032 2.7770 1.7449 0.6464  -0.1260 -0.3437 475 PHE A CD1 
3126 C CD2 . PHE A 402 ? 1.7261 3.1029 2.0799 0.7051  -0.1441 -0.3454 475 PHE A CD2 
3127 C CE1 . PHE A 402 ? 1.8020 3.2573 2.1487 0.6800  -0.1174 -0.3737 475 PHE A CE1 
3128 C CE2 . PHE A 402 ? 1.7130 3.1477 2.0606 0.7300  -0.1353 -0.3713 475 PHE A CE2 
3129 C CZ  . PHE A 402 ? 1.7728 3.2470 2.1160 0.7175  -0.1215 -0.3861 475 PHE A CZ  
3130 N N   . GLY A 403 ? 1.1558 2.1668 1.4705 0.5929  -0.1684 -0.2501 476 GLY A N   
3131 C CA  . GLY A 403 ? 1.2709 2.2156 1.5763 0.5508  -0.1680 -0.2234 476 GLY A CA  
3132 C C   . GLY A 403 ? 1.1952 2.0290 1.4808 0.5478  -0.1722 -0.2155 476 GLY A C   
3133 O O   . GLY A 403 ? 1.2668 2.0468 1.5447 0.5123  -0.1692 -0.1947 476 GLY A O   
3134 N N   . SER A 404 ? 1.1524 1.9531 1.4292 0.5854  -0.1795 -0.2327 477 SER A N   
3135 C CA  . SER A 404 ? 0.9438 1.6422 1.2006 0.5830  -0.1857 -0.2263 477 SER A CA  
3136 C C   . SER A 404 ? 1.1698 1.8734 1.4161 0.5652  -0.1760 -0.2353 477 SER A C   
3137 O O   . SER A 404 ? 1.1973 1.8254 1.4272 0.5578  -0.1803 -0.2299 477 SER A O   
3138 C CB  . SER A 404 ? 1.2819 1.9220 1.5284 0.6322  -0.2034 -0.2372 477 SER A CB  
3139 O OG  . SER A 404 ? 1.7581 2.3838 2.0111 0.6460  -0.2144 -0.2249 477 SER A OG  
3140 N N   . LEU A 405 ? 1.4895 2.2859 1.7446 0.5564  -0.1635 -0.2481 478 LEU A N   
3141 C CA  . LEU A 405 ? 1.4374 2.2494 1.6811 0.5371  -0.1538 -0.2564 478 LEU A CA  
3142 C C   . LEU A 405 ? 1.2718 2.0401 1.5087 0.4860  -0.1484 -0.2305 478 LEU A C   
3143 O O   . LEU A 405 ? 1.0664 1.8106 1.2892 0.4700  -0.1457 -0.2307 478 LEU A O   
3144 C CB  . LEU A 405 ? 1.1766 2.1067 1.4317 0.5352  -0.1409 -0.2733 478 LEU A CB  
3145 C CG  . LEU A 405 ? 1.2352 2.2226 1.4986 0.5898  -0.1438 -0.3028 478 LEU A CG  
3146 C CD1 . LEU A 405 ? 1.5882 2.7026 1.8645 0.5814  -0.1287 -0.3171 478 LEU A CD1 
3147 C CD2 . LEU A 405 ? 1.3231 2.2457 1.5651 0.6273  -0.1521 -0.3235 478 LEU A CD2 
3148 N N   . VAL A 406 ? 1.3122 2.0704 1.5579 0.4617  -0.1474 -0.2085 479 VAL A N   
3149 C CA  . VAL A 406 ? 1.3063 2.0178 1.5464 0.4185  -0.1429 -0.1836 479 VAL A CA  
3150 C C   . VAL A 406 ? 1.3878 2.0007 1.6173 0.4260  -0.1526 -0.1737 479 VAL A C   
3151 O O   . VAL A 406 ? 1.0231 1.5958 1.2456 0.3990  -0.1503 -0.1590 479 VAL A O   
3152 C CB  . VAL A 406 ? 0.9295 1.6535 1.1785 0.3941  -0.1392 -0.1659 479 VAL A CB  
3153 C CG1 . VAL A 406 ? 0.8937 1.5725 1.1355 0.3518  -0.1335 -0.1425 479 VAL A CG1 
3154 C CG2 . VAL A 406 ? 1.4413 2.2671 1.7008 0.3870  -0.1321 -0.1759 479 VAL A CG2 
3155 N N   . THR A 407 ? 1.3897 1.9658 1.6179 0.4625  -0.1646 -0.1809 480 THR A N   
3156 C CA  . THR A 407 ? 1.2411 1.7254 1.4582 0.4690  -0.1757 -0.1707 480 THR A CA  
3157 C C   . THR A 407 ? 1.3283 1.7863 1.5287 0.4846  -0.1818 -0.1872 480 THR A C   
3158 O O   . THR A 407 ? 1.5466 1.9374 1.7355 0.4747  -0.1884 -0.1766 480 THR A O   
3159 C CB  . THR A 407 ? 1.3798 1.8293 1.5984 0.4975  -0.1879 -0.1681 480 THR A CB  
3160 O OG1 . THR A 407 ? 1.9631 2.4510 2.1954 0.4860  -0.1823 -0.1579 480 THR A OG1 
3161 C CG2 . THR A 407 ? 1.4804 1.8390 1.6887 0.4917  -0.1975 -0.1501 480 THR A CG2 
3162 N N   . LEU A 408 ? 1.2103 1.7246 1.4085 0.5084  -0.1794 -0.2136 481 LEU A N   
3163 C CA  . LEU A 408 ? 1.1134 1.6060 1.2916 0.5266  -0.1847 -0.2343 481 LEU A CA  
3164 C C   . LEU A 408 ? 1.0165 1.5193 1.1860 0.4908  -0.1761 -0.2298 481 LEU A C   
3165 O O   . LEU A 408 ? 1.2478 1.7343 1.3977 0.4988  -0.1796 -0.2459 481 LEU A O   
