data_5I74
# 
_entry.id   5I74 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I74         
WWPDB D_1000218381 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5I75 unspecified 
PDB . 5I73 unspecified 
PDB . 5I71 unspecified 
PDB . 5I6X unspecified 
PDB . 5I6Z unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I74 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coleman, J.A.' 1 
'Green, E.M.'   2 
'Gouaux, E.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            532 
_citation.language                  ? 
_citation.page_first                334 
_citation.page_last                 339 
_citation.title                     'X-ray structures and mechanism of the human serotonin transporter.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature17629 
_citation.pdbx_database_id_PubMed   27049939 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Coleman, J.A.' 1 ? 
primary 'Green, E.M.'   2 ? 
primary 'Gouaux, E.'    3 ? 
# 
_cell.entry_id           5I74 
_cell.length_a           129.590 
_cell.length_b           164.000 
_cell.length_c           140.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I74 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sodium-dependent serotonin transporter'                                                     61689.766 1 ? ? ? ? 
2 polymer     man '8B6 antibody, heavy chain'                                                                  23688.365 1 ? ? ? ? 
3 polymer     man '8B6 antibody, light chain'                                                                  23718.217 1 ? ? ? ? 
4 non-polymer syn '(1S)-1-(4-bromophenyl)-1-[3-(dimethylamino)propyl]-1,3-dihydro-2-benzofuran-5-carbonitrile' 385.298   1 ? ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     221.208   2 ? ? ? ? 
6 non-polymer syn CHOLESTEROL                                                                                  386.654   1 ? ? ? ? 
7 non-polymer syn DODECANE                                                                                     170.335   1 ? ? ? ? 
8 non-polymer syn HEXANE                                                                                       86.175    1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SERT,5HT transporter,5HTT,Solute carrier family 6 member 4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRK
ICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYT
RHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNED
VSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITC
FFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTLVPR
;
;GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRK
ICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYT
RHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNED
VSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITC
FFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTLVPR
;
A ? 
2 'polypeptide(L)' no no 
;EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAY
MELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTW
NSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
;
;EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAY
MELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTW
NSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
;
B ? 
3 'polypeptide(L)' no no 
;DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQA
EDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQA
EDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   GLY n 
1 5   GLU n 
1 6   ARG n 
1 7   GLU n 
1 8   THR n 
1 9   TRP n 
1 10  GLY n 
1 11  LYS n 
1 12  LYS n 
1 13  VAL n 
1 14  ASP n 
1 15  PHE n 
1 16  LEU n 
1 17  LEU n 
1 18  SER n 
1 19  VAL n 
1 20  ILE n 
1 21  GLY n 
1 22  TYR n 
1 23  ALA n 
1 24  VAL n 
1 25  ASP n 
1 26  LEU n 
1 27  GLY n 
1 28  ASN n 
1 29  VAL n 
1 30  TRP n 
1 31  ARG n 
1 32  PHE n 
1 33  PRO n 
1 34  TYR n 
1 35  ILE n 
1 36  CYS n 
1 37  ALA n 
1 38  GLN n 
1 39  ASN n 
1 40  GLY n 
1 41  GLY n 
1 42  GLY n 
1 43  ALA n 
1 44  PHE n 
1 45  LEU n 
1 46  LEU n 
1 47  PRO n 
1 48  TYR n 
1 49  THR n 
1 50  ILE n 
1 51  MET n 
1 52  ALA n 
1 53  ILE n 
1 54  PHE n 
1 55  GLY n 
1 56  GLY n 
1 57  ILE n 
1 58  PRO n 
1 59  LEU n 
1 60  PHE n 
1 61  TYR n 
1 62  MET n 
1 63  GLU n 
1 64  LEU n 
1 65  ALA n 
1 66  LEU n 
1 67  GLY n 
1 68  GLN n 
1 69  TYR n 
1 70  HIS n 
1 71  ARG n 
1 72  ASN n 
1 73  GLY n 
1 74  CYS n 
1 75  ILE n 
1 76  SER n 
1 77  ILE n 
1 78  TRP n 
1 79  ARG n 
1 80  LYS n 
1 81  ILE n 
1 82  CYS n 
1 83  PRO n 
1 84  ILE n 
1 85  PHE n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  GLY n 
1 90  TYR n 
1 91  ALA n 
1 92  ILE n 
1 93  CYS n 
1 94  ILE n 
1 95  ILE n 
1 96  ALA n 
1 97  PHE n 
1 98  TYR n 
1 99  ILE n 
1 100 ALA n 
1 101 SER n 
1 102 TYR n 
1 103 TYR n 
1 104 ASN n 
1 105 THR n 
1 106 ILE n 
1 107 MET n 
1 108 ALA n 
1 109 TRP n 
1 110 ALA n 
1 111 LEU n 
1 112 TYR n 
1 113 TYR n 
1 114 LEU n 
1 115 ILE n 
1 116 SER n 
1 117 SER n 
1 118 PHE n 
1 119 THR n 
1 120 ASP n 
1 121 GLN n 
1 122 LEU n 
1 123 PRO n 
1 124 TRP n 
1 125 THR n 
1 126 SER n 
1 127 CYS n 
1 128 LYS n 
1 129 ASN n 
1 130 SER n 
1 131 TRP n 
1 132 ASN n 
1 133 THR n 
1 134 GLY n 
1 135 ASN n 
1 136 CYS n 
1 137 THR n 
1 138 ASN n 
1 139 TYR n 
1 140 PHE n 
1 141 SER n 
1 142 GLU n 
1 143 ASP n 
1 144 ASN n 
1 145 ILE n 
1 146 THR n 
1 147 TRP n 
1 148 THR n 
1 149 LEU n 
1 150 HIS n 
1 151 SER n 
1 152 THR n 
1 153 SER n 
1 154 PRO n 
1 155 ALA n 
1 156 GLU n 
1 157 GLU n 
1 158 PHE n 
1 159 TYR n 
1 160 THR n 
1 161 ARG n 
1 162 HIS n 
1 163 VAL n 
1 164 LEU n 
1 165 GLN n 
1 166 ILE n 
1 167 HIS n 
1 168 ARG n 
1 169 SER n 
1 170 LYS n 
1 171 GLY n 
1 172 LEU n 
1 173 GLN n 
1 174 ASP n 
1 175 LEU n 
1 176 GLY n 
1 177 GLY n 
1 178 ILE n 
1 179 SER n 
1 180 TRP n 
1 181 GLN n 
1 182 LEU n 
1 183 ALA n 
1 184 LEU n 
1 185 CYS n 
1 186 ILE n 
1 187 MET n 
1 188 LEU n 
1 189 ILE n 
1 190 PHE n 
1 191 THR n 
1 192 VAL n 
1 193 ILE n 
1 194 TYR n 
1 195 PHE n 
1 196 SER n 
1 197 ILE n 
1 198 TRP n 
1 199 LYS n 
1 200 GLY n 
1 201 VAL n 
1 202 LYS n 
1 203 THR n 
1 204 SER n 
1 205 GLY n 
1 206 LYS n 
1 207 VAL n 
1 208 VAL n 
1 209 TRP n 
1 210 VAL n 
1 211 THR n 
1 212 ALA n 
1 213 THR n 
1 214 PHE n 
1 215 PRO n 
1 216 TYR n 
1 217 ILE n 
1 218 ALA n 
1 219 LEU n 
1 220 SER n 
1 221 VAL n 
1 222 LEU n 
1 223 LEU n 
1 224 VAL n 
1 225 ARG n 
1 226 GLY n 
1 227 ALA n 
1 228 THR n 
1 229 LEU n 
1 230 PRO n 
1 231 GLY n 
1 232 ALA n 
1 233 TRP n 
1 234 ARG n 
1 235 GLY n 
1 236 VAL n 
1 237 LEU n 
1 238 PHE n 
1 239 TYR n 
1 240 LEU n 
1 241 LYS n 
1 242 PRO n 
1 243 ASN n 
1 244 TRP n 
1 245 GLN n 
1 246 LYS n 
1 247 LEU n 
1 248 LEU n 
1 249 GLU n 
1 250 THR n 
1 251 GLY n 
1 252 VAL n 
1 253 TRP n 
1 254 ILE n 
1 255 ASP n 
1 256 ALA n 
1 257 ALA n 
1 258 ALA n 
1 259 GLN n 
1 260 ILE n 
1 261 PHE n 
1 262 PHE n 
1 263 SER n 
1 264 LEU n 
1 265 GLY n 
1 266 PRO n 
1 267 GLY n 
1 268 PHE n 
1 269 GLY n 
1 270 VAL n 
1 271 LEU n 
1 272 LEU n 
1 273 ALA n 
1 274 PHE n 
1 275 ALA n 
1 276 SER n 
1 277 TYR n 
1 278 ASN n 
1 279 LYS n 
1 280 PHE n 
1 281 ASN n 
1 282 ASN n 
1 283 ASN n 
1 284 CYS n 
1 285 TYR n 
1 286 GLN n 
1 287 ASP n 
1 288 ALA n 
1 289 LEU n 
1 290 VAL n 
1 291 THR n 
1 292 SER n 
1 293 VAL n 
1 294 VAL n 
1 295 ASN n 
1 296 CYS n 
1 297 MET n 
1 298 THR n 
1 299 SER n 
1 300 PHE n 
1 301 VAL n 
1 302 SER n 
1 303 GLY n 
1 304 PHE n 
1 305 VAL n 
1 306 ILE n 
1 307 PHE n 
1 308 THR n 
1 309 VAL n 
1 310 LEU n 
1 311 GLY n 
1 312 TYR n 
1 313 MET n 
1 314 ALA n 
1 315 GLU n 
1 316 MET n 
1 317 ARG n 
1 318 ASN n 
1 319 GLU n 
1 320 ASP n 
1 321 VAL n 
1 322 SER n 
1 323 GLU n 
1 324 VAL n 
1 325 ALA n 
1 326 LYS n 
1 327 ASP n 
1 328 ALA n 
1 329 GLY n 
1 330 PRO n 
1 331 SER n 
1 332 LEU n 
1 333 LEU n 
1 334 PHE n 
1 335 ILE n 
1 336 THR n 
1 337 TYR n 
1 338 ALA n 
1 339 GLU n 
1 340 ALA n 
1 341 ILE n 
1 342 ALA n 
1 343 ASN n 
1 344 MET n 
1 345 PRO n 
1 346 ALA n 
1 347 SER n 
1 348 THR n 
1 349 PHE n 
1 350 PHE n 
1 351 ALA n 
1 352 ILE n 
1 353 ILE n 
1 354 PHE n 
1 355 PHE n 
1 356 LEU n 
1 357 MET n 
1 358 LEU n 
1 359 ILE n 
1 360 THR n 
1 361 LEU n 
1 362 GLY n 
1 363 LEU n 
1 364 ASP n 
1 365 SER n 
1 366 SER n 
1 367 PHE n 
1 368 ALA n 
1 369 GLY n 
1 370 LEU n 
1 371 GLU n 
1 372 GLY n 
1 373 VAL n 
1 374 ILE n 
1 375 THR n 
1 376 ALA n 
1 377 VAL n 
1 378 LEU n 
1 379 ASP n 
1 380 GLU n 
1 381 PHE n 
1 382 PRO n 
1 383 HIS n 
1 384 VAL n 
1 385 TRP n 
1 386 ALA n 
1 387 LYS n 
1 388 ARG n 
1 389 ARG n 
1 390 GLU n 
1 391 ARG n 
1 392 PHE n 
1 393 VAL n 
1 394 LEU n 
1 395 ALA n 
1 396 VAL n 
1 397 VAL n 
1 398 ILE n 
1 399 THR n 
1 400 CYS n 
1 401 PHE n 
1 402 PHE n 
1 403 GLY n 
1 404 SER n 
1 405 LEU n 
1 406 VAL n 
1 407 THR n 
1 408 LEU n 
1 409 THR n 
1 410 PHE n 
1 411 GLY n 
1 412 GLY n 
1 413 ALA n 
1 414 TYR n 
1 415 VAL n 
1 416 VAL n 
1 417 LYS n 
1 418 LEU n 
1 419 LEU n 
1 420 GLU n 
1 421 GLU n 
1 422 TYR n 
1 423 ALA n 
1 424 THR n 
1 425 GLY n 
1 426 PRO n 
1 427 ALA n 
1 428 VAL n 
1 429 LEU n 
1 430 THR n 
1 431 VAL n 
1 432 ALA n 
1 433 LEU n 
1 434 ILE n 
1 435 GLU n 
1 436 ALA n 
1 437 VAL n 
1 438 ALA n 
1 439 VAL n 
1 440 SER n 
1 441 TRP n 
1 442 PHE n 
1 443 TYR n 
1 444 GLY n 
1 445 ILE n 
1 446 THR n 
1 447 GLN n 
1 448 PHE n 
1 449 CYS n 
1 450 ARG n 
1 451 ASP n 
1 452 VAL n 
1 453 LYS n 
1 454 GLU n 
1 455 MET n 
1 456 LEU n 
1 457 GLY n 
1 458 PHE n 
1 459 SER n 
1 460 PRO n 
1 461 GLY n 
1 462 TRP n 
1 463 PHE n 
1 464 TRP n 
1 465 ARG n 
1 466 ILE n 
1 467 CYS n 
1 468 TRP n 
1 469 VAL n 
1 470 ALA n 
1 471 ILE n 
1 472 SER n 
1 473 PRO n 
1 474 LEU n 
1 475 PHE n 
1 476 LEU n 
1 477 LEU n 
1 478 PHE n 
1 479 ILE n 
1 480 ILE n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 LEU n 
1 485 MET n 
1 486 SER n 
1 487 PRO n 
1 488 PRO n 
1 489 GLN n 
1 490 LEU n 
1 491 ARG n 
1 492 LEU n 
1 493 PHE n 
1 494 GLN n 
1 495 TYR n 
1 496 ASN n 
1 497 TYR n 
1 498 PRO n 
1 499 TYR n 
1 500 TRP n 
1 501 SER n 
1 502 ILE n 
1 503 ILE n 
1 504 LEU n 
1 505 GLY n 
1 506 TYR n 
1 507 ALA n 
1 508 ILE n 
1 509 GLY n 
1 510 THR n 
1 511 SER n 
1 512 SER n 
1 513 PHE n 
1 514 ILE n 
1 515 CYS n 
1 516 ILE n 
1 517 PRO n 
1 518 THR n 
1 519 TYR n 
1 520 ILE n 
1 521 ALA n 
1 522 TYR n 
1 523 ARG n 
1 524 LEU n 
1 525 ILE n 
1 526 ILE n 
1 527 THR n 
1 528 PRO n 
1 529 GLY n 
1 530 THR n 
1 531 PHE n 
1 532 LYS n 
1 533 GLU n 
1 534 ARG n 
1 535 ILE n 
1 536 ILE n 
1 537 LYS n 
1 538 SER n 
1 539 ILE n 
1 540 THR n 
1 541 PRO n 
1 542 GLU n 
1 543 THR n 
1 544 PRO n 
1 545 THR n 
1 546 LEU n 
1 547 VAL n 
1 548 PRO n 
1 549 ARG n 
2 1   GLU n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  TYR n 
2 34  MET n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  SER n 
2 41  HIS n 
2 42  GLY n 
2 43  LYS n 
2 44  SER n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  ASN n 
2 51  ILE n 
2 52  ASN n 
2 53  PRO n 
2 54  ASN n 
2 55  ASN n 
2 56  GLY n 
2 57  GLY n 
2 58  THR n 
2 59  SER n 
2 60  TYR n 
2 61  ASN n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  VAL n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  THR n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  ARG n 
2 85  SER n 
2 86  LEU n 
2 87  THR n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  THR n 
2 98  ARG n 
2 99  SER n 
2 100 PRO n 
2 101 VAL n 
2 102 ARG n 
2 103 PRO n 
2 104 TYR n 
2 105 TYR n 
2 106 PHE n 
2 107 ASP n 
2 108 TYR n 
2 109 TRP n 
2 110 GLY n 
2 111 GLN n 
2 112 GLY n 
2 113 THR n 
2 114 THR n 
2 115 LEU n 
2 116 THR n 
2 117 VAL n 
2 118 SER n 
2 119 SER n 
2 120 ALA n 
2 121 LYS n 
2 122 THR n 
2 123 THR n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 VAL n 
2 128 TYR n 
2 129 PRO n 
2 130 LEU n 
2 131 ALA n 
2 132 PRO n 
2 133 GLY n 
2 134 CYS n 
2 135 GLY n 
2 136 ASP n 
2 137 THR n 
2 138 THR n 
2 139 GLY n 
2 140 SER n 
2 141 SER n 
2 142 VAL n 
2 143 THR n 
2 144 LEU n 
2 145 GLY n 
2 146 CYS n 
2 147 LEU n 
2 148 VAL n 
2 149 LYS n 
2 150 GLY n 
2 151 TYR n 
2 152 PHE n 
2 153 PRO n 
2 154 GLU n 
2 155 SER n 
2 156 VAL n 
2 157 THR n 
2 158 VAL n 
2 159 THR n 
2 160 TRP n 
2 161 ASN n 
2 162 SER n 
2 163 GLY n 
2 164 SER n 
2 165 LEU n 
2 166 SER n 
2 167 SER n 
2 168 SER n 
2 169 VAL n 
2 170 HIS n 
2 171 THR n 
2 172 PHE n 
2 173 PRO n 
2 174 ALA n 
2 175 LEU n 
2 176 LEU n 
2 177 GLN n 
2 178 SER n 
2 179 GLY n 
2 180 LEU n 
2 181 TYR n 
2 182 THR n 
2 183 MET n 
2 184 SER n 
2 185 SER n 
2 186 SER n 
2 187 VAL n 
2 188 THR n 
2 189 VAL n 
2 190 PRO n 
2 191 SER n 
2 192 SER n 
2 193 THR n 
2 194 TRP n 
2 195 PRO n 
2 196 SER n 
2 197 GLN n 
2 198 THR n 
2 199 VAL n 
2 200 THR n 
2 201 CYS n 
2 202 SER n 
2 203 VAL n 
2 204 ALA n 
2 205 HIS n 
2 206 PRO n 
2 207 ALA n 
2 208 SER n 
2 209 SER n 
2 210 THR n 
2 211 THR n 
2 212 VAL n 
2 213 ASP n 
2 214 LYS n 
2 215 LYS n 
2 216 LEU n 
2 217 GLU n 
2 218 PRO n 
2 219 SER n 
2 220 GLY n 
2 221 PRO n 
3 1   ASP n 
3 2   ILE n 
3 3   VAL n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   HIS n 
3 9   LYS n 
3 10  PHE n 
3 11  MET n 
3 12  SER n 
3 13  THR n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  ASP n 
3 18  ARG n 
3 19  VAL n 
3 20  SER n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  LYS n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  ASP n 
3 29  VAL n 
3 30  SER n 
3 31  THR n 
3 32  ALA n 
3 33  VAL n 
3 34  ALA n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  PRO n 
3 41  GLY n 
3 42  GLN n 
3 43  SER n 
3 44  PRO n 
3 45  LYS n 
3 46  LEU n 
3 47  LEU n 
3 48  ILE n 
3 49  TYR n 
3 50  SER n 
3 51  ALA n 
3 52  SER n 
3 53  TYR n 
3 54  ARG n 
3 55  TYR n 
3 56  THR n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  ASP n 
3 61  ARG n 
3 62  PHE n 
3 63  THR n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  ASP n 
3 71  PHE n 
3 72  THR n 
3 73  PHE n 
3 74  THR n 
3 75  ILE n 
3 76  SER n 
3 77  SER n 
3 78  VAL n 
3 79  GLN n 
3 80  ALA n 
3 81  GLU n 
3 82  ASP n 
3 83  LEU n 
3 84  ALA n 
3 85  VAL n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  HIS n 
3 92  TYR n 
3 93  SER n 
3 94  ILE n 
3 95  PRO n 
3 96  ARG n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLY n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 LEU n 
3 105 GLU n 
3 106 ILE n 
3 107 LYS n 
3 108 ARG n 
3 109 ALA n 
3 110 ASP n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 THR n 
3 115 VAL n 
3 116 SER n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 SER n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 THR n 
3 127 SER n 
3 128 GLY n 
3 129 GLY n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 PHE n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 LYS n 
3 143 ASP n 
3 144 ILE n 
3 145 ASN n 
3 146 VAL n 
3 147 LYS n 
3 148 TRP n 
3 149 LYS n 
3 150 ILE n 
3 151 ASP n 
3 152 GLY n 
3 153 SER n 
3 154 GLU n 
3 155 ARG n 
3 156 GLN n 
3 157 ASN n 
3 158 GLY n 
3 159 VAL n 
3 160 LEU n 
3 161 ASN n 
3 162 SER n 
3 163 TRP n 
3 164 THR n 
3 165 ASP n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 MET n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 THR n 
3 183 LYS n 
3 184 ASP n 
3 185 GLU n 
3 186 TYR n 
3 187 GLU n 
3 188 ARG n 
3 189 HIS n 
3 190 ASN n 
3 191 SER n 
3 192 TYR n 
3 193 THR n 
3 194 CYS n 
3 195 GLU n 
3 196 ALA n 
3 197 THR n 
3 198 HIS n 
3 199 LYS n 
3 200 THR n 
3 201 SER n 
3 202 THR n 
3 203 SER n 
3 204 PRO n 
3 205 ILE n 
3 206 VAL n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 ASN n 
3 213 GLU n 
3 214 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 549 Human ? 'SLC6A4, HTT, SERT' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Homo sapiens' 
9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 221 ?     ? ?                   ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 214 ?     ? ?                   ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SC6A4_HUMAN P31645 ? 1 
;QGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKIC
PIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRH
VLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKP
NWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVS
EVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFF
GSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICS
FLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPT
;
76 
2 PDB 5I74        5I74   ? 2 ? 1  
3 PDB 5I74        5I74   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5I74 A 3 ? 545 ? P31645 76 ? 618 ? 76 618 
2 2 5I74 B 1 ? 221 ? 5I74   20 ? 240 ? 20 240 
3 3 5I74 C 1 ? 214 ? 5I74   21 ? 234 ? 21 234 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I74 GLY A 1   ? UNP P31645 ?   ?   'cloning artifact'    74  1  
1 5I74 SER A 2   ? UNP P31645 ?   ?   'cloning artifact'    75  2  
1 5I74 ALA A 37  ? UNP P31645 TYR 110 'engineered mutation' 110 3  
1 5I74 ALA A 218 ? UNP P31645 ILE 291 'engineered mutation' 291 4  
1 5I74 SER A 366 ? UNP P31645 THR 439 'engineered mutation' 439 5  
1 5I74 ALA A 481 ? UNP P31645 CYS 554 'engineered mutation' 554 6  
1 5I74 ALA A 507 ? UNP P31645 CYS 580 'engineered mutation' 580 7  
1 5I74 LEU A 546 ? UNP P31645 ?   ?   'cloning artifact'    619 8  
1 5I74 VAL A 547 ? UNP P31645 ?   ?   'cloning artifact'    620 9  
1 5I74 PRO A 548 ? UNP P31645 ?   ?   'cloning artifact'    621 10 
1 5I74 ARG A 549 ? UNP P31645 ?   ?   'cloning artifact'    622 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
69D non-polymer                  . '(1S)-1-(4-bromophenyl)-1-[3-(dimethylamino)propyl]-1,3-dihydro-2-benzofuran-5-carbonitrile' ? 
'C20 H21 Br N2 O' 385.298 
ALA 'L-peptide linking'          y ALANINE                                                                                      ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'      133.103 
CLR non-polymer                  . CHOLESTEROL                                                                                  ? 
'C27 H46 O'       386.654 
CYS 'L-peptide linking'          y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'    121.158 
D12 non-polymer                  . DODECANE                                                                                     ? 
'C12 H26'         170.335 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                      ? 
'C2 H5 N O2'      75.067  
HEX non-polymer                  . HEXANE                                                                                       ? 
'C6 H14'          86.175  
HIS 'L-peptide linking'          y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                      ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                     ? 
'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                      ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                                       ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking'          y THREONINE                                                                                    ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                     ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                       ? 
'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I74 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.38 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.62 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris pH 8.5, 125 mM NaCl, 125 mM magnesium chloride, 33.4% PEG 400' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-11-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.902 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.902 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5I74 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.395 
_reflns.d_resolution_low                 101.680 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       41581 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.70 
_reflns.pdbx_Rmerge_I_obs                0.06051 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.6000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I74 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39603 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.40 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             101.678 
_refine.ls_d_res_high                            3.395 
_refine.ls_percent_reflns_obs                    99.24 
_refine.ls_R_factor_obs                          0.2510 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2489 
_refine.ls_R_factor_R_free                       0.2962 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1980 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.61 
_refine.pdbx_overall_phase_error                 34.36 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7512 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         98 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7610 
_refine_hist.d_res_high                       3.395 
_refine_hist.d_res_low                        101.678 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 7837  'X-RAY DIFFRACTION' ? 
f_angle_d          1.005  ? ? 10693 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 10.689 ? ? 2676  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.216  ? ? 1209  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1317  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.3948 3.4797   2544 0.3853 93.00  0.4498 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.4797 3.5738   2655 0.3507 99.00  0.4033 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.5738 3.6790   2680 0.3316 99.00  0.3740 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.6790 3.7977   2723 0.2918 100.00 0.3292 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.7977 3.9335   2674 0.2635 100.00 0.2965 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.9335 4.0910   2710 0.2585 100.00 0.3480 . . 147 . . . . 
'X-RAY DIFFRACTION' . 4.0910 4.2771   2703 0.2214 100.00 0.2608 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.2771 4.5026   2705 0.1973 100.00 0.2837 . . 147 . . . . 
'X-RAY DIFFRACTION' . 4.5026 4.7847   2702 0.1875 100.00 0.3153 . . 140 . . . . 
'X-RAY DIFFRACTION' . 4.7847 5.1542   2719 0.1951 100.00 0.2362 . . 148 . . . . 
'X-RAY DIFFRACTION' . 5.1542 5.6728   2697 0.2251 100.00 0.2850 . . 138 . . . . 
'X-RAY DIFFRACTION' . 5.6728 6.4936   2717 0.2470 100.00 0.3600 . . 141 . . . . 
'X-RAY DIFFRACTION' . 6.4936 8.1807   2691 0.2663 100.00 0.2935 . . 141 . . . . 
'X-RAY DIFFRACTION' . 8.1807 101.7235 2703 0.2551 99.00  0.2697 . . 144 . . . . 
# 
_struct.entry_id                     5I74 
_struct.title                        
'X-ray structure of the ts3 human serotonin transporter complexed with Br-citalopram at the central site' 
_struct.pdbx_descriptor              'Sodium-dependent serotonin transporter, Heavy chain, Light chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I74 
_struct_keywords.text            'Membrane protein' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 8 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 11  ? VAL A 24  ? LYS A 84  VAL A 97  1 ? 14 
HELX_P HELX_P2  AA2 ASP A 25  ? TRP A 30  ? ASP A 98  TRP A 103 1 ? 6  
HELX_P HELX_P3  AA3 TRP A 30  ? ASN A 39  ? TRP A 103 ASN A 112 1 ? 10 
HELX_P HELX_P4  AA4 GLY A 40  ? ALA A 43  ? GLY A 113 ALA A 116 5 ? 4  
HELX_P HELX_P5  AA5 PHE A 44  ? PHE A 54  ? PHE A 117 PHE A 127 1 ? 11 
HELX_P HELX_P6  AA6 GLY A 55  ? ARG A 71  ? GLY A 128 ARG A 144 1 ? 17 
HELX_P HELX_P7  AA7 ILE A 75  ? LYS A 80  ? ILE A 148 LYS A 153 1 ? 6  
HELX_P HELX_P8  AA8 CYS A 82  ? ILE A 84  ? CYS A 155 ILE A 157 5 ? 3  
HELX_P HELX_P9  AA9 PHE A 85  ? SER A 116 ? PHE A 158 SER A 189 1 ? 32 
HELX_P HELX_P10 AB1 SER A 117 ? THR A 119 ? SER A 190 THR A 192 5 ? 3  
HELX_P HELX_P11 AB2 SER A 153 ? HIS A 162 ? SER A 226 HIS A 235 1 ? 10 
HELX_P HELX_P12 AB3 GLN A 165 ? SER A 169 ? GLN A 238 SER A 242 5 ? 5  
HELX_P HELX_P13 AB4 SER A 179 ? PHE A 195 ? SER A 252 PHE A 268 1 ? 17 
HELX_P HELX_P14 AB5 GLY A 200 ? VAL A 207 ? GLY A 273 VAL A 280 1 ? 8  
HELX_P HELX_P15 AB6 VAL A 207 ? THR A 228 ? VAL A 280 THR A 301 1 ? 22 
HELX_P HELX_P16 AB7 ALA A 232 ? LYS A 241 ? ALA A 305 LYS A 314 1 ? 10 
HELX_P HELX_P17 AB8 GLU A 249 ? GLY A 265 ? GLU A 322 GLY A 338 1 ? 17 
HELX_P HELX_P18 AB9 GLY A 269 ? TYR A 277 ? GLY A 342 TYR A 350 1 ? 9  
HELX_P HELX_P19 AC1 ASN A 283 ? ARG A 317 ? ASN A 356 ARG A 390 1 ? 35 
HELX_P HELX_P20 AC2 ASP A 320 ? ALA A 325 ? ASP A 393 ALA A 398 1 ? 6  
HELX_P HELX_P21 AC3 GLY A 329 ? ILE A 335 ? GLY A 402 ILE A 408 1 ? 7  
HELX_P HELX_P22 AC4 ILE A 335 ? ASN A 343 ? ILE A 408 ASN A 416 1 ? 9  
HELX_P HELX_P23 AC5 ALA A 346 ? PHE A 381 ? ALA A 419 PHE A 454 1 ? 36 
HELX_P HELX_P24 AC6 ARG A 388 ? SER A 404 ? ARG A 461 SER A 477 1 ? 17 
HELX_P HELX_P25 AC7 GLY A 411 ? ALA A 423 ? GLY A 484 ALA A 496 1 ? 13 
HELX_P HELX_P26 AC8 ALA A 423 ? PHE A 442 ? ALA A 496 PHE A 515 1 ? 20 
HELX_P HELX_P27 AC9 GLY A 444 ? LEU A 456 ? GLY A 517 LEU A 529 1 ? 13 
HELX_P HELX_P28 AD1 GLY A 461 ? ALA A 470 ? GLY A 534 ALA A 543 1 ? 10 
HELX_P HELX_P29 AD2 ALA A 470 ? SER A 486 ? ALA A 543 SER A 559 1 ? 17 
HELX_P HELX_P30 AD3 TRP A 500 ? ILE A 514 ? TRP A 573 ILE A 587 1 ? 15 
HELX_P HELX_P31 AD4 ILE A 514 ? THR A 527 ? ILE A 587 THR A 600 1 ? 14 
HELX_P HELX_P32 AD5 THR A 530 ? THR A 540 ? THR A 603 THR A 613 1 ? 11 
HELX_P HELX_P33 AD6 THR B 28  ? TYR B 32  ? THR B 47  TYR B 51  5 ? 5  
HELX_P HELX_P34 AD7 THR B 87  ? SER B 91  ? THR B 106 SER B 110 5 ? 5  
HELX_P HELX_P35 AD8 SER B 162 ? SER B 164 ? SER B 181 SER B 183 5 ? 3  
HELX_P HELX_P36 AD9 GLN C 79  ? LEU C 83  ? GLN C 99  LEU C 103 5 ? 5  
HELX_P HELX_P37 AE1 SER C 121 ? SER C 127 ? SER C 141 SER C 147 1 ? 7  
HELX_P HELX_P38 AE2 LYS C 183 ? GLU C 187 ? LYS C 203 GLU C 207 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 127 SG  ? ? ? 1_555 A CYS 136 SG ? ? A CYS 200 A CYS 209 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2 disulf ?   ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 41  B CYS 115 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf3 disulf ?   ? B CYS 134 SG  ? ? ? 1_555 C CYS 214 SG ? ? B CYS 153 C CYS 234 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4 disulf ?   ? B CYS 146 SG  ? ? ? 1_555 B CYS 201 SG ? ? B CYS 165 B CYS 220 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf5 disulf ?   ? C CYS 23  SG  ? ? ? 1_555 C CYS 88  SG ? ? C CYS 43  C CYS 108 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf6 disulf ?   ? C CYS 134 SG  ? ? ? 1_555 C CYS 194 SG ? ? C CYS 154 C CYS 214 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
covale1 covale one ? A ASN 135 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 208 A NAG 701 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale2 covale one ? A ASN 144 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 217 A NAG 705 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 176 A . ? GLY 249 A GLY 177 A ? GLY 250 A 1 -1.21 
2 ARG 102 B . ? ARG 121 B PRO 103 B ? PRO 122 B 1 -7.71 
3 PHE 152 B . ? PHE 171 B PRO 153 B ? PRO 172 B 1 -6.77 
4 SER 164 B . ? SER 183 B LEU 165 B ? LEU 184 B 1 -0.39 
5 TRP 194 B . ? TRP 213 B PRO 195 B ? PRO 214 B 1 -9.65 
6 ILE 94  C . ? ILE 114 C PRO 95  C ? PRO 115 C 1 -6.13 
7 TYR 140 C . ? TYR 160 C PRO 141 C ? PRO 161 C 1 1.13  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 6 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
AA7 ? 5 ? 
AA8 ? 4 ? 
AA9 ? 3 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 491 ? LEU A 492 ? ARG A 564 LEU A 565 
AA1 2 TYR A 495 ? ASN A 496 ? TYR A 568 ASN A 569 
AA2 1 GLN B 3   ? GLN B 6   ? GLN B 22  GLN B 25  
AA2 2 VAL B 18  ? SER B 25  ? VAL B 37  SER B 44  
AA2 3 THR B 78  ? LEU B 83  ? THR B 97  LEU B 102 
AA2 4 ALA B 68  ? ASP B 73  ? ALA B 87  ASP B 92  
AA3 1 GLU B 10  ? VAL B 12  ? GLU B 29  VAL B 31  
AA3 2 THR B 113 ? VAL B 117 ? THR B 132 VAL B 136 
AA3 3 ALA B 92  ? SER B 99  ? ALA B 111 SER B 118 
AA3 4 TYR B 33  ? GLN B 39  ? TYR B 52  GLN B 58  
AA3 5 LEU B 45  ? ASN B 52  ? LEU B 64  ASN B 71  
AA3 6 GLY B 57  ? TYR B 60  ? GLY B 76  TYR B 79  
AA4 1 GLU B 10  ? VAL B 12  ? GLU B 29  VAL B 31  
AA4 2 THR B 113 ? VAL B 117 ? THR B 132 VAL B 136 
AA4 3 ALA B 92  ? SER B 99  ? ALA B 111 SER B 118 
AA4 4 TYR B 108 ? TRP B 109 ? TYR B 127 TRP B 128 
AA5 1 SER B 126 ? LEU B 130 ? SER B 145 LEU B 149 
AA5 2 SER B 141 ? TYR B 151 ? SER B 160 TYR B 170 
AA5 3 LEU B 180 ? PRO B 190 ? LEU B 199 PRO B 209 
AA5 4 HIS B 170 ? GLN B 177 ? HIS B 189 GLN B 196 
AA6 1 THR B 157 ? TRP B 160 ? THR B 176 TRP B 179 
AA6 2 THR B 200 ? HIS B 205 ? THR B 219 HIS B 224 
AA6 3 THR B 210 ? LYS B 215 ? THR B 229 LYS B 234 
AA7 1 PHE C 10  ? SER C 14  ? PHE C 30  SER C 34  
AA7 2 THR C 102 ? LYS C 107 ? THR C 122 LYS C 127 
AA7 3 VAL C 85  ? GLN C 90  ? VAL C 105 GLN C 110 
AA7 4 ALA C 34  ? GLN C 38  ? ALA C 54  GLN C 58  
AA7 5 PRO C 44  ? TYR C 49  ? PRO C 64  TYR C 69  
AA8 1 PHE C 10  ? SER C 14  ? PHE C 30  SER C 34  
AA8 2 THR C 102 ? LYS C 107 ? THR C 122 LYS C 127 
AA8 3 VAL C 85  ? GLN C 90  ? VAL C 105 GLN C 110 
AA8 4 THR C 97  ? PHE C 98  ? THR C 117 PHE C 118 
AA9 1 VAL C 19  ? LYS C 24  ? VAL C 39  LYS C 44  
AA9 2 ASP C 70  ? ILE C 75  ? ASP C 90  ILE C 95  
AA9 3 PHE C 62  ? SER C 65  ? PHE C 82  SER C 85  
AB1 1 THR C 114 ? PHE C 118 ? THR C 134 PHE C 138 
AB1 2 GLY C 129 ? PHE C 139 ? GLY C 149 PHE C 159 
AB1 3 TYR C 173 ? THR C 182 ? TYR C 193 THR C 202 
AB1 4 VAL C 159 ? TRP C 163 ? VAL C 179 TRP C 183 
AB2 1 ASN C 145 ? LYS C 149 ? ASN C 165 LYS C 169 
AB2 2 TYR C 192 ? THR C 197 ? TYR C 212 THR C 217 
AB2 3 ILE C 205 ? PHE C 209 ? ILE C 225 PHE C 229 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 492 ? N LEU A 565 O TYR A 495 ? O TYR A 568 
AA2 1 2 N GLN B 5   ? N GLN B 24  O LYS B 23  ? O LYS B 42  
AA2 2 3 N VAL B 18  ? N VAL B 37  O LEU B 83  ? O LEU B 102 
AA2 3 4 O TYR B 80  ? O TYR B 99  N THR B 71  ? N THR B 90  
AA3 1 2 N GLU B 10  ? N GLU B 29  O THR B 116 ? O THR B 135 
AA3 2 3 O THR B 113 ? O THR B 132 N TYR B 94  ? N TYR B 113 
AA3 3 4 O VAL B 93  ? O VAL B 112 N GLN B 39  ? N GLN B 58  
AA3 4 5 N TRP B 36  ? N TRP B 55  O ILE B 48  ? O ILE B 67  
AA3 5 6 N ASN B 50  ? N ASN B 69  O SER B 59  ? O SER B 78  
AA4 1 2 N GLU B 10  ? N GLU B 29  O THR B 116 ? O THR B 135 
AA4 2 3 O THR B 113 ? O THR B 132 N TYR B 94  ? N TYR B 113 
AA4 3 4 N ARG B 98  ? N ARG B 117 O TYR B 108 ? O TYR B 127 
AA5 1 2 N SER B 126 ? N SER B 145 O LYS B 149 ? O LYS B 168 
AA5 2 3 N TYR B 151 ? N TYR B 170 O TYR B 181 ? O TYR B 200 
AA5 3 4 O SER B 186 ? O SER B 205 N HIS B 170 ? N HIS B 189 
AA6 1 2 N THR B 159 ? N THR B 178 O SER B 202 ? O SER B 221 
AA6 2 3 N CYS B 201 ? N CYS B 220 O LYS B 214 ? O LYS B 233 
AA7 1 2 N THR C 13  ? N THR C 33  O LYS C 107 ? O LYS C 127 
AA7 2 3 O THR C 102 ? O THR C 122 N TYR C 86  ? N TYR C 106 
AA7 3 4 O VAL C 85  ? O VAL C 105 N GLN C 38  ? N GLN C 58  
AA7 4 5 N GLN C 37  ? N GLN C 57  O LYS C 45  ? O LYS C 65  
AA8 1 2 N THR C 13  ? N THR C 33  O LYS C 107 ? O LYS C 127 
AA8 2 3 O THR C 102 ? O THR C 122 N TYR C 86  ? N TYR C 106 
AA8 3 4 N GLN C 90  ? N GLN C 110 O THR C 97  ? O THR C 117 
AA9 1 2 N VAL C 19  ? N VAL C 39  O ILE C 75  ? O ILE C 95  
AA9 2 3 O THR C 74  ? O THR C 94  N THR C 63  ? N THR C 83  
AB1 1 2 N THR C 114 ? N THR C 134 O ASN C 137 ? O ASN C 157 
AB1 2 3 N CYS C 134 ? N CYS C 154 O SER C 177 ? O SER C 197 
AB1 3 4 O THR C 178 ? O THR C 198 N LEU C 160 ? N LEU C 180 
AB2 1 2 N LYS C 147 ? N LYS C 167 O GLU C 195 ? O GLU C 215 
AB2 2 3 N CYS C 194 ? N CYS C 214 O LYS C 207 ? O LYS C 227 
# 
_atom_sites.entry_id                    5I74 
_atom_sites.fract_transf_matrix[1][1]   0.007717 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006098 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007134 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? -1.590 192.350 -11.375 1.00 319.29 ? 74  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? -0.981 191.371 -10.494 1.00 313.34 ? 74  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? -0.808 191.869 -9.072  1.00 310.31 ? 74  GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? -1.004 193.052 -8.791  1.00 330.92 ? 74  GLY A O   1 
ATOM   5    N  N   . SER A 1 2   ? -0.442 190.958 -8.168  1.00 268.01 ? 75  SER A N   1 
ATOM   6    C  CA  . SER A 1 2   ? -0.251 191.337 -6.772  1.00 250.77 ? 75  SER A CA  1 
ATOM   7    C  C   . SER A 1 2   ? 1.027  192.149 -6.592  1.00 267.21 ? 75  SER A C   1 
ATOM   8    O  O   . SER A 1 2   ? 1.006  193.234 -5.999  1.00 246.56 ? 75  SER A O   1 
ATOM   9    C  CB  . SER A 1 2   ? -0.227 190.089 -5.889  1.00 236.94 ? 75  SER A CB  1 
ATOM   10   N  N   . GLN A 1 3   ? 2.149  191.641 -7.097  1.00 316.15 ? 76  GLN A N   1 
ATOM   11   C  CA  . GLN A 1 3   ? 3.435  192.325 -7.011  1.00 330.03 ? 76  GLN A CA  1 
ATOM   12   C  C   . GLN A 1 3   ? 4.072  192.330 -8.392  1.00 340.64 ? 76  GLN A C   1 
ATOM   13   O  O   . GLN A 1 3   ? 4.408  191.268 -8.927  1.00 329.26 ? 76  GLN A O   1 
ATOM   14   C  CB  . GLN A 1 3   ? 4.356  191.647 -5.993  1.00 321.17 ? 76  GLN A CB  1 
ATOM   15   N  N   . GLY A 1 4   ? 4.236  193.520 -8.963  1.00 361.24 ? 77  GLY A N   1 
ATOM   16   C  CA  . GLY A 1 4   ? 4.723  193.655 -10.323 1.00 362.01 ? 77  GLY A CA  1 
ATOM   17   C  C   . GLY A 1 4   ? 6.215  193.486 -10.534 1.00 350.63 ? 77  GLY A C   1 
ATOM   18   O  O   . GLY A 1 4   ? 6.634  192.753 -11.434 1.00 357.48 ? 77  GLY A O   1 
ATOM   19   N  N   . GLU A 1 5   ? 7.029  194.151 -9.715  1.00 273.19 ? 78  GLU A N   1 
ATOM   20   C  CA  . GLU A 1 5   ? 8.452  194.262 -10.002 1.00 214.53 ? 78  GLU A CA  1 
ATOM   21   C  C   . GLU A 1 5   ? 9.235  194.438 -8.709  1.00 225.08 ? 78  GLU A C   1 
ATOM   22   O  O   . GLU A 1 5   ? 8.675  194.753 -7.656  1.00 218.86 ? 78  GLU A O   1 
ATOM   23   C  CB  . GLU A 1 5   ? 8.732  195.429 -10.956 1.00 212.45 ? 78  GLU A CB  1 
ATOM   24   C  CG  . GLU A 1 5   ? 8.161  196.756 -10.483 1.00 210.25 ? 78  GLU A CG  1 
ATOM   25   C  CD  . GLU A 1 5   ? 8.317  197.861 -11.509 1.00 217.50 ? 78  GLU A CD  1 
ATOM   26   O  OE1 . GLU A 1 5   ? 8.941  197.614 -12.561 1.00 235.62 ? 78  GLU A OE1 1 
ATOM   27   O  OE2 . GLU A 1 5   ? 7.811  198.976 -11.263 1.00 212.26 ? 78  GLU A OE2 1 
ATOM   28   N  N   . ARG A 1 6   ? 10.546 194.227 -8.808  1.00 249.35 ? 79  ARG A N   1 
ATOM   29   C  CA  . ARG A 1 6   ? 11.461 194.346 -7.686  1.00 229.75 ? 79  ARG A CA  1 
ATOM   30   C  C   . ARG A 1 6   ? 12.099 195.735 -7.665  1.00 240.95 ? 79  ARG A C   1 
ATOM   31   O  O   . ARG A 1 6   ? 11.781 196.610 -8.474  1.00 226.97 ? 79  ARG A O   1 
ATOM   32   C  CB  . ARG A 1 6   ? 12.528 193.250 -7.752  1.00 198.44 ? 79  ARG A CB  1 
ATOM   33   N  N   . GLU A 1 7   ? 13.020 195.932 -6.723  1.00 267.26 ? 80  GLU A N   1 
ATOM   34   C  CA  . GLU A 1 7   ? 13.661 197.220 -6.516  1.00 272.86 ? 80  GLU A CA  1 
ATOM   35   C  C   . GLU A 1 7   ? 14.924 197.344 -7.368  1.00 258.63 ? 80  GLU A C   1 
ATOM   36   O  O   . GLU A 1 7   ? 15.265 196.464 -8.163  1.00 254.80 ? 80  GLU A O   1 
ATOM   37   C  CB  . GLU A 1 7   ? 13.984 197.420 -5.036  1.00 267.35 ? 80  GLU A CB  1 
ATOM   38   C  CG  . GLU A 1 7   ? 12.764 197.589 -4.145  1.00 285.64 ? 80  GLU A CG  1 
ATOM   39   C  CD  . GLU A 1 7   ? 11.922 198.788 -4.536  1.00 297.81 ? 80  GLU A CD  1 
ATOM   40   O  OE1 . GLU A 1 7   ? 10.684 198.645 -4.626  1.00 282.88 ? 80  GLU A OE1 1 
ATOM   41   O  OE2 . GLU A 1 7   ? 12.498 199.874 -4.759  1.00 311.28 ? 80  GLU A OE2 1 
ATOM   42   N  N   . THR A 1 8   ? 15.630 198.460 -7.195  1.00 224.44 ? 81  THR A N   1 
ATOM   43   C  CA  . THR A 1 8   ? 16.852 198.734 -7.939  1.00 232.34 ? 81  THR A CA  1 
ATOM   44   C  C   . THR A 1 8   ? 17.802 199.531 -7.053  1.00 237.02 ? 81  THR A C   1 
ATOM   45   O  O   . THR A 1 8   ? 17.531 199.773 -5.873  1.00 226.96 ? 81  THR A O   1 
ATOM   46   C  CB  . THR A 1 8   ? 16.553 199.482 -9.243  1.00 235.57 ? 81  THR A CB  1 
ATOM   47   O  OG1 . THR A 1 8   ? 17.778 199.731 -9.947  1.00 255.25 ? 81  THR A OG1 1 
ATOM   48   C  CG2 . THR A 1 8   ? 15.866 200.807 -8.951  1.00 223.58 ? 81  THR A CG2 1 
ATOM   49   N  N   . TRP A 1 9   ? 18.924 199.943 -7.636  1.00 233.52 ? 82  TRP A N   1 
ATOM   50   C  CA  . TRP A 1 9   ? 19.951 200.670 -6.906  1.00 199.80 ? 82  TRP A CA  1 
ATOM   51   C  C   . TRP A 1 9   ? 19.613 202.155 -6.814  1.00 192.02 ? 82  TRP A C   1 
ATOM   52   O  O   . TRP A 1 9   ? 18.991 202.733 -7.712  1.00 201.24 ? 82  TRP A O   1 
ATOM   53   C  CB  . TRP A 1 9   ? 21.312 200.489 -7.577  1.00 184.17 ? 82  TRP A CB  1 
ATOM   54   N  N   . GLY A 1 10  ? 20.027 202.769 -5.703  1.00 176.87 ? 83  GLY A N   1 
ATOM   55   C  CA  . GLY A 1 10  ? 19.816 204.198 -5.542  1.00 185.50 ? 83  GLY A CA  1 
ATOM   56   C  C   . GLY A 1 10  ? 20.773 205.029 -6.375  1.00 203.19 ? 83  GLY A C   1 
ATOM   57   O  O   . GLY A 1 10  ? 20.405 206.091 -6.885  1.00 233.89 ? 83  GLY A O   1 
ATOM   58   N  N   . LYS A 1 11  ? 22.010 204.562 -6.523  1.00 174.09 ? 84  LYS A N   1 
ATOM   59   C  CA  . LYS A 1 11  ? 22.995 205.236 -7.353  1.00 183.62 ? 84  LYS A CA  1 
ATOM   60   C  C   . LYS A 1 11  ? 23.994 204.204 -7.858  1.00 193.31 ? 84  LYS A C   1 
ATOM   61   O  O   . LYS A 1 11  ? 24.217 203.171 -7.219  1.00 209.82 ? 84  LYS A O   1 
ATOM   62   C  CB  . LYS A 1 11  ? 23.704 206.360 -6.579  1.00 172.97 ? 84  LYS A CB  1 
ATOM   63   C  CG  . LYS A 1 11  ? 24.733 207.139 -7.391  1.00 165.79 ? 84  LYS A CG  1 
ATOM   64   C  CD  . LYS A 1 11  ? 25.017 208.500 -6.782  1.00 178.29 ? 84  LYS A CD  1 
ATOM   65   C  CE  . LYS A 1 11  ? 23.835 209.440 -6.964  1.00 205.38 ? 84  LYS A CE  1 
ATOM   66   N  NZ  . LYS A 1 11  ? 24.145 210.825 -6.511  1.00 250.52 ? 84  LYS A NZ  1 
ATOM   67   N  N   . LYS A 1 12  ? 24.578 204.491 -9.027  1.00 204.96 ? 85  LYS A N   1 
ATOM   68   C  CA  . LYS A 1 12  ? 25.609 203.626 -9.591  1.00 197.16 ? 85  LYS A CA  1 
ATOM   69   C  C   . LYS A 1 12  ? 26.773 203.442 -8.624  1.00 224.35 ? 85  LYS A C   1 
ATOM   70   O  O   . LYS A 1 12  ? 27.296 202.332 -8.470  1.00 246.11 ? 85  LYS A O   1 
ATOM   71   C  CB  . LYS A 1 12  ? 26.103 204.216 -10.912 1.00 200.59 ? 85  LYS A CB  1 
ATOM   72   C  CG  . LYS A 1 12  ? 27.300 203.507 -11.515 1.00 200.07 ? 85  LYS A CG  1 
ATOM   73   C  CD  . LYS A 1 12  ? 26.885 202.264 -12.280 1.00 205.08 ? 85  LYS A CD  1 
ATOM   74   C  CE  . LYS A 1 12  ? 28.063 201.688 -13.049 1.00 198.42 ? 85  LYS A CE  1 
ATOM   75   N  NZ  . LYS A 1 12  ? 27.647 200.613 -13.988 1.00 192.60 ? 85  LYS A NZ  1 
ATOM   76   N  N   . VAL A 1 13  ? 27.192 204.523 -7.964  1.00 208.60 ? 86  VAL A N   1 
ATOM   77   C  CA  . VAL A 1 13  ? 28.348 204.450 -7.078  1.00 179.29 ? 86  VAL A CA  1 
ATOM   78   C  C   . VAL A 1 13  ? 28.037 203.624 -5.839  1.00 158.68 ? 86  VAL A C   1 
ATOM   79   O  O   . VAL A 1 13  ? 28.944 203.057 -5.220  1.00 174.09 ? 86  VAL A O   1 
ATOM   80   C  CB  . VAL A 1 13  ? 28.812 205.870 -6.708  1.00 197.28 ? 86  VAL A CB  1 
ATOM   81   C  CG1 . VAL A 1 13  ? 30.189 205.836 -6.063  1.00 187.57 ? 86  VAL A CG1 1 
ATOM   82   C  CG2 . VAL A 1 13  ? 28.820 206.760 -7.944  1.00 201.67 ? 86  VAL A CG2 1 
ATOM   83   N  N   . ASP A 1 14  ? 26.759 203.524 -5.468  1.00 218.74 ? 87  ASP A N   1 
ATOM   84   C  CA  . ASP A 1 14  ? 26.385 202.782 -4.269  1.00 234.23 ? 87  ASP A CA  1 
ATOM   85   C  C   . ASP A 1 14  ? 26.680 201.295 -4.420  1.00 222.98 ? 87  ASP A C   1 
ATOM   86   O  O   . ASP A 1 14  ? 27.372 200.703 -3.584  1.00 227.00 ? 87  ASP A O   1 
ATOM   87   C  CB  . ASP A 1 14  ? 24.908 203.017 -3.956  1.00 232.67 ? 87  ASP A CB  1 
ATOM   88   C  CG  . ASP A 1 14  ? 24.637 204.426 -3.467  1.00 241.68 ? 87  ASP A CG  1 
ATOM   89   O  OD1 . ASP A 1 14  ? 25.378 205.348 -3.869  1.00 259.98 ? 87  ASP A OD1 1 
ATOM   90   O  OD2 . ASP A 1 14  ? 23.690 204.609 -2.674  1.00 246.49 ? 87  ASP A OD2 1 
ATOM   91   N  N   . PHE A 1 15  ? 26.161 200.669 -5.478  1.00 196.12 ? 88  PHE A N   1 
ATOM   92   C  CA  . PHE A 1 15  ? 26.460 199.261 -5.708  1.00 196.78 ? 88  PHE A CA  1 
ATOM   93   C  C   . PHE A 1 15  ? 27.862 199.058 -6.265  1.00 193.89 ? 88  PHE A C   1 
ATOM   94   O  O   . PHE A 1 15  ? 28.478 198.014 -6.012  1.00 214.20 ? 88  PHE A O   1 
ATOM   95   C  CB  . PHE A 1 15  ? 25.423 198.642 -6.643  1.00 210.49 ? 88  PHE A CB  1 
ATOM   96   C  CG  . PHE A 1 15  ? 24.205 198.131 -5.934  1.00 217.52 ? 88  PHE A CG  1 
ATOM   97   C  CD1 . PHE A 1 15  ? 24.154 198.107 -4.549  1.00 206.86 ? 88  PHE A CD1 1 
ATOM   98   C  CD2 . PHE A 1 15  ? 23.117 197.662 -6.647  1.00 211.50 ? 88  PHE A CD2 1 
ATOM   99   C  CE1 . PHE A 1 15  ? 23.038 197.634 -3.892  1.00 185.00 ? 88  PHE A CE1 1 
ATOM   100  C  CE2 . PHE A 1 15  ? 21.998 197.188 -5.993  1.00 196.26 ? 88  PHE A CE2 1 
ATOM   101  C  CZ  . PHE A 1 15  ? 21.959 197.173 -4.616  1.00 184.05 ? 88  PHE A CZ  1 
ATOM   102  N  N   . LEU A 1 16  ? 28.378 200.035 -7.016  1.00 186.10 ? 89  LEU A N   1 
ATOM   103  C  CA  . LEU A 1 16  ? 29.763 199.963 -7.470  1.00 208.89 ? 89  LEU A CA  1 
ATOM   104  C  C   . LEU A 1 16  ? 30.718 199.846 -6.289  1.00 209.36 ? 89  LEU A C   1 
ATOM   105  O  O   . LEU A 1 16  ? 31.704 199.103 -6.347  1.00 193.86 ? 89  LEU A O   1 
ATOM   106  C  CB  . LEU A 1 16  ? 30.101 201.189 -8.318  1.00 202.85 ? 89  LEU A CB  1 
ATOM   107  C  CG  . LEU A 1 16  ? 31.502 201.238 -8.928  1.00 201.53 ? 89  LEU A CG  1 
ATOM   108  C  CD1 . LEU A 1 16  ? 31.722 200.057 -9.861  1.00 200.13 ? 89  LEU A CD1 1 
ATOM   109  C  CD2 . LEU A 1 16  ? 31.720 202.553 -9.660  1.00 203.39 ? 89  LEU A CD2 1 
ATOM   110  N  N   . LEU A 1 17  ? 30.438 200.574 -5.206  1.00 200.34 ? 90  LEU A N   1 
ATOM   111  C  CA  . LEU A 1 17  ? 31.207 200.438 -3.976  1.00 182.69 ? 90  LEU A CA  1 
ATOM   112  C  C   . LEU A 1 17  ? 30.729 199.282 -3.110  1.00 177.81 ? 90  LEU A C   1 
ATOM   113  O  O   . LEU A 1 17  ? 31.460 198.857 -2.210  1.00 189.92 ? 90  LEU A O   1 
ATOM   114  C  CB  . LEU A 1 17  ? 31.148 201.736 -3.167  1.00 167.81 ? 90  LEU A CB  1 
ATOM   115  C  CG  . LEU A 1 17  ? 32.278 202.747 -3.372  1.00 169.89 ? 90  LEU A CG  1 
ATOM   116  C  CD1 . LEU A 1 17  ? 32.386 203.170 -4.829  1.00 171.36 ? 90  LEU A CD1 1 
ATOM   117  C  CD2 . LEU A 1 17  ? 32.074 203.956 -2.473  1.00 174.19 ? 90  LEU A CD2 1 
ATOM   118  N  N   . SER A 1 18  ? 29.522 198.769 -3.355  1.00 177.28 ? 91  SER A N   1 
ATOM   119  C  CA  . SER A 1 18  ? 29.014 197.663 -2.552  1.00 184.77 ? 91  SER A CA  1 
ATOM   120  C  C   . SER A 1 18  ? 29.671 196.346 -2.945  1.00 173.21 ? 91  SER A C   1 
ATOM   121  O  O   . SER A 1 18  ? 30.045 195.552 -2.074  1.00 171.51 ? 91  SER A O   1 
ATOM   122  C  CB  . SER A 1 18  ? 27.495 197.569 -2.687  1.00 201.54 ? 91  SER A CB  1 
ATOM   123  O  OG  . SER A 1 18  ? 26.943 196.752 -1.672  1.00 218.09 ? 91  SER A OG  1 
ATOM   124  N  N   . VAL A 1 19  ? 29.824 196.101 -4.249  1.00 154.87 ? 92  VAL A N   1 
ATOM   125  C  CA  . VAL A 1 19  ? 30.525 194.898 -4.687  1.00 159.90 ? 92  VAL A CA  1 
ATOM   126  C  C   . VAL A 1 19  ? 31.999 194.966 -4.299  1.00 180.82 ? 92  VAL A C   1 
ATOM   127  O  O   . VAL A 1 19  ? 32.608 193.941 -3.963  1.00 180.81 ? 92  VAL A O   1 
ATOM   128  C  CB  . VAL A 1 19  ? 30.333 194.693 -6.203  1.00 132.00 ? 92  VAL A CB  1 
ATOM   129  C  CG1 . VAL A 1 19  ? 30.747 195.937 -6.972  1.00 131.28 ? 92  VAL A CG1 1 
ATOM   130  C  CG2 . VAL A 1 19  ? 31.107 193.475 -6.687  1.00 131.54 ? 92  VAL A CG2 1 
ATOM   131  N  N   . ILE A 1 20  ? 32.590 196.163 -4.316  1.00 172.12 ? 93  ILE A N   1 
ATOM   132  C  CA  . ILE A 1 20  ? 33.980 196.316 -3.894  1.00 145.28 ? 93  ILE A CA  1 
ATOM   133  C  C   . ILE A 1 20  ? 34.113 196.051 -2.400  1.00 138.16 ? 93  ILE A C   1 
ATOM   134  O  O   . ILE A 1 20  ? 35.006 195.318 -1.960  1.00 114.14 ? 93  ILE A O   1 
ATOM   135  C  CB  . ILE A 1 20  ? 34.506 197.713 -4.269  1.00 131.53 ? 93  ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 20  ? 34.606 197.853 -5.787  1.00 158.53 ? 93  ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 20  ? 35.857 197.969 -3.621  1.00 115.33 ? 93  ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 20  ? 35.113 199.201 -6.243  1.00 165.73 ? 93  ILE A CD1 1 
ATOM   139  N  N   . GLY A 1 21  ? 33.228 196.648 -1.597  1.00 205.46 ? 94  GLY A N   1 
ATOM   140  C  CA  . GLY A 1 21  ? 33.221 196.360 -0.173  1.00 214.53 ? 94  GLY A CA  1 
ATOM   141  C  C   . GLY A 1 21  ? 33.003 194.892 0.127   1.00 201.37 ? 94  GLY A C   1 
ATOM   142  O  O   . GLY A 1 21  ? 33.510 194.374 1.126   1.00 214.42 ? 94  GLY A O   1 
ATOM   143  N  N   . TYR A 1 22  ? 32.251 194.200 -0.729  1.00 154.70 ? 95  TYR A N   1 
ATOM   144  C  CA  . TYR A 1 22  ? 32.129 192.752 -0.602  1.00 140.40 ? 95  TYR A CA  1 
ATOM   145  C  C   . TYR A 1 22  ? 33.459 192.064 -0.885  1.00 147.23 ? 95  TYR A C   1 
ATOM   146  O  O   . TYR A 1 22  ? 33.889 191.186 -0.129  1.00 168.24 ? 95  TYR A O   1 
ATOM   147  C  CB  . TYR A 1 22  ? 31.047 192.234 -1.547  1.00 155.78 ? 95  TYR A CB  1 
ATOM   148  C  CG  . TYR A 1 22  ? 31.182 190.766 -1.887  1.00 128.72 ? 95  TYR A CG  1 
ATOM   149  C  CD1 . TYR A 1 22  ? 30.806 189.785 -0.981  1.00 124.50 ? 95  TYR A CD1 1 
ATOM   150  C  CD2 . TYR A 1 22  ? 31.696 190.362 -3.112  1.00 151.06 ? 95  TYR A CD2 1 
ATOM   151  C  CE1 . TYR A 1 22  ? 30.925 188.445 -1.290  1.00 127.67 ? 95  TYR A CE1 1 
ATOM   152  C  CE2 . TYR A 1 22  ? 31.825 189.023 -3.427  1.00 153.50 ? 95  TYR A CE2 1 
ATOM   153  C  CZ  . TYR A 1 22  ? 31.438 188.068 -2.511  1.00 132.25 ? 95  TYR A CZ  1 
ATOM   154  O  OH  . TYR A 1 22  ? 31.563 186.733 -2.819  1.00 127.57 ? 95  TYR A OH  1 
ATOM   155  N  N   . ALA A 1 23  ? 34.125 192.455 -1.973  1.00 135.54 ? 96  ALA A N   1 
ATOM   156  C  CA  . ALA A 1 23  ? 35.345 191.781 -2.401  1.00 142.53 ? 96  ALA A CA  1 
ATOM   157  C  C   . ALA A 1 23  ? 36.554 192.120 -1.538  1.00 155.65 ? 96  ALA A C   1 
ATOM   158  O  O   . ALA A 1 23  ? 37.525 191.356 -1.534  1.00 131.37 ? 96  ALA A O   1 
ATOM   159  C  CB  . ALA A 1 23  ? 35.647 192.121 -3.862  1.00 160.32 ? 96  ALA A CB  1 
ATOM   160  N  N   . VAL A 1 24  ? 36.524 193.235 -0.815  1.00 174.46 ? 97  VAL A N   1 
ATOM   161  C  CA  . VAL A 1 24  ? 37.637 193.657 0.029   1.00 149.36 ? 97  VAL A CA  1 
ATOM   162  C  C   . VAL A 1 24  ? 37.351 193.212 1.457   1.00 146.55 ? 97  VAL A C   1 
ATOM   163  O  O   . VAL A 1 24  ? 36.305 193.550 2.026   1.00 140.68 ? 97  VAL A O   1 
ATOM   164  C  CB  . VAL A 1 24  ? 37.857 195.176 -0.047  1.00 142.15 ? 97  VAL A CB  1 
ATOM   165  C  CG1 . VAL A 1 24  ? 38.926 195.605 0.943   1.00 142.81 ? 97  VAL A CG1 1 
ATOM   166  C  CG2 . VAL A 1 24  ? 38.246 195.582 -1.461  1.00 167.53 ? 97  VAL A CG2 1 
ATOM   167  N  N   . ASP A 1 25  ? 38.281 192.460 2.039   1.00 160.75 ? 98  ASP A N   1 
ATOM   168  C  CA  . ASP A 1 25  ? 38.116 191.916 3.380   1.00 177.41 ? 98  ASP A CA  1 
ATOM   169  C  C   . ASP A 1 25  ? 39.497 191.726 4.000   1.00 161.62 ? 98  ASP A C   1 
ATOM   170  O  O   . ASP A 1 25  ? 40.503 192.216 3.478   1.00 160.37 ? 98  ASP A O   1 
ATOM   171  C  CB  . ASP A 1 25  ? 37.309 190.612 3.341   1.00 165.76 ? 98  ASP A CB  1 
ATOM   172  C  CG  . ASP A 1 25  ? 38.029 189.500 2.606   1.00 163.71 ? 98  ASP A CG  1 
ATOM   173  O  OD1 . ASP A 1 25  ? 38.858 189.806 1.724   1.00 199.98 ? 98  ASP A OD1 1 
ATOM   174  O  OD2 . ASP A 1 25  ? 37.763 188.318 2.908   1.00 151.18 ? 98  ASP A OD2 1 
ATOM   175  N  N   . LEU A 1 26  ? 39.536 191.018 5.132   1.00 162.56 ? 99  LEU A N   1 
ATOM   176  C  CA  . LEU A 1 26  ? 40.791 190.819 5.852   1.00 163.21 ? 99  LEU A CA  1 
ATOM   177  C  C   . LEU A 1 26  ? 41.815 190.080 4.998   1.00 163.30 ? 99  LEU A C   1 
ATOM   178  O  O   . LEU A 1 26  ? 43.003 190.429 4.999   1.00 164.97 ? 99  LEU A O   1 
ATOM   179  C  CB  . LEU A 1 26  ? 40.526 190.054 7.149   1.00 169.56 ? 99  LEU A CB  1 
ATOM   180  C  CG  . LEU A 1 26  ? 39.357 190.552 8.001   1.00 202.05 ? 99  LEU A CG  1 
ATOM   181  C  CD1 . LEU A 1 26  ? 38.977 189.518 9.049   1.00 213.66 ? 99  LEU A CD1 1 
ATOM   182  C  CD2 . LEU A 1 26  ? 39.693 191.883 8.657   1.00 191.38 ? 99  LEU A CD2 1 
ATOM   183  N  N   . GLY A 1 27  ? 41.371 189.058 4.259   1.00 134.10 ? 100 GLY A N   1 
ATOM   184  C  CA  . GLY A 1 27  ? 42.297 188.267 3.462   1.00 141.75 ? 100 GLY A CA  1 
ATOM   185  C  C   . GLY A 1 27  ? 43.114 189.106 2.500   1.00 121.13 ? 100 GLY A C   1 
ATOM   186  O  O   . GLY A 1 27  ? 44.302 188.845 2.286   1.00 127.51 ? 100 GLY A O   1 
ATOM   187  N  N   . ASN A 1 28  ? 42.492 190.131 1.910   1.00 142.51 ? 101 ASN A N   1 
ATOM   188  C  CA  . ASN A 1 28  ? 43.235 191.069 1.077   1.00 140.87 ? 101 ASN A CA  1 
ATOM   189  C  C   . ASN A 1 28  ? 44.313 191.791 1.874   1.00 155.95 ? 101 ASN A C   1 
ATOM   190  O  O   . ASN A 1 28  ? 45.375 192.115 1.331   1.00 151.98 ? 101 ASN A O   1 
ATOM   191  C  CB  . ASN A 1 28  ? 42.280 192.083 0.445   1.00 139.64 ? 101 ASN A CB  1 
ATOM   192  C  CG  . ASN A 1 28  ? 41.450 191.487 -0.675  1.00 165.09 ? 101 ASN A CG  1 
ATOM   193  O  OD1 . ASN A 1 28  ? 40.392 190.904 -0.440  1.00 190.47 ? 101 ASN A OD1 1 
ATOM   194  N  ND2 . ASN A 1 28  ? 41.925 191.639 -1.906  1.00 185.21 ? 101 ASN A ND2 1 
ATOM   195  N  N   . VAL A 1 29  ? 44.061 192.050 3.157   1.00 149.03 ? 102 VAL A N   1 
ATOM   196  C  CA  . VAL A 1 29  ? 44.998 192.828 3.961   1.00 154.37 ? 102 VAL A CA  1 
ATOM   197  C  C   . VAL A 1 29  ? 46.180 191.976 4.405   1.00 147.13 ? 102 VAL A C   1 
ATOM   198  O  O   . VAL A 1 29  ? 47.336 192.402 4.310   1.00 154.46 ? 102 VAL A O   1 
ATOM   199  C  CB  . VAL A 1 29  ? 44.270 193.457 5.161   1.00 185.29 ? 102 VAL A CB  1 
ATOM   200  C  CG1 . VAL A 1 29  ? 45.249 194.231 6.030   1.00 159.65 ? 102 VAL A CG1 1 
ATOM   201  C  CG2 . VAL A 1 29  ? 43.153 194.362 4.675   1.00 206.76 ? 102 VAL A CG2 1 
ATOM   202  N  N   . TRP A 1 30  ? 45.916 190.767 4.899   1.00 138.27 ? 103 TRP A N   1 
ATOM   203  C  CA  . TRP A 1 30  ? 46.963 189.917 5.457   1.00 139.36 ? 103 TRP A CA  1 
ATOM   204  C  C   . TRP A 1 30  ? 47.309 188.744 4.547   1.00 149.12 ? 103 TRP A C   1 
ATOM   205  O  O   . TRP A 1 30  ? 48.486 188.541 4.236   1.00 155.83 ? 103 TRP A O   1 
ATOM   206  C  CB  . TRP A 1 30  ? 46.600 189.437 6.877   1.00 140.97 ? 103 TRP A CB  1 
ATOM   207  C  CG  . TRP A 1 30  ? 45.431 188.511 7.002   1.00 155.58 ? 103 TRP A CG  1 
ATOM   208  C  CD1 . TRP A 1 30  ? 44.125 188.859 7.180   1.00 208.64 ? 103 TRP A CD1 1 
ATOM   209  C  CD2 . TRP A 1 30  ? 45.467 187.078 7.009   1.00 140.64 ? 103 TRP A CD2 1 
ATOM   210  N  NE1 . TRP A 1 30  ? 43.342 187.734 7.273   1.00 202.75 ? 103 TRP A NE1 1 
ATOM   211  C  CE2 . TRP A 1 30  ? 44.142 186.627 7.171   1.00 173.27 ? 103 TRP A CE2 1 
ATOM   212  C  CE3 . TRP A 1 30  ? 46.490 186.134 6.881   1.00 139.60 ? 103 TRP A CE3 1 
ATOM   213  C  CZ2 . TRP A 1 30  ? 43.813 185.274 7.210   1.00 180.17 ? 103 TRP A CZ2 1 
ATOM   214  C  CZ3 . TRP A 1 30  ? 46.161 184.791 6.915   1.00 166.40 ? 103 TRP A CZ3 1 
ATOM   215  C  CH2 . TRP A 1 30  ? 44.835 184.374 7.081   1.00 183.14 ? 103 TRP A CH2 1 
ATOM   216  N  N   . ARG A 1 31  ? 46.325 187.919 4.176   1.00 159.56 ? 104 ARG A N   1 
ATOM   217  C  CA  . ARG A 1 31  ? 46.602 186.682 3.447   1.00 157.65 ? 104 ARG A CA  1 
ATOM   218  C  C   . ARG A 1 31  ? 47.445 186.915 2.195   1.00 155.53 ? 104 ARG A C   1 
ATOM   219  O  O   . ARG A 1 31  ? 48.380 186.153 1.921   1.00 165.34 ? 104 ARG A O   1 
ATOM   220  C  CB  . ARG A 1 31  ? 45.286 185.992 3.086   1.00 162.62 ? 104 ARG A CB  1 
ATOM   221  C  CG  . ARG A 1 31  ? 45.381 184.478 3.017   1.00 166.21 ? 104 ARG A CG  1 
ATOM   222  C  CD  . ARG A 1 31  ? 44.046 183.837 3.349   1.00 199.48 ? 104 ARG A CD  1 
ATOM   223  N  NE  . ARG A 1 31  ? 44.168 182.400 3.572   1.00 209.57 ? 104 ARG A NE  1 
ATOM   224  C  CZ  . ARG A 1 31  ? 43.205 181.642 4.085   1.00 210.73 ? 104 ARG A CZ  1 
ATOM   225  N  NH1 . ARG A 1 31  ? 43.400 180.342 4.254   1.00 190.67 ? 104 ARG A NH1 1 
ATOM   226  N  NH2 . ARG A 1 31  ? 42.047 182.186 4.434   1.00 210.76 ? 104 ARG A NH2 1 
ATOM   227  N  N   . PHE A 1 32  ? 47.133 187.961 1.418   1.00 136.59 ? 105 PHE A N   1 
ATOM   228  C  CA  . PHE A 1 32  ? 47.873 188.182 0.174   1.00 133.41 ? 105 PHE A CA  1 
ATOM   229  C  C   . PHE A 1 32  ? 49.328 188.570 0.411   1.00 138.49 ? 105 PHE A C   1 
ATOM   230  O  O   . PHE A 1 32  ? 50.209 188.008 -0.265  1.00 152.08 ? 105 PHE A O   1 
ATOM   231  C  CB  . PHE A 1 32  ? 47.149 189.214 -0.697  1.00 135.79 ? 105 PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 32  ? 47.962 189.688 -1.874  1.00 138.59 ? 105 PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 32  ? 48.053 188.921 -3.024  1.00 176.09 ? 105 PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 32  ? 48.638 190.898 -1.827  1.00 134.66 ? 105 PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 32  ? 48.800 189.353 -4.107  1.00 169.44 ? 105 PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 32  ? 49.387 191.335 -2.906  1.00 135.59 ? 105 PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 32  ? 49.467 190.561 -4.047  1.00 142.47 ? 105 PHE A CZ  1 
ATOM   238  N  N   . PRO A 1 33  ? 49.662 189.519 1.299   1.00 152.60 ? 106 PRO A N   1 
ATOM   239  C  CA  . PRO A 1 33  ? 51.089 189.821 1.525   1.00 147.62 ? 106 PRO A CA  1 
ATOM   240  C  C   . PRO A 1 33  ? 51.926 188.613 1.916   1.00 132.76 ? 106 PRO A C   1 
ATOM   241  O  O   . PRO A 1 33  ? 53.035 188.441 1.392   1.00 135.49 ? 106 PRO A O   1 
ATOM   242  C  CB  . PRO A 1 33  ? 51.044 190.863 2.650   1.00 121.71 ? 106 PRO A CB  1 
ATOM   243  C  CG  . PRO A 1 33  ? 49.752 191.546 2.462   1.00 121.97 ? 106 PRO A CG  1 
ATOM   244  C  CD  . PRO A 1 33  ? 48.790 190.521 1.944   1.00 120.03 ? 106 PRO A CD  1 
ATOM   245  N  N   . TYR A 1 34  ? 51.428 187.771 2.825   1.00 124.95 ? 107 TYR A N   1 
ATOM   246  C  CA  . TYR A 1 34  ? 52.211 186.624 3.277   1.00 124.95 ? 107 TYR A CA  1 
ATOM   247  C  C   . TYR A 1 34  ? 52.470 185.650 2.136   1.00 139.86 ? 107 TYR A C   1 
ATOM   248  O  O   . TYR A 1 34  ? 53.621 185.285 1.864   1.00 156.58 ? 107 TYR A O   1 
ATOM   249  C  CB  . TYR A 1 34  ? 51.500 185.918 4.432   1.00 127.14 ? 107 TYR A CB  1 
ATOM   250  C  CG  . TYR A 1 34  ? 52.203 184.657 4.889   1.00 151.48 ? 107 TYR A CG  1 
ATOM   251  C  CD1 . TYR A 1 34  ? 53.235 184.712 5.815   1.00 179.39 ? 107 TYR A CD1 1 
ATOM   252  C  CD2 . TYR A 1 34  ? 51.837 183.412 4.388   1.00 141.22 ? 107 TYR A CD2 1 
ATOM   253  C  CE1 . TYR A 1 34  ? 53.883 183.564 6.233   1.00 197.08 ? 107 TYR A CE1 1 
ATOM   254  C  CE2 . TYR A 1 34  ? 52.482 182.259 4.797   1.00 132.21 ? 107 TYR A CE2 1 
ATOM   255  C  CZ  . TYR A 1 34  ? 53.502 182.341 5.721   1.00 167.22 ? 107 TYR A CZ  1 
ATOM   256  O  OH  . TYR A 1 34  ? 54.145 181.197 6.135   1.00 206.04 ? 107 TYR A OH  1 
ATOM   257  N  N   . ILE A 1 35  ? 51.406 185.209 1.460   1.00 128.84 ? 108 ILE A N   1 
ATOM   258  C  CA  . ILE A 1 35  ? 51.560 184.268 0.358   1.00 130.41 ? 108 ILE A CA  1 
ATOM   259  C  C   . ILE A 1 35  ? 52.365 184.877 -0.779  1.00 134.55 ? 108 ILE A C   1 
ATOM   260  O  O   . ILE A 1 35  ? 52.981 184.147 -1.564  1.00 155.01 ? 108 ILE A O   1 
ATOM   261  C  CB  . ILE A 1 35  ? 50.177 183.784 -0.128  1.00 122.77 ? 108 ILE A CB  1 
ATOM   262  C  CG1 . ILE A 1 35  ? 50.320 182.540 -1.007  1.00 149.12 ? 108 ILE A CG1 1 
ATOM   263  C  CG2 . ILE A 1 35  ? 49.453 184.886 -0.886  1.00 122.21 ? 108 ILE A CG2 1 
ATOM   264  C  CD1 . ILE A 1 35  ? 49.001 182.004 -1.515  1.00 183.80 ? 108 ILE A CD1 1 
ATOM   265  N  N   . CYS A 1 36  ? 52.388 186.207 -0.883  1.00 138.93 ? 109 CYS A N   1 
ATOM   266  C  CA  . CYS A 1 36  ? 53.207 186.849 -1.904  1.00 130.24 ? 109 CYS A CA  1 
ATOM   267  C  C   . CYS A 1 36  ? 54.680 186.834 -1.517  1.00 145.02 ? 109 CYS A C   1 
ATOM   268  O  O   . CYS A 1 36  ? 55.553 186.687 -2.381  1.00 186.40 ? 109 CYS A O   1 
ATOM   269  C  CB  . CYS A 1 36  ? 52.724 188.278 -2.140  1.00 120.04 ? 109 CYS A CB  1 
ATOM   270  S  SG  . CYS A 1 36  ? 53.770 189.240 -3.256  1.00 182.55 ? 109 CYS A SG  1 
ATOM   271  N  N   . ALA A 1 37  ? 54.976 186.970 -0.223  1.00 137.66 ? 110 ALA A N   1 
ATOM   272  C  CA  . ALA A 1 37  ? 56.365 187.006 0.222   1.00 146.91 ? 110 ALA A CA  1 
ATOM   273  C  C   . ALA A 1 37  ? 57.008 185.625 0.203   1.00 150.03 ? 110 ALA A C   1 
ATOM   274  O  O   . ALA A 1 37  ? 58.146 185.478 -0.257  1.00 149.11 ? 110 ALA A O   1 
ATOM   275  C  CB  . ALA A 1 37  ? 56.452 187.609 1.624   1.00 149.93 ? 110 ALA A CB  1 
ATOM   276  N  N   . GLN A 1 38  ? 56.308 184.603 0.702   1.00 146.96 ? 111 GLN A N   1 
ATOM   277  C  CA  . GLN A 1 38  ? 56.916 183.283 0.816   1.00 157.04 ? 111 GLN A CA  1 
ATOM   278  C  C   . GLN A 1 38  ? 56.994 182.549 -0.516  1.00 152.41 ? 111 GLN A C   1 
ATOM   279  O  O   . GLN A 1 38  ? 57.777 181.600 -0.638  1.00 158.69 ? 111 GLN A O   1 
ATOM   280  C  CB  . GLN A 1 38  ? 56.155 182.425 1.829   1.00 152.55 ? 111 GLN A CB  1 
ATOM   281  C  CG  . GLN A 1 38  ? 54.861 181.825 1.307   1.00 171.06 ? 111 GLN A CG  1 
ATOM   282  C  CD  . GLN A 1 38  ? 54.380 180.659 2.153   1.00 168.85 ? 111 GLN A CD  1 
ATOM   283  O  OE1 . GLN A 1 38  ? 55.051 180.245 3.099   1.00 143.91 ? 111 GLN A OE1 1 
ATOM   284  N  NE2 . GLN A 1 38  ? 53.214 180.122 1.812   1.00 161.12 ? 111 GLN A NE2 1 
ATOM   285  N  N   . ASN A 1 39  ? 56.206 182.954 -1.509  1.00 132.02 ? 112 ASN A N   1 
ATOM   286  C  CA  . ASN A 1 39  ? 56.252 182.359 -2.840  1.00 144.79 ? 112 ASN A CA  1 
ATOM   287  C  C   . ASN A 1 39  ? 56.756 183.410 -3.821  1.00 149.77 ? 112 ASN A C   1 
ATOM   288  O  O   . ASN A 1 39  ? 56.032 184.353 -4.155  1.00 161.25 ? 112 ASN A O   1 
ATOM   289  C  CB  . ASN A 1 39  ? 54.877 181.840 -3.256  1.00 146.36 ? 112 ASN A CB  1 
ATOM   290  C  CG  . ASN A 1 39  ? 54.397 180.696 -2.384  1.00 164.85 ? 112 ASN A CG  1 
ATOM   291  O  OD1 . ASN A 1 39  ? 55.191 179.879 -1.919  1.00 189.02 ? 112 ASN A OD1 1 
ATOM   292  N  ND2 . ASN A 1 39  ? 53.089 180.632 -2.160  1.00 130.08 ? 112 ASN A ND2 1 
ATOM   293  N  N   . GLY A 1 40  ? 57.998 183.250 -4.276  1.00 171.20 ? 113 GLY A N   1 
ATOM   294  C  CA  . GLY A 1 40  ? 58.541 184.055 -5.350  1.00 185.25 ? 113 GLY A CA  1 
ATOM   295  C  C   . GLY A 1 40  ? 58.807 185.508 -5.026  1.00 199.79 ? 113 GLY A C   1 
ATOM   296  O  O   . GLY A 1 40  ? 59.424 186.199 -5.847  1.00 210.11 ? 113 GLY A O   1 
ATOM   297  N  N   . GLY A 1 41  ? 58.386 185.997 -3.862  1.00 197.37 ? 114 GLY A N   1 
ATOM   298  C  CA  . GLY A 1 41  ? 58.513 187.418 -3.585  1.00 201.72 ? 114 GLY A CA  1 
ATOM   299  C  C   . GLY A 1 41  ? 57.718 188.240 -4.579  1.00 191.28 ? 114 GLY A C   1 
ATOM   300  O  O   . GLY A 1 41  ? 56.579 187.907 -4.931  1.00 214.02 ? 114 GLY A O   1 
ATOM   301  N  N   . GLY A 1 42  ? 58.331 189.328 -5.054  1.00 139.03 ? 115 GLY A N   1 
ATOM   302  C  CA  . GLY A 1 42  ? 57.679 190.161 -6.051  1.00 134.52 ? 115 GLY A CA  1 
ATOM   303  C  C   . GLY A 1 42  ? 57.341 189.412 -7.325  1.00 166.09 ? 115 GLY A C   1 
ATOM   304  O  O   . GLY A 1 42  ? 56.359 189.737 -8.000  1.00 110.81 ? 115 GLY A O   1 
ATOM   305  N  N   . ALA A 1 43  ? 58.132 188.390 -7.663  1.00 181.20 ? 116 ALA A N   1 
ATOM   306  C  CA  . ALA A 1 43  ? 57.847 187.566 -8.832  1.00 159.99 ? 116 ALA A CA  1 
ATOM   307  C  C   . ALA A 1 43  ? 56.507 186.850 -8.733  1.00 140.61 ? 116 ALA A C   1 
ATOM   308  O  O   . ALA A 1 43  ? 56.031 186.322 -9.744  1.00 139.57 ? 116 ALA A O   1 
ATOM   309  C  CB  . ALA A 1 43  ? 58.967 186.545 -9.043  1.00 169.18 ? 116 ALA A CB  1 
ATOM   310  N  N   . PHE A 1 44  ? 55.893 186.818 -7.547  1.00 139.90 ? 117 PHE A N   1 
ATOM   311  C  CA  . PHE A 1 44  ? 54.550 186.269 -7.411  1.00 133.16 ? 117 PHE A CA  1 
ATOM   312  C  C   . PHE A 1 44  ? 53.507 187.105 -8.143  1.00 146.63 ? 117 PHE A C   1 
ATOM   313  O  O   . PHE A 1 44  ? 52.388 186.627 -8.357  1.00 189.61 ? 117 PHE A O   1 
ATOM   314  C  CB  . PHE A 1 44  ? 54.181 186.155 -5.930  1.00 139.59 ? 117 PHE A CB  1 
ATOM   315  C  CG  . PHE A 1 44  ? 52.904 185.407 -5.677  1.00 131.21 ? 117 PHE A CG  1 
ATOM   316  C  CD1 . PHE A 1 44  ? 52.867 184.025 -5.766  1.00 131.25 ? 117 PHE A CD1 1 
ATOM   317  C  CD2 . PHE A 1 44  ? 51.743 186.084 -5.342  1.00 131.82 ? 117 PHE A CD2 1 
ATOM   318  C  CE1 . PHE A 1 44  ? 51.694 183.333 -5.532  1.00 137.93 ? 117 PHE A CE1 1 
ATOM   319  C  CE2 . PHE A 1 44  ? 50.566 185.398 -5.106  1.00 130.81 ? 117 PHE A CE2 1 
ATOM   320  C  CZ  . PHE A 1 44  ? 50.542 184.021 -5.200  1.00 139.76 ? 117 PHE A CZ  1 
ATOM   321  N  N   . LEU A 1 45  ? 53.846 188.337 -8.534  1.00 119.54 ? 118 LEU A N   1 
ATOM   322  C  CA  . LEU A 1 45  ? 52.882 189.174 -9.241  1.00 135.17 ? 118 LEU A CA  1 
ATOM   323  C  C   . LEU A 1 45  ? 52.546 188.613 -10.618 1.00 164.01 ? 118 LEU A C   1 
ATOM   324  O  O   . LEU A 1 45  ? 51.427 188.810 -11.107 1.00 149.15 ? 118 LEU A O   1 
ATOM   325  C  CB  . LEU A 1 45  ? 53.416 190.600 -9.367  1.00 111.90 ? 118 LEU A CB  1 
ATOM   326  C  CG  . LEU A 1 45  ? 53.603 191.383 -8.066  1.00 113.87 ? 118 LEU A CG  1 
ATOM   327  C  CD1 . LEU A 1 45  ? 54.170 192.765 -8.350  1.00 117.65 ? 118 LEU A CD1 1 
ATOM   328  C  CD2 . LEU A 1 45  ? 52.292 191.485 -7.304  1.00 151.75 ? 118 LEU A CD2 1 
ATOM   329  N  N   . LEU A 1 46  ? 53.497 187.918 -11.259 1.00 159.68 ? 119 LEU A N   1 
ATOM   330  C  CA  . LEU A 1 46  ? 53.240 187.398 -12.602 1.00 134.08 ? 119 LEU A CA  1 
ATOM   331  C  C   . LEU A 1 46  ? 52.155 186.326 -12.607 1.00 144.52 ? 119 LEU A C   1 
ATOM   332  O  O   . LEU A 1 46  ? 51.165 186.477 -13.344 1.00 130.90 ? 119 LEU A O   1 
ATOM   333  C  CB  . LEU A 1 46  ? 54.550 186.916 -13.235 1.00 129.79 ? 119 LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 46  ? 54.514 186.355 -14.658 1.00 129.40 ? 119 LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 46  ? 55.751 186.794 -15.422 1.00 133.91 ? 119 LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 46  ? 54.417 184.835 -14.645 1.00 151.21 ? 119 LEU A CD2 1 
ATOM   337  N  N   . PRO A 1 47  ? 52.256 185.237 -11.830 1.00 158.96 ? 120 PRO A N   1 
ATOM   338  C  CA  . PRO A 1 47  ? 51.178 184.234 -11.860 1.00 152.87 ? 120 PRO A CA  1 
ATOM   339  C  C   . PRO A 1 47  ? 49.885 184.712 -11.224 1.00 142.11 ? 120 PRO A C   1 
ATOM   340  O  O   . PRO A 1 47  ? 48.817 184.190 -11.568 1.00 131.73 ? 120 PRO A O   1 
ATOM   341  C  CB  . PRO A 1 47  ? 51.776 183.051 -11.088 1.00 112.81 ? 120 PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 47  ? 52.727 183.681 -10.147 1.00 114.57 ? 120 PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 47  ? 53.325 184.844 -10.890 1.00 128.49 ? 120 PRO A CD  1 
ATOM   344  N  N   . TYR A 1 48  ? 49.947 185.683 -10.310 1.00 131.64 ? 121 TYR A N   1 
ATOM   345  C  CA  . TYR A 1 48  ? 48.734 186.177 -9.667  1.00 143.10 ? 121 TYR A CA  1 
ATOM   346  C  C   . TYR A 1 48  ? 47.809 186.847 -10.676 1.00 165.77 ? 121 TYR A C   1 
ATOM   347  O  O   . TYR A 1 48  ? 46.581 186.730 -10.578 1.00 185.86 ? 121 TYR A O   1 
ATOM   348  C  CB  . TYR A 1 48  ? 49.102 187.143 -8.541  1.00 130.88 ? 121 TYR A CB  1 
ATOM   349  C  CG  . TYR A 1 48  ? 47.918 187.750 -7.823  1.00 133.82 ? 121 TYR A CG  1 
ATOM   350  C  CD1 . TYR A 1 48  ? 47.158 186.997 -6.937  1.00 161.45 ? 121 TYR A CD1 1 
ATOM   351  C  CD2 . TYR A 1 48  ? 47.568 189.080 -8.021  1.00 127.42 ? 121 TYR A CD2 1 
ATOM   352  C  CE1 . TYR A 1 48  ? 46.076 187.550 -6.276  1.00 164.80 ? 121 TYR A CE1 1 
ATOM   353  C  CE2 . TYR A 1 48  ? 46.490 189.641 -7.363  1.00 126.87 ? 121 TYR A CE2 1 
ATOM   354  C  CZ  . TYR A 1 48  ? 45.747 188.872 -6.492  1.00 140.74 ? 121 TYR A CZ  1 
ATOM   355  O  OH  . TYR A 1 48  ? 44.673 189.426 -5.835  1.00 138.87 ? 121 TYR A OH  1 
ATOM   356  N  N   . THR A 1 49  ? 48.379 187.547 -11.658 1.00 131.53 ? 122 THR A N   1 
ATOM   357  C  CA  . THR A 1 49  ? 47.562 188.190 -12.679 1.00 135.96 ? 122 THR A CA  1 
ATOM   358  C  C   . THR A 1 49  ? 47.067 187.186 -13.714 1.00 131.67 ? 122 THR A C   1 
ATOM   359  O  O   . THR A 1 49  ? 45.925 187.282 -14.177 1.00 154.21 ? 122 THR A O   1 
ATOM   360  C  CB  . THR A 1 49  ? 48.352 189.308 -13.360 1.00 138.72 ? 122 THR A CB  1 
ATOM   361  O  OG1 . THR A 1 49  ? 49.529 188.760 -13.967 1.00 154.12 ? 122 THR A OG1 1 
ATOM   362  C  CG2 . THR A 1 49  ? 48.760 190.365 -12.344 1.00 122.55 ? 122 THR A CG2 1 
ATOM   363  N  N   . ILE A 1 50  ? 47.911 186.219 -14.084 1.00 143.95 ? 123 ILE A N   1 
ATOM   364  C  CA  . ILE A 1 50  ? 47.518 185.225 -15.079 1.00 139.61 ? 123 ILE A CA  1 
ATOM   365  C  C   . ILE A 1 50  ? 46.327 184.416 -14.582 1.00 157.41 ? 123 ILE A C   1 
ATOM   366  O  O   . ILE A 1 50  ? 45.377 184.156 -15.332 1.00 168.74 ? 123 ILE A O   1 
ATOM   367  C  CB  . ILE A 1 50  ? 48.713 184.321 -15.433 1.00 121.51 ? 123 ILE A CB  1 
ATOM   368  C  CG1 . ILE A 1 50  ? 49.860 185.156 -16.005 1.00 113.35 ? 123 ILE A CG1 1 
ATOM   369  C  CG2 . ILE A 1 50  ? 48.296 183.244 -16.424 1.00 114.13 ? 123 ILE A CG2 1 
ATOM   370  C  CD1 . ILE A 1 50  ? 51.072 184.342 -16.398 1.00 114.66 ? 123 ILE A CD1 1 
ATOM   371  N  N   . MET A 1 51  ? 46.351 184.011 -13.310 1.00 147.15 ? 124 MET A N   1 
ATOM   372  C  CA  . MET A 1 51  ? 45.201 183.329 -12.729 1.00 118.98 ? 124 MET A CA  1 
ATOM   373  C  C   . MET A 1 51  ? 44.009 184.260 -12.560 1.00 118.73 ? 124 MET A C   1 
ATOM   374  O  O   . MET A 1 51  ? 42.876 183.783 -12.444 1.00 126.86 ? 124 MET A O   1 
ATOM   375  C  CB  . MET A 1 51  ? 45.577 182.710 -11.384 1.00 119.71 ? 124 MET A CB  1 
ATOM   376  C  CG  . MET A 1 51  ? 46.537 181.545 -11.501 1.00 120.60 ? 124 MET A CG  1 
ATOM   377  S  SD  . MET A 1 51  ? 45.863 180.226 -12.527 1.00 125.97 ? 124 MET A SD  1 
ATOM   378  C  CE  . MET A 1 51  ? 47.213 179.051 -12.493 1.00 195.73 ? 124 MET A CE  1 
ATOM   379  N  N   . ALA A 1 52  ? 44.241 185.572 -12.536 1.00 122.54 ? 125 ALA A N   1 
ATOM   380  C  CA  . ALA A 1 52  ? 43.143 186.531 -12.501 1.00 99.04  ? 125 ALA A CA  1 
ATOM   381  C  C   . ALA A 1 52  ? 42.535 186.709 -13.886 1.00 117.07 ? 125 ALA A C   1 
ATOM   382  O  O   . ALA A 1 52  ? 41.352 186.420 -14.099 1.00 100.69 ? 125 ALA A O   1 
ATOM   383  C  CB  . ALA A 1 52  ? 43.632 187.872 -11.949 1.00 126.67 ? 125 ALA A CB  1 
ATOM   384  N  N   . ILE A 1 53  ? 43.340 187.195 -14.834 1.00 161.67 ? 126 ILE A N   1 
ATOM   385  C  CA  . ILE A 1 53  ? 42.861 187.466 -16.189 1.00 140.12 ? 126 ILE A CA  1 
ATOM   386  C  C   . ILE A 1 53  ? 42.173 186.240 -16.775 1.00 145.74 ? 126 ILE A C   1 
ATOM   387  O  O   . ILE A 1 53  ? 41.048 186.318 -17.280 1.00 134.64 ? 126 ILE A O   1 
ATOM   388  C  CB  . ILE A 1 53  ? 44.025 187.934 -17.081 1.00 126.45 ? 126 ILE A CB  1 
ATOM   389  C  CG1 . ILE A 1 53  ? 44.554 189.288 -16.605 1.00 128.09 ? 126 ILE A CG1 1 
ATOM   390  C  CG2 . ILE A 1 53  ? 43.592 188.003 -18.536 1.00 161.10 ? 126 ILE A CG2 1 
ATOM   391  C  CD1 . ILE A 1 53  ? 45.730 189.800 -17.408 1.00 134.72 ? 126 ILE A CD1 1 
ATOM   392  N  N   . PHE A 1 54  ? 42.852 185.093 -16.744 1.00 147.48 ? 127 PHE A N   1 
ATOM   393  C  CA  . PHE A 1 54  ? 42.268 183.885 -17.318 1.00 151.26 ? 127 PHE A CA  1 
ATOM   394  C  C   . PHE A 1 54  ? 41.227 183.257 -16.395 1.00 145.99 ? 127 PHE A C   1 
ATOM   395  O  O   . PHE A 1 54  ? 40.098 182.986 -16.817 1.00 162.87 ? 127 PHE A O   1 
ATOM   396  C  CB  . PHE A 1 54  ? 43.374 182.880 -17.643 1.00 154.72 ? 127 PHE A CB  1 
ATOM   397  C  CG  . PHE A 1 54  ? 44.331 183.352 -18.699 1.00 158.00 ? 127 PHE A CG  1 
ATOM   398  C  CD1 . PHE A 1 54  ? 43.953 184.325 -19.611 1.00 134.03 ? 127 PHE A CD1 1 
ATOM   399  C  CD2 . PHE A 1 54  ? 45.609 182.824 -18.782 1.00 153.39 ? 127 PHE A CD2 1 
ATOM   400  C  CE1 . PHE A 1 54  ? 44.831 184.763 -20.583 1.00 144.38 ? 127 PHE A CE1 1 
ATOM   401  C  CE2 . PHE A 1 54  ? 46.492 183.258 -19.753 1.00 135.34 ? 127 PHE A CE2 1 
ATOM   402  C  CZ  . PHE A 1 54  ? 46.102 184.228 -20.654 1.00 151.46 ? 127 PHE A CZ  1 
ATOM   403  N  N   . GLY A 1 55  ? 41.596 182.986 -15.144 1.00 146.26 ? 128 GLY A N   1 
ATOM   404  C  CA  . GLY A 1 55  ? 40.677 182.351 -14.217 1.00 127.53 ? 128 GLY A CA  1 
ATOM   405  C  C   . GLY A 1 55  ? 39.660 183.229 -13.513 1.00 124.76 ? 128 GLY A C   1 
ATOM   406  O  O   . GLY A 1 55  ? 38.461 182.935 -13.528 1.00 151.04 ? 128 GLY A O   1 
ATOM   407  N  N   . GLY A 1 56  ? 40.127 184.312 -12.894 1.00 123.36 ? 129 GLY A N   1 
ATOM   408  C  CA  . GLY A 1 56  ? 39.296 185.096 -11.999 1.00 120.29 ? 129 GLY A CA  1 
ATOM   409  C  C   . GLY A 1 56  ? 38.315 186.049 -12.651 1.00 135.34 ? 129 GLY A C   1 
ATOM   410  O  O   . GLY A 1 56  ? 37.136 186.087 -12.285 1.00 123.43 ? 129 GLY A O   1 
ATOM   411  N  N   . ILE A 1 57  ? 38.795 186.828 -13.614 1.00 163.73 ? 130 ILE A N   1 
ATOM   412  C  CA  . ILE A 1 57  ? 37.992 187.875 -14.244 1.00 127.71 ? 130 ILE A CA  1 
ATOM   413  C  C   . ILE A 1 57  ? 36.831 187.284 -15.042 1.00 129.94 ? 130 ILE A C   1 
ATOM   414  O  O   . ILE A 1 57  ? 35.721 187.830 -14.972 1.00 136.49 ? 130 ILE A O   1 
ATOM   415  C  CB  . ILE A 1 57  ? 38.862 188.789 -15.124 1.00 146.82 ? 130 ILE A CB  1 
ATOM   416  C  CG1 . ILE A 1 57  ? 40.082 189.282 -14.343 1.00 116.34 ? 130 ILE A CG1 1 
ATOM   417  C  CG2 . ILE A 1 57  ? 38.055 189.982 -15.602 1.00 154.13 ? 130 ILE A CG2 1 
ATOM   418  C  CD1 . ILE A 1 57  ? 39.735 190.077 -13.110 1.00 115.87 ? 130 ILE A CD1 1 
ATOM   419  N  N   . PRO A 1 58  ? 37.010 186.207 -15.820 1.00 142.55 ? 131 PRO A N   1 
ATOM   420  C  CA  . PRO A 1 58  ? 35.848 185.648 -16.531 1.00 127.59 ? 131 PRO A CA  1 
ATOM   421  C  C   . PRO A 1 58  ? 34.804 185.044 -15.608 1.00 127.82 ? 131 PRO A C   1 
ATOM   422  O  O   . PRO A 1 58  ? 33.623 185.008 -15.972 1.00 151.04 ? 131 PRO A O   1 
ATOM   423  C  CB  . PRO A 1 58  ? 36.471 184.587 -17.449 1.00 130.74 ? 131 PRO A CB  1 
ATOM   424  C  CG  . PRO A 1 58  ? 37.879 185.020 -17.610 1.00 140.89 ? 131 PRO A CG  1 
ATOM   425  C  CD  . PRO A 1 58  ? 38.254 185.563 -16.271 1.00 130.53 ? 131 PRO A CD  1 
ATOM   426  N  N   . LEU A 1 59  ? 35.199 184.558 -14.430 1.00 125.35 ? 132 LEU A N   1 
ATOM   427  C  CA  . LEU A 1 59  ? 34.214 184.071 -13.471 1.00 138.38 ? 132 LEU A CA  1 
ATOM   428  C  C   . LEU A 1 59  ? 33.513 185.223 -12.763 1.00 132.65 ? 132 LEU A C   1 
ATOM   429  O  O   . LEU A 1 59  ? 32.319 185.132 -12.456 1.00 144.21 ? 132 LEU A O   1 
ATOM   430  C  CB  . LEU A 1 59  ? 34.879 183.145 -12.453 1.00 157.15 ? 132 LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 59  ? 35.340 181.783 -12.972 1.00 150.87 ? 132 LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 59  ? 36.049 181.010 -11.873 1.00 145.25 ? 132 LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 59  ? 34.158 180.992 -13.510 1.00 122.61 ? 132 LEU A CD2 1 
ATOM   434  N  N   . PHE A 1 60  ? 34.240 186.310 -12.496 1.00 155.12 ? 133 PHE A N   1 
ATOM   435  C  CA  . PHE A 1 60  ? 33.632 187.477 -11.865 1.00 157.11 ? 133 PHE A CA  1 
ATOM   436  C  C   . PHE A 1 60  ? 32.654 188.164 -12.811 1.00 173.98 ? 133 PHE A C   1 
ATOM   437  O  O   . PHE A 1 60  ? 31.559 188.567 -12.401 1.00 202.98 ? 133 PHE A O   1 
ATOM   438  C  CB  . PHE A 1 60  ? 34.727 188.446 -11.416 1.00 157.35 ? 133 PHE A CB  1 
ATOM   439  C  CG  . PHE A 1 60  ? 34.243 189.539 -10.505 1.00 164.70 ? 133 PHE A CG  1 
ATOM   440  C  CD1 . PHE A 1 60  ? 34.249 189.367 -9.131  1.00 175.70 ? 133 PHE A CD1 1 
ATOM   441  C  CD2 . PHE A 1 60  ? 33.797 190.744 -11.022 1.00 207.29 ? 133 PHE A CD2 1 
ATOM   442  C  CE1 . PHE A 1 60  ? 33.810 190.373 -8.290  1.00 185.27 ? 133 PHE A CE1 1 
ATOM   443  C  CE2 . PHE A 1 60  ? 33.356 191.752 -10.186 1.00 205.67 ? 133 PHE A CE2 1 
ATOM   444  C  CZ  . PHE A 1 60  ? 33.363 191.566 -8.819  1.00 177.34 ? 133 PHE A CZ  1 
ATOM   445  N  N   . TYR A 1 61  ? 33.032 188.296 -14.083 1.00 154.68 ? 134 TYR A N   1 
ATOM   446  C  CA  . TYR A 1 61  ? 32.191 188.954 -15.075 1.00 146.20 ? 134 TYR A CA  1 
ATOM   447  C  C   . TYR A 1 61  ? 31.058 188.046 -15.539 1.00 147.61 ? 134 TYR A C   1 
ATOM   448  O  O   . TYR A 1 61  ? 29.935 188.514 -15.759 1.00 154.44 ? 134 TYR A O   1 
ATOM   449  C  CB  . TYR A 1 61  ? 33.055 189.401 -16.257 1.00 171.16 ? 134 TYR A CB  1 
ATOM   450  C  CG  . TYR A 1 61  ? 32.291 189.905 -17.460 1.00 193.28 ? 134 TYR A CG  1 
ATOM   451  C  CD1 . TYR A 1 61  ? 31.621 191.121 -17.425 1.00 194.42 ? 134 TYR A CD1 1 
ATOM   452  C  CD2 . TYR A 1 61  ? 32.264 189.176 -18.640 1.00 189.25 ? 134 TYR A CD2 1 
ATOM   453  C  CE1 . TYR A 1 61  ? 30.931 191.587 -18.528 1.00 164.80 ? 134 TYR A CE1 1 
ATOM   454  C  CE2 . TYR A 1 61  ? 31.578 189.634 -19.748 1.00 194.69 ? 134 TYR A CE2 1 
ATOM   455  C  CZ  . TYR A 1 61  ? 30.914 190.839 -19.687 1.00 188.49 ? 134 TYR A CZ  1 
ATOM   456  O  OH  . TYR A 1 61  ? 30.231 191.298 -20.788 1.00 196.73 ? 134 TYR A OH  1 
ATOM   457  N  N   . MET A 1 62  ? 31.333 186.749 -15.693 1.00 117.40 ? 135 MET A N   1 
ATOM   458  C  CA  . MET A 1 62  ? 30.277 185.807 -16.053 1.00 137.90 ? 135 MET A CA  1 
ATOM   459  C  C   . MET A 1 62  ? 29.270 185.662 -14.919 1.00 149.14 ? 135 MET A C   1 
ATOM   460  O  O   . MET A 1 62  ? 28.065 185.527 -15.163 1.00 134.37 ? 135 MET A O   1 
ATOM   461  C  CB  . MET A 1 62  ? 30.888 184.453 -16.420 1.00 122.02 ? 135 MET A CB  1 
ATOM   462  C  CG  . MET A 1 62  ? 29.900 183.437 -16.980 1.00 123.00 ? 135 MET A CG  1 
ATOM   463  S  SD  . MET A 1 62  ? 29.135 182.399 -15.719 1.00 171.03 ? 135 MET A SD  1 
ATOM   464  C  CE  . MET A 1 62  ? 30.571 181.565 -15.046 1.00 148.74 ? 135 MET A CE  1 
ATOM   465  N  N   . GLU A 1 63  ? 29.748 185.690 -13.674 1.00 178.85 ? 136 GLU A N   1 
ATOM   466  C  CA  . GLU A 1 63  ? 28.845 185.671 -12.529 1.00 204.69 ? 136 GLU A CA  1 
ATOM   467  C  C   . GLU A 1 63  ? 28.071 186.979 -12.416 1.00 195.99 ? 136 GLU A C   1 
ATOM   468  O  O   . GLU A 1 63  ? 26.892 186.980 -12.041 1.00 178.53 ? 136 GLU A O   1 
ATOM   469  C  CB  . GLU A 1 63  ? 29.641 185.398 -11.250 1.00 192.55 ? 136 GLU A CB  1 
ATOM   470  C  CG  . GLU A 1 63  ? 28.895 185.680 -9.954  1.00 176.86 ? 136 GLU A CG  1 
ATOM   471  C  CD  . GLU A 1 63  ? 27.913 184.587 -9.583  1.00 191.78 ? 136 GLU A CD  1 
ATOM   472  O  OE1 . GLU A 1 63  ? 27.833 183.576 -10.311 1.00 196.07 ? 136 GLU A OE1 1 
ATOM   473  O  OE2 . GLU A 1 63  ? 27.223 184.739 -8.554  1.00 202.06 ? 136 GLU A OE2 1 
ATOM   474  N  N   . LEU A 1 64  ? 28.713 188.100 -12.748 1.00 168.79 ? 137 LEU A N   1 
ATOM   475  C  CA  . LEU A 1 64  ? 28.080 189.405 -12.611 1.00 151.26 ? 137 LEU A CA  1 
ATOM   476  C  C   . LEU A 1 64  ? 27.081 189.699 -13.724 1.00 193.15 ? 137 LEU A C   1 
ATOM   477  O  O   . LEU A 1 64  ? 26.169 190.508 -13.521 1.00 181.75 ? 137 LEU A O   1 
ATOM   478  C  CB  . LEU A 1 64  ? 29.151 190.499 -12.571 1.00 135.22 ? 137 LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 64  ? 28.727 191.880 -12.067 1.00 156.98 ? 137 LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 64  ? 28.221 191.796 -10.636 1.00 169.19 ? 137 LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 64  ? 29.881 192.864 -12.171 1.00 141.60 ? 137 LEU A CD2 1 
ATOM   482  N  N   . ALA A 1 65  ? 27.225 189.062 -14.888 1.00 219.21 ? 138 ALA A N   1 
ATOM   483  C  CA  . ALA A 1 65  ? 26.319 189.329 -16.001 1.00 205.87 ? 138 ALA A CA  1 
ATOM   484  C  C   . ALA A 1 65  ? 24.984 188.613 -15.831 1.00 189.87 ? 138 ALA A C   1 
ATOM   485  O  O   . ALA A 1 65  ? 23.928 189.189 -16.118 1.00 186.29 ? 138 ALA A O   1 
ATOM   486  C  CB  . ALA A 1 65  ? 26.975 188.924 -17.321 1.00 185.25 ? 138 ALA A CB  1 
ATOM   487  N  N   . LEU A 1 66  ? 25.013 187.359 -15.371 1.00 172.33 ? 139 LEU A N   1 
ATOM   488  C  CA  . LEU A 1 66  ? 23.777 186.603 -15.190 1.00 126.32 ? 139 LEU A CA  1 
ATOM   489  C  C   . LEU A 1 66  ? 22.862 187.260 -14.164 1.00 158.73 ? 139 LEU A C   1 
ATOM   490  O  O   . LEU A 1 66  ? 21.633 187.201 -14.299 1.00 197.70 ? 139 LEU A O   1 
ATOM   491  C  CB  . LEU A 1 66  ? 24.099 185.168 -14.772 1.00 135.31 ? 139 LEU A CB  1 
ATOM   492  C  CG  . LEU A 1 66  ? 24.935 184.345 -15.754 1.00 148.29 ? 139 LEU A CG  1 
ATOM   493  C  CD1 . LEU A 1 66  ? 25.305 182.998 -15.153 1.00 124.16 ? 139 LEU A CD1 1 
ATOM   494  C  CD2 . LEU A 1 66  ? 24.185 184.161 -17.062 1.00 192.55 ? 139 LEU A CD2 1 
ATOM   495  N  N   . GLY A 1 67  ? 23.440 187.892 -13.141 1.00 182.78 ? 140 GLY A N   1 
ATOM   496  C  CA  . GLY A 1 67  ? 22.621 188.561 -12.142 1.00 176.89 ? 140 GLY A CA  1 
ATOM   497  C  C   . GLY A 1 67  ? 21.894 189.768 -12.703 1.00 179.39 ? 140 GLY A C   1 
ATOM   498  O  O   . GLY A 1 67  ? 20.693 189.943 -12.481 1.00 159.42 ? 140 GLY A O   1 
ATOM   499  N  N   . GLN A 1 68  ? 22.610 190.615 -13.445 1.00 192.60 ? 141 GLN A N   1 
ATOM   500  C  CA  . GLN A 1 68  ? 21.990 191.785 -14.050 1.00 195.04 ? 141 GLN A CA  1 
ATOM   501  C  C   . GLN A 1 68  ? 21.099 191.424 -15.228 1.00 197.79 ? 141 GLN A C   1 
ATOM   502  O  O   . GLN A 1 68  ? 20.287 192.254 -15.652 1.00 210.69 ? 141 GLN A O   1 
ATOM   503  C  CB  . GLN A 1 68  ? 23.062 192.783 -14.497 1.00 202.00 ? 141 GLN A CB  1 
ATOM   504  C  CG  . GLN A 1 68  ? 22.571 194.221 -14.570 1.00 215.38 ? 141 GLN A CG  1 
ATOM   505  C  CD  . GLN A 1 68  ? 23.677 195.201 -14.901 1.00 226.13 ? 141 GLN A CD  1 
ATOM   506  O  OE1 . GLN A 1 68  ? 23.623 196.369 -14.518 1.00 231.70 ? 141 GLN A OE1 1 
ATOM   507  N  NE2 . GLN A 1 68  ? 24.688 194.731 -15.619 1.00 235.81 ? 141 GLN A NE2 1 
ATOM   508  N  N   . TYR A 1 69  ? 21.230 190.213 -15.765 1.00 157.94 ? 142 TYR A N   1 
ATOM   509  C  CA  . TYR A 1 69  ? 20.367 189.775 -16.856 1.00 158.61 ? 142 TYR A CA  1 
ATOM   510  C  C   . TYR A 1 69  ? 19.065 189.178 -16.326 1.00 160.79 ? 142 TYR A C   1 
ATOM   511  O  O   . TYR A 1 69  ? 17.982 189.722 -16.564 1.00 199.32 ? 142 TYR A O   1 
ATOM   512  C  CB  . TYR A 1 69  ? 21.108 188.770 -17.743 1.00 154.72 ? 142 TYR A CB  1 
ATOM   513  C  CG  . TYR A 1 69  ? 20.329 188.351 -18.968 1.00 159.52 ? 142 TYR A CG  1 
ATOM   514  C  CD1 . TYR A 1 69  ? 20.217 189.195 -20.066 1.00 179.46 ? 142 TYR A CD1 1 
ATOM   515  C  CD2 . TYR A 1 69  ? 19.705 187.113 -19.027 1.00 176.04 ? 142 TYR A CD2 1 
ATOM   516  C  CE1 . TYR A 1 69  ? 19.502 188.816 -21.189 1.00 213.06 ? 142 TYR A CE1 1 
ATOM   517  C  CE2 . TYR A 1 69  ? 18.991 186.725 -20.144 1.00 204.46 ? 142 TYR A CE2 1 
ATOM   518  C  CZ  . TYR A 1 69  ? 18.892 187.579 -21.222 1.00 216.62 ? 142 TYR A CZ  1 
ATOM   519  O  OH  . TYR A 1 69  ? 18.181 187.195 -22.335 1.00 209.21 ? 142 TYR A OH  1 
ATOM   520  N  N   . HIS A 1 70  ? 19.160 188.064 -15.596 1.00 161.84 ? 143 HIS A N   1 
ATOM   521  C  CA  . HIS A 1 70  ? 17.963 187.379 -15.117 1.00 161.27 ? 143 HIS A CA  1 
ATOM   522  C  C   . HIS A 1 70  ? 17.300 188.102 -13.951 1.00 178.76 ? 143 HIS A C   1 
ATOM   523  O  O   . HIS A 1 70  ? 16.088 187.957 -13.752 1.00 182.64 ? 143 HIS A O   1 
ATOM   524  C  CB  . HIS A 1 70  ? 18.307 185.945 -14.712 1.00 159.02 ? 143 HIS A CB  1 
ATOM   525  C  CG  . HIS A 1 70  ? 18.802 185.105 -15.846 1.00 170.10 ? 143 HIS A CG  1 
ATOM   526  N  ND1 . HIS A 1 70  ? 20.097 185.173 -16.315 1.00 213.82 ? 143 HIS A ND1 1 
ATOM   527  C  CD2 . HIS A 1 70  ? 18.174 184.179 -16.609 1.00 159.38 ? 143 HIS A CD2 1 
ATOM   528  C  CE1 . HIS A 1 70  ? 20.246 184.323 -17.315 1.00 210.22 ? 143 HIS A CE1 1 
ATOM   529  N  NE2 . HIS A 1 70  ? 19.093 183.709 -17.514 1.00 195.71 ? 143 HIS A NE2 1 
ATOM   530  N  N   . ARG A 1 71  ? 18.068 188.873 -13.176 1.00 197.66 ? 144 ARG A N   1 
ATOM   531  C  CA  . ARG A 1 71  ? 17.548 189.608 -12.019 1.00 201.06 ? 144 ARG A CA  1 
ATOM   532  C  C   . ARG A 1 71  ? 16.849 188.676 -11.032 1.00 204.58 ? 144 ARG A C   1 
ATOM   533  O  O   . ARG A 1 71  ? 15.796 189.002 -10.479 1.00 205.89 ? 144 ARG A O   1 
ATOM   534  C  CB  . ARG A 1 71  ? 16.612 190.741 -12.450 1.00 203.27 ? 144 ARG A CB  1 
ATOM   535  C  CG  . ARG A 1 71  ? 17.224 191.721 -13.436 1.00 203.14 ? 144 ARG A CG  1 
ATOM   536  C  CD  . ARG A 1 71  ? 16.508 193.062 -13.386 1.00 205.22 ? 144 ARG A CD  1 
ATOM   537  N  NE  . ARG A 1 71  ? 15.056 192.921 -13.473 1.00 226.71 ? 144 ARG A NE  1 
ATOM   538  C  CZ  . ARG A 1 71  ? 14.357 193.042 -14.597 1.00 254.99 ? 144 ARG A CZ  1 
ATOM   539  N  NH1 . ARG A 1 71  ? 13.039 192.897 -14.577 1.00 252.49 ? 144 ARG A NH1 1 
ATOM   540  N  NH2 . ARG A 1 71  ? 14.974 193.310 -15.739 1.00 267.39 ? 144 ARG A NH2 1 
ATOM   541  N  N   . ASN A 1 72  ? 17.436 187.504 -10.811 1.00 201.27 ? 145 ASN A N   1 
ATOM   542  C  CA  . ASN A 1 72  ? 16.891 186.513 -9.897  1.00 177.42 ? 145 ASN A CA  1 
ATOM   543  C  C   . ASN A 1 72  ? 17.933 186.146 -8.849  1.00 193.82 ? 145 ASN A C   1 
ATOM   544  O  O   . ASN A 1 72  ? 19.132 186.380 -9.025  1.00 175.78 ? 145 ASN A O   1 
ATOM   545  C  CB  . ASN A 1 72  ? 16.436 185.255 -10.649 1.00 149.97 ? 145 ASN A CB  1 
ATOM   546  N  N   . GLY A 1 73  ? 17.462 185.563 -7.753  1.00 206.86 ? 146 GLY A N   1 
ATOM   547  C  CA  . GLY A 1 73  ? 18.340 185.150 -6.681  1.00 173.96 ? 146 GLY A CA  1 
ATOM   548  C  C   . GLY A 1 73  ? 19.180 183.946 -7.065  1.00 177.85 ? 146 GLY A C   1 
ATOM   549  O  O   . GLY A 1 73  ? 19.144 183.440 -8.186  1.00 144.63 ? 146 GLY A O   1 
ATOM   550  N  N   . CYS A 1 74  ? 19.961 183.479 -6.089  1.00 212.49 ? 147 CYS A N   1 
ATOM   551  C  CA  . CYS A 1 74  ? 20.832 182.326 -6.286  1.00 216.79 ? 147 CYS A CA  1 
ATOM   552  C  C   . CYS A 1 74  ? 20.061 181.035 -6.520  1.00 208.95 ? 147 CYS A C   1 
ATOM   553  O  O   . CYS A 1 74  ? 20.657 180.057 -6.984  1.00 208.42 ? 147 CYS A O   1 
ATOM   554  C  CB  . CYS A 1 74  ? 21.755 182.155 -5.078  1.00 207.25 ? 147 CYS A CB  1 
ATOM   555  S  SG  . CYS A 1 74  ? 22.384 183.707 -4.394  1.00 257.53 ? 147 CYS A SG  1 
ATOM   556  N  N   . ILE A 1 75  ? 18.765 181.007 -6.215  1.00 191.39 ? 148 ILE A N   1 
ATOM   557  C  CA  . ILE A 1 75  ? 17.958 179.798 -6.338  1.00 161.48 ? 148 ILE A CA  1 
ATOM   558  C  C   . ILE A 1 75  ? 17.073 179.906 -7.572  1.00 177.34 ? 148 ILE A C   1 
ATOM   559  O  O   . ILE A 1 75  ? 17.175 179.091 -8.497  1.00 173.33 ? 148 ILE A O   1 
ATOM   560  C  CB  . ILE A 1 75  ? 17.114 179.560 -5.073  1.00 134.20 ? 148 ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1 75  ? 17.944 179.841 -3.820  1.00 151.54 ? 148 ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1 75  ? 16.590 178.133 -5.049  1.00 135.68 ? 148 ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1 75  ? 17.139 179.820 -2.536  1.00 140.50 ? 148 ILE A CD1 1 
ATOM   564  N  N   . SER A 1 76  ? 16.190 180.909 -7.586  1.00 199.06 ? 149 SER A N   1 
ATOM   565  C  CA  . SER A 1 76  ? 15.221 181.065 -8.667  1.00 200.88 ? 149 SER A CA  1 
ATOM   566  C  C   . SER A 1 76  ? 15.872 181.223 -10.036 1.00 184.86 ? 149 SER A C   1 
ATOM   567  O  O   . SER A 1 76  ? 15.204 181.002 -11.052 1.00 208.61 ? 149 SER A O   1 
ATOM   568  C  CB  . SER A 1 76  ? 14.315 182.266 -8.382  1.00 187.71 ? 149 SER A CB  1 
ATOM   569  O  OG  . SER A 1 76  ? 15.073 183.453 -8.233  1.00 192.61 ? 149 SER A OG  1 
ATOM   570  N  N   . ILE A 1 77  ? 17.152 181.599 -10.095 1.00 107.68 ? 150 ILE A N   1 
ATOM   571  C  CA  . ILE A 1 77  ? 17.811 181.727 -11.390 1.00 134.92 ? 150 ILE A CA  1 
ATOM   572  C  C   . ILE A 1 77  ? 18.079 180.364 -12.014 1.00 152.59 ? 150 ILE A C   1 
ATOM   573  O  O   . ILE A 1 77  ? 18.201 180.262 -13.240 1.00 154.51 ? 150 ILE A O   1 
ATOM   574  C  CB  . ILE A 1 77  ? 19.117 182.536 -11.267 1.00 144.10 ? 150 ILE A CB  1 
ATOM   575  C  CG1 . ILE A 1 77  ? 19.551 183.060 -12.639 1.00 122.42 ? 150 ILE A CG1 1 
ATOM   576  C  CG2 . ILE A 1 77  ? 20.224 181.690 -10.654 1.00 106.33 ? 150 ILE A CG2 1 
ATOM   577  C  CD1 . ILE A 1 77  ? 20.779 183.937 -12.601 1.00 109.00 ? 150 ILE A CD1 1 
ATOM   578  N  N   . TRP A 1 78  ? 18.166 179.305 -11.205 1.00 182.61 ? 151 TRP A N   1 
ATOM   579  C  CA  . TRP A 1 78  ? 18.376 177.973 -11.758 1.00 177.86 ? 151 TRP A CA  1 
ATOM   580  C  C   . TRP A 1 78  ? 17.092 177.385 -12.325 1.00 178.23 ? 151 TRP A C   1 
ATOM   581  O  O   . TRP A 1 78  ? 17.147 176.590 -13.270 1.00 176.55 ? 151 TRP A O   1 
ATOM   582  C  CB  . TRP A 1 78  ? 18.959 177.043 -10.696 1.00 190.25 ? 151 TRP A CB  1 
ATOM   583  C  CG  . TRP A 1 78  ? 20.377 177.358 -10.356 1.00 178.42 ? 151 TRP A CG  1 
ATOM   584  C  CD1 . TRP A 1 78  ? 20.842 177.900 -9.195  1.00 192.20 ? 151 TRP A CD1 1 
ATOM   585  C  CD2 . TRP A 1 78  ? 21.521 177.164 -11.196 1.00 169.47 ? 151 TRP A CD2 1 
ATOM   586  N  NE1 . TRP A 1 78  ? 22.206 178.049 -9.255  1.00 209.84 ? 151 TRP A NE1 1 
ATOM   587  C  CE2 . TRP A 1 78  ? 22.647 177.605 -10.474 1.00 200.00 ? 151 TRP A CE2 1 
ATOM   588  C  CE3 . TRP A 1 78  ? 21.702 176.658 -12.486 1.00 174.10 ? 151 TRP A CE3 1 
ATOM   589  C  CZ2 . TRP A 1 78  ? 23.935 177.556 -11.000 1.00 211.57 ? 151 TRP A CZ2 1 
ATOM   590  C  CZ3 . TRP A 1 78  ? 22.981 176.609 -13.006 1.00 191.01 ? 151 TRP A CZ3 1 
ATOM   591  C  CH2 . TRP A 1 78  ? 24.082 177.055 -12.264 1.00 210.99 ? 151 TRP A CH2 1 
ATOM   592  N  N   . ARG A 1 79  ? 15.938 177.756 -11.767 1.00 194.59 ? 152 ARG A N   1 
ATOM   593  C  CA  . ARG A 1 79  ? 14.669 177.354 -12.363 1.00 203.94 ? 152 ARG A CA  1 
ATOM   594  C  C   . ARG A 1 79  ? 14.550 177.858 -13.795 1.00 198.90 ? 152 ARG A C   1 
ATOM   595  O  O   . ARG A 1 79  ? 13.888 177.225 -14.625 1.00 214.52 ? 152 ARG A O   1 
ATOM   596  C  CB  . ARG A 1 79  ? 13.506 177.873 -11.516 1.00 208.11 ? 152 ARG A CB  1 
ATOM   597  C  CG  . ARG A 1 79  ? 12.132 177.422 -11.987 1.00 217.00 ? 152 ARG A CG  1 
ATOM   598  C  CD  . ARG A 1 79  ? 11.031 178.240 -11.331 1.00 228.25 ? 152 ARG A CD  1 
ATOM   599  N  NE  . ARG A 1 79  ? 11.107 178.198 -9.874  1.00 225.27 ? 152 ARG A NE  1 
ATOM   600  C  CZ  . ARG A 1 79  ? 10.292 178.865 -9.063  1.00 214.96 ? 152 ARG A CZ  1 
ATOM   601  N  NH1 . ARG A 1 79  ? 9.334  179.631 -9.567  1.00 200.81 ? 152 ARG A NH1 1 
ATOM   602  N  NH2 . ARG A 1 79  ? 10.434 178.768 -7.749  1.00 220.24 ? 152 ARG A NH2 1 
ATOM   603  N  N   . LYS A 1 80  ? 15.194 178.981 -14.104 1.00 176.51 ? 153 LYS A N   1 
ATOM   604  C  CA  . LYS A 1 80  ? 15.168 179.565 -15.437 1.00 167.73 ? 153 LYS A CA  1 
ATOM   605  C  C   . LYS A 1 80  ? 16.339 179.120 -16.305 1.00 166.90 ? 153 LYS A C   1 
ATOM   606  O  O   . LYS A 1 80  ? 16.420 179.536 -17.465 1.00 167.19 ? 153 LYS A O   1 
ATOM   607  C  CB  . LYS A 1 80  ? 15.156 181.095 -15.339 1.00 156.25 ? 153 LYS A CB  1 
ATOM   608  C  CG  . LYS A 1 80  ? 14.180 181.650 -14.311 1.00 195.82 ? 153 LYS A CG  1 
ATOM   609  C  CD  . LYS A 1 80  ? 12.756 181.195 -14.586 1.00 211.86 ? 153 LYS A CD  1 
ATOM   610  C  CE  . LYS A 1 80  ? 11.779 181.836 -13.613 1.00 194.14 ? 153 LYS A CE  1 
ATOM   611  N  NZ  . LYS A 1 80  ? 12.133 181.545 -12.196 1.00 182.03 ? 153 LYS A NZ  1 
ATOM   612  N  N   . ILE A 1 81  ? 17.248 178.301 -15.776 1.00 169.55 ? 154 ILE A N   1 
ATOM   613  C  CA  . ILE A 1 81  ? 18.386 177.814 -16.550 1.00 170.72 ? 154 ILE A CA  1 
ATOM   614  C  C   . ILE A 1 81  ? 18.383 176.291 -16.565 1.00 177.81 ? 154 ILE A C   1 
ATOM   615  O  O   . ILE A 1 81  ? 18.041 175.668 -17.576 1.00 190.03 ? 154 ILE A O   1 
ATOM   616  C  CB  . ILE A 1 81  ? 19.715 178.354 -15.987 1.00 151.11 ? 154 ILE A CB  1 
ATOM   617  C  CG1 . ILE A 1 81  ? 19.745 179.881 -16.052 1.00 144.34 ? 154 ILE A CG1 1 
ATOM   618  C  CG2 . ILE A 1 81  ? 20.896 177.771 -16.749 1.00 142.46 ? 154 ILE A CG2 1 
ATOM   619  C  CD1 . ILE A 1 81  ? 19.652 180.430 -17.456 1.00 146.55 ? 154 ILE A CD1 1 
ATOM   620  N  N   . CYS A 1 82  ? 18.769 175.685 -15.443 1.00 182.76 ? 155 CYS A N   1 
ATOM   621  C  CA  . CYS A 1 82  ? 18.822 174.231 -15.291 1.00 184.73 ? 155 CYS A CA  1 
ATOM   622  C  C   . CYS A 1 82  ? 18.179 173.880 -13.957 1.00 192.60 ? 155 CYS A C   1 
ATOM   623  O  O   . CYS A 1 82  ? 18.855 173.855 -12.919 1.00 210.78 ? 155 CYS A O   1 
ATOM   624  C  CB  . CYS A 1 82  ? 20.255 173.712 -15.374 1.00 188.39 ? 155 CYS A CB  1 
ATOM   625  S  SG  . CYS A 1 82  ? 21.076 174.040 -16.949 1.00 208.14 ? 155 CYS A SG  1 
ATOM   626  N  N   . PRO A 1 83  ? 16.869 173.625 -13.944 1.00 179.54 ? 156 PRO A N   1 
ATOM   627  C  CA  . PRO A 1 83  ? 16.169 173.393 -12.668 1.00 192.18 ? 156 PRO A CA  1 
ATOM   628  C  C   . PRO A 1 83  ? 16.783 172.306 -11.800 1.00 196.40 ? 156 PRO A C   1 
ATOM   629  O  O   . PRO A 1 83  ? 16.722 172.416 -10.569 1.00 238.16 ? 156 PRO A O   1 
ATOM   630  C  CB  . PRO A 1 83  ? 14.746 173.023 -13.115 1.00 188.35 ? 156 PRO A CB  1 
ATOM   631  C  CG  . PRO A 1 83  ? 14.862 172.670 -14.570 1.00 175.73 ? 156 PRO A CG  1 
ATOM   632  C  CD  . PRO A 1 83  ? 15.957 173.535 -15.095 1.00 174.45 ? 156 PRO A CD  1 
ATOM   633  N  N   . ILE A 1 84  ? 17.382 171.268 -12.392 1.00 138.53 ? 157 ILE A N   1 
ATOM   634  C  CA  . ILE A 1 84  ? 17.997 170.211 -11.591 1.00 148.51 ? 157 ILE A CA  1 
ATOM   635  C  C   . ILE A 1 84  ? 19.130 170.759 -10.735 1.00 181.87 ? 157 ILE A C   1 
ATOM   636  O  O   . ILE A 1 84  ? 19.436 170.210 -9.669  1.00 156.35 ? 157 ILE A O   1 
ATOM   637  C  CB  . ILE A 1 84  ? 18.489 169.065 -12.496 1.00 142.01 ? 157 ILE A CB  1 
ATOM   638  C  CG1 . ILE A 1 84  ? 19.157 169.629 -13.753 1.00 156.35 ? 157 ILE A CG1 1 
ATOM   639  C  CG2 . ILE A 1 84  ? 17.343 168.126 -12.838 1.00 155.57 ? 157 ILE A CG2 1 
ATOM   640  C  CD1 . ILE A 1 84  ? 19.781 168.574 -14.639 1.00 187.83 ? 157 ILE A CD1 1 
ATOM   641  N  N   . PHE A 1 85  ? 19.761 171.845 -11.172 1.00 196.23 ? 158 PHE A N   1 
ATOM   642  C  CA  . PHE A 1 85  ? 20.845 172.473 -10.432 1.00 179.54 ? 158 PHE A CA  1 
ATOM   643  C  C   . PHE A 1 85  ? 20.344 173.506 -9.432  1.00 170.30 ? 158 PHE A C   1 
ATOM   644  O  O   . PHE A 1 85  ? 21.157 174.220 -8.834  1.00 182.07 ? 158 PHE A O   1 
ATOM   645  C  CB  . PHE A 1 85  ? 21.844 173.109 -11.401 1.00 154.75 ? 158 PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 85  ? 22.564 172.110 -12.261 1.00 156.80 ? 158 PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 85  ? 22.804 170.826 -11.798 1.00 157.72 ? 158 PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 85  ? 22.991 172.448 -13.533 1.00 175.80 ? 158 PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 85  ? 23.463 169.902 -12.585 1.00 159.47 ? 158 PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 85  ? 23.650 171.527 -14.326 1.00 193.07 ? 158 PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 85  ? 23.886 170.253 -13.851 1.00 195.80 ? 158 PHE A CZ  1 
ATOM   652  N  N   . LYS A 1 86  ? 19.024 173.612 -9.259  1.00 167.27 ? 159 LYS A N   1 
ATOM   653  C  CA  . LYS A 1 86  ? 18.454 174.528 -8.276  1.00 145.93 ? 159 LYS A CA  1 
ATOM   654  C  C   . LYS A 1 86  ? 19.026 174.296 -6.884  1.00 152.15 ? 159 LYS A C   1 
ATOM   655  O  O   . LYS A 1 86  ? 19.168 175.246 -6.105  1.00 205.52 ? 159 LYS A O   1 
ATOM   656  C  CB  . LYS A 1 86  ? 16.933 174.374 -8.259  1.00 147.47 ? 159 LYS A CB  1 
ATOM   657  C  CG  . LYS A 1 86  ? 16.169 175.600 -7.804  1.00 157.71 ? 159 LYS A CG  1 
ATOM   658  C  CD  . LYS A 1 86  ? 14.675 175.361 -7.940  1.00 207.81 ? 159 LYS A CD  1 
ATOM   659  C  CE  . LYS A 1 86  ? 13.879 176.626 -7.698  1.00 202.24 ? 159 LYS A CE  1 
ATOM   660  N  NZ  . LYS A 1 86  ? 12.413 176.388 -7.813  1.00 165.09 ? 159 LYS A NZ  1 
ATOM   661  N  N   . GLY A 1 87  ? 19.371 173.045 -6.559  1.00 156.46 ? 160 GLY A N   1 
ATOM   662  C  CA  . GLY A 1 87  ? 19.962 172.753 -5.263  1.00 166.85 ? 160 GLY A CA  1 
ATOM   663  C  C   . GLY A 1 87  ? 21.224 173.545 -4.987  1.00 135.06 ? 160 GLY A C   1 
ATOM   664  O  O   . GLY A 1 87  ? 21.579 173.767 -3.826  1.00 139.08 ? 160 GLY A O   1 
ATOM   665  N  N   . ILE A 1 88  ? 21.919 173.975 -6.046  1.00 131.59 ? 161 ILE A N   1 
ATOM   666  C  CA  . ILE A 1 88  ? 23.055 174.882 -5.890  1.00 135.41 ? 161 ILE A CA  1 
ATOM   667  C  C   . ILE A 1 88  ? 22.658 176.078 -5.036  1.00 151.85 ? 161 ILE A C   1 
ATOM   668  O  O   . ILE A 1 88  ? 23.299 176.384 -4.023  1.00 133.80 ? 161 ILE A O   1 
ATOM   669  C  CB  . ILE A 1 88  ? 23.575 175.330 -7.268  1.00 150.67 ? 161 ILE A CB  1 
ATOM   670  C  CG1 . ILE A 1 88  ? 24.341 174.198 -7.953  1.00 138.40 ? 161 ILE A CG1 1 
ATOM   671  C  CG2 . ILE A 1 88  ? 24.436 176.578 -7.142  1.00 139.71 ? 161 ILE A CG2 1 
ATOM   672  C  CD1 . ILE A 1 88  ? 24.823 174.560 -9.337  1.00 139.84 ? 161 ILE A CD1 1 
ATOM   673  N  N   . GLY A 1 89  ? 21.573 176.756 -5.426  1.00 151.68 ? 162 GLY A N   1 
ATOM   674  C  CA  . GLY A 1 89  ? 21.096 177.889 -4.652  1.00 130.40 ? 162 GLY A CA  1 
ATOM   675  C  C   . GLY A 1 89  ? 20.811 177.541 -3.206  1.00 130.83 ? 162 GLY A C   1 
ATOM   676  O  O   . GLY A 1 89  ? 20.958 178.388 -2.321  1.00 131.54 ? 162 GLY A O   1 
ATOM   677  N  N   . TYR A 1 90  ? 20.410 176.296 -2.943  1.00 123.19 ? 163 TYR A N   1 
ATOM   678  C  CA  . TYR A 1 90  ? 20.247 175.856 -1.564  1.00 144.98 ? 163 TYR A CA  1 
ATOM   679  C  C   . TYR A 1 90  ? 21.591 175.536 -0.923  1.00 122.82 ? 163 TYR A C   1 
ATOM   680  O  O   . TYR A 1 90  ? 21.837 175.918 0.227   1.00 121.74 ? 163 TYR A O   1 
ATOM   681  C  CB  . TYR A 1 90  ? 19.320 174.641 -1.505  1.00 144.88 ? 163 TYR A CB  1 
ATOM   682  C  CG  . TYR A 1 90  ? 17.863 174.982 -1.714  1.00 145.59 ? 163 TYR A CG  1 
ATOM   683  C  CD1 . TYR A 1 90  ? 17.384 176.257 -1.445  1.00 135.07 ? 163 TYR A CD1 1 
ATOM   684  C  CD2 . TYR A 1 90  ? 16.965 174.030 -2.179  1.00 152.10 ? 163 TYR A CD2 1 
ATOM   685  C  CE1 . TYR A 1 90  ? 16.053 176.575 -1.633  1.00 161.98 ? 163 TYR A CE1 1 
ATOM   686  C  CE2 . TYR A 1 90  ? 15.631 174.339 -2.370  1.00 142.36 ? 163 TYR A CE2 1 
ATOM   687  C  CZ  . TYR A 1 90  ? 15.181 175.613 -2.096  1.00 161.10 ? 163 TYR A CZ  1 
ATOM   688  O  OH  . TYR A 1 90  ? 13.855 175.928 -2.284  1.00 181.91 ? 163 TYR A OH  1 
ATOM   689  N  N   . ALA A 1 91  ? 22.473 174.853 -1.661  1.00 133.66 ? 164 ALA A N   1 
ATOM   690  C  CA  . ALA A 1 91  ? 23.780 174.494 -1.117  1.00 123.80 ? 164 ALA A CA  1 
ATOM   691  C  C   . ALA A 1 91  ? 24.520 175.729 -0.627  1.00 128.21 ? 164 ALA A C   1 
ATOM   692  O  O   . ALA A 1 91  ? 24.987 175.775 0.519   1.00 120.60 ? 164 ALA A O   1 
ATOM   693  C  CB  . ALA A 1 91  ? 24.602 173.752 -2.171  1.00 149.80 ? 164 ALA A CB  1 
ATOM   694  N  N   . ILE A 1 92  ? 24.607 176.754 -1.482  1.00 123.71 ? 165 ILE A N   1 
ATOM   695  C  CA  . ILE A 1 92  ? 25.206 178.028 -1.087  1.00 130.41 ? 165 ILE A CA  1 
ATOM   696  C  C   . ILE A 1 92  ? 24.625 178.494 0.239   1.00 125.12 ? 165 ILE A C   1 
ATOM   697  O  O   . ILE A 1 92  ? 25.360 178.850 1.169   1.00 151.66 ? 165 ILE A O   1 
ATOM   698  C  CB  . ILE A 1 92  ? 25.000 179.081 -2.190  1.00 120.34 ? 165 ILE A CB  1 
ATOM   699  C  CG1 . ILE A 1 92  ? 25.779 178.696 -3.450  1.00 155.93 ? 165 ILE A CG1 1 
ATOM   700  C  CG2 . ILE A 1 92  ? 25.408 180.460 -1.693  1.00 124.38 ? 165 ILE A CG2 1 
ATOM   701  C  CD1 . ILE A 1 92  ? 25.629 179.685 -4.584  1.00 197.41 ? 165 ILE A CD1 1 
ATOM   702  N  N   . CYS A 1 93  ? 23.293 178.463 0.354   1.00 126.90 ? 166 CYS A N   1 
ATOM   703  C  CA  . CYS A 1 93  ? 22.642 178.841 1.603   1.00 138.34 ? 166 CYS A CA  1 
ATOM   704  C  C   . CYS A 1 93  ? 23.242 178.075 2.775   1.00 134.01 ? 166 CYS A C   1 
ATOM   705  O  O   . CYS A 1 93  ? 23.760 178.673 3.727   1.00 102.48 ? 166 CYS A O   1 
ATOM   706  C  CB  . CYS A 1 93  ? 21.135 178.592 1.509   1.00 110.48 ? 166 CYS A CB  1 
ATOM   707  S  SG  . CYS A 1 93  ? 20.249 179.738 0.433   1.00 171.55 ? 166 CYS A SG  1 
ATOM   708  N  N   . ILE A 1 94  ? 23.227 176.742 2.691   1.00 109.76 ? 167 ILE A N   1 
ATOM   709  C  CA  . ILE A 1 94  ? 23.836 175.931 3.741   1.00 136.87 ? 167 ILE A CA  1 
ATOM   710  C  C   . ILE A 1 94  ? 25.298 176.316 3.907   1.00 142.64 ? 167 ILE A C   1 
ATOM   711  O  O   . ILE A 1 94  ? 25.786 176.521 5.026   1.00 108.13 ? 167 ILE A O   1 
ATOM   712  C  CB  . ILE A 1 94  ? 23.675 174.433 3.428   1.00 148.84 ? 167 ILE A CB  1 
ATOM   713  C  CG1 . ILE A 1 94  ? 22.196 174.083 3.253   1.00 110.46 ? 167 ILE A CG1 1 
ATOM   714  C  CG2 . ILE A 1 94  ? 24.303 173.588 4.527   1.00 103.17 ? 167 ILE A CG2 1 
ATOM   715  C  CD1 . ILE A 1 94  ? 21.946 172.625 2.937   1.00 169.20 ? 167 ILE A CD1 1 
ATOM   716  N  N   . ILE A 1 95  ? 26.004 176.464 2.782   1.00 143.04 ? 168 ILE A N   1 
ATOM   717  C  CA  . ILE A 1 95  ? 27.396 176.904 2.820   1.00 145.21 ? 168 ILE A CA  1 
ATOM   718  C  C   . ILE A 1 95  ? 27.506 178.218 3.579   1.00 122.51 ? 168 ILE A C   1 
ATOM   719  O  O   . ILE A 1 95  ? 28.342 178.371 4.479   1.00 113.26 ? 168 ILE A O   1 
ATOM   720  C  CB  . ILE A 1 95  ? 27.957 177.022 1.392   1.00 135.43 ? 168 ILE A CB  1 
ATOM   721  C  CG1 . ILE A 1 95  ? 28.413 175.653 0.901   1.00 103.46 ? 168 ILE A CG1 1 
ATOM   722  C  CG2 . ILE A 1 95  ? 29.119 177.984 1.351   1.00 104.58 ? 168 ILE A CG2 1 
ATOM   723  C  CD1 . ILE A 1 95  ? 29.483 175.063 1.774   1.00 112.63 ? 168 ILE A CD1 1 
ATOM   724  N  N   . ALA A 1 96  ? 26.628 179.172 3.253   1.00 118.13 ? 169 ALA A N   1 
ATOM   725  C  CA  . ALA A 1 96  ? 26.635 180.448 3.956   1.00 111.81 ? 169 ALA A CA  1 
ATOM   726  C  C   . ALA A 1 96  ? 26.468 180.244 5.454   1.00 110.87 ? 169 ALA A C   1 
ATOM   727  O  O   . ALA A 1 96  ? 27.182 180.861 6.255   1.00 111.07 ? 169 ALA A O   1 
ATOM   728  C  CB  . ALA A 1 96  ? 25.535 181.357 3.409   1.00 114.52 ? 169 ALA A CB  1 
ATOM   729  N  N   . PHE A 1 97  ? 25.556 179.348 5.849   1.00 127.22 ? 170 PHE A N   1 
ATOM   730  C  CA  . PHE A 1 97  ? 25.330 179.106 7.270   1.00 146.43 ? 170 PHE A CA  1 
ATOM   731  C  C   . PHE A 1 97  ? 26.603 178.649 7.965   1.00 144.16 ? 170 PHE A C   1 
ATOM   732  O  O   . PHE A 1 97  ? 26.810 178.955 9.145   1.00 137.13 ? 170 PHE A O   1 
ATOM   733  C  CB  . PHE A 1 97  ? 24.221 178.074 7.467   1.00 163.72 ? 170 PHE A CB  1 
ATOM   734  C  CG  . PHE A 1 97  ? 24.144 177.538 8.867   1.00 147.84 ? 170 PHE A CG  1 
ATOM   735  C  CD1 . PHE A 1 97  ? 23.696 178.337 9.905   1.00 148.53 ? 170 PHE A CD1 1 
ATOM   736  C  CD2 . PHE A 1 97  ? 24.528 176.236 9.146   1.00 124.27 ? 170 PHE A CD2 1 
ATOM   737  C  CE1 . PHE A 1 97  ? 23.628 177.849 11.196  1.00 119.57 ? 170 PHE A CE1 1 
ATOM   738  C  CE2 . PHE A 1 97  ? 24.462 175.742 10.435  1.00 116.19 ? 170 PHE A CE2 1 
ATOM   739  C  CZ  . PHE A 1 97  ? 24.011 176.549 11.461  1.00 118.42 ? 170 PHE A CZ  1 
ATOM   740  N  N   . TYR A 1 98  ? 27.468 177.925 7.255   1.00 151.26 ? 171 TYR A N   1 
ATOM   741  C  CA  . TYR A 1 98  ? 28.745 177.550 7.845   1.00 124.29 ? 171 TYR A CA  1 
ATOM   742  C  C   . TYR A 1 98  ? 29.698 178.738 7.883   1.00 124.99 ? 171 TYR A C   1 
ATOM   743  O  O   . TYR A 1 98  ? 30.356 178.978 8.903   1.00 125.76 ? 171 TYR A O   1 
ATOM   744  C  CB  . TYR A 1 98  ? 29.356 176.381 7.072   1.00 143.13 ? 171 TYR A CB  1 
ATOM   745  C  CG  . TYR A 1 98  ? 28.530 175.114 7.133   1.00 148.31 ? 171 TYR A CG  1 
ATOM   746  C  CD1 . TYR A 1 98  ? 27.732 174.834 8.235   1.00 120.87 ? 171 TYR A CD1 1 
ATOM   747  C  CD2 . TYR A 1 98  ? 28.546 174.200 6.087   1.00 188.18 ? 171 TYR A CD2 1 
ATOM   748  C  CE1 . TYR A 1 98  ? 26.975 173.679 8.296   1.00 121.03 ? 171 TYR A CE1 1 
ATOM   749  C  CE2 . TYR A 1 98  ? 27.791 173.041 6.139   1.00 201.13 ? 171 TYR A CE2 1 
ATOM   750  C  CZ  . TYR A 1 98  ? 27.008 172.786 7.245   1.00 163.66 ? 171 TYR A CZ  1 
ATOM   751  O  OH  . TYR A 1 98  ? 26.256 171.635 7.301   1.00 153.46 ? 171 TYR A OH  1 
ATOM   752  N  N   . ILE A 1 99  ? 29.754 179.511 6.794   1.00 115.06 ? 172 ILE A N   1 
ATOM   753  C  CA  . ILE A 1 99  ? 30.711 180.611 6.713   1.00 115.88 ? 172 ILE A CA  1 
ATOM   754  C  C   . ILE A 1 99  ? 30.407 181.662 7.770   1.00 130.75 ? 172 ILE A C   1 
ATOM   755  O  O   . ILE A 1 99  ? 31.317 182.208 8.407   1.00 119.27 ? 172 ILE A O   1 
ATOM   756  C  CB  . ILE A 1 99  ? 30.709 181.217 5.299   1.00 144.58 ? 172 ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 99  ? 31.088 180.158 4.266   1.00 138.61 ? 172 ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 99  ? 31.657 182.401 5.232   1.00 104.28 ? 172 ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 99  ? 30.963 180.640 2.847   1.00 171.07 ? 172 ILE A CD1 1 
ATOM   760  N  N   . ALA A 1 100 ? 29.124 181.954 7.983   1.00 155.59 ? 173 ALA A N   1 
ATOM   761  C  CA  . ALA A 1 100 ? 28.729 182.919 8.997   1.00 156.37 ? 173 ALA A CA  1 
ATOM   762  C  C   . ALA A 1 100 ? 29.020 182.441 10.413  1.00 151.69 ? 173 ALA A C   1 
ATOM   763  O  O   . ALA A 1 100 ? 28.928 183.245 11.348  1.00 151.73 ? 173 ALA A O   1 
ATOM   764  C  CB  . ALA A 1 100 ? 27.241 183.245 8.854   1.00 134.30 ? 173 ALA A CB  1 
ATOM   765  N  N   . SER A 1 101 ? 29.374 181.166 10.599  1.00 134.68 ? 174 SER A N   1 
ATOM   766  C  CA  . SER A 1 101 ? 29.636 180.669 11.944  1.00 134.75 ? 174 SER A CA  1 
ATOM   767  C  C   . SER A 1 101 ? 30.974 181.155 12.489  1.00 169.43 ? 174 SER A C   1 
ATOM   768  O  O   . SER A 1 101 ? 31.135 181.270 13.708  1.00 193.37 ? 174 SER A O   1 
ATOM   769  C  CB  . SER A 1 101 ? 29.585 179.141 11.963  1.00 134.57 ? 174 SER A CB  1 
ATOM   770  O  OG  . SER A 1 101 ? 28.289 178.670 11.639  1.00 138.57 ? 174 SER A OG  1 
ATOM   771  N  N   . TYR A 1 102 ? 31.937 181.447 11.616  1.00 141.37 ? 175 TYR A N   1 
ATOM   772  C  CA  . TYR A 1 102 ? 33.257 181.913 12.024  1.00 138.03 ? 175 TYR A CA  1 
ATOM   773  C  C   . TYR A 1 102 ? 33.525 183.356 11.618  1.00 159.74 ? 175 TYR A C   1 
ATOM   774  O  O   . TYR A 1 102 ? 33.880 184.175 12.471  1.00 191.00 ? 175 TYR A O   1 
ATOM   775  C  CB  . TYR A 1 102 ? 34.369 180.980 11.503  1.00 150.36 ? 175 TYR A CB  1 
ATOM   776  C  CG  . TYR A 1 102 ? 34.490 180.809 10.005  1.00 150.93 ? 175 TYR A CG  1 
ATOM   777  C  CD1 . TYR A 1 102 ? 33.756 179.840 9.335   1.00 138.88 ? 175 TYR A CD1 1 
ATOM   778  C  CD2 . TYR A 1 102 ? 35.381 181.581 9.268   1.00 134.99 ? 175 TYR A CD2 1 
ATOM   779  C  CE1 . TYR A 1 102 ? 33.881 179.668 7.969   1.00 155.65 ? 175 TYR A CE1 1 
ATOM   780  C  CE2 . TYR A 1 102 ? 35.511 181.417 7.903   1.00 134.10 ? 175 TYR A CE2 1 
ATOM   781  C  CZ  . TYR A 1 102 ? 34.760 180.459 7.258   1.00 133.94 ? 175 TYR A CZ  1 
ATOM   782  O  OH  . TYR A 1 102 ? 34.888 180.293 5.899   1.00 164.56 ? 175 TYR A OH  1 
ATOM   783  N  N   . TYR A 1 103 ? 33.379 183.680 10.328  1.00 146.22 ? 176 TYR A N   1 
ATOM   784  C  CA  . TYR A 1 103 ? 33.830 184.958 9.777   1.00 144.21 ? 176 TYR A CA  1 
ATOM   785  C  C   . TYR A 1 103 ? 33.389 186.163 10.605  1.00 157.29 ? 176 TYR A C   1 
ATOM   786  O  O   . TYR A 1 103 ? 34.071 187.195 10.604  1.00 157.95 ? 176 TYR A O   1 
ATOM   787  C  CB  . TYR A 1 103 ? 33.313 185.092 8.340   1.00 122.84 ? 176 TYR A CB  1 
ATOM   788  C  CG  . TYR A 1 103 ? 33.806 186.311 7.592   1.00 125.73 ? 176 TYR A CG  1 
ATOM   789  C  CD1 . TYR A 1 103 ? 33.110 187.513 7.644   1.00 142.73 ? 176 TYR A CD1 1 
ATOM   790  C  CD2 . TYR A 1 103 ? 34.956 186.254 6.817   1.00 142.24 ? 176 TYR A CD2 1 
ATOM   791  C  CE1 . TYR A 1 103 ? 33.555 188.626 6.958   1.00 181.99 ? 176 TYR A CE1 1 
ATOM   792  C  CE2 . TYR A 1 103 ? 35.408 187.362 6.125   1.00 146.66 ? 176 TYR A CE2 1 
ATOM   793  C  CZ  . TYR A 1 103 ? 34.704 188.545 6.199   1.00 167.30 ? 176 TYR A CZ  1 
ATOM   794  O  OH  . TYR A 1 103 ? 35.150 189.650 5.513   1.00 165.68 ? 176 TYR A OH  1 
ATOM   795  N  N   . ASN A 1 104 ? 32.264 186.062 11.317  1.00 164.15 ? 177 ASN A N   1 
ATOM   796  C  CA  . ASN A 1 104 ? 31.844 187.162 12.179  1.00 166.85 ? 177 ASN A CA  1 
ATOM   797  C  C   . ASN A 1 104 ? 32.609 187.189 13.499  1.00 169.36 ? 177 ASN A C   1 
ATOM   798  O  O   . ASN A 1 104 ? 32.849 188.271 14.052  1.00 152.85 ? 177 ASN A O   1 
ATOM   799  C  CB  . ASN A 1 104 ? 30.339 187.080 12.444  1.00 154.06 ? 177 ASN A CB  1 
ATOM   800  C  CG  . ASN A 1 104 ? 29.513 187.432 11.221  1.00 164.24 ? 177 ASN A CG  1 
ATOM   801  O  OD1 . ASN A 1 104 ? 29.197 188.599 10.986  1.00 197.61 ? 177 ASN A OD1 1 
ATOM   802  N  ND2 . ASN A 1 104 ? 29.155 186.422 10.437  1.00 167.34 ? 177 ASN A ND2 1 
ATOM   803  N  N   . THR A 1 105 ? 33.000 186.020 14.017  1.00 181.82 ? 178 THR A N   1 
ATOM   804  C  CA  . THR A 1 105 ? 33.709 185.973 15.292  1.00 177.06 ? 178 THR A CA  1 
ATOM   805  C  C   . THR A 1 105 ? 35.071 186.649 15.208  1.00 148.41 ? 178 THR A C   1 
ATOM   806  O  O   . THR A 1 105 ? 35.587 187.131 16.223  1.00 150.21 ? 178 THR A O   1 
ATOM   807  C  CB  . THR A 1 105 ? 33.872 184.525 15.753  1.00 172.16 ? 178 THR A CB  1 
ATOM   808  O  OG1 . THR A 1 105 ? 34.656 183.804 14.795  1.00 175.99 ? 178 THR A OG1 1 
ATOM   809  C  CG2 . THR A 1 105 ? 32.517 183.859 15.892  1.00 149.17 ? 178 THR A CG2 1 
ATOM   810  N  N   . ILE A 1 106 ? 35.673 186.683 14.018  1.00 111.41 ? 179 ILE A N   1 
ATOM   811  C  CA  . ILE A 1 106 ? 36.925 187.414 13.839  1.00 120.16 ? 179 ILE A CA  1 
ATOM   812  C  C   . ILE A 1 106 ? 36.702 188.899 14.092  1.00 146.78 ? 179 ILE A C   1 
ATOM   813  O  O   . ILE A 1 106 ? 37.450 189.546 14.839  1.00 185.06 ? 179 ILE A O   1 
ATOM   814  C  CB  . ILE A 1 106 ? 37.495 187.158 12.433  1.00 110.25 ? 179 ILE A CB  1 
ATOM   815  C  CG1 . ILE A 1 106 ? 37.548 185.655 12.153  1.00 115.08 ? 179 ILE A CG1 1 
ATOM   816  C  CG2 . ILE A 1 106 ? 38.874 187.784 12.298  1.00 118.24 ? 179 ILE A CG2 1 
ATOM   817  C  CD1 . ILE A 1 106 ? 37.944 185.310 10.736  1.00 141.13 ? 179 ILE A CD1 1 
ATOM   818  N  N   . MET A 1 107 ? 35.659 189.460 13.476  1.00 144.21 ? 180 MET A N   1 
ATOM   819  C  CA  . MET A 1 107 ? 35.282 190.836 13.771  1.00 152.51 ? 180 MET A CA  1 
ATOM   820  C  C   . MET A 1 107 ? 34.914 191.008 15.237  1.00 149.41 ? 180 MET A C   1 
ATOM   821  O  O   . MET A 1 107 ? 35.065 192.104 15.786  1.00 172.13 ? 180 MET A O   1 
ATOM   822  C  CB  . MET A 1 107 ? 34.118 191.268 12.882  1.00 175.90 ? 180 MET A CB  1 
ATOM   823  C  CG  . MET A 1 107 ? 34.445 191.339 11.408  1.00 156.52 ? 180 MET A CG  1 
ATOM   824  S  SD  . MET A 1 107 ? 33.017 191.909 10.475  1.00 198.07 ? 180 MET A SD  1 
ATOM   825  C  CE  . MET A 1 107 ? 31.851 190.592 10.804  1.00 152.45 ? 180 MET A CE  1 
ATOM   826  N  N   . ALA A 1 108 ? 34.410 189.951 15.881  1.00 118.12 ? 181 ALA A N   1 
ATOM   827  C  CA  . ALA A 1 108 ? 34.152 190.028 17.315  1.00 120.15 ? 181 ALA A CA  1 
ATOM   828  C  C   . ALA A 1 108 ? 35.451 190.182 18.096  1.00 117.76 ? 181 ALA A C   1 
ATOM   829  O  O   . ALA A 1 108 ? 35.511 190.940 19.072  1.00 155.93 ? 181 ALA A O   1 
ATOM   830  C  CB  . ALA A 1 108 ? 33.381 188.794 17.783  1.00 117.34 ? 181 ALA A CB  1 
ATOM   831  N  N   . TRP A 1 109 ? 36.503 189.474 17.677  1.00 136.25 ? 182 TRP A N   1 
ATOM   832  C  CA  . TRP A 1 109 ? 37.816 189.662 18.287  1.00 143.79 ? 182 TRP A CA  1 
ATOM   833  C  C   . TRP A 1 109 ? 38.313 191.085 18.073  1.00 157.70 ? 182 TRP A C   1 
ATOM   834  O  O   . TRP A 1 109 ? 38.793 191.737 19.008  1.00 144.27 ? 182 TRP A O   1 
ATOM   835  C  CB  . TRP A 1 109 ? 38.814 188.657 17.711  1.00 144.23 ? 182 TRP A CB  1 
ATOM   836  C  CG  . TRP A 1 109 ? 38.439 187.222 17.920  1.00 149.13 ? 182 TRP A CG  1 
ATOM   837  C  CD1 . TRP A 1 109 ? 37.540 186.729 18.821  1.00 148.83 ? 182 TRP A CD1 1 
ATOM   838  C  CD2 . TRP A 1 109 ? 38.952 186.092 17.205  1.00 127.99 ? 182 TRP A CD2 1 
ATOM   839  N  NE1 . TRP A 1 109 ? 37.465 185.361 18.714  1.00 136.30 ? 182 TRP A NE1 1 
ATOM   840  C  CE2 . TRP A 1 109 ? 38.322 184.945 17.728  1.00 130.57 ? 182 TRP A CE2 1 
ATOM   841  C  CE3 . TRP A 1 109 ? 39.885 185.938 16.174  1.00 109.34 ? 182 TRP A CE3 1 
ATOM   842  C  CZ2 . TRP A 1 109 ? 38.594 183.663 17.256  1.00 110.15 ? 182 TRP A CZ2 1 
ATOM   843  C  CZ3 . TRP A 1 109 ? 40.153 184.665 15.707  1.00 106.68 ? 182 TRP A CZ3 1 
ATOM   844  C  CH2 . TRP A 1 109 ? 39.511 183.544 16.248  1.00 127.92 ? 182 TRP A CH2 1 
ATOM   845  N  N   . ALA A 1 110 ? 38.204 191.585 16.837  1.00 161.20 ? 183 ALA A N   1 
ATOM   846  C  CA  . ALA A 1 110 ? 38.645 192.947 16.554  1.00 154.11 ? 183 ALA A CA  1 
ATOM   847  C  C   . ALA A 1 110 ? 37.848 193.974 17.349  1.00 161.09 ? 183 ALA A C   1 
ATOM   848  O  O   . ALA A 1 110 ? 38.379 195.032 17.705  1.00 179.14 ? 183 ALA A O   1 
ATOM   849  C  CB  . ALA A 1 110 ? 38.539 193.232 15.056  1.00 151.65 ? 183 ALA A CB  1 
ATOM   850  N  N   . LEU A 1 111 ? 36.580 193.678 17.643  1.00 145.61 ? 184 LEU A N   1 
ATOM   851  C  CA  . LEU A 1 111 ? 35.752 194.580 18.434  1.00 178.77 ? 184 LEU A CA  1 
ATOM   852  C  C   . LEU A 1 111 ? 36.141 194.544 19.906  1.00 174.66 ? 184 LEU A C   1 
ATOM   853  O  O   . LEU A 1 111 ? 36.191 195.591 20.563  1.00 146.01 ? 184 LEU A O   1 
ATOM   854  C  CB  . LEU A 1 111 ? 34.274 194.221 18.263  1.00 166.56 ? 184 LEU A CB  1 
ATOM   855  C  CG  . LEU A 1 111 ? 33.268 195.033 19.083  1.00 167.31 ? 184 LEU A CG  1 
ATOM   856  C  CD1 . LEU A 1 111 ? 33.388 196.515 18.769  1.00 148.45 ? 184 LEU A CD1 1 
ATOM   857  C  CD2 . LEU A 1 111 ? 31.851 194.542 18.832  1.00 147.81 ? 184 LEU A CD2 1 
ATOM   858  N  N   . TYR A 1 112 ? 36.413 193.351 20.443  1.00 159.38 ? 185 TYR A N   1 
ATOM   859  C  CA  . TYR A 1 112 ? 36.908 193.266 21.812  1.00 142.31 ? 185 TYR A CA  1 
ATOM   860  C  C   . TYR A 1 112 ? 38.258 193.954 21.950  1.00 150.76 ? 185 TYR A C   1 
ATOM   861  O  O   . TYR A 1 112 ? 38.576 194.494 23.016  1.00 156.90 ? 185 TYR A O   1 
ATOM   862  C  CB  . TYR A 1 112 ? 37.002 191.805 22.253  1.00 133.48 ? 185 TYR A CB  1 
ATOM   863  C  CG  . TYR A 1 112 ? 37.208 191.626 23.741  1.00 130.16 ? 185 TYR A CG  1 
ATOM   864  C  CD1 . TYR A 1 112 ? 36.126 191.562 24.608  1.00 152.26 ? 185 TYR A CD1 1 
ATOM   865  C  CD2 . TYR A 1 112 ? 38.484 191.520 24.279  1.00 130.19 ? 185 TYR A CD2 1 
ATOM   866  C  CE1 . TYR A 1 112 ? 36.308 191.399 25.969  1.00 188.65 ? 185 TYR A CE1 1 
ATOM   867  C  CE2 . TYR A 1 112 ? 38.677 191.356 25.639  1.00 133.87 ? 185 TYR A CE2 1 
ATOM   868  C  CZ  . TYR A 1 112 ? 37.586 191.295 26.479  1.00 165.86 ? 185 TYR A CZ  1 
ATOM   869  O  OH  . TYR A 1 112 ? 37.772 191.132 27.832  1.00 167.68 ? 185 TYR A OH  1 
ATOM   870  N  N   . TYR A 1 113 ? 39.060 193.951 20.883  1.00 158.70 ? 186 TYR A N   1 
ATOM   871  C  CA  . TYR A 1 113 ? 40.305 194.710 20.889  1.00 187.88 ? 186 TYR A CA  1 
ATOM   872  C  C   . TYR A 1 113 ? 40.039 196.208 20.809  1.00 180.19 ? 186 TYR A C   1 
ATOM   873  O  O   . TYR A 1 113 ? 40.756 197.007 21.423  1.00 160.80 ? 186 TYR A O   1 
ATOM   874  C  CB  . TYR A 1 113 ? 41.198 194.264 19.732  1.00 176.32 ? 186 TYR A CB  1 
ATOM   875  C  CG  . TYR A 1 113 ? 42.214 193.211 20.105  1.00 152.97 ? 186 TYR A CG  1 
ATOM   876  C  CD1 . TYR A 1 113 ? 41.887 191.862 20.090  1.00 157.13 ? 186 TYR A CD1 1 
ATOM   877  C  CD2 . TYR A 1 113 ? 43.505 193.568 20.470  1.00 158.28 ? 186 TYR A CD2 1 
ATOM   878  C  CE1 . TYR A 1 113 ? 42.818 190.898 20.430  1.00 174.25 ? 186 TYR A CE1 1 
ATOM   879  C  CE2 . TYR A 1 113 ? 44.442 192.614 20.809  1.00 199.10 ? 186 TYR A CE2 1 
ATOM   880  C  CZ  . TYR A 1 113 ? 44.094 191.281 20.789  1.00 185.67 ? 186 TYR A CZ  1 
ATOM   881  O  OH  . TYR A 1 113 ? 45.028 190.330 21.129  1.00 161.66 ? 186 TYR A OH  1 
ATOM   882  N  N   . LEU A 1 114 ? 39.011 196.608 20.054  1.00 148.37 ? 187 LEU A N   1 
ATOM   883  C  CA  . LEU A 1 114 ? 38.711 198.028 19.901  1.00 161.47 ? 187 LEU A CA  1 
ATOM   884  C  C   . LEU A 1 114 ? 38.208 198.634 21.205  1.00 169.30 ? 187 LEU A C   1 
ATOM   885  O  O   . LEU A 1 114 ? 38.635 199.728 21.592  1.00 192.80 ? 187 LEU A O   1 
ATOM   886  C  CB  . LEU A 1 114 ? 37.687 198.230 18.784  1.00 168.66 ? 187 LEU A CB  1 
ATOM   887  C  CG  . LEU A 1 114 ? 37.246 199.670 18.515  1.00 158.70 ? 187 LEU A CG  1 
ATOM   888  C  CD1 . LEU A 1 114 ? 38.425 200.521 18.067  1.00 150.61 ? 187 LEU A CD1 1 
ATOM   889  C  CD2 . LEU A 1 114 ? 36.129 199.708 17.483  1.00 142.54 ? 187 LEU A CD2 1 
ATOM   890  N  N   . ILE A 1 115 ? 37.299 197.941 21.896  1.00 144.50 ? 188 ILE A N   1 
ATOM   891  C  CA  . ILE A 1 115 ? 36.779 198.459 23.156  1.00 161.48 ? 188 ILE A CA  1 
ATOM   892  C  C   . ILE A 1 115 ? 37.832 198.419 24.254  1.00 166.94 ? 188 ILE A C   1 
ATOM   893  O  O   . ILE A 1 115 ? 37.719 199.154 25.242  1.00 181.26 ? 188 ILE A O   1 
ATOM   894  C  CB  . ILE A 1 115 ? 35.517 197.685 23.583  1.00 154.59 ? 188 ILE A CB  1 
ATOM   895  C  CG1 . ILE A 1 115 ? 35.855 196.222 23.878  1.00 170.07 ? 188 ILE A CG1 1 
ATOM   896  C  CG2 . ILE A 1 115 ? 34.447 197.777 22.506  1.00 150.44 ? 188 ILE A CG2 1 
ATOM   897  C  CD1 . ILE A 1 115 ? 34.666 195.404 24.333  1.00 148.13 ? 188 ILE A CD1 1 
ATOM   898  N  N   . SER A 1 116 ? 38.854 197.580 24.111  1.00 154.80 ? 189 SER A N   1 
ATOM   899  C  CA  . SER A 1 116 ? 39.965 197.536 25.050  1.00 181.44 ? 189 SER A CA  1 
ATOM   900  C  C   . SER A 1 116 ? 41.064 198.530 24.703  1.00 181.68 ? 189 SER A C   1 
ATOM   901  O  O   . SER A 1 116 ? 42.037 198.646 25.457  1.00 178.89 ? 189 SER A O   1 
ATOM   902  C  CB  . SER A 1 116 ? 40.550 196.121 25.111  1.00 172.74 ? 189 SER A CB  1 
ATOM   903  O  OG  . SER A 1 116 ? 39.565 195.178 25.494  1.00 154.22 ? 189 SER A OG  1 
ATOM   904  N  N   . SER A 1 117 ? 40.932 199.245 23.589  1.00 186.94 ? 190 SER A N   1 
ATOM   905  C  CA  . SER A 1 117 ? 41.935 200.200 23.142  1.00 204.96 ? 190 SER A CA  1 
ATOM   906  C  C   . SER A 1 117 ? 41.666 201.619 23.625  1.00 208.61 ? 190 SER A C   1 
ATOM   907  O  O   . SER A 1 117 ? 42.424 202.529 23.276  1.00 227.76 ? 190 SER A O   1 
ATOM   908  C  CB  . SER A 1 117 ? 42.024 200.186 21.611  1.00 190.05 ? 190 SER A CB  1 
ATOM   909  O  OG  . SER A 1 117 ? 43.015 201.085 21.147  1.00 217.79 ? 190 SER A OG  1 
ATOM   910  N  N   . PHE A 1 118 ? 40.615 201.832 24.415  1.00 194.08 ? 191 PHE A N   1 
ATOM   911  C  CA  . PHE A 1 118 ? 40.283 203.167 24.898  1.00 202.76 ? 191 PHE A CA  1 
ATOM   912  C  C   . PHE A 1 118 ? 41.053 203.556 26.154  1.00 190.58 ? 191 PHE A C   1 
ATOM   913  O  O   . PHE A 1 118 ? 40.903 204.689 26.625  1.00 225.28 ? 191 PHE A O   1 
ATOM   914  C  CB  . PHE A 1 118 ? 38.778 203.273 25.162  1.00 209.40 ? 191 PHE A CB  1 
ATOM   915  C  CG  . PHE A 1 118 ? 37.936 203.169 23.921  1.00 199.81 ? 191 PHE A CG  1 
ATOM   916  C  CD1 . PHE A 1 118 ? 38.476 203.438 22.675  1.00 192.36 ? 191 PHE A CD1 1 
ATOM   917  C  CD2 . PHE A 1 118 ? 36.602 202.803 24.002  1.00 187.88 ? 191 PHE A CD2 1 
ATOM   918  C  CE1 . PHE A 1 118 ? 37.705 203.342 21.532  1.00 182.01 ? 191 PHE A CE1 1 
ATOM   919  C  CE2 . PHE A 1 118 ? 35.825 202.705 22.863  1.00 187.87 ? 191 PHE A CE2 1 
ATOM   920  C  CZ  . PHE A 1 118 ? 36.377 202.975 21.627  1.00 182.71 ? 191 PHE A CZ  1 
ATOM   921  N  N   . THR A 1 119 ? 41.862 202.657 26.705  1.00 178.05 ? 192 THR A N   1 
ATOM   922  C  CA  . THR A 1 119 ? 42.666 202.974 27.875  1.00 190.38 ? 192 THR A CA  1 
ATOM   923  C  C   . THR A 1 119 ? 43.921 203.736 27.464  1.00 186.06 ? 192 THR A C   1 
ATOM   924  O  O   . THR A 1 119 ? 44.466 203.534 26.374  1.00 186.63 ? 192 THR A O   1 
ATOM   925  C  CB  . THR A 1 119 ? 43.047 201.694 28.624  1.00 208.57 ? 192 THR A CB  1 
ATOM   926  O  OG1 . THR A 1 119 ? 41.896 200.849 28.742  1.00 230.51 ? 192 THR A OG1 1 
ATOM   927  C  CG2 . THR A 1 119 ? 43.568 202.018 30.018  1.00 213.77 ? 192 THR A CG2 1 
ATOM   928  N  N   . ASP A 1 120 ? 44.372 204.633 28.347  1.00 215.42 ? 193 ASP A N   1 
ATOM   929  C  CA  . ASP A 1 120 ? 45.596 205.381 28.078  1.00 222.37 ? 193 ASP A CA  1 
ATOM   930  C  C   . ASP A 1 120 ? 46.799 204.456 27.951  1.00 224.81 ? 193 ASP A C   1 
ATOM   931  O  O   . ASP A 1 120 ? 47.709 204.725 27.159  1.00 233.87 ? 193 ASP A O   1 
ATOM   932  C  CB  . ASP A 1 120 ? 45.834 206.418 29.177  1.00 237.92 ? 193 ASP A CB  1 
ATOM   933  C  CG  . ASP A 1 120 ? 46.047 205.788 30.539  1.00 242.40 ? 193 ASP A CG  1 
ATOM   934  O  OD1 . ASP A 1 120 ? 45.451 204.723 30.803  1.00 261.73 ? 193 ASP A OD1 1 
ATOM   935  O  OD2 . ASP A 1 120 ? 46.813 206.357 31.346  1.00 229.46 ? 193 ASP A OD2 1 
ATOM   936  N  N   . GLN A 1 121 ? 46.822 203.369 28.717  1.00 215.96 ? 194 GLN A N   1 
ATOM   937  C  CA  . GLN A 1 121 ? 47.855 202.347 28.617  1.00 193.48 ? 194 GLN A CA  1 
ATOM   938  C  C   . GLN A 1 121 ? 47.223 201.078 28.062  1.00 184.22 ? 194 GLN A C   1 
ATOM   939  O  O   . GLN A 1 121 ? 46.304 200.521 28.672  1.00 183.61 ? 194 GLN A O   1 
ATOM   940  C  CB  . GLN A 1 121 ? 48.506 202.085 29.975  1.00 213.59 ? 194 GLN A CB  1 
ATOM   941  C  CG  . GLN A 1 121 ? 49.310 203.259 30.512  1.00 231.37 ? 194 GLN A CG  1 
ATOM   942  C  CD  . GLN A 1 121 ? 50.519 203.583 29.654  1.00 237.97 ? 194 GLN A CD  1 
ATOM   943  O  OE1 . GLN A 1 121 ? 51.041 202.724 28.943  1.00 233.72 ? 194 GLN A OE1 1 
ATOM   944  N  NE2 . GLN A 1 121 ? 50.971 204.830 29.717  1.00 240.70 ? 194 GLN A NE2 1 
ATOM   945  N  N   . LEU A 1 122 ? 47.714 200.630 26.912  1.00 216.96 ? 195 LEU A N   1 
ATOM   946  C  CA  . LEU A 1 122 ? 47.108 199.493 26.238  1.00 210.67 ? 195 LEU A CA  1 
ATOM   947  C  C   . LEU A 1 122 ? 47.402 198.206 27.007  1.00 200.82 ? 195 LEU A C   1 
ATOM   948  O  O   . LEU A 1 122 ? 48.483 198.058 27.586  1.00 234.73 ? 195 LEU A O   1 
ATOM   949  C  CB  . LEU A 1 122 ? 47.620 199.385 24.800  1.00 194.07 ? 195 LEU A CB  1 
ATOM   950  C  CG  . LEU A 1 122 ? 47.392 200.619 23.917  1.00 194.43 ? 195 LEU A CG  1 
ATOM   951  C  CD1 . LEU A 1 122 ? 48.543 201.607 24.036  1.00 221.62 ? 195 LEU A CD1 1 
ATOM   952  C  CD2 . LEU A 1 122 ? 47.170 200.233 22.465  1.00 191.38 ? 195 LEU A CD2 1 
ATOM   953  N  N   . PRO A 1 123 ? 46.457 197.261 27.037  1.00 158.16 ? 196 PRO A N   1 
ATOM   954  C  CA  . PRO A 1 123 ? 46.624 196.087 27.910  1.00 160.47 ? 196 PRO A CA  1 
ATOM   955  C  C   . PRO A 1 123 ? 47.766 195.169 27.508  1.00 179.88 ? 196 PRO A C   1 
ATOM   956  O  O   . PRO A 1 123 ? 48.393 194.568 28.389  1.00 190.88 ? 196 PRO A O   1 
ATOM   957  C  CB  . PRO A 1 123 ? 45.268 195.374 27.801  1.00 166.61 ? 196 PRO A CB  1 
ATOM   958  C  CG  . PRO A 1 123 ? 44.315 196.420 27.308  1.00 158.64 ? 196 PRO A CG  1 
ATOM   959  C  CD  . PRO A 1 123 ? 45.125 197.304 26.414  1.00 162.71 ? 196 PRO A CD  1 
ATOM   960  N  N   . TRP A 1 124 ? 48.059 195.037 26.216  1.00 163.80 ? 197 TRP A N   1 
ATOM   961  C  CA  . TRP A 1 124 ? 49.085 194.108 25.758  1.00 146.52 ? 197 TRP A CA  1 
ATOM   962  C  C   . TRP A 1 124 ? 50.488 194.700 25.800  1.00 137.54 ? 197 TRP A C   1 
ATOM   963  O  O   . TRP A 1 124 ? 51.436 194.039 25.364  1.00 147.70 ? 197 TRP A O   1 
ATOM   964  C  CB  . TRP A 1 124 ? 48.771 193.609 24.340  1.00 128.16 ? 197 TRP A CB  1 
ATOM   965  C  CG  . TRP A 1 124 ? 48.632 194.677 23.293  1.00 145.29 ? 197 TRP A CG  1 
ATOM   966  C  CD1 . TRP A 1 124 ? 49.627 195.209 22.524  1.00 171.29 ? 197 TRP A CD1 1 
ATOM   967  C  CD2 . TRP A 1 124 ? 47.419 195.316 22.877  1.00 146.85 ? 197 TRP A CD2 1 
ATOM   968  N  NE1 . TRP A 1 124 ? 49.110 196.149 21.665  1.00 162.67 ? 197 TRP A NE1 1 
ATOM   969  C  CE2 . TRP A 1 124 ? 47.757 196.234 21.862  1.00 143.58 ? 197 TRP A CE2 1 
ATOM   970  C  CE3 . TRP A 1 124 ? 46.082 195.207 23.269  1.00 138.96 ? 197 TRP A CE3 1 
ATOM   971  C  CZ2 . TRP A 1 124 ? 46.806 197.035 21.234  1.00 128.35 ? 197 TRP A CZ2 1 
ATOM   972  C  CZ3 . TRP A 1 124 ? 45.140 196.005 22.646  1.00 137.11 ? 197 TRP A CZ3 1 
ATOM   973  C  CH2 . TRP A 1 124 ? 45.507 196.908 21.641  1.00 129.15 ? 197 TRP A CH2 1 
ATOM   974  N  N   . THR A 1 125 ? 50.643 195.925 26.301  1.00 138.36 ? 198 THR A N   1 
ATOM   975  C  CA  . THR A 1 125 ? 51.978 196.497 26.474  1.00 134.44 ? 198 THR A CA  1 
ATOM   976  C  C   . THR A 1 125 ? 52.666 195.904 27.702  1.00 135.22 ? 198 THR A C   1 
ATOM   977  O  O   . THR A 1 125 ? 53.676 195.203 27.586  1.00 155.56 ? 198 THR A O   1 
ATOM   978  C  CB  . THR A 1 125 ? 51.890 198.023 26.580  1.00 146.39 ? 198 THR A CB  1 
ATOM   979  O  OG1 . THR A 1 125 ? 51.262 198.551 25.405  1.00 137.48 ? 198 THR A OG1 1 
ATOM   980  C  CG2 . THR A 1 125 ? 53.281 198.624 26.719  1.00 186.49 ? 198 THR A CG2 1 
ATOM   981  N  N   . SER A 1 126 ? 52.127 196.177 28.887  1.00 163.64 ? 199 SER A N   1 
ATOM   982  C  CA  . SER A 1 126 ? 52.726 195.714 30.128  1.00 186.46 ? 199 SER A CA  1 
ATOM   983  C  C   . SER A 1 126 ? 52.451 194.228 30.349  1.00 161.14 ? 199 SER A C   1 
ATOM   984  O  O   . SER A 1 126 ? 51.489 193.658 29.826  1.00 144.55 ? 199 SER A O   1 
ATOM   985  C  CB  . SER A 1 126 ? 52.199 196.524 31.314  1.00 199.74 ? 199 SER A CB  1 
ATOM   986  O  OG  . SER A 1 126 ? 52.552 197.892 31.196  1.00 214.98 ? 199 SER A OG  1 
ATOM   987  N  N   . CYS A 1 127 ? 53.321 193.601 31.139  1.00 179.57 ? 200 CYS A N   1 
ATOM   988  C  CA  . CYS A 1 127 ? 53.191 192.192 31.485  1.00 166.23 ? 200 CYS A CA  1 
ATOM   989  C  C   . CYS A 1 127 ? 52.469 191.961 32.806  1.00 173.72 ? 200 CYS A C   1 
ATOM   990  O  O   . CYS A 1 127 ? 52.268 190.803 33.186  1.00 136.13 ? 200 CYS A O   1 
ATOM   991  C  CB  . CYS A 1 127 ? 54.571 191.525 31.545  1.00 134.04 ? 200 CYS A CB  1 
ATOM   992  S  SG  . CYS A 1 127 ? 55.113 190.743 30.004  1.00 269.12 ? 200 CYS A SG  1 
ATOM   993  N  N   . LYS A 1 128 ? 52.075 193.016 33.515  1.00 198.77 ? 201 LYS A N   1 
ATOM   994  C  CA  . LYS A 1 128 ? 51.362 192.860 34.777  1.00 182.51 ? 201 LYS A CA  1 
ATOM   995  C  C   . LYS A 1 128 ? 49.868 192.913 34.489  1.00 188.35 ? 201 LYS A C   1 
ATOM   996  O  O   . LYS A 1 128 ? 49.313 193.987 34.235  1.00 225.22 ? 201 LYS A O   1 
ATOM   997  C  CB  . LYS A 1 128 ? 51.775 193.944 35.770  1.00 187.15 ? 201 LYS A CB  1 
ATOM   998  N  N   . ASN A 1 129 ? 49.217 191.755 34.568  1.00 168.00 ? 202 ASN A N   1 
ATOM   999  C  CA  . ASN A 1 129 ? 47.799 191.607 34.265  1.00 185.08 ? 202 ASN A CA  1 
ATOM   1000 C  C   . ASN A 1 129 ? 47.305 190.348 34.959  1.00 176.06 ? 202 ASN A C   1 
ATOM   1001 O  O   . ASN A 1 129 ? 48.093 189.516 35.413  1.00 189.58 ? 202 ASN A O   1 
ATOM   1002 C  CB  . ASN A 1 129 ? 47.531 191.526 32.756  1.00 195.84 ? 202 ASN A CB  1 
ATOM   1003 C  CG  . ASN A 1 129 ? 47.864 192.813 32.024  1.00 182.98 ? 202 ASN A CG  1 
ATOM   1004 O  OD1 . ASN A 1 129 ? 47.065 193.749 31.994  1.00 165.20 ? 202 ASN A OD1 1 
ATOM   1005 N  ND2 . ASN A 1 129 ? 49.049 192.863 31.426  1.00 185.50 ? 202 ASN A ND2 1 
ATOM   1006 N  N   . SER A 1 130 ? 45.979 190.219 35.039  1.00 173.55 ? 203 SER A N   1 
ATOM   1007 C  CA  . SER A 1 130 ? 45.400 189.017 35.629  1.00 182.84 ? 203 SER A CA  1 
ATOM   1008 C  C   . SER A 1 130 ? 45.633 187.787 34.759  1.00 178.64 ? 203 SER A C   1 
ATOM   1009 O  O   . SER A 1 130 ? 45.744 186.673 35.284  1.00 193.25 ? 203 SER A O   1 
ATOM   1010 C  CB  . SER A 1 130 ? 43.904 189.220 35.870  1.00 191.22 ? 203 SER A CB  1 
ATOM   1011 O  OG  . SER A 1 130 ? 43.223 189.501 34.659  1.00 158.89 ? 203 SER A OG  1 
ATOM   1012 N  N   . TRP A 1 131 ? 45.711 187.962 33.440  1.00 166.53 ? 204 TRP A N   1 
ATOM   1013 C  CA  . TRP A 1 131 ? 45.823 186.841 32.514  1.00 163.26 ? 204 TRP A CA  1 
ATOM   1014 C  C   . TRP A 1 131 ? 47.259 186.461 32.175  1.00 157.41 ? 204 TRP A C   1 
ATOM   1015 O  O   . TRP A 1 131 ? 47.472 185.417 31.549  1.00 153.61 ? 204 TRP A O   1 
ATOM   1016 C  CB  . TRP A 1 131 ? 45.073 187.159 31.216  1.00 170.19 ? 204 TRP A CB  1 
ATOM   1017 C  CG  . TRP A 1 131 ? 45.510 188.440 30.572  1.00 159.14 ? 204 TRP A CG  1 
ATOM   1018 C  CD1 . TRP A 1 131 ? 46.522 188.602 29.670  1.00 140.10 ? 204 TRP A CD1 1 
ATOM   1019 C  CD2 . TRP A 1 131 ? 44.946 189.740 30.781  1.00 146.63 ? 204 TRP A CD2 1 
ATOM   1020 N  NE1 . TRP A 1 131 ? 46.623 189.923 29.305  1.00 134.45 ? 204 TRP A NE1 1 
ATOM   1021 C  CE2 . TRP A 1 131 ? 45.666 190.642 29.972  1.00 139.28 ? 204 TRP A CE2 1 
ATOM   1022 C  CE3 . TRP A 1 131 ? 43.903 190.229 31.573  1.00 162.40 ? 204 TRP A CE3 1 
ATOM   1023 C  CZ2 . TRP A 1 131 ? 45.376 192.004 29.934  1.00 143.54 ? 204 TRP A CZ2 1 
ATOM   1024 C  CZ3 . TRP A 1 131 ? 43.616 191.581 31.532  1.00 204.09 ? 204 TRP A CZ3 1 
ATOM   1025 C  CH2 . TRP A 1 131 ? 44.350 192.453 30.719  1.00 190.44 ? 204 TRP A CH2 1 
ATOM   1026 N  N   . ASN A 1 132 ? 48.243 187.265 32.564  1.00 135.16 ? 205 ASN A N   1 
ATOM   1027 C  CA  . ASN A 1 132 ? 49.622 186.990 32.193  1.00 131.28 ? 205 ASN A CA  1 
ATOM   1028 C  C   . ASN A 1 132 ? 50.226 185.907 33.079  1.00 140.58 ? 205 ASN A C   1 
ATOM   1029 O  O   . ASN A 1 132 ? 49.808 185.699 34.221  1.00 149.30 ? 205 ASN A O   1 
ATOM   1030 C  CB  . ASN A 1 132 ? 50.466 188.262 32.273  1.00 144.24 ? 205 ASN A CB  1 
ATOM   1031 C  CG  . ASN A 1 132 ? 50.370 189.103 31.015  1.00 162.40 ? 205 ASN A CG  1 
ATOM   1032 O  OD1 . ASN A 1 132 ? 49.531 189.995 30.911  1.00 166.53 ? 205 ASN A OD1 1 
ATOM   1033 N  ND2 . ASN A 1 132 ? 51.232 188.816 30.048  1.00 177.48 ? 205 ASN A ND2 1 
ATOM   1034 N  N   . THR A 1 133 ? 51.219 185.211 32.532  1.00 140.44 ? 206 THR A N   1 
ATOM   1035 C  CA  . THR A 1 133 ? 51.939 184.167 33.240  1.00 142.88 ? 206 THR A CA  1 
ATOM   1036 C  C   . THR A 1 133 ? 53.317 184.675 33.658  1.00 141.79 ? 206 THR A C   1 
ATOM   1037 O  O   . THR A 1 133 ? 53.692 185.823 33.406  1.00 141.23 ? 206 THR A O   1 
ATOM   1038 C  CB  . THR A 1 133 ? 52.064 182.914 32.370  1.00 135.38 ? 206 THR A CB  1 
ATOM   1039 O  OG1 . THR A 1 133 ? 52.744 183.243 31.152  1.00 122.31 ? 206 THR A OG1 1 
ATOM   1040 C  CG2 . THR A 1 133 ? 50.689 182.355 32.043  1.00 137.61 ? 206 THR A CG2 1 
ATOM   1041 N  N   . GLY A 1 134 ? 54.084 183.799 34.311  1.00 129.13 ? 207 GLY A N   1 
ATOM   1042 C  CA  . GLY A 1 134 ? 55.453 184.135 34.658  1.00 130.18 ? 207 GLY A CA  1 
ATOM   1043 C  C   . GLY A 1 134 ? 56.387 184.184 33.469  1.00 128.52 ? 207 GLY A C   1 
ATOM   1044 O  O   . GLY A 1 134 ? 57.453 184.804 33.555  1.00 145.70 ? 207 GLY A O   1 
ATOM   1045 N  N   . ASN A 1 135 ? 56.011 183.544 32.361  1.00 136.98 ? 208 ASN A N   1 
ATOM   1046 C  CA  . ASN A 1 135 ? 56.804 183.604 31.141  1.00 131.34 ? 208 ASN A CA  1 
ATOM   1047 C  C   . ASN A 1 135 ? 56.721 184.956 30.446  1.00 131.95 ? 208 ASN A C   1 
ATOM   1048 O  O   . ASN A 1 135 ? 57.510 185.206 29.528  1.00 132.68 ? 208 ASN A O   1 
ATOM   1049 C  CB  . ASN A 1 135 ? 56.358 182.514 30.166  1.00 136.17 ? 208 ASN A CB  1 
ATOM   1050 C  CG  . ASN A 1 135 ? 56.727 181.120 30.630  1.00 129.96 ? 208 ASN A CG  1 
ATOM   1051 O  OD1 . ASN A 1 135 ? 57.863 180.677 30.459  1.00 144.35 ? 208 ASN A OD1 1 
ATOM   1052 N  ND2 . ASN A 1 135 ? 55.765 180.415 31.212  1.00 152.92 ? 208 ASN A ND2 1 
ATOM   1053 N  N   . CYS A 1 136 ? 55.790 185.821 30.844  1.00 182.83 ? 209 CYS A N   1 
ATOM   1054 C  CA  . CYS A 1 136 ? 55.622 187.103 30.172  1.00 187.78 ? 209 CYS A CA  1 
ATOM   1055 C  C   . CYS A 1 136 ? 56.874 187.952 30.334  1.00 190.00 ? 209 CYS A C   1 
ATOM   1056 O  O   . CYS A 1 136 ? 57.324 188.207 31.456  1.00 222.33 ? 209 CYS A O   1 
ATOM   1057 C  CB  . CYS A 1 136 ? 54.406 187.839 30.733  1.00 194.01 ? 209 CYS A CB  1 
ATOM   1058 S  SG  . CYS A 1 136 ? 53.801 189.216 29.712  1.00 184.91 ? 209 CYS A SG  1 
ATOM   1059 N  N   . THR A 1 137 ? 57.431 188.394 29.209  1.00 163.11 ? 210 THR A N   1 
ATOM   1060 C  CA  . THR A 1 137 ? 58.569 189.305 29.198  1.00 175.57 ? 210 THR A CA  1 
ATOM   1061 C  C   . THR A 1 137 ? 58.310 190.365 28.141  1.00 162.04 ? 210 THR A C   1 
ATOM   1062 O  O   . THR A 1 137 ? 58.126 190.037 26.965  1.00 129.33 ? 210 THR A O   1 
ATOM   1063 C  CB  . THR A 1 137 ? 59.881 188.565 28.912  1.00 165.29 ? 210 THR A CB  1 
ATOM   1064 O  OG1 . THR A 1 137 ? 59.703 187.688 27.793  1.00 152.29 ? 210 THR A OG1 1 
ATOM   1065 C  CG2 . THR A 1 137 ? 60.320 187.757 30.126  1.00 130.36 ? 210 THR A CG2 1 
ATOM   1066 N  N   . ASN A 1 138 ? 58.301 191.626 28.555  1.00 214.58 ? 211 ASN A N   1 
ATOM   1067 C  CA  . ASN A 1 138 ? 58.009 192.748 27.678  1.00 211.82 ? 211 ASN A CA  1 
ATOM   1068 C  C   . ASN A 1 138 ? 59.247 193.623 27.526  1.00 214.08 ? 211 ASN A C   1 
ATOM   1069 O  O   . ASN A 1 138 ? 60.323 193.322 28.052  1.00 222.60 ? 211 ASN A O   1 
ATOM   1070 C  CB  . ASN A 1 138 ? 56.828 193.560 28.216  1.00 210.89 ? 211 ASN A CB  1 
ATOM   1071 C  CG  . ASN A 1 138 ? 57.155 194.278 29.512  1.00 249.89 ? 211 ASN A CG  1 
ATOM   1072 O  OD1 . ASN A 1 138 ? 57.940 193.791 30.326  1.00 283.04 ? 211 ASN A OD1 1 
ATOM   1073 N  ND2 . ASN A 1 138 ? 56.553 195.446 29.709  1.00 241.47 ? 211 ASN A ND2 1 
ATOM   1074 N  N   . TYR A 1 139 ? 59.086 194.719 26.794  1.00 229.88 ? 212 TYR A N   1 
ATOM   1075 C  CA  . TYR A 1 139 ? 60.143 195.700 26.626  1.00 234.08 ? 212 TYR A CA  1 
ATOM   1076 C  C   . TYR A 1 139 ? 59.903 196.881 27.564  1.00 243.30 ? 212 TYR A C   1 
ATOM   1077 O  O   . TYR A 1 139 ? 58.958 196.893 28.358  1.00 249.40 ? 212 TYR A O   1 
ATOM   1078 C  CB  . TYR A 1 139 ? 60.248 196.123 25.161  1.00 220.66 ? 212 TYR A CB  1 
ATOM   1079 C  CG  . TYR A 1 139 ? 60.976 195.097 24.322  1.00 208.22 ? 212 TYR A CG  1 
ATOM   1080 C  CD1 . TYR A 1 139 ? 60.328 193.956 23.866  1.00 207.90 ? 212 TYR A CD1 1 
ATOM   1081 C  CD2 . TYR A 1 139 ? 62.319 195.257 24.007  1.00 206.34 ? 212 TYR A CD2 1 
ATOM   1082 C  CE1 . TYR A 1 139 ? 60.993 193.010 23.107  1.00 205.25 ? 212 TYR A CE1 1 
ATOM   1083 C  CE2 . TYR A 1 139 ? 62.993 194.317 23.249  1.00 218.84 ? 212 TYR A CE2 1 
ATOM   1084 C  CZ  . TYR A 1 139 ? 62.325 193.196 22.802  1.00 217.34 ? 212 TYR A CZ  1 
ATOM   1085 O  OH  . TYR A 1 139 ? 62.991 192.257 22.047  1.00 227.56 ? 212 TYR A OH  1 
ATOM   1086 N  N   . PHE A 1 140 ? 60.781 197.882 27.472  1.00 248.17 ? 213 PHE A N   1 
ATOM   1087 C  CA  . PHE A 1 140 ? 60.957 198.883 28.528  1.00 246.83 ? 213 PHE A CA  1 
ATOM   1088 C  C   . PHE A 1 140 ? 61.323 198.204 29.846  1.00 240.96 ? 213 PHE A C   1 
ATOM   1089 O  O   . PHE A 1 140 ? 61.031 198.709 30.932  1.00 249.31 ? 213 PHE A O   1 
ATOM   1090 C  CB  . PHE A 1 140 ? 59.717 199.773 28.687  1.00 245.76 ? 213 PHE A CB  1 
ATOM   1091 C  CG  . PHE A 1 140 ? 59.980 201.053 29.433  1.00 249.52 ? 213 PHE A CG  1 
ATOM   1092 C  CD1 . PHE A 1 140 ? 60.783 202.037 28.881  1.00 247.66 ? 213 PHE A CD1 1 
ATOM   1093 C  CD2 . PHE A 1 140 ? 59.417 201.276 30.680  1.00 244.43 ? 213 PHE A CD2 1 
ATOM   1094 C  CE1 . PHE A 1 140 ? 61.028 203.215 29.561  1.00 242.57 ? 213 PHE A CE1 1 
ATOM   1095 C  CE2 . PHE A 1 140 ? 59.658 202.452 31.365  1.00 239.61 ? 213 PHE A CE2 1 
ATOM   1096 C  CZ  . PHE A 1 140 ? 60.464 203.423 30.804  1.00 241.55 ? 213 PHE A CZ  1 
ATOM   1097 N  N   . SER A 1 141 ? 61.964 197.047 29.740  1.00 241.59 ? 214 SER A N   1 
ATOM   1098 C  CA  . SER A 1 141 ? 62.401 196.220 30.853  1.00 259.13 ? 214 SER A CA  1 
ATOM   1099 C  C   . SER A 1 141 ? 63.925 196.119 30.821  1.00 288.68 ? 214 SER A C   1 
ATOM   1100 O  O   . SER A 1 141 ? 64.597 196.814 30.053  1.00 267.91 ? 214 SER A O   1 
ATOM   1101 C  CB  . SER A 1 141 ? 61.734 194.843 30.796  1.00 237.27 ? 214 SER A CB  1 
ATOM   1102 O  OG  . SER A 1 141 ? 62.180 194.012 31.853  1.00 225.57 ? 214 SER A OG  1 
ATOM   1103 N  N   . GLU A 1 142 ? 64.466 195.263 31.686  1.00 343.14 ? 215 GLU A N   1 
ATOM   1104 C  CA  . GLU A 1 142 ? 65.904 195.027 31.723  1.00 367.52 ? 215 GLU A CA  1 
ATOM   1105 C  C   . GLU A 1 142 ? 66.424 194.642 30.343  1.00 378.56 ? 215 GLU A C   1 
ATOM   1106 O  O   . GLU A 1 142 ? 65.746 193.958 29.574  1.00 376.89 ? 215 GLU A O   1 
ATOM   1107 C  CB  . GLU A 1 142 ? 66.225 193.921 32.731  1.00 364.49 ? 215 GLU A CB  1 
ATOM   1108 C  CG  . GLU A 1 142 ? 65.464 192.626 32.482  1.00 354.74 ? 215 GLU A CG  1 
ATOM   1109 C  CD  . GLU A 1 142 ? 65.829 191.530 33.462  1.00 350.90 ? 215 GLU A CD  1 
ATOM   1110 O  OE1 . GLU A 1 142 ? 66.726 191.752 34.302  1.00 350.73 ? 215 GLU A OE1 1 
ATOM   1111 O  OE2 . GLU A 1 142 ? 65.217 190.443 33.391  1.00 347.80 ? 215 GLU A OE2 1 
ATOM   1112 N  N   . ASP A 1 143 ? 67.627 195.110 30.023  1.00 326.71 ? 216 ASP A N   1 
ATOM   1113 C  CA  . ASP A 1 143 ? 68.260 194.790 28.751  1.00 294.13 ? 216 ASP A CA  1 
ATOM   1114 C  C   . ASP A 1 143 ? 68.875 193.392 28.841  1.00 294.31 ? 216 ASP A C   1 
ATOM   1115 O  O   . ASP A 1 143 ? 68.684 192.669 29.823  1.00 297.81 ? 216 ASP A O   1 
ATOM   1116 C  CB  . ASP A 1 143 ? 69.286 195.863 28.391  1.00 277.38 ? 216 ASP A CB  1 
ATOM   1117 C  CG  . ASP A 1 143 ? 69.612 195.890 26.908  1.00 253.30 ? 216 ASP A CG  1 
ATOM   1118 O  OD1 . ASP A 1 143 ? 69.349 194.881 26.221  1.00 246.06 ? 216 ASP A OD1 1 
ATOM   1119 O  OD2 . ASP A 1 143 ? 70.135 196.918 26.431  1.00 251.71 ? 216 ASP A OD2 1 
ATOM   1120 N  N   . ASN A 1 144 ? 69.603 192.983 27.800  1.00 289.75 ? 217 ASN A N   1 
ATOM   1121 C  CA  . ASN A 1 144 ? 70.348 191.728 27.719  1.00 282.82 ? 217 ASN A CA  1 
ATOM   1122 C  C   . ASN A 1 144 ? 69.436 190.503 27.666  1.00 260.52 ? 217 ASN A C   1 
ATOM   1123 O  O   . ASN A 1 144 ? 69.936 189.384 27.472  1.00 273.52 ? 217 ASN A O   1 
ATOM   1124 C  CB  . ASN A 1 144 ? 71.365 191.596 28.870  1.00 312.71 ? 217 ASN A CB  1 
ATOM   1125 C  CG  . ASN A 1 144 ? 71.096 190.407 29.783  1.00 344.96 ? 217 ASN A CG  1 
ATOM   1126 O  OD1 . ASN A 1 144 ? 70.128 190.394 30.546  1.00 334.08 ? 217 ASN A OD1 1 
ATOM   1127 N  ND2 . ASN A 1 144 ? 71.969 189.404 29.708  1.00 404.13 ? 217 ASN A ND2 1 
ATOM   1128 N  N   . ILE A 1 145 ? 68.115 190.679 27.782  1.00 233.81 ? 218 ILE A N   1 
ATOM   1129 C  CA  . ILE A 1 145 ? 67.195 189.551 27.873  1.00 213.75 ? 218 ILE A CA  1 
ATOM   1130 C  C   . ILE A 1 145 ? 67.360 188.615 26.686  1.00 186.35 ? 218 ILE A C   1 
ATOM   1131 O  O   . ILE A 1 145 ? 67.605 189.043 25.550  1.00 168.71 ? 218 ILE A O   1 
ATOM   1132 C  CB  . ILE A 1 145 ? 65.738 190.037 27.976  1.00 203.42 ? 218 ILE A CB  1 
ATOM   1133 C  CG1 . ILE A 1 145 ? 65.325 190.824 26.723  1.00 180.49 ? 218 ILE A CG1 1 
ATOM   1134 C  CG2 . ILE A 1 145 ? 65.532 190.848 29.242  1.00 223.44 ? 218 ILE A CG2 1 
ATOM   1135 C  CD1 . ILE A 1 145 ? 65.608 192.317 26.778  1.00 197.05 ? 218 ILE A CD1 1 
ATOM   1136 N  N   . THR A 1 146 ? 67.235 187.319 26.956  1.00 168.91 ? 219 THR A N   1 
ATOM   1137 C  CA  . THR A 1 146 ? 67.317 186.275 25.946  1.00 125.38 ? 219 THR A CA  1 
ATOM   1138 C  C   . THR A 1 146 ? 66.037 185.458 25.994  1.00 133.37 ? 219 THR A C   1 
ATOM   1139 O  O   . THR A 1 146 ? 65.591 185.060 27.075  1.00 123.63 ? 219 THR A O   1 
ATOM   1140 C  CB  . THR A 1 146 ? 68.530 185.374 26.180  1.00 154.28 ? 219 THR A CB  1 
ATOM   1141 O  OG1 . THR A 1 146 ? 68.309 184.572 27.347  1.00 150.42 ? 219 THR A OG1 1 
ATOM   1142 C  CG2 . THR A 1 146 ? 69.777 186.216 26.388  1.00 152.01 ? 219 THR A CG2 1 
ATOM   1143 N  N   . TRP A 1 147 ? 65.450 185.211 24.828  1.00 174.08 ? 220 TRP A N   1 
ATOM   1144 C  CA  . TRP A 1 147 ? 64.177 184.513 24.759  1.00 151.95 ? 220 TRP A CA  1 
ATOM   1145 C  C   . TRP A 1 147 ? 64.361 183.025 25.028  1.00 142.55 ? 220 TRP A C   1 
ATOM   1146 O  O   . TRP A 1 147 ? 65.397 182.434 24.710  1.00 179.01 ? 220 TRP A O   1 
ATOM   1147 C  CB  . TRP A 1 147 ? 63.525 184.722 23.393  1.00 147.90 ? 220 TRP A CB  1 
ATOM   1148 C  CG  . TRP A 1 147 ? 62.036 184.608 23.421  1.00 166.97 ? 220 TRP A CG  1 
ATOM   1149 C  CD1 . TRP A 1 147 ? 61.292 183.499 23.146  1.00 177.70 ? 220 TRP A CD1 1 
ATOM   1150 C  CD2 . TRP A 1 147 ? 61.103 185.647 23.742  1.00 165.02 ? 220 TRP A CD2 1 
ATOM   1151 N  NE1 . TRP A 1 147 ? 59.954 183.781 23.275  1.00 164.55 ? 220 TRP A NE1 1 
ATOM   1152 C  CE2 . TRP A 1 147 ? 59.811 185.095 23.640  1.00 158.94 ? 220 TRP A CE2 1 
ATOM   1153 C  CE3 . TRP A 1 147 ? 61.235 186.991 24.105  1.00 172.97 ? 220 TRP A CE3 1 
ATOM   1154 C  CZ2 . TRP A 1 147 ? 58.660 185.839 23.888  1.00 152.58 ? 220 TRP A CZ2 1 
ATOM   1155 C  CZ3 . TRP A 1 147 ? 60.091 187.728 24.350  1.00 153.47 ? 220 TRP A CZ3 1 
ATOM   1156 C  CH2 . TRP A 1 147 ? 58.820 187.150 24.241  1.00 143.70 ? 220 TRP A CH2 1 
ATOM   1157 N  N   . THR A 1 148 ? 63.333 182.421 25.616  1.00 139.56 ? 221 THR A N   1 
ATOM   1158 C  CA  . THR A 1 148 ? 63.342 181.021 26.003  1.00 141.27 ? 221 THR A CA  1 
ATOM   1159 C  C   . THR A 1 148 ? 62.224 180.290 25.267  1.00 139.43 ? 221 THR A C   1 
ATOM   1160 O  O   . THR A 1 148 ? 61.261 180.903 24.799  1.00 159.33 ? 221 THR A O   1 
ATOM   1161 C  CB  . THR A 1 148 ? 63.176 180.875 27.525  1.00 158.97 ? 221 THR A CB  1 
ATOM   1162 O  OG1 . THR A 1 148 ? 63.937 181.895 28.184  1.00 134.16 ? 221 THR A OG1 1 
ATOM   1163 C  CG2 . THR A 1 148 ? 63.666 179.521 28.002  1.00 134.66 ? 221 THR A CG2 1 
ATOM   1164 N  N   . LEU A 1 149 ? 62.372 178.965 25.157  1.00 127.86 ? 222 LEU A N   1 
ATOM   1165 C  CA  . LEU A 1 149 ? 61.376 178.157 24.457  1.00 135.39 ? 222 LEU A CA  1 
ATOM   1166 C  C   . LEU A 1 149 ? 59.987 178.336 25.057  1.00 151.90 ? 222 LEU A C   1 
ATOM   1167 O  O   . LEU A 1 149 ? 58.984 178.322 24.334  1.00 167.11 ? 222 LEU A O   1 
ATOM   1168 C  CB  . LEU A 1 149 ? 61.782 176.682 24.487  1.00 140.64 ? 222 LEU A CB  1 
ATOM   1169 C  CG  . LEU A 1 149 ? 62.897 176.237 23.540  1.00 122.52 ? 222 LEU A CG  1 
ATOM   1170 C  CD1 . LEU A 1 149 ? 63.340 174.820 23.866  1.00 126.04 ? 222 LEU A CD1 1 
ATOM   1171 C  CD2 . LEU A 1 149 ? 62.431 176.328 22.097  1.00 121.04 ? 222 LEU A CD2 1 
ATOM   1172 N  N   . HIS A 1 150 ? 59.906 178.503 26.375  1.00 123.97 ? 223 HIS A N   1 
ATOM   1173 C  CA  . HIS A 1 150 ? 58.627 178.659 27.052  1.00 134.26 ? 223 HIS A CA  1 
ATOM   1174 C  C   . HIS A 1 150 ? 58.196 180.113 27.206  1.00 150.31 ? 223 HIS A C   1 
ATOM   1175 O  O   . HIS A 1 150 ? 57.066 180.361 27.640  1.00 169.86 ? 223 HIS A O   1 
ATOM   1176 C  CB  . HIS A 1 150 ? 58.680 177.993 28.431  1.00 135.82 ? 223 HIS A CB  1 
ATOM   1177 C  CG  . HIS A 1 150 ? 59.088 176.553 28.389  1.00 143.43 ? 223 HIS A CG  1 
ATOM   1178 N  ND1 . HIS A 1 150 ? 58.454 175.623 27.595  1.00 164.51 ? 223 HIS A ND1 1 
ATOM   1179 C  CD2 . HIS A 1 150 ? 60.063 175.883 29.048  1.00 140.18 ? 223 HIS A CD2 1 
ATOM   1180 C  CE1 . HIS A 1 150 ? 59.023 174.442 27.763  1.00 156.22 ? 223 HIS A CE1 1 
ATOM   1181 N  NE2 . HIS A 1 150 ? 60.002 174.573 28.640  1.00 140.29 ? 223 HIS A NE2 1 
ATOM   1182 N  N   . SER A 1 151 ? 59.054 181.070 26.862  1.00 130.20 ? 224 SER A N   1 
ATOM   1183 C  CA  . SER A 1 151 ? 58.723 182.475 27.055  1.00 124.15 ? 224 SER A CA  1 
ATOM   1184 C  C   . SER A 1 151 ? 57.687 182.941 26.037  1.00 114.48 ? 224 SER A C   1 
ATOM   1185 O  O   . SER A 1 151 ? 57.622 182.447 24.908  1.00 144.29 ? 224 SER A O   1 
ATOM   1186 C  CB  . SER A 1 151 ? 59.980 183.340 26.952  1.00 117.35 ? 224 SER A CB  1 
ATOM   1187 O  OG  . SER A 1 151 ? 60.854 183.096 28.040  1.00 174.80 ? 224 SER A OG  1 
ATOM   1188 N  N   . THR A 1 152 ? 56.870 183.908 26.454  1.00 119.05 ? 225 THR A N   1 
ATOM   1189 C  CA  . THR A 1 152 ? 55.829 184.479 25.612  1.00 117.18 ? 225 THR A CA  1 
ATOM   1190 C  C   . THR A 1 152 ? 55.790 185.988 25.811  1.00 129.13 ? 225 THR A C   1 
ATOM   1191 O  O   . THR A 1 152 ? 56.140 186.497 26.879  1.00 159.99 ? 225 THR A O   1 
ATOM   1192 C  CB  . THR A 1 152 ? 54.449 183.879 25.921  1.00 152.87 ? 225 THR A CB  1 
ATOM   1193 O  OG1 . THR A 1 152 ? 54.211 183.922 27.334  1.00 185.10 ? 225 THR A OG1 1 
ATOM   1194 C  CG2 . THR A 1 152 ? 54.365 182.439 25.436  1.00 154.12 ? 225 THR A CG2 1 
ATOM   1195 N  N   . SER A 1 153 ? 55.355 186.699 24.768  1.00 121.30 ? 226 SER A N   1 
ATOM   1196 C  CA  . SER A 1 153 ? 55.279 188.152 24.772  1.00 141.29 ? 226 SER A CA  1 
ATOM   1197 C  C   . SER A 1 153 ? 53.943 188.618 25.336  1.00 137.57 ? 226 SER A C   1 
ATOM   1198 O  O   . SER A 1 153 ? 52.950 187.885 25.297  1.00 161.22 ? 226 SER A O   1 
ATOM   1199 C  CB  . SER A 1 153 ? 55.469 188.688 23.354  1.00 130.41 ? 226 SER A CB  1 
ATOM   1200 O  OG  . SER A 1 153 ? 54.396 188.312 22.511  1.00 144.57 ? 226 SER A OG  1 
ATOM   1201 N  N   . PRO A 1 154 ? 53.883 189.842 25.873  1.00 138.95 ? 227 PRO A N   1 
ATOM   1202 C  CA  . PRO A 1 154 ? 52.619 190.313 26.467  1.00 138.92 ? 227 PRO A CA  1 
ATOM   1203 C  C   . PRO A 1 154 ? 51.480 190.428 25.469  1.00 150.38 ? 227 PRO A C   1 
ATOM   1204 O  O   . PRO A 1 154 ? 50.314 190.300 25.862  1.00 138.91 ? 227 PRO A O   1 
ATOM   1205 C  CB  . PRO A 1 154 ? 52.997 191.680 27.054  1.00 144.47 ? 227 PRO A CB  1 
ATOM   1206 C  CG  . PRO A 1 154 ? 54.197 192.106 26.278  1.00 180.66 ? 227 PRO A CG  1 
ATOM   1207 C  CD  . PRO A 1 154 ? 54.955 190.843 26.003  1.00 180.89 ? 227 PRO A CD  1 
ATOM   1208 N  N   . ALA A 1 155 ? 51.777 190.675 24.191  1.00 155.78 ? 228 ALA A N   1 
ATOM   1209 C  CA  . ALA A 1 155 ? 50.725 190.667 23.181  1.00 152.24 ? 228 ALA A CA  1 
ATOM   1210 C  C   . ALA A 1 155 ? 50.252 189.247 22.899  1.00 139.38 ? 228 ALA A C   1 
ATOM   1211 O  O   . ALA A 1 155 ? 49.045 188.996 22.785  1.00 130.50 ? 228 ALA A O   1 
ATOM   1212 C  CB  . ALA A 1 155 ? 51.222 191.336 21.900  1.00 145.21 ? 228 ALA A CB  1 
ATOM   1213 N  N   . GLU A 1 156 ? 51.194 188.308 22.783  1.00 154.02 ? 229 GLU A N   1 
ATOM   1214 C  CA  . GLU A 1 156 ? 50.834 186.902 22.639  1.00 139.38 ? 229 GLU A CA  1 
ATOM   1215 C  C   . GLU A 1 156 ? 50.045 186.413 23.846  1.00 139.94 ? 229 GLU A C   1 
ATOM   1216 O  O   . GLU A 1 156 ? 49.092 185.639 23.704  1.00 138.76 ? 229 GLU A O   1 
ATOM   1217 C  CB  . GLU A 1 156 ? 52.096 186.063 22.445  1.00 170.80 ? 229 GLU A CB  1 
ATOM   1218 C  CG  . GLU A 1 156 ? 51.865 184.563 22.412  1.00 181.00 ? 229 GLU A CG  1 
ATOM   1219 C  CD  . GLU A 1 156 ? 53.166 183.784 22.398  1.00 178.93 ? 229 GLU A CD  1 
ATOM   1220 O  OE1 . GLU A 1 156 ? 54.238 184.420 22.485  1.00 160.48 ? 229 GLU A OE1 1 
ATOM   1221 O  OE2 . GLU A 1 156 ? 53.118 182.540 22.303  1.00 184.25 ? 229 GLU A OE2 1 
ATOM   1222 N  N   . GLU A 1 157 ? 50.426 186.857 25.045  1.00 130.99 ? 230 GLU A N   1 
ATOM   1223 C  CA  . GLU A 1 157 ? 49.671 186.496 26.239  1.00 132.75 ? 230 GLU A CA  1 
ATOM   1224 C  C   . GLU A 1 157 ? 48.284 187.127 26.226  1.00 145.24 ? 230 GLU A C   1 
ATOM   1225 O  O   . GLU A 1 157 ? 47.310 186.506 26.666  1.00 139.94 ? 230 GLU A O   1 
ATOM   1226 C  CB  . GLU A 1 157 ? 50.439 186.919 27.491  1.00 160.33 ? 230 GLU A CB  1 
ATOM   1227 C  CG  . GLU A 1 157 ? 51.738 186.163 27.715  1.00 133.02 ? 230 GLU A CG  1 
ATOM   1228 C  CD  . GLU A 1 157 ? 51.579 185.006 28.680  1.00 141.90 ? 230 GLU A CD  1 
ATOM   1229 O  OE1 . GLU A 1 157 ? 50.786 185.133 29.636  1.00 162.07 ? 230 GLU A OE1 1 
ATOM   1230 O  OE2 . GLU A 1 157 ? 52.245 183.968 28.482  1.00 161.47 ? 230 GLU A OE2 1 
ATOM   1231 N  N   . PHE A 1 158 ? 48.176 188.358 25.722  1.00 142.20 ? 231 PHE A N   1 
ATOM   1232 C  CA  . PHE A 1 158 ? 46.889 189.047 25.719  1.00 134.26 ? 231 PHE A CA  1 
ATOM   1233 C  C   . PHE A 1 158 ? 45.913 188.385 24.757  1.00 128.19 ? 231 PHE A C   1 
ATOM   1234 O  O   . PHE A 1 158 ? 44.750 188.150 25.103  1.00 138.54 ? 231 PHE A O   1 
ATOM   1235 C  CB  . PHE A 1 158 ? 47.081 190.522 25.364  1.00 175.01 ? 231 PHE A CB  1 
ATOM   1236 C  CG  . PHE A 1 158 ? 45.804 191.312 25.357  1.00 156.97 ? 231 PHE A CG  1 
ATOM   1237 C  CD1 . PHE A 1 158 ? 45.163 191.623 26.544  1.00 168.59 ? 231 PHE A CD1 1 
ATOM   1238 C  CD2 . PHE A 1 158 ? 45.246 191.748 24.167  1.00 125.85 ? 231 PHE A CD2 1 
ATOM   1239 C  CE1 . PHE A 1 158 ? 43.988 192.350 26.546  1.00 137.34 ? 231 PHE A CE1 1 
ATOM   1240 C  CE2 . PHE A 1 158 ? 44.071 192.478 24.164  1.00 137.27 ? 231 PHE A CE2 1 
ATOM   1241 C  CZ  . PHE A 1 158 ? 43.442 192.779 25.354  1.00 131.65 ? 231 PHE A CZ  1 
ATOM   1242 N  N   . TYR A 1 159 ? 46.368 188.078 23.540  1.00 146.34 ? 232 TYR A N   1 
ATOM   1243 C  CA  . TYR A 1 159 ? 45.509 187.375 22.592  1.00 127.67 ? 232 TYR A CA  1 
ATOM   1244 C  C   . TYR A 1 159 ? 45.206 185.963 23.067  1.00 128.47 ? 232 TYR A C   1 
ATOM   1245 O  O   . TYR A 1 159 ? 44.047 185.535 23.080  1.00 126.34 ? 232 TYR A O   1 
ATOM   1246 C  CB  . TYR A 1 159 ? 46.160 187.340 21.210  1.00 125.30 ? 232 TYR A CB  1 
ATOM   1247 C  CG  . TYR A 1 159 ? 45.287 186.722 20.140  1.00 142.71 ? 232 TYR A CG  1 
ATOM   1248 C  CD1 . TYR A 1 159 ? 43.900 186.808 20.208  1.00 143.06 ? 232 TYR A CD1 1 
ATOM   1249 C  CD2 . TYR A 1 159 ? 45.848 186.046 19.067  1.00 149.63 ? 232 TYR A CD2 1 
ATOM   1250 C  CE1 . TYR A 1 159 ? 43.100 186.244 19.231  1.00 132.01 ? 232 TYR A CE1 1 
ATOM   1251 C  CE2 . TYR A 1 159 ? 45.057 185.480 18.086  1.00 129.90 ? 232 TYR A CE2 1 
ATOM   1252 C  CZ  . TYR A 1 159 ? 43.684 185.582 18.173  1.00 118.90 ? 232 TYR A CZ  1 
ATOM   1253 O  OH  . TYR A 1 159 ? 42.890 185.021 17.201  1.00 119.26 ? 232 TYR A OH  1 
ATOM   1254 N  N   . THR A 1 160 ? 46.244 185.219 23.434  1.00 133.21 ? 233 THR A N   1 
ATOM   1255 C  CA  . THR A 1 160 ? 46.068 183.831 23.845  1.00 132.86 ? 233 THR A CA  1 
ATOM   1256 C  C   . THR A 1 160 ? 45.138 183.708 25.049  1.00 149.66 ? 233 THR A C   1 
ATOM   1257 O  O   . THR A 1 160 ? 44.037 183.155 24.945  1.00 151.77 ? 233 THR A O   1 
ATOM   1258 C  CB  . THR A 1 160 ? 47.431 183.200 24.140  1.00 142.37 ? 233 THR A CB  1 
ATOM   1259 O  OG1 . THR A 1 160 ? 48.263 183.295 22.977  1.00 155.76 ? 233 THR A OG1 1 
ATOM   1260 C  CG2 . THR A 1 160 ? 47.280 181.742 24.518  1.00 150.70 ? 233 THR A CG2 1 
ATOM   1261 N  N   . ARG A 1 161 ? 45.555 184.242 26.194  1.00 136.35 ? 234 ARG A N   1 
ATOM   1262 C  CA  . ARG A 1 161 ? 44.949 183.900 27.474  1.00 118.21 ? 234 ARG A CA  1 
ATOM   1263 C  C   . ARG A 1 161 ? 43.792 184.800 27.896  1.00 120.65 ? 234 ARG A C   1 
ATOM   1264 O  O   . ARG A 1 161 ? 43.119 184.482 28.881  1.00 141.54 ? 234 ARG A O   1 
ATOM   1265 C  CB  . ARG A 1 161 ? 46.019 183.916 28.572  1.00 119.78 ? 234 ARG A CB  1 
ATOM   1266 C  CG  . ARG A 1 161 ? 47.175 182.981 28.293  1.00 119.94 ? 234 ARG A CG  1 
ATOM   1267 C  CD  . ARG A 1 161 ? 48.172 182.988 29.427  1.00 119.67 ? 234 ARG A CD  1 
ATOM   1268 N  NE  . ARG A 1 161 ? 47.563 182.584 30.689  1.00 122.07 ? 234 ARG A NE  1 
ATOM   1269 C  CZ  . ARG A 1 161 ? 47.434 181.321 31.085  1.00 142.82 ? 234 ARG A CZ  1 
ATOM   1270 N  NH1 . ARG A 1 161 ? 46.870 181.043 32.253  1.00 160.98 ? 234 ARG A NH1 1 
ATOM   1271 N  NH2 . ARG A 1 161 ? 47.868 180.336 30.312  1.00 153.86 ? 234 ARG A NH2 1 
ATOM   1272 N  N   . HIS A 1 162 ? 43.532 185.902 27.195  1.00 126.13 ? 235 HIS A N   1 
ATOM   1273 C  CA  . HIS A 1 162 ? 42.498 186.844 27.613  1.00 146.14 ? 235 HIS A CA  1 
ATOM   1274 C  C   . HIS A 1 162 ? 41.314 186.839 26.653  1.00 150.73 ? 235 HIS A C   1 
ATOM   1275 O  O   . HIS A 1 162 ? 40.255 186.302 26.987  1.00 148.46 ? 235 HIS A O   1 
ATOM   1276 C  CB  . HIS A 1 162 ? 43.080 188.252 27.759  1.00 151.39 ? 235 HIS A CB  1 
ATOM   1277 C  CG  . HIS A 1 162 ? 42.104 189.252 28.295  1.00 150.07 ? 235 HIS A CG  1 
ATOM   1278 N  ND1 . HIS A 1 162 ? 41.593 189.179 29.573  1.00 133.18 ? 235 HIS A ND1 1 
ATOM   1279 C  CD2 . HIS A 1 162 ? 41.537 190.341 27.725  1.00 140.83 ? 235 HIS A CD2 1 
ATOM   1280 C  CE1 . HIS A 1 162 ? 40.758 190.183 29.768  1.00 177.20 ? 235 HIS A CE1 1 
ATOM   1281 N  NE2 . HIS A 1 162 ? 40.706 190.903 28.662  1.00 178.36 ? 235 HIS A NE2 1 
ATOM   1282 N  N   . VAL A 1 163 ? 41.458 187.426 25.463  1.00 120.84 ? 236 VAL A N   1 
ATOM   1283 C  CA  . VAL A 1 163 ? 40.321 187.541 24.555  1.00 141.91 ? 236 VAL A CA  1 
ATOM   1284 C  C   . VAL A 1 163 ? 39.936 186.173 24.002  1.00 117.74 ? 236 VAL A C   1 
ATOM   1285 O  O   . VAL A 1 163 ? 38.775 185.757 24.089  1.00 162.94 ? 236 VAL A O   1 
ATOM   1286 C  CB  . VAL A 1 163 ? 40.625 188.548 23.431  1.00 119.38 ? 236 VAL A CB  1 
ATOM   1287 C  CG1 . VAL A 1 163 ? 42.050 188.385 22.929  1.00 117.25 ? 236 VAL A CG1 1 
ATOM   1288 C  CG2 . VAL A 1 163 ? 39.630 188.385 22.291  1.00 118.99 ? 236 VAL A CG2 1 
ATOM   1289 N  N   . LEU A 1 164 ? 40.900 185.449 23.434  1.00 115.10 ? 237 LEU A N   1 
ATOM   1290 C  CA  . LEU A 1 164 ? 40.595 184.125 22.906  1.00 112.97 ? 237 LEU A CA  1 
ATOM   1291 C  C   . LEU A 1 164 ? 40.438 183.109 24.029  1.00 159.55 ? 237 LEU A C   1 
ATOM   1292 O  O   . LEU A 1 164 ? 39.586 182.215 23.948  1.00 139.10 ? 237 LEU A O   1 
ATOM   1293 C  CB  . LEU A 1 164 ? 41.681 183.687 21.924  1.00 123.18 ? 237 LEU A CB  1 
ATOM   1294 C  CG  . LEU A 1 164 ? 41.437 182.383 21.163  1.00 142.04 ? 237 LEU A CG  1 
ATOM   1295 C  CD1 . LEU A 1 164 ? 40.112 182.436 20.418  1.00 159.48 ? 237 LEU A CD1 1 
ATOM   1296 C  CD2 . LEU A 1 164 ? 42.582 182.106 20.202  1.00 159.06 ? 237 LEU A CD2 1 
ATOM   1297 N  N   . GLN A 1 165 ? 41.243 183.240 25.088  1.00 153.14 ? 238 GLN A N   1 
ATOM   1298 C  CA  . GLN A 1 165 ? 41.200 182.340 26.243  1.00 151.30 ? 238 GLN A CA  1 
ATOM   1299 C  C   . GLN A 1 165 ? 41.374 180.885 25.811  1.00 160.34 ? 238 GLN A C   1 
ATOM   1300 O  O   . GLN A 1 165 ? 40.763 179.971 26.369  1.00 155.36 ? 238 GLN A O   1 
ATOM   1301 C  CB  . GLN A 1 165 ? 39.908 182.531 27.041  1.00 154.78 ? 238 GLN A CB  1 
ATOM   1302 C  CG  . GLN A 1 165 ? 40.024 182.179 28.515  1.00 217.01 ? 238 GLN A CG  1 
ATOM   1303 C  CD  . GLN A 1 165 ? 38.816 182.625 29.315  1.00 212.65 ? 238 GLN A CD  1 
ATOM   1304 O  OE1 . GLN A 1 165 ? 37.888 183.231 28.777  1.00 173.61 ? 238 GLN A OE1 1 
ATOM   1305 N  NE2 . GLN A 1 165 ? 38.821 182.330 30.609  1.00 184.92 ? 238 GLN A NE2 1 
ATOM   1306 N  N   . ILE A 1 166 ? 42.225 180.671 24.804  1.00 165.58 ? 239 ILE A N   1 
ATOM   1307 C  CA  . ILE A 1 166 ? 42.409 179.346 24.226  1.00 138.94 ? 239 ILE A CA  1 
ATOM   1308 C  C   . ILE A 1 166 ? 43.167 178.402 25.145  1.00 144.65 ? 239 ILE A C   1 
ATOM   1309 O  O   . ILE A 1 166 ? 43.171 177.189 24.908  1.00 161.48 ? 239 ILE A O   1 
ATOM   1310 C  CB  . ILE A 1 166 ? 43.122 179.468 22.863  1.00 108.15 ? 239 ILE A CB  1 
ATOM   1311 C  CG1 . ILE A 1 166 ? 42.848 178.240 21.994  1.00 105.87 ? 239 ILE A CG1 1 
ATOM   1312 C  CG2 . ILE A 1 166 ? 44.616 179.666 23.057  1.00 154.45 ? 239 ILE A CG2 1 
ATOM   1313 C  CD1 . ILE A 1 166 ? 43.404 178.356 20.593  1.00 125.06 ? 239 ILE A CD1 1 
ATOM   1314 N  N   . HIS A 1 167 ? 43.802 178.924 26.197  1.00 133.66 ? 240 HIS A N   1 
ATOM   1315 C  CA  . HIS A 1 167 ? 44.477 178.074 27.169  1.00 133.91 ? 240 HIS A CA  1 
ATOM   1316 C  C   . HIS A 1 167 ? 43.504 177.264 28.014  1.00 142.82 ? 240 HIS A C   1 
ATOM   1317 O  O   . HIS A 1 167 ? 43.940 176.363 28.739  1.00 123.96 ? 240 HIS A O   1 
ATOM   1318 C  CB  . HIS A 1 167 ? 45.363 178.921 28.084  1.00 156.69 ? 240 HIS A CB  1 
ATOM   1319 C  CG  . HIS A 1 167 ? 44.596 179.759 29.059  1.00 132.41 ? 240 HIS A CG  1 
ATOM   1320 N  ND1 . HIS A 1 167 ? 43.975 180.936 28.702  1.00 121.53 ? 240 HIS A ND1 1 
ATOM   1321 C  CD2 . HIS A 1 167 ? 44.350 179.590 30.380  1.00 121.00 ? 240 HIS A CD2 1 
ATOM   1322 C  CE1 . HIS A 1 167 ? 43.379 181.456 29.761  1.00 165.24 ? 240 HIS A CE1 1 
ATOM   1323 N  NE2 . HIS A 1 167 ? 43.592 180.659 30.792  1.00 123.07 ? 240 HIS A NE2 1 
ATOM   1324 N  N   . ARG A 1 168 ? 42.209 177.562 27.941  1.00 138.57 ? 241 ARG A N   1 
ATOM   1325 C  CA  . ARG A 1 168 ? 41.195 176.883 28.734  1.00 140.17 ? 241 ARG A CA  1 
ATOM   1326 C  C   . ARG A 1 168 ? 40.618 175.659 28.033  1.00 143.19 ? 241 ARG A C   1 
ATOM   1327 O  O   . ARG A 1 168 ? 39.762 174.977 28.608  1.00 148.07 ? 241 ARG A O   1 
ATOM   1328 C  CB  . ARG A 1 168 ? 40.073 177.867 29.086  1.00 139.68 ? 241 ARG A CB  1 
ATOM   1329 C  CG  . ARG A 1 168 ? 39.326 177.549 30.370  1.00 170.85 ? 241 ARG A CG  1 
ATOM   1330 C  CD  . ARG A 1 168 ? 38.820 178.821 31.032  1.00 141.44 ? 241 ARG A CD  1 
ATOM   1331 N  NE  . ARG A 1 168 ? 38.040 178.543 32.234  1.00 185.23 ? 241 ARG A NE  1 
ATOM   1332 C  CZ  . ARG A 1 168 ? 37.720 179.456 33.144  1.00 228.61 ? 241 ARG A CZ  1 
ATOM   1333 N  NH1 . ARG A 1 168 ? 38.121 180.711 32.997  1.00 231.90 ? 241 ARG A NH1 1 
ATOM   1334 N  NH2 . ARG A 1 168 ? 37.005 179.114 34.207  1.00 246.34 ? 241 ARG A NH2 1 
ATOM   1335 N  N   . SER A 1 169 ? 41.068 175.359 26.815  1.00 150.06 ? 242 SER A N   1 
ATOM   1336 C  CA  . SER A 1 169 ? 40.598 174.206 26.063  1.00 146.99 ? 242 SER A CA  1 
ATOM   1337 C  C   . SER A 1 169 ? 41.785 173.358 25.630  1.00 120.43 ? 242 SER A C   1 
ATOM   1338 O  O   . SER A 1 169 ? 42.862 173.879 25.324  1.00 115.16 ? 242 SER A O   1 
ATOM   1339 C  CB  . SER A 1 169 ? 39.786 174.630 24.832  1.00 142.02 ? 242 SER A CB  1 
ATOM   1340 O  OG  . SER A 1 169 ? 40.597 175.335 23.909  1.00 128.27 ? 242 SER A OG  1 
ATOM   1341 N  N   . LYS A 1 170 ? 41.578 172.042 25.603  1.00 163.60 ? 243 LYS A N   1 
ATOM   1342 C  CA  . LYS A 1 170 ? 42.631 171.109 25.228  1.00 161.01 ? 243 LYS A CA  1 
ATOM   1343 C  C   . LYS A 1 170 ? 42.673 170.817 23.734  1.00 157.11 ? 243 LYS A C   1 
ATOM   1344 O  O   . LYS A 1 170 ? 43.621 170.172 23.274  1.00 155.20 ? 243 LYS A O   1 
ATOM   1345 C  CB  . LYS A 1 170 ? 42.470 169.791 25.996  1.00 193.79 ? 243 LYS A CB  1 
ATOM   1346 C  CG  . LYS A 1 170 ? 42.613 169.928 27.504  1.00 229.09 ? 243 LYS A CG  1 
ATOM   1347 C  CD  . LYS A 1 170 ? 42.604 168.569 28.191  1.00 229.73 ? 243 LYS A CD  1 
ATOM   1348 C  CE  . LYS A 1 170 ? 41.299 167.828 27.946  1.00 223.12 ? 243 LYS A CE  1 
ATOM   1349 N  NZ  . LYS A 1 170 ? 41.288 166.493 28.605  1.00 206.29 ? 243 LYS A NZ  1 
ATOM   1350 N  N   . GLY A 1 171 ? 41.686 171.264 22.975  1.00 167.74 ? 244 GLY A N   1 
ATOM   1351 C  CA  . GLY A 1 171 ? 41.652 171.018 21.549  1.00 164.22 ? 244 GLY A CA  1 
ATOM   1352 C  C   . GLY A 1 171 ? 40.220 170.904 21.067  1.00 163.47 ? 244 GLY A C   1 
ATOM   1353 O  O   . GLY A 1 171 ? 39.290 171.340 21.738  1.00 194.15 ? 244 GLY A O   1 
ATOM   1354 N  N   . LEU A 1 172 ? 40.073 170.313 19.877  1.00 159.11 ? 245 LEU A N   1 
ATOM   1355 C  CA  . LEU A 1 172 ? 38.742 170.059 19.338  1.00 104.25 ? 245 LEU A CA  1 
ATOM   1356 C  C   . LEU A 1 172 ? 37.934 169.141 20.244  1.00 113.80 ? 245 LEU A C   1 
ATOM   1357 O  O   . LEU A 1 172 ? 36.701 169.220 20.265  1.00 158.08 ? 245 LEU A O   1 
ATOM   1358 C  CB  . LEU A 1 172 ? 38.845 169.453 17.938  1.00 102.48 ? 245 LEU A CB  1 
ATOM   1359 C  CG  . LEU A 1 172 ? 39.328 170.354 16.800  1.00 100.32 ? 245 LEU A CG  1 
ATOM   1360 C  CD1 . LEU A 1 172 ? 39.403 169.569 15.500  1.00 108.61 ? 245 LEU A CD1 1 
ATOM   1361 C  CD2 . LEU A 1 172 ? 38.411 171.553 16.645  1.00 117.90 ? 245 LEU A CD2 1 
ATOM   1362 N  N   . GLN A 1 173 ? 38.607 168.263 20.993  1.00 148.96 ? 246 GLN A N   1 
ATOM   1363 C  CA  . GLN A 1 173 ? 37.901 167.307 21.839  1.00 151.03 ? 246 GLN A CA  1 
ATOM   1364 C  C   . GLN A 1 173 ? 37.090 168.018 22.917  1.00 182.43 ? 246 GLN A C   1 
ATOM   1365 O  O   . GLN A 1 173 ? 35.862 167.887 22.977  1.00 232.89 ? 246 GLN A O   1 
ATOM   1366 C  CB  . GLN A 1 173 ? 38.897 166.326 22.464  1.00 156.61 ? 246 GLN A CB  1 
ATOM   1367 C  CG  . GLN A 1 173 ? 39.705 165.512 21.457  1.00 165.53 ? 246 GLN A CG  1 
ATOM   1368 C  CD  . GLN A 1 173 ? 40.880 166.281 20.878  1.00 186.46 ? 246 GLN A CD  1 
ATOM   1369 O  OE1 . GLN A 1 173 ? 41.175 167.399 21.302  1.00 168.67 ? 246 GLN A OE1 1 
ATOM   1370 N  NE2 . GLN A 1 173 ? 41.556 165.684 19.903  1.00 192.97 ? 246 GLN A NE2 1 
ATOM   1371 N  N   . ASP A 1 174 ? 37.759 168.781 23.780  1.00 157.11 ? 247 ASP A N   1 
ATOM   1372 C  CA  . ASP A 1 174 ? 37.080 169.612 24.772  1.00 167.37 ? 247 ASP A CA  1 
ATOM   1373 C  C   . ASP A 1 174 ? 37.395 171.073 24.466  1.00 155.00 ? 247 ASP A C   1 
ATOM   1374 O  O   . ASP A 1 174 ? 38.491 171.555 24.768  1.00 167.56 ? 247 ASP A O   1 
ATOM   1375 C  CB  . ASP A 1 174 ? 37.520 169.221 26.183  1.00 173.63 ? 247 ASP A CB  1 
ATOM   1376 C  CG  . ASP A 1 174 ? 37.029 170.188 27.241  1.00 206.10 ? 247 ASP A CG  1 
ATOM   1377 O  OD1 . ASP A 1 174 ? 35.909 169.991 27.758  1.00 233.41 ? 247 ASP A OD1 1 
ATOM   1378 O  OD2 . ASP A 1 174 ? 37.770 171.140 27.564  1.00 199.54 ? 247 ASP A OD2 1 
ATOM   1379 N  N   . LEU A 1 175 ? 36.436 171.778 23.864  1.00 151.34 ? 248 LEU A N   1 
ATOM   1380 C  CA  . LEU A 1 175 ? 36.532 173.216 23.646  1.00 149.68 ? 248 LEU A CA  1 
ATOM   1381 C  C   . LEU A 1 175 ? 35.677 174.042 24.602  1.00 162.49 ? 248 LEU A C   1 
ATOM   1382 O  O   . LEU A 1 175 ? 35.748 175.274 24.562  1.00 149.89 ? 248 LEU A O   1 
ATOM   1383 C  CB  . LEU A 1 175 ? 36.171 173.551 22.193  1.00 119.62 ? 248 LEU A CB  1 
ATOM   1384 C  CG  . LEU A 1 175 ? 35.042 172.758 21.531  1.00 118.45 ? 248 LEU A CG  1 
ATOM   1385 C  CD1 . LEU A 1 175 ? 33.681 173.330 21.895  1.00 158.69 ? 248 LEU A CD1 1 
ATOM   1386 C  CD2 . LEU A 1 175 ? 35.227 172.713 20.020  1.00 114.73 ? 248 LEU A CD2 1 
ATOM   1387 N  N   . GLY A 1 176 ? 34.884 173.407 25.460  1.00 164.62 ? 249 GLY A N   1 
ATOM   1388 C  CA  . GLY A 1 176 ? 33.914 174.126 26.270  1.00 151.24 ? 249 GLY A CA  1 
ATOM   1389 C  C   . GLY A 1 176 ? 34.496 174.825 27.483  1.00 177.30 ? 249 GLY A C   1 
ATOM   1390 O  O   . GLY A 1 176 ? 35.564 174.445 27.963  1.00 221.70 ? 249 GLY A O   1 
ATOM   1391 N  N   . GLY A 1 177 ? 33.801 175.843 27.989  1.00 176.86 ? 250 GLY A N   1 
ATOM   1392 C  CA  . GLY A 1 177 ? 32.549 176.315 27.421  1.00 174.43 ? 250 GLY A CA  1 
ATOM   1393 C  C   . GLY A 1 177 ? 32.664 177.580 26.587  1.00 161.18 ? 250 GLY A C   1 
ATOM   1394 O  O   . GLY A 1 177 ? 33.690 177.827 25.957  1.00 155.16 ? 250 GLY A O   1 
ATOM   1395 N  N   . ILE A 1 178 ? 31.600 178.387 26.593  1.00 166.65 ? 251 ILE A N   1 
ATOM   1396 C  CA  . ILE A 1 178 ? 31.497 179.584 25.762  1.00 151.85 ? 251 ILE A CA  1 
ATOM   1397 C  C   . ILE A 1 178 ? 31.948 180.801 26.559  1.00 146.43 ? 251 ILE A C   1 
ATOM   1398 O  O   . ILE A 1 178 ? 31.711 180.894 27.769  1.00 159.53 ? 251 ILE A O   1 
ATOM   1399 C  CB  . ILE A 1 178 ? 30.054 179.762 25.247  1.00 131.61 ? 251 ILE A CB  1 
ATOM   1400 C  CG1 . ILE A 1 178 ? 29.577 178.495 24.534  1.00 146.05 ? 251 ILE A CG1 1 
ATOM   1401 C  CG2 . ILE A 1 178 ? 29.952 180.961 24.314  1.00 130.15 ? 251 ILE A CG2 1 
ATOM   1402 C  CD1 . ILE A 1 178 ? 28.175 178.604 23.973  1.00 157.51 ? 251 ILE A CD1 1 
ATOM   1403 N  N   . SER A 1 179 ? 32.609 181.737 25.878  1.00 131.53 ? 252 SER A N   1 
ATOM   1404 C  CA  . SER A 1 179 ? 32.976 183.020 26.465  1.00 139.20 ? 252 SER A CA  1 
ATOM   1405 C  C   . SER A 1 179 ? 31.872 184.036 26.199  1.00 158.19 ? 252 SER A C   1 
ATOM   1406 O  O   . SER A 1 179 ? 31.429 184.195 25.057  1.00 142.91 ? 252 SER A O   1 
ATOM   1407 C  CB  . SER A 1 179 ? 34.303 183.518 25.892  1.00 160.81 ? 252 SER A CB  1 
ATOM   1408 O  OG  . SER A 1 179 ? 35.354 182.611 26.172  1.00 223.33 ? 252 SER A OG  1 
ATOM   1409 N  N   . TRP A 1 180 ? 31.431 184.724 27.256  1.00 160.73 ? 253 TRP A N   1 
ATOM   1410 C  CA  . TRP A 1 180 ? 30.303 185.641 27.128  1.00 141.02 ? 253 TRP A CA  1 
ATOM   1411 C  C   . TRP A 1 180 ? 30.701 186.984 26.525  1.00 160.49 ? 253 TRP A C   1 
ATOM   1412 O  O   . TRP A 1 180 ? 29.874 187.631 25.873  1.00 180.76 ? 253 TRP A O   1 
ATOM   1413 C  CB  . TRP A 1 180 ? 29.641 185.855 28.491  1.00 141.05 ? 253 TRP A CB  1 
ATOM   1414 C  CG  . TRP A 1 180 ? 30.574 186.357 29.549  1.00 147.64 ? 253 TRP A CG  1 
ATOM   1415 C  CD1 . TRP A 1 180 ? 31.311 185.603 30.414  1.00 161.41 ? 253 TRP A CD1 1 
ATOM   1416 C  CD2 . TRP A 1 180 ? 30.867 187.725 29.860  1.00 151.44 ? 253 TRP A CD2 1 
ATOM   1417 N  NE1 . TRP A 1 180 ? 32.045 186.415 31.243  1.00 190.86 ? 253 TRP A NE1 1 
ATOM   1418 C  CE2 . TRP A 1 180 ? 31.790 187.723 30.923  1.00 171.75 ? 253 TRP A CE2 1 
ATOM   1419 C  CE3 . TRP A 1 180 ? 30.438 188.951 29.342  1.00 152.73 ? 253 TRP A CE3 1 
ATOM   1420 C  CZ2 . TRP A 1 180 ? 32.294 188.898 31.477  1.00 170.67 ? 253 TRP A CZ2 1 
ATOM   1421 C  CZ3 . TRP A 1 180 ? 30.939 190.116 29.894  1.00 155.28 ? 253 TRP A CZ3 1 
ATOM   1422 C  CH2 . TRP A 1 180 ? 31.857 190.081 30.950  1.00 158.37 ? 253 TRP A CH2 1 
ATOM   1423 N  N   . GLN A 1 181 ? 31.945 187.422 26.735  1.00 166.20 ? 254 GLN A N   1 
ATOM   1424 C  CA  . GLN A 1 181 ? 32.379 188.711 26.203  1.00 155.86 ? 254 GLN A CA  1 
ATOM   1425 C  C   . GLN A 1 181 ? 32.305 188.729 24.680  1.00 147.08 ? 254 GLN A C   1 
ATOM   1426 O  O   . GLN A 1 181 ? 31.681 189.618 24.084  1.00 157.81 ? 254 GLN A O   1 
ATOM   1427 C  CB  . GLN A 1 181 ? 33.799 189.025 26.676  1.00 175.26 ? 254 GLN A CB  1 
ATOM   1428 C  CG  . GLN A 1 181 ? 33.976 189.069 28.188  1.00 159.59 ? 254 GLN A CG  1 
ATOM   1429 C  CD  . GLN A 1 181 ? 34.289 187.710 28.788  1.00 160.55 ? 254 GLN A CD  1 
ATOM   1430 O  OE1 . GLN A 1 181 ? 33.948 186.672 28.220  1.00 165.47 ? 254 GLN A OE1 1 
ATOM   1431 N  NE2 . GLN A 1 181 ? 34.946 187.711 29.942  1.00 201.51 ? 254 GLN A NE2 1 
ATOM   1432 N  N   . LEU A 1 182 ? 32.939 187.750 24.030  1.00 143.01 ? 255 LEU A N   1 
ATOM   1433 C  CA  . LEU A 1 182 ? 32.877 187.662 22.577  1.00 161.11 ? 255 LEU A CA  1 
ATOM   1434 C  C   . LEU A 1 182 ? 31.463 187.390 22.085  1.00 160.57 ? 255 LEU A C   1 
ATOM   1435 O  O   . LEU A 1 182 ? 31.139 187.730 20.942  1.00 145.07 ? 255 LEU A O   1 
ATOM   1436 C  CB  . LEU A 1 182 ? 33.831 186.579 22.065  1.00 153.44 ? 255 LEU A CB  1 
ATOM   1437 C  CG  . LEU A 1 182 ? 35.316 186.942 21.962  1.00 132.42 ? 255 LEU A CG  1 
ATOM   1438 C  CD1 . LEU A 1 182 ? 35.499 188.240 21.187  1.00 144.75 ? 255 LEU A CD1 1 
ATOM   1439 C  CD2 . LEU A 1 182 ? 35.966 187.035 23.335  1.00 140.10 ? 255 LEU A CD2 1 
ATOM   1440 N  N   . ALA A 1 183 ? 30.618 186.782 22.920  1.00 159.35 ? 256 ALA A N   1 
ATOM   1441 C  CA  . ALA A 1 183 ? 29.210 186.645 22.569  1.00 159.39 ? 256 ALA A CA  1 
ATOM   1442 C  C   . ALA A 1 183 ? 28.527 188.005 22.519  1.00 181.48 ? 256 ALA A C   1 
ATOM   1443 O  O   . ALA A 1 183 ? 27.696 188.258 21.639  1.00 211.08 ? 256 ALA A O   1 
ATOM   1444 C  CB  . ALA A 1 183 ? 28.507 185.721 23.562  1.00 165.22 ? 256 ALA A CB  1 
ATOM   1445 N  N   . LEU A 1 184 ? 28.867 188.897 23.453  1.00 175.95 ? 257 LEU A N   1 
ATOM   1446 C  CA  . LEU A 1 184 ? 28.318 190.248 23.416  1.00 180.86 ? 257 LEU A CA  1 
ATOM   1447 C  C   . LEU A 1 184 ? 28.856 191.029 22.224  1.00 188.27 ? 257 LEU A C   1 
ATOM   1448 O  O   . LEU A 1 184 ? 28.108 191.764 21.567  1.00 167.61 ? 257 LEU A O   1 
ATOM   1449 C  CB  . LEU A 1 184 ? 28.627 190.979 24.723  1.00 141.04 ? 257 LEU A CB  1 
ATOM   1450 C  CG  . LEU A 1 184 ? 27.558 190.938 25.818  1.00 150.26 ? 257 LEU A CG  1 
ATOM   1451 C  CD1 . LEU A 1 184 ? 27.221 189.508 26.216  1.00 144.43 ? 257 LEU A CD1 1 
ATOM   1452 C  CD2 . LEU A 1 184 ? 28.007 191.741 27.030  1.00 188.92 ? 257 LEU A CD2 1 
ATOM   1453 N  N   . CYS A 1 185 ? 30.151 190.883 21.928  1.00 191.23 ? 258 CYS A N   1 
ATOM   1454 C  CA  . CYS A 1 185 ? 30.728 191.563 20.772  1.00 161.54 ? 258 CYS A CA  1 
ATOM   1455 C  C   . CYS A 1 185 ? 30.061 191.106 19.480  1.00 157.47 ? 258 CYS A C   1 
ATOM   1456 O  O   . CYS A 1 185 ? 29.640 191.929 18.655  1.00 182.04 ? 258 CYS A O   1 
ATOM   1457 C  CB  . CYS A 1 185 ? 32.236 191.317 20.716  1.00 151.97 ? 258 CYS A CB  1 
ATOM   1458 S  SG  . CYS A 1 185 ? 33.155 191.932 22.146  1.00 147.47 ? 258 CYS A SG  1 
ATOM   1459 N  N   . ILE A 1 186 ? 29.946 189.789 19.291  1.00 156.68 ? 259 ILE A N   1 
ATOM   1460 C  CA  . ILE A 1 186 ? 29.314 189.267 18.088  1.00 166.27 ? 259 ILE A CA  1 
ATOM   1461 C  C   . ILE A 1 186 ? 27.822 189.572 18.068  1.00 160.14 ? 259 ILE A C   1 
ATOM   1462 O  O   . ILE A 1 186 ? 27.213 189.589 16.993  1.00 134.55 ? 259 ILE A O   1 
ATOM   1463 C  CB  . ILE A 1 186 ? 29.577 187.755 17.953  1.00 154.84 ? 259 ILE A CB  1 
ATOM   1464 C  CG1 . ILE A 1 186 ? 29.399 187.312 16.501  1.00 118.29 ? 259 ILE A CG1 1 
ATOM   1465 C  CG2 . ILE A 1 186 ? 28.655 186.961 18.862  1.00 146.96 ? 259 ILE A CG2 1 
ATOM   1466 C  CD1 . ILE A 1 186 ? 29.585 185.834 16.296  1.00 115.76 ? 259 ILE A CD1 1 
ATOM   1467 N  N   . MET A 1 187 ? 27.212 189.817 19.232  1.00 159.66 ? 260 MET A N   1 
ATOM   1468 C  CA  . MET A 1 187 ? 25.833 190.292 19.246  1.00 163.99 ? 260 MET A CA  1 
ATOM   1469 C  C   . MET A 1 187 ? 25.746 191.726 18.742  1.00 168.13 ? 260 MET A C   1 
ATOM   1470 O  O   . MET A 1 187 ? 24.825 192.073 17.993  1.00 167.77 ? 260 MET A O   1 
ATOM   1471 C  CB  . MET A 1 187 ? 25.246 190.184 20.653  1.00 163.18 ? 260 MET A CB  1 
ATOM   1472 C  CG  . MET A 1 187 ? 24.651 188.827 20.978  1.00 148.76 ? 260 MET A CG  1 
ATOM   1473 S  SD  . MET A 1 187 ? 23.981 188.741 22.649  1.00 237.93 ? 260 MET A SD  1 
ATOM   1474 C  CE  . MET A 1 187 ? 22.732 190.023 22.577  1.00 154.00 ? 260 MET A CE  1 
ATOM   1475 N  N   . LEU A 1 188 ? 26.696 192.575 19.145  1.00 167.76 ? 261 LEU A N   1 
ATOM   1476 C  CA  . LEU A 1 188 ? 26.729 193.940 18.631  1.00 172.65 ? 261 LEU A CA  1 
ATOM   1477 C  C   . LEU A 1 188 ? 26.983 193.953 17.129  1.00 173.84 ? 261 LEU A C   1 
ATOM   1478 O  O   . LEU A 1 188 ? 26.436 194.794 16.405  1.00 164.41 ? 261 LEU A O   1 
ATOM   1479 C  CB  . LEU A 1 188 ? 27.796 194.752 19.365  1.00 149.41 ? 261 LEU A CB  1 
ATOM   1480 C  CG  . LEU A 1 188 ? 28.017 196.186 18.878  1.00 153.43 ? 261 LEU A CG  1 
ATOM   1481 C  CD1 . LEU A 1 188 ? 26.723 196.982 18.943  1.00 155.32 ? 261 LEU A CD1 1 
ATOM   1482 C  CD2 . LEU A 1 188 ? 29.110 196.867 19.687  1.00 183.77 ? 261 LEU A CD2 1 
ATOM   1483 N  N   . ILE A 1 189 ? 27.804 193.021 16.640  1.00 179.98 ? 262 ILE A N   1 
ATOM   1484 C  CA  . ILE A 1 189 ? 28.081 192.966 15.208  1.00 190.22 ? 262 ILE A CA  1 
ATOM   1485 C  C   . ILE A 1 189 ? 26.871 192.442 14.446  1.00 190.52 ? 262 ILE A C   1 
ATOM   1486 O  O   . ILE A 1 189 ? 26.501 192.981 13.397  1.00 182.00 ? 262 ILE A O   1 
ATOM   1487 C  CB  . ILE A 1 189 ? 29.334 192.118 14.945  1.00 164.39 ? 262 ILE A CB  1 
ATOM   1488 C  CG1 . ILE A 1 189 ? 30.544 192.798 15.574  1.00 155.41 ? 262 ILE A CG1 1 
ATOM   1489 C  CG2 . ILE A 1 189 ? 29.543 191.914 13.451  1.00 151.16 ? 262 ILE A CG2 1 
ATOM   1490 C  CD1 . ILE A 1 189 ? 31.780 191.990 15.489  1.00 170.02 ? 262 ILE A CD1 1 
ATOM   1491 N  N   . PHE A 1 190 ? 26.232 191.388 14.956  1.00 172.45 ? 263 PHE A N   1 
ATOM   1492 C  CA  . PHE A 1 190 ? 24.995 190.918 14.346  1.00 164.99 ? 263 PHE A CA  1 
ATOM   1493 C  C   . PHE A 1 190 ? 23.893 191.964 14.423  1.00 156.19 ? 263 PHE A C   1 
ATOM   1494 O  O   . PHE A 1 190 ? 22.931 191.896 13.650  1.00 169.27 ? 263 PHE A O   1 
ATOM   1495 C  CB  . PHE A 1 190 ? 24.545 189.615 15.006  1.00 151.98 ? 263 PHE A CB  1 
ATOM   1496 C  CG  . PHE A 1 190 ? 25.350 188.420 14.586  1.00 144.60 ? 263 PHE A CG  1 
ATOM   1497 C  CD1 . PHE A 1 190 ? 25.862 188.334 13.303  1.00 120.17 ? 263 PHE A CD1 1 
ATOM   1498 C  CD2 . PHE A 1 190 ? 25.601 187.388 15.471  1.00 153.75 ? 263 PHE A CD2 1 
ATOM   1499 C  CE1 . PHE A 1 190 ? 26.603 187.240 12.908  1.00 116.85 ? 263 PHE A CE1 1 
ATOM   1500 C  CE2 . PHE A 1 190 ? 26.345 186.293 15.081  1.00 145.05 ? 263 PHE A CE2 1 
ATOM   1501 C  CZ  . PHE A 1 190 ? 26.845 186.218 13.798  1.00 128.07 ? 263 PHE A CZ  1 
ATOM   1502 N  N   . THR A 1 191 ? 24.012 192.928 15.338  1.00 154.10 ? 264 THR A N   1 
ATOM   1503 C  CA  . THR A 1 191 ? 23.081 194.049 15.371  1.00 155.92 ? 264 THR A CA  1 
ATOM   1504 C  C   . THR A 1 191 ? 23.435 195.101 14.324  1.00 177.88 ? 264 THR A C   1 
ATOM   1505 O  O   . THR A 1 191 ? 22.541 195.674 13.692  1.00 171.82 ? 264 THR A O   1 
ATOM   1506 C  CB  . THR A 1 191 ? 23.062 194.676 16.765  1.00 147.48 ? 264 THR A CB  1 
ATOM   1507 O  OG1 . THR A 1 191 ? 22.824 193.658 17.744  1.00 165.92 ? 264 THR A OG1 1 
ATOM   1508 C  CG2 . THR A 1 191 ? 21.968 195.728 16.861  1.00 169.76 ? 264 THR A CG2 1 
ATOM   1509 N  N   . VAL A 1 192 ? 24.728 195.366 14.125  1.00 183.97 ? 265 VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 192 ? 25.117 196.397 13.168  1.00 179.33 ? 265 VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 192 ? 24.950 195.906 11.733  1.00 151.50 ? 265 VAL A C   1 
ATOM   1512 O  O   . VAL A 1 192 ? 24.746 196.715 10.819  1.00 147.27 ? 265 VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 192 ? 26.554 196.882 13.439  1.00 135.80 ? 265 VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 192 ? 27.579 195.888 12.916  1.00 141.97 ? 265 VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 192 ? 26.777 198.259 12.827  1.00 137.87 ? 265 VAL A CG2 1 
ATOM   1516 N  N   . ILE A 1 193 ? 25.027 194.593 11.501  1.00 141.06 ? 266 ILE A N   1 
ATOM   1517 C  CA  . ILE A 1 193 ? 24.722 194.072 10.173  1.00 171.12 ? 266 ILE A CA  1 
ATOM   1518 C  C   . ILE A 1 193 ? 23.221 193.964 9.948   1.00 152.45 ? 266 ILE A C   1 
ATOM   1519 O  O   . ILE A 1 193 ? 22.773 193.953 8.795   1.00 145.09 ? 266 ILE A O   1 
ATOM   1520 C  CB  . ILE A 1 193 ? 25.383 192.705 9.926   1.00 172.55 ? 266 ILE A CB  1 
ATOM   1521 C  CG1 . ILE A 1 193 ? 24.710 191.614 10.758  1.00 188.50 ? 266 ILE A CG1 1 
ATOM   1522 C  CG2 . ILE A 1 193 ? 26.874 192.760 10.231  1.00 135.67 ? 266 ILE A CG2 1 
ATOM   1523 C  CD1 . ILE A 1 193 ? 25.247 190.233 10.478  1.00 169.42 ? 266 ILE A CD1 1 
ATOM   1524 N  N   . TYR A 1 194 ? 22.430 193.890 11.020  1.00 163.12 ? 267 TYR A N   1 
ATOM   1525 C  CA  . TYR A 1 194 ? 20.981 193.806 10.875  1.00 167.94 ? 267 TYR A CA  1 
ATOM   1526 C  C   . TYR A 1 194 ? 20.413 195.104 10.316  1.00 172.75 ? 267 TYR A C   1 
ATOM   1527 O  O   . TYR A 1 194 ? 19.625 195.091 9.364   1.00 190.66 ? 267 TYR A O   1 
ATOM   1528 C  CB  . TYR A 1 194 ? 20.343 193.474 12.223  1.00 194.33 ? 267 TYR A CB  1 
ATOM   1529 C  CG  . TYR A 1 194 ? 18.844 193.273 12.173  1.00 201.76 ? 267 TYR A CG  1 
ATOM   1530 C  CD1 . TYR A 1 194 ? 18.230 192.740 11.048  1.00 178.35 ? 267 TYR A CD1 1 
ATOM   1531 C  CD2 . TYR A 1 194 ? 18.043 193.623 13.252  1.00 227.94 ? 267 TYR A CD2 1 
ATOM   1532 C  CE1 . TYR A 1 194 ? 16.862 192.556 11.000  1.00 192.88 ? 267 TYR A CE1 1 
ATOM   1533 C  CE2 . TYR A 1 194 ? 16.673 193.444 13.213  1.00 223.63 ? 267 TYR A CE2 1 
ATOM   1534 C  CZ  . TYR A 1 194 ? 16.088 192.910 12.085  1.00 213.38 ? 267 TYR A CZ  1 
ATOM   1535 O  OH  . TYR A 1 194 ? 14.724 192.729 12.040  1.00 225.45 ? 267 TYR A OH  1 
ATOM   1536 N  N   . PHE A 1 195 ? 20.808 196.240 10.895  1.00 174.11 ? 268 PHE A N   1 
ATOM   1537 C  CA  . PHE A 1 195 ? 20.281 197.527 10.459  1.00 204.38 ? 268 PHE A CA  1 
ATOM   1538 C  C   . PHE A 1 195 ? 20.858 197.980 9.125   1.00 196.99 ? 268 PHE A C   1 
ATOM   1539 O  O   . PHE A 1 195 ? 20.354 198.951 8.551   1.00 233.49 ? 268 PHE A O   1 
ATOM   1540 C  CB  . PHE A 1 195 ? 20.540 198.586 11.532  1.00 219.10 ? 268 PHE A CB  1 
ATOM   1541 C  CG  . PHE A 1 195 ? 19.808 198.334 12.820  1.00 209.09 ? 268 PHE A CG  1 
ATOM   1542 C  CD1 . PHE A 1 195 ? 18.680 197.528 12.846  1.00 191.07 ? 268 PHE A CD1 1 
ATOM   1543 C  CD2 . PHE A 1 195 ? 20.246 198.900 14.006  1.00 220.12 ? 268 PHE A CD2 1 
ATOM   1544 C  CE1 . PHE A 1 195 ? 18.005 197.291 14.028  1.00 196.02 ? 268 PHE A CE1 1 
ATOM   1545 C  CE2 . PHE A 1 195 ? 19.574 198.668 15.192  1.00 217.31 ? 268 PHE A CE2 1 
ATOM   1546 C  CZ  . PHE A 1 195 ? 18.453 197.862 15.202  1.00 217.36 ? 268 PHE A CZ  1 
ATOM   1547 N  N   . SER A 1 196 ? 21.892 197.311 8.624   1.00 155.83 ? 269 SER A N   1 
ATOM   1548 C  CA  . SER A 1 196 ? 22.454 197.596 7.310   1.00 165.81 ? 269 SER A CA  1 
ATOM   1549 C  C   . SER A 1 196 ? 21.879 196.701 6.220   1.00 182.67 ? 269 SER A C   1 
ATOM   1550 O  O   . SER A 1 196 ? 22.306 196.800 5.065   1.00 162.39 ? 269 SER A O   1 
ATOM   1551 C  CB  . SER A 1 196 ? 23.978 197.444 7.348   1.00 165.84 ? 269 SER A CB  1 
ATOM   1552 O  OG  . SER A 1 196 ? 24.534 198.169 8.430   1.00 170.98 ? 269 SER A OG  1 
ATOM   1553 N  N   . ILE A 1 197 ? 20.927 195.836 6.560   1.00 187.88 ? 270 ILE A N   1 
ATOM   1554 C  CA  . ILE A 1 197 ? 20.390 194.834 5.645   1.00 170.34 ? 270 ILE A CA  1 
ATOM   1555 C  C   . ILE A 1 197 ? 18.871 194.938 5.611   1.00 189.88 ? 270 ILE A C   1 
ATOM   1556 O  O   . ILE A 1 197 ? 18.276 195.096 4.540   1.00 216.84 ? 270 ILE A O   1 
ATOM   1557 C  CB  . ILE A 1 197 ? 20.847 193.415 6.022   1.00 167.05 ? 270 ILE A CB  1 
ATOM   1558 C  CG1 . ILE A 1 197 ? 22.350 193.265 5.787   1.00 188.26 ? 270 ILE A CG1 1 
ATOM   1559 C  CG2 . ILE A 1 197 ? 20.103 192.389 5.194   1.00 171.27 ? 270 ILE A CG2 1 
ATOM   1560 C  CD1 . ILE A 1 197 ? 22.775 193.529 4.359   1.00 200.32 ? 270 ILE A CD1 1 
ATOM   1561 N  N   . TRP A 1 198 ? 18.241 194.833 6.785   1.00 189.13 ? 271 TRP A N   1 
ATOM   1562 C  CA  . TRP A 1 198 ? 16.800 194.643 6.950   1.00 201.10 ? 271 TRP A CA  1 
ATOM   1563 C  C   . TRP A 1 198 ? 15.954 195.515 6.027   1.00 218.25 ? 271 TRP A C   1 
ATOM   1564 O  O   . TRP A 1 198 ? 14.901 195.075 5.552   1.00 207.50 ? 271 TRP A O   1 
ATOM   1565 C  CB  . TRP A 1 198 ? 16.399 194.911 8.405   1.00 171.80 ? 271 TRP A CB  1 
ATOM   1566 C  CG  . TRP A 1 198 ? 16.539 196.352 8.836   1.00 183.00 ? 271 TRP A CG  1 
ATOM   1567 C  CD1 . TRP A 1 198 ? 17.525 197.228 8.478   1.00 179.75 ? 271 TRP A CD1 1 
ATOM   1568 C  CD2 . TRP A 1 198 ? 15.652 197.082 9.695   1.00 182.00 ? 271 TRP A CD2 1 
ATOM   1569 N  NE1 . TRP A 1 198 ? 17.310 198.451 9.063   1.00 194.57 ? 271 TRP A NE1 1 
ATOM   1570 C  CE2 . TRP A 1 198 ? 16.167 198.389 9.815   1.00 191.12 ? 271 TRP A CE2 1 
ATOM   1571 C  CE3 . TRP A 1 198 ? 14.474 196.756 10.375  1.00 178.28 ? 271 TRP A CE3 1 
ATOM   1572 C  CZ2 . TRP A 1 198 ? 15.545 199.368 10.588  1.00 204.80 ? 271 TRP A CZ2 1 
ATOM   1573 C  CZ3 . TRP A 1 198 ? 13.859 197.731 11.142  1.00 206.20 ? 271 TRP A CZ3 1 
ATOM   1574 C  CH2 . TRP A 1 198 ? 14.395 199.020 11.241  1.00 222.81 ? 271 TRP A CH2 1 
ATOM   1575 N  N   . LYS A 1 199 ? 16.394 196.742 5.760   1.00 222.05 ? 272 LYS A N   1 
ATOM   1576 C  CA  . LYS A 1 199 ? 15.675 197.622 4.849   1.00 210.39 ? 272 LYS A CA  1 
ATOM   1577 C  C   . LYS A 1 199 ? 15.947 197.298 3.386   1.00 208.25 ? 272 LYS A C   1 
ATOM   1578 O  O   . LYS A 1 199 ? 15.422 197.989 2.507   1.00 221.93 ? 272 LYS A O   1 
ATOM   1579 C  CB  . LYS A 1 199 ? 16.027 199.084 5.131   1.00 212.25 ? 272 LYS A CB  1 
ATOM   1580 C  CG  . LYS A 1 199 ? 15.431 199.621 6.423   1.00 238.11 ? 272 LYS A CG  1 
ATOM   1581 C  CD  . LYS A 1 199 ? 15.735 201.099 6.607   1.00 254.94 ? 272 LYS A CD  1 
ATOM   1582 C  CE  . LYS A 1 199 ? 15.222 201.922 5.437   1.00 246.26 ? 272 LYS A CE  1 
ATOM   1583 N  NZ  . LYS A 1 199 ? 15.534 203.370 5.596   1.00 237.63 ? 272 LYS A NZ  1 
ATOM   1584 N  N   . GLY A 1 200 ? 16.750 196.276 3.108   1.00 184.87 ? 273 GLY A N   1 
ATOM   1585 C  CA  . GLY A 1 200 ? 17.013 195.861 1.748   1.00 186.43 ? 273 GLY A CA  1 
ATOM   1586 C  C   . GLY A 1 200 ? 18.277 196.480 1.185   1.00 204.91 ? 273 GLY A C   1 
ATOM   1587 O  O   . GLY A 1 200 ? 19.200 196.874 1.905   1.00 207.57 ? 273 GLY A O   1 
ATOM   1588 N  N   . VAL A 1 201 ? 18.311 196.561 -0.147  1.00 210.74 ? 274 VAL A N   1 
ATOM   1589 C  CA  . VAL A 1 201 ? 19.457 197.135 -0.842  1.00 198.35 ? 274 VAL A CA  1 
ATOM   1590 C  C   . VAL A 1 201 ? 19.552 198.642 -0.676  1.00 198.19 ? 274 VAL A C   1 
ATOM   1591 O  O   . VAL A 1 201 ? 20.549 199.241 -1.096  1.00 171.27 ? 274 VAL A O   1 
ATOM   1592 C  CB  . VAL A 1 201 ? 19.405 196.774 -2.339  1.00 184.77 ? 274 VAL A CB  1 
ATOM   1593 C  CG1 . VAL A 1 201 ? 19.502 195.267 -2.524  1.00 164.66 ? 274 VAL A CG1 1 
ATOM   1594 C  CG2 . VAL A 1 201 ? 18.133 197.314 -2.971  1.00 205.69 ? 274 VAL A CG2 1 
ATOM   1595 N  N   . LYS A 1 202 ? 18.540 199.273 -0.076  1.00 217.32 ? 275 LYS A N   1 
ATOM   1596 C  CA  . LYS A 1 202 ? 18.595 200.712 0.152   1.00 216.34 ? 275 LYS A CA  1 
ATOM   1597 C  C   . LYS A 1 202 ? 19.651 201.061 1.195   1.00 224.14 ? 275 LYS A C   1 
ATOM   1598 O  O   . LYS A 1 202 ? 20.501 201.929 0.966   1.00 239.65 ? 275 LYS A O   1 
ATOM   1599 C  CB  . LYS A 1 202 ? 17.220 201.226 0.579   1.00 211.97 ? 275 LYS A CB  1 
ATOM   1600 N  N   . THR A 1 203 ? 19.612 200.394 2.350   1.00 214.51 ? 276 THR A N   1 
ATOM   1601 C  CA  . THR A 1 203 ? 20.602 200.657 3.389   1.00 203.35 ? 276 THR A CA  1 
ATOM   1602 C  C   . THR A 1 203 ? 21.932 199.973 3.101   1.00 182.83 ? 276 THR A C   1 
ATOM   1603 O  O   . THR A 1 203 ? 22.988 200.526 3.426   1.00 182.57 ? 276 THR A O   1 
ATOM   1604 C  CB  . THR A 1 203 ? 20.074 200.212 4.754   1.00 210.62 ? 276 THR A CB  1 
ATOM   1605 O  OG1 . THR A 1 203 ? 19.449 198.929 4.636   1.00 222.23 ? 276 THR A OG1 1 
ATOM   1606 C  CG2 . THR A 1 203 ? 19.071 201.220 5.292   1.00 208.24 ? 276 THR A CG2 1 
ATOM   1607 N  N   . SER A 1 204 ? 21.906 198.783 2.495   1.00 179.24 ? 277 SER A N   1 
ATOM   1608 C  CA  . SER A 1 204 ? 23.148 198.072 2.215   1.00 174.01 ? 277 SER A CA  1 
ATOM   1609 C  C   . SER A 1 204 ? 24.030 198.824 1.229   1.00 180.95 ? 277 SER A C   1 
ATOM   1610 O  O   . SER A 1 204 ? 25.234 198.556 1.163   1.00 199.20 ? 277 SER A O   1 
ATOM   1611 C  CB  . SER A 1 204 ? 22.853 196.668 1.685   1.00 177.82 ? 277 SER A CB  1 
ATOM   1612 O  OG  . SER A 1 204 ? 22.387 196.713 0.349   1.00 191.41 ? 277 SER A OG  1 
ATOM   1613 N  N   . GLY A 1 205 ? 23.463 199.748 0.458   1.00 193.18 ? 278 GLY A N   1 
ATOM   1614 C  CA  . GLY A 1 205 ? 24.264 200.603 -0.394  1.00 191.85 ? 278 GLY A CA  1 
ATOM   1615 C  C   . GLY A 1 205 ? 24.672 201.885 0.302   1.00 175.24 ? 278 GLY A C   1 
ATOM   1616 O  O   . GLY A 1 205 ? 25.679 202.502 -0.057  1.00 163.86 ? 278 GLY A O   1 
ATOM   1617 N  N   . LYS A 1 206 ? 23.891 202.297 1.303   1.00 187.54 ? 279 LYS A N   1 
ATOM   1618 C  CA  . LYS A 1 206 ? 24.227 203.495 2.065   1.00 193.07 ? 279 LYS A CA  1 
ATOM   1619 C  C   . LYS A 1 206 ? 25.265 203.208 3.144   1.00 203.66 ? 279 LYS A C   1 
ATOM   1620 O  O   . LYS A 1 206 ? 26.193 204.000 3.341   1.00 224.69 ? 279 LYS A O   1 
ATOM   1621 C  CB  . LYS A 1 206 ? 22.965 204.097 2.683   1.00 194.75 ? 279 LYS A CB  1 
ATOM   1622 C  CG  . LYS A 1 206 ? 22.462 205.342 1.969   1.00 207.29 ? 279 LYS A CG  1 
ATOM   1623 C  CD  . LYS A 1 206 ? 22.225 205.079 0.490   1.00 212.54 ? 279 LYS A CD  1 
ATOM   1624 C  CE  . LYS A 1 206 ? 21.798 206.347 -0.231  1.00 226.78 ? 279 LYS A CE  1 
ATOM   1625 N  NZ  . LYS A 1 206 ? 21.587 206.121 -1.687  1.00 245.85 ? 279 LYS A NZ  1 
ATOM   1626 N  N   . VAL A 1 207 ? 25.125 202.085 3.853   1.00 194.43 ? 280 VAL A N   1 
ATOM   1627 C  CA  . VAL A 1 207 ? 26.084 201.748 4.900   1.00 164.34 ? 280 VAL A CA  1 
ATOM   1628 C  C   . VAL A 1 207 ? 27.434 201.386 4.295   1.00 171.49 ? 280 VAL A C   1 
ATOM   1629 O  O   . VAL A 1 207 ? 28.480 201.569 4.932   1.00 186.73 ? 280 VAL A O   1 
ATOM   1630 C  CB  . VAL A 1 207 ? 25.526 200.614 5.783   1.00 161.20 ? 280 VAL A CB  1 
ATOM   1631 C  CG1 . VAL A 1 207 ? 26.493 200.274 6.906   1.00 160.40 ? 280 VAL A CG1 1 
ATOM   1632 C  CG2 . VAL A 1 207 ? 24.171 201.007 6.353   1.00 178.51 ? 280 VAL A CG2 1 
ATOM   1633 N  N   . VAL A 1 208 ? 27.441 200.888 3.055   1.00 175.61 ? 281 VAL A N   1 
ATOM   1634 C  CA  . VAL A 1 208 ? 28.691 200.539 2.384   1.00 180.48 ? 281 VAL A CA  1 
ATOM   1635 C  C   . VAL A 1 208 ? 29.575 201.768 2.204   1.00 176.72 ? 281 VAL A C   1 
ATOM   1636 O  O   . VAL A 1 208 ? 30.808 201.658 2.190   1.00 161.33 ? 281 VAL A O   1 
ATOM   1637 C  CB  . VAL A 1 208 ? 28.383 199.839 1.042   1.00 164.65 ? 281 VAL A CB  1 
ATOM   1638 C  CG1 . VAL A 1 208 ? 29.345 200.280 -0.053  1.00 148.34 ? 281 VAL A CG1 1 
ATOM   1639 C  CG2 . VAL A 1 208 ? 28.431 198.328 1.215   1.00 150.78 ? 281 VAL A CG2 1 
ATOM   1640 N  N   . TRP A 1 209 ? 28.966 202.954 2.090   1.00 223.23 ? 282 TRP A N   1 
ATOM   1641 C  CA  . TRP A 1 209 ? 29.730 204.191 1.945   1.00 224.62 ? 282 TRP A CA  1 
ATOM   1642 C  C   . TRP A 1 209 ? 30.800 204.322 3.023   1.00 224.89 ? 282 TRP A C   1 
ATOM   1643 O  O   . TRP A 1 209 ? 31.951 204.667 2.735   1.00 222.78 ? 282 TRP A O   1 
ATOM   1644 C  CB  . TRP A 1 209 ? 28.785 205.394 1.989   1.00 258.29 ? 282 TRP A CB  1 
ATOM   1645 C  CG  . TRP A 1 209 ? 28.219 205.787 0.659   1.00 264.44 ? 282 TRP A CG  1 
ATOM   1646 C  CD1 . TRP A 1 209 ? 27.121 205.260 0.044   1.00 245.41 ? 282 TRP A CD1 1 
ATOM   1647 C  CD2 . TRP A 1 209 ? 28.719 206.805 -0.216  1.00 265.36 ? 282 TRP A CD2 1 
ATOM   1648 N  NE1 . TRP A 1 209 ? 26.910 205.883 -1.163  1.00 234.53 ? 282 TRP A NE1 1 
ATOM   1649 C  CE2 . TRP A 1 209 ? 27.878 206.836 -1.345  1.00 250.18 ? 282 TRP A CE2 1 
ATOM   1650 C  CE3 . TRP A 1 209 ? 29.799 207.692 -0.154  1.00 267.50 ? 282 TRP A CE3 1 
ATOM   1651 C  CZ2 . TRP A 1 209 ? 28.082 207.718 -2.404  1.00 254.31 ? 282 TRP A CZ2 1 
ATOM   1652 C  CZ3 . TRP A 1 209 ? 30.000 208.567 -1.206  1.00 269.27 ? 282 TRP A CZ3 1 
ATOM   1653 C  CH2 . TRP A 1 209 ? 29.146 208.573 -2.316  1.00 262.92 ? 282 TRP A CH2 1 
ATOM   1654 N  N   . VAL A 1 210 ? 30.435 204.050 4.276   1.00 139.22 ? 283 VAL A N   1 
ATOM   1655 C  CA  . VAL A 1 210 ? 31.392 204.182 5.369   1.00 160.86 ? 283 VAL A CA  1 
ATOM   1656 C  C   . VAL A 1 210 ? 32.307 202.965 5.448   1.00 164.91 ? 283 VAL A C   1 
ATOM   1657 O  O   . VAL A 1 210 ? 33.517 203.099 5.665   1.00 147.77 ? 283 VAL A O   1 
ATOM   1658 C  CB  . VAL A 1 210 ? 30.648 204.419 6.695   1.00 151.28 ? 283 VAL A CB  1 
ATOM   1659 C  CG1 . VAL A 1 210 ? 31.638 204.642 7.828   1.00 165.19 ? 283 VAL A CG1 1 
ATOM   1660 C  CG2 . VAL A 1 210 ? 29.700 205.601 6.566   1.00 180.84 ? 283 VAL A CG2 1 
ATOM   1661 N  N   . THR A 1 211 ? 31.752 201.764 5.267   1.00 185.80 ? 284 THR A N   1 
ATOM   1662 C  CA  . THR A 1 211 ? 32.531 200.549 5.489   1.00 184.29 ? 284 THR A CA  1 
ATOM   1663 C  C   . THR A 1 211 ? 33.560 200.315 4.390   1.00 177.21 ? 284 THR A C   1 
ATOM   1664 O  O   . THR A 1 211 ? 34.608 199.712 4.647   1.00 189.87 ? 284 THR A O   1 
ATOM   1665 C  CB  . THR A 1 211 ? 31.602 199.339 5.599   1.00 174.19 ? 284 THR A CB  1 
ATOM   1666 O  OG1 . THR A 1 211 ? 30.958 199.112 4.340   1.00 166.48 ? 284 THR A OG1 1 
ATOM   1667 C  CG2 . THR A 1 211 ? 30.546 199.576 6.669   1.00 164.95 ? 284 THR A CG2 1 
ATOM   1668 N  N   . ALA A 1 212 ? 33.278 200.754 3.162   1.00 145.98 ? 285 ALA A N   1 
ATOM   1669 C  CA  . ALA A 1 212 ? 34.222 200.545 2.069   1.00 142.21 ? 285 ALA A CA  1 
ATOM   1670 C  C   . ALA A 1 212 ? 35.336 201.587 2.067   1.00 170.56 ? 285 ALA A C   1 
ATOM   1671 O  O   . ALA A 1 212 ? 36.497 201.256 1.801   1.00 188.12 ? 285 ALA A O   1 
ATOM   1672 C  CB  . ALA A 1 212 ? 33.486 200.551 0.729   1.00 180.03 ? 285 ALA A CB  1 
ATOM   1673 N  N   . THR A 1 213 ? 35.004 202.847 2.356   1.00 181.54 ? 286 THR A N   1 
ATOM   1674 C  CA  . THR A 1 213 ? 35.970 203.931 2.206   1.00 187.76 ? 286 THR A CA  1 
ATOM   1675 C  C   . THR A 1 213 ? 36.952 204.014 3.370   1.00 180.86 ? 286 THR A C   1 
ATOM   1676 O  O   . THR A 1 213 ? 38.117 204.372 3.162   1.00 163.59 ? 286 THR A O   1 
ATOM   1677 C  CB  . THR A 1 213 ? 35.239 205.265 2.049   1.00 181.50 ? 286 THR A CB  1 
ATOM   1678 O  OG1 . THR A 1 213 ? 34.315 205.437 3.131   1.00 197.78 ? 286 THR A OG1 1 
ATOM   1679 C  CG2 . THR A 1 213 ? 34.483 205.304 0.729   1.00 171.08 ? 286 THR A CG2 1 
ATOM   1680 N  N   . PHE A 1 214 ? 36.508 203.701 4.586   1.00 185.08 ? 287 PHE A N   1 
ATOM   1681 C  CA  . PHE A 1 214 ? 37.377 203.844 5.753   1.00 196.15 ? 287 PHE A CA  1 
ATOM   1682 C  C   . PHE A 1 214 ? 38.654 203.008 5.688   1.00 189.35 ? 287 PHE A C   1 
ATOM   1683 O  O   . PHE A 1 214 ? 39.721 203.546 6.037   1.00 179.73 ? 287 PHE A O   1 
ATOM   1684 C  CB  . PHE A 1 214 ? 36.582 203.518 7.026   1.00 186.60 ? 287 PHE A CB  1 
ATOM   1685 C  CG  . PHE A 1 214 ? 37.394 203.608 8.286   1.00 175.71 ? 287 PHE A CG  1 
ATOM   1686 C  CD1 . PHE A 1 214 ? 37.636 204.833 8.884   1.00 185.54 ? 287 PHE A CD1 1 
ATOM   1687 C  CD2 . PHE A 1 214 ? 37.911 202.467 8.877   1.00 178.27 ? 287 PHE A CD2 1 
ATOM   1688 C  CE1 . PHE A 1 214 ? 38.382 204.919 10.044  1.00 196.70 ? 287 PHE A CE1 1 
ATOM   1689 C  CE2 . PHE A 1 214 ? 38.657 202.547 10.036  1.00 178.21 ? 287 PHE A CE2 1 
ATOM   1690 C  CZ  . PHE A 1 214 ? 38.893 203.774 10.620  1.00 187.68 ? 287 PHE A CZ  1 
ATOM   1691 N  N   . PRO A 1 215 ? 38.635 201.730 5.283   1.00 164.33 ? 288 PRO A N   1 
ATOM   1692 C  CA  . PRO A 1 215 ? 39.891 200.961 5.273   1.00 160.40 ? 288 PRO A CA  1 
ATOM   1693 C  C   . PRO A 1 215 ? 40.976 201.561 4.400   1.00 159.93 ? 288 PRO A C   1 
ATOM   1694 O  O   . PRO A 1 215 ? 42.160 201.356 4.685   1.00 146.79 ? 288 PRO A O   1 
ATOM   1695 C  CB  . PRO A 1 215 ? 39.453 199.584 4.756   1.00 136.79 ? 288 PRO A CB  1 
ATOM   1696 C  CG  . PRO A 1 215 ? 38.027 199.486 5.131   1.00 134.42 ? 288 PRO A CG  1 
ATOM   1697 C  CD  . PRO A 1 215 ? 37.483 200.871 4.956   1.00 144.62 ? 288 PRO A CD  1 
ATOM   1698 N  N   . TYR A 1 216 ? 40.618 202.295 3.344   1.00 160.00 ? 289 TYR A N   1 
ATOM   1699 C  CA  . TYR A 1 216 ? 41.643 202.915 2.510   1.00 151.84 ? 289 TYR A CA  1 
ATOM   1700 C  C   . TYR A 1 216 ? 42.290 204.098 3.219   1.00 178.91 ? 289 TYR A C   1 
ATOM   1701 O  O   . TYR A 1 216 ? 43.506 204.303 3.115   1.00 195.95 ? 289 TYR A O   1 
ATOM   1702 C  CB  . TYR A 1 216 ? 41.042 203.339 1.171   1.00 139.08 ? 289 TYR A CB  1 
ATOM   1703 C  CG  . TYR A 1 216 ? 40.673 202.169 0.288   1.00 146.22 ? 289 TYR A CG  1 
ATOM   1704 C  CD1 . TYR A 1 216 ? 39.440 201.541 0.412   1.00 164.33 ? 289 TYR A CD1 1 
ATOM   1705 C  CD2 . TYR A 1 216 ? 41.562 201.686 -0.662  1.00 149.87 ? 289 TYR A CD2 1 
ATOM   1706 C  CE1 . TYR A 1 216 ? 39.101 200.468 -0.390  1.00 137.51 ? 289 TYR A CE1 1 
ATOM   1707 C  CE2 . TYR A 1 216 ? 41.232 200.615 -1.468  1.00 143.41 ? 289 TYR A CE2 1 
ATOM   1708 C  CZ  . TYR A 1 216 ? 40.001 200.009 -1.328  1.00 136.81 ? 289 TYR A CZ  1 
ATOM   1709 O  OH  . TYR A 1 216 ? 39.668 198.942 -2.130  1.00 184.69 ? 289 TYR A OH  1 
ATOM   1710 N  N   . ILE A 1 217 ? 41.495 204.884 3.948   1.00 133.96 ? 290 ILE A N   1 
ATOM   1711 C  CA  . ILE A 1 217 ? 42.052 205.979 4.738   1.00 148.89 ? 290 ILE A CA  1 
ATOM   1712 C  C   . ILE A 1 217 ? 42.957 205.429 5.833   1.00 158.58 ? 290 ILE A C   1 
ATOM   1713 O  O   . ILE A 1 217 ? 44.076 205.915 6.046   1.00 147.02 ? 290 ILE A O   1 
ATOM   1714 C  CB  . ILE A 1 217 ? 40.923 206.848 5.322   1.00 177.79 ? 290 ILE A CB  1 
ATOM   1715 C  CG1 . ILE A 1 217 ? 40.069 207.438 4.198   1.00 179.32 ? 290 ILE A CG1 1 
ATOM   1716 C  CG2 . ILE A 1 217 ? 41.497 207.950 6.200   1.00 153.70 ? 290 ILE A CG2 1 
ATOM   1717 C  CD1 . ILE A 1 217 ? 38.902 208.268 4.689   1.00 146.22 ? 290 ILE A CD1 1 
ATOM   1718 N  N   . ALA A 1 218 ? 42.487 204.395 6.538   1.00 170.66 ? 291 ALA A N   1 
ATOM   1719 C  CA  . ALA A 1 218 ? 43.302 203.785 7.584   1.00 162.16 ? 291 ALA A CA  1 
ATOM   1720 C  C   . ALA A 1 218 ? 44.584 203.191 7.010   1.00 154.32 ? 291 ALA A C   1 
ATOM   1721 O  O   . ALA A 1 218 ? 45.651 203.288 7.627   1.00 148.08 ? 291 ALA A O   1 
ATOM   1722 C  CB  . ALA A 1 218 ? 42.497 202.716 8.322   1.00 160.24 ? 291 ALA A CB  1 
ATOM   1723 N  N   . LEU A 1 219 ? 44.499 202.576 5.828   1.00 138.13 ? 292 LEU A N   1 
ATOM   1724 C  CA  . LEU A 1 219 ? 45.693 202.034 5.186   1.00 158.26 ? 292 LEU A CA  1 
ATOM   1725 C  C   . LEU A 1 219 ? 46.644 203.138 4.747   1.00 176.23 ? 292 LEU A C   1 
ATOM   1726 O  O   . LEU A 1 219 ? 47.860 202.923 4.704   1.00 189.25 ? 292 LEU A O   1 
ATOM   1727 C  CB  . LEU A 1 219 ? 45.307 201.164 3.989   1.00 154.59 ? 292 LEU A CB  1 
ATOM   1728 C  CG  . LEU A 1 219 ? 44.759 199.762 4.271   1.00 146.54 ? 292 LEU A CG  1 
ATOM   1729 C  CD1 . LEU A 1 219 ? 44.358 199.076 2.975   1.00 126.40 ? 292 LEU A CD1 1 
ATOM   1730 C  CD2 . LEU A 1 219 ? 45.766 198.922 5.036   1.00 158.27 ? 292 LEU A CD2 1 
ATOM   1731 N  N   . SER A 1 220 ? 46.116 204.317 4.408   1.00 165.59 ? 293 SER A N   1 
ATOM   1732 C  CA  . SER A 1 220 ? 46.989 205.437 4.075   1.00 163.25 ? 293 SER A CA  1 
ATOM   1733 C  C   . SER A 1 220 ? 47.705 205.960 5.314   1.00 164.07 ? 293 SER A C   1 
ATOM   1734 O  O   . SER A 1 220 ? 48.914 206.228 5.273   1.00 141.73 ? 293 SER A O   1 
ATOM   1735 C  CB  . SER A 1 220 ? 46.183 206.551 3.406   1.00 149.35 ? 293 SER A CB  1 
ATOM   1736 O  OG  . SER A 1 220 ? 47.017 207.640 3.050   1.00 190.06 ? 293 SER A OG  1 
ATOM   1737 N  N   . VAL A 1 221 ? 46.979 206.103 6.426   1.00 153.64 ? 294 VAL A N   1 
ATOM   1738 C  CA  . VAL A 1 221 ? 47.598 206.569 7.666   1.00 175.56 ? 294 VAL A CA  1 
ATOM   1739 C  C   . VAL A 1 221 ? 48.659 205.579 8.133   1.00 169.32 ? 294 VAL A C   1 
ATOM   1740 O  O   . VAL A 1 221 ? 49.774 205.963 8.506   1.00 153.74 ? 294 VAL A O   1 
ATOM   1741 C  CB  . VAL A 1 221 ? 46.527 206.801 8.747   1.00 178.02 ? 294 VAL A CB  1 
ATOM   1742 C  CG1 . VAL A 1 221 ? 47.175 207.240 10.052  1.00 211.01 ? 294 VAL A CG1 1 
ATOM   1743 C  CG2 . VAL A 1 221 ? 45.515 207.834 8.278   1.00 158.91 ? 294 VAL A CG2 1 
ATOM   1744 N  N   . LEU A 1 222 ? 48.328 204.285 8.111   1.00 174.16 ? 295 LEU A N   1 
ATOM   1745 C  CA  . LEU A 1 222 ? 49.291 203.262 8.501   1.00 185.31 ? 295 LEU A CA  1 
ATOM   1746 C  C   . LEU A 1 222 ? 50.431 203.129 7.500   1.00 199.47 ? 295 LEU A C   1 
ATOM   1747 O  O   . LEU A 1 222 ? 51.507 202.644 7.867   1.00 216.30 ? 295 LEU A O   1 
ATOM   1748 C  CB  . LEU A 1 222 ? 48.587 201.915 8.671   1.00 190.89 ? 295 LEU A CB  1 
ATOM   1749 C  CG  . LEU A 1 222 ? 47.557 201.823 9.799   1.00 193.35 ? 295 LEU A CG  1 
ATOM   1750 C  CD1 . LEU A 1 222 ? 46.863 200.471 9.781   1.00 171.59 ? 295 LEU A CD1 1 
ATOM   1751 C  CD2 . LEU A 1 222 ? 48.215 202.075 11.147  1.00 208.10 ? 295 LEU A CD2 1 
ATOM   1752 N  N   . LEU A 1 223 ? 50.221 203.542 6.249   1.00 173.73 ? 296 LEU A N   1 
ATOM   1753 C  CA  . LEU A 1 223 ? 51.295 203.509 5.263   1.00 160.07 ? 296 LEU A CA  1 
ATOM   1754 C  C   . LEU A 1 223 ? 52.289 204.639 5.499   1.00 164.27 ? 296 LEU A C   1 