3166 C CB  . LEU A 408 ? 1.4408 1.9952 1.6195 0.5679  -0.1836 -0.2663 481 LEU A CB  
3167 C CG  . LEU A 408 ? 1.3380 1.8759 1.5214 0.6123  -0.1960 -0.2742 481 LEU A CG  
3168 C CD1 . LEU A 408 ? 1.5112 2.1291 1.7011 0.6525  -0.1920 -0.3049 481 LEU A CD1 
3169 C CD2 . LEU A 408 ? 1.1248 1.5559 1.2850 0.6315  -0.2145 -0.2737 481 LEU A CD2 
3170 N N   . THR A 409 ? 0.9477 1.4743 1.1291 0.4515  -0.1660 -0.2078 482 THR A N   
3171 C CA  . THR A 409 ? 1.1176 1.6526 1.2913 0.4155  -0.1593 -0.1989 482 THR A CA  
3172 C C   . THR A 409 ? 1.2764 1.7284 1.4381 0.4040  -0.1694 -0.1840 482 THR A C   
3173 O O   . THR A 409 ? 1.1442 1.5334 1.3039 0.4203  -0.1807 -0.1790 482 THR A O   
3174 C CB  . THR A 409 ? 1.2031 1.7759 1.3902 0.3771  -0.1478 -0.1775 482 THR A CB  
3175 O OG1 . THR A 409 ? 1.0057 1.5283 1.2032 0.3695  -0.1510 -0.1548 482 THR A OG1 
3176 C CG2 . THR A 409 ? 1.6305 2.2939 1.8279 0.3812  -0.1382 -0.1911 482 THR A CG2 
3177 N N   . PHE A 410 ? 1.4546 1.9094 1.6078 0.3742  -0.1662 -0.1754 483 PHE A N   
3178 C CA  . PHE A 410 ? 1.2899 1.6767 1.4338 0.3597  -0.1760 -0.1594 483 PHE A CA  
3179 C C   . PHE A 410 ? 1.4302 1.7735 1.5909 0.3450  -0.1774 -0.1296 483 PHE A C   
3180 O O   . PHE A 410 ? 1.7439 2.0253 1.9021 0.3494  -0.1881 -0.1196 483 PHE A O   
3181 C CB  . PHE A 410 ? 1.3412 1.7491 1.4739 0.3295  -0.1725 -0.1544 483 PHE A CB  
3182 C CG  . PHE A 410 ? 1.4319 1.8862 1.5452 0.3414  -0.1695 -0.1843 483 PHE A CG  
3183 C CD1 . PHE A 410 ? 1.4995 1.9188 1.5911 0.3675  -0.1797 -0.2073 483 PHE A CD1 
3184 C CD2 . PHE A 410 ? 1.4392 1.9711 1.5534 0.3257  -0.1565 -0.1899 483 PHE A CD2 
3185 C CE1 . PHE A 410 ? 1.5310 1.9930 1.6025 0.3811  -0.1757 -0.2376 483 PHE A CE1 
3186 C CE2 . PHE A 410 ? 1.4672 2.0485 1.5633 0.3369  -0.1520 -0.2183 483 PHE A CE2 
3187 C CZ  . PHE A 410 ? 1.5585 2.1053 1.6334 0.3664  -0.1609 -0.2433 483 PHE A CZ  
3188 N N   . GLY A 411 ? 1.2095 1.5861 1.3855 0.3266  -0.1664 -0.1158 484 GLY A N   
3189 C CA  . GLY A 411 ? 1.3027 1.6438 1.4934 0.3158  -0.1652 -0.0912 484 GLY A CA  
3190 C C   . GLY A 411 ? 1.1619 1.5115 1.3608 0.3380  -0.1643 -0.0986 484 GLY A C   
3191 O O   . GLY A 411 ? 0.9340 1.3162 1.1422 0.3280  -0.1553 -0.0937 484 GLY A O   
3192 N N   . GLY A 412 ? 1.3294 1.6469 1.5223 0.3671  -0.1751 -0.1098 485 GLY A N   
3193 C CA  . GLY A 412 ? 1.4992 1.8246 1.6979 0.3920  -0.1772 -0.1176 485 GLY A CA  
3194 C C   . GLY A 412 ? 1.4669 1.7364 1.6703 0.3919  -0.1825 -0.0979 485 GLY A C   
3195 O O   . GLY A 412 ? 1.7968 2.0785 2.0088 0.3950  -0.1790 -0.0930 485 GLY A O   
3196 N N   . ALA A 413 ? 1.0860 1.2977 1.2829 0.3864  -0.1911 -0.0862 486 ALA A N   
3197 C CA  . ALA A 413 ? 1.0386 1.1995 1.2390 0.3846  -0.1962 -0.0665 486 ALA A CA  
3198 C C   . ALA A 413 ? 1.3501 1.5227 1.5658 0.3625  -0.1830 -0.0468 486 ALA A C   
3199 O O   . ALA A 413 ? 1.7884 1.9426 2.0081 0.3652  -0.1825 -0.0361 486 ALA A O   
3200 C CB  . ALA A 413 ? 1.2204 1.3272 1.4119 0.3764  -0.2070 -0.0559 486 ALA A CB  
3201 N N   . TYR A 414 ? 1.0401 1.2411 1.2612 0.3407  -0.1727 -0.0424 487 TYR A N   
3202 C CA  . TYR A 414 ? 1.0711 1.2808 1.3026 0.3205  -0.1603 -0.0267 487 TYR A CA  
3203 C C   . TYR A 414 ? 1.2636 1.5034 1.4965 0.3277  -0.1549 -0.0347 487 TYR A C   
3204 O O   . TYR A 414 ? 1.4865 1.7116 1.7232 0.3222  -0.1496 -0.0232 487 TYR A O   
3205 C CB  . TYR A 414 ? 1.3423 1.5773 1.5747 0.2972  -0.1529 -0.0227 487 TYR A CB  
3206 C CG  . TYR A 414 ? 1.4796 1.6894 1.7113 0.2870  -0.1586 -0.0121 487 TYR A CG  