ATOM   1755 O  O   . LEU A 1 223 ? 53.506 204.420 5.480   1.00 135.42 ? 296 LEU A O   1 
ATOM   1756 C  CB  . LEU A 1 223 ? 50.717 203.588 3.850   1.00 148.63 ? 296 LEU A CB  1 
ATOM   1757 C  CG  . LEU A 1 223 ? 51.739 203.572 2.710   1.00 158.00 ? 296 LEU A CG  1 
ATOM   1758 C  CD1 . LEU A 1 223 ? 52.492 202.250 2.678   1.00 131.29 ? 296 LEU A CD1 1 
ATOM   1759 C  CD2 . LEU A 1 223 ? 51.067 203.845 1.373   1.00 159.70 ? 296 LEU A CD2 1 
ATOM   1760 N  N   . VAL A 1 224 ? 51.786 205.857 5.722   1.00 162.74 ? 297 VAL A N   1 
ATOM   1761 C  CA  . VAL A 1 224 ? 52.673 206.971 6.045   1.00 168.30 ? 297 VAL A CA  1 
ATOM   1762 C  C   . VAL A 1 224 ? 53.358 206.735 7.383   1.00 160.09 ? 297 VAL A C   1 
ATOM   1763 O  O   . VAL A 1 224 ? 54.510 207.142 7.583   1.00 147.21 ? 297 VAL A O   1 
ATOM   1764 C  CB  . VAL A 1 224 ? 51.889 208.299 6.032   1.00 175.57 ? 297 VAL A CB  1 
ATOM   1765 C  CG1 . VAL A 1 224 ? 52.815 209.474 6.322   1.00 160.75 ? 297 VAL A CG1 1 
ATOM   1766 C  CG2 . VAL A 1 224 ? 51.191 208.488 4.695   1.00 190.69 ? 297 VAL A CG2 1 
ATOM   1767 N  N   . ARG A 1 225 ? 52.675 206.066 8.314   1.00 180.78 ? 298 ARG A N   1 
ATOM   1768 C  CA  . ARG A 1 225 ? 53.284 205.755 9.603   1.00 191.02 ? 298 ARG A CA  1 
ATOM   1769 C  C   . ARG A 1 225 ? 54.376 204.702 9.456   1.00 183.61 ? 298 ARG A C   1 
ATOM   1770 O  O   . ARG A 1 225 ? 55.467 204.842 10.021  1.00 194.09 ? 298 ARG A O   1 
ATOM   1771 C  CB  . ARG A 1 225 ? 52.213 205.285 10.588  1.00 185.70 ? 298 ARG A CB  1 
ATOM   1772 C  CG  . ARG A 1 225 ? 52.752 204.773 11.921  1.00 191.88 ? 298 ARG A CG  1 
ATOM   1773 C  CD  . ARG A 1 225 ? 53.344 205.892 12.769  1.00 215.41 ? 298 ARG A CD  1 
ATOM   1774 N  NE  . ARG A 1 225 ? 54.740 206.168 12.444  1.00 209.07 ? 298 ARG A NE  1 
ATOM   1775 C  CZ  . ARG A 1 225 ? 55.465 207.124 13.015  1.00 209.41 ? 298 ARG A CZ  1 
ATOM   1776 N  NH1 . ARG A 1 225 ? 54.926 207.903 13.943  1.00 213.66 ? 298 ARG A NH1 1 
ATOM   1777 N  NH2 . ARG A 1 225 ? 56.729 207.303 12.658  1.00 209.37 ? 298 ARG A NH2 1 
ATOM   1778 N  N   . GLY A 1 226 ? 54.099 203.638 8.699   1.00 160.02 ? 299 GLY A N   1 
ATOM   1779 C  CA  . GLY A 1 226 ? 55.077 202.576 8.540   1.00 173.32 ? 299 GLY A CA  1 
ATOM   1780 C  C   . GLY A 1 226 ? 56.263 202.971 7.685   1.00 176.95 ? 299 GLY A C   1 
ATOM   1781 O  O   . GLY A 1 226 ? 57.360 202.428 7.853   1.00 155.20 ? 299 GLY A O   1 
ATOM   1782 N  N   . ALA A 1 227 ? 56.068 203.913 6.758   1.00 166.30 ? 300 ALA A N   1 
ATOM   1783 C  CA  . ALA A 1 227 ? 57.173 204.361 5.918   1.00 154.11 ? 300 ALA A CA  1 
ATOM   1784 C  C   . ALA A 1 227 ? 58.188 205.175 6.710   1.00 188.55 ? 300 ALA A C   1 
ATOM   1785 O  O   . ALA A 1 227 ? 59.382 205.158 6.388   1.00 192.35 ? 300 ALA A O   1 
ATOM   1786 C  CB  . ALA A 1 227 ? 56.640 205.176 4.740   1.00 144.23 ? 300 ALA A CB  1 
ATOM   1787 N  N   . THR A 1 228 ? 57.739 205.886 7.744   1.00 208.49 ? 301 THR A N   1 
ATOM   1788 C  CA  . THR A 1 228 ? 58.633 206.684 8.573   1.00 214.26 ? 301 THR A CA  1 
ATOM   1789 C  C   . THR A 1 228 ? 59.359 205.862 9.630   1.00 208.64 ? 301 THR A C   1 
ATOM   1790 O  O   . THR A 1 228 ? 60.268 206.388 10.281  1.00 211.28 ? 301 THR A O   1 
ATOM   1791 C  CB  . THR A 1 228 ? 57.855 207.812 9.256   1.00 237.29 ? 301 THR A CB  1 
ATOM   1792 O  OG1 . THR A 1 228 ? 56.759 207.259 9.996   1.00 251.40 ? 301 THR A OG1 1 
ATOM   1793 C  CG2 . THR A 1 228 ? 57.324 208.795 8.224   1.00 235.22 ? 301 THR A CG2 1 
ATOM   1794 N  N   . LEU A 1 229 ? 58.985 204.601 9.816   1.00 191.13 ? 302 LEU A N   1 
ATOM   1795 C  CA  . LEU A 1 229 ? 59.635 203.778 10.822  1.00 189.78 ? 302 LEU A CA  1 
ATOM   1796 C  C   . LEU A 1 229 ? 61.024 203.360 10.344  1.00 195.06 ? 302 LEU A C   1 
ATOM   1797 O  O   . LEU A 1 229 ? 61.206 203.035 9.166   1.00 191.25 ? 302 LEU A O   1 
ATOM   1798 C  CB  . LEU A 1 229 ? 58.794 202.541 11.130  1.00 185.01 ? 302 LEU A CB  1 
ATOM   1799 C  CG  . LEU A 1 229 ? 57.385 202.804 11.663  1.00 191.80 ? 302 LEU A CG  1 
ATOM   1800 C  CD1 . LEU A 1 229 ? 56.647 201.496 11.898  1.00 208.20 ? 302 LEU A CD1 1 
ATOM   1801 C  CD2 . LEU A 1 229 ? 57.438 203.632 12.937  1.00 195.51 ? 302 LEU A CD2 1 
ATOM   1802 N  N   . PRO A 1 230 ? 62.019 203.358 11.228  1.00 198.59 ? 303 PRO A N   1 
ATOM   1803 C  CA  . PRO A 1 230 ? 63.368 202.961 10.816  1.00 200.60 ? 303 PRO A CA  1 
ATOM   1804 C  C   . PRO A 1 230 ? 63.455 201.467 10.555  1.00 199.70 ? 303 PRO A C   1 
ATOM   1805 O  O   . PRO A 1 230 ? 62.777 200.657 11.193  1.00 178.44 ? 303 PRO A O   1 
ATOM   1806 C  CB  . PRO A 1 230 ? 64.237 203.368 12.010  1.00 200.05 ? 303 PRO A CB  1 
ATOM   1807 C  CG  . PRO A 1 230 ? 63.307 203.306 13.174  1.00 199.91 ? 303 PRO A CG  1 
ATOM   1808 C  CD  . PRO A 1 230 ? 61.963 203.738 12.650  1.00 195.53 ? 303 PRO A CD  1 
ATOM   1809 N  N   . GLY A 1 231 ? 64.307 201.108 9.598   1.00 213.13 ? 304 GLY A N   1 
ATOM   1810 C  CA  . GLY A 1 231 ? 64.460 199.722 9.212   1.00 184.03 ? 304 GLY A CA  1 
ATOM   1811 C  C   . GLY A 1 231 ? 63.268 199.116 8.510   1.00 149.82 ? 304 GLY A C   1 
ATOM   1812 O  O   . GLY A 1 231 ? 63.192 197.889 8.403   1.00 147.06 ? 304 GLY A O   1 
ATOM   1813 N  N   . ALA A 1 232 ? 62.330 199.935 8.027   1.00 154.16 ? 305 ALA A N   1 
ATOM   1814 C  CA  . ALA A 1 232 ? 61.158 199.398 7.345   1.00 181.28 ? 305 ALA A CA  1 
ATOM   1815 C  C   . ALA A 1 232 ? 61.496 198.831 5.973   1.00 155.84 ? 305 ALA A C   1 
ATOM   1816 O  O   . ALA A 1 232 ? 60.674 198.114 5.393   1.00 144.56 ? 305 ALA A O   1 
ATOM   1817 C  CB  . ALA A 1 232 ? 60.081 200.477 7.216   1.00 184.85 ? 305 ALA A CB  1 
ATOM   1818 N  N   . TRP A 1 233 ? 62.684 199.131 5.446   1.00 141.73 ? 306 TRP A N   1 
ATOM   1819 C  CA  . TRP A 1 233 ? 63.082 198.618 4.142   1.00 158.31 ? 306 TRP A CA  1 
ATOM   1820 C  C   . TRP A 1 233 ? 63.336 197.117 4.149   1.00 172.69 ? 306 TRP A C   1 
ATOM   1821 O  O   . TRP A 1 233 ? 63.423 196.519 3.073   1.00 191.43 ? 306 TRP A O   1 
ATOM   1822 C  CB  . TRP A 1 233 ? 64.333 199.350 3.651   1.00 158.47 ? 306 TRP A CB  1 
ATOM   1823 C  CG  . TRP A 1 233 ? 65.527 199.152 4.532   1.00 155.65 ? 306 TRP A CG  1 
ATOM   1824 C  CD1 . TRP A 1 233 ? 65.926 199.950 5.563   1.00 189.59 ? 306 TRP A CD1 1 
ATOM   1825 C  CD2 . TRP A 1 233 ? 66.478 198.083 4.459   1.00 157.38 ? 306 TRP A CD2 1 
ATOM   1826 N  NE1 . TRP A 1 233 ? 67.067 199.445 6.138   1.00 212.72 ? 306 TRP A NE1 1 
ATOM   1827 C  CE2 . TRP A 1 233 ? 67.426 198.298 5.479   1.00 188.90 ? 306 TRP A CE2 1 
ATOM   1828 C  CE3 . TRP A 1 233 ? 66.620 196.965 3.632   1.00 156.36 ? 306 TRP A CE3 1 
ATOM   1829 C  CZ2 . TRP A 1 233 ? 68.501 197.437 5.693   1.00 180.61 ? 306 TRP A CZ2 1 
ATOM   1830 C  CZ3 . TRP A 1 233 ? 67.686 196.111 3.846   1.00 156.90 ? 306 TRP A CZ3 1 
ATOM   1831 C  CH2 . TRP A 1 233 ? 68.613 196.352 4.868   1.00 168.88 ? 306 TRP A CH2 1 
ATOM   1832 N  N   . ARG A 1 234 ? 63.466 196.497 5.324   1.00 168.29 ? 307 ARG A N   1 
ATOM   1833 C  CA  . ARG A 1 234 ? 63.709 195.059 5.372   1.00 157.15 ? 307 ARG A CA  1 
ATOM   1834 C  C   . ARG A 1 234 ? 62.456 194.275 5.007   1.00 155.46 ? 307 ARG A C   1 
ATOM   1835 O  O   . ARG A 1 234 ? 62.530 193.285 4.270   1.00 178.87 ? 307 ARG A O   1 
ATOM   1836 C  CB  . ARG A 1 234 ? 64.213 194.658 6.757   1.00 155.83 ? 307 ARG A CB  1 
ATOM   1837 C  CG  . ARG A 1 234 ? 65.477 195.380 7.168   1.00 167.12 ? 307 ARG A CG  1 
ATOM   1838 C  CD  . ARG A 1 234 ? 65.993 194.893 8.505   1.00 159.16 ? 307 ARG A CD  1 
ATOM   1839 N  NE  . ARG A 1 234 ? 67.165 195.654 8.919   1.00 174.34 ? 307 ARG A NE  1 
ATOM   1840 C  CZ  . ARG A 1 234 ? 68.408 195.369 8.548   1.00 183.23 ? 307 ARG A CZ  1 
ATOM   1841 N  NH1 . ARG A 1 234 ? 68.645 194.334 7.753   1.00 187.79 ? 307 ARG A NH1 1 
ATOM   1842 N  NH2 . ARG A 1 234 ? 69.415 196.121 8.968   1.00 178.44 ? 307 ARG A NH2 1 
ATOM   1843 N  N   . GLY A 1 235 ? 61.298 194.699 5.514   1.00 140.31 ? 308 GLY A N   1 
ATOM   1844 C  CA  . GLY A 1 235 ? 60.057 194.046 5.138   1.00 159.79 ? 308 GLY A CA  1 
ATOM   1845 C  C   . GLY A 1 235 ? 59.664 194.308 3.700   1.00 156.34 ? 308 GLY A C   1 
ATOM   1846 O  O   . GLY A 1 235 ? 59.038 193.458 3.059   1.00 137.31 ? 308 GLY A O   1 
ATOM   1847 N  N   . VAL A 1 236 ? 60.022 195.480 3.171   1.00 177.70 ? 309 VAL A N   1 
ATOM   1848 C  CA  . VAL A 1 236 ? 59.749 195.773 1.768   1.00 174.65 ? 309 VAL A CA  1 
ATOM   1849 C  C   . VAL A 1 236 ? 60.682 194.974 0.869   1.00 159.87 ? 309 VAL A C   1 
ATOM   1850 O  O   . VAL A 1 236 ? 60.284 194.504 -0.204  1.00 156.46 ? 309 VAL A O   1 
ATOM   1851 C  CB  . VAL A 1 236 ? 59.865 197.286 1.507   1.00 164.61 ? 309 VAL A CB  1 
ATOM   1852 C  CG1 . VAL A 1 236 ? 59.477 197.610 0.071   1.00 152.67 ? 309 VAL A CG1 1 
ATOM   1853 C  CG2 . VAL A 1 236 ? 59.000 198.061 2.488   1.00 176.59 ? 309 VAL A CG2 1 
ATOM   1854 N  N   . LEU A 1 237 ? 61.939 194.809 1.288   1.00 142.41 ? 310 LEU A N   1 
ATOM   1855 C  CA  . LEU A 1 237 ? 62.870 193.971 0.540   1.00 142.84 ? 310 LEU A CA  1 
ATOM   1856 C  C   . LEU A 1 237 ? 62.405 192.520 0.534   1.00 154.04 ? 310 LEU A C   1 
ATOM   1857 O  O   . LEU A 1 237 ? 62.250 191.910 -0.529  1.00 137.66 ? 310 LEU A O   1 
ATOM   1858 C  CB  . LEU A 1 237 ? 64.274 194.088 1.135   1.00 179.74 ? 310 LEU A CB  1 
ATOM   1859 C  CG  . LEU A 1 237 ? 65.355 193.195 0.521   1.00 180.31 ? 310 LEU A CG  1 
ATOM   1860 C  CD1 . LEU A 1 237 ? 65.595 193.564 -0.935  1.00 158.45 ? 310 LEU A CD1 1 
ATOM   1861 C  CD2 . LEU A 1 237 ? 66.646 193.277 1.325   1.00 165.63 ? 310 LEU A CD2 1 
ATOM   1862 N  N   . PHE A 1 238 ? 62.164 191.956 1.722   1.00 147.17 ? 311 PHE A N   1 
ATOM   1863 C  CA  . PHE A 1 238 ? 61.643 190.596 1.823   1.00 155.02 ? 311 PHE A CA  1 
ATOM   1864 C  C   . PHE A 1 238 ? 60.311 190.448 1.100   1.00 127.65 ? 311 PHE A C   1 
ATOM   1865 O  O   . PHE A 1 238 ? 59.954 189.343 0.674   1.00 125.47 ? 311 PHE A O   1 
ATOM   1866 C  CB  . PHE A 1 238 ? 61.498 190.210 3.297   1.00 178.21 ? 311 PHE A CB  1 
ATOM   1867 C  CG  . PHE A 1 238 ? 60.920 188.840 3.522   1.00 165.11 ? 311 PHE A CG  1 
ATOM   1868 C  CD1 . PHE A 1 238 ? 61.721 187.713 3.436   1.00 165.40 ? 311 PHE A CD1 1 
ATOM   1869 C  CD2 . PHE A 1 238 ? 59.580 188.681 3.838   1.00 121.29 ? 311 PHE A CD2 1 
ATOM   1870 C  CE1 . PHE A 1 238 ? 61.194 186.452 3.649   1.00 168.44 ? 311 PHE A CE1 1 
ATOM   1871 C  CE2 . PHE A 1 238 ? 59.047 187.424 4.052   1.00 118.78 ? 311 PHE A CE2 1 
ATOM   1872 C  CZ  . PHE A 1 238 ? 59.855 186.308 3.957   1.00 162.71 ? 311 PHE A CZ  1 
ATOM   1873 N  N   . TYR A 1 239 ? 59.567 191.545 0.951   1.00 132.02 ? 312 TYR A N   1 
ATOM   1874 C  CA  . TYR A 1 239 ? 58.273 191.507 0.280   1.00 136.03 ? 312 TYR A CA  1 
ATOM   1875 C  C   . TYR A 1 239 ? 58.429 191.449 -1.236  1.00 145.80 ? 312 TYR A C   1 
ATOM   1876 O  O   . TYR A 1 239 ? 57.759 190.654 -1.906  1.00 137.10 ? 312 TYR A O   1 
ATOM   1877 C  CB  . TYR A 1 239 ? 57.449 192.728 0.699   1.00 128.39 ? 312 TYR A CB  1 
ATOM   1878 C  CG  . TYR A 1 239 ? 56.077 192.831 0.073   1.00 140.11 ? 312 TYR A CG  1 
ATOM   1879 C  CD1 . TYR A 1 239 ? 55.220 191.739 0.038   1.00 133.82 ? 312 TYR A CD1 1 
ATOM   1880 C  CD2 . TYR A 1 239 ? 55.626 194.034 -0.458  1.00 141.61 ? 312 TYR A CD2 1 
ATOM   1881 C  CE1 . TYR A 1 239 ? 53.961 191.837 -0.525  1.00 135.24 ? 312 TYR A CE1 1 
ATOM   1882 C  CE2 . TYR A 1 239 ? 54.370 194.142 -1.021  1.00 139.68 ? 312 TYR A CE2 1 
ATOM   1883 C  CZ  . TYR A 1 239 ? 53.541 193.041 -1.053  1.00 143.07 ? 312 TYR A CZ  1 
ATOM   1884 O  OH  . TYR A 1 239 ? 52.289 193.147 -1.614  1.00 132.94 ? 312 TYR A OH  1 
ATOM   1885 N  N   . LEU A 1 240 ? 59.298 192.290 -1.794  1.00 174.85 ? 313 LEU A N   1 
ATOM   1886 C  CA  . LEU A 1 240 ? 59.464 192.404 -3.236  1.00 143.07 ? 313 LEU A CA  1 
ATOM   1887 C  C   . LEU A 1 240 ? 60.654 191.626 -3.788  1.00 157.71 ? 313 LEU A C   1 
ATOM   1888 O  O   . LEU A 1 240 ? 60.864 191.644 -5.005  1.00 124.46 ? 313 LEU A O   1 
ATOM   1889 C  CB  . LEU A 1 240 ? 59.594 193.879 -3.633  1.00 136.46 ? 313 LEU A CB  1 
ATOM   1890 C  CG  . LEU A 1 240 ? 58.413 194.781 -3.270  1.00 145.64 ? 313 LEU A CG  1 
ATOM   1891 C  CD1 . LEU A 1 240 ? 58.607 196.174 -3.849  1.00 148.87 ? 313 LEU A CD1 1 
ATOM   1892 C  CD2 . LEU A 1 240 ? 57.102 194.174 -3.747  1.00 126.23 ? 313 LEU A CD2 1 
ATOM   1893 N  N   . LYS A 1 241 ? 61.440 190.954 -2.939  1.00 187.00 ? 314 LYS A N   1 
ATOM   1894 C  CA  . LYS A 1 241 ? 62.644 190.281 -3.422  1.00 187.70 ? 314 LYS A CA  1 
ATOM   1895 C  C   . LYS A 1 241 ? 62.271 189.162 -4.385  1.00 195.91 ? 314 LYS A C   1 
ATOM   1896 O  O   . LYS A 1 241 ? 61.632 188.180 -3.985  1.00 227.94 ? 314 LYS A O   1 
ATOM   1897 C  CB  . LYS A 1 241 ? 63.471 189.719 -2.263  1.00 203.04 ? 314 LYS A CB  1 
ATOM   1898 C  CG  . LYS A 1 241 ? 64.780 189.074 -2.692  1.00 205.58 ? 314 LYS A CG  1 
ATOM   1899 C  CD  . LYS A 1 241 ? 65.563 188.560 -1.493  1.00 201.31 ? 314 LYS A CD  1 
ATOM   1900 C  CE  . LYS A 1 241 ? 66.876 187.923 -1.922  1.00 184.61 ? 314 LYS A CE  1 
ATOM   1901 N  NZ  . LYS A 1 241 ? 67.655 187.419 -0.756  1.00 184.39 ? 314 LYS A NZ  1 
ATOM   1902 N  N   . PRO A 1 242 ? 62.654 189.272 -5.657  1.00 155.37 ? 315 PRO A N   1 
ATOM   1903 C  CA  . PRO A 1 242 ? 62.263 188.250 -6.636  1.00 152.15 ? 315 PRO A CA  1 
ATOM   1904 C  C   . PRO A 1 242 ? 62.966 186.927 -6.372  1.00 162.41 ? 315 PRO A C   1 
ATOM   1905 O  O   . PRO A 1 242 ? 64.186 186.877 -6.202  1.00 190.72 ? 315 PRO A O   1 
ATOM   1906 C  CB  . PRO A 1 242 ? 62.696 188.856 -7.978  1.00 171.07 ? 315 PRO A CB  1 
ATOM   1907 C  CG  . PRO A 1 242 ? 62.997 190.305 -7.692  1.00 192.28 ? 315 PRO A CG  1 
ATOM   1908 C  CD  . PRO A 1 242 ? 63.448 190.347 -6.271  1.00 181.18 ? 315 PRO A CD  1 
ATOM   1909 N  N   . ASN A 1 243 ? 62.184 185.852 -6.345  1.00 146.27 ? 316 ASN A N   1 
ATOM   1910 C  CA  . ASN A 1 243 ? 62.706 184.492 -6.408  1.00 142.37 ? 316 ASN A CA  1 
ATOM   1911 C  C   . ASN A 1 243 ? 62.060 183.836 -7.620  1.00 154.28 ? 316 ASN A C   1 
ATOM   1912 O  O   . ASN A 1 243 ? 60.859 183.546 -7.608  1.00 151.86 ? 316 ASN A O   1 
ATOM   1913 C  CB  . ASN A 1 243 ? 62.407 183.719 -5.124  1.00 135.14 ? 316 ASN A CB  1 
ATOM   1914 C  CG  . ASN A 1 243 ? 63.214 182.438 -5.011  1.00 148.08 ? 316 ASN A CG  1 
ATOM   1915 O  OD1 . ASN A 1 243 ? 63.601 181.842 -6.016  1.00 179.42 ? 316 ASN A OD1 1 
ATOM   1916 N  ND2 . ASN A 1 243 ? 63.474 182.008 -3.781  1.00 166.72 ? 316 ASN A ND2 1 
ATOM   1917 N  N   . TRP A 1 244 ? 62.852 183.599 -8.662  1.00 185.01 ? 317 TRP A N   1 
ATOM   1918 C  CA  . TRP A 1 244 ? 62.322 183.037 -9.894  1.00 187.46 ? 317 TRP A CA  1 
ATOM   1919 C  C   . TRP A 1 244 ? 62.335 181.516 -9.905  1.00 194.41 ? 317 TRP A C   1 
ATOM   1920 O  O   . TRP A 1 244 ? 61.723 180.914 -10.794 1.00 203.14 ? 317 TRP A O   1 
ATOM   1921 C  CB  . TRP A 1 244 ? 63.104 183.572 -11.098 1.00 216.12 ? 317 TRP A CB  1 
ATOM   1922 C  CG  . TRP A 1 244 ? 63.076 185.067 -11.203 1.00 219.71 ? 317 TRP A CG  1 
ATOM   1923 C  CD1 . TRP A 1 244 ? 64.047 185.936 -10.796 1.00 237.34 ? 317 TRP A CD1 1 
ATOM   1924 C  CD2 . TRP A 1 244 ? 62.019 185.872 -11.743 1.00 188.84 ? 317 TRP A CD2 1 
ATOM   1925 N  NE1 . TRP A 1 244 ? 63.663 187.230 -11.054 1.00 231.70 ? 317 TRP A NE1 1 
ATOM   1926 C  CE2 . TRP A 1 244 ? 62.422 187.218 -11.634 1.00 190.84 ? 317 TRP A CE2 1 
ATOM   1927 C  CE3 . TRP A 1 244 ? 60.773 185.585 -12.309 1.00 197.03 ? 317 TRP A CE3 1 
ATOM   1928 C  CZ2 . TRP A 1 244 ? 61.624 188.274 -12.071 1.00 191.03 ? 317 TRP A CZ2 1 
ATOM   1929 C  CZ3 . TRP A 1 244 ? 59.982 186.636 -12.742 1.00 213.30 ? 317 TRP A CZ3 1 
ATOM   1930 C  CH2 . TRP A 1 244 ? 60.411 187.963 -12.620 1.00 194.91 ? 317 TRP A CH2 1 
ATOM   1931 N  N   . GLN A 1 245 ? 63.005 180.883 -8.941  1.00 188.16 ? 318 GLN A N   1 
ATOM   1932 C  CA  . GLN A 1 245 ? 62.980 179.431 -8.830  1.00 185.06 ? 318 GLN A CA  1 
ATOM   1933 C  C   . GLN A 1 245 ? 61.663 178.913 -8.270  1.00 186.80 ? 318 GLN A C   1 
ATOM   1934 O  O   . GLN A 1 245 ? 61.408 177.707 -8.348  1.00 182.84 ? 318 GLN A O   1 
ATOM   1935 C  CB  . GLN A 1 245 ? 64.139 178.952 -7.954  1.00 186.18 ? 318 GLN A CB  1 
ATOM   1936 C  CG  . GLN A 1 245 ? 65.504 179.456 -8.397  1.00 205.15 ? 318 GLN A CG  1 
ATOM   1937 C  CD  . GLN A 1 245 ? 65.941 178.873 -9.728  1.00 215.90 ? 318 GLN A CD  1 
ATOM   1938 O  OE1 . GLN A 1 245 ? 65.469 177.813 -10.139 1.00 220.03 ? 318 GLN A OE1 1 
ATOM   1939 N  NE2 . GLN A 1 245 ? 66.846 179.566 -10.408 1.00 210.32 ? 318 GLN A NE2 1 
ATOM   1940 N  N   . LYS A 1 246 ? 60.828 179.792 -7.711  1.00 169.81 ? 319 LYS A N   1 
ATOM   1941 C  CA  . LYS A 1 246 ? 59.536 179.372 -7.185  1.00 144.41 ? 319 LYS A CA  1 
ATOM   1942 C  C   . LYS A 1 246 ? 58.524 179.105 -8.291  1.00 142.16 ? 319 LYS A C   1 
ATOM   1943 O  O   . LYS A 1 246 ? 57.654 178.242 -8.130  1.00 129.53 ? 319 LYS A O   1 
ATOM   1944 C  CB  . LYS A 1 246 ? 58.991 180.430 -6.223  1.00 132.71 ? 319 LYS A CB  1 
ATOM   1945 C  CG  . LYS A 1 246 ? 59.595 180.377 -4.830  1.00 133.62 ? 319 LYS A CG  1 
ATOM   1946 C  CD  . LYS A 1 246 ? 59.147 179.128 -4.087  1.00 136.41 ? 319 LYS A CD  1 
ATOM   1947 C  CE  . LYS A 1 246 ? 59.635 179.131 -2.647  1.00 149.49 ? 319 LYS A CE  1 
ATOM   1948 N  NZ  . LYS A 1 246 ? 59.118 177.960 -1.886  1.00 162.17 ? 319 LYS A NZ  1 
ATOM   1949 N  N   . LEU A 1 247 ? 58.620 179.824 -9.413  1.00 136.33 ? 320 LEU A N   1 
ATOM   1950 C  CA  . LEU A 1 247 ? 57.682 179.616 -10.511 1.00 136.50 ? 320 LEU A CA  1 
ATOM   1951 C  C   . LEU A 1 247 ? 57.811 178.229 -11.127 1.00 163.83 ? 320 LEU A C   1 
ATOM   1952 O  O   . LEU A 1 247 ? 56.879 177.774 -11.800 1.00 156.11 ? 320 LEU A O   1 
ATOM   1953 C  CB  . LEU A 1 247 ? 57.884 180.683 -11.586 1.00 133.82 ? 320 LEU A CB  1 
ATOM   1954 C  CG  . LEU A 1 247 ? 57.556 182.120 -11.178 1.00 144.32 ? 320 LEU A CG  1 
ATOM   1955 C  CD1 . LEU A 1 247 ? 57.855 183.081 -12.316 1.00 146.26 ? 320 LEU A CD1 1 
ATOM   1956 C  CD2 . LEU A 1 247 ? 56.102 182.233 -10.747 1.00 155.13 ? 320 LEU A CD2 1 
ATOM   1957 N  N   . LEU A 1 248 ? 58.940 177.550 -10.915 1.00 166.47 ? 321 LEU A N   1 
ATOM   1958 C  CA  . LEU A 1 248 ? 59.097 176.190 -11.415 1.00 164.96 ? 321 LEU A CA  1 
ATOM   1959 C  C   . LEU A 1 248 ? 58.294 175.182 -10.604 1.00 171.38 ? 321 LEU A C   1 
ATOM   1960 O  O   . LEU A 1 248 ? 57.984 174.101 -11.115 1.00 190.65 ? 321 LEU A O   1 
ATOM   1961 C  CB  . LEU A 1 248 ? 60.575 175.798 -11.418 1.00 136.09 ? 321 LEU A CB  1 
ATOM   1962 C  CG  . LEU A 1 248 ? 61.498 176.652 -12.288 1.00 141.08 ? 321 LEU A CG  1 
ATOM   1963 C  CD1 . LEU A 1 248 ? 62.937 176.184 -12.155 1.00 172.22 ? 321 LEU A CD1 1 
ATOM   1964 C  CD2 . LEU A 1 248 ? 61.051 176.618 -13.741 1.00 142.75 ? 321 LEU A CD2 1 
ATOM   1965 N  N   . GLU A 1 249 ? 57.955 175.507 -9.359  1.00 141.51 ? 322 GLU A N   1 
ATOM   1966 C  CA  . GLU A 1 249 ? 57.157 174.615 -8.530  1.00 135.58 ? 322 GLU A CA  1 
ATOM   1967 C  C   . GLU A 1 249 ? 55.690 174.716 -8.927  1.00 129.75 ? 322 GLU A C   1 
ATOM   1968 O  O   . GLU A 1 249 ? 55.147 175.818 -9.057  1.00 128.04 ? 322 GLU A O   1 
ATOM   1969 C  CB  . GLU A 1 249 ? 57.334 174.960 -7.052  1.00 151.92 ? 322 GLU A CB  1 
ATOM   1970 C  CG  . GLU A 1 249 ? 58.778 174.933 -6.577  1.00 192.88 ? 322 GLU A CG  1 
ATOM   1971 C  CD  . GLU A 1 249 ? 58.924 175.363 -5.129  1.00 199.65 ? 322 GLU A CD  1 
ATOM   1972 O  OE1 . GLU A 1 249 ? 57.893 175.651 -4.486  1.00 178.25 ? 322 GLU A OE1 1 
ATOM   1973 O  OE2 . GLU A 1 249 ? 60.070 175.414 -4.636  1.00 211.96 ? 322 GLU A OE2 1 
ATOM   1974 N  N   . THR A 1 250 ? 55.048 173.562 -9.119  1.00 163.03 ? 323 THR A N   1 
ATOM   1975 C  CA  . THR A 1 250 ? 53.650 173.533 -9.530  1.00 166.87 ? 323 THR A CA  1 
ATOM   1976 C  C   . THR A 1 250 ? 52.699 174.007 -8.439  1.00 156.43 ? 323 THR A C   1 
ATOM   1977 O  O   . THR A 1 250 ? 51.516 174.223 -8.724  1.00 155.56 ? 323 THR A O   1 
ATOM   1978 C  CB  . THR A 1 250 ? 53.262 172.118 -9.968  1.00 196.53 ? 323 THR A CB  1 
ATOM   1979 O  OG1 . THR A 1 250 ? 51.869 172.083 -10.308 1.00 189.39 ? 323 THR A OG1 1 
ATOM   1980 C  CG2 . THR A 1 250 ? 53.533 171.119 -8.850  1.00 210.38 ? 323 THR A CG2 1 
ATOM   1981 N  N   . GLY A 1 251 ? 53.179 174.176 -7.210  1.00 179.82 ? 324 GLY A N   1 
ATOM   1982 C  CA  . GLY A 1 251 ? 52.324 174.567 -6.107  1.00 186.55 ? 324 GLY A CA  1 
ATOM   1983 C  C   . GLY A 1 251 ? 51.948 176.035 -6.081  1.00 177.37 ? 324 GLY A C   1 
ATOM   1984 O  O   . GLY A 1 251 ? 50.800 176.376 -5.782  1.00 200.39 ? 324 GLY A O   1 
ATOM   1985 N  N   . VAL A 1 252 ? 52.905 176.914 -6.392  1.00 126.60 ? 325 VAL A N   1 
ATOM   1986 C  CA  . VAL A 1 252 ? 52.665 178.348 -6.250  1.00 115.78 ? 325 VAL A CA  1 
ATOM   1987 C  C   . VAL A 1 252 ? 51.602 178.831 -7.230  1.00 127.59 ? 325 VAL A C   1 
ATOM   1988 O  O   . VAL A 1 252 ? 50.868 179.783 -6.937  1.00 171.00 ? 325 VAL A O   1 
ATOM   1989 C  CB  . VAL A 1 252 ? 53.980 179.133 -6.412  1.00 116.71 ? 325 VAL A CB  1 
ATOM   1990 C  CG1 . VAL A 1 252 ? 54.990 178.698 -5.361  1.00 169.88 ? 325 VAL A CG1 1 
ATOM   1991 C  CG2 . VAL A 1 252 ? 54.547 178.953 -7.812  1.00 131.71 ? 325 VAL A CG2 1 
ATOM   1992 N  N   . TRP A 1 253 ? 51.498 178.197 -8.400  1.00 132.73 ? 326 TRP A N   1 
ATOM   1993 C  CA  . TRP A 1 253 ? 50.451 178.571 -9.345  1.00 133.79 ? 326 TRP A CA  1 
ATOM   1994 C  C   . TRP A 1 253 ? 49.075 178.211 -8.804  1.00 140.44 ? 326 TRP A C   1 
ATOM   1995 O  O   . TRP A 1 253 ? 48.116 178.975 -8.965  1.00 142.43 ? 326 TRP A O   1 
ATOM   1996 C  CB  . TRP A 1 253 ? 50.697 177.897 -10.695 1.00 134.39 ? 326 TRP A CB  1 
ATOM   1997 C  CG  . TRP A 1 253 ? 51.881 178.447 -11.428 1.00 146.76 ? 326 TRP A CG  1 
ATOM   1998 C  CD1 . TRP A 1 253 ? 53.189 178.094 -11.260 1.00 155.74 ? 326 TRP A CD1 1 
ATOM   1999 C  CD2 . TRP A 1 253 ? 51.864 179.450 -12.450 1.00 150.94 ? 326 TRP A CD2 1 
ATOM   2000 N  NE1 . TRP A 1 253 ? 53.988 178.817 -12.113 1.00 132.86 ? 326 TRP A NE1 1 
ATOM   2001 C  CE2 . TRP A 1 253 ? 53.198 179.657 -12.855 1.00 141.91 ? 326 TRP A CE2 1 
ATOM   2002 C  CE3 . TRP A 1 253 ? 50.851 180.194 -13.061 1.00 156.25 ? 326 TRP A CE3 1 
ATOM   2003 C  CZ2 . TRP A 1 253 ? 53.544 180.576 -13.843 1.00 158.05 ? 326 TRP A CZ2 1 
ATOM   2004 C  CZ3 . TRP A 1 253 ? 51.196 181.106 -14.042 1.00 163.07 ? 326 TRP A CZ3 1 
ATOM   2005 C  CH2 . TRP A 1 253 ? 52.531 181.289 -14.423 1.00 156.24 ? 326 TRP A CH2 1 
ATOM   2006 N  N   . ILE A 1 254 ? 48.963 177.052 -8.154  1.00 154.81 ? 327 ILE A N   1 
ATOM   2007 C  CA  . ILE A 1 254 ? 47.708 176.671 -7.516  1.00 129.42 ? 327 ILE A CA  1 
ATOM   2008 C  C   . ILE A 1 254 ? 47.385 177.622 -6.370  1.00 114.46 ? 327 ILE A C   1 
ATOM   2009 O  O   . ILE A 1 254 ? 46.228 178.016 -6.178  1.00 131.32 ? 327 ILE A O   1 
ATOM   2010 C  CB  . ILE A 1 254 ? 47.783 175.209 -7.041  1.00 118.50 ? 327 ILE A CB  1 
ATOM   2011 C  CG1 . ILE A 1 254 ? 48.128 174.293 -8.219  1.00 140.11 ? 327 ILE A CG1 1 
ATOM   2012 C  CG2 . ILE A 1 254 ? 46.475 174.794 -6.394  1.00 128.34 ? 327 ILE A CG2 1 
ATOM   2013 C  CD1 . ILE A 1 254 ? 48.514 172.889 -7.817  1.00 142.18 ? 327 ILE A CD1 1 
ATOM   2014 N  N   . ASP A 1 255 ? 48.403 178.010 -5.596  1.00 146.27 ? 328 ASP A N   1 
ATOM   2015 C  CA  . ASP A 1 255 ? 48.193 178.966 -4.514  1.00 142.58 ? 328 ASP A CA  1 
ATOM   2016 C  C   . ASP A 1 255 ? 47.673 180.295 -5.045  1.00 145.67 ? 328 ASP A C   1 
ATOM   2017 O  O   . ASP A 1 255 ? 46.745 180.881 -4.475  1.00 153.80 ? 328 ASP A O   1 
ATOM   2018 C  CB  . ASP A 1 255 ? 49.494 179.172 -3.737  1.00 142.32 ? 328 ASP A CB  1 
ATOM   2019 C  CG  . ASP A 1 255 ? 49.934 177.925 -2.994  1.00 175.46 ? 328 ASP A CG  1 
ATOM   2020 O  OD1 . ASP A 1 255 ? 49.449 176.827 -3.334  1.00 207.86 ? 328 ASP A OD1 1 
ATOM   2021 O  OD2 . ASP A 1 255 ? 50.768 178.043 -2.072  1.00 171.95 ? 328 ASP A OD2 1 
ATOM   2022 N  N   . ALA A 1 256 ? 48.258 180.788 -6.140  1.00 143.13 ? 329 ALA A N   1 
ATOM   2023 C  CA  . ALA A 1 256 ? 47.782 182.035 -6.730  1.00 158.56 ? 329 ALA A CA  1 
ATOM   2024 C  C   . ALA A 1 256 ? 46.367 181.883 -7.275  1.00 163.99 ? 329 ALA A C   1 
ATOM   2025 O  O   . ALA A 1 256 ? 45.544 182.798 -7.146  1.00 156.81 ? 329 ALA A O   1 
ATOM   2026 C  CB  . ALA A 1 256 ? 48.737 182.491 -7.832  1.00 140.40 ? 329 ALA A CB  1 
ATOM   2027 N  N   . ALA A 1 257 ? 46.066 180.733 -7.881  1.00 120.31 ? 330 ALA A N   1 
ATOM   2028 C  CA  . ALA A 1 257 ? 44.734 180.506 -8.432  1.00 118.56 ? 330 ALA A CA  1 
ATOM   2029 C  C   . ALA A 1 257 ? 43.675 180.526 -7.336  1.00 124.91 ? 330 ALA A C   1 
ATOM   2030 O  O   . ALA A 1 257 ? 42.668 181.239 -7.439  1.00 156.94 ? 330 ALA A O   1 
ATOM   2031 C  CB  . ALA A 1 257 ? 44.706 179.179 -9.190  1.00 155.92 ? 330 ALA A CB  1 
ATOM   2032 N  N   . ALA A 1 258 ? 43.889 179.747 -6.273  1.00 109.19 ? 331 ALA A N   1 
ATOM   2033 C  CA  . ALA A 1 258 ? 42.949 179.753 -5.157  1.00 119.65 ? 331 ALA A CA  1 
ATOM   2034 C  C   . ALA A 1 258 ? 42.862 181.134 -4.521  1.00 117.26 ? 331 ALA A C   1 
ATOM   2035 O  O   . ALA A 1 258 ? 41.775 181.584 -4.137  1.00 135.33 ? 331 ALA A O   1 
ATOM   2036 C  CB  . ALA A 1 258 ? 43.359 178.707 -4.121  1.00 118.96 ? 331 ALA A CB  1 
ATOM   2037 N  N   . GLN A 1 259 ? 43.998 181.831 -4.420  1.00 120.65 ? 332 GLN A N   1 
ATOM   2038 C  CA  . GLN A 1 259 ? 44.005 183.144 -3.784  1.00 144.55 ? 332 GLN A CA  1 
ATOM   2039 C  C   . GLN A 1 259 ? 43.168 184.149 -4.565  1.00 141.63 ? 332 GLN A C   1 
ATOM   2040 O  O   . GLN A 1 259 ? 42.398 184.915 -3.975  1.00 117.72 ? 332 GLN A O   1 
ATOM   2041 C  CB  . GLN A 1 259 ? 45.442 183.647 -3.630  1.00 141.95 ? 332 GLN A CB  1 
ATOM   2042 C  CG  . GLN A 1 259 ? 45.551 185.043 -3.028  1.00 116.25 ? 332 GLN A CG  1 
ATOM   2043 C  CD  . GLN A 1 259 ? 45.004 185.120 -1.613  1.00 129.03 ? 332 GLN A CD  1 
ATOM   2044 O  OE1 . GLN A 1 259 ? 44.962 184.122 -0.893  1.00 145.64 ? 332 GLN A OE1 1 
ATOM   2045 N  NE2 . GLN A 1 259 ? 44.580 186.313 -1.208  1.00 123.44 ? 332 GLN A NE2 1 
ATOM   2046 N  N   . ILE A 1 260 ? 43.297 184.162 -5.894  1.00 126.00 ? 333 ILE A N   1 
ATOM   2047 C  CA  . ILE A 1 260 ? 42.532 185.124 -6.681  1.00 151.68 ? 333 ILE A CA  1 
ATOM   2048 C  C   . ILE A 1 260 ? 41.063 184.715 -6.746  1.00 144.94 ? 333 ILE A C   1 
ATOM   2049 O  O   . ILE A 1 260 ? 40.166 185.571 -6.724  1.00 125.04 ? 333 ILE A O   1 
ATOM   2050 C  CB  . ILE A 1 260 ? 43.150 185.296 -8.083  1.00 142.20 ? 333 ILE A CB  1 
ATOM   2051 C  CG1 . ILE A 1 260 ? 42.460 186.437 -8.835  1.00 156.78 ? 333 ILE A CG1 1 
ATOM   2052 C  CG2 . ILE A 1 260 ? 43.076 184.008 -8.890  1.00 141.34 ? 333 ILE A CG2 1 
ATOM   2053 C  CD1 . ILE A 1 260 ? 42.687 187.801 -8.220  1.00 146.50 ? 333 ILE A CD1 1 
ATOM   2054 N  N   . PHE A 1 261 ? 40.789 183.406 -6.802  1.00 127.42 ? 334 PHE A N   1 
ATOM   2055 C  CA  . PHE A 1 261 ? 39.403 182.949 -6.817  1.00 110.65 ? 334 PHE A CA  1 
ATOM   2056 C  C   . PHE A 1 261 ? 38.678 183.367 -5.546  1.00 119.41 ? 334 PHE A C   1 
ATOM   2057 O  O   . PHE A 1 261 ? 37.614 183.994 -5.600  1.00 119.23 ? 334 PHE A O   1 
ATOM   2058 C  CB  . PHE A 1 261 ? 39.334 181.432 -6.988  1.00 105.52 ? 334 PHE A CB  1 
ATOM   2059 C  CG  . PHE A 1 261 ? 37.984 180.853 -6.659  1.00 108.59 ? 334 PHE A CG  1 
ATOM   2060 C  CD1 . PHE A 1 261 ? 36.929 180.973 -7.549  1.00 129.16 ? 334 PHE A CD1 1 
ATOM   2061 C  CD2 . PHE A 1 261 ? 37.765 180.206 -5.453  1.00 123.79 ? 334 PHE A CD2 1 
ATOM   2062 C  CE1 . PHE A 1 261 ? 35.684 180.449 -7.249  1.00 145.66 ? 334 PHE A CE1 1 
ATOM   2063 C  CE2 . PHE A 1 261 ? 36.521 179.682 -5.147  1.00 146.91 ? 334 PHE A CE2 1 
ATOM   2064 C  CZ  . PHE A 1 261 ? 35.481 179.802 -6.046  1.00 148.69 ? 334 PHE A CZ  1 
ATOM   2065 N  N   . PHE A 1 262 ? 39.241 183.022 -4.385  1.00 117.07 ? 335 PHE A N   1 
ATOM   2066 C  CA  . PHE A 1 262 ? 38.600 183.401 -3.132  1.00 106.40 ? 335 PHE A CA  1 
ATOM   2067 C  C   . PHE A 1 262 ? 38.616 184.908 -2.926  1.00 123.78 ? 335 PHE A C   1 
ATOM   2068 O  O   . PHE A 1 262 ? 37.693 185.453 -2.314  1.00 140.22 ? 335 PHE A O   1 
ATOM   2069 C  CB  . PHE A 1 262 ? 39.274 182.695 -1.957  1.00 104.14 ? 335 PHE A CB  1 
ATOM   2070 C  CG  . PHE A 1 262 ? 38.846 181.267 -1.787  1.00 119.14 ? 335 PHE A CG  1 
ATOM   2071 C  CD1 . PHE A 1 262 ? 37.725 180.952 -1.037  1.00 110.59 ? 335 PHE A CD1 1 
ATOM   2072 C  CD2 . PHE A 1 262 ? 39.562 180.241 -2.378  1.00 105.86 ? 335 PHE A CD2 1 
ATOM   2073 C  CE1 . PHE A 1 262 ? 37.327 179.638 -0.878  1.00 107.35 ? 335 PHE A CE1 1 
ATOM   2074 C  CE2 . PHE A 1 262 ? 39.171 178.926 -2.222  1.00 106.65 ? 335 PHE A CE2 1 
ATOM   2075 C  CZ  . PHE A 1 262 ? 38.051 178.624 -1.471  1.00 107.13 ? 335 PHE A CZ  1 
ATOM   2076 N  N   . SER A 1 263 ? 39.639 185.598 -3.432  1.00 133.66 ? 336 SER A N   1 
ATOM   2077 C  CA  . SER A 1 263 ? 39.697 187.047 -3.265  1.00 145.78 ? 336 SER A CA  1 
ATOM   2078 C  C   . SER A 1 263 ? 38.571 187.737 -4.025  1.00 169.54 ? 336 SER A C   1 
ATOM   2079 O  O   . SER A 1 263 ? 37.960 188.683 -3.514  1.00 147.26 ? 336 SER A O   1 
ATOM   2080 C  CB  . SER A 1 263 ? 41.056 187.578 -3.718  1.00 134.45 ? 336 SER A CB  1 
ATOM   2081 O  OG  . SER A 1 263 ? 41.145 188.977 -3.516  1.00 144.72 ? 336 SER A OG  1 
ATOM   2082 N  N   . LEU A 1 264 ? 38.281 187.281 -5.246  1.00 168.00 ? 337 LEU A N   1 
ATOM   2083 C  CA  . LEU A 1 264 ? 37.166 187.857 -5.991  1.00 132.47 ? 337 LEU A CA  1 
ATOM   2084 C  C   . LEU A 1 264 ? 35.822 187.321 -5.513  1.00 132.94 ? 337 LEU A C   1 
ATOM   2085 O  O   . LEU A 1 264 ? 34.819 188.042 -5.562  1.00 118.21 ? 337 LEU A O   1 
ATOM   2086 C  CB  . LEU A 1 264 ? 37.338 187.592 -7.486  1.00 143.20 ? 337 LEU A CB  1 
ATOM   2087 C  CG  . LEU A 1 264 ? 38.532 188.289 -8.140  1.00 134.08 ? 337 LEU A CG  1 
ATOM   2088 C  CD1 . LEU A 1 264 ? 38.559 188.019 -9.636  1.00 170.17 ? 337 LEU A CD1 1 
ATOM   2089 C  CD2 . LEU A 1 264 ? 38.496 189.784 -7.860  1.00 120.76 ? 337 LEU A CD2 1 
ATOM   2090 N  N   . GLY A 1 265 ? 35.785 186.075 -5.049  1.00 155.99 ? 338 GLY A N   1 
ATOM   2091 C  CA  . GLY A 1 265 ? 34.579 185.469 -4.536  1.00 166.43 ? 338 GLY A CA  1 
ATOM   2092 C  C   . GLY A 1 265 ? 33.419 185.392 -5.514  1.00 150.99 ? 338 GLY A C   1 
ATOM   2093 O  O   . GLY A 1 265 ? 32.326 185.895 -5.237  1.00 143.41 ? 338 GLY A O   1 
ATOM   2094 N  N   . PRO A 1 266 ? 33.623 184.762 -6.685  1.00 144.03 ? 339 PRO A N   1 
ATOM   2095 C  CA  . PRO A 1 266 ? 32.487 184.538 -7.586  1.00 153.84 ? 339 PRO A CA  1 
ATOM   2096 C  C   . PRO A 1 266 ? 31.806 183.207 -7.307  1.00 150.14 ? 339 PRO A C   1 
ATOM   2097 O  O   . PRO A 1 266 ? 32.237 182.457 -6.425  1.00 133.58 ? 339 PRO A O   1 
ATOM   2098 C  CB  . PRO A 1 266 ? 33.141 184.559 -8.969  1.00 153.75 ? 339 PRO A CB  1 
ATOM   2099 C  CG  . PRO A 1 266 ? 34.479 183.945 -8.722  1.00 132.16 ? 339 PRO A CG  1 
ATOM   2100 C  CD  . PRO A 1 266 ? 34.883 184.304 -7.301  1.00 138.94 ? 339 PRO A CD  1 
ATOM   2101 N  N   . GLY A 1 267 ? 30.746 182.902 -8.052  1.00 157.34 ? 340 GLY A N   1 
ATOM   2102 C  CA  . GLY A 1 267 ? 30.057 181.636 -7.919  1.00 174.98 ? 340 GLY A CA  1 
ATOM   2103 C  C   . GLY A 1 267 ? 29.308 181.429 -6.622  1.00 166.80 ? 340 GLY A C   1 
ATOM   2104 O  O   . GLY A 1 267 ? 28.759 180.341 -6.414  1.00 141.29 ? 340 GLY A O   1 
ATOM   2105 N  N   . PHE A 1 268 ? 29.272 182.424 -5.740  1.00 173.68 ? 341 PHE A N   1 
ATOM   2106 C  CA  . PHE A 1 268 ? 28.531 182.333 -4.491  1.00 162.34 ? 341 PHE A CA  1 
ATOM   2107 C  C   . PHE A 1 268 ? 27.140 182.945 -4.589  1.00 152.01 ? 341 PHE A C   1 
ATOM   2108 O  O   . PHE A 1 268 ? 26.365 182.855 -3.633  1.00 108.31 ? 341 PHE A O   1 
ATOM   2109 C  CB  . PHE A 1 268 ? 29.322 183.008 -3.364  1.00 152.53 ? 341 PHE A CB  1 
ATOM   2110 C  CG  . PHE A 1 268 ? 28.863 182.629 -1.985  1.00 141.83 ? 341 PHE A CG  1 
ATOM   2111 C  CD1 . PHE A 1 268 ? 29.215 181.408 -1.436  1.00 139.28 ? 341 PHE A CD1 1 
ATOM   2112 C  CD2 . PHE A 1 268 ? 28.089 183.497 -1.233  1.00 146.64 ? 341 PHE A CD2 1 
ATOM   2113 C  CE1 . PHE A 1 268 ? 28.798 181.059 -0.167  1.00 113.29 ? 341 PHE A CE1 1 
ATOM   2114 C  CE2 . PHE A 1 268 ? 27.667 183.151 0.036   1.00 160.37 ? 341 PHE A CE2 1 
ATOM   2115 C  CZ  . PHE A 1 268 ? 28.023 181.930 0.570   1.00 117.77 ? 341 PHE A CZ  1 
ATOM   2116 N  N   . GLY A 1 269 ? 26.798 183.547 -5.725  1.00 156.12 ? 342 GLY A N   1 
ATOM   2117 C  CA  . GLY A 1 269 ? 25.517 184.198 -5.881  1.00 180.94 ? 342 GLY A CA  1 
ATOM   2118 C  C   . GLY A 1 269 ? 25.412 185.569 -5.251  1.00 162.68 ? 342 GLY A C   1 
ATOM   2119 O  O   . GLY A 1 269 ? 24.365 186.216 -5.389  1.00 171.46 ? 342 GLY A O   1 
ATOM   2120 N  N   . VAL A 1 270 ? 26.452 186.032 -4.556  1.00 135.96 ? 343 VAL A N   1 
ATOM   2121 C  CA  . VAL A 1 270 ? 26.429 187.379 -3.995  1.00 161.10 ? 343 VAL A CA  1 
ATOM   2122 C  C   . VAL A 1 270 ? 26.498 188.416 -5.108  1.00 160.87 ? 343 VAL A C   1 
ATOM   2123 O  O   . VAL A 1 270 ? 25.698 189.358 -5.151  1.00 148.22 ? 343 VAL A O   1 
ATOM   2124 C  CB  . VAL A 1 270 ? 27.574 187.561 -2.984  1.00 147.40 ? 343 VAL A CB  1 
ATOM   2125 C  CG1 . VAL A 1 270 ? 27.815 189.035 -2.735  1.00 142.15 ? 343 VAL A CG1 1 
ATOM   2126 C  CG2 . VAL A 1 270 ? 27.244 186.850 -1.683  1.00 137.71 ? 343 VAL A CG2 1 
ATOM   2127 N  N   . LEU A 1 271 ? 27.460 188.262 -6.021  1.00 157.00 ? 344 LEU A N   1 
ATOM   2128 C  CA  . LEU A 1 271 ? 27.509 189.125 -7.196  1.00 161.43 ? 344 LEU A CA  1 
ATOM   2129 C  C   . LEU A 1 271 ? 26.240 188.993 -8.025  1.00 184.00 ? 344 LEU A C   1 
ATOM   2130 O  O   . LEU A 1 271 ? 25.813 189.957 -8.670  1.00 196.83 ? 344 LEU A O   1 
ATOM   2131 C  CB  . LEU A 1 271 ? 28.732 188.784 -8.046  1.00 144.22 ? 344 LEU A CB  1 
ATOM   2132 C  CG  . LEU A 1 271 ? 30.044 188.585 -7.288  1.00 156.42 ? 344 LEU A CG  1 
ATOM   2133 C  CD1 . LEU A 1 271 ? 31.113 188.029 -8.211  1.00 149.03 ? 344 LEU A CD1 1 
ATOM   2134 C  CD2 . LEU A 1 271 ? 30.501 189.889 -6.658  1.00 144.29 ? 344 LEU A CD2 1 
ATOM   2135 N  N   . LEU A 1 272 ? 25.630 187.806 -8.020  1.00 191.09 ? 345 LEU A N   1 
ATOM   2136 C  CA  . LEU A 1 272 ? 24.361 187.612 -8.710  1.00 166.16 ? 345 LEU A CA  1 
ATOM   2137 C  C   . LEU A 1 272 ? 23.270 188.487 -8.105  1.00 150.97 ? 345 LEU A C   1 
ATOM   2138 O  O   . LEU A 1 272 ? 22.483 189.105 -8.832  1.00 166.67 ? 345 LEU A O   1 
ATOM   2139 C  CB  . LEU A 1 272 ? 23.961 186.139 -8.645  1.00 147.87 ? 345 LEU A CB  1 
ATOM   2140 C  CG  . LEU A 1 272 ? 22.995 185.604 -9.698  1.00 143.82 ? 345 LEU A CG  1 
ATOM   2141 C  CD1 . LEU A 1 272 ? 23.741 185.323 -10.989 1.00 153.19 ? 345 LEU A CD1 1 
ATOM   2142 C  CD2 . LEU A 1 272 ? 22.301 184.353 -9.187  1.00 144.05 ? 345 LEU A CD2 1 
ATOM   2143 N  N   . ALA A 1 273 ? 23.214 188.555 -6.773  1.00 154.25 ? 346 ALA A N   1 
ATOM   2144 C  CA  . ALA A 1 273 ? 22.180 189.345 -6.113  1.00 172.98 ? 346 ALA A CA  1 
ATOM   2145 C  C   . ALA A 1 273 ? 22.457 190.838 -6.238  1.00 177.90 ? 346 ALA A C   1 
ATOM   2146 O  O   . ALA A 1 273 ? 21.530 191.630 -6.444  1.00 167.17 ? 346 ALA A O   1 
ATOM   2147 C  CB  . ALA A 1 273 ? 22.069 188.939 -4.644  1.00 167.32 ? 346 ALA A CB  1 
ATOM   2148 N  N   . PHE A 1 274 ? 23.723 191.243 -6.109  1.00 178.16 ? 347 PHE A N   1 
ATOM   2149 C  CA  . PHE A 1 274 ? 24.062 192.652 -6.277  1.00 170.09 ? 347 PHE A CA  1 
ATOM   2150 C  C   . PHE A 1 274 ? 23.793 193.120 -7.699  1.00 167.55 ? 347 PHE A C   1 
ATOM   2151 O  O   . PHE A 1 274 ? 23.359 194.259 -7.912  1.00 184.99 ? 347 PHE A O   1 
ATOM   2152 C  CB  . PHE A 1 274 ? 25.522 192.897 -5.900  1.00 190.34 ? 347 PHE A CB  1 
ATOM   2153 C  CG  . PHE A 1 274 ? 25.725 193.212 -4.451  1.00 184.23 ? 347 PHE A CG  1 
ATOM   2154 C  CD1 . PHE A 1 274 ? 24.642 193.321 -3.596  1.00 189.50 ? 347 PHE A CD1 1 
ATOM   2155 C  CD2 . PHE A 1 274 ? 26.998 193.414 -3.944  1.00 164.76 ? 347 PHE A CD2 1 
ATOM   2156 C  CE1 . PHE A 1 274 ? 24.822 193.615 -2.260  1.00 186.74 ? 347 PHE A CE1 1 
ATOM   2157 C  CE2 . PHE A 1 274 ? 27.184 193.711 -2.610  1.00 184.67 ? 347 PHE A CE2 1 
ATOM   2158 C  CZ  . PHE A 1 274 ? 26.094 193.811 -1.767  1.00 189.94 ? 347 PHE A CZ  1 
ATOM   2159 N  N   . ALA A 1 275 ? 24.047 192.261 -8.687  1.00 172.82 ? 348 ALA A N   1 
ATOM   2160 C  CA  . ALA A 1 275 ? 23.722 192.620 -10.060 1.00 190.61 ? 348 ALA A CA  1 
ATOM   2161 C  C   . ALA A 1 275 ? 22.227 192.529 -10.334 1.00 190.28 ? 348 ALA A C   1 
ATOM   2162 O  O   . ALA A 1 275 ? 21.737 193.194 -11.253 1.00 167.74 ? 348 ALA A O   1 
ATOM   2163 C  CB  . ALA A 1 275 ? 24.497 191.733 -11.032 1.00 186.10 ? 348 ALA A CB  1 
ATOM   2164 N  N   . SER A 1 276 ? 21.494 191.738 -9.544  1.00 194.35 ? 349 SER A N   1 
ATOM   2165 C  CA  . SER A 1 276 ? 20.054 191.599 -9.746  1.00 198.32 ? 349 SER A CA  1 
ATOM   2166 C  C   . SER A 1 276 ? 19.338 192.941 -9.667  1.00 193.52 ? 349 SER A C   1 
ATOM   2167 O  O   . SER A 1 276 ? 18.357 193.163 -10.386 1.00 201.63 ? 349 SER A O   1 
ATOM   2168 C  CB  . SER A 1 276 ? 19.469 190.627 -8.719  1.00 200.91 ? 349 SER A CB  1 
ATOM   2169 O  OG  . SER A 1 276 ? 18.056 190.572 -8.816  1.00 195.96 ? 349 SER A OG  1 
ATOM   2170 N  N   . TYR A 1 277 ? 19.802 193.841 -8.804  1.00 176.68 ? 350 TYR A N   1 
ATOM   2171 C  CA  . TYR A 1 277 ? 19.263 195.192 -8.717  1.00 176.84 ? 350 TYR A CA  1 
ATOM   2172 C  C   . TYR A 1 277 ? 20.237 196.125 -9.427  1.00 174.70 ? 350 TYR A C   1 
ATOM   2173 O  O   . TYR A 1 277 ? 21.313 196.423 -8.900  1.00 186.40 ? 350 TYR A O   1 
ATOM   2174 C  CB  . TYR A 1 277 ? 19.067 195.611 -7.261  1.00 169.75 ? 350 TYR A CB  1 
ATOM   2175 C  CG  . TYR A 1 277 ? 18.441 194.548 -6.384  1.00 187.16 ? 350 TYR A CG  1 
ATOM   2176 C  CD1 . TYR A 1 277 ? 19.230 193.627 -5.707  1.00 167.19 ? 350 TYR A CD1 1 
ATOM   2177 C  CD2 . TYR A 1 277 ? 17.064 194.472 -6.224  1.00 232.61 ? 350 TYR A CD2 1 
ATOM   2178 C  CE1 . TYR A 1 277 ? 18.666 192.656 -4.903  1.00 169.75 ? 350 TYR A CE1 1 
ATOM   2179 C  CE2 . TYR A 1 277 ? 16.490 193.505 -5.419  1.00 223.38 ? 350 TYR A CE2 1 
ATOM   2180 C  CZ  . TYR A 1 277 ? 17.296 192.600 -4.762  1.00 183.64 ? 350 TYR A CZ  1 
ATOM   2181 O  OH  . TYR A 1 277 ? 16.728 191.638 -3.960  1.00 162.34 ? 350 TYR A OH  1 
ATOM   2182 N  N   . ASN A 1 278 ? 19.847 196.597 -10.609 1.00 180.86 ? 351 ASN A N   1 
ATOM   2183 C  CA  . ASN A 1 278 ? 20.668 197.468 -11.444 1.00 197.81 ? 351 ASN A CA  1 
ATOM   2184 C  C   . ASN A 1 278 ? 19.902 197.727 -12.735 1.00 205.76 ? 351 ASN A C   1 
ATOM   2185 O  O   . ASN A 1 278 ? 18.864 197.112 -12.996 1.00 187.70 ? 351 ASN A O   1 
ATOM   2186 C  CB  . ASN A 1 278 ? 22.042 196.862 -11.751 1.00 196.53 ? 351 ASN A CB  1 
ATOM   2187 C  CG  . ASN A 1 278 ? 23.146 197.900 -11.769 1.00 200.55 ? 351 ASN A CG  1 
ATOM   2188 O  OD1 . ASN A 1 278 ? 22.982 199.007 -11.256 1.00 202.67 ? 351 ASN A OD1 1 
ATOM   2189 N  ND2 . ASN A 1 278 ? 24.283 197.544 -12.358 1.00 181.10 ? 351 ASN A ND2 1 
ATOM   2190 N  N   . LYS A 1 279 ? 20.430 198.640 -13.543 1.00 222.88 ? 352 LYS A N   1 
ATOM   2191 C  CA  . LYS A 1 279 ? 19.822 198.935 -14.830 1.00 230.53 ? 352 LYS A CA  1 
ATOM   2192 C  C   . LYS A 1 279 ? 20.096 197.804 -15.817 1.00 232.22 ? 352 LYS A C   1 
ATOM   2193 O  O   . LYS A 1 279 ? 21.127 197.129 -15.752 1.00 228.69 ? 352 LYS A O   1 
ATOM   2194 C  CB  . LYS A 1 279 ? 20.355 200.258 -15.381 1.00 245.00 ? 352 LYS A CB  1 
ATOM   2195 C  CG  . LYS A 1 279 ? 20.332 201.399 -14.376 1.00 243.23 ? 352 LYS A CG  1 
ATOM   2196 C  CD  . LYS A 1 279 ? 21.011 202.641 -14.932 1.00 252.24 ? 352 LYS A CD  1 
ATOM   2197 C  CE  . LYS A 1 279 ? 20.254 203.201 -16.124 1.00 253.63 ? 352 LYS A CE  1 
ATOM   2198 N  NZ  . LYS A 1 279 ? 18.878 203.626 -15.750 1.00 238.52 ? 352 LYS A NZ  1 
ATOM   2199 N  N   . PHE A 1 280 ? 19.153 197.595 -16.738 1.00 229.14 ? 353 PHE A N   1 
ATOM   2200 C  CA  . PHE A 1 280 ? 19.308 196.518 -17.712 1.00 207.50 ? 353 PHE A CA  1 
ATOM   2201 C  C   . PHE A 1 280 ? 20.316 196.883 -18.795 1.00 202.24 ? 353 PHE A C   1 
ATOM   2202 O  O   . PHE A 1 280 ? 21.091 196.028 -19.237 1.00 188.35 ? 353 PHE A O   1 
ATOM   2203 C  CB  . PHE A 1 280 ? 17.957 196.166 -18.335 1.00 196.84 ? 353 PHE A CB  1 
ATOM   2204 C  CG  . PHE A 1 280 ? 17.961 194.870 -19.098 1.00 204.50 ? 353 PHE A CG  1 
ATOM   2205 C  CD1 . PHE A 1 280 ? 17.681 193.674 -18.458 1.00 204.12 ? 353 PHE A CD1 1 
ATOM   2206 C  CD2 . PHE A 1 280 ? 18.247 194.847 -20.454 1.00 213.27 ? 353 PHE A CD2 1 
ATOM   2207 C  CE1 . PHE A 1 280 ? 17.685 192.480 -19.154 1.00 193.74 ? 353 PHE A CE1 1 
ATOM   2208 C  CE2 . PHE A 1 280 ? 18.253 193.655 -21.156 1.00 207.80 ? 353 PHE A CE2 1 
ATOM   2209 C  CZ  . PHE A 1 280 ? 17.971 192.471 -20.505 1.00 188.29 ? 353 PHE A CZ  1 
ATOM   2210 N  N   . ASN A 1 281 ? 20.320 198.140 -19.235 1.00 207.16 ? 354 ASN A N   1 
ATOM   2211 C  CA  . ASN A 1 281 ? 21.298 198.610 -20.208 1.00 202.81 ? 354 ASN A CA  1 
ATOM   2212 C  C   . ASN A 1 281 ? 22.621 199.005 -19.567 1.00 197.24 ? 354 ASN A C   1 
ATOM   2213 O  O   . ASN A 1 281 ? 23.531 199.441 -20.282 1.00 184.60 ? 354 ASN A O   1 
ATOM   2214 C  CB  . ASN A 1 281 ? 20.734 199.794 -20.998 1.00 196.51 ? 354 ASN A CB  1 
ATOM   2215 C  CG  . ASN A 1 281 ? 20.192 199.385 -22.354 1.00 205.13 ? 354 ASN A CG  1 
ATOM   2216 O  OD1 . ASN A 1 281 ? 19.025 199.017 -22.485 1.00 231.53 ? 354 ASN A OD1 1 
ATOM   2217 N  ND2 . ASN A 1 281 ? 21.042 199.447 -23.373 1.00 177.96 ? 354 ASN A ND2 1 
ATOM   2218 N  N   . ASN A 1 282 ? 22.743 198.874 -18.248 1.00 191.71 ? 355 ASN A N   1 
ATOM   2219 C  CA  . ASN A 1 282 ? 23.976 199.230 -17.561 1.00 203.69 ? 355 ASN A CA  1 
ATOM   2220 C  C   . ASN A 1 282 ? 25.117 198.313 -17.992 1.00 198.09 ? 355 ASN A C   1 
ATOM   2221 O  O   . ASN A 1 282 ? 24.910 197.156 -18.367 1.00 183.94 ? 355 ASN A O   1 
ATOM   2222 C  CB  . ASN A 1 282 ? 23.768 199.158 -16.047 1.00 211.70 ? 355 ASN A CB  1 
ATOM   2223 C  CG  . ASN A 1 282 ? 25.016 199.508 -15.266 1.00 218.61 ? 355 ASN A CG  1 
ATOM   2224 O  OD1 . ASN A 1 282 ? 25.299 200.680 -15.017 1.00 228.14 ? 355 ASN A OD1 1 
ATOM   2225 N  ND2 . ASN A 1 282 ? 25.769 198.489 -14.869 1.00 195.12 ? 355 ASN A ND2 1 
ATOM   2226 N  N   . ASN A 1 283 ? 26.335 198.848 -17.936 1.00 184.28 ? 356 ASN A N   1 
ATOM   2227 C  CA  . ASN A 1 283 ? 27.508 198.147 -18.444 1.00 173.52 ? 356 ASN A CA  1 
ATOM   2228 C  C   . ASN A 1 283 ? 28.068 197.213 -17.377 1.00 206.93 ? 356 ASN A C   1 
ATOM   2229 O  O   . ASN A 1 283 ? 28.414 197.654 -16.276 1.00 226.08 ? 356 ASN A O   1 
ATOM   2230 C  CB  . ASN A 1 283 ? 28.563 199.156 -18.888 1.00 177.30 ? 356 ASN A CB  1 
ATOM   2231 C  CG  . ASN A 1 283 ? 29.805 198.493 -19.445 1.00 205.57 ? 356 ASN A CG  1 
ATOM   2232 O  OD1 . ASN A 1 283 ? 30.681 198.060 -18.695 1.00 225.42 ? 356 ASN A OD1 1 
ATOM   2233 N  ND2 . ASN A 1 283 ? 29.891 198.412 -20.767 1.00 202.26 ? 356 ASN A ND2 1 
ATOM   2234 N  N   . CYS A 1 284 ? 28.151 195.919 -17.701 1.00 217.87 ? 357 CYS A N   1 
ATOM   2235 C  CA  . CYS A 1 284 ? 28.762 194.952 -16.794 1.00 198.90 ? 357 CYS A CA  1 
ATOM   2236 C  C   . CYS A 1 284 ? 30.283 194.949 -16.906 1.00 175.96 ? 357 CYS A C   1 
ATOM   2237 O  O   . CYS A 1 284 ? 30.981 194.763 -15.903 1.00 178.53 ? 357 CYS A O   1 
ATOM   2238 C  CB  . CYS A 1 284 ? 28.219 193.550 -17.078 1.00 178.54 ? 357 CYS A CB  1 
ATOM   2239 S  SG  . CYS A 1 284 ? 26.422 193.407 -17.044 1.00 216.45 ? 357 CYS A SG  1 
ATOM   2240 N  N   . TYR A 1 285 ? 30.804 195.153 -18.117 1.00 169.05 ? 358 TYR A N   1 
ATOM   2241 C  CA  . TYR A 1 285 ? 32.231 194.987 -18.384 1.00 169.89 ? 358 TYR A CA  1 
ATOM   2242 C  C   . TYR A 1 285 ? 33.071 195.944 -17.543 1.00 187.31 ? 358 TYR A C   1 
ATOM   2243 O  O   . TYR A 1 285 ? 33.936 195.521 -16.763 1.00 223.21 ? 358 TYR A O   1 
ATOM   2244 C  CB  . TYR A 1 285 ? 32.481 195.202 -19.879 1.00 172.38 ? 358 TYR A CB  1 
ATOM   2245 C  CG  . TYR A 1 285 ? 33.836 194.772 -20.388 1.00 173.79 ? 358 TYR A CG  1 
ATOM   2246 C  CD1 . TYR A 1 285 ? 34.047 193.478 -20.844 1.00 170.48 ? 358 TYR A CD1 1 
ATOM   2247 C  CD2 . TYR A 1 285 ? 34.896 195.667 -20.441 1.00 198.89 ? 358 TYR A CD2 1 
ATOM   2248 C  CE1 . TYR A 1 285 ? 35.281 193.082 -21.323 1.00 191.22 ? 358 TYR A CE1 1 
ATOM   2249 C  CE2 . TYR A 1 285 ? 36.133 195.281 -20.918 1.00 200.55 ? 358 TYR A CE2 1 
ATOM   2250 C  CZ  . TYR A 1 285 ? 36.321 193.988 -21.357 1.00 204.11 ? 358 TYR A CZ  1 
ATOM   2251 O  OH  . TYR A 1 285 ? 37.553 193.601 -21.833 1.00 221.87 ? 358 TYR A OH  1 
ATOM   2252 N  N   . GLN A 1 286 ? 32.816 197.248 -17.686 1.00 182.29 ? 359 GLN A N   1 
ATOM   2253 C  CA  . GLN A 1 286 ? 33.596 198.249 -16.965 1.00 191.60 ? 359 GLN A CA  1 
ATOM   2254 C  C   . GLN A 1 286 ? 33.470 198.071 -15.458 1.00 211.32 ? 359 GLN A C   1 
ATOM   2255 O  O   . GLN A 1 286 ? 34.449 198.238 -14.721 1.00 228.04 ? 359 GLN A O   1 
ATOM   2256 C  CB  . GLN A 1 286 ? 33.151 199.651 -17.382 1.00 192.69 ? 359 GLN A CB  1 
ATOM   2257 C  CG  . GLN A 1 286 ? 33.902 200.781 -16.702 1.00 205.58 ? 359 GLN A CG  1 
ATOM   2258 C  CD  . GLN A 1 286 ? 33.368 202.143 -17.094 1.00 227.29 ? 359 GLN A CD  1 
ATOM   2259 O  OE1 . GLN A 1 286 ? 32.366 202.248 -17.802 1.00 250.88 ? 359 GLN A OE1 1 
ATOM   2260 N  NE2 . GLN A 1 286 ? 34.035 203.196 -16.635 1.00 211.34 ? 359 GLN A NE2 1 
ATOM   2261 N  N   . ASP A 1 287 ? 32.271 197.736 -14.981 1.00 207.30 ? 360 ASP A N   1 
ATOM   2262 C  CA  . ASP A 1 287 ? 32.042 197.493 -13.562 1.00 202.09 ? 360 ASP A CA  1 
ATOM   2263 C  C   . ASP A 1 287 ? 32.948 196.388 -13.033 1.00 185.91 ? 360 ASP A C   1 
ATOM   2264 O  O   . ASP A 1 287 ? 33.810 196.640 -12.186 1.00 178.36 ? 360 ASP A O   1 
ATOM   2265 C  CB  . ASP A 1 287 ? 30.575 197.143 -13.312 1.00 189.37 ? 360 ASP A CB  1 
ATOM   2266 C  CG  . ASP A 1 287 ? 29.650 198.312 -13.570 1.00 192.47 ? 360 ASP A CG  1 
ATOM   2267 O  OD1 . ASP A 1 287 ? 30.008 199.184 -14.388 1.00 186.55 ? 360 ASP A OD1 1 
ATOM   2268 O  OD2 . ASP A 1 287 ? 28.565 198.362 -12.953 1.00 218.20 ? 360 ASP A OD2 1 
ATOM   2269 N  N   . ALA A 1 288 ? 32.752 195.163 -13.531 1.00 151.72 ? 361 ALA A N   1 
ATOM   2270 C  CA  . ALA A 1 288 ? 33.546 194.026 -13.072 1.00 133.72 ? 361 ALA A CA  1 
ATOM   2271 C  C   . ALA A 1 288 ? 35.039 194.306 -13.179 1.00 157.64 ? 361 ALA A C   1 
ATOM   2272 O  O   . ALA A 1 288 ? 35.804 194.013 -12.249 1.00 193.72 ? 361 ALA A O   1 
ATOM   2273 C  CB  . ALA A 1 288 ? 33.176 192.777 -13.872 1.00 111.02 ? 361 ALA A CB  1 
ATOM   2274 N  N   . LEU A 1 289 ? 35.470 194.881 -14.305 1.00 155.17 ? 362 LEU A N   1 
ATOM   2275 C  CA  . LEU A 1 289 ? 36.877 195.231 -14.478 1.00 165.49 ? 362 LEU A CA  1 
ATOM   2276 C  C   . LEU A 1 289 ? 37.361 196.131 -13.344 1.00 175.60 ? 362 LEU A C   1 
ATOM   2277 O  O   . LEU A 1 289 ? 38.274 195.770 -12.588 1.00 205.59 ? 362 LEU A O   1 
ATOM   2278 C  CB  . LEU A 1 289 ? 37.080 195.902 -15.840 1.00 174.26 ? 362 LEU A CB  1 
ATOM   2279 C  CG  . LEU A 1 289 ? 38.506 196.047 -16.382 1.00 184.09 ? 362 LEU A CG  1 
ATOM   2280 C  CD1 . LEU A 1 289 ? 38.494 195.971 -17.901 1.00 183.49 ? 362 LEU A CD1 1 
ATOM   2281 C  CD2 . LEU A 1 289 ? 39.149 197.349 -15.924 1.00 168.24 ? 362 LEU A CD2 1 
ATOM   2282 N  N   . VAL A 1 290 ? 36.758 197.317 -13.221 1.00 147.41 ? 363 VAL A N   1 
ATOM   2283 C  CA  . VAL A 1 290 ? 37.200 198.302 -12.234 1.00 168.60 ? 363 VAL A CA  1 
ATOM   2284 C  C   . VAL A 1 290 ? 37.190 197.711 -10.829 1.00 173.29 ? 363 VAL A C   1 
ATOM   2285 O  O   . VAL A 1 290 ? 38.138 197.899 -10.057 1.00 142.52 ? 363 VAL A O   1 
ATOM   2286 C  CB  . VAL A 1 290 ? 36.329 199.569 -12.320 1.00 145.44 ? 363 VAL A CB  1 
ATOM   2287 C  CG1 . VAL A 1 290 ? 36.573 200.469 -11.119 1.00 142.04 ? 363 VAL A CG1 1 
ATOM   2288 C  CG2 . VAL A 1 290 ? 36.617 200.320 -13.611 1.00 153.09 ? 363 VAL A CG2 1 
ATOM   2289 N  N   . THR A 1 291 ? 36.127 196.986 -10.474 1.00 174.72 ? 364 THR A N   1 
ATOM   2290 C  CA  . THR A 1 291 ? 36.028 196.435 -9.124  1.00 183.78 ? 364 THR A CA  1 
ATOM   2291 C  C   . THR A 1 291 ? 37.141 195.429 -8.856  1.00 181.49 ? 364 THR A C   1 
ATOM   2292 O  O   . THR A 1 291 ? 37.799 195.476 -7.808  1.00 171.78 ? 364 THR A O   1 
ATOM   2293 C  CB  . THR A 1 291 ? 34.658 195.788 -8.916  1.00 156.13 ? 364 THR A CB  1 
ATOM   2294 O  OG1 . THR A 1 291 ? 34.473 194.737 -9.872  1.00 153.36 ? 364 THR A OG1 1 
ATOM   2295 C  CG2 . THR A 1 291 ? 33.553 196.821 -9.078  1.00 160.85 ? 364 THR A CG2 1 
ATOM   2296 N  N   . SER A 1 292 ? 37.372 194.511 -9.800  1.00 151.91 ? 365 SER A N   1 
ATOM   2297 C  CA  . SER A 1 292 ? 38.425 193.515 -9.618  1.00 110.24 ? 365 SER A CA  1 
ATOM   2298 C  C   . SER A 1 292 ? 39.790 194.179 -9.476  1.00 111.35 ? 365 SER A C   1 
ATOM   2299 O  O   . SER A 1 292 ? 40.573 193.837 -8.578  1.00 156.91 ? 365 SER A O   1 
ATOM   2300 C  CB  . SER A 1 292 ? 38.419 192.532 -10.787 1.00 146.24 ? 365 SER A CB  1 
ATOM   2301 O  OG  . SER A 1 292 ? 37.159 191.895 -10.911 1.00 156.63 ? 365 SER A OG  1 
ATOM   2302 N  N   . VAL A 1 293 ? 40.088 195.143 -10.352 1.00 127.08 ? 366 VAL A N   1 
ATOM   2303 C  CA  . VAL A 1 293 ? 41.374 195.833 -10.285 1.00 146.50 ? 366 VAL A CA  1 
ATOM   2304 C  C   . VAL A 1 293 ? 41.526 196.557 -8.951  1.00 164.96 ? 366 VAL A C   1 
ATOM   2305 O  O   . VAL A 1 293 ? 42.598 196.529 -8.333  1.00 169.19 ? 366 VAL A O   1 
ATOM   2306 C  CB  . VAL A 1 293 ? 41.528 196.797 -11.477 1.00 162.29 ? 366 VAL A CB  1 
ATOM   2307 C  CG1 . VAL A 1 293 ? 42.828 197.579 -11.367 1.00 174.18 ? 366 VAL A CG1 1 
ATOM   2308 C  CG2 . VAL A 1 293 ? 41.479 196.026 -12.787 1.00 134.25 ? 366 VAL A CG2 1 
ATOM   2309 N  N   . VAL A 1 294 ? 40.456 197.202 -8.480  1.00 188.17 ? 367 VAL A N   1 
ATOM   2310 C  CA  . VAL A 1 294 ? 40.508 197.906 -7.200  1.00 204.86 ? 367 VAL A CA  1 
ATOM   2311 C  C   . VAL A 1 294 ? 40.791 196.931 -6.064  1.00 200.80 ? 367 VAL A C   1 
ATOM   2312 O  O   . VAL A 1 294 ? 41.560 197.235 -5.143  1.00 221.78 ? 367 VAL A O   1 
ATOM   2313 C  CB  . VAL A 1 294 ? 39.203 198.690 -6.966  1.00 208.92 ? 367 VAL A CB  1 
ATOM   2314 C  CG1 . VAL A 1 294 ? 39.071 199.092 -5.503  1.00 193.60 ? 367 VAL A CG1 1 
ATOM   2315 C  CG2 . VAL A 1 294 ? 39.161 199.921 -7.855  1.00 221.21 ? 367 VAL A CG2 1 
ATOM   2316 N  N   . ASN A 1 295 ? 40.183 195.744 -6.113  1.00 174.52 ? 368 ASN A N   1 
ATOM   2317 C  CA  . ASN A 1 295 ? 40.450 194.738 -5.090  1.00 150.70 ? 368 ASN A CA  1 
ATOM   2318 C  C   . ASN A 1 295 ? 41.917 194.319 -5.099  1.00 152.01 ? 368 ASN A C   1 
ATOM   2319 O  O   . ASN A 1 295 ? 42.589 194.332 -4.057  1.00 166.74 ? 368 ASN A O   1 
ATOM   2320 C  CB  . ASN A 1 295 ? 39.541 193.527 -5.301  1.00 153.86 ? 368 ASN A CB  1 
ATOM   2321 C  CG  . ASN A 1 295 ? 39.907 192.360 -4.408  1.00 166.52 ? 368 ASN A CG  1 
ATOM   2322 O  OD1 . ASN A 1 295 ? 39.551 192.331 -3.230  1.00 186.51 ? 368 ASN A OD1 1 
ATOM   2323 N  ND2 . ASN A 1 295 ? 40.622 191.390 -4.965  1.00 174.71 ? 368 ASN A ND2 1 
ATOM   2324 N  N   . CYS A 1 296 ? 42.435 193.955 -6.276  1.00 134.54 ? 369 CYS A N   1 
ATOM   2325 C  CA  . CYS A 1 296 ? 43.805 193.453 -6.356  1.00 137.37 ? 369 CYS A CA  1 
ATOM   2326 C  C   . CYS A 1 296 ? 44.816 194.517 -5.939  1.00 166.02 ? 369 CYS A C   1 
ATOM   2327 O  O   . CYS A 1 296 ? 45.747 194.238 -5.171  1.00 206.43 ? 369 CYS A O   1 
ATOM   2328 C  CB  . CYS A 1 296 ? 44.091 192.949 -7.770  1.00 144.39 ? 369 CYS A CB  1 
ATOM   2329 S  SG  . CYS A 1 296 ? 43.127 191.487 -8.230  1.00 131.17 ? 369 CYS A SG  1 
ATOM   2330 N  N   . MET A 1 297 ? 44.649 195.747 -6.432  1.00 174.42 ? 370 MET A N   1 
ATOM   2331 C  CA  . MET A 1 297 ? 45.553 196.821 -6.031  1.00 189.57 ? 370 MET A CA  1 
ATOM   2332 C  C   . MET A 1 297 ? 45.420 197.135 -4.546  1.00 197.65 ? 370 MET A C   1 
ATOM   2333 O  O   . MET A 1 297 ? 46.408 197.504 -3.898  1.00 186.54 ? 370 MET A O   1 
ATOM   2334 C  CB  . MET A 1 297 ? 45.291 198.072 -6.872  1.00 172.92 ? 370 MET A CB  1 
ATOM   2335 C  CG  . MET A 1 297 ? 45.459 197.854 -8.370  1.00 184.07 ? 370 MET A CG  1 
ATOM   2336 S  SD  . MET A 1 297 ? 47.120 197.331 -8.839  1.00 260.60 ? 370 MET A SD  1 
ATOM   2337 C  CE  . MET A 1 297 ? 48.026 198.865 -8.652  1.00 199.09 ? 370 MET A CE  1 
ATOM   2338 N  N   . THR A 1 298 ? 44.213 196.993 -3.993  1.00 178.40 ? 371 THR A N   1 
ATOM   2339 C  CA  . THR A 1 298 ? 44.033 197.148 -2.553  1.00 158.39 ? 371 THR A CA  1 
ATOM   2340 C  C   . THR A 1 298 ? 44.881 196.139 -1.789  1.00 185.55 ? 371 THR A C   1 
ATOM   2341 O  O   . THR A 1 298 ? 45.546 196.490 -0.805  1.00 189.15 ? 371 THR A O   1 
ATOM   2342 C  CB  . THR A 1 298 ? 42.556 196.994 -2.186  1.00 153.64 ? 371 THR A CB  1 
ATOM   2343 O  OG1 . THR A 1 298 ? 41.773 197.915 -2.955  1.00 171.87 ? 371 THR A OG1 1 
ATOM   2344 C  CG2 . THR A 1 298 ? 42.341 197.270 -0.706  1.00 170.34 ? 371 THR A CG2 1 
ATOM   2345 N  N   . SER A 1 299 ? 44.875 194.877 -2.232  1.00 195.53 ? 372 SER A N   1 
ATOM   2346 C  CA  . SER A 1 299 ? 45.783 193.897 -1.644  1.00 150.02 ? 372 SER A CA  1 
ATOM   2347 C  C   . SER A 1 299 ? 47.237 194.323 -1.818  1.00 142.08 ? 372 SER A C   1 
ATOM   2348 O  O   . SER A 1 299 ? 48.060 194.147 -0.908  1.00 139.58 ? 372 SER A O   1 
ATOM   2349 C  CB  . SER A 1 299 ? 45.553 192.521 -2.272  1.00 122.62 ? 372 SER A CB  1 
ATOM   2350 O  OG  . SER A 1 299 ? 44.211 192.097 -2.112  1.00 108.45 ? 372 SER A OG  1 
ATOM   2351 N  N   . PHE A 1 300 ? 47.565 194.905 -2.975  1.00 140.69 ? 373 PHE A N   1 
ATOM   2352 C  CA  . PHE A 1 300 ? 48.948 195.270 -3.265  1.00 149.37 ? 373 PHE A CA  1 
ATOM   2353 C  C   . PHE A 1 300 ? 49.461 196.327 -2.293  1.00 160.12 ? 373 PHE A C   1 
ATOM   2354 O  O   . PHE A 1 300 ? 50.572 196.209 -1.762  1.00 154.15 ? 373 PHE A O   1 
ATOM   2355 C  CB  . PHE A 1 300 ? 49.068 195.756 -4.709  1.00 164.28 ? 373 PHE A CB  1 
ATOM   2356 C  CG  . PHE A 1 300 ? 50.482 196.019 -5.146  1.00 181.21 ? 373 PHE A CG  1 
ATOM   2357 C  CD1 . PHE A 1 300 ? 51.355 194.969 -5.383  1.00 181.31 ? 373 PHE A CD1 1 
ATOM   2358 C  CD2 . PHE A 1 300 ? 50.936 197.315 -5.327  1.00 165.10 ? 373 PHE A CD2 1 
ATOM   2359 C  CE1 . PHE A 1 300 ? 52.656 195.207 -5.788  1.00 142.31 ? 373 PHE A CE1 1 
ATOM   2360 C  CE2 . PHE A 1 300 ? 52.236 197.559 -5.733  1.00 153.14 ? 373 PHE A CE2 1 
ATOM   2361 C  CZ  . PHE A 1 300 ? 53.097 196.503 -5.963  1.00 145.23 ? 373 PHE A CZ  1 
ATOM   2362 N  N   . VAL A 1 301 ? 48.669 197.375 -2.050  1.00 143.30 ? 374 VAL A N   1 
ATOM   2363 C  CA  . VAL A 1 301 ? 49.103 198.401 -1.103  1.00 147.34 ? 374 VAL A CA  1 
ATOM   2364 C  C   . VAL A 1 301 ? 49.023 197.883 0.329   1.00 154.36 ? 374 VAL A C   1 
ATOM   2365 O  O   . VAL A 1 301 ? 49.824 198.281 1.189   1.00 140.94 ? 374 VAL A O   1 
ATOM   2366 C  CB  . VAL A 1 301 ? 48.283 199.692 -1.289  1.00 138.81 ? 374 VAL A CB  1 
ATOM   2367 C  CG1 . VAL A 1 301 ? 48.604 200.330 -2.632  1.00 129.75 ? 374 VAL A CG1 1 
ATOM   2368 C  CG2 . VAL A 1 301 ? 46.795 199.407 -1.176  1.00 142.37 ? 374 VAL A CG2 1 
ATOM   2369 N  N   . SER A 1 302 ? 48.069 196.989 0.611   1.00 162.35 ? 375 SER A N   1 
ATOM   2370 C  CA  . SER A 1 302 ? 48.038 196.335 1.914   1.00 136.41 ? 375 SER A CA  1 
ATOM   2371 C  C   . SER A 1 302 ? 49.340 195.598 2.194   1.00 117.18 ? 375 SER A C   1 
ATOM   2372 O  O   . SER A 1 302 ? 49.783 195.532 3.348   1.00 110.85 ? 375 SER A O   1 
ATOM   2373 C  CB  . SER A 1 302 ? 46.851 195.374 1.991   1.00 129.21 ? 375 SER A CB  1 
ATOM   2374 O  OG  . SER A 1 302 ? 45.635 196.045 1.711   1.00 149.48 ? 375 SER A OG  1 
ATOM   2375 N  N   . GLY A 1 303 ? 49.970 195.048 1.151   1.00 149.23 ? 376 GLY A N   1 
ATOM   2376 C  CA  . GLY A 1 303 ? 51.273 194.426 1.328   1.00 138.82 ? 376 GLY A CA  1 
ATOM   2377 C  C   . GLY A 1 303 ? 52.302 195.381 1.902   1.00 120.46 ? 376 GLY A C   1 
ATOM   2378 O  O   . GLY A 1 303 ? 53.051 195.032 2.818   1.00 120.65 ? 376 GLY A O   1 
ATOM   2379 N  N   . PHE A 1 304 ? 52.353 196.603 1.368   1.00 140.76 ? 377 PHE A N   1 
ATOM   2380 C  CA  . PHE A 1 304 ? 53.271 197.601 1.906   1.00 157.19 ? 377 PHE A CA  1 
ATOM   2381 C  C   . PHE A 1 304 ? 52.883 197.997 3.323   1.00 145.75 ? 377 PHE A C   1 
ATOM   2382 O  O   . PHE A 1 304 ? 53.754 198.144 4.191   1.00 146.97 ? 377 PHE A O   1 
ATOM   2383 C  CB  . PHE A 1 304 ? 53.308 198.830 0.999   1.00 163.64 ? 377 PHE A CB  1 
ATOM   2384 C  CG  . PHE A 1 304 ? 53.905 198.566 -0.351  1.00 163.96 ? 377 PHE A CG  1 
ATOM   2385 C  CD1 . PHE A 1 304 ? 55.269 198.691 -0.555  1.00 149.92 ? 377 PHE A CD1 1 
ATOM   2386 C  CD2 . PHE A 1 304 ? 53.104 198.189 -1.415  1.00 172.60 ? 377 PHE A CD2 1 
ATOM   2387 C  CE1 . PHE A 1 304 ? 55.823 198.447 -1.797  1.00 154.85 ? 377 PHE A CE1 1 
ATOM   2388 C  CE2 . PHE A 1 304 ? 53.652 197.944 -2.658  1.00 176.00 ? 377 PHE A CE2 1 
ATOM   2389 C  CZ  . PHE A 1 304 ? 55.013 198.073 -2.850  1.00 166.40 ? 377 PHE A CZ  1 
ATOM   2390 N  N   . VAL A 1 305 ? 51.582 198.167 3.578   1.00 163.14 ? 378 VAL A N   1 
ATOM   2391 C  CA  . VAL A 1 305 ? 51.134 198.552 4.915   1.00 162.36 ? 378 VAL A CA  1 
ATOM   2392 C  C   . VAL A 1 305 ? 51.579 197.523 5.947   1.00 157.82 ? 378 VAL A C   1 
ATOM   2393 O  O   . VAL A 1 305 ? 51.975 197.874 7.066   1.00 142.16 ? 378 VAL A O   1 
ATOM   2394 C  CB  . VAL A 1 305 ? 49.607 198.750 4.934   1.00 161.14 ? 378 VAL A CB  1 
ATOM   2395 C  CG1 . VAL A 1 305 ? 49.133 199.080 6.342   1.00 146.69 ? 378 VAL A CG1 1 
ATOM   2396 C  CG2 . VAL A 1 305 ? 49.204 199.848 3.965   1.00 196.23 ? 378 VAL A CG2 1 
ATOM   2397 N  N   . ILE A 1 306 ? 51.534 196.240 5.589   1.00 162.53 ? 379 ILE A N   1 
ATOM   2398 C  CA  . ILE A 1 306 ? 51.931 195.197 6.530   1.00 151.52 ? 379 ILE A CA  1 
ATOM   2399 C  C   . ILE A 1 306 ? 53.449 195.114 6.644   1.00 138.43 ? 379 ILE A C   1 
ATOM   2400 O  O   . ILE A 1 306 ? 54.002 195.055 7.749   1.00 130.59 ? 379 ILE A O   1 
ATOM   2401 C  CB  . ILE A 1 306 ? 51.323 193.845 6.115   1.00 123.57 ? 379 ILE A CB  1 
ATOM   2402 C  CG1 . ILE A 1 306 ? 49.801 193.881 6.260   1.00 142.20 ? 379 ILE A CG1 1 
ATOM   2403 C  CG2 . ILE A 1 306 ? 51.912 192.714 6.946   1.00 114.48 ? 379 ILE A CG2 1 
ATOM   2404 C  CD1 . ILE A 1 306 ? 49.331 194.153 7.672   1.00 132.88 ? 379 ILE A CD1 1 
ATOM   2405 N  N   . PHE A 1 307 ? 54.150 195.117 5.508   1.00 146.82 ? 380 PHE A N   1 
ATOM   2406 C  CA  . PHE A 1 307 ? 55.573 194.800 5.523   1.00 130.53 ? 380 PHE A CA  1 
ATOM   2407 C  C   . PHE A 1 307 ? 56.459 195.976 5.907   1.00 138.81 ? 380 PHE A C   1 
ATOM   2408 O  O   . PHE A 1 307 ? 57.633 195.762 6.225   1.00 129.33 ? 380 PHE A O   1 
ATOM   2409 C  CB  . PHE A 1 307 ? 56.002 194.240 4.167   1.00 134.56 ? 380 PHE A CB  1 
ATOM   2410 C  CG  . PHE A 1 307 ? 55.821 192.757 4.054   1.00 121.30 ? 380 PHE A CG  1 
ATOM   2411 C  CD1 . PHE A 1 307 ? 56.764 191.892 4.585   1.00 121.01 ? 380 PHE A CD1 1 
ATOM   2412 C  CD2 . PHE A 1 307 ? 54.701 192.225 3.440   1.00 144.39 ? 380 PHE A CD2 1 
ATOM   2413 C  CE1 . PHE A 1 307 ? 56.600 190.526 4.495   1.00 135.81 ? 380 PHE A CE1 1 
ATOM   2414 C  CE2 . PHE A 1 307 ? 54.531 190.858 3.346   1.00 138.82 ? 380 PHE A CE2 1 
ATOM   2415 C  CZ  . PHE A 1 307 ? 55.481 190.009 3.876   1.00 134.88 ? 380 PHE A CZ  1 
ATOM   2416 N  N   . THR A 1 308 ? 55.946 197.208 5.887   1.00 163.52 ? 381 THR A N   1 
ATOM   2417 C  CA  . THR A 1 308 ? 56.711 198.296 6.489   1.00 166.80 ? 381 THR A CA  1 
ATOM   2418 C  C   . THR A 1 308 ? 56.771 198.136 8.003   1.00 179.39 ? 381 THR A C   1 
ATOM   2419 O  O   . THR A 1 308 ? 57.834 198.306 8.615   1.00 150.34 ? 381 THR A O   1 
ATOM   2420 C  CB  . THR A 1 308 ? 56.107 199.649 6.113   1.00 158.41 ? 381 THR A CB  1 
ATOM   2421 O  OG1 . THR A 1 308 ? 54.697 199.636 6.368   1.00 155.20 ? 381 THR A OG1 1 
ATOM   2422 C  CG2 . THR A 1 308 ? 56.358 199.958 4.643   1.00 173.99 ? 381 THR A CG2 1 
ATOM   2423 N  N   . VAL A 1 309 ? 55.641 197.779 8.616   1.00 196.82 ? 382 VAL A N   1 
ATOM   2424 C  CA  . VAL A 1 309 ? 55.592 197.597 10.062  1.00 166.98 ? 382 VAL A CA  1 
ATOM   2425 C  C   . VAL A 1 309 ? 56.312 196.316 10.469  1.00 150.16 ? 382 VAL A C   1 
ATOM   2426 O  O   . VAL A 1 309 ? 56.972 196.267 11.513  1.00 169.71 ? 382 VAL A O   1 
ATOM   2427 C  CB  . VAL A 1 309 ? 54.130 197.611 10.541  1.00 154.35 ? 382 VAL A CB  1 
ATOM   2428 C  CG1 . VAL A 1 309 ? 54.060 197.490 12.050  1.00 150.08 ? 382 VAL A CG1 1 
ATOM   2429 C  CG2 . VAL A 1 309 ? 53.439 198.880 10.072  1.00 160.55 ? 382 VAL A CG2 1 
ATOM   2430 N  N   . LEU A 1 310 ? 56.197 195.259 9.659   1.00 139.81 ? 383 LEU A N   1 
ATOM   2431 C  CA  . LEU A 1 310 ? 56.937 194.036 9.959   1.00 122.41 ? 383 LEU A CA  1 
ATOM   2432 C  C   . LEU A 1 310 ? 58.429 194.206 9.699   1.00 135.26 ? 383 LEU A C   1 
ATOM   2433 O  O   . LEU A 1 310 ? 59.248 193.523 10.324  1.00 148.65 ? 383 LEU A O   1 
ATOM   2434 C  CB  . LEU A 1 310 ? 56.387 192.863 9.148   1.00 139.76 ? 383 LEU A CB  1 
ATOM   2435 C  CG  . LEU A 1 310 ? 55.407 191.945 9.885   1.00 120.40 ? 383 LEU A CG  1 
ATOM   2436 C  CD1 . LEU A 1 310 ? 54.142 192.697 10.268  1.00 147.63 ? 383 LEU A CD1 1 
ATOM   2437 C  CD2 . LEU A 1 310 ? 55.078 190.716 9.049   1.00 132.04 ? 383 LEU A CD2 1 
ATOM   2438 N  N   . GLY A 1 311 ? 58.799 195.101 8.782   1.00 133.01 ? 384 GLY A N   1 
ATOM   2439 C  CA  . GLY A 1 311 ? 60.205 195.421 8.607   1.00 149.59 ? 384 GLY A CA  1 
ATOM   2440 C  C   . GLY A 1 311 ? 60.752 196.229 9.766   1.00 158.94 ? 384 GLY A C   1 
ATOM   2441 O  O   . GLY A 1 311 ? 61.891 196.026 10.196  1.00 124.76 ? 384 GLY A O   1 
ATOM   2442 N  N   . TYR A 1 312 ? 59.947 197.158 10.288  1.00 180.32 ? 385 TYR A N   1 
ATOM   2443 C  CA  . TYR A 1 312 ? 60.327 197.866 11.506  1.00 194.34 ? 385 TYR A CA  1 
ATOM   2444 C  C   . TYR A 1 312 ? 60.435 196.906 12.686  1.00 185.93 ? 385 TYR A C   1 
ATOM   2445 O  O   . TYR A 1 312 ? 61.307 197.065 13.550  1.00 186.43 ? 385 TYR A O   1 
ATOM   2446 C  CB  . TYR A 1 312 ? 59.314 198.974 11.795  1.00 202.11 ? 385 TYR A CB  1 
ATOM   2447 C  CG  . TYR A 1 312 ? 59.229 199.384 13.246  1.00 201.23 ? 385 TYR A CG  1 
ATOM   2448 C  CD1 . TYR A 1 312 ? 60.185 200.216 13.811  1.00 205.48 ? 385 TYR A CD1 1 
ATOM   2449 C  CD2 . TYR A 1 312 ? 58.183 198.947 14.049  1.00 192.58 ? 385 TYR A CD2 1 
ATOM   2450 C  CE1 . TYR A 1 312 ? 60.108 200.596 15.137  1.00 224.41 ? 385 TYR A CE1 1 
ATOM   2451 C  CE2 . TYR A 1 312 ? 58.097 199.321 15.375  1.00 206.70 ? 385 TYR A CE2 1 
ATOM   2452 C  CZ  . TYR A 1 312 ? 59.061 200.145 15.914  1.00 220.04 ? 385 TYR A CZ  1 
ATOM   2453 O  OH  . TYR A 1 312 ? 58.978 200.520 17.236  1.00 212.05 ? 385 TYR A OH  1 
ATOM   2454 N  N   . MET A 1 313 ? 59.559 195.901 12.735  1.00 202.70 ? 386 MET A N   1 
ATOM   2455 C  CA  . MET A 1 313 ? 59.616 194.911 13.806  1.00 165.55 ? 386 MET A CA  1 
ATOM   2456 C  C   . MET A 1 313 ? 60.858 194.038 13.678  1.00 164.74 ? 386 MET A C   1 
ATOM   2457 O  O   . MET A 1 313 ? 61.491 193.696 14.684  1.00 177.41 ? 386 MET A O   1 
ATOM   2458 C  CB  . MET A 1 313 ? 58.351 194.053 13.789  1.00 177.52 ? 386 MET A CB  1 
ATOM   2459 C  CG  . MET A 1 313 ? 58.027 193.388 15.114  1.00 168.76 ? 386 MET A CG  1 
ATOM   2460 S  SD  . MET A 1 313 ? 57.561 194.588 16.376  1.00 162.16 ? 386 MET A SD  1 
ATOM   2461 C  CE  . MET A 1 313 ? 57.076 193.501 17.714  1.00 244.81 ? 386 MET A CE  1 
ATOM   2462 N  N   . ALA A 1 314 ? 61.221 193.667 12.448  1.00 155.77 ? 387 ALA A N   1 
ATOM   2463 C  CA  . ALA A 1 314 ? 62.454 192.922 12.228  1.00 168.80 ? 387 ALA A CA  1 
ATOM   2464 C  C   . ALA A 1 314 ? 63.690 193.786 12.435  1.00 160.72 ? 387 ALA A C   1 
ATOM   2465 O  O   . ALA A 1 314 ? 64.786 193.245 12.610  1.00 138.16 ? 387 ALA A O   1 
ATOM   2466 C  CB  . ALA A 1 314 ? 62.465 192.321 10.822  1.00 196.22 ? 387 ALA A CB  1 
ATOM   2467 N  N   . GLU A 1 315 ? 63.542 195.112 12.398  1.00 176.62 ? 388 GLU A N   1 
ATOM   2468 C  CA  . GLU A 1 315 ? 64.651 195.997 12.736  1.00 192.31 ? 388 GLU A CA  1 
ATOM   2469 C  C   . GLU A 1 315 ? 64.808 196.133 14.245  1.00 183.54 ? 388 GLU A C   1 
ATOM   2470 O  O   . GLU A 1 315 ? 65.934 196.182 14.753  1.00 199.67 ? 388 GLU A O   1 
ATOM   2471 C  CB  . GLU A 1 315 ? 64.444 197.369 12.092  1.00 214.37 ? 388 GLU A CB  1 
ATOM   2472 C  CG  . GLU A 1 315 ? 65.563 198.369 12.358  1.00 187.62 ? 388 GLU A CG  1 
ATOM   2473 C  CD  . GLU A 1 315 ? 66.807 198.103 11.528  1.00 188.93 ? 388 GLU A CD  1 
ATOM   2474 O  OE1 . GLU A 1 315 ? 67.861 198.702 11.827  1.00 209.10 ? 388 GLU A OE1 1 
ATOM   2475 O  OE2 . GLU A 1 315 ? 66.730 197.299 10.575  1.00 195.23 ? 388 GLU A OE2 1 
ATOM   2476 N  N   . MET A 1 316 ? 63.691 196.200 14.975  1.00 196.15 ? 389 MET A N   1 
ATOM   2477 C  CA  . MET A 1 316 ? 63.760 196.244 16.433  1.00 208.87 ? 389 MET A CA  1 
ATOM   2478 C  C   . MET A 1 316 ? 64.273 194.922 16.993  1.00 193.18 ? 389 MET A C   1 
ATOM   2479 O  O   . MET A 1 316 ? 65.117 194.908 17.896  1.00 193.41 ? 389 MET A O   1 
ATOM   2480 C  CB  . MET A 1 316 ? 62.387 196.590 17.008  1.00 218.89 ? 389 MET A CB  1 
ATOM   2481 C  CG  . MET A 1 316 ? 62.414 197.050 18.455  1.00 220.95 ? 389 MET A CG  1 
ATOM   2482 S  SD  . MET A 1 316 ? 60.889 197.885 18.937  1.00 192.39 ? 389 MET A SD  1 
ATOM   2483 C  CE  . MET A 1 316 ? 59.680 196.613 18.584  1.00 173.83 ? 389 MET A CE  1 
ATOM   2484 N  N   . ARG A 1 317 ? 63.771 193.807 16.472  1.00 196.91 ? 390 ARG A N   1 
ATOM   2485 C  CA  . ARG A 1 317 ? 64.394 192.505 16.666  1.00 199.43 ? 390 ARG A CA  1 
ATOM   2486 C  C   . ARG A 1 317 ? 65.536 192.394 15.657  1.00 204.83 ? 390 ARG A C   1 
ATOM   2487 O  O   . ARG A 1 317 ? 65.945 193.391 15.056  1.00 237.85 ? 390 ARG A O   1 
ATOM   2488 C  CB  . ARG A 1 317 ? 63.349 191.400 16.539  1.00 197.61 ? 390 ARG A CB  1 
ATOM   2489 C  CG  . ARG A 1 317 ? 62.267 191.480 17.608  1.00 196.68 ? 390 ARG A CG  1 
ATOM   2490 C  CD  . ARG A 1 317 ? 60.970 190.812 17.176  1.00 193.64 ? 390 ARG A CD  1 
ATOM   2491 N  NE  . ARG A 1 317 ? 61.135 189.388 16.898  1.00 192.38 ? 390 ARG A NE  1 
ATOM   2492 C  CZ  . ARG A 1 317 ? 60.125 188.537 16.753  1.00 204.14 ? 390 ARG A CZ  1 
ATOM   2493 N  NH1 . ARG A 1 317 ? 58.874 188.964 16.868  1.00 190.98 ? 390 ARG A NH1 1 
ATOM   2494 N  NH2 . ARG A 1 317 ? 60.363 187.258 16.499  1.00 215.50 ? 390 ARG A NH2 1 
ATOM   2495 N  N   . ASN A 1 318 ? 66.100 191.206 15.463  1.00 156.63 ? 391 ASN A N   1 
ATOM   2496 C  CA  . ASN A 1 318 ? 67.186 191.059 14.496  1.00 147.82 ? 391 ASN A CA  1 
ATOM   2497 C  C   . ASN A 1 318 ? 66.644 190.422 13.220  1.00 191.74 ? 391 ASN A C   1 
ATOM   2498 O  O   . ASN A 1 318 ? 66.446 189.206 13.148  1.00 181.87 ? 391 ASN A O   1 
ATOM   2499 C  CB  . ASN A 1 318 ? 68.327 190.242 15.090  1.00 144.01 ? 391 ASN A CB  1 
ATOM   2500 C  CG  . ASN A 1 318 ? 69.235 191.075 15.969  1.00 183.92 ? 391 ASN A CG  1 
ATOM   2501 O  OD1 . ASN A 1 318 ? 69.462 192.256 15.701  1.00 153.44 ? 391 ASN A OD1 1 
ATOM   2502 N  ND2 . ASN A 1 318 ? 69.762 190.467 17.024  1.00 219.88 ? 391 ASN A ND2 1 
ATOM   2503 N  N   . GLU A 1 319 ? 66.416 191.270 12.214  1.00 225.96 ? 392 GLU A N   1 
ATOM   2504 C  CA  . GLU A 1 319 ? 66.224 190.930 10.807  1.00 238.34 ? 392 GLU A CA  1 
ATOM   2505 C  C   . GLU A 1 319 ? 65.337 189.715 10.567  1.00 227.43 ? 392 GLU A C   1 
ATOM   2506 O  O   . GLU A 1 319 ? 64.342 189.505 11.270  1.00 217.15 ? 392 GLU A O   1 
ATOM   2507 C  CB  . GLU A 1 319 ? 67.577 190.711 10.132  1.00 235.76 ? 392 GLU A CB  1 
ATOM   2508 C  CG  . GLU A 1 319 ? 67.631 191.255 8.713   1.00 252.83 ? 392 GLU A CG  1 
ATOM   2509 C  CD  . GLU A 1 319 ? 68.976 191.047 8.065   1.00 278.17 ? 392 GLU A CD  1 
ATOM   2510 O  OE1 . GLU A 1 319 ? 69.984 190.991 8.800   1.00 272.24 ? 392 GLU A OE1 1 
ATOM   2511 O  OE2 . GLU A 1 319 ? 69.026 190.929 6.822   1.00 294.85 ? 392 GLU A OE2 1 
ATOM   2512 N  N   . ASP A 1 320 ? 65.742 188.896 9.591   1.00 218.13 ? 393 ASP A N   1 
ATOM   2513 C  CA  . ASP A 1 320 ? 65.082 187.655 9.207   1.00 189.73 ? 393 ASP A CA  1 
ATOM   2514 C  C   . ASP A 1 320 ? 63.569 187.809 9.229   1.00 180.53 ? 393 ASP A C   1 
ATOM   2515 O  O   . ASP A 1 320 ? 62.894 187.207 10.068  1.00 175.95 ? 393 ASP A O   1 
ATOM   2516 C  CB  . ASP A 1 320 ? 65.527 186.517 10.120  1.00 221.96 ? 393 ASP A CB  1 
ATOM   2517 N  N   . VAL A 1 321 ? 63.032 188.624 8.315   1.00 197.36 ? 394 VAL A N   1 
ATOM   2518 C  CA  . VAL A 1 321 ? 61.621 188.995 8.351   1.00 178.59 ? 394 VAL A CA  1 
ATOM   2519 C  C   . VAL A 1 321 ? 60.717 187.771 8.320   1.00 165.75 ? 394 VAL A C   1 
ATOM   2520 O  O   . VAL A 1 321 ? 59.572 187.834 8.780   1.00 175.53 ? 394 VAL A O   1 
ATOM   2521 C  CB  . VAL A 1 321 ? 61.292 189.956 7.188   1.00 164.73 ? 394 VAL A CB  1 
ATOM   2522 C  CG1 . VAL A 1 321 ? 59.957 190.643 7.425   1.00 155.70 ? 394 VAL A CG1 1 
ATOM   2523 C  CG2 . VAL A 1 321 ? 62.402 190.982 7.015   1.00 171.11 ? 394 VAL A CG2 1 
ATOM   2524 N  N   . SER A 1 322 ? 61.211 186.648 7.795   1.00 162.81 ? 395 SER A N   1 
ATOM   2525 C  CA  . SER A 1 322 ? 60.431 185.416 7.819   1.00 161.46 ? 395 SER A CA  1 
ATOM   2526 C  C   . SER A 1 322 ? 60.214 184.913 9.240   1.00 163.41 ? 395 SER A C   1 
ATOM   2527 O  O   . SER A 1 322 ? 59.234 184.208 9.501   1.00 189.79 ? 395 SER A O   1 
ATOM   2528 C  CB  . SER A 1 322 ? 61.119 184.342 6.976   1.00 169.31 ? 395 SER A CB  1 
ATOM   2529 O  OG  . SER A 1 322 ? 60.439 183.103 7.072   1.00 205.95 ? 395 SER A OG  1 
ATOM   2530 N  N   . GLU A 1 323 ? 61.104 185.266 10.171  1.00 178.76 ? 396 GLU A N   1 
ATOM   2531 C  CA  . GLU A 1 323 ? 60.969 184.778 11.541  1.00 181.02 ? 396 GLU A CA  1 
ATOM   2532 C  C   . GLU A 1 323 ? 59.824 185.477 12.264  1.00 181.99 ? 396 GLU A C   1 
ATOM   2533 O  O   . GLU A 1 323 ? 59.003 184.828 12.923  1.00 191.42 ? 396 GLU A O   1 
ATOM   2534 C  CB  . GLU A 1 323 ? 62.282 184.967 12.300  1.00 201.61 ? 396 GLU A CB  1 
ATOM   2535 C  CG  . GLU A 1 323 ? 63.463 184.250 11.672  1.00 216.74 ? 396 GLU A CG  1 
ATOM   2536 C  CD  . GLU A 1 323 ? 63.265 182.752 11.589  1.00 221.80 ? 396 GLU A CD  1 
ATOM   2537 O  OE1 . GLU A 1 323 ? 62.928 182.141 12.623  1.00 233.00 ? 396 GLU A OE1 1 
ATOM   2538 O  OE2 . GLU A 1 323 ? 63.443 182.188 10.489  1.00 207.97 ? 396 GLU A OE2 1 
ATOM   2539 N  N   . VAL A 1 324 ? 59.756 186.808 12.159  1.00 151.95 ? 397 VAL A N   1 
ATOM   2540 C  CA  . VAL A 1 324 ? 58.643 187.539 12.752  1.00 145.25 ? 397 VAL A CA  1 
ATOM   2541 C  C   . VAL A 1 324 ? 57.349 187.301 11.982  1.00 146.47 ? 397 VAL A C   1 
ATOM   2542 O  O   . VAL A 1 324 ? 56.259 187.422 12.553  1.00 152.36 ? 397 VAL A O   1 
ATOM   2543 C  CB  . VAL A 1 324 ? 58.977 189.042 12.837  1.00 146.79 ? 397 VAL A CB  1 
ATOM   2544 C  CG1 . VAL A 1 324 ? 59.037 189.666 11.453  1.00 148.47 ? 397 VAL A CG1 1 
ATOM   2545 C  CG2 . VAL A 1 324 ? 57.979 189.772 13.728  1.00 170.59 ? 397 VAL A CG2 1 
ATOM   2546 N  N   . ALA A 1 325 ? 57.439 186.960 10.699  1.00 157.29 ? 398 ALA A N   1 
ATOM   2547 C  CA  . ALA A 1 325 ? 56.279 186.644 9.878   1.00 152.80 ? 398 ALA A CA  1 
ATOM   2548 C  C   . ALA A 1 325 ? 55.975 185.151 9.837   1.00 151.29 ? 398 ALA A C   1 
ATOM   2549 O  O   . ALA A 1 325 ? 55.124 184.732 9.045   1.00 147.82 ? 398 ALA A O   1 
ATOM   2550 C  CB  . ALA A 1 325 ? 56.474 187.175 8.457   1.00 141.86 ? 398 ALA A CB  1 
ATOM   2551 N  N   . LYS A 1 326 ? 56.678 184.344 10.640  1.00 170.45 ? 399 LYS A N   1 
ATOM   2552 C  CA  . LYS A 1 326 ? 56.487 182.894 10.631  1.00 187.36 ? 399 LYS A CA  1 
ATOM   2553 C  C   . LYS A 1 326 ? 55.015 182.514 10.738  1.00 182.16 ? 399 LYS A C   1 
ATOM   2554 O  O   . LYS A 1 326 ? 54.507 181.714 9.944   1.00 163.41 ? 399 LYS A O   1 
ATOM   2555 C  CB  . LYS A 1 326 ? 57.282 182.257 11.773  1.00 204.80 ? 399 LYS A CB  1 
ATOM   2556 C  CG  . LYS A 1 326 ? 58.608 181.646 11.357  1.00 215.75 ? 399 LYS A CG  1 
ATOM   2557 C  CD  . LYS A 1 326 ? 59.291 180.979 12.540  1.00 201.96 ? 399 LYS A CD  1 
ATOM   2558 C  CE  . LYS A 1 326 ? 60.499 180.173 12.100  1.00 185.17 ? 399 LYS A CE  1 
ATOM   2559 N  NZ  . LYS A 1 326 ? 61.203 179.558 13.259  1.00 161.05 ? 399 LYS A NZ  1 
ATOM   2560 N  N   . ASP A 1 327 ? 54.312 183.080 11.715  1.00 199.15 ? 400 ASP A N   1 
ATOM   2561 C  CA  . ASP A 1 327 ? 52.908 182.749 11.906  1.00 199.28 ? 400 ASP A CA  1 
ATOM   2562 C  C   . ASP A 1 327 ? 52.062 183.418 10.830  1.00 205.21 ? 400 ASP A C   1 
ATOM   2563 O  O   . ASP A 1 327 ? 52.117 184.639 10.648  1.00 200.56 ? 400 ASP A O   1 
ATOM   2564 C  CB  . ASP A 1 327 ? 52.446 183.181 13.297  1.00 196.97 ? 400 ASP A CB  1 
ATOM   2565 C  CG  . ASP A 1 327 ? 51.226 182.414 13.772  1.00 205.92 ? 400 ASP A CG  1 
ATOM   2566 O  OD1 . ASP A 1 327 ? 50.437 181.953 12.921  1.00 211.16 ? 400 ASP A OD1 1 
ATOM   2567 O  OD2 . ASP A 1 327 ? 51.059 182.270 15.002  1.00 197.86 ? 400 ASP A OD2 1 
ATOM   2568 N  N   . ALA A 1 328 ? 51.278 182.615 10.114  1.00 209.53 ? 401 ALA A N   1 
ATOM   2569 C  CA  . ALA A 1 328 ? 50.400 183.096 9.053   1.00 176.49 ? 401 ALA A CA  1 
ATOM   2570 C  C   . ALA A 1 328 ? 48.959 182.943 9.519   1.00 155.83 ? 401 ALA A C   1 
ATOM   2571 O  O   . ALA A 1 328 ? 48.456 181.822 9.645   1.00 164.67 ? 401 ALA A O   1 
ATOM   2572 C  CB  . ALA A 1 328 ? 50.641 182.332 7.754   1.00 185.03 ? 401 ALA A CB  1 
ATOM   2573 N  N   . GLY A 1 329 ? 48.297 184.069 9.767   1.00 173.25 ? 402 GLY A N   1 
ATOM   2574 C  CA  . GLY A 1 329 ? 46.935 184.061 10.239  1.00 174.77 ? 402 GLY A CA  1 
ATOM   2575 C  C   . GLY A 1 329 ? 46.594 185.322 11.003  1.00 192.91 ? 402 GLY A C   1 
ATOM   2576 O  O   . GLY A 1 329 ? 47.257 186.356 10.869  1.00 232.25 ? 402 GLY A O   1 
ATOM   2577 N  N   . PRO A 1 330 ? 45.539 185.262 11.819  1.00 170.88 ? 403 PRO A N   1 
ATOM   2578 C  CA  . PRO A 1 330 ? 45.175 186.439 12.624  1.00 177.90 ? 403 PRO A CA  1 
ATOM   2579 C  C   . PRO A 1 330 ? 46.262 186.860 13.595  1.00 144.80 ? 403 PRO A C   1 
ATOM   2580 O  O   . PRO A 1 330 ? 46.350 188.047 13.938  1.00 144.98 ? 403 PRO A O   1 
ATOM   2581 C  CB  . PRO A 1 330 ? 43.906 185.981 13.359  1.00 188.65 ? 403 PRO A CB  1 
ATOM   2582 C  CG  . PRO A 1 330 ? 43.371 184.852 12.534  1.00 182.86 ? 403 PRO A CG  1 
ATOM   2583 C  CD  . PRO A 1 330 ? 44.576 184.160 11.977  1.00 160.15 ? 403 PRO A CD  1 
ATOM   2584 N  N   . SER A 1 331 ? 47.103 185.922 14.042  1.00 127.43 ? 404 SER A N   1 
ATOM   2585 C  CA  . SER A 1 331 ? 48.184 186.258 14.961  1.00 132.96 ? 404 SER A CA  1 
ATOM   2586 C  C   . SER A 1 331 ? 49.157 187.264 14.363  1.00 142.57 ? 404 SER A C   1 
ATOM   2587 O  O   . SER A 1 331 ? 49.846 187.965 15.112  1.00 151.49 ? 404 SER A O   1 
ATOM   2588 C  CB  . SER A 1 331 ? 48.934 184.991 15.373  1.00 173.99 ? 404 SER A CB  1 
ATOM   2589 O  OG  . SER A 1 331 ? 48.048 184.040 15.935  1.00 164.19 ? 404 SER A OG  1 
ATOM   2590 N  N   . LEU A 1 332 ? 49.232 187.349 13.034  1.00 125.01 ? 405 LEU A N   1 
ATOM   2591 C  CA  . LEU A 1 332 ? 50.047 188.385 12.412  1.00 141.30 ? 405 LEU A CA  1 
ATOM   2592 C  C   . LEU A 1 332 ? 49.469 189.768 12.689  1.00 144.16 ? 405 LEU A C   1 
ATOM   2593 O  O   . LEU A 1 332 ? 50.213 190.711 12.983  1.00 151.37 ? 405 LEU A O   1 
ATOM   2594 C  CB  . LEU A 1 332 ? 50.158 188.126 10.908  1.00 103.24 ? 405 LEU A CB  1 
ATOM   2595 C  CG  . LEU A 1 332 ? 51.317 188.771 10.146  1.00 106.75 ? 405 LEU A CG  1 
ATOM   2596 C  CD1 . LEU A 1 332 ? 51.719 187.895 8.971   1.00 112.86 ? 405 LEU A CD1 1 
ATOM   2597 C  CD2 . LEU A 1 332 ? 50.952 190.168 9.665   1.00 113.02 ? 405 LEU A CD2 1 
ATOM   2598 N  N   . LEU A 1 333 ? 48.145 189.908 12.597  1.00 154.88 ? 406 LEU A N   1 
ATOM   2599 C  CA  . LEU A 1 333 ? 47.508 191.185 12.898  1.00 166.70 ? 406 LEU A CA  1 
ATOM   2600 C  C   . LEU A 1 333 ? 47.303 191.384 14.396  1.00 178.54 ? 406 LEU A C   1 
ATOM   2601 O  O   . LEU A 1 333 ? 47.552 192.476 14.918  1.00 215.94 ? 406 LEU A O   1 
ATOM   2602 C  CB  . LEU A 1 333 ? 46.171 191.291 12.165  1.00 162.48 ? 406 LEU A CB  1 
ATOM   2603 C  CG  . LEU A 1 333 ? 46.219 191.230 10.638  1.00 157.32 ? 406 LEU A CG  1 
ATOM   2604 C  CD1 . LEU A 1 333 ? 44.819 191.352 10.058  1.00 165.82 ? 406 LEU A CD1 1 
ATOM   2605 C  CD2 . LEU A 1 333 ? 47.129 192.316 10.085  1.00 163.41 ? 406 LEU A CD2 1 
ATOM   2606 N  N   . PHE A 1 334 ? 46.850 190.345 15.102  1.00 138.21 ? 407 PHE A N   1 
ATOM   2607 C  CA  . PHE A 1 334 ? 46.445 190.498 16.495  1.00 142.16 ? 407 PHE A CA  1 
ATOM   2608 C  C   . PHE A 1 334 ? 47.609 190.462 17.478  1.00 127.90 ? 407 PHE A C   1 
ATOM   2609 O  O   . PHE A 1 334 ? 47.459 190.947 18.605  1.00 155.83 ? 407 PHE A O   1 
ATOM   2610 C  CB  . PHE A 1 334 ? 45.431 189.416 16.874  1.00 120.28 ? 407 PHE A CB  1 
ATOM   2611 C  CG  . PHE A 1 334 ? 44.050 189.665 16.340  1.00 133.12 ? 407 PHE A CG  1 
ATOM   2612 C  CD1 . PHE A 1 334 ? 43.215 190.586 16.950  1.00 156.56 ? 407 PHE A CD1 1 
ATOM   2613 C  CD2 . PHE A 1 334 ? 43.583 188.975 15.235  1.00 116.03 ? 407 PHE A CD2 1 
ATOM   2614 C  CE1 . PHE A 1 334 ? 41.942 190.818 16.464  1.00 167.38 ? 407 PHE A CE1 1 
ATOM   2615 C  CE2 . PHE A 1 334 ? 42.311 189.201 14.745  1.00 115.87 ? 407 PHE A CE2 1 
ATOM   2616 C  CZ  . PHE A 1 334 ? 41.489 190.124 15.361  1.00 147.92 ? 407 PHE A CZ  1 
ATOM   2617 N  N   . ILE A 1 335 ? 48.754 189.901 17.095  1.00 113.08 ? 408 ILE A N   1 
ATOM   2618 C  CA  . ILE A 1 335 ? 49.883 189.807 18.013  1.00 113.30 ? 408 ILE A CA  1 
ATOM   2619 C  C   . ILE A 1 335 ? 51.056 190.612 17.473  1.00 137.65 ? 408 ILE A C   1 
ATOM   2620 O  O   . ILE A 1 335 ? 51.450 191.623 18.063  1.00 182.24 ? 408 ILE A O   1 
ATOM   2621 C  CB  . ILE A 1 335 ? 50.290 188.342 18.259  1.00 118.10 ? 408 ILE A CB  1 
ATOM   2622 C  CG1 . ILE A 1 335 ? 49.133 187.561 18.884  1.00 133.00 ? 408 ILE A CG1 1 
ATOM   2623 C  CG2 . ILE A 1 335 ? 51.520 188.275 19.152  1.00 135.37 ? 408 ILE A CG2 1 
ATOM   2624 C  CD1 . ILE A 1 335 ? 49.471 186.119 19.196  1.00 116.40 ? 408 ILE A CD1 1 
ATOM   2625 N  N   . THR A 1 336 ? 51.622 190.161 16.351  1.00 133.82 ? 409 THR A N   1 
ATOM   2626 C  CA  . THR A 1 336 ? 52.785 190.825 15.768  1.00 139.22 ? 409 THR A CA  1 
ATOM   2627 C  C   . THR A 1 336 ? 52.503 192.299 15.497  1.00 152.98 ? 409 THR A C   1 
ATOM   2628 O  O   . THR A 1 336 ? 53.152 193.186 16.065  1.00 160.79 ? 409 THR A O   1 
ATOM   2629 C  CB  . THR A 1 336 ? 53.202 190.109 14.482  1.00 135.01 ? 409 THR A CB  1 
ATOM   2630 O  OG1 . THR A 1 336 ? 53.510 188.740 14.773  1.00 167.49 ? 409 THR A OG1 1 
ATOM   2631 C  CG2 . THR A 1 336 ? 54.424 190.780 13.872  1.00 131.19 ? 409 THR A CG2 1 
ATOM   2632 N  N   . TYR A 1 337 ? 51.537 192.575 14.617  1.00 127.43 ? 410 TYR A N   1 
ATOM   2633 C  CA  . TYR A 1 337 ? 51.233 193.954 14.249  1.00 128.78 ? 410 TYR A CA  1 
ATOM   2634 C  C   . TYR A 1 337 ? 50.795 194.771 15.460  1.00 155.07 ? 410 TYR A C   1 
ATOM   2635 O  O   . TYR A 1 337 ? 51.184 195.936 15.604  1.00 145.91 ? 410 TYR A O   1 
ATOM   2636 C  CB  . TYR A 1 337 ? 50.154 193.975 13.167  1.00 125.49 ? 410 TYR A CB  1 
ATOM   2637 C  CG  . TYR A 1 337 ? 50.179 195.201 12.284  1.00 124.33 ? 410 TYR A CG  1 
ATOM   2638 C  CD1 . TYR A 1 337 ? 49.599 196.393 12.698  1.00 130.56 ? 410 TYR A CD1 1 
ATOM   2639 C  CD2 . TYR A 1 337 ? 50.775 195.164 11.031  1.00 130.48 ? 410 TYR A CD2 1 
ATOM   2640 C  CE1 . TYR A 1 337 ? 49.617 197.515 11.892  1.00 138.80 ? 410 TYR A CE1 1 
ATOM   2641 C  CE2 . TYR A 1 337 ? 50.798 196.279 10.216  1.00 167.34 ? 410 TYR A CE2 1 
ATOM   2642 C  CZ  . TYR A 1 337 ? 50.217 197.452 10.652  1.00 163.30 ? 410 TYR A CZ  1 
ATOM   2643 O  OH  . TYR A 1 337 ? 50.237 198.566 9.844   1.00 161.61 ? 410 TYR A OH  1 
ATOM   2644 N  N   . ALA A 1 338 ? 49.992 194.175 16.345  1.00 162.73 ? 411 ALA A N   1 
ATOM   2645 C  CA  . ALA A 1 338 ? 49.516 194.896 17.523  1.00 137.62 ? 411 ALA A CA  1 
ATOM   2646 C  C   . ALA A 1 338 ? 50.666 195.237 18.463  1.00 131.41 ? 411 ALA A C   1 
ATOM   2647 O  O   . ALA A 1 338 ? 50.762 196.366 18.960  1.00 135.42 ? 411 ALA A O   1 
ATOM   2648 C  CB  . ALA A 1 338 ? 48.453 194.072 18.248  1.00 119.81 ? 411 ALA A CB  1 
ATOM   2649 N  N   . GLU A 1 339 ? 51.548 194.267 18.723  1.00 167.60 ? 412 GLU A N   1 
ATOM   2650 C  CA  . GLU A 1 339 ? 52.725 194.539 19.541  1.00 171.26 ? 412 GLU A CA  1 
ATOM   2651 C  C   . GLU A 1 339 ? 53.617 195.588 18.892  1.00 172.56 ? 412 GLU A C   1 
ATOM   2652 O  O   . GLU A 1 339 ? 54.290 196.353 19.593  1.00 175.79 ? 412 GLU A O   1 
ATOM   2653 C  CB  . GLU A 1 339 ? 53.502 193.245 19.786  1.00 172.17 ? 412 GLU A CB  1 
ATOM   2654 C  CG  . GLU A 1 339 ? 54.739 193.400 20.652  1.00 210.10 ? 412 GLU A CG  1 
ATOM   2655 C  CD  . GLU A 1 339 ? 55.338 192.065 21.047  1.00 218.15 ? 412 GLU A CD  1 
ATOM   2656 O  OE1 . GLU A 1 339 ? 55.370 191.762 22.258  1.00 203.42 ? 412 GLU A OE1 1 
ATOM   2657 O  OE2 . GLU A 1 339 ? 55.766 191.315 20.145  1.00 229.44 ? 412 GLU A OE2 1 
ATOM   2658 N  N   . ALA A 1 340 ? 53.630 195.646 17.558  1.00 154.45 ? 413 ALA A N   1 
ATOM   2659 C  CA  . ALA A 1 340 ? 54.361 196.708 16.877  1.00 135.57 ? 413 ALA A CA  1 
ATOM   2660 C  C   . ALA A 1 340 ? 53.658 198.052 17.016  1.00 146.70 ? 413 ALA A C   1 
ATOM   2661 O  O   . ALA A 1 340 ? 54.307 199.101 16.934  1.00 194.79 ? 413 ALA A O   1 
ATOM   2662 C  CB  . ALA A 1 340 ? 54.549 196.354 15.404  1.00 140.43 ? 413 ALA A CB  1 
ATOM   2663 N  N   . ILE A 1 341 ? 52.340 198.044 17.225  1.00 145.64 ? 414 ILE A N   1 
ATOM   2664 C  CA  . ILE A 1 341 ? 51.610 199.292 17.426  1.00 161.65 ? 414 ILE A CA  1 
ATOM   2665 C  C   . ILE A 1 341 ? 51.820 199.819 18.841  1.00 176.41 ? 414 ILE A C   1 
ATOM   2666 O  O   . ILE A 1 341 ? 51.952 201.031 19.050  1.00 184.02 ? 414 ILE A O   1 
ATOM   2667 C  CB  . ILE A 1 341 ? 50.115 199.090 17.112  1.00 153.21 ? 414 ILE A CB  1 
ATOM   2668 C  CG1 . ILE A 1 341 ? 49.912 198.815 15.621  1.00 147.31 ? 414 ILE A CG1 1 
ATOM   2669 C  CG2 . ILE A 1 341 ? 49.301 200.305 17.537  1.00 174.12 ? 414 ILE A CG2 1 
ATOM   2670 C  CD1 . ILE A 1 341 ? 48.463 198.615 15.234  1.00 146.44 ? 414 ILE A CD1 1 
ATOM   2671 N  N   . ALA A 1 342 ? 51.869 198.923 19.830  1.00 152.28 ? 415 ALA A N   1 
ATOM   2672 C  CA  . ALA A 1 342 ? 52.009 199.347 21.219  1.00 155.89 ? 415 ALA A CA  1 
ATOM   2673 C  C   . ALA A 1 342 ? 53.332 200.054 21.489  1.00 193.76 ? 415 ALA A C   1 
ATOM   2674 O  O   . ALA A 1 342 ? 53.446 200.767 22.492  1.00 217.14 ? 415 ALA A O   1 
ATOM   2675 C  CB  . ALA A 1 342 ? 51.865 198.143 22.151  1.00 177.92 ? 415 ALA A CB  1 
ATOM   2676 N  N   . ASN A 1 343 ? 54.329 199.876 20.625  1.00 205.81 ? 416 ASN A N   1 
ATOM   2677 C  CA  . ASN A 1 343 ? 55.640 200.485 20.802  1.00 214.12 ? 416 ASN A CA  1 
ATOM   2678 C  C   . ASN A 1 343 ? 55.784 201.820 20.078  1.00 213.89 ? 416 ASN A C   1 
ATOM   2679 O  O   . ASN A 1 343 ? 56.882 202.384 20.062  1.00 236.26 ? 416 ASN A O   1 
ATOM   2680 C  CB  . ASN A 1 343 ? 56.736 199.522 20.338  1.00 220.11 ? 416 ASN A CB  1 
ATOM   2681 C  CG  . ASN A 1 343 ? 56.895 198.333 21.264  1.00 230.20 ? 416 ASN A CG  1 
ATOM   2682 O  OD1 . ASN A 1 343 ? 56.843 197.182 20.832  1.00 231.37 ? 416 ASN A OD1 1 
ATOM   2683 N  ND2 . ASN A 1 343 ? 57.090 198.607 22.550  1.00 229.50 ? 416 ASN A ND2 1 
ATOM   2684 N  N   . MET A 1 344 ? 54.709 202.336 19.483  1.00 189.79 ? 417 MET A N   1 
ATOM   2685 C  CA  . MET A 1 344 ? 54.796 203.562 18.707  1.00 199.05 ? 417 MET A CA  1 
ATOM   2686 C  C   . MET A 1 344 ? 54.034 204.693 19.392  1.00 216.09 ? 417 MET A C   1 
ATOM   2687 O  O   . MET A 1 344 ? 53.087 204.443 20.146  1.00 226.53 ? 417 MET A O   1 
ATOM   2688 C  CB  . MET A 1 344 ? 54.234 203.359 17.294  1.00 199.22 ? 417 MET A CB  1 
ATOM   2689 C  CG  . MET A 1 344 ? 54.960 202.303 16.479  1.00 195.25 ? 417 MET A CG  1 
ATOM   2690 S  SD  . MET A 1 344 ? 54.390 202.243 14.770  1.00 227.49 ? 417 MET A SD  1 
ATOM   2691 C  CE  . MET A 1 344 ? 52.632 201.994 15.006  1.00 177.49 ? 417 MET A CE  1 
ATOM   2692 N  N   . PRO A 1 345 ? 54.428 205.948 19.161  1.00 216.54 ? 418 PRO A N   1 
ATOM   2693 C  CA  . PRO A 1 345 ? 53.706 207.068 19.776  1.00 211.20 ? 418 PRO A CA  1 
ATOM   2694 C  C   . PRO A 1 345 ? 52.275 207.151 19.267  1.00 191.68 ? 418 PRO A C   1 
ATOM   2695 O  O   . PRO A 1 345 ? 51.964 206.725 18.151  1.00 181.37 ? 418 PRO A O   1 
ATOM   2696 C  CB  . PRO A 1 345 ? 54.525 208.294 19.354  1.00 234.24 ? 418 PRO A CB  1 
ATOM   2697 C  CG  . PRO A 1 345 ? 55.254 207.857 18.126  1.00 233.19 ? 418 PRO A CG  1 
ATOM   2698 C  CD  . PRO A 1 345 ? 55.565 206.408 18.346  1.00 218.92 ? 418 PRO A CD  1 
ATOM   2699 N  N   . ALA A 1 346 ? 51.404 207.713 20.106  1.00 211.14 ? 419 ALA A N   1 
ATOM   2700 C  CA  . ALA A 1 346 ? 49.964 207.749 19.852  1.00 222.15 ? 419 ALA A CA  1 
ATOM   2701 C  C   . ALA A 1 346 ? 49.436 206.344 19.567  1.00 226.11 ? 419 ALA A C   1 
ATOM   2702 O  O   . ALA A 1 346 ? 48.674 206.112 18.626  1.00 214.03 ? 419 ALA A O   1 
ATOM   2703 C  CB  . ALA A 1 346 ? 49.626 208.712 18.712  1.00 205.58 ? 419 ALA A CB  1 
ATOM   2704 N  N   . SER A 1 347 ? 49.859 205.396 20.408  1.00 222.01 ? 420 SER A N   1 
ATOM   2705 C  CA  . SER A 1 347 ? 49.513 203.993 20.198  1.00 191.53 ? 420 SER A CA  1 
ATOM   2706 C  C   . SER A 1 347 ? 48.013 203.754 20.303  1.00 173.84 ? 420 SER A C   1 
ATOM   2707 O  O   . SER A 1 347 ? 47.475 202.884 19.608  1.00 169.52 ? 420 SER A O   1 
ATOM   2708 C  CB  . SER A 1 347 ? 50.267 203.122 21.202  1.00 175.91 ? 420 SER A CB  1 
ATOM   2709 O  OG  . SER A 1 347 ? 50.298 203.736 22.478  1.00 195.15 ? 420 SER A OG  1 
ATOM   2710 N  N   . THR A 1 348 ? 47.324 204.506 21.165  1.00 178.77 ? 421 THR A N   1 
ATOM   2711 C  CA  . THR A 1 348 ? 45.871 204.395 21.248  1.00 179.39 ? 421 THR A CA  1 
ATOM   2712 C  C   . THR A 1 348 ? 45.219 204.732 19.912  1.00 181.70 ? 421 THR A C   1 
ATOM   2713 O  O   . THR A 1 348 ? 44.310 204.026 19.458  1.00 192.00 ? 421 THR A O   1 
ATOM   2714 C  CB  . THR A 1 348 ? 45.341 205.311 22.353  1.00 167.12 ? 421 THR A CB  1 
ATOM   2715 O  OG1 . THR A 1 348 ? 45.859 204.886 23.620  1.00 154.56 ? 421 THR A OG1 1 
ATOM   2716 C  CG2 . THR A 1 348 ? 43.821 205.283 22.395  1.00 155.06 ? 421 THR A CG2 1 
ATOM   2717 N  N   . PHE A 1 349 ? 45.689 205.797 19.261  1.00 181.70 ? 422 PHE A N   1 
ATOM   2718 C  CA  . PHE A 1 349 ? 45.140 206.209 17.973  1.00 168.55 ? 422 PHE A CA  1 
ATOM   2719 C  C   . PHE A 1 349 ? 45.328 205.121 16.920  1.00 162.10 ? 422 PHE A C   1 
ATOM   2720 O  O   . PHE A 1 349 ? 44.358 204.640 16.316  1.00 172.36 ? 422 PHE A O   1 
ATOM   2721 C  CB  . PHE A 1 349 ? 45.806 207.519 17.540  1.00 202.43 ? 422 PHE A CB  1 
ATOM   2722 C  CG  . PHE A 1 349 ? 45.541 207.904 16.113  1.00 193.92 ? 422 PHE A CG  1 
ATOM   2723 C  CD1 . PHE A 1 349 ? 44.372 208.558 15.764  1.00 188.13 ? 422 PHE A CD1 1 
ATOM   2724 C  CD2 . PHE A 1 349 ? 46.474 207.636 15.125  1.00 186.41 ? 422 PHE A CD2 1 
ATOM   2725 C  CE1 . PHE A 1 349 ? 44.130 208.922 14.453  1.00 198.05 ? 422 PHE A CE1 1 
ATOM   2726 C  CE2 . PHE A 1 349 ? 46.239 207.996 13.812  1.00 177.98 ? 422 PHE A CE2 1 
ATOM   2727 C  CZ  . PHE A 1 349 ? 45.066 208.641 13.476  1.00 185.99 ? 422 PHE A CZ  1 
ATOM   2728 N  N   . PHE A 1 350 ? 46.579 204.709 16.698  1.00 170.73 ? 423 PHE A N   1 
ATOM   2729 C  CA  . PHE A 1 350 ? 46.876 203.726 15.664  1.00 184.07 ? 423 PHE A CA  1 
ATOM   2730 C  C   . PHE A 1 350 ? 46.286 202.356 15.969  1.00 173.29 ? 423 PHE A C   1 
ATOM   2731 O  O   . PHE A 1 350 ? 46.092 201.563 15.043  1.00 182.50 ? 423 PHE A O   1 
ATOM   2732 C  CB  . PHE A 1 350 ? 48.388 203.612 15.464  1.00 174.92 ? 423 PHE A CB  1 
ATOM   2733 C  CG  . PHE A 1 350 ? 49.007 204.830 14.839  1.00 167.31 ? 423 PHE A CG  1 
ATOM   2734 C  CD1 . PHE A 1 350 ? 48.965 205.017 13.468  1.00 162.54 ? 423 PHE A CD1 1 
ATOM   2735 C  CD2 . PHE A 1 350 ? 49.628 205.788 15.623  1.00 197.14 ? 423 PHE A CD2 1 
ATOM   2736 C  CE1 . PHE A 1 350 ? 49.530 206.137 12.888  1.00 175.09 ? 423 PHE A CE1 1 
ATOM   2737 C  CE2 . PHE A 1 350 ? 50.197 206.910 15.049  1.00 226.02 ? 423 PHE A CE2 1 
ATOM   2738 C  CZ  . PHE A 1 350 ? 50.147 207.085 13.680  1.00 206.58 ? 423 PHE A CZ  1 
ATOM   2739 N  N   . ALA A 1 351 ? 46.002 202.054 17.237  1.00 173.31 ? 424 ALA A N   1 
ATOM   2740 C  CA  . ALA A 1 351 ? 45.310 200.810 17.555  1.00 165.22 ? 424 ALA A CA  1 
ATOM   2741 C  C   . ALA A 1 351 ? 43.821 200.917 17.245  1.00 178.12 ? 424 ALA A C   1 
ATOM   2742 O  O   . ALA A 1 351 ? 43.237 200.011 16.634  1.00 208.21 ? 424 ALA A O   1 
ATOM   2743 C  CB  . ALA A 1 351 ? 45.532 200.444 19.023  1.00 164.70 ? 424 ALA A CB  1 
ATOM   2744 N  N   . ILE A 1 352 ? 43.197 202.026 17.653  1.00 163.79 ? 425 ILE A N   1 
ATOM   2745 C  CA  . ILE A 1 352 ? 41.769 202.219 17.413  1.00 162.15 ? 425 ILE A CA  1 
ATOM   2746 C  C   . ILE A 1 352 ? 41.471 202.195 15.919  1.00 190.91 ? 425 ILE A C   1 
ATOM   2747 O  O   . ILE A 1 352 ? 40.560 201.493 15.462  1.00 201.11 ? 425 ILE A O   1 
ATOM   2748 C  CB  . ILE A 1 352 ? 41.285 203.528 18.063  1.00 157.75 ? 425 ILE A CB  1 
ATOM   2749 C  CG1 . ILE A 1 352 ? 41.230 203.385 19.585  1.00 177.85 ? 425 ILE A CG1 1 
ATOM   2750 C  CG2 . ILE A 1 352 ? 39.921 203.926 17.518  1.00 158.40 ? 425 ILE A CG2 1 
ATOM   2751 C  CD1 . ILE A 1 352 ? 40.846 204.660 20.302  1.00 207.15 ? 425 ILE A CD1 1 
ATOM   2752 N  N   . ILE A 1 353 ? 42.240 202.954 15.133  1.00 205.17 ? 426 ILE A N   1 
ATOM   2753 C  CA  . ILE A 1 353 ? 41.973 202.995 13.698  1.00 197.57 ? 426 ILE A CA  1 
ATOM   2754 C  C   . ILE A 1 353 ? 42.278 201.648 13.049  1.00 191.13 ? 426 ILE A C   1 
ATOM   2755 O  O   . ILE A 1 353 ? 41.685 201.300 12.021  1.00 190.33 ? 426 ILE A O   1 
ATOM   2756 C  CB  . ILE A 1 353 ? 42.762 204.137 13.029  1.00 179.65 ? 426 ILE A CB  1 
ATOM   2757 C  CG1 . ILE A 1 353 ? 44.264 203.852 13.055  1.00 181.97 ? 426 ILE A CG1 1 
ATOM   2758 C  CG2 . ILE A 1 353 ? 42.459 205.463 13.711  1.00 184.78 ? 426 ILE A CG2 1 
ATOM   2759 C  CD1 . ILE A 1 353 ? 45.086 204.859 12.280  1.00 180.22 ? 426 ILE A CD1 1 
ATOM   2760 N  N   . PHE A 1 354 ? 43.191 200.868 13.633  1.00 164.36 ? 427 PHE A N   1 
ATOM   2761 C  CA  . PHE A 1 354 ? 43.523 199.563 13.069  1.00 152.53 ? 427 PHE A CA  1 
ATOM   2762 C  C   . PHE A 1 354 ? 42.387 198.568 13.276  1.00 163.33 ? 427 PHE A C   1 
ATOM   2763 O  O   . PHE A 1 354 ? 41.906 197.948 12.319  1.00 197.43 ? 427 PHE A O   1 
ATOM   2764 C  CB  . PHE A 1 354 ? 44.819 199.043 13.692  1.00 165.58 ? 427 PHE A CB  1 
ATOM   2765 C  CG  . PHE A 1 354 ? 45.275 197.723 13.138  1.00 159.88 ? 427 PHE A CG  1 
ATOM   2766 C  CD1 . PHE A 1 354 ? 45.929 197.656 11.920  1.00 172.96 ? 427 PHE A CD1 1 
ATOM   2767 C  CD2 . PHE A 1 354 ? 45.061 196.550 13.843  1.00 158.43 ? 427 PHE A CD2 1 
ATOM   2768 C  CE1 . PHE A 1 354 ? 46.353 196.443 11.409  1.00 166.24 ? 427 PHE A CE1 1 
ATOM   2769 C  CE2 . PHE A 1 354 ? 45.483 195.334 13.339  1.00 152.51 ? 427 PHE A CE2 1 
ATOM   2770 C  CZ  . PHE A 1 354 ? 46.130 195.281 12.121  1.00 140.77 ? 427 PHE A CZ  1 
ATOM   2771 N  N   . PHE A 1 355 ? 41.939 198.405 14.524  1.00 167.39 ? 428 PHE A N   1 
ATOM   2772 C  CA  . PHE A 1 355 ? 40.867 197.450 14.792  1.00 160.32 ? 428 PHE A CA  1 
ATOM   2773 C  C   . PHE A 1 355 ? 39.561 197.895 14.145  1.00 144.34 ? 428 PHE A C   1 
ATOM   2774 O  O   . PHE A 1 355 ? 38.823 197.071 13.587  1.00 128.78 ? 428 PHE A O   1 
ATOM   2775 C  CB  . PHE A 1 355 ? 40.702 197.266 16.299  1.00 158.49 ? 428 PHE A CB  1 
ATOM   2776 C  CG  . PHE A 1 355 ? 41.956 196.806 16.986  1.00 162.17 ? 428 PHE A CG  1 
ATOM   2777 C  CD1 . PHE A 1 355 ? 42.789 195.880 16.380  1.00 133.61 ? 428 PHE A CD1 1 
ATOM   2778 C  CD2 . PHE A 1 355 ? 42.312 197.313 18.224  1.00 209.95 ? 428 PHE A CD2 1 
ATOM   2779 C  CE1 . PHE A 1 355 ? 43.948 195.458 17.001  1.00 135.30 ? 428 PHE A CE1 1 
ATOM   2780 C  CE2 . PHE A 1 355 ? 43.471 196.894 18.850  1.00 217.55 ? 428 PHE A CE2 1 
ATOM   2781 C  CZ  . PHE A 1 355 ? 44.290 195.966 18.237  1.00 183.32 ? 428 PHE A CZ  1 
ATOM   2782 N  N   . LEU A 1 356 ? 39.267 199.197 14.201  1.00 192.22 ? 429 LEU A N   1 
ATOM   2783 C  CA  . LEU A 1 356 ? 38.119 199.725 13.472  1.00 198.02 ? 429 LEU A CA  1 
ATOM   2784 C  C   . LEU A 1 356 ? 38.240 199.426 11.983  1.00 172.93 ? 429 LEU A C   1 
ATOM   2785 O  O   . LEU A 1 356 ? 37.246 199.093 11.324  1.00 172.55 ? 429 LEU A O   1 
ATOM   2786 C  CB  . LEU A 1 356 ? 37.994 201.229 13.717  1.00 195.71 ? 429 LEU A CB  1 
ATOM   2787 C  CG  . LEU A 1 356 ? 36.677 201.898 13.325  1.00 192.18 ? 429 LEU A CG  1 
ATOM   2788 C  CD1 . LEU A 1 356 ? 35.523 201.311 14.121  1.00 186.21 ? 429 LEU A CD1 1 
ATOM   2789 C  CD2 . LEU A 1 356 ? 36.764 203.402 13.532  1.00 227.69 ? 429 LEU A CD2 1 
ATOM   2790 N  N   . MET A 1 357 ? 39.458 199.522 11.440  1.00 154.14 ? 430 MET A N   1 
ATOM   2791 C  CA  . MET A 1 357 ? 39.673 199.169 10.040  1.00 156.52 ? 430 MET A CA  1 
ATOM   2792 C  C   . MET A 1 357 ? 39.337 197.707 9.783   1.00 153.33 ? 430 MET A C   1 
ATOM   2793 O  O   . MET A 1 357 ? 38.706 197.382 8.773   1.00 157.49 ? 430 MET A O   1 
ATOM   2794 C  CB  . MET A 1 357 ? 41.117 199.461 9.631   1.00 168.16 ? 430 MET A CB  1 
ATOM   2795 C  CG  . MET A 1 357 ? 41.414 199.132 8.173   1.00 153.43 ? 430 MET A CG  1 
ATOM   2796 S  SD  . MET A 1 357 ? 43.174 199.120 7.776   1.00 202.32 ? 430 MET A SD  1 
ATOM   2797 C  CE  . MET A 1 357 ? 43.730 197.712 8.732   1.00 140.61 ? 430 MET A CE  1 
ATOM   2798 N  N   . LEU A 1 358 ? 39.748 196.812 10.685  1.00 148.43 ? 431 LEU A N   1 
ATOM   2799 C  CA  . LEU A 1 358 ? 39.424 195.396 10.526  1.00 141.87 ? 431 LEU A CA  1 
ATOM   2800 C  C   . LEU A 1 358 ? 37.915 195.176 10.512  1.00 144.85 ? 431 LEU A C   1 
ATOM   2801 O  O   . LEU A 1 358 ? 37.376 194.495 9.624   1.00 176.99 ? 431 LEU A O   1 
ATOM   2802 C  CB  . LEU A 1 358 ? 40.075 194.582 11.647  1.00 172.15 ? 431 LEU A CB  1 
ATOM   2803 C  CG  . LEU A 1 358 ? 41.459 193.971 11.411  1.00 168.20 ? 431 LEU A CG  1 
ATOM   2804 C  CD1 . LEU A 1 358 ? 42.433 194.993 10.849  1.00 160.35 ? 431 LEU A CD1 1 
ATOM   2805 C  CD2 . LEU A 1 358 ? 42.001 193.374 12.703  1.00 140.39 ? 431 LEU A CD2 1 
ATOM   2806 N  N   . ILE A 1 359 ? 37.214 195.757 11.491  1.00 135.93 ? 432 ILE A N   1 
ATOM   2807 C  CA  . ILE A 1 359 ? 35.764 195.593 11.570  1.00 162.49 ? 432 ILE A CA  1 
ATOM   2808 C  C   . ILE A 1 359 ? 35.101 196.095 10.292  1.00 184.72 ? 432 ILE A C   1 
ATOM   2809 O  O   . ILE A 1 359 ? 34.229 195.428 9.723   1.00 177.90 ? 432 ILE A O   1 
ATOM   2810 C  CB  . ILE A 1 359 ? 35.209 196.309 12.813  1.00 152.85 ? 432 ILE A CB  1 
ATOM   2811 C  CG1 . ILE A 1 359 ? 35.899 195.794 14.078  1.00 136.65 ? 432 ILE A CG1 1 
ATOM   2812 C  CG2 . ILE A 1 359 ? 33.703 196.113 12.911  1.00 146.86 ? 432 ILE A CG2 1 
ATOM   2813 C  CD1 . ILE A 1 359 ? 35.486 196.525 15.334  1.00 140.35 ? 432 ILE A CD1 1 
ATOM   2814 N  N   . THR A 1 360 ? 35.513 197.273 9.813   1.00 189.30 ? 433 THR A N   1 
ATOM   2815 C  CA  . THR A 1 360 ? 34.948 197.789 8.569   1.00 172.80 ? 433 THR A CA  1 
ATOM   2816 C  C   . THR A 1 360 ? 35.317 196.916 7.375   1.00 158.43 ? 433 THR A C   1 
ATOM   2817 O  O   . THR A 1 360 ? 34.578 196.879 6.384   1.00 161.47 ? 433 THR A O   1 
ATOM   2818 C  CB  . THR A 1 360 ? 35.408 199.227 8.327   1.00 162.96 ? 433 THR A CB  1 
ATOM   2819 O  OG1 . THR A 1 360 ? 36.840 199.282 8.336   1.00 150.50 ? 433 THR A OG1 1 
ATOM   2820 C  CG2 . THR A 1 360 ? 34.858 200.154 9.402   1.00 168.50 ? 433 THR A CG2 1 
ATOM   2821 N  N   . LEU A 1 361 ? 36.448 196.212 7.448   1.00 131.56 ? 434 LEU A N   1 
ATOM   2822 C  CA  . LEU A 1 361 ? 36.849 195.335 6.353   1.00 138.79 ? 434 LEU A CA  1 
ATOM   2823 C  C   . LEU A 1 361 ? 35.956 194.106 6.277   1.00 152.63 ? 434 LEU A C   1 
ATOM   2824 O  O   . LEU A 1 361 ? 35.619 193.645 5.180   1.00 162.97 ? 434 LEU A O   1 
ATOM   2825 C  CB  . LEU A 1 361 ? 38.313 194.925 6.516   1.00 141.38 ? 434 LEU A CB  1 
ATOM   2826 C  CG  . LEU A 1 361 ? 39.377 195.934 6.080   1.00 131.61 ? 434 LEU A CG  1 
ATOM   2827 C  CD1 . LEU A 1 361 ? 40.670 195.695 6.839   1.00 134.22 ? 434 LEU A CD1 1 
ATOM   2828 C  CD2 . LEU A 1 361 ? 39.611 195.853 4.581   1.00 127.61 ? 434 LEU A CD2 1 
ATOM   2829 N  N   . GLY A 1 362 ? 35.560 193.558 7.428   1.00 171.28 ? 435 GLY A N   1 
ATOM   2830 C  CA  . GLY A 1 362 ? 34.691 192.393 7.407   1.00 183.17 ? 435 GLY A CA  1 
ATOM   2831 C  C   . GLY A 1 362 ? 33.217 192.713 7.261   1.00 194.69 ? 435 GLY A C   1 
ATOM   2832 O  O   . GLY A 1 362 ? 32.454 191.896 6.730   1.00 188.99 ? 435 GLY A O   1 
ATOM   2833 N  N   . LEU A 1 363 ? 32.797 193.899 7.710   1.00 171.86 ? 436 LEU A N   1 
ATOM   2834 C  CA  . LEU A 1 363 ? 31.371 194.193 7.826   1.00 150.74 ? 436 LEU A CA  1 
ATOM   2835 C  C   . LEU A 1 363 ? 30.683 194.220 6.466   1.00 161.08 ? 436 LEU A C   1 
ATOM   2836 O  O   . LEU A 1 363 ? 29.606 193.639 6.301   1.00 173.36 ? 436 LEU A O   1 
ATOM   2837 C  CB  . LEU A 1 363 ? 31.162 195.519 8.558   1.00 158.70 ? 436 LEU A CB  1 
ATOM   2838 C  CG  . LEU A 1 363 ? 31.106 195.431 10.083  1.00 142.98 ? 436 LEU A CG  1 
ATOM   2839 C  CD1 . LEU A 1 363 ? 30.693 196.764 10.680  1.00 143.39 ? 436 LEU A CD1 1 
ATOM   2840 C  CD2 . LEU A 1 363 ? 30.164 194.322 10.525  1.00 148.33 ? 436 LEU A CD2 1 
ATOM   2841 N  N   . ASP A 1 364 ? 31.276 194.901 5.483   1.00 198.30 ? 437 ASP A N   1 
ATOM   2842 C  CA  . ASP A 1 364 ? 30.643 194.987 4.169   1.00 196.31 ? 437 ASP A CA  1 
ATOM   2843 C  C   . ASP A 1 364 ? 30.573 193.620 3.496   1.00 202.80 ? 437 ASP A C   1 
ATOM   2844 O  O   . ASP A 1 364 ? 29.540 193.255 2.917   1.00 227.51 ? 437 ASP A O   1 
ATOM   2845 C  CB  . ASP A 1 364 ? 31.390 195.991 3.291   1.00 199.49 ? 437 ASP A CB  1 
ATOM   2846 C  CG  . ASP A 1 364 ? 32.871 196.055 3.609   1.00 208.53 ? 437 ASP A CG  1 
ATOM   2847 O  OD1 . ASP A 1 364 ? 33.420 195.042 4.090   1.00 207.39 ? 437 ASP A OD1 1 
ATOM   2848 O  OD2 . ASP A 1 364 ? 33.486 197.118 3.380   1.00 199.23 ? 437 ASP A OD2 1 
ATOM   2849 N  N   . SER A 1 365 ? 31.662 192.849 3.571   1.00 173.28 ? 438 SER A N   1 
ATOM   2850 C  CA  . SER A 1 365 ? 31.652 191.498 3.021   1.00 162.84 ? 438 SER A CA  1 
ATOM   2851 C  C   . SER A 1 365 ? 30.588 190.635 3.684   1.00 145.74 ? 438 SER A C   1 
ATOM   2852 O  O   . SER A 1 365 ? 30.004 189.761 3.033   1.00 151.77 ? 438 SER A O   1 
ATOM   2853 C  CB  . SER A 1 365 ? 33.031 190.857 3.176   1.00 160.63 ? 438 SER A CB  1 
ATOM   2854 O  OG  . SER A 1 365 ? 34.034 191.656 2.575   1.00 137.06 ? 438 SER A OG  1 
ATOM   2855 N  N   . SER A 1 366 ? 30.321 190.863 4.973   1.00 143.28 ? 439 SER A N   1 
ATOM   2856 C  CA  . SER A 1 366 ? 29.222 190.157 5.625   1.00 159.80 ? 439 SER A CA  1 
ATOM   2857 C  C   . SER A 1 366 ? 27.870 190.655 5.121   1.00 182.91 ? 439 SER A C   1 
ATOM   2858 O  O   . SER A 1 366 ? 26.948 189.855 4.913   1.00 145.15 ? 439 SER A O   1 
ATOM   2859 C  CB  . SER A 1 366 ? 29.326 190.312 7.142   1.00 171.20 ? 439 SER A CB  1 
ATOM   2860 O  OG  . SER A 1 366 ? 28.348 189.527 7.802   1.00 197.76 ? 439 SER A OG  1 
ATOM   2861 N  N   . PHE A 1 367 ? 27.737 191.972 4.923   1.00 184.34 ? 440 PHE A N   1 
ATOM   2862 C  CA  . PHE A 1 367 ? 26.510 192.536 4.365   1.00 144.23 ? 440 PHE A CA  1 
ATOM   2863 C  C   . PHE A 1 367 ? 26.144 191.841 3.064   1.00 152.87 ? 440 PHE A C   1 
ATOM   2864 O  O   . PHE A 1 367 ? 25.000 191.414 2.869   1.00 173.20 ? 440 PHE A O   1 
ATOM   2865 C  CB  . PHE A 1 367 ? 26.668 194.038 4.107   1.00 148.36 ? 440 PHE A CB  1 
ATOM   2866 C  CG  . PHE A 1 367 ? 26.934 194.858 5.335   1.00 152.65 ? 440 PHE A CG  1 
ATOM   2867 C  CD1 . PHE A 1 367 ? 26.630 194.381 6.597   1.00 171.35 ? 440 PHE A CD1 1 
ATOM   2868 C  CD2 . PHE A 1 367 ? 27.479 196.126 5.217   1.00 166.38 ? 440 PHE A CD2 1 
ATOM   2869 C  CE1 . PHE A 1 367 ? 26.880 195.152 7.716   1.00 201.84 ? 440 PHE A CE1 1 
ATOM   2870 C  CE2 . PHE A 1 367 ? 27.729 196.898 6.332   1.00 158.66 ? 440 PHE A CE2 1 
ATOM   2871 C  CZ  . PHE A 1 367 ? 27.428 196.411 7.583   1.00 181.18 ? 440 PHE A CZ  1 
ATOM   2872 N  N   . ALA A 1 368 ? 27.113 191.723 2.157   1.00 141.98 ? 441 ALA A N   1 
ATOM   2873 C  CA  . ALA A 1 368 ? 26.836 191.097 0.870   1.00 163.39 ? 441 ALA A CA  1 
ATOM   2874 C  C   . ALA A 1 368 ? 26.659 189.590 1.011   1.00 124.22 ? 441 ALA A C   1 
ATOM   2875 O  O   . ALA A 1 368 ? 25.793 188.997 0.354   1.00 132.10 ? 441 ALA A O   1 
ATOM   2876 C  CB  . ALA A 1 368 ? 27.956 191.418 -0.111  1.00 168.38 ? 441 ALA A CB  1 
ATOM   2877 N  N   . GLY A 1 369 ? 27.471 188.957 1.862   1.00 127.50 ? 442 GLY A N   1 
ATOM   2878 C  CA  . GLY A 1 369 ? 27.349 187.522 2.064   1.00 126.21 ? 442 GLY A CA  1 
ATOM   2879 C  C   . GLY A 1 369 ? 25.960 187.112 2.512   1.00 147.16 ? 442 GLY A C   1 
ATOM   2880 O  O   . GLY A 1 369 ? 25.423 186.101 2.054   1.00 149.19 ? 442 GLY A O   1 
ATOM   2881 N  N   . LEU A 1 370 ? 25.360 187.890 3.414   1.00 131.40 ? 443 LEU A N   1 
ATOM   2882 C  CA  . LEU A 1 370 ? 23.969 187.648 3.774   1.00 135.64 ? 443 LEU A CA  1 
ATOM   2883 C  C   . LEU A 1 370 ? 23.014 188.138 2.694   1.00 171.49 ? 443 LEU A C   1 
ATOM   2884 O  O   . LEU A 1 370 ? 21.936 187.559 2.515   1.00 148.24 ? 443 LEU A O   1 
ATOM   2885 C  CB  . LEU A 1 370 ? 23.641 188.321 5.107   1.00 175.26 ? 443 LEU A CB  1 
ATOM   2886 C  CG  . LEU A 1 370 ? 24.265 187.710 6.362   1.00 187.19 ? 443 LEU A CG  1 
ATOM   2887 C  CD1 . LEU A 1 370 ? 23.827 188.482 7.596   1.00 204.31 ? 443 LEU A CD1 1 
ATOM   2888 C  CD2 . LEU A 1 370 ? 23.892 186.241 6.485   1.00 140.84 ? 443 LEU A CD2 1 
ATOM   2889 N  N   . GLU A 1 371 ? 23.397 189.186 1.960   1.00 192.39 ? 444 GLU A N   1 
ATOM   2890 C  CA  . GLU A 1 371 ? 22.493 189.786 0.982   1.00 167.99 ? 444 GLU A CA  1 
ATOM   2891 C  C   . GLU A 1 371 ? 22.191 188.825 -0.160  1.00 144.40 ? 444 GLU A C   1 
ATOM   2892 O  O   . GLU A 1 371 ? 21.062 188.786 -0.664  1.00 144.53 ? 444 GLU A O   1 
ATOM   2893 C  CB  . GLU A 1 371 ? 23.091 191.087 0.446   1.00 149.44 ? 444 GLU A CB  1 
ATOM   2894 C  CG  . GLU A 1 371 ? 22.104 191.983 -0.288  1.00 155.32 ? 444 GLU A CG  1 
ATOM   2895 C  CD  . GLU A 1 371 ? 21.060 192.582 0.637   1.00 203.29 ? 444 GLU A CD  1 
ATOM   2896 O  OE1 . GLU A 1 371 ? 20.117 191.860 1.024   1.00 211.73 ? 444 GLU A OE1 1 
ATOM   2897 O  OE2 . GLU A 1 371 ? 21.187 193.775 0.985   1.00 219.72 ? 444 GLU A OE2 1 
ATOM   2898 N  N   . GLY A 1 372 ? 23.185 188.040 -0.581  1.00 150.05 ? 445 GLY A N   1 
ATOM   2899 C  CA  . GLY A 1 372 ? 22.950 187.080 -1.646  1.00 160.80 ? 445 GLY A CA  1 
ATOM   2900 C  C   . GLY A 1 372 ? 21.976 185.988 -1.247  1.00 149.45 ? 445 GLY A C   1 
ATOM   2901 O  O   . GLY A 1 372 ? 21.115 185.591 -2.038  1.00 155.67 ? 445 GLY A O   1 
ATOM   2902 N  N   . VAL A 1 373 ? 22.092 185.493 -0.014  1.00 136.02 ? 446 VAL A N   1 
ATOM   2903 C  CA  . VAL A 1 373 ? 21.202 184.434 0.449   1.00 141.99 ? 446 VAL A CA  1 
ATOM   2904 C  C   . VAL A 1 373 ? 19.800 184.977 0.688   1.00 150.45 ? 446 VAL A C   1 
ATOM   2905 O  O   . VAL A 1 373 ? 18.803 184.341 0.325   1.00 169.82 ? 446 VAL A O   1 
ATOM   2906 C  CB  . VAL A 1 373 ? 21.780 183.773 1.713   1.00 149.67 ? 446 VAL A CB  1 
ATOM   2907 C  CG1 . VAL A 1 373 ? 20.815 182.736 2.266   1.00 108.64 ? 446 VAL A CG1 1 
ATOM   2908 C  CG2 . VAL A 1 373 ? 23.126 183.142 1.404   1.00 152.76 ? 446 VAL A CG2 1 
ATOM   2909 N  N   . ILE A 1 374 ? 19.699 186.159 1.301   1.00 147.07 ? 447 ILE A N   1 
ATOM   2910 C  CA  . ILE A 1 374 ? 18.391 186.758 1.552   1.00 172.42 ? 447 ILE A CA  1 
ATOM   2911 C  C   . ILE A 1 374 ? 17.678 187.049 0.237   1.00 173.57 ? 447 ILE A C   1 
ATOM   2912 O  O   . ILE A 1 374 ? 16.487 186.753 0.082   1.00 152.31 ? 447 ILE A O   1 
ATOM   2913 C  CB  . ILE A 1 374 ? 18.542 188.025 2.415   1.00 166.27 ? 447 ILE A CB  1 
ATOM   2914 C  CG1 . ILE A 1 374 ? 19.061 187.651 3.805   1.00 164.62 ? 447 ILE A CG1 1 
ATOM   2915 C  CG2 . ILE A 1 374 ? 17.217 188.764 2.519   1.00 141.86 ? 447 ILE A CG2 1 
ATOM   2916 C  CD1 . ILE A 1 374 ? 19.588 188.821 4.600   1.00 150.11 ? 447 ILE A CD1 1 
ATOM   2917 N  N   . THR A 1 375 ? 18.396 187.621 -0.733  1.00 183.98 ? 448 THR A N   1 
ATOM   2918 C  CA  . THR A 1 375 ? 17.815 187.832 -2.056  1.00 158.40 ? 448 THR A CA  1 
ATOM   2919 C  C   . THR A 1 375 ? 17.427 186.507 -2.701  1.00 138.83 ? 448 THR A C   1 
ATOM   2920 O  O   . THR A 1 375 ? 16.387 186.410 -3.364  1.00 139.36 ? 448 THR A O   1 
ATOM   2921 C  CB  . THR A 1 375 ? 18.801 188.595 -2.944  1.00 160.02 ? 448 THR A CB  1 
ATOM   2922 O  OG1 . THR A 1 375 ? 19.078 189.877 -2.365  1.00 175.63 ? 448 THR A OG1 1 
ATOM   2923 C  CG2 . THR A 1 375 ? 18.232 188.787 -4.344  1.00 143.95 ? 448 THR A CG2 1 
ATOM   2924 N  N   . ALA A 1 376 ? 18.244 185.470 -2.499  1.00 127.43 ? 449 ALA A N   1 
ATOM   2925 C  CA  . ALA A 1 376 ? 17.967 184.170 -3.100  1.00 145.94 ? 449 ALA A CA  1 
ATOM   2926 C  C   . ALA A 1 376 ? 16.666 183.579 -2.570  1.00 136.41 ? 449 ALA A C   1 
ATOM   2927 O  O   . ALA A 1 376 ? 15.837 183.081 -3.340  1.00 143.05 ? 449 ALA A O   1 
ATOM   2928 C  CB  . ALA A 1 376 ? 19.134 183.218 -2.841  1.00 193.42 ? 449 ALA A CB  1 
ATOM   2929 N  N   . VAL A 1 377 ? 16.468 183.626 -1.252  1.00 142.69 ? 450 VAL A N   1 
ATOM   2930 C  CA  . VAL A 1 377 ? 15.281 183.015 -0.662  1.00 149.53 ? 450 VAL A CA  1 
ATOM   2931 C  C   . VAL A 1 377 ? 14.050 183.886 -0.889  1.00 157.86 ? 450 VAL A C   1 
ATOM   2932 O  O   . VAL A 1 377 ? 12.948 183.372 -1.109  1.00 159.02 ? 450 VAL A O   1 
ATOM   2933 C  CB  . VAL A 1 377 ? 15.515 182.736 0.833   1.00 151.36 ? 450 VAL A CB  1 
ATOM   2934 C  CG1 . VAL A 1 377 ? 14.297 182.062 1.448   1.00 184.14 ? 450 VAL A CG1 1 
ATOM   2935 C  CG2 . VAL A 1 377 ? 16.754 181.874 1.024   1.00 125.79 ? 450 VAL A CG2 1 
ATOM   2936 N  N   . LEU A 1 378 ? 14.211 185.211 -0.841  1.00 163.96 ? 451 LEU A N   1 
ATOM   2937 C  CA  . LEU A 1 378 ? 13.080 186.096 -1.103  1.00 169.67 ? 451 LEU A CA  1 
ATOM   2938 C  C   . LEU A 1 378 ? 12.601 185.963 -2.543  1.00 174.69 ? 451 LEU A C   1 
ATOM   2939 O  O   . LEU A 1 378 ? 11.393 185.980 -2.808  1.00 177.34 ? 451 LEU A O   1 
ATOM   2940 C  CB  . LEU A 1 378 ? 13.455 187.545 -0.795  1.00 173.52 ? 451 LEU A CB  1 
ATOM   2941 C  CG  . LEU A 1 378 ? 13.594 187.937 0.678   1.00 171.40 ? 451 LEU A CG  1 
ATOM   2942 C  CD1 . LEU A 1 378 ? 13.884 189.425 0.810   1.00 144.33 ? 451 LEU A CD1 1 
ATOM   2943 C  CD2 . LEU A 1 378 ? 12.347 187.560 1.460   1.00 145.26 ? 451 LEU A CD2 1 
ATOM   2944 N  N   . ASP A 1 379 ? 13.534 185.826 -3.488  1.00 183.53 ? 452 ASP A N   1 
ATOM   2945 C  CA  . ASP A 1 379 ? 13.152 185.620 -4.880  1.00 180.28 ? 452 ASP A CA  1 
ATOM   2946 C  C   . ASP A 1 379 ? 12.656 184.202 -5.132  1.00 181.27 ? 452 ASP A C   1 
ATOM   2947 O  O   . ASP A 1 379 ? 11.855 183.984 -6.048  1.00 183.60 ? 452 ASP A O   1 
ATOM   2948 C  CB  . ASP A 1 379 ? 14.329 185.935 -5.804  1.00 196.76 ? 452 ASP A CB  1 
ATOM   2949 C  CG  . ASP A 1 379 ? 14.690 187.409 -5.804  1.00 210.42 ? 452 ASP A CG  1 
ATOM   2950 O  OD1 . ASP A 1 379 ? 14.427 188.088 -4.790  1.00 229.97 ? 452 ASP A OD1 1 
ATOM   2951 O  OD2 . ASP A 1 379 ? 15.236 187.887 -6.820  1.00 181.86 ? 452 ASP A OD2 1 
ATOM   2952 N  N   . GLU A 1 380 ? 13.120 183.231 -4.342  1.00 161.14 ? 453 GLU A N   1 
ATOM   2953 C  CA  . GLU A 1 380 ? 12.678 181.853 -4.520  1.00 164.38 ? 453 GLU A CA  1 
ATOM   2954 C  C   . GLU A 1 380 ? 11.301 181.612 -3.917  1.00 173.01 ? 453 GLU A C   1 
ATOM   2955 O  O   . GLU A 1 380 ? 10.524 180.815 -4.454  1.00 175.95 ? 453 GLU A O   1 
ATOM   2956 C  CB  . GLU A 1 380 ? 13.697 180.890 -3.908  1.00 201.61 ? 453 GLU A CB  1 
ATOM   2957 C  CG  . GLU A 1 380 ? 13.344 179.422 -4.078  1.00 197.56 ? 453 GLU A CG  1 
ATOM   2958 C  CD  . GLU A 1 380 ? 12.854 179.101 -5.476  1.00 165.23 ? 453 GLU A CD  1 
ATOM   2959 O  OE1 . GLU A 1 380 ? 11.770 178.495 -5.603  1.00 181.01 ? 453 GLU A OE1 1 
ATOM   2960 O  OE2 . GLU A 1 380 ? 13.548 179.465 -6.448  1.00 153.16 ? 453 GLU A OE2 1 
ATOM   2961 N  N   . PHE A 1 381 ? 10.977 182.293 -2.818  1.00 191.62 ? 454 PHE A N   1 
ATOM   2962 C  CA  . PHE A 1 381 ? 9.678  182.180 -2.160  1.00 198.25 ? 454 PHE A CA  1 
ATOM   2963 C  C   . PHE A 1 381 ? 9.025  183.559 -2.114  1.00 225.95 ? 454 PHE A C   1 
ATOM   2964 O  O   . PHE A 1 381 ? 8.850  184.138 -1.033  1.00 232.58 ? 454 PHE A O   1 
ATOM   2965 C  CB  . PHE A 1 381 ? 9.821  181.599 -0.754  1.00 183.31 ? 454 PHE A CB  1 
ATOM   2966 C  CG  . PHE A 1 381 ? 10.060 180.112 -0.726  1.00 183.32 ? 454 PHE A CG  1 
ATOM   2967 C  CD1 . PHE A 1 381 ? 11.229 179.570 -1.236  1.00 181.51 ? 454 PHE A CD1 1 
ATOM   2968 C  CD2 . PHE A 1 381 ? 9.121  179.258 -0.169  1.00 192.06 ? 454 PHE A CD2 1 
ATOM   2969 C  CE1 . PHE A 1 381 ? 11.450 178.204 -1.207  1.00 180.48 ? 454 PHE A CE1 1 
ATOM   2970 C  CE2 . PHE A 1 381 ? 9.338  177.891 -0.134  1.00 193.83 ? 454 PHE A CE2 1 
ATOM   2971 C  CZ  . PHE A 1 381 ? 10.503 177.364 -0.654  1.00 182.90 ? 454 PHE A CZ  1 
ATOM   2972 N  N   . PRO A 1 382 ? 8.647  184.114 -3.266  1.00 233.86 ? 455 PRO A N   1 
ATOM   2973 C  CA  . PRO A 1 382 ? 8.067  185.460 -3.271  1.00 228.48 ? 455 PRO A CA  1 
ATOM   2974 C  C   . PRO A 1 382 ? 6.621  185.462 -2.800  1.00 233.94 ? 455 PRO A C   1 
ATOM   2975 O  O   . PRO A 1 382 ? 5.853  184.534 -3.068  1.00 236.46 ? 455 PRO A O   1 
ATOM   2976 C  CB  . PRO A 1 382 ? 8.175  185.879 -4.741  1.00 238.26 ? 455 PRO A CB  1 
ATOM   2977 C  CG  . PRO A 1 382 ? 8.040  184.596 -5.482  1.00 241.54 ? 455 PRO A CG  1 
ATOM   2978 C  CD  . PRO A 1 382 ? 8.664  183.523 -4.617  1.00 237.45 ? 455 PRO A CD  1 
ATOM   2979 N  N   . HIS A 1 383 ? 6.271  186.519 -2.064  1.00 252.09 ? 456 HIS A N   1 
ATOM   2980 C  CA  . HIS A 1 383 ? 4.921  186.808 -1.582  1.00 264.82 ? 456 HIS A CA  1 
ATOM   2981 C  C   . HIS A 1 383 ? 4.445  185.798 -0.540  1.00 259.80 ? 456 HIS A C   1 
ATOM   2982 O  O   . HIS A 1 383 ? 3.483  186.063 0.188   1.00 258.22 ? 456 HIS A O   1 
ATOM   2983 C  CB  . HIS A 1 383 ? 3.933  186.877 -2.750  1.00 268.56 ? 456 HIS A CB  1 
ATOM   2984 C  CG  . HIS A 1 383 ? 2.761  187.773 -2.494  1.00 274.70 ? 456 HIS A CG  1 
ATOM   2985 N  ND1 . HIS A 1 383 ? 1.527  187.294 -2.111  1.00 270.19 ? 456 HIS A ND1 1 
ATOM   2986 C  CD2 . HIS A 1 383 ? 2.637  189.120 -2.561  1.00 279.42 ? 456 HIS A CD2 1 
ATOM   2987 C  CE1 . HIS A 1 383 ? 0.693  188.307 -1.955  1.00 265.98 ? 456 HIS A CE1 1 
ATOM   2988 N  NE2 . HIS A 1 383 ? 1.342  189.426 -2.222  1.00 273.39 ? 456 HIS A NE2 1 
ATOM   2989 N  N   . VAL A 1 384 ? 5.109  184.644 -0.457  1.00 245.99 ? 457 VAL A N   1 
ATOM   2990 C  CA  . VAL A 1 384 ? 5.064  183.844 0.762   1.00 243.91 ? 457 VAL A CA  1 
ATOM   2991 C  C   . VAL A 1 384 ? 6.084  184.391 1.753   1.00 220.79 ? 457 VAL A C   1 
ATOM   2992 O  O   . VAL A 1 384 ? 5.886  184.313 2.972   1.00 222.09 ? 457 VAL A O   1 
ATOM   2993 C  CB  . VAL A 1 384 ? 5.282  182.354 0.435   1.00 240.08 ? 457 VAL A CB  1 
ATOM   2994 C  CG1 . VAL A 1 384 ? 6.250  182.196 -0.721  1.00 233.26 ? 457 VAL A CG1 1 
ATOM   2995 C  CG2 . VAL A 1 384 ? 5.762  181.579 1.657   1.00 217.44 ? 457 VAL A CG2 1 
ATOM   2996 N  N   . TRP A 1 385 ? 7.156  184.987 1.242   1.00 210.65 ? 458 TRP A N   1 
ATOM   2997 C  CA  . TRP A 1 385 ? 8.086  185.819 1.983   1.00 232.06 ? 458 TRP A CA  1 
ATOM   2998 C  C   . TRP A 1 385 ? 7.927  187.258 1.501   1.00 249.17 ? 458 TRP A C   1 
ATOM   2999 O  O   . TRP A 1 385 ? 7.020  187.573 0.721   1.00 234.97 ? 458 TRP A O   1 
ATOM   3000 C  CB  . TRP A 1 385 ? 9.520  185.312 1.819   1.00 239.99 ? 458 TRP A CB  1 
ATOM   3001 C  CG  . TRP A 1 385 ? 9.905  184.295 2.838   1.00 233.44 ? 458 TRP A CG  1 
ATOM   3002 C  CD1 . TRP A 1 385 ? 10.202 182.982 2.619   1.00 233.86 ? 458 TRP A CD1 1 
ATOM   3003 C  CD2 . TRP A 1 385 ? 10.026 184.504 4.249   1.00 216.49 ? 458 TRP A CD2 1 
ATOM   3004 N  NE1 . TRP A 1 385 ? 10.507 182.362 3.806   1.00 217.89 ? 458 TRP A NE1 1 
ATOM   3005 C  CE2 . TRP A 1 385 ? 10.405 183.275 4.823   1.00 215.19 ? 458 TRP A CE2 1 
ATOM   3006 C  CE3 . TRP A 1 385 ? 9.852  185.613 5.083   1.00 220.16 ? 458 TRP A CE3 1 
ATOM   3007 C  CZ2 . TRP A 1 385 ? 10.614 183.123 6.191   1.00 226.40 ? 458 TRP A CZ2 1 
ATOM   3008 C  CZ3 . TRP A 1 385 ? 10.059 185.461 6.441   1.00 228.64 ? 458 TRP A CZ3 1 
ATOM   3009 C  CH2 . TRP A 1 385 ? 10.436 184.226 6.982   1.00 227.93 ? 458 TRP A CH2 1 
ATOM   3010 N  N   . ALA A 1 386 ? 8.794  188.143 1.995   1.00 283.26 ? 459 ALA A N   1 
ATOM   3011 C  CA  . ALA A 1 386 ? 8.767  189.583 1.756   1.00 291.05 ? 459 ALA A CA  1 
ATOM   3012 C  C   . ALA A 1 386 ? 7.585  190.258 2.439   1.00 307.22 ? 459 ALA A C   1 
ATOM   3013 O  O   . ALA A 1 386 ? 7.438  191.481 2.316   1.00 307.92 ? 459 ALA A O   1 
ATOM   3014 C  CB  . ALA A 1 386 ? 8.762  189.947 0.262   1.00 289.11 ? 459 ALA A CB  1 
ATOM   3015 N  N   . LYS A 1 387 ? 6.717  189.503 3.124   1.00 314.19 ? 460 LYS A N   1 
ATOM   3016 C  CA  . LYS A 1 387 ? 5.708  190.120 3.979   1.00 304.68 ? 460 LYS A CA  1 
ATOM   3017 C  C   . LYS A 1 387 ? 6.345  191.153 4.899   1.00 285.00 ? 460 LYS A C   1 
ATOM   3018 O  O   . LYS A 1 387 ? 5.803  192.246 5.095   1.00 285.04 ? 460 LYS A O   1 
ATOM   3019 C  CB  . LYS A 1 387 ? 4.968  189.044 4.781   1.00 298.95 ? 460 LYS A CB  1 
ATOM   3020 C  CG  . LYS A 1 387 ? 5.868  188.083 5.554   1.00 287.21 ? 460 LYS A CG  1 
ATOM   3021 C  CD  . LYS A 1 387 ? 5.077  186.907 6.112   1.00 288.73 ? 460 LYS A CD  1 
ATOM   3022 C  CE  . LYS A 1 387 ? 5.900  186.107 7.113   1.00 279.89 ? 460 LYS A CE  1 
ATOM   3023 N  NZ  . LYS A 1 387 ? 5.160  184.916 7.618   1.00 291.55 ? 460 LYS A NZ  1 
ATOM   3024 N  N   . ARG A 1 388 ? 7.497  190.817 5.476   1.00 261.17 ? 461 ARG A N   1 
ATOM   3025 C  CA  . ARG A 1 388 ? 8.431  191.795 6.015   1.00 267.16 ? 461 ARG A CA  1 
ATOM   3026 C  C   . ARG A 1 388 ? 9.837  191.289 5.740   1.00 255.57 ? 461 ARG A C   1 
ATOM   3027 O  O   . ARG A 1 388 ? 10.139 190.125 6.018   1.00 255.97 ? 461 ARG A O   1 
ATOM   3028 C  CB  . ARG A 1 388 ? 8.222  192.020 7.517   1.00 286.29 ? 461 ARG A CB  1 
ATOM   3029 C  CG  . ARG A 1 388 ? 7.828  193.444 7.873   1.00 287.58 ? 461 ARG A CG  1 
ATOM   3030 C  CD  . ARG A 1 388 ? 6.318  193.602 7.934   1.00 280.74 ? 461 ARG A CD  1 
ATOM   3031 N  NE  . ARG A 1 388 ? 5.896  194.981 7.707   1.00 282.79 ? 461 ARG A NE  1 
ATOM   3032 C  CZ  . ARG A 1 388 ? 5.915  195.934 8.633   1.00 293.58 ? 461 ARG A CZ  1 
ATOM   3033 N  NH1 . ARG A 1 388 ? 6.346  195.664 9.858   1.00 298.57 ? 461 ARG A NH1 1 
ATOM   3034 N  NH2 . ARG A 1 388 ? 5.508  197.159 8.332   1.00 298.58 ? 461 ARG A NH2 1 
ATOM   3035 N  N   . ARG A 1 389 ? 10.694 192.151 5.189   1.00 248.22 ? 462 ARG A N   1 
ATOM   3036 C  CA  . ARG A 1 389 ? 12.070 191.729 4.953   1.00 232.42 ? 462 ARG A CA  1 
ATOM   3037 C  C   . ARG A 1 389 ? 12.862 191.675 6.251   1.00 240.28 ? 462 ARG A C   1 
ATOM   3038 O  O   . ARG A 1 389 ? 13.721 190.802 6.415   1.00 232.05 ? 462 ARG A O   1 
ATOM   3039 C  CB  . ARG A 1 389 ? 12.753 192.652 3.943   1.00 218.91 ? 462 ARG A CB  1 
ATOM   3040 C  CG  . ARG A 1 389 ? 14.197 192.262 3.654   1.00 196.62 ? 462 ARG A CG  1 
ATOM   3041 C  CD  . ARG A 1 389 ? 14.704 192.826 2.339   1.00 209.92 ? 462 ARG A CD  1 
ATOM   3042 N  NE  . ARG A 1 389 ? 16.010 192.269 1.993   1.00 223.82 ? 462 ARG A NE  1 
ATOM   3043 C  CZ  . ARG A 1 389 ? 16.633 192.473 0.837   1.00 210.98 ? 462 ARG A CZ  1 
ATOM   3044 N  NH1 . ARG A 1 389 ? 16.071 193.225 -0.100  1.00 206.03 ? 462 ARG A NH1 1 
ATOM   3045 N  NH2 . ARG A 1 389 ? 17.818 191.922 0.616   1.00 190.25 ? 462 ARG A NH2 1 
ATOM   3046 N  N   . GLU A 1 390 ? 12.577 192.583 7.188   1.00 270.45 ? 463 GLU A N   1 
ATOM   3047 C  CA  . GLU A 1 390 ? 13.258 192.562 8.478   1.00 279.66 ? 463 GLU A CA  1 
ATOM   3048 C  C   . GLU A 1 390 ? 12.986 191.269 9.236   1.00 270.57 ? 463 GLU A C   1 
ATOM   3049 O  O   . GLU A 1 390 ? 13.824 190.830 10.032  1.00 276.08 ? 463 GLU A O   1 
ATOM   3050 C  CB  . GLU A 1 390 ? 12.831 193.768 9.316   1.00 284.51 ? 463 GLU A CB  1 
ATOM   3051 N  N   . ARG A 1 391 ? 11.828 190.647 9.004   1.00 204.73 ? 464 ARG A N   1 
ATOM   3052 C  CA  . ARG A 1 391 ? 11.521 189.383 9.664   1.00 182.88 ? 464 ARG A CA  1 
ATOM   3053 C  C   . ARG A 1 391 ? 12.449 188.274 9.184   1.00 188.28 ? 464 ARG A C   1 
ATOM   3054 O  O   . ARG A 1 391 ? 13.014 187.529 9.993   1.00 200.09 ? 464 ARG A O   1 
ATOM   3055 C  CB  . ARG A 1 391 ? 10.059 189.007 9.421   1.00 213.41 ? 464 ARG A CB  1 
ATOM   3056 N  N   . PHE A 1 392 ? 12.622 188.151 7.866   1.00 202.39 ? 465 PHE A N   1 
ATOM   3057 C  CA  . PHE A 1 392 ? 13.505 187.118 7.336   1.00 192.03 ? 465 PHE A CA  1 
ATOM   3058 C  C   . PHE A 1 392 ? 14.964 187.422 7.652   1.00 165.40 ? 465 PHE A C   1 
ATOM   3059 O  O   . PHE A 1 392 ? 15.728 186.516 8.007   1.00 153.75 ? 465 PHE A O   1 
ATOM   3060 C  CB  . PHE A 1 392 ? 13.306 186.971 5.828   1.00 193.37 ? 465 PHE A CB  1 
ATOM   3061 C  CG  . PHE A 1 392 ? 14.201 185.941 5.201   1.00 170.58 ? 465 PHE A CG  1 
ATOM   3062 C  CD1 . PHE A 1 392 ? 13.882 184.596 5.270   1.00 156.36 ? 465 PHE A CD1 1 
ATOM   3063 C  CD2 . PHE A 1 392 ? 15.364 186.317 4.548   1.00 145.82 ? 465 PHE A CD2 1 
ATOM   3064 C  CE1 . PHE A 1 392 ? 14.704 183.645 4.699   1.00 169.11 ? 465 PHE A CE1 1 
ATOM   3065 C  CE2 . PHE A 1 392 ? 16.189 185.370 3.975   1.00 135.44 ? 465 PHE A CE2 1 
ATOM   3066 C  CZ  . PHE A 1 392 ? 15.859 184.033 4.051   1.00 159.88 ? 465 PHE A CZ  1 
ATOM   3067 N  N   . VAL A 1 393 ? 15.369 188.688 7.524   1.00 175.79 ? 466 VAL A N   1 
ATOM   3068 C  CA  . VAL A 1 393 ? 16.746 189.065 7.829   1.00 166.94 ? 466 VAL A CA  1 
ATOM   3069 C  C   . VAL A 1 393 ? 17.070 188.762 9.285   1.00 176.94 ? 466 VAL A C   1 
ATOM   3070 O  O   . VAL A 1 393 ? 18.134 188.214 9.599   1.00 222.61 ? 466 VAL A O   1 
ATOM   3071 C  CB  . VAL A 1 393 ? 16.983 190.549 7.494   1.00 168.61 ? 466 VAL A CB  1 
ATOM   3072 C  CG1 . VAL A 1 393 ? 18.347 190.993 7.994   1.00 171.59 ? 466 VAL A CG1 1 
ATOM   3073 C  CG2 . VAL A 1 393 ? 16.863 190.780 5.996   1.00 182.54 ? 466 VAL A CG2 1 
ATOM   3074 N  N   . LEU A 1 394 ? 16.157 189.106 10.196  1.00 159.07 ? 467 LEU A N   1 
ATOM   3075 C  CA  . LEU A 1 394 ? 16.363 188.791 11.606  1.00 166.68 ? 467 LEU A CA  1 
ATOM   3076 C  C   . LEU A 1 394 ? 16.384 187.283 11.833  1.00 172.82 ? 467 LEU A C   1 
ATOM   3077 O  O   . LEU A 1 394 ? 17.198 186.776 12.618  1.00 158.11 ? 467 LEU A O   1 
ATOM   3078 C  CB  . LEU A 1 394 ? 15.273 189.456 12.448  1.00 158.77 ? 467 LEU A CB  1 
ATOM   3079 C  CG  . LEU A 1 394 ? 15.314 189.297 13.968  1.00 178.26 ? 467 LEU A CG  1 
ATOM   3080 C  CD1 . LEU A 1 394 ? 14.900 190.596 14.638  1.00 170.04 ? 467 LEU A CD1 1 
ATOM   3081 C  CD2 . LEU A 1 394 ? 14.404 188.163 14.415  1.00 178.44 ? 467 LEU A CD2 1 
ATOM   3082 N  N   . ALA A 1 395 ? 15.501 186.551 11.146  1.00 149.29 ? 468 ALA A N   1 
ATOM   3083 C  CA  . ALA A 1 395 ? 15.472 185.099 11.281  1.00 153.66 ? 468 ALA A CA  1 
ATOM   3084 C  C   . ALA A 1 395 ? 16.775 184.464 10.813  1.00 166.69 ? 468 ALA A C   1 
ATOM   3085 O  O   . ALA A 1 395 ? 17.162 183.402 11.313  1.00 201.97 ? 468 ALA A O   1 
ATOM   3086 C  CB  . ALA A 1 395 ? 14.290 184.522 10.502  1.00 175.65 ? 468 ALA A CB  1 
ATOM   3087 N  N   . VAL A 1 396 ? 17.461 185.092 9.857   1.00 142.48 ? 469 VAL A N   1 
ATOM   3088 C  CA  . VAL A 1 396 ? 18.765 184.595 9.432   1.00 125.36 ? 469 VAL A CA  1 
ATOM   3089 C  C   . VAL A 1 396 ? 19.848 185.003 10.424  1.00 131.00 ? 469 VAL A C   1 
ATOM   3090 O  O   . VAL A 1 396 ? 20.734 184.207 10.754  1.00 148.20 ? 469 VAL A O   1 
ATOM   3091 C  CB  . VAL A 1 396 ? 19.082 185.090 8.008   1.00 148.58 ? 469 VAL A CB  1 
ATOM   3092 C  CG1 . VAL A 1 396 ? 20.497 184.696 7.608   1.00 176.71 ? 469 VAL A CG1 1 
ATOM   3093 C  CG2 . VAL A 1 396 ? 18.072 184.534 7.016   1.00 140.24 ? 469 VAL A CG2 1 
ATOM   3094 N  N   . VAL A 1 397 ? 19.785 186.240 10.924  1.00 138.75 ? 470 VAL A N   1 
ATOM   3095 C  CA  . VAL A 1 397 ? 20.836 186.751 11.801  1.00 135.95 ? 470 VAL A CA  1 
ATOM   3096 C  C   . VAL A 1 397 ? 20.880 185.962 13.105  1.00 139.76 ? 470 VAL A C   1 
ATOM   3097 O  O   . VAL A 1 397 ? 21.955 185.568 13.575  1.00 164.47 ? 470 VAL A O   1 
ATOM   3098 C  CB  . VAL A 1 397 ? 20.637 188.257 12.056  1.00 152.26 ? 470 VAL A CB  1 
ATOM   3099 C  CG1 . VAL A 1 397 ? 21.477 188.714 13.236  1.00 172.33 ? 470 VAL A CG1 1 
ATOM   3100 C  CG2 . VAL A 1 397 ? 20.995 189.055 10.812  1.00 132.01 ? 470 VAL A CG2 1 
ATOM   3101 N  N   . ILE A 1 398 ? 19.714 185.715 13.709  1.00 143.39 ? 471 ILE A N   1 
ATOM   3102 C  CA  . ILE A 1 398 ? 19.687 184.982 14.974  1.00 152.96 ? 471 ILE A CA  1 
ATOM   3103 C  C   . ILE A 1 398 ? 20.184 183.555 14.778  1.00 161.97 ? 471 ILE A C   1 
ATOM   3104 O  O   . ILE A 1 398 ? 20.941 183.022 15.604  1.00 181.86 ? 471 ILE A O   1 
ATOM   3105 C  CB  . ILE A 1 398 ? 18.273 185.016 15.583  1.00 167.37 ? 471 ILE A CB  1 
ATOM   3106 C  CG1 . ILE A 1 398 ? 17.923 186.438 16.029  1.00 186.04 ? 471 ILE A CG1 1 
ATOM   3107 C  CG2 . ILE A 1 398 ? 18.167 184.046 16.749  1.00 167.46 ? 471 ILE A CG2 1 
ATOM   3108 C  CD1 . ILE A 1 398 ? 16.637 186.532 16.820  1.00 189.41 ? 471 ILE A CD1 1 
ATOM   3109 N  N   . THR A 1 399 ? 19.778 182.918 13.677  1.00 149.20 ? 472 THR A N   1 
ATOM   3110 C  CA  . THR A 1 399 ? 20.261 181.574 13.374  1.00 166.23 ? 472 THR A CA  1 
ATOM   3111 C  C   . THR A 1 399 ? 21.776 181.559 13.211  1.00 171.25 ? 472 THR A C   1 
ATOM   3112 O  O   . THR A 1 399 ? 22.449 180.629 13.672  1.00 156.58 ? 472 THR A O   1 
ATOM   3113 C  CB  . THR A 1 399 ? 19.577 181.045 12.113  1.00 139.44 ? 472 THR A CB  1 
ATOM   3114 O  OG1 . THR A 1 399 ? 18.155 181.097 12.284  1.00 164.01 ? 472 THR A OG1 1 
ATOM   3115 C  CG2 . THR A 1 399 ? 19.996 179.610 11.838  1.00 138.41 ? 472 THR A CG2 1 
ATOM   3116 N  N   . CYS A 1 400 ? 22.331 182.585 12.561  1.00 157.59 ? 473 CYS A N   1 
ATOM   3117 C  CA  . CYS A 1 400 ? 23.783 182.691 12.461  1.00 148.68 ? 473 CYS A CA  1 
ATOM   3118 C  C   . CYS A 1 400 ? 24.424 182.889 13.827  1.00 145.55 ? 473 CYS A C   1 
ATOM   3119 O  O   . CYS A 1 400 ? 25.538 182.406 14.065  1.00 146.10 ? 473 CYS A O   1 
ATOM   3120 C  CB  . CYS A 1 400 ? 24.167 183.837 11.525  1.00 121.56 ? 473 CYS A CB  1 
ATOM   3121 S  SG  . CYS A 1 400 ? 23.685 183.588 9.802   1.00 193.21 ? 473 CYS A SG  1 
ATOM   3122 N  N   . PHE A 1 401 ? 23.741 183.590 14.737  1.00 162.45 ? 474 PHE A N   1 
ATOM   3123 C  CA  . PHE A 1 401 ? 24.291 183.783 16.075  1.00 131.36 ? 474 PHE A CA  1 
ATOM   3124 C  C   . PHE A 1 401 ? 24.356 182.467 16.836  1.00 143.35 ? 474 PHE A C   1 
ATOM   3125 O  O   . PHE A 1 401 ? 25.382 182.145 17.448  1.00 177.12 ? 474 PHE A O   1 
ATOM   3126 C  CB  . PHE A 1 401 ? 23.469 184.810 16.851  1.00 142.87 ? 474 PHE A CB  1 
ATOM   3127 C  CG  . PHE A 1 401 ? 23.865 184.924 18.294  1.00 129.16 ? 474 PHE A CG  1 
ATOM   3128 C  CD1 . PHE A 1 401 ? 25.061 185.524 18.651  1.00 130.89 ? 474 PHE A CD1 1 
ATOM   3129 C  CD2 . PHE A 1 401 ? 23.050 184.421 19.293  1.00 132.51 ? 474 PHE A CD2 1 
ATOM   3130 C  CE1 . PHE A 1 401 ? 25.435 185.623 19.977  1.00 131.50 ? 474 PHE A CE1 1 
ATOM   3131 C  CE2 . PHE A 1 401 ? 23.417 184.519 20.622  1.00 149.88 ? 474 PHE A CE2 1 
ATOM   3132 C  CZ  . PHE A 1 401 ? 24.610 185.122 20.964  1.00 134.29 ? 474 PHE A CZ  1 
ATOM   3133 N  N   . PHE A 1 402 ? 23.268 181.693 16.818  1.00 167.53 ? 475 PHE A N   1 
ATOM   3134 C  CA  . PHE A 1 402 ? 23.308 180.389 17.472  1.00 173.24 ? 475 PHE A CA  1 
ATOM   3135 C  C   . PHE A 1 402 ? 24.276 179.442 16.773  1.00 140.79 ? 475 PHE A C   1 
ATOM   3136 O  O   . PHE A 1 402 ? 24.836 178.547 17.415  1.00 128.83 ? 475 PHE A O   1 
ATOM   3137 C  CB  . PHE A 1 402 ? 21.907 179.782 17.534  1.00 176.45 ? 475 PHE A CB  1 
ATOM   3138 C  CG  . PHE A 1 402 ? 21.041 180.375 18.609  1.00 162.09 ? 475 PHE A CG  1 
ATOM   3139 C  CD1 . PHE A 1 402 ? 21.301 180.114 19.944  1.00 151.88 ? 475 PHE A CD1 1 
ATOM   3140 C  CD2 . PHE A 1 402 ? 19.969 181.190 18.286  1.00 174.20 ? 475 PHE A CD2 1 
ATOM   3141 C  CE1 . PHE A 1 402 ? 20.509 180.656 20.938  1.00 169.18 ? 475 PHE A CE1 1 
ATOM   3142 C  CE2 . PHE A 1 402 ? 19.172 181.734 19.276  1.00 184.73 ? 475 PHE A CE2 1 
ATOM   3143 C  CZ  . PHE A 1 402 ? 19.443 181.467 20.603  1.00 185.64 ? 475 PHE A CZ  1 
ATOM   3144 N  N   . GLY A 1 403 ? 24.490 179.626 15.469  1.00 137.79 ? 476 GLY A N   1 
ATOM   3145 C  CA  . GLY A 1 403 ? 25.487 178.840 14.765  1.00 154.54 ? 476 GLY A CA  1 
ATOM   3146 C  C   . GLY A 1 403 ? 26.913 179.249 15.067  1.00 147.25 ? 476 GLY A C   1 
ATOM   3147 O  O   . GLY A 1 403 ? 27.834 178.454 14.854  1.00 136.81 ? 476 GLY A O   1 
ATOM   3148 N  N   . SER A 1 404 ? 27.116 180.468 15.560  1.00 154.96 ? 477 SER A N   1 
ATOM   3149 C  CA  . SER A 1 404 ? 28.443 180.954 15.909  1.00 117.54 ? 477 SER A CA  1 
ATOM   3150 C  C   . SER A 1 404 ? 28.813 180.685 17.362  1.00 118.58 ? 477 SER A C   1 
ATOM   3151 O  O   . SER A 1 404 ? 29.924 181.030 17.775  1.00 135.68 ? 477 SER A O   1 
ATOM   3152 C  CB  . SER A 1 404 ? 28.548 182.455 15.623  1.00 145.48 ? 477 SER A CB  1 
ATOM   3153 O  OG  . SER A 1 404 ? 28.386 182.724 14.241  1.00 175.24 ? 477 SER A OG  1 
ATOM   3154 N  N   . LEU A 1 405 ? 27.915 180.082 18.146  1.00 122.82 ? 478 LEU A N   1 
ATOM   3155 C  CA  . LEU A 1 405 ? 28.236 179.787 19.539  1.00 122.21 ? 478 LEU A CA  1 
ATOM   3156 C  C   . LEU A 1 405 ? 29.310 178.713 19.652  1.00 152.60 ? 478 LEU A C   1 
ATOM   3157 O  O   . LEU A 1 405 ? 30.060 178.691 20.634  1.00 147.24 ? 478 LEU A O   1 
ATOM   3158 C  CB  . LEU A 1 405 ? 26.978 179.362 20.296  1.00 126.78 ? 478 LEU A CB  1 
ATOM   3159 C  CG  . LEU A 1 405 ? 25.898 180.432 20.471  1.00 157.83 ? 478 LEU A CG  1 
ATOM   3160 C  CD1 . LEU A 1 405 ? 24.730 179.887 21.277  1.00 170.74 ? 478 LEU A CD1 1 
ATOM   3161 C  CD2 . LEU A 1 405 ? 26.473 181.677 21.130  1.00 159.68 ? 478 LEU A CD2 1 
ATOM   3162 N  N   . VAL A 1 406 ? 29.394 177.815 18.667  1.00 162.68 ? 479 VAL A N   1 
ATOM   3163 C  CA  . VAL A 1 406 ? 30.480 176.841 18.643  1.00 134.29 ? 479 VAL A CA  1 
ATOM   3164 C  C   . VAL A 1 406 ? 31.817 177.543 18.448  1.00 129.15 ? 479 VAL A C   1 
ATOM   3165 O  O   . VAL A 1 406 ? 32.849 177.088 18.957  1.00 145.63 ? 479 VAL A O   1 
ATOM   3166 C  CB  . VAL A 1 406 ? 30.228 175.791 17.545  1.00 129.98 ? 479 VAL A CB  1 
ATOM   3167 C  CG1 . VAL A 1 406 ? 31.255 174.671 17.624  1.00 133.65 ? 479 VAL A CG1 1 
ATOM   3168 C  CG2 . VAL A 1 406 ? 28.815 175.240 17.653  1.00 208.66 ? 479 VAL A CG2 1 
ATOM   3169 N  N   . THR A 1 407 ? 31.821 178.661 17.723  1.00 124.86 ? 480 THR A N   1 
ATOM   3170 C  CA  . THR A 1 407 ? 33.040 179.421 17.489  1.00 121.42 ? 480 THR A CA  1 
ATOM   3171 C  C   . THR A 1 407 ? 33.390 180.341 18.652  1.00 130.44 ? 480 THR A C   1 
ATOM   3172 O  O   . THR A 1 407 ? 34.542 180.777 18.759  1.00 152.00 ? 480 THR A O   1 
ATOM   3173 C  CB  . THR A 1 407 ? 32.892 180.240 16.205  1.00 129.72 ? 480 THR A CB  1 
ATOM   3174 O  OG1 . THR A 1 407 ? 32.279 179.432 15.193  1.00 192.39 ? 480 THR A OG1 1 
ATOM   3175 C  CG2 . THR A 1 407 ? 34.240 180.703 15.706  1.00 147.98 ? 480 THR A CG2 1 
ATOM   3176 N  N   . LEU A 1 408 ? 32.436 180.627 19.534  1.00 124.98 ? 481 LEU A N   1 
ATOM   3177 C  CA  . LEU A 1 408 ? 32.663 181.520 20.661  1.00 114.59 ? 481 LEU A CA  1 
ATOM   3178 C  C   . LEU A 1 408 ? 33.205 180.801 21.887  1.00 115.57 ? 481 LEU A C   1 
ATOM   3179 O  O   . LEU A 1 408 ? 33.393 181.438 22.929  1.00 167.50 ? 481 LEU A O   1 
ATOM   3180 C  CB  . LEU A 1 408 ? 31.365 182.248 21.025  1.00 136.65 ? 481 LEU A CB  1 
ATOM   3181 C  CG  . LEU A 1 408 ? 30.841 183.240 19.988  1.00 144.15 ? 481 LEU A CG  1 
ATOM   3182 C  CD1 . LEU A 1 408 ? 29.457 183.728 20.376  1.00 146.96 ? 481 LEU A CD1 1 
ATOM   3183 C  CD2 . LEU A 1 408 ? 31.802 184.408 19.833  1.00 116.98 ? 481 LEU A CD2 1 
ATOM   3184 N  N   . THR A 1 409 ? 33.459 179.499 21.791  1.00 128.44 ? 482 THR A N   1 
ATOM   3185 C  CA  . THR A 1 409 ? 34.010 178.757 22.913  1.00 147.14 ? 482 THR A CA  1 
ATOM   3186 C  C   . THR A 1 409 ? 35.489 179.098 23.093  1.00 159.80 ? 482 THR A C   1 
ATOM   3187 O  O   . THR A 1 409 ? 36.073 179.891 22.348  1.00 125.40 ? 482 THR A O   1 
ATOM   3188 C  CB  . THR A 1 409 ? 33.816 177.257 22.702  1.00 152.03 ? 482 THR A CB  1 
ATOM   3189 O  OG1 . THR A 1 409 ? 34.478 176.850 21.498  1.00 125.97 ? 482 THR A OG1 1 
ATOM   3190 C  CG2 . THR A 1 409 ? 32.335 176.922 22.598  1.00 151.63 ? 482 THR A CG2 1 
ATOM   3191 N  N   . PHE A 1 410 ? 36.106 178.485 24.107  1.00 159.94 ? 483 PHE A N   1 
ATOM   3192 C  CA  . PHE A 1 410 ? 37.523 178.725 24.353  1.00 120.72 ? 483 PHE A CA  1 
ATOM   3193 C  C   . PHE A 1 410 ? 38.390 178.142 23.245  1.00 134.54 ? 483 PHE A C   1 
ATOM   3194 O  O   . PHE A 1 410 ? 39.471 178.671 22.962  1.00 166.95 ? 483 PHE A O   1 
ATOM   3195 C  CB  . PHE A 1 410 ? 37.931 178.147 25.708  1.00 134.99 ? 483 PHE A CB  1 
ATOM   3196 C  CG  . PHE A 1 410 ? 37.124 178.673 26.862  1.00 150.05 ? 483 PHE A CG  1 
ATOM   3197 C  CD1 . PHE A 1 410 ? 37.166 180.015 27.202  1.00 132.42 ? 483 PHE A CD1 1 
ATOM   3198 C  CD2 . PHE A 1 410 ? 36.334 177.822 27.616  1.00 154.65 ? 483 PHE A CD2 1 
ATOM   3199 C  CE1 . PHE A 1 410 ? 36.426 180.499 28.266  1.00 136.35 ? 483 PHE A CE1 1 
ATOM   3200 C  CE2 . PHE A 1 410 ? 35.595 178.302 28.682  1.00 152.48 ? 483 PHE A CE2 1 
ATOM   3201 C  CZ  . PHE A 1 410 ? 35.641 179.641 29.006  1.00 148.99 ? 483 PHE A CZ  1 
ATOM   3202 N  N   . GLY A 1 411 ? 37.935 177.066 22.607  1.00 144.87 ? 484 GLY A N   1 
ATOM   3203 C  CA  . GLY A 1 411 ? 38.676 176.442 21.528  1.00 149.06 ? 484 GLY A CA  1 
ATOM   3204 C  C   . GLY A 1 411 ? 38.143 176.804 20.157  1.00 122.69 ? 484 GLY A C   1 
ATOM   3205 O  O   . GLY A 1 411 ? 38.339 176.060 19.192  1.00 133.34 ? 484 GLY A O   1 
ATOM   3206 N  N   . GLY A 1 412 ? 37.457 177.945 20.066  1.00 155.72 ? 485 GLY A N   1 
ATOM   3207 C  CA  . GLY A 1 412 ? 36.782 178.307 18.831  1.00 182.90 ? 485 GLY A CA  1 
ATOM   3208 C  C   . GLY A 1 412 ? 37.706 178.459 17.638  1.00 165.18 ? 485 GLY A C   1 
ATOM   3209 O  O   . GLY A 1 412 ? 37.314 178.156 16.508  1.00 175.74 ? 485 GLY A O   1 
ATOM   3210 N  N   . ALA A 1 413 ? 38.938 178.925 17.866  1.00 107.81 ? 486 ALA A N   1 
ATOM   3211 C  CA  . ALA A 1 413 ? 39.860 179.163 16.757  1.00 124.79 ? 486 ALA A CA  1 
ATOM   3212 C  C   . ALA A 1 413 ? 40.149 177.880 15.987  1.00 156.54 ? 486 ALA A C   1 
ATOM   3213 O  O   . ALA A 1 413 ? 40.249 177.894 14.751  1.00 166.46 ? 486 ALA A O   1 
ATOM   3214 C  CB  . ALA A 1 413 ? 41.157 179.780 17.279  1.00 106.14 ? 486 ALA A CB  1 
ATOM   3215 N  N   . TYR A 1 414 ? 40.291 176.760 16.702  1.00 121.36 ? 487 TYR A N   1 
ATOM   3216 C  CA  . TYR A 1 414 ? 40.465 175.473 16.038  1.00 116.35 ? 487 TYR A CA  1 
ATOM   3217 C  C   . TYR A 1 414 ? 39.305 175.185 15.093  1.00 145.08 ? 487 TYR A C   1 
ATOM   3218 O  O   . TYR A 1 414 ? 39.509 174.706 13.970  1.00 162.15 ? 487 TYR A O   1 
ATOM   3219 C  CB  . TYR A 1 414 ? 40.594 174.361 17.080  1.00 115.70 ? 487 TYR A CB  1 
ATOM   3220 C  CG  . TYR A 1 414 ? 41.688 174.583 18.101  1.00 132.92 ? 487 TYR A CG  1 
ATOM   3221 C  CD1 . TYR A 1 414 ? 42.915 175.119 17.732  1.00 141.24 ? 487 TYR A CD1 1 
ATOM   3222 C  CD2 . TYR A 1 414 ? 41.490 174.258 19.437  1.00 120.68 ? 487 TYR A CD2 1 
ATOM   3223 C  CE1 . TYR A 1 414 ? 43.916 175.321 18.665  1.00 117.61 ? 487 TYR A CE1 1 
ATOM   3224 C  CE2 . TYR A 1 414 ? 42.482 174.457 20.376  1.00 120.60 ? 487 TYR A CE2 1 
ATOM   3225 C  CZ  . TYR A 1 414 ? 43.693 174.988 19.985  1.00 124.09 ? 487 TYR A CZ  1 
ATOM   3226 O  OH  . TYR A 1 414 ? 44.683 175.188 20.918  1.00 169.91 ? 487 TYR A OH  1 
ATOM   3227 N  N   . VAL A 1 415 ? 38.080 175.486 15.529  1.00 120.39 ? 488 VAL A N   1 
ATOM   3228 C  CA  . VAL A 1 415 ? 36.915 175.292 14.675  1.00 98.59  ? 488 VAL A CA  1 
ATOM   3229 C  C   . VAL A 1 415 ? 36.934 176.272 13.508  1.00 119.99 ? 488 VAL A C   1 
ATOM   3230 O  O   . VAL A 1 415 ? 36.427 175.962 12.423  1.00 159.97 ? 488 VAL A O   1 
ATOM   3231 C  CB  . VAL A 1 415 ? 35.626 175.418 15.508  1.00 110.75 ? 488 VAL A CB  1 
ATOM   3232 C  CG1 . VAL A 1 415 ? 34.414 174.996 14.692  1.00 165.40 ? 488 VAL A CG1 1 
ATOM   3233 C  CG2 . VAL A 1 415 ? 35.737 174.587 16.777  1.00 105.37 ? 488 VAL A CG2 1 
ATOM   3234 N  N   . VAL A 1 416 ? 37.513 177.461 13.700  1.00 106.88 ? 489 VAL A N   1 
ATOM   3235 C  CA  . VAL A 1 416 ? 37.649 178.408 12.594  1.00 121.03 ? 489 VAL A CA  1 
ATOM   3236 C  C   . VAL A 1 416 ? 38.538 177.821 11.507  1.00 116.72 ? 489 VAL A C   1 
ATOM   3237 O  O   . VAL A 1 416 ? 38.165 177.780 10.327  1.00 115.21 ? 489 VAL A O   1 
ATOM   3238 C  CB  . VAL A 1 416 ? 38.201 179.756 13.092  1.00 110.79 ? 489 VAL A CB  1 
ATOM   3239 C  CG1 . VAL A 1 416 ? 38.284 180.748 11.940  1.00 111.33 ? 489 VAL A CG1 1 
ATOM   3240 C  CG2 . VAL A 1 416 ? 37.346 180.307 14.203  1.00 102.84 ? 489 VAL A CG2 1 
ATOM   3241 N  N   . LYS A 1 417 ? 39.732 177.362 11.890  1.00 135.71 ? 490 LYS A N   1 
ATOM   3242 C  CA  . LYS A 1 417 ? 40.640 176.765 10.914  1.00 132.80 ? 490 LYS A CA  1 
ATOM   3243 C  C   . LYS A 1 417 ? 40.012 175.545 10.251  1.00 131.20 ? 490 LYS A C   1 
ATOM   3244 O  O   . LYS A 1 417 ? 40.065 175.393 9.024   1.00 168.17 ? 490 LYS A O   1 
ATOM   3245 C  CB  . LYS A 1 417 ? 41.958 176.391 11.591  1.00 135.63 ? 490 LYS A CB  1 
ATOM   3246 C  CG  . LYS A 1 417 ? 43.072 177.407 11.419  1.00 151.61 ? 490 LYS A CG  1 
ATOM   3247 C  CD  . LYS A 1 417 ? 43.778 177.223 10.087  1.00 186.08 ? 490 LYS A CD  1 
ATOM   3248 C  CE  . LYS A 1 417 ? 45.051 178.050 10.020  1.00 201.39 ? 490 LYS A CE  1 
ATOM   3249 N  NZ  . LYS A 1 417 ? 45.831 177.771 8.782   1.00 240.62 ? 490 LYS A NZ  1 
ATOM   3250 N  N   . LEU A 1 418 ? 39.399 174.668 11.052  1.00 100.86 ? 491 LEU A N   1 
ATOM   3251 C  CA  . LEU A 1 418 ? 38.834 173.435 10.512  1.00 93.77  ? 491 LEU A CA  1 
ATOM   3252 C  C   . LEU A 1 418 ? 37.714 173.725 9.521   1.00 94.67  ? 491 LEU A C   1 
ATOM   3253 O  O   . LEU A 1 418 ? 37.655 173.128 8.441   1.00 151.95 ? 491 LEU A O   1 
ATOM   3254 C  CB  . LEU A 1 418 ? 38.327 172.551 11.650  1.00 94.55  ? 491 LEU A CB  1 
ATOM   3255 C  CG  . LEU A 1 418 ? 37.742 171.202 11.234  1.00 122.27 ? 491 LEU A CG  1 
ATOM   3256 C  CD1 . LEU A 1 418 ? 38.833 170.284 10.701  1.00 130.60 ? 491 LEU A CD1 1 
ATOM   3257 C  CD2 . LEU A 1 418 ? 37.013 170.557 12.397  1.00 138.35 ? 491 LEU A CD2 1 
ATOM   3258 N  N   . LEU A 1 419 ? 36.812 174.641 9.875   1.00 100.89 ? 492 LEU A N   1 
ATOM   3259 C  CA  . LEU A 1 419 ? 35.693 174.952 8.990   1.00 140.64 ? 492 LEU A CA  1 
ATOM   3260 C  C   . LEU A 1 419 ? 36.161 175.676 7.734   1.00 134.99 ? 492 LEU A C   1 
ATOM   3261 O  O   . LEU A 1 419 ? 35.664 175.407 6.635   1.00 180.38 ? 492 LEU A O   1 
ATOM   3262 C  CB  . LEU A 1 419 ? 34.652 175.789 9.733   1.00 119.50 ? 492 LEU A CB  1 
ATOM   3263 C  CG  . LEU A 1 419 ? 33.445 175.052 10.320  1.00 112.46 ? 492 LEU A CG  1 
ATOM   3264 C  CD1 . LEU A 1 419 ? 33.878 173.884 11.192  1.00 145.33 ? 492 LEU A CD1 1 
ATOM   3265 C  CD2 . LEU A 1 419 ? 32.574 176.015 11.110  1.00 115.53 ? 492 LEU A CD2 1 
ATOM   3266 N  N   . GLU A 1 420 ? 37.119 176.593 7.874   1.00 133.04 ? 493 GLU A N   1 
ATOM   3267 C  CA  . GLU A 1 420 ? 37.552 177.380 6.724   1.00 137.00 ? 493 GLU A CA  1 
ATOM   3268 C  C   . GLU A 1 420 ? 38.341 176.531 5.734   1.00 136.21 ? 493 GLU A C   1 
ATOM   3269 O  O   . GLU A 1 420 ? 38.047 176.527 4.533   1.00 146.18 ? 493 GLU A O   1 
ATOM   3270 C  CB  . GLU A 1 420 ? 38.378 178.579 7.191   1.00 152.80 ? 493 GLU A CB  1 
ATOM   3271 C  CG  . GLU A 1 420 ? 38.778 179.532 6.077   1.00 143.09 ? 493 GLU A CG  1 
ATOM   3272 C  CD  . GLU A 1 420 ? 39.384 180.817 6.605   1.00 192.88 ? 493 GLU A CD  1 
ATOM   3273 O  OE1 . GLU A 1 420 ? 39.246 181.861 5.934   1.00 205.19 ? 493 GLU A OE1 1 
ATOM   3274 O  OE2 . GLU A 1 420 ? 39.992 180.783 7.696   1.00 213.77 ? 493 GLU A OE2 1 
ATOM   3275 N  N   . GLU A 1 421 ? 39.354 175.808 6.217   1.00 128.97 ? 494 GLU A N   1 
ATOM   3276 C  CA  . GLU A 1 421 ? 40.230 175.075 5.308   1.00 124.87 ? 494 GLU A CA  1 
ATOM   3277 C  C   . GLU A 1 421 ? 39.603 173.765 4.837   1.00 119.62 ? 494 GLU A C   1 
ATOM   3278 O  O   . GLU A 1 421 ? 39.599 173.469 3.637   1.00 135.82 ? 494 GLU A O   1 
ATOM   3279 C  CB  . GLU A 1 421 ? 41.577 174.810 5.980   1.00 127.94 ? 494 GLU A CB  1 
ATOM   3280 C  CG  . GLU A 1 421 ? 42.666 174.385 5.015   1.00 170.22 ? 494 GLU A CG  1 
ATOM   3281 C  CD  . GLU A 1 421 ? 43.796 175.389 4.948   1.00 189.28 ? 494 GLU A CD  1 
ATOM   3282 O  OE1 . GLU A 1 421 ? 43.876 176.250 5.850   1.00 150.43 ? 494 GLU A OE1 1 
ATOM   3283 O  OE2 . GLU A 1 421 ? 44.601 175.323 3.996   1.00 210.22 ? 494 GLU A OE2 1 
ATOM   3284 N  N   . TYR A 1 422 ? 39.071 172.966 5.762   1.00 111.22 ? 495 TYR A N   1 
ATOM   3285 C  CA  . TYR A 1 422 ? 38.628 171.616 5.435   1.00 106.25 ? 495 TYR A CA  1 
ATOM   3286 C  C   . TYR A 1 422 ? 37.160 171.522 5.032   1.00 132.74 ? 495 TYR A C   1 
ATOM   3287 O  O   . TYR A 1 422 ? 36.734 170.454 4.581   1.00 141.40 ? 495 TYR A O   1 
ATOM   3288 C  CB  . TYR A 1 422 ? 38.874 170.671 6.619   1.00 106.11 ? 495 TYR A CB  1 
ATOM   3289 C  CG  . TYR A 1 422 ? 40.289 170.150 6.722   1.00 116.59 ? 495 TYR A CG  1 
ATOM   3290 C  CD1 . TYR A 1 422 ? 41.242 170.471 5.765   1.00 129.54 ? 495 TYR A CD1 1 
ATOM   3291 C  CD2 . TYR A 1 422 ? 40.667 169.323 7.772   1.00 151.50 ? 495 TYR A CD2 1 
ATOM   3292 C  CE1 . TYR A 1 422 ? 42.536 169.990 5.856   1.00 118.80 ? 495 TYR A CE1 1 
ATOM   3293 C  CE2 . TYR A 1 422 ? 41.958 168.836 7.871   1.00 157.00 ? 495 TYR A CE2 1 
ATOM   3294 C  CZ  . TYR A 1 422 ? 42.887 169.173 6.911   1.00 128.96 ? 495 TYR A CZ  1 
ATOM   3295 O  OH  . TYR A 1 422 ? 44.173 168.692 7.007   1.00 127.33 ? 495 TYR A OH  1 
ATOM   3296 N  N   . ALA A 1 423 ? 36.370 172.587 5.178   1.00 106.58 ? 496 ALA A N   1 
ATOM   3297 C  CA  . ALA A 1 423 ? 34.936 172.449 4.952   1.00 114.28 ? 496 ALA A CA  1 
ATOM   3298 C  C   . ALA A 1 423 ? 34.395 173.457 3.947   1.00 133.18 ? 496 ALA A C   1 
ATOM   3299 O  O   . ALA A 1 423 ? 33.953 173.080 2.857   1.00 145.94 ? 496 ALA A O   1 
ATOM   3300 C  CB  . ALA A 1 423 ? 34.178 172.579 6.272   1.00 102.58 ? 496 ALA A CB  1 
ATOM   3301 N  N   . THR A 1 424 ? 34.410 174.737 4.316   1.00 102.98 ? 497 THR A N   1 
ATOM   3302 C  CA  . THR A 1 424 ? 33.764 175.750 3.492   1.00 114.53 ? 497 THR A CA  1 
ATOM   3303 C  C   . THR A 1 424 ? 34.500 175.953 2.174   1.00 135.17 ? 497 THR A C   1 
ATOM   3304 O  O   . THR A 1 424 ? 33.869 176.044 1.117   1.00 130.71 ? 497 THR A O   1 
ATOM   3305 C  CB  . THR A 1 424 ? 33.673 177.066 4.261   1.00 104.06 ? 497 THR A CB  1 
ATOM   3306 O  OG1 . THR A 1 424 ? 34.990 177.539 4.564   1.00 154.32 ? 497 THR A OG1 1 
ATOM   3307 C  CG2 . THR A 1 424 ? 32.907 176.864 5.558   1.00 105.48 ? 497 THR A CG2 1 
ATOM   3308 N  N   . GLY A 1 425 ? 35.830 176.021 2.214   1.00 117.25 ? 498 GLY A N   1 
ATOM   3309 C  CA  . GLY A 1 425 ? 36.622 176.295 1.036   1.00 101.66 ? 498 GLY A CA  1 
ATOM   3310 C  C   . GLY A 1 425 ? 36.406 175.326 -0.114  1.00 121.21 ? 498 GLY A C   1 
ATOM   3311 O  O   . GLY A 1 425 ? 36.033 175.729 -1.224  1.00 117.32 ? 498 GLY A O   1 
ATOM   3312 N  N   . PRO A 1 426 ? 36.628 174.028 0.122   1.00 113.45 ? 499 PRO A N   1 
ATOM   3313 C  CA  . PRO A 1 426 ? 36.458 173.057 -0.973  1.00 129.37 ? 499 PRO A CA  1 
ATOM   3314 C  C   . PRO A 1 426 ? 35.033 172.961 -1.479  1.00 136.53 ? 499 PRO A C   1 
ATOM   3315 O  O   . PRO A 1 426 ? 34.824 172.618 -2.650  1.00 169.94 ? 499 PRO A O   1 
ATOM   3316 C  CB  . PRO A 1 426 ? 36.922 171.735 -0.345  1.00 122.95 ? 499 PRO A CB  1 
ATOM   3317 C  CG  . PRO A 1 426 ? 36.771 171.941 1.124   1.00 123.30 ? 499 PRO A CG  1 
ATOM   3318 C  CD  . PRO A 1 426 ? 37.120 173.377 1.349   1.00 114.06 ? 499 PRO A CD  1 
ATOM   3319 N  N   . ALA A 1 427 ? 34.041 173.249 -0.636  1.00 113.15 ? 500 ALA A N   1 
ATOM   3320 C  CA  . ALA A 1 427 ? 32.658 173.201 -1.089  1.00 130.67 ? 500 ALA A CA  1 
ATOM   3321 C  C   . ALA A 1 427 ? 32.268 174.451 -1.870  1.00 133.38 ? 500 ALA A C   1 
ATOM   3322 O  O   . ALA A 1 427 ? 31.428 174.371 -2.773  1.00 177.73 ? 500 ALA A O   1 
ATOM   3323 C  CB  . ALA A 1 427 ? 31.723 172.997 0.101   1.00 135.15 ? 500 ALA A CB  1 
ATOM   3324 N  N   . VAL A 1 428 ? 32.854 175.605 -1.541  1.00 108.89 ? 501 VAL A N   1 
ATOM   3325 C  CA  . VAL A 1 428 ? 32.632 176.801 -2.349  1.00 133.73 ? 501 VAL A CA  1 
ATOM   3326 C  C   . VAL A 1 428 ? 33.307 176.650 -3.706  1.00 125.59 ? 501 VAL A C   1 
ATOM   3327 O  O   . VAL A 1 428 ? 32.731 176.999 -4.745  1.00 143.54 ? 501 VAL A O   1 
ATOM   3328 C  CB  . VAL A 1 428 ? 33.126 178.057 -1.608  1.00 100.43 ? 501 VAL A CB  1 
ATOM   3329 C  CG1 . VAL A 1 428 ? 33.089 179.267 -2.529  1.00 90.53  ? 501 VAL A CG1 1 
ATOM   3330 C  CG2 . VAL A 1 428 ? 32.281 178.313 -0.375  1.00 103.90 ? 501 VAL A CG2 1 
ATOM   3331 N  N   . LEU A 1 429 ? 34.535 176.127 -3.720  1.00 140.81 ? 502 LEU A N   1 
ATOM   3332 C  CA  . LEU A 1 429 ? 35.187 175.817 -4.988  1.00 139.54 ? 502 LEU A CA  1 
ATOM   3333 C  C   . LEU A 1 429 ? 34.390 174.784 -5.776  1.00 137.04 ? 502 LEU A C   1 
ATOM   3334 O  O   . LEU A 1 429 ? 34.297 174.864 -7.007  1.00 129.30 ? 502 LEU A O   1 
ATOM   3335 C  CB  . LEU A 1 429 ? 36.609 175.318 -4.736  1.00 126.01 ? 502 LEU A CB  1 
ATOM   3336 C  CG  . LEU A 1 429 ? 37.734 176.337 -4.572  1.00 110.77 ? 502 LEU A CG  1 
ATOM   3337 C  CD1 . LEU A 1 429 ? 38.848 175.738 -3.737  1.00 113.47 ? 502 LEU A CD1 1 
ATOM   3338 C  CD2 . LEU A 1 429 ? 38.262 176.749 -5.934  1.00 114.39 ? 502 LEU A CD2 1 
ATOM   3339 N  N   . THR A 1 430 ? 33.798 173.810 -5.079  1.00 117.02 ? 503 THR A N   1 
ATOM   3340 C  CA  . THR A 1 430 ? 33.026 172.772 -5.754  1.00 104.52 ? 503 THR A CA  1 
ATOM   3341 C  C   . THR A 1 430 ? 31.768 173.348 -6.393  1.00 131.59 ? 503 THR A C   1 
ATOM   3342 O  O   . THR A 1 430 ? 31.515 173.138 -7.585  1.00 126.19 ? 503 THR A O   1 
ATOM   3343 C  CB  . THR A 1 430 ? 32.664 171.660 -4.768  1.00 119.92 ? 503 THR A CB  1 
ATOM   3344 O  OG1 . THR A 1 430 ? 33.861 171.078 -4.240  1.00 127.23 ? 503 THR A OG1 1 
ATOM   3345 C  CG2 . THR A 1 430 ? 31.845 170.581 -5.461  1.00 126.70 ? 503 THR A CG2 1 
ATOM   3346 N  N   . VAL A 1 431 ? 30.967 174.082 -5.616  1.00 141.67 ? 504 VAL A N   1 
ATOM   3347 C  CA  . VAL A 1 431 ? 29.733 174.646 -6.155  1.00 122.42 ? 504 VAL A CA  1 
ATOM   3348 C  C   . VAL A 1 431 ? 30.039 175.669 -7.242  1.00 121.08 ? 504 VAL A C   1 
ATOM   3349 O  O   . VAL A 1 431 ? 29.277 175.807 -8.209  1.00 140.61 ? 504 VAL A O   1 
ATOM   3350 C  CB  . VAL A 1 431 ? 28.874 175.246 -5.020  1.00 136.66 ? 504 VAL A CB  1 
ATOM   3351 C  CG1 . VAL A 1 431 ? 29.548 176.461 -4.397  1.00 155.87 ? 504 VAL A CG1 1 
ATOM   3352 C  CG2 . VAL A 1 431 ? 27.489 175.601 -5.530  1.00 155.65 ? 504 VAL A CG2 1 
ATOM   3353 N  N   . ALA A 1 432 ? 31.161 176.384 -7.122  1.00 119.56 ? 505 ALA A N   1 
ATOM   3354 C  CA  . ALA A 1 432 ? 31.574 177.283 -8.193  1.00 122.75 ? 505 ALA A CA  1 
ATOM   3355 C  C   . ALA A 1 432 ? 31.956 176.508 -9.447  1.00 135.31 ? 505 ALA A C   1 
ATOM   3356 O  O   . ALA A 1 432 ? 31.729 176.986 -10.565 1.00 139.49 ? 505 ALA A O   1 
ATOM   3357 C  CB  . ALA A 1 432 ? 32.738 178.158 -7.730  1.00 165.22 ? 505 ALA A CB  1 
ATOM   3358 N  N   . LEU A 1 433 ? 32.531 175.315 -9.281  1.00 138.91 ? 506 LEU A N   1 
ATOM   3359 C  CA  . LEU A 1 433 ? 32.810 174.461 -10.430 1.00 132.42 ? 506 LEU A CA  1 
ATOM   3360 C  C   . LEU A 1 433 ? 31.517 173.978 -11.077 1.00 128.50 ? 506 LEU A C   1 
ATOM   3361 O  O   . LEU A 1 433 ? 31.413 173.929 -12.310 1.00 159.21 ? 506 LEU A O   1 
ATOM   3362 C  CB  . LEU A 1 433 ? 33.684 173.281 -9.999  1.00 143.09 ? 506 LEU A CB  1 
ATOM   3363 C  CG  . LEU A 1 433 ? 34.381 172.422 -11.059 1.00 130.06 ? 506 LEU A CG  1 
ATOM   3364 C  CD1 . LEU A 1 433 ? 33.476 171.307 -11.571 1.00 132.22 ? 506 LEU A CD1 1 
ATOM   3365 C  CD2 . LEU A 1 433 ? 34.875 173.289 -12.209 1.00 122.53 ? 506 LEU A CD2 1 
ATOM   3366 N  N   . ILE A 1 434 ? 30.517 173.626 -10.263 1.00 127.13 ? 507 ILE A N   1 
ATOM   3367 C  CA  . ILE A 1 434 ? 29.235 173.185 -10.806 1.00 135.05 ? 507 ILE A CA  1 
ATOM   3368 C  C   . ILE A 1 434 ? 28.560 174.320 -11.565 1.00 130.80 ? 507 ILE A C   1 
ATOM   3369 O  O   . ILE A 1 434 ? 27.923 174.099 -12.602 1.00 117.86 ? 507 ILE A O   1 
ATOM   3370 C  CB  . ILE A 1 434 ? 28.328 172.643 -9.685  1.00 128.56 ? 507 ILE A CB  1 
ATOM   3371 C  CG1 . ILE A 1 434 ? 29.071 171.619 -8.827  1.00 124.31 ? 507 ILE A CG1 1 
ATOM   3372 C  CG2 . ILE A 1 434 ? 27.085 172.000 -10.279 1.00 114.74 ? 507 ILE A CG2 1 
ATOM   3373 C  CD1 . ILE A 1 434 ? 29.224 170.271 -9.483  1.00 128.01 ? 507 ILE A CD1 1 
ATOM   3374 N  N   . GLU A 1 435 ? 28.681 175.550 -11.060 1.00 137.53 ? 508 GLU A N   1 
ATOM   3375 C  CA  . GLU A 1 435 ? 28.091 176.686 -11.763 1.00 141.68 ? 508 GLU A CA  1 
ATOM   3376 C  C   . GLU A 1 435 ? 28.834 176.980 -13.061 1.00 144.98 ? 508 GLU A C   1 
ATOM   3377 O  O   . GLU A 1 435 ? 28.206 177.216 -14.102 1.00 146.10 ? 508 GLU A O   1 
ATOM   3378 C  CB  . GLU A 1 435 ? 28.081 177.919 -10.860 1.00 142.32 ? 508 GLU A CB  1 
ATOM   3379 C  CG  . GLU A 1 435 ? 27.193 177.783 -9.637  1.00 163.70 ? 508 GLU A CG  1 
ATOM   3380 C  CD  . GLU A 1 435 ? 27.077 179.077 -8.857  1.00 186.66 ? 508 GLU A CD  1 
ATOM   3381 O  OE1 . GLU A 1 435 ? 27.511 180.126 -9.377  1.00 206.80 ? 508 GLU A OE1 1 
ATOM   3382 O  OE2 . GLU A 1 435 ? 26.552 179.044 -7.724  1.00 188.04 ? 508 GLU A OE2 1 
ATOM   3383 N  N   . ALA A 1 436 ? 30.169 176.969 -13.019 1.00 180.60 ? 509 ALA A N   1 
ATOM   3384 C  CA  . ALA A 1 436 ? 30.951 177.246 -14.221 1.00 201.48 ? 509 ALA A CA  1 
ATOM   3385 C  C   . ALA A 1 436 ? 30.703 176.197 -15.297 1.00 171.73 ? 509 ALA A C   1 
ATOM   3386 O  O   . ALA A 1 436 ? 30.688 176.514 -16.492 1.00 166.30 ? 509 ALA A O   1 
ATOM   3387 C  CB  . ALA A 1 436 ? 32.437 177.321 -13.874 1.00 215.01 ? 509 ALA A CB  1 
ATOM   3388 N  N   . VAL A 1 437 ? 30.507 174.941 -14.893 1.00 166.71 ? 510 VAL A N   1 
ATOM   3389 C  CA  . VAL A 1 437 ? 30.193 173.895 -15.861 1.00 155.01 ? 510 VAL A CA  1 
ATOM   3390 C  C   . VAL A 1 437 ? 28.762 174.044 -16.363 1.00 127.93 ? 510 VAL A C   1 
ATOM   3391 O  O   . VAL A 1 437 ? 28.481 173.854 -17.553 1.00 163.38 ? 510 VAL A O   1 
ATOM   3392 C  CB  . VAL A 1 437 ? 30.440 172.507 -15.241 1.00 142.44 ? 510 VAL A CB  1 
ATOM   3393 C  CG1 . VAL A 1 437 ? 29.840 171.412 -16.111 1.00 125.25 ? 510 VAL A CG1 1 
ATOM   3394 C  CG2 . VAL A 1 437 ? 31.931 172.274 -15.046 1.00 136.35 ? 510 VAL A CG2 1 
ATOM   3395 N  N   . ALA A 1 438 ? 27.838 174.409 -15.470 1.00 133.14 ? 511 ALA A N   1 
ATOM   3396 C  CA  . ALA A 1 438 ? 26.426 174.458 -15.833 1.00 152.18 ? 511 ALA A CA  1 
ATOM   3397 C  C   . ALA A 1 438 ? 26.131 175.594 -16.804 1.00 130.89 ? 511 ALA A C   1 
ATOM   3398 O  O   . ALA A 1 438 ? 25.393 175.408 -17.777 1.00 134.30 ? 511 ALA A O   1 
ATOM   3399 C  CB  . ALA A 1 438 ? 25.568 174.594 -14.576 1.00 153.61 ? 511 ALA A CB  1 
ATOM   3400 N  N   . VAL A 1 439 ? 26.687 176.781 -16.557 1.00 149.00 ? 512 VAL A N   1 
ATOM   3401 C  CA  . VAL A 1 439 ? 26.390 177.915 -17.426 1.00 118.02 ? 512 VAL A CA  1 
ATOM   3402 C  C   . VAL A 1 439 ? 27.008 177.713 -18.805 1.00 152.55 ? 512 VAL A C   1 
ATOM   3403 O  O   . VAL A 1 439 ? 26.389 178.025 -19.829 1.00 183.64 ? 512 VAL A O   1 
ATOM   3404 C  CB  . VAL A 1 439 ? 26.866 179.227 -16.776 1.00 144.81 ? 512 VAL A CB  1 
ATOM   3405 C  CG1 . VAL A 1 439 ? 26.583 180.410 -17.691 1.00 121.61 ? 512 VAL A CG1 1 
ATOM   3406 C  CG2 . VAL A 1 439 ? 26.192 179.421 -15.428 1.00 137.24 ? 512 VAL A CG2 1 
ATOM   3407 N  N   . SER A 1 440 ? 28.231 177.183 -18.857 1.00 167.17 ? 513 SER A N   1 
ATOM   3408 C  CA  . SER A 1 440 ? 28.930 177.059 -20.132 1.00 176.87 ? 513 SER A CA  1 
ATOM   3409 C  C   . SER A 1 440 ? 28.433 175.869 -20.948 1.00 184.03 ? 513 SER A C   1 
ATOM   3410 O  O   . SER A 1 440 ? 28.137 176.007 -22.140 1.00 205.84 ? 513 SER A O   1 
ATOM   3411 C  CB  . SER A 1 440 ? 30.437 176.946 -19.891 1.00 184.80 ? 513 SER A CB  1 
ATOM   3412 O  OG  . SER A 1 440 ? 31.146 176.876 -21.115 1.00 208.03 ? 513 SER A OG  1 
ATOM   3413 N  N   . TRP A 1 441 ? 28.341 174.693 -20.329 1.00 189.82 ? 514 TRP A N   1 
ATOM   3414 C  CA  . TRP A 1 441 ? 28.116 173.452 -21.060 1.00 196.76 ? 514 TRP A CA  1 
ATOM   3415 C  C   . TRP A 1 441 ? 26.663 172.989 -21.072 1.00 196.18 ? 514 TRP A C   1 
ATOM   3416 O  O   . TRP A 1 441 ? 26.360 171.979 -21.715 1.00 204.34 ? 514 TRP A O   1 
ATOM   3417 C  CB  . TRP A 1 441 ? 29.007 172.346 -20.488 1.00 211.37 ? 514 TRP A CB  1 
ATOM   3418 C  CG  . TRP A 1 441 ? 30.472 172.612 -20.670 1.00 213.11 ? 514 TRP A CG  1 
ATOM   3419 C  CD1 . TRP A 1 441 ? 31.040 173.629 -21.382 1.00 203.94 ? 514 TRP A CD1 1 
ATOM   3420 C  CD2 . TRP A 1 441 ? 31.554 171.849 -20.129 1.00 212.42 ? 514 TRP A CD2 1 
ATOM   3421 N  NE1 . TRP A 1 441 ? 32.410 173.545 -21.318 1.00 200.85 ? 514 TRP A NE1 1 
ATOM   3422 C  CE2 . TRP A 1 441 ? 32.751 172.460 -20.554 1.00 212.20 ? 514 TRP A CE2 1 
ATOM   3423 C  CE3 . TRP A 1 441 ? 31.628 170.707 -19.326 1.00 197.17 ? 514 TRP A CE3 1 
ATOM   3424 C  CZ2 . TRP A 1 441 ? 34.005 171.968 -20.203 1.00 214.35 ? 514 TRP A CZ2 1 
ATOM   3425 C  CZ3 . TRP A 1 441 ? 32.873 170.221 -18.980 1.00 210.33 ? 514 TRP A CZ3 1 
ATOM   3426 C  CH2 . TRP A 1 441 ? 34.045 170.850 -19.417 1.00 217.65 ? 514 TRP A CH2 1 
ATOM   3427 N  N   . PHE A 1 442 ? 25.757 173.691 -20.388 1.00 204.42 ? 515 PHE A N   1 
ATOM   3428 C  CA  . PHE A 1 442 ? 24.342 173.324 -20.392 1.00 179.19 ? 515 PHE A CA  1 
ATOM   3429 C  C   . PHE A 1 442 ? 23.502 174.428 -21.021 1.00 177.54 ? 515 PHE A C   1 
ATOM   3430 O  O   . PHE A 1 442 ? 22.974 174.237 -22.119 1.00 218.31 ? 515 PHE A O   1 
ATOM   3431 C  CB  . PHE A 1 442 ? 23.866 172.998 -18.975 1.00 178.83 ? 515 PHE A CB  1 
ATOM   3432 C  CG  . PHE A 1 442 ? 23.935 171.539 -18.631 1.00 177.93 ? 515 PHE A CG  1 
ATOM   3433 C  CD1 . PHE A 1 442 ? 25.121 170.966 -18.204 1.00 173.64 ? 515 PHE A CD1 1 
ATOM   3434 C  CD2 . PHE A 1 442 ? 22.808 170.740 -18.730 1.00 190.08 ? 515 PHE A CD2 1 
ATOM   3435 C  CE1 . PHE A 1 442 ? 25.183 169.621 -17.886 1.00 182.58 ? 515 PHE A CE1 1 
ATOM   3436 C  CE2 . PHE A 1 442 ? 22.863 169.395 -18.413 1.00 193.10 ? 515 PHE A CE2 1 
ATOM   3437 C  CZ  . PHE A 1 442 ? 24.052 168.835 -17.991 1.00 178.49 ? 515 PHE A CZ  1 
ATOM   3438 N  N   . TYR A 1 443 ? 23.353 175.577 -20.357 1.00 176.05 ? 516 TYR A N   1 
ATOM   3439 C  CA  . TYR A 1 443 ? 22.683 176.718 -20.970 1.00 173.48 ? 516 TYR A CA  1 
ATOM   3440 C  C   . TYR A 1 443 ? 23.387 177.168 -22.242 1.00 177.42 ? 516 TYR A C   1 
ATOM   3441 O  O   . TYR A 1 443 ? 22.754 177.781 -23.110 1.00 227.84 ? 516 TYR A O   1 
ATOM   3442 C  CB  . TYR A 1 443 ? 22.606 177.866 -19.961 1.00 170.85 ? 516 TYR A CB  1 
ATOM   3443 C  CG  . TYR A 1 443 ? 22.050 179.162 -20.507 1.00 180.04 ? 516 TYR A CG  1 
ATOM   3444 C  CD1 . TYR A 1 443 ? 20.683 179.341 -20.670 1.00 181.27 ? 516 TYR A CD1 1 
ATOM   3445 C  CD2 . TYR A 1 443 ? 22.894 180.214 -20.840 1.00 187.94 ? 516 TYR A CD2 1 
ATOM   3446 C  CE1 . TYR A 1 443 ? 20.172 180.528 -21.161 1.00 205.65 ? 516 TYR A CE1 1 
ATOM   3447 C  CE2 . TYR A 1 443 ? 22.393 181.403 -21.332 1.00 201.29 ? 516 TYR A CE2 1 
ATOM   3448 C  CZ  . TYR A 1 443 ? 21.032 181.556 -21.490 1.00 208.79 ? 516 TYR A CZ  1 
ATOM   3449 O  OH  . TYR A 1 443 ? 20.530 182.740 -21.979 1.00 209.26 ? 516 TYR A OH  1 
ATOM   3450 N  N   . GLY A 1 444 ? 24.675 176.869 -22.372 1.00 114.42 ? 517 GLY A N   1 
ATOM   3451 C  CA  . GLY A 1 444 ? 25.438 177.191 -23.559 1.00 146.26 ? 517 GLY A CA  1 
ATOM   3452 C  C   . GLY A 1 444 ? 26.173 178.508 -23.437 1.00 157.78 ? 517 GLY A C   1 
ATOM   3453 O  O   . GLY A 1 444 ? 25.676 179.452 -22.816 1.00 163.92 ? 517 GLY A O   1 
ATOM   3454 N  N   . ILE A 1 445 ? 27.364 178.581 -24.029 1.00 161.37 ? 518 ILE A N   1 
ATOM   3455 C  CA  . ILE A 1 445 ? 28.117 179.827 -24.005 1.00 152.01 ? 518 ILE A CA  1 
ATOM   3456 C  C   . ILE A 1 445 ? 27.645 180.773 -25.103 1.00 180.47 ? 518 ILE A C   1 
ATOM   3457 O  O   . ILE A 1 445 ? 27.727 181.998 -24.950 1.00 176.55 ? 518 ILE A O   1 
ATOM   3458 C  CB  . ILE A 1 445 ? 29.625 179.540 -24.108 1.00 172.74 ? 518 ILE A CB  1 
ATOM   3459 C  CG1 . ILE A 1 445 ? 30.423 180.795 -23.759 1.00 144.53 ? 518 ILE A CG1 1 
ATOM   3460 C  CG2 . ILE A 1 445 ? 29.983 179.030 -25.497 1.00 212.90 ? 518 ILE A CG2 1 
ATOM   3461 C  CD1 . ILE A 1 445 ? 29.981 181.437 -22.465 1.00 142.90 ? 518 ILE A CD1 1 
ATOM   3462 N  N   . THR A 1 446 ? 27.142 180.231 -26.215 1.00 189.07 ? 519 THR A N   1 
ATOM   3463 C  CA  . THR A 1 446 ? 26.713 181.075 -27.325 1.00 180.83 ? 519 THR A CA  1 
ATOM   3464 C  C   . THR A 1 446 ? 25.494 181.905 -26.945 1.00 171.68 ? 519 THR A C   1 
ATOM   3465 O  O   . THR A 1 446 ? 25.435 183.105 -27.241 1.00 161.73 ? 519 THR A O   1 
ATOM   3466 C  CB  . THR A 1 446 ? 26.415 180.213 -28.552 1.00 186.11 ? 519 THR A CB  1 
ATOM   3467 O  OG1 . THR A 1 446 ? 25.366 179.287 -28.244 1.00 193.84 ? 519 THR A OG1 1 
ATOM   3468 C  CG2 . THR A 1 446 ? 27.658 179.440 -28.972 1.00 171.01 ? 519 THR A CG2 1 
ATOM   3469 N  N   . GLN A 1 447 ? 24.512 181.284 -26.287 1.00 155.05 ? 520 GLN A N   1 
ATOM   3470 C  CA  . GLN A 1 447 ? 23.349 182.035 -25.827 1.00 149.22 ? 520 GLN A CA  1 
ATOM   3471 C  C   . GLN A 1 447 ? 23.731 183.047 -24.756 1.00 144.38 ? 520 GLN A C   1 
ATOM   3472 O  O   . GLN A 1 447 ? 23.110 184.111 -24.662 1.00 150.54 ? 520 GLN A O   1 
ATOM   3473 C  CB  . GLN A 1 447 ? 22.277 181.077 -25.307 1.00 139.60 ? 520 GLN A CB  1 
ATOM   3474 C  CG  . GLN A 1 447 ? 20.947 181.745 -24.993 1.00 171.02 ? 520 GLN A CG  1 
ATOM   3475 C  CD  . GLN A 1 447 ? 20.316 182.397 -26.209 1.00 198.10 ? 520 GLN A CD  1 
ATOM   3476 O  OE1 . GLN A 1 447 ? 20.475 181.925 -27.336 1.00 193.19 ? 520 GLN A OE1 1 
ATOM   3477 N  NE2 . GLN A 1 447 ? 19.596 183.491 -25.987 1.00 200.89 ? 520 GLN A NE2 1 
ATOM   3478 N  N   . PHE A 1 448 ? 24.749 182.739 -23.949 1.00 185.44 ? 521 PHE A N   1 
ATOM   3479 C  CA  . PHE A 1 448 ? 25.247 183.706 -22.976 1.00 190.58 ? 521 PHE A CA  1 
ATOM   3480 C  C   . PHE A 1 448 ? 25.837 184.923 -23.677 1.00 186.90 ? 521 PHE A C   1 
ATOM   3481 O  O   . PHE A 1 448 ? 25.550 186.070 -23.310 1.00 170.75 ? 521 PHE A O   1 
ATOM   3482 C  CB  . PHE A 1 448 ? 26.284 183.043 -22.068 1.00 168.54 ? 521 PHE A CB  1 
ATOM   3483 C  CG  . PHE A 1 448 ? 26.962 183.994 -21.122 1.00 177.24 ? 521 PHE A CG  1 
ATOM   3484 C  CD1 . PHE A 1 448 ? 26.318 184.429 -19.976 1.00 180.64 ? 521 PHE A CD1 1 
ATOM   3485 C  CD2 . PHE A 1 448 ? 28.248 184.444 -21.373 1.00 186.31 ? 521 PHE A CD2 1 
ATOM   3486 C  CE1 . PHE A 1 448 ? 26.941 185.302 -19.102 1.00 173.58 ? 521 PHE A CE1 1 
ATOM   3487 C  CE2 . PHE A 1 448 ? 28.876 185.316 -20.503 1.00 173.20 ? 521 PHE A CE2 1 
ATOM   3488 C  CZ  . PHE A 1 448 ? 28.222 185.745 -19.366 1.00 164.57 ? 521 PHE A CZ  1 
ATOM   3489 N  N   . CYS A 1 449 ? 26.664 184.689 -24.701 1.00 191.73 ? 522 CYS A N   1 
ATOM   3490 C  CA  . CYS A 1 449 ? 27.210 185.795 -25.480 1.00 210.48 ? 522 CYS A CA  1 
ATOM   3491 C  C   . CYS A 1 449 ? 26.114 186.554 -26.214 1.00 218.67 ? 522 CYS A C   1 
ATOM   3492 O  O   . CYS A 1 449 ? 26.271 187.746 -26.505 1.00 232.91 ? 522 CYS A O   1 
ATOM   3493 C  CB  . CYS A 1 449 ? 28.254 185.276 -26.469 1.00 224.93 ? 522 CYS A CB  1 
ATOM   3494 S  SG  . CYS A 1 449 ? 29.672 184.459 -25.698 1.00 187.23 ? 522 CYS A SG  1 
ATOM   3495 N  N   . ARG A 1 450 ? 25.001 185.885 -26.526 1.00 193.84 ? 523 ARG A N   1 
ATOM   3496 C  CA  . ARG A 1 450 ? 23.872 186.578 -27.136 1.00 195.89 ? 523 ARG A CA  1 
ATOM   3497 C  C   . ARG A 1 450 ? 23.160 187.462 -26.119 1.00 196.25 ? 523 ARG A C   1 
ATOM   3498 O  O   . ARG A 1 450 ? 22.702 188.560 -26.456 1.00 198.57 ? 523 ARG A O   1 
ATOM   3499 C  CB  . ARG A 1 450 ? 22.906 185.561 -27.751 1.00 195.13 ? 523 ARG A CB  1 
ATOM   3500 C  CG  . ARG A 1 450 ? 21.894 186.148 -28.729 1.00 201.80 ? 523 ARG A CG  1 
ATOM   3501 C  CD  . ARG A 1 450 ? 20.598 186.547 -28.038 1.00 214.12 ? 523 ARG A CD  1 
ATOM   3502 N  NE  . ARG A 1 450 ? 19.637 187.127 -28.971 1.00 239.03 ? 523 ARG A NE  1 
ATOM   3503 C  CZ  . ARG A 1 450 ? 18.432 187.568 -28.623 1.00 241.79 ? 523 ARG A CZ  1 
ATOM   3504 N  NH1 . ARG A 1 450 ? 18.038 187.498 -27.359 1.00 246.46 ? 523 ARG A NH1 1 
ATOM   3505 N  NH2 . ARG A 1 450 ? 17.622 188.081 -29.540 1.00 212.72 ? 523 ARG A NH2 1 
ATOM   3506 N  N   . ASP A 1 451 ? 23.057 187.000 -24.870 1.00 188.66 ? 524 ASP A N   1 
ATOM   3507 C  CA  . ASP A 1 451 ? 22.462 187.824 -23.823 1.00 183.13 ? 524 ASP A CA  1 
ATOM   3508 C  C   . ASP A 1 451 ? 23.328 189.041 -23.528 1.00 192.24 ? 524 ASP A C   1 
ATOM   3509 O  O   . ASP A 1 451 ? 22.812 190.155 -23.367 1.00 204.60 ? 524 ASP A O   1 
ATOM   3510 C  CB  . ASP A 1 451 ? 22.251 186.995 -22.557 1.00 163.44 ? 524 ASP A CB  1 
ATOM   3511 C  CG  . ASP A 1 451 ? 21.397 185.766 -22.800 1.00 166.58 ? 524 ASP A CG  1 
ATOM   3512 O  OD1 . ASP A 1 451 ? 20.517 185.815 -23.685 1.00 178.44 ? 524 ASP A OD1 1 
ATOM   3513 O  OD2 . ASP A 1 451 ? 21.609 184.749 -22.107 1.00 174.81 ? 524 ASP A OD2 1 
ATOM   3514 N  N   . VAL A 1 452 ? 24.647 188.847 -23.448 1.00 203.51 ? 525 VAL A N   1 
ATOM   3515 C  CA  . VAL A 1 452 ? 25.555 189.982 -23.318 1.00 209.59 ? 525 VAL A CA  1 
ATOM   3516 C  C   . VAL A 1 452 ? 25.435 190.897 -24.528 1.00 215.14 ? 525 VAL A C   1 
ATOM   3517 O  O   . VAL A 1 452 ? 25.542 192.124 -24.407 1.00 230.57 ? 525 VAL A O   1 
ATOM   3518 C  CB  . VAL A 1 452 ? 27.002 189.488 -23.118 1.00 202.76 ? 525 VAL A CB  1 
ATOM   3519 C  CG1 . VAL A 1 452 ? 27.958 190.663 -22.990 1.00 201.30 ? 525 VAL A CG1 1 
ATOM   3520 C  CG2 . VAL A 1 452 ? 27.091 188.589 -21.895 1.00 194.95 ? 525 VAL A CG2 1 
ATOM   3521 N  N   . LYS A 1 453 ? 25.198 190.321 -25.710 1.00 167.56 ? 526 LYS A N   1 
ATOM   3522 C  CA  . LYS A 1 453 ? 24.961 191.135 -26.898 1.00 160.57 ? 526 LYS A CA  1 
ATOM   3523 C  C   . LYS A 1 453 ? 23.667 191.930 -26.779 1.00 184.22 ? 526 LYS A C   1 
ATOM   3524 O  O   . LYS A 1 453 ? 23.540 193.000 -27.384 1.00 165.21 ? 526 LYS A O   1 
ATOM   3525 C  CB  . LYS A 1 453 ? 24.936 190.245 -28.142 1.00 162.11 ? 526 LYS A CB  1 
ATOM   3526 C  CG  . LYS A 1 453 ? 24.830 190.997 -29.461 1.00 202.33 ? 526 LYS A CG  1 
ATOM   3527 C  CD  . LYS A 1 453 ? 24.857 190.041 -30.645 1.00 218.94 ? 526 LYS A CD  1 
ATOM   3528 C  CE  . LYS A 1 453 ? 23.717 189.037 -30.574 1.00 230.31 ? 526 LYS A CE  1 
ATOM   3529 N  NZ  . LYS A 1 453 ? 23.743 188.082 -31.717 1.00 217.16 ? 526 LYS A NZ  1 
ATOM   3530 N  N   . GLU A 1 454 ? 22.700 191.430 -26.007 1.00 209.54 ? 527 GLU A N   1 
ATOM   3531 C  CA  . GLU A 1 454 ? 21.459 192.168 -25.795 1.00 198.52 ? 527 GLU A CA  1 
ATOM   3532 C  C   . GLU A 1 454 ? 21.649 193.300 -24.791 1.00 192.45 ? 527 GLU A C   1 
ATOM   3533 O  O   . GLU A 1 454 ? 21.212 194.431 -25.031 1.00 206.92 ? 527 GLU A O   1 
ATOM   3534 C  CB  . GLU A 1 454 ? 20.355 191.216 -25.331 1.00 185.56 ? 527 GLU A CB  1 
ATOM   3535 C  CG  . GLU A 1 454 ? 19.088 191.907 -24.842 1.00 194.91 ? 527 GLU A CG  1 
ATOM   3536 C  CD  . GLU A 1 454 ? 18.543 192.913 -25.838 1.00 231.65 ? 527 GLU A CD  1 
ATOM   3537 O  OE1 . GLU A 1 454 ? 18.400 194.099 -25.471 1.00 225.32 ? 527 GLU A OE1 1 
ATOM   3538 O  OE2 . GLU A 1 454 ? 18.264 192.520 -26.990 1.00 246.61 ? 527 GLU A OE2 1 
ATOM   3539 N  N   . MET A 1 455 ? 22.301 193.015 -23.661 1.00 181.67 ? 528 MET A N   1 
ATOM   3540 C  CA  . MET A 1 455 ? 22.462 194.034 -22.627 1.00 185.66 ? 528 MET A CA  1 
ATOM   3541 C  C   . MET A 1 455 ? 23.443 195.118 -23.059 1.00 174.25 ? 528 MET A C   1 
ATOM   3542 O  O   . MET A 1 455 ? 23.127 196.312 -23.007 1.00 174.09 ? 528 MET A O   1 
ATOM   3543 C  CB  . MET A 1 455 ? 22.918 193.389 -21.318 1.00 190.61 ? 528 MET A CB  1 
ATOM   3544 C  CG  . MET A 1 455 ? 21.851 192.557 -20.626 1.00 205.50 ? 528 MET A CG  1 
ATOM   3545 S  SD  . MET A 1 455 ? 22.402 191.917 -19.033 1.00 208.17 ? 528 MET A SD  1 
ATOM   3546 C  CE  . MET A 1 455 ? 22.830 193.435 -18.186 1.00 158.66 ? 528 MET A CE  1 
ATOM   3547 N  N   . LEU A 1 456 ? 24.641 194.722 -23.488 1.00 177.80 ? 529 LEU A N   1 
ATOM   3548 C  CA  . LEU A 1 456 ? 25.684 195.678 -23.835 1.00 193.27 ? 529 LEU A CA  1 
ATOM   3549 C  C   . LEU A 1 456 ? 25.587 196.184 -25.268 1.00 200.86 ? 529 LEU A C   1 
ATOM   3550 O  O   . LEU A 1 456 ? 26.275 197.151 -25.613 1.00 187.17 ? 529 LEU A O   1 
ATOM   3551 C  CB  . LEU A 1 456 ? 27.070 195.059 -23.611 1.00 184.98 ? 529 LEU A CB  1 
ATOM   3552 C  CG  . LEU A 1 456 ? 27.661 195.073 -22.196 1.00 158.58 ? 529 LEU A CG  1 
ATOM   3553 C  CD1 . LEU A 1 456 ? 26.899 194.156 -21.248 1.00 152.10 ? 529 LEU A CD1 1 
ATOM   3554 C  CD2 . LEU A 1 456 ? 29.136 194.699 -22.234 1.00 164.19 ? 529 LEU A CD2 1 
ATOM   3555 N  N   . GLY A 1 457 ? 24.755 195.567 -26.106 1.00 226.20 ? 530 GLY A N   1 
ATOM   3556 C  CA  . GLY A 1 457 ? 24.650 195.944 -27.497 1.00 241.22 ? 530 GLY A CA  1 
ATOM   3557 C  C   . GLY A 1 457 ? 25.650 195.277 -28.416 1.00 229.09 ? 530 GLY A C   1 
ATOM   3558 O  O   . GLY A 1 457 ? 25.521 195.403 -29.640 1.00 265.89 ? 530 GLY A O   1 
ATOM   3559 N  N   . PHE A 1 458 ? 26.638 194.572 -27.869 1.00 192.79 ? 531 PHE A N   1 
ATOM   3560 C  CA  . PHE A 1 458 ? 27.646 193.889 -28.663 1.00 192.26 ? 531 PHE A CA  1 
ATOM   3561 C  C   . PHE A 1 458 ? 28.030 192.585 -27.982 1.00 200.28 ? 531 PHE A C   1 
ATOM   3562 O  O   . PHE A 1 458 ? 28.034 192.486 -26.751 1.00 178.06 ? 531 PHE A O   1 
ATOM   3563 C  CB  . PHE A 1 458 ? 28.893 194.762 -28.870 1.00 193.05 ? 531 PHE A CB  1 
ATOM   3564 C  CG  . PHE A 1 458 ? 29.544 195.211 -27.589 1.00 196.36 ? 531 PHE A CG  1 
ATOM   3565 C  CD1 . PHE A 1 458 ? 29.120 196.365 -26.950 1.00 200.87 ? 531 PHE A CD1 1 
ATOM   3566 C  CD2 . PHE A 1 458 ? 30.585 194.486 -27.029 1.00 178.75 ? 531 PHE A CD2 1 
ATOM   3567 C  CE1 . PHE A 1 458 ? 29.716 196.785 -25.776 1.00 204.08 ? 531 PHE A CE1 1 
ATOM   3568 C  CE2 . PHE A 1 458 ? 31.185 194.901 -25.854 1.00 191.94 ? 531 PHE A CE2 1 
ATOM   3569 C  CZ  . PHE A 1 458 ? 30.750 196.053 -25.227 1.00 201.57 ? 531 PHE A CZ  1 
ATOM   3570 N  N   . SER A 1 459 ? 28.354 191.587 -28.798 1.00 213.84 ? 532 SER A N   1 
ATOM   3571 C  CA  . SER A 1 459 ? 28.751 190.293 -28.275 1.00 212.21 ? 532 SER A CA  1 
ATOM   3572 C  C   . SER A 1 459 ? 30.139 190.374 -27.641 1.00 204.22 ? 532 SER A C   1 
ATOM   3573 O  O   . SER A 1 459 ? 31.007 191.112 -28.114 1.00 193.79 ? 532 SER A O   1 
ATOM   3574 C  CB  . SER A 1 459 ? 28.745 189.245 -29.384 1.00 223.28 ? 532 SER A CB  1 
ATOM   3575 O  OG  . SER A 1 459 ? 29.074 187.960 -28.882 1.00 223.48 ? 532 SER A OG  1 
ATOM   3576 N  N   . PRO A 1 460 ? 30.370 189.628 -26.564 1.00 212.98 ? 533 PRO A N   1 
ATOM   3577 C  CA  . PRO A 1 460 ? 31.696 189.627 -25.941 1.00 196.65 ? 533 PRO A CA  1 
ATOM   3578 C  C   . PRO A 1 460 ? 32.743 189.020 -26.860 1.00 193.90 ? 533 PRO A C   1 
ATOM   3579 O  O   . PRO A 1 460 ? 32.449 188.170 -27.705 1.00 201.64 ? 533 PRO A O   1 
ATOM   3580 C  CB  . PRO A 1 460 ? 31.497 188.776 -24.682 1.00 183.69 ? 533 PRO A CB  1 
ATOM   3581 C  CG  . PRO A 1 460 ? 30.311 187.921 -24.984 1.00 165.01 ? 533 PRO A CG  1 
ATOM   3582 C  CD  . PRO A 1 460 ? 29.418 188.766 -25.845 1.00 191.05 ? 533 PRO A CD  1 
ATOM   3583 N  N   . GLY A 1 461 ? 33.984 189.462 -26.678 1.00 191.91 ? 534 GLY A N   1 
ATOM   3584 C  CA  . GLY A 1 461 ? 35.063 189.048 -27.549 1.00 206.60 ? 534 GLY A CA  1 
ATOM   3585 C  C   . GLY A 1 461 ? 35.393 187.572 -27.427 1.00 195.41 ? 534 GLY A C   1 
ATOM   3586 O  O   . GLY A 1 461 ? 34.955 186.865 -26.519 1.00 210.58 ? 534 GLY A O   1 
ATOM   3587 N  N   . TRP A 1 462 ? 36.191 187.102 -28.390 1.00 187.74 ? 535 TRP A N   1 
ATOM   3588 C  CA  . TRP A 1 462 ? 36.629 185.710 -28.386 1.00 185.97 ? 535 TRP A CA  1 
ATOM   3589 C  C   . TRP A 1 462 ? 37.522 185.406 -27.191 1.00 196.82 ? 535 TRP A C   1 
ATOM   3590 O  O   . TRP A 1 462 ? 37.566 184.259 -26.729 1.00 178.01 ? 535 TRP A O   1 
ATOM   3591 C  CB  . TRP A 1 462 ? 37.360 185.390 -29.689 1.00 195.12 ? 535 TRP A CB  1 
ATOM   3592 C  CG  . TRP A 1 462 ? 38.429 186.386 -30.030 1.00 225.97 ? 535 TRP A CG  1 
ATOM   3593 C  CD1 . TRP A 1 462 ? 38.280 187.532 -30.756 1.00 235.87 ? 535 TRP A CD1 1 
ATOM   3594 C  CD2 . TRP A 1 462 ? 39.811 186.327 -29.655 1.00 234.82 ? 535 TRP A CD2 1 
ATOM   3595 N  NE1 . TRP A 1 462 ? 39.482 188.189 -30.858 1.00 243.18 ? 535 TRP A NE1 1 
ATOM   3596 C  CE2 . TRP A 1 462 ? 40.439 187.470 -30.191 1.00 241.40 ? 535 TRP A CE2 1 
ATOM   3597 C  CE3 . TRP A 1 462 ? 40.579 185.418 -28.920 1.00 210.96 ? 535 TRP A CE3 1 
ATOM   3598 C  CZ2 . TRP A 1 462 ? 41.797 187.728 -30.014 1.00 225.40 ? 535 TRP A CZ2 1 
ATOM   3599 C  CZ3 . TRP A 1 462 ? 41.927 185.677 -28.746 1.00 195.41 ? 535 TRP A CZ3 1 
ATOM   3600 C  CH2 . TRP A 1 462 ? 42.522 186.821 -29.291 1.00 198.01 ? 535 TRP A CH2 1 
ATOM   3601 N  N   . PHE A 1 463 ? 38.234 186.414 -26.679 1.00 197.16 ? 536 PHE A N   1 
ATOM   3602 C  CA  . PHE A 1 463 ? 39.101 186.205 -25.524 1.00 183.96 ? 536 PHE A CA  1 
ATOM   3603 C  C   . PHE A 1 463 ? 38.300 185.778 -24.300 1.00 155.79 ? 536 PHE A C   1 
ATOM   3604 O  O   . PHE A 1 463 ? 38.738 184.912 -23.534 1.00 149.40 ? 536 PHE A O   1 
ATOM   3605 C  CB  . PHE A 1 463 ? 39.894 187.479 -25.233 1.00 195.79 ? 536 PHE A CB  1 
ATOM   3606 C  CG  . PHE A 1 463 ? 40.391 187.577 -23.819 1.00 184.42 ? 536 PHE A CG  1 
ATOM   3607 C  CD1 . PHE A 1 463 ? 41.482 186.835 -23.400 1.00 160.11 ? 536 PHE A CD1 1 
ATOM   3608 C  CD2 . PHE A 1 463 ? 39.771 188.421 -22.912 1.00 180.61 ? 536 PHE A CD2 1 
ATOM   3609 C  CE1 . PHE A 1 463 ? 41.941 186.927 -22.101 1.00 164.26 ? 536 PHE A CE1 1 
ATOM   3610 C  CE2 . PHE A 1 463 ? 40.226 188.517 -21.611 1.00 162.36 ? 536 PHE A CE2 1 
ATOM   3611 C  CZ  . PHE A 1 463 ? 41.311 187.770 -21.206 1.00 162.47 ? 536 PHE A CZ  1 
ATOM   3612 N  N   . TRP A 1 464 ? 37.125 186.373 -24.098 1.00 176.83 ? 537 TRP A N   1 
ATOM   3613 C  CA  . TRP A 1 464 ? 36.289 185.998 -22.963 1.00 152.61 ? 537 TRP A CA  1 
ATOM   3614 C  C   . TRP A 1 464 ? 35.539 184.699 -23.228 1.00 146.57 ? 537 TRP A C   1 
ATOM   3615 O  O   . TRP A 1 464 ? 35.391 183.868 -22.322 1.00 149.76 ? 537 TRP A O   1 
ATOM   3616 C  CB  . TRP A 1 464 ? 35.306 187.123 -22.643 1.00 148.05 ? 537 TRP A CB  1 
ATOM   3617 C  CG  . TRP A 1 464 ? 35.970 188.429 -22.367 1.00 149.89 ? 537 TRP A CG  1 
ATOM   3618 C  CD1 . TRP A 1 464 ? 36.133 189.466 -23.237 1.00 199.82 ? 537 TRP A CD1 1 
ATOM   3619 C  CD2 . TRP A 1 464 ? 36.570 188.840 -21.135 1.00 150.96 ? 537 TRP A CD2 1 
ATOM   3620 N  NE1 . TRP A 1 464 ? 36.796 190.500 -22.622 1.00 222.59 ? 537 TRP A NE1 1 
ATOM   3621 C  CE2 . TRP A 1 464 ? 37.076 190.140 -21.330 1.00 192.60 ? 537 TRP A CE2 1 
ATOM   3622 C  CE3 . TRP A 1 464 ? 36.728 188.236 -19.884 1.00 170.62 ? 537 TRP A CE3 1 
ATOM   3623 C  CZ2 . TRP A 1 464 ? 37.728 190.846 -20.323 1.00 196.13 ? 537 TRP A CZ2 1 
ATOM   3624 C  CZ3 . TRP A 1 464 ? 37.375 188.938 -18.887 1.00 178.81 ? 537 TRP A CZ3 1 
ATOM   3625 C  CH2 . TRP A 1 464 ? 37.867 190.229 -19.111 1.00 195.40 ? 537 TRP A CH2 1 
ATOM   3626 N  N   . ARG A 1 465 ? 35.060 184.511 -24.459 1.00 161.60 ? 538 ARG A N   1 
ATOM   3627 C  CA  . ARG A 1 465 ? 34.338 183.290 -24.802 1.00 170.73 ? 538 ARG A CA  1 
ATOM   3628 C  C   . ARG A 1 465 ? 35.220 182.063 -24.610 1.00 141.37 ? 538 ARG A C   1 
ATOM   3629 O  O   . ARG A 1 465 ? 34.800 181.071 -24.003 1.00 146.00 ? 538 ARG A O   1 
ATOM   3630 C  CB  . ARG A 1 465 ? 33.826 183.371 -26.240 1.00 208.91 ? 538 ARG A CB  1 
ATOM   3631 N  N   . ILE A 1 466 ? 36.457 182.117 -25.111 1.00 131.53 ? 539 ILE A N   1 
ATOM   3632 C  CA  . ILE A 1 466 ? 37.365 180.989 -24.948 1.00 149.18 ? 539 ILE A CA  1 
ATOM   3633 C  C   . ILE A 1 466 ? 37.740 180.786 -23.485 1.00 162.36 ? 539 ILE A C   1 
ATOM   3634 O  O   . ILE A 1 466 ? 38.130 179.680 -23.095 1.00 149.44 ? 539 ILE A O   1 
ATOM   3635 C  CB  . ILE A 1 466 ? 38.618 181.175 -25.827 1.00 131.65 ? 539 ILE A CB  1 
ATOM   3636 C  CG1 . ILE A 1 466 ? 39.336 179.838 -26.023 1.00 139.69 ? 539 ILE A CG1 1 
ATOM   3637 C  CG2 . ILE A 1 466 ? 39.562 182.200 -25.218 1.00 160.13 ? 539 ILE A CG2 1 
ATOM   3638 C  CD1 . ILE A 1 466 ? 40.524 179.912 -26.955 1.00 169.40 ? 539 ILE A CD1 1 
ATOM   3639 N  N   . CYS A 1 467 ? 37.619 181.827 -22.658 1.00 167.94 ? 540 CYS A N   1 
ATOM   3640 C  CA  . CYS A 1 467 ? 37.852 181.671 -21.227 1.00 147.23 ? 540 CYS A CA  1 
ATOM   3641 C  C   . CYS A 1 467 ? 36.691 180.956 -20.549 1.00 143.25 ? 540 CYS A C   1 
ATOM   3642 O  O   . CYS A 1 467 ? 36.907 180.085 -19.699 1.00 181.46 ? 540 CYS A O   1 
ATOM   3643 C  CB  . CYS A 1 467 ? 38.090 183.034 -20.576 1.00 153.30 ? 540 CYS A CB  1 
ATOM   3644 S  SG  . CYS A 1 467 ? 39.750 183.713 -20.813 1.00 135.83 ? 540 CYS A SG  1 
ATOM   3645 N  N   . TRP A 1 468 ? 35.453 181.310 -20.908 1.00 146.68 ? 541 TRP A N   1 
ATOM   3646 C  CA  . TRP A 1 468 ? 34.304 180.651 -20.296 1.00 148.78 ? 541 TRP A CA  1 
ATOM   3647 C  C   . TRP A 1 468 ? 34.153 179.214 -20.779 1.00 154.27 ? 541 TRP A C   1 
ATOM   3648 O  O   . TRP A 1 468 ? 33.721 178.347 -20.011 1.00 150.52 ? 541 TRP A O   1 
ATOM   3649 C  CB  . TRP A 1 468 ? 33.024 181.434 -20.581 1.00 149.03 ? 541 TRP A CB  1 
ATOM   3650 C  CG  . TRP A 1 468 ? 33.072 182.865 -20.153 1.00 148.67 ? 541 TRP A CG  1 
ATOM   3651 C  CD1 . TRP A 1 468 ? 33.519 183.350 -18.959 1.00 150.38 ? 541 TRP A CD1 1 
ATOM   3652 C  CD2 . TRP A 1 468 ? 32.636 184.001 -20.909 1.00 169.58 ? 541 TRP A CD2 1 
ATOM   3653 N  NE1 . TRP A 1 468 ? 33.399 184.719 -18.929 1.00 166.25 ? 541 TRP A NE1 1 
ATOM   3654 C  CE2 . TRP A 1 468 ? 32.859 185.142 -20.115 1.00 164.73 ? 541 TRP A CE2 1 
ATOM   3655 C  CE3 . TRP A 1 468 ? 32.085 184.164 -22.183 1.00 195.82 ? 541 TRP A CE3 1 
ATOM   3656 C  CZ2 . TRP A 1 468 ? 32.548 186.426 -20.552 1.00 148.38 ? 541 TRP A CZ2 1 
ATOM   3657 C  CZ3 . TRP A 1 468 ? 31.777 185.439 -22.615 1.00 210.67 ? 541 TRP A CZ3 1 
ATOM   3658 C  CH2 . TRP A 1 468 ? 32.008 186.554 -21.802 1.00 180.80 ? 541 TRP A CH2 1 
ATOM   3659 N  N   . VAL A 1 469 ? 34.501 178.942 -22.039 1.00 170.28 ? 542 VAL A N   1 
ATOM   3660 C  CA  . VAL A 1 469 ? 34.335 177.598 -22.586 1.00 166.58 ? 542 VAL A CA  1 
ATOM   3661 C  C   . VAL A 1 469 ? 35.304 176.626 -21.924 1.00 169.62 ? 542 VAL A C   1 
ATOM   3662 O  O   . VAL A 1 469 ? 34.928 175.513 -21.537 1.00 168.10 ? 542 VAL A O   1 
ATOM   3663 C  CB  . VAL A 1 469 ? 34.517 177.614 -24.114 1.00 159.39 ? 542 VAL A CB  1 
ATOM   3664 C  CG1 . VAL A 1 469 ? 34.593 176.195 -24.657 1.00 174.87 ? 542 VAL A CG1 1 
ATOM   3665 C  CG2 . VAL A 1 469 ? 33.385 178.372 -24.775 1.00 164.20 ? 542 VAL A CG2 1 
ATOM   3666 N  N   . ALA A 1 470 ? 36.564 177.033 -21.782 1.00 166.70 ? 543 ALA A N   1 
ATOM   3667 C  CA  . ALA A 1 470 ? 37.634 176.133 -21.367 1.00 184.52 ? 543 ALA A CA  1 
ATOM   3668 C  C   . ALA A 1 470 ? 38.358 176.624 -20.121 1.00 188.80 ? 543 ALA A C   1 
ATOM   3669 O  O   . ALA A 1 470 ? 38.392 175.910 -19.114 1.00 184.20 ? 543 ALA A O   1 
ATOM   3670 C  CB  . ALA A 1 470 ? 38.624 175.933 -22.522 1.00 208.59 ? 543 ALA A CB  1 
ATOM   3671 N  N   . ILE A 1 471 ? 38.963 177.814 -20.176 1.00 181.96 ? 544 ILE A N   1 
ATOM   3672 C  CA  . ILE A 1 471 ? 39.958 178.220 -19.185 1.00 141.00 ? 544 ILE A CA  1 
ATOM   3673 C  C   . ILE A 1 471 ? 39.378 178.219 -17.773 1.00 126.35 ? 544 ILE A C   1 
ATOM   3674 O  O   . ILE A 1 471 ? 40.024 177.755 -16.828 1.00 156.72 ? 544 ILE A O   1 
ATOM   3675 C  CB  . ILE A 1 471 ? 40.537 179.597 -19.553 1.00 125.23 ? 544 ILE A CB  1 
ATOM   3676 C  CG1 . ILE A 1 471 ? 40.974 179.617 -21.019 1.00 139.37 ? 544 ILE A CG1 1 
ATOM   3677 C  CG2 . ILE A 1 471 ? 41.705 179.933 -18.649 1.00 124.30 ? 544 ILE A CG2 1 
ATOM   3678 C  CD1 . ILE A 1 471 ? 42.032 178.588 -21.356 1.00 162.27 ? 544 ILE A CD1 1 
ATOM   3679 N  N   . SER A 1 472 ? 38.165 178.759 -17.598 1.00 151.92 ? 545 SER A N   1 
ATOM   3680 C  CA  . SER A 1 472 ? 37.626 178.904 -16.244 1.00 144.32 ? 545 SER A CA  1 
ATOM   3681 C  C   . SER A 1 472 ? 37.280 177.567 -15.593 1.00 143.77 ? 545 SER A C   1 
ATOM   3682 O  O   . SER A 1 472 ? 37.715 177.332 -14.448 1.00 190.83 ? 545 SER A O   1 
ATOM   3683 C  CB  . SER A 1 472 ? 36.427 179.859 -16.262 1.00 148.03 ? 545 SER A CB  1 
ATOM   3684 O  OG  . SER A 1 472 ? 36.805 181.142 -16.730 1.00 156.38 ? 545 SER A OG  1 
ATOM   3685 N  N   . PRO A 1 473 ? 36.510 176.665 -16.222 1.00 114.65 ? 546 PRO A N   1 
ATOM   3686 C  CA  . PRO A 1 473 ? 36.200 175.393 -15.542 1.00 139.93 ? 546 PRO A CA  1 
ATOM   3687 C  C   . PRO A 1 473 ? 37.433 174.580 -15.188 1.00 142.39 ? 546 PRO A C   1 
ATOM   3688 O  O   . PRO A 1 473 ? 37.490 173.991 -14.101 1.00 135.40 ? 546 PRO A O   1 
ATOM   3689 C  CB  . PRO A 1 473 ? 35.307 174.665 -16.556 1.00 159.97 ? 546 PRO A CB  1 
ATOM   3690 C  CG  . PRO A 1 473 ? 34.705 175.749 -17.369 1.00 156.43 ? 546 PRO A CG  1 
ATOM   3691 C  CD  . PRO A 1 473 ? 35.783 176.778 -17.501 1.00 116.41 ? 546 PRO A CD  1 
ATOM   3692 N  N   . LEU A 1 474 ? 38.426 174.526 -16.078 1.00 144.95 ? 547 LEU A N   1 
ATOM   3693 C  CA  . LEU A 1 474 ? 39.685 173.878 -15.730 1.00 145.54 ? 547 LEU A CA  1 
ATOM   3694 C  C   . LEU A 1 474 ? 40.438 174.665 -14.666 1.00 148.47 ? 547 LEU A C   1 
ATOM   3695 O  O   . LEU A 1 474 ? 41.231 174.089 -13.913 1.00 190.89 ? 547 LEU A O   1 
ATOM   3696 C  CB  . LEU A 1 474 ? 40.550 173.705 -16.978 1.00 175.22 ? 547 LEU A CB  1 
ATOM   3697 C  CG  . LEU A 1 474 ? 39.995 172.779 -18.061 1.00 184.87 ? 547 LEU A CG  1 
ATOM   3698 C  CD1 . LEU A 1 474 ? 40.855 172.847 -19.312 1.00 195.47 ? 547 LEU A CD1 1 
ATOM   3699 C  CD2 . LEU A 1 474 ? 39.906 171.351 -17.547 1.00 170.26 ? 547 LEU A CD2 1 
ATOM   3700 N  N   . PHE A 1 475 ? 40.202 175.976 -14.593 1.00 127.57 ? 548 PHE A N   1 
ATOM   3701 C  CA  . PHE A 1 475 ? 40.855 176.806 -13.586 1.00 130.80 ? 548 PHE A CA  1 
ATOM   3702 C  C   . PHE A 1 475 ? 40.363 176.459 -12.188 1.00 132.69 ? 548 PHE A C   1 
ATOM   3703 O  O   . PHE A 1 475 ? 41.157 176.397 -11.242 1.00 132.68 ? 548 PHE A O   1 
ATOM   3704 C  CB  . PHE A 1 475 ? 40.618 178.284 -13.904 1.00 134.23 ? 548 PHE A CB  1 
ATOM   3705 C  CG  . PHE A 1 475 ? 40.916 179.215 -12.762 1.00 126.43 ? 548 PHE A CG  1 
ATOM   3706 C  CD1 . PHE A 1 475 ? 42.209 179.649 -12.524 1.00 141.87 ? 548 PHE A CD1 1 
ATOM   3707 C  CD2 . PHE A 1 475 ? 39.897 179.678 -11.942 1.00 115.12 ? 548 PHE A CD2 1 
ATOM   3708 C  CE1 . PHE A 1 475 ? 42.482 180.514 -11.482 1.00 147.79 ? 548 PHE A CE1 1 
ATOM   3709 C  CE2 . PHE A 1 475 ? 40.166 180.540 -10.897 1.00 115.19 ? 548 PHE A CE2 1 
ATOM   3710 C  CZ  . PHE A 1 475 ? 41.460 180.959 -10.667 1.00 142.60 ? 548 PHE A CZ  1 
ATOM   3711 N  N   . LEU A 1 476 ? 39.056 176.230 -12.033 1.00 121.67 ? 549 LEU A N   1 
ATOM   3712 C  CA  . LEU A 1 476 ? 38.552 175.764 -10.744 1.00 116.93 ? 549 LEU A CA  1 
ATOM   3713 C  C   . LEU A 1 476 ? 38.888 174.294 -10.521 1.00 116.92 ? 549 LEU A C   1 
ATOM   3714 O  O   . LEU A 1 476 ? 39.196 173.879 -9.394  1.00 131.91 ? 549 LEU A O   1 
ATOM   3715 C  CB  . LEU A 1 476 ? 37.044 175.987 -10.659 1.00 117.15 ? 549 LEU A CB  1 
ATOM   3716 C  CG  . LEU A 1 476 ? 36.592 177.442 -10.775 1.00 122.82 ? 549 LEU A CG  1 
ATOM   3717 C  CD1 . LEU A 1 476 ? 35.083 177.548 -10.640 1.00 147.44 ? 549 LEU A CD1 1 
ATOM   3718 C  CD2 . LEU A 1 476 ? 37.291 178.286 -9.727  1.00 102.19 ? 549 LEU A CD2 1 
ATOM   3719 N  N   . LEU A 1 477 ? 38.838 173.497 -11.590 1.00 134.64 ? 550 LEU A N   1 
ATOM   3720 C  CA  . LEU A 1 477 ? 39.106 172.067 -11.482 1.00 147.48 ? 550 LEU A CA  1 
ATOM   3721 C  C   . LEU A 1 477 ? 40.525 171.804 -10.994 1.00 138.76 ? 550 LEU A C   1 
ATOM   3722 O  O   . LEU A 1 477 ? 40.765 170.851 -10.242 1.00 112.84 ? 550 LEU A O   1 
ATOM   3723 C  CB  . LEU A 1 477 ? 38.871 171.402 -12.837 1.00 126.15 ? 550 LEU A CB  1 
ATOM   3724 C  CG  . LEU A 1 477 ? 38.851 169.877 -12.901 1.00 115.69 ? 550 LEU A CG  1 
ATOM   3725 C  CD1 . LEU A 1 477 ? 37.442 169.352 -12.677 1.00 120.57 ? 550 LEU A CD1 1 
ATOM   3726 C  CD2 . LEU A 1 477 ? 39.400 169.416 -14.235 1.00 122.08 ? 550 LEU A CD2 1 
ATOM   3727 N  N   . PHE A 1 478 ? 41.480 172.637 -11.415 1.00 128.86 ? 551 PHE A N   1 
ATOM   3728 C  CA  . PHE A 1 478 ? 42.858 172.480 -10.962 1.00 131.50 ? 551 PHE A CA  1 
ATOM   3729 C  C   . PHE A 1 478 ? 42.966 172.690 -9.457  1.00 131.95 ? 551 PHE A C   1 
ATOM   3730 O  O   . PHE A 1 478 ? 43.691 171.961 -8.768  1.00 166.01 ? 551 PHE A O   1 
ATOM   3731 C  CB  . PHE A 1 478 ? 43.763 173.460 -11.710 1.00 135.01 ? 551 PHE A CB  1 
ATOM   3732 C  CG  . PHE A 1 478 ? 45.210 173.056 -11.739 1.00 163.85 ? 551 PHE A CG  1 
ATOM   3733 C  CD1 . PHE A 1 478 ? 45.608 171.803 -11.301 1.00 161.59 ? 551 PHE A CD1 1 
ATOM   3734 C  CD2 . PHE A 1 478 ? 46.175 173.935 -12.204 1.00 173.00 ? 551 PHE A CD2 1 
ATOM   3735 C  CE1 . PHE A 1 478 ? 46.939 171.434 -11.330 1.00 172.51 ? 551 PHE A CE1 1 
ATOM   3736 C  CE2 . PHE A 1 478 ? 47.508 173.573 -12.235 1.00 190.61 ? 551 PHE A CE2 1 
ATOM   3737 C  CZ  . PHE A 1 478 ? 47.890 172.320 -11.797 1.00 208.75 ? 551 PHE A CZ  1 
ATOM   3738 N  N   . ILE A 1 479 ? 42.244 173.679 -8.928  1.00 122.80 ? 552 ILE A N   1 
ATOM   3739 C  CA  . ILE A 1 479 ? 42.307 173.967 -7.499  1.00 125.64 ? 552 ILE A CA  1 
ATOM   3740 C  C   . ILE A 1 479 ? 41.633 172.856 -6.702  1.00 149.25 ? 552 ILE A C   1 
ATOM   3741 O  O   . ILE A 1 479 ? 42.183 172.363 -5.708  1.00 127.66 ? 552 ILE A O   1 
ATOM   3742 C  CB  . ILE A 1 479 ? 41.674 175.337 -7.201  1.00 104.26 ? 552 ILE A CB  1 
ATOM   3743 C  CG1 . ILE A 1 479 ? 42.266 176.410 -8.115  1.00 108.27 ? 552 ILE A CG1 1 
ATOM   3744 C  CG2 . ILE A 1 479 ? 41.887 175.715 -5.747  1.00 104.94 ? 552 ILE A CG2 1 
ATOM   3745 C  CD1 . ILE A 1 479 ? 41.590 177.754 -7.982  1.00 110.25 ? 552 ILE A CD1 1 
ATOM   3746 N  N   . ILE A 1 480 ? 40.433 172.445 -7.124  1.00 169.46 ? 553 ILE A N   1 
ATOM   3747 C  CA  . ILE A 1 480 ? 39.719 171.386 -6.411  1.00 143.92 ? 553 ILE A CA  1 
ATOM   3748 C  C   . ILE A 1 480 ? 40.532 170.097 -6.417  1.00 124.59 ? 553 ILE A C   1 
ATOM   3749 O  O   . ILE A 1 480 ? 40.695 169.438 -5.381  1.00 104.81 ? 553 ILE A O   1 
ATOM   3750 C  CB  . ILE A 1 480 ? 38.320 171.175 -7.018  1.00 135.53 ? 553 ILE A CB  1 
ATOM   3751 C  CG1 . ILE A 1 480 ? 37.328 172.170 -6.419  1.00 105.27 ? 553 ILE A CG1 1 
ATOM   3752 C  CG2 . ILE A 1 480 ? 37.830 169.759 -6.760  1.00 132.83 ? 553 ILE A CG2 1 
ATOM   3753 C  CD1 . ILE A 1 480 ? 36.974 171.860 -4.982  1.00 125.52 ? 553 ILE A CD1 1 
ATOM   3754 N  N   . ALA A 1 481 ? 41.063 169.723 -7.584  1.00 121.77 ? 554 ALA A N   1 
ATOM   3755 C  CA  . ALA A 1 481 ? 41.871 168.511 -7.675  1.00 97.12  ? 554 ALA A CA  1 
ATOM   3756 C  C   . ALA A 1 481 ? 43.131 168.623 -6.829  1.00 104.74 ? 554 ALA A C   1 
ATOM   3757 O  O   . ALA A 1 481 ? 43.552 167.647 -6.195  1.00 123.74 ? 554 ALA A O   1 
ATOM   3758 C  CB  . ALA A 1 481 ? 42.232 168.230 -9.132  1.00 99.23  ? 554 ALA A CB  1 
ATOM   3759 N  N   . SER A 1 482 ? 43.748 169.807 -6.806  1.00 106.03 ? 555 SER A N   1 
ATOM   3760 C  CA  . SER A 1 482 ? 44.959 169.991 -6.015  1.00 125.46 ? 555 SER A CA  1 
ATOM   3761 C  C   . SER A 1 482 ? 44.676 169.835 -4.526  1.00 137.85 ? 555 SER A C   1 
ATOM   3762 O  O   . SER A 1 482 ? 45.465 169.220 -3.798  1.00 106.72 ? 555 SER A O   1 
ATOM   3763 C  CB  . SER A 1 482 ? 45.569 171.359 -6.306  1.00 110.32 ? 555 SER A CB  1 
ATOM   3764 O  OG  . SER A 1 482 ? 46.693 171.600 -5.477  1.00 168.71 ? 555 SER A OG  1 
ATOM   3765 N  N   . PHE A 1 483 ? 43.553 170.383 -4.054  1.00 123.75 ? 556 PHE A N   1 
ATOM   3766 C  CA  . PHE A 1 483 ? 43.209 170.248 -2.642  1.00 102.95 ? 556 PHE A CA  1 
ATOM   3767 C  C   . PHE A 1 483 ? 42.860 168.807 -2.294  1.00 107.26 ? 556 PHE A C   1 
ATOM   3768 O  O   . PHE A 1 483 ? 43.373 168.253 -1.315  1.00 107.46 ? 556 PHE A O   1 
ATOM   3769 C  CB  . PHE A 1 483 ? 42.050 171.178 -2.285  1.00 111.66 ? 556 PHE A CB  1 
ATOM   3770 C  CG  . PHE A 1 483 ? 41.506 170.958 -0.901  1.00 125.76 ? 556 PHE A CG  1 
ATOM   3771 C  CD1 . PHE A 1 483 ? 42.162 171.473 0.204   1.00 128.21 ? 556 PHE A CD1 1 
ATOM   3772 C  CD2 . PHE A 1 483 ? 40.342 170.231 -0.704  1.00 113.59 ? 556 PHE A CD2 1 
ATOM   3773 C  CE1 . PHE A 1 483 ? 41.669 171.270 1.479   1.00 151.65 ? 556 PHE A CE1 1 
ATOM   3774 C  CE2 . PHE A 1 483 ? 39.845 170.023 0.569   1.00 94.04  ? 556 PHE A CE2 1 
ATOM   3775 C  CZ  . PHE A 1 483 ? 40.508 170.544 1.661   1.00 138.08 ? 556 PHE A CZ  1 
ATOM   3776 N  N   . LEU A 1 484 ? 41.978 168.184 -3.081  1.00 117.76 ? 557 LEU A N   1 
ATOM   3777 C  CA  . LEU A 1 484 ? 41.549 166.824 -2.771  1.00 137.64 ? 557 LEU A CA  1 
ATOM   3778 C  C   . LEU A 1 484 ? 42.702 165.834 -2.857  1.00 131.57 ? 557 LEU A C   1 
ATOM   3779 O  O   . LEU A 1 484 ? 42.718 164.837 -2.126  1.00 132.74 ? 557 LEU A O   1 
ATOM   3780 C  CB  . LEU A 1 484 ? 40.416 166.402 -3.707  1.00 130.17 ? 557 LEU A CB  1 
ATOM   3781 C  CG  . LEU A 1 484 ? 39.103 167.177 -3.576  1.00 118.11 ? 557 LEU A CG  1 
ATOM   3782 C  CD1 . LEU A 1 484 ? 38.083 166.674 -4.584  1.00 149.73 ? 557 LEU A CD1 1 
ATOM   3783 C  CD2 . LEU A 1 484 ? 38.557 167.075 -2.159  1.00 119.59 ? 557 LEU A CD2 1 
ATOM   3784 N  N   . MET A 1 485 ? 43.677 166.090 -3.733  1.00 148.35 ? 558 MET A N   1 
ATOM   3785 C  CA  . MET A 1 485 ? 44.802 165.171 -3.867  1.00 150.82 ? 558 MET A CA  1 
ATOM   3786 C  C   . MET A 1 485 ? 45.719 165.228 -2.651  1.00 140.73 ? 558 MET A C   1 
ATOM   3787 O  O   . MET A 1 485 ? 46.212 164.191 -2.192  1.00 142.48 ? 558 MET A O   1 
ATOM   3788 C  CB  . MET A 1 485 ? 45.584 165.478 -5.143  1.00 156.58 ? 558 MET A CB  1 
ATOM   3789 C  CG  . MET A 1 485 ? 45.055 164.769 -6.377  1.00 167.81 ? 558 MET A CG  1 
ATOM   3790 S  SD  . MET A 1 485 ? 45.123 162.974 -6.219  1.00 120.48 ? 558 MET A SD  1 
ATOM   3791 C  CE  . MET A 1 485 ? 44.606 162.476 -7.860  1.00 196.35 ? 558 MET A CE  1 
ATOM   3792 N  N   . SER A 1 486 ? 45.976 166.424 -2.126  1.00 138.53 ? 559 SER A N   1 
ATOM   3793 C  CA  . SER A 1 486 ? 46.839 166.601 -0.957  1.00 138.72 ? 559 SER A CA  1 
ATOM   3794 C  C   . SER A 1 486 ? 46.264 167.675 -0.047  1.00 148.23 ? 559 SER A C   1 
ATOM   3795 O  O   . SER A 1 486 ? 46.668 168.843 -0.103  1.00 137.39 ? 559 SER A O   1 
ATOM   3796 C  CB  . SER A 1 486 ? 48.269 166.948 -1.379  1.00 173.91 ? 559 SER A CB  1 
ATOM   3797 O  OG  . SER A 1 486 ? 48.864 165.877 -2.090  1.00 212.88 ? 559 SER A OG  1 
ATOM   3798 N  N   . PRO A 1 487 ? 45.304 167.317 0.804   1.00 167.19 ? 560 PRO A N   1 
ATOM   3799 C  CA  . PRO A 1 487 ? 44.818 168.261 1.817   1.00 109.58 ? 560 PRO A CA  1 
ATOM   3800 C  C   . PRO A 1 487 ? 45.938 168.668 2.756   1.00 102.00 ? 560 PRO A C   1 
ATOM   3801 O  O   . PRO A 1 487 ? 46.699 167.815 3.238   1.00 114.91 ? 560 PRO A O   1 
ATOM   3802 C  CB  . PRO A 1 487 ? 43.734 167.462 2.556   1.00 103.11 ? 560 PRO A CB  1 
ATOM   3803 C  CG  . PRO A 1 487 ? 43.293 166.432 1.575   1.00 122.33 ? 560 PRO A CG  1 
ATOM   3804 C  CD  . PRO A 1 487 ? 44.522 166.069 0.791   1.00 173.08 ? 560 PRO A CD  1 
ATOM   3805 N  N   . PRO A 1 488 ? 46.075 169.961 3.041   1.00 105.48 ? 561 PRO A N   1 
ATOM   3806 C  CA  . PRO A 1 488 ? 47.204 170.420 3.855   1.00 105.66 ? 561 PRO A CA  1 
ATOM   3807 C  C   . PRO A 1 488 ? 47.062 170.014 5.313   1.00 105.71 ? 561 PRO A C   1 
ATOM   3808 O  O   . PRO A 1 488 ? 45.957 169.866 5.840   1.00 130.31 ? 561 PRO A O   1 
ATOM   3809 C  CB  . PRO A 1 488 ? 47.155 171.943 3.698   1.00 120.52 ? 561 PRO A CB  1 
ATOM   3810 C  CG  . PRO A 1 488 ? 45.718 172.235 3.422   1.00 133.89 ? 561 PRO A CG  1 
ATOM   3811 C  CD  . PRO A 1 488 ? 45.211 171.074 2.610   1.00 124.38 ? 561 PRO A CD  1 
ATOM   3812 N  N   . GLN A 1 489 ? 48.209 169.838 5.964   1.00 140.13 ? 562 GLN A N   1 
ATOM   3813 C  CA  . GLN A 1 489 ? 48.251 169.510 7.385   1.00 123.76 ? 562 GLN A CA  1 
ATOM   3814 C  C   . GLN A 1 489 ? 48.006 170.774 8.201   1.00 121.30 ? 562 GLN A C   1 
ATOM   3815 O  O   . GLN A 1 489 ? 48.707 171.776 8.029   1.00 120.77 ? 562 GLN A O   1 
ATOM   3816 C  CB  . GLN A 1 489 ? 49.598 168.887 7.745   1.00 124.14 ? 562 GLN A CB  1 
ATOM   3817 C  CG  . GLN A 1 489 ? 49.728 168.475 9.201   1.00 152.10 ? 562 GLN A CG  1 
ATOM   3818 C  CD  . GLN A 1 489 ? 48.905 167.247 9.536   1.00 178.58 ? 562 GLN A CD  1 
ATOM   3819 O  OE1 . GLN A 1 489 ? 49.033 166.205 8.893   1.00 191.90 ? 562 GLN A OE1 1 
ATOM   3820 N  NE2 . GLN A 1 489 ? 48.053 167.364 10.548  1.00 185.06 ? 562 GLN A NE2 1 
ATOM   3821 N  N   . LEU A 1 490 ? 47.013 170.730 9.086   1.00 122.50 ? 563 LEU A N   1 
ATOM   3822 C  CA  . LEU A 1 490 ? 46.608 171.905 9.844   1.00 118.56 ? 563 LEU A CA  1 
ATOM   3823 C  C   . LEU A 1 490 ? 47.369 171.995 11.160  1.00 129.40 ? 563 LEU A C   1 
ATOM   3824 O  O   . LEU A 1 490 ? 47.540 170.997 11.866  1.00 140.36 ? 563 LEU A O   1 
ATOM   3825 C  CB  . LEU A 1 490 ? 45.102 171.879 10.115  1.00 104.47 ? 563 LEU A CB  1 
ATOM   3826 C  CG  . LEU A 1 490 ? 44.171 171.754 8.909   1.00 95.85  ? 563 LEU A CG  1 
ATOM   3827 C  CD1 . LEU A 1 490 ? 42.726 171.959 9.334   1.00 95.40  ? 563 LEU A CD1 1 
ATOM   3828 C  CD2 . LEU A 1 490 ? 44.557 172.738 7.816   1.00 104.68 ? 563 LEU A CD2 1 
ATOM   3829 N  N   . ARG A 1 491 ? 47.834 173.202 11.478  1.00 123.99 ? 564 ARG A N   1 
ATOM   3830 C  CA  . ARG A 1 491 ? 48.507 173.469 12.741  1.00 122.75 ? 564 ARG A CA  1 
ATOM   3831 C  C   . ARG A 1 491 ? 48.149 174.872 13.209  1.00 117.99 ? 564 ARG A C   1 
ATOM   3832 O  O   . ARG A 1 491 ? 48.152 175.815 12.413  1.00 118.39 ? 564 ARG A O   1 
ATOM   3833 C  CB  . ARG A 1 491 ? 50.027 173.329 12.602  1.00 177.10 ? 564 ARG A CB  1 
ATOM   3834 C  CG  . ARG A 1 491 ? 50.808 173.788 13.821  1.00 173.29 ? 564 ARG A CG  1 
ATOM   3835 C  CD  . ARG A 1 491 ? 52.297 173.827 13.537  1.00 138.00 ? 564 ARG A CD  1 
ATOM   3836 N  NE  . ARG A 1 491 ? 53.048 174.383 14.658  1.00 124.19 ? 564 ARG A NE  1 
ATOM   3837 C  CZ  . ARG A 1 491 ? 53.528 173.662 15.665  1.00 155.04 ? 564 ARG A CZ  1 
ATOM   3838 N  NH1 . ARG A 1 491 ? 54.202 174.251 16.643  1.00 196.00 ? 564 ARG A NH1 1 
ATOM   3839 N  NH2 . ARG A 1 491 ? 53.335 172.350 15.694  1.00 128.74 ? 564 ARG A NH2 1 
ATOM   3840 N  N   . LEU A 1 492 ? 47.835 175.003 14.497  1.00 118.01 ? 565 LEU A N   1 
ATOM   3841 C  CA  . LEU A 1 492 ? 47.568 176.305 15.091  1.00 133.58 ? 565 LEU A CA  1 
ATOM   3842 C  C   . LEU A 1 492 ? 48.066 176.328 16.529  1.00 119.07 ? 565 LEU A C   1 
ATOM   3843 O  O   . LEU A 1 492 ? 47.818 175.388 17.289  1.00 124.85 ? 565 LEU A O   1 
ATOM   3844 C  CB  . LEU A 1 492 ? 46.073 176.645 15.054  1.00 117.36 ? 565 LEU A CB  1 
ATOM   3845 C  CG  . LEU A 1 492 ? 45.666 177.948 15.746  1.00 102.88 ? 565 LEU A CG  1 
ATOM   3846 C  CD1 . LEU A 1 492 ? 46.304 179.145 15.056  1.00 145.53 ? 565 LEU A CD1 1 
ATOM   3847 C  CD2 . LEU A 1 492 ? 44.153 178.092 15.793  1.00 102.91 ? 565 LEU A CD2 1 
ATOM   3848 N  N   . PHE A 1 493 ? 48.754 177.412 16.889  1.00 123.06 ? 566 PHE A N   1 
ATOM   3849 C  CA  . PHE A 1 493 ? 49.181 177.700 18.261  1.00 141.36 ? 566 PHE A CA  1 
ATOM   3850 C  C   . PHE A 1 493 ? 49.816 176.481 18.933  1.00 148.91 ? 566 PHE A C   1 
ATOM   3851 O  O   . PHE A 1 493 ? 49.316 175.952 19.928  1.00 152.83 ? 566 PHE A O   1 
ATOM   3852 C  CB  . PHE A 1 493 ? 48.011 178.230 19.093  1.00 141.63 ? 566 PHE A CB  1 
ATOM   3853 C  CG  . PHE A 1 493 ? 47.725 179.690 18.879  1.00 125.13 ? 566 PHE A CG  1 
ATOM   3854 C  CD1 . PHE A 1 493 ? 48.718 180.547 18.433  1.00 137.11 ? 566 PHE A CD1 1 
ATOM   3855 C  CD2 . PHE A 1 493 ? 46.463 180.206 19.128  1.00 125.18 ? 566 PHE A CD2 1 
ATOM   3856 C  CE1 . PHE A 1 493 ? 48.458 181.891 18.238  1.00 176.08 ? 566 PHE A CE1 1 
ATOM   3857 C  CE2 . PHE A 1 493 ? 46.196 181.548 18.934  1.00 153.88 ? 566 PHE A CE2 1 
ATOM   3858 C  CZ  . PHE A 1 493 ? 47.194 182.393 18.489  1.00 177.51 ? 566 PHE A CZ  1 
ATOM   3859 N  N   . GLN A 1 494 ? 50.947 176.048 18.372  1.00 156.03 ? 567 GLN A N   1 
ATOM   3860 C  CA  . GLN A 1 494 ? 51.740 174.946 18.927  1.00 169.75 ? 567 GLN A CA  1 
ATOM   3861 C  C   . GLN A 1 494 ? 50.898 173.687 19.131  1.00 154.69 ? 567 GLN A C   1 
ATOM   3862 O  O   . GLN A 1 494 ? 51.150 172.896 20.043  1.00 155.91 ? 567 GLN A O   1 
ATOM   3863 C  CB  . GLN A 1 494 ? 52.411 175.358 20.242  1.00 172.85 ? 567 GLN A CB  1 
ATOM   3864 C  CG  . GLN A 1 494 ? 52.928 176.793 20.272  1.00 172.10 ? 567 GLN A CG  1 
ATOM   3865 C  CD  . GLN A 1 494 ? 54.063 177.036 19.296  1.00 202.87 ? 567 GLN A CD  1 
ATOM   3866 O  OE1 . GLN A 1 494 ? 54.754 176.105 18.882  1.00 230.76 ? 567 GLN A OE1 1 
ATOM   3867 N  NE2 . GLN A 1 494 ? 54.260 178.296 18.924  1.00 193.47 ? 567 GLN A NE2 1 
ATOM   3868 N  N   . TYR A 1 495 ? 49.888 173.495 18.284  1.00 169.42 ? 568 TYR A N   1 
ATOM   3869 C  CA  . TYR A 1 495 ? 48.969 172.369 18.408  1.00 140.74 ? 568 TYR A CA  1 
ATOM   3870 C  C   . TYR A 1 495 ? 48.711 171.783 17.030  1.00 132.64 ? 568 TYR A C   1 