3207 C CD1 . TYR A 414 ? 1.1341 1.2984 1.3705 0.2887  -0.1650 0.0030  487 TYR A CD1 
3208 C CD2 . TYR A 414 ? 1.5457 1.7812 1.7711 0.2735  -0.1582 -0.0160 487 TYR A CD2 
3209 C CE1 . TYR A 414 ? 1.0157 1.1622 1.2524 0.2774  -0.1715 0.0140  487 TYR A CE1 
3210 C CE2 . TYR A 414 ? 1.2953 1.5101 1.5189 0.2627  -0.1648 -0.0054 487 TYR A CE2 
3211 C CZ  . TYR A 414 ? 1.0276 1.1986 1.2577 0.2648  -0.1718 0.0096  487 TYR A CZ  
3212 O OH  . TYR A 414 ? 1.2564 1.4117 1.4856 0.2522  -0.1797 0.0213  487 TYR A OH  
3213 N N   . VAL A 415 ? 1.1732 1.4582 1.4026 0.3401  -0.1564 -0.0549 488 VAL A N   
3214 C CA  . VAL A 415 ? 0.8774 1.2020 1.1093 0.3469  -0.1531 -0.0634 488 VAL A CA  
3215 C C   . VAL A 415 ? 0.9820 1.2786 1.2128 0.3708  -0.1625 -0.0631 488 VAL A C   
3216 O O   . VAL A 415 ? 1.5671 1.8778 1.7998 0.3712  -0.1601 -0.0610 488 VAL A O   
3217 C CB  . VAL A 415 ? 1.0320 1.4222 1.2633 0.3551  -0.1522 -0.0848 488 VAL A CB  
3218 C CG1 . VAL A 415 ? 1.2406 1.6825 1.4769 0.3539  -0.1477 -0.0901 488 VAL A CG1 
3219 C CG2 . VAL A 415 ? 1.0506 1.4629 1.2791 0.3309  -0.1453 -0.0838 488 VAL A CG2 
3220 N N   . VAL A 416 ? 0.9033 1.1579 1.1280 0.3886  -0.1743 -0.0645 489 VAL A N   
3221 C CA  . VAL A 416 ? 0.8899 1.1083 1.1097 0.4089  -0.1856 -0.0610 489 VAL A CA  
3222 C C   . VAL A 416 ? 0.8651 1.0511 1.0876 0.3914  -0.1802 -0.0387 489 VAL A C   
3223 O O   . VAL A 416 ? 0.9911 1.1782 1.2125 0.3969  -0.1810 -0.0349 489 VAL A O   
3224 C CB  . VAL A 416 ? 1.0183 1.1896 1.2262 0.4269  -0.2008 -0.0657 489 VAL A CB  
3225 C CG1 . VAL A 416 ? 0.9353 1.0640 1.1348 0.4447  -0.2141 -0.0590 489 VAL A CG1 
3226 C CG2 . VAL A 416 ? 0.9268 1.1293 1.1291 0.4477  -0.2050 -0.0910 489 VAL A CG2 
3227 N N   . LYS A 417 ? 0.9175 1.0775 1.1435 0.3711  -0.1746 -0.0242 490 LYS A N   
3228 C CA  . LYS A 417 ? 0.9461 1.0809 1.1764 0.3555  -0.1668 -0.0041 490 LYS A CA  
3229 C C   . LYS A 417 ? 0.9636 1.1290 1.1963 0.3438  -0.1537 -0.0044 490 LYS A C   
3230 O O   . LYS A 417 ? 1.2813 1.4376 1.5107 0.3440  -0.1513 0.0021  490 LYS A O   
3231 C CB  . LYS A 417 ? 1.0287 1.1415 1.2658 0.3378  -0.1626 0.0103  490 LYS A CB  
3232 C CG  . LYS A 417 ? 1.3815 1.4495 1.6167 0.3397  -0.1729 0.0233  490 LYS A CG  
3233 C CD  . LYS A 417 ? 1.6754 1.7234 1.9134 0.3345  -0.1675 0.0406  490 LYS A CD  
3234 C CE  . LYS A 417 ? 1.9066 1.9169 2.1446 0.3296  -0.1763 0.0573  490 LYS A CE  
3235 N NZ  . LYS A 417 ? 2.1321 2.1310 2.3739 0.3225  -0.1686 0.0749  490 LYS A NZ  
3236 N N   . LEU A 418 ? 1.0832 1.2837 1.3184 0.3314  -0.1461 -0.0118 491 LEU A N   
3237 C CA  . LEU A 418 ? 0.8066 1.0318 1.0400 0.3147  -0.1346 -0.0117 491 LEU A CA  
3238 C C   . LEU A 418 ? 0.8489 1.1015 1.0775 0.3249  -0.1377 -0.0210 491 LEU A C   
3239 O O   . LEU A 418 ? 1.5030 1.7494 1.7261 0.3158  -0.1316 -0.0152 491 LEU A O   
3240 C CB  . LEU A 418 ? 0.7990 1.0592 1.0330 0.2984  -0.1292 -0.0181 491 LEU A CB  
3241 C CG  . LEU A 418 ? 1.1809 1.4628 1.4087 0.2756  -0.1189 -0.0176 491 LEU A CG  
3242 C CD1 . LEU A 418 ? 1.1516 1.3888 1.3765 0.2623  -0.1098 -0.0018 491 LEU A CD1 
3243 C CD2 . LEU A 418 ? 1.6729 1.9913 1.8990 0.2584  -0.1162 -0.0228 491 LEU A CD2 
3244 N N   . LEU A 419 ? 1.0188 1.3028 1.2488 0.3447  -0.1474 -0.0357 492 LEU A N   
3245 C CA  . LEU A 419 ? 1.3132 1.6311 1.5414 0.3577  -0.1526 -0.0443 492 LEU A CA  
3246 C C   . LEU A 419 ? 1.5944 1.8737 1.8170 0.3721  -0.1608 -0.0351 492 LEU A C   
3247 O O   . LEU A 419 ? 1.9513 2.2447 2.1692 0.3713  -0.1612 -0.0337 492 LEU A O   