ATOM   3871 O  O   . TYR A 1 495 ? 48.283 172.499 16.119  1.00 124.71 ? 568 TYR A O   1 
ATOM   3872 C  CB  . TYR A 1 495 ? 47.654 172.802 19.066  1.00 139.49 ? 568 TYR A CB  1 
ATOM   3873 C  CG  . TYR A 1 495 ? 46.510 171.827 18.891  1.00 125.62 ? 568 TYR A CG  1 
ATOM   3874 C  CD1 . TYR A 1 495 ? 46.456 170.650 19.627  1.00 171.16 ? 568 TYR A CD1 1 
ATOM   3875 C  CD2 . TYR A 1 495 ? 45.476 172.093 18.004  1.00 124.18 ? 568 TYR A CD2 1 
ATOM   3876 C  CE1 . TYR A 1 495 ? 45.408 169.758 19.474  1.00 171.98 ? 568 TYR A CE1 1 
ATOM   3877 C  CE2 . TYR A 1 495 ? 44.424 171.209 17.844  1.00 124.52 ? 568 TYR A CE2 1 
ATOM   3878 C  CZ  . TYR A 1 495 ? 44.394 170.043 18.582  1.00 145.25 ? 568 TYR A CZ  1 
ATOM   3879 O  OH  . TYR A 1 495 ? 43.348 169.161 18.426  1.00 138.66 ? 568 TYR A OH  1 
ATOM   3880 N  N   . ASN A 1 496 ? 48.967 170.487 16.882  1.00 153.09 ? 569 ASN A N   1 
ATOM   3881 C  CA  . ASN A 1 496 ? 48.737 169.789 15.626  1.00 149.57 ? 569 ASN A CA  1 
ATOM   3882 C  C   . ASN A 1 496 ? 47.363 169.134 15.637  1.00 149.40 ? 569 ASN A C   1 
ATOM   3883 O  O   . ASN A 1 496 ? 46.958 168.526 16.632  1.00 159.79 ? 569 ASN A O   1 
ATOM   3884 C  CB  . ASN A 1 496 ? 49.818 168.737 15.383  1.00 147.60 ? 569 ASN A CB  1 
ATOM   3885 C  CG  . ASN A 1 496 ? 51.192 169.348 15.204  1.00 165.35 ? 569 ASN A CG  1 
ATOM   3886 O  OD1 . ASN A 1 496 ? 51.558 169.768 14.107  1.00 163.57 ? 569 ASN A OD1 1 
ATOM   3887 N  ND2 . ASN A 1 496 ? 51.961 169.401 16.285  1.00 193.62 ? 569 ASN A ND2 1 
ATOM   3888 N  N   . TYR A 1 497 ? 46.653 169.261 14.520  1.00 122.89 ? 570 TYR A N   1 
ATOM   3889 C  CA  . TYR A 1 497 ? 45.306 168.728 14.431  1.00 109.95 ? 570 TYR A CA  1 
ATOM   3890 C  C   . TYR A 1 497 ? 45.331 167.203 14.365  1.00 114.23 ? 570 TYR A C   1 
ATOM   3891 O  O   . TYR A 1 497 ? 46.274 166.609 13.834  1.00 153.77 ? 570 TYR A O   1 
ATOM   3892 C  CB  . TYR A 1 497 ? 44.592 169.285 13.205  1.00 105.03 ? 570 TYR A CB  1 
ATOM   3893 C  CG  . TYR A 1 497 ? 44.056 170.678 13.408  1.00 101.06 ? 570 TYR A CG  1 
ATOM   3894 C  CD1 . TYR A 1 497 ? 44.915 171.745 13.624  1.00 126.13 ? 570 TYR A CD1 1 
ATOM   3895 C  CD2 . TYR A 1 497 ? 42.691 170.927 13.384  1.00 126.37 ? 570 TYR A CD2 1 
ATOM   3896 C  CE1 . TYR A 1 497 ? 44.432 173.020 13.811  1.00 118.23 ? 570 TYR A CE1 1 
ATOM   3897 C  CE2 . TYR A 1 497 ? 42.197 172.201 13.570  1.00 123.97 ? 570 TYR A CE2 1 
ATOM   3898 C  CZ  . TYR A 1 497 ? 43.074 173.242 13.783  1.00 100.33 ? 570 TYR A CZ  1 
ATOM   3899 O  OH  . TYR A 1 497 ? 42.597 174.514 13.969  1.00 107.55 ? 570 TYR A OH  1 
ATOM   3900 N  N   . PRO A 1 498 ? 44.307 166.547 14.907  1.00 108.74 ? 571 PRO A N   1 
ATOM   3901 C  CA  . PRO A 1 498 ? 44.241 165.085 14.826  1.00 120.01 ? 571 PRO A CA  1 
ATOM   3902 C  C   . PRO A 1 498 ? 44.089 164.614 13.387  1.00 142.36 ? 571 PRO A C   1 
ATOM   3903 O  O   . PRO A 1 498 ? 43.695 165.365 12.492  1.00 171.59 ? 571 PRO A O   1 
ATOM   3904 C  CB  . PRO A 1 498 ? 43.002 164.737 15.660  1.00 142.89 ? 571 PRO A CB  1 
ATOM   3905 C  CG  . PRO A 1 498 ? 42.785 165.928 16.543  1.00 112.07 ? 571 PRO A CG  1 
ATOM   3906 C  CD  . PRO A 1 498 ? 43.224 167.105 15.733  1.00 105.07 ? 571 PRO A CD  1 
ATOM   3907 N  N   . TYR A 1 499 ? 44.415 163.337 13.174  1.00 127.48 ? 572 TYR A N   1 
ATOM   3908 C  CA  . TYR A 1 499 ? 44.355 162.769 11.831  1.00 124.94 ? 572 TYR A CA  1 
ATOM   3909 C  C   . TYR A 1 499 ? 42.930 162.733 11.295  1.00 141.52 ? 572 TYR A C   1 
ATOM   3910 O  O   . TYR A 1 499 ? 42.726 162.792 10.077  1.00 156.95 ? 572 TYR A O   1 
ATOM   3911 C  CB  . TYR A 1 499 ? 44.961 161.365 11.831  1.00 160.14 ? 572 TYR A CB  1 
ATOM   3912 C  CG  . TYR A 1 499 ? 44.323 160.419 12.825  1.00 152.72 ? 572 TYR A CG  1 
ATOM   3913 C  CD1 . TYR A 1 499 ? 44.715 160.411 14.158  1.00 151.70 ? 572 TYR A CD1 1 
ATOM   3914 C  CD2 . TYR A 1 499 ? 43.334 159.529 12.430  1.00 132.29 ? 572 TYR A CD2 1 
ATOM   3915 C  CE1 . TYR A 1 499 ? 44.136 159.549 15.068  1.00 155.31 ? 572 TYR A CE1 1 
ATOM   3916 C  CE2 . TYR A 1 499 ? 42.752 158.662 13.331  1.00 137.83 ? 572 TYR A CE2 1 
ATOM   3917 C  CZ  . TYR A 1 499 ? 43.154 158.676 14.649  1.00 135.78 ? 572 TYR A CZ  1 
ATOM   3918 O  OH  . TYR A 1 499 ? 42.575 157.814 15.552  1.00 138.32 ? 572 TYR A OH  1 
ATOM   3919 N  N   . TRP A 1 500 ? 41.936 162.651 12.178  1.00 132.02 ? 573 TRP A N   1 
ATOM   3920 C  CA  . TRP A 1 500 ? 40.543 162.565 11.758  1.00 104.69 ? 573 TRP A CA  1 
ATOM   3921 C  C   . TRP A 1 500 ? 39.925 163.919 11.442  1.00 101.54 ? 573 TRP A C   1 
ATOM   3922 O  O   . TRP A 1 500 ? 38.746 163.968 11.075  1.00 134.33 ? 573 TRP A O   1 
ATOM   3923 C  CB  . TRP A 1 500 ? 39.706 161.860 12.830  1.00 110.55 ? 573 TRP A CB  1 
ATOM   3924 C  CG  . TRP A 1 500 ? 39.877 162.414 14.215  1.00 146.03 ? 573 TRP A CG  1 
ATOM   3925 C  CD1 . TRP A 1 500 ? 40.671 161.913 15.204  1.00 144.16 ? 573 TRP A CD1 1 
ATOM   3926 C  CD2 . TRP A 1 500 ? 39.232 163.571 14.767  1.00 110.12 ? 573 TRP A CD2 1 
ATOM   3927 N  NE1 . TRP A 1 500 ? 40.563 162.684 16.336  1.00 111.91 ? 573 TRP A NE1 1 
ATOM   3928 C  CE2 . TRP A 1 500 ? 39.687 163.709 16.093  1.00 110.53 ? 573 TRP A CE2 1 
ATOM   3929 C  CE3 . TRP A 1 500 ? 38.316 164.502 14.268  1.00 145.56 ? 573 TRP A CE3 1 
ATOM   3930 C  CZ2 . TRP A 1 500 ? 39.259 164.740 16.925  1.00 120.30 ? 573 TRP A CZ2 1 
ATOM   3931 C  CZ3 . TRP A 1 500 ? 37.893 165.526 15.096  1.00 140.49 ? 573 TRP A CZ3 1 
ATOM   3932 C  CH2 . TRP A 1 500 ? 38.364 165.637 16.410  1.00 132.48 ? 573 TRP A CH2 1 
ATOM   3933 N  N   . SER A 1 501 ? 40.681 165.011 11.583  1.00 106.76 ? 574 SER A N   1 
ATOM   3934 C  CA  . SER A 1 501 ? 40.138 166.333 11.281  1.00 108.40 ? 574 SER A CA  1 
ATOM   3935 C  C   . SER A 1 501 ? 39.628 166.404 9.847   1.00 118.39 ? 574 SER A C   1 
ATOM   3936 O  O   . SER A 1 501 ? 38.540 166.936 9.594   1.00 134.84 ? 574 SER A O   1 
ATOM   3937 C  CB  . SER A 1 501 ? 41.202 167.402 11.526  1.00 124.17 ? 574 SER A CB  1 
ATOM   3938 O  OG  . SER A 1 501 ? 41.738 167.295 12.833  1.00 124.64 ? 574 SER A OG  1 
ATOM   3939 N  N   . ILE A 1 502 ? 40.392 165.856 8.898   1.00 143.31 ? 575 ILE A N   1 
ATOM   3940 C  CA  . ILE A 1 502 ? 39.966 165.850 7.502   1.00 135.83 ? 575 ILE A CA  1 
ATOM   3941 C  C   . ILE A 1 502 ? 38.653 165.095 7.341   1.00 139.92 ? 575 ILE A C   1 
ATOM   3942 O  O   . ILE A 1 502 ? 37.845 165.418 6.461   1.00 163.05 ? 575 ILE A O   1 
ATOM   3943 C  CB  . ILE A 1 502 ? 41.078 165.263 6.607   1.00 118.06 ? 575 ILE A CB  1 
ATOM   3944 C  CG1 . ILE A 1 502 ? 40.700 165.375 5.130   1.00 117.39 ? 575 ILE A CG1 1 
ATOM   3945 C  CG2 . ILE A 1 502 ? 41.374 163.816 6.984   1.00 119.55 ? 575 ILE A CG2 1 
ATOM   3946 C  CD1 . ILE A 1 502 ? 40.463 166.796 4.673   1.00 129.54 ? 575 ILE A CD1 1 
ATOM   3947 N  N   . ILE A 1 503 ? 38.408 164.096 8.191   1.00 132.49 ? 576 ILE A N   1 
ATOM   3948 C  CA  . ILE A 1 503 ? 37.137 163.383 8.145   1.00 133.58 ? 576 ILE A CA  1 
ATOM   3949 C  C   . ILE A 1 503 ? 36.000 164.300 8.575   1.00 129.75 ? 576 ILE A C   1 
ATOM   3950 O  O   . ILE A 1 503 ? 34.907 164.269 7.997   1.00 132.99 ? 576 ILE A O   1 
ATOM   3951 C  CB  . ILE A 1 503 ? 37.200 162.119 9.020   1.00 107.64 ? 576 ILE A CB  1 
ATOM   3952 C  CG1 . ILE A 1 503 ? 38.460 161.315 8.706   1.00 123.70 ? 576 ILE A CG1 1 
ATOM   3953 C  CG2 . ILE A 1 503 ? 35.959 161.264 8.812   1.00 109.76 ? 576 ILE A CG2 1 
ATOM   3954 C  CD1 . ILE A 1 503 ? 38.678 160.154 9.643   1.00 137.08 ? 576 ILE A CD1 1 
ATOM   3955 N  N   . LEU A 1 504 ? 36.239 165.133 9.590   1.00 127.88 ? 577 LEU A N   1 
ATOM   3956 C  CA  . LEU A 1 504 ? 35.186 166.011 10.089  1.00 123.63 ? 577 LEU A CA  1 
ATOM   3957 C  C   . LEU A 1 504 ? 34.865 167.108 9.081   1.00 113.64 ? 577 LEU A C   1 
ATOM   3958 O  O   . LEU A 1 504 ? 33.702 167.298 8.707   1.00 126.99 ? 577 LEU A O   1 
ATOM   3959 C  CB  . LEU A 1 504 ? 35.598 166.605 11.438  1.00 112.17 ? 577 LEU A CB  1 
ATOM   3960 C  CG  . LEU A 1 504 ? 34.625 167.557 12.137  1.00 124.62 ? 577 LEU A CG  1 
ATOM   3961 C  CD1 . LEU A 1 504 ? 33.199 167.035 12.073  1.00 112.10 ? 577 LEU A CD1 1 
ATOM   3962 C  CD2 . LEU A 1 504 ? 35.048 167.758 13.585  1.00 128.28 ? 577 LEU A CD2 1 
ATOM   3963 N  N   . GLY A 1 505 ? 35.891 167.831 8.622   1.00 105.82 ? 578 GLY A N   1 
ATOM   3964 C  CA  . GLY A 1 505 ? 35.669 168.883 7.640   1.00 101.28 ? 578 GLY A CA  1 
ATOM   3965 C  C   . GLY A 1 505 ? 34.949 168.383 6.405   1.00 114.02 ? 578 GLY A C   1 
ATOM   3966 O  O   . GLY A 1 505 ? 33.945 168.960 5.978   1.00 104.76 ? 578 GLY A O   1 
ATOM   3967 N  N   . TYR A 1 506 ? 35.446 167.289 5.820   1.00 132.18 ? 579 TYR A N   1 
ATOM   3968 C  CA  . TYR A 1 506 ? 34.743 166.658 4.708   1.00 126.98 ? 579 TYR A CA  1 
ATOM   3969 C  C   . TYR A 1 506 ? 33.304 166.334 5.083   1.00 121.79 ? 579 TYR A C   1 
ATOM   3970 O  O   . TYR A 1 506 ? 32.377 166.603 4.309   1.00 139.30 ? 579 TYR A O   1 
ATOM   3971 C  CB  . TYR A 1 506 ? 35.476 165.389 4.266   1.00 118.43 ? 579 TYR A CB  1 
ATOM   3972 C  CG  . TYR A 1 506 ? 36.662 165.634 3.359   1.00 125.20 ? 579 TYR A CG  1 
ATOM   3973 C  CD1 . TYR A 1 506 ? 36.956 166.909 2.892   1.00 139.45 ? 579 TYR A CD1 1 
ATOM   3974 C  CD2 . TYR A 1 506 ? 37.481 164.585 2.959   1.00 111.13 ? 579 TYR A CD2 1 
ATOM   3975 C  CE1 . TYR A 1 506 ? 38.037 167.133 2.058   1.00 131.40 ? 579 TYR A CE1 1 
ATOM   3976 C  CE2 . TYR A 1 506 ? 38.564 164.800 2.126   1.00 108.91 ? 579 TYR A CE2 1 
ATOM   3977 C  CZ  . TYR A 1 506 ? 38.837 166.075 1.678   1.00 120.67 ? 579 TYR A CZ  1 
ATOM   3978 O  OH  . TYR A 1 506 ? 39.913 166.294 0.849   1.00 104.42 ? 579 TYR A OH  1 
ATOM   3979 N  N   . ALA A 1 507 ? 33.094 165.777 6.280   1.00 130.33 ? 580 ALA A N   1 
ATOM   3980 C  CA  . ALA A 1 507 ? 31.738 165.474 6.726   1.00 122.75 ? 580 ALA A CA  1 
ATOM   3981 C  C   . ALA A 1 507 ? 30.891 166.737 6.798   1.00 106.36 ? 580 ALA A C   1 
ATOM   3982 O  O   . ALA A 1 507 ? 29.690 166.706 6.506   1.00 131.34 ? 580 ALA A O   1 
ATOM   3983 C  CB  . ALA A 1 507 ? 31.770 164.769 8.081   1.00 102.31 ? 580 ALA A CB  1 
ATOM   3984 N  N   . ILE A 1 508 ? 31.500 167.859 7.180   1.00 103.99 ? 581 ILE A N   1 
ATOM   3985 C  CA  . ILE A 1 508 ? 30.776 169.123 7.146   1.00 97.09  ? 581 ILE A CA  1 
ATOM   3986 C  C   . ILE A 1 508 ? 30.715 169.660 5.723   1.00 98.03  ? 581 ILE A C   1 
ATOM   3987 O  O   . ILE A 1 508 ? 29.731 170.304 5.338   1.00 112.50 ? 581 ILE A O   1 
ATOM   3988 C  CB  . ILE A 1 508 ? 31.420 170.135 8.108   1.00 114.16 ? 581 ILE A CB  1 
ATOM   3989 C  CG1 . ILE A 1 508 ? 31.494 169.550 9.519   1.00 137.45 ? 581 ILE A CG1 1 
ATOM   3990 C  CG2 . ILE A 1 508 ? 30.639 171.441 8.117   1.00 97.21  ? 581 ILE A CG2 1 
ATOM   3991 C  CD1 . ILE A 1 508 ? 32.125 170.476 10.533  1.00 127.28 ? 581 ILE A CD1 1 
ATOM   3992 N  N   . GLY A 1 509 ? 31.745 169.395 4.918   1.00 121.38 ? 582 GLY A N   1 
ATOM   3993 C  CA  . GLY A 1 509 ? 31.731 169.866 3.544   1.00 148.89 ? 582 GLY A CA  1 
ATOM   3994 C  C   . GLY A 1 509 ? 30.714 169.129 2.693   1.00 153.62 ? 582 GLY A C   1 
ATOM   3995 O  O   . GLY A 1 509 ? 29.941 169.746 1.954   1.00 125.47 ? 582 GLY A O   1 
ATOM   3996 N  N   . THR A 1 510 ? 30.693 167.797 2.795   1.00 153.53 ? 583 THR A N   1 
ATOM   3997 C  CA  . THR A 1 510 ? 29.757 167.009 2.000   1.00 130.87 ? 583 THR A CA  1 
ATOM   3998 C  C   . THR A 1 510 ? 28.314 167.297 2.393   1.00 136.36 ? 583 THR A C   1 
ATOM   3999 O  O   . THR A 1 510 ? 27.431 167.357 1.530   1.00 137.97 ? 583 THR A O   1 
ATOM   4000 C  CB  . THR A 1 510 ? 30.062 165.518 2.145   1.00 138.26 ? 583 THR A CB  1 
ATOM   4001 O  OG1 . THR A 1 510 ? 30.086 165.164 3.535   1.00 163.88 ? 583 THR A OG1 1 
ATOM   4002 C  CG2 . THR A 1 510 ? 31.404 165.181 1.512   1.00 127.45 ? 583 THR A CG2 1 
ATOM   4003 N  N   . SER A 1 511 ? 28.058 167.491 3.688   1.00 135.16 ? 584 SER A N   1 
ATOM   4004 C  CA  . SER A 1 511 ? 26.703 167.726 4.173   1.00 116.92 ? 584 SER A CA  1 
ATOM   4005 C  C   . SER A 1 511 ? 26.107 169.034 3.671   1.00 113.53 ? 584 SER A C   1 
ATOM   4006 O  O   . SER A 1 511 ? 24.897 169.238 3.817   1.00 129.96 ? 584 SER A O   1 
ATOM   4007 C  CB  . SER A 1 511 ? 26.682 167.710 5.702   1.00 120.95 ? 584 SER A CB  1 
ATOM   4008 O  OG  . SER A 1 511 ? 27.401 168.812 6.228   1.00 134.10 ? 584 SER A OG  1 
ATOM   4009 N  N   . SER A 1 512 ? 26.917 169.927 3.105   1.00 133.49 ? 585 SER A N   1 
ATOM   4010 C  CA  . SER A 1 512 ? 26.383 171.175 2.575   1.00 134.04 ? 585 SER A CA  1 
ATOM   4011 C  C   . SER A 1 512 ? 25.725 170.969 1.214   1.00 154.93 ? 585 SER A C   1 
ATOM   4012 O  O   . SER A 1 512 ? 24.609 171.444 0.979   1.00 164.98 ? 585 SER A O   1 
ATOM   4013 C  CB  . SER A 1 512 ? 27.494 172.220 2.480   1.00 160.42 ? 585 SER A CB  1 
ATOM   4014 O  OG  . SER A 1 512 ? 28.529 171.787 1.614   1.00 171.79 ? 585 SER A OG  1 
ATOM   4015 N  N   . PHE A 1 513 ? 26.401 170.267 0.308   1.00 185.54 ? 586 PHE A N   1 
ATOM   4016 C  CA  . PHE A 1 513 ? 25.911 170.076 -1.051  1.00 178.67 ? 586 PHE A CA  1 
ATOM   4017 C  C   . PHE A 1 513 ? 25.129 168.778 -1.237  1.00 191.30 ? 586 PHE A C   1 
ATOM   4018 O  O   . PHE A 1 513 ? 24.876 168.391 -2.379  1.00 208.50 ? 586 PHE A O   1 
ATOM   4019 C  CB  . PHE A 1 513 ? 27.055 170.172 -2.071  1.00 157.82 ? 586 PHE A CB  1 
ATOM   4020 C  CG  . PHE A 1 513 ? 28.223 169.273 -1.792  1.00 158.73 ? 586 PHE A CG  1 
ATOM   4021 C  CD1 . PHE A 1 513 ? 28.195 167.939 -2.162  1.00 162.74 ? 586 PHE A CD1 1 
ATOM   4022 C  CD2 . PHE A 1 513 ? 29.374 169.777 -1.207  1.00 157.63 ? 586 PHE A CD2 1 
ATOM   4023 C  CE1 . PHE A 1 513 ? 29.280 167.116 -1.924  1.00 175.57 ? 586 PHE A CE1 1 
ATOM   4024 C  CE2 . PHE A 1 513 ? 30.462 168.959 -0.969  1.00 155.57 ? 586 PHE A CE2 1 
ATOM   4025 C  CZ  . PHE A 1 513 ? 30.415 167.628 -1.329  1.00 162.68 ? 586 PHE A CZ  1 
ATOM   4026 N  N   . ILE A 1 514 ? 24.787 168.072 -0.159  1.00 189.94 ? 587 ILE A N   1 
ATOM   4027 C  CA  . ILE A 1 514 ? 23.944 166.880 -0.255  1.00 194.36 ? 587 ILE A CA  1 
ATOM   4028 C  C   . ILE A 1 514 ? 22.650 167.187 -1.002  1.00 196.70 ? 587 ILE A C   1 
ATOM   4029 O  O   . ILE A 1 514 ? 22.011 166.283 -1.552  1.00 221.35 ? 587 ILE A O   1 
ATOM   4030 C  CB  . ILE A 1 514 ? 23.620 166.303 1.137   1.00 219.18 ? 587 ILE A CB  1 
ATOM   4031 C  CG1 . ILE A 1 514 ? 23.027 167.387 2.042   1.00 232.97 ? 587 ILE A CG1 1 
ATOM   4032 C  CG2 . ILE A 1 514 ? 24.845 165.654 1.761   1.00 222.77 ? 587 ILE A CG2 1 
ATOM   4033 C  CD1 . ILE A 1 514 ? 22.560 166.880 3.391   1.00 239.70 ? 587 ILE A CD1 1 
ATOM   4034 N  N   . CYS A 1 515 ? 22.254 168.462 -1.030  1.00 169.98 ? 588 CYS A N   1 
ATOM   4035 C  CA  . CYS A 1 515 ? 20.951 168.838 -1.568  1.00 190.53 ? 588 CYS A CA  1 
ATOM   4036 C  C   . CYS A 1 515 ? 20.885 168.776 -3.092  1.00 194.91 ? 588 CYS A C   1 
ATOM   4037 O  O   . CYS A 1 515 ? 19.824 168.456 -3.638  1.00 200.52 ? 588 CYS A O   1 
ATOM   4038 C  CB  . CYS A 1 515 ? 20.571 170.240 -1.084  1.00 195.15 ? 588 CYS A CB  1 
ATOM   4039 S  SG  . CYS A 1 515 ? 21.847 171.491 -1.325  1.00 168.56 ? 588 CYS A SG  1 
ATOM   4040 N  N   . ILE A 1 516 ? 21.967 169.095 -3.799  1.00 177.16 ? 589 ILE A N   1 
ATOM   4041 C  CA  . ILE A 1 516 ? 21.902 169.149 -5.263  1.00 180.71 ? 589 ILE A CA  1 
ATOM   4042 C  C   . ILE A 1 516 ? 21.721 167.763 -5.888  1.00 174.97 ? 589 ILE A C   1 
ATOM   4043 O  O   . ILE A 1 516 ? 20.855 167.618 -6.762  1.00 217.88 ? 589 ILE A O   1 
ATOM   4044 C  CB  . ILE A 1 516 ? 23.114 169.890 -5.865  1.00 157.71 ? 589 ILE A CB  1 
ATOM   4045 C  CG1 . ILE A 1 516 ? 23.517 169.292 -7.220  1.00 157.64 ? 589 ILE A CG1 1 
ATOM   4046 C  CG2 . ILE A 1 516 ? 24.286 169.958 -4.901  1.00 156.33 ? 589 ILE A CG2 1 
ATOM   4047 C  CD1 . ILE A 1 516 ? 24.589 170.088 -7.940  1.00 174.69 ? 589 ILE A CD1 1 
ATOM   4048 N  N   . PRO A 1 517 ? 22.475 166.721 -5.506  1.00 122.66 ? 590 PRO A N   1 
ATOM   4049 C  CA  . PRO A 1 517 ? 22.228 165.414 -6.143  1.00 124.84 ? 590 PRO A CA  1 
ATOM   4050 C  C   . PRO A 1 517 ? 20.871 164.828 -5.794  1.00 176.42 ? 590 PRO A C   1 
ATOM   4051 O  O   . PRO A 1 517 ? 20.203 164.259 -6.668  1.00 204.63 ? 590 PRO A O   1 
ATOM   4052 C  CB  . PRO A 1 517 ? 23.376 164.539 -5.616  1.00 151.84 ? 590 PRO A CB  1 
ATOM   4053 C  CG  . PRO A 1 517 ? 24.378 165.493 -5.053  1.00 170.05 ? 590 PRO A CG  1 
ATOM   4054 C  CD  . PRO A 1 517 ? 23.563 166.617 -4.521  1.00 132.11 ? 590 PRO A CD  1 
ATOM   4055 N  N   . THR A 1 518 ? 20.442 164.946 -4.533  1.00 190.82 ? 591 THR A N   1 
ATOM   4056 C  CA  . THR A 1 518 ? 19.118 164.472 -4.141  1.00 188.49 ? 591 THR A CA  1 
ATOM   4057 C  C   . THR A 1 518 ? 18.006 165.290 -4.782  1.00 177.65 ? 591 THR A C   1 
ATOM   4058 O  O   . THR A 1 518 ? 16.890 164.784 -4.937  1.00 200.69 ? 591 THR A O   1 
ATOM   4059 C  CB  . THR A 1 518 ? 18.968 164.501 -2.618  1.00 173.33 ? 591 THR A CB  1 
ATOM   4060 O  OG1 . THR A 1 518 ? 19.194 165.832 -2.141  1.00 171.23 ? 591 THR A OG1 1 
ATOM   4061 C  CG2 . THR A 1 518 ? 19.966 163.553 -1.967  1.00 193.26 ? 591 THR A CG2 1 
ATOM   4062 N  N   . TYR A 1 519 ? 18.282 166.544 -5.147  1.00 148.97 ? 592 TYR A N   1 
ATOM   4063 C  CA  . TYR A 1 519 ? 17.301 167.348 -5.866  1.00 150.47 ? 592 TYR A CA  1 
ATOM   4064 C  C   . TYR A 1 519 ? 17.249 166.962 -7.339  1.00 159.96 ? 592 TYR A C   1 
ATOM   4065 O  O   . TYR A 1 519 ? 16.173 166.968 -7.949  1.00 148.45 ? 592 TYR A O   1 
ATOM   4066 C  CB  . TYR A 1 519 ? 17.621 168.833 -5.709  1.00 143.51 ? 592 TYR A CB  1 
ATOM   4067 C  CG  . TYR A 1 519 ? 16.566 169.742 -6.289  1.00 160.82 ? 592 TYR A CG  1 
ATOM   4068 C  CD1 . TYR A 1 519 ? 15.438 170.084 -5.556  1.00 191.01 ? 592 TYR A CD1 1 
ATOM   4069 C  CD2 . TYR A 1 519 ? 16.694 170.256 -7.570  1.00 149.82 ? 592 TYR A CD2 1 
ATOM   4070 C  CE1 . TYR A 1 519 ? 14.467 170.915 -6.083  1.00 200.82 ? 592 TYR A CE1 1 
ATOM   4071 C  CE2 . TYR A 1 519 ? 15.730 171.085 -8.104  1.00 167.02 ? 592 TYR A CE2 1 
ATOM   4072 C  CZ  . TYR A 1 519 ? 14.619 171.413 -7.359  1.00 187.64 ? 592 TYR A CZ  1 
ATOM   4073 O  OH  . TYR A 1 519 ? 13.659 172.241 -7.892  1.00 178.86 ? 592 TYR A OH  1 
ATOM   4074 N  N   . ILE A 1 520 ? 18.403 166.630 -7.924  1.00 178.85 ? 593 ILE A N   1 
ATOM   4075 C  CA  . ILE A 1 520 ? 18.421 166.072 -9.273  1.00 152.65 ? 593 ILE A CA  1 
ATOM   4076 C  C   . ILE A 1 520 ? 17.634 164.771 -9.309  1.00 164.04 ? 593 ILE A C   1 
ATOM   4077 O  O   . ILE A 1 520 ? 16.877 164.508 -10.252 1.00 190.95 ? 593 ILE A O   1 
ATOM   4078 C  CB  . ILE A 1 520 ? 19.871 165.874 -9.755  1.00 143.69 ? 593 ILE A CB  1 
ATOM   4079 C  CG1 . ILE A 1 520 ? 20.564 167.224 -9.952  1.00 148.92 ? 593 ILE A CG1 1 
ATOM   4080 C  CG2 . ILE A 1 520 ? 19.906 165.067 -11.044 1.00 159.31 ? 593 ILE A CG2 1 
ATOM   4081 C  CD1 . ILE A 1 520 ? 21.983 167.114 -10.468 1.00 151.96 ? 593 ILE A CD1 1 
ATOM   4082 N  N   . ALA A 1 521 ? 17.790 163.940 -8.275  1.00 155.39 ? 594 ALA A N   1 
ATOM   4083 C  CA  . ALA A 1 521 ? 16.970 162.740 -8.162  1.00 171.20 ? 594 ALA A CA  1 
ATOM   4084 C  C   . ALA A 1 521 ? 15.508 163.084 -7.908  1.00 205.21 ? 594 ALA A C   1 
ATOM   4085 O  O   . ALA A 1 521 ? 14.616 162.324 -8.303  1.00 198.98 ? 594 ALA A O   1 
ATOM   4086 C  CB  . ALA A 1 521 ? 17.505 161.838 -7.051  1.00 144.68 ? 594 ALA A CB  1 
ATOM   4087 N  N   . TYR A 1 522 ? 15.243 164.219 -7.255  1.00 221.28 ? 595 TYR A N   1 
ATOM   4088 C  CA  . TYR A 1 522 ? 13.864 164.626 -7.004  1.00 225.75 ? 595 TYR A CA  1 
ATOM   4089 C  C   . TYR A 1 522 ? 13.151 164.978 -8.304  1.00 227.69 ? 595 TYR A C   1 
ATOM   4090 O  O   . TYR A 1 522 ? 12.061 164.466 -8.583  1.00 246.67 ? 595 TYR A O   1 
ATOM   4091 C  CB  . TYR A 1 522 ? 13.832 165.805 -6.030  1.00 226.72 ? 595 TYR A CB  1 
ATOM   4092 C  CG  . TYR A 1 522 ? 12.454 166.392 -5.815  1.00 239.53 ? 595 TYR A CG  1 
ATOM   4093 C  CD1 . TYR A 1 522 ? 11.559 165.809 -4.926  1.00 229.18 ? 595 TYR A CD1 1 
ATOM   4094 C  CD2 . TYR A 1 522 ? 12.049 167.532 -6.498  1.00 249.29 ? 595 TYR A CD2 1 
ATOM   4095 C  CE1 . TYR A 1 522 ? 10.299 166.343 -4.726  1.00 232.52 ? 595 TYR A CE1 1 
ATOM   4096 C  CE2 . TYR A 1 522 ? 10.791 168.073 -6.305  1.00 245.69 ? 595 TYR A CE2 1 
ATOM   4097 C  CZ  . TYR A 1 522 ? 9.921  167.475 -5.419  1.00 243.35 ? 595 TYR A CZ  1 
ATOM   4098 O  OH  . TYR A 1 522 ? 8.669  168.012 -5.225  1.00 249.26 ? 595 TYR A OH  1 
ATOM   4099 N  N   . ARG A 1 523 ? 13.751 165.855 -9.113  1.00 214.04 ? 596 ARG A N   1 
ATOM   4100 C  CA  . ARG A 1 523 ? 13.139 166.205 -10.391 1.00 219.45 ? 596 ARG A CA  1 
ATOM   4101 C  C   . ARG A 1 523 ? 13.184 165.042 -11.373 1.00 228.52 ? 596 ARG A C   1 
ATOM   4102 O  O   . ARG A 1 523 ? 12.320 164.942 -12.252 1.00 224.94 ? 596 ARG A O   1 
ATOM   4103 C  CB  . ARG A 1 523 ? 13.824 167.431 -10.994 1.00 219.46 ? 596 ARG A CB  1 
ATOM   4104 C  CG  . ARG A 1 523 ? 13.702 168.690 -10.156 1.00 215.20 ? 596 ARG A CG  1 
ATOM   4105 C  CD  . ARG A 1 523 ? 14.125 169.914 -10.949 1.00 210.75 ? 596 ARG A CD  1 
ATOM   4106 N  NE  . ARG A 1 523 ? 13.206 170.197 -12.047 1.00 201.37 ? 596 ARG A NE  1 
ATOM   4107 C  CZ  . ARG A 1 523 ? 12.170 171.023 -11.958 1.00 203.70 ? 596 ARG A CZ  1 
ATOM   4108 N  NH1 . ARG A 1 523 ? 11.919 171.654 -10.819 1.00 204.27 ? 596 ARG A NH1 1 
ATOM   4109 N  NH2 . ARG A 1 523 ? 11.385 171.222 -13.008 1.00 210.14 ? 596 ARG A NH2 1 
ATOM   4110 N  N   . LEU A 1 524 ? 14.178 164.161 -11.244 1.00 228.78 ? 597 LEU A N   1 
ATOM   4111 C  CA  . LEU A 1 524 ? 14.254 163.001 -12.125 1.00 213.85 ? 597 LEU A CA  1 
ATOM   4112 C  C   . LEU A 1 524 ? 13.145 162.002 -11.818 1.00 226.69 ? 597 LEU A C   1 
ATOM   4113 O  O   . LEU A 1 524 ? 12.584 161.389 -12.734 1.00 252.62 ? 597 LEU A O   1 
ATOM   4114 C  CB  . LEU A 1 524 ? 15.626 162.337 -12.002 1.00 204.80 ? 597 LEU A CB  1 
ATOM   4115 N  N   . ILE A 1 525 ? 12.820 161.817 -10.536 1.00 204.42 ? 598 ILE A N   1 
ATOM   4116 C  CA  . ILE A 1 525 ? 11.735 160.914 -10.171 1.00 189.85 ? 598 ILE A CA  1 
ATOM   4117 C  C   . ILE A 1 525 ? 10.365 161.570 -10.297 1.00 189.73 ? 598 ILE A C   1 
ATOM   4118 O  O   . ILE A 1 525 ? 9.357  160.862 -10.421 1.00 169.57 ? 598 ILE A O   1 
ATOM   4119 C  CB  . ILE A 1 525 ? 11.927 160.384 -8.740  1.00 154.40 ? 598 ILE A CB  1 
ATOM   4120 N  N   . ILE A 1 526 ? 10.296 162.901 -10.270 1.00 189.82 ? 599 ILE A N   1 
ATOM   4121 C  CA  . ILE A 1 526 ? 9.006  163.582 -10.317 1.00 173.00 ? 599 ILE A CA  1 
ATOM   4122 C  C   . ILE A 1 526 ? 8.483  163.675 -11.745 1.00 177.69 ? 599 ILE A C   1 
ATOM   4123 O  O   . ILE A 1 526 ? 7.291  163.464 -11.995 1.00 203.10 ? 599 ILE A O   1 
ATOM   4124 C  CB  . ILE A 1 526 ? 9.118  164.971 -9.664  1.00 169.01 ? 599 ILE A CB  1 
ATOM   4125 N  N   . THR A 1 527 ? 9.352  163.989 -12.697 1.00 196.60 ? 600 THR A N   1 
ATOM   4126 C  CA  . THR A 1 527 ? 8.916  164.237 -14.069 1.00 220.90 ? 600 THR A CA  1 
ATOM   4127 C  C   . THR A 1 527 ? 8.503  162.936 -14.745 1.00 233.71 ? 600 THR A C   1 
ATOM   4128 O  O   . THR A 1 527 ? 9.309  161.998 -14.809 1.00 188.90 ? 600 THR A O   1 
ATOM   4129 C  CB  . THR A 1 527 ? 10.027 164.915 -14.865 1.00 200.24 ? 600 THR A CB  1 
ATOM   4130 N  N   . PRO A 1 528 ? 7.273  162.831 -15.258 1.00 265.42 ? 601 PRO A N   1 
ATOM   4131 C  CA  . PRO A 1 528 ? 6.846  161.590 -15.921 1.00 270.39 ? 601 PRO A CA  1 
ATOM   4132 C  C   . PRO A 1 528 ? 7.502  161.393 -17.278 1.00 275.18 ? 601 PRO A C   1 
ATOM   4133 O  O   . PRO A 1 528 ? 8.352  162.188 -17.692 1.00 271.47 ? 601 PRO A O   1 
ATOM   4134 C  CB  . PRO A 1 528 ? 5.326  161.767 -16.059 1.00 255.06 ? 601 PRO A CB  1 
ATOM   4135 C  CG  . PRO A 1 528 ? 4.967  162.908 -15.144 1.00 252.94 ? 601 PRO A CG  1 
ATOM   4136 C  CD  . PRO A 1 528 ? 6.168  163.793 -15.124 1.00 254.96 ? 601 PRO A CD  1 
ATOM   4137 N  N   . GLY A 1 529 ? 7.106  160.336 -17.981 1.00 280.43 ? 602 GLY A N   1 
ATOM   4138 C  CA  . GLY A 1 529 ? 7.660  160.048 -19.285 1.00 286.57 ? 602 GLY A CA  1 
ATOM   4139 C  C   . GLY A 1 529 ? 9.025  159.391 -19.206 1.00 286.75 ? 602 GLY A C   1 
ATOM   4140 O  O   . GLY A 1 529 ? 9.467  158.901 -18.162 1.00 281.08 ? 602 GLY A O   1 
ATOM   4141 N  N   . THR A 1 530 ? 9.703  159.384 -20.350 1.00 288.47 ? 603 THR A N   1 
ATOM   4142 C  CA  . THR A 1 530 ? 11.037 158.812 -20.426 1.00 280.50 ? 603 THR A CA  1 
ATOM   4143 C  C   . THR A 1 530 ? 12.042 159.698 -19.694 1.00 255.22 ? 603 THR A C   1 
ATOM   4144 O  O   . THR A 1 530 ? 11.836 160.901 -19.511 1.00 253.50 ? 603 THR A O   1 
ATOM   4145 C  CB  . THR A 1 530 ? 11.465 158.631 -21.882 1.00 275.26 ? 603 THR A CB  1 
ATOM   4146 N  N   . PHE A 1 531 ? 13.147 159.080 -19.270 1.00 215.43 ? 604 PHE A N   1 
ATOM   4147 C  CA  . PHE A 1 531 ? 14.191 159.831 -18.581 1.00 195.97 ? 604 PHE A CA  1 
ATOM   4148 C  C   . PHE A 1 531 ? 14.832 160.864 -19.497 1.00 196.55 ? 604 PHE A C   1 
ATOM   4149 O  O   . PHE A 1 531 ? 15.335 161.888 -19.021 1.00 218.20 ? 604 PHE A O   1 
ATOM   4150 C  CB  . PHE A 1 531 ? 15.251 158.877 -18.030 1.00 205.38 ? 604 PHE A CB  1 
ATOM   4151 N  N   . LYS A 1 532 ? 14.828 160.616 -20.809 1.00 155.21 ? 605 LYS A N   1 
ATOM   4152 C  CA  . LYS A 1 532 ? 15.343 161.605 -21.748 1.00 169.02 ? 605 LYS A CA  1 
ATOM   4153 C  C   . LYS A 1 532 ? 14.422 162.814 -21.846 1.00 177.00 ? 605 LYS A C   1 
ATOM   4154 O  O   . LYS A 1 532 ? 14.894 163.934 -22.070 1.00 163.76 ? 605 LYS A O   1 
ATOM   4155 C  CB  . LYS A 1 532 ? 15.538 160.972 -23.126 1.00 165.98 ? 605 LYS A CB  1 
ATOM   4156 N  N   . GLU A 1 533 ? 13.113 162.610 -21.684 1.00 190.22 ? 606 GLU A N   1 
ATOM   4157 C  CA  . GLU A 1 533 ? 12.186 163.736 -21.682 1.00 203.51 ? 606 GLU A CA  1 
ATOM   4158 C  C   . GLU A 1 533 ? 12.264 164.507 -20.371 1.00 212.07 ? 606 GLU A C   1 
ATOM   4159 O  O   . GLU A 1 533 ? 12.141 165.738 -20.358 1.00 217.93 ? 606 GLU A O   1 
ATOM   4160 C  CB  . GLU A 1 533 ? 10.761 163.244 -21.935 1.00 190.71 ? 606 GLU A CB  1 
ATOM   4161 N  N   . ARG A 1 534 ? 12.462 163.798 -19.256 1.00 204.66 ? 607 ARG A N   1 
ATOM   4162 C  CA  . ARG A 1 534 ? 12.664 164.469 -17.975 1.00 203.96 ? 607 ARG A CA  1 
ATOM   4163 C  C   . ARG A 1 534 ? 13.947 165.286 -17.980 1.00 209.31 ? 607 ARG A C   1 
ATOM   4164 O  O   . ARG A 1 534 ? 13.965 166.431 -17.512 1.00 205.32 ? 607 ARG A O   1 
ATOM   4165 C  CB  . ARG A 1 534 ? 12.688 163.443 -16.843 1.00 211.42 ? 607 ARG A CB  1 
ATOM   4166 N  N   . ILE A 1 535 ? 15.034 164.714 -18.502 1.00 203.09 ? 608 ILE A N   1 
ATOM   4167 C  CA  . ILE A 1 535 ? 16.278 165.461 -18.605 1.00 175.36 ? 608 ILE A CA  1 
ATOM   4168 C  C   . ILE A 1 535 ? 16.201 166.507 -19.706 1.00 186.38 ? 608 ILE A C   1 
ATOM   4169 O  O   . ILE A 1 535 ? 17.044 167.410 -19.757 1.00 151.41 ? 608 ILE A O   1 
ATOM   4170 C  CB  . ILE A 1 535 ? 17.467 164.509 -18.837 1.00 132.77 ? 608 ILE A CB  1 
ATOM   4171 N  N   . ILE A 1 536 ? 15.210 166.407 -20.595 1.00 197.88 ? 609 ILE A N   1 
ATOM   4172 C  CA  . ILE A 1 536 ? 14.988 167.444 -21.598 1.00 165.41 ? 609 ILE A CA  1 
ATOM   4173 C  C   . ILE A 1 536 ? 14.279 168.642 -20.980 1.00 161.82 ? 609 ILE A C   1 
ATOM   4174 O  O   . ILE A 1 536 ? 14.627 169.794 -21.261 1.00 139.19 ? 609 ILE A O   1 
ATOM   4175 C  CB  . ILE A 1 536 ? 14.203 166.874 -22.794 1.00 136.86 ? 609 ILE A CB  1 
ATOM   4176 N  N   . LYS A 1 537 ? 13.273 168.395 -20.137 1.00 165.69 ? 610 LYS A N   1 
ATOM   4177 C  CA  . LYS A 1 537 ? 12.652 169.487 -19.395 1.00 176.10 ? 610 LYS A CA  1 
ATOM   4178 C  C   . LYS A 1 537 ? 13.608 170.064 -18.360 1.00 190.31 ? 610 LYS A C   1 
ATOM   4179 O  O   . LYS A 1 537 ? 13.490 171.239 -17.994 1.00 209.16 ? 610 LYS A O   1 
ATOM   4180 C  CB  . LYS A 1 537 ? 11.367 169.005 -18.722 1.00 175.41 ? 610 LYS A CB  1 
ATOM   4181 N  N   . SER A 1 538 ? 14.555 169.257 -17.879 1.00 167.14 ? 611 SER A N   1 
ATOM   4182 C  CA  . SER A 1 538 ? 15.564 169.753 -16.952 1.00 163.08 ? 611 SER A CA  1 
ATOM   4183 C  C   . SER A 1 538 ? 16.655 170.539 -17.668 1.00 180.31 ? 611 SER A C   1 
ATOM   4184 O  O   . SER A 1 538 ? 17.219 171.475 -17.092 1.00 216.16 ? 611 SER A O   1 
ATOM   4185 C  CB  . SER A 1 538 ? 16.181 168.589 -16.178 1.00 163.26 ? 611 SER A CB  1 
ATOM   4186 N  N   . ILE A 1 539 ? 16.972 170.169 -18.908 1.00 172.86 ? 612 ILE A N   1 
ATOM   4187 C  CA  . ILE A 1 539 ? 17.970 170.907 -19.674 1.00 190.30 ? 612 ILE A CA  1 
ATOM   4188 C  C   . ILE A 1 539 ? 17.367 172.175 -20.264 1.00 213.77 ? 612 ILE A C   1 
ATOM   4189 O  O   . ILE A 1 539 ? 17.999 173.237 -20.259 1.00 208.02 ? 612 ILE A O   1 
ATOM   4190 C  CB  . ILE A 1 539 ? 18.575 170.005 -20.763 1.00 183.33 ? 612 ILE A CB  1 
ATOM   4191 N  N   . THR A 1 540 ? 16.143 172.087 -20.781 1.00 218.51 ? 613 THR A N   1 
ATOM   4192 C  CA  . THR A 1 540 ? 15.494 173.258 -21.353 1.00 195.39 ? 613 THR A CA  1 
ATOM   4193 C  C   . THR A 1 540 ? 14.986 174.173 -20.240 1.00 164.44 ? 613 THR A C   1 
ATOM   4194 O  O   . THR A 1 540 ? 14.453 173.695 -19.236 1.00 164.62 ? 613 THR A O   1 
ATOM   4195 C  CB  . THR A 1 540 ? 14.332 172.847 -22.255 1.00 189.19 ? 613 THR A CB  1 
ATOM   4196 N  N   . PRO A 1 541 ? 15.146 175.485 -20.393 1.00 162.15 ? 614 PRO A N   1 
ATOM   4197 C  CA  . PRO A 1 541 ? 14.685 176.413 -19.356 1.00 159.86 ? 614 PRO A CA  1 
ATOM   4198 C  C   . PRO A 1 541 ? 13.170 176.404 -19.221 1.00 179.29 ? 614 PRO A C   1 
ATOM   4199 O  O   . PRO A 1 541 ? 12.435 175.958 -20.105 1.00 205.19 ? 614 PRO A O   1 
ATOM   4200 C  CB  . PRO A 1 541 ? 15.186 177.776 -19.849 1.00 159.51 ? 614 PRO A CB  1 
ATOM   4201 C  CG  . PRO A 1 541 ? 16.281 177.459 -20.822 1.00 157.99 ? 614 PRO A CG  1 
ATOM   4202 C  CD  . PRO A 1 541 ? 15.875 176.174 -21.469 1.00 161.37 ? 614 PRO A CD  1 
ATOM   4203 N  N   . GLU A 1 542 ? 12.709 176.914 -18.083 1.00 220.99 ? 615 GLU A N   1 
ATOM   4204 C  CA  . GLU A 1 542 ? 11.281 176.995 -17.800 1.00 233.59 ? 615 GLU A CA  1 
ATOM   4205 C  C   . GLU A 1 542 ? 10.830 178.448 -17.692 1.00 252.18 ? 615 GLU A C   1 
ATOM   4206 O  O   . GLU A 1 542 ? 9.986  178.905 -18.462 1.00 270.10 ? 615 GLU A O   1 
ATOM   4207 C  CB  . GLU A 1 542 ? 10.945 176.241 -16.512 1.00 226.39 ? 615 GLU A CB  1 
ATOM   4208 N  N   . GLU B 2 1   ? 52.215 175.620 33.838  1.00 178.90 ? 20  GLU B N   1 
ATOM   4209 C  CA  . GLU B 2 1   ? 51.622 174.314 34.103  1.00 172.65 ? 20  GLU B CA  1 
ATOM   4210 C  C   . GLU B 2 1   ? 52.285 173.639 35.301  1.00 156.41 ? 20  GLU B C   1 
ATOM   4211 O  O   . GLU B 2 1   ? 52.597 172.448 35.260  1.00 157.19 ? 20  GLU B O   1 
ATOM   4212 C  CB  . GLU B 2 1   ? 51.727 173.417 32.868  1.00 171.38 ? 20  GLU B CB  1 
ATOM   4213 N  N   . VAL B 2 2   ? 52.501 174.410 36.365  1.00 198.32 ? 21  VAL B N   1 
ATOM   4214 C  CA  . VAL B 2 2   ? 53.094 173.864 37.581  1.00 154.87 ? 21  VAL B CA  1 
ATOM   4215 C  C   . VAL B 2 2   ? 52.058 172.995 38.282  1.00 134.49 ? 21  VAL B C   1 
ATOM   4216 O  O   . VAL B 2 2   ? 50.956 173.455 38.605  1.00 138.66 ? 21  VAL B O   1 
ATOM   4217 C  CB  . VAL B 2 2   ? 53.591 174.986 38.502  1.00 145.75 ? 21  VAL B CB  1 
ATOM   4218 C  CG1 . VAL B 2 2   ? 54.295 174.400 39.716  1.00 145.55 ? 21  VAL B CG1 1 
ATOM   4219 C  CG2 . VAL B 2 2   ? 54.512 175.928 37.742  1.00 175.81 ? 21  VAL B CG2 1 
ATOM   4220 N  N   . GLN B 2 3   ? 52.409 171.734 38.526  1.00 149.37 ? 22  GLN B N   1 
ATOM   4221 C  CA  . GLN B 2 3   ? 51.491 170.783 39.135  1.00 132.37 ? 22  GLN B CA  1 
ATOM   4222 C  C   . GLN B 2 3   ? 52.226 169.945 40.168  1.00 134.52 ? 22  GLN B C   1 
ATOM   4223 O  O   . GLN B 2 3   ? 53.293 169.393 39.882  1.00 144.04 ? 22  GLN B O   1 
ATOM   4224 C  CB  . GLN B 2 3   ? 50.851 169.871 38.080  1.00 163.62 ? 22  GLN B CB  1 
ATOM   4225 C  CG  . GLN B 2 3   ? 49.940 170.588 37.093  1.00 191.50 ? 22  GLN B CG  1 
ATOM   4226 C  CD  . GLN B 2 3   ? 49.183 169.627 36.196  1.00 185.62 ? 22  GLN B CD  1 
ATOM   4227 O  OE1 . GLN B 2 3   ? 49.058 168.442 36.503  1.00 174.63 ? 22  GLN B OE1 1 
ATOM   4228 N  NE2 . GLN B 2 3   ? 48.675 170.135 35.078  1.00 167.15 ? 22  GLN B NE2 1 
ATOM   4229 N  N   . LEU B 2 4   ? 51.652 169.863 41.367  1.00 151.25 ? 23  LEU B N   1 
ATOM   4230 C  CA  . LEU B 2 4   ? 52.134 168.990 42.433  1.00 146.46 ? 23  LEU B CA  1 
ATOM   4231 C  C   . LEU B 2 4   ? 51.053 167.946 42.691  1.00 121.16 ? 23  LEU B C   1 
ATOM   4232 O  O   . LEU B 2 4   ? 49.977 168.273 43.202  1.00 120.14 ? 23  LEU B O   1 
ATOM   4233 C  CB  . LEU B 2 4   ? 52.449 169.788 43.697  1.00 153.09 ? 23  LEU B CB  1 
ATOM   4234 C  CG  . LEU B 2 4   ? 53.307 171.047 43.529  1.00 139.64 ? 23  LEU B CG  1 
ATOM   4235 C  CD1 . LEU B 2 4   ? 53.538 171.731 44.869  1.00 120.49 ? 23  LEU B CD1 1 
ATOM   4236 C  CD2 . LEU B 2 4   ? 54.631 170.721 42.857  1.00 144.85 ? 23  LEU B CD2 1 
ATOM   4237 N  N   . GLN B 2 5   ? 51.338 166.695 42.339  1.00 127.33 ? 24  GLN B N   1 
ATOM   4238 C  CA  . GLN B 2 5   ? 50.375 165.603 42.440  1.00 128.09 ? 24  GLN B CA  1 
ATOM   4239 C  C   . GLN B 2 5   ? 50.766 164.717 43.616  1.00 146.70 ? 24  GLN B C   1 
ATOM   4240 O  O   . GLN B 2 5   ? 51.768 163.998 43.552  1.00 130.92 ? 24  GLN B O   1 
ATOM   4241 C  CB  . GLN B 2 5   ? 50.328 164.803 41.139  1.00 126.85 ? 24  GLN B CB  1 
ATOM   4242 C  CG  . GLN B 2 5   ? 49.347 163.638 41.149  1.00 170.44 ? 24  GLN B CG  1 
ATOM   4243 C  CD  . GLN B 2 5   ? 47.898 164.088 41.154  1.00 188.44 ? 24  GLN B CD  1 
ATOM   4244 O  OE1 . GLN B 2 5   ? 47.592 165.244 40.859  1.00 194.88 ? 24  GLN B OE1 1 
ATOM   4245 N  NE2 . GLN B 2 5   ? 46.995 163.173 41.489  1.00 164.78 ? 24  GLN B NE2 1 
ATOM   4246 N  N   . GLN B 2 6   ? 49.968 164.758 44.679  1.00 140.65 ? 25  GLN B N   1 
ATOM   4247 C  CA  . GLN B 2 6   ? 50.249 163.965 45.864  1.00 132.59 ? 25  GLN B CA  1 
ATOM   4248 C  C   . GLN B 2 6   ? 49.689 162.554 45.699  1.00 123.04 ? 25  GLN B C   1 
ATOM   4249 O  O   . GLN B 2 6   ? 49.106 162.201 44.670  1.00 120.76 ? 25  GLN B O   1 
ATOM   4250 C  CB  . GLN B 2 6   ? 49.669 164.638 47.105  1.00 129.08 ? 25  GLN B CB  1 
ATOM   4251 C  CG  . GLN B 2 6   ? 49.771 166.151 47.098  1.00 123.66 ? 25  GLN B CG  1 
ATOM   4252 C  CD  . GLN B 2 6   ? 49.418 166.760 48.439  1.00 138.59 ? 25  GLN B CD  1 
ATOM   4253 O  OE1 . GLN B 2 6   ? 49.265 167.975 48.561  1.00 135.23 ? 25  GLN B OE1 1 
ATOM   4254 N  NE2 . GLN B 2 6   ? 49.290 165.917 49.456  1.00 147.12 ? 25  GLN B NE2 1 
ATOM   4255 N  N   . SER B 2 7   ? 49.867 161.734 46.731  1.00 134.15 ? 26  SER B N   1 
ATOM   4256 C  CA  . SER B 2 7   ? 49.319 160.388 46.729  1.00 162.37 ? 26  SER B CA  1 
ATOM   4257 C  C   . SER B 2 7   ? 47.855 160.421 47.168  1.00 189.33 ? 26  SER B C   1 
ATOM   4258 O  O   . SER B 2 7   ? 47.290 161.475 47.473  1.00 187.29 ? 26  SER B O   1 
ATOM   4259 C  CB  . SER B 2 7   ? 50.149 159.475 47.628  1.00 138.52 ? 26  SER B CB  1 
ATOM   4260 O  OG  . SER B 2 7   ? 50.156 159.941 48.966  1.00 139.72 ? 26  SER B OG  1 
ATOM   4261 N  N   . GLY B 2 8   ? 47.230 159.247 47.201  1.00 188.18 ? 27  GLY B N   1 
ATOM   4262 C  CA  . GLY B 2 8   ? 45.840 159.138 47.568  1.00 165.73 ? 27  GLY B CA  1 
ATOM   4263 C  C   . GLY B 2 8   ? 45.634 159.124 49.069  1.00 164.80 ? 27  GLY B C   1 
ATOM   4264 O  O   . GLY B 2 8   ? 46.574 159.304 49.850  1.00 195.97 ? 27  GLY B O   1 
ATOM   4265 N  N   . PRO B 2 9   ? 44.394 158.913 49.501  1.00 141.78 ? 28  PRO B N   1 
ATOM   4266 C  CA  . PRO B 2 9   ? 44.113 158.858 50.938  1.00 152.94 ? 28  PRO B CA  1 
ATOM   4267 C  C   . PRO B 2 9   ? 44.707 157.611 51.574  1.00 143.98 ? 28  PRO B C   1 
ATOM   4268 O  O   . PRO B 2 9   ? 44.998 156.613 50.910  1.00 150.91 ? 28  PRO B O   1 
ATOM   4269 C  CB  . PRO B 2 9   ? 42.582 158.838 51.000  1.00 183.11 ? 28  PRO B CB  1 
ATOM   4270 C  CG  . PRO B 2 9   ? 42.169 158.243 49.695  1.00 175.63 ? 28  PRO B CG  1 
ATOM   4271 C  CD  . PRO B 2 9   ? 43.180 158.720 48.689  1.00 156.59 ? 28  PRO B CD  1 
ATOM   4272 N  N   . GLU B 2 10  ? 44.889 157.683 52.891  1.00 172.71 ? 29  GLU B N   1 
ATOM   4273 C  CA  . GLU B 2 10  ? 45.495 156.594 53.646  1.00 192.33 ? 29  GLU B CA  1 
ATOM   4274 C  C   . GLU B 2 10  ? 44.726 156.371 54.938  1.00 204.56 ? 29  GLU B C   1 
ATOM   4275 O  O   . GLU B 2 10  ? 44.396 157.331 55.641  1.00 201.75 ? 29  GLU B O   1 
ATOM   4276 C  CB  . GLU B 2 10  ? 46.968 156.890 53.960  1.00 210.09 ? 29  GLU B CB  1 
ATOM   4277 C  CG  . GLU B 2 10  ? 47.870 156.979 52.737  1.00 214.17 ? 29  GLU B CG  1 
ATOM   4278 C  CD  . GLU B 2 10  ? 48.076 155.636 52.061  1.00 212.54 ? 29  GLU B CD  1 
ATOM   4279 O  OE1 . GLU B 2 10  ? 47.863 154.596 52.719  1.00 207.59 ? 29  GLU B OE1 1 
ATOM   4280 O  OE2 . GLU B 2 10  ? 48.451 155.622 50.870  1.00 216.81 ? 29  GLU B OE2 1 
ATOM   4281 N  N   . LEU B 2 11  ? 44.441 155.107 55.241  1.00 198.64 ? 30  LEU B N   1 
ATOM   4282 C  CA  . LEU B 2 11  ? 43.878 154.698 56.522  1.00 177.82 ? 30  LEU B CA  1 
ATOM   4283 C  C   . LEU B 2 11  ? 44.858 153.741 57.180  1.00 154.32 ? 30  LEU B C   1 
ATOM   4284 O  O   . LEU B 2 11  ? 45.184 152.695 56.609  1.00 179.74 ? 30  LEU B O   1 
ATOM   4285 C  CB  . LEU B 2 11  ? 42.515 154.026 56.351  1.00 178.60 ? 30  LEU B CB  1 
ATOM   4286 C  CG  . LEU B 2 11  ? 42.020 153.303 57.607  1.00 183.73 ? 30  LEU B CG  1 
ATOM   4287 C  CD1 . LEU B 2 11  ? 41.616 154.298 58.686  1.00 176.64 ? 30  LEU B CD1 1 
ATOM   4288 C  CD2 . LEU B 2 11  ? 40.881 152.348 57.289  1.00 189.80 ? 30  LEU B CD2 1 
ATOM   4289 N  N   . VAL B 2 12  ? 45.325 154.092 58.375  1.00 175.12 ? 31  VAL B N   1 
ATOM   4290 C  CA  . VAL B 2 12  ? 46.356 153.314 59.052  1.00 175.71 ? 31  VAL B CA  1 
ATOM   4291 C  C   . VAL B 2 12  ? 46.007 153.187 60.527  1.00 184.09 ? 31  VAL B C   1 
ATOM   4292 O  O   . VAL B 2 12  ? 45.456 154.114 61.129  1.00 213.70 ? 31  VAL B O   1 
ATOM   4293 C  CB  . VAL B 2 12  ? 47.748 153.948 58.869  1.00 208.20 ? 31  VAL B CB  1 
ATOM   4294 C  CG1 . VAL B 2 12  ? 48.382 153.461 57.576  1.00 226.40 ? 31  VAL B CG1 1 
ATOM   4295 C  CG2 . VAL B 2 12  ? 47.630 155.462 58.860  1.00 209.57 ? 31  VAL B CG2 1 
ATOM   4296 N  N   . LYS B 2 13  ? 46.329 152.034 61.108  1.00 168.79 ? 32  LYS B N   1 
ATOM   4297 C  CA  . LYS B 2 13  ? 46.091 151.826 62.525  1.00 170.45 ? 32  LYS B CA  1 
ATOM   4298 C  C   . LYS B 2 13  ? 47.045 152.685 63.355  1.00 194.51 ? 32  LYS B C   1 
ATOM   4299 O  O   . LYS B 2 13  ? 48.157 152.992 62.917  1.00 210.25 ? 32  LYS B O   1 
ATOM   4300 C  CB  . LYS B 2 13  ? 46.265 150.355 62.891  1.00 176.94 ? 32  LYS B CB  1 
ATOM   4301 C  CG  . LYS B 2 13  ? 45.140 149.451 62.413  1.00 209.87 ? 32  LYS B CG  1 
ATOM   4302 C  CD  . LYS B 2 13  ? 45.280 148.052 62.994  1.00 229.84 ? 32  LYS B CD  1 
ATOM   4303 C  CE  . LYS B 2 13  ? 44.088 147.177 62.639  1.00 226.86 ? 32  LYS B CE  1 
ATOM   4304 N  NZ  . LYS B 2 13  ? 44.184 145.829 63.268  1.00 216.72 ? 32  LYS B NZ  1 
ATOM   4305 N  N   . PRO B 2 14  ? 46.625 153.097 64.551  1.00 217.49 ? 33  PRO B N   1 
ATOM   4306 C  CA  . PRO B 2 14  ? 47.520 153.873 65.417  1.00 228.61 ? 33  PRO B CA  1 
ATOM   4307 C  C   . PRO B 2 14  ? 48.770 153.085 65.777  1.00 229.13 ? 33  PRO B C   1 
ATOM   4308 O  O   . PRO B 2 14  ? 48.723 151.873 65.999  1.00 234.38 ? 33  PRO B O   1 
ATOM   4309 C  CB  . PRO B 2 14  ? 46.657 154.159 66.651  1.00 235.77 ? 33  PRO B CB  1 
ATOM   4310 C  CG  . PRO B 2 14  ? 45.252 154.076 66.153  1.00 236.41 ? 33  PRO B CG  1 
ATOM   4311 C  CD  . PRO B 2 14  ? 45.263 153.006 65.102  1.00 230.21 ? 33  PRO B CD  1 
ATOM   4312 N  N   . GLY B 2 15  ? 49.898 153.791 65.833  1.00 220.21 ? 34  GLY B N   1 
ATOM   4313 C  CA  . GLY B 2 15  ? 51.179 153.179 66.100  1.00 223.04 ? 34  GLY B CA  1 
ATOM   4314 C  C   . GLY B 2 15  ? 51.965 152.781 64.870  1.00 234.24 ? 34  GLY B C   1 
ATOM   4315 O  O   . GLY B 2 15  ? 53.158 152.471 64.990  1.00 214.97 ? 34  GLY B O   1 
ATOM   4316 N  N   . ALA B 2 16  ? 51.343 152.778 63.695  1.00 248.38 ? 35  ALA B N   1 
ATOM   4317 C  CA  . ALA B 2 16  ? 52.016 152.409 62.461  1.00 245.87 ? 35  ALA B CA  1 
ATOM   4318 C  C   . ALA B 2 16  ? 52.680 153.641 61.846  1.00 224.78 ? 35  ALA B C   1 
ATOM   4319 O  O   . ALA B 2 16  ? 52.745 154.711 62.457  1.00 221.35 ? 35  ALA B O   1 
ATOM   4320 C  CB  . ALA B 2 16  ? 51.029 151.751 61.499  1.00 241.84 ? 35  ALA B CB  1 
ATOM   4321 N  N   . SER B 2 17  ? 53.187 153.497 60.624  1.00 212.19 ? 36  SER B N   1 
ATOM   4322 C  CA  . SER B 2 17  ? 53.820 154.587 59.898  1.00 197.51 ? 36  SER B CA  1 
ATOM   4323 C  C   . SER B 2 17  ? 53.145 154.743 58.542  1.00 199.75 ? 36  SER B C   1 
ATOM   4324 O  O   . SER B 2 17  ? 52.484 153.826 58.047  1.00 215.87 ? 36  SER B O   1 
ATOM   4325 C  CB  . SER B 2 17  ? 55.325 154.344 59.716  1.00 194.55 ? 36  SER B CB  1 
ATOM   4326 O  OG  . SER B 2 17  ? 55.967 154.165 60.966  1.00 214.75 ? 36  SER B OG  1 
ATOM   4327 N  N   . VAL B 2 18  ? 53.318 155.919 57.940  1.00 166.21 ? 37  VAL B N   1 
ATOM   4328 C  CA  . VAL B 2 18  ? 52.702 156.209 56.649  1.00 170.08 ? 37  VAL B CA  1 
ATOM   4329 C  C   . VAL B 2 18  ? 53.622 157.134 55.864  1.00 182.30 ? 37  VAL B C   1 
ATOM   4330 O  O   . VAL B 2 18  ? 54.336 157.961 56.436  1.00 174.11 ? 37  VAL B O   1 
ATOM   4331 C  CB  . VAL B 2 18  ? 51.288 156.820 56.824  1.00 160.52 ? 37  VAL B CB  1 
ATOM   4332 C  CG1 . VAL B 2 18  ? 51.366 158.192 57.479  1.00 168.54 ? 37  VAL B CG1 1 
ATOM   4333 C  CG2 . VAL B 2 18  ? 50.554 156.886 55.490  1.00 149.74 ? 37  VAL B CG2 1 
ATOM   4334 N  N   . LYS B 2 19  ? 53.612 156.981 54.540  1.00 169.80 ? 38  LYS B N   1 
ATOM   4335 C  CA  . LYS B 2 19  ? 54.439 157.787 53.651  1.00 157.56 ? 38  LYS B CA  1 
ATOM   4336 C  C   . LYS B 2 19  ? 53.567 158.406 52.569  1.00 151.90 ? 38  LYS B C   1 
ATOM   4337 O  O   . LYS B 2 19  ? 52.752 157.713 51.952  1.00 184.00 ? 38  LYS B O   1 
ATOM   4338 C  CB  . LYS B 2 19  ? 55.555 156.949 53.017  1.00 183.03 ? 38  LYS B CB  1 
ATOM   4339 C  CG  . LYS B 2 19  ? 56.470 157.738 52.091  1.00 195.51 ? 38  LYS B CG  1 
ATOM   4340 C  CD  . LYS B 2 19  ? 57.520 156.847 51.445  1.00 181.92 ? 38  LYS B CD  1 
ATOM   4341 C  CE  . LYS B 2 19  ? 58.448 156.237 52.483  1.00 182.13 ? 38  LYS B CE  1 
ATOM   4342 N  NZ  . LYS B 2 19  ? 59.502 155.393 51.855  1.00 188.95 ? 38  LYS B NZ  1 
ATOM   4343 N  N   . ILE B 2 20  ? 53.744 159.706 52.342  1.00 135.31 ? 39  ILE B N   1 
ATOM   4344 C  CA  . ILE B 2 20  ? 53.008 160.455 51.331  1.00 151.66 ? 39  ILE B CA  1 
ATOM   4345 C  C   . ILE B 2 20  ? 54.008 161.031 50.340  1.00 182.74 ? 39  ILE B C   1 
ATOM   4346 O  O   . ILE B 2 20  ? 55.054 161.556 50.739  1.00 188.68 ? 39  ILE B O   1 
ATOM   4347 C  CB  . ILE B 2 20  ? 52.162 161.580 51.964  1.00 142.35 ? 39  ILE B CB  1 
ATOM   4348 C  CG1 . ILE B 2 20  ? 51.231 161.012 53.036  1.00 158.87 ? 39  ILE B CG1 1 
ATOM   4349 C  CG2 . ILE B 2 20  ? 51.367 162.320 50.899  1.00 133.51 ? 39  ILE B CG2 1 
ATOM   4350 C  CD1 . ILE B 2 20  ? 50.475 162.071 53.805  1.00 167.95 ? 39  ILE B CD1 1 
ATOM   4351 N  N   . SER B 2 21  ? 53.694 160.929 49.051  1.00 191.95 ? 40  SER B N   1 
ATOM   4352 C  CA  . SER B 2 21  ? 54.579 161.449 48.021  1.00 167.85 ? 40  SER B CA  1 
ATOM   4353 C  C   . SER B 2 21  ? 54.047 162.756 47.437  1.00 163.14 ? 40  SER B C   1 
ATOM   4354 O  O   . SER B 2 21  ? 52.928 163.194 47.713  1.00 177.64 ? 40  SER B O   1 
ATOM   4355 C  CB  . SER B 2 21  ? 54.768 160.413 46.909  1.00 158.79 ? 40  SER B CB  1 
ATOM   4356 O  OG  . SER B 2 21  ? 53.533 160.104 46.286  1.00 163.41 ? 40  SER B OG  1 
ATOM   4357 N  N   . CYS B 2 22  ? 54.888 163.376 46.612  1.00 134.45 ? 41  CYS B N   1 
ATOM   4358 C  CA  . CYS B 2 22  ? 54.582 164.603 45.893  1.00 128.79 ? 41  CYS B CA  1 
ATOM   4359 C  C   . CYS B 2 22  ? 55.299 164.534 44.553  1.00 175.45 ? 41  CYS B C   1 
ATOM   4360 O  O   . CYS B 2 22  ? 56.522 164.364 44.523  1.00 171.90 ? 41  CYS B O   1 
ATOM   4361 C  CB  . CYS B 2 22  ? 55.041 165.829 46.689  1.00 131.75 ? 41  CYS B CB  1 
ATOM   4362 S  SG  . CYS B 2 22  ? 54.290 167.409 46.234  1.00 111.85 ? 41  CYS B SG  1 
ATOM   4363 N  N   . LYS B 2 23  ? 54.562 164.705 43.460  1.00 160.78 ? 42  LYS B N   1 
ATOM   4364 C  CA  . LYS B 2 23  ? 55.133 164.656 42.117  1.00 123.73 ? 42  LYS B CA  1 
ATOM   4365 C  C   . LYS B 2 23  ? 55.076 166.057 41.523  1.00 132.75 ? 42  LYS B C   1 
ATOM   4366 O  O   . LYS B 2 23  ? 53.994 166.564 41.209  1.00 118.87 ? 42  LYS B O   1 
ATOM   4367 C  CB  . LYS B 2 23  ? 54.391 163.650 41.239  1.00 136.99 ? 42  LYS B CB  1 
ATOM   4368 C  CG  . LYS B 2 23  ? 54.824 163.658 39.778  1.00 160.83 ? 42  LYS B CG  1 
ATOM   4369 C  CD  . LYS B 2 23  ? 56.314 163.396 39.632  1.00 173.02 ? 42  LYS B CD  1 
ATOM   4370 C  CE  . LYS B 2 23  ? 56.748 163.488 38.176  1.00 180.44 ? 42  LYS B CE  1 
ATOM   4371 N  NZ  . LYS B 2 23  ? 58.213 163.274 38.016  1.00 184.92 ? 42  LYS B NZ  1 
ATOM   4372 N  N   . ALA B 2 24  ? 56.241 166.674 41.361  1.00 140.26 ? 43  ALA B N   1 
ATOM   4373 C  CA  . ALA B 2 24  ? 56.349 168.042 40.879  1.00 137.20 ? 43  ALA B CA  1 
ATOM   4374 C  C   . ALA B 2 24  ? 56.564 168.059 39.372  1.00 142.49 ? 43  ALA B C   1 
ATOM   4375 O  O   . ALA B 2 24  ? 57.278 167.214 38.825  1.00 121.19 ? 43  ALA B O   1 
ATOM   4376 C  CB  . ALA B 2 24  ? 57.499 168.772 41.577  1.00 121.59 ? 43  ALA B CB  1 
ATOM   4377 N  N   . SER B 2 25  ? 55.938 169.026 38.707  1.00 160.70 ? 44  SER B N   1 
ATOM   4378 C  CA  . SER B 2 25  ? 56.091 169.186 37.268  1.00 148.67 ? 44  SER B CA  1 
ATOM   4379 C  C   . SER B 2 25  ? 55.780 170.629 36.899  1.00 141.31 ? 44  SER B C   1 
ATOM   4380 O  O   . SER B 2 25  ? 55.143 171.360 37.661  1.00 151.87 ? 44  SER B O   1 
ATOM   4381 C  CB  . SER B 2 25  ? 55.187 168.219 36.496  1.00 168.78 ? 44  SER B CB  1 
ATOM   4382 O  OG  . SER B 2 25  ? 53.832 168.369 36.883  1.00 183.29 ? 44  SER B OG  1 
ATOM   4383 N  N   . GLY B 2 26  ? 56.246 171.030 35.717  1.00 92.66  ? 45  GLY B N   1 
ATOM   4384 C  CA  . GLY B 2 26  ? 56.005 172.365 35.211  1.00 133.37 ? 45  GLY B CA  1 
ATOM   4385 C  C   . GLY B 2 26  ? 57.006 173.415 35.642  1.00 137.23 ? 45  GLY B C   1 
ATOM   4386 O  O   . GLY B 2 26  ? 56.831 174.591 35.294  1.00 94.78  ? 45  GLY B O   1 
ATOM   4387 N  N   . TYR B 2 27  ? 58.044 173.037 36.383  1.00 157.36 ? 46  TYR B N   1 
ATOM   4388 C  CA  . TYR B 2 27  ? 59.053 173.980 36.843  1.00 146.85 ? 46  TYR B CA  1 
ATOM   4389 C  C   . TYR B 2 27  ? 60.342 173.215 37.101  1.00 145.81 ? 46  TYR B C   1 
ATOM   4390 O  O   . TYR B 2 27  ? 60.341 171.985 37.207  1.00 133.83 ? 46  TYR B O   1 
ATOM   4391 C  CB  . TYR B 2 27  ? 58.599 174.719 38.107  1.00 126.72 ? 46  TYR B CB  1 
ATOM   4392 C  CG  . TYR B 2 27  ? 58.617 173.860 39.352  1.00 153.22 ? 46  TYR B CG  1 
ATOM   4393 C  CD1 . TYR B 2 27  ? 57.578 172.983 39.632  1.00 170.54 ? 46  TYR B CD1 1 
ATOM   4394 C  CD2 . TYR B 2 27  ? 59.674 173.927 40.247  1.00 149.03 ? 46  TYR B CD2 1 
ATOM   4395 C  CE1 . TYR B 2 27  ? 57.595 172.196 40.770  1.00 137.17 ? 46  TYR B CE1 1 
ATOM   4396 C  CE2 . TYR B 2 27  ? 59.705 173.141 41.381  1.00 140.32 ? 46  TYR B CE2 1 
ATOM   4397 C  CZ  . TYR B 2 27  ? 58.662 172.281 41.641  1.00 134.67 ? 46  TYR B CZ  1 
ATOM   4398 O  OH  . TYR B 2 27  ? 58.689 171.503 42.775  1.00 139.96 ? 46  TYR B OH  1 
ATOM   4399 N  N   . THR B 2 28  ? 61.445 173.955 37.203  1.00 162.25 ? 47  THR B N   1 
ATOM   4400 C  CA  . THR B 2 28  ? 62.726 173.330 37.511  1.00 153.16 ? 47  THR B CA  1 
ATOM   4401 C  C   . THR B 2 28  ? 62.715 172.851 38.957  1.00 144.76 ? 47  THR B C   1 
ATOM   4402 O  O   . THR B 2 28  ? 62.593 173.657 39.885  1.00 134.74 ? 47  THR B O   1 
ATOM   4403 C  CB  . THR B 2 28  ? 63.870 174.316 37.282  1.00 139.30 ? 47  THR B CB  1 
ATOM   4404 O  OG1 . THR B 2 28  ? 63.822 174.807 35.936  1.00 168.06 ? 47  THR B OG1 1 
ATOM   4405 C  CG2 . THR B 2 28  ? 65.213 173.639 37.523  1.00 141.52 ? 47  THR B CG2 1 
ATOM   4406 N  N   . PHE B 2 29  ? 62.896 171.542 39.150  1.00 134.64 ? 48  PHE B N   1 
ATOM   4407 C  CA  . PHE B 2 29  ? 62.654 170.949 40.462  1.00 101.75 ? 48  PHE B CA  1 
ATOM   4408 C  C   . PHE B 2 29  ? 63.747 171.302 41.459  1.00 104.23 ? 48  PHE B C   1 
ATOM   4409 O  O   . PHE B 2 29  ? 63.490 171.350 42.668  1.00 117.97 ? 48  PHE B O   1 
ATOM   4410 C  CB  . PHE B 2 29  ? 62.522 169.432 40.334  1.00 105.07 ? 48  PHE B CB  1 
ATOM   4411 C  CG  . PHE B 2 29  ? 62.233 168.737 41.633  1.00 133.44 ? 48  PHE B CG  1 
ATOM   4412 C  CD1 . PHE B 2 29  ? 60.960 168.759 42.177  1.00 145.71 ? 48  PHE B CD1 1 
ATOM   4413 C  CD2 . PHE B 2 29  ? 63.233 168.058 42.309  1.00 132.25 ? 48  PHE B CD2 1 
ATOM   4414 C  CE1 . PHE B 2 29  ? 60.690 168.120 43.372  1.00 134.90 ? 48  PHE B CE1 1 
ATOM   4415 C  CE2 . PHE B 2 29  ? 62.969 167.417 43.504  1.00 126.13 ? 48  PHE B CE2 1 
ATOM   4416 C  CZ  . PHE B 2 29  ? 61.695 167.448 44.036  1.00 99.53  ? 48  PHE B CZ  1 
ATOM   4417 N  N   . THR B 2 30  ? 64.962 171.553 40.981  1.00 137.38 ? 49  THR B N   1 
ATOM   4418 C  CA  . THR B 2 30  ? 66.083 171.883 41.849  1.00 137.58 ? 49  THR B CA  1 
ATOM   4419 C  C   . THR B 2 30  ? 66.108 173.350 42.260  1.00 153.87 ? 49  THR B C   1 
ATOM   4420 O  O   . THR B 2 30  ? 66.959 173.733 43.070  1.00 145.36 ? 49  THR B O   1 
ATOM   4421 C  CB  . THR B 2 30  ? 67.400 171.518 41.158  1.00 153.39 ? 49  THR B CB  1 
ATOM   4422 O  OG1 . THR B 2 30  ? 67.531 172.276 39.948  1.00 209.01 ? 49  THR B OG1 1 
ATOM   4423 C  CG2 . THR B 2 30  ? 67.431 170.034 40.824  1.00 136.36 ? 49  THR B CG2 1 
ATOM   4424 N  N   . ASP B 2 31  ? 65.208 174.176 41.726  1.00 172.33 ? 50  ASP B N   1 
ATOM   4425 C  CA  . ASP B 2 31  ? 65.229 175.608 41.993  1.00 175.36 ? 50  ASP B CA  1 
ATOM   4426 C  C   . ASP B 2 31  ? 64.477 176.019 43.252  1.00 171.45 ? 50  ASP B C   1 
ATOM   4427 O  O   . ASP B 2 31  ? 64.656 177.150 43.714  1.00 172.89 ? 50  ASP B O   1 
ATOM   4428 C  CB  . ASP B 2 31  ? 64.642 176.377 40.803  1.00 203.02 ? 50  ASP B CB  1 
ATOM   4429 C  CG  . ASP B 2 31  ? 65.688 176.742 39.769  1.00 221.07 ? 50  ASP B CG  1 
ATOM   4430 O  OD1 . ASP B 2 31  ? 66.869 176.890 40.142  1.00 206.12 ? 50  ASP B OD1 1 
ATOM   4431 O  OD2 . ASP B 2 31  ? 65.326 176.893 38.584  1.00 245.10 ? 50  ASP B OD2 1 
ATOM   4432 N  N   . TYR B 2 32  ? 63.646 175.149 43.823  1.00 156.17 ? 51  TYR B N   1 
ATOM   4433 C  CA  . TYR B 2 32  ? 62.735 175.585 44.872  1.00 107.12 ? 51  TYR B CA  1 
ATOM   4434 C  C   . TYR B 2 32  ? 62.708 174.602 46.033  1.00 120.95 ? 51  TYR B C   1 
ATOM   4435 O  O   . TYR B 2 32  ? 62.905 173.396 45.861  1.00 106.25 ? 51  TYR B O   1 
ATOM   4436 C  CB  . TYR B 2 32  ? 61.314 175.768 44.332  1.00 101.35 ? 51  TYR B CB  1 
ATOM   4437 C  CG  . TYR B 2 32  ? 61.177 176.843 43.277  1.00 116.54 ? 51  TYR B CG  1 
ATOM   4438 C  CD1 . TYR B 2 32  ? 60.952 178.166 43.632  1.00 101.94 ? 51  TYR B CD1 1 
ATOM   4439 C  CD2 . TYR B 2 32  ? 61.266 176.533 41.927  1.00 132.47 ? 51  TYR B CD2 1 
ATOM   4440 C  CE1 . TYR B 2 32  ? 60.823 179.152 42.671  1.00 102.32 ? 51  TYR B CE1 1 
ATOM   4441 C  CE2 . TYR B 2 32  ? 61.139 177.512 40.959  1.00 114.74 ? 51  TYR B CE2 1 
ATOM   4442 C  CZ  . TYR B 2 32  ? 60.917 178.820 41.337  1.00 101.90 ? 51  TYR B CZ  1 
ATOM   4443 O  OH  . TYR B 2 32  ? 60.790 179.798 40.377  1.00 156.16 ? 51  TYR B OH  1 
ATOM   4444 N  N   . TYR B 2 33  ? 62.457 175.149 47.221  1.00 143.42 ? 52  TYR B N   1 
ATOM   4445 C  CA  . TYR B 2 33  ? 62.176 174.346 48.402  1.00 132.34 ? 52  TYR B CA  1 
ATOM   4446 C  C   . TYR B 2 33  ? 60.836 173.633 48.265  1.00 122.76 ? 52  TYR B C   1 
ATOM   4447 O  O   . TYR B 2 33  ? 59.860 174.197 47.758  1.00 115.45 ? 52  TYR B O   1 
ATOM   4448 C  CB  . TYR B 2 33  ? 62.145 175.230 49.650  1.00 130.31 ? 52  TYR B CB  1 
ATOM   4449 C  CG  . TYR B 2 33  ? 63.482 175.490 50.303  1.00 124.77 ? 52  TYR B CG  1 
ATOM   4450 C  CD1 . TYR B 2 33  ? 64.436 174.488 50.409  1.00 140.83 ? 52  TYR B CD1 1 
ATOM   4451 C  CD2 . TYR B 2 33  ? 63.784 176.741 50.829  1.00 126.92 ? 52  TYR B CD2 1 
ATOM   4452 C  CE1 . TYR B 2 33  ? 65.655 174.726 51.015  1.00 149.89 ? 52  TYR B CE1 1 
ATOM   4453 C  CE2 . TYR B 2 33  ? 65.000 176.988 51.434  1.00 130.90 ? 52  TYR B CE2 1 
ATOM   4454 C  CZ  . TYR B 2 33  ? 65.932 175.978 51.525  1.00 138.66 ? 52  TYR B CZ  1 
ATOM   4455 O  OH  . TYR B 2 33  ? 67.145 176.218 52.127  1.00 152.93 ? 52  TYR B OH  1 
ATOM   4456 N  N   . MET B 2 34  ? 60.787 172.393 48.742  1.00 114.78 ? 53  MET B N   1 
ATOM   4457 C  CA  . MET B 2 34  ? 59.547 171.637 48.845  1.00 141.29 ? 53  MET B CA  1 
ATOM   4458 C  C   . MET B 2 34  ? 59.108 171.605 50.304  1.00 169.72 ? 53  MET B C   1 
ATOM   4459 O  O   . MET B 2 34  ? 59.925 171.355 51.196  1.00 158.05 ? 53  MET B O   1 
ATOM   4460 C  CB  . MET B 2 34  ? 59.720 170.216 48.307  1.00 114.56 ? 53  MET B CB  1 
ATOM   4461 C  CG  . MET B 2 34  ? 58.435 169.405 48.287  1.00 130.36 ? 53  MET B CG  1 
ATOM   4462 S  SD  . MET B 2 34  ? 57.162 170.132 47.236  1.00 161.81 ? 53  MET B SD  1 
ATOM   4463 C  CE  . MET B 2 34  ? 58.009 170.171 45.660  1.00 124.91 ? 53  MET B CE  1 
ATOM   4464 N  N   . ASN B 2 35  ? 57.822 171.851 50.540  1.00 186.60 ? 54  ASN B N   1 
ATOM   4465 C  CA  . ASN B 2 35  ? 57.288 172.035 51.881  1.00 121.23 ? 54  ASN B CA  1 
ATOM   4466 C  C   . ASN B 2 35  ? 56.088 171.123 52.095  1.00 127.33 ? 54  ASN B C   1 
ATOM   4467 O  O   . ASN B 2 35  ? 55.507 170.586 51.148  1.00 106.60 ? 54  ASN B O   1 
ATOM   4468 C  CB  . ASN B 2 35  ? 56.871 173.494 52.124  1.00 137.05 ? 54  ASN B CB  1 
ATOM   4469 C  CG  . ASN B 2 35  ? 58.010 174.472 51.913  1.00 119.53 ? 54  ASN B CG  1 
ATOM   4470 O  OD1 . ASN B 2 35  ? 58.556 175.021 52.870  1.00 123.78 ? 54  ASN B OD1 1 
ATOM   4471 N  ND2 . ASN B 2 35  ? 58.371 174.700 50.655  1.00 119.44 ? 54  ASN B ND2 1 
ATOM   4472 N  N   . TRP B 2 36  ? 55.717 170.964 53.365  1.00 137.00 ? 55  TRP B N   1 
ATOM   4473 C  CA  . TRP B 2 36  ? 54.545 170.190 53.749  1.00 142.07 ? 55  TRP B CA  1 
ATOM   4474 C  C   . TRP B 2 36  ? 53.788 170.937 54.836  1.00 153.51 ? 55  TRP B C   1 
ATOM   4475 O  O   . TRP B 2 36  ? 54.378 171.339 55.844  1.00 120.01 ? 55  TRP B O   1 
ATOM   4476 C  CB  . TRP B 2 36  ? 54.937 168.790 54.235  1.00 117.61 ? 55  TRP B CB  1 
ATOM   4477 C  CG  . TRP B 2 36  ? 55.443 167.905 53.140  1.00 121.72 ? 55  TRP B CG  1 
ATOM   4478 C  CD1 . TRP B 2 36  ? 56.727 167.810 52.692  1.00 152.88 ? 55  TRP B CD1 1 
ATOM   4479 C  CD2 . TRP B 2 36  ? 54.672 166.992 52.349  1.00 122.33 ? 55  TRP B CD2 1 
ATOM   4480 N  NE1 . TRP B 2 36  ? 56.806 166.891 51.673  1.00 181.27 ? 55  TRP B NE1 1 
ATOM   4481 C  CE2 . TRP B 2 36  ? 55.558 166.375 51.443  1.00 155.22 ? 55  TRP B CE2 1 
ATOM   4482 C  CE3 . TRP B 2 36  ? 53.321 166.635 52.320  1.00 138.29 ? 55  TRP B CE3 1 
ATOM   4483 C  CZ2 . TRP B 2 36  ? 55.135 165.422 50.519  1.00 161.86 ? 55  TRP B CZ2 1 
ATOM   4484 C  CZ3 . TRP B 2 36  ? 52.903 165.689 51.401  1.00 169.85 ? 55  TRP B CZ3 1 
ATOM   4485 C  CH2 . TRP B 2 36  ? 53.807 165.094 50.514  1.00 180.23 ? 55  TRP B CH2 1 
ATOM   4486 N  N   . VAL B 2 37  ? 52.488 171.120 54.626  1.00 166.49 ? 56  VAL B N   1 
ATOM   4487 C  CA  . VAL B 2 37  ? 51.626 171.848 55.550  1.00 151.75 ? 56  VAL B CA  1 
ATOM   4488 C  C   . VAL B 2 37  ? 50.512 170.912 55.997  1.00 152.39 ? 56  VAL B C   1 
ATOM   4489 O  O   . VAL B 2 37  ? 49.789 170.353 55.164  1.00 162.92 ? 56  VAL B O   1 
ATOM   4490 C  CB  . VAL B 2 37  ? 51.049 173.121 54.911  1.00 143.38 ? 56  VAL B CB  1 
ATOM   4491 C  CG1 . VAL B 2 37  ? 50.095 173.811 55.874  1.00 172.16 ? 56  VAL B CG1 1 
ATOM   4492 C  CG2 . VAL B 2 37  ? 52.171 174.064 54.502  1.00 131.29 ? 56  VAL B CG2 1 
ATOM   4493 N  N   . LYS B 2 38  ? 50.382 170.741 57.309  1.00 132.54 ? 57  LYS B N   1 
ATOM   4494 C  CA  . LYS B 2 38  ? 49.312 169.951 57.898  1.00 124.39 ? 57  LYS B CA  1 
ATOM   4495 C  C   . LYS B 2 38  ? 48.137 170.856 58.244  1.00 149.81 ? 57  LYS B C   1 
ATOM   4496 O  O   . LYS B 2 38  ? 48.306 171.868 58.932  1.00 162.11 ? 57  LYS B O   1 
ATOM   4497 C  CB  . LYS B 2 38  ? 49.809 169.229 59.151  1.00 120.79 ? 57  LYS B CB  1 
ATOM   4498 C  CG  . LYS B 2 38  ? 48.706 168.714 60.060  1.00 119.27 ? 57  LYS B CG  1 
ATOM   4499 C  CD  . LYS B 2 38  ? 49.277 168.216 61.379  1.00 129.17 ? 57  LYS B CD  1 
ATOM   4500 C  CE  . LYS B 2 38  ? 48.177 167.830 62.354  1.00 163.03 ? 57  LYS B CE  1 
ATOM   4501 N  NZ  . LYS B 2 38  ? 48.728 167.412 63.672  1.00 141.21 ? 57  LYS B NZ  1 
ATOM   4502 N  N   . GLN B 2 39  ? 46.953 170.494 57.758  1.00 156.94 ? 58  GLN B N   1 
ATOM   4503 C  CA  . GLN B 2 39  ? 45.719 171.206 58.075  1.00 165.87 ? 58  GLN B CA  1 
ATOM   4504 C  C   . GLN B 2 39  ? 44.767 170.230 58.752  1.00 196.52 ? 58  GLN B C   1 
ATOM   4505 O  O   . GLN B 2 39  ? 44.280 169.287 58.117  1.00 175.28 ? 58  GLN B O   1 
ATOM   4506 C  CB  . GLN B 2 39  ? 45.088 171.806 56.820  1.00 118.02 ? 58  GLN B CB  1 
ATOM   4507 C  CG  . GLN B 2 39  ? 43.841 172.629 57.097  1.00 123.63 ? 58  GLN B CG  1 
ATOM   4508 C  CD  . GLN B 2 39  ? 43.217 173.190 55.836  1.00 156.37 ? 58  GLN B CD  1 
ATOM   4509 O  OE1 . GLN B 2 39  ? 43.484 172.714 54.733  1.00 158.76 ? 58  GLN B OE1 1 
ATOM   4510 N  NE2 . GLN B 2 39  ? 42.383 174.212 55.992  1.00 161.46 ? 58  GLN B NE2 1 
ATOM   4511 N  N   . SER B 2 40  ? 44.507 170.457 60.038  1.00 195.35 ? 59  SER B N   1 
ATOM   4512 C  CA  . SER B 2 40  ? 43.543 169.653 60.769  1.00 183.72 ? 59  SER B CA  1 
ATOM   4513 C  C   . SER B 2 40  ? 42.122 170.039 60.368  1.00 224.99 ? 59  SER B C   1 
ATOM   4514 O  O   . SER B 2 40  ? 41.868 171.131 59.853  1.00 254.20 ? 59  SER B O   1 
ATOM   4515 C  CB  . SER B 2 40  ? 43.731 169.825 62.276  1.00 186.12 ? 59  SER B CB  1 
ATOM   4516 O  OG  . SER B 2 40  ? 45.061 169.530 62.664  1.00 205.49 ? 59  SER B OG  1 
ATOM   4517 N  N   . HIS B 2 41  ? 41.190 169.118 60.604  1.00 223.44 ? 60  HIS B N   1 
ATOM   4518 C  CA  . HIS B 2 41  ? 39.793 169.372 60.276  1.00 246.25 ? 60  HIS B CA  1 
ATOM   4519 C  C   . HIS B 2 41  ? 39.273 170.555 61.082  1.00 237.88 ? 60  HIS B C   1 
ATOM   4520 O  O   . HIS B 2 41  ? 39.349 170.560 62.315  1.00 238.30 ? 60  HIS B O   1 
ATOM   4521 C  CB  . HIS B 2 41  ? 38.954 168.125 60.548  1.00 254.81 ? 60  HIS B CB  1 
ATOM   4522 C  CG  . HIS B 2 41  ? 37.512 168.274 60.179  1.00 250.99 ? 60  HIS B CG  1 
ATOM   4523 N  ND1 . HIS B 2 41  ? 37.099 168.594 58.903  1.00 240.70 ? 60  HIS B ND1 1 
ATOM   4524 C  CD2 . HIS B 2 41  ? 36.384 168.147 60.917  1.00 230.58 ? 60  HIS B CD2 1 
ATOM   4525 C  CE1 . HIS B 2 41  ? 35.780 168.657 58.872  1.00 223.58 ? 60  HIS B CE1 1 
ATOM   4526 N  NE2 . HIS B 2 41  ? 35.322 168.390 60.081  1.00 227.45 ? 60  HIS B NE2 1 
ATOM   4527 N  N   . GLY B 2 42  ? 38.743 171.557 60.383  1.00 212.29 ? 61  GLY B N   1 
ATOM   4528 C  CA  . GLY B 2 42  ? 38.249 172.758 61.021  1.00 216.19 ? 61  GLY B CA  1 
ATOM   4529 C  C   . GLY B 2 42  ? 39.304 173.660 61.623  1.00 236.24 ? 61  GLY B C   1 
ATOM   4530 O  O   . GLY B 2 42  ? 38.950 174.706 62.180  1.00 251.41 ? 61  GLY B O   1 
ATOM   4531 N  N   . LYS B 2 43  ? 40.582 173.300 61.532  1.00 243.27 ? 62  LYS B N   1 
ATOM   4532 C  CA  . LYS B 2 43  ? 41.660 174.085 62.111  1.00 235.85 ? 62  LYS B CA  1 
ATOM   4533 C  C   . LYS B 2 43  ? 42.412 174.841 61.017  1.00 214.66 ? 62  LYS B C   1 
ATOM   4534 O  O   . LYS B 2 43  ? 42.073 174.785 59.833  1.00 206.51 ? 62  LYS B O   1 
ATOM   4535 C  CB  . LYS B 2 43  ? 42.604 173.186 62.913  1.00 217.33 ? 62  LYS B CB  1 
ATOM   4536 C  CG  . LYS B 2 43  ? 41.973 172.575 64.154  1.00 216.64 ? 62  LYS B CG  1 
ATOM   4537 C  CD  . LYS B 2 43  ? 41.481 173.655 65.106  1.00 230.67 ? 62  LYS B CD  1 
ATOM   4538 C  CE  . LYS B 2 43  ? 40.837 173.053 66.346  1.00 261.15 ? 62  LYS B CE  1 
ATOM   4539 N  NZ  . LYS B 2 43  ? 40.340 174.103 67.279  1.00 263.29 ? 62  LYS B NZ  1 
ATOM   4540 N  N   . SER B 2 44  ? 43.454 175.561 61.430  1.00 195.19 ? 63  SER B N   1 
ATOM   4541 C  CA  . SER B 2 44  ? 44.235 176.391 60.529  1.00 181.06 ? 63  SER B CA  1 
ATOM   4542 C  C   . SER B 2 44  ? 45.411 175.602 59.954  1.00 195.90 ? 63  SER B C   1 
ATOM   4543 O  O   . SER B 2 44  ? 45.622 174.427 60.265  1.00 211.71 ? 63  SER B O   1 
ATOM   4544 C  CB  . SER B 2 44  ? 44.716 177.647 61.253  1.00 151.12 ? 63  SER B CB  1 
ATOM   4545 O  OG  . SER B 2 44  ? 45.485 178.472 60.395  1.00 159.27 ? 63  SER B OG  1 
ATOM   4546 N  N   . LEU B 2 45  ? 46.192 176.264 59.104  1.00 167.10 ? 64  LEU B N   1 
ATOM   4547 C  CA  . LEU B 2 45  ? 47.349 175.640 58.480  1.00 112.30 ? 64  LEU B CA  1 
ATOM   4548 C  C   . LEU B 2 45  ? 48.530 175.614 59.442  1.00 149.17 ? 64  LEU B C   1 
ATOM   4549 O  O   . LEU B 2 45  ? 48.717 176.521 60.259  1.00 152.94 ? 64  LEU B O   1 
ATOM   4550 C  CB  . LEU B 2 45  ? 47.735 176.386 57.203  1.00 108.66 ? 64  LEU B CB  1 
ATOM   4551 C  CG  . LEU B 2 45  ? 46.653 176.492 56.127  1.00 137.96 ? 64  LEU B CG  1 
ATOM   4552 C  CD1 . LEU B 2 45  ? 47.145 177.314 54.945  1.00 111.45 ? 64  LEU B CD1 1 
ATOM   4553 C  CD2 . LEU B 2 45  ? 46.216 175.109 55.676  1.00 158.99 ? 64  LEU B CD2 1 
ATOM   4554 N  N   . GLU B 2 46  ? 49.335 174.557 59.337  1.00 167.20 ? 65  GLU B N   1 
ATOM   4555 C  CA  . GLU B 2 46  ? 50.484 174.367 60.216  1.00 155.64 ? 65  GLU B CA  1 
ATOM   4556 C  C   . GLU B 2 46  ? 51.678 173.943 59.376  1.00 170.13 ? 65  GLU B C   1 
ATOM   4557 O  O   . GLU B 2 46  ? 51.642 172.892 58.732  1.00 150.05 ? 65  GLU B O   1 
ATOM   4558 C  CB  . GLU B 2 46  ? 50.177 173.320 61.291  1.00 135.26 ? 65  GLU B CB  1 
ATOM   4559 C  CG  . GLU B 2 46  ? 50.784 173.621 62.647  1.00 155.08 ? 65  GLU B CG  1 
ATOM   4560 C  CD  . GLU B 2 46  ? 50.178 172.776 63.750  1.00 188.23 ? 65  GLU B CD  1 
ATOM   4561 O  OE1 . GLU B 2 46  ? 49.458 171.806 63.430  1.00 178.33 ? 65  GLU B OE1 1 
ATOM   4562 O  OE2 . GLU B 2 46  ? 50.416 173.086 64.936  1.00 171.11 ? 65  GLU B OE2 1 
ATOM   4563 N  N   . TRP B 2 47  ? 52.736 174.750 59.389  1.00 196.58 ? 66  TRP B N   1 
ATOM   4564 C  CA  . TRP B 2 47  ? 53.922 174.452 58.596  1.00 156.77 ? 66  TRP B CA  1 
ATOM   4565 C  C   . TRP B 2 47  ? 54.740 173.356 59.267  1.00 144.68 ? 66  TRP B C   1 
ATOM   4566 O  O   . TRP B 2 47  ? 55.111 173.474 60.439  1.00 161.36 ? 66  TRP B O   1 
ATOM   4567 C  CB  . TRP B 2 47  ? 54.768 175.712 58.408  1.00 140.00 ? 66  TRP B CB  1 
ATOM   4568 C  CG  . TRP B 2 47  ? 56.011 175.491 57.599  1.00 165.13 ? 66  TRP B CG  1 
ATOM   4569 C  CD1 . TRP B 2 47  ? 56.083 175.226 56.261  1.00 175.62 ? 66  TRP B CD1 1 
ATOM   4570 C  CD2 . TRP B 2 47  ? 57.362 175.528 58.073  1.00 156.02 ? 66  TRP B CD2 1 
ATOM   4571 N  NE1 . TRP B 2 47  ? 57.395 175.089 55.876  1.00 156.04 ? 66  TRP B NE1 1 
ATOM   4572 C  CE2 . TRP B 2 47  ? 58.200 175.271 56.970  1.00 140.89 ? 66  TRP B CE2 1 
ATOM   4573 C  CE3 . TRP B 2 47  ? 57.944 175.751 59.324  1.00 158.27 ? 66  TRP B CE3 1 
ATOM   4574 C  CZ2 . TRP B 2 47  ? 59.588 175.232 57.080  1.00 148.91 ? 66  TRP B CZ2 1 
ATOM   4575 C  CZ3 . TRP B 2 47  ? 59.323 175.711 59.432  1.00 143.54 ? 66  TRP B CZ3 1 
ATOM   4576 C  CH2 . TRP B 2 47  ? 60.128 175.453 58.316  1.00 141.73 ? 66  TRP B CH2 1 
ATOM   4577 N  N   . ILE B 2 48  ? 55.018 172.287 58.522  1.00 107.15 ? 67  ILE B N   1 
ATOM   4578 C  CA  . ILE B 2 48  ? 55.779 171.161 59.052  1.00 108.50 ? 67  ILE B CA  1 
ATOM   4579 C  C   . ILE B 2 48  ? 57.268 171.431 58.880  1.00 140.60 ? 67  ILE B C   1 
ATOM   4580 O  O   . ILE B 2 48  ? 58.002 171.575 59.864  1.00 117.15 ? 67  ILE B O   1 
ATOM   4581 C  CB  . ILE B 2 48  ? 55.376 169.841 58.369  1.00 126.35 ? 67  ILE B CB  1 
ATOM   4582 C  CG1 . ILE B 2 48  ? 53.886 169.565 58.580  1.00 140.41 ? 67  ILE B CG1 1 
ATOM   4583 C  CG2 . ILE B 2 48  ? 56.211 168.689 58.904  1.00 107.12 ? 67  ILE B CG2 1 
ATOM   4584 C  CD1 . ILE B 2 48  ? 53.410 168.272 57.954  1.00 113.54 ? 67  ILE B CD1 1 
ATOM   4585 N  N   . GLY B 2 49  ? 57.721 171.498 57.635  1.00 177.76 ? 68  GLY B N   1 
ATOM   4586 C  CA  . GLY B 2 49  ? 59.125 171.742 57.358  1.00 168.10 ? 68  GLY B CA  1 
ATOM   4587 C  C   . GLY B 2 49  ? 59.374 171.679 55.869  1.00 164.73 ? 68  GLY B C   1 
ATOM   4588 O  O   . GLY B 2 49  ? 58.527 171.229 55.089  1.00 191.94 ? 68  GLY B O   1 
ATOM   4589 N  N   . ASN B 2 50  ? 60.559 172.140 55.481  1.00 145.35 ? 69  ASN B N   1 
ATOM   4590 C  CA  . ASN B 2 50  ? 60.962 172.158 54.085  1.00 147.53 ? 69  ASN B CA  1 
ATOM   4591 C  C   . ASN B 2 50  ? 62.198 171.293 53.876  1.00 137.58 ? 69  ASN B C   1 
ATOM   4592 O  O   . ASN B 2 50  ? 62.813 170.792 54.824  1.00 138.43 ? 69  ASN B O   1 
ATOM   4593 C  CB  . ASN B 2 50  ? 61.241 173.591 53.609  1.00 120.88 ? 69  ASN B CB  1 
ATOM   4594 C  CG  . ASN B 2 50  ? 62.477 174.192 54.252  1.00 125.09 ? 69  ASN B CG  1 
ATOM   4595 O  OD1 . ASN B 2 50  ? 62.406 174.782 55.330  1.00 169.72 ? 69  ASN B OD1 1 
ATOM   4596 N  ND2 . ASN B 2 50  ? 63.618 174.050 53.588  1.00 126.81 ? 69  ASN B ND2 1 
ATOM   4597 N  N   . ILE B 2 51  ? 62.574 171.159 52.607  1.00 151.64 ? 70  ILE B N   1 
ATOM   4598 C  CA  . ILE B 2 51  ? 63.719 170.352 52.203  1.00 163.83 ? 70  ILE B CA  1 
ATOM   4599 C  C   . ILE B 2 51  ? 64.305 170.957 50.934  1.00 154.75 ? 70  ILE B C   1 
ATOM   4600 O  O   . ILE B 2 51  ? 63.576 171.451 50.068  1.00 122.70 ? 70  ILE B O   1 
ATOM   4601 C  CB  . ILE B 2 51  ? 63.321 168.871 52.006  1.00 109.45 ? 70  ILE B CB  1 
ATOM   4602 C  CG1 . ILE B 2 51  ? 64.527 168.029 51.585  1.00 111.99 ? 70  ILE B CG1 1 
ATOM   4603 C  CG2 . ILE B 2 51  ? 62.188 168.743 50.998  1.00 110.78 ? 70  ILE B CG2 1 
ATOM   4604 C  CD1 . ILE B 2 51  ? 64.225 166.552 51.458  1.00 148.60 ? 70  ILE B CD1 1 
ATOM   4605 N  N   . ASN B 2 52  ? 65.634 170.925 50.838  1.00 150.65 ? 71  ASN B N   1 
ATOM   4606 C  CA  . ASN B 2 52  ? 66.363 171.424 49.685  1.00 124.76 ? 71  ASN B CA  1 
ATOM   4607 C  C   . ASN B 2 52  ? 66.635 170.249 48.766  1.00 128.99 ? 71  ASN B C   1 
ATOM   4608 O  O   . ASN B 2 52  ? 67.383 169.336 49.153  1.00 176.37 ? 71  ASN B O   1 
ATOM   4609 C  CB  . ASN B 2 52  ? 67.674 172.078 50.119  1.00 128.06 ? 71  ASN B CB  1 
ATOM   4610 C  CG  . ASN B 2 52  ? 68.334 172.870 49.006  1.00 127.97 ? 71  ASN B CG  1 
ATOM   4611 O  OD1 . ASN B 2 52  ? 68.155 172.575 47.823  1.00 161.84 ? 71  ASN B OD1 1 
ATOM   4612 N  ND2 . ASN B 2 52  ? 69.105 173.882 49.380  1.00 143.92 ? 71  ASN B ND2 1 
ATOM   4613 N  N   . PRO B 2 53  ? 66.060 170.217 47.560  1.00 134.65 ? 72  PRO B N   1 
ATOM   4614 C  CA  . PRO B 2 53  ? 66.194 169.023 46.712  1.00 140.91 ? 72  PRO B CA  1 
ATOM   4615 C  C   . PRO B 2 53  ? 67.603 168.779 46.208  1.00 156.71 ? 72  PRO B C   1 
ATOM   4616 O  O   . PRO B 2 53  ? 67.930 167.630 45.887  1.00 202.49 ? 72  PRO B O   1 
ATOM   4617 C  CB  . PRO B 2 53  ? 65.233 169.306 45.546  1.00 154.88 ? 72  PRO B CB  1 
ATOM   4618 C  CG  . PRO B 2 53  ? 64.335 170.408 46.031  1.00 127.22 ? 72  PRO B CG  1 
ATOM   4619 C  CD  . PRO B 2 53  ? 65.174 171.225 46.959  1.00 129.63 ? 72  PRO B CD  1 
ATOM   4620 N  N   . ASN B 2 54  ? 68.442 169.813 46.115  1.00 129.84 ? 73  ASN B N   1 
ATOM   4621 C  CA  . ASN B 2 54  ? 69.796 169.621 45.605  1.00 136.29 ? 73  ASN B CA  1 
ATOM   4622 C  C   . ASN B 2 54  ? 70.585 168.675 46.501  1.00 160.29 ? 73  ASN B C   1 
ATOM   4623 O  O   . ASN B 2 54  ? 71.024 167.603 46.067  1.00 180.36 ? 73  ASN B O   1 
ATOM   4624 C  CB  . ASN B 2 54  ? 70.504 170.971 45.489  1.00 136.29 ? 73  ASN B CB  1 
ATOM   4625 C  CG  . ASN B 2 54  ? 69.643 172.023 44.823  1.00 168.67 ? 73  ASN B CG  1 
ATOM   4626 O  OD1 . ASN B 2 54  ? 68.788 171.707 43.998  1.00 151.40 ? 73  ASN B OD1 1 
ATOM   4627 N  ND2 . ASN B 2 54  ? 69.859 173.283 45.184  1.00 172.11 ? 73  ASN B ND2 1 
ATOM   4628 N  N   . ASN B 2 55  ? 70.772 169.056 47.762  1.00 172.60 ? 74  ASN B N   1 
ATOM   4629 C  CA  . ASN B 2 55  ? 71.365 168.187 48.767  1.00 158.72 ? 74  ASN B CA  1 
ATOM   4630 C  C   . ASN B 2 55  ? 70.325 167.521 49.657  1.00 149.26 ? 74  ASN B C   1 
ATOM   4631 O  O   . ASN B 2 55  ? 70.691 166.716 50.520  1.00 168.15 ? 74  ASN B O   1 
ATOM   4632 C  CB  . ASN B 2 55  ? 72.356 168.976 49.629  1.00 155.93 ? 74  ASN B CB  1 
ATOM   4633 C  CG  . ASN B 2 55  ? 71.691 170.101 50.396  1.00 155.34 ? 74  ASN B CG  1 
ATOM   4634 O  OD1 . ASN B 2 55  ? 70.656 170.623 49.984  1.00 160.10 ? 74  ASN B OD1 1 
ATOM   4635 N  ND2 . ASN B 2 55  ? 72.287 170.481 51.521  1.00 172.35 ? 74  ASN B ND2 1 
ATOM   4636 N  N   . GLY B 2 56  ? 69.046 167.831 49.468  1.00 192.63 ? 75  GLY B N   1 
ATOM   4637 C  CA  . GLY B 2 56  ? 68.018 167.339 50.365  1.00 204.88 ? 75  GLY B CA  1 
ATOM   4638 C  C   . GLY B 2 56  ? 68.077 167.935 51.754  1.00 184.12 ? 75  GLY B C   1 
ATOM   4639 O  O   . GLY B 2 56  ? 67.704 167.265 52.722  1.00 158.18 ? 75  GLY B O   1 
ATOM   4640 N  N   . GLY B 2 57  ? 68.545 169.175 51.881  1.00 192.41 ? 76  GLY B N   1 
ATOM   4641 C  CA  . GLY B 2 57  ? 68.762 169.758 53.197  1.00 200.52 ? 76  GLY B CA  1 
ATOM   4642 C  C   . GLY B 2 57  ? 67.454 170.009 53.925  1.00 183.70 ? 76  GLY B C   1 
ATOM   4643 O  O   . GLY B 2 57  ? 66.630 170.817 53.470  1.00 181.30 ? 76  GLY B O   1 
ATOM   4644 N  N   . THR B 2 58  ? 67.280 169.396 55.089  1.00 168.10 ? 77  THR B N   1 
ATOM   4645 C  CA  . THR B 2 58  ? 65.994 169.402 55.773  1.00 154.22 ? 77  THR B CA  1 
ATOM   4646 C  C   . THR B 2 58  ? 65.953 170.473 56.855  1.00 183.01 ? 77  THR B C   1 
ATOM   4647 O  O   . THR B 2 58  ? 66.905 170.632 57.625  1.00 210.42 ? 77  THR B O   1 
ATOM   4648 C  CB  . THR B 2 58  ? 65.704 168.033 56.390  1.00 157.18 ? 77  THR B CB  1 
ATOM   4649 O  OG1 . THR B 2 58  ? 66.760 167.679 57.291  1.00 189.44 ? 77  THR B OG1 1 
ATOM   4650 C  CG2 . THR B 2 58  ? 65.591 166.974 55.305  1.00 162.99 ? 77  THR B CG2 1 
ATOM   4651 N  N   . SER B 2 59  ? 64.843 171.209 56.903  1.00 162.62 ? 78  SER B N   1 
ATOM   4652 C  CA  . SER B 2 59  ? 64.584 172.180 57.963  1.00 167.61 ? 78  SER B CA  1 
ATOM   4653 C  C   . SER B 2 59  ? 63.201 171.895 58.532  1.00 172.51 ? 78  SER B C   1 
ATOM   4654 O  O   . SER B 2 59  ? 62.195 172.074 57.840  1.00 160.47 ? 78  SER B O   1 
ATOM   4655 C  CB  . SER B 2 59  ? 64.676 173.614 57.440  1.00 130.28 ? 78  SER B CB  1 
ATOM   4656 O  OG  . SER B 2 59  ? 64.340 174.550 58.450  1.00 131.84 ? 78  SER B OG  1 
ATOM   4657 N  N   . TYR B 2 60  ? 63.145 171.466 59.789  1.00 182.27 ? 79  TYR B N   1 
ATOM   4658 C  CA  . TYR B 2 60  ? 61.892 171.065 60.405  1.00 143.07 ? 79  TYR B CA  1 
ATOM   4659 C  C   . TYR B 2 60  ? 61.389 172.148 61.356  1.00 164.56 ? 79  TYR B C   1 
ATOM   4660 O  O   . TYR B 2 60  ? 62.011 173.195 61.545  1.00 187.66 ? 79  TYR B O   1 
ATOM   4661 C  CB  . TYR B 2 60  ? 62.058 169.736 61.144  1.00 133.70 ? 79  TYR B CB  1 
ATOM   4662 C  CG  . TYR B 2 60  ? 62.573 168.606 60.285  1.00 129.89 ? 79  TYR B CG  1 
ATOM   4663 C  CD1 . TYR B 2 60  ? 61.714 167.871 59.480  1.00 124.35 ? 79  TYR B CD1 1 
ATOM   4664 C  CD2 . TYR B 2 60  ? 63.920 168.268 60.287  1.00 171.88 ? 79  TYR B CD2 1 
ATOM   4665 C  CE1 . TYR B 2 60  ? 62.182 166.833 58.695  1.00 146.97 ? 79  TYR B CE1 1 
ATOM   4666 C  CE2 . TYR B 2 60  ? 64.397 167.232 59.509  1.00 192.27 ? 79  TYR B CE2 1 
ATOM   4667 C  CZ  . TYR B 2 60  ? 63.525 166.519 58.713  1.00 190.07 ? 79  TYR B CZ  1 
ATOM   4668 O  OH  . TYR B 2 60  ? 63.999 165.487 57.935  1.00 190.73 ? 79  TYR B OH  1 
ATOM   4669 N  N   . ASN B 2 61  ? 60.236 171.880 61.961  1.00 157.47 ? 80  ASN B N   1 
ATOM   4670 C  CA  . ASN B 2 61  ? 59.663 172.728 62.995  1.00 199.23 ? 80  ASN B CA  1 
ATOM   4671 C  C   . ASN B 2 61  ? 59.892 172.078 64.352  1.00 219.02 ? 80  ASN B C   1 
ATOM   4672 O  O   . ASN B 2 61  ? 59.849 170.850 64.476  1.00 205.40 ? 80  ASN B O   1 
ATOM   4673 C  CB  . ASN B 2 61  ? 58.166 172.944 62.757  1.00 177.71 ? 80  ASN B CB  1 
ATOM   4674 C  CG  . ASN B 2 61  ? 57.580 174.038 63.634  1.00 178.27 ? 80  ASN B CG  1 
ATOM   4675 O  OD1 . ASN B 2 61  ? 58.167 174.429 64.643  1.00 218.42 ? 80  ASN B OD1 1 
ATOM   4676 N  ND2 . ASN B 2 61  ? 56.408 174.533 63.252  1.00 165.45 ? 80  ASN B ND2 1 
ATOM   4677 N  N   . GLN B 2 62  ? 60.136 172.910 65.369  1.00 235.11 ? 81  GLN B N   1 
ATOM   4678 C  CA  . GLN B 2 62  ? 60.357 172.389 66.714  1.00 237.56 ? 81  GLN B CA  1 
ATOM   4679 C  C   . GLN B 2 62  ? 59.162 171.582 67.205  1.00 233.55 ? 81  GLN B C   1 
ATOM   4680 O  O   . GLN B 2 62  ? 59.325 170.648 67.999  1.00 240.81 ? 81  GLN B O   1 
ATOM   4681 C  CB  . GLN B 2 62  ? 60.660 173.537 67.678  1.00 245.09 ? 81  GLN B CB  1 
ATOM   4682 C  CG  . GLN B 2 62  ? 61.053 173.091 69.078  1.00 268.91 ? 81  GLN B CG  1 
ATOM   4683 C  CD  . GLN B 2 62  ? 61.325 174.257 70.007  1.00 282.29 ? 81  GLN B CD  1 
ATOM   4684 O  OE1 . GLN B 2 62  ? 61.154 175.417 69.632  1.00 281.72 ? 81  GLN B OE1 1 
ATOM   4685 N  NE2 . GLN B 2 62  ? 61.753 173.955 71.227  1.00 284.56 ? 81  GLN B NE2 1 
ATOM   4686 N  N   . LYS B 2 63  ? 57.958 171.918 66.737  1.00 221.85 ? 82  LYS B N   1 
ATOM   4687 C  CA  . LYS B 2 63  ? 56.777 171.149 67.112  1.00 196.82 ? 82  LYS B CA  1 
ATOM   4688 C  C   . LYS B 2 63  ? 56.780 169.775 66.453  1.00 195.59 ? 82  LYS B C   1 
ATOM   4689 O  O   . LYS B 2 63  ? 56.351 168.788 67.062  1.00 233.88 ? 82  LYS B O   1 
ATOM   4690 C  CB  . LYS B 2 63  ? 55.514 171.926 66.738  1.00 187.06 ? 82  LYS B CB  1 
ATOM   4691 C  CG  . LYS B 2 63  ? 54.220 171.304 67.232  1.00 210.51 ? 82  LYS B CG  1 
ATOM   4692 C  CD  . LYS B 2 63  ? 53.032 172.194 66.905  1.00 209.97 ? 82  LYS B CD  1 
ATOM   4693 C  CE  . LYS B 2 63  ? 51.748 171.650 67.507  1.00 229.68 ? 82  LYS B CE  1 
ATOM   4694 N  NZ  . LYS B 2 63  ? 50.589 172.545 67.234  1.00 221.83 ? 82  LYS B NZ  1 
ATOM   4695 N  N   . PHE B 2 64  ? 57.257 169.692 65.213  1.00 181.27 ? 83  PHE B N   1 
ATOM   4696 C  CA  . PHE B 2 64  ? 57.285 168.444 64.462  1.00 185.07 ? 83  PHE B CA  1 
ATOM   4697 C  C   . PHE B 2 64  ? 58.625 167.722 64.535  1.00 191.94 ? 83  PHE B C   1 
ATOM   4698 O  O   . PHE B 2 64  ? 58.793 166.698 63.865  1.00 200.37 ? 83  PHE B O   1 
ATOM   4699 C  CB  . PHE B 2 64  ? 56.918 168.703 62.997  1.00 181.05 ? 83  PHE B CB  1 
ATOM   4700 C  CG  . PHE B 2 64  ? 55.516 169.204 62.805  1.00 177.49 ? 83  PHE B CG  1 
ATOM   4701 C  CD1 . PHE B 2 64  ? 54.458 168.317 62.701  1.00 166.46 ? 83  PHE B CD1 1 
ATOM   4702 C  CD2 . PHE B 2 64  ? 55.254 170.562 62.728  1.00 184.13 ? 83  PHE B CD2 1 
ATOM   4703 C  CE1 . PHE B 2 64  ? 53.165 168.774 62.524  1.00 169.05 ? 83  PHE B CE1 1 
ATOM   4704 C  CE2 . PHE B 2 64  ? 53.964 171.026 62.552  1.00 176.37 ? 83  PHE B CE2 1 
ATOM   4705 C  CZ  . PHE B 2 64  ? 52.918 170.130 62.450  1.00 171.98 ? 83  PHE B CZ  1 
ATOM   4706 N  N   . LYS B 2 65  ? 59.584 168.232 65.307  1.00 185.78 ? 84  LYS B N   1 
ATOM   4707 C  CA  . LYS B 2 65  ? 60.874 167.563 65.434  1.00 186.25 ? 84  LYS B CA  1 
ATOM   4708 C  C   . LYS B 2 65  ? 60.690 166.155 65.986  1.00 187.17 ? 84  LYS B C   1 
ATOM   4709 O  O   . LYS B 2 65  ? 60.042 165.957 67.018  1.00 224.75 ? 84  LYS B O   1 
ATOM   4710 C  CB  . LYS B 2 65  ? 61.809 168.369 66.336  1.00 202.03 ? 84  LYS B CB  1 
ATOM   4711 C  CG  . LYS B 2 65  ? 62.479 169.547 65.647  1.00 194.48 ? 84  LYS B CG  1 
ATOM   4712 C  CD  . LYS B 2 65  ? 63.415 170.285 66.591  1.00 221.82 ? 84  LYS B CD  1 
ATOM   4713 C  CE  . LYS B 2 65  ? 64.050 171.487 65.910  1.00 222.24 ? 84  LYS B CE  1 
ATOM   4714 N  NZ  . LYS B 2 65  ? 64.960 172.228 66.826  1.00 222.05 ? 84  LYS B NZ  1 
ATOM   4715 N  N   . GLY B 2 66  ? 61.264 165.175 65.291  1.00 176.46 ? 85  GLY B N   1 
ATOM   4716 C  CA  . GLY B 2 66  ? 61.094 163.784 65.646  1.00 210.10 ? 85  GLY B CA  1 
ATOM   4717 C  C   . GLY B 2 66  ? 59.790 163.164 65.197  1.00 192.36 ? 85  GLY B C   1 
ATOM   4718 O  O   . GLY B 2 66  ? 59.585 161.964 65.422  1.00 177.23 ? 85  GLY B O   1 
ATOM   4719 N  N   . LYS B 2 67  ? 58.904 163.938 64.571  1.00 190.87 ? 86  LYS B N   1 
ATOM   4720 C  CA  . LYS B 2 67  ? 57.614 163.443 64.100  1.00 197.48 ? 86  LYS B CA  1 
ATOM   4721 C  C   . LYS B 2 67  ? 57.649 163.093 62.615  1.00 179.36 ? 86  LYS B C   1 
ATOM   4722 O  O   . LYS B 2 67  ? 57.470 161.930 62.242  1.00 179.51 ? 86  LYS B O   1 
ATOM   4723 C  CB  . LYS B 2 67  ? 56.521 164.484 64.383  1.00 208.63 ? 86  LYS B CB  1 
ATOM   4724 C  CG  . LYS B 2 67  ? 55.127 164.050 63.970  1.00 205.81 ? 86  LYS B CG  1 
ATOM   4725 C  CD  . LYS B 2 67  ? 54.689 162.809 64.730  1.00 208.59 ? 86  LYS B CD  1 
ATOM   4726 C  CE  . LYS B 2 67  ? 53.284 162.390 64.332  1.00 203.57 ? 86  LYS B CE  1 
ATOM   4727 N  NZ  . LYS B 2 67  ? 52.843 161.169 65.061  1.00 216.74 ? 86  LYS B NZ  1 
ATOM   4728 N  N   . ALA B 2 68  ? 57.870 164.086 61.759  1.00 137.23 ? 87  ALA B N   1 
ATOM   4729 C  CA  . ALA B 2 68  ? 57.873 163.902 60.316  1.00 142.90 ? 87  ALA B CA  1 
ATOM   4730 C  C   . ALA B 2 68  ? 59.298 163.852 59.780  1.00 181.93 ? 87  ALA B C   1 
ATOM   4731 O  O   . ALA B 2 68  ? 60.196 164.532 60.284  1.00 203.42 ? 87  ALA B O   1 
ATOM   4732 C  CB  . ALA B 2 68  ? 57.103 165.029 59.625  1.00 127.44 ? 87  ALA B CB  1 
ATOM   4733 N  N   . THR B 2 69  ? 59.498 163.036 58.747  1.00 173.05 ? 88  THR B N   1 
ATOM   4734 C  CA  . THR B 2 69  ? 60.789 162.920 58.079  1.00 157.04 ? 88  THR B CA  1 
ATOM   4735 C  C   . THR B 2 69  ? 60.609 163.192 56.593  1.00 152.66 ? 88  THR B C   1 
ATOM   4736 O  O   . THR B 2 69  ? 59.791 162.542 55.935  1.00 159.96 ? 88  THR B O   1 
ATOM   4737 C  CB  . THR B 2 69  ? 61.408 161.535 58.294  1.00 166.50 ? 88  THR B CB  1 
ATOM   4738 O  OG1 . THR B 2 69  ? 61.606 161.311 59.695  1.00 188.80 ? 88  THR B OG1 1 
ATOM   4739 C  CG2 . THR B 2 69  ? 62.747 161.435 57.578  1.00 197.06 ? 88  THR B CG2 1 
ATOM   4740 N  N   . LEU B 2 70  ? 61.375 164.144 56.069  1.00 135.29 ? 89  LEU B N   1 
ATOM   4741 C  CA  . LEU B 2 70  ? 61.279 164.550 54.673  1.00 145.52 ? 89  LEU B CA  1 
ATOM   4742 C  C   . LEU B 2 70  ? 62.436 163.976 53.866  1.00 171.35 ? 89  LEU B C   1 
ATOM   4743 O  O   . LEU B 2 70  ? 63.587 163.989 54.312  1.00 181.69 ? 89  LEU B O   1 
ATOM   4744 C  CB  . LEU B 2 70  ? 61.270 166.075 54.548  1.00 138.21 ? 89  LEU B CB  1 
ATOM   4745 C  CG  . LEU B 2 70  ? 60.177 166.822 55.313  1.00 137.72 ? 89  LEU B CG  1 
ATOM   4746 C  CD1 . LEU B 2 70  ? 60.236 168.313 55.018  1.00 131.05 ? 89  LEU B CD1 1 
ATOM   4747 C  CD2 . LEU B 2 70  ? 58.811 166.259 54.972  1.00 131.47 ? 89  LEU B CD2 1 
ATOM   4748 N  N   . THR B 2 71  ? 62.120 163.473 52.674  1.00 168.80 ? 90  THR B N   1 
ATOM   4749 C  CA  . THR B 2 71  ? 63.108 162.974 51.728  1.00 168.08 ? 90  THR B CA  1 
ATOM   4750 C  C   . THR B 2 71  ? 62.775 163.508 50.340  1.00 163.52 ? 90  THR B C   1 
ATOM   4751 O  O   . THR B 2 71  ? 61.687 164.037 50.099  1.00 166.05 ? 90  THR B O   1 
ATOM   4752 C  CB  . THR B 2 71  ? 63.159 161.439 51.712  1.00 172.15 ? 90  THR B CB  1 
ATOM   4753 O  OG1 . THR B 2 71  ? 61.833 160.913 51.580  1.00 138.25 ? 90  THR B OG1 1 
ATOM   4754 C  CG2 . THR B 2 71  ? 63.787 160.908 52.993  1.00 160.97 ? 90  THR B CG2 1 
ATOM   4755 N  N   . VAL B 2 72  ? 63.727 163.369 49.418  1.00 138.51 ? 91  VAL B N   1 
ATOM   4756 C  CA  . VAL B 2 72  ? 63.567 163.892 48.066  1.00 140.55 ? 91  VAL B CA  1 
ATOM   4757 C  C   . VAL B 2 72  ? 64.294 162.975 47.092  1.00 154.19 ? 91  VAL B C   1 
ATOM   4758 O  O   . VAL B 2 72  ? 65.306 162.354 47.429  1.00 149.02 ? 91  VAL B O   1 
ATOM   4759 C  CB  . VAL B 2 72  ? 64.075 165.352 47.965  1.00 169.15 ? 91  VAL B CB  1 
ATOM   4760 C  CG1 . VAL B 2 72  ? 65.587 165.414 48.135  1.00 183.58 ? 91  VAL B CG1 1 
ATOM   4761 C  CG2 . VAL B 2 72  ? 63.642 165.989 46.653  1.00 122.65 ? 91  VAL B CG2 1 
ATOM   4762 N  N   . ASP B 2 73  ? 63.753 162.878 45.878  1.00 168.46 ? 92  ASP B N   1 
ATOM   4763 C  CA  . ASP B 2 73  ? 64.350 162.110 44.792  1.00 185.46 ? 92  ASP B CA  1 
ATOM   4764 C  C   . ASP B 2 73  ? 64.418 162.995 43.557  1.00 164.09 ? 92  ASP B C   1 
ATOM   4765 O  O   . ASP B 2 73  ? 63.378 163.404 43.026  1.00 143.73 ? 92  ASP B O   1 
ATOM   4766 C  CB  . ASP B 2 73  ? 63.544 160.839 44.502  1.00 127.95 ? 92  ASP B CB  1 
ATOM   4767 C  CG  . ASP B 2 73  ? 64.070 160.073 43.303  1.00 151.79 ? 92  ASP B CG  1 
ATOM   4768 O  OD1 . ASP B 2 73  ? 65.303 160.054 43.098  1.00 202.05 ? 92  ASP B OD1 1 
ATOM   4769 O  OD2 . ASP B 2 73  ? 63.249 159.491 42.563  1.00 128.35 ? 92  ASP B OD2 1 
ATOM   4770 N  N   . LYS B 2 74  ? 65.638 163.293 43.105  1.00 153.16 ? 93  LYS B N   1 
ATOM   4771 C  CA  . LYS B 2 74  ? 65.827 164.139 41.933  1.00 151.40 ? 93  LYS B CA  1 
ATOM   4772 C  C   . LYS B 2 74  ? 65.619 163.391 40.624  1.00 151.02 ? 93  LYS B C   1 
ATOM   4773 O  O   . LYS B 2 74  ? 65.332 164.026 39.604  1.00 158.44 ? 93  LYS B O   1 
ATOM   4774 C  CB  . LYS B 2 74  ? 67.226 164.758 41.946  1.00 173.95 ? 93  LYS B CB  1 
ATOM   4775 C  CG  . LYS B 2 74  ? 67.505 165.648 43.144  1.00 168.74 ? 93  LYS B CG  1 
ATOM   4776 C  CD  . LYS B 2 74  ? 68.891 166.264 43.055  1.00 180.52 ? 93  LYS B CD  1 
ATOM   4777 C  CE  . LYS B 2 74  ? 69.967 165.194 42.988  1.00 197.88 ? 93  LYS B CE  1 
ATOM   4778 N  NZ  . LYS B 2 74  ? 71.330 165.783 42.893  1.00 218.56 ? 93  LYS B NZ  1 
ATOM   4779 N  N   . SER B 2 75  ? 65.766 162.064 40.627  1.00 175.83 ? 94  SER B N   1 
ATOM   4780 C  CA  . SER B 2 75  ? 65.591 161.296 39.399  1.00 180.44 ? 94  SER B CA  1 
ATOM   4781 C  C   . SER B 2 75  ? 64.164 161.412 38.880  1.00 188.17 ? 94  SER B C   1 
ATOM   4782 O  O   . SER B 2 75  ? 63.940 161.717 37.703  1.00 212.17 ? 94  SER B O   1 
ATOM   4783 C  CB  . SER B 2 75  ? 65.963 159.833 39.640  1.00 209.32 ? 94  SER B CB  1 
ATOM   4784 O  OG  . SER B 2 75  ? 67.312 159.712 40.056  1.00 224.38 ? 94  SER B OG  1 
ATOM   4785 N  N   . SER B 2 76  ? 63.183 161.168 39.746  1.00 169.42 ? 95  SER B N   1 
ATOM   4786 C  CA  . SER B 2 76  ? 61.777 161.309 39.397  1.00 145.34 ? 95  SER B CA  1 
ATOM   4787 C  C   . SER B 2 76  ? 61.201 162.660 39.796  1.00 125.27 ? 95  SER B C   1 
ATOM   4788 O  O   . SER B 2 76  ? 60.027 162.921 39.514  1.00 130.18 ? 95  SER B O   1 
ATOM   4789 C  CB  . SER B 2 76  ? 60.959 160.188 40.047  1.00 142.24 ? 95  SER B CB  1 
ATOM   4790 O  OG  . SER B 2 76  ? 59.584 160.305 39.722  1.00 158.58 ? 95  SER B OG  1 
ATOM   4791 N  N   . THR B 2 77  ? 61.999 163.522 40.426  1.00 118.36 ? 96  THR B N   1 
ATOM   4792 C  CA  . THR B 2 77  ? 61.543 164.805 40.963  1.00 130.86 ? 96  THR B CA  1 
ATOM   4793 C  C   . THR B 2 77  ? 60.304 164.610 41.837  1.00 146.78 ? 96  THR B C   1 
ATOM   4794 O  O   . THR B 2 77  ? 59.212 165.102 41.546  1.00 119.30 ? 96  THR B O   1 
ATOM   4795 C  CB  . THR B 2 77  ? 61.275 165.814 39.842  1.00 107.06 ? 96  THR B CB  1 
ATOM   4796 O  OG1 . THR B 2 77  ? 60.138 165.394 39.075  1.00 125.34 ? 96  THR B OG1 1 
ATOM   4797 C  CG2 . THR B 2 77  ? 62.483 165.926 38.926  1.00 110.87 ? 96  THR B CG2 1 
ATOM   4798 N  N   . THR B 2 78  ? 60.499 163.874 42.929  1.00 177.36 ? 97  THR B N   1 
ATOM   4799 C  CA  . THR B 2 78  ? 59.403 163.465 43.796  1.00 166.33 ? 97  THR B CA  1 
ATOM   4800 C  C   . THR B 2 78  ? 59.836 163.585 45.248  1.00 183.03 ? 97  THR B C   1 
ATOM   4801 O  O   . THR B 2 78  ? 60.892 163.071 45.626  1.00 171.09 ? 97  THR B O   1 
ATOM   4802 C  CB  . THR B 2 78  ? 58.971 162.025 43.488  1.00 150.81 ? 97  THR B CB  1 
ATOM   4803 O  OG1 . THR B 2 78  ? 58.499 161.944 42.137  1.00 180.58 ? 97  THR B OG1 1 
ATOM   4804 C  CG2 . THR B 2 78  ? 57.870 161.575 44.431  1.00 151.06 ? 97  THR B CG2 1 
ATOM   4805 N  N   . ALA B 2 79  ? 59.019 164.249 46.059  1.00 191.71 ? 98  ALA B N   1 
ATOM   4806 C  CA  . ALA B 2 79  ? 59.322 164.459 47.468  1.00 178.16 ? 98  ALA B CA  1 
ATOM   4807 C  C   . ALA B 2 79  ? 58.469 163.537 48.329  1.00 151.90 ? 98  ALA B C   1 
ATOM   4808 O  O   . ALA B 2 79  ? 57.353 163.177 47.961  1.00 134.55 ? 98  ALA B O   1 
ATOM   4809 C  CB  . ALA B 2 79  ? 59.087 165.915 47.870  1.00 153.56 ? 98  ALA B CB  1 
ATOM   4810 N  N   . TYR B 2 80  ? 59.009 163.136 49.474  1.00 147.85 ? 99  TYR B N   1 
ATOM   4811 C  CA  . TYR B 2 80  ? 58.313 162.204 50.347  1.00 163.66 ? 99  TYR B CA  1 
ATOM   4812 C  C   . TYR B 2 80  ? 58.307 162.719 51.778  1.00 170.75 ? 99  TYR B C   1 
ATOM   4813 O  O   . TYR B 2 80  ? 59.248 163.382 52.225  1.00 158.75 ? 99  TYR B O   1 
ATOM   4814 C  CB  . TYR B 2 80  ? 58.950 160.809 50.297  1.00 180.59 ? 99  TYR B CB  1 
ATOM   4815 C  CG  . TYR B 2 80  ? 58.995 160.203 48.912  1.00 175.38 ? 99  TYR B CG  1 
ATOM   4816 C  CD1 . TYR B 2 80  ? 57.934 159.448 48.428  1.00 173.21 ? 99  TYR B CD1 1 
ATOM   4817 C  CD2 . TYR B 2 80  ? 60.100 160.382 48.090  1.00 174.86 ? 99  TYR B CD2 1 
ATOM   4818 C  CE1 . TYR B 2 80  ? 57.972 158.891 47.164  1.00 169.22 ? 99  TYR B CE1 1 
ATOM   4819 C  CE2 . TYR B 2 80  ? 60.146 159.829 46.824  1.00 190.25 ? 99  TYR B CE2 1 
ATOM   4820 C  CZ  . TYR B 2 80  ? 59.080 159.083 46.367  1.00 181.03 ? 99  TYR B CZ  1 
ATOM   4821 O  OH  . TYR B 2 80  ? 59.120 158.531 45.107  1.00 197.51 ? 99  TYR B OH  1 
ATOM   4822 N  N   . MET B 2 81  ? 57.225 162.406 52.490  1.00 178.64 ? 100 MET B N   1 
ATOM   4823 C  CA  . MET B 2 81  ? 57.089 162.711 53.908  1.00 175.69 ? 100 MET B CA  1 
ATOM   4824 C  C   . MET B 2 81  ? 56.601 161.465 54.630  1.00 163.03 ? 100 MET B C   1 
ATOM   4825 O  O   . MET B 2 81  ? 55.582 160.882 54.246  1.00 159.74 ? 100 MET B O   1 
ATOM   4826 C  CB  . MET B 2 81  ? 56.116 163.870 54.148  1.00 185.36 ? 100 MET B CB  1 
ATOM   4827 C  CG  . MET B 2 81  ? 55.903 164.190 55.622  1.00 171.18 ? 100 MET B CG  1 
ATOM   4828 S  SD  . MET B 2 81  ? 54.702 165.502 55.913  1.00 151.64 ? 100 MET B SD  1 
ATOM   4829 C  CE  . MET B 2 81  ? 53.199 164.717 55.337  1.00 197.30 ? 100 MET B CE  1 
ATOM   4830 N  N   . GLU B 2 82  ? 57.322 161.061 55.673  1.00 161.68 ? 101 GLU B N   1 
ATOM   4831 C  CA  . GLU B 2 82  ? 56.988 159.872 56.441  1.00 157.00 ? 101 GLU B CA  1 
ATOM   4832 C  C   . GLU B 2 82  ? 56.650 160.255 57.874  1.00 186.73 ? 101 GLU B C   1 
ATOM   4833 O  O   . GLU B 2 82  ? 57.316 161.105 58.477  1.00 193.14 ? 101 GLU B O   1 
ATOM   4834 C  CB  . GLU B 2 82  ? 58.135 158.857 56.424  1.00 158.20 ? 101 GLU B CB  1 
ATOM   4835 C  CG  . GLU B 2 82  ? 57.760 157.502 57.004  1.00 157.87 ? 101 GLU B CG  1 
ATOM   4836 C  CD  . GLU B 2 82  ? 58.839 156.458 56.801  1.00 201.56 ? 101 GLU B CD  1 
ATOM   4837 O  OE1 . GLU B 2 82  ? 58.770 155.396 57.456  1.00 196.43 ? 101 GLU B OE1 1 
ATOM   4838 O  OE2 . GLU B 2 82  ? 59.754 156.697 55.986  1.00 230.59 ? 101 GLU B OE2 1 
ATOM   4839 N  N   . LEU B 2 83  ? 55.610 159.617 58.409  1.00 192.27 ? 102 LEU B N   1 
ATOM   4840 C  CA  . LEU B 2 83  ? 55.123 159.850 59.761  1.00 164.45 ? 102 LEU B CA  1 
ATOM   4841 C  C   . LEU B 2 83  ? 55.134 158.536 60.528  1.00 192.23 ? 102 LEU B C   1 
ATOM   4842 O  O   . LEU B 2 83  ? 54.662 157.511 60.019  1.00 198.18 ? 102 LEU B O   1 
ATOM   4843 C  CB  . LEU B 2 83  ? 53.706 160.431 59.744  1.00 130.07 ? 102 LEU B CB  1 
ATOM   4844 C  CG  . LEU B 2 83  ? 53.463 161.671 58.883  1.00 155.53 ? 102 LEU B CG  1 
ATOM   4845 C  CD1 . LEU B 2 83  ? 51.982 162.011 58.838  1.00 131.98 ? 102 LEU B CD1 1 
ATOM   4846 C  CD2 . LEU B 2 83  ? 54.263 162.844 59.411  1.00 176.92 ? 102 LEU B CD2 1 
ATOM   4847 N  N   . ARG B 2 84  ? 55.666 158.573 61.748  1.00 186.82 ? 103 ARG B N   1 
ATOM   4848 C  CA  . ARG B 2 84  ? 55.675 157.432 62.650  1.00 175.56 ? 103 ARG B CA  1 
ATOM   4849 C  C   . ARG B 2 84  ? 54.951 157.802 63.939  1.00 191.95 ? 103 ARG B C   1 
ATOM   4850 O  O   . ARG B 2 84  ? 54.778 158.981 64.260  1.00 186.97 ? 103 ARG B O   1 
ATOM   4851 C  CB  . ARG B 2 84  ? 57.105 156.969 62.965  1.00 164.26 ? 103 ARG B CB  1 
ATOM   4852 C  CG  . ARG B 2 84  ? 57.838 157.836 63.980  1.00 169.95 ? 103 ARG B CG  1 
ATOM   4853 C  CD  . ARG B 2 84  ? 59.136 157.177 64.429  1.00 202.68 ? 103 ARG B CD  1 
ATOM   4854 N  NE  . ARG B 2 84  ? 59.717 157.832 65.599  1.00 217.21 ? 103 ARG B NE  1 
ATOM   4855 C  CZ  . ARG B 2 84  ? 60.706 158.718 65.548  1.00 205.33 ? 103 ARG B CZ  1 
ATOM   4856 N  NH1 . ARG B 2 84  ? 61.235 159.061 64.381  1.00 189.18 ? 103 ARG B NH1 1 
ATOM   4857 N  NH2 . ARG B 2 84  ? 61.170 159.261 66.666  1.00 194.28 ? 103 ARG B NH2 1 
ATOM   4858 N  N   . SER B 2 85  ? 54.528 156.771 64.675  1.00 203.47 ? 104 SER B N   1 
ATOM   4859 C  CA  . SER B 2 85  ? 53.763 156.925 65.914  1.00 209.69 ? 104 SER B CA  1 
ATOM   4860 C  C   . SER B 2 85  ? 52.491 157.742 65.661  1.00 192.37 ? 104 SER B C   1 
ATOM   4861 O  O   . SER B 2 85  ? 52.328 158.874 66.121  1.00 193.81 ? 104 SER B O   1 
ATOM   4862 C  CB  . SER B 2 85  ? 54.622 157.556 67.017  1.00 223.84 ? 104 SER B CB  1 
ATOM   4863 O  OG  . SER B 2 85  ? 55.762 156.762 67.298  1.00 212.81 ? 104 SER B OG  1 
ATOM   4864 N  N   . LEU B 2 86  ? 51.589 157.121 64.906  1.00 158.06 ? 105 LEU B N   1 
ATOM   4865 C  CA  . LEU B 2 86  ? 50.373 157.788 64.464  1.00 155.12 ? 105 LEU B CA  1 
ATOM   4866 C  C   . LEU B 2 86  ? 49.297 157.721 65.541  1.00 162.58 ? 105 LEU B C   1 
ATOM   4867 O  O   . LEU B 2 86  ? 49.071 156.667 66.143  1.00 187.44 ? 105 LEU B O   1 
ATOM   4868 C  CB  . LEU B 2 86  ? 49.871 157.155 63.169  1.00 151.23 ? 105 LEU B CB  1 
ATOM   4869 C  CG  . LEU B 2 86  ? 50.785 157.361 61.960  1.00 159.62 ? 105 LEU B CG  1 
ATOM   4870 C  CD1 . LEU B 2 86  ? 50.440 156.386 60.852  1.00 175.19 ? 105 LEU B CD1 1 
ATOM   4871 C  CD2 . LEU B 2 86  ? 50.686 158.794 61.463  1.00 151.31 ? 105 LEU B CD2 1 
ATOM   4872 N  N   . THR B 2 87  ? 48.635 158.851 65.778  1.00 165.53 ? 106 THR B N   1 
ATOM   4873 C  CA  . THR B 2 87  ? 47.556 158.962 66.751  1.00 182.03 ? 106 THR B CA  1 
ATOM   4874 C  C   . THR B 2 87  ? 46.341 159.593 66.081  1.00 189.84 ? 106 THR B C   1 
ATOM   4875 O  O   . THR B 2 87  ? 46.335 159.857 64.875  1.00 201.74 ? 106 THR B O   1 
ATOM   4876 C  CB  . THR B 2 87  ? 47.986 159.784 67.974  1.00 185.51 ? 106 THR B CB  1 
ATOM   4877 O  OG1 . THR B 2 87  ? 48.352 161.106 67.558  1.00 199.80 ? 106 THR B OG1 1 
ATOM   4878 C  CG2 . THR B 2 87  ? 49.169 159.129 68.675  1.00 181.51 ? 106 THR B CG2 1 
ATOM   4879 N  N   . SER B 2 88  ? 45.299 159.839 66.880  1.00 205.84 ? 107 SER B N   1 
ATOM   4880 C  CA  . SER B 2 88  ? 44.077 160.427 66.340  1.00 221.04 ? 107 SER B CA  1 
ATOM   4881 C  C   . SER B 2 88  ? 44.287 161.871 65.905  1.00 197.46 ? 107 SER B C   1 
ATOM   4882 O  O   . SER B 2 88  ? 43.609 162.345 64.986  1.00 192.99 ? 107 SER B O   1 
ATOM   4883 C  CB  . SER B 2 88  ? 42.953 160.340 67.371  1.00 246.65 ? 107 SER B CB  1 
ATOM   4884 O  OG  . SER B 2 88  ? 43.305 161.014 68.567  1.00 261.09 ? 107 SER B OG  1 
ATOM   4885 N  N   . GLU B 2 89  ? 45.216 162.585 66.547  1.00 212.30 ? 108 GLU B N   1 
ATOM   4886 C  CA  . GLU B 2 89  ? 45.500 163.959 66.143  1.00 212.40 ? 108 GLU B CA  1 
ATOM   4887 C  C   . GLU B 2 89  ? 46.112 164.020 64.750  1.00 217.32 ? 108 GLU B C   1 
ATOM   4888 O  O   . GLU B 2 89  ? 45.966 165.032 64.054  1.00 229.23 ? 108 GLU B O   1 
ATOM   4889 C  CB  . GLU B 2 89  ? 46.431 164.625 67.157  1.00 235.32 ? 108 GLU B CB  1 
ATOM   4890 C  CG  . GLU B 2 89  ? 45.814 164.842 68.529  1.00 244.69 ? 108 GLU B CG  1 
ATOM   4891 C  CD  . GLU B 2 89  ? 44.794 165.964 68.548  1.00 248.19 ? 108 GLU B CD  1 
ATOM   4892 O  OE1 . GLU B 2 89  ? 44.784 166.780 67.601  1.00 256.55 ? 108 GLU B OE1 1 
ATOM   4893 O  OE2 . GLU B 2 89  ? 44.001 166.031 69.510  1.00 233.80 ? 108 GLU B OE2 1 
ATOM   4894 N  N   . ASP B 2 90  ? 46.794 162.955 64.327  1.00 208.52 ? 109 ASP B N   1 
ATOM   4895 C  CA  . ASP B 2 90  ? 47.443 162.936 63.022  1.00 157.40 ? 109 ASP B CA  1 
ATOM   4896 C  C   . ASP B 2 90  ? 46.457 162.804 61.870  1.00 171.33 ? 109 ASP B C   1 
ATOM   4897 O  O   . ASP B 2 90  ? 46.874 162.894 60.711  1.00 208.38 ? 109 ASP B O   1 
ATOM   4898 C  CB  . ASP B 2 90  ? 48.466 161.802 62.959  1.00 130.40 ? 109 ASP B CB  1 
ATOM   4899 C  CG  . ASP B 2 90  ? 49.634 162.022 63.900  1.00 147.27 ? 109 ASP B CG  1 
ATOM   4900 O  OD1 . ASP B 2 90  ? 49.947 163.195 64.195  1.00 142.76 ? 109 ASP B OD1 1 
ATOM   4901 O  OD2 . ASP B 2 90  ? 50.239 161.025 64.342  1.00 141.67 ? 109 ASP B OD2 1 
ATOM   4902 N  N   . SER B 2 91  ? 45.174 162.597 62.150  1.00 182.55 ? 110 SER B N   1 
ATOM   4903 C  CA  . SER B 2 91  ? 44.177 162.545 61.090  1.00 192.15 ? 110 SER B CA  1 
ATOM   4904 C  C   . SER B 2 91  ? 43.852 163.966 60.654  1.00 150.39 ? 110 SER B C   1 
ATOM   4905 O  O   . SER B 2 91  ? 43.333 164.761 61.445  1.00 151.84 ? 110 SER B O   1 
ATOM   4906 C  CB  . SER B 2 91  ? 42.920 161.826 61.570  1.00 205.95 ? 110 SER B CB  1 
ATOM   4907 O  OG  . SER B 2 91  ? 43.216 160.515 62.012  1.00 205.30 ? 110 SER B OG  1 
ATOM   4908 N  N   . ALA B 2 92  ? 44.127 164.267 59.390  1.00 123.69 ? 111 ALA B N   1 
ATOM   4909 C  CA  . ALA B 2 92  ? 44.066 165.622 58.861  1.00 154.38 ? 111 ALA B CA  1 
ATOM   4910 C  C   . ALA B 2 92  ? 44.408 165.566 57.380  1.00 141.37 ? 111 ALA B C   1 
ATOM   4911 O  O   . ALA B 2 92  ? 44.754 164.512 56.838  1.00 139.40 ? 111 ALA B O   1 
ATOM   4912 C  CB  . ALA B 2 92  ? 45.018 166.573 59.597  1.00 123.98 ? 111 ALA B CB  1 
ATOM   4913 N  N   . VAL B 2 93  ? 44.297 166.718 56.733  1.00 139.59 ? 112 VAL B N   1 
ATOM   4914 C  CA  . VAL B 2 93  ? 44.617 166.865 55.319  1.00 156.35 ? 112 VAL B CA  1 
ATOM   4915 C  C   . VAL B 2 93  ? 46.011 167.466 55.209  1.00 175.37 ? 112 VAL B C   1 
ATOM   4916 O  O   . VAL B 2 93  ? 46.262 168.561 55.723  1.00 171.10 ? 112 VAL B O   1 
ATOM   4917 C  CB  . VAL B 2 93  ? 43.580 167.736 54.593  1.00 167.95 ? 112 VAL B CB  1 
ATOM   4918 C  CG1 . VAL B 2 93  ? 43.927 167.852 53.116  1.00 154.56 ? 112 VAL B CG1 1 
ATOM   4919 C  CG2 . VAL B 2 93  ? 42.182 167.161 54.788  1.00 172.34 ? 112 VAL B CG2 1 
ATOM   4920 N  N   . TYR B 2 94  ? 46.915 166.760 54.536  1.00 175.85 ? 113 TYR B N   1 
ATOM   4921 C  CA  . TYR B 2 94  ? 48.296 167.194 54.379  1.00 126.81 ? 113 TYR B CA  1 
ATOM   4922 C  C   . TYR B 2 94  ? 48.534 167.681 52.956  1.00 138.73 ? 113 TYR B C   1 
ATOM   4923 O  O   . TYR B 2 94  ? 47.958 167.148 52.002  1.00 117.25 ? 113 TYR B O   1 
ATOM   4924 C  CB  . TYR B 2 94  ? 49.268 166.061 54.713  1.00 112.66 ? 113 TYR B CB  1 
ATOM   4925 C  CG  . TYR B 2 94  ? 49.226 165.629 56.159  1.00 130.67 ? 113 TYR B CG  1 
ATOM   4926 C  CD1 . TYR B 2 94  ? 48.326 164.664 56.591  1.00 157.26 ? 113 TYR B CD1 1 
ATOM   4927 C  CD2 . TYR B 2 94  ? 50.084 166.190 57.094  1.00 132.78 ? 113 TYR B CD2 1 
ATOM   4928 C  CE1 . TYR B 2 94  ? 48.284 164.269 57.916  1.00 156.75 ? 113 TYR B CE1 1 
ATOM   4929 C  CE2 . TYR B 2 94  ? 50.051 165.801 58.418  1.00 134.52 ? 113 TYR B CE2 1 
ATOM   4930 C  CZ  . TYR B 2 94  ? 49.150 164.842 58.825  1.00 140.16 ? 113 TYR B CZ  1 
ATOM   4931 O  OH  . TYR B 2 94  ? 49.117 164.457 60.145  1.00 154.18 ? 113 TYR B OH  1 
ATOM   4932 N  N   . TYR B 2 95  ? 49.388 168.693 52.820  1.00 144.75 ? 114 TYR B N   1 
ATOM   4933 C  CA  . TYR B 2 95  ? 49.718 169.275 51.528  1.00 138.06 ? 114 TYR B CA  1 
ATOM   4934 C  C   . TYR B 2 95  ? 51.228 169.341 51.357  1.00 136.48 ? 114 TYR B C   1 
ATOM   4935 O  O   . TYR B 2 95  ? 51.976 169.444 52.332  1.00 115.31 ? 114 TYR B O   1 
ATOM   4936 C  CB  . TYR B 2 95  ? 49.135 170.689 51.372  1.00 113.94 ? 114 TYR B CB  1 
ATOM   4937 C  CG  . TYR B 2 95  ? 47.628 170.769 51.471  1.00 130.31 ? 114 TYR B CG  1 
ATOM   4938 C  CD1 . TYR B 2 95  ? 47.002 170.971 52.694  1.00 145.74 ? 114 TYR B CD1 1 
ATOM   4939 C  CD2 . TYR B 2 95  ? 46.832 170.659 50.339  1.00 137.52 ? 114 TYR B CD2 1 
ATOM   4940 C  CE1 . TYR B 2 95  ? 45.625 171.050 52.788  1.00 132.31 ? 114 TYR B CE1 1 
ATOM   4941 C  CE2 . TYR B 2 95  ? 45.454 170.737 50.424  1.00 142.68 ? 114 TYR B CE2 1 
ATOM   4942 C  CZ  . TYR B 2 95  ? 44.856 170.933 51.650  1.00 149.82 ? 114 TYR B CZ  1 
ATOM   4943 O  OH  . TYR B 2 95  ? 43.486 171.012 51.740  1.00 195.42 ? 114 TYR B OH  1 
ATOM   4944 N  N   . CYS B 2 96  ? 51.670 169.274 50.104  1.00 130.47 ? 115 CYS B N   1 
ATOM   4945 C  CA  . CYS B 2 96  ? 53.045 169.577 49.730  1.00 108.24 ? 115 CYS B CA  1 
ATOM   4946 C  C   . CYS B 2 96  ? 53.023 170.780 48.801  1.00 122.50 ? 115 CYS B C   1 
ATOM   4947 O  O   . CYS B 2 96  ? 52.299 170.780 47.799  1.00 119.41 ? 115 CYS B O   1 
ATOM   4948 C  CB  . CYS B 2 96  ? 53.728 168.381 49.058  1.00 101.51 ? 115 CYS B CB  1 
ATOM   4949 S  SG  . CYS B 2 96  ? 52.851 167.675 47.643  1.00 229.86 ? 115 CYS B SG  1 
ATOM   4950 N  N   . THR B 2 97  ? 53.799 171.806 49.136  1.00 92.12  ? 116 THR B N   1 
ATOM   4951 C  CA  . THR B 2 97  ? 53.736 173.064 48.411  1.00 130.73 ? 116 THR B CA  1 
ATOM   4952 C  C   . THR B 2 97  ? 55.133 173.572 48.088  1.00 143.50 ? 116 THR B C   1 
ATOM   4953 O  O   . THR B 2 97  ? 56.065 173.418 48.881  1.00 118.94 ? 116 THR B O   1 
ATOM   4954 C  CB  . THR B 2 97  ? 52.964 174.126 49.206  1.00 127.36 ? 116 THR B CB  1 
ATOM   4955 O  OG1 . THR B 2 97  ? 53.010 175.371 48.502  1.00 155.32 ? 116 THR B OG1 1 
ATOM   4956 C  CG2 . THR B 2 97  ? 53.557 174.301 50.599  1.00 99.02  ? 116 THR B CG2 1 
ATOM   4957 N  N   . ARG B 2 98  ? 55.264 174.182 46.914  1.00 174.78 ? 117 ARG B N   1 
ATOM   4958 C  CA  . ARG B 2 98  ? 56.530 174.744 46.470  1.00 163.09 ? 117 ARG B CA  1 
ATOM   4959 C  C   . ARG B 2 98  ? 56.742 176.121 47.087  1.00 122.64 ? 117 ARG B C   1 
ATOM   4960 O  O   . ARG B 2 98  ? 55.793 176.891 47.260  1.00 123.20 ? 117 ARG B O   1 
ATOM   4961 C  CB  . ARG B 2 98  ? 56.550 174.847 44.946  1.00 173.21 ? 117 ARG B CB  1 
ATOM   4962 C  CG  . ARG B 2 98  ? 57.918 175.090 44.357  1.00 147.07 ? 117 ARG B CG  1 
ATOM   4963 C  CD  . ARG B 2 98  ? 57.833 175.520 42.905  1.00 118.44 ? 117 ARG B CD  1 
ATOM   4964 N  NE  . ARG B 2 98  ? 57.510 176.935 42.767  1.00 119.17 ? 117 ARG B NE  1 
ATOM   4965 C  CZ  . ARG B 2 98  ? 57.482 177.583 41.608  1.00 133.14 ? 117 ARG B CZ  1 
ATOM   4966 N  NH1 . ARG B 2 98  ? 57.758 176.940 40.481  1.00 134.29 ? 117 ARG B NH1 1 
ATOM   4967 N  NH2 . ARG B 2 98  ? 57.180 178.873 41.574  1.00 154.96 ? 117 ARG B NH2 1 
ATOM   4968 N  N   . SER B 2 99  ? 57.993 176.431 47.423  1.00 115.39 ? 118 SER B N   1 
ATOM   4969 C  CA  . SER B 2 99  ? 58.317 177.739 47.975  1.00 99.92  ? 118 SER B CA  1 
ATOM   4970 C  C   . SER B 2 99  ? 59.696 178.162 47.497  1.00 102.26 ? 118 SER B C   1 
ATOM   4971 O  O   . SER B 2 99  ? 60.571 177.311 47.307  1.00 115.28 ? 118 SER B O   1 
ATOM   4972 C  CB  . SER B 2 99  ? 58.278 177.730 49.509  1.00 101.57 ? 118 SER B CB  1 
ATOM   4973 O  OG  . SER B 2 99  ? 59.218 176.811 50.035  1.00 149.92 ? 118 SER B OG  1 
ATOM   4974 N  N   . PRO B 2 100 ? 59.921 179.461 47.290  1.00 103.95 ? 119 PRO B N   1 
ATOM   4975 C  CA  . PRO B 2 100 ? 61.275 179.932 46.969  1.00 139.39 ? 119 PRO B CA  1 
ATOM   4976 C  C   . PRO B 2 100 ? 62.098 180.192 48.220  1.00 157.03 ? 119 PRO B C   1 
ATOM   4977 O  O   . PRO B 2 100 ? 61.644 179.923 49.337  1.00 182.22 ? 119 PRO B O   1 
ATOM   4978 C  CB  . PRO B 2 100 ? 61.015 181.223 46.187  1.00 118.42 ? 119 PRO B CB  1 
ATOM   4979 C  CG  . PRO B 2 100 ? 59.747 181.741 46.772  1.00 106.17 ? 119 PRO B CG  1 
ATOM   4980 C  CD  . PRO B 2 100 ? 58.919 180.532 47.151  1.00 103.48 ? 119 PRO B CD  1 
ATOM   4981 N  N   . VAL B 2 101 ? 63.314 180.711 48.045  1.00 164.57 ? 120 VAL B N   1 
ATOM   4982 C  CA  . VAL B 2 101 ? 64.149 181.029 49.199  1.00 133.13 ? 120 VAL B CA  1 
ATOM   4983 C  C   . VAL B 2 101 ? 63.733 182.356 49.826  1.00 121.84 ? 120 VAL B C   1 
ATOM   4984 O  O   . VAL B 2 101 ? 63.779 182.504 51.053  1.00 123.38 ? 120 VAL B O   1 
ATOM   4985 C  CB  . VAL B 2 101 ? 65.633 181.038 48.798  1.00 165.12 ? 120 VAL B CB  1 
ATOM   4986 C  CG1 . VAL B 2 101 ? 66.517 181.195 50.026  1.00 216.89 ? 120 VAL B CG1 1 
ATOM   4987 C  CG2 . VAL B 2 101 ? 65.979 179.766 48.048  1.00 123.26 ? 120 VAL B CG2 1 
ATOM   4988 N  N   . ARG B 2 102 ? 63.281 183.310 49.016  1.00 158.23 ? 121 ARG B N   1 
ATOM   4989 C  CA  . ARG B 2 102 ? 62.888 184.632 49.497  1.00 161.59 ? 121 ARG B CA  1 
ATOM   4990 C  C   . ARG B 2 102 ? 62.301 185.475 48.366  1.00 173.54 ? 121 ARG B C   1 
ATOM   4991 O  O   . ARG B 2 102 ? 62.842 185.496 47.262  1.00 215.03 ? 121 ARG B O   1 
ATOM   4992 C  CB  . ARG B 2 102 ? 64.086 185.365 50.115  1.00 169.15 ? 121 ARG B CB  1 
ATOM   4993 C  CG  . ARG B 2 102 ? 63.856 186.851 50.357  1.00 175.31 ? 121 ARG B CG  1 
ATOM   4994 C  CD  . ARG B 2 102 ? 65.025 187.505 51.080  1.00 214.24 ? 121 ARG B CD  1 
ATOM   4995 N  NE  . ARG B 2 102 ? 66.271 187.419 50.324  1.00 204.83 ? 121 ARG B NE  1 
ATOM   4996 C  CZ  . ARG B 2 102 ? 67.267 186.589 50.616  1.00 204.04 ? 121 ARG B CZ  1 
ATOM   4997 N  NH1 . ARG B 2 102 ? 67.167 185.770 51.655  1.00 203.22 ? 121 ARG B NH1 1 
ATOM   4998 N  NH2 . ARG B 2 102 ? 68.366 186.580 49.873  1.00 182.55 ? 121 ARG B NH2 1 
ATOM   4999 N  N   . PRO B 2 103 ? 61.178 186.169 48.636  1.00 137.24 ? 122 PRO B N   1 
ATOM   5000 C  CA  . PRO B 2 103 ? 60.397 186.048 49.873  1.00 122.27 ? 122 PRO B CA  1 
ATOM   5001 C  C   . PRO B 2 103 ? 59.734 184.681 49.968  1.00 117.33 ? 122 PRO B C   1 
ATOM   5002 O  O   . PRO B 2 103 ? 59.442 184.080 48.934  1.00 115.67 ? 122 PRO B O   1 
ATOM   5003 C  CB  . PRO B 2 103 ? 59.357 187.162 49.744  1.00 124.78 ? 122 PRO B CB  1 
ATOM   5004 C  CG  . PRO B 2 103 ? 59.198 187.349 48.280  1.00 123.02 ? 122 PRO B CG  1 
ATOM   5005 C  CD  . PRO B 2 103 ? 60.564 187.121 47.694  1.00 145.63 ? 122 PRO B CD  1 
ATOM   5006 N  N   . TYR B 2 104 ? 59.495 184.197 51.183  1.00 136.81 ? 123 TYR B N   1 
ATOM   5007 C  CA  . TYR B 2 104 ? 59.099 182.810 51.391  1.00 128.97 ? 123 TYR B CA  1 
ATOM   5008 C  C   . TYR B 2 104 ? 57.580 182.735 51.323  1.00 149.22 ? 123 TYR B C   1 
ATOM   5009 O  O   . TYR B 2 104 ? 56.882 183.226 52.210  1.00 171.02 ? 123 TYR B O   1 
ATOM   5010 C  CB  . TYR B 2 104 ? 59.621 182.305 52.734  1.00 126.03 ? 123 TYR B CB  1 
ATOM   5011 C  CG  . TYR B 2 104 ? 59.866 180.813 52.798  1.00 118.91 ? 123 TYR B CG  1 
ATOM   5012 C  CD1 . TYR B 2 104 ? 58.833 179.929 53.080  1.00 150.24 ? 123 TYR B CD1 1 
ATOM   5013 C  CD2 . TYR B 2 104 ? 61.138 180.292 52.593  1.00 117.37 ? 123 TYR B CD2 1 
ATOM   5014 C  CE1 . TYR B 2 104 ? 59.058 178.565 53.146  1.00 174.14 ? 123 TYR B CE1 1 
ATOM   5015 C  CE2 . TYR B 2 104 ? 61.372 178.932 52.657  1.00 115.06 ? 123 TYR B CE2 1 
ATOM   5016 C  CZ  . TYR B 2 104 ? 60.330 178.073 52.934  1.00 153.29 ? 123 TYR B CZ  1 
ATOM   5017 O  OH  . TYR B 2 104 ? 60.564 176.718 52.998  1.00 113.21 ? 123 TYR B OH  1 
ATOM   5018 N  N   . TYR B 2 105 ? 57.064 182.115 50.271  1.00 170.22 ? 124 TYR B N   1 
ATOM   5019 C  CA  . TYR B 2 105 ? 55.626 181.974 50.125  1.00 119.16 ? 124 TYR B CA  1 
ATOM   5020 C  C   . TYR B 2 105 ? 55.349 180.660 49.423  1.00 109.63 ? 124 TYR B C   1 
ATOM   5021 O  O   . TYR B 2 105 ? 56.221 180.091 48.763  1.00 160.81 ? 124 TYR B O   1 
ATOM   5022 C  CB  . TYR B 2 105 ? 55.008 183.149 49.353  1.00 113.81 ? 124 TYR B CB  1 
ATOM   5023 C  CG  . TYR B 2 105 ? 55.668 183.451 48.025  1.00 112.44 ? 124 TYR B CG  1 
ATOM   5024 C  CD1 . TYR B 2 105 ? 55.481 182.619 46.927  1.00 161.83 ? 124 TYR B CD1 1 
ATOM   5025 C  CD2 . TYR B 2 105 ? 56.464 184.578 47.863  1.00 114.67 ? 124 TYR B CD2 1 
ATOM   5026 C  CE1 . TYR B 2 105 ? 56.075 182.891 45.713  1.00 167.92 ? 124 TYR B CE1 1 
ATOM   5027 C  CE2 . TYR B 2 105 ? 57.062 184.860 46.648  1.00 114.12 ? 124 TYR B CE2 1 
ATOM   5028 C  CZ  . TYR B 2 105 ? 56.863 184.012 45.578  1.00 151.73 ? 124 TYR B CZ  1 
ATOM   5029 O  OH  . TYR B 2 105 ? 57.451 184.280 44.365  1.00 149.30 ? 124 TYR B OH  1 
ATOM   5030 N  N   . PHE B 2 106 ? 54.123 180.184 49.563  1.00 132.58 ? 125 PHE B N   1 
ATOM   5031 C  CA  . PHE B 2 106 ? 53.720 178.934 48.936  1.00 146.24 ? 125 PHE B CA  1 
ATOM   5032 C  C   . PHE B 2 106 ? 52.917 179.308 47.696  1.00 147.71 ? 125 PHE B C   1 
ATOM   5033 O  O   . PHE B 2 106 ? 51.751 179.701 47.789  1.00 175.87 ? 125 PHE B O   1 
ATOM   5034 C  CB  . PHE B 2 106 ? 52.930 178.087 49.925  1.00 126.05 ? 125 PHE B CB  1 
ATOM   5035 C  CG  . PHE B 2 106 ? 53.638 177.884 51.239  1.00 125.22 ? 125 PHE B CG  1 
ATOM   5036 C  CD1 . PHE B 2 106 ? 55.011 177.690 51.278  1.00 156.43 ? 125 PHE B CD1 1 
ATOM   5037 C  CD2 . PHE B 2 106 ? 52.938 177.906 52.433  1.00 160.33 ? 125 PHE B CD2 1 
ATOM   5038 C  CE1 . PHE B 2 106 ? 55.668 177.510 52.481  1.00 140.79 ? 125 PHE B CE1 1 
ATOM   5039 C  CE2 . PHE B 2 106 ? 53.589 177.726 53.640  1.00 154.19 ? 125 PHE B CE2 1 
ATOM   5040 C  CZ  . PHE B 2 106 ? 54.956 177.528 53.663  1.00 129.74 ? 125 PHE B CZ  1 
ATOM   5041 N  N   . ASP B 2 107 ? 53.551 179.174 46.530  1.00 121.07 ? 126 ASP B N   1 
ATOM   5042 C  CA  . ASP B 2 107 ? 52.916 179.577 45.281  1.00 138.31 ? 126 ASP B CA  1 
ATOM   5043 C  C   . ASP B 2 107 ? 52.009 178.486 44.732  1.00 135.67 ? 126 ASP B C   1 
ATOM   5044 O  O   . ASP B 2 107 ? 50.906 178.773 44.254  1.00 163.22 ? 126 ASP B O   1 
ATOM   5045 C  CB  . ASP B 2 107 ? 53.981 179.965 44.253  1.00 160.14 ? 126 ASP B CB  1 
ATOM   5046 C  CG  . ASP B 2 107 ? 55.199 179.064 44.302  1.00 157.33 ? 126 ASP B CG  1 
ATOM   5047 O  OD1 . ASP B 2 107 ? 55.051 177.880 44.673  1.00 178.39 ? 126 ASP B OD1 1 
ATOM   5048 O  OD2 . ASP B 2 107 ? 56.305 179.542 43.970  1.00 126.04 ? 126 ASP B OD2 1 
ATOM   5049 N  N   . TYR B 2 108 ? 52.454 177.234 44.789  1.00 119.34 ? 127 TYR B N   1 
ATOM   5050 C  CA  . TYR B 2 108 ? 51.709 176.113 44.238  1.00 123.69 ? 127 TYR B CA  1 
ATOM   5051 C  C   . TYR B 2 108 ? 51.593 175.027 45.294  1.00 142.93 ? 127 TYR B C   1 
ATOM   5052 O  O   . TYR B 2 108 ? 52.582 174.686 45.951  1.00 141.79 ? 127 TYR B O   1 
ATOM   5053 C  CB  . TYR B 2 108 ? 52.387 175.570 42.975  1.00 117.12 ? 127 TYR B CB  1 
ATOM   5054 C  CG  . TYR B 2 108 ? 52.568 176.614 41.896  1.00 116.98 ? 127 TYR B CG  1 
ATOM   5055 C  CD1 . TYR B 2 108 ? 51.538 176.916 41.015  1.00 129.21 ? 127 TYR B CD1 1 
ATOM   5056 C  CD2 . TYR B 2 108 ? 53.767 177.301 41.762  1.00 149.35 ? 127 TYR B CD2 1 
ATOM   5057 C  CE1 . TYR B 2 108 ? 51.698 177.872 40.028  1.00 141.25 ? 127 TYR B CE1 1 
ATOM   5058 C  CE2 . TYR B 2 108 ? 53.937 178.258 40.778  1.00 176.91 ? 127 TYR B CE2 1 
ATOM   5059 C  CZ  . TYR B 2 108 ? 52.899 178.540 39.915  1.00 148.16 ? 127 TYR B CZ  1 
ATOM   5060 O  OH  . TYR B 2 108 ? 53.066 179.492 38.934  1.00 119.05 ? 127 TYR B OH  1 
ATOM   5061 N  N   . TRP B 2 109 ? 50.387 174.493 45.457  1.00 130.92 ? 128 TRP B N   1 
ATOM   5062 C  CA  . TRP B 2 109 ? 50.101 173.466 46.444  1.00 127.30 ? 128 TRP B CA  1 
ATOM   5063 C  C   . TRP B 2 109 ? 49.677 172.182 45.747  1.00 121.83 ? 128 TRP B C   1 
ATOM   5064 O  O   . TRP B 2 109 ? 49.162 172.205 44.625  1.00 122.92 ? 128 TRP B O   1 
ATOM   5065 C  CB  . TRP B 2 109 ? 48.991 173.910 47.406  1.00 140.29 ? 128 TRP B CB  1 
ATOM   5066 C  CG  . TRP B 2 109 ? 49.346 175.076 48.280  1.00 111.89 ? 128 TRP B CG  1 
ATOM   5067 C  CD1 . TRP B 2 109 ? 49.647 176.345 47.878  1.00 103.48 ? 128 TRP B CD1 1 
ATOM   5068 C  CD2 . TRP B 2 109 ? 49.407 175.084 49.711  1.00 89.59  ? 128 TRP B CD2 1 
ATOM   5069 N  NE1 . TRP B 2 109 ? 49.905 177.139 48.970  1.00 91.47  ? 128 TRP B NE1 1 
ATOM   5070 C  CE2 . TRP B 2 109 ? 49.763 176.388 50.107  1.00 91.76  ? 128 TRP B CE2 1 
ATOM   5071 C  CE3 . TRP B 2 109 ? 49.200 174.113 50.696  1.00 97.10  ? 128 TRP B CE3 1 
ATOM   5072 C  CZ2 . TRP B 2 109 ? 49.917 176.746 51.444  1.00 94.07  ? 128 TRP B CZ2 1 
ATOM   5073 C  CZ3 . TRP B 2 109 ? 49.354 174.470 52.023  1.00 111.08 ? 128 TRP B CZ3 1 
ATOM   5074 C  CH2 . TRP B 2 109 ? 49.710 175.774 52.385  1.00 102.34 ? 128 TRP B CH2 1 
ATOM   5075 N  N   . GLY B 2 110 ? 49.903 171.057 46.422  1.00 99.46  ? 129 GLY B N   1 
ATOM   5076 C  CA  . GLY B 2 110 ? 49.336 169.804 45.978  1.00 114.83 ? 129 GLY B CA  1 
ATOM   5077 C  C   . GLY B 2 110 ? 47.854 169.730 46.288  1.00 124.46 ? 129 GLY B C   1 
ATOM   5078 O  O   . GLY B 2 110 ? 47.314 170.514 47.067  1.00 134.43 ? 129 GLY B O   1 
ATOM   5079 N  N   . GLN B 2 111 ? 47.184 168.759 45.663  1.00 137.57 ? 130 GLN B N   1 
ATOM   5080 C  CA  . GLN B 2 111 ? 45.741 168.639 45.838  1.00 140.50 ? 130 GLN B CA  1 
ATOM   5081 C  C   . GLN B 2 111 ? 45.354 168.231 47.254  1.00 137.25 ? 130 GLN B C   1 
ATOM   5082 O  O   . GLN B 2 111 ? 44.187 168.378 47.629  1.00 144.40 ? 130 GLN B O   1 
ATOM   5083 C  CB  . GLN B 2 111 ? 45.164 167.637 44.836  1.00 152.02 ? 130 GLN B CB  1 
ATOM   5084 C  CG  . GLN B 2 111 ? 45.360 166.174 45.210  1.00 157.03 ? 130 GLN B CG  1 
ATOM   5085 C  CD  . GLN B 2 111 ? 46.767 165.674 44.942  1.00 153.80 ? 130 GLN B CD  1 
ATOM   5086 O  OE1 . GLN B 2 111 ? 47.649 166.435 44.542  1.00 155.62 ? 130 GLN B OE1 1 
ATOM   5087 N  NE2 . GLN B 2 111 ? 46.982 164.381 45.156  1.00 143.26 ? 130 GLN B NE2 1 
ATOM   5088 N  N   . GLY B 2 112 ? 46.294 167.733 48.041  1.00 122.34 ? 131 GLY B N   1 
ATOM   5089 C  CA  . GLY B 2 112 ? 46.031 167.350 49.410  1.00 104.22 ? 131 GLY B CA  1 
ATOM   5090 C  C   . GLY B 2 112 ? 45.957 165.840 49.575  1.00 107.46 ? 131 GLY B C   1 
ATOM   5091 O  O   . GLY B 2 112 ? 45.694 165.088 48.633  1.00 112.79 ? 131 GLY B O   1 
ATOM   5092 N  N   . THR B 2 113 ? 46.205 165.400 50.807  1.00 119.58 ? 132 THR B N   1 
ATOM   5093 C  CA  . THR B 2 113 ? 46.165 163.986 51.160  1.00 143.61 ? 132 THR B CA  1 
ATOM   5094 C  C   . THR B 2 113 ? 45.381 163.831 52.453  1.00 171.10 ? 132 THR B C   1 
ATOM   5095 O  O   . THR B 2 113 ? 45.774 164.378 53.488  1.00 142.94 ? 132 THR B O   1 
ATOM   5096 C  CB  . THR B 2 113 ? 47.577 163.413 51.317  1.00 115.35 ? 132 THR B CB  1 
ATOM   5097 O  OG1 . THR B 2 113 ? 48.309 163.599 50.100  1.00 147.08 ? 132 THR B OG1 1 
ATOM   5098 C  CG2 . THR B 2 113 ? 47.512 161.930 51.641  1.00 146.24 ? 132 THR B CG2 1 
ATOM   5099 N  N   . THR B 2 114 ? 44.281 163.086 52.394  1.00 186.14 ? 133 THR B N   1 
ATOM   5100 C  CA  . THR B 2 114 ? 43.448 162.838 53.563  1.00 166.49 ? 133 THR B CA  1 
ATOM   5101 C  C   . THR B 2 114 ? 43.989 161.628 54.315  1.00 139.43 ? 133 THR B C   1 
ATOM   5102 O  O   . THR B 2 114 ? 44.039 160.521 53.768  1.00 141.22 ? 133 THR B O   1 
ATOM   5103 C  CB  . THR B 2 114 ? 41.993 162.610 53.156  1.00 176.61 ? 133 THR B CB  1 
ATOM   5104 O  OG1 . THR B 2 114 ? 41.489 163.779 52.496  1.00 175.64 ? 133 THR B OG1 1 
ATOM   5105 C  CG2 . THR B 2 114 ? 41.137 162.316 54.380  1.00 160.20 ? 133 THR B CG2 1 
ATOM   5106 N  N   . LEU B 2 115 ? 44.390 161.839 55.564  1.00 149.76 ? 134 LEU B N   1 
ATOM   5107 C  CA  . LEU B 2 115 ? 44.936 160.786 56.409  1.00 143.25 ? 134 LEU B CA  1 
ATOM   5108 C  C   . LEU B 2 115 ? 43.951 160.470 57.525  1.00 197.46 ? 134 LEU B C   1 
ATOM   5109 O  O   . LEU B 2 115 ? 43.415 161.383 58.162  1.00 213.50 ? 134 LEU B O   1 
ATOM   5110 C  CB  . LEU B 2 115 ? 46.287 161.196 56.998  1.00 128.30 ? 134 LEU B CB  1 
ATOM   5111 C  CG  . LEU B 2 115 ? 46.906 160.215 57.997  1.00 146.46 ? 134 LEU B CG  1 
ATOM   5112 C  CD1 . LEU B 2 115 ? 47.118 158.854 57.354  1.00 168.57 ? 134 LEU B CD1 1 
ATOM   5113 C  CD2 . LEU B 2 115 ? 48.214 160.757 58.553  1.00 165.68 ? 134 LEU B CD2 1 
ATOM   5114 N  N   . THR B 2 116 ? 43.714 159.181 57.755  1.00 206.80 ? 135 THR B N   1 
ATOM   5115 C  CA  . THR B 2 116 ? 42.861 158.724 58.844  1.00 186.10 ? 135 THR B CA  1 
ATOM   5116 C  C   . THR B 2 116 ? 43.606 157.657 59.629  1.00 160.45 ? 135 THR B C   1 
ATOM   5117 O  O   . THR B 2 116 ? 43.969 156.610 59.077  1.00 158.79 ? 135 THR B O   1 
ATOM   5118 C  CB  . THR B 2 116 ? 41.528 158.177 58.326  1.00 194.47 ? 135 THR B CB  1 
ATOM   5119 O  OG1 . THR B 2 116 ? 40.886 159.166 57.513  1.00 176.95 ? 135 THR B OG1 1 
ATOM   5120 C  CG2 . THR B 2 116 ? 40.618 157.828 59.495  1.00 206.96 ? 135 THR B CG2 1 
ATOM   5121 N  N   . VAL B 2 117 ? 43.840 157.927 60.908  1.00 160.64 ? 136 VAL B N   1 
ATOM   5122 C  CA  . VAL B 2 117 ? 44.509 156.998 61.806  1.00 166.11 ? 136 VAL B CA  1 
ATOM   5123 C  C   . VAL B 2 117 ? 43.450 156.406 62.724  1.00 185.11 ? 136 VAL B C   1 
ATOM   5124 O  O   . VAL B 2 117 ? 42.938 157.089 63.620  1.00 165.52 ? 136 VAL B O   1 
ATOM   5125 C  CB  . VAL B 2 117 ? 45.622 157.683 62.609  1.00 167.01 ? 136 VAL B CB  1 
ATOM   5126 C  CG1 . VAL B 2 117 ? 46.270 156.696 63.560  1.00 146.96 ? 136 VAL B CG1 1 
ATOM   5127 C  CG2 . VAL B 2 117 ? 46.655 158.289 61.670  1.00 174.57 ? 136 VAL B CG2 1 
ATOM   5128 N  N   . SER B 2 118 ? 43.121 155.135 62.505  1.00 223.11 ? 137 SER B N   1 
ATOM   5129 C  CA  . SER B 2 118 ? 42.156 154.439 63.344  1.00 245.07 ? 137 SER B CA  1 
ATOM   5130 C  C   . SER B 2 118 ? 42.359 152.940 63.188  1.00 250.13 ? 137 SER B C   1 
ATOM   5131 O  O   . SER B 2 118 ? 42.928 152.471 62.199  1.00 257.52 ? 137 SER B O   1 
ATOM   5132 C  CB  . SER B 2 118 ? 40.718 154.829 62.990  1.00 241.21 ? 137 SER B CB  1 
ATOM   5133 O  OG  . SER B 2 118 ? 39.784 154.090 63.757  1.00 249.36 ? 137 SER B OG  1 
ATOM   5134 N  N   . SER B 2 119 ? 41.874 152.195 64.178  1.00 243.51 ? 138 SER B N   1 
ATOM   5135 C  CA  . SER B 2 119 ? 41.891 150.740 64.137  1.00 230.58 ? 138 SER B CA  1 
ATOM   5136 C  C   . SER B 2 119 ? 40.599 150.154 63.585  1.00 222.76 ? 138 SER B C   1 
ATOM   5137 O  O   . SER B 2 119 ? 40.482 148.927 63.492  1.00 245.47 ? 138 SER B O   1 
ATOM   5138 C  CB  . SER B 2 119 ? 42.153 150.172 65.536  1.00 225.48 ? 138 SER B CB  1 
ATOM   5139 O  OG  . SER B 2 119 ? 43.440 150.533 66.005  1.00 235.28 ? 138 SER B OG  1 
ATOM   5140 N  N   . ALA B 2 120 ? 39.635 150.995 63.222  1.00 343.53 ? 139 ALA B N   1 
ATOM   5141 C  CA  . ALA B 2 120 ? 38.361 150.505 62.718  1.00 312.30 ? 139 ALA B CA  1 
ATOM   5142 C  C   . ALA B 2 120 ? 38.545 149.812 61.373  1.00 315.38 ? 139 ALA B C   1 
ATOM   5143 O  O   . ALA B 2 120 ? 39.318 150.262 60.523  1.00 304.27 ? 139 ALA B O   1 
ATOM   5144 C  CB  . ALA B 2 120 ? 37.363 151.654 62.587  1.00 293.52 ? 139 ALA B CB  1 
ATOM   5145 N  N   . LYS B 2 121 ? 37.830 148.705 61.191  1.00 327.19 ? 140 LYS B N   1 
ATOM   5146 C  CA  . LYS B 2 121 ? 37.909 147.952 59.948  1.00 329.86 ? 140 LYS B CA  1 
ATOM   5147 C  C   . LYS B 2 121 ? 37.376 148.784 58.788  1.00 305.37 ? 140 LYS B C   1 
ATOM   5148 O  O   . LYS B 2 121 ? 36.428 149.559 58.942  1.00 301.79 ? 140 LYS B O   1 
ATOM   5149 C  CB  . LYS B 2 121 ? 37.117 146.649 60.076  1.00 340.39 ? 140 LYS B CB  1 
ATOM   5150 C  CG  . LYS B 2 121 ? 37.153 145.757 58.845  1.00 347.62 ? 140 LYS B CG  1 
ATOM   5151 C  CD  . LYS B 2 121 ? 38.566 145.291 58.540  1.00 347.10 ? 140 LYS B CD  1 
ATOM   5152 C  CE  . LYS B 2 121 ? 38.594 144.364 57.335  1.00 307.33 ? 140 LYS B CE  1 
ATOM   5153 N  NZ  . LYS B 2 121 ? 39.969 143.876 57.044  1.00 308.84 ? 140 LYS B NZ  1 
ATOM   5154 N  N   . THR B 2 122 ? 37.994 148.623 57.619  1.00 269.40 ? 141 THR B N   1 
ATOM   5155 C  CA  . THR B 2 122 ? 37.521 149.313 56.426  1.00 266.83 ? 141 THR B CA  1 
ATOM   5156 C  C   . THR B 2 122 ? 36.179 148.724 56.011  1.00 265.03 ? 141 THR B C   1 
ATOM   5157 O  O   . THR B 2 122 ? 36.072 147.519 55.762  1.00 268.05 ? 141 THR B O   1 
ATOM   5158 C  CB  . THR B 2 122 ? 38.539 149.185 55.295  1.00 278.98 ? 141 THR B CB  1 
ATOM   5159 O  OG1 . THR B 2 122 ? 39.821 149.638 55.747  1.00 272.54 ? 141 THR B OG1 1 
ATOM   5160 C  CG2 . THR B 2 122 ? 38.110 150.019 54.097  1.00 267.92 ? 141 THR B CG2 1 
ATOM   5161 N  N   . THR B 2 123 ? 35.157 149.574 55.935  1.00 260.36 ? 142 THR B N   1 
ATOM   5162 C  CA  . THR B 2 123 ? 33.795 149.121 55.699  1.00 258.28 ? 142 THR B CA  1 
ATOM   5163 C  C   . THR B 2 123 ? 33.324 149.575 54.328  1.00 262.86 ? 142 THR B C   1 
ATOM   5164 O  O   . THR B 2 123 ? 33.318 150.785 54.052  1.00 273.00 ? 142 THR B O   1 
ATOM   5165 C  CB  . THR B 2 123 ? 32.858 149.649 56.784  1.00 276.18 ? 142 THR B CB  1 
ATOM   5166 O  OG1 . THR B 2 123 ? 33.431 149.398 58.073  1.00 285.58 ? 142 THR B OG1 1 
ATOM   5167 C  CG2 . THR B 2 123 ? 31.508 148.955 56.698  1.00 279.94 ? 142 THR B CG2 1 
ATOM   5168 N  N   . PRO B 2 124 ? 32.929 148.662 53.445  1.00 269.26 ? 143 PRO B N   1 
ATOM   5169 C  CA  . PRO B 2 124 ? 32.417 149.066 52.133  1.00 269.39 ? 143 PRO B CA  1 
ATOM   5170 C  C   . PRO B 2 124 ? 31.095 149.796 52.269  1.00 264.05 ? 143 PRO B C   1 
ATOM   5171 O  O   . PRO B 2 124 ? 30.251 149.427 53.101  1.00 251.57 ? 143 PRO B O   1 
ATOM   5172 C  CB  . PRO B 2 124 ? 32.246 147.730 51.395  1.00 263.63 ? 143 PRO B CB  1 
ATOM   5173 C  CG  . PRO B 2 124 ? 32.063 146.725 52.482  1.00 272.75 ? 143 PRO B CG  1 
ATOM   5174 C  CD  . PRO B 2 124 ? 32.919 147.200 53.622  1.00 272.01 ? 143 PRO B CD  1 
ATOM   5175 N  N   . PRO B 2 125 ? 30.877 150.840 51.476  1.00 269.80 ? 144 PRO B N   1 
ATOM   5176 C  CA  . PRO B 2 125 ? 29.641 151.616 51.596  1.00 251.64 ? 144 PRO B CA  1 
ATOM   5177 C  C   . PRO B 2 125 ? 28.448 150.906 50.978  1.00 269.20 ? 144 PRO B C   1 
ATOM   5178 O  O   . PRO B 2 125 ? 28.576 150.094 50.058  1.00 265.47 ? 144 PRO B O   1 
ATOM   5179 C  CB  . PRO B 2 125 ? 29.964 152.905 50.830  1.00 268.94 ? 144 PRO B CB  1 
ATOM   5180 C  CG  . PRO B 2 125 ? 30.962 152.478 49.811  1.00 287.27 ? 144 PRO B CG  1 
ATOM   5181 C  CD  . PRO B 2 125 ? 31.789 151.400 50.464  1.00 283.50 ? 144 PRO B CD  1 
ATOM   5182 N  N   . SER B 2 126 ? 27.272 151.228 51.507  1.00 315.36 ? 145 SER B N   1 
ATOM   5183 C  CA  . SER B 2 126 ? 26.004 150.755 50.970  1.00 326.11 ? 145 SER B CA  1 
ATOM   5184 C  C   . SER B 2 126 ? 25.382 151.877 50.150  1.00 330.16 ? 145 SER B C   1 
ATOM   5185 O  O   . SER B 2 126 ? 25.190 152.989 50.657  1.00 343.47 ? 145 SER B O   1 
ATOM   5186 C  CB  . SER B 2 126 ? 25.063 150.313 52.091  1.00 319.71 ? 145 SER B CB  1 
ATOM   5187 O  OG  . SER B 2 126 ? 25.624 149.245 52.834  1.00 323.36 ? 145 SER B OG  1 
ATOM   5188 N  N   . VAL B 2 127 ? 25.074 151.586 48.889  1.00 306.47 ? 146 VAL B N   1 
ATOM   5189 C  CA  . VAL B 2 127 ? 24.579 152.575 47.938  1.00 291.98 ? 146 VAL B CA  1 
ATOM   5190 C  C   . VAL B 2 127 ? 23.105 152.289 47.693  1.00 298.66 ? 146 VAL B C   1 
ATOM   5191 O  O   . VAL B 2 127 ? 22.752 151.291 47.053  1.00 284.31 ? 146 VAL B O   1 
ATOM   5192 C  CB  . VAL B 2 127 ? 25.373 152.547 46.625  1.00 280.45 ? 146 VAL B CB  1 
ATOM   5193 C  CG1 . VAL B 2 127 ? 24.896 153.650 45.693  1.00 262.17 ? 146 VAL B CG1 1 
ATOM   5194 C  CG2 . VAL B 2 127 ? 26.862 152.671 46.905  1.00 287.56 ? 146 VAL B CG2 1 
ATOM   5195 N  N   . TYR B 2 128 ? 22.242 153.166 48.199  1.00 320.07 ? 147 TYR B N   1 
ATOM   5196 C  CA  . TYR B 2 128 ? 20.799 153.038 48.036  1.00 338.00 ? 147 TYR B CA  1 
ATOM   5197 C  C   . TYR B 2 128 ? 20.260 154.234 47.262  1.00 358.03 ? 147 TYR B C   1 
ATOM   5198 O  O   . TYR B 2 128 ? 20.376 155.377 47.740  1.00 356.84 ? 147 TYR B O   1 
ATOM   5199 C  CB  . TYR B 2 128 ? 20.116 152.915 49.399  1.00 332.85 ? 147 TYR B CB  1 
ATOM   5200 C  CG  . TYR B 2 128 ? 20.545 151.682 50.164  1.00 337.00 ? 147 TYR B CG  1 
ATOM   5201 C  CD1 . TYR B 2 128 ? 20.826 150.493 49.501  1.00 347.25 ? 147 TYR B CD1 1 
ATOM   5202 C  CD2 . TYR B 2 128 ? 20.683 151.708 51.546  1.00 326.59 ? 147 TYR B CD2 1 
ATOM   5203 C  CE1 . TYR B 2 128 ? 21.223 149.364 50.192  1.00 346.75 ? 147 TYR B CE1 1 
ATOM   5204 C  CE2 . TYR B 2 128 ? 21.080 150.582 52.246  1.00 328.32 ? 147 TYR B CE2 1 
ATOM   5205 C  CZ  . TYR B 2 128 ? 21.349 149.413 51.563  1.00 339.76 ? 147 TYR B CZ  1 
ATOM   5206 O  OH  . TYR B 2 128 ? 21.744 148.290 52.254  1.00 344.24 ? 147 TYR B OH  1 
ATOM   5207 N  N   . PRO B 2 129 ? 19.683 154.037 46.079  1.00 375.96 ? 148 PRO B N   1 
ATOM   5208 C  CA  . PRO B 2 129 ? 19.185 155.178 45.303  1.00 392.56 ? 148 PRO B CA  1 
ATOM   5209 C  C   . PRO B 2 129 ? 17.919 155.761 45.910  1.00 418.25 ? 148 PRO B C   1 
ATOM   5210 O  O   . PRO B 2 129 ? 17.125 155.062 46.544  1.00 384.98 ? 148 PRO B O   1 
ATOM   5211 C  CB  . PRO B 2 129 ? 18.908 154.569 43.924  1.00 378.64 ? 148 PRO B CB  1 
ATOM   5212 C  CG  . PRO B 2 129 ? 18.583 153.141 44.220  1.00 375.08 ? 148 PRO B CG  1 
ATOM   5213 C  CD  . PRO B 2 129 ? 19.445 152.753 45.395  1.00 373.80 ? 148 PRO B CD  1 
ATOM   5214 N  N   . LEU B 2 130 ? 17.738 157.066 45.715  1.00 483.74 ? 149 LEU B N   1 
ATOM   5215 C  CA  . LEU B 2 130 ? 16.555 157.774 46.196  1.00 501.24 ? 149 LEU B CA  1 
ATOM   5216 C  C   . LEU B 2 130 ? 15.761 158.267 44.991  1.00 509.47 ? 149 LEU B C   1 
ATOM   5217 O  O   . LEU B 2 130 ? 16.158 159.235 44.333  1.00 516.44 ? 149 LEU B O   1 
ATOM   5218 C  CB  . LEU B 2 130 ? 16.953 158.930 47.110  1.00 508.92 ? 149 LEU B CB  1 
ATOM   5219 C  CG  . LEU B 2 130 ? 17.831 158.541 48.301  1.00 517.59 ? 149 LEU B CG  1 
ATOM   5220 C  CD1 . LEU B 2 130 ? 18.199 159.764 49.126  1.00 519.14 ? 149 LEU B CD1 1 
ATOM   5221 C  CD2 . LEU B 2 130 ? 17.138 157.495 49.161  1.00 518.99 ? 149 LEU B CD2 1 
ATOM   5222 N  N   . ALA B 2 131 ? 14.624 157.623 44.729  1.00 506.08 ? 150 ALA B N   1 
ATOM   5223 C  CA  . ALA B 2 131 ? 13.795 157.900 43.566  1.00 501.78 ? 150 ALA B CA  1 
ATOM   5224 C  C   . ALA B 2 131 ? 12.527 158.629 43.975  1.00 492.14 ? 150 ALA B C   1 
ATOM   5225 O  O   . ALA B 2 131 ? 11.826 158.170 44.887  1.00 488.45 ? 150 ALA B O   1 
ATOM   5226 C  CB  . ALA B 2 131 ? 13.435 156.600 42.838  1.00 503.56 ? 150 ALA B CB  1 
ATOM   5227 N  N   . PRO B 2 132 ? 12.211 159.764 43.351  1.00 487.00 ? 151 PRO B N   1 
ATOM   5228 C  CA  . PRO B 2 132 ? 10.954 160.452 43.665  1.00 478.71 ? 151 PRO B CA  1 
ATOM   5229 C  C   . PRO B 2 132 ? 9.752  159.553 43.413  1.00 477.32 ? 151 PRO B C   1 
ATOM   5230 O  O   . PRO B 2 132 ? 9.752  158.715 42.508  1.00 482.28 ? 151 PRO B O   1 
ATOM   5231 C  CB  . PRO B 2 132 ? 10.958 161.656 42.715  1.00 481.75 ? 151 PRO B CB  1 
ATOM   5232 C  CG  . PRO B 2 132 ? 12.393 161.853 42.348  1.00 485.96 ? 151 PRO B CG  1 
ATOM   5233 C  CD  . PRO B 2 132 ? 13.002 160.484 42.338  1.00 489.58 ? 151 PRO B CD  1 
ATOM   5234 N  N   . GLY B 2 133 ? 8.719  159.737 44.232  1.00 474.58 ? 152 GLY B N   1 
ATOM   5235 C  CA  . GLY B 2 133 ? 7.539  158.907 44.125  1.00 474.31 ? 152 GLY B CA  1 
ATOM   5236 C  C   . GLY B 2 133 ? 6.745  159.178 42.862  1.00 468.05 ? 152 GLY B C   1 
ATOM   5237 O  O   . GLY B 2 133 ? 6.888  160.207 42.200  1.00 475.34 ? 152 GLY B O   1 
ATOM   5238 N  N   . CYS B 2 134 ? 5.884  158.219 42.523  1.00 447.28 ? 153 CYS B N   1 
ATOM   5239 C  CA  . CYS B 2 134 ? 5.026  158.335 41.352  1.00 426.58 ? 153 CYS B CA  1 
ATOM   5240 C  C   . CYS B 2 134 ? 3.788  159.186 41.604  1.00 401.64 ? 153 CYS B C   1 
ATOM   5241 O  O   . CYS B 2 134 ? 3.071  159.503 40.649  1.00 410.00 ? 153 CYS B O   1 
ATOM   5242 C  CB  . CYS B 2 134 ? 4.603  156.946 40.870  1.00 428.66 ? 153 CYS B CB  1 
ATOM   5243 S  SG  . CYS B 2 134 ? 3.640  155.987 42.063  1.00 349.33 ? 153 CYS B SG  1 
ATOM   5244 N  N   . GLY B 2 135 ? 3.519  159.555 42.853  1.00 344.65 ? 154 GLY B N   1 
ATOM   5245 C  CA  . GLY B 2 135 ? 2.419  160.431 43.187  1.00 307.81 ? 154 GLY B CA  1 
ATOM   5246 C  C   . GLY B 2 135 ? 2.784  161.892 43.297  1.00 309.66 ? 154 GLY B C   1 
ATOM   5247 O  O   . GLY B 2 135 ? 1.898  162.723 43.517  1.00 288.45 ? 154 GLY B O   1 
ATOM   5248 N  N   . ASP B 2 136 ? 4.061  162.232 43.153  1.00 340.68 ? 155 ASP B N   1 
ATOM   5249 C  CA  . ASP B 2 136 ? 4.491  163.617 43.239  1.00 344.54 ? 155 ASP B CA  1 
ATOM   5250 C  C   . ASP B 2 136 ? 4.032  164.400 42.012  1.00 358.14 ? 155 ASP B C   1 
ATOM   5251 O  O   . ASP B 2 136 ? 3.739  163.838 40.953  1.00 338.83 ? 155 ASP B O   1 
ATOM   5252 C  CB  . ASP B 2 136 ? 6.012  163.698 43.371  1.00 331.31 ? 155 ASP B CB  1 
ATOM   5253 C  CG  . ASP B 2 136 ? 6.540  162.888 44.539  1.00 323.15 ? 155 ASP B CG  1 
ATOM   5254 O  OD1 . ASP B 2 136 ? 5.883  161.897 44.921  1.00 326.49 ? 155 ASP B OD1 1 
ATOM   5255 O  OD2 . ASP B 2 136 ? 7.612  163.241 45.073  1.00 314.94 ? 155 ASP B OD2 1 
ATOM   5256 N  N   . THR B 2 137 ? 3.972  165.718 42.170  1.00 397.01 ? 156 THR B N   1 
ATOM   5257 C  CA  . THR B 2 137 ? 3.590  166.614 41.086  1.00 397.87 ? 156 THR B CA  1 
ATOM   5258 C  C   . THR B 2 137 ? 4.836  167.010 40.306  1.00 387.68 ? 156 THR B C   1 
ATOM   5259 O  O   . THR B 2 137 ? 5.750  167.631 40.861  1.00 397.34 ? 156 THR B O   1 
ATOM   5260 C  CB  . THR B 2 137 ? 2.883  167.855 41.629  1.00 396.59 ? 156 THR B CB  1 
ATOM   5261 O  OG1 . THR B 2 137 ? 1.677  167.469 42.300  1.00 387.02 ? 156 THR B OG1 1 
ATOM   5262 C  CG2 . THR B 2 137 ? 2.546  168.814 40.496  1.00 402.51 ? 156 THR B CG2 1 
ATOM   5263 N  N   . THR B 2 138 ? 4.874  166.655 39.025  1.00 334.02 ? 157 THR B N   1 
ATOM   5264 C  CA  . THR B 2 138 ? 6.009  167.001 38.180  1.00 299.99 ? 157 THR B CA  1 
ATOM   5265 C  C   . THR B 2 138 ? 5.869  168.447 37.722  1.00 282.53 ? 157 THR B C   1 
ATOM   5266 O  O   . THR B 2 138 ? 4.911  168.795 37.024  1.00 293.52 ? 157 THR B O   1 
ATOM   5267 C  CB  . THR B 2 138 ? 6.090  166.060 36.979  1.00 279.59 ? 157 THR B CB  1 
ATOM   5268 O  OG1 . THR B 2 138 ? 6.244  164.710 37.436  1.00 268.47 ? 157 THR B OG1 1 
ATOM   5269 C  CG2 . THR B 2 138 ? 7.271  166.428 36.094  1.00 275.09 ? 157 THR B CG2 1 
ATOM   5270 N  N   . GLY B 2 139 ? 6.821  169.282 38.113  1.00 237.26 ? 158 GLY B N   1 
ATOM   5271 C  CA  . GLY B 2 139 ? 6.837  170.689 37.783  1.00 238.70 ? 158 GLY B CA  1 
ATOM   5272 C  C   . GLY B 2 139 ? 7.846  171.020 36.706  1.00 269.08 ? 158 GLY B C   1 
ATOM   5273 O  O   . GLY B 2 139 ? 8.163  170.195 35.840  1.00 244.83 ? 158 GLY B O   1 
ATOM   5274 N  N   . SER B 2 140 ? 8.359  172.250 36.756  1.00 307.50 ? 159 SER B N   1 
ATOM   5275 C  CA  . SER B 2 140 ? 9.408  172.659 35.830  1.00 333.84 ? 159 SER B CA  1 
ATOM   5276 C  C   . SER B 2 140 ? 10.719 171.927 36.083  1.00 343.28 ? 159 SER B C   1 
ATOM   5277 O  O   . SER B 2 140 ? 11.577 171.894 35.194  1.00 351.56 ? 159 SER B O   1 
ATOM   5278 C  CB  . SER B 2 140 ? 9.629  174.170 35.920  1.00 332.47 ? 159 SER B CB  1 
ATOM   5279 O  OG  . SER B 2 140 ? 9.978  174.557 37.238  1.00 329.33 ? 159 SER B OG  1 
ATOM   5280 N  N   . SER B 2 141 ? 10.896 171.344 37.268  1.00 287.57 ? 160 SER B N   1 
ATOM   5281 C  CA  . SER B 2 141 ? 12.120 170.626 37.591  1.00 264.08 ? 160 SER B CA  1 
ATOM   5282 C  C   . SER B 2 141 ? 11.814 169.523 38.594  1.00 292.44 ? 160 SER B C   1 
ATOM   5283 O  O   . SER B 2 141 ? 10.913 169.650 39.428  1.00 233.65 ? 160 SER B O   1 
ATOM   5284 C  CB  . SER B 2 141 ? 13.192 171.569 38.151  1.00 252.17 ? 160 SER B CB  1 
ATOM   5285 O  OG  . SER B 2 141 ? 12.740 172.210 39.331  1.00 235.20 ? 160 SER B OG  1 
ATOM   5286 N  N   . VAL B 2 142 ? 12.578 168.437 38.499  1.00 369.06 ? 161 VAL B N   1 
ATOM   5287 C  CA  . VAL B 2 142 ? 12.494 167.306 39.411  1.00 384.69 ? 161 VAL B CA  1 
ATOM   5288 C  C   . VAL B 2 142 ? 13.854 167.127 40.073  1.00 375.32 ? 161 VAL B C   1 
ATOM   5289 O  O   . VAL B 2 142 ? 14.900 167.381 39.465  1.00 392.19 ? 161 VAL B O   1 
ATOM   5290 C  CB  . VAL B 2 142 ? 12.060 166.012 38.686  1.00 407.65 ? 161 VAL B CB  1 
ATOM   5291 C  CG1 . VAL B 2 142 ? 11.706 164.922 39.688  1.00 410.30 ? 161 VAL B CG1 1 
ATOM   5292 C  CG2 . VAL B 2 142 ? 10.889 166.289 37.754  1.00 417.54 ? 161 VAL B CG2 1 
ATOM   5293 N  N   . THR B 2 143 ? 13.835 166.689 41.331  1.00 319.22 ? 162 THR B N   1 
ATOM   5294 C  CA  . THR B 2 143 ? 15.043 166.535 42.133  1.00 284.07 ? 162 THR B CA  1 
ATOM   5295 C  C   . THR B 2 143 ? 15.256 165.062 42.452  1.00 341.06 ? 162 THR B C   1 
ATOM   5296 O  O   . THR B 2 143 ? 14.392 164.423 43.062  1.00 259.15 ? 162 THR B O   1 
ATOM   5297 C  CB  . THR B 2 143 ? 14.954 167.354 43.423  1.00 250.84 ? 162 THR B CB  1 
ATOM   5298 O  OG1 . THR B 2 143 ? 14.743 168.734 43.099  1.00 252.34 ? 162 THR B OG1 1 
ATOM   5299 C  CG2 . THR B 2 143 ? 16.238 167.221 44.227  1.00 273.89 ? 162 THR B CG2 1 
ATOM   5300 N  N   . LEU B 2 144 ? 16.399 164.531 42.033  1.00 516.46 ? 163 LEU B N   1 
ATOM   5301 C  CA  . LEU B 2 144 ? 16.817 163.162 42.289  1.00 530.15 ? 163 LEU B CA  1 
ATOM   5302 C  C   . LEU B 2 144 ? 17.920 163.157 43.346  1.00 526.48 ? 163 LEU B C   1 
ATOM   5303 O  O   . LEU B 2 144 ? 18.350 164.206 43.836  1.00 530.54 ? 163 LEU B O   1 
ATOM   5304 C  CB  . LEU B 2 144 ? 17.289 162.501 40.992  1.00 545.15 ? 163 LEU B CB  1 
ATOM   5305 C  CG  . LEU B 2 144 ? 16.693 163.029 39.680  1.00 551.32 ? 163 LEU B CG  1 
ATOM   5306 C  CD1 . LEU B 2 144 ? 17.363 162.366 38.486  1.00 556.00 ? 163 LEU B CD1 1 
ATOM   5307 C  CD2 . LEU B 2 144 ? 15.179 162.842 39.617  1.00 549.92 ? 163 LEU B CD2 1 
ATOM   5308 N  N   . GLY B 2 145 ? 18.392 161.964 43.690  1.00 388.49 ? 164 GLY B N   1 
ATOM   5309 C  CA  . GLY B 2 145 ? 19.466 161.847 44.660  1.00 302.05 ? 164 GLY B CA  1 
ATOM   5310 C  C   . GLY B 2 145 ? 19.781 160.398 44.966  1.00 291.80 ? 164 GLY B C   1 
ATOM   5311 O  O   . GLY B 2 145 ? 18.988 159.490 44.691  1.00 248.26 ? 164 GLY B O   1 
ATOM   5312 N  N   . CYS B 2 146 ? 20.961 160.201 45.556  1.00 359.64 ? 165 CYS B N   1 
ATOM   5313 C  CA  . CYS B 2 146 ? 21.439 158.885 45.953  1.00 353.31 ? 165 CYS B CA  1 
ATOM   5314 C  C   . CYS B 2 146 ? 21.994 158.948 47.370  1.00 338.59 ? 165 CYS B C   1 
ATOM   5315 O  O   . CYS B 2 146 ? 22.458 159.998 47.828  1.00 340.52 ? 165 CYS B O   1 
ATOM   5316 C  CB  . CYS B 2 146 ? 22.506 158.355 44.975  1.00 360.45 ? 165 CYS B CB  1 
ATOM   5317 S  SG  . CYS B 2 146 ? 21.850 157.886 43.343  1.00 244.82 ? 165 CYS B SG  1 
ATOM   5318 N  N   . LEU B 2 147 ? 21.941 157.809 48.060  1.00 283.59 ? 166 LEU B N   1 
ATOM   5319 C  CA  . LEU B 2 147 ? 22.283 157.713 49.474  1.00 247.92 ? 166 LEU B CA  1 
ATOM   5320 C  C   . LEU B 2 147 ? 23.419 156.719 49.683  1.00 274.05 ? 166 LEU B C   1 
ATOM   5321 O  O   . LEU B 2 147 ? 23.463 155.666 49.038  1.00 268.74 ? 166 LEU B O   1 
ATOM   5322 C  CB  . LEU B 2 147 ? 21.059 157.286 50.298  1.00 245.91 ? 166 LEU B CB  1 
ATOM   5323 C  CG  . LEU B 2 147 ? 21.255 157.006 51.790  1.00 253.26 ? 166 LEU B CG  1 
ATOM   5324 C  CD1 . LEU B 2 147 ? 21.643 158.273 52.533  1.00 247.60 ? 166 LEU B CD1 1 
ATOM   5325 C  CD2 . LEU B 2 147 ? 19.999 156.390 52.391  1.00 247.96 ? 166 LEU B CD2 1 
ATOM   5326 N  N   . VAL B 2 148 ? 24.334 157.058 50.593  1.00 329.93 ? 167 VAL B N   1 
ATOM   5327 C  CA  . VAL B 2 148 ? 25.466 156.208 50.948  1.00 317.68 ? 167 VAL B CA  1 
ATOM   5328 C  C   . VAL B 2 148 ? 25.480 156.038 52.461  1.00 318.19 ? 167 VAL B C   1 
ATOM   5329 O  O   . VAL B 2 148 ? 25.374 157.024 53.199  1.00 316.07 ? 167 VAL B O   1 
ATOM   5330 C  CB  . VAL B 2 148 ? 26.802 156.800 50.459  1.00 312.03 ? 167 VAL B CB  1 
ATOM   5331 C  CG1 . VAL B 2 148 ? 27.967 155.939 50.917  1.00 312.78 ? 167 VAL B CG1 1 
ATOM   5332 C  CG2 . VAL B 2 148 ? 26.800 156.939 48.945  1.00 318.44 ? 167 VAL B CG2 1 
ATOM   5333 N  N   . LYS B 2 149 ? 25.622 154.795 52.924  1.00 316.62 ? 168 LYS B N   1 
ATOM   5334 C  CA  . LYS B 2 149 ? 25.518 154.502 54.348  1.00 287.93 ? 168 LYS B CA  1 
ATOM   5335 C  C   . LYS B 2 149 ? 26.577 153.494 54.773  1.00 276.97 ? 168 LYS B C   1 
ATOM   5336 O  O   . LYS B 2 149 ? 26.862 152.537 54.049  1.00 301.17 ? 168 LYS B O   1 
ATOM   5337 C  CB  . LYS B 2 149 ? 24.117 153.970 54.690  1.00 278.04 ? 168 LYS B CB  1 
ATOM   5338 C  CG  . LYS B 2 149 ? 23.927 153.542 56.139  1.00 291.63 ? 168 LYS B CG  1 
ATOM   5339 C  CD  . LYS B 2 149 ? 23.788 152.030 56.254  1.00 300.10 ? 168 LYS B CD  1 
ATOM   5340 C  CE  . LYS B 2 149 ? 23.522 151.603 57.689  1.00 296.56 ? 168 LYS B CE  1 
ATOM   5341 N  NZ  . LYS B 2 149 ? 23.329 150.131 57.806  1.00 286.47 ? 168 LYS B NZ  1 
ATOM   5342 N  N   . GLY B 2 150 ? 27.149 153.713 55.958  1.00 241.98 ? 169 GLY B N   1 
ATOM   5343 C  CA  . GLY B 2 150 ? 28.007 152.730 56.595  1.00 240.46 ? 169 GLY B CA  1 
ATOM   5344 C  C   . GLY B 2 150 ? 29.347 152.452 55.944  1.00 258.55 ? 169 GLY B C   1 
ATOM   5345 O  O   . GLY B 2 150 ? 29.627 151.308 55.571  1.00 283.35 ? 169 GLY B O   1 
ATOM   5346 N  N   . TYR B 2 151 ? 30.183 153.478 55.790  1.00 240.33 ? 170 TYR B N   1 
ATOM   5347 C  CA  . TYR B 2 151 ? 31.529 153.306 55.262  1.00 243.98 ? 170 TYR B CA  1 
ATOM   5348 C  C   . TYR B 2 151 ? 32.541 153.987 56.175  1.00 249.94 ? 170 TYR B C   1 
ATOM   5349 O  O   . TYR B 2 151 ? 32.234 154.976 56.845  1.00 241.15 ? 170 TYR B O   1 
ATOM   5350 C  CB  . TYR B 2 151 ? 31.653 153.868 53.839  1.00 246.77 ? 170 TYR B CB  1 
ATOM   5351 C  CG  . TYR B 2 151 ? 31.530 155.371 53.758  1.00 241.35 ? 170 TYR B CG  1 
ATOM   5352 C  CD1 . TYR B 2 151 ? 30.285 155.986 53.732  1.00 238.02 ? 170 TYR B CD1 1 
ATOM   5353 C  CD2 . TYR B 2 151 ? 32.659 156.177 53.701  1.00 250.17 ? 170 TYR B CD2 1 
ATOM   5354 C  CE1 . TYR B 2 151 ? 30.169 157.360 53.657  1.00 242.78 ? 170 TYR B CE1 1 
ATOM   5355 C  CE2 . TYR B 2 151 ? 32.554 157.551 53.627  1.00 254.47 ? 170 TYR B CE2 1 
ATOM   5356 C  CZ  . TYR B 2 151 ? 31.307 158.137 53.605  1.00 247.38 ? 170 TYR B CZ  1 
ATOM   5357 O  OH  . TYR B 2 151 ? 31.198 159.507 53.530  1.00 249.53 ? 170 TYR B OH  1 
ATOM   5358 N  N   . PHE B 2 152 ? 33.753 153.436 56.198  1.00 263.93 ? 171 PHE B N   1 
ATOM   5359 C  CA  . PHE B 2 152 ? 34.866 154.007 56.953  1.00 256.36 ? 171 PHE B CA  1 
ATOM   5360 C  C   . PHE B 2 152 ? 36.175 153.747 56.210  1.00 269.04 ? 171 PHE B C   1 
ATOM   5361 O  O   . PHE B 2 152 ? 36.315 152.709 55.562  1.00 258.33 ? 171 PHE B O   1 
ATOM   5362 C  CB  . PHE B 2 152 ? 34.921 153.405 58.361  1.00 249.81 ? 171 PHE B CB  1 
ATOM   5363 C  CG  . PHE B 2 152 ? 35.997 153.986 59.231  1.00 250.97 ? 171 PHE B CG  1 
ATOM   5364 C  CD1 . PHE B 2 152 ? 35.741 155.098 60.016  1.00 247.82 ? 171 PHE B CD1 1 
ATOM   5365 C  CD2 . PHE B 2 152 ? 37.263 153.424 59.266  1.00 255.43 ? 171 PHE B CD2 1 
ATOM   5366 C  CE1 . PHE B 2 152 ? 36.727 155.639 60.817  1.00 249.11 ? 171 PHE B CE1 1 
ATOM   5367 C  CE2 . PHE B 2 152 ? 38.254 153.963 60.063  1.00 256.73 ? 171 PHE B CE2 1 
ATOM   5368 C  CZ  . PHE B 2 152 ? 37.984 155.071 60.841  1.00 253.56 ? 171 PHE B CZ  1 
ATOM   5369 N  N   . PRO B 2 153 ? 37.141 154.682 56.278  1.00 281.63 ? 172 PRO B N   1 
ATOM   5370 C  CA  . PRO B 2 153 ? 37.203 156.037 56.837  1.00 282.02 ? 172 PRO B CA  1 
ATOM   5371 C  C   . PRO B 2 153 ? 36.490 157.004 55.912  1.00 285.27 ? 172 PRO B C   1 
ATOM   5372 O  O   . PRO B 2 153 ? 35.775 156.534 55.029  1.00 267.40 ? 172 PRO B O   1 
ATOM   5373 C  CB  . PRO B 2 153 ? 38.699 156.326 56.888  1.00 273.91 ? 172 PRO B CB  1 
ATOM   5374 C  CG  . PRO B 2 153 ? 39.237 155.580 55.732  1.00 257.69 ? 172 PRO B CG  1 
ATOM   5375 C  CD  . PRO B 2 153 ? 38.420 154.314 55.646  1.00 265.19 ? 172 PRO B CD  1 
ATOM   5376 N  N   . GLU B 2 154 ? 36.660 158.313 56.079  1.00 306.41 ? 173 GLU B N   1 
ATOM   5377 C  CA  . GLU B 2 154 ? 35.972 159.230 55.181  1.00 308.92 ? 173 GLU B CA  1 
ATOM   5378 C  C   . GLU B 2 154 ? 36.866 159.417 53.961  1.00 319.30 ? 173 GLU B C   1 
ATOM   5379 O  O   . GLU B 2 154 ? 37.784 160.242 53.954  1.00 317.62 ? 173 GLU B O   1 
ATOM   5380 C  CB  . GLU B 2 154 ? 35.690 160.558 55.879  1.00 304.46 ? 173 GLU B CB  1 
ATOM   5381 C  CG  . GLU B 2 154 ? 36.856 161.078 56.731  1.00 314.83 ? 173 GLU B CG  1 
ATOM   5382 C  CD  . GLU B 2 154 ? 36.887 162.595 56.845  1.00 315.29 ? 173 GLU B CD  1 
ATOM   5383 O  OE1 . GLU B 2 154 ? 35.805 163.219 56.872  1.00 294.24 ? 173 GLU B OE1 1 
ATOM   5384 O  OE2 . GLU B 2 154 ? 37.998 163.164 56.911  1.00 328.39 ? 173 GLU B OE2 1 
ATOM   5385 N  N   . SER B 2 155 ? 36.584 158.631 52.924  1.00 247.91 ? 174 SER B N   1 
ATOM   5386 C  CA  . SER B 2 155 ? 36.976 158.916 51.551  1.00 262.92 ? 174 SER B CA  1 
ATOM   5387 C  C   . SER B 2 155 ? 35.850 158.390 50.679  1.00 277.61 ? 174 SER B C   1 
ATOM   5388 O  O   . SER B 2 155 ? 35.603 157.181 50.668  1.00 270.89 ? 174 SER B O   1 
ATOM   5389 C  CB  . SER B 2 155 ? 38.309 158.257 51.194  1.00 272.80 ? 174 SER B CB  1 
ATOM   5390 O  OG  . SER B 2 155 ? 39.336 158.658 52.084  1.00 263.38 ? 174 SER B OG  1 
ATOM   5391 N  N   . VAL B 2 156 ? 35.169 159.271 49.952  1.00 303.17 ? 175 VAL B N   1 
ATOM   5392 C  CA  . VAL B 2 156 ? 34.114 158.835 49.047  1.00 314.20 ? 175 VAL B CA  1 
ATOM   5393 C  C   . VAL B 2 156 ? 33.976 159.868 47.942  1.00 327.24 ? 175 VAL B C   1 
ATOM   5394 O  O   . VAL B 2 156 ? 34.174 161.066 48.160  1.00 350.59 ? 175 VAL B O   1 
ATOM   5395 C  CB  . VAL B 2 156 ? 32.776 158.607 49.796  1.00 269.34 ? 175 VAL B CB  1 
ATOM   5396 C  CG1 . VAL B 2 156 ? 32.208 159.923 50.312  1.00 264.34 ? 175 VAL B CG1 1 
ATOM   5397 C  CG2 . VAL B 2 156 ? 31.775 157.881 48.909  1.00 269.12 ? 175 VAL B CG2 1 
ATOM   5398 N  N   . THR B 2 157 ? 33.646 159.397 46.742  1.00 312.26 ? 176 THR B N   1 
ATOM   5399 C  CA  . THR B 2 157 ? 33.414 160.285 45.610  1.00 323.65 ? 176 THR B CA  1 
ATOM   5400 C  C   . THR B 2 157 ? 32.169 159.818 44.875  1.00 325.29 ? 176 THR B C   1 
ATOM   5401 O  O   . THR B 2 157 ? 32.145 158.707 44.339  1.00 342.14 ? 176 THR B O   1 
ATOM   5402 C  CB  . THR B 2 157 ? 34.621 160.309 44.667  1.00 328.01 ? 176 THR B CB  1 
ATOM   5403 O  OG1 . THR B 2 157 ? 35.792 160.690 45.400  1.00 316.08 ? 176 THR B OG1 1 
ATOM   5404 C  CG2 . THR B 2 157 ? 34.393 161.302 43.538  1.00 323.29 ? 176 THR B CG2 1 
ATOM   5405 N  N   . VAL B 2 158 ? 31.147 160.667 44.836  1.00 284.15 ? 177 VAL B N   1 
ATOM   5406 C  CA  . VAL B 2 158 ? 29.889 160.361 44.164  1.00 274.15 ? 177 VAL B CA  1 
ATOM   5407 C  C   . VAL B 2 158 ? 29.760 161.295 42.971  1.00 290.87 ? 177 VAL B C   1 
ATOM   5408 O  O   . VAL B 2 158 ? 29.693 162.519 43.136  1.00 299.83 ? 177 VAL B O   1 
ATOM   5409 C  CB  . VAL B 2 158 ? 28.688 160.504 45.111  1.00 262.06 ? 177 VAL B CB  1 
ATOM   5410 C  CG1 . VAL B 2 158 ? 27.395 160.182 44.378  1.00 259.19 ? 177 VAL B CG1 1 
ATOM   5411 C  CG2 . VAL B 2 158 ? 28.858 159.602 46.324  1.00 277.93 ? 177 VAL B CG2 1 
ATOM   5412 N  N   . THR B 2 159 ? 29.731 160.722 41.773  1.00 248.72 ? 178 THR B N   1 
ATOM   5413 C  CA  . THR B 2 159 ? 29.605 161.486 40.542  1.00 257.34 ? 178 THR B CA  1 
ATOM   5414 C  C   . THR B 2 159 ? 28.277 161.163 39.864  1.00 314.60 ? 178 THR B C   1 
ATOM   5415 O  O   . THR B 2 159 ? 27.524 160.284 40.295  1.00 259.23 ? 178 THR B O   1 
ATOM   5416 C  CB  . THR B 2 159 ? 30.780 161.196 39.605  1.00 282.67 ? 178 THR B CB  1 
ATOM   5417 O  OG1 . THR B 2 159 ? 30.770 159.811 39.237  1.00 290.60 ? 178 THR B OG1 1 
ATOM   5418 C  CG2 . THR B 2 159 ? 32.100 161.522 40.287  1.00 281.62 ? 178 THR B CG2 1 
ATOM   5419 N  N   . TRP B 2 160 ? 28.004 161.879 38.774  1.00 425.54 ? 179 TRP B N   1 
ATOM   5420 C  CA  . TRP B 2 160 ? 26.758 161.725 38.033  1.00 442.25 ? 179 TRP B CA  1 
ATOM   5421 C  C   . TRP B 2 160 ? 27.059 161.718 36.543  1.00 450.58 ? 179 TRP B C   1 
ATOM   5422 O  O   . TRP B 2 160 ? 27.555 162.714 36.008  1.00 456.00 ? 179 TRP B O   1 
ATOM   5423 C  CB  . TRP B 2 160 ? 25.774 162.849 38.372  1.00 444.59 ? 179 TRP B CB  1 
ATOM   5424 C  CG  . TRP B 2 160 ? 25.242 162.789 39.770  1.00 441.64 ? 179 TRP B CG  1 
ATOM   5425 C  CD1 . TRP B 2 160 ? 25.827 163.296 40.894  1.00 440.06 ? 179 TRP B CD1 1 
ATOM   5426 C  CD2 . TRP B 2 160 ? 24.011 162.193 40.193  1.00 439.15 ? 179 TRP B CD2 1 
ATOM   5427 N  NE1 . TRP B 2 160 ? 25.038 163.050 41.991  1.00 437.21 ? 179 TRP B NE1 1 
ATOM   5428 C  CE2 . TRP B 2 160 ? 23.916 162.374 41.587  1.00 436.66 ? 179 TRP B CE2 1 
ATOM   5429 C  CE3 . TRP B 2 160 ? 22.980 161.523 39.528  1.00 440.80 ? 179 TRP B CE3 1 
ATOM   5430 C  CZ2 . TRP B 2 160 ? 22.832 161.908 42.328  1.00 435.00 ? 179 TRP B CZ2 1 
ATOM   5431 C  CZ3 . TRP B 2 160 ? 21.904 161.062 40.264  1.00 438.71 ? 179 TRP B CZ3 1 
ATOM   5432 C  CH2 . TRP B 2 160 ? 21.839 161.257 41.650  1.00 434.47 ? 179 TRP B CH2 1 
ATOM   5433 N  N   . ASN B 2 161 ? 26.742 160.603 35.881  1.00 403.49 ? 180 ASN B N   1 
ATOM   5434 C  CA  . ASN B 2 161 ? 26.841 160.480 34.425  1.00 380.98 ? 180 ASN B CA  1 
ATOM   5435 C  C   . ASN B 2 161 ? 28.206 160.930 33.909  1.00 380.52 ? 180 ASN B C   1 
ATOM   5436 O  O   . ASN B 2 161 ? 28.312 161.656 32.918  1.00 376.70 ? 180 ASN B O   1 
ATOM   5437 C  CB  . ASN B 2 161 ? 25.716 161.255 33.738  1.00 376.86 ? 180 ASN B CB  1 
ATOM   5438 C  CG  . ASN B 2 161 ? 24.341 160.762 34.139  1.00 376.54 ? 180 ASN B CG  1 
ATOM   5439 O  OD1 . ASN B 2 161 ? 24.161 159.588 34.467  1.00 374.68 ? 180 ASN B OD1 1 
ATOM   5440 N  ND2 . ASN B 2 161 ? 23.360 161.657 34.116  1.00 375.65 ? 180 ASN B ND2 1 
ATOM   5441 N  N   . SER B 2 162 ? 29.262 160.496 34.601  1.00 393.56 ? 181 SER B N   1 
ATOM   5442 C  CA  . SER B 2 162 ? 30.645 160.797 34.225  1.00 406.71 ? 181 SER B CA  1 
ATOM   5443 C  C   . SER B 2 162 ? 30.917 162.300 34.187  1.00 414.21 ? 181 SER B C   1 
ATOM   5444 O  O   . SER B 2 162 ? 31.754 162.770 33.413  1.00 408.37 ? 181 SER B O   1 
ATOM   5445 C  CB  . SER B 2 162 ? 31.011 160.154 32.883  1.00 405.30 ? 181 SER B CB  1 
ATOM   5446 O  OG  . SER B 2 162 ? 32.349 160.447 32.523  1.00 404.36 ? 181 SER B OG  1 
ATOM   5447 N  N   . GLY B 2 163 ? 30.212 163.065 35.019  1.00 409.80 ? 182 GLY B N   1 
ATOM   5448 C  CA  . GLY B 2 163 ? 30.464 164.484 35.155  1.00 408.31 ? 182 GLY B CA  1 
ATOM   5449 C  C   . GLY B 2 163 ? 29.622 165.392 34.285  1.00 406.04 ? 182 GLY B C   1 
ATOM   5450 O  O   . GLY B 2 163 ? 29.804 166.615 34.343  1.00 411.42 ? 182 GLY B O   1 
ATOM   5451 N  N   . SER B 2 164 ? 28.714 164.847 33.482  1.00 393.69 ? 183 SER B N   1 
ATOM   5452 C  CA  . SER B 2 164 ? 27.866 165.674 32.630  1.00 377.42 ? 183 SER B CA  1 
ATOM   5453 C  C   . SER B 2 164 ? 26.408 165.229 32.698  1.00 364.29 ? 183 SER B C   1 
ATOM   5454 O  O   . SER B 2 164 ? 26.082 164.098 32.338  1.00 354.64 ? 183 SER B O   1 
ATOM   5455 C  CB  . SER B 2 164 ? 28.359 165.632 31.182  1.00 375.08 ? 183 SER B CB  1 
ATOM   5456 O  OG  . SER B 2 164 ? 28.318 164.312 30.669  1.00 379.40 ? 183 SER B OG  1 
ATOM   5457 N  N   . LEU B 2 165 ? 25.531 166.120 33.153  1.00 367.05 ? 184 LEU B N   1 
ATOM   5458 C  CA  . LEU B 2 165 ? 25.926 167.459 33.579  1.00 385.45 ? 184 LEU B CA  1 
ATOM   5459 C  C   . LEU B 2 165 ? 25.501 167.713 35.019  1.00 423.79 ? 184 LEU B C   1 
ATOM   5460 O  O   . LEU B 2 165 ? 24.392 167.355 35.415  1.00 378.71 ? 184 LEU B O   1 
ATOM   5461 C  CB  . LEU B 2 165 ? 25.317 168.521 32.653  1.00 377.51 ? 184 LEU B CB  1 
ATOM   5462 C  CG  . LEU B 2 165 ? 23.791 168.574 32.487  1.00 383.71 ? 184 LEU B CG  1 
ATOM   5463 C  CD1 . LEU B 2 165 ? 23.127 169.504 33.502  1.00 386.69 ? 184 LEU B CD1 1 
ATOM   5464 C  CD2 . LEU B 2 165 ? 23.421 168.985 31.070  1.00 386.78 ? 184 LEU B CD2 1 
ATOM   5465 N  N   . SER B 2 166 ? 26.390 168.293 35.821  1.00 526.28 ? 185 SER B N   1 
ATOM   5466 C  CA  . SER B 2 166 ? 26.014 168.797 37.138  1.00 533.92 ? 185 SER B CA  1 
ATOM   5467 C  C   . SER B 2 166 ? 26.241 170.305 37.175  1.00 532.64 ? 185 SER B C   1 
ATOM   5468 O  O   . SER B 2 166 ? 27.378 170.757 37.339  1.00 541.99 ? 185 SER B O   1 
ATOM   5469 C  CB  . SER B 2 166 ? 26.827 168.098 38.222  1.00 538.42 ? 185 SER B CB  1 
ATOM   5470 O  OG  . SER B 2 166 ? 28.215 168.333 38.047  1.00 544.00 ? 185 SER B OG  1 
ATOM   5471 N  N   . SER B 2 167 ? 25.174 171.093 37.022  1.00 487.19 ? 186 SER B N   1 
ATOM   5472 C  CA  . SER B 2 167 ? 25.175 172.463 37.511  1.00 456.03 ? 186 SER B CA  1 
ATOM   5473 C  C   . SER B 2 167 ? 24.299 172.677 38.739  1.00 436.96 ? 186 SER B C   1 
ATOM   5474 O  O   . SER B 2 167 ? 24.429 173.716 39.395  1.00 438.26 ? 186 SER B O   1 
ATOM   5475 C  CB  . SER B 2 167 ? 24.723 173.419 36.398  1.00 456.37 ? 186 SER B CB  1 
ATOM   5476 O  OG  . SER B 2 167 ? 23.475 173.019 35.858  1.00 458.57 ? 186 SER B OG  1 
ATOM   5477 N  N   . SER B 2 168 ? 23.413 171.734 39.061  1.00 422.75 ? 187 SER B N   1 
ATOM   5478 C  CA  . SER B 2 168 ? 22.484 171.872 40.175  1.00 406.10 ? 187 SER B CA  1 
ATOM   5479 C  C   . SER B 2 168 ? 22.833 171.030 41.395  1.00 396.20 ? 187 SER B C   1 
ATOM   5480 O  O   . SER B 2 168 ? 22.123 171.112 42.402  1.00 407.37 ? 187 SER B O   1 
ATOM   5481 C  CB  . SER B 2 168 ? 21.062 171.537 39.713  1.00 393.62 ? 187 SER B CB  1 
ATOM   5482 O  OG  . SER B 2 168 ? 21.033 170.317 38.993  1.00 388.60 ? 187 SER B OG  1 
ATOM   5483 N  N   . VAL B 2 169 ? 23.890 170.221 41.336  1.00 367.25 ? 188 VAL B N   1 
ATOM   5484 C  CA  . VAL B 2 169 ? 24.065 169.150 42.313  1.00 337.82 ? 188 VAL B CA  1 
ATOM   5485 C  C   . VAL B 2 169 ? 24.380 169.727 43.686  1.00 322.93 ? 188 VAL B C   1 
ATOM   5486 O  O   . VAL B 2 169 ? 25.235 170.610 43.830  1.00 324.31 ? 188 VAL B O   1 
ATOM   5487 C  CB  . VAL B 2 169 ? 25.157 168.174 41.850  1.00 336.35 ? 188 VAL B CB  1 
ATOM   5488 C  CG1 . VAL B 2 169 ? 25.639 167.319 43.011  1.00 338.00 ? 188 VAL B CG1 1 
ATOM   5489 C  CG2 . VAL B 2 169 ? 24.622 167.287 40.749  1.00 334.91 ? 188 VAL B CG2 1 
ATOM   5490 N  N   . HIS B 2 170 ? 23.679 169.229 44.702  1.00 298.09 ? 189 HIS B N   1 
ATOM   5491 C  CA  . HIS B 2 170 ? 23.963 169.531 46.098  1.00 279.71 ? 189 HIS B CA  1 
ATOM   5492 C  C   . HIS B 2 170 ? 24.474 168.268 46.777  1.00 279.84 ? 189 HIS B C   1 
ATOM   5493 O  O   . HIS B 2 170 ? 23.874 167.198 46.634  1.00 244.91 ? 189 HIS B O   1 
ATOM   5494 C  CB  . HIS B 2 170 ? 22.717 170.051 46.820  1.00 271.65 ? 189 HIS B CB  1 
ATOM   5495 C  CG  . HIS B 2 170 ? 22.166 171.319 46.246  1.00 282.24 ? 189 HIS B CG  1 
ATOM   5496 N  ND1 . HIS B 2 170 ? 22.565 172.566 46.677  1.00 283.74 ? 189 HIS B ND1 1 
ATOM   5497 C  CD2 . HIS B 2 170 ? 21.240 171.533 45.282  1.00 291.37 ? 189 HIS B CD2 1 
ATOM   5498 C  CE1 . HIS B 2 170 ? 21.912 173.493 45.999  1.00 281.76 ? 189 HIS B CE1 1 
ATOM   5499 N  NE2 . HIS B 2 170 ? 21.103 172.893 45.146  1.00 297.09 ? 189 HIS B NE2 1 
ATOM   5500 N  N   . THR B 2 171 ? 25.578 168.392 47.508  1.00 331.93 ? 190 THR B N   1 
ATOM   5501 C  CA  . THR B 2 171 ? 26.197 167.271 48.204  1.00 322.02 ? 190 THR B CA  1 
ATOM   5502 C  C   . THR B 2 171 ? 26.165 167.535 49.702  1.00 314.79 ? 190 THR B C   1 
ATOM   5503 O  O   . THR B 2 171 ? 26.580 168.608 50.154  1.00 314.76 ? 190 THR B O   1 
ATOM   5504 C  CB  . THR B 2 171 ? 27.637 167.055 47.734  1.00 324.21 ? 190 THR B CB  1 
ATOM   5505 O  OG1 . THR B 2 171 ? 27.645 166.773 46.329  1.00 337.96 ? 190 THR B OG1 1 
ATOM   5506 C  CG2 . THR B 2 171 ? 28.274 165.894 48.482  1.00 325.46 ? 190 THR B CG2 1 
ATOM   5507 N  N   . PHE B 2 172 ? 25.675 166.552 50.473  1.00 309.48 ? 191 PHE B N   1 
ATOM   5508 C  CA  . PHE B 2 172 ? 25.524 166.796 51.903  1.00 300.42 ? 191 PHE B CA  1 
ATOM   5509 C  C   . PHE B 2 172 ? 26.676 166.178 52.678  1.00 279.06 ? 191 PHE B C   1 
ATOM   5510 O  O   . PHE B 2 172 ? 27.017 165.010 52.441  1.00 281.84 ? 191 PHE B O   1 
ATOM   5511 C  CB  . PHE B 2 172 ? 24.194 166.240 52.399  1.00 299.39 ? 191 PHE B CB  1 
ATOM   5512 C  CG  . PHE B 2 172 ? 23.002 166.881 51.749  1.00 290.18 ? 191 PHE B CG  1 
ATOM   5513 C  CD1 . PHE B 2 172 ? 22.532 168.106 52.192  1.00 293.53 ? 191 PHE B CD1 1 
ATOM   5514 C  CD2 . PHE B 2 172 ? 22.363 166.270 50.683  1.00 273.70 ? 191 PHE B CD2 1 
ATOM   5515 C  CE1 . PHE B 2 172 ? 21.442 168.705 51.591  1.00 294.83 ? 191 PHE B CE1 1 
ATOM   5516 C  CE2 . PHE B 2 172 ? 21.272 166.864 50.079  1.00 272.33 ? 191 PHE B CE2 1 
ATOM   5517 C  CZ  . PHE B 2 172 ? 20.810 168.082 50.535  1.00 288.17 ? 191 PHE B CZ  1 
ATOM   5518 N  N   . PRO B 2 173 ? 27.301 166.932 53.586  1.00 246.22 ? 192 PRO B N   1 
ATOM   5519 C  CA  . PRO B 2 173 ? 28.483 166.421 54.292  1.00 240.39 ? 192 PRO B CA  1 
ATOM   5520 C  C   . PRO B 2 173 ? 28.180 165.148 55.068  1.00 272.22 ? 192 PRO B C   1 
ATOM   5521 O  O   . PRO B 2 173 ? 27.052 164.910 55.507  1.00 271.07 ? 192 PRO B O   1 
ATOM   5522 C  CB  . PRO B 2 173 ? 28.858 167.571 55.236  1.00 220.37 ? 192 PRO B CB  1 
ATOM   5523 C  CG  . PRO B 2 173 ? 28.226 168.784 54.635  1.00 219.35 ? 192 PRO B CG  1 
ATOM   5524 C  CD  . PRO B 2 173 ? 26.960 168.302 53.999  1.00 241.45 ? 192 PRO B CD  1 
ATOM   5525 N  N   . ALA B 2 174 ? 29.213 164.328 55.236  1.00 292.67 ? 193 ALA B N   1 
ATOM   5526 C  CA  . ALA B 2 174 ? 29.068 163.043 55.898  1.00 293.79 ? 193 ALA B CA  1 
ATOM   5527 C  C   . ALA B 2 174 ? 28.945 163.215 57.407  1.00 273.43 ? 193 ALA B C   1 
ATOM   5528 O  O   . ALA B 2 174 ? 29.505 164.142 58.000  1.00 272.84 ? 193 ALA B O   1 
ATOM   5529 C  CB  . ALA B 2 174 ? 30.255 162.135 55.574  1.00 296.83 ? 193 ALA B CB  1 
ATOM   5530 N  N   . LEU B 2 175 ? 28.200 162.303 58.025  1.00 241.31 ? 194 LEU B N   1 
ATOM   5531 C  CA  . LEU B 2 175 ? 28.012 162.270 59.468  1.00 241.92 ? 194 LEU B CA  1 
ATOM   5532 C  C   . LEU B 2 175 ? 28.502 160.929 59.993  1.00 267.10 ? 194 LEU B C   1 
ATOM   5533 O  O   . LEU B 2 175 ? 28.140 159.878 59.454  1.00 260.91 ? 194 LEU B O   1 
ATOM   5534 C  CB  . LEU B 2 175 ? 26.542 162.488 59.838  1.00 228.97 ? 194 LEU B CB  1 
ATOM   5535 C  CG  . LEU B 2 175 ? 25.903 163.771 59.300  1.00 231.24 ? 194 LEU B CG  1 
ATOM   5536 C  CD1 . LEU B 2 175 ? 24.448 163.872 59.729  1.00 245.73 ? 194 LEU B CD1 1 
ATOM   5537 C  CD2 . LEU B 2 175 ? 26.685 164.996 59.752  1.00 214.35 ? 194 LEU B CD2 1 
ATOM   5538 N  N   . LEU B 2 176 ? 29.325 160.970 61.037  1.00 299.76 ? 195 LEU B N   1 
ATOM   5539 C  CA  . LEU B 2 176 ? 29.956 159.779 61.592  1.00 315.72 ? 195 LEU B CA  1 
ATOM   5540 C  C   . LEU B 2 176 ? 29.144 159.278 62.780  1.00 326.62 ? 195 LEU B C   1 
ATOM   5541 O  O   . LEU B 2 176 ? 28.900 160.029 63.731  1.00 309.20 ? 195 LEU B O   1 
ATOM   5542 C  CB  . LEU B 2 176 ? 31.394 160.078 62.014  1.00 313.59 ? 195 LEU B CB  1 
ATOM   5543 C  CG  . LEU B 2 176 ? 32.145 158.958 62.735  1.00 317.28 ? 195 LEU B CG  1 
ATOM   5544 C  CD1 . LEU B 2 176 ? 32.270 157.734 61.842  1.00 322.74 ? 195 LEU B CD1 1 
ATOM   5545 C  CD2 . LEU B 2 176 ? 33.514 159.438 63.191  1.00 316.93 ? 195 LEU B CD2 1 
ATOM   5546 N  N   . GLN B 2 177 ? 28.727 158.015 62.722  1.00 353.96 ? 196 GLN B N   1 
ATOM   5547 C  CA  . GLN B 2 177 ? 27.998 157.404 63.824  1.00 352.34 ? 196 GLN B CA  1 
ATOM   5548 C  C   . GLN B 2 177 ? 28.379 155.935 63.926  1.00 348.19 ? 196 GLN B C   1 
ATOM   5549 O  O   . GLN B 2 177 ? 28.472 155.239 62.911  1.00 358.10 ? 196 GLN B O   1 
ATOM   5550 C  CB  . GLN B 2 177 ? 26.484 157.556 63.640  1.00 352.54 ? 196 GLN B CB  1 
ATOM   5551 C  CG  . GLN B 2 177 ? 25.977 157.132 62.271  1.00 353.98 ? 196 GLN B CG  1 
ATOM   5552 C  CD  . GLN B 2 177 ? 24.517 157.476 62.056  1.00 350.04 ? 196 GLN B CD  1 
ATOM   5553 O  OE1 . GLN B 2 177 ? 23.852 157.999 62.951  1.00 351.51 ? 196 GLN B OE1 1 
ATOM   5554 N  NE2 . GLN B 2 177 ? 24.010 157.187 60.863  1.00 342.34 ? 196 GLN B NE2 1 
ATOM   5555 N  N   . SER B 2 178 ? 28.583 155.471 65.162  1.00 285.67 ? 197 SER B N   1 
ATOM   5556 C  CA  . SER B 2 178 ? 28.964 154.083 65.442  1.00 265.11 ? 197 SER B CA  1 
ATOM   5557 C  C   . SER B 2 178 ? 30.193 153.660 64.640  1.00 279.10 ? 197 SER B C   1 
ATOM   5558 O  O   . SER B 2 178 ? 30.320 152.502 64.234  1.00 239.33 ? 197 SER B O   1 
ATOM   5559 C  CB  . SER B 2 178 ? 27.797 153.125 65.184  1.00 239.10 ? 197 SER B CB  1 
ATOM   5560 O  OG  . SER B 2 178 ? 27.478 153.062 63.805  1.00 231.74 ? 197 SER B OG  1 
ATOM   5561 N  N   . GLY B 2 179 ? 31.111 154.597 64.411  1.00 289.88 ? 198 GLY B N   1 
ATOM   5562 C  CA  . GLY B 2 179 ? 32.320 154.311 63.667  1.00 296.14 ? 198 GLY B CA  1 
ATOM   5563 C  C   . GLY B 2 179 ? 32.152 154.218 62.168  1.00 307.02 ? 198 GLY B C   1 
ATOM   5564 O  O   . GLY B 2 179 ? 33.105 153.835 61.478  1.00 324.86 ? 198 GLY B O   1 
ATOM   5565 N  N   . LEU B 2 180 ? 30.977 154.556 61.638  1.00 290.63 ? 199 LEU B N   1 
ATOM   5566 C  CA  . LEU B 2 180 ? 30.704 154.473 60.210  1.00 297.26 ? 199 LEU B CA  1 
ATOM   5567 C  C   . LEU B 2 180 ? 30.100 155.785 59.730  1.00 296.17 ? 199 LEU B C   1 
ATOM   5568 O  O   . LEU B 2 180 ? 29.212 156.342 60.385  1.00 286.66 ? 199 LEU B O   1 
ATOM   5569 C  CB  . LEU B 2 180 ? 29.758 153.307 59.895  1.00 282.27 ? 199 LEU B CB  1 
ATOM   5570 C  CG  . LEU B 2 180 ? 30.241 151.905 60.270  1.00 271.33 ? 199 LEU B CG  1 
ATOM   5571 C  CD1 . LEU B 2 180 ? 29.228 150.853 59.844  1.00 256.88 ? 199 LEU B CD1 1 
ATOM   5572 C  CD2 . LEU B 2 180 ? 31.601 151.619 59.655  1.00 267.29 ? 199 LEU B CD2 1 
ATOM   5573 N  N   . TYR B 2 181 ? 30.598 156.282 58.600  1.00 291.65 ? 200 TYR B N   1 
ATOM   5574 C  CA  . TYR B 2 181 ? 30.081 157.503 58.000  1.00 284.05 ? 200 TYR B CA  1 
ATOM   5575 C  C   . TYR B 2 181 ? 28.824 157.227 57.181  1.00 311.59 ? 200 TYR B C   1 
ATOM   5576 O  O   . TYR B 2 181 ? 28.607 156.116 56.686  1.00 315.13 ? 200 TYR B O   1 
ATOM   5577 C  CB  . TYR B 2 181 ? 31.142 158.157 57.115  1.00 266.23 ? 200 TYR B CB  1 
ATOM   5578 C  CG  . TYR B 2 181 ? 32.352 158.656 57.872  1.00 259.54 ? 200 TYR B CG  1 
ATOM   5579 C  CD1 . TYR B 2 181 ? 33.440 157.826 58.107  1.00 260.68 ? 200 TYR B CD1 1 
ATOM   5580 C  CD2 . TYR B 2 181 ? 32.406 159.959 58.352  1.00 257.52 ? 200 TYR B CD2 1 
ATOM   5581 C  CE1 . TYR B 2 181 ? 34.547 158.279 58.798  1.00 264.27 ? 200 TYR B CE1 1 
ATOM   5582 C  CE2 . TYR B 2 181 ? 33.509 160.421 59.044  1.00 264.17 ? 200 TYR B CE2 1 
ATOM   5583 C  CZ  . TYR B 2 181 ? 34.577 159.577 59.264  1.00 263.44 ? 200 TYR B CZ  1 
ATOM   5584 O  OH  . TYR B 2 181 ? 35.677 160.033 59.953  1.00 251.25 ? 200 TYR B OH  1 
ATOM   5585 N  N   . THR B 2 182 ? 27.989 158.257 57.048  1.00 260.26 ? 201 THR B N   1 
ATOM   5586 C  CA  . THR B 2 182 ? 26.792 158.207 56.219  1.00 250.77 ? 201 THR B CA  1 
ATOM   5587 C  C   . THR B 2 182 ? 26.583 159.568 55.571  1.00 291.64 ? 201 THR B C   1 
ATOM   5588 O  O   . THR B 2 182 ? 26.695 160.599 56.239  1.00 259.95 ? 201 THR B O   1 
ATOM   5589 C  CB  . THR B 2 182 ? 25.556 157.818 57.044  1.00 250.89 ? 201 THR B CB  1 
ATOM   5590 O  OG1 . THR B 2 182 ? 25.764 156.535 57.648  1.00 274.29 ? 201 THR B OG1 1 
ATOM   5591 C  CG2 . THR B 2 182 ? 24.313 157.765 56.168  1.00 240.97 ? 201 THR B CG2 1 
ATOM   5592 N  N   . MET B 2 183 ? 26.273 159.575 54.274  1.00 389.32 ? 202 MET B N   1 
ATOM   5593 C  CA  . MET B 2 183 ? 26.086 160.827 53.551  1.00 395.13 ? 202 MET B CA  1 
ATOM   5594 C  C   . MET B 2 183 ? 25.093 160.617 52.412  1.00 392.12 ? 202 MET B C   1 
ATOM   5595 O  O   . MET B 2 183 ? 24.625 159.502 52.162  1.00 398.54 ? 202 MET B O   1 
ATOM   5596 C  CB  . MET B 2 183 ? 27.427 161.367 53.040  1.00 406.51 ? 202 MET B CB  1 
ATOM   5597 C  CG  . MET B 2 183 ? 28.238 160.380 52.210  1.00 419.52 ? 202 MET B CG  1 
ATOM   5598 S  SD  . MET B 2 183 ? 27.773 160.354 50.468  1.00 283.10 ? 202 MET B SD  1 
ATOM   5599 C  CE  . MET B 2 183 ? 28.037 162.070 50.026  1.00 258.23 ? 202 MET B CE  1 
ATOM   5600 N  N   . SER B 2 184 ? 24.788 161.707 51.707  1.00 335.32 ? 203 SER B N   1 
ATOM   5601 C  CA  . SER B 2 184 ? 23.782 161.681 50.653  1.00 326.01 ? 203 SER B CA  1 
ATOM   5602 C  C   . SER B 2 184 ? 24.038 162.818 49.673  1.00 363.63 ? 203 SER B C   1 
ATOM   5603 O  O   . SER B 2 184 ? 24.707 163.807 49.993  1.00 311.61 ? 203 SER B O   1 
ATOM   5604 C  CB  . SER B 2 184 ? 22.367 161.781 51.233  1.00 307.30 ? 203 SER B CB  1 
ATOM   5605 O  OG  . SER B 2 184 ? 22.228 162.939 52.039  1.00 300.16 ? 203 SER B OG  1 
ATOM   5606 N  N   . SER B 2 185 ? 23.477 162.666 48.472  1.00 479.11 ? 204 SER B N   1 
ATOM   5607 C  CA  . SER B 2 185 ? 23.643 163.640 47.402  1.00 485.91 ? 204 SER B CA  1 
ATOM   5608 C  C   . SER B 2 185 ? 22.340 163.783 46.628  1.00 480.16 ? 204 SER B C   1 
ATOM   5609 O  O   . SER B 2 185 ? 21.518 162.863 46.589  1.00 485.16 ? 204 SER B O   1 
ATOM   5610 C  CB  . SER B 2 185 ? 24.776 163.239 46.448  1.00 493.81 ? 204 SER B CB  1 
ATOM   5611 O  OG  . SER B 2 185 ? 24.888 164.157 45.374  1.00 496.49 ? 204 SER B OG  1 
ATOM   5612 N  N   . SER B 2 186 ? 22.167 164.947 46.001  1.00 338.76 ? 205 SER B N   1 
ATOM   5613 C  CA  . SER B 2 186 ? 20.958 165.249 45.248  1.00 265.97 ? 205 SER B CA  1 
ATOM   5614 C  C   . SER B 2 186 ? 21.311 166.104 44.038  1.00 312.79 ? 205 SER B C   1 
ATOM   5615 O  O   . SER B 2 186 ? 22.376 166.725 43.978  1.00 267.66 ? 205 SER B O   1 
ATOM   5616 C  CB  . SER B 2 186 ? 19.918 165.967 46.116  1.00 223.35 ? 205 SER B CB  1 
ATOM   5617 O  OG  . SER B 2 186 ? 20.377 167.251 46.500  1.00 222.15 ? 205 SER B OG  1 
ATOM   5618 N  N   . VAL B 2 187 ? 20.390 166.136 43.078  1.00 435.85 ? 206 VAL B N   1 
ATOM   5619 C  CA  . VAL B 2 187 ? 20.572 166.870 41.828  1.00 445.58 ? 206 VAL B CA  1 
ATOM   5620 C  C   . VAL B 2 187 ? 19.211 167.373 41.367  1.00 429.48 ? 206 VAL B C   1 
ATOM   5621 O  O   . VAL B 2 187 ? 18.196 166.698 41.547  1.00 427.13 ? 206 VAL B O   1 
ATOM   5622 C  CB  . VAL B 2 187 ? 21.242 165.981 40.755  1.00 457.44 ? 206 VAL B CB  1 
ATOM   5623 C  CG1 . VAL B 2 187 ? 20.495 164.663 40.613  1.00 456.47 ? 206 VAL B CG1 1 
ATOM   5624 C  CG2 . VAL B 2 187 ? 21.319 166.703 39.416  1.00 465.57 ? 206 VAL B CG2 1 
ATOM   5625 N  N   . THR B 2 188 ? 19.186 168.568 40.779  1.00 378.96 ? 207 THR B N   1 
ATOM   5626 C  CA  . THR B 2 188 ? 17.958 169.160 40.254  1.00 343.48 ? 207 THR B CA  1 
ATOM   5627 C  C   . THR B 2 188 ? 18.054 169.213 38.733  1.00 355.80 ? 207 THR B C   1 
ATOM   5628 O  O   . THR B 2 188 ? 18.852 169.978 38.182  1.00 335.53 ? 207 THR B O   1 
ATOM   5629 C  CB  . THR B 2 188 ? 17.727 170.553 40.837  1.00 324.56 ? 207 THR B CB  1 
ATOM   5630 O  OG1 . THR B 2 188 ? 17.646 170.467 42.266  1.00 316.89 ? 207 THR B OG1 1 
ATOM   5631 C  CG2 . THR B 2 188 ? 16.435 171.147 40.297  1.00 323.13 ? 207 THR B CG2 1 
ATOM   5632 N  N   . VAL B 2 189 ? 17.240 168.408 38.058  1.00 402.65 ? 208 VAL B N   1 
ATOM   5633 C  CA  . VAL B 2 189 ? 17.248 168.361 36.597  1.00 399.53 ? 208 VAL B CA  1 
ATOM   5634 C  C   . VAL B 2 189 ? 15.856 168.706 36.082  1.00 387.90 ? 208 VAL B C   1 
ATOM   5635 O  O   . VAL B 2 189 ? 14.861 168.412 36.756  1.00 386.75 ? 208 VAL B O   1 
ATOM   5636 C  CB  . VAL B 2 189 ? 17.709 166.986 36.087  1.00 401.63 ? 208 VAL B CB  1 
ATOM   5637 C  CG1 . VAL B 2 189 ? 19.190 166.789 36.368  1.00 403.66 ? 208 VAL B CG1 1 
ATOM   5638 C  CG2 . VAL B 2 189 ? 16.890 165.878 36.730  1.00 398.23 ? 208 VAL B CG2 1 
ATOM   5639 N  N   . PRO B 2 190 ? 15.732 169.325 34.910  1.00 373.26 ? 209 PRO B N   1 
ATOM   5640 C  CA  . PRO B 2 190 ? 14.403 169.675 34.399  1.00 350.84 ? 209 PRO B CA  1 
ATOM   5641 C  C   . PRO B 2 190 ? 13.584 168.438 34.067  1.00 330.80 ? 209 PRO B C   1 
ATOM   5642 O  O   . PRO B 2 190 ? 14.099 167.326 33.930  1.00 325.80 ? 209 PRO B O   1 
ATOM   5643 C  CB  . PRO B 2 190 ? 14.708 170.494 33.140  1.00 350.79 ? 209 PRO B CB  1 
ATOM   5644 C  CG  . PRO B 2 190 ? 16.069 170.049 32.723  1.00 356.55 ? 209 PRO B CG  1 
ATOM   5645 C  CD  . PRO B 2 190 ? 16.806 169.758 33.998  1.00 363.29 ? 209 PRO B CD  1 
ATOM   5646 N  N   . SER B 2 191 ? 12.273 168.650 33.941  1.00 320.15 ? 210 SER B N   1 
ATOM   5647 C  CA  . SER B 2 191 ? 11.354 167.558 33.645  1.00 325.78 ? 210 SER B CA  1 
ATOM   5648 C  C   . SER B 2 191 ? 11.482 167.044 32.218  1.00 367.00 ? 210 SER B C   1 
ATOM   5649 O  O   . SER B 2 191 ? 10.921 165.988 31.908  1.00 303.73 ? 210 SER B O   1 
ATOM   5650 C  CB  . SER B 2 191 ? 9.914  168.004 33.904  1.00 306.87 ? 210 SER B CB  1 
ATOM   5651 O  OG  . SER B 2 191 ? 9.745  168.426 35.246  1.00 306.74 ? 210 SER B OG  1 
ATOM   5652 N  N   . SER B 2 192 ? 12.199 167.755 31.346  1.00 464.53 ? 211 SER B N   1 
ATOM   5653 C  CA  . SER B 2 192 ? 12.342 167.324 29.962  1.00 467.86 ? 211 SER B CA  1 
ATOM   5654 C  C   . SER B 2 192 ? 13.397 166.240 29.782  1.00 455.87 ? 211 SER B C   1 
ATOM   5655 O  O   . SER B 2 192 ? 13.353 165.513 28.784  1.00 467.79 ? 211 SER B O   1 
ATOM   5656 C  CB  . SER B 2 192 ? 12.681 168.522 29.072  1.00 471.79 ? 211 SER B CB  1 
ATOM   5657 O  OG  . SER B 2 192 ? 13.845 169.187 29.532  1.00 470.49 ? 211 SER B OG  1 
ATOM   5658 N  N   . THR B 2 193 ? 14.341 166.116 30.713  1.00 414.15 ? 212 THR B N   1 
ATOM   5659 C  CA  . THR B 2 193 ? 15.399 165.119 30.620  1.00 380.09 ? 212 THR B CA  1 
ATOM   5660 C  C   . THR B 2 193 ? 15.104 163.854 31.415  1.00 360.73 ? 212 THR B C   1 
ATOM   5661 O  O   . THR B 2 193 ? 15.923 162.929 31.405  1.00 363.62 ? 212 THR B O   1 
ATOM   5662 C  CB  . THR B 2 193 ? 16.733 165.714 31.087  1.00 368.34 ? 212 THR B CB  1 
ATOM   5663 O  OG1 . THR B 2 193 ? 17.788 164.777 30.840  1.00 368.71 ? 212 THR B OG1 1 
ATOM   5664 C  CG2 . THR B 2 193 ? 16.687 166.028 32.573  1.00 363.91 ? 212 THR B CG2 1 
ATOM   5665 N  N   . TRP B 2 194 ? 13.966 163.786 32.097  1.00 339.45 ? 213 TRP B N   1 
ATOM   5666 C  CA  . TRP B 2 194 ? 13.673 162.650 32.964  1.00 323.75 ? 213 TRP B CA  1 
ATOM   5667 C  C   . TRP B 2 194 ? 12.205 162.233 32.891  1.00 315.25 ? 213 TRP B C   1 
ATOM   5668 O  O   . TRP B 2 194 ? 11.320 163.084 32.791  1.00 307.85 ? 213 TRP B O   1 
ATOM   5669 C  CB  . TRP B 2 194 ? 14.051 162.996 34.409  1.00 323.57 ? 213 TRP B CB  1 
ATOM   5670 C  CG  . TRP B 2 194 ? 13.821 161.891 35.394  1.00 320.41 ? 213 TRP B CG  1 
ATOM   5671 C  CD1 . TRP B 2 194 ? 14.706 160.916 35.751  1.00 315.74 ? 213 TRP B CD1 1 
ATOM   5672 C  CD2 . TRP B 2 194 ? 12.630 161.649 36.152  1.00 311.22 ? 213 TRP B CD2 1 
ATOM   5673 N  NE1 . TRP B 2 194 ? 14.140 160.081 36.683  1.00 307.04 ? 213 TRP B NE1 1 
ATOM   5674 C  CE2 . TRP B 2 194 ? 12.865 160.509 36.946  1.00 299.29 ? 213 TRP B CE2 1 
ATOM   5675 C  CE3 . TRP B 2 194 ? 11.387 162.284 36.236  1.00 304.06 ? 213 TRP B CE3 1 
ATOM   5676 C  CZ2 . TRP B 2 194 ? 11.905 159.992 37.813  1.00 277.69 ? 213 TRP B CZ2 1 
ATOM   5677 C  CZ3 . TRP B 2 194 ? 10.434 161.768 37.097  1.00 286.40 ? 213 TRP B CZ3 1 
ATOM   5678 C  CH2 . TRP B 2 194 ? 10.699 160.634 37.873  1.00 275.77 ? 213 TRP B CH2 1 
ATOM   5679 N  N   . PRO B 2 195 ? 11.942 160.916 32.943  1.00 321.14 ? 214 PRO B N   1 
ATOM   5680 C  CA  . PRO B 2 195 ? 12.956 159.858 32.861  1.00 317.50 ? 214 PRO B CA  1 
ATOM   5681 C  C   . PRO B 2 195 ? 13.236 159.421 31.424  1.00 308.81 ? 214 PRO B C   1 
ATOM   5682 O  O   . PRO B 2 195 ? 13.195 158.226 31.131  1.00 309.13 ? 214 PRO B O   1 
ATOM   5683 C  CB  . PRO B 2 195 ? 12.322 158.721 33.658  1.00 310.44 ? 214 PRO B CB  1 
ATOM   5684 C  CG  . PRO B 2 195 ? 10.862 158.881 33.393  1.00 299.27 ? 214 PRO B CG  1 
ATOM   5685 C  CD  . PRO B 2 195 ? 10.609 160.367 33.251  1.00 310.97 ? 214 PRO B CD  1 
ATOM   5686 N  N   . SER B 2 196 ? 13.519 160.381 30.542  1.00 296.02 ? 215 SER B N   1 
ATOM   5687 C  CA  . SER B 2 196 ? 13.745 160.055 29.138  1.00 311.31 ? 215 SER B CA  1 
ATOM   5688 C  C   . SER B 2 196 ? 15.148 159.502 28.907  1.00 340.81 ? 215 SER B C   1 
ATOM   5689 O  O   . SER B 2 196 ? 15.316 158.475 28.242  1.00 339.39 ? 215 SER B O   1 
ATOM   5690 C  CB  . SER B 2 196 ? 13.507 161.292 28.269  1.00 309.38 ? 215 SER B CB  1 
ATOM   5691 O  OG  . SER B 2 196 ? 14.368 162.352 28.646  1.00 308.56 ? 215 SER B OG  1 
ATOM   5692 N  N   . GLN B 2 197 ? 16.162 160.168 29.451  1.00 367.52 ? 216 GLN B N   1 
ATOM   5693 C  CA  . GLN B 2 197 ? 17.546 159.780 29.230  1.00 389.88 ? 216 GLN B CA  1 
ATOM   5694 C  C   . GLN B 2 197 ? 18.016 158.849 30.348  1.00 404.69 ? 216 GLN B C   1 
ATOM   5695 O  O   . GLN B 2 197 ? 17.231 158.394 31.185  1.00 394.46 ? 216 GLN B O   1 
ATOM   5696 C  CB  . GLN B 2 197 ? 18.431 161.019 29.116  1.00 378.60 ? 216 GLN B CB  1 
ATOM   5697 C  CG  . GLN B 2 197 ? 18.134 161.885 27.903  1.00 371.09 ? 216 GLN B CG  1 
ATOM   5698 C  CD  . GLN B 2 197 ? 19.108 163.037 27.758  1.00 368.14 ? 216 GLN B CD  1 
ATOM   5699 O  OE1 . GLN B 2 197 ? 20.018 163.202 28.570  1.00 369.32 ? 216 GLN B OE1 1 
ATOM   5700 N  NE2 . GLN B 2 197 ? 18.922 163.842 26.718  1.00 367.91 ? 216 GLN B NE2 1 
ATOM   5701 N  N   . THR B 2 198 ? 19.314 158.556 30.366  1.00 425.88 ? 217 THR B N   1 
ATOM   5702 C  CA  . THR B 2 198 ? 19.917 157.675 31.360  1.00 438.49 ? 217 THR B CA  1 
ATOM   5703 C  C   . THR B 2 198 ? 20.682 158.528 32.367  1.00 430.78 ? 217 THR B C   1 
ATOM   5704 O  O   . THR B 2 198 ? 21.701 159.138 32.028  1.00 438.59 ? 217 THR B O   1 
ATOM   5705 C  CB  . THR B 2 198 ? 20.839 156.655 30.696  1.00 456.73 ? 217 THR B CB  1 
ATOM   5706 O  OG1 . THR B 2 198 ? 20.070 155.789 29.851  1.00 461.70 ? 217 THR B OG1 1 
ATOM   5707 C  CG2 . THR B 2 198 ? 21.563 155.823 31.746  1.00 461.21 ? 217 THR B CG2 1 
ATOM   5708 N  N   . VAL B 2 199 ? 20.189 158.568 33.602  1.00 392.41 ? 218 VAL B N   1 
ATOM   5709 C  CA  . VAL B 2 199 ? 20.831 159.290 34.695  1.00 385.13 ? 218 VAL B CA  1 
ATOM   5710 C  C   . VAL B 2 199 ? 21.231 158.269 35.751  1.00 418.83 ? 218 VAL B C   1 
ATOM   5711 O  O   . VAL B 2 199 ? 20.369 157.594 36.326  1.00 380.37 ? 218 VAL B O   1 
ATOM   5712 C  CB  . VAL B 2 199 ? 19.912 160.368 35.290  1.00 364.71 ? 218 VAL B CB  1 
ATOM   5713 C  CG1 . VAL B 2 199 ? 20.624 161.114 36.408  1.00 359.57 ? 218 VAL B CG1 1 
ATOM   5714 C  CG2 . VAL B 2 199 ? 19.454 161.332 34.205  1.00 364.73 ? 218 VAL B CG2 1 
ATOM   5715 N  N   . THR B 2 200 ? 22.533 158.159 36.005  1.00 512.79 ? 219 THR B N   1 
ATOM   5716 C  CA  . THR B 2 200 ? 23.078 157.145 36.898  1.00 524.81 ? 219 THR B CA  1 
ATOM   5717 C  C   . THR B 2 200 ? 24.088 157.787 37.836  1.00 511.47 ? 219 THR B C   1 
ATOM   5718 O  O   . THR B 2 200 ? 24.978 158.516 37.387  1.00 519.73 ? 219 THR B O   1 
ATOM   5719 C  CB  . THR B 2 200 ? 23.739 156.013 36.100  1.00 544.51 ? 219 THR B CB  1 
ATOM   5720 O  OG1 . THR B 2 200 ? 22.776 155.418 35.221  1.00 551.05 ? 219 THR B OG1 1 
ATOM   5721 C  CG2 . THR B 2 200 ? 24.295 154.947 37.031  1.00 550.04 ? 219 THR B CG2 1 
ATOM   5722 N  N   . CYS B 2 201 ? 23.950 157.519 39.132  1.00 404.49 ? 220 CYS B N   1 
ATOM   5723 C  CA  . CYS B 2 201 ? 24.885 158.013 40.133  1.00 327.72 ? 220 CYS B CA  1 
ATOM   5724 C  C   . CYS B 2 201 ? 25.942 156.955 40.419  1.00 296.24 ? 220 CYS B C   1 
ATOM   5725 O  O   . CYS B 2 201 ? 25.640 155.758 40.486  1.00 295.46 ? 220 CYS B O   1 
ATOM   5726 C  CB  . CYS B 2 201 ? 24.163 158.404 41.428  1.00 311.57 ? 220 CYS B CB  1 
ATOM   5727 S  SG  . CYS B 2 201 ? 23.417 157.040 42.361  1.00 321.51 ? 220 CYS B SG  1 
ATOM   5728 N  N   . SER B 2 202 ? 27.185 157.404 40.578  1.00 275.28 ? 221 SER B N   1 
ATOM   5729 C  CA  . SER B 2 202 ? 28.321 156.527 40.826  1.00 276.74 ? 221 SER B CA  1 
ATOM   5730 C  C   . SER B 2 202 ? 28.899 156.829 42.200  1.00 289.62 ? 221 SER B C   1 
ATOM   5731 O  O   . SER B 2 202 ? 29.106 157.996 42.547  1.00 272.11 ? 221 SER B O   1 
ATOM   5732 C  CB  . SER B 2 202 ? 29.397 156.698 39.749  1.00 273.80 ? 221 SER B CB  1 
ATOM   5733 O  OG  . SER B 2 202 ? 30.526 155.886 40.022  1.00 274.62 ? 221 SER B OG  1 
ATOM   5734 N  N   . VAL B 2 203 ? 29.159 155.780 42.975  1.00 330.70 ? 222 VAL B N   1 
ATOM   5735 C  CA  . VAL B 2 203 ? 29.712 155.905 44.319  1.00 325.08 ? 222 VAL B CA  1 
ATOM   5736 C  C   . VAL B 2 203 ? 31.022 155.134 44.366  1.00 334.60 ? 222 VAL B C   1 
ATOM   5737 O  O   . VAL B 2 203 ? 31.036 153.910 44.187  1.00 320.63 ? 222 VAL B O   1 
ATOM   5738 C  CB  . VAL B 2 203 ? 28.736 155.397 45.390  1.00 317.89 ? 222 VAL B CB  1 
ATOM   5739 C  CG1 . VAL B 2 203 ? 29.392 155.437 46.762  1.00 322.21 ? 222 VAL B CG1 1 
ATOM   5740 C  CG2 . VAL B 2 203 ? 27.465 156.230 45.378  1.00 313.46 ? 222 VAL B CG2 1 
ATOM   5741 N  N   . ALA B 2 204 ? 32.116 155.847 44.613  1.00 367.09 ? 223 ALA B N   1 
ATOM   5742 C  CA  . ALA B 2 204 ? 33.451 155.268 44.658  1.00 360.90 ? 223 ALA B CA  1 
ATOM   5743 C  C   . ALA B 2 204 ? 34.014 155.404 46.065  1.00 340.59 ? 223 ALA B C   1 
ATOM   5744 O  O   . ALA B 2 204 ? 33.919 156.476 46.676  1.00 346.09 ? 223 ALA B O   1 
ATOM   5745 C  CB  . ALA B 2 204 ? 34.378 155.945 43.644  1.00 357.93 ? 223 ALA B CB  1 
ATOM   5746 N  N   . HIS B 2 205 ? 34.601 154.317 46.568  1.00 297.48 ? 224 HIS B N   1 
ATOM   5747 C  CA  . HIS B 2 205 ? 35.204 154.257 47.899  1.00 257.99 ? 224 HIS B CA  1 
ATOM   5748 C  C   . HIS B 2 205 ? 36.654 153.824 47.726  1.00 269.64 ? 224 HIS B C   1 
ATOM   5749 O  O   . HIS B 2 205 ? 36.950 152.619 47.658  1.00 265.48 ? 224 HIS B O   1 
ATOM   5750 C  CB  . HIS B 2 205 ? 34.440 153.299 48.812  1.00 256.97 ? 224 HIS B CB  1 
ATOM   5751 C  CG  . HIS B 2 205 ? 34.717 153.501 50.270  1.00 263.11 ? 224 HIS B CG  1 
ATOM   5752 N  ND1 . HIS B 2 205 ? 35.657 152.766 50.958  1.00 284.47 ? 224 HIS B ND1 1 
ATOM   5753 C  CD2 . HIS B 2 205 ? 34.172 154.352 51.171  1.00 251.57 ? 224 HIS B CD2 1 
ATOM   5754 C  CE1 . HIS B 2 205 ? 35.681 153.156 52.220  1.00 256.33 ? 224 HIS B CE1 1 
ATOM   5755 N  NE2 . HIS B 2 205 ? 34.790 154.118 52.375  1.00 252.18 ? 224 HIS B NE2 1 
ATOM   5756 N  N   . PRO B 2 206 ? 37.587 154.775 47.617  1.00 301.08 ? 225 PRO B N   1 
ATOM   5757 C  CA  . PRO B 2 206 ? 38.991 154.406 47.375  1.00 314.84 ? 225 PRO B CA  1 
ATOM   5758 C  C   . PRO B 2 206 ? 39.648 153.695 48.544  1.00 327.65 ? 225 PRO B C   1 
ATOM   5759 O  O   . PRO B 2 206 ? 40.613 152.952 48.325  1.00 339.45 ? 225 PRO B O   1 
ATOM   5760 C  CB  . PRO B 2 206 ? 39.664 155.756 47.096  1.00 314.87 ? 225 PRO B CB  1 
ATOM   5761 C  CG  . PRO B 2 206 ? 38.817 156.747 47.825  1.00 303.27 ? 225 PRO B CG  1 
ATOM   5762 C  CD  . PRO B 2 206 ? 37.406 156.233 47.724  1.00 305.43 ? 225 PRO B CD  1 
ATOM   5763 N  N   . ALA B 2 207 ? 39.169 153.900 49.772  1.00 265.70 ? 226 ALA B N   1 
ATOM   5764 C  CA  . ALA B 2 207 ? 39.739 153.193 50.915  1.00 267.45 ? 226 ALA B CA  1 
ATOM   5765 C  C   . ALA B 2 207 ? 39.501 151.693 50.800  1.00 270.22 ? 226 ALA B C   1 
ATOM   5766 O  O   . ALA B 2 207 ? 40.430 150.892 50.950  1.00 274.36 ? 226 ALA B O   1 
ATOM   5767 C  CB  . ALA B 2 207 ? 39.151 153.738 52.214  1.00 280.56 ? 226 ALA B CB  1 
ATOM   5768 N  N   . SER B 2 208 ? 38.259 151.295 50.536  1.00 268.23 ? 227 SER B N   1 
ATOM   5769 C  CA  . SER B 2 208 ? 37.940 149.907 50.234  1.00 270.98 ? 227 SER B CA  1 
ATOM   5770 C  C   . SER B 2 208 ? 38.036 149.597 48.748  1.00 273.54 ? 227 SER B C   1 
ATOM   5771 O  O   . SER B 2 208 ? 37.913 148.428 48.367  1.00 276.55 ? 227 SER B O   1 
ATOM   5772 C  CB  . SER B 2 208 ? 36.534 149.563 50.741  1.00 272.98 ? 227 SER B CB  1 
ATOM   5773 O  OG  . SER B 2 208 ? 35.557 150.391 50.135  1.00 276.45 ? 227 SER B OG  1 
ATOM   5774 N  N   . SER B 2 209 ? 38.253 150.614 47.911  1.00 290.47 ? 228 SER B N   1 
ATOM   5775 C  CA  . SER B 2 209 ? 38.387 150.448 46.463  1.00 306.13 ? 228 SER B CA  1 
ATOM   5776 C  C   . SER B 2 209 ? 37.163 149.749 45.874  1.00 305.09 ? 228 SER B C   1 
ATOM   5777 O  O   . SER B 2 209 ? 37.272 148.793 45.103  1.00 289.41 ? 228 SER B O   1 
ATOM   5778 C  CB  . SER B 2 209 ? 39.674 149.696 46.113  1.00 308.00 ? 228 SER B CB  1 
ATOM   5779 O  OG  . SER B 2 209 ? 40.814 150.397 46.578  1.00 312.57 ? 228 SER B OG  1 
ATOM   5780 N  N   . THR B 2 210 ? 35.983 150.240 46.245  1.00 317.80 ? 229 THR B N   1 
ATOM   5781 C  CA  . THR B 2 210 ? 34.717 149.662 45.806  1.00 310.43 ? 229 THR B CA  1 
ATOM   5782 C  C   . THR B 2 210 ? 33.901 150.731 45.095  1.00 315.12 ? 229 THR B C   1 
ATOM   5783 O  O   . THR B 2 210 ? 33.561 151.758 45.693  1.00 309.57 ? 229 THR B O   1 
ATOM   5784 C  CB  . THR B 2 210 ? 33.932 149.085 46.987  1.00 300.09 ? 229 THR B CB  1 
ATOM   5785 O  OG1 . THR B 2 210 ? 33.776 150.089 47.998  1.00 290.66 ? 229 THR B OG1 1 
ATOM   5786 C  CG2 . THR B 2 210 ? 34.659 147.884 47.574  1.00 309.03 ? 229 THR B CG2 1 
ATOM   5787 N  N   . THR B 2 211 ? 33.585 150.485 43.825  1.00 319.14 ? 230 THR B N   1 
ATOM   5788 C  CA  . THR B 2 211 ? 32.805 151.405 43.003  1.00 317.12 ? 230 THR B CA  1 
ATOM   5789 C  C   . THR B 2 211 ? 31.479 150.739 42.656  1.00 312.25 ? 230 THR B C   1 
ATOM   5790 O  O   . THR B 2 211 ? 31.448 149.752 41.912  1.00 329.32 ? 230 THR B O   1 
ATOM   5791 C  CB  . THR B 2 211 ? 33.568 151.793 41.738  1.00 309.69 ? 230 THR B CB  1 
ATOM   5792 O  OG1 . THR B 2 211 ? 34.805 152.423 42.096  1.00 305.78 ? 230 THR B OG1 1 
ATOM   5793 C  CG2 . THR B 2 211 ? 32.743 152.752 40.892  1.00 306.94 ? 230 THR B CG2 1 
ATOM   5794 N  N   . VAL B 2 212 ? 30.388 151.279 43.194  1.00 284.83 ? 231 VAL B N   1 
ATOM   5795 C  CA  . VAL B 2 212 ? 29.041 150.787 42.937  1.00 265.05 ? 231 VAL B CA  1 
ATOM   5796 C  C   . VAL B 2 212 ? 28.250 151.897 42.261  1.00 274.29 ? 231 VAL B C   1 
ATOM   5797 O  O   . VAL B 2 212 ? 28.230 153.035 42.744  1.00 255.35 ? 231 VAL B O   1 
ATOM   5798 C  CB  . VAL B 2 212 ? 28.347 150.328 44.233  1.00 258.05 ? 231 VAL B CB  1 
ATOM   5799 C  CG1 . VAL B 2 212 ? 26.934 149.852 43.940  1.00 257.17 ? 231 VAL B CG1 1 
ATOM   5800 C  CG2 . VAL B 2 212 ? 29.156 149.229 44.906  1.00 260.71 ? 231 VAL B CG2 1 
ATOM   5801 N  N   . ASP B 2 213 ? 27.606 151.567 41.144  1.00 293.09 ? 232 ASP B N   1 
ATOM   5802 C  CA  . ASP B 2 213 ? 26.821 152.517 40.369  1.00 302.82 ? 232 ASP B CA  1 
ATOM   5803 C  C   . ASP B 2 213 ? 25.357 152.102 40.384  1.00 330.40 ? 232 ASP B C   1 
ATOM   5804 O  O   . ASP B 2 213 ? 25.038 150.915 40.267  1.00 302.85 ? 232 ASP B O   1 
ATOM   5805 C  CB  . ASP B 2 213 ? 27.326 152.600 38.925  1.00 292.20 ? 232 ASP B CB  1 
ATOM   5806 C  CG  . ASP B 2 213 ? 28.827 152.801 38.844  1.00 300.14 ? 232 ASP B CG  1 
ATOM   5807 O  OD1 . ASP B 2 213 ? 29.398 153.412 39.772  1.00 309.37 ? 232 ASP B OD1 1 
ATOM   5808 O  OD2 . ASP B 2 213 ? 29.436 152.345 37.854  1.00 302.91 ? 232 ASP B OD2 1 
ATOM   5809 N  N   . LYS B 2 214 ? 24.467 153.084 40.527  1.00 393.61 ? 233 LYS B N   1 
ATOM   5810 C  CA  . LYS B 2 214 ? 23.036 152.823 40.587  1.00 401.82 ? 233 LYS B CA  1 
ATOM   5811 C  C   . LYS B 2 214 ? 22.292 153.833 39.727  1.00 391.10 ? 233 LYS B C   1 
ATOM   5812 O  O   . LYS B 2 214 ? 22.600 155.028 39.753  1.00 393.38 ? 233 LYS B O   1 
ATOM   5813 C  CB  . LYS B 2 214 ? 22.513 152.882 42.030  1.00 401.56 ? 233 LYS B CB  1 
ATOM   5814 C  CG  . LYS B 2 214 ? 23.112 151.839 42.963  1.00 402.26 ? 233 LYS B CG  1 
ATOM   5815 C  CD  . LYS B 2 214 ? 22.724 150.428 42.550  1.00 401.99 ? 233 LYS B CD  1 
ATOM   5816 C  CE  . LYS B 2 214 ? 23.319 149.397 43.496  1.00 400.80 ? 233 LYS B CE  1 
ATOM   5817 N  NZ  . LYS B 2 214 ? 22.924 148.008 43.135  1.00 403.14 ? 233 LYS B NZ  1 
ATOM   5818 N  N   . LYS B 2 215 ? 21.307 153.348 38.977  1.00 371.97 ? 234 LYS B N   1 
ATOM   5819 C  CA  . LYS B 2 215 ? 20.492 154.182 38.108  1.00 348.58 ? 234 LYS B CA  1 
ATOM   5820 C  C   . LYS B 2 215 ? 19.120 154.405 38.733  1.00 325.25 ? 234 LYS B C   1 
ATOM   5821 O  O   . LYS B 2 215 ? 18.578 153.532 39.416  1.00 320.58 ? 234 LYS B O   1 
ATOM   5822 C  CB  . LYS B 2 215 ? 20.339 153.547 36.722  1.00 349.49 ? 234 LYS B CB  1 
ATOM   5823 C  CG  . LYS B 2 215 ? 19.596 154.418 35.717  1.00 349.51 ? 234 LYS B CG  1 
ATOM   5824 C  CD  . LYS B 2 215 ? 19.409 153.713 34.383  1.00 352.80 ? 234 LYS B CD  1 
ATOM   5825 C  CE  . LYS B 2 215 ? 18.579 154.561 33.431  1.00 351.20 ? 234 LYS B CE  1 
ATOM   5826 N  NZ  . LYS B 2 215 ? 18.407 153.911 32.103  1.00 351.67 ? 234 LYS B NZ  1 
ATOM   5827 N  N   . LEU B 2 216 ? 18.563 155.589 38.492  1.00 310.61 ? 235 LEU B N   1 
ATOM   5828 C  CA  . LEU B 2 216 ? 17.309 155.999 39.109  1.00 293.35 ? 235 LEU B CA  1 
ATOM   5829 C  C   . LEU B 2 216 ? 16.128 155.509 38.279  1.00 306.32 ? 235 LEU B C   1 
ATOM   5830 O  O   . LEU B 2 216 ? 16.002 155.859 37.101  1.00 272.22 ? 235 LEU B O   1 
ATOM   5831 C  CB  . LEU B 2 216 ? 17.251 157.516 39.256  1.00 274.11 ? 235 LEU B CB  1 
ATOM   5832 C  CG  . LEU B 2 216 ? 16.294 157.957 40.358  1.00 256.75 ? 235 LEU B CG  1 
ATOM   5833 C  CD1 . LEU B 2 216 ? 16.989 157.827 41.698  1.00 255.40 ? 235 LEU B CD1 1 
ATOM   5834 C  CD2 . LEU B 2 216 ? 15.799 159.367 40.125  1.00 258.62 ? 235 LEU B CD2 1 
ATOM   5835 N  N   . GLU B 2 217 ? 15.267 154.702 38.895  1.00 352.73 ? 236 GLU B N   1 
ATOM   5836 C  CA  . GLU B 2 217 ? 14.037 154.233 38.270  1.00 366.11 ? 236 GLU B CA  1 
ATOM   5837 C  C   . GLU B 2 217 ? 12.835 154.743 39.054  1.00 363.70 ? 236 GLU B C   1 
ATOM   5838 O  O   . GLU B 2 217 ? 12.686 154.398 40.239  1.00 346.08 ? 236 GLU B O   1 
ATOM   5839 C  CB  . GLU B 2 217 ? 14.015 152.706 38.186  1.00 361.27 ? 236 GLU B CB  1 
ATOM   5840 C  CG  . GLU B 2 217 ? 15.114 152.129 37.312  1.00 360.82 ? 236 GLU B CG  1 
ATOM   5841 C  CD  . GLU B 2 217 ? 15.083 152.680 35.898  1.00 359.25 ? 236 GLU B CD  1 
ATOM   5842 O  OE1 . GLU B 2 217 ? 13.975 152.878 35.357  1.00 354.65 ? 236 GLU B OE1 1 
ATOM   5843 O  OE2 . GLU B 2 217 ? 16.169 152.921 35.331  1.00 361.85 ? 236 GLU B OE2 1 
ATOM   5844 N  N   . PRO B 2 218 ? 11.958 155.565 38.456  1.00 374.82 ? 237 PRO B N   1 
ATOM   5845 C  CA  . PRO B 2 218 ? 10.755 156.066 39.130  1.00 370.16 ? 237 PRO B CA  1 
ATOM   5846 C  C   . PRO B 2 218 ? 9.779  154.951 39.498  1.00 363.95 ? 237 PRO B C   1 
ATOM   5847 O  O   . PRO B 2 218 ? 9.164  155.022 40.563  1.00 352.55 ? 237 PRO B O   1 
ATOM   5848 C  CB  . PRO B 2 218 ? 10.136 157.007 38.092  1.00 372.92 ? 237 PRO B CB  1 
ATOM   5849 C  CG  . PRO B 2 218 ? 10.660 156.524 36.783  1.00 376.49 ? 237 PRO B CG  1 
ATOM   5850 C  CD  . PRO B 2 218 ? 12.051 156.045 37.067  1.00 377.19 ? 237 PRO B CD  1 
ATOM   5851 N  N   . ASP C 3 1   ? 58.552 181.895 69.047  1.00 212.47 ? 21  ASP C N   1 
ATOM   5852 C  CA  . ASP C 3 1   ? 57.798 181.807 67.802  1.00 184.95 ? 21  ASP C CA  1 
ATOM   5853 C  C   . ASP C 3 1   ? 56.889 183.018 67.621  1.00 149.94 ? 21  ASP C C   1 
ATOM   5854 O  O   . ASP C 3 1   ? 56.910 183.949 68.426  1.00 164.98 ? 21  ASP C O   1 
ATOM   5855 C  CB  . ASP C 3 1   ? 56.975 180.518 67.763  1.00 171.06 ? 21  ASP C CB  1 
ATOM   5856 C  CG  . ASP C 3 1   ? 57.839 179.279 67.633  1.00 161.72 ? 21  ASP C CG  1 
ATOM   5857 O  OD1 . ASP C 3 1   ? 59.026 179.335 68.019  1.00 190.69 ? 21  ASP C OD1 1 
ATOM   5858 O  OD2 . ASP C 3 1   ? 57.331 178.248 67.144  1.00 135.51 ? 21  ASP C OD2 1 
ATOM   5859 N  N   . ILE C 3 2   ? 56.090 182.996 66.557  1.00 205.87 ? 22  ILE C N   1 
ATOM   5860 C  CA  . ILE C 3 2   ? 55.236 184.114 66.180  1.00 177.83 ? 22  ILE C CA  1 
ATOM   5861 C  C   . ILE C 3 2   ? 53.787 183.649 66.184  1.00 199.02 ? 22  ILE C C   1 
ATOM   5862 O  O   . ILE C 3 2   ? 53.473 182.563 65.686  1.00 176.96 ? 22  ILE C O   1 
ATOM   5863 C  CB  . ILE C 3 2   ? 55.627 184.679 64.798  1.00 134.18 ? 22  ILE C CB  1 
ATOM   5864 C  CG1 . ILE C 3 2   ? 57.121 185.012 64.767  1.00 144.57 ? 22  ILE C CG1 1 
ATOM   5865 C  CG2 . ILE C 3 2   ? 54.787 185.899 64.454  1.00 139.04 ? 22  ILE C CG2 1 
ATOM   5866 C  CD1 . ILE C 3 2   ? 57.575 185.912 65.901  1.00 153.63 ? 22  ILE C CD1 1 
ATOM   5867 N  N   . VAL C 3 3   ? 52.909 184.471 66.749  1.00 209.54 ? 23  VAL C N   1 
ATOM   5868 C  CA  . VAL C 3 3   ? 51.484 184.172 66.836  1.00 195.69 ? 23  VAL C CA  1 
ATOM   5869 C  C   . VAL C 3 3   ? 50.751 185.150 65.930  1.00 202.61 ? 23  VAL C C   1 
ATOM   5870 O  O   . VAL C 3 3   ? 50.745 186.362 66.182  1.00 180.49 ? 23  VAL C O   1 
ATOM   5871 C  CB  . VAL C 3 3   ? 50.968 184.258 68.278  1.00 178.96 ? 23  VAL C CB  1 
ATOM   5872 C  CG1 . VAL C 3 3   ? 49.468 184.003 68.319  1.00 182.32 ? 23  VAL C CG1 1 
ATOM   5873 C  CG2 . VAL C 3 3   ? 51.706 183.269 69.166  1.00 199.21 ? 23  VAL C CG2 1 
ATOM   5874 N  N   . MET C 3 4   ? 50.133 184.629 64.872  1.00 232.63 ? 24  MET C N   1 
ATOM   5875 C  CA  . MET C 3 4   ? 49.287 185.427 63.992  1.00 228.32 ? 24  MET C CA  1 
ATOM   5876 C  C   . MET C 3 4   ? 47.852 185.303 64.489  1.00 238.24 ? 24  MET C C   1 
ATOM   5877 O  O   . MET C 3 4   ? 47.248 184.228 64.404  1.00 229.76 ? 24  MET C O   1 
ATOM   5878 C  CB  . MET C 3 4   ? 49.417 184.961 62.544  1.00 221.34 ? 24  MET C CB  1 
ATOM   5879 C  CG  . MET C 3 4   ? 50.851 184.871 62.049  1.00 215.54 ? 24  MET C CG  1 
ATOM   5880 S  SD  . MET C 3 4   ? 51.723 186.448 62.114  1.00 164.22 ? 24  MET C SD  1 
ATOM   5881 C  CE  . MET C 3 4   ? 50.886 187.361 60.821  1.00 140.77 ? 24  MET C CE  1 
ATOM   5882 N  N   . THR C 3 5   ? 47.308 186.398 65.008  1.00 236.18 ? 25  THR C N   1 
ATOM   5883 C  CA  . THR C 3 5   ? 46.009 186.399 65.668  1.00 228.44 ? 25  THR C CA  1 
ATOM   5884 C  C   . THR C 3 5   ? 44.988 187.085 64.773  1.00 225.52 ? 25  THR C C   1 
ATOM   5885 O  O   . THR C 3 5   ? 45.121 188.276 64.472  1.00 245.18 ? 25  THR C O   1 
ATOM   5886 C  CB  . THR C 3 5   ? 46.086 187.102 67.024  1.00 223.91 ? 25  THR C CB  1 
ATOM   5887 O  OG1 . THR C 3 5   ? 47.023 186.421 67.868  1.00 217.00 ? 25  THR C OG1 1 
ATOM   5888 C  CG2 . THR C 3 5   ? 44.721 187.117 67.696  1.00 237.45 ? 25  THR C CG2 1 
ATOM   5889 N  N   . GLN C 3 6   ? 43.976 186.334 64.348  1.00 194.22 ? 26  GLN C N   1 
ATOM   5890 C  CA  . GLN C 3 6   ? 42.825 186.890 63.648  1.00 210.44 ? 26  GLN C CA  1 
ATOM   5891 C  C   . GLN C 3 6   ? 41.669 186.944 64.640  1.00 258.54 ? 26  GLN C C   1 
ATOM   5892 O  O   . GLN C 3 6   ? 41.127 185.904 65.028  1.00 251.89 ? 26  GLN C O   1 
ATOM   5893 C  CB  . GLN C 3 6   ? 42.473 186.054 62.419  1.00 180.89 ? 26  GLN C CB  1 
ATOM   5894 C  CG  . GLN C 3 6   ? 43.633 185.864 61.454  1.00 185.23 ? 26  GLN C CG  1 
ATOM   5895 C  CD  . GLN C 3 6   ? 43.222 185.160 60.176  1.00 188.90 ? 26  GLN C CD  1 
ATOM   5896 O  OE1 . GLN C 3 6   ? 44.017 184.447 59.562  1.00 176.60 ? 26  GLN C OE1 1 
ATOM   5897 N  NE2 . GLN C 3 6   ? 41.976 185.362 59.764  1.00 195.65 ? 26  GLN C NE2 1 
ATOM   5898 N  N   . SER C 3 7   ? 41.297 188.159 65.050  1.00 319.95 ? 27  SER C N   1 
ATOM   5899 C  CA  . SER C 3 7   ? 40.291 188.308 66.097  1.00 334.77 ? 27  SER C CA  1 
ATOM   5900 C  C   . SER C 3 7   ? 38.910 187.889 65.607  1.00 336.80 ? 27  SER C C   1 
ATOM   5901 O  O   . SER C 3 7   ? 38.119 187.328 66.374  1.00 357.76 ? 27  SER C O   1 
ATOM   5902 C  CB  . SER C 3 7   ? 40.268 189.752 66.599  1.00 347.94 ? 27  SER C CB  1 
ATOM   5903 O  OG  . SER C 3 7   ? 39.989 190.654 65.543  1.00 357.75 ? 27  SER C OG  1 
ATOM   5904 N  N   . HIS C 3 8   ? 38.603 188.149 64.340  1.00 234.85 ? 28  HIS C N   1 
ATOM   5905 C  CA  . HIS C 3 8   ? 37.309 187.809 63.762  1.00 187.59 ? 28  HIS C CA  1 
ATOM   5906 C  C   . HIS C 3 8   ? 37.424 186.458 63.066  1.00 171.60 ? 28  HIS C C   1 
ATOM   5907 O  O   . HIS C 3 8   ? 38.106 186.334 62.044  1.00 177.08 ? 28  HIS C O   1 
ATOM   5908 C  CB  . HIS C 3 8   ? 36.848 188.892 62.790  1.00 189.74 ? 28  HIS C CB  1 
ATOM   5909 C  CG  . HIS C 3 8   ? 36.708 190.245 63.415  1.00 220.45 ? 28  HIS C CG  1 
ATOM   5910 N  ND1 . HIS C 3 8   ? 35.544 190.668 64.020  1.00 228.92 ? 28  HIS C ND1 1 
ATOM   5911 C  CD2 . HIS C 3 8   ? 37.586 191.269 63.530  1.00 208.16 ? 28  HIS C CD2 1 
ATOM   5912 C  CE1 . HIS C 3 8   ? 35.711 191.895 64.480  1.00 222.18 ? 28  HIS C CE1 1 
ATOM   5913 N  NE2 . HIS C 3 8   ? 36.941 192.283 64.196  1.00 204.27 ? 28  HIS C NE2 1 
ATOM   5914 N  N   . LYS C 3 9   ? 36.754 185.447 63.621  1.00 196.97 ? 29  LYS C N   1 
ATOM   5915 C  CA  . LYS C 3 9   ? 36.724 184.130 62.999  1.00 179.72 ? 29  LYS C CA  1 
ATOM   5916 C  C   . LYS C 3 9   ? 35.712 184.047 61.866  1.00 180.92 ? 29  LYS C C   1 
ATOM   5917 O  O   . LYS C 3 9   ? 35.825 183.160 61.013  1.00 190.06 ? 29  LYS C O   1 
ATOM   5918 C  CB  . LYS C 3 9   ? 36.410 183.059 64.048  1.00 176.81 ? 29  LYS C CB  1 
ATOM   5919 C  CG  . LYS C 3 9   ? 37.338 183.077 65.253  1.00 176.20 ? 29  LYS C CG  1 
ATOM   5920 C  CD  . LYS C 3 9   ? 38.752 182.671 64.876  1.00 168.08 ? 29  LYS C CD  1 
ATOM   5921 C  CE  . LYS C 3 9   ? 38.799 181.232 64.390  1.00 179.37 ? 29  LYS C CE  1 
ATOM   5922 N  NZ  . LYS C 3 9   ? 40.190 180.793 64.092  1.00 189.34 ? 29  LYS C NZ  1 
ATOM   5923 N  N   . PHE C 3 10  ? 34.730 184.946 61.841  1.00 189.59 ? 30  PHE C N   1 
ATOM   5924 C  CA  . PHE C 3 10  ? 33.719 184.989 60.796  1.00 186.02 ? 30  PHE C CA  1 
ATOM   5925 C  C   . PHE C 3 10  ? 33.390 186.442 60.489  1.00 199.13 ? 30  PHE C C   1 
ATOM   5926 O  O   . PHE C 3 10  ? 33.306 187.271 61.399  1.00 242.17 ? 30  PHE C O   1 
ATOM   5927 C  CB  . PHE C 3 10  ? 32.439 184.248 61.210  1.00 188.87 ? 30  PHE C CB  1 
ATOM   5928 C  CG  . PHE C 3 10  ? 32.651 182.797 61.537  1.00 184.34 ? 30  PHE C CG  1 
ATOM   5929 C  CD1 . PHE C 3 10  ? 32.957 182.402 62.829  1.00 210.26 ? 30  PHE C CD1 1 
ATOM   5930 C  CD2 . PHE C 3 10  ? 32.535 181.828 60.555  1.00 183.50 ? 30  PHE C CD2 1 
ATOM   5931 C  CE1 . PHE C 3 10  ? 33.150 181.068 63.134  1.00 211.17 ? 30  PHE C CE1 1 
ATOM   5932 C  CE2 . PHE C 3 10  ? 32.726 180.492 60.854  1.00 191.55 ? 30  PHE C CE2 1 
ATOM   5933 C  CZ  . PHE C 3 10  ? 33.034 180.112 62.145  1.00 192.90 ? 30  PHE C CZ  1 
ATOM   5934 N  N   . MET C 3 11  ? 33.206 186.744 59.206  1.00 190.39 ? 31  MET C N   1 
ATOM   5935 C  CA  . MET C 3 11  ? 32.810 188.077 58.776  1.00 215.43 ? 31  MET C CA  1 
ATOM   5936 C  C   . MET C 3 11  ? 31.730 187.962 57.713  1.00 225.76 ? 31  MET C C   1 
ATOM   5937 O  O   . MET C 3 11  ? 31.795 187.091 56.842  1.00 191.09 ? 31  MET C O   1 
ATOM   5938 C  CB  . MET C 3 11  ? 33.999 188.879 58.233  1.00 184.62 ? 31  MET C CB  1 
ATOM   5939 C  CG  . MET C 3 11  ? 34.948 189.387 59.306  1.00 186.44 ? 31  MET C CG  1 
ATOM   5940 S  SD  . MET C 3 11  ? 36.074 190.650 58.683  1.00 227.25 ? 31  MET C SD  1 
ATOM   5941 C  CE  . MET C 3 11  ? 34.909 191.888 58.117  1.00 179.31 ? 31  MET C CE  1 
ATOM   5942 N  N   . SER C 3 12  ? 30.740 188.847 57.791  1.00 232.36 ? 32  SER C N   1 
ATOM   5943 C  CA  . SER C 3 12  ? 29.610 188.853 56.875  1.00 205.33 ? 32  SER C CA  1 
ATOM   5944 C  C   . SER C 3 12  ? 29.740 190.010 55.895  1.00 206.34 ? 32  SER C C   1 
ATOM   5945 O  O   . SER C 3 12  ? 30.166 191.109 56.267  1.00 212.24 ? 32  SER C O   1 
ATOM   5946 C  CB  . SER C 3 12  ? 28.286 188.962 57.637  1.00 218.19 ? 32  SER C CB  1 
ATOM   5947 O  OG  . SER C 3 12  ? 28.128 187.884 58.543  1.00 213.41 ? 32  SER C OG  1 
ATOM   5948 N  N   . THR C 3 13  ? 29.371 189.756 54.643  1.00 246.75 ? 33  THR C N   1 
ATOM   5949 C  CA  . THR C 3 13  ? 29.421 190.770 53.599  1.00 256.42 ? 33  THR C CA  1 
ATOM   5950 C  C   . THR C 3 13  ? 28.413 190.394 52.523  1.00 268.17 ? 33  THR C C   1 
ATOM   5951 O  O   . THR C 3 13  ? 27.917 189.267 52.474  1.00 271.15 ? 33  THR C O   1 
ATOM   5952 C  CB  . THR C 3 13  ? 30.828 190.909 53.009  1.00 248.73 ? 33  THR C CB  1 
ATOM   5953 O  OG1 . THR C 3 13  ? 30.875 192.053 52.148  1.00 257.74 ? 33  THR C OG1 1 
ATOM   5954 C  CG2 . THR C 3 13  ? 31.192 189.669 52.209  1.00 243.64 ? 33  THR C CG2 1 
ATOM   5955 N  N   . SER C 3 14  ? 28.112 191.360 51.661  1.00 219.37 ? 34  SER C N   1 
ATOM   5956 C  CA  . SER C 3 14  ? 27.172 191.170 50.568  1.00 226.20 ? 34  SER C CA  1 
ATOM   5957 C  C   . SER C 3 14  ? 27.896 191.318 49.237  1.00 227.05 ? 34  SER C C   1 
ATOM   5958 O  O   . SER C 3 14  ? 28.972 191.918 49.155  1.00 219.43 ? 34  SER C O   1 
ATOM   5959 C  CB  . SER C 3 14  ? 26.010 192.170 50.651  1.00 236.48 ? 34  SER C CB  1 
ATOM   5960 O  OG  . SER C 3 14  ? 25.290 192.017 51.862  1.00 245.23 ? 34  SER C OG  1 
ATOM   5961 N  N   . VAL C 3 15  ? 27.299 190.739 48.192  1.00 243.26 ? 35  VAL C N   1 
ATOM   5962 C  CA  . VAL C 3 15  ? 27.889 190.814 46.861  1.00 228.08 ? 35  VAL C CA  1 
ATOM   5963 C  C   . VAL C 3 15  ? 28.000 192.270 46.438  1.00 231.17 ? 35  VAL C C   1 
ATOM   5964 O  O   . VAL C 3 15  ? 27.015 193.019 46.452  1.00 255.58 ? 35  VAL C O   1 
ATOM   5965 C  CB  . VAL C 3 15  ? 27.054 190.001 45.859  1.00 233.91 ? 35  VAL C CB  1 
ATOM   5966 C  CG1 . VAL C 3 15  ? 27.615 190.152 44.454  1.00 234.09 ? 35  VAL C CG1 1 
ATOM   5967 C  CG2 . VAL C 3 15  ? 27.014 188.537 46.266  1.00 230.80 ? 35  VAL C CG2 1 
ATOM   5968 N  N   . GLY C 3 16  ? 29.210 192.680 46.056  1.00 231.75 ? 36  GLY C N   1 
ATOM   5969 C  CA  . GLY C 3 16  ? 29.478 194.051 45.689  1.00 233.19 ? 36  GLY C CA  1 
ATOM   5970 C  C   . GLY C 3 16  ? 29.983 194.930 46.813  1.00 249.29 ? 36  GLY C C   1 
ATOM   5971 O  O   . GLY C 3 16  ? 30.495 196.024 46.539  1.00 236.24 ? 36  GLY C O   1 
ATOM   5972 N  N   . ASP C 3 17  ? 29.863 194.493 48.064  1.00 252.42 ? 37  ASP C N   1 
ATOM   5973 C  CA  . ASP C 3 17  ? 30.321 195.282 49.195  1.00 240.27 ? 37  ASP C CA  1 
ATOM   5974 C  C   . ASP C 3 17  ? 31.842 195.231 49.311  1.00 253.68 ? 37  ASP C C   1 
ATOM   5975 O  O   . ASP C 3 17  ? 32.501 194.309 48.826  1.00 223.21 ? 37  ASP C O   1 
ATOM   5976 C  CB  . ASP C 3 17  ? 29.689 194.786 50.496  1.00 228.76 ? 37  ASP C CB  1 
ATOM   5977 C  CG  . ASP C 3 17  ? 28.183 194.932 50.507  1.00 244.63 ? 37  ASP C CG  1 
ATOM   5978 O  OD1 . ASP C 3 17  ? 27.570 194.863 49.422  1.00 256.27 ? 37  ASP C OD1 1 
ATOM   5979 O  OD2 . ASP C 3 17  ? 27.612 195.113 51.603  1.00 252.43 ? 37  ASP C OD2 1 
ATOM   5980 N  N   . ARG C 3 18  ? 32.394 196.249 49.966  1.00 283.48 ? 38  ARG C N   1 
ATOM   5981 C  CA  . ARG C 3 18  ? 33.823 196.324 50.238  1.00 275.37 ? 38  ARG C CA  1 
ATOM   5982 C  C   . ARG C 3 18  ? 34.109 195.643 51.571  1.00 267.05 ? 38  ARG C C   1 
ATOM   5983 O  O   . ARG C 3 18  ? 33.604 196.075 52.613  1.00 275.57 ? 38  ARG C O   1 
ATOM   5984 C  CB  . ARG C 3 18  ? 34.288 197.779 50.262  1.00 283.83 ? 38  ARG C CB  1 
ATOM   5985 C  CG  . ARG C 3 18  ? 35.749 197.966 50.632  1.00 277.81 ? 38  ARG C CG  1 
ATOM   5986 C  CD  . ARG C 3 18  ? 36.087 199.441 50.780  1.00 286.31 ? 38  ARG C CD  1 