3248 C CB  . LEU A 419 ? 1.0362 1.4002 1.2693 0.3802  -0.1609 -0.0630 492 LEU A CB  
3249 C CG  . LEU A 419 ? 0.9865 1.4220 1.2244 0.3676  -0.1539 -0.0748 492 LEU A CG  
3250 C CD1 . LEU A 419 ? 1.2616 1.6945 1.4975 0.3356  -0.1421 -0.0684 492 LEU A CD1 
3251 C CD2 . LEU A 419 ? 1.0055 1.4865 1.2496 0.3952  -0.1612 -0.0943 492 LEU A CD2 
3252 N N   . GLU A 420 ? 1.5939 1.8251 1.8149 0.3826  -0.1682 -0.0280 493 GLU A N   
3253 C CA  . GLU A 420 ? 1.6338 1.8265 1.8469 0.3951  -0.1783 -0.0178 493 GLU A CA  
3254 C C   . GLU A 420 ? 1.5625 1.7304 1.7715 0.3752  -0.1678 -0.0010 493 GLU A C   
3255 O O   . GLU A 420 ? 1.6290 1.7827 1.8292 0.3799  -0.1727 0.0067  493 GLU A O   
3256 C CB  . GLU A 420 ? 1.9590 2.1063 2.1685 0.4085  -0.1907 -0.0150 493 GLU A CB  
3257 C CG  . GLU A 420 ? 2.0451 2.1509 2.2428 0.4219  -0.2050 -0.0045 493 GLU A CG  
3258 C CD  . GLU A 420 ? 2.3580 2.4131 2.5478 0.4303  -0.2187 -0.0009 493 GLU A CD  
3259 O OE1 . GLU A 420 ? 2.5144 2.5308 2.6908 0.4417  -0.2337 0.0071  493 GLU A OE1 
3260 O OE2 . GLU A 420 ? 2.3830 2.4351 2.5773 0.4235  -0.2157 -0.0054 493 GLU A OE2 
3261 N N   . GLU A 421 ? 1.2168 1.3798 1.4308 0.3541  -0.1534 0.0047  494 GLU A N   
3262 C CA  . GLU A 421 ? 1.0587 1.1952 1.2694 0.3391  -0.1423 0.0195  494 GLU A CA  
3263 C C   . GLU A 421 ? 1.0026 1.1587 1.2085 0.3208  -0.1276 0.0162  494 GLU A C   
3264 O O   . GLU A 421 ? 1.2549 1.3978 1.4514 0.3135  -0.1201 0.0227  494 GLU A O   
3265 C CB  . GLU A 421 ? 1.3930 1.4983 1.6125 0.3319  -0.1382 0.0319  494 GLU A CB  
3266 C CG  . GLU A 421 ? 1.6479 1.7274 1.8664 0.3224  -0.1280 0.0480  494 GLU A CG  
3267 C CD  . GLU A 421 ? 1.8772 1.9298 2.1057 0.3203  -0.1302 0.0626  494 GLU A CD  
3268 O OE1 . GLU A 421 ? 1.8534 1.8984 2.0842 0.3274  -0.1435 0.0605  494 GLU A OE1 
3269 O OE2 . GLU A 421 ? 1.9927 2.0337 2.2263 0.3116  -0.1186 0.0755  494 GLU A OE2 
3270 N N   . TYR A 422 ? 0.8822 1.0683 1.0913 0.3120  -0.1239 0.0061  495 TYR A N   
3271 C CA  . TYR A 422 ? 0.9290 1.1266 1.1295 0.2908  -0.1117 0.0035  495 TYR A CA  
3272 C C   . TYR A 422 ? 1.2724 1.5155 1.4652 0.2877  -0.1157 -0.0086 495 TYR A C   
3273 O O   . TYR A 422 ? 1.4002 1.6495 1.5802 0.2686  -0.1079 -0.0106 495 TYR A O   
3274 C CB  . TYR A 422 ? 1.0409 1.2386 1.2467 0.2760  -0.1047 0.0040  495 TYR A CB  
3275 C CG  . TYR A 422 ? 1.0051 1.1601 1.2150 0.2706  -0.0955 0.0180  495 TYR A CG  
3276 C CD1 . TYR A 422 ? 1.0434 1.1682 1.2528 0.2776  -0.0920 0.0280  495 TYR A CD1 
3277 C CD2 . TYR A 422 ? 1.3907 1.5395 1.6051 0.2585  -0.0906 0.0220  495 TYR A CD2 
3278 C CE1 . TYR A 422 ? 1.1068 1.2014 1.3232 0.2748  -0.0828 0.0407  495 TYR A CE1 
3279 C CE2 . TYR A 422 ? 1.4805 1.5945 1.7012 0.2566  -0.0831 0.0355  495 TYR A CE2 
3280 C CZ  . TYR A 422 ? 1.1429 1.2324 1.3661 0.2658  -0.0787 0.0443  495 TYR A CZ  
3281 O OH  . TYR A 422 ? 1.1220 1.1853 1.3547 0.2661  -0.0704 0.0577  495 TYR A OH  
3282 N N   . ALA A 423 ? 1.0770 1.3520 1.2767 0.3067  -0.1285 -0.0170 496 ALA A N   
3283 C CA  . ALA A 423 ? 1.0877 1.4180 1.2851 0.3058  -0.1332 -0.0283 496 ALA A CA  
3284 C C   . ALA A 423 ? 1.3823 1.7199 1.5761 0.3251  -0.1450 -0.0279 496 ALA A C   
3285 O O   . ALA A 423 ? 1.5609 1.9037 1.7422 0.3140  -0.1432 -0.0254 496 ALA A O   
3286 C CB  . ALA A 423 ? 1.0575 1.4343 1.2670 0.3129  -0.1375 -0.0404 496 ALA A CB  
3287 N N   . THR A 424 ? 1.0720 1.4069 1.2740 0.3537  -0.1580 -0.0302 497 THR A N   
3288 C CA  . THR A 424 ? 1.1382 1.4822 1.3371 0.3762  -0.1728 -0.0298 497 THR A CA  
3289 C C   . THR A 424 ? 1.4783 1.7792 1.6624 0.3711  -0.1731 -0.0149 497 THR A C   