ATOM   5987 N  NE  . ARG C 3 18  ? 37.503 199.655 51.064  1.00 272.50 ? 38  ARG C NE  1 
ATOM   5988 C  CZ  . ARG C 3 18  ? 38.430 199.840 50.131  1.00 271.23 ? 38  ARG C CZ  1 
ATOM   5989 N  NH1 . ARG C 3 18  ? 38.093 199.837 48.849  1.00 287.26 ? 38  ARG C NH1 1 
ATOM   5990 N  NH2 . ARG C 3 18  ? 39.696 200.028 50.479  1.00 263.32 ? 38  ARG C NH2 1 
ATOM   5991 N  N   . VAL C 3 19  ? 34.917 194.586 51.541  1.00 240.66 ? 39  VAL C N   1 
ATOM   5992 C  CA  . VAL C 3 19  ? 35.197 193.800 52.737  1.00 227.27 ? 39  VAL C CA  1 
ATOM   5993 C  C   . VAL C 3 19  ? 36.694 193.836 53.013  1.00 216.36 ? 39  VAL C C   1 
ATOM   5994 O  O   . VAL C 3 19  ? 37.511 193.934 52.093  1.00 239.92 ? 39  VAL C O   1 
ATOM   5995 C  CB  . VAL C 3 19  ? 34.683 192.346 52.594  1.00 216.74 ? 39  VAL C CB  1 
ATOM   5996 C  CG1 . VAL C 3 19  ? 35.448 191.603 51.510  1.00 209.93 ? 39  VAL C CG1 1 
ATOM   5997 C  CG2 . VAL C 3 19  ? 34.757 191.607 53.925  1.00 225.27 ? 39  VAL C CG2 1 
ATOM   5998 N  N   . SER C 3 20  ? 37.050 193.781 54.295  1.00 187.09 ? 40  SER C N   1 
ATOM   5999 C  CA  . SER C 3 20  ? 38.445 193.804 54.712  1.00 175.61 ? 40  SER C CA  1 
ATOM   6000 C  C   . SER C 3 20  ? 38.631 192.900 55.920  1.00 175.09 ? 40  SER C C   1 
ATOM   6001 O  O   . SER C 3 20  ? 37.776 192.852 56.809  1.00 187.88 ? 40  SER C O   1 
ATOM   6002 C  CB  . SER C 3 20  ? 38.908 195.228 55.046  1.00 182.08 ? 40  SER C CB  1 
ATOM   6003 O  OG  . SER C 3 20  ? 38.807 196.076 53.915  1.00 193.63 ? 40  SER C OG  1 
ATOM   6004 N  N   . ILE C 3 21  ? 39.755 192.187 55.946  1.00 159.57 ? 41  ILE C N   1 
ATOM   6005 C  CA  . ILE C 3 21  ? 40.098 191.273 57.028  1.00 157.34 ? 41  ILE C CA  1 
ATOM   6006 C  C   . ILE C 3 21  ? 41.380 191.763 57.683  1.00 190.13 ? 41  ILE C C   1 
ATOM   6007 O  O   . ILE C 3 21  ? 42.327 192.163 56.996  1.00 207.14 ? 41  ILE C O   1 
ATOM   6008 C  CB  . ILE C 3 21  ? 40.259 189.825 56.520  1.00 152.93 ? 41  ILE C CB  1 
ATOM   6009 C  CG1 . ILE C 3 21  ? 39.012 189.387 55.752  1.00 157.54 ? 41  ILE C CG1 1 
ATOM   6010 C  CG2 . ILE C 3 21  ? 40.528 188.876 57.679  1.00 178.11 ? 41  ILE C CG2 1 
ATOM   6011 C  CD1 . ILE C 3 21  ? 39.076 187.963 55.245  1.00 155.38 ? 41  ILE C CD1 1 
ATOM   6012 N  N   . THR C 3 22  ? 41.409 191.732 59.013  1.00 197.24 ? 42  THR C N   1 
ATOM   6013 C  CA  . THR C 3 22  ? 42.549 192.201 59.787  1.00 205.00 ? 42  THR C CA  1 
ATOM   6014 C  C   . THR C 3 22  ? 43.374 191.020 60.281  1.00 206.08 ? 42  THR C C   1 
ATOM   6015 O  O   . THR C 3 22  ? 42.828 189.969 60.630  1.00 189.38 ? 42  THR C O   1 
ATOM   6016 C  CB  . THR C 3 22  ? 42.091 193.047 60.977  1.00 199.96 ? 42  THR C CB  1 
ATOM   6017 O  OG1 . THR C 3 22  ? 41.333 192.233 61.881  1.00 213.42 ? 42  THR C OG1 1 
ATOM   6018 C  CG2 . THR C 3 22  ? 41.226 194.206 60.503  1.00 211.47 ? 42  THR C CG2 1 
ATOM   6019 N  N   . CYS C 3 23  ? 44.694 191.201 60.308  1.00 193.86 ? 43  CYS C N   1 
ATOM   6020 C  CA  . CYS C 3 23  ? 45.623 190.184 60.787  1.00 162.65 ? 43  CYS C CA  1 
ATOM   6021 C  C   . CYS C 3 23  ? 46.532 190.815 61.830  1.00 180.35 ? 43  CYS C C   1 
ATOM   6022 O  O   . CYS C 3 23  ? 47.287 191.742 61.517  1.00 176.61 ? 43  CYS C O   1 
ATOM   6023 C  CB  . CYS C 3 23  ? 46.447 189.600 59.635  1.00 163.69 ? 43  CYS C CB  1 
ATOM   6024 S  SG  . CYS C 3 23  ? 47.476 188.164 60.052  1.00 215.34 ? 43  CYS C SG  1 
ATOM   6025 N  N   . LYS C 3 24  ? 46.454 190.319 63.062  1.00 194.15 ? 44  LYS C N   1 
ATOM   6026 C  CA  . LYS C 3 24  ? 47.279 190.803 64.163  1.00 195.89 ? 44  LYS C CA  1 
ATOM   6027 C  C   . LYS C 3 24  ? 48.381 189.788 64.437  1.00 175.54 ? 44  LYS C C   1 
ATOM   6028 O  O   . LYS C 3 24  ? 48.098 188.615 64.702  1.00 174.12 ? 44  LYS C O   1 
ATOM   6029 C  CB  . LYS C 3 24  ? 46.437 191.034 65.419  1.00 201.00 ? 44  LYS C CB  1 
ATOM   6030 C  CG  . LYS C 3 24  ? 47.239 191.482 66.632  1.00 209.13 ? 44  LYS C CG  1 
ATOM   6031 C  CD  . LYS C 3 24  ? 46.378 191.519 67.886  1.00 204.07 ? 44  LYS C CD  1 
ATOM   6032 C  CE  . LYS C 3 24  ? 45.206 192.475 67.728  1.00 225.94 ? 44  LYS C CE  1 
ATOM   6033 N  NZ  . LYS C 3 24  ? 44.355 192.519 68.949  1.00 240.84 ? 44  LYS C NZ  1 
ATOM   6034 N  N   . ALA C 3 25  ? 49.628 190.237 64.372  1.00 165.25 ? 45  ALA C N   1 
ATOM   6035 C  CA  . ALA C 3 25  ? 50.777 189.376 64.587  1.00 164.85 ? 45  ALA C CA  1 
ATOM   6036 C  C   . ALA C 3 25  ? 51.286 189.525 66.019  1.00 198.74 ? 45  ALA C C   1 
ATOM   6037 O  O   . ALA C 3 25  ? 50.688 190.216 66.850  1.00 227.26 ? 45  ALA C O   1 
ATOM   6038 C  CB  . ALA C 3 25  ? 51.864 189.695 63.564  1.00 144.63 ? 45  ALA C CB  1 
ATOM   6039 N  N   . SER C 3 26  ? 52.406 188.867 66.318  1.00 198.25 ? 46  SER C N   1 
ATOM   6040 C  CA  . SER C 3 26  ? 53.010 188.939 67.655  1.00 188.21 ? 46  SER C CA  1 
ATOM   6041 C  C   . SER C 3 26  ? 53.937 190.147 67.751  1.00 201.45 ? 46  SER C C   1 
ATOM   6042 O  O   . SER C 3 26  ? 53.643 191.112 68.463  1.00 204.08 ? 46  SER C O   1 
ATOM   6043 C  CB  . SER C 3 26  ? 53.750 187.639 67.974  1.00 169.87 ? 46  SER C CB  1 
ATOM   6044 O  OG  . SER C 3 26  ? 54.942 187.530 67.218  1.00 187.74 ? 46  SER C OG  1 
ATOM   6045 N  N   . GLN C 3 27  ? 55.062 190.102 67.042  1.00 195.21 ? 47  GLN C N   1 
ATOM   6046 C  CA  . GLN C 3 27  ? 56.022 191.193 67.028  1.00 184.93 ? 47  GLN C CA  1 
ATOM   6047 C  C   . GLN C 3 27  ? 55.886 191.986 65.729  1.00 173.47 ? 47  GLN C C   1 
ATOM   6048 O  O   . GLN C 3 27  ? 55.015 191.724 64.897  1.00 153.63 ? 47  GLN C O   1 
ATOM   6049 C  CB  . GLN C 3 27  ? 57.443 190.657 67.213  1.00 166.67 ? 47  GLN C CB  1 
ATOM   6050 C  CG  . GLN C 3 27  ? 57.962 189.839 66.045  1.00 156.31 ? 47  GLN C CG  1 
ATOM   6051 C  CD  . GLN C 3 27  ? 59.284 189.164 66.351  1.00 160.80 ? 47  GLN C CD  1 
ATOM   6052 O  OE1 . GLN C 3 27  ? 59.512 188.698 67.467  1.00 187.52 ? 47  GLN C OE1 1 
ATOM   6053 N  NE2 . GLN C 3 27  ? 60.165 189.111 65.359  1.00 146.95 ? 47  GLN C NE2 1 
ATOM   6054 N  N   . ASP C 3 28  ? 56.766 192.971 65.555  1.00 174.85 ? 48  ASP C N   1 
ATOM   6055 C  CA  . ASP C 3 28  ? 56.702 193.835 64.382  1.00 154.96 ? 48  ASP C CA  1 
ATOM   6056 C  C   . ASP C 3 28  ? 57.195 193.076 63.157  1.00 158.72 ? 48  ASP C C   1 
ATOM   6057 O  O   . ASP C 3 28  ? 58.333 192.599 63.130  1.00 164.75 ? 48  ASP C O   1 
ATOM   6058 C  CB  . ASP C 3 28  ? 57.535 195.094 64.605  1.00 148.11 ? 48  ASP C CB  1 
ATOM   6059 C  CG  . ASP C 3 28  ? 57.526 196.017 63.403  1.00 159.49 ? 48  ASP C CG  1 
ATOM   6060 O  OD1 . ASP C 3 28  ? 58.361 195.822 62.496  1.00 132.49 ? 48  ASP C OD1 1 
ATOM   6061 O  OD2 . ASP C 3 28  ? 56.682 196.936 63.363  1.00 208.57 ? 48  ASP C OD2 1 
ATOM   6062 N  N   . VAL C 3 29  ? 56.334 192.969 62.140  1.00 189.02 ? 49  VAL C N   1 
ATOM   6063 C  CA  . VAL C 3 29  ? 56.606 192.124 60.979  1.00 174.83 ? 49  VAL C CA  1 
ATOM   6064 C  C   . VAL C 3 29  ? 57.244 192.869 59.814  1.00 174.26 ? 49  VAL C C   1 
ATOM   6065 O  O   . VAL C 3 29  ? 57.706 192.222 58.860  1.00 139.76 ? 49  VAL C O   1 
ATOM   6066 C  CB  . VAL C 3 29  ? 55.295 191.461 60.513  1.00 159.86 ? 49  VAL C CB  1 
ATOM   6067 C  CG1 . VAL C 3 29  ? 55.575 190.206 59.734  1.00 153.25 ? 49  VAL C CG1 1 
ATOM   6068 C  CG2 . VAL C 3 29  ? 54.424 191.147 61.704  1.00 183.21 ? 49  VAL C CG2 1 
ATOM   6069 N  N   . SER C 3 30  ? 57.306 194.197 59.867  1.00 211.36 ? 50  SER C N   1 
ATOM   6070 C  CA  . SER C 3 30  ? 57.689 195.035 58.721  1.00 222.53 ? 50  SER C CA  1 
ATOM   6071 C  C   . SER C 3 30  ? 56.685 194.747 57.605  1.00 225.76 ? 50  SER C C   1 
ATOM   6072 O  O   . SER C 3 30  ? 55.473 194.726 57.871  1.00 249.93 ? 50  SER C O   1 
ATOM   6073 C  CB  . SER C 3 30  ? 59.155 194.812 58.363  1.00 214.13 ? 50  SER C CB  1 
ATOM   6074 O  OG  . SER C 3 30  ? 59.533 195.600 57.246  1.00 215.37 ? 50  SER C OG  1 
ATOM   6075 N  N   . THR C 3 31  ? 57.123 194.523 56.368  1.00 185.65 ? 51  THR C N   1 
ATOM   6076 C  CA  . THR C 3 31  ? 56.228 194.369 55.229  1.00 166.24 ? 51  THR C CA  1 
ATOM   6077 C  C   . THR C 3 31  ? 55.927 192.920 54.871  1.00 155.12 ? 51  THR C C   1 
ATOM   6078 O  O   . THR C 3 31  ? 55.257 192.679 53.863  1.00 162.97 ? 51  THR C O   1 
ATOM   6079 C  CB  . THR C 3 31  ? 56.808 195.075 53.998  1.00 191.10 ? 51  THR C CB  1 
ATOM   6080 O  OG1 . THR C 3 31  ? 58.158 194.644 53.787  1.00 203.45 ? 51  THR C OG1 1 
ATOM   6081 C  CG2 . THR C 3 31  ? 56.775 196.584 54.181  1.00 187.04 ? 51  THR C CG2 1 
ATOM   6082 N  N   . ALA C 3 32  ? 56.396 191.948 55.650  1.00 114.29 ? 52  ALA C N   1 
ATOM   6083 C  CA  . ALA C 3 32  ? 56.344 190.556 55.212  1.00 126.26 ? 52  ALA C CA  1 
ATOM   6084 C  C   . ALA C 3 32  ? 55.056 189.916 55.713  1.00 161.04 ? 52  ALA C C   1 
ATOM   6085 O  O   . ALA C 3 32  ? 54.947 189.545 56.881  1.00 165.71 ? 52  ALA C O   1 
ATOM   6086 C  CB  . ALA C 3 32  ? 57.566 189.803 55.724  1.00 128.97 ? 52  ALA C CB  1 
ATOM   6087 N  N   . VAL C 3 33  ? 54.108 189.711 54.805  1.00 191.41 ? 53  VAL C N   1 
ATOM   6088 C  CA  . VAL C 3 33  ? 52.860 189.020 55.114  1.00 180.86 ? 53  VAL C CA  1 
ATOM   6089 C  C   . VAL C 3 33  ? 52.321 188.422 53.822  1.00 181.86 ? 53  VAL C C   1 
ATOM   6090 O  O   . VAL C 3 33  ? 52.456 189.015 52.749  1.00 210.13 ? 53  VAL C O   1 
ATOM   6091 C  CB  . VAL C 3 33  ? 51.844 189.974 55.786  1.00 177.88 ? 53  VAL C CB  1 
ATOM   6092 C  CG1 . VAL C 3 33  ? 50.429 189.759 55.265  1.00 203.82 ? 53  VAL C CG1 1 
ATOM   6093 C  CG2 . VAL C 3 33  ? 51.870 189.803 57.294  1.00 178.38 ? 53  VAL C CG2 1 
ATOM   6094 N  N   . ALA C 3 34  ? 51.684 187.259 53.932  1.00 182.31 ? 54  ALA C N   1 
ATOM   6095 C  CA  . ALA C 3 34  ? 51.093 186.584 52.788  1.00 178.80 ? 54  ALA C CA  1 
ATOM   6096 C  C   . ALA C 3 34  ? 49.641 186.252 53.093  1.00 201.63 ? 54  ALA C C   1 
ATOM   6097 O  O   . ALA C 3 34  ? 49.317 185.792 54.192  1.00 240.27 ? 54  ALA C O   1 
ATOM   6098 C  CB  . ALA C 3 34  ? 51.862 185.305 52.429  1.00 184.44 ? 54  ALA C CB  1 
ATOM   6099 N  N   . TRP C 3 35  ? 48.773 186.502 52.119  1.00 169.56 ? 55  TRP C N   1 
ATOM   6100 C  CA  . TRP C 3 35  ? 47.351 186.203 52.215  1.00 139.98 ? 55  TRP C CA  1 
ATOM   6101 C  C   . TRP C 3 35  ? 47.021 185.079 51.242  1.00 139.55 ? 55  TRP C C   1 
ATOM   6102 O  O   . TRP C 3 35  ? 47.261 185.209 50.035  1.00 172.52 ? 55  TRP C O   1 
ATOM   6103 C  CB  . TRP C 3 35  ? 46.507 187.439 51.910  1.00 143.29 ? 55  TRP C CB  1 
ATOM   6104 C  CG  . TRP C 3 35  ? 46.675 188.547 52.897  1.00 142.56 ? 55  TRP C CG  1 
ATOM   6105 C  CD1 . TRP C 3 35  ? 47.561 189.581 52.826  1.00 162.35 ? 55  TRP C CD1 1 
ATOM   6106 C  CD2 . TRP C 3 35  ? 45.930 188.738 54.105  1.00 145.11 ? 55  TRP C CD2 1 
ATOM   6107 N  NE1 . TRP C 3 35  ? 47.415 190.406 53.916  1.00 151.79 ? 55  TRP C NE1 1 
ATOM   6108 C  CE2 . TRP C 3 35  ? 46.420 189.910 54.716  1.00 169.19 ? 55  TRP C CE2 1 
ATOM   6109 C  CE3 . TRP C 3 35  ? 44.897 188.033 54.729  1.00 148.23 ? 55  TRP C CE3 1 
ATOM   6110 C  CZ2 . TRP C 3 35  ? 45.912 190.391 55.921  1.00 196.11 ? 55  TRP C CZ2 1 
ATOM   6111 C  CZ3 . TRP C 3 35  ? 44.394 188.513 55.925  1.00 183.34 ? 55  TRP C CZ3 1 
ATOM   6112 C  CH2 . TRP C 3 35  ? 44.902 189.680 56.507  1.00 202.22 ? 55  TRP C CH2 1 
ATOM   6113 N  N   . TYR C 3 36  ? 46.469 183.989 51.771  1.00 140.52 ? 56  TYR C N   1 
ATOM   6114 C  CA  . TYR C 3 36  ? 46.094 182.815 51.000  1.00 139.15 ? 56  TYR C CA  1 
ATOM   6115 C  C   . TYR C 3 36  ? 44.581 182.636 51.002  1.00 144.69 ? 56  TYR C C   1 
ATOM   6116 O  O   . TYR C 3 36  ? 43.897 182.973 51.975  1.00 156.03 ? 56  TYR C O   1 
ATOM   6117 C  CB  . TYR C 3 36  ? 46.749 181.549 51.562  1.00 133.91 ? 56  TYR C CB  1 
ATOM   6118 C  CG  . TYR C 3 36  ? 48.256 181.518 51.462  1.00 152.71 ? 56  TYR C CG  1 
ATOM   6119 C  CD1 . TYR C 3 36  ? 49.048 182.147 52.412  1.00 125.31 ? 56  TYR C CD1 1 
ATOM   6120 C  CD2 . TYR C 3 36  ? 48.887 180.843 50.425  1.00 163.39 ? 56  TYR C CD2 1 
ATOM   6121 C  CE1 . TYR C 3 36  ? 50.426 182.115 52.328  1.00 141.94 ? 56  TYR C CE1 1 
ATOM   6122 C  CE2 . TYR C 3 36  ? 50.264 180.805 50.332  1.00 162.86 ? 56  TYR C CE2 1 
ATOM   6123 C  CZ  . TYR C 3 36  ? 51.029 181.444 51.286  1.00 178.27 ? 56  TYR C CZ  1 
ATOM   6124 O  OH  . TYR C 3 36  ? 52.403 181.409 51.199  1.00 198.70 ? 56  TYR C OH  1 
ATOM   6125 N  N   . GLN C 3 37  ? 44.070 182.081 49.904  1.00 158.64 ? 57  GLN C N   1 
ATOM   6126 C  CA  . GLN C 3 37  ? 42.653 181.782 49.736  1.00 141.76 ? 57  GLN C CA  1 
ATOM   6127 C  C   . GLN C 3 37  ? 42.485 180.282 49.549  1.00 158.73 ? 57  GLN C C   1 
ATOM   6128 O  O   . GLN C 3 37  ? 43.012 179.711 48.588  1.00 203.39 ? 57  GLN C O   1 
ATOM   6129 C  CB  . GLN C 3 37  ? 42.069 182.530 48.536  1.00 147.29 ? 57  GLN C CB  1 
ATOM   6130 C  CG  . GLN C 3 37  ? 40.664 182.086 48.155  1.00 163.50 ? 57  GLN C CG  1 
ATOM   6131 C  CD  . GLN C 3 37  ? 40.278 182.500 46.747  1.00 168.27 ? 57  GLN C CD  1 
ATOM   6132 O  OE1 . GLN C 3 37  ? 41.130 182.881 45.944  1.00 173.11 ? 57  GLN C OE1 1 
ATOM   6133 N  NE2 . GLN C 3 37  ? 38.988 182.424 46.440  1.00 173.29 ? 57  GLN C NE2 1 
ATOM   6134 N  N   . GLN C 3 38  ? 41.755 179.648 50.463  1.00 143.46 ? 58  GLN C N   1 
ATOM   6135 C  CA  . GLN C 3 38  ? 41.447 178.224 50.383  1.00 144.69 ? 58  GLN C CA  1 
ATOM   6136 C  C   . GLN C 3 38  ? 39.942 178.067 50.209  1.00 150.70 ? 58  GLN C C   1 
ATOM   6137 O  O   . GLN C 3 38  ? 39.171 178.369 51.126  1.00 152.37 ? 58  GLN C O   1 
ATOM   6138 C  CB  . GLN C 3 38  ? 41.933 177.482 51.627  1.00 157.40 ? 58  GLN C CB  1 
ATOM   6139 C  CG  . GLN C 3 38  ? 41.669 175.984 51.590  1.00 144.61 ? 58  GLN C CG  1 
ATOM   6140 C  CD  . GLN C 3 38  ? 42.139 175.277 52.845  1.00 143.90 ? 58  GLN C CD  1 
ATOM   6141 O  OE1 . GLN C 3 38  ? 42.503 175.917 53.832  1.00 139.83 ? 58  GLN C OE1 1 
ATOM   6142 N  NE2 . GLN C 3 38  ? 42.134 173.949 52.813  1.00 142.94 ? 58  GLN C NE2 1 
ATOM   6143 N  N   . LYS C 3 39  ? 39.528 177.600 49.037  1.00 197.32 ? 59  LYS C N   1 
ATOM   6144 C  CA  . LYS C 3 39  ? 38.124 177.308 48.813  1.00 204.27 ? 59  LYS C CA  1 
ATOM   6145 C  C   . LYS C 3 39  ? 37.763 175.960 49.437  1.00 197.31 ? 59  LYS C C   1 
ATOM   6146 O  O   . LYS C 3 39  ? 38.629 175.097 49.603  1.00 193.51 ? 59  LYS C O   1 
ATOM   6147 C  CB  . LYS C 3 39  ? 37.813 177.294 47.319  1.00 222.27 ? 59  LYS C CB  1 
ATOM   6148 C  CG  . LYS C 3 39  ? 37.978 178.645 46.641  1.00 206.06 ? 59  LYS C CG  1 
ATOM   6149 C  CD  . LYS C 3 39  ? 37.539 178.598 45.187  1.00 207.92 ? 59  LYS C CD  1 
ATOM   6150 C  CE  . LYS C 3 39  ? 37.662 179.964 44.531  1.00 214.97 ? 59  LYS C CE  1 
ATOM   6151 N  NZ  . LYS C 3 39  ? 37.201 179.948 43.115  1.00 258.72 ? 59  LYS C NZ  1 
ATOM   6152 N  N   . PRO C 3 40  ? 36.498 175.765 49.808  1.00 179.96 ? 60  PRO C N   1 
ATOM   6153 C  CA  . PRO C 3 40  ? 36.101 174.492 50.424  1.00 167.35 ? 60  PRO C CA  1 
ATOM   6154 C  C   . PRO C 3 40  ? 36.379 173.316 49.499  1.00 168.88 ? 60  PRO C C   1 
ATOM   6155 O  O   . PRO C 3 40  ? 36.003 173.323 48.324  1.00 181.20 ? 60  PRO C O   1 
ATOM   6156 C  CB  . PRO C 3 40  ? 34.599 174.674 50.674  1.00 186.77 ? 60  PRO C CB  1 
ATOM   6157 C  CG  . PRO C 3 40  ? 34.412 176.151 50.768  1.00 202.53 ? 60  PRO C CG  1 
ATOM   6158 C  CD  . PRO C 3 40  ? 35.395 176.743 49.801  1.00 198.96 ? 60  PRO C CD  1 
ATOM   6159 N  N   . GLY C 3 41  ? 37.043 172.299 50.043  1.00 165.42 ? 61  GLY C N   1 
ATOM   6160 C  CA  . GLY C 3 41  ? 37.406 171.129 49.272  1.00 186.50 ? 61  GLY C CA  1 
ATOM   6161 C  C   . GLY C 3 41  ? 38.588 171.305 48.347  1.00 178.48 ? 61  GLY C C   1 
ATOM   6162 O  O   . GLY C 3 41  ? 38.880 170.395 47.563  1.00 164.64 ? 61  GLY C O   1 
ATOM   6163 N  N   . GLN C 3 42  ? 39.279 172.441 48.409  1.00 185.52 ? 62  GLN C N   1 
ATOM   6164 C  CA  . GLN C 3 42  ? 40.416 172.717 47.547  1.00 176.33 ? 62  GLN C CA  1 
ATOM   6165 C  C   . GLN C 3 42  ? 41.648 173.042 48.381  1.00 195.94 ? 62  GLN C C   1 
ATOM   6166 O  O   . GLN C 3 42  ? 41.557 173.367 49.569  1.00 183.37 ? 62  GLN C O   1 
ATOM   6167 C  CB  . GLN C 3 42  ? 40.128 173.882 46.590  1.00 178.37 ? 62  GLN C CB  1 
ATOM   6168 C  CG  . GLN C 3 42  ? 39.046 173.607 45.564  1.00 198.93 ? 62  GLN C CG  1 
ATOM   6169 C  CD  . GLN C 3 42  ? 38.867 174.761 44.597  1.00 194.97 ? 62  GLN C CD  1 
ATOM   6170 O  OE1 . GLN C 3 42  ? 39.581 175.762 44.671  1.00 187.08 ? 62  GLN C OE1 1 
ATOM   6171 N  NE2 . GLN C 3 42  ? 37.912 174.628 43.684  1.00 197.29 ? 62  GLN C NE2 1 
ATOM   6172 N  N   . SER C 3 43  ? 42.807 172.948 47.737  1.00 210.33 ? 63  SER C N   1 
ATOM   6173 C  CA  . SER C 3 43  ? 44.047 173.350 48.373  1.00 161.18 ? 63  SER C CA  1 
ATOM   6174 C  C   . SER C 3 43  ? 44.121 174.874 48.459  1.00 151.35 ? 63  SER C C   1 
ATOM   6175 O  O   . SER C 3 43  ? 43.489 175.579 47.667  1.00 154.59 ? 63  SER C O   1 
ATOM   6176 C  CB  . SER C 3 43  ? 45.244 172.815 47.593  1.00 166.89 ? 63  SER C CB  1 
ATOM   6177 O  OG  . SER C 3 43  ? 45.243 173.294 46.259  1.00 206.01 ? 63  SER C OG  1 
ATOM   6178 N  N   . PRO C 3 44  ? 44.873 175.408 49.422  1.00 135.29 ? 64  PRO C N   1 
ATOM   6179 C  CA  . PRO C 3 44  ? 45.035 176.863 49.498  1.00 136.28 ? 64  PRO C CA  1 
ATOM   6180 C  C   . PRO C 3 44  ? 45.687 177.413 48.239  1.00 143.50 ? 64  PRO C C   1 
ATOM   6181 O  O   . PRO C 3 44  ? 46.499 176.749 47.590  1.00 165.21 ? 64  PRO C O   1 
ATOM   6182 C  CB  . PRO C 3 44  ? 45.932 177.058 50.726  1.00 129.40 ? 64  PRO C CB  1 
ATOM   6183 C  CG  . PRO C 3 44  ? 45.719 175.830 51.547  1.00 129.49 ? 64  PRO C CG  1 
ATOM   6184 C  CD  . PRO C 3 44  ? 45.506 174.720 50.560  1.00 135.30 ? 64  PRO C CD  1 
ATOM   6185 N  N   . LYS C 3 45  ? 45.311 178.640 47.890  1.00 135.23 ? 65  LYS C N   1 
ATOM   6186 C  CA  . LYS C 3 45  ? 45.854 179.334 46.731  1.00 135.45 ? 65  LYS C CA  1 
ATOM   6187 C  C   . LYS C 3 45  ? 46.451 180.658 47.182  1.00 145.77 ? 65  LYS C C   1 
ATOM   6188 O  O   . LYS C 3 45  ? 45.799 181.424 47.899  1.00 151.04 ? 65  LYS C O   1 
ATOM   6189 C  CB  . LYS C 3 45  ? 44.777 179.571 45.670  1.00 154.41 ? 65  LYS C CB  1 
ATOM   6190 C  CG  . LYS C 3 45  ? 45.272 180.335 44.453  1.00 182.04 ? 65  LYS C CG  1 
ATOM   6191 C  CD  . LYS C 3 45  ? 44.154 180.560 43.449  1.00 191.94 ? 65  LYS C CD  1 
ATOM   6192 C  CE  . LYS C 3 45  ? 44.649 181.332 42.237  1.00 170.71 ? 65  LYS C CE  1 
ATOM   6193 N  NZ  . LYS C 3 45  ? 43.562 181.560 41.247  1.00 157.72 ? 65  LYS C NZ  1 
ATOM   6194 N  N   . LEU C 3 46  ? 47.685 180.922 46.764  1.00 159.36 ? 66  LEU C N   1 
ATOM   6195 C  CA  . LEU C 3 46  ? 48.347 182.163 47.138  1.00 135.47 ? 66  LEU C CA  1 
ATOM   6196 C  C   . LEU C 3 46  ? 47.726 183.340 46.398  1.00 130.90 ? 66  LEU C C   1 
ATOM   6197 O  O   . LEU C 3 46  ? 47.581 183.313 45.172  1.00 148.19 ? 66  LEU C O   1 
ATOM   6198 C  CB  . LEU C 3 46  ? 49.842 182.085 46.837  1.00 150.91 ? 66  LEU C CB  1 
ATOM   6199 C  CG  . LEU C 3 46  ? 50.622 183.386 47.046  1.00 125.61 ? 66  LEU C CG  1 
ATOM   6200 C  CD1 . LEU C 3 46  ? 50.540 183.846 48.494  1.00 124.90 ? 66  LEU C CD1 1 
ATOM   6201 C  CD2 . LEU C 3 46  ? 52.066 183.219 46.617  1.00 123.75 ? 66  LEU C CD2 1 
ATOM   6202 N  N   . LEU C 3 47  ? 47.359 184.375 47.149  1.00 131.28 ? 67  LEU C N   1 
ATOM   6203 C  CA  . LEU C 3 47  ? 46.836 185.609 46.582  1.00 148.88 ? 67  LEU C CA  1 
ATOM   6204 C  C   . LEU C 3 47  ? 47.820 186.759 46.742  1.00 132.32 ? 67  LEU C C   1 
ATOM   6205 O  O   . LEU C 3 47  ? 48.292 187.318 45.747  1.00 151.25 ? 67  LEU C O   1 
ATOM   6206 C  CB  . LEU C 3 47  ? 45.491 185.974 47.225  1.00 172.19 ? 67  LEU C CB  1 
ATOM   6207 C  CG  . LEU C 3 47  ? 44.290 185.077 46.927  1.00 142.23 ? 67  LEU C CG  1 
ATOM   6208 C  CD1 . LEU C 3 47  ? 43.008 185.773 47.354  1.00 146.70 ? 67  LEU C CD1 1 
ATOM   6209 C  CD2 . LEU C 3 47  ? 44.241 184.703 45.454  1.00 144.84 ? 67  LEU C CD2 1 
ATOM   6210 N  N   . ILE C 3 48  ? 48.137 187.132 47.978  1.00 129.85 ? 68  ILE C N   1 
ATOM   6211 C  CA  . ILE C 3 48  ? 48.932 188.318 48.264  1.00 128.40 ? 68  ILE C CA  1 
ATOM   6212 C  C   . ILE C 3 48  ? 50.241 187.895 48.916  1.00 178.12 ? 68  ILE C C   1 
ATOM   6213 O  O   . ILE C 3 48  ? 50.273 186.948 49.710  1.00 162.81 ? 68  ILE C O   1 
ATOM   6214 C  CB  . ILE C 3 48  ? 48.144 189.300 49.157  1.00 130.78 ? 68  ILE C CB  1 
ATOM   6215 C  CG1 . ILE C 3 48  ? 46.955 189.870 48.382  1.00 136.20 ? 68  ILE C CG1 1 
ATOM   6216 C  CG2 . ILE C 3 48  ? 49.031 190.416 49.669  1.00 129.16 ? 68  ILE C CG2 1 
ATOM   6217 C  CD1 . ILE C 3 48  ? 47.346 190.619 47.125  1.00 154.03 ? 68  ILE C CD1 1 
ATOM   6218 N  N   . TYR C 3 49  ? 51.327 188.579 48.555  1.00 185.79 ? 69  TYR C N   1 
ATOM   6219 C  CA  . TYR C 3 49  ? 52.630 188.349 49.159  1.00 169.44 ? 69  TYR C CA  1 
ATOM   6220 C  C   . TYR C 3 49  ? 53.308 189.687 49.411  1.00 171.10 ? 69  TYR C C   1 
ATOM   6221 O  O   . TYR C 3 49  ? 53.217 190.601 48.584  1.00 186.45 ? 69  TYR C O   1 
ATOM   6222 C  CB  . TYR C 3 49  ? 53.519 187.469 48.266  1.00 168.55 ? 69  TYR C CB  1 
ATOM   6223 C  CG  . TYR C 3 49  ? 54.161 188.208 47.110  1.00 177.36 ? 69  TYR C CG  1 
ATOM   6224 C  CD1 . TYR C 3 49  ? 53.427 188.540 45.979  1.00 207.71 ? 69  TYR C CD1 1 
ATOM   6225 C  CD2 . TYR C 3 49  ? 55.501 188.574 47.151  1.00 171.65 ? 69  TYR C CD2 1 
ATOM   6226 C  CE1 . TYR C 3 49  ? 54.007 189.217 44.923  1.00 198.67 ? 69  TYR C CE1 1 
ATOM   6227 C  CE2 . TYR C 3 49  ? 56.090 189.252 46.099  1.00 187.13 ? 69  TYR C CE2 1 
ATOM   6228 C  CZ  . TYR C 3 49  ? 55.338 189.571 44.988  1.00 180.22 ? 69  TYR C CZ  1 
ATOM   6229 O  OH  . TYR C 3 49  ? 55.919 190.245 43.938  1.00 206.18 ? 69  TYR C OH  1 
ATOM   6230 N  N   . SER C 3 50  ? 53.974 189.792 50.566  1.00 177.84 ? 70  SER C N   1 
ATOM   6231 C  CA  . SER C 3 50  ? 54.766 190.961 50.950  1.00 149.11 ? 70  SER C CA  1 
ATOM   6232 C  C   . SER C 3 50  ? 53.926 192.241 50.895  1.00 152.80 ? 70  SER C C   1 
ATOM   6233 O  O   . SER C 3 50  ? 54.101 193.092 50.026  1.00 201.52 ? 70  SER C O   1 
ATOM   6234 C  CB  . SER C 3 50  ? 56.019 191.061 50.070  1.00 141.49 ? 70  SER C CB  1 
ATOM   6235 O  OG  . SER C 3 50  ? 56.830 189.919 50.260  1.00 147.05 ? 70  SER C OG  1 
ATOM   6236 N  N   . ALA C 3 51  ? 53.000 192.338 51.850  1.00 137.02 ? 71  ALA C N   1 
ATOM   6237 C  CA  . ALA C 3 51  ? 52.165 193.527 52.039  1.00 174.76 ? 71  ALA C CA  1 
ATOM   6238 C  C   . ALA C 3 51  ? 51.396 193.802 50.752  1.00 168.38 ? 71  ALA C C   1 
ATOM   6239 O  O   . ALA C 3 51  ? 50.541 192.981 50.374  1.00 141.29 ? 71  ALA C O   1 
ATOM   6240 C  CB  . ALA C 3 51  ? 53.054 194.665 52.557  1.00 189.20 ? 71  ALA C CB  1 
ATOM   6241 N  N   . SER C 3 52  ? 51.620 194.916 50.062  1.00 188.65 ? 72  SER C N   1 
ATOM   6242 C  CA  . SER C 3 52  ? 50.704 195.297 48.997  1.00 202.48 ? 72  SER C CA  1 
ATOM   6243 C  C   . SER C 3 52  ? 50.827 194.441 47.751  1.00 191.06 ? 72  SER C C   1 
ATOM   6244 O  O   . SER C 3 52  ? 49.890 194.429 46.951  1.00 202.79 ? 72  SER C O   1 
ATOM   6245 C  CB  . SER C 3 52  ? 50.916 196.755 48.584  1.00 234.33 ? 72  SER C CB  1 
ATOM   6246 O  OG  . SER C 3 52  ? 52.273 196.995 48.261  1.00 228.45 ? 72  SER C OG  1 
ATOM   6247 N  N   . TYR C 3 53  ? 51.951 193.763 47.542  1.00 156.30 ? 73  TYR C N   1 
ATOM   6248 C  CA  . TYR C 3 53  ? 52.216 193.135 46.248  1.00 165.38 ? 73  TYR C CA  1 
ATOM   6249 C  C   . TYR C 3 53  ? 51.271 191.961 45.964  1.00 141.65 ? 73  TYR C C   1 
ATOM   6250 O  O   . TYR C 3 53  ? 50.818 191.261 46.873  1.00 138.87 ? 73  TYR C O   1 
ATOM   6251 C  CB  . TYR C 3 53  ? 53.671 192.663 46.171  1.00 140.30 ? 73  TYR C CB  1 
ATOM   6252 C  CG  . TYR C 3 53  ? 54.666 193.799 46.170  1.00 162.81 ? 73  TYR C CG  1 
ATOM   6253 C  CD1 . TYR C 3 53  ? 54.966 194.467 44.996  1.00 208.84 ? 73  TYR C CD1 1 
ATOM   6254 C  CD2 . TYR C 3 53  ? 55.293 194.216 47.342  1.00 165.47 ? 73  TYR C CD2 1 
ATOM   6255 C  CE1 . TYR C 3 53  ? 55.864 195.508 44.972  1.00 212.94 ? 73  TYR C CE1 1 
ATOM   6256 C  CE2 . TYR C 3 53  ? 56.205 195.268 47.329  1.00 180.63 ? 73  TYR C CE2 1 
ATOM   6257 C  CZ  . TYR C 3 53  ? 56.483 195.908 46.137  1.00 202.10 ? 73  TYR C CZ  1 
ATOM   6258 O  OH  . TYR C 3 53  ? 57.382 196.952 46.104  1.00 219.50 ? 73  TYR C OH  1 
ATOM   6259 N  N   . ARG C 3 54  ? 50.978 191.744 44.677  1.00 174.44 ? 74  ARG C N   1 
ATOM   6260 C  CA  . ARG C 3 54  ? 50.072 190.686 44.238  1.00 177.55 ? 74  ARG C CA  1 
ATOM   6261 C  C   . ARG C 3 54  ? 50.843 189.627 43.463  1.00 176.97 ? 74  ARG C C   1 
ATOM   6262 O  O   . ARG C 3 54  ? 51.771 189.946 42.714  1.00 195.45 ? 74  ARG C O   1 
ATOM   6263 C  CB  . ARG C 3 54  ? 48.943 191.238 43.358  1.00 189.25 ? 74  ARG C CB  1 
ATOM   6264 C  CG  . ARG C 3 54  ? 48.255 192.476 43.909  1.00 202.87 ? 74  ARG C CG  1 
ATOM   6265 C  CD  . ARG C 3 54  ? 47.143 192.919 42.967  1.00 190.92 ? 74  ARG C CD  1 
ATOM   6266 N  NE  . ARG C 3 54  ? 46.483 194.148 43.395  1.00 214.22 ? 74  ARG C NE  1 
ATOM   6267 C  CZ  . ARG C 3 54  ? 46.787 195.358 42.936  1.00 225.57 ? 74  ARG C CZ  1 
ATOM   6268 N  NH1 . ARG C 3 54  ? 47.747 195.505 42.033  1.00 216.61 ? 74  ARG C NH1 1 
ATOM   6269 N  NH2 . ARG C 3 54  ? 46.131 196.421 43.380  1.00 237.19 ? 74  ARG C NH2 1 
ATOM   6270 N  N   . TYR C 3 55  ? 50.471 188.367 43.662  1.00 161.52 ? 75  TYR C N   1 
ATOM   6271 C  CA  . TYR C 3 55  ? 51.059 187.277 42.904  1.00 130.45 ? 75  TYR C CA  1 
ATOM   6272 C  C   . TYR C 3 55  ? 50.453 187.219 41.503  1.00 144.90 ? 75  TYR C C   1 
ATOM   6273 O  O   . TYR C 3 55  ? 49.367 187.746 41.244  1.00 139.32 ? 75  TYR C O   1 
ATOM   6274 C  CB  . TYR C 3 55  ? 50.859 185.951 43.636  1.00 128.52 ? 75  TYR C CB  1 
ATOM   6275 C  CG  . TYR C 3 55  ? 51.691 184.821 43.087  1.00 126.79 ? 75  TYR C CG  1 
ATOM   6276 C  CD1 . TYR C 3 55  ? 53.069 184.806 43.252  1.00 123.06 ? 75  TYR C CD1 1 
ATOM   6277 C  CD2 . TYR C 3 55  ? 51.099 183.768 42.407  1.00 157.57 ? 75  TYR C CD2 1 
ATOM   6278 C  CE1 . TYR C 3 55  ? 53.835 183.772 42.751  1.00 121.92 ? 75  TYR C CE1 1 
ATOM   6279 C  CE2 . TYR C 3 55  ? 51.856 182.731 41.903  1.00 154.00 ? 75  TYR C CE2 1 
ATOM   6280 C  CZ  . TYR C 3 55  ? 53.223 182.737 42.077  1.00 173.42 ? 75  TYR C CZ  1 
ATOM   6281 O  OH  . TYR C 3 55  ? 53.979 181.704 41.575  1.00 204.14 ? 75  TYR C OH  1 
ATOM   6282 N  N   . THR C 3 56  ? 51.185 186.587 40.588  1.00 196.04 ? 76  THR C N   1 
ATOM   6283 C  CA  . THR C 3 56  ? 50.710 186.440 39.219  1.00 208.35 ? 76  THR C CA  1 
ATOM   6284 C  C   . THR C 3 56  ? 49.456 185.574 39.173  1.00 195.94 ? 76  THR C C   1 
ATOM   6285 O  O   . THR C 3 56  ? 49.326 184.597 39.915  1.00 194.40 ? 76  THR C O   1 
ATOM   6286 C  CB  . THR C 3 56  ? 51.799 185.822 38.341  1.00 207.69 ? 76  THR C CB  1 
ATOM   6287 O  OG1 . THR C 3 56  ? 52.137 184.521 38.840  1.00 198.44 ? 76  THR C OG1 1 
ATOM   6288 C  CG2 . THR C 3 56  ? 53.042 186.698 38.337  1.00 228.72 ? 76  THR C CG2 1 
ATOM   6289 N  N   . GLY C 3 57  ? 48.532 185.935 38.285  1.00 179.09 ? 77  GLY C N   1 
ATOM   6290 C  CA  . GLY C 3 57  ? 47.278 185.221 38.166  1.00 198.30 ? 77  GLY C CA  1 
ATOM   6291 C  C   . GLY C 3 57  ? 46.214 185.626 39.159  1.00 176.14 ? 77  GLY C C   1 
ATOM   6292 O  O   . GLY C 3 57  ? 45.210 184.917 39.291  1.00 199.42 ? 77  GLY C O   1 
ATOM   6293 N  N   . VAL C 3 58  ? 46.398 186.736 39.856  1.00 151.54 ? 78  VAL C N   1 
ATOM   6294 C  CA  . VAL C 3 58  ? 45.457 187.224 40.862  1.00 152.68 ? 78  VAL C CA  1 
ATOM   6295 C  C   . VAL C 3 58  ? 44.707 188.411 40.274  1.00 160.73 ? 78  VAL C C   1 
ATOM   6296 O  O   . VAL C 3 58  ? 45.346 189.347 39.779  1.00 191.85 ? 78  VAL C O   1 
ATOM   6297 C  CB  . VAL C 3 58  ? 46.169 187.625 42.168  1.00 174.68 ? 78  VAL C CB  1 
ATOM   6298 C  CG1 . VAL C 3 58  ? 45.184 188.260 43.136  1.00 201.89 ? 78  VAL C CG1 1 
ATOM   6299 C  CG2 . VAL C 3 58  ? 46.835 186.412 42.800  1.00 155.82 ? 78  VAL C CG2 1 
ATOM   6300 N  N   . PRO C 3 59  ? 43.375 188.412 40.295  1.00 163.12 ? 79  PRO C N   1 
ATOM   6301 C  CA  . PRO C 3 59  ? 42.626 189.538 39.726  1.00 190.24 ? 79  PRO C CA  1 
ATOM   6302 C  C   . PRO C 3 59  ? 42.889 190.831 40.484  1.00 202.94 ? 79  PRO C C   1 
ATOM   6303 O  O   . PRO C 3 59  ? 43.380 190.838 41.616  1.00 201.90 ? 79  PRO C O   1 
ATOM   6304 C  CB  . PRO C 3 59  ? 41.162 189.100 39.865  1.00 195.52 ? 79  PRO C CB  1 
ATOM   6305 C  CG  . PRO C 3 59  ? 41.217 187.610 40.005  1.00 182.51 ? 79  PRO C CG  1 
ATOM   6306 C  CD  . PRO C 3 59  ? 42.487 187.328 40.747  1.00 164.36 ? 79  PRO C CD  1 
ATOM   6307 N  N   . ASP C 3 60  ? 42.551 191.945 39.831  1.00 206.99 ? 80  ASP C N   1 
ATOM   6308 C  CA  . ASP C 3 60  ? 42.837 193.262 40.388  1.00 211.21 ? 80  ASP C CA  1 
ATOM   6309 C  C   . ASP C 3 60  ? 41.969 193.595 41.595  1.00 203.33 ? 80  ASP C C   1 
ATOM   6310 O  O   . ASP C 3 60  ? 42.327 194.491 42.368  1.00 201.14 ? 80  ASP C O   1 
ATOM   6311 C  CB  . ASP C 3 60  ? 42.655 194.335 39.313  1.00 233.68 ? 80  ASP C CB  1 
ATOM   6312 C  CG  . ASP C 3 60  ? 43.513 194.084 38.089  1.00 233.32 ? 80  ASP C CG  1 
ATOM   6313 O  OD1 . ASP C 3 60  ? 44.682 194.525 38.079  1.00 202.23 ? 80  ASP C OD1 1 
ATOM   6314 O  OD2 . ASP C 3 60  ? 43.017 193.446 37.136  1.00 240.22 ? 80  ASP C OD2 1 
ATOM   6315 N  N   . ARG C 3 61  ? 40.843 192.902 41.778  1.00 196.83 ? 81  ARG C N   1 
ATOM   6316 C  CA  . ARG C 3 61  ? 39.937 193.223 42.876  1.00 209.49 ? 81  ARG C CA  1 
ATOM   6317 C  C   . ARG C 3 61  ? 40.508 192.871 44.244  1.00 210.40 ? 81  ARG C C   1 
ATOM   6318 O  O   . ARG C 3 61  ? 39.964 193.330 45.254  1.00 235.46 ? 81  ARG C O   1 
ATOM   6319 C  CB  . ARG C 3 61  ? 38.596 192.512 42.678  1.00 205.85 ? 81  ARG C CB  1 
ATOM   6320 C  CG  . ARG C 3 61  ? 38.686 190.996 42.637  1.00 201.20 ? 81  ARG C CG  1 
ATOM   6321 C  CD  . ARG C 3 61  ? 37.304 190.368 42.530  1.00 208.35 ? 81  ARG C CD  1 
ATOM   6322 N  NE  . ARG C 3 61  ? 37.364 188.911 42.471  1.00 207.87 ? 81  ARG C NE  1 
ATOM   6323 C  CZ  . ARG C 3 61  ? 37.395 188.209 41.342  1.00 223.30 ? 81  ARG C CZ  1 
ATOM   6324 N  NH1 . ARG C 3 61  ? 37.371 188.831 40.171  1.00 237.56 ? 81  ARG C NH1 1 
ATOM   6325 N  NH2 . ARG C 3 61  ? 37.449 186.885 41.384  1.00 221.13 ? 81  ARG C NH2 1 
ATOM   6326 N  N   . PHE C 3 62  ? 41.578 192.082 44.305  1.00 179.23 ? 82  PHE C N   1 
ATOM   6327 C  CA  . PHE C 3 62  ? 42.204 191.704 45.565  1.00 160.55 ? 82  PHE C CA  1 
ATOM   6328 C  C   . PHE C 3 62  ? 43.376 192.638 45.842  1.00 157.09 ? 82  PHE C C   1 
ATOM   6329 O  O   . PHE C 3 62  ? 44.281 192.767 45.011  1.00 179.61 ? 82  PHE C O   1 
ATOM   6330 C  CB  . PHE C 3 62  ? 42.679 190.253 45.528  1.00 156.45 ? 82  PHE C CB  1 
ATOM   6331 C  CG  . PHE C 3 62  ? 41.586 189.264 45.245  1.00 159.95 ? 82  PHE C CG  1 
ATOM   6332 C  CD1 . PHE C 3 62  ? 40.764 188.811 46.262  1.00 197.94 ? 82  PHE C CD1 1 
ATOM   6333 C  CD2 . PHE C 3 62  ? 41.386 188.783 43.962  1.00 167.87 ? 82  PHE C CD2 1 
ATOM   6334 C  CE1 . PHE C 3 62  ? 39.758 187.898 46.005  1.00 225.61 ? 82  PHE C CE1 1 
ATOM   6335 C  CE2 . PHE C 3 62  ? 40.382 187.870 43.698  1.00 209.06 ? 82  PHE C CE2 1 
ATOM   6336 C  CZ  . PHE C 3 62  ? 39.567 187.427 44.721  1.00 227.58 ? 82  PHE C CZ  1 
ATOM   6337 N  N   . THR C 3 63  ? 43.355 193.286 47.005  1.00 172.74 ? 83  THR C N   1 
ATOM   6338 C  CA  . THR C 3 63  ? 44.433 194.164 47.435  1.00 184.95 ? 83  THR C CA  1 
ATOM   6339 C  C   . THR C 3 63  ? 44.802 193.843 48.877  1.00 186.57 ? 83  THR C C   1 
ATOM   6340 O  O   . THR C 3 63  ? 44.082 193.139 49.589  1.00 170.79 ? 83  THR C O   1 
ATOM   6341 C  CB  . THR C 3 63  ? 44.050 195.647 47.309  1.00 201.53 ? 83  THR C CB  1 
ATOM   6342 O  OG1 . THR C 3 63  ? 42.911 195.923 48.134  1.00 203.65 ? 83  THR C OG1 1 
ATOM   6343 C  CG2 . THR C 3 63  ? 43.728 196.006 45.863  1.00 228.19 ? 83  THR C CG2 1 
ATOM   6344 N  N   . GLY C 3 64  ? 45.946 194.373 49.301  1.00 244.09 ? 84  GLY C N   1 
ATOM   6345 C  CA  . GLY C 3 64  ? 46.390 194.226 50.673  1.00 252.32 ? 84  GLY C CA  1 
ATOM   6346 C  C   . GLY C 3 64  ? 47.234 195.420 51.058  1.00 243.18 ? 84  GLY C C   1 
ATOM   6347 O  O   . GLY C 3 64  ? 47.771 196.126 50.199  1.00 246.99 ? 84  GLY C O   1 
ATOM   6348 N  N   . SER C 3 65  ? 47.349 195.643 52.365  1.00 226.14 ? 85  SER C N   1 
ATOM   6349 C  CA  . SER C 3 65  ? 48.045 196.826 52.850  1.00 229.33 ? 85  SER C CA  1 
ATOM   6350 C  C   . SER C 3 65  ? 48.382 196.659 54.327  1.00 230.75 ? 85  SER C C   1 
ATOM   6351 O  O   . SER C 3 65  ? 47.997 195.681 54.978  1.00 247.52 ? 85  SER C O   1 
ATOM   6352 C  CB  . SER C 3 65  ? 47.206 198.087 52.620  1.00 242.37 ? 85  SER C CB  1 
ATOM   6353 O  OG  . SER C 3 65  ? 45.953 197.989 53.275  1.00 247.38 ? 85  SER C OG  1 
ATOM   6354 N  N   . GLY C 3 66  ? 49.081 197.664 54.853  1.00 214.81 ? 86  GLY C N   1 
ATOM   6355 C  CA  . GLY C 3 66  ? 49.562 197.711 56.219  1.00 205.83 ? 86  GLY C CA  1 
ATOM   6356 C  C   . GLY C 3 66  ? 51.027 197.345 56.343  1.00 197.68 ? 86  GLY C C   1 
ATOM   6357 O  O   . GLY C 3 66  ? 51.527 196.480 55.618  1.00 183.51 ? 86  GLY C O   1 
ATOM   6358 N  N   . SER C 3 67  ? 51.727 198.016 57.256  1.00 202.90 ? 87  SER C N   1 
ATOM   6359 C  CA  . SER C 3 67  ? 53.095 197.666 57.624  1.00 188.10 ? 87  SER C CA  1 
ATOM   6360 C  C   . SER C 3 67  ? 53.212 197.802 59.132  1.00 195.27 ? 87  SER C C   1 
ATOM   6361 O  O   . SER C 3 67  ? 53.052 198.903 59.667  1.00 220.16 ? 87  SER C O   1 
ATOM   6362 C  CB  . SER C 3 67  ? 54.114 198.563 56.915  1.00 197.72 ? 87  SER C CB  1 
ATOM   6363 O  OG  . SER C 3 67  ? 55.439 198.205 57.265  1.00 209.85 ? 87  SER C OG  1 
ATOM   6364 N  N   . GLY C 3 68  ? 53.492 196.708 59.809  1.00 171.48 ? 88  GLY C N   1 
ATOM   6365 C  CA  . GLY C 3 68  ? 53.450 196.711 61.257  1.00 174.22 ? 88  GLY C CA  1 
ATOM   6366 C  C   . GLY C 3 68  ? 53.111 195.323 61.769  1.00 167.37 ? 88  GLY C C   1 
ATOM   6367 O  O   . GLY C 3 68  ? 53.433 194.322 61.133  1.00 151.06 ? 88  GLY C O   1 
ATOM   6368 N  N   . THR C 3 69  ? 52.497 195.290 62.952  1.00 197.90 ? 89  THR C N   1 
ATOM   6369 C  CA  . THR C 3 69  ? 51.908 194.049 63.439  1.00 195.71 ? 89  THR C CA  1 
ATOM   6370 C  C   . THR C 3 69  ? 50.556 193.782 62.785  1.00 207.55 ? 89  THR C C   1 
ATOM   6371 O  O   . THR C 3 69  ? 50.223 192.629 62.490  1.00 196.96 ? 89  THR C O   1 
ATOM   6372 C  CB  . THR C 3 69  ? 51.761 194.093 64.959  1.00 220.67 ? 89  THR C CB  1 
ATOM   6373 O  OG1 . THR C 3 69  ? 50.898 195.177 65.325  1.00 252.31 ? 89  THR C OG1 1 
ATOM   6374 C  CG2 . THR C 3 69  ? 53.117 194.290 65.618  1.00 218.17 ? 89  THR C CG2 1 
ATOM   6375 N  N   . ASP C 3 70  ? 49.771 194.832 62.549  1.00 221.96 ? 90  ASP C N   1 
ATOM   6376 C  CA  . ASP C 3 70  ? 48.437 194.698 61.978  1.00 203.49 ? 90  ASP C CA  1 
ATOM   6377 C  C   . ASP C 3 70  ? 48.481 194.866 60.464  1.00 183.52 ? 90  ASP C C   1 
ATOM   6378 O  O   . ASP C 3 70  ? 49.178 195.742 59.943  1.00 182.52 ? 90  ASP C O   1 
ATOM   6379 C  CB  . ASP C 3 70  ? 47.487 195.731 62.586  1.00 209.17 ? 90  ASP C CB  1 
ATOM   6380 C  CG  . ASP C 3 70  ? 47.440 195.663 64.101  1.00 224.64 ? 90  ASP C CG  1 
ATOM   6381 O  OD1 . ASP C 3 70  ? 47.564 194.549 64.651  1.00 227.05 ? 90  ASP C OD1 1 
ATOM   6382 O  OD2 . ASP C 3 70  ? 47.281 196.724 64.741  1.00 215.32 ? 90  ASP C OD2 1 
ATOM   6383 N  N   . PHE C 3 71  ? 47.726 194.023 59.762  1.00 155.23 ? 91  PHE C N   1 
ATOM   6384 C  CA  . PHE C 3 71  ? 47.645 194.066 58.309  1.00 163.62 ? 91  PHE C CA  1 
ATOM   6385 C  C   . PHE C 3 71  ? 46.192 193.959 57.872  1.00 216.23 ? 91  PHE C C   1 
ATOM   6386 O  O   . PHE C 3 71  ? 45.333 193.474 58.615  1.00 226.30 ? 91  PHE C O   1 
ATOM   6387 C  CB  . PHE C 3 71  ? 48.466 192.945 57.663  1.00 161.89 ? 91  PHE C CB  1 
ATOM   6388 C  CG  . PHE C 3 71  ? 49.941 193.071 57.888  1.00 173.89 ? 91  PHE C CG  1 
ATOM   6389 C  CD1 . PHE C 3 71  ? 50.528 192.541 59.023  1.00 179.92 ? 91  PHE C CD1 1 
ATOM   6390 C  CD2 . PHE C 3 71  ? 50.743 193.721 56.965  1.00 178.26 ? 91  PHE C CD2 1 
ATOM   6391 C  CE1 . PHE C 3 71  ? 51.885 192.654 59.233  1.00 171.55 ? 91  PHE C CE1 1 
ATOM   6392 C  CE2 . PHE C 3 71  ? 52.103 193.838 57.170  1.00 171.70 ? 91  PHE C CE2 1 
ATOM   6393 C  CZ  . PHE C 3 71  ? 52.675 193.304 58.305  1.00 160.79 ? 91  PHE C CZ  1 
ATOM   6394 N  N   . THR C 3 72  ? 45.923 194.410 56.647  1.00 246.17 ? 92  THR C N   1 
ATOM   6395 C  CA  . THR C 3 72  ? 44.565 194.441 56.119  1.00 237.13 ? 92  THR C CA  1 
ATOM   6396 C  C   . THR C 3 72  ? 44.536 193.838 54.723  1.00 202.39 ? 92  THR C C   1 
ATOM   6397 O  O   . THR C 3 72  ? 45.357 194.192 53.872  1.00 200.16 ? 92  THR C O   1 
ATOM   6398 C  CB  . THR C 3 72  ? 44.020 195.875 56.083  1.00 228.66 ? 92  THR C CB  1 
ATOM   6399 O  OG1 . THR C 3 72  ? 44.041 196.430 57.404  1.00 210.96 ? 92  THR C OG1 1 
ATOM   6400 C  CG2 . THR C 3 72  ? 42.592 195.893 55.557  1.00 230.60 ? 92  THR C CG2 1 
ATOM   6401 N  N   . PHE C 3 73  ? 43.594 192.926 54.494  1.00 169.12 ? 93  PHE C N   1 
ATOM   6402 C  CA  . PHE C 3 73  ? 43.326 192.368 53.174  1.00 179.24 ? 93  PHE C CA  1 
ATOM   6403 C  C   . PHE C 3 73  ? 41.983 192.903 52.697  1.00 197.13 ? 93  PHE C C   1 
ATOM   6404 O  O   . PHE C 3 73  ? 40.964 192.718 53.371  1.00 225.05 ? 93  PHE C O   1 
ATOM   6405 C  CB  . PHE C 3 73  ? 43.325 190.840 53.210  1.00 174.96 ? 93  PHE C CB  1 
ATOM   6406 C  CG  . PHE C 3 73  ? 42.989 190.201 51.892  1.00 178.99 ? 93  PHE C CG  1 
ATOM   6407 C  CD1 . PHE C 3 73  ? 43.914 190.181 50.861  1.00 164.61 ? 93  PHE C CD1 1 
ATOM   6408 C  CD2 . PHE C 3 73  ? 41.753 189.613 51.688  1.00 181.94 ? 93  PHE C CD2 1 
ATOM   6409 C  CE1 . PHE C 3 73  ? 43.608 189.591 49.648  1.00 174.45 ? 93  PHE C CE1 1 
ATOM   6410 C  CE2 . PHE C 3 73  ? 41.441 189.021 50.479  1.00 170.82 ? 93  PHE C CE2 1 
ATOM   6411 C  CZ  . PHE C 3 73  ? 42.370 189.010 49.458  1.00 175.85 ? 93  PHE C CZ  1 
ATOM   6412 N  N   . THR C 3 74  ? 41.980 193.562 51.540  1.00 156.60 ? 94  THR C N   1 
ATOM   6413 C  CA  . THR C 3 74  ? 40.821 194.306 51.066  1.00 163.28 ? 94  THR C CA  1 
ATOM   6414 C  C   . THR C 3 74  ? 40.316 193.726 49.753  1.00 168.72 ? 94  THR C C   1 
ATOM   6415 O  O   . THR C 3 74  ? 41.100 193.495 48.826  1.00 201.82 ? 94  THR C O   1 
ATOM   6416 C  CB  . THR C 3 74  ? 41.160 195.789 50.887  1.00 173.46 ? 94  THR C CB  1 
ATOM   6417 O  OG1 . THR C 3 74  ? 41.717 196.305 52.102  1.00 182.95 ? 94  THR C OG1 1 
ATOM   6418 C  CG2 . THR C 3 74  ? 39.911 196.584 50.534  1.00 175.65 ? 94  THR C CG2 1 
ATOM   6419 N  N   . ILE C 3 75  ? 39.006 193.496 49.683  1.00 170.83 ? 95  ILE C N   1 
ATOM   6420 C  CA  . ILE C 3 75  ? 38.313 193.117 48.459  1.00 174.85 ? 95  ILE C CA  1 
ATOM   6421 C  C   . ILE C 3 75  ? 37.270 194.186 48.166  1.00 182.34 ? 95  ILE C C   1 
ATOM   6422 O  O   . ILE C 3 75  ? 36.425 194.487 49.020  1.00 244.17 ? 95  ILE C O   1 
ATOM   6423 C  CB  . ILE C 3 75  ? 37.653 191.731 48.574  1.00 174.99 ? 95  ILE C CB  1 
ATOM   6424 C  CG1 . ILE C 3 75  ? 38.697 190.661 48.890  1.00 171.01 ? 95  ILE C CG1 1 
ATOM   6425 C  CG2 . ILE C 3 75  ? 36.909 191.387 47.294  1.00 179.93 ? 95  ILE C CG2 1 
ATOM   6426 C  CD1 . ILE C 3 75  ? 38.116 189.270 49.016  1.00 170.52 ? 95  ILE C CD1 1 
ATOM   6427 N  N   . SER C 3 76  ? 37.332 194.757 46.962  1.00 185.29 ? 96  SER C N   1 
ATOM   6428 C  CA  . SER C 3 76  ? 36.409 195.826 46.582  1.00 208.32 ? 96  SER C CA  1 
ATOM   6429 C  C   . SER C 3 76  ? 35.061 195.259 46.144  1.00 205.65 ? 96  SER C C   1 
ATOM   6430 O  O   . SER C 3 76  ? 34.037 195.484 46.795  1.00 203.64 ? 96  SER C O   1 
ATOM   6431 C  CB  . SER C 3 76  ? 37.029 196.683 45.474  1.00 209.01 ? 96  SER C CB  1 
ATOM   6432 O  OG  . SER C 3 76  ? 37.340 195.897 44.336  1.00 227.29 ? 96  SER C OG  1 
ATOM   6433 N  N   . SER C 3 77  ? 35.047 194.524 45.035  1.00 240.72 ? 97  SER C N   1 
ATOM   6434 C  CA  . SER C 3 77  ? 33.829 193.918 44.506  1.00 246.06 ? 97  SER C CA  1 
ATOM   6435 C  C   . SER C 3 77  ? 33.842 192.431 44.840  1.00 236.64 ? 97  SER C C   1 
ATOM   6436 O  O   . SER C 3 77  ? 34.651 191.673 44.296  1.00 267.15 ? 97  SER C O   1 
ATOM   6437 C  CB  . SER C 3 77  ? 33.721 194.144 42.999  1.00 254.69 ? 97  SER C CB  1 
ATOM   6438 O  OG  . SER C 3 77  ? 32.561 193.524 42.471  1.00 265.97 ? 97  SER C OG  1 
ATOM   6439 N  N   . VAL C 3 78  ? 32.944 192.019 45.730  1.00 204.03 ? 98  VAL C N   1 
ATOM   6440 C  CA  . VAL C 3 78  ? 32.829 190.624 46.138  1.00 201.26 ? 98  VAL C CA  1 
ATOM   6441 C  C   . VAL C 3 78  ? 31.937 189.894 45.143  1.00 207.00 ? 98  VAL C C   1 
ATOM   6442 O  O   . VAL C 3 78  ? 30.822 190.342 44.849  1.00 275.32 ? 98  VAL C O   1 
ATOM   6443 C  CB  . VAL C 3 78  ? 32.267 190.511 47.565  1.00 201.24 ? 98  VAL C CB  1 
ATOM   6444 C  CG1 . VAL C 3 78  ? 32.035 189.052 47.930  1.00 202.93 ? 98  VAL C CG1 1 
ATOM   6445 C  CG2 . VAL C 3 78  ? 33.210 191.170 48.557  1.00 201.10 ? 98  VAL C CG2 1 
ATOM   6446 N  N   . GLN C 3 79  ? 32.426 188.773 44.624  1.00 203.82 ? 99  GLN C N   1 
ATOM   6447 C  CA  . GLN C 3 79  ? 31.664 187.943 43.708  1.00 211.88 ? 99  GLN C CA  1 
ATOM   6448 C  C   . GLN C 3 79  ? 31.125 186.717 44.443  1.00 213.46 ? 99  GLN C C   1 
ATOM   6449 O  O   . GLN C 3 79  ? 31.374 186.509 45.633  1.00 204.24 ? 99  GLN C O   1 
ATOM   6450 C  CB  . GLN C 3 79  ? 32.525 187.535 42.512  1.00 214.76 ? 99  GLN C CB  1 
ATOM   6451 C  CG  . GLN C 3 79  ? 33.026 188.702 41.677  1.00 207.97 ? 99  GLN C CG  1 
ATOM   6452 C  CD  . GLN C 3 79  ? 33.872 188.254 40.500  1.00 226.38 ? 99  GLN C CD  1 
ATOM   6453 O  OE1 . GLN C 3 79  ? 34.148 187.066 40.337  1.00 232.76 ? 99  GLN C OE1 1 
ATOM   6454 N  NE2 . GLN C 3 79  ? 34.286 189.206 39.672  1.00 210.03 ? 99  GLN C NE2 1 
ATOM   6455 N  N   . ALA C 3 80  ? 30.373 185.891 43.715  1.00 247.70 ? 100 ALA C N   1 
ATOM   6456 C  CA  . ALA C 3 80  ? 29.832 184.671 44.300  1.00 236.84 ? 100 ALA C CA  1 
ATOM   6457 C  C   . ALA C 3 80  ? 30.882 183.573 44.396  1.00 230.53 ? 100 ALA C C   1 
ATOM   6458 O  O   . ALA C 3 80  ? 30.804 182.723 45.290  1.00 233.02 ? 100 ALA C O   1 
ATOM   6459 C  CB  . ALA C 3 80  ? 28.634 184.185 43.486  1.00 250.81 ? 100 ALA C CB  1 
ATOM   6460 N  N   . GLU C 3 81  ? 31.864 183.578 43.497  1.00 255.65 ? 101 GLU C N   1 
ATOM   6461 C  CA  . GLU C 3 81  ? 32.961 182.621 43.543  1.00 261.21 ? 101 GLU C CA  1 
ATOM   6462 C  C   . GLU C 3 81  ? 34.074 183.053 44.489  1.00 244.50 ? 101 GLU C C   1 
ATOM   6463 O  O   . GLU C 3 81  ? 35.072 182.335 44.616  1.00 238.86 ? 101 GLU C O   1 
ATOM   6464 C  CB  . GLU C 3 81  ? 33.529 182.405 42.136  1.00 274.58 ? 101 GLU C CB  1 
ATOM   6465 C  CG  . GLU C 3 81  ? 33.909 183.684 41.411  1.00 282.50 ? 101 GLU C CG  1 
ATOM   6466 C  CD  . GLU C 3 81  ? 34.366 183.430 39.988  1.00 288.80 ? 101 GLU C CD  1 
ATOM   6467 O  OE1 . GLU C 3 81  ? 34.448 182.249 39.591  1.00 303.07 ? 101 GLU C OE1 1 
ATOM   6468 O  OE2 . GLU C 3 81  ? 34.641 184.411 39.266  1.00 284.74 ? 101 GLU C OE2 1 
ATOM   6469 N  N   . ASP C 3 82  ? 33.922 184.195 45.158  1.00 212.16 ? 102 ASP C N   1 
ATOM   6470 C  CA  . ASP C 3 82  ? 34.888 184.669 46.140  1.00 193.53 ? 102 ASP C CA  1 
ATOM   6471 C  C   . ASP C 3 82  ? 34.673 184.056 47.517  1.00 186.38 ? 102 ASP C C   1 
ATOM   6472 O  O   . ASP C 3 82  ? 35.383 184.424 48.460  1.00 176.26 ? 102 ASP C O   1 
ATOM   6473 C  CB  . ASP C 3 82  ? 34.833 186.196 46.245  1.00 186.70 ? 102 ASP C CB  1 
ATOM   6474 C  CG  . ASP C 3 82  ? 35.349 186.886 44.997  1.00 188.68 ? 102 ASP C CG  1 
ATOM   6475 O  OD1 . ASP C 3 82  ? 36.202 186.298 44.300  1.00 185.77 ? 102 ASP C OD1 1 
ATOM   6476 O  OD2 . ASP C 3 82  ? 34.904 188.019 44.716  1.00 229.78 ? 102 ASP C OD2 1 
ATOM   6477 N  N   . LEU C 3 83  ? 33.718 183.141 47.656  1.00 201.07 ? 103 LEU C N   1 
ATOM   6478 C  CA  . LEU C 3 83  ? 33.432 182.518 48.941  1.00 200.20 ? 103 LEU C CA  1 
ATOM   6479 C  C   . LEU C 3 83  ? 34.492 181.464 49.235  1.00 201.59 ? 103 LEU C C   1 
ATOM   6480 O  O   . LEU C 3 83  ? 34.619 180.479 48.499  1.00 242.78 ? 103 LEU C O   1 
ATOM   6481 C  CB  . LEU C 3 83  ? 32.039 181.894 48.915  1.00 210.99 ? 103 LEU C CB  1 
ATOM   6482 C  CG  . LEU C 3 83  ? 31.666 180.884 50.000  1.00 217.96 ? 103 LEU C CG  1 
ATOM   6483 C  CD1 . LEU C 3 83  ? 31.174 181.584 51.252  1.00 231.86 ? 103 LEU C CD1 1 
ATOM   6484 C  CD2 . LEU C 3 83  ? 30.616 179.930 49.472  1.00 210.74 ? 103 LEU C CD2 1 
ATOM   6485 N  N   . ALA C 3 84  ? 35.239 181.666 50.316  1.00 177.97 ? 104 ALA C N   1 
ATOM   6486 C  CA  . ALA C 3 84  ? 36.342 180.788 50.696  1.00 179.42 ? 104 ALA C CA  1 
ATOM   6487 C  C   . ALA C 3 84  ? 36.800 181.188 52.093  1.00 184.54 ? 104 ALA C C   1 
ATOM   6488 O  O   . ALA C 3 84  ? 36.226 182.080 52.726  1.00 205.77 ? 104 ALA C O   1 
ATOM   6489 C  CB  . ALA C 3 84  ? 37.493 180.862 49.690  1.00 191.20 ? 104 ALA C CB  1 
ATOM   6490 N  N   . VAL C 3 85  ? 37.847 180.519 52.570  1.00 174.78 ? 105 VAL C N   1 
ATOM   6491 C  CA  . VAL C 3 85  ? 38.480 180.827 53.847  1.00 165.95 ? 105 VAL C CA  1 
ATOM   6492 C  C   . VAL C 3 85  ? 39.824 181.482 53.562  1.00 164.11 ? 105 VAL C C   1 
ATOM   6493 O  O   . VAL C 3 85  ? 40.611 180.970 52.757  1.00 196.40 ? 105 VAL C O   1 
ATOM   6494 C  CB  . VAL C 3 85  ? 38.651 179.567 54.712  1.00 165.22 ? 105 VAL C CB  1 
ATOM   6495 C  CG1 . VAL C 3 85  ? 39.263 179.926 56.057  1.00 173.75 ? 105 VAL C CG1 1 
ATOM   6496 C  CG2 . VAL C 3 85  ? 37.314 178.864 54.894  1.00 184.43 ? 105 VAL C CG2 1 
ATOM   6497 N  N   . TYR C 3 86  ? 40.088 182.606 54.220  1.00 146.56 ? 106 TYR C N   1 
ATOM   6498 C  CA  . TYR C 3 86  ? 41.293 183.389 53.988  1.00 142.74 ? 106 TYR C CA  1 
ATOM   6499 C  C   . TYR C 3 86  ? 42.241 183.265 55.173  1.00 187.93 ? 106 TYR C C   1 
ATOM   6500 O  O   . TYR C 3 86  ? 41.813 183.302 56.331  1.00 193.61 ? 106 TYR C O   1 
ATOM   6501 C  CB  . TYR C 3 86  ? 40.947 184.860 53.741  1.00 145.46 ? 106 TYR C CB  1 
ATOM   6502 C  CG  . TYR C 3 86  ? 40.177 185.089 52.461  1.00 152.19 ? 106 TYR C CG  1 
ATOM   6503 C  CD1 . TYR C 3 86  ? 38.808 184.859 52.399  1.00 171.97 ? 106 TYR C CD1 1 
ATOM   6504 C  CD2 . TYR C 3 86  ? 40.819 185.532 51.312  1.00 159.57 ? 106 TYR C CD2 1 
ATOM   6505 C  CE1 . TYR C 3 86  ? 38.101 185.063 51.230  1.00 190.67 ? 106 TYR C CE1 1 
ATOM   6506 C  CE2 . TYR C 3 86  ? 40.120 185.740 50.139  1.00 169.02 ? 106 TYR C CE2 1 
ATOM   6507 C  CZ  . TYR C 3 86  ? 38.762 185.504 50.103  1.00 180.76 ? 106 TYR C CZ  1 
ATOM   6508 O  OH  . TYR C 3 86  ? 38.061 185.710 48.937  1.00 187.45 ? 106 TYR C OH  1 
ATOM   6509 N  N   . TYR C 3 87  ? 43.532 183.118 54.877  1.00 183.84 ? 107 TYR C N   1 
ATOM   6510 C  CA  . TYR C 3 87  ? 44.559 182.977 55.899  1.00 129.96 ? 107 TYR C CA  1 
ATOM   6511 C  C   . TYR C 3 87  ? 45.645 184.023 55.693  1.00 157.13 ? 107 TYR C C   1 
ATOM   6512 O  O   . TYR C 3 87  ? 45.914 184.447 54.566  1.00 161.42 ? 107 TYR C O   1 
ATOM   6513 C  CB  . TYR C 3 87  ? 45.188 181.575 55.880  1.00 127.25 ? 107 TYR C CB  1 
ATOM   6514 C  CG  . TYR C 3 87  ? 44.247 180.456 56.270  1.00 133.62 ? 107 TYR C CG  1 
ATOM   6515 C  CD1 . TYR C 3 87  ? 44.073 180.101 57.602  1.00 181.02 ? 107 TYR C CD1 1 
ATOM   6516 C  CD2 . TYR C 3 87  ? 43.542 179.746 55.307  1.00 138.22 ? 107 TYR C CD2 1 
ATOM   6517 C  CE1 . TYR C 3 87  ? 43.217 179.077 57.964  1.00 201.49 ? 107 TYR C CE1 1 
ATOM   6518 C  CE2 . TYR C 3 87  ? 42.684 178.719 55.659  1.00 145.85 ? 107 TYR C CE2 1 
ATOM   6519 C  CZ  . TYR C 3 87  ? 42.526 178.389 56.988  1.00 197.00 ? 107 TYR C CZ  1 
ATOM   6520 O  OH  . TYR C 3 87  ? 41.675 177.369 57.344  1.00 209.35 ? 107 TYR C OH  1 
ATOM   6521 N  N   . CYS C 3 88  ? 46.268 184.436 56.795  1.00 207.54 ? 108 CYS C N   1 
ATOM   6522 C  CA  . CYS C 3 88  ? 47.425 185.321 56.761  1.00 214.52 ? 108 CYS C CA  1 
ATOM   6523 C  C   . CYS C 3 88  ? 48.607 184.629 57.426  1.00 202.15 ? 108 CYS C C   1 
ATOM   6524 O  O   . CYS C 3 88  ? 48.437 183.886 58.398  1.00 228.71 ? 108 CYS C O   1 
ATOM   6525 C  CB  . CYS C 3 88  ? 47.131 186.666 57.445  1.00 205.74 ? 108 CYS C CB  1 
ATOM   6526 S  SG  . CYS C 3 88  ? 46.546 186.595 59.155  1.00 248.52 ? 108 CYS C SG  1 
ATOM   6527 N  N   . GLN C 3 89  ? 49.806 184.875 56.898  1.00 164.94 ? 109 GLN C N   1 
ATOM   6528 C  CA  . GLN C 3 89  ? 50.991 184.128 57.295  1.00 164.26 ? 109 GLN C CA  1 
ATOM   6529 C  C   . GLN C 3 89  ? 52.206 185.047 57.279  1.00 174.99 ? 109 GLN C C   1 
ATOM   6530 O  O   . GLN C 3 89  ? 52.306 185.936 56.431  1.00 154.71 ? 109 GLN C O   1 
ATOM   6531 C  CB  . GLN C 3 89  ? 51.207 182.928 56.360  1.00 128.32 ? 109 GLN C CB  1 
ATOM   6532 C  CG  . GLN C 3 89  ? 52.500 182.161 56.572  1.00 151.72 ? 109 GLN C CG  1 
ATOM   6533 C  CD  . GLN C 3 89  ? 53.411 182.212 55.360  1.00 140.54 ? 109 GLN C CD  1 
ATOM   6534 O  OE1 . GLN C 3 89  ? 54.140 183.183 55.158  1.00 145.23 ? 109 GLN C OE1 1 
ATOM   6535 N  NE2 . GLN C 3 89  ? 53.371 181.163 54.543  1.00 135.93 ? 109 GLN C NE2 1 
ATOM   6536 N  N   . GLN C 3 90  ? 53.119 184.830 58.224  1.00 156.98 ? 110 GLN C N   1 
ATOM   6537 C  CA  . GLN C 3 90  ? 54.370 185.574 58.304  1.00 138.54 ? 110 GLN C CA  1 
ATOM   6538 C  C   . GLN C 3 90  ? 55.511 184.705 57.787  1.00 174.39 ? 110 GLN C C   1 
ATOM   6539 O  O   . GLN C 3 90  ? 55.677 183.563 58.229  1.00 191.32 ? 110 GLN C O   1 
ATOM   6540 C  CB  . GLN C 3 90  ? 54.645 186.028 59.740  1.00 167.01 ? 110 GLN C CB  1 
ATOM   6541 C  CG  . GLN C 3 90  ? 54.621 184.920 60.797  1.00 184.36 ? 110 GLN C CG  1 
ATOM   6542 C  CD  . GLN C 3 90  ? 55.978 184.268 61.016  1.00 160.08 ? 110 GLN C CD  1 
ATOM   6543 O  OE1 . GLN C 3 90  ? 56.988 184.707 60.467  1.00 148.79 ? 110 GLN C OE1 1 
ATOM   6544 N  NE2 . GLN C 3 90  ? 56.003 183.208 61.815  1.00 150.45 ? 110 GLN C NE2 1 
ATOM   6545 N  N   . HIS C 3 91  ? 56.257 185.218 56.811  1.00 191.36 ? 111 HIS C N   1 
ATOM   6546 C  CA  . HIS C 3 91  ? 57.366 184.465 56.241  1.00 212.33 ? 111 HIS C CA  1 
ATOM   6547 C  C   . HIS C 3 91  ? 58.743 184.880 56.745  1.00 235.68 ? 111 HIS C C   1 
ATOM   6548 O  O   . HIS C 3 91  ? 59.743 184.337 56.264  1.00 238.50 ? 111 HIS C O   1 
ATOM   6549 C  CB  . HIS C 3 91  ? 57.334 184.528 54.714  1.00 188.79 ? 111 HIS C CB  1 
ATOM   6550 C  CG  . HIS C 3 91  ? 57.241 185.907 54.140  1.00 183.83 ? 111 HIS C CG  1 
ATOM   6551 N  ND1 . HIS C 3 91  ? 58.334 186.576 53.633  1.00 176.46 ? 111 HIS C ND1 1 
ATOM   6552 C  CD2 . HIS C 3 91  ? 56.176 186.720 53.937  1.00 173.31 ? 111 HIS C CD2 1 
ATOM   6553 C  CE1 . HIS C 3 91  ? 57.952 187.750 53.164  1.00 174.48 ? 111 HIS C CE1 1 
ATOM   6554 N  NE2 . HIS C 3 91  ? 56.647 187.862 53.337  1.00 174.20 ? 111 HIS C NE2 1 
ATOM   6555 N  N   . TYR C 3 92  ? 58.839 185.823 57.681  1.00 239.62 ? 112 TYR C N   1 
ATOM   6556 C  CA  . TYR C 3 92  ? 60.165 186.301 58.078  1.00 228.27 ? 112 TYR C CA  1 
ATOM   6557 C  C   . TYR C 3 92  ? 60.880 185.290 58.974  1.00 223.31 ? 112 TYR C C   1 
ATOM   6558 O  O   . TYR C 3 92  ? 61.902 184.717 58.585  1.00 229.02 ? 112 TYR C O   1 
ATOM   6559 C  CB  . TYR C 3 92  ? 60.063 187.682 58.739  1.00 234.82 ? 112 TYR C CB  1 
ATOM   6560 C  CG  . TYR C 3 92  ? 59.293 187.749 60.040  1.00 249.89 ? 112 TYR C CG  1 
ATOM   6561 C  CD1 . TYR C 3 92  ? 57.912 187.650 60.060  1.00 272.86 ? 112 TYR C CD1 1 
ATOM   6562 C  CD2 . TYR C 3 92  ? 59.952 187.936 61.249  1.00 262.85 ? 112 TYR C CD2 1 
ATOM   6563 C  CE1 . TYR C 3 92  ? 57.210 187.717 61.246  1.00 278.96 ? 112 TYR C CE1 1 
ATOM   6564 C  CE2 . TYR C 3 92  ? 59.254 188.008 62.440  1.00 288.98 ? 112 TYR C CE2 1 
ATOM   6565 C  CZ  . TYR C 3 92  ? 57.882 187.899 62.429  1.00 284.88 ? 112 TYR C CZ  1 
ATOM   6566 O  OH  . TYR C 3 92  ? 57.172 187.971 63.602  1.00 278.00 ? 112 TYR C OH  1 
ATOM   6567 N  N   . SER C 3 93  ? 60.347 185.040 60.167  1.00 155.37 ? 113 SER C N   1 
ATOM   6568 C  CA  . SER C 3 93  ? 61.049 184.258 61.174  1.00 152.59 ? 113 SER C CA  1 
ATOM   6569 C  C   . SER C 3 93  ? 60.641 182.792 61.124  1.00 135.15 ? 113 SER C C   1 
ATOM   6570 O  O   . SER C 3 93  ? 59.485 182.462 60.847  1.00 123.29 ? 113 SER C O   1 
ATOM   6571 C  CB  . SER C 3 93  ? 60.785 184.816 62.573  1.00 163.52 ? 113 SER C CB  1 
ATOM   6572 O  OG  . SER C 3 93  ? 61.513 184.097 63.554  1.00 193.27 ? 113 SER C OG  1 
ATOM   6573 N  N   . ILE C 3 94  ? 61.607 181.920 61.388  1.00 133.48 ? 114 ILE C N   1 
ATOM   6574 C  CA  . ILE C 3 94  ? 61.369 180.488 61.498  1.00 138.68 ? 114 ILE C CA  1 
ATOM   6575 C  C   . ILE C 3 94  ? 60.856 180.168 62.898  1.00 165.38 ? 114 ILE C C   1 
ATOM   6576 O  O   . ILE C 3 94  ? 61.396 180.672 63.883  1.00 182.09 ? 114 ILE C O   1 
ATOM   6577 C  CB  . ILE C 3 94  ? 62.655 179.692 61.186  1.00 166.55 ? 114 ILE C CB  1 
ATOM   6578 C  CG1 . ILE C 3 94  ? 63.141 179.995 59.767  1.00 148.87 ? 114 ILE C CG1 1 
ATOM   6579 C  CG2 . ILE C 3 94  ? 62.441 178.196 61.378  1.00 176.38 ? 114 ILE C CG2 1 
ATOM   6580 C  CD1 . ILE C 3 94  ? 64.433 179.297 59.407  1.00 182.29 ? 114 ILE C CD1 1 
ATOM   6581 N  N   . PRO C 3 95  ? 59.808 179.332 63.000  1.00 170.03 ? 115 PRO C N   1 
ATOM   6582 C  CA  . PRO C 3 95  ? 58.997 178.767 61.916  1.00 113.30 ? 115 PRO C CA  1 
ATOM   6583 C  C   . PRO C 3 95  ? 57.959 179.739 61.360  1.00 151.89 ? 115 PRO C C   1 
ATOM   6584 O  O   . PRO C 3 95  ? 57.617 180.723 62.017  1.00 182.06 ? 115 PRO C O   1 
ATOM   6585 C  CB  . PRO C 3 95  ? 58.312 177.577 62.586  1.00 106.74 ? 115 PRO C CB  1 
ATOM   6586 C  CG  . PRO C 3 95  ? 58.151 178.012 63.996  1.00 170.42 ? 115 PRO C CG  1 
ATOM   6587 C  CD  . PRO C 3 95  ? 59.372 178.835 64.318  1.00 178.94 ? 115 PRO C CD  1 
ATOM   6588 N  N   . ARG C 3 96  ? 57.461 179.454 60.160  1.00 170.14 ? 116 ARG C N   1 
ATOM   6589 C  CA  . ARG C 3 96  ? 56.373 180.230 59.582  1.00 167.08 ? 116 ARG C CA  1 
ATOM   6590 C  C   . ARG C 3 96  ? 55.052 179.789 60.199  1.00 167.37 ? 116 ARG C C   1 
ATOM   6591 O  O   . ARG C 3 96  ? 54.771 178.590 60.294  1.00 167.86 ? 116 ARG C O   1 
ATOM   6592 C  CB  . ARG C 3 96  ? 56.332 180.059 58.062  1.00 165.82 ? 116 ARG C CB  1 
ATOM   6593 C  CG  . ARG C 3 96  ? 57.465 180.741 57.299  1.00 180.88 ? 116 ARG C CG  1 
ATOM   6594 C  CD  . ARG C 3 96  ? 58.743 179.912 57.305  1.00 207.42 ? 116 ARG C CD  1 
ATOM   6595 N  NE  . ARG C 3 96  ? 59.745 180.438 56.382  1.00 201.64 ? 116 ARG C NE  1 
ATOM   6596 C  CZ  . ARG C 3 96  ? 60.615 181.395 56.686  1.00 205.83 ? 116 ARG C CZ  1 
ATOM   6597 N  NH1 . ARG C 3 96  ? 60.610 181.942 57.894  1.00 220.44 ? 116 ARG C NH1 1 
ATOM   6598 N  NH2 . ARG C 3 96  ? 61.491 181.809 55.780  1.00 173.62 ? 116 ARG C NH2 1 
ATOM   6599 N  N   . THR C 3 97  ? 54.242 180.757 60.618  1.00 139.85 ? 117 THR C N   1 
ATOM   6600 C  CA  . THR C 3 97  ? 52.980 180.477 61.284  1.00 152.72 ? 117 THR C CA  1 
ATOM   6601 C  C   . THR C 3 97  ? 51.824 181.106 60.518  1.00 174.10 ? 117 THR C C   1 
ATOM   6602 O  O   . THR C 3 97  ? 52.004 182.035 59.726  1.00 142.74 ? 117 THR C O   1 
ATOM   6603 C  CB  . THR C 3 97  ? 52.988 180.990 62.730  1.00 179.40 ? 117 THR C CB  1 
ATOM   6604 O  OG1 . THR C 3 97  ? 53.264 182.397 62.741  1.00 157.22 ? 117 THR C OG1 1 
ATOM   6605 C  CG2 . THR C 3 97  ? 54.047 180.261 63.545  1.00 197.36 ? 117 THR C CG2 1 
ATOM   6606 N  N   . PHE C 3 98  ? 50.627 180.586 60.772  1.00 195.84 ? 118 PHE C N   1 
ATOM   6607 C  CA  . PHE C 3 98  ? 49.407 181.038 60.122  1.00 155.47 ? 118 PHE C CA  1 
ATOM   6608 C  C   . PHE C 3 98  ? 48.436 181.588 61.158  1.00 162.40 ? 118 PHE C C   1 
ATOM   6609 O  O   . PHE C 3 98  ? 48.520 181.278 62.349  1.00 205.04 ? 118 PHE C O   1 
ATOM   6610 C  CB  . PHE C 3 98  ? 48.730 179.900 59.346  1.00 132.30 ? 118 PHE C CB  1 
ATOM   6611 C  CG  . PHE C 3 98  ? 49.526 179.397 58.179  1.00 131.54 ? 118 PHE C CG  1 
ATOM   6612 C  CD1 . PHE C 3 98  ? 50.481 178.409 58.348  1.00 161.61 ? 118 PHE C CD1 1 
ATOM   6613 C  CD2 . PHE C 3 98  ? 49.309 179.903 56.909  1.00 132.83 ? 118 PHE C CD2 1 
ATOM   6614 C  CE1 . PHE C 3 98  ? 51.211 177.940 57.272  1.00 166.84 ? 118 PHE C CE1 1 
ATOM   6615 C  CE2 . PHE C 3 98  ? 50.036 179.439 55.829  1.00 132.02 ? 118 PHE C CE2 1 
ATOM   6616 C  CZ  . PHE C 3 98  ? 50.988 178.456 56.010  1.00 130.24 ? 118 PHE C CZ  1 
ATOM   6617 N  N   . GLY C 3 99  ? 47.508 182.417 60.685  1.00 142.37 ? 119 GLY C N   1 
ATOM   6618 C  CA  . GLY C 3 99  ? 46.436 182.888 61.532  1.00 167.42 ? 119 GLY C CA  1 
ATOM   6619 C  C   . GLY C 3 99  ? 45.343 181.851 61.694  1.00 180.31 ? 119 GLY C C   1 
ATOM   6620 O  O   . GLY C 3 99  ? 45.335 180.805 61.047  1.00 132.20 ? 119 GLY C O   1 
ATOM   6621 N  N   . GLY C 3 100 ? 44.400 182.156 62.587  1.00 222.26 ? 120 GLY C N   1 
ATOM   6622 C  CA  . GLY C 3 100 ? 43.286 181.254 62.821  1.00 234.44 ? 120 GLY C CA  1 
ATOM   6623 C  C   . GLY C 3 100 ? 42.379 181.084 61.621  1.00 234.68 ? 120 GLY C C   1 
ATOM   6624 O  O   . GLY C 3 100 ? 41.701 180.058 61.504  1.00 223.44 ? 120 GLY C O   1 
ATOM   6625 N  N   . GLY C 3 101 ? 42.354 182.059 60.728  1.00 135.63 ? 121 GLY C N   1 
ATOM   6626 C  CA  . GLY C 3 101 ? 41.521 182.005 59.546  1.00 138.40 ? 121 GLY C CA  1 
ATOM   6627 C  C   . GLY C 3 101 ? 40.208 182.737 59.744  1.00 154.65 ? 121 GLY C C   1 
ATOM   6628 O  O   . GLY C 3 101 ? 39.643 182.780 60.843  1.00 205.40 ? 121 GLY C O   1 
ATOM   6629 N  N   . THR C 3 102 ? 39.707 183.323 58.659  1.00 146.11 ? 122 THR C N   1 
ATOM   6630 C  CA  . THR C 3 102 ? 38.450 184.065 58.671  1.00 151.68 ? 122 THR C CA  1 
ATOM   6631 C  C   . THR C 3 102 ? 37.573 183.534 57.547  1.00 167.52 ? 122 THR C C   1 
ATOM   6632 O  O   . THR C 3 102 ? 37.910 183.685 56.368  1.00 201.87 ? 122 THR C O   1 
ATOM   6633 C  CB  . THR C 3 102 ? 38.689 185.568 58.510  1.00 152.39 ? 122 THR C CB  1 
ATOM   6634 O  OG1 . THR C 3 102 ? 39.553 186.031 59.555  1.00 186.53 ? 122 THR C OG1 1 
ATOM   6635 C  CG2 . THR C 3 102 ? 37.371 186.326 58.577  1.00 162.72 ? 122 THR C CG2 1 
ATOM   6636 N  N   . LYS C 3 103 ? 36.451 182.919 57.908  1.00 170.93 ? 123 LYS C N   1 
ATOM   6637 C  CA  . LYS C 3 103 ? 35.506 182.397 56.930  1.00 164.15 ? 123 LYS C CA  1 
ATOM   6638 C  C   . LYS C 3 103 ? 34.555 183.516 56.522  1.00 184.66 ? 123 LYS C C   1 
ATOM   6639 O  O   . LYS C 3 103 ? 33.825 184.055 57.361  1.00 235.26 ? 123 LYS C O   1 
ATOM   6640 C  CB  . LYS C 3 103 ? 34.737 181.208 57.503  1.00 170.34 ? 123 LYS C CB  1 
ATOM   6641 C  CG  . LYS C 3 103 ? 33.781 180.552 56.523  1.00 178.24 ? 123 LYS C CG  1 
ATOM   6642 C  CD  . LYS C 3 103 ? 33.088 179.355 57.155  1.00 182.62 ? 123 LYS C CD  1 
ATOM   6643 C  CE  . LYS C 3 103 ? 32.125 178.695 56.182  1.00 194.55 ? 123 LYS C CE  1 
ATOM   6644 N  NZ  . LYS C 3 103 ? 31.437 177.524 56.793  1.00 205.80 ? 123 LYS C NZ  1 
ATOM   6645 N  N   . LEU C 3 104 ? 34.566 183.862 55.238  1.00 179.92 ? 124 LEU C N   1 
ATOM   6646 C  CA  . LEU C 3 104 ? 33.770 184.970 54.723  1.00 197.98 ? 124 LEU C CA  1 
ATOM   6647 C  C   . LEU C 3 104 ? 32.443 184.425 54.209  1.00 242.33 ? 124 LEU C C   1 
ATOM   6648 O  O   . LEU C 3 104 ? 32.408 183.691 53.217  1.00 218.57 ? 124 LEU C O   1 
ATOM   6649 C  CB  . LEU C 3 104 ? 34.525 185.707 53.620  1.00 179.65 ? 124 LEU C CB  1 
ATOM   6650 C  CG  . LEU C 3 104 ? 33.872 186.988 53.099  1.00 186.10 ? 124 LEU C CG  1 
ATOM   6651 C  CD1 . LEU C 3 104 ? 33.786 188.022 54.210  1.00 199.55 ? 124 LEU C CD1 1 
ATOM   6652 C  CD2 . LEU C 3 104 ? 34.636 187.539 51.905  1.00 185.15 ? 124 LEU C CD2 1 
ATOM   6653 N  N   . GLU C 3 105 ? 31.354 184.786 54.880  1.00 254.06 ? 125 GLU C N   1 
ATOM   6654 C  CA  . GLU C 3 105 ? 30.015 184.376 54.483  1.00 265.02 ? 125 GLU C CA  1 
ATOM   6655 C  C   . GLU C 3 105 ? 29.324 185.515 53.746  1.00 257.36 ? 125 GLU C C   1 
ATOM   6656 O  O   . GLU C 3 105 ? 29.428 186.680 54.142  1.00 260.44 ? 125 GLU C O   1 
ATOM   6657 C  CB  . GLU C 3 105 ? 29.191 183.950 55.700  1.00 277.29 ? 125 GLU C CB  1 
ATOM   6658 C  CG  . GLU C 3 105 ? 29.255 184.921 56.868  1.00 281.83 ? 125 GLU C CG  1 
ATOM   6659 C  CD  . GLU C 3 105 ? 28.576 184.383 58.112  1.00 301.52 ? 125 GLU C CD  1 
ATOM   6660 O  OE1 . GLU C 3 105 ? 27.961 183.299 58.033  1.00 322.59 ? 125 GLU C OE1 1 
ATOM   6661 O  OE2 . GLU C 3 105 ? 28.659 185.043 59.169  1.00 303.55 ? 125 GLU C OE2 1 
ATOM   6662 N  N   . ILE C 3 106 ? 28.621 185.171 52.672  1.00 224.09 ? 126 ILE C N   1 
ATOM   6663 C  CA  . ILE C 3 106 ? 27.996 186.159 51.800  1.00 214.71 ? 126 ILE C CA  1 
ATOM   6664 C  C   . ILE C 3 106 ? 26.555 186.376 52.240  1.00 220.46 ? 126 ILE C C   1 
ATOM   6665 O  O   . ILE C 3 106 ? 25.810 185.414 52.465  1.00 233.58 ? 126 ILE C O   1 
ATOM   6666 C  CB  . ILE C 3 106 ? 28.068 185.715 50.330  1.00 193.15 ? 126 ILE C CB  1 
ATOM   6667 C  CG1 . ILE C 3 106 ? 29.523 185.487 49.915  1.00 157.60 ? 126 ILE C CG1 1 
ATOM   6668 C  CG2 . ILE C 3 106 ? 27.414 186.748 49.428  1.00 196.78 ? 126 ILE C CG2 1 
ATOM   6669 C  CD1 . ILE C 3 106 ? 29.688 185.054 48.475  1.00 156.46 ? 126 ILE C CD1 1 
ATOM   6670 N  N   . LYS C 3 107 ? 26.162 187.642 52.361  1.00 200.41 ? 127 LYS C N   1 
ATOM   6671 C  CA  . LYS C 3 107 ? 24.812 188.021 52.758  1.00 186.35 ? 127 LYS C CA  1 
ATOM   6672 C  C   . LYS C 3 107 ? 24.006 188.394 51.521  1.00 196.83 ? 127 LYS C C   1 
ATOM   6673 O  O   . LYS C 3 107 ? 24.496 189.123 50.652  1.00 188.56 ? 127 LYS C O   1 
ATOM   6674 C  CB  . LYS C 3 107 ? 24.847 189.190 53.743  1.00 185.38 ? 127 LYS C CB  1 
ATOM   6675 C  CG  . LYS C 3 107 ? 23.481 189.655 54.222  1.00 209.60 ? 127 LYS C CG  1 
ATOM   6676 C  CD  . LYS C 3 107 ? 22.791 188.586 55.053  1.00 254.81 ? 127 LYS C CD  1 
ATOM   6677 C  CE  . LYS C 3 107 ? 21.453 189.074 55.583  1.00 270.39 ? 127 LYS C CE  1 
ATOM   6678 N  NZ  . LYS C 3 107 ? 21.608 190.252 56.481  1.00 257.07 ? 127 LYS C NZ  1 
ATOM   6679 N  N   . ARG C 3 108 ? 22.775 187.896 51.445  1.00 223.71 ? 128 ARG C N   1 
ATOM   6680 C  CA  . ARG C 3 108 ? 21.896 188.179 50.317  1.00 247.12 ? 128 ARG C CA  1 
ATOM   6681 C  C   . ARG C 3 108 ? 20.455 188.196 50.816  1.00 284.42 ? 128 ARG C C   1 
ATOM   6682 O  O   . ARG C 3 108 ? 20.193 188.099 52.018  1.00 272.81 ? 128 ARG C O   1 
ATOM   6683 C  CB  . ARG C 3 108 ? 22.098 187.154 49.194  1.00 216.52 ? 128 ARG C CB  1 
ATOM   6684 C  CG  . ARG C 3 108 ? 21.750 185.729 49.591  1.00 220.03 ? 128 ARG C CG  1 
ATOM   6685 C  CD  . ARG C 3 108 ? 21.237 184.936 48.400  1.00 239.62 ? 128 ARG C CD  1 
ATOM   6686 N  NE  . ARG C 3 108 ? 19.968 185.461 47.903  1.00 259.27 ? 128 ARG C NE  1 
ATOM   6687 C  CZ  . ARG C 3 108 ? 19.281 184.930 46.897  1.00 252.55 ? 128 ARG C CZ  1 
ATOM   6688 N  NH1 . ARG C 3 108 ? 19.739 183.853 46.273  1.00 231.37 ? 128 ARG C NH1 1 
ATOM   6689 N  NH2 . ARG C 3 108 ? 18.134 185.476 46.513  1.00 239.61 ? 128 ARG C NH2 1 
ATOM   6690 N  N   . ALA C 3 109 ? 19.517 188.319 49.880  1.00 314.11 ? 129 ALA C N   1 
ATOM   6691 C  CA  . ALA C 3 109 ? 18.104 188.318 50.219  1.00 331.13 ? 129 ALA C CA  1 
ATOM   6692 C  C   . ALA C 3 109 ? 17.640 186.912 50.589  1.00 332.70 ? 129 ALA C C   1 
ATOM   6693 O  O   . ALA C 3 109 ? 18.274 185.907 50.255  1.00 346.46 ? 129 ALA C O   1 
ATOM   6694 C  CB  . ALA C 3 109 ? 17.272 188.857 49.056  1.00 334.35 ? 129 ALA C CB  1 
ATOM   6695 N  N   . ASP C 3 110 ? 16.515 186.853 51.297  1.00 294.54 ? 130 ASP C N   1 
ATOM   6696 C  CA  . ASP C 3 110 ? 15.961 185.577 51.723  1.00 281.40 ? 130 ASP C CA  1 
ATOM   6697 C  C   . ASP C 3 110 ? 15.499 184.759 50.522  1.00 294.81 ? 130 ASP C C   1 
ATOM   6698 O  O   . ASP C 3 110 ? 15.165 185.297 49.463  1.00 292.79 ? 130 ASP C O   1 
ATOM   6699 C  CB  . ASP C 3 110 ? 14.793 185.797 52.683  1.00 304.43 ? 130 ASP C CB  1 
ATOM   6700 C  CG  . ASP C 3 110 ? 15.183 186.615 53.897  1.00 311.70 ? 130 ASP C CG  1 
ATOM   6701 O  OD1 . ASP C 3 110 ? 16.357 186.536 54.315  1.00 288.99 ? 130 ASP C OD1 1 
ATOM   6702 O  OD2 . ASP C 3 110 ? 14.316 187.337 54.434  1.00 329.03 ? 130 ASP C OD2 1 
ATOM   6703 N  N   . ALA C 3 111 ? 15.482 183.440 50.698  1.00 227.90 ? 131 ALA C N   1 
ATOM   6704 C  CA  . ALA C 3 111 ? 15.074 182.521 49.647  1.00 233.28 ? 131 ALA C CA  1 
ATOM   6705 C  C   . ALA C 3 111 ? 14.191 181.435 50.242  1.00 242.56 ? 131 ALA C C   1 
ATOM   6706 O  O   . ALA C 3 111 ? 14.461 180.936 51.337  1.00 242.77 ? 131 ALA C O   1 
ATOM   6707 C  CB  . ALA C 3 111 ? 16.285 181.891 48.949  1.00 243.43 ? 131 ALA C CB  1 
ATOM   6708 N  N   . ALA C 3 112 ? 13.140 181.076 49.515  1.00 261.85 ? 132 ALA C N   1 
ATOM   6709 C  CA  . ALA C 3 112 ? 12.210 180.058 49.985  1.00 285.88 ? 132 ALA C CA  1 
ATOM   6710 C  C   . ALA C 3 112 ? 12.817 178.674 49.798  1.00 266.86 ? 132 ALA C C   1 
ATOM   6711 O  O   . ALA C 3 112 ? 13.143 178.301 48.665  1.00 259.77 ? 132 ALA C O   1 
ATOM   6712 C  CB  . ALA C 3 112 ? 10.886 180.157 49.240  1.00 311.26 ? 132 ALA C CB  1 
ATOM   6713 N  N   . PRO C 3 113 ? 12.993 177.892 50.863  1.00 268.04 ? 133 PRO C N   1 
ATOM   6714 C  CA  . PRO C 3 113 ? 13.552 176.543 50.706  1.00 274.70 ? 133 PRO C CA  1 
ATOM   6715 C  C   . PRO C 3 113 ? 12.592 175.629 49.960  1.00 298.85 ? 133 PRO C C   1 
ATOM   6716 O  O   . PRO C 3 113 ? 11.395 175.592 50.249  1.00 322.60 ? 133 PRO C O   1 
ATOM   6717 C  CB  . PRO C 3 113 ? 13.767 176.077 52.152  1.00 269.15 ? 133 PRO C CB  1 
ATOM   6718 C  CG  . PRO C 3 113 ? 12.796 176.882 52.952  1.00 272.52 ? 133 PRO C CG  1 
ATOM   6719 C  CD  . PRO C 3 113 ? 12.708 178.217 52.271  1.00 266.04 ? 133 PRO C CD  1 
ATOM   6720 N  N   . THR C 3 114 ? 13.129 174.891 48.994  1.00 271.88 ? 134 THR C N   1 
ATOM   6721 C  CA  . THR C 3 114 ? 12.383 173.844 48.310  1.00 280.44 ? 134 THR C CA  1 
ATOM   6722 C  C   . THR C 3 114 ? 12.575 172.541 49.076  1.00 288.94 ? 134 THR C C   1 
ATOM   6723 O  O   . THR C 3 114 ? 13.706 172.061 49.221  1.00 299.57 ? 134 THR C O   1 
ATOM   6724 C  CB  . THR C 3 114 ? 12.845 173.695 46.861  1.00 278.40 ? 134 THR C CB  1 
ATOM   6725 O  OG1 . THR C 3 114 ? 12.657 174.934 46.166  1.00 275.27 ? 134 THR C OG1 1 
ATOM   6726 C  CG2 . THR C 3 114 ? 12.051 172.602 46.159  1.00 287.67 ? 134 THR C CG2 1 
ATOM   6727 N  N   . VAL C 3 115 ? 11.476 171.983 49.575  1.00 292.77 ? 135 VAL C N   1 
ATOM   6728 C  CA  . VAL C 3 115 ? 11.493 170.784 50.405  1.00 296.94 ? 135 VAL C CA  1 
ATOM   6729 C  C   . VAL C 3 115 ? 10.952 169.624 49.584  1.00 304.75 ? 135 VAL C C   1 
ATOM   6730 O  O   . VAL C 3 115 ? 9.888  169.738 48.964  1.00 314.17 ? 135 VAL C O   1 
ATOM   6731 C  CB  . VAL C 3 115 ? 10.669 170.982 51.689  1.00 301.45 ? 135 VAL C CB  1 
ATOM   6732 C  CG1 . VAL C 3 115 ? 10.716 169.733 52.549  1.00 305.70 ? 135 VAL C CG1 1 
ATOM   6733 C  CG2 . VAL C 3 115 ? 11.175 172.191 52.463  1.00 293.94 ? 135 VAL C CG2 1 
ATOM   6734 N  N   . SER C 3 116 ? 11.683 168.511 49.576  1.00 304.27 ? 136 SER C N   1 
ATOM   6735 C  CA  . SER C 3 116 ? 11.276 167.325 48.827  1.00 322.13 ? 136 SER C CA  1 
ATOM   6736 C  C   . SER C 3 116 ? 11.501 166.093 49.688  1.00 336.27 ? 136 SER C C   1 
ATOM   6737 O  O   . SER C 3 116 ? 12.625 165.840 50.130  1.00 348.90 ? 136 SER C O   1 
ATOM   6738 C  CB  . SER C 3 116 ? 12.050 167.211 47.510  1.00 323.06 ? 136 SER C CB  1 
ATOM   6739 O  OG  . SER C 3 116 ? 11.828 168.345 46.690  1.00 325.40 ? 136 SER C OG  1 
ATOM   6740 N  N   . ILE C 3 117 ? 10.440 165.323 49.912  1.00 319.16 ? 137 ILE C N   1 
ATOM   6741 C  CA  . ILE C 3 117 ? 10.490 164.122 50.738  1.00 322.28 ? 137 ILE C CA  1 
ATOM   6742 C  C   . ILE C 3 117 ? 10.605 162.907 49.828  1.00 324.69 ? 137 ILE C C   1 
ATOM   6743 O  O   . ILE C 3 117 ? 10.009 162.870 48.743  1.00 326.30 ? 137 ILE C O   1 
ATOM   6744 C  CB  . ILE C 3 117 ? 9.253  164.036 51.656  1.00 328.27 ? 137 ILE C CB  1 
ATOM   6745 C  CG1 . ILE C 3 117 ? 9.362  162.852 52.619  1.00 336.88 ? 137 ILE C CG1 1 
ATOM   6746 C  CG2 . ILE C 3 117 ? 7.968  163.960 50.837  1.00 339.95 ? 137 ILE C CG2 1 
ATOM   6747 C  CD1 . ILE C 3 117 ? 8.339  162.885 53.734  1.00 332.90 ? 137 ILE C CD1 1 
ATOM   6748 N  N   . PHE C 3 118 ? 11.391 161.916 50.253  1.00 324.93 ? 138 PHE C N   1 
ATOM   6749 C  CA  . PHE C 3 118 ? 11.617 160.745 49.425  1.00 326.88 ? 138 PHE C CA  1 
ATOM   6750 C  C   . PHE C 3 118 ? 11.403 159.460 50.213  1.00 342.07 ? 138 PHE C C   1 
ATOM   6751 O  O   . PHE C 3 118 ? 11.839 159.345 51.371  1.00 330.13 ? 138 PHE C O   1 
ATOM   6752 C  CB  . PHE C 3 118 ? 13.037 160.759 48.840  1.00 322.58 ? 138 PHE C CB  1 
ATOM   6753 C  CG  . PHE C 3 118 ? 13.283 161.883 47.876  1.00 318.95 ? 138 PHE C CG  1 
ATOM   6754 C  CD1 . PHE C 3 118 ? 13.708 163.121 48.327  1.00 316.89 ? 138 PHE C CD1 1 
ATOM   6755 C  CD2 . PHE C 3 118 ? 13.091 161.700 46.517  1.00 319.71 ? 138 PHE C CD2 1 
ATOM   6756 C  CE1 . PHE C 3 118 ? 13.935 164.157 47.442  1.00 307.86 ? 138 PHE C CE1 1 
ATOM   6757 C  CE2 . PHE C 3 118 ? 13.317 162.732 45.627  1.00 318.03 ? 138 PHE C CE2 1 
ATOM   6758 C  CZ  . PHE C 3 118 ? 13.739 163.962 46.090  1.00 310.56 ? 138 PHE C CZ  1 
ATOM   6759 N  N   . PRO C 3 119 ? 10.747 158.478 49.596  1.00 387.44 ? 139 PRO C N   1 
ATOM   6760 C  CA  . PRO C 3 119 ? 10.524 157.177 50.236  1.00 410.47 ? 139 PRO C CA  1 
ATOM   6761 C  C   . PRO C 3 119 ? 11.746 156.283 50.123  1.00 426.90 ? 139 PRO C C   1 
ATOM   6762 O  O   . PRO C 3 119 ? 12.619 156.509 49.272  1.00 434.28 ? 139 PRO C O   1 
ATOM   6763 C  CB  . PRO C 3 119 ? 9.341  156.602 49.445  1.00 414.61 ? 139 PRO C CB  1 
ATOM   6764 C  CG  . PRO C 3 119 ? 9.506  157.187 48.085  1.00 410.59 ? 139 PRO C CG  1 
ATOM   6765 C  CD  . PRO C 3 119 ? 10.076 158.571 48.287  1.00 403.03 ? 139 PRO C CD  1 
ATOM   6766 N  N   . PRO C 3 120 ? 11.844 155.255 50.966  1.00 353.76 ? 140 PRO C N   1 
ATOM   6767 C  CA  . PRO C 3 120 ? 12.950 154.297 50.839  1.00 349.81 ? 140 PRO C CA  1 
ATOM   6768 C  C   . PRO C 3 120 ? 12.808 153.432 49.594  1.00 410.59 ? 140 PRO C C   1 
ATOM   6769 O  O   . PRO C 3 120 ? 11.707 153.023 49.218  1.00 355.40 ? 140 PRO C O   1 
ATOM   6770 C  CB  . PRO C 3 120 ? 12.838 153.451 52.115  1.00 340.93 ? 140 PRO C CB  1 
ATOM   6771 C  CG  . PRO C 3 120 ? 11.932 154.227 53.031  1.00 342.22 ? 140 PRO C CG  1 
ATOM   6772 C  CD  . PRO C 3 120 ? 11.006 154.981 52.144  1.00 342.99 ? 140 PRO C CD  1 
ATOM   6773 N  N   . SER C 3 121 ? 13.944 153.158 48.956  1.00 566.19 ? 141 SER C N   1 
ATOM   6774 C  CA  . SER C 3 121 ? 13.997 152.323 47.764  1.00 563.69 ? 141 SER C CA  1 
ATOM   6775 C  C   . SER C 3 121 ? 13.851 150.845 48.118  1.00 557.03 ? 141 SER C C   1 
ATOM   6776 O  O   . SER C 3 121 ? 14.047 150.426 49.262  1.00 553.52 ? 141 SER C O   1 
ATOM   6777 C  CB  . SER C 3 121 ? 15.307 152.545 47.008  1.00 561.76 ? 141 SER C CB  1 
ATOM   6778 O  OG  . SER C 3 121 ? 16.423 152.193 47.807  1.00 560.37 ? 141 SER C OG  1 
ATOM   6779 N  N   . SER C 3 122 ? 13.498 150.049 47.103  1.00 553.64 ? 142 SER C N   1 
ATOM   6780 C  CA  . SER C 3 122 ? 13.367 148.608 47.296  1.00 550.04 ? 142 SER C CA  1 
ATOM   6781 C  C   . SER C 3 122 ? 14.714 147.944 47.558  1.00 527.47 ? 142 SER C C   1 
ATOM   6782 O  O   . SER C 3 122 ? 14.772 146.924 48.256  1.00 537.83 ? 142 SER C O   1 
ATOM   6783 C  CB  . SER C 3 122 ? 12.697 147.974 46.077  1.00 560.97 ? 142 SER C CB  1 
ATOM   6784 O  OG  . SER C 3 122 ? 13.481 148.156 44.911  1.00 562.54 ? 142 SER C OG  1 
ATOM   6785 N  N   . GLU C 3 123 ? 15.799 148.495 47.005  1.00 477.28 ? 143 GLU C N   1 
ATOM   6786 C  CA  . GLU C 3 123 ? 17.124 147.937 47.262  1.00 433.61 ? 143 GLU C CA  1 
ATOM   6787 C  C   . GLU C 3 123 ? 17.457 147.972 48.747  1.00 420.53 ? 143 GLU C C   1 
ATOM   6788 O  O   . GLU C 3 123 ? 18.093 147.051 49.272  1.00 404.79 ? 143 GLU C O   1 
ATOM   6789 C  CB  . GLU C 3 123 ? 18.183 148.694 46.460  1.00 417.30 ? 143 GLU C CB  1 
ATOM   6790 C  CG  . GLU C 3 123 ? 18.205 148.369 44.977  1.00 416.08 ? 143 GLU C CG  1 
ATOM   6791 C  CD  . GLU C 3 123 ? 19.349 149.054 44.254  1.00 417.08 ? 143 GLU C CD  1 
ATOM   6792 O  OE1 . GLU C 3 123 ? 19.204 149.349 43.050  1.00 419.96 ? 143 GLU C OE1 1 
ATOM   6793 O  OE2 . GLU C 3 123 ? 20.393 149.302 44.895  1.00 407.68 ? 143 GLU C OE2 1 
ATOM   6794 N  N   . GLN C 3 124 ? 17.036 149.031 49.441  1.00 430.48 ? 144 GLN C N   1 
ATOM   6795 C  CA  . GLN C 3 124 ? 17.235 149.093 50.884  1.00 428.88 ? 144 GLN C CA  1 
ATOM   6796 C  C   . GLN C 3 124 ? 16.274 148.167 51.617  1.00 418.69 ? 144 GLN C C   1 
ATOM   6797 O  O   . GLN C 3 124 ? 16.608 147.652 52.691  1.00 428.30 ? 144 GLN C O   1 
ATOM   6798 C  CB  . GLN C 3 124 ? 17.071 150.533 51.371  1.00 432.27 ? 144 GLN C CB  1 
ATOM   6799 C  CG  . GLN C 3 124 ? 17.499 150.761 52.809  1.00 432.14 ? 144 GLN C CG  1 
ATOM   6800 C  CD  . GLN C 3 124 ? 17.322 152.201 53.246  1.00 428.92 ? 144 GLN C CD  1 
ATOM   6801 O  OE1 . GLN C 3 124 ? 16.950 153.063 52.449  1.00 429.67 ? 144 GLN C OE1 1 
ATOM   6802 N  NE2 . GLN C 3 124 ? 17.587 152.470 54.519  1.00 426.34 ? 144 GLN C NE2 1 
ATOM   6803 N  N   . LEU C 3 125 ? 15.083 147.940 51.056  1.00 395.15 ? 145 LEU C N   1 
ATOM   6804 C  CA  . LEU C 3 125 ? 14.138 147.012 51.668  1.00 386.97 ? 145 LEU C CA  1 
ATOM   6805 C  C   . LEU C 3 125 ? 14.630 145.574 51.582  1.00 397.23 ? 145 LEU C C   1 
ATOM   6806 O  O   . LEU C 3 125 ? 14.297 144.754 52.445  1.00 362.22 ? 145 LEU C O   1 
ATOM   6807 C  CB  . LEU C 3 125 ? 12.767 147.145 51.006  1.00 371.25 ? 145 LEU C CB  1 
ATOM   6808 C  CG  . LEU C 3 125 ? 12.090 148.512 51.115  1.00 363.10 ? 145 LEU C CG  1 
ATOM   6809 C  CD1 . LEU C 3 125 ? 10.750 148.507 50.396  1.00 360.94 ? 145 LEU C CD1 1 
ATOM   6810 C  CD2 . LEU C 3 125 ? 11.920 148.913 52.572  1.00 358.87 ? 145 LEU C CD2 1 
ATOM   6811 N  N   . THR C 3 126 ? 15.415 145.249 50.551  1.00 441.83 ? 146 THR C N   1 
ATOM   6812 C  CA  . THR C 3 126 ? 16.009 143.919 50.470  1.00 457.99 ? 146 THR C CA  1 
ATOM   6813 C  C   . THR C 3 126 ? 16.983 143.677 51.617  1.00 479.45 ? 146 THR C C   1 
ATOM   6814 O  O   . THR C 3 126 ? 17.107 142.545 52.100  1.00 466.53 ? 146 THR C O   1 
ATOM   6815 C  CB  . THR C 3 126 ? 16.712 143.739 49.121  1.00 447.46 ? 146 THR C CB  1 
ATOM   6816 O  OG1 . THR C 3 126 ? 15.791 144.021 48.060  1.00 447.28 ? 146 THR C OG1 1 
ATOM   6817 C  CG2 . THR C 3 126 ? 17.227 142.315 48.965  1.00 444.36 ? 146 THR C CG2 1 
ATOM   6818 N  N   . SER C 3 127 ? 17.663 144.724 52.078  1.00 512.20 ? 147 SER C N   1 
ATOM   6819 C  CA  . SER C 3 127 ? 18.621 144.614 53.170  1.00 517.39 ? 147 SER C CA  1 
ATOM   6820 C  C   . SER C 3 127 ? 17.980 144.739 54.547  1.00 508.79 ? 147 SER C C   1 
ATOM   6821 O  O   . SER C 3 127 ? 18.684 144.603 55.553  1.00 514.82 ? 147 SER C O   1 
ATOM   6822 C  CB  . SER C 3 127 ? 19.719 145.673 53.016  1.00 515.88 ? 147 SER C CB  1 
ATOM   6823 O  OG  . SER C 3 127 ? 20.448 145.483 51.815  1.00 514.49 ? 147 SER C OG  1 
ATOM   6824 N  N   . GLY C 3 128 ? 16.674 144.988 54.621  1.00 417.90 ? 148 GLY C N   1 
ATOM   6825 C  CA  . GLY C 3 128 ? 15.988 145.016 55.896  1.00 358.49 ? 148 GLY C CA  1 
ATOM   6826 C  C   . GLY C 3 128 ? 15.963 146.343 56.621  1.00 359.24 ? 148 GLY C C   1 
ATOM   6827 O  O   . GLY C 3 128 ? 15.903 146.358 57.856  1.00 350.37 ? 148 GLY C O   1 
ATOM   6828 N  N   . GLY C 3 129 ? 16.007 147.461 55.900  1.00 393.42 ? 149 GLY C N   1 
ATOM   6829 C  CA  . GLY C 3 129 ? 15.924 148.767 56.529  1.00 393.12 ? 149 GLY C CA  1 
ATOM   6830 C  C   . GLY C 3 129 ? 15.235 149.754 55.613  1.00 404.06 ? 149 GLY C C   1 
ATOM   6831 O  O   . GLY C 3 129 ? 15.067 149.504 54.415  1.00 406.11 ? 149 GLY C O   1 
ATOM   6832 N  N   . ALA C 3 130 ? 14.822 150.883 56.190  1.00 415.29 ? 150 ALA C N   1 
ATOM   6833 C  CA  . ALA C 3 130 ? 14.129 151.892 55.401  1.00 436.77 ? 150 ALA C CA  1 
ATOM   6834 C  C   . ALA C 3 130 ? 14.410 153.277 55.963  1.00 463.80 ? 150 ALA C C   1 
ATOM   6835 O  O   . ALA C 3 130 ? 14.482 153.455 57.178  1.00 421.48 ? 150 ALA C O   1 
ATOM   6836 C  CB  . ALA C 3 130 ? 12.621 151.628 55.371  1.00 431.25 ? 150 ALA C CB  1 
ATOM   6837 N  N   . SER C 3 131 ? 14.551 154.259 55.076  1.00 541.38 ? 151 SER C N   1 
ATOM   6838 C  CA  . SER C 3 131 ? 14.825 155.624 55.503  1.00 538.50 ? 151 SER C CA  1 
ATOM   6839 C  C   . SER C 3 131 ? 14.014 156.602 54.669  1.00 532.11 ? 151 SER C C   1 
ATOM   6840 O  O   . SER C 3 131 ? 14.081 156.578 53.437  1.00 540.34 ? 151 SER C O   1 
ATOM   6841 C  CB  . SER C 3 131 ? 16.320 155.945 55.393  1.00 536.58 ? 151 SER C CB  1 
ATOM   6842 O  OG  . SER C 3 131 ? 17.080 155.123 56.263  1.00 537.11 ? 151 SER C OG  1 
ATOM   6843 N  N   . VAL C 3 132 ? 13.258 157.462 55.345  1.00 464.56 ? 152 VAL C N   1 
ATOM   6844 C  CA  . VAL C 3 132 ? 12.534 158.549 54.700  1.00 424.93 ? 152 VAL C CA  1 
ATOM   6845 C  C   . VAL C 3 132 ? 13.417 159.789 54.721  1.00 402.72 ? 152 VAL C C   1 
ATOM   6846 O  O   . VAL C 3 132 ? 14.012 160.123 55.756  1.00 401.48 ? 152 VAL C O   1 
ATOM   6847 C  CB  . VAL C 3 132 ? 11.190 158.810 55.400  1.00 426.94 ? 152 VAL C CB  1 
ATOM   6848 C  CG1 . VAL C 3 132 ? 10.484 160.000 54.772  1.00 428.57 ? 152 VAL C CG1 1 
ATOM   6849 C  CG2 . VAL C 3 132 ? 10.311 157.570 55.336  1.00 434.20 ? 152 VAL C CG2 1 
ATOM   6850 N  N   . VAL C 3 133 ? 13.511 160.469 53.579  1.00 353.57 ? 153 VAL C N   1 
ATOM   6851 C  CA  . VAL C 3 133 ? 14.422 161.599 53.430  1.00 324.29 ? 153 VAL C CA  1 
ATOM   6852 C  C   . VAL C 3 133 ? 13.619 162.882 53.269  1.00 326.61 ? 153 VAL C C   1 
ATOM   6853 O  O   . VAL C 3 133 ? 12.520 162.886 52.707  1.00 324.85 ? 153 VAL C O   1 
ATOM   6854 C  CB  . VAL C 3 133 ? 15.380 161.390 52.238  1.00 319.72 ? 153 VAL C CB  1 
ATOM   6855 C  CG1 . VAL C 3 133 ? 16.501 162.418 52.262  1.00 297.90 ? 153 VAL C CG1 1 
ATOM   6856 C  CG2 . VAL C 3 133 ? 15.948 159.979 52.255  1.00 325.57 ? 153 VAL C CG2 1 
ATOM   6857 N  N   . CYS C 3 134 ? 14.170 163.980 53.784  1.00 347.31 ? 154 CYS C N   1 
ATOM   6858 C  CA  . CYS C 3 134 ? 13.588 165.308 53.621  1.00 335.66 ? 154 CYS C CA  1 
ATOM   6859 C  C   . CYS C 3 134 ? 14.697 166.260 53.202  1.00 314.71 ? 154 CYS C C   1 
ATOM   6860 O  O   . CYS C 3 134 ? 15.648 166.476 53.958  1.00 310.61 ? 154 CYS C O   1 
ATOM   6861 C  CB  . CYS C 3 134 ? 12.924 165.784 54.916  1.00 344.95 ? 154 CYS C CB  1 
ATOM   6862 S  SG  . CYS C 3 134 ? 11.748 167.154 54.753  1.00 308.82 ? 154 CYS C SG  1 
ATOM   6863 N  N   . PHE C 3 135 ? 14.577 166.828 52.005  1.00 300.14 ? 155 PHE C N   1 
ATOM   6864 C  CA  . PHE C 3 135 ? 15.604 167.688 51.433  1.00 284.76 ? 155 PHE C CA  1 
ATOM   6865 C  C   . PHE C 3 135 ? 15.147 169.139 51.455  1.00 286.42 ? 155 PHE C C   1 
ATOM   6866 O  O   . PHE C 3 135 ? 14.009 169.444 51.079  1.00 326.03 ? 155 PHE C O   1 
ATOM   6867 C  CB  . PHE C 3 135 ? 15.939 167.267 50.000  1.00 282.76 ? 155 PHE C CB  1 
ATOM   6868 C  CG  . PHE C 3 135 ? 16.943 166.155 49.914  1.00 281.11 ? 155 PHE C CG  1 
ATOM   6869 C  CD1 . PHE C 3 135 ? 17.760 165.857 50.993  1.00 280.43 ? 155 PHE C CD1 1 
ATOM   6870 C  CD2 . PHE C 3 135 ? 17.076 165.411 48.754  1.00 283.57 ? 155 PHE C CD2 1 
ATOM   6871 C  CE1 . PHE C 3 135 ? 18.688 164.835 50.916  1.00 279.21 ? 155 PHE C CE1 1 
ATOM   6872 C  CE2 . PHE C 3 135 ? 18.001 164.388 48.672  1.00 282.52 ? 155 PHE C CE2 1 
ATOM   6873 C  CZ  . PHE C 3 135 ? 18.808 164.100 49.754  1.00 281.67 ? 155 PHE C CZ  1 
ATOM   6874 N  N   . LEU C 3 136 ? 16.041 170.025 51.890  1.00 274.94 ? 156 LEU C N   1 
ATOM   6875 C  CA  . LEU C 3 136 ? 15.798 171.464 51.928  1.00 268.96 ? 156 LEU C CA  1 
ATOM   6876 C  C   . LEU C 3 136 ? 16.864 172.134 51.071  1.00 266.16 ? 156 LEU C C   1 
ATOM   6877 O  O   . LEU C 3 136 ? 18.050 172.106 51.419  1.00 292.53 ? 156 LEU C O   1 
ATOM   6878 C  CB  . LEU C 3 136 ? 15.829 171.995 53.362  1.00 267.48 ? 156 LEU C CB  1 
ATOM   6879 C  CG  . LEU C 3 136 ? 14.891 171.394 54.415  1.00 282.37 ? 156 LEU C CG  1 
ATOM   6880 C  CD1 . LEU C 3 136 ? 15.404 170.063 54.957  1.00 288.99 ? 156 LEU C CD1 1 
ATOM   6881 C  CD2 . LEU C 3 136 ? 14.688 172.377 55.550  1.00 274.26 ? 156 LEU C CD2 1 
ATOM   6882 N  N   . ASN C 3 137 ? 16.449 172.739 49.960  1.00 260.81 ? 157 ASN C N   1 
ATOM   6883 C  CA  . ASN C 3 137 ? 17.378 173.287 48.982  1.00 265.35 ? 157 ASN C CA  1 
ATOM   6884 C  C   . ASN C 3 137 ? 17.125 174.772 48.763  1.00 260.21 ? 157 ASN C C   1 
ATOM   6885 O  O   . ASN C 3 137 ? 15.977 175.226 48.773  1.00 279.98 ? 157 ASN C O   1 
ATOM   6886 C  CB  . ASN C 3 137 ? 17.265 172.548 47.644  1.00 255.36 ? 157 ASN C CB  1 
ATOM   6887 C  CG  . ASN C 3 137 ? 17.558 171.067 47.769  1.00 262.36 ? 157 ASN C CG  1 
ATOM   6888 O  OD1 . ASN C 3 137 ? 18.323 170.644 48.635  1.00 286.00 ? 157 ASN C OD1 1 
ATOM   6889 N  ND2 . ASN C 3 137 ? 16.950 170.269 46.899  1.00 266.10 ? 157 ASN C ND2 1 
ATOM   6890 N  N   . ASN C 3 138 ? 18.212 175.522 48.563  1.00 238.59 ? 158 ASN C N   1 
ATOM   6891 C  CA  . ASN C 3 138 ? 18.171 176.914 48.112  1.00 233.84 ? 158 ASN C CA  1 
ATOM   6892 C  C   . ASN C 3 138 ? 17.360 177.791 49.072  1.00 249.25 ? 158 ASN C C   1 
ATOM   6893 O  O   . ASN C 3 138 ? 16.255 178.246 48.773  1.00 281.19 ? 158 ASN C O   1 
ATOM   6894 C  CB  . ASN C 3 138 ? 17.617 177.002 46.684  1.00 237.06 ? 158 ASN C CB  1 
ATOM   6895 C  CG  . ASN C 3 138 ? 18.430 176.195 45.693  1.00 258.86 ? 158 ASN C CG  1 
ATOM   6896 O  OD1 . ASN C 3 138 ? 18.158 175.016 45.465  1.00 241.50 ? 158 ASN C OD1 1 
ATOM   6897 N  ND2 . ASN C 3 138 ? 19.434 176.827 45.097  1.00 273.77 ? 158 ASN C ND2 1 
ATOM   6898 N  N   . PHE C 3 139 ? 17.948 178.017 50.246  1.00 231.23 ? 159 PHE C N   1 
ATOM   6899 C  CA  . PHE C 3 139 ? 17.379 178.930 51.227  1.00 254.84 ? 159 PHE C CA  1 
ATOM   6900 C  C   . PHE C 3 139 ? 18.501 179.741 51.862  1.00 244.25 ? 159 PHE C C   1 
ATOM   6901 O  O   . PHE C 3 139 ? 19.683 179.560 51.549  1.00 215.77 ? 159 PHE C O   1 
ATOM   6902 C  CB  . PHE C 3 139 ? 16.566 178.179 52.290  1.00 258.25 ? 159 PHE C CB  1 
ATOM   6903 C  CG  . PHE C 3 139 ? 17.364 177.178 53.076  1.00 247.80 ? 159 PHE C CG  1 
ATOM   6904 C  CD1 . PHE C 3 139 ? 17.496 175.873 52.631  1.00 241.85 ? 159 PHE C CD1 1 
ATOM   6905 C  CD2 . PHE C 3 139 ? 17.972 177.539 54.267  1.00 239.77 ? 159 PHE C CD2 1 
ATOM   6906 C  CE1 . PHE C 3 139 ? 18.226 174.950 53.355  1.00 240.94 ? 159 PHE C CE1 1 
ATOM   6907 C  CE2 . PHE C 3 139 ? 18.703 176.622 54.995  1.00 232.84 ? 159 PHE C CE2 1 
ATOM   6908 C  CZ  . PHE C 3 139 ? 18.830 175.325 54.538  1.00 236.42 ? 159 PHE C CZ  1 
ATOM   6909 N  N   . TYR C 3 140 ? 18.116 180.628 52.777  1.00 273.85 ? 160 TYR C N   1 
ATOM   6910 C  CA  . TYR C 3 140 ? 19.038 181.534 53.456  1.00 270.62 ? 160 TYR C CA  1 
ATOM   6911 C  C   . TYR C 3 140 ? 18.268 182.360 54.481  1.00 275.54 ? 160 TYR C C   1 
ATOM   6912 O  O   . TYR C 3 140 ? 17.169 182.834 54.193  1.00 277.67 ? 160 TYR C O   1 
ATOM   6913 C  CB  . TYR C 3 140 ? 19.737 182.459 52.452  1.00 264.55 ? 160 TYR C CB  1 
ATOM   6914 C  CG  . TYR C 3 140 ? 20.843 183.296 53.051  1.00 269.36 ? 160 TYR C CG  1 
ATOM   6915 C  CD1 . TYR C 3 140 ? 22.139 182.807 53.135  1.00 270.67 ? 160 TYR C CD1 1 
ATOM   6916 C  CD2 . TYR C 3 140 ? 20.592 184.573 53.536  1.00 268.25 ? 160 TYR C CD2 1 
ATOM   6917 C  CE1 . TYR C 3 140 ? 23.155 183.564 53.684  1.00 255.61 ? 160 TYR C CE1 1 
ATOM   6918 C  CE2 . TYR C 3 140 ? 21.602 185.339 54.088  1.00 259.47 ? 160 TYR C CE2 1 
ATOM   6919 C  CZ  . TYR C 3 140 ? 22.882 184.829 54.158  1.00 248.10 ? 160 TYR C CZ  1 
ATOM   6920 O  OH  . TYR C 3 140 ? 23.894 185.582 54.705  1.00 232.25 ? 160 TYR C OH  1 
ATOM   6921 N  N   . PRO C 3 141 ? 18.844 182.554 55.679  1.00 282.73 ? 161 PRO C N   1 
ATOM   6922 C  CA  . PRO C 3 141 ? 20.158 182.081 56.130  1.00 279.01 ? 161 PRO C CA  1 
ATOM   6923 C  C   . PRO C 3 141 ? 20.174 180.623 56.586  1.00 297.33 ? 161 PRO C C   1 
ATOM   6924 O  O   . PRO C 3 141 ? 19.197 179.897 56.397  1.00 294.15 ? 161 PRO C O   1 
ATOM   6925 C  CB  . PRO C 3 141 ? 20.470 183.009 57.303  1.00 278.98 ? 161 PRO C CB  1 
ATOM   6926 C  CG  . PRO C 3 141 ? 19.136 183.317 57.875  1.00 289.59 ? 161 PRO C CG  1 
ATOM   6927 C  CD  . PRO C 3 141 ? 18.190 183.391 56.702  1.00 296.43 ? 161 PRO C CD  1 
ATOM   6928 N  N   . LYS C 3 142 ? 21.298 180.213 57.179  1.00 324.63 ? 162 LYS C N   1 
ATOM   6929 C  CA  . LYS C 3 142 ? 21.474 178.824 57.589  1.00 343.19 ? 162 LYS C CA  1 
ATOM   6930 C  C   . LYS C 3 142 ? 20.455 178.401 58.641  1.00 344.64 ? 162 LYS C C   1 
ATOM   6931 O  O   . LYS C 3 142 ? 20.085 177.223 58.704  1.00 370.93 ? 162 LYS C O   1 
ATOM   6932 C  CB  . LYS C 3 142 ? 22.898 178.617 58.114  1.00 332.94 ? 162 LYS C CB  1 
ATOM   6933 C  CG  . LYS C 3 142 ? 23.192 177.213 58.622  1.00 336.00 ? 162 LYS C CG  1 
ATOM   6934 C  CD  . LYS C 3 142 ? 24.575 177.131 59.248  1.00 326.42 ? 162 LYS C CD  1 
ATOM   6935 C  CE  . LYS C 3 142 ? 24.828 175.757 59.848  1.00 331.50 ? 162 LYS C CE  1 
ATOM   6936 N  NZ  . LYS C 3 142 ? 26.181 175.656 60.460  1.00 324.07 ? 162 LYS C NZ  1 
ATOM   6937 N  N   . ASP C 3 143 ? 19.974 179.338 59.456  1.00 275.57 ? 163 ASP C N   1 
ATOM   6938 C  CA  . ASP C 3 143 ? 19.111 178.973 60.572  1.00 268.54 ? 163 ASP C CA  1 
ATOM   6939 C  C   . ASP C 3 143 ? 17.721 178.613 60.063  1.00 295.90 ? 163 ASP C C   1 
ATOM   6940 O  O   . ASP C 3 143 ? 17.035 179.444 59.459  1.00 289.58 ? 163 ASP C O   1 
ATOM   6941 C  CB  . ASP C 3 143 ? 19.030 180.123 61.573  1.00 274.68 ? 163 ASP C CB  1 
ATOM   6942 C  CG  . ASP C 3 143 ? 20.388 180.529 62.106  1.00 270.53 ? 163 ASP C CG  1 
ATOM   6943 O  OD1 . ASP C 3 143 ? 21.269 179.652 62.220  1.00 271.35 ? 163 ASP C OD1 1 
ATOM   6944 O  OD2 . ASP C 3 143 ? 20.575 181.726 62.411  1.00 270.80 ? 163 ASP C OD2 1 
ATOM   6945 N  N   . ILE C 3 144 ? 17.310 177.369 60.309  1.00 344.20 ? 164 ILE C N   1 
ATOM   6946 C  CA  . ILE C 3 144 ? 15.979 176.903 59.943  1.00 358.31 ? 164 ILE C CA  1 
ATOM   6947 C  C   . ILE C 3 144 ? 15.627 175.743 60.861  1.00 354.21 ? 164 ILE C C   1 
ATOM   6948 O  O   . ILE C 3 144 ? 16.501 174.977 61.278  1.00 365.02 ? 164 ILE C O   1 
ATOM   6949 C  CB  . ILE C 3 144 ? 15.923 176.509 58.444  1.00 357.59 ? 164 ILE C CB  1 
ATOM   6950 C  CG1 . ILE C 3 144 ? 14.541 175.968 58.066  1.00 379.93 ? 164 ILE C CG1 1 
ATOM   6951 C  CG2 . ILE C 3 144 ? 17.019 175.513 58.112  1.00 347.83 ? 164 ILE C CG2 1 
ATOM   6952 C  CD1 . ILE C 3 144 ? 14.339 175.800 56.578  1.00 381.81 ? 164 ILE C CD1 1 
ATOM   6953 N  N   . ASN C 3 145 ? 14.342 175.613 61.177  1.00 302.88 ? 165 ASN C N   1 
ATOM   6954 C  CA  . ASN C 3 145 ? 13.844 174.509 61.984  1.00 283.40 ? 165 ASN C CA  1 
ATOM   6955 C  C   . ASN C 3 145 ? 13.292 173.416 61.079  1.00 280.46 ? 165 ASN C C   1 
ATOM   6956 O  O   . ASN C 3 145 ? 12.711 173.701 60.028  1.00 282.32 ? 165 ASN C O   1 
ATOM   6957 C  CB  . ASN C 3 145 ? 12.761 174.986 62.955  1.00 299.95 ? 165 ASN C CB  1 
ATOM   6958 C  CG  . ASN C 3 145 ? 12.169 173.853 63.770  1.00 313.62 ? 165 ASN C CG  1 
ATOM   6959 O  OD1 . ASN C 3 145 ? 11.127 173.300 63.420  1.00 297.96 ? 165 ASN C OD1 1 
ATOM   6960 N  ND2 . ASN C 3 145 ? 12.835 173.499 64.863  1.00 330.49 ? 165 ASN C ND2 1 
ATOM   6961 N  N   . VAL C 3 146 ? 13.492 172.163 61.481  1.00 283.74 ? 166 VAL C N   1 
ATOM   6962 C  CA  . VAL C 3 146 ? 12.985 171.009 60.746  1.00 290.22 ? 166 VAL C CA  1 
ATOM   6963 C  C   . VAL C 3 146 ? 12.228 170.121 61.721  1.00 329.37 ? 166 VAL C C   1 
ATOM   6964 O  O   . VAL C 3 146 ? 12.800 169.659 62.716  1.00 329.72 ? 166 VAL C O   1 
ATOM   6965 C  CB  . VAL C 3 146 ? 14.108 170.217 60.057  1.00 285.49 ? 166 VAL C CB  1 
ATOM   6966 C  CG1 . VAL C 3 146 ? 13.531 169.005 59.346  1.00 292.83 ? 166 VAL C CG1 1 
ATOM   6967 C  CG2 . VAL C 3 146 ? 14.863 171.103 59.079  1.00 283.66 ? 166 VAL C CG2 1 
ATOM   6968 N  N   . LYS C 3 147 ? 10.951 169.879 61.438  1.00 335.68 ? 167 LYS C N   1 
ATOM   6969 C  CA  . LYS C 3 147 ? 10.107 169.038 62.273  1.00 329.10 ? 167 LYS C CA  1 
ATOM   6970 C  C   . LYS C 3 147 ? 9.595  167.857 61.460  1.00 333.70 ? 167 LYS C C   1 
ATOM   6971 O  O   . LYS C 3 147 ? 9.153  168.020 60.317  1.00 332.22 ? 167 LYS C O   1 
ATOM   6972 C  CB  . LYS C 3 147 ? 8.930  169.832 62.852  1.00 330.25 ? 167 LYS C CB  1 
ATOM   6973 C  CG  . LYS C 3 147 ? 8.109  169.061 63.874  1.00 357.88 ? 167 LYS C CG  1 
ATOM   6974 C  CD  . LYS C 3 147 ? 7.074  169.953 64.541  1.00 365.97 ? 167 LYS C CD  1 
ATOM   6975 C  CE  . LYS C 3 147 ? 7.732  171.118 65.262  1.00 363.09 ? 167 LYS C CE  1 
ATOM   6976 N  NZ  . LYS C 3 147 ? 6.731  172.006 65.915  1.00 355.66 ? 167 LYS C NZ  1 
ATOM   6977 N  N   . TRP C 3 148 ? 9.659  166.671 62.058  1.00 324.74 ? 168 TRP C N   1 
ATOM   6978 C  CA  . TRP C 3 148 ? 9.253  165.432 61.414  1.00 328.47 ? 168 TRP C CA  1 
ATOM   6979 C  C   . TRP C 3 148 ? 7.930  164.939 61.984  1.00 356.03 ? 168 TRP C C   1 
ATOM   6980 O  O   . TRP C 3 148 ? 7.646  165.102 63.172  1.00 354.61 ? 168 TRP C O   1 
ATOM   6981 C  CB  . TRP C 3 148 ? 10.315 164.346 61.592  1.00 328.23 ? 168 TRP C CB  1 
ATOM   6982 C  CG  . TRP C 3 148 ? 11.423 164.415 60.599  1.00 326.33 ? 168 TRP C CG  1 
ATOM   6983 C  CD1 . TRP C 3 148 ? 12.574 165.138 60.702  1.00 313.27 ? 168 TRP C CD1 1 
ATOM   6984 C  CD2 . TRP C 3 148 ? 11.491 163.728 59.346  1.00 324.39 ? 168 TRP C CD2 1 
ATOM   6985 N  NE1 . TRP C 3 148 ? 13.356 164.943 59.590  1.00 308.55 ? 168 TRP C NE1 1 
ATOM   6986 C  CE2 . TRP C 3 148 ? 12.712 164.082 58.741  1.00 315.26 ? 168 TRP C CE2 1 
ATOM   6987 C  CE3 . TRP C 3 148 ? 10.636 162.849 58.675  1.00 335.24 ? 168 TRP C CE3 1 
ATOM   6988 C  CZ2 . TRP C 3 148 ? 13.101 163.586 57.501  1.00 314.26 ? 168 TRP C CZ2 1 
ATOM   6989 C  CZ3 . TRP C 3 148 ? 11.023 162.358 57.442  1.00 328.17 ? 168 TRP C CZ3 1 
ATOM   6990 C  CH2 . TRP C 3 148 ? 12.244 162.729 56.867  1.00 322.57 ? 168 TRP C CH2 1 
ATOM   6991 N  N   . LYS C 3 149 ? 7.122  164.337 61.115  1.00 385.52 ? 169 LYS C N   1 
ATOM   6992 C  CA  . LYS C 3 149 ? 5.859  163.722 61.508  1.00 396.31 ? 169 LYS C CA  1 
ATOM   6993 C  C   . LYS C 3 149 ? 5.733  162.379 60.807  1.00 402.20 ? 169 LYS C C   1 
ATOM   6994 O  O   . LYS C 3 149 ? 5.683  162.325 59.573  1.00 403.21 ? 169 LYS C O   1 
ATOM   6995 C  CB  . LYS C 3 149 ? 4.671  164.626 61.161  1.00 404.73 ? 169 LYS C CB  1 
ATOM   6996 C  CG  . LYS C 3 149 ? 4.693  165.981 61.853  1.00 406.42 ? 169 LYS C CG  1 
ATOM   6997 C  CD  . LYS C 3 149 ? 3.558  166.870 61.373  1.00 418.34 ? 169 LYS C CD  1 
ATOM   6998 C  CE  . LYS C 3 149 ? 3.613  168.239 62.032  1.00 415.31 ? 169 LYS C CE  1 
ATOM   6999 N  NZ  . LYS C 3 149 ? 2.535  169.139 61.537  1.00 418.11 ? 169 LYS C NZ  1 
ATOM   7000 N  N   . ILE C 3 150 ? 5.660  161.297 61.584  1.00 403.97 ? 170 ILE C N   1 
ATOM   7001 C  CA  . ILE C 3 150 ? 5.481  159.979 60.987  1.00 416.01 ? 170 ILE C CA  1 
ATOM   7002 C  C   . ILE C 3 150 ? 4.030  159.870 60.546  1.00 417.50 ? 170 ILE C C   1 
ATOM   7003 O  O   . ILE C 3 150 ? 3.731  159.946 59.349  1.00 443.44 ? 170 ILE C O   1 
ATOM   7004 C  CB  . ILE C 3 150 ? 5.854  158.850 61.965  1.00 421.17 ? 170 ILE C CB  1 
ATOM   7005 C  CG1 . ILE C 3 150 ? 7.334  158.933 62.340  1.00 405.52 ? 170 ILE C CG1 1 
ATOM   7006 C  CG2 . ILE C 3 150 ? 5.534  157.490 61.362  1.00 438.22 ? 170 ILE C CG2 1 
ATOM   7007 C  CD1 . ILE C 3 150 ? 7.806  157.786 63.207  1.00 406.38 ? 170 ILE C CD1 1 
ATOM   7008 N  N   . ASP C 3 151 ? 3.116  159.700 61.501  1.00 379.58 ? 171 ASP C N   1 
ATOM   7009 C  CA  . ASP C 3 151 ? 1.697  159.951 61.273  1.00 365.28 ? 171 ASP C CA  1 
ATOM   7010 C  C   . ASP C 3 151 ? 1.225  160.939 62.331  1.00 365.19 ? 171 ASP C C   1 
ATOM   7011 O  O   . ASP C 3 151 ? 1.062  160.569 63.498  1.00 367.43 ? 171 ASP C O   1 
ATOM   7012 C  CB  . ASP C 3 151 ? 0.889  158.653 61.335  1.00 371.15 ? 171 ASP C CB  1 
ATOM   7013 C  CG  . ASP C 3 151 ? 1.458  157.564 60.441  1.00 371.27 ? 171 ASP C CG  1 
ATOM   7014 O  OD1 . ASP C 3 151 ? 1.772  157.855 59.267  1.00 368.86 ? 171 ASP C OD1 1 
ATOM   7015 O  OD2 . ASP C 3 151 ? 1.599  156.418 60.915  1.00 373.78 ? 171 ASP C OD2 1 
ATOM   7016 N  N   . GLY C 3 152 ? 0.996  162.187 61.930  1.00 371.74 ? 172 GLY C N   1 
ATOM   7017 C  CA  . GLY C 3 152 ? 0.353  163.160 62.795  1.00 375.09 ? 172 GLY C CA  1 
ATOM   7018 C  C   . GLY C 3 152 ? 1.115  163.526 64.055  1.00 369.61 ? 172 GLY C C   1 
ATOM   7019 O  O   . GLY C 3 152 ? 0.667  164.377 64.828  1.00 371.57 ? 172 GLY C O   1 
ATOM   7020 N  N   . SER C 3 153 ? 2.273  162.903 64.270  1.00 360.40 ? 173 SER C N   1 
ATOM   7021 C  CA  . SER C 3 153 ? 2.992  162.993 65.532  1.00 356.82 ? 173 SER C CA  1 
ATOM   7022 C  C   . SER C 3 153 ? 4.440  163.382 65.284  1.00 357.76 ? 173 SER C C   1 
ATOM   7023 O  O   . SER C 3 153 ? 5.091  162.844 64.384  1.00 349.58 ? 173 SER C O   1 
ATOM   7024 C  CB  . SER C 3 153 ? 2.938  161.663 66.294  1.00 360.80 ? 173 SER C CB  1 
ATOM   7025 O  OG  . SER C 3 153 ? 3.767  161.702 67.441  1.00 359.05 ? 173 SER C OG  1 
ATOM   7026 N  N   . GLU C 3 154 ? 4.946  164.298 66.108  1.00 349.79 ? 174 GLU C N   1 
ATOM   7027 C  CA  . GLU C 3 154 ? 6.303  164.801 65.943  1.00 352.39 ? 174 GLU C CA  1 
ATOM   7028 C  C   . GLU C 3 154 ? 7.306  163.700 66.266  1.00 397.00 ? 174 GLU C C   1 
ATOM   7029 O  O   . GLU C 3 154 ? 7.279  163.126 67.360  1.00 377.41 ? 174 GLU C O   1 
ATOM   7030 C  CB  . GLU C 3 154 ? 6.526  166.017 66.839  1.00 339.63 ? 174 GLU C CB  1 
ATOM   7031 C  CG  . GLU C 3 154 ? 7.911  166.627 66.720  1.00 337.28 ? 174 GLU C CG  1 
ATOM   7032 C  CD  . GLU C 3 154 ? 8.082  167.864 67.580  1.00 336.23 ? 174 GLU C CD  1 
ATOM   7033 O  OE1 . GLU C 3 154 ? 7.095  168.294 68.214  1.00 333.64 ? 174 GLU C OE1 1 
ATOM   7034 O  OE2 . GLU C 3 154 ? 9.205  168.408 67.623  1.00 342.54 ? 174 GLU C OE2 1 
ATOM   7035 N  N   . ARG C 3 155 ? 8.192  163.407 65.316  1.00 474.38 ? 175 ARG C N   1 
ATOM   7036 C  CA  . ARG C 3 155 ? 9.206  162.369 65.472  1.00 482.95 ? 175 ARG C CA  1 
ATOM   7037 C  C   . ARG C 3 155 ? 10.564 163.043 65.611  1.00 479.90 ? 175 ARG C C   1 
ATOM   7038 O  O   . ARG C 3 155 ? 11.109 163.565 64.633  1.00 472.44 ? 175 ARG C O   1 
ATOM   7039 C  CB  . ARG C 3 155 ? 9.188  161.412 64.282  1.00 484.66 ? 175 ARG C CB  1 
ATOM   7040 C  CG  . ARG C 3 155 ? 10.223 160.308 64.365  1.00 481.20 ? 175 ARG C CG  1 
ATOM   7041 C  CD  . ARG C 3 155 ? 10.015 159.470 65.612  1.00 482.59 ? 175 ARG C CD  1 
ATOM   7042 N  NE  . ARG C 3 155 ? 10.949 158.352 65.685  1.00 481.27 ? 175 ARG C NE  1 
ATOM   7043 C  CZ  . ARG C 3 155 ? 10.961 157.457 66.667  1.00 483.90 ? 175 ARG C CZ  1 