3290 O O   . THR A 424 ? 1.7610 2.0808 1.9363 0.3718  -0.1789 -0.0131 497 THR A O   
3291 C CB  . THR A 424 ? 1.1242 1.4580 1.3307 0.4094  -0.1876 -0.0350 497 THR A CB  
3292 O OG1 . THR A 424 ? 1.3313 1.6046 1.5352 0.4086  -0.1866 -0.0255 497 THR A OG1 
3293 C CG2 . THR A 424 ? 0.9851 1.3715 1.2047 0.4184  -0.1873 -0.0525 497 THR A CG2 
3294 N N   . GLY A 425 ? 0.8795 1.1277 1.0606 0.3637  -0.1662 -0.0036 498 GLY A N   
3295 C CA  . GLY A 425 ? 0.8966 1.1055 1.0644 0.3601  -0.1661 0.0113  498 GLY A CA  
3296 C C   . GLY A 425 ? 1.2173 1.4300 1.3688 0.3400  -0.1558 0.0151  498 GLY A C   
3297 O O   . GLY A 425 ? 1.4982 1.7042 1.6365 0.3440  -0.1632 0.0228  498 GLY A O   
3298 N N   . PRO A 426 ? 1.2965 1.5169 1.4455 0.3181  -0.1398 0.0097  499 PRO A N   
3299 C CA  . PRO A 426 ? 1.5056 1.7303 1.6348 0.2979  -0.1303 0.0087  499 PRO A CA  
3300 C C   . PRO A 426 ? 1.6118 1.8872 1.7348 0.2951  -0.1397 -0.0002 499 PRO A C   
3301 O O   . PRO A 426 ? 1.9209 2.2006 2.0240 0.2820  -0.1379 0.0005  499 PRO A O   
3302 C CB  . PRO A 426 ? 1.3583 1.5694 1.4869 0.2778  -0.1128 0.0046  499 PRO A CB  
3303 C CG  . PRO A 426 ? 1.3230 1.5462 1.4722 0.2852  -0.1163 0.0006  499 PRO A CG  
3304 C CD  . PRO A 426 ? 1.2313 1.4428 1.3922 0.3099  -0.1294 0.0068  499 PRO A CD  
3305 N N   . ALA A 427 ? 1.1427 1.4594 1.2822 0.3070  -0.1495 -0.0089 500 ALA A N   
3306 C CA  . ALA A 427 ? 1.2187 1.5951 1.3577 0.3062  -0.1592 -0.0168 500 ALA A CA  
3307 C C   . ALA A 427 ? 1.3333 1.7180 1.4702 0.3296  -0.1770 -0.0106 500 ALA A C   
3308 O O   . ALA A 427 ? 1.7617 2.1776 1.8876 0.3227  -0.1833 -0.0103 500 ALA A O   
3309 C CB  . ALA A 427 ? 1.0484 1.4733 1.2073 0.3119  -0.1619 -0.0285 500 ALA A CB  
3310 N N   . VAL A 428 ? 1.0363 1.3904 1.1818 0.3561  -0.1865 -0.0046 501 VAL A N   
3311 C CA  . VAL A 428 ? 1.1776 1.5268 1.3183 0.3797  -0.2055 0.0038  501 VAL A CA  
3312 C C   . VAL A 428 ? 1.1948 1.5085 1.3116 0.3643  -0.2023 0.0180  501 VAL A C   
3313 O O   . VAL A 428 ? 1.3473 1.6763 1.4521 0.3683  -0.2146 0.0242  501 VAL A O   
3314 C CB  . VAL A 428 ? 0.9517 1.2674 1.1027 0.4095  -0.2175 0.0062  501 VAL A CB  
3315 C CG1 . VAL A 428 ? 0.9851 1.2779 1.1246 0.4306  -0.2378 0.0188  501 VAL A CG1 
3316 C CG2 . VAL A 428 ? 0.9403 1.2991 1.1119 0.4290  -0.2222 -0.0103 501 VAL A CG2 
3317 N N   . LEU A 429 ? 1.2576 1.5276 1.3677 0.3472  -0.1858 0.0233  502 LEU A N   
3318 C CA  . LEU A 429 ? 1.3651 1.6067 1.4518 0.3306  -0.1782 0.0345  502 LEU A CA  
3319 C C   . LEU A 429 ? 1.3053 1.5791 1.3742 0.3083  -0.1720 0.0274  502 LEU A C   
3320 O O   . LEU A 429 ? 1.0920 1.3644 1.1392 0.3014  -0.1760 0.0348  502 LEU A O   
3321 C CB  . LEU A 429 ? 0.9665 1.1642 1.0536 0.3187  -0.1596 0.0393  502 LEU A CB  
3322 C CG  . LEU A 429 ? 1.0390 1.1947 1.1301 0.3311  -0.1655 0.0544  502 LEU A CG  
3323 C CD1 . LEU A 429 ? 1.2124 1.3429 1.3164 0.3239  -0.1495 0.0551  502 LEU A CD1 
3324 C CD2 . LEU A 429 ? 1.4445 1.5808 1.5127 0.3242  -0.1671 0.0696  502 LEU A CD2 
3325 N N   . THR A 430 ? 1.1351 1.4370 1.2107 0.2947  -0.1634 0.0136  503 THR A N   
3326 C CA  . THR A 430 ? 1.0161 1.3463 1.0725 0.2690  -0.1582 0.0057  503 THR A CA  
3327 C C   . THR A 430 ? 1.1733 1.5551 1.2272 0.2760  -0.1778 0.0065  503 THR A C   
3328 O O   . THR A 430 ? 1.3098 1.6962 1.3393 0.2620  -0.1800 0.0101  503 THR A O   
3329 C CB  . THR A 430 ? 1.2597 1.6089 1.3231 0.2511  -0.1477 -0.0075 503 THR A CB  
3330 O OG1 . THR A 430 ? 1.2607 1.5608 1.3244 0.2443  -0.1302 -0.0069 503 THR A OG1 
3331 C CG2 . THR A 430 ? 1.4841 1.8600 1.5236 0.2210  -0.1450 -0.0153 503 THR A CG2 
3332 N N   . VAL A 431 ? 1.1416 1.5643 1.2207 0.2987  -0.1919 0.0029  504 VAL A N   
3333 C CA  . VAL A 431 ? 1.1005 1.5803 1.1829 0.3103  -0.2116 0.0036  504 VAL A CA  
3334 C C   . VAL A 431 ? 1.0136 1.4674 1.0828 0.3269  -0.2262 0.0194  504 VAL A C   
3335 O O   . VAL A 431 ? 1.1642 1.6514 1.2222 0.3252  -0.2395 0.0243  504 VAL A O   
3336 C CB  . VAL A 431 ? 0.9704 1.5005 1.0847 0.3368  -0.2221 -0.0051 504 VAL A CB  
3337 C CG1 . VAL A 431 ? 0.9704 1.4603 1.0987 0.3720  -0.2300 -0.0005 504 VAL A CG1 
3338 C CG2 . VAL A 431 ? 1.7807 2.3838 1.9013 0.3461  -0.2402 -0.0059 504 VAL A CG2 
3339 N N   . ALA A 432 ? 1.0167 1.4114 1.0856 0.3403  -0.2245 0.0287  505 ALA A N   
3340 C CA  . ALA A 432 ? 1.0459 1.4077 1.0982 0.3511  -0.2377 0.0463  505 ALA A CA  
3341 C C   . ALA A 432 ? 1.0642 1.4130 1.0844 0.3209  -0.2272 0.0522  505 ALA A C   
3342 O O   . ALA A 432 ? 1.0927 1.4412 1.0937 0.3219  -0.2403 0.0650  505 ALA A O   
3343 C CB  . ALA A 432 ? 1.3991 1.7017 1.4572 0.3665  -0.2375 0.0552  505 ALA A CB  
3344 N N   . LEU A 433 ? 1.3262 1.6625 1.3385 0.2948  -0.2039 0.0424  506 LEU A N   
3345 C CA  . LEU A 433 ? 1.2943 1.6174 1.2734 0.2664  -0.1911 0.0431  506 LEU A CA  
3346 C C   . LEU A 433 ? 1.2841 1.6593 1.2486 0.2510  -0.2005 0.0373  506 LEU A C   
3347 O O   . LEU A 433 ? 1.1174 1.4932 1.0528 0.2376  -0.2041 0.0439  506 LEU A O   
3348 C CB  . LEU A 433 ? 1.1234 1.4151 1.0980 0.2470  -0.1645 0.0326  506 LEU A CB  
3349 C CG  . LEU A 433 ? 1.0886 1.3519 1.0283 0.2224  -0.1463 0.0310  506 LEU A CG  
3350 C CD1 . LEU A 433 ? 1.1062 1.3955 1.0215 0.1953  -0.1432 0.0171  506 LEU A CD1 
3351 C CD2 . LEU A 433 ? 1.1687 1.4164 1.0890 0.2264  -0.1532 0.0478  506 LEU A CD2 
3352 N N   . ILE A 434 ? 1.3808 1.8035 1.3649 0.2510  -0.2048 0.0255  507 ILE A N   
3353 C CA  . ILE A 434 ? 1.4520 1.9337 1.4261 0.2344  -0.2151 0.0204  507 ILE A CA  
3354 C C   . ILE A 434 ? 1.3764 1.8895 1.3521 0.2557  -0.2408 0.0342  507 ILE A C   
3355 O O   . ILE A 434 ? 1.1540 1.6970 1.1076 0.2391  -0.2498 0.0375  507 ILE A O   
3356 C CB  . ILE A 434 ? 1.1800 1.7131 1.1781 0.2299  -0.2147 0.0067  507 ILE A CB  
3357 C CG1 . ILE A 434 ? 1.1094 1.6041 1.1072 0.2126  -0.1917 -0.0040 507 ILE A CG1 
3358 C CG2 . ILE A 434 ? 1.2452 1.8389 1.2289 0.2034  -0.2228 0.0017  507 ILE A CG2 
3359 C CD1 . ILE A 434 ? 1.3336 1.7912 1.2931 0.1774  -0.1750 -0.0095 507 ILE A CD1 
3360 N N   . GLU A 435 ? 1.3045 1.8078 1.3040 0.2923  -0.2539 0.0425  508 GLU A N   
3361 C CA  . GLU A 435 ? 1.3337 1.8554 1.3338 0.3173  -0.2802 0.0574  508 GLU A CA  
3362 C C   . GLU A 435 ? 1.3205 1.7978 1.2857 0.3061  -0.2821 0.0742  508 GLU A C   
3363 O O   . GLU A 435 ? 1.2931 1.7972 1.2406 0.3020  -0.2983 0.0843  508 GLU A O   
3364 C CB  . GLU A 435 ? 1.8190 2.3287 1.8484 0.3599  -0.2935 0.0607  508 GLU A CB  
3365 C CG  . GLU A 435 ? 1.9593 2.5253 2.0232 0.3765  -0.2953 0.0447  508 GLU A CG  
3366 C CD  . GLU A 435 ? 2.1507 2.7046 2.2386 0.4221  -0.3106 0.0462  508 GLU A CD  
3367 O OE1 . GLU A 435 ? 2.4640 2.9747 2.5407 0.4421  -0.3265 0.0619  508 GLU A OE1 
3368 O OE2 . GLU A 435 ? 2.1184 2.7037 2.2333 0.4368  -0.3069 0.0314  508 GLU A OE2 
3369 N N   . ALA A 436 ? 1.6931 2.1072 1.6485 0.3002  -0.2655 0.0778  509 ALA A N   
3370 C CA  . ALA A 436 ? 2.0055 2.3785 1.9285 0.2885  -0.2643 0.0941  509 ALA A CA  
3371 C C   . ALA A 436 ? 1.7649 2.1561 1.6526 0.2539  -0.2555 0.0899  509 ALA A C   
3372 O O   . ALA A 436 ? 1.8149 2.2020 1.6739 0.2459  -0.2650 0.1042  509 ALA A O   
3373 C CB  . ALA A 436 ? 2.3322 2.6453 2.2557 0.2861  -0.2448 0.0964  509 ALA A CB  
3374 N N   . VAL A 437 ? 1.5935 2.0020 1.4801 0.2317  -0.2382 0.0703  510 VAL A N   
3375 C CA  . VAL A 437 ? 1.6147 2.0367 1.4645 0.1969  -0.2300 0.0627  510 VAL A CA  
3376 C C   . VAL A 437 ? 1.6626 2.1500 1.5100 0.1937  -0.2539 0.0655  510 VAL A C   
3377 O O   . VAL A 437 ? 2.1741 2.6731 1.9873 0.1739  -0.2602 0.0710  510 VAL A O   
3378 C CB  . VAL A 437 ? 1.7627 2.1716 1.6082 0.1733  -0.2049 0.0412  510 VAL A CB  
3379 C CG1 . VAL A 437 ? 1.7399 2.1658 1.5457 0.1368  -0.2006 0.0306  510 VAL A CG1 
3380 C CG2 . VAL A 437 ? 1.8765 2.2229 1.7189 0.1748  -0.1809 0.0401  510 VAL A CG2 
3381 N N   . ALA A 438 ? 1.4808 2.0147 1.3650 0.2139  -0.2674 0.0619  511 ALA A N   
3382 C CA  . ALA A 438 ? 1.6375 2.2461 1.5275 0.2128  -0.2894 0.0633  511 ALA A CA  
3383 C C   . ALA A 438 ? 1.4332 2.0545 1.3153 0.2321  -0.3161 0.0851  511 ALA A C   
3384 O O   . ALA A 438 ? 1.2618 1.9296 1.1266 0.2170  -0.3309 0.0901  511 ALA A O   
3385 C CB  . ALA A 438 ? 1.6699 2.3281 1.6044 0.2341  -0.2953 0.0541  511 ALA A CB  
3386 N N   . VAL A 439 ? 1.7399 2.3187 1.6331 0.2639  -0.3238 0.0991  512 VAL A N   
3387 C CA  . VAL A 439 ? 1.3535 1.9357 1.2384 0.2845  -0.3516 0.1220  512 VAL A CA  
3388 C C   . VAL A 439 ? 1.5141 2.0645 1.3509 0.2559  -0.3482 0.1347  512 VAL A C   
3389 O O   . VAL A 439 ? 2.2092 2.7868 2.0267 0.2532  -0.3696 0.1499  512 VAL A O   
3390 C CB  . VAL A 439 ? 1.5667 2.1063 1.4747 0.3264  -0.3629 0.1330  512 VAL A CB  
3391 C CG1 . VAL A 439 ? 1.4802 2.0128 1.3745 0.3467  -0.3933 0.1588  512 VAL A CG1 
3392 C CG2 . VAL A 439 ? 1.7931 2.3691 1.7461 0.3565  -0.3667 0.1188  512 VAL A CG2 
3393 N N   . SER A 440 ? 1.7601 2.2565 1.5774 0.2350  -0.3210 0.1283  513 SER A N   
3394 C CA  . SER A 440 ? 2.0542 2.5170 1.8264 0.2110  -0.3143 0.1397  513 SER A CA  
3395 C C   . SER A 440 ? 2.1422 2.6301 1.8770 0.1708  -0.3034 0.1272  513 SER A C   
3396 O O   . SER A 440 ? 2.3230 2.8088 2.0183 0.1525  -0.3087 0.1386  513 SER A O   
3397 C CB  . SER A 440 ? 1.9986 2.3965 1.7677 0.2092  -0.2896 0.1390  513 SER A CB  
3398 O OG  . SER A 440 ? 2.0677 2.4394 1.7937 0.1858  -0.2805 0.1490  513 SER A OG  
3399 N N   . TRP A 441 ? 2.0889 2.5977 1.8324 0.1553  -0.2888 0.1039  514 TRP A N   
3400 C CA  . TRP A 441 ? 2.3427 2.8597 2.0456 0.1142  -0.2752 0.0887  514 TRP A CA  
3401 C C   . TRP A 441 ? 2.3393 2.9265 2.0442 0.0988  -0.2921 0.0820  514 TRP A C   
3402 O O   . TRP A 441 ? 2.4362 3.0357 2.1011 0.0628  -0.2888 0.0735  514 TRP A O   
3403 C CB  . TRP A 441 ? 2.5036 2.9756 2.2022 0.0997  -0.2420 0.0667  514 TRP A CB  
3404 C CG  . TRP A 441 ? 2.4666 2.8769 2.1545 0.1060  -0.2221 0.0720  514 TRP A CG  
3405 C CD1 . TRP A 441 ? 2.4725 2.8646 2.1490 0.1165  -0.2303 0.0938  514 TRP A CD1 
3406 C CD2 . TRP A 441 ? 2.4273 2.7900 2.1153 0.1015  -0.1916 0.0566  514 TRP A CD2 
3407 N NE1 . TRP A 441 ? 2.5159 2.8574 2.1867 0.1171  -0.2058 0.0927  514 TRP A NE1 
3408 C CE2 . TRP A 441 ? 2.4062 2.7300 2.0853 0.1100  -0.1818 0.0698  514 TRP A CE2 
3409 C CE3 . TRP A 441 ? 2.3744 2.7240 2.0685 0.0908  -0.1727 0.0343  514 TRP A CE3 
3410 C CZ2 . TRP A 441 ? 2.2650 2.5442 1.9449 0.1104  -0.1532 0.0608  514 TRP A CZ2 
3411 C CZ3 . TRP A 441 ? 2.3501 2.6487 2.0432 0.0928  -0.1454 0.0258  514 TRP A CZ3 
3412 C CH2 . TRP A 441 ? 2.2460 2.5131 1.9338 0.1036  -0.1356 0.0386  514 TRP A CH2 
3413 N N   . PHE A 442 ? 2.1783 2.8134 1.9282 0.1251  -0.3101 0.0852  515 PHE A N   
3414 C CA  . PHE A 442 ? 2.0675 2.7813 1.8255 0.1122  -0.3272 0.0808  515 PHE A CA  
3415 C C   . PHE A 442 ? 2.1772 2.9448 1.9446 0.1335  -0.3613 0.1029  515 PHE A C   
3416 O O   . PHE A 442 ? 2.5634 3.3742 2.3044 0.1091  -0.3756 0.1078  515 PHE A O   
3417 C CB  . PHE A 442 ? 1.9227 2.6688 1.7258 0.1242  -0.3227 0.0668  515 PHE A CB  
3418 C CG  . PHE A 442 ? 1.8597 2.5917 1.6464 0.0865  -0.2991 0.0442  515 PHE A CG  
3419 C CD1 . PHE A 442 ? 1.8638 2.5208 1.6399 0.0816  -0.2714 0.0334  515 PHE A CD1 
3420 C CD2 . PHE A 442 ? 1.8644 2.6581 1.6459 0.0554  -0.3058 0.0348  515 PHE A CD2 
3421 C CE1 . PHE A 442 ? 1.8718 2.5092 1.6306 0.0491  -0.2515 0.0135  515 PHE A CE1 
3422 C CE2 . PHE A 442 ? 1.8624 2.6353 1.6242 0.0187  -0.2861 0.0151  515 PHE A CE2 
3423 C CZ  . PHE A 442 ? 1.8663 2.5577 1.6160 0.0169  -0.2592 0.0043  515 PHE A CZ  
3424 N N   . TYR A 443 ? 2.2441 3.0041 2.0457 0.1790  -0.3752 0.1168  516 TYR A N   
3425 C CA  . TYR A 443 ? 2.2078 3.0113 2.0209 0.2069  -0.4094 0.1389  516 TYR A CA  
3426 C C   . TYR A 443 ? 2.2307 2.9954 1.9984 0.1952  -0.4176 0.1592  516 TYR A C   
3427 O O   . TYR A 443 ? 2.7721 3.5757 2.5308 0.2008  -0.4456 0.1781  516 TYR A O   
3428 C CB  . TYR A 443 ? 2.1012 2.8963 1.9599 0.2606  -0.4213 0.1456  516 TYR A CB  
3429 C CG  . TYR A 443 ? 2.1158 2.9369 1.9830 0.2959  -0.4570 0.1699  516 TYR A CG  
3430 C CD1 . TYR A 443 ? 2.3601 3.2717 2.2451 0.3036  -0.4809 0.1739  516 TYR A CD1 
3431 C CD2 . TYR A 443 ? 2.0370 2.7923 1.8940 0.3211  -0.4682 0.1902  516 TYR A CD2 
3432 C CE1 . TYR A 443 ? 2.4646 3.3995 2.3582 0.3395  -0.5150 0.1970  516 TYR A CE1 
3433 C CE2 . TYR A 443 ? 2.1974 2.9687 2.0590 0.3545  -0.5029 0.2137  516 TYR A CE2 
3434 C CZ  . TYR A 443 ? 2.3860 3.2465 2.2666 0.3655  -0.5263 0.2168  516 TYR A CZ  
3435 O OH  . TYR A 443 ? 2.4777 3.3536 2.3638 0.4022  -0.5621 0.2410  516 TYR A OH  
3436 N N   . GLY A 444 ? 1.8511 2.5429 1.5903 0.1786  -0.3933 0.1560  517 GLY A N   
3437 C CA  . GLY A 444 ? 2.2513 2.9053 1.9455 0.1646  -0.3968 0.1744  517 GLY A CA  
3438 C C   . GLY A 444 ? 2.1052 2.7086 1.8096 0.1987  -0.4081 0.1966  517 GLY A C   
3439 O O   . GLY A 444 ? 1.8962 2.5163 1.6332 0.2372  -0.4330 0.2087  517 GLY A O   
3440 N N   . ILE A 445 ? 2.0983 2.6396 1.7738 0.1846  -0.3898 0.2017  518 ILE A N   
3441 C CA  . ILE A 445 ? 1.8656 2.3535 1.5454 0.2095  -0.3993 0.2239  518 ILE A CA  
3442 C C   . ILE A 445 ? 1.8958 2.3917 1.5489 0.2131  -0.4319 0.2548  518 ILE A C   
3443 O O   . ILE A 445 ? 1.6728 2.1389 1.3357 0.2426  -0.4542 0.2770  518 ILE A O   
3444 C CB  . ILE A 445 ? 1.9203 2.3471 1.5807 0.1911  -0.3677 0.2198  518 ILE A CB  
3445 C CG1 . ILE A 445 ? 1.6938 2.0666 1.3645 0.2159  -0.3778 0.2417  518 ILE A CG1 
3446 C CG2 . ILE A 445 ? 2.3185 2.7435 1.9243 0.1513  -0.3554 0.2223  518 ILE A CG2 
3447 C CD1 . ILE A 445 ? 1.6050 1.9751 1.3245 0.2568  -0.3913 0.2383  518 ILE A CD1 
3448 N N   . THR A 446 ? 1.9541 2.4877 1.5709 0.1822  -0.4360 0.2563  519 THR A N   
3449 C CA  . THR A 446 ? 2.1026 2.6495 1.6899 0.1810  -0.4675 0.2862  519 THR A CA  
3450 C C   . THR A 446 ? 2.0482 2.6378 1.6713 0.2209  -0.5050 0.2993  519 THR A C   
3451 O O   . THR A 446 ? 2.1900 2.7588 1.8092 0.2450  -0.5343 0.3280  519 THR A O   
3452 C CB  . THR A 446 ? 2.2839 2.8679 1.8235 0.1365  -0.4631 0.2819  519 THR A CB  
3453 O OG1 . THR A 446 ? 2.3762 3.0232 1.9343 0.1288  -0.4628