ATOM   7044 N  NH1 . ARG C 3 155 ? 10.090 157.552 67.662  1.00 486.73 ? 175 ARG C NH1 1 
ATOM   7045 N  NH2 . ARG C 3 155 ? 11.846 156.470 66.656  1.00 483.65 ? 175 ARG C NH2 1 
ATOM   7046 N  N   . GLN C 3 156 ? 11.105 163.035 66.826  1.00 488.12 ? 176 GLN C N   1 
ATOM   7047 C  CA  . GLN C 3 156 ? 12.411 163.612 67.103  1.00 490.83 ? 176 GLN C CA  1 
ATOM   7048 C  C   . GLN C 3 156 ? 13.523 162.572 67.179  1.00 494.24 ? 176 GLN C C   1 
ATOM   7049 O  O   . GLN C 3 156 ? 14.688 162.944 67.354  1.00 485.03 ? 176 GLN C O   1 
ATOM   7050 C  CB  . GLN C 3 156 ? 12.360 164.414 68.404  1.00 491.63 ? 176 GLN C CB  1 
ATOM   7051 C  CG  . GLN C 3 156 ? 13.271 165.627 68.425  1.00 483.43 ? 176 GLN C CG  1 
ATOM   7052 C  CD  . GLN C 3 156 ? 12.759 166.757 67.552  1.00 479.98 ? 176 GLN C CD  1 
ATOM   7053 O  OE1 . GLN C 3 156 ? 11.606 166.751 67.120  1.00 482.80 ? 176 GLN C OE1 1 
ATOM   7054 N  NE2 . GLN C 3 156 ? 13.617 167.736 67.289  1.00 472.36 ? 176 GLN C NE2 1 
ATOM   7055 N  N   . ASN C 3 157 ? 13.200 161.289 67.051  1.00 500.23 ? 177 ASN C N   1 
ATOM   7056 C  CA  . ASN C 3 157 ? 14.181 160.218 67.166  1.00 494.44 ? 177 ASN C CA  1 
ATOM   7057 C  C   . ASN C 3 157 ? 14.544 159.696 65.783  1.00 495.51 ? 177 ASN C C   1 
ATOM   7058 O  O   . ASN C 3 157 ? 13.663 159.466 64.948  1.00 502.36 ? 177 ASN C O   1 
ATOM   7059 C  CB  . ASN C 3 157 ? 13.649 159.080 68.039  1.00 499.39 ? 177 ASN C CB  1 
ATOM   7060 C  CG  . ASN C 3 157 ? 13.998 159.259 69.503  1.00 500.20 ? 177 ASN C CG  1 
ATOM   7061 O  OD1 . ASN C 3 157 ? 14.648 160.233 69.883  1.00 495.04 ? 177 ASN C OD1 1 
ATOM   7062 N  ND2 . ASN C 3 157 ? 13.565 158.319 70.335  1.00 505.58 ? 177 ASN C ND2 1 
ATOM   7063 N  N   . GLY C 3 158 ? 15.841 159.506 65.549  1.00 481.59 ? 178 GLY C N   1 
ATOM   7064 C  CA  . GLY C 3 158 ? 16.310 159.054 64.256  1.00 472.65 ? 178 GLY C CA  1 
ATOM   7065 C  C   . GLY C 3 158 ? 16.414 160.136 63.209  1.00 455.11 ? 178 GLY C C   1 
ATOM   7066 O  O   . GLY C 3 158 ? 16.462 159.825 62.016  1.00 457.37 ? 178 GLY C O   1 
ATOM   7067 N  N   . VAL C 3 159 ? 16.453 161.402 63.618  1.00 355.09 ? 179 VAL C N   1 
ATOM   7068 C  CA  . VAL C 3 159 ? 16.512 162.537 62.705  1.00 301.31 ? 179 VAL C CA  1 
ATOM   7069 C  C   . VAL C 3 159 ? 17.928 163.092 62.716  1.00 289.98 ? 179 VAL C C   1 
ATOM   7070 O  O   . VAL C 3 159 ? 18.486 163.361 63.787  1.00 286.59 ? 179 VAL C O   1 
ATOM   7071 C  CB  . VAL C 3 159 ? 15.495 163.623 63.095  1.00 302.60 ? 179 VAL C CB  1 
ATOM   7072 C  CG1 . VAL C 3 159 ? 15.642 164.838 62.192  1.00 300.39 ? 179 VAL C CG1 1 
ATOM   7073 C  CG2 . VAL C 3 159 ? 14.080 163.068 63.035  1.00 313.06 ? 179 VAL C CG2 1 
ATOM   7074 N  N   . LEU C 3 160 ? 18.506 163.266 61.530  1.00 285.43 ? 180 LEU C N   1 
ATOM   7075 C  CA  . LEU C 3 160 ? 19.839 163.840 61.387  1.00 288.13 ? 180 LEU C CA  1 
ATOM   7076 C  C   . LEU C 3 160 ? 19.770 165.040 60.455  1.00 277.80 ? 180 LEU C C   1 
ATOM   7077 O  O   . LEU C 3 160 ? 19.327 164.917 59.308  1.00 297.55 ? 180 LEU C O   1 
ATOM   7078 C  CB  . LEU C 3 160 ? 20.836 162.804 60.861  1.00 294.17 ? 180 LEU C CB  1 
ATOM   7079 C  CG  . LEU C 3 160 ? 21.274 161.730 61.859  1.00 293.13 ? 180 LEU C CG  1 
ATOM   7080 C  CD1 . LEU C 3 160 ? 22.327 160.824 61.241  1.00 285.68 ? 180 LEU C CD1 1 
ATOM   7081 C  CD2 . LEU C 3 160 ? 21.793 162.366 63.140  1.00 278.70 ? 180 LEU C CD2 1 
ATOM   7082 N  N   . ASN C 3 161 ? 20.206 166.195 60.950  1.00 264.39 ? 181 ASN C N   1 
ATOM   7083 C  CA  . ASN C 3 161 ? 20.251 167.424 60.169  1.00 259.17 ? 181 ASN C CA  1 
ATOM   7084 C  C   . ASN C 3 161 ? 21.682 167.692 59.725  1.00 249.88 ? 181 ASN C C   1 
ATOM   7085 O  O   . ASN C 3 161 ? 22.601 167.709 60.552  1.00 262.17 ? 181 ASN C O   1 
ATOM   7086 C  CB  . ASN C 3 161 ? 19.718 168.607 60.979  1.00 258.48 ? 181 ASN C CB  1 
ATOM   7087 C  CG  . ASN C 3 161 ? 18.213 168.563 61.154  1.00 279.36 ? 181 ASN C CG  1 
ATOM   7088 O  OD1 . ASN C 3 161 ? 17.495 168.017 60.317  1.00 273.04 ? 181 ASN C OD1 1 
ATOM   7089 N  ND2 . ASN C 3 161 ? 17.726 169.145 62.244  1.00 295.30 ? 181 ASN C ND2 1 
ATOM   7090 N  N   . SER C 3 162 ? 21.866 167.901 58.423  1.00 250.77 ? 182 SER C N   1 
ATOM   7091 C  CA  . SER C 3 162 ? 23.179 168.163 57.847  1.00 251.16 ? 182 SER C CA  1 
ATOM   7092 C  C   . SER C 3 162 ? 23.107 169.437 57.020  1.00 255.18 ? 182 SER C C   1 
ATOM   7093 O  O   . SER C 3 162 ? 22.398 169.485 56.008  1.00 272.22 ? 182 SER C O   1 
ATOM   7094 C  CB  . SER C 3 162 ? 23.649 166.988 56.985  1.00 242.20 ? 182 SER C CB  1 
ATOM   7095 O  OG  . SER C 3 162 ? 24.939 167.229 56.451  1.00 232.35 ? 182 SER C OG  1 
ATOM   7096 N  N   . TRP C 3 163 ? 23.838 170.463 57.450  1.00 251.82 ? 183 TRP C N   1 
ATOM   7097 C  CA  . TRP C 3 163 ? 23.926 171.727 56.732  1.00 242.25 ? 183 TRP C CA  1 
ATOM   7098 C  C   . TRP C 3 163 ? 25.185 171.736 55.877  1.00 237.96 ? 183 TRP C C   1 
ATOM   7099 O  O   . TRP C 3 163 ? 26.278 171.436 56.370  1.00 233.34 ? 183 TRP C O   1 
ATOM   7100 C  CB  . TRP C 3 163 ? 23.946 172.912 57.699  1.00 237.95 ? 183 TRP C CB  1 
ATOM   7101 C  CG  . TRP C 3 163 ? 22.645 173.163 58.397  1.00 246.80 ? 183 TRP C CG  1 
ATOM   7102 C  CD1 . TRP C 3 163 ? 21.539 173.765 57.874  1.00 252.71 ? 183 TRP C CD1 1 
ATOM   7103 C  CD2 . TRP C 3 163 ? 22.321 172.839 59.754  1.00 251.36 ? 183 TRP C CD2 1 
ATOM   7104 N  NE1 . TRP C 3 163 ? 20.541 173.825 58.816  1.00 275.03 ? 183 TRP C NE1 1 
ATOM   7105 C  CE2 . TRP C 3 163 ? 20.997 173.264 59.980  1.00 269.94 ? 183 TRP C CE2 1 
ATOM   7106 C  CE3 . TRP C 3 163 ? 23.021 172.226 60.799  1.00 240.83 ? 183 TRP C CE3 1 
ATOM   7107 C  CZ2 . TRP C 3 163 ? 20.358 173.096 61.207  1.00 264.18 ? 183 TRP C CZ2 1 
ATOM   7108 C  CZ3 . TRP C 3 163 ? 22.384 172.060 62.016  1.00 254.09 ? 183 TRP C CZ3 1 
ATOM   7109 C  CH2 . TRP C 3 163 ? 21.067 172.494 62.210  1.00 260.26 ? 183 TRP C CH2 1 
ATOM   7110 N  N   . THR C 3 164 ? 25.031 172.078 54.601  1.00 240.76 ? 184 THR C N   1 
ATOM   7111 C  CA  . THR C 3 164 ? 26.177 172.177 53.712  1.00 234.28 ? 184 THR C CA  1 
ATOM   7112 C  C   . THR C 3 164 ? 26.838 173.546 53.856  1.00 245.14 ? 184 THR C C   1 
ATOM   7113 O  O   . THR C 3 164 ? 26.372 174.422 54.590  1.00 210.67 ? 184 THR C O   1 
ATOM   7114 C  CB  . THR C 3 164 ? 25.754 171.936 52.264  1.00 216.96 ? 184 THR C CB  1 
ATOM   7115 O  OG1 . THR C 3 164 ? 24.934 173.024 51.817  1.00 225.88 ? 184 THR C OG1 1 
ATOM   7116 C  CG2 . THR C 3 164 ? 24.968 170.644 52.145  1.00 226.21 ? 184 THR C CG2 1 
ATOM   7117 N  N   . ASP C 3 165 ? 27.945 173.731 53.145  1.00 265.42 ? 185 ASP C N   1 
ATOM   7118 C  CA  . ASP C 3 165 ? 28.576 175.036 53.052  1.00 263.17 ? 185 ASP C CA  1 
ATOM   7119 C  C   . ASP C 3 165 ? 27.794 175.931 52.095  1.00 264.65 ? 185 ASP C C   1 
ATOM   7120 O  O   . ASP C 3 165 ? 27.000 175.463 51.274  1.00 262.73 ? 185 ASP C O   1 
ATOM   7121 C  CB  . ASP C 3 165 ? 30.029 174.904 52.595  1.00 264.67 ? 185 ASP C CB  1 
ATOM   7122 C  CG  . ASP C 3 165 ? 30.910 174.245 53.640  1.00 270.14 ? 185 ASP C CG  1 
ATOM   7123 O  OD1 . ASP C 3 165 ? 30.585 174.345 54.842  1.00 263.51 ? 185 ASP C OD1 1 
ATOM   7124 O  OD2 . ASP C 3 165 ? 31.929 173.629 53.261  1.00 258.55 ? 185 ASP C OD2 1 
ATOM   7125 N  N   . GLN C 3 166 ? 28.019 177.237 52.222  1.00 273.41 ? 186 GLN C N   1 
ATOM   7126 C  CA  . GLN C 3 166 ? 27.335 178.200 51.370  1.00 244.82 ? 186 GLN C CA  1 
ATOM   7127 C  C   . GLN C 3 166 ? 27.682 177.954 49.904  1.00 204.65 ? 186 GLN C C   1 
ATOM   7128 O  O   . GLN C 3 166 ? 28.752 177.438 49.570  1.00 194.85 ? 186 GLN C O   1 
ATOM   7129 C  CB  . GLN C 3 166 ? 27.704 179.629 51.776  1.00 231.30 ? 186 GLN C CB  1 
ATOM   7130 C  CG  . GLN C 3 166 ? 26.775 180.692 51.216  1.00 199.78 ? 186 GLN C CG  1 
ATOM   7131 C  CD  . GLN C 3 166 ? 27.035 182.062 51.808  1.00 205.01 ? 186 GLN C CD  1 
ATOM   7132 O  OE1 . GLN C 3 166 ? 27.885 182.223 52.684  1.00 219.45 ? 186 GLN C OE1 1 
ATOM   7133 N  NE2 . GLN C 3 166 ? 26.299 183.060 51.332  1.00 206.94 ? 186 GLN C NE2 1 
ATOM   7134 N  N   . ASP C 3 167 ? 26.747 178.307 49.028  1.00 216.10 ? 187 ASP C N   1 
ATOM   7135 C  CA  . ASP C 3 167 ? 26.909 178.068 47.603  1.00 213.29 ? 187 ASP C CA  1 
ATOM   7136 C  C   . ASP C 3 167 ? 27.746 179.166 46.957  1.00 201.47 ? 187 ASP C C   1 
ATOM   7137 O  O   . ASP C 3 167 ? 27.702 180.331 47.357  1.00 227.53 ? 187 ASP C O   1 
ATOM   7138 C  CB  . ASP C 3 167 ? 25.544 177.977 46.922  1.00 221.82 ? 187 ASP C CB  1 
ATOM   7139 C  CG  . ASP C 3 167 ? 25.630 177.386 45.532  1.00 250.42 ? 187 ASP C CG  1 
ATOM   7140 O  OD1 . ASP C 3 167 ? 25.848 178.152 44.572  1.00 272.38 ? 187 ASP C OD1 1 
ATOM   7141 O  OD2 . ASP C 3 167 ? 25.483 176.152 45.400  1.00 263.34 ? 187 ASP C OD2 1 
ATOM   7142 N  N   . SER C 3 168 ? 28.518 178.778 45.945  1.00 215.21 ? 188 SER C N   1 
ATOM   7143 C  CA  . SER C 3 168 ? 29.406 179.693 45.241  1.00 232.03 ? 188 SER C CA  1 
ATOM   7144 C  C   . SER C 3 168 ? 28.771 180.315 44.004  1.00 245.36 ? 188 SER C C   1 
ATOM   7145 O  O   . SER C 3 168 ? 29.451 181.052 43.282  1.00 247.65 ? 188 SER C O   1 
ATOM   7146 C  CB  . SER C 3 168 ? 30.699 178.973 44.844  1.00 244.38 ? 188 SER C CB  1 
ATOM   7147 O  OG  . SER C 3 168 ? 30.434 177.895 43.964  1.00 221.34 ? 188 SER C OG  1 
ATOM   7148 N  N   . LYS C 3 169 ? 27.496 180.036 43.736  1.00 271.55 ? 189 LYS C N   1 
ATOM   7149 C  CA  . LYS C 3 169 ? 26.804 180.580 42.572  1.00 275.84 ? 189 LYS C CA  1 
ATOM   7150 C  C   . LYS C 3 169 ? 25.735 181.578 42.999  1.00 280.75 ? 189 LYS C C   1 
ATOM   7151 O  O   . LYS C 3 169 ? 25.899 182.783 42.792  1.00 279.20 ? 189 LYS C O   1 
ATOM   7152 C  CB  . LYS C 3 169 ? 26.202 179.448 41.737  1.00 273.36 ? 189 LYS C CB  1 
ATOM   7153 C  CG  . LYS C 3 169 ? 27.174 178.321 41.429  1.00 261.25 ? 189 LYS C CG  1 
ATOM   7154 C  CD  . LYS C 3 169 ? 26.476 177.119 40.802  1.00 271.62 ? 189 LYS C CD  1 
ATOM   7155 C  CE  . LYS C 3 169 ? 25.748 176.268 41.840  1.00 279.29 ? 189 LYS C CE  1 
ATOM   7156 N  NZ  . LYS C 3 169 ? 24.457 176.856 42.302  1.00 284.29 ? 189 LYS C NZ  1 
ATOM   7157 N  N   . ASP C 3 170 ? 24.630 181.112 43.576  1.00 284.35 ? 190 ASP C N   1 
ATOM   7158 C  CA  . ASP C 3 170 ? 23.575 181.990 44.063  1.00 280.97 ? 190 ASP C CA  1 
ATOM   7159 C  C   . ASP C 3 170 ? 23.681 182.279 45.555  1.00 267.76 ? 190 ASP C C   1 
ATOM   7160 O  O   . ASP C 3 170 ? 22.865 183.042 46.081  1.00 270.27 ? 190 ASP C O   1 
ATOM   7161 C  CB  . ASP C 3 170 ? 22.201 181.389 43.747  1.00 303.87 ? 190 ASP C CB  1 
ATOM   7162 C  CG  . ASP C 3 170 ? 22.039 179.986 44.295  1.00 308.65 ? 190 ASP C CG  1 
ATOM   7163 O  OD1 . ASP C 3 170 ? 23.065 179.301 44.489  1.00 298.09 ? 190 ASP C OD1 1 
ATOM   7164 O  OD2 . ASP C 3 170 ? 20.886 179.567 44.530  1.00 317.57 ? 190 ASP C OD2 1 
ATOM   7165 N  N   . SER C 3 171 ? 24.663 181.691 46.242  1.00 231.35 ? 191 SER C N   1 
ATOM   7166 C  CA  . SER C 3 171 ? 24.883 181.882 47.677  1.00 216.24 ? 191 SER C CA  1 
ATOM   7167 C  C   . SER C 3 171 ? 23.633 181.497 48.477  1.00 231.38 ? 191 SER C C   1 
ATOM   7168 O  O   . SER C 3 171 ? 22.981 182.322 49.119  1.00 279.70 ? 191 SER C O   1 
ATOM   7169 C  CB  . SER C 3 171 ? 25.312 183.323 47.978  1.00 204.04 ? 191 SER C CB  1 
ATOM   7170 O  OG  . SER C 3 171 ? 26.508 183.655 47.293  1.00 216.49 ? 191 SER C OG  1 
ATOM   7171 N  N   . THR C 3 172 ? 23.320 180.204 48.420  1.00 209.89 ? 192 THR C N   1 
ATOM   7172 C  CA  . THR C 3 172 ? 22.161 179.646 49.105  1.00 245.57 ? 192 THR C CA  1 
ATOM   7173 C  C   . THR C 3 172 ? 22.562 178.364 49.818  1.00 235.70 ? 192 THR C C   1 
ATOM   7174 O  O   . THR C 3 172 ? 23.122 177.454 49.198  1.00 212.02 ? 192 THR C O   1 
ATOM   7175 C  CB  . THR C 3 172 ? 21.013 179.363 48.128  1.00 251.66 ? 192 THR C CB  1 
ATOM   7176 O  OG1 . THR C 3 172 ? 21.495 178.571 47.035  1.00 240.64 ? 192 THR C OG1 1 
ATOM   7177 C  CG2 . THR C 3 172 ? 20.425 180.663 47.594  1.00 246.91 ? 192 THR C CG2 1 
ATOM   7178 N  N   . TYR C 3 173 ? 22.272 178.296 51.114  1.00 236.92 ? 193 TYR C N   1 
ATOM   7179 C  CA  . TYR C 3 173 ? 22.554 177.097 51.887  1.00 234.83 ? 193 TYR C CA  1 
ATOM   7180 C  C   . TYR C 3 173 ? 21.573 175.983 51.530  1.00 254.50 ? 193 TYR C C   1 
ATOM   7181 O  O   . TYR C 3 173 ? 20.488 176.216 50.991  1.00 268.98 ? 193 TYR C O   1 
ATOM   7182 C  CB  . TYR C 3 173 ? 22.480 177.388 53.386  1.00 237.60 ? 193 TYR C CB  1 
ATOM   7183 C  CG  . TYR C 3 173 ? 23.601 178.256 53.913  1.00 221.78 ? 193 TYR C CG  1 
ATOM   7184 C  CD1 . TYR C 3 173 ? 24.779 177.691 54.384  1.00 217.89 ? 193 TYR C CD1 1 
ATOM   7185 C  CD2 . TYR C 3 173 ? 23.478 179.638 53.949  1.00 234.20 ? 193 TYR C CD2 1 
ATOM   7186 C  CE1 . TYR C 3 173 ? 25.805 178.478 54.871  1.00 229.08 ? 193 TYR C CE1 1 
ATOM   7187 C  CE2 . TYR C 3 173 ? 24.498 180.434 54.435  1.00 239.52 ? 193 TYR C CE2 1 
ATOM   7188 C  CZ  . TYR C 3 173 ? 25.659 179.849 54.894  1.00 248.26 ? 193 TYR C CZ  1 
ATOM   7189 O  OH  . TYR C 3 173 ? 26.678 180.638 55.378  1.00 261.55 ? 193 TYR C OH  1 
ATOM   7190 N  N   . SER C 3 174 ? 21.975 174.753 51.840  1.00 254.08 ? 194 SER C N   1 
ATOM   7191 C  CA  . SER C 3 174 ? 21.136 173.580 51.649  1.00 246.26 ? 194 SER C CA  1 
ATOM   7192 C  C   . SER C 3 174 ? 21.371 172.617 52.800  1.00 257.57 ? 194 SER C C   1 
ATOM   7193 O  O   . SER C 3 174 ? 22.502 172.471 53.273  1.00 265.67 ? 194 SER C O   1 
ATOM   7194 C  CB  . SER C 3 174 ? 21.429 172.888 50.311  1.00 241.70 ? 194 SER C CB  1 
ATOM   7195 O  OG  . SER C 3 174 ? 21.217 173.771 49.224  1.00 242.51 ? 194 SER C OG  1 
ATOM   7196 N  N   . MET C 3 175 ? 20.303 171.964 53.254  1.00 257.45 ? 195 MET C N   1 
ATOM   7197 C  CA  . MET C 3 175 ? 20.401 171.031 54.366  1.00 258.14 ? 195 MET C CA  1 
ATOM   7198 C  C   . MET C 3 175 ? 19.539 169.808 54.089  1.00 257.71 ? 195 MET C C   1 
ATOM   7199 O  O   . MET C 3 175 ? 18.600 169.847 53.289  1.00 261.72 ? 195 MET C O   1 
ATOM   7200 C  CB  . MET C 3 175 ? 19.979 171.675 55.691  1.00 243.46 ? 195 MET C CB  1 
ATOM   7201 C  CG  . MET C 3 175 ? 18.494 171.954 55.801  1.00 250.80 ? 195 MET C CG  1 
ATOM   7202 S  SD  . MET C 3 175 ? 17.982 172.189 57.510  1.00 303.60 ? 195 MET C SD  1 
ATOM   7203 C  CE  . MET C 3 175 ? 18.469 170.620 58.220  1.00 256.81 ? 195 MET C CE  1 
ATOM   7204 N  N   . SER C 3 176 ? 19.873 168.716 54.774  1.00 254.32 ? 196 SER C N   1 
ATOM   7205 C  CA  . SER C 3 176 ? 19.168 167.450 54.630  1.00 263.07 ? 196 SER C CA  1 
ATOM   7206 C  C   . SER C 3 176 ? 18.780 166.927 56.003  1.00 297.83 ? 196 SER C C   1 
ATOM   7207 O  O   . SER C 3 176 ? 19.614 166.882 56.914  1.00 310.58 ? 196 SER C O   1 
ATOM   7208 C  CB  . SER C 3 176 ? 20.028 166.415 53.899  1.00 261.98 ? 196 SER C CB  1 
ATOM   7209 O  OG  . SER C 3 176 ? 21.233 166.167 54.603  1.00 256.22 ? 196 SER C OG  1 
ATOM   7210 N  N   . SER C 3 177 ? 17.519 166.535 56.146  1.00 283.64 ? 197 SER C N   1 
ATOM   7211 C  CA  . SER C 3 177 ? 17.013 165.891 57.350  1.00 282.14 ? 197 SER C CA  1 
ATOM   7212 C  C   . SER C 3 177 ? 16.699 164.440 57.016  1.00 289.30 ? 197 SER C C   1 
ATOM   7213 O  O   . SER C 3 177 ? 15.892 164.166 56.121  1.00 294.88 ? 197 SER C O   1 
ATOM   7214 C  CB  . SER C 3 177 ? 15.771 166.608 57.877  1.00 287.07 ? 197 SER C CB  1 
ATOM   7215 O  OG  . SER C 3 177 ? 15.349 166.055 59.110  1.00 307.63 ? 197 SER C OG  1 
ATOM   7216 N  N   . THR C 3 178 ? 17.339 163.518 57.727  1.00 289.24 ? 198 THR C N   1 
ATOM   7217 C  CA  . THR C 3 178 ? 17.234 162.092 57.454  1.00 295.20 ? 198 THR C CA  1 
ATOM   7218 C  C   . THR C 3 178 ? 16.503 161.401 58.596  1.00 309.09 ? 198 THR C C   1 
ATOM   7219 O  O   . THR C 3 178 ? 16.812 161.640 59.770  1.00 304.26 ? 198 THR C O   1 
ATOM   7220 C  CB  . THR C 3 178 ? 18.620 161.469 57.265  1.00 289.56 ? 198 THR C CB  1 
ATOM   7221 O  OG1 . THR C 3 178 ? 19.314 162.152 56.214  1.00 297.23 ? 198 THR C OG1 1 
ATOM   7222 C  CG2 . THR C 3 178 ? 18.501 159.994 56.913  1.00 295.92 ? 198 THR C CG2 1 
ATOM   7223 N  N   . LEU C 3 179 ? 15.537 160.548 58.248  1.00 334.40 ? 199 LEU C N   1 
ATOM   7224 C  CA  . LEU C 3 179 ? 14.828 159.716 59.217  1.00 320.47 ? 199 LEU C CA  1 
ATOM   7225 C  C   . LEU C 3 179 ? 15.114 158.257 58.882  1.00 369.98 ? 199 LEU C C   1 
ATOM   7226 O  O   . LEU C 3 179 ? 14.681 157.760 57.838  1.00 327.08 ? 199 LEU C O   1 
ATOM   7227 C  CB  . LEU C 3 179 ? 13.328 160.005 59.199  1.00 326.90 ? 199 LEU C CB  1 
ATOM   7228 C  CG  . LEU C 3 179 ? 12.500 159.309 60.281  1.00 335.01 ? 199 LEU C CG  1 
ATOM   7229 C  CD1 . LEU C 3 179 ? 12.979 159.716 61.666  1.00 336.36 ? 199 LEU C CD1 1 
ATOM   7230 C  CD2 . LEU C 3 179 ? 11.021 159.615 60.111  1.00 341.13 ? 199 LEU C CD2 1 
ATOM   7231 N  N   . THR C 3 180 ? 15.837 157.574 59.765  1.00 493.93 ? 200 THR C N   1 
ATOM   7232 C  CA  . THR C 3 180 ? 16.254 156.194 59.553  1.00 525.33 ? 200 THR C CA  1 
ATOM   7233 C  C   . THR C 3 180 ? 15.477 155.275 60.486  1.00 553.31 ? 200 THR C C   1 
ATOM   7234 O  O   . THR C 3 180 ? 15.447 155.500 61.701  1.00 557.52 ? 200 THR C O   1 
ATOM   7235 C  CB  . THR C 3 180 ? 17.759 156.035 59.786  1.00 525.81 ? 200 THR C CB  1 
ATOM   7236 O  OG1 . THR C 3 180 ? 18.476 156.891 58.888  1.00 522.57 ? 200 THR C OG1 1 
ATOM   7237 C  CG2 . THR C 3 180 ? 18.187 154.594 59.555  1.00 530.89 ? 200 THR C CG2 1 
ATOM   7238 N  N   . LEU C 3 181 ? 14.856 154.241 59.918  1.00 571.93 ? 201 LEU C N   1 
ATOM   7239 C  CA  . LEU C 3 181 ? 14.003 153.335 60.673  1.00 594.51 ? 201 LEU C CA  1 
ATOM   7240 C  C   . LEU C 3 181 ? 14.140 151.911 60.146  1.00 623.65 ? 201 LEU C C   1 
ATOM   7241 O  O   . LEU C 3 181 ? 14.638 151.668 59.041  1.00 606.98 ? 201 LEU C O   1 
ATOM   7242 C  CB  . LEU C 3 181 ? 12.530 153.768 60.617  1.00 595.17 ? 201 LEU C CB  1 
ATOM   7243 C  CG  . LEU C 3 181 ? 12.152 155.080 61.309  1.00 594.56 ? 201 LEU C CG  1 
ATOM   7244 C  CD1 . LEU C 3 181 ? 10.696 155.426 61.043  1.00 598.64 ? 201 LEU C CD1 1 
ATOM   7245 C  CD2 . LEU C 3 181 ? 12.421 154.995 62.804  1.00 595.31 ? 201 LEU C CD2 1 
ATOM   7246 N  N   . THR C 3 182 ? 13.680 150.966 60.961  1.00 675.09 ? 202 THR C N   1 
ATOM   7247 C  CA  . THR C 3 182 ? 13.680 149.565 60.577  1.00 688.25 ? 202 THR C CA  1 
ATOM   7248 C  C   . THR C 3 182 ? 12.579 149.287 59.555  1.00 696.43 ? 202 THR C C   1 
ATOM   7249 O  O   . THR C 3 182 ? 11.613 150.042 59.416  1.00 697.34 ? 202 THR C O   1 
ATOM   7250 C  CB  . THR C 3 182 ? 13.491 148.670 61.802  1.00 691.74 ? 202 THR C CB  1 
ATOM   7251 O  OG1 . THR C 3 182 ? 12.219 148.944 62.404  1.00 695.60 ? 202 THR C OG1 1 
ATOM   7252 C  CG2 . THR C 3 182 ? 14.591 148.926 62.822  1.00 688.38 ? 202 THR C CG2 1 
ATOM   7253 N  N   . LYS C 3 183 ? 12.744 148.180 58.828  1.00 702.32 ? 203 LYS C N   1 
ATOM   7254 C  CA  . LYS C 3 183 ? 11.749 147.788 57.835  1.00 708.10 ? 203 LYS C CA  1 
ATOM   7255 C  C   . LYS C 3 183 ? 10.428 147.406 58.494  1.00 708.33 ? 203 LYS C C   1 
ATOM   7256 O  O   . LYS C 3 183 ? 9.351  147.752 57.989  1.00 718.49 ? 203 LYS C O   1 
ATOM   7257 C  CB  . LYS C 3 183 ? 12.287 146.631 56.992  1.00 711.52 ? 203 LYS C CB  1 
ATOM   7258 C  CG  . LYS C 3 183 ? 11.309 146.086 55.965  1.00 716.37 ? 203 LYS C CG  1 
ATOM   7259 C  CD  . LYS C 3 183 ? 11.941 144.967 55.152  1.00 716.76 ? 203 LYS C CD  1 
ATOM   7260 C  CE  . LYS C 3 183 ? 12.423 143.836 56.048  1.00 718.34 ? 203 LYS C CE  1 
ATOM   7261 N  NZ  . LYS C 3 183 ? 13.086 142.752 55.272  1.00 718.20 ? 203 LYS C NZ  1 
ATOM   7262 N  N   . ASP C 3 184 ? 10.492 146.698 59.626  1.00 693.53 ? 204 ASP C N   1 
ATOM   7263 C  CA  . ASP C 3 184 ? 9.276  146.283 60.318  1.00 685.10 ? 204 ASP C CA  1 
ATOM   7264 C  C   . ASP C 3 184 ? 8.448  147.486 60.753  1.00 680.77 ? 204 ASP C C   1 
ATOM   7265 O  O   . ASP C 3 184 ? 7.214  147.462 60.674  1.00 685.99 ? 204 ASP C O   1 
ATOM   7266 C  CB  . ASP C 3 184 ? 9.631  145.414 61.525  1.00 683.05 ? 204 ASP C CB  1 
ATOM   7267 C  CG  . ASP C 3 184 ? 10.434 144.186 61.143  1.00 682.07 ? 204 ASP C CG  1 
ATOM   7268 O  OD1 . ASP C 3 184 ? 10.232 143.666 60.025  1.00 683.43 ? 204 ASP C OD1 1 
ATOM   7269 O  OD2 . ASP C 3 184 ? 11.267 143.741 61.959  1.00 680.31 ? 204 ASP C OD2 1 
ATOM   7270 N  N   . GLU C 3 185 ? 9.109  148.549 61.216  1.00 673.50 ? 205 GLU C N   1 
ATOM   7271 C  CA  . GLU C 3 185 ? 8.392  149.761 61.591  1.00 673.21 ? 205 GLU C CA  1 
ATOM   7272 C  C   . GLU C 3 185 ? 7.970  150.569 60.371  1.00 674.43 ? 205 GLU C C   1 
ATOM   7273 O  O   . GLU C 3 185 ? 6.966  151.288 60.426  1.00 674.72 ? 205 GLU C O   1 
ATOM   7274 C  CB  . GLU C 3 185 ? 9.256  150.615 62.522  1.00 667.10 ? 205 GLU C CB  1 
ATOM   7275 C  CG  . GLU C 3 185 ? 8.526  151.794 63.147  1.00 667.22 ? 205 GLU C CG  1 
ATOM   7276 C  CD  . GLU C 3 185 ? 9.384  152.554 64.140  1.00 663.44 ? 205 GLU C CD  1 
ATOM   7277 O  OE1 . GLU C 3 185 ? 10.548 152.154 64.352  1.00 661.16 ? 205 GLU C OE1 1 
ATOM   7278 O  OE2 . GLU C 3 185 ? 8.893  153.551 64.710  1.00 662.91 ? 205 GLU C OE2 1 
ATOM   7279 N  N   . TYR C 3 186 ? 8.712  150.459 59.266  1.00 676.48 ? 206 TYR C N   1 
ATOM   7280 C  CA  . TYR C 3 186 ? 8.342  151.186 58.057  1.00 680.72 ? 206 TYR C CA  1 
ATOM   7281 C  C   . TYR C 3 186 ? 7.096  150.602 57.407  1.00 696.28 ? 206 TYR C C   1 
ATOM   7282 O  O   . TYR C 3 186 ? 6.298  151.345 56.825  1.00 690.75 ? 206 TYR C O   1 
ATOM   7283 C  CB  . TYR C 3 186 ? 9.503  151.189 57.064  1.00 673.94 ? 206 TYR C CB  1 
ATOM   7284 C  CG  . TYR C 3 186 ? 9.131  151.715 55.696  1.00 672.15 ? 206 TYR C CG  1 
ATOM   7285 C  CD1 . TYR C 3 186 ? 8.897  153.068 55.491  1.00 669.17 ? 206 TYR C CD1 1 
ATOM   7286 C  CD2 . TYR C 3 186 ? 9.015  150.858 54.609  1.00 673.87 ? 206 TYR C CD2 1 
ATOM   7287 C  CE1 . TYR C 3 186 ? 8.556  153.553 54.242  1.00 668.45 ? 206 TYR C CE1 1 
ATOM   7288 C  CE2 . TYR C 3 186 ? 8.676  151.334 53.356  1.00 673.38 ? 206 TYR C CE2 1 
ATOM   7289 C  CZ  . TYR C 3 186 ? 8.448  152.682 53.179  1.00 670.80 ? 206 TYR C CZ  1 
ATOM   7290 O  OH  . TYR C 3 186 ? 8.109  153.160 51.934  1.00 670.96 ? 206 TYR C OH  1 
ATOM   7291 N  N   . GLU C 3 187 ? 6.903  149.287 57.496  1.00 715.65 ? 207 GLU C N   1 
ATOM   7292 C  CA  . GLU C 3 187 ? 5.730  148.670 56.889  1.00 726.18 ? 207 GLU C CA  1 
ATOM   7293 C  C   . GLU C 3 187 ? 4.482  148.783 57.756  1.00 721.03 ? 207 GLU C C   1 
ATOM   7294 O  O   . GLU C 3 187 ? 3.411  148.340 57.328  1.00 733.51 ? 207 GLU C O   1 
ATOM   7295 C  CB  . GLU C 3 187 ? 6.013  147.198 56.573  1.00 733.04 ? 207 GLU C CB  1 
ATOM   7296 C  CG  . GLU C 3 187 ? 7.051  146.990 55.478  1.00 732.01 ? 207 GLU C CG  1 
ATOM   7297 C  CD  . GLU C 3 187 ? 7.169  145.540 55.049  1.00 735.94 ? 207 GLU C CD  1 
ATOM   7298 O  OE1 . GLU C 3 187 ? 6.479  144.685 55.641  1.00 740.63 ? 207 GLU C OE1 1 
ATOM   7299 O  OE2 . GLU C 3 187 ? 7.951  145.257 54.116  1.00 734.50 ? 207 GLU C OE2 1 
ATOM   7300 N  N   . ARG C 3 188 ? 4.591  149.353 58.955  1.00 682.97 ? 208 ARG C N   1 
ATOM   7301 C  CA  . ARG C 3 188 ? 3.447  149.578 59.827  1.00 658.93 ? 208 ARG C CA  1 
ATOM   7302 C  C   . ARG C 3 188 ? 2.882  150.990 59.722  1.00 640.84 ? 208 ARG C C   1 
ATOM   7303 O  O   . ARG C 3 188 ? 1.915  151.307 60.420  1.00 650.56 ? 208 ARG C O   1 
ATOM   7304 C  CB  . ARG C 3 188 ? 3.824  149.279 61.283  1.00 654.28 ? 208 ARG C CB  1 
ATOM   7305 C  CG  . ARG C 3 188 ? 4.041  147.803 61.572  1.00 657.55 ? 208 ARG C CG  1 
ATOM   7306 C  CD  . ARG C 3 188 ? 4.159  147.537 63.064  1.00 659.40 ? 208 ARG C CD  1 
ATOM   7307 N  NE  . ARG C 3 188 ? 5.406  148.049 63.624  1.00 654.40 ? 208 ARG C NE  1 
ATOM   7308 C  CZ  . ARG C 3 188 ? 6.508  147.321 63.777  1.00 653.15 ? 208 ARG C CZ  1 
ATOM   7309 N  NH1 . ARG C 3 188 ? 6.520  146.047 63.411  1.00 656.07 ? 208 ARG C NH1 1 
ATOM   7310 N  NH2 . ARG C 3 188 ? 7.599  147.867 64.298  1.00 649.29 ? 208 ARG C NH2 1 
ATOM   7311 N  N   . HIS C 3 189 ? 3.457  151.840 58.872  1.00 616.91 ? 209 HIS C N   1 
ATOM   7312 C  CA  . HIS C 3 189 ? 2.973  153.200 58.683  1.00 605.13 ? 209 HIS C CA  1 
ATOM   7313 C  C   . HIS C 3 189 ? 2.927  153.507 57.193  1.00 572.76 ? 209 HIS C C   1 
ATOM   7314 O  O   . HIS C 3 189 ? 3.638  152.894 56.394  1.00 574.58 ? 209 HIS C O   1 
ATOM   7315 C  CB  . HIS C 3 189 ? 3.853  154.218 59.421  1.00 628.68 ? 209 HIS C CB  1 
ATOM   7316 C  CG  . HIS C 3 189 ? 3.939  153.979 60.896  1.00 658.66 ? 209 HIS C CG  1 
ATOM   7317 N  ND1 . HIS C 3 189 ? 2.989  154.443 61.781  1.00 672.90 ? 209 HIS C ND1 1 
ATOM   7318 C  CD2 . HIS C 3 189 ? 4.857  153.320 61.642  1.00 670.52 ? 209 HIS C CD2 1 
ATOM   7319 C  CE1 . HIS C 3 189 ? 3.320  154.083 63.008  1.00 680.09 ? 209 HIS C CE1 1 
ATOM   7320 N  NE2 . HIS C 3 189 ? 4.450  153.401 62.951  1.00 678.11 ? 209 HIS C NE2 1 
ATOM   7321 N  N   . ASN C 3 190 ? 2.080  154.470 56.821  1.00 540.94 ? 210 ASN C N   1 
ATOM   7322 C  CA  . ASN C 3 190 ? 1.801  154.756 55.415  1.00 512.67 ? 210 ASN C CA  1 
ATOM   7323 C  C   . ASN C 3 190 ? 2.282  156.149 55.012  1.00 466.22 ? 210 ASN C C   1 
ATOM   7324 O  O   . ASN C 3 190 ? 3.310  156.273 54.346  1.00 474.27 ? 210 ASN C O   1 
ATOM   7325 C  CB  . ASN C 3 190 ? 0.304  154.582 55.133  1.00 533.25 ? 210 ASN C CB  1 
ATOM   7326 C  CG  . ASN C 3 190 ? -0.051 154.798 53.671  1.00 543.11 ? 210 ASN C CG  1 
ATOM   7327 O  OD1 . ASN C 3 190 ? 0.773  154.583 52.775  1.00 542.23 ? 210 ASN C OD1 1 
ATOM   7328 N  ND2 . ASN C 3 190 ? -1.281 155.217 53.424  1.00 550.34 ? 210 ASN C ND2 1 
ATOM   7329 N  N   . SER C 3 191 ? 1.583  157.208 55.411  1.00 378.66 ? 211 SER C N   1 
ATOM   7330 C  CA  . SER C 3 191 ? 1.867  158.550 54.910  1.00 364.90 ? 211 SER C CA  1 
ATOM   7331 C  C   . SER C 3 191 ? 2.851  159.260 55.831  1.00 370.20 ? 211 SER C C   1 
ATOM   7332 O  O   . SER C 3 191 ? 2.534  159.527 56.995  1.00 361.37 ? 211 SER C O   1 
ATOM   7333 C  CB  . SER C 3 191 ? 0.578  159.362 54.781  1.00 367.35 ? 211 SER C CB  1 
ATOM   7334 O  OG  . SER C 3 191 ? -0.068 159.518 56.031  1.00 369.70 ? 211 SER C OG  1 
ATOM   7335 N  N   . TYR C 3 192 ? 4.029  159.582 55.304  1.00 368.07 ? 212 TYR C N   1 
ATOM   7336 C  CA  . TYR C 3 192 ? 5.054  160.311 56.034  1.00 350.49 ? 212 TYR C CA  1 
ATOM   7337 C  C   . TYR C 3 192 ? 5.008  161.792 55.680  1.00 348.45 ? 212 TYR C C   1 
ATOM   7338 O  O   . TYR C 3 192 ? 4.721  162.170 54.539  1.00 346.38 ? 212 TYR C O   1 
ATOM   7339 C  CB  . TYR C 3 192 ? 6.449  159.755 55.736  1.00 347.25 ? 212 TYR C CB  1 
ATOM   7340 C  CG  . TYR C 3 192 ? 6.712  158.390 56.331  1.00 349.95 ? 212 TYR C CG  1 
ATOM   7341 C  CD1 . TYR C 3 192 ? 7.182  158.257 57.631  1.00 349.46 ? 212 TYR C CD1 1 
ATOM   7342 C  CD2 . TYR C 3 192 ? 6.504  157.236 55.589  1.00 353.00 ? 212 TYR C CD2 1 
ATOM   7343 C  CE1 . TYR C 3 192 ? 7.429  157.012 58.179  1.00 351.90 ? 212 TYR C CE1 1 
ATOM   7344 C  CE2 . TYR C 3 192 ? 6.748  155.987 56.127  1.00 355.40 ? 212 TYR C CE2 1 
ATOM   7345 C  CZ  . TYR C 3 192 ? 7.211  155.880 57.422  1.00 354.81 ? 212 TYR C CZ  1 
ATOM   7346 O  OH  . TYR C 3 192 ? 7.456  154.638 57.963  1.00 357.18 ? 212 TYR C OH  1 
ATOM   7347 N  N   . THR C 3 193 ? 5.291  162.629 56.677  1.00 345.53 ? 213 THR C N   1 
ATOM   7348 C  CA  . THR C 3 193 ? 5.247  164.077 56.518  1.00 340.88 ? 213 THR C CA  1 
ATOM   7349 C  C   . THR C 3 193 ? 6.485  164.693 57.152  1.00 340.63 ? 213 THR C C   1 
ATOM   7350 O  O   . THR C 3 193 ? 6.872  164.310 58.258  1.00 336.18 ? 213 THR C O   1 
ATOM   7351 C  CB  . THR C 3 193 ? 3.978  164.658 57.159  1.00 352.45 ? 213 THR C CB  1 
ATOM   7352 O  OG1 . THR C 3 193 ? 2.823  164.187 56.453  1.00 362.64 ? 213 THR C OG1 1 
ATOM   7353 C  CG2 . THR C 3 193 ? 4.000  166.179 57.126  1.00 344.89 ? 213 THR C CG2 1 
ATOM   7354 N  N   . CYS C 3 194 ? 7.109  165.639 56.454  1.00 384.53 ? 214 CYS C N   1 
ATOM   7355 C  CA  . CYS C 3 194 ? 8.178  166.444 57.024  1.00 386.36 ? 214 CYS C CA  1 
ATOM   7356 C  C   . CYS C 3 194 ? 7.921  167.907 56.698  1.00 366.51 ? 214 CYS C C   1 
ATOM   7357 O  O   . CYS C 3 194 ? 7.529  168.245 55.576  1.00 369.33 ? 214 CYS C O   1 
ATOM   7358 C  CB  . CYS C 3 194 ? 9.569  166.008 56.519  1.00 384.86 ? 214 CYS C CB  1 
ATOM   7359 S  SG  . CYS C 3 194 ? 9.923  166.257 54.760  1.00 381.89 ? 214 CYS C SG  1 
ATOM   7360 N  N   . GLU C 3 195 ? 8.120  168.768 57.694  1.00 340.91 ? 215 GLU C N   1 
ATOM   7361 C  CA  . GLU C 3 195 ? 7.864  170.193 57.558  1.00 317.83 ? 215 GLU C CA  1 
ATOM   7362 C  C   . GLU C 3 195 ? 9.085  170.980 58.012  1.00 312.43 ? 215 GLU C C   1 
ATOM   7363 O  O   . GLU C 3 195 ? 9.907  170.499 58.797  1.00 310.20 ? 215 GLU C O   1 
ATOM   7364 C  CB  . GLU C 3 195 ? 6.631  170.626 58.365  1.00 325.90 ? 215 GLU C CB  1 
ATOM   7365 C  CG  . GLU C 3 195 ? 6.720  170.330 59.853  1.00 327.86 ? 215 GLU C CG  1 
ATOM   7366 C  CD  . GLU C 3 195 ? 5.535  170.879 60.623  1.00 325.28 ? 215 GLU C CD  1 
ATOM   7367 O  OE1 . GLU C 3 195 ? 5.658  171.074 61.850  1.00 326.75 ? 215 GLU C OE1 1 
ATOM   7368 O  OE2 . GLU C 3 195 ? 4.481  171.122 59.999  1.00 327.55 ? 215 GLU C OE2 1 
ATOM   7369 N  N   . ALA C 3 196 ? 9.190  172.208 57.507  1.00 308.31 ? 216 ALA C N   1 
ATOM   7370 C  CA  . ALA C 3 196 ? 10.318 173.080 57.808  1.00 303.39 ? 216 ALA C CA  1 
ATOM   7371 C  C   . ALA C 3 196 ? 9.810  174.479 58.118  1.00 308.73 ? 216 ALA C C   1 
ATOM   7372 O  O   . ALA C 3 196 ? 8.994  175.026 57.371  1.00 309.85 ? 216 ALA C O   1 
ATOM   7373 C  CB  . ALA C 3 196 ? 11.310 173.123 56.642  1.00 296.51 ? 216 ALA C CB  1 
ATOM   7374 N  N   . THR C 3 197 ? 10.299 175.052 59.214  1.00 314.60 ? 217 THR C N   1 
ATOM   7375 C  CA  . THR C 3 197 ? 9.944  176.400 59.636  1.00 311.11 ? 217 THR C CA  1 
ATOM   7376 C  C   . THR C 3 197 ? 11.123 177.324 59.362  1.00 289.68 ? 217 THR C C   1 
ATOM   7377 O  O   . THR C 3 197 ? 12.205 177.141 59.930  1.00 274.17 ? 217 THR C O   1 
ATOM   7378 C  CB  . THR C 3 197 ? 9.573  176.432 61.119  1.00 294.50 ? 217 THR C CB  1 
ATOM   7379 O  OG1 . THR C 3 197 ? 8.525  175.488 61.373  1.00 304.55 ? 217 THR C OG1 1 
ATOM   7380 C  CG2 . THR C 3 197 ? 9.103  177.822 61.521  1.00 293.60 ? 217 THR C CG2 1 
ATOM   7381 N  N   . HIS C 3 198 ? 10.911 178.311 58.495  1.00 279.80 ? 218 HIS C N   1 
ATOM   7382 C  CA  . HIS C 3 198 ? 11.939 179.270 58.116  1.00 267.61 ? 218 HIS C CA  1 
ATOM   7383 C  C   . HIS C 3 198 ? 11.406 180.681 58.349  1.00 279.76 ? 218 HIS C C   1 
ATOM   7384 O  O   . HIS C 3 198 ? 10.258 180.874 58.758  1.00 297.90 ? 218 HIS C O   1 
ATOM   7385 C  CB  . HIS C 3 198 ? 12.366 179.065 56.656  1.00 264.53 ? 218 HIS C CB  1 
ATOM   7386 C  CG  . HIS C 3 198 ? 13.697 179.664 56.324  1.00 280.64 ? 218 HIS C CG  1 
ATOM   7387 N  ND1 . HIS C 3 198 ? 13.828 180.877 55.683  1.00 276.84 ? 218 HIS C ND1 1 
ATOM   7388 C  CD2 . HIS C 3 198 ? 14.956 179.216 56.543  1.00 262.05 ? 218 HIS C CD2 1 
ATOM   7389 C  CE1 . HIS C 3 198 ? 15.110 181.151 55.523  1.00 249.28 ? 218 HIS C CE1 1 
ATOM   7390 N  NE2 . HIS C 3 198 ? 15.816 180.159 56.035  1.00 238.93 ? 218 HIS C NE2 1 
ATOM   7391 N  N   . LYS C 3 199 ? 12.248 181.677 58.084  1.00 275.61 ? 219 LYS C N   1 
ATOM   7392 C  CA  . LYS C 3 199 ? 11.881 183.071 58.294  1.00 287.50 ? 219 LYS C CA  1 
ATOM   7393 C  C   . LYS C 3 199 ? 11.297 183.733 57.053  1.00 292.89 ? 219 LYS C C   1 
ATOM   7394 O  O   . LYS C 3 199 ? 10.872 184.890 57.131  1.00 294.66 ? 219 LYS C O   1 
ATOM   7395 C  CB  . LYS C 3 199 ? 13.094 183.874 58.775  1.00 268.21 ? 219 LYS C CB  1 
ATOM   7396 C  CG  . LYS C 3 199 ? 14.187 184.030 57.735  1.00 267.72 ? 219 LYS C CG  1 
ATOM   7397 C  CD  . LYS C 3 199 ? 15.300 184.930 58.244  1.00 258.77 ? 219 LYS C CD  1 
ATOM   7398 C  CE  . LYS C 3 199 ? 14.783 186.324 58.562  1.00 257.99 ? 219 LYS C CE  1 
ATOM   7399 N  NZ  . LYS C 3 199 ? 14.208 186.991 57.361  1.00 259.63 ? 219 LYS C NZ  1 
ATOM   7400 N  N   . THR C 3 200 ? 11.268 183.037 55.914  1.00 297.70 ? 220 THR C N   1 
ATOM   7401 C  CA  . THR C 3 200 ? 10.669 183.619 54.717  1.00 310.07 ? 220 THR C CA  1 
ATOM   7402 C  C   . THR C 3 200 ? 9.150  183.661 54.829  1.00 307.13 ? 220 THR C C   1 
ATOM   7403 O  O   . THR C 3 200 ? 8.512  184.601 54.341  1.00 308.23 ? 220 THR C O   1 
ATOM   7404 C  CB  . THR C 3 200 ? 11.091 182.835 53.475  1.00 309.91 ? 220 THR C CB  1 
ATOM   7405 O  OG1 . THR C 3 200 ? 10.677 181.469 53.604  1.00 322.74 ? 220 THR C OG1 1 
ATOM   7406 C  CG2 . THR C 3 200 ? 12.600 182.889 53.297  1.00 296.37 ? 220 THR C CG2 1 
ATOM   7407 N  N   . SER C 3 201 ? 8.556  182.655 55.465  1.00 282.24 ? 221 SER C N   1 
ATOM   7408 C  CA  . SER C 3 201 ? 7.117  182.601 55.665  1.00 291.65 ? 221 SER C CA  1 
ATOM   7409 C  C   . SER C 3 201 ? 6.827  181.997 57.030  1.00 299.74 ? 221 SER C C   1 
ATOM   7410 O  O   . SER C 3 201 ? 7.593  181.172 57.536  1.00 288.65 ? 221 SER C O   1 
ATOM   7411 C  CB  . SER C 3 201 ? 6.422  181.785 54.567  1.00 292.86 ? 221 SER C CB  1 
ATOM   7412 O  OG  . SER C 3 201 ? 5.021  181.742 54.773  1.00 297.97 ? 221 SER C OG  1 
ATOM   7413 N  N   . THR C 3 202 ? 5.710  182.420 57.626  1.00 302.05 ? 222 THR C N   1 
ATOM   7414 C  CA  . THR C 3 202 ? 5.353  181.928 58.952  1.00 298.93 ? 222 THR C CA  1 
ATOM   7415 C  C   . THR C 3 202 ? 4.825  180.500 58.902  1.00 301.36 ? 222 THR C C   1 
ATOM   7416 O  O   . THR C 3 202 ? 4.939  179.765 59.890  1.00 302.87 ? 222 THR C O   1 
ATOM   7417 C  CB  . THR C 3 202 ? 4.317  182.850 59.596  1.00 296.14 ? 222 THR C CB  1 
ATOM   7418 O  OG1 . THR C 3 202 ? 3.132  182.880 58.791  1.00 309.78 ? 222 THR C OG1 1 
ATOM   7419 C  CG2 . THR C 3 202 ? 4.871  184.262 59.725  1.00 290.41 ? 222 THR C CG2 1 
ATOM   7420 N  N   . SER C 3 203 ? 4.254  180.092 57.775  1.00 302.68 ? 223 SER C N   1 
ATOM   7421 C  CA  . SER C 3 203 ? 3.706  178.748 57.649  1.00 308.13 ? 223 SER C CA  1 
ATOM   7422 C  C   . SER C 3 203 ? 4.815  177.765 57.295  1.00 323.38 ? 223 SER C C   1 
ATOM   7423 O  O   . SER C 3 203 ? 5.481  177.943 56.268  1.00 316.18 ? 223 SER C O   1 
ATOM   7424 C  CB  . SER C 3 203 ? 2.616  178.714 56.586  1.00 318.08 ? 223 SER C CB  1 
ATOM   7425 O  OG  . SER C 3 203 ? 1.542  179.572 56.932  1.00 341.67 ? 223 SER C OG  1 
ATOM   7426 N  N   . PRO C 3 204 ? 5.053  176.735 58.107  1.00 336.78 ? 224 PRO C N   1 
ATOM   7427 C  CA  . PRO C 3 204 ? 6.090  175.755 57.764  1.00 343.10 ? 224 PRO C CA  1 
ATOM   7428 C  C   . PRO C 3 204 ? 5.718  174.968 56.517  1.00 343.65 ? 224 PRO C C   1 
ATOM   7429 O  O   . PRO C 3 204 ? 4.579  174.521 56.358  1.00 351.42 ? 224 PRO C O   1 
ATOM   7430 C  CB  . PRO C 3 204 ? 6.147  174.847 59.000  1.00 349.91 ? 224 PRO C CB  1 
ATOM   7431 C  CG  . PRO C 3 204 ? 5.507  175.642 60.098  1.00 343.01 ? 224 PRO C CG  1 
ATOM   7432 C  CD  . PRO C 3 204 ? 4.463  176.479 59.430  1.00 336.68 ? 224 PRO C CD  1 
ATOM   7433 N  N   . ILE C 3 205 ? 6.696  174.806 55.626  1.00 320.61 ? 225 ILE C N   1 
ATOM   7434 C  CA  . ILE C 3 205 ? 6.478  174.044 54.403  1.00 313.04 ? 225 ILE C CA  1 
ATOM   7435 C  C   . ILE C 3 205 ? 6.313  172.572 54.750  1.00 314.71 ? 225 ILE C C   1 
ATOM   7436 O  O   . ILE C 3 205 ? 7.143  171.984 55.456  1.00 314.07 ? 225 ILE C O   1 
ATOM   7437 C  CB  . ILE C 3 205 ? 7.634  174.267 53.418  1.00 312.00 ? 225 ILE C CB  1 
ATOM   7438 C  CG1 . ILE C 3 205 ? 7.747  175.753 53.073  1.00 302.37 ? 225 ILE C CG1 1 
ATOM   7439 C  CG2 . ILE C 3 205 ? 7.432  173.437 52.159  1.00 310.85 ? 225 ILE C CG2 1 
ATOM   7440 C  CD1 . ILE C 3 205 ? 8.847  176.074 52.094  1.00 295.50 ? 225 ILE C CD1 1 
ATOM   7441 N  N   . VAL C 3 206 ? 5.237  171.968 54.251  1.00 319.50 ? 226 VAL C N   1 
ATOM   7442 C  CA  . VAL C 3 206 ? 4.843  170.611 54.609  1.00 325.45 ? 226 VAL C CA  1 
ATOM   7443 C  C   . VAL C 3 206 ? 4.871  169.747 53.357  1.00 332.48 ? 226 VAL C C   1 
ATOM   7444 O  O   . VAL C 3 206 ? 4.264  170.100 52.339  1.00 346.26 ? 226 VAL C O   1 
ATOM   7445 C  CB  . VAL C 3 206 ? 3.445  170.587 55.256  1.00 329.49 ? 226 VAL C CB  1 
ATOM   7446 C  CG1 . VAL C 3 206 ? 2.955  169.159 55.415  1.00 338.13 ? 226 VAL C CG1 1 
ATOM   7447 C  CG2 . VAL C 3 206 ? 3.470  171.303 56.598  1.00 328.23 ? 226 VAL C CG2 1 
ATOM   7448 N  N   . LYS C 3 207 ? 5.574  168.618 53.434  1.00 326.86 ? 227 LYS C N   1 
ATOM   7449 C  CA  . LYS C 3 207 ? 5.595  167.632 52.363  1.00 330.50 ? 227 LYS C CA  1 
ATOM   7450 C  C   . LYS C 3 207 ? 5.193  166.276 52.924  1.00 341.81 ? 227 LYS C C   1 
ATOM   7451 O  O   . LYS C 3 207 ? 5.534  165.941 54.060  1.00 334.13 ? 227 LYS C O   1 
ATOM   7452 C  CB  . LYS C 3 207 ? 6.977  167.545 51.704  1.00 327.62 ? 227 LYS C CB  1 
ATOM   7453 C  CG  . LYS C 3 207 ? 7.299  168.717 50.791  1.00 320.19 ? 227 LYS C CG  1 
ATOM   7454 C  CD  . LYS C 3 207 ? 6.306  168.802 49.641  1.00 322.76 ? 227 LYS C CD  1 
ATOM   7455 C  CE  . LYS C 3 207 ? 6.627  169.962 48.712  1.00 318.44 ? 227 LYS C CE  1 
ATOM   7456 N  NZ  . LYS C 3 207 ? 6.570  171.272 49.417  1.00 315.29 ? 227 LYS C NZ  1 
ATOM   7457 N  N   . SER C 3 208 ? 4.462  165.501 52.126  1.00 363.82 ? 228 SER C N   1 
ATOM   7458 C  CA  . SER C 3 208 ? 3.960  164.212 52.579  1.00 386.34 ? 228 SER C CA  1 
ATOM   7459 C  C   . SER C 3 208 ? 3.903  163.249 51.403  1.00 403.55 ? 228 SER C C   1 
ATOM   7460 O  O   . SER C 3 208 ? 3.833  163.659 50.242  1.00 405.19 ? 228 SER C O   1 
ATOM   7461 C  CB  . SER C 3 208 ? 2.573  164.343 53.221  1.00 402.18 ? 228 SER C CB  1 
ATOM   7462 O  OG  . SER C 3 208 ? 2.578  165.304 54.261  1.00 404.97 ? 228 SER C OG  1 
ATOM   7463 N  N   . PHE C 3 209 ? 3.935  161.955 51.720  1.00 422.57 ? 229 PHE C N   1 
ATOM   7464 C  CA  . PHE C 3 209 ? 3.760  160.927 50.703  1.00 440.93 ? 229 PHE C CA  1 
ATOM   7465 C  C   . PHE C 3 209 ? 3.114  159.703 51.336  1.00 456.46 ? 229 PHE C C   1 
ATOM   7466 O  O   . PHE C 3 209 ? 3.095  159.548 52.560  1.00 467.43 ? 229 PHE C O   1 
ATOM   7467 C  CB  . PHE C 3 209 ? 5.089  160.553 50.028  1.00 439.11 ? 229 PHE C CB  1 
ATOM   7468 C  CG  . PHE C 3 209 ? 6.005  159.728 50.889  1.00 442.29 ? 229 PHE C CG  1 
ATOM   7469 C  CD1 . PHE C 3 209 ? 6.915  160.336 51.735  1.00 440.64 ? 229 PHE C CD1 1 
ATOM   7470 C  CD2 . PHE C 3 209 ? 5.969  158.342 50.839  1.00 448.57 ? 229 PHE C CD2 1 
ATOM   7471 C  CE1 . PHE C 3 209 ? 7.763  159.581 52.522  1.00 441.95 ? 229 PHE C CE1 1 
ATOM   7472 C  CE2 . PHE C 3 209 ? 6.810  157.583 51.628  1.00 449.39 ? 229 PHE C CE2 1 
ATOM   7473 C  CZ  . PHE C 3 209 ? 7.710  158.203 52.469  1.00 445.38 ? 229 PHE C CZ  1 
ATOM   7474 N  N   . ASN C 3 210 ? 2.582  158.834 50.482  1.00 461.99 ? 230 ASN C N   1 
ATOM   7475 C  CA  . ASN C 3 210 ? 1.945  157.595 50.907  1.00 485.90 ? 230 ASN C CA  1 
ATOM   7476 C  C   . ASN C 3 210 ? 2.869  156.417 50.628  1.00 534.14 ? 230 ASN C C   1 
ATOM   7477 O  O   . ASN C 3 210 ? 3.588  156.403 49.624  1.00 503.52 ? 230 ASN C O   1 
ATOM   7478 C  CB  . ASN C 3 210 ? 0.607  157.396 50.192  1.00 479.75 ? 230 ASN C CB  1 
ATOM   7479 C  CG  . ASN C 3 210 ? -0.348 158.553 50.410  1.00 478.42 ? 230 ASN C CG  1 
ATOM   7480 O  OD1 . ASN C 3 210 ? -0.310 159.219 51.444  1.00 472.47 ? 230 ASN C OD1 1 
ATOM   7481 N  ND2 . ASN C 3 210 ? -1.213 158.799 49.431  1.00 484.81 ? 230 ASN C ND2 1 
ATOM   7482 N  N   . ARG C 3 211 ? 2.845  155.424 51.521  1.00 625.60 ? 231 ARG C N   1 
ATOM   7483 C  CA  . ARG C 3 211 ? 3.754  154.291 51.397  1.00 642.53 ? 231 ARG C CA  1 
ATOM   7484 C  C   . ARG C 3 211 ? 3.312  153.285 50.344  1.00 643.25 ? 231 ARG C C   1 
ATOM   7485 O  O   . ARG C 3 211 ? 4.153  152.534 49.837  1.00 649.32 ? 231 ARG C O   1 
ATOM   7486 C  CB  . ARG C 3 211 ? 3.908  153.575 52.743  1.00 655.29 ? 231 ARG C CB  1 
ATOM   7487 C  CG  . ARG C 3 211 ? 4.995  152.506 52.753  1.00 661.78 ? 231 ARG C CG  1 
ATOM   7488 C  CD  . ARG C 3 211 ? 4.819  151.524 53.895  1.00 669.83 ? 231 ARG C CD  1 
ATOM   7489 N  NE  . ARG C 3 211 ? 3.485  150.931 53.908  1.00 678.65 ? 231 ARG C NE  1 
ATOM   7490 C  CZ  . ARG C 3 211 ? 3.155  149.817 53.262  1.00 684.18 ? 231 ARG C CZ  1 
ATOM   7491 N  NH1 . ARG C 3 211 ? 4.064  149.171 52.544  1.00 682.87 ? 231 ARG C NH1 1 
ATOM   7492 N  NH2 . ARG C 3 211 ? 1.916  149.350 53.332  1.00 690.83 ? 231 ARG C NH2 1 
ATOM   7493 N  N   . ASN C 3 212 ? 2.035  153.263 49.973  1.00 614.41 ? 232 ASN C N   1 
ATOM   7494 C  CA  . ASN C 3 212 ? 1.545  152.216 49.082  1.00 591.93 ? 232 ASN C CA  1 
ATOM   7495 C  C   . ASN C 3 212 ? 1.681  152.712 47.650  1.00 579.60 ? 232 ASN C C   1 
ATOM   7496 O  O   . ASN C 3 212 ? 0.885  153.530 47.182  1.00 583.73 ? 232 ASN C O   1 
ATOM   7497 C  CB  . ASN C 3 212 ? 0.100  151.860 49.415  1.00 589.59 ? 232 ASN C CB  1 
ATOM   7498 N  N   . GLU C 3 213 ? 2.687  152.180 46.956  1.00 567.09 ? 233 GLU C N   1 
ATOM   7499 C  CA  . GLU C 3 213 ? 2.934  152.407 45.532  1.00 563.13 ? 233 GLU C CA  1 
ATOM   7500 C  C   . GLU C 3 213 ? 2.728  153.869 45.139  1.00 574.52 ? 233 GLU C C   1 
ATOM   7501 O  O   . GLU C 3 213 ? 2.105  154.183 44.123  1.00 559.20 ? 233 GLU C O   1 
ATOM   7502 C  CB  . GLU C 3 213 ? 2.081  151.475 44.677  1.00 561.70 ? 233 GLU C CB  1 
ATOM   7503 C  CG  . GLU C 3 213 ? 2.903  150.711 43.649  1.00 561.21 ? 233 GLU C CG  1 
ATOM   7504 C  CD  . GLU C 3 213 ? 4.182  150.133 44.238  1.00 558.98 ? 233 GLU C CD  1 
ATOM   7505 O  OE1 . GLU C 3 213 ? 4.110  149.459 45.288  1.00 561.39 ? 233 GLU C OE1 1 
ATOM   7506 O  OE2 . GLU C 3 213 ? 5.263  150.363 43.655  1.00 554.29 ? 233 GLU C OE2 1 
ATOM   7507 N  N   . CYS C 3 214 ? 3.288  154.764 45.956  1.00 608.67 ? 234 CYS C N   1 
ATOM   7508 C  CA  . CYS C 3 214 ? 3.194  156.221 45.785  1.00 611.89 ? 234 CYS C CA  1 
ATOM   7509 C  C   . CYS C 3 214 ? 1.874  156.704 45.181  1.00 616.55 ? 234 CYS C C   1 
ATOM   7510 O  O   . CYS C 3 214 ? 1.423  157.817 45.454  1.00 614.83 ? 234 CYS C O   1 
ATOM   7511 C  CB  . CYS C 3 214 ? 4.365  156.736 44.935  1.00 607.84 ? 234 CYS C CB  1 
ATOM   7512 S  SG  . CYS C 3 214 ? 4.929  155.648 43.596  1.00 449.12 ? 234 CYS C SG  1 
HETATM 7513 C  C05 . 69D D 4 .   ? 32.044 185.421 1.881   1.00 119.14 ? 700 69D A C05 1 
HETATM 7514 C  C07 . 69D D 4 .   ? 32.613 184.241 1.718   1.00 124.53 ? 700 69D A C07 1 
HETATM 7515 C  C08 . 69D D 4 .   ? 32.469 183.373 0.692   1.00 138.91 ? 700 69D A C08 1 
HETATM 7516 C  C10 . 69D D 4 .   ? 30.997 185.498 3.047   1.00 149.68 ? 700 69D A C10 1 
HETATM 7517 C  C11 . 69D D 4 .   ? 31.426 184.171 -0.200  1.00 181.31 ? 700 69D A C11 1 
HETATM 7518 C  C13 . 69D D 4 .   ? 33.503 183.729 2.607   1.00 160.38 ? 700 69D A C13 1 
HETATM 7519 C  C14 . 69D D 4 .   ? 33.306 182.024 0.755   1.00 170.98 ? 700 69D A C14 1 
HETATM 7520 C  C15 . 69D D 4 .   ? 31.169 186.461 4.029   1.00 165.05 ? 700 69D A C15 1 
HETATM 7521 C  C16 . 69D D 4 .   ? 29.900 184.651 3.097   1.00 155.38 ? 700 69D A C16 1 
HETATM 7522 C  C17 . 69D D 4 .   ? 34.093 182.705 2.593   1.00 169.37 ? 700 69D A C17 1 
HETATM 7523 C  C18 . 69D D 4 .   ? 34.091 181.861 1.825   1.00 160.34 ? 700 69D A C18 1 
HETATM 7524 C  C19 . 69D D 4 .   ? 30.263 186.571 5.069   1.00 196.27 ? 700 69D A C19 1 
HETATM 7525 C  C20 . 69D D 4 .   ? 28.991 184.761 4.140   1.00 160.00 ? 700 69D A C20 1 
HETATM 7526 C  C21 . 69D D 4 .   ? 29.172 185.721 5.126   1.00 185.96 ? 700 69D A C21 1 
HETATM 7527 C  C24 . 69D D 4 .   ? 34.943 180.605 2.004   1.00 138.30 ? 700 69D A C24 1 
HETATM 7528 BR BR  . 69D D 4 .   ? 27.909 185.889 6.590   1.00 275.45 ? 700 69D A BR  1 
HETATM 7529 O  O02 . 69D D 4 .   ? 31.337 185.674 0.571   1.00 155.49 ? 700 69D A O02 1 
HETATM 7530 N  N03 . 69D D 4 .   ? 35.325 187.724 -0.360  1.00 151.80 ? 700 69D A N03 1 
HETATM 7531 N  N04 . 69D D 4 .   ? 35.574 179.673 2.135   1.00 138.43 ? 700 69D A N04 1 
HETATM 7532 C  C06 . 69D D 4 .   ? 33.107 186.494 2.106   1.00 127.70 ? 700 69D A C06 1 
HETATM 7533 C  C09 . 69D D 4 .   ? 33.267 187.272 0.806   1.00 146.10 ? 700 69D A C09 1 
HETATM 7534 C  C12 . 69D D 4 .   ? 34.554 188.090 0.813   1.00 163.18 ? 700 69D A C12 1 
HETATM 7535 C  C22 . 69D D 4 .   ? 36.519 188.546 -0.429  1.00 142.30 ? 700 69D A C22 1 
HETATM 7536 C  C23 . 69D D 4 .   ? 35.720 186.336 -0.222  1.00 149.95 ? 700 69D A C23 1 
HETATM 7537 C  C1  . NAG E 5 .   ? 56.019 179.073 31.661  1.00 106.38 ? 701 NAG A C1  1 
HETATM 7538 C  C2  . NAG E 5 .   ? 55.235 178.683 32.913  1.00 109.73 ? 701 NAG A C2  1 
HETATM 7539 C  C3  . NAG E 5 .   ? 55.537 177.236 33.296  1.00 121.99 ? 701 NAG A C3  1 
HETATM 7540 C  C4  . NAG E 5 .   ? 55.280 176.310 32.115  1.00 126.39 ? 701 NAG A C4  1 
HETATM 7541 C  C5  . NAG E 5 .   ? 56.061 176.787 30.894  1.00 129.44 ? 701 NAG A C5  1 
HETATM 7542 C  C6  . NAG E 5 .   ? 55.754 175.987 29.648  1.00 100.78 ? 701 NAG A C6  1 
HETATM 7543 C  C7  . NAG E 5 .   ? 54.626 179.927 34.939  1.00 195.18 ? 701 NAG A C7  1 
HETATM 7544 C  C8  . NAG E 5 .   ? 55.105 180.850 36.018  1.00 205.61 ? 701 NAG A C8  1 
HETATM 7545 N  N2  . NAG E 5 .   ? 55.534 179.576 34.021  1.00 141.70 ? 701 NAG A N2  1 
HETATM 7546 O  O3  . NAG E 5 .   ? 54.722 176.855 34.398  1.00 145.05 ? 701 NAG A O3  1 
HETATM 7547 O  O4  . NAG E 5 .   ? 55.680 174.983 32.438  1.00 103.78 ? 701 NAG A O4  1 
HETATM 7548 O  O5  . NAG E 5 .   ? 55.726 178.152 30.602  1.00 122.92 ? 701 NAG A O5  1 
HETATM 7549 O  O6  . NAG E 5 .   ? 55.591 176.828 28.514  1.00 99.00  ? 701 NAG A O6  1 
HETATM 7550 O  O7  . NAG E 5 .   ? 53.470 179.517 34.899  1.00 206.41 ? 701 NAG A O7  1 
HETATM 7551 C  C1  . CLR F 6 .   ? 37.505 160.056 16.698  1.00 216.93 ? 702 CLR A C1  1 
HETATM 7552 C  C2  . CLR F 6 .   ? 37.977 159.701 18.100  1.00 211.07 ? 702 CLR A C2  1 
HETATM 7553 C  C3  . CLR F 6 .   ? 38.296 160.988 18.843  1.00 213.80 ? 702 CLR A C3  1 
HETATM 7554 C  C4  . CLR F 6 .   ? 37.060 161.869 18.936  1.00 215.20 ? 702 CLR A C4  1 
HETATM 7555 C  C5  . CLR F 6 .   ? 36.360 161.997 17.608  1.00 208.01 ? 702 CLR A C5  1 
HETATM 7556 C  C6  . CLR F 6 .   ? 35.887 163.188 17.234  1.00 216.08 ? 702 CLR A C6  1 
HETATM 7557 C  C7  . CLR F 6 .   ? 35.465 163.474 15.816  1.00 218.77 ? 702 CLR A C7  1 
HETATM 7558 C  C8  . CLR F 6 .   ? 34.735 162.265 15.285  1.00 222.57 ? 702 CLR A C8  1 
HETATM 7559 C  C9  . CLR F 6 .   ? 35.679 161.077 15.320  1.00 215.85 ? 702 CLR A C9  1 
HETATM 7560 C  C10 . CLR F 6 .   ? 36.172 160.774 16.745  1.00 217.97 ? 702 CLR A C10 1 
HETATM 7561 C  C11 . CLR F 6 .   ? 35.046 159.858 14.633  1.00 223.30 ? 702 CLR A C11 1 
HETATM 7562 C  C12 . CLR F 6 .   ? 34.385 160.166 13.282  1.00 229.18 ? 702 CLR A C12 1 
HETATM 7563 C  C13 . CLR F 6 .   ? 33.400 161.303 13.430  1.00 230.90 ? 702 CLR A C13 1 
HETATM 7564 C  C14 . CLR F 6 .   ? 34.223 162.483 13.881  1.00 227.09 ? 702 CLR A C14 1 
HETATM 7565 C  C15 . CLR F 6 .   ? 33.340 163.693 13.675  1.00 222.22 ? 702 CLR A C15 1 
HETATM 7566 C  C16 . CLR F 6 .   ? 32.529 163.335 12.439  1.00 218.03 ? 702 CLR A C16 1 
HETATM 7567 C  C17 . CLR F 6 .   ? 32.712 161.846 12.181  1.00 213.73 ? 702 CLR A C17 1 
HETATM 7568 C  C18 . CLR F 6 .   ? 32.371 160.895 14.476  1.00 239.35 ? 702 CLR A C18 1 
HETATM 7569 C  C19 . CLR F 6 .   ? 35.195 159.881 17.482  1.00 224.80 ? 702 CLR A C19 1 
HETATM 7570 C  C20 . CLR F 6 .   ? 31.363 161.231 11.830  1.00 199.01 ? 702 CLR A C20 1 
HETATM 7571 C  C21 . CLR F 6 .   ? 31.522 159.776 11.428  1.00 198.72 ? 702 CLR A C21 1 
HETATM 7572 C  C22 . CLR F 6 .   ? 30.647 162.023 10.744  1.00 189.15 ? 702 CLR A C22 1 
HETATM 7573 C  C23 . CLR F 6 .   ? 29.500 162.833 11.344  1.00 206.22 ? 702 CLR A C23 1 
HETATM 7574 C  C24 . CLR F 6 .   ? 29.284 164.160 10.619  1.00 214.65 ? 702 CLR A C24 1 
HETATM 7575 C  C25 . CLR F 6 .   ? 27.829 164.620 10.672  1.00 188.77 ? 702 CLR A C25 1 
HETATM 7576 C  C26 . CLR F 6 .   ? 27.734 166.140 10.633  1.00 177.14 ? 702 CLR A C26 1 
HETATM 7577 C  C27 . CLR F 6 .   ? 27.014 164.008 9.543   1.00 166.65 ? 702 CLR A C27 1 
HETATM 7578 O  O1  . CLR F 6 .   ? 38.733 160.669 20.165  1.00 211.64 ? 702 CLR A O1  1 
HETATM 7579 C  C1  . D12 G 7 .   ? 45.029 179.978 -0.026  1.00 111.91 ? 703 D12 A C1  1 
HETATM 7580 C  C2  . D12 G 7 .   ? 43.594 179.497 -0.074  1.00 134.95 ? 703 D12 A C2  1 
HETATM 7581 C  C3  . D12 G 7 .   ? 42.633 180.486 0.549   1.00 120.91 ? 703 D12 A C3  1 
HETATM 7582 C  C4  . D12 G 7 .   ? 41.241 179.914 0.717   1.00 100.99 ? 703 D12 A C4  1 
HETATM 7583 C  C5  . D12 G 7 .   ? 41.214 178.713 1.637   1.00 105.34 ? 703 D12 A C5  1 
HETATM 7584 C  C6  . D12 G 7 .   ? 40.000 177.839 1.407   1.00 104.00 ? 703 D12 A C6  1 
HETATM 7585 C  C7  . D12 G 7 .   ? 40.254 176.388 1.759   1.00 126.98 ? 703 D12 A C7  1 
HETATM 7586 C  C8  . D12 G 7 .   ? 40.280 175.484 0.544   1.00 110.26 ? 703 D12 A C8  1 
HETATM 7587 C  C9  . D12 G 7 .   ? 41.513 175.693 -0.310  1.00 109.32 ? 703 D12 A C9  1 
HETATM 7588 C  C10 . D12 G 7 .   ? 41.651 174.650 -1.398  1.00 118.33 ? 703 D12 A C10 1 
HETATM 7589 C  C11 . D12 G 7 .   ? 42.870 174.873 -2.269  1.00 124.38 ? 703 D12 A C11 1 
HETATM 7590 C  C12 . D12 G 7 .   ? 44.150 174.987 -1.469  1.00 123.43 ? 703 D12 A C12 1 
HETATM 7591 C  C1  . HEX H 8 .   ? 32.448 161.846 5.551   1.00 111.43 ? 704 HEX A C1  1 
HETATM 7592 C  C2  . HEX H 8 .   ? 33.141 161.100 4.431   1.00 77.31  ? 704 HEX A C2  1 
HETATM 7593 C  C3  . HEX H 8 .   ? 33.603 162.083 3.377   1.00 122.33 ? 704 HEX A C3  1 
HETATM 7594 C  C4  . HEX H 8 .   ? 34.035 161.333 2.135   1.00 136.98 ? 704 HEX A C4  1 
HETATM 7595 C  C5  . HEX H 8 .   ? 34.433 162.319 1.057   1.00 97.88  ? 704 HEX A C5  1 
HETATM 7596 C  C6  . HEX H 8 .   ? 34.670 161.579 -0.242  1.00 106.88 ? 704 HEX A C6  1 
HETATM 7597 C  C1  . NAG I 5 .   ? 71.894 188.189 30.485  1.00 343.15 ? 705 NAG A C1  1 
HETATM 7598 C  C2  . NAG I 5 .   ? 72.023 188.391 31.995  1.00 346.84 ? 705 NAG A C2  1 
HETATM 7599 C  C3  . NAG I 5 .   ? 72.057 187.040 32.705  1.00 347.30 ? 705 NAG A C3  1 
HETATM 7600 C  C4  . NAG I 5 .   ? 70.859 186.192 32.296  1.00 347.21 ? 705 NAG A C4  1 
HETATM 7601 C  C5  . NAG I 5 .   ? 70.771 186.093 30.775  1.00 347.39 ? 705 NAG A C5  1 
HETATM 7602 C  C6  . NAG I 5 .   ? 69.532 185.370 30.300  1.00 346.38 ? 705 NAG A C6  1 
HETATM 7603 C  C7  . NAG I 5 .   ? 73.293 189.950 33.402  1.00 344.80 ? 705 NAG A C7  1 
HETATM 7604 C  C8  . NAG I 5 .   ? 74.587 190.683 33.582  1.00 350.38 ? 705 NAG A C8  1 
HETATM 7605 N  N2  . NAG I 5 .   ? 73.206 189.170 32.320  1.00 345.39 ? 705 NAG A N2  1 
HETATM 7606 O  O3  . NAG I 5 .   ? 72.048 187.244 34.113  1.00 347.50 ? 705 NAG A O3  1 
HETATM 7607 O  O4  . NAG I 5 .   ? 70.982 184.884 32.844  1.00 344.84 ? 705 NAG A O4  1 
HETATM 7608 O  O5  . NAG I 5 .   ? 70.730 187.408 30.201  1.00 348.62 ? 705 NAG A O5  1 
HETATM 7609 O  O6  . NAG I 5 .   ? 69.575 183.989 30.634  1.00 343.54 ? 705 NAG A O6  1 
HETATM 7610 O  O7  . NAG I 5 .   ? 72.368 190.057 34.202  1.00 341.80 ? 705 NAG A O7  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 3.3383 4.6939  4.0994  0.8416  -0.5729 -0.2096 74  GLY A N   
2    C CA  . GLY A 1   ? 3.2524 4.6460  4.0070  0.8197  -0.5378 -0.2088 74  GLY A CA  
3    C C   . GLY A 1   ? 3.2119 4.6174  3.9612  0.8501  -0.5193 -0.2387 74  GLY A C   
4    O O   . GLY A 1   ? 3.4861 4.8558  4.2315  0.8893  -0.5363 -0.2619 74  GLY A O   
5    N N   . SER A 2   ? 2.6597 4.1156  3.4077  0.8313  -0.4855 -0.2382 75  SER A N   
6    C CA  . SER A 2   ? 2.4382 3.9115  3.1785  0.8570  -0.4663 -0.2658 75  SER A CA  
7    C C   . SER A 2   ? 2.6950 4.0612  3.3966  0.8709  -0.4811 -0.2748 75  SER A C   
8    O O   . SER A 2   ? 2.4472 3.7819  3.1391  0.9088  -0.4918 -0.3026 75  SER A O   
9    C CB  . SER A 2   ? 2.2315 3.7906  2.9806  0.8291  -0.4270 -0.2587 75  SER A CB  
10   N N   . GLN A 3   ? 3.3414 4.6509  4.0200  0.8403  -0.4832 -0.2520 76  GLN A N   
11   C CA  . GLN A 3   ? 3.5636 4.7708  4.2051  0.8474  -0.4980 -0.2557 76  GLN A CA  
12   C C   . GLN A 3   ? 3.7301 4.8589  4.3537  0.8241  -0.5247 -0.2282 76  GLN A C   
13   O O   . GLN A 3   ? 3.5805 4.7262  4.2036  0.7879  -0.5145 -0.2038 76  GLN A O   
14   C CB  . GLN A 3   ? 3.4516 4.6731  4.0783  0.8330  -0.4688 -0.2567 76  GLN A CB  
15   N N   . GLY A 4   ? 4.0246 5.0687  4.6321  0.8440  -0.5596 -0.2322 77  GLY A N   
16   C CA  . GLY A 4   ? 4.0647 5.0360  4.6539  0.8231  -0.5883 -0.2057 77  GLY A CA  
17   C C   . GLY A 4   ? 3.9581 4.8537  4.5106  0.7994  -0.5918 -0.1892 77  GLY A C   
18   O O   . GLY A 4   ? 4.0545 4.9342  4.5940  0.7614  -0.5899 -0.1620 77  GLY A O   
19   N N   . GLU A 5   ? 3.0019 3.8453  3.5328  0.8155  -0.5930 -0.2045 78  GLU A N   
20   C CA  . GLU A 5   ? 2.3003 3.0571  2.7937  0.7949  -0.6031 -0.1881 78  GLU A CA  
21   C C   . GLU A 5   ? 2.4426 3.1870  2.9222  0.8067  -0.5867 -0.2068 78  GLU A C   
22   O O   . GLU A 5   ? 2.3446 3.1322  2.8390  0.8368  -0.5755 -0.2353 78  GLU A O   
23   C CB  . GLU A 5   ? 2.3140 2.9727  2.7853  0.8002  -0.6468 -0.1781 78  GLU A CB  
24   C CG  . GLU A 5   ? 2.2945 2.9244  2.7698  0.8403  -0.6673 -0.2047 78  GLU A CG  
25   C CD  . GLU A 5   ? 2.4241 2.9604  2.8794  0.8411  -0.7110 -0.1911 78  GLU A CD  
26   O OE1 . GLU A 5   ? 2.6747 3.1676  3.1100  0.8089  -0.7245 -0.1601 78  GLU A OE1 
27   O OE2 . GLU A 5   ? 2.3665 2.8736  2.8248  0.8734  -0.7324 -0.2115 78  GLU A OE2 
28   N N   . ARG A 6   ? 2.7847 3.4615  3.2279  0.7714  -0.5777 -0.1881 79  ARG A N   
29   C CA  . ARG A 6   ? 2.5497 3.2049  2.9747  0.7750  -0.5631 -0.2006 79  ARG A CA  
30   C C   . ARG A 6   ? 2.7308 3.2917  3.1325  0.7984  -0.6020 -0.2098 79  ARG A C   
31   O O   . ARG A 6   ? 2.5695 3.0837  2.9706  0.8139  -0.6407 -0.2070 79  ARG A O   
32   C CB  . ARG A 6   ? 2.1654 2.8075  2.5671  0.7228  -0.5299 -0.1747 79  ARG A CB  
33   N N   . GLU A 7   ? 3.0808 3.6115  3.4623  0.7995  -0.5933 -0.2197 80  GLU A N   
34   C CA  . GLU A 7   ? 3.1886 3.6316  3.5473  0.8213  -0.6294 -0.2310 80  GLU A CA  
35   C C   . GLU A 7   ? 3.0508 3.4028  3.3732  0.7779  -0.6410 -0.1972 80  GLU A C   
36   O O   . GLU A 7   ? 3.0027 3.3607  3.3177  0.7346  -0.6217 -0.1674 80  GLU A O   
37   C CB  . GLU A 7   ? 3.1148 3.5736  3.4697  0.8456  -0.6163 -0.2607 80  GLU A CB  
38   C CG  . GLU A 7   ? 3.3119 3.8475  3.6935  0.8863  -0.6050 -0.2969 80  GLU A CG  
39   C CD  . GLU A 7   ? 3.4775 3.9757  3.8623  0.9152  -0.6374 -0.3134 80  GLU A CD  
40   O OE1 . GLU A 7   ? 3.2568 3.8220  3.6694  0.9308  -0.6290 -0.3240 80  GLU A OE1 
41   O OE2 . GLU A 7   ? 3.6886 4.0904  4.0483  0.9212  -0.6724 -0.3147 80  GLU A OE2 
42   N N   . THR A 8   ? 2.6536 2.9215  2.9525  0.7897  -0.6739 -0.2025 81  THR A N   
43   C CA  . THR A 8   ? 2.7939 2.9757  3.0583  0.7502  -0.6889 -0.1709 81  THR A CA  
44   C C   . THR A 8   ? 2.8815 3.0016  3.1227  0.7595  -0.7038 -0.1838 81  THR A C   
45   O O   . THR A 8   ? 2.7423 2.8886  2.9925  0.7949  -0.6993 -0.2174 81  THR A O   
46   C CB  . THR A 8   ? 2.8551 2.9817  3.1140  0.7481  -0.7309 -0.1520 81  THR A CB  
47   O OG1 . THR A 8   ? 3.1416 3.1909  3.3657  0.7065  -0.7438 -0.1193 81  THR A OG1 
48   C CG2 . THR A 8   ? 2.7129 2.8030  2.9793  0.7968  -0.7727 -0.1795 81  THR A CG2 
49   N N   . TRP A 9   ? 2.8740 2.9142  3.0844  0.7264  -0.7222 -0.1565 82  TRP A N   
50   C CA  . TRP A 9   ? 2.4766 2.4527  2.6624  0.7267  -0.7381 -0.1629 82  TRP A CA  
51   C C   . TRP A 9   ? 2.4029 2.3091  2.5839  0.7665  -0.7928 -0.1829 82  TRP A C   
52   O O   . TRP A 9   ? 2.5274 2.4054  2.7134  0.7765  -0.8255 -0.1755 82  TRP A O   
53   C CB  . TRP A 9   ? 2.3057 2.2301  2.4620  0.6726  -0.7355 -0.1237 82  TRP A CB  
54   N N   . GLY A 10  ? 2.2244 2.1013  2.3947  0.7891  -0.8034 -0.2091 83  GLY A N   
55   C CA  . GLY A 10  ? 2.3627 2.1639  2.5215  0.8176  -0.8490 -0.2296 83  GLY A CA  
56   C C   . GLY A 10  ? 2.6320 2.3285  2.7599  0.7843  -0.8893 -0.1968 83  GLY A C   
57   O O   . GLY A 10  ? 3.0443 2.6785  3.1642  0.7912  -0.9258 -0.1980 83  GLY A O   
58   N N   . LYS A 11  ? 2.2756 1.9541  2.3849  0.7431  -0.8799 -0.1661 84  LYS A N   
59   C CA  . LYS A 11  ? 2.4357 2.0253  2.5156  0.7042  -0.9142 -0.1294 84  LYS A CA  
60   C C   . LYS A 11  ? 2.5527 2.1707  2.6216  0.6461  -0.8748 -0.0912 84  LYS A C   
61   O O   . LYS A 11  ? 2.7367 2.4211  2.8143  0.6382  -0.8271 -0.0982 84  LYS A O   
62   C CB  . LYS A 11  ? 2.3364 1.8429  2.3928  0.7137  -0.9507 -0.1439 84  LYS A CB  
63   C CG  . LYS A 11  ? 2.2868 1.7001  2.3124  0.6700  -0.9886 -0.1045 84  LYS A CG  
64   C CD  . LYS A 11  ? 2.4817 1.8060  2.4865  0.6831  -1.0307 -0.1248 84  LYS A CD  
65   C CE  . LYS A 11  ? 2.8313 2.1282  2.8438  0.7180  -1.0574 -0.1518 84  LYS A CE  
66   N NZ  . LYS A 11  ? 3.4432 2.6431  3.4324  0.7270  -1.1046 -0.1693 84  LYS A NZ  
67   N N   . LYS A 12  ? 2.7231 2.2917  2.7727  0.6060  -0.8959 -0.0506 85  LYS A N   
68   C CA  . LYS A 12  ? 2.6214 2.2117  2.6581  0.5511  -0.8630 -0.0140 85  LYS A CA  
69   C C   . LYS A 12  ? 2.9714 2.5570  2.9957  0.5344  -0.8443 -0.0164 85  LYS A C   
70   O O   . LYS A 12  ? 3.2269 2.8692  3.2551  0.5101  -0.7980 -0.0076 85  LYS A O   
71   C CB  . LYS A 12  ? 2.6924 2.2225  2.7065  0.5132  -0.8967 0.0282  85  LYS A CB  
72   C CG  . LYS A 12  ? 2.6863 2.2319  2.6834  0.4564  -0.8685 0.0662  85  LYS A CG  
73   C CD  . LYS A 12  ? 2.7204 2.3414  2.7302  0.4410  -0.8266 0.0771  85  LYS A CD  
74   C CE  . LYS A 12  ? 2.6394 2.2697  2.6300  0.3862  -0.8049 0.1154  85  LYS A CE  
75   N NZ  . LYS A 12  ? 2.5430 2.2340  2.5408  0.3701  -0.7727 0.1275  85  LYS A NZ  
76   N N   . VAL A 13  ? 2.8000 2.3166  2.8093  0.5474  -0.8818 -0.0285 86  VAL A N   
77   C CA  . VAL A 13  ? 2.4369 1.9429  2.4323  0.5292  -0.8696 -0.0287 86  VAL A CA  
78   C C   . VAL A 13  ? 2.1460 1.7238  2.1593  0.5561  -0.8272 -0.0632 86  VAL A C   
79   O O   . VAL A 13  ? 2.3356 1.9356  2.3434  0.5348  -0.7989 -0.0585 86  VAL A O   
80   C CB  . VAL A 13  ? 2.7046 2.1133  2.6779  0.5365  -0.9254 -0.0339 86  VAL A CB  
81   C CG1 . VAL A 13  ? 2.5935 1.9846  2.5488  0.5048  -0.9173 -0.0226 86  VAL A CG1 
82   C CG2 . VAL A 13  ? 2.7888 2.1266  2.7472  0.5171  -0.9733 -0.0022 86  VAL A CG2 
83   N N   . ASP A 14  ? 2.8854 2.5046  2.9210  0.6018  -0.8219 -0.0968 87  ASP A N   
84   C CA  . ASP A 14  ? 3.0520 2.7435  3.1041  0.6276  -0.7833 -0.1292 87  ASP A CA  
85   C C   . ASP A 14  ? 2.8803 2.6488  2.9433  0.5959  -0.7279 -0.1101 87  ASP A C   
86   O O   . ASP A 14  ? 2.9229 2.7192  2.9828  0.5842  -0.6991 -0.1129 87  ASP A O   
87   C CB  . ASP A 14  ? 3.0133 2.7387  3.0886  0.6819  -0.7908 -0.1665 87  ASP A CB  
88   C CG  . ASP A 14  ? 3.1541 2.8089  3.2196  0.7224  -0.8423 -0.1960 87  ASP A CG  
89   O OD1 . ASP A 14  ? 3.4236 2.9892  3.4652  0.7042  -0.8833 -0.1780 87  ASP A OD1 
90   O OD2 . ASP A 14  ? 3.1982 2.8876  3.2797  0.7721  -0.8424 -0.2372 87  ASP A OD2 
91   N N   . PHE A 15  ? 2.5250 2.3267  2.6001  0.5821  -0.7139 -0.0910 88  PHE A N   
92   C CA  . PHE A 15  ? 2.5088 2.3757  2.5924  0.5513  -0.6648 -0.0728 88  PHE A CA  
93   C C   . PHE A 15  ? 2.4893 2.3258  2.5520  0.5019  -0.6593 -0.0363 88  PHE A C   
94   O O   . PHE A 15  ? 2.7311 2.6107  2.7966  0.4793  -0.6204 -0.0269 88  PHE A O   
95   C CB  . PHE A 15  ? 2.6608 2.5735  2.7631  0.5530  -0.6526 -0.0666 88  PHE A CB  
96   C CG  . PHE A 15  ? 2.7167 2.7013  2.8467  0.5896  -0.6318 -0.0978 88  PHE A CG  
97   C CD1 . PHE A 15  ? 2.5709 2.5825  2.7063  0.6151  -0.6192 -0.1272 88  PHE A CD1 
98   C CD2 . PHE A 15  ? 2.6189 2.6480  2.7690  0.5967  -0.6245 -0.0969 88  PHE A CD2 
99   C CE1 . PHE A 15  ? 2.2612 2.3462  2.4218  0.6467  -0.5991 -0.1543 88  PHE A CE1 
100  C CE2 . PHE A 15  ? 2.3929 2.4942  2.5700  0.6279  -0.6053 -0.1236 88  PHE A CE2 
101  C CZ  . PHE A 15  ? 2.2265 2.3574  2.4090  0.6526  -0.5921 -0.1519 88  PHE A CZ  
102  N N   . LEU A 16  ? 2.4213 2.1860  2.4638  0.4846  -0.6984 -0.0151 89  LEU A N   
103  C CA  . LEU A 16  ? 2.7254 2.4636  2.7479  0.4380  -0.6957 0.0192  89  LEU A CA  
104  C C   . LEU A 16  ? 2.7328 2.4721  2.7496  0.4333  -0.6821 0.0107  89  LEU A C   
105  O O   . LEU A 16  ? 2.5298 2.2929  2.5431  0.4003  -0.6540 0.0311  89  LEU A O   
106  C CB  . LEU A 16  ? 2.6828 2.3409  2.6838  0.4223  -0.7458 0.0420  89  LEU A CB  
107  C CG  . LEU A 16  ? 2.6817 2.3139  2.6615  0.3711  -0.7477 0.0813  89  LEU A CG  
108  C CD1 . LEU A 16  ? 2.6432 2.3332  2.6275  0.3402  -0.7081 0.1051  89  LEU A CD1 
109  C CD2 . LEU A 16  ? 2.7396 2.2902  2.6980  0.3575  -0.8024 0.1030  89  LEU A CD2 
110  N N   . LEU A 17  ? 2.6271 2.3420  2.6429  0.4673  -0.7024 -0.0203 90  LEU A N   
111  C CA  . LEU A 17  ? 2.4031 2.1246  2.4138  0.4673  -0.6891 -0.0328 90  LEU A CA  
112  C C   . LEU A 17  ? 2.3073 2.1106  2.3381  0.4847  -0.6429 -0.0542 90  LEU A C   
113  O O   . LEU A 17  ? 2.4552 2.2777  2.4830  0.4765  -0.6226 -0.0574 90  LEU A O   
114  C CB  . LEU A 17  ? 2.2404 1.8982  2.2375  0.4958  -0.7326 -0.0585 90  LEU A CB  
115  C CG  . LEU A 17  ? 2.3027 1.8784  2.2739  0.4674  -0.7722 -0.0365 90  LEU A CG  
116  C CD1 . LEU A 17  ? 2.3376 1.8730  2.3003  0.4391  -0.7972 -0.0008 90  LEU A CD1 
117  C CD2 . LEU A 17  ? 2.3820 1.8960  2.3406  0.5014  -0.8149 -0.0686 90  LEU A CD2 
118  N N   . SER A 18  ? 2.2774 2.1299  2.3284  0.5069  -0.6274 -0.0674 91  SER A N   
119  C CA  . SER A 18  ? 2.3393 2.2713  2.4096  0.5206  -0.5851 -0.0850 91  SER A CA  
120  C C   . SER A 18  ? 2.1768 2.1521  2.2522  0.4831  -0.5444 -0.0580 91  SER A C   
121  O O   . SER A 18  ? 2.1400 2.1564  2.2203  0.4790  -0.5141 -0.0626 91  SER A O   
122  C CB  . SER A 18  ? 2.5309 2.5041  2.6227  0.5551  -0.5837 -0.1068 91  SER A CB  
123  O OG  . SER A 18  ? 2.7104 2.7569  2.8191  0.5737  -0.5502 -0.1288 91  SER A OG  
124  N N   . VAL A 19  ? 1.9483 1.9144  2.0217  0.4563  -0.5442 -0.0303 92  VAL A N   
125  C CA  . VAL A 19  ? 1.9992 2.0008  2.0754  0.4218  -0.5083 -0.0061 92  VAL A CA  
126  C C   . VAL A 19  ? 2.2772 2.2546  2.3385  0.3958  -0.5061 0.0097  92  VAL A C   
127  O O   . VAL A 19  ? 2.2623 2.2781  2.3295  0.3796  -0.4728 0.0173  92  VAL A O   
128  C CB  . VAL A 19  ? 1.6480 1.6451  1.7224  0.4007  -0.5108 0.0175  92  VAL A CB  
129  C CG1 . VAL A 19  ? 1.6689 1.5962  1.7230  0.3894  -0.5529 0.0340  92  VAL A CG1 
130  C CG2 . VAL A 19  ? 1.6305 1.6615  1.7060  0.3671  -0.4751 0.0398  92  VAL A CG2 
131  N N   . ILE A 20  ? 2.1944 2.1081  2.2372  0.3913  -0.5429 0.0150  93  ILE A N   
132  C CA  . ILE A 20  ? 1.8662 1.7577  1.8959  0.3663  -0.5441 0.0298  93  ILE A CA  
133  C C   . ILE A 20  ? 1.7664 1.6823  1.8006  0.3844  -0.5293 0.0065  93  ILE A C   
134  O O   . ILE A 20  ? 1.4528 1.3950  1.4889  0.3655  -0.5041 0.0169  93  ILE A O   
135  C CB  . ILE A 20  ? 1.7249 1.5396  1.7332  0.3557  -0.5913 0.0419  93  ILE A CB  
136  C CG1 . ILE A 20  ? 2.0751 1.8719  2.0763  0.3286  -0.6023 0.0724  93  ILE A CG1 
137  C CG2 . ILE A 20  ? 1.5311 1.3241  1.5270  0.3337  -0.5960 0.0527  93  ILE A CG2 
138  C CD1 . ILE A 20  ? 2.1987 1.9200  2.1782  0.3133  -0.6504 0.0895  93  ILE A CD1 
139  N N   . GLY A 21  ? 2.6205 2.5300  2.6561  0.4221  -0.5452 -0.0258 94  GLY A N   
140  C CA  . GLY A 21  ? 2.7238 2.6646  2.7626  0.4412  -0.5295 -0.0500 94  GLY A CA  
141  C C   . GLY A 21  ? 2.5257 2.5425  2.5831  0.4370  -0.4826 -0.0485 94  GLY A C   
142  O O   . GLY A 21  ? 2.6817 2.7259  2.7396  0.4345  -0.4631 -0.0528 94  GLY A O   
143  N N   . TYR A 22  ? 1.9185 1.9683  1.9909  0.4351  -0.4658 -0.0415 95  TYR A N   
144  C CA  . TYR A 22  ? 1.7104 1.8249  1.7993  0.4252  -0.4238 -0.0352 95  TYR A CA  
145  C C   . TYR A 22  ? 1.7984 1.9122  1.8833  0.3890  -0.4059 -0.0070 95  TYR A C   
146  O O   . TYR A 22  ? 2.0504 2.2002  2.1416  0.3827  -0.3795 -0.0057 95  TYR A O   
147  C CB  . TYR A 22  ? 1.8905 2.0340  1.9945  0.4292  -0.4144 -0.0334 95  TYR A CB  
148  C CG  . TYR A 22  ? 1.5277 1.7187  1.6443  0.4072  -0.3771 -0.0171 95  TYR A CG  
149  C CD1 . TYR A 22  ? 1.4509 1.6981  1.5815  0.4143  -0.3484 -0.0269 95  TYR A CD1 
150  C CD2 . TYR A 22  ? 1.8158 1.9947  1.9289  0.3791  -0.3718 0.0080  95  TYR A CD2 
151  C CE1 . TYR A 22  ? 1.4751 1.7589  1.6167  0.3943  -0.3179 -0.0121 95  TYR A CE1 
152  C CE2 . TYR A 22  ? 1.8303 2.0482  1.9538  0.3614  -0.3398 0.0200  95  TYR A CE2 
153  C CZ  . TYR A 22  ? 1.5400 1.8070  1.6780  0.3692  -0.3141 0.0100  95  TYR A CZ  
154  O OH  . TYR A 22  ? 1.4667 1.7659  1.6145  0.3516  -0.2856 0.0219  95  TYR A OH  
155  N N   . ALA A 23  ? 1.6667 1.7420  1.7413  0.3650  -0.4204 0.0162  96  ALA A N   
156  C CA  . ALA A 23  ? 1.7536 1.8353  1.8265  0.3316  -0.4024 0.0429  96  ALA A CA  
157  C C   . ALA A 23  ? 1.9290 1.9927  1.9924  0.3209  -0.4083 0.0478  96  ALA A C   
158  O O   . ALA A 23  ? 1.6132 1.6976  1.6807  0.2991  -0.3869 0.0649  96  ALA A O   
159  C CB  . ALA A 23  ? 1.9914 2.0449  2.0552  0.3087  -0.4158 0.0665  96  ALA A CB  
160  N N   . VAL A 24  ? 2.1839 2.2096  2.2352  0.3364  -0.4377 0.0324  97  VAL A N   
161  C CA  . VAL A 24  ? 1.8767 1.8813  1.9170  0.3261  -0.4478 0.0357  97  VAL A CA  
162  C C   . VAL A 24  ? 1.8275 1.8676  1.8732  0.3478  -0.4314 0.0122  97  VAL A C   
163  O O   . VAL A 24  ? 1.7512 1.7968  1.7973  0.3789  -0.4385 -0.0154 97  VAL A O   
164  C CB  . VAL A 24  ? 1.8151 1.7505  1.8355  0.3271  -0.4936 0.0337  97  VAL A CB  
165  C CG1 . VAL A 24  ? 1.8342 1.7491  1.8430  0.3178  -0.5052 0.0340  97  VAL A CG1 
166  C CG2 . VAL A 24  ? 2.1494 2.0530  2.1629  0.3000  -0.5097 0.0623  97  VAL A CG2 
167  N N   . ASP A 25  ? 1.9970 2.0639  2.0469  0.3316  -0.4098 0.0235  98  ASP A N   
168  C CA  . ASP A 25  ? 2.1939 2.2990  2.2480  0.3471  -0.3921 0.0062  98  ASP A CA  
169  C C   . ASP A 25  ? 1.9955 2.1000  2.0453  0.3257  -0.3882 0.0214  98  ASP A C   
170  O O   . ASP A 25  ? 1.9931 2.0645  2.0358  0.3023  -0.4037 0.0414  98  ASP A O   
171  C CB  . ASP A 25  ? 2.0201 2.1845  2.0936  0.3537  -0.3570 0.0041  98  ASP A CB  
172  C CG  . ASP A 25  ? 1.9829 2.1689  2.0685  0.3266  -0.3316 0.0314  98  ASP A CG  
173  O OD1 . ASP A 25  ? 2.4533 2.6111  2.5341  0.3050  -0.3411 0.0516  98  ASP A OD1 
174  O OD2 . ASP A 25  ? 1.8042 2.0360  1.9039  0.3270  -0.3029 0.0326  98  ASP A OD2 
175  N N   . LEU A 26  ? 1.9925 2.1369  2.0471  0.3330  -0.3682 0.0130  99  LEU A N   
176  C CA  . LEU A 26  ? 2.0008 2.1484  2.0521  0.3154  -0.3652 0.0258  99  LEU A CA  
177  C C   . LEU A 26  ? 1.9942 2.1522  2.0583  0.2857  -0.3492 0.0575  99  LEU A C   
178  O O   . LEU A 26  ? 2.0231 2.1626  2.0825  0.2651  -0.3604 0.0741  99  LEU A O   
179  C CB  . LEU A 26  ? 2.0642 2.2587  2.1194  0.3283  -0.3444 0.0131  99  LEU A CB  
180  C CG  . LEU A 26  ? 2.4760 2.6792  2.5216  0.3606  -0.3522 -0.0204 99  LEU A CG  
181  C CD1 . LEU A 26  ? 2.6005 2.8638  2.6536  0.3685  -0.3245 -0.0267 99  LEU A CD1 
182  C CD2 . LEU A 26  ? 2.3642 2.5209  2.3864  0.3697  -0.3866 -0.0379 99  LEU A CD2 
183  N N   . GLY A 27  ? 1.6086 1.7977  1.6888  0.2835  -0.3236 0.0655  100 GLY A N   
184  C CA  . GLY A 27  ? 1.6965 1.9002  1.7891  0.2594  -0.3063 0.0917  100 GLY A CA  
185  C C   . GLY A 27  ? 1.4500 1.6178  1.5344  0.2383  -0.3267 0.1095  100 GLY A C   
186  O O   . GLY A 27  ? 1.5263 1.7023  1.6161  0.2167  -0.3213 0.1305  100 GLY A O   
187  N N   . ASN A 28  ? 1.7378 1.8674  1.8094  0.2439  -0.3516 0.1026  101 ASN A N   
188  C CA  . ASN A 28  ? 1.7335 1.8248  1.7941  0.2218  -0.3764 0.1210  101 ASN A CA  
189  C C   . ASN A 28  ? 1.9353 2.0040  1.9860  0.2093  -0.3969 0.1269  101 ASN A C   
190  O O   . ASN A 28  ? 1.8891 1.9476  1.9378  0.1820  -0.4063 0.1509  101 ASN A O   
191  C CB  . ASN A 28  ? 1.7362 1.7857  1.7839  0.2328  -0.4036 0.1110  101 ASN A CB  
192  C CG  . ASN A 28  ? 2.0495 2.1176  2.1056  0.2358  -0.3877 0.1134  101 ASN A CG  
193  O OD1 . ASN A 28  ? 2.3597 2.4526  2.4246  0.2576  -0.3721 0.0955  101 ASN A OD1 
194  N ND2 . ASN A 28  ? 2.3088 2.3671  2.3613  0.2123  -0.3922 0.1362  101 ASN A ND2 
195  N N   . VAL A 29  ? 1.8516 1.9153  1.8955  0.2278  -0.4045 0.1057  102 VAL A N   
196  C CA  . VAL A 29  ? 1.9323 1.9694  1.9637  0.2171  -0.4282 0.1082  102 VAL A CA  
197  C C   . VAL A 29  ? 1.8230 1.8993  1.8678  0.1989  -0.4071 0.1265  102 VAL A C   
198  O O   . VAL A 29  ? 1.9207 1.9850  1.9631  0.1738  -0.4210 0.1465  102 VAL A O   
199  C CB  . VAL A 29  ? 2.3354 2.3528  2.3518  0.2454  -0.4454 0.0758  102 VAL A CB  
200  C CG1 . VAL A 29  ? 2.0255 2.0138  2.0268  0.2339  -0.4710 0.0768  102 VAL A CG1 
201  C CG2 . VAL A 29  ? 2.6246 2.6016  2.6298  0.2653  -0.4693 0.0575  102 VAL A CG2 
202  N N   . TRP A 30  ? 1.6899 1.8141  1.7497  0.2105  -0.3749 0.1212  103 TRP A N   
203  C CA  . TRP A 30  ? 1.6868 1.8479  1.7602  0.1978  -0.3562 0.1363  103 TRP A CA  
204  C C   . TRP A 30  ? 1.7904 1.9897  1.8857  0.1869  -0.3262 0.1555  103 TRP A C   
205  O O   . TRP A 30  ? 1.8675 2.0808  1.9727  0.1657  -0.3224 0.1775  103 TRP A O   
206  C CB  . TRP A 30  ? 1.6998 1.8844  1.7719  0.2167  -0.3461 0.1182  103 TRP A CB  
207  C CG  . TRP A 30  ? 1.8713 2.0879  1.9521  0.2376  -0.3211 0.1040  103 TRP A CG  
208  C CD1 . TRP A 30  ? 2.5486 2.7583  2.6204  0.2612  -0.3259 0.0794  103 TRP A CD1 
209  C CD2 . TRP A 30  ? 1.6603 1.9221  1.7613  0.2364  -0.2889 0.1140  103 TRP A CD2 
210  N NE1 . TRP A 30  ? 2.4556 2.7066  2.5412  0.2720  -0.2980 0.0753  103 TRP A NE1 
211  C CE2 . TRP A 30  ? 2.0670 2.3468  2.1696  0.2566  -0.2761 0.0965  103 TRP A CE2 
212  C CE3 . TRP A 30  ? 1.6323 1.9209  1.7511  0.2208  -0.2712 0.1360  103 TRP A CE3 
213  C CZ2 . TRP A 30  ? 2.1357 2.4549  2.2552  0.2586  -0.2477 0.1018  103 TRP A CZ2 
214  C CZ3 . TRP A 30  ? 1.9541 2.2786  2.0896  0.2260  -0.2435 0.1392  103 TRP A CZ3 
215  C CH2 . TRP A 30  ? 2.1620 2.4995  2.2970  0.2433  -0.2328 0.1231  103 TRP A CH2 
216  N N   . ARG A 31  ? 1.9129 2.1327  2.0169  0.2017  -0.3044 0.1465  104 ARG A N   
217  C CA  . ARG A 31  ? 1.8702 2.1256  1.9941  0.1948  -0.2754 0.1605  104 ARG A CA  
218  C C   . ARG A 31  ? 1.8437 2.0952  1.9705  0.1723  -0.2783 0.1818  104 ARG A C   
219  O O   . ARG A 31  ? 1.9527 2.2343  2.0952  0.1606  -0.2613 0.1979  104 ARG A O   
220  C CB  . ARG A 31  ? 1.9275 2.1954  2.0560  0.2119  -0.2587 0.1467  104 ARG A CB  
221  C CG  . ARG A 31  ? 1.9534 2.2601  2.1016  0.2126  -0.2280 0.1532  104 ARG A CG  
222  C CD  . ARG A 31  ? 2.3691 2.6904  2.5200  0.2309  -0.2154 0.1367  104 ARG A CD  
223  N NE  . ARG A 31  ? 2.4802 2.8339  2.6485  0.2310  -0.1904 0.1431  104 ARG A NE  
224  C CZ  . ARG A 31  ? 2.4867 2.8600  2.6599  0.2425  -0.1779 0.1337  104 ARG A CZ  
225  N NH1 . ARG A 31  ? 2.2199 2.6166  2.4082  0.2401  -0.1584 0.1422  104 ARG A NH1 
226  N NH2 . ARG A 31  ? 2.4913 2.8618  2.6549  0.2563  -0.1859 0.1162  104 ARG A NH2 
227  N N   . PHE A 32  ? 1.6204 1.8372  1.7322  0.1661  -0.3003 0.1826  105 PHE A N   
228  C CA  . PHE A 32  ? 1.5796 1.7973  1.6922  0.1426  -0.3027 0.2046  105 PHE A CA  
229  C C   . PHE A 32  ? 1.6409 1.8645  1.7564  0.1192  -0.3126 0.2252  105 PHE A C   
230  O O   . PHE A 32  ? 1.7974 2.0546  1.9264  0.1037  -0.2965 0.2435  105 PHE A O   
231  C CB  . PHE A 32  ? 1.6289 1.8067  1.7237  0.1403  -0.3262 0.2028  105 PHE A CB  
232  C CG  . PHE A 32  ? 1.6668 1.8418  1.7572  0.1118  -0.3352 0.2281  105 PHE A CG  
233  C CD1 . PHE A 32  ? 2.1285 2.3351  2.2270  0.1041  -0.3126 0.2382  105 PHE A CD1 
234  C CD2 . PHE A 32  ? 1.6325 1.7745  1.7095  0.0917  -0.3669 0.2419  105 PHE A CD2 
235  C CE1 . PHE A 32  ? 2.0445 2.2557  2.1377  0.0771  -0.3196 0.2619  105 PHE A CE1 
236  C CE2 . PHE A 32  ? 1.6449 1.7893  1.7176  0.0623  -0.3754 0.2681  105 PHE A CE2 
237  C CZ  . PHE A 32  ? 1.7168 1.8988  1.7975  0.0551  -0.3507 0.2782  105 PHE A CZ  
238  N N   . PRO A 33  ? 1.8334 2.0279  1.9370  0.1152  -0.3392 0.2232  106 PRO A N   
239  C CA  . PRO A 33  ? 1.7650 1.9701  1.8736  0.0904  -0.3484 0.2447  106 PRO A CA  
240  C C   . PRO A 33  ? 1.5510 1.8094  1.6838  0.0902  -0.3199 0.2531  106 PRO A C   
241  O O   . PRO A 33  ? 1.5715 1.8593  1.7172  0.0696  -0.3139 0.2751  106 PRO A O   
242  C CB  . PRO A 33  ? 1.4569 1.6200  1.5474  0.0936  -0.3799 0.2332  106 PRO A CB  
243  C CG  . PRO A 33  ? 1.4807 1.6005  1.5529  0.1113  -0.3964 0.2129  106 PRO A CG  
244  C CD  . PRO A 33  ? 1.4434 1.5906  1.5266  0.1303  -0.3665 0.2025  106 PRO A CD  
245  N N   . TYR A 34  ? 1.4446 1.7182  1.5846  0.1125  -0.3030 0.2368  107 TYR A N   
246  C CA  . TYR A 34  ? 1.4219 1.7410  1.5847  0.1136  -0.2794 0.2451  107 TYR A CA  
247  C C   . TYR A 34  ? 1.5928 1.9473  1.7740  0.1109  -0.2530 0.2553  107 TYR A C   
248  O O   . TYR A 34  ? 1.7876 2.1758  1.9859  0.0977  -0.2443 0.2730  107 TYR A O   
249  C CB  . TYR A 34  ? 1.4469 1.7726  1.6111  0.1367  -0.2683 0.2270  107 TYR A CB  
250  C CG  . TYR A 34  ? 1.7331 2.1016  1.9209  0.1395  -0.2454 0.2360  107 TYR A CG  
251  C CD1 . TYR A 34  ? 2.0798 2.4621  2.2739  0.1311  -0.2529 0.2463  107 TYR A CD1 
252  C CD2 . TYR A 34  ? 1.5898 1.9825  1.7934  0.1505  -0.2185 0.2343  107 TYR A CD2 
253  C CE1 . TYR A 34  ? 2.2838 2.7038  2.5006  0.1349  -0.2342 0.2554  107 TYR A CE1 
254  C CE2 . TYR A 34  ? 1.4571 1.8837  1.6826  0.1544  -0.2006 0.2424  107 TYR A CE2 
255  C CZ  . TYR A 34  ? 1.8934 2.3340  2.1260  0.1472  -0.2086 0.2533  107 TYR A CZ  
256  O OH  . TYR A 34  ? 2.3667 2.8397  2.6221  0.1524  -0.1929 0.2621  107 TYR A OH  
257  N N   . ILE A 35  ? 1.4560 1.8053  1.6342  0.1240  -0.2403 0.2432  108 ILE A N   
258  C CA  . ILE A 35  ? 1.4611 1.8405  1.6534  0.1233  -0.2161 0.2491  108 ILE A CA  
259  C C   . ILE A 35  ? 1.5116 1.8991  1.7016  0.0999  -0.2227 0.2679  108 ILE A C   
260  O O   . ILE A 35  ? 1.7536 2.1779  1.9582  0.0955  -0.2032 0.2767  108 ILE A O   
261  C CB  . ILE A 35  ? 1.3701 1.7381  1.5564  0.1401  -0.2052 0.2318  108 ILE A CB  
262  C CG1 . ILE A 35  ? 1.6880 2.0878  1.8900  0.1438  -0.1780 0.2336  108 ILE A CG1 
263  C CG2 . ILE A 35  ? 1.3816 1.7150  1.5468  0.1344  -0.2249 0.2289  108 ILE A CG2 
264  C CD1 . ILE A 35  ? 2.1323 2.5223  2.3291  0.1577  -0.1680 0.2179  108 ILE A CD1 
265  N N   . CYS A 36  ? 1.5842 1.9388  1.7558  0.0844  -0.2510 0.2744  109 CYS A N   
266  C CA  . CYS A 36  ? 1.4721 1.8361  1.6404  0.0574  -0.2600 0.2965  109 CYS A CA  
267  C C   . CYS A 36  ? 1.6422 2.0409  1.8269  0.0401  -0.2601 0.3160  109 CYS A C   
268  O O   . CYS A 36  ? 2.1500 2.5873  2.3449  0.0229  -0.2507 0.3339  109 CYS A O   
269  C CB  . CYS A 36  ? 1.3687 1.6809  1.5114  0.0452  -0.2938 0.2989  109 CYS A CB  
270  S SG  . CYS A 36  ? 2.1604 2.4799  2.2959  0.0056  -0.3116 0.3313  109 CYS A SG  
271  N N   . ALA A 37  ? 1.5509 1.9411  1.7387  0.0444  -0.2703 0.3125  110 ALA A N   
272  C CA  . ALA A 37  ? 1.6516 2.0746  1.8556  0.0273  -0.2733 0.3314  110 ALA A CA  
273  C C   . ALA A 37  ? 1.6623 2.1422  1.8959  0.0386  -0.2417 0.3338  110 ALA A C   
274  O O   . ALA A 37  ? 1.6299 2.1547  1.8810  0.0231  -0.2347 0.3525  110 ALA A O   
275  C CB  . ALA A 37  ? 1.7025 2.0963  1.8979  0.0283  -0.2963 0.3260  110 ALA A CB  
276  N N   . GLN A 38  ? 1.6212 2.1013  1.8614  0.0655  -0.2233 0.3154  111 GLN A N   
277  C CA  . GLN A 38  ? 1.7241 2.2504  1.9922  0.0781  -0.1975 0.3169  111 GLN A CA  
278  C C   . GLN A 38  ? 1.6517 2.2092  1.9301  0.0811  -0.1742 0.3176  111 GLN A C   
279  O O   . GLN A 38  ? 1.7083 2.3096  2.0115  0.0882  -0.1552 0.3218  111 GLN A O   
280  C CB  . GLN A 38  ? 1.6706 2.1844  1.9412  0.1030  -0.1883 0.2997  111 GLN A CB  
281  C CG  . GLN A 38  ? 1.9137 2.4098  2.1761  0.1205  -0.1744 0.2816  111 GLN A CG  
282  C CD  . GLN A 38  ? 1.8809 2.3809  2.1538  0.1420  -0.1601 0.2705  111 GLN A CD  
283  O OE1 . GLN A 38  ? 1.5548 2.0716  1.8415  0.1447  -0.1597 0.2768  111 GLN A OE1 
284  N NE2 . GLN A 38  ? 1.7902 2.2752  2.0564  0.1556  -0.1496 0.2556  111 GLN A NE2 
285  N N   . ASN A 39  ? 1.4067 1.9431  1.6662  0.0773  -0.1759 0.3125  112 ASN A N   
286  C CA  . ASN A 39  ? 1.5572 2.1225  1.8215  0.0782  -0.1556 0.3123  112 ASN A CA  
287  C C   . ASN A 39  ? 1.6214 2.1954  1.8738  0.0498  -0.1683 0.3310  112 ASN A C   
288  O O   . ASN A 39  ? 1.7882 2.3223  2.0163  0.0396  -0.1871 0.3311  112 ASN A O   
289  C CB  . ASN A 39  ? 1.5905 2.1282  1.8424  0.0963  -0.1461 0.2919  112 ASN A CB  
290  C CG  . ASN A 39  ? 1.8218 2.3557  2.0862  0.1213  -0.1326 0.2764  112 ASN A CG  
291  O OD1 . ASN A 39  ? 2.1105 2.6741  2.3975  0.1291  -0.1208 0.2797  112 ASN A OD1 
292  N ND2 . ASN A 39  ? 1.3976 1.8965  1.6482  0.1334  -0.1352 0.2605  112 ASN A ND2 
293  N N   . GLY A 40  ? 1.8688 2.4969  2.1390  0.0368  -0.1590 0.3475  113 GLY A N   
294  C CA  . GLY A 40  ? 2.0425 2.6923  2.3037  0.0083  -0.1662 0.3674  113 GLY A CA  
295  C C   . GLY A 40  ? 2.2417 2.8622  2.4872  -0.0208 -0.1997 0.3866  113 GLY A C   
296  O O   . GLY A 40  ? 2.3667 3.0098  2.6067  -0.0494 -0.2079 0.4084  113 GLY A O   
297  N N   . GLY A 41  ? 2.2300 2.8019  2.4673  -0.0156 -0.2203 0.3795  114 GLY A N   
298  C CA  . GLY A 41  ? 2.3043 2.8373  2.5227  -0.0415 -0.2558 0.3942  114 GLY A CA  
299  C C   . GLY A 41  ? 2.1937 2.6894  2.3847  -0.0538 -0.2712 0.3970  114 GLY A C   
300  O O   . GLY A 41  ? 2.4937 2.9645  2.6736  -0.0340 -0.2630 0.3782  114 GLY A O   
301  N N   . GLY A 42  ? 1.5366 2.0291  1.7168  -0.0885 -0.2951 0.4227  115 GLY A N   
302  C CA  . GLY A 42  ? 1.4998 1.9577  1.6538  -0.1040 -0.3129 0.4303  115 GLY A CA  
303  C C   . GLY A 42  ? 1.8876 2.3815  2.0415  -0.0977 -0.2853 0.4269  115 GLY A C   
304  O O   . GLY A 42  ? 1.2064 1.6649  1.3390  -0.0953 -0.2932 0.4211  115 GLY A O   
305  N N   . ALA A 43  ? 2.0477 2.6119  2.2251  -0.0933 -0.2533 0.4290  116 ALA A N   
306  C CA  . ALA A 43  ? 1.7670 2.3677  1.9441  -0.0840 -0.2253 0.4216  116 ALA A CA  
307  C C   . ALA A 43  ? 1.5358 2.1005  1.7064  -0.0501 -0.2134 0.3910  116 ALA A C   
308  O O   . ALA A 43  ? 1.5199 2.0997  1.6834  -0.0435 -0.1963 0.3832  116 ALA A O   
309  C CB  . ALA A 43  ? 1.8471 2.5281  2.0530  -0.0796 -0.1939 0.4247  116 ALA A CB  
310  N N   . PHE A 44  ? 1.5409 2.0617  1.7131  -0.0297 -0.2222 0.3739  117 PHE A N   
311  C CA  . PHE A 44  ? 1.4692 1.9558  1.6345  -0.0010 -0.2145 0.3473  117 PHE A CA  
312  C C   . PHE A 44  ? 1.6640 2.1056  1.8018  -0.0078 -0.2344 0.3468  117 PHE A C   
313  O O   . PHE A 44  ? 2.2165 2.6395  2.3481  0.0127  -0.2260 0.3272  117 PHE A O   
314  C CB  . PHE A 44  ? 1.5587 2.0145  1.7308  0.0191  -0.2212 0.3317  117 PHE A CB  
315  C CG  . PHE A 44  ? 1.4603 1.8942  1.6307  0.0485  -0.2092 0.3055  117 PHE A CG  
316  C CD1 . PHE A 44  ? 1.4445 1.9103  1.6320  0.0676  -0.1792 0.2932  117 PHE A CD1 
317  C CD2 . PHE A 44  ? 1.4915 1.8734  1.6438  0.0571  -0.2291 0.2932  117 PHE A CD2 
318  C CE1 . PHE A 44  ? 1.5360 1.9825  1.7221  0.0910  -0.1699 0.2716  117 PHE A CE1 
319  C CE2 . PHE A 44  ? 1.4829 1.8517  1.6355  0.0823  -0.2178 0.2707  117 PHE A CE2 
320  C CZ  . PHE A 44  ? 1.5799 1.9810  1.7491  0.0974  -0.1884 0.2611  117 PHE A CZ  
321  N N   . LEU A 45  ? 1.3324 1.7556  1.4539  -0.0368 -0.2621 0.3692  118 LEU A N   
322  C CA  . LEU A 45  ? 1.5543 1.9319  1.6498  -0.0434 -0.2844 0.3707  118 LEU A CA  
323  C C   . LEU A 45  ? 1.9121 2.3191  2.0003  -0.0450 -0.2649 0.3708  118 LEU A C   
324  O O   . LEU A 45  ? 1.7406 2.1140  1.8123  -0.0369 -0.2732 0.3613  118 LEU A O   
325  C CB  . LEU A 45  ? 1.2741 1.6239  1.3538  -0.0769 -0.3210 0.3978  118 LEU A CB  
326  C CG  . LEU A 45  ? 1.3135 1.6200  1.3931  -0.0769 -0.3486 0.3963  118 LEU A CG  
327  C CD1 . LEU A 45  ? 1.3766 1.6544  1.4392  -0.1139 -0.3867 0.4254  118 LEU A CD1 
328  C CD2 . LEU A 45  ? 1.8141 2.0657  1.8859  -0.0451 -0.3589 0.3672  118 LEU A CD2 
329  N N   . LEU A 46  ? 1.8320 2.3032  1.9321  -0.0546 -0.2393 0.3804  119 LEU A N   
330  C CA  . LEU A 46  ? 1.5007 2.0029  1.5910  -0.0569 -0.2209 0.3793  119 LEU A CA  
331  C C   . LEU A 46  ? 1.6351 2.1275  1.7284  -0.0237 -0.2005 0.3487  119 LEU A C   
332  O O   . LEU A 46  ? 1.4768 1.9456  1.5513  -0.0218 -0.2066 0.3430  119 LEU A O   
333  C CB  . LEU A 46  ? 1.4169 1.9948  1.5197  -0.0725 -0.1981 0.3942  119 LEU A CB  
334  C CG  . LEU A 46  ? 1.4007 2.0231  1.4927  -0.0766 -0.1767 0.3934  119 LEU A CG  
335  C CD1 . LEU A 46  ? 1.4383 2.1207  1.5290  -0.1104 -0.1750 0.4231  119 LEU A CD1 
336  C CD2 . LEU A 46  ? 1.6606 2.3144  1.7703  -0.0442 -0.1415 0.3651  119 LEU A CD2 
337  N N   . PRO A 47  ? 1.8051 2.3136  1.9210  0.0016  -0.1781 0.3296  120 PRO A N   
338  C CA  . PRO A 47  ? 1.7314 2.2278  1.8490  0.0295  -0.1617 0.3028  120 PRO A CA  
339  C C   . PRO A 47  ? 1.6178 2.0559  1.7260  0.0426  -0.1815 0.2902  120 PRO A C   
340  O O   . PRO A 47  ? 1.4924 1.9176  1.5951  0.0579  -0.1746 0.2732  120 PRO A O   
341  C CB  . PRO A 47  ? 1.2049 1.7315  1.3499  0.0492  -0.1374 0.2908  120 PRO A CB  
342  C CG  . PRO A 47  ? 1.2223 1.7522  1.3787  0.0380  -0.1502 0.3064  120 PRO A CG  
343  C CD  . PRO A 47  ? 1.4012 1.9386  1.5423  0.0052  -0.1684 0.3327  120 PRO A CD  
344  N N   . TYR A 48  ? 1.4969 1.9015  1.6033  0.0377  -0.2063 0.2971  121 TYR A N   
345  C CA  . TYR A 48  ? 1.6619 2.0152  1.7600  0.0531  -0.2254 0.2827  121 TYR A CA  
346  C C   . TYR A 48  ? 1.9656 2.2914  2.0413  0.0465  -0.2425 0.2851  121 TYR A C   
347  O O   . TYR A 48  ? 2.2297 2.5307  2.3017  0.0651  -0.2457 0.2675  121 TYR A O   
348  C CB  . TYR A 48  ? 1.5170 1.8406  1.6151  0.0485  -0.2503 0.2888  121 TYR A CB  
349  C CG  . TYR A 48  ? 1.5740 1.8474  1.6632  0.0663  -0.2715 0.2721  121 TYR A CG  
350  C CD1 . TYR A 48  ? 1.9203 2.1933  2.0206  0.0935  -0.2581 0.2490  121 TYR A CD1 
351  C CD2 . TYR A 48  ? 1.5146 1.7424  1.5843  0.0561  -0.3058 0.2797  121 TYR A CD2 
352  C CE1 . TYR A 48  ? 1.9777 2.2132  2.0709  0.1111  -0.2760 0.2325  121 TYR A CE1 
353  C CE2 . TYR A 48  ? 1.5244 1.7090  1.5872  0.0760  -0.3255 0.2617  121 TYR A CE2 
354  C CZ  . TYR A 48  ? 1.6935 1.8855  1.7684  0.1040  -0.3092 0.2374  121 TYR A CZ  
355  O OH  . TYR A 48  ? 1.6835 1.8407  1.7524  0.1252  -0.3272 0.2183  121 TYR A OH  
356  N N   . THR A 49  ? 1.5345 1.8673  1.5956  0.0191  -0.2540 0.3081  122 THR A N   
357  C CA  . THR A 49  ? 1.6066 1.9142  1.6452  0.0104  -0.2719 0.3136  122 THR A CA  
358  C C   . THR A 49  ? 1.5432 1.8807  1.5788  0.0172  -0.2471 0.3033  122 THR A C   
359  O O   . THR A 49  ? 1.8405 2.1542  1.8646  0.0258  -0.2554 0.2941  122 THR A O   
360  C CB  . THR A 49  ? 1.6482 1.9524  1.6702  -0.0246 -0.2952 0.3450  122 THR A CB  
361  O OG1 . THR A 49  ? 1.8210 2.1855  1.8492  -0.0426 -0.2720 0.3595  122 THR A OG1 
362  C CG2 . THR A 49  ? 1.4560 1.7217  1.4785  -0.0322 -0.3248 0.3542  122 THR A CG2 
363  N N   . ILE A 50  ? 1.6779 2.0677  1.7238  0.0145  -0.2176 0.3037  123 ILE A N   
364  C CA  . ILE A 50  ? 1.6151 2.0329  1.6564  0.0214  -0.1943 0.2917  123 ILE A CA  
365  C C   . ILE A 50  ? 1.8445 2.2420  1.8944  0.0504  -0.1855 0.2643  123 ILE A C   
366  O O   . ILE A 50  ? 1.9944 2.3846  2.0325  0.0552  -0.1847 0.2549  123 ILE A O   
367  C CB  . ILE A 50  ? 1.3621 1.8396  1.4152  0.0175  -0.1649 0.2937  123 ILE A CB  
368  C CG1 . ILE A 50  ? 1.2521 1.7580  1.2966  -0.0144 -0.1735 0.3232  123 ILE A CG1 
369  C CG2 . ILE A 50  ? 1.2622 1.7650  1.3092  0.0273  -0.1416 0.2771  123 ILE A CG2 
370  C CD1 . ILE A 50  ? 1.2421 1.8151  1.2995  -0.0177 -0.1448 0.3254  123 ILE A CD1 
371  N N   . MET A 51  ? 1.7102 2.1005  1.7804  0.0683  -0.1798 0.2525  124 MET A N   
372  C CA  . MET A 51  ? 1.3565 1.7290  1.4351  0.0929  -0.1740 0.2296  124 MET A CA  
373  C C   . MET A 51  ? 1.3714 1.7011  1.4389  0.0979  -0.2004 0.2261  124 MET A C   
374  O O   . MET A 51  ? 1.4764 1.7967  1.5469  0.1147  -0.1971 0.2090  124 MET A O   
375  C CB  . MET A 51  ? 1.3561 1.7346  1.4576  0.1083  -0.1625 0.2210  124 MET A CB  
376  C CG  . MET A 51  ? 1.3490 1.7679  1.4655  0.1110  -0.1352 0.2189  124 MET A CG  
377  S SD  . MET A 51  ? 1.4131 1.8470  1.5264  0.1215  -0.1132 0.2008  124 MET A SD  
378  C CE  . MET A 51  ? 2.2754 2.7532  2.4082  0.1271  -0.0860 0.1988  124 MET A CE  
379  N N   . ALA A 52  ? 1.4321 1.7362  1.4876  0.0840  -0.2276 0.2420  125 ALA A N   
380  C CA  . ALA A 52  ? 1.1525 1.4142  1.1965  0.0899  -0.2558 0.2386  125 ALA A CA  
381  C C   . ALA A 52  ? 1.3878 1.6473  1.4132  0.0798  -0.2626 0.2445  125 ALA A C   
382  O O   . ALA A 52  ? 1.1832 1.4343  1.2081  0.0945  -0.2630 0.2298  125 ALA A O   
383  C CB  . ALA A 52  ? 1.5158 1.7442  1.5529  0.0793  -0.2860 0.2527  125 ALA A CB  
384  N N   . ILE A 53  ? 1.9543 2.2243  1.9642  0.0532  -0.2687 0.2672  126 ILE A N   
385  C CA  . ILE A 53  ? 1.6888 1.9577  1.6773  0.0396  -0.2777 0.2766  126 ILE A CA  
386  C C   . ILE A 53  ? 1.7508 2.0452  1.7414  0.0523  -0.2526 0.2579  126 ILE A C   
387  O O   . ILE A 53  ? 1.6185 1.8968  1.6005  0.0589  -0.2627 0.2508  126 ILE A O   
388  C CB  . ILE A 53  ? 1.5133 1.8049  1.4863  0.0068  -0.2805 0.3048  126 ILE A CB  
389  C CG1 . ILE A 53  ? 1.5474 1.8048  1.5148  -0.0097 -0.3129 0.3260  126 ILE A CG1 
390  C CG2 . ILE A 53  ? 1.9570 2.2578  1.9064  -0.0080 -0.2843 0.3139  126 ILE A CG2 
391  C CD1 . ILE A 53  ? 1.6275 1.9102  1.5810  -0.0458 -0.3175 0.3574  126 ILE A CD1 
392  N N   . PHE A 54  ? 1.7560 2.0896  1.7580  0.0557  -0.2212 0.2498  127 PHE A N   
393  C CA  . PHE A 54  ? 1.7968 2.1509  1.7995  0.0667  -0.1989 0.2313  127 PHE A CA  
394  C C   . PHE A 54  ? 1.7295 2.0676  1.7501  0.0926  -0.1944 0.2085  127 PHE A C   
395  O O   . PHE A 54  ? 1.9475 2.2773  1.9634  0.1002  -0.1974 0.1974  127 PHE A O   
396  C CB  . PHE A 54  ? 1.8236 2.2229  1.8319  0.0631  -0.1692 0.2292  127 PHE A CB  
397  C CG  . PHE A 54  ? 1.8618 2.2897  1.8518  0.0372  -0.1694 0.2502  127 PHE A CG  
398  C CD1 . PHE A 54  ? 1.5711 1.9850  1.5362  0.0179  -0.1921 0.2673  127 PHE A CD1 
399  C CD2 . PHE A 54  ? 1.7860 2.2580  1.7842  0.0319  -0.1476 0.2540  127 PHE A CD2 
400  C CE1 . PHE A 54  ? 1.6981 2.1425  1.6451  -0.0090 -0.1926 0.2893  127 PHE A CE1 
401  C CE2 . PHE A 54  ? 1.5511 2.0580  1.5331  0.0069  -0.1467 0.2741  127 PHE A CE2 
402  C CZ  . PHE A 54  ? 1.7685 2.2622  1.7240  -0.0150 -0.1689 0.2926  127 PHE A CZ  
403  N N   . GLY A 55  ? 1.7261 2.0638  1.7673  0.1049  -0.1870 0.2024  128 GLY A N   
404  C CA  . GLY A 55  ? 1.4863 1.8152  1.5442  0.1270  -0.1814 0.1831  128 GLY A CA  
405  C C   . GLY A 55  ? 1.4608 1.7588  1.5207  0.1384  -0.2048 0.1786  128 GLY A C   
406  O O   . GLY A 55  ? 1.7942 2.0875  1.8573  0.1506  -0.2066 0.1654  128 GLY A O   
407  N N   . GLY A 56  ? 1.4504 1.7281  1.5085  0.1350  -0.2238 0.1887  129 GLY A N   
408  C CA  . GLY A 56  ? 1.4196 1.6692  1.4818  0.1507  -0.2448 0.1803  129 GLY A CA  
409  C C   . GLY A 56  ? 1.6238 1.8463  1.6723  0.1517  -0.2717 0.1818  129 GLY A C   
410  O O   . GLY A 56  ? 1.4730 1.6883  1.5285  0.1706  -0.2786 0.1665  129 GLY A O   
411  N N   . ILE A 57  ? 1.9938 2.2036  2.0234  0.1311  -0.2879 0.2011  130 ILE A N   
412  C CA  . ILE A 57  ? 1.5531 1.7313  1.5681  0.1299  -0.3189 0.2067  130 ILE A CA  
413  C C   . ILE A 57  ? 1.5777 1.7682  1.5914  0.1371  -0.3132 0.1965  130 ILE A C   
414  O O   . ILE A 57  ? 1.6669 1.8373  1.6820  0.1521  -0.3335 0.1882  130 ILE A O   
415  C CB  . ILE A 57  ? 1.8070 1.9708  1.8004  0.1014  -0.3377 0.2340  130 ILE A CB  
416  C CG1 . ILE A 57  ? 1.4226 1.5790  1.4187  0.0911  -0.3422 0.2454  130 ILE A CG1 
417  C CG2 . ILE A 57  ? 1.9183 2.0407  1.8973  0.1016  -0.3753 0.2411  130 ILE A CG2 
418  C CD1 . ILE A 57  ? 1.4265 1.5460  1.4299  0.1098  -0.3643 0.2343  130 ILE A CD1 
419  N N   . PRO A 58  ? 1.7275 1.9501  1.7385  0.1280  -0.2880 0.1957  131 PRO A N   
420  C CA  . PRO A 58  ? 1.5353 1.7675  1.5449  0.1344  -0.2850 0.1849  131 PRO A CA  
421  C C   . PRO A 58  ? 1.5285 1.7678  1.5602  0.1590  -0.2770 0.1627  131 PRO A C   
422  O O   . PRO A 58  ? 1.8221 2.0615  1.8553  0.1676  -0.2855 0.1546  131 PRO A O   
423  C CB  . PRO A 58  ? 1.5676 1.8315  1.5684  0.1192  -0.2588 0.1871  131 PRO A CB  
424  C CG  . PRO A 58  ? 1.6979 1.9663  1.6891  0.1002  -0.2575 0.2058  131 PRO A CG  
425  C CD  . PRO A 58  ? 1.5676 1.8184  1.5738  0.1101  -0.2653 0.2054  131 PRO A CD  
426  N N   . LEU A 59  ? 1.4882 1.7371  1.5373  0.1694  -0.2613 0.1540  132 LEU A N   
427  C CA  . LEU A 59  ? 1.6432 1.9021  1.7126  0.1909  -0.2552 0.1354  132 LEU A CA  
428  C C   . LEU A 59  ? 1.5766 1.8133  1.6503  0.2082  -0.2812 0.1297  132 LEU A C   
429  O O   . LEU A 59  ? 1.7161 1.9618  1.8016  0.2253  -0.2851 0.1158  132 LEU A O   
430  C CB  . LEU A 59  ? 1.8696 2.1471  1.9544  0.1948  -0.2307 0.1296  132 LEU A CB  
431  C CG  . LEU A 59  ? 1.7820 2.0824  1.8681  0.1852  -0.2040 0.1287  132 LEU A CG  
432  C CD1 . LEU A 59  ? 1.7011 2.0146  1.8032  0.1904  -0.1847 0.1252  132 LEU A CD1 
433  C CD2 . LEU A 59  ? 1.4189 1.7316  1.5082  0.1886  -0.1988 0.1177  132 LEU A CD2 
434  N N   . PHE A 60  ? 1.8736 2.0823  1.9380  0.2043  -0.3001 0.1397  133 PHE A N   
435  C CA  . PHE A 60  ? 1.9074 2.0885  1.9734  0.2223  -0.3283 0.1325  133 PHE A CA  
436  C C   . PHE A 60  ? 2.1298 2.2937  2.1871  0.2254  -0.3534 0.1345  133 PHE A C   
437  O O   . PHE A 60  ? 2.4947 2.6555  2.5623  0.2485  -0.3675 0.1196  133 PHE A O   
438  C CB  . PHE A 60  ? 1.9242 2.0745  1.9801  0.2141  -0.3448 0.1439  133 PHE A CB  
439  C CG  . PHE A 60  ? 2.0265 2.1467  2.0846  0.2358  -0.3718 0.1318  133 PHE A CG  
440  C CD1 . PHE A 60  ? 2.1581 2.2887  2.2291  0.2536  -0.3629 0.1154  133 PHE A CD1 
441  C CD2 . PHE A 60  ? 2.5831 2.6638  2.6291  0.2389  -0.4074 0.1364  133 PHE A CD2 
442  C CE1 . PHE A 60  ? 2.2880 2.3924  2.3592  0.2756  -0.3876 0.1011  133 PHE A CE1 
443  C CE2 . PHE A 60  ? 2.5723 2.6224  2.6200  0.2619  -0.4339 0.1223  133 PHE A CE2 
444  C CZ  . PHE A 60  ? 2.2051 2.2681  2.2650  0.2810  -0.4234 0.1033  133 PHE A CZ  
445  N N   . TYR A 61  ? 1.8940 2.0502  1.9329  0.2027  -0.3591 0.1529  134 TYR A N   
446  C CA  . TYR A 61  ? 1.7961 1.9348  1.8242  0.2022  -0.3847 0.1587  134 TYR A CA  
447  C C   . TYR A 61  ? 1.8001 1.9703  1.8381  0.2099  -0.3713 0.1466  134 TYR A C   
448  O O   . TYR A 61  ? 1.8873 2.0510  1.9297  0.2244  -0.3914 0.1402  134 TYR A O   
449  C CB  . TYR A 61  ? 2.1257 2.2492  2.1282  0.1719  -0.3951 0.1850  134 TYR A CB  
450  C CG  . TYR A 61  ? 2.4152 2.5254  2.4030  0.1656  -0.4186 0.1950  134 TYR A CG  
451  C CD1 . TYR A 61  ? 2.4435 2.5147  2.4289  0.1783  -0.4567 0.1966  134 TYR A CD1 
452  C CD2 . TYR A 61  ? 2.3600 2.4955  2.3351  0.1474  -0.4043 0.2025  134 TYR A CD2 
453  C CE1 . TYR A 61  ? 2.0770 2.1354  2.0493  0.1724  -0.4803 0.2075  134 TYR A CE1 
454  C CE2 . TYR A 61  ? 2.4375 2.5624  2.3976  0.1402  -0.4266 0.2128  134 TYR A CE2 
455  C CZ  . TYR A 61  ? 2.3720 2.4584  2.3312  0.1523  -0.4648 0.2165  134 TYR A CZ  
456  O OH  . TYR A 61  ? 2.4851 2.5602  2.4298  0.1452  -0.4890 0.2284  134 TYR A OH  
457  N N   . MET A 62  ? 1.4051 1.6085  1.4471  0.2006  -0.3393 0.1431  135 MET A N   
458  C CA  . MET A 62  ? 1.6519 1.8839  1.7037  0.2061  -0.3269 0.1312  135 MET A CA  
459  C C   . MET A 62  ? 1.7804 2.0282  1.8579  0.2323  -0.3254 0.1116  135 MET A C   
460  O O   . MET A 62  ? 1.5850 1.8481  1.6723  0.2425  -0.3317 0.1030  135 MET A O   
461  C CB  . MET A 62  ? 1.4430 1.7009  1.4922  0.1906  -0.2951 0.1310  135 MET A CB  
462  C CG  . MET A 62  ? 1.4454 1.7280  1.4999  0.1905  -0.2845 0.1209  135 MET A CG  
463  S SD  . MET A 62  ? 2.0340 2.3453  2.1190  0.2082  -0.2650 0.1015  135 MET A SD  
464  C CE  . MET A 62  ? 1.7496 2.0653  1.8365  0.2007  -0.2373 0.1032  135 MET A CE  
465  N N   . GLU A 63  ? 2.1528 2.4014  2.2414  0.2428  -0.3170 0.1049  136 GLU A N   
466  C CA  . GLU A 63  ? 2.4665 2.7336  2.5773  0.2678  -0.3164 0.0866  136 GLU A CA  
467  C C   . GLU A 63  ? 2.3629 2.6088  2.4751  0.2884  -0.3488 0.0805  136 GLU A C   
468  O O   . GLU A 63  ? 2.1283 2.3970  2.2581  0.3091  -0.3531 0.0656  136 GLU A O   
469  C CB  . GLU A 63  ? 2.3082 2.5810  2.4268  0.2721  -0.3002 0.0820  136 GLU A CB  
470  C CG  . GLU A 63  ? 2.0982 2.3867  2.2348  0.2985  -0.3034 0.0639  136 GLU A CG  
471  C CD  . GLU A 63  ? 2.2650 2.6000  2.4218  0.3047  -0.2838 0.0530  136 GLU A CD  
472  O OE1 . GLU A 63  ? 2.3144 2.6641  2.4712  0.2884  -0.2685 0.0589  136 GLU A OE1 
473  O OE2 . GLU A 63  ? 2.3825 2.7404  2.5546  0.3254  -0.2841 0.0383  136 GLU A OE2 
474  N N   . LEU A 64  ? 2.0385 2.2416  2.1330  0.2830  -0.3733 0.0923  137 LEU A N   
475  C CA  . LEU A 64  ? 1.8263 1.9999  1.9207  0.3037  -0.4081 0.0864  137 LEU A CA  
476  C C   . LEU A 64  ? 2.3585 2.5296  2.4507  0.3054  -0.4279 0.0902  137 LEU A C   
477  O O   . LEU A 64  ? 2.2144 2.3758  2.3156  0.3302  -0.4529 0.0791  137 LEU A O   
478  C CB  . LEU A 64  ? 1.6464 1.7698  1.7215  0.2944  -0.4306 0.0998  137 LEU A CB  
479  C CG  . LEU A 64  ? 1.9353 2.0190  2.0101  0.3189  -0.4677 0.0901  137 LEU A CG  
480  C CD1 . LEU A 64  ? 2.0759 2.1819  2.1706  0.3498  -0.4591 0.0630  137 LEU A CD1 
481  C CD2 . LEU A 64  ? 1.7654 1.7964  1.8184  0.3018  -0.4908 0.1081  137 LEU A CD2 
482  N N   . ALA A 65  ? 2.6893 2.8700  2.7695  0.2808  -0.4180 0.1047  138 ALA A N   
483  C CA  . ALA A 65  ? 2.5226 2.7013  2.5982  0.2797  -0.4377 0.1102  138 ALA A CA  
484  C C   . ALA A 65  ? 2.2971 2.5202  2.3969  0.2966  -0.4276 0.0929  138 ALA A C   
485  O O   . ALA A 65  ? 2.2490 2.4720  2.3573  0.3133  -0.4512 0.0879  138 ALA A O   
486  C CB  . ALA A 65  ? 2.2708 2.4460  2.3217  0.2465  -0.4312 0.1312  138 ALA A CB  
487  N N   . LEU A 66  ? 2.0580 2.3197  2.1700  0.2918  -0.3943 0.0846  139 LEU A N   
488  C CA  . LEU A 66  ? 1.4523 1.7596  1.5877  0.3032  -0.3840 0.0707  139 LEU A CA  
489  C C   . LEU A 66  ? 1.8501 2.1720  2.0091  0.3370  -0.3970 0.0525  139 LEU A C   
490  O O   . LEU A 66  ? 2.3274 2.6798  2.5046  0.3508  -0.4044 0.0437  139 LEU A O   
491  C CB  . LEU A 66  ? 1.5531 1.8924  1.6957  0.2901  -0.3482 0.0671  139 LEU A CB  
492  C CG  . LEU A 66  ? 1.7271 2.0587  1.8487  0.2604  -0.3323 0.0801  139 LEU A CG  
493  C CD1 . LEU A 66  ? 1.4100 1.7666  1.5409  0.2523  -0.3001 0.0747  139 LEU A CD1 
494  C CD2 . LEU A 66  ? 2.2884 2.6260  2.4014  0.2494  -0.3428 0.0852  139 LEU A CD2 
495  N N   . GLY A 67  ? 2.1607 2.4639  2.3201  0.3511  -0.4004 0.0458  140 GLY A N   
496  C CA  . GLY A 67  ? 2.0746 2.3922  2.2541  0.3857  -0.4130 0.0254  140 GLY A CA  
497  C C   . GLY A 67  ? 2.1151 2.4067  2.2942  0.4050  -0.4510 0.0234  140 GLY A C   
498  O O   . GLY A 67  ? 1.8440 2.1677  2.0454  0.4304  -0.4599 0.0081  140 GLY A O   
499  N N   . GLN A 68  ? 2.3094 2.5443  2.4640  0.3926  -0.4751 0.0400  141 GLN A N   
500  C CA  . GLN A 68  ? 2.3523 2.5543  2.5041  0.4085  -0.5153 0.0416  141 GLN A CA  
501  C C   . GLN A 68  ? 2.3788 2.6023  2.5340  0.3999  -0.5211 0.0502  141 GLN A C   
502  O O   . GLN A 68  ? 2.5448 2.7549  2.7055  0.4184  -0.5531 0.0483  141 GLN A O   
503  C CB  . GLN A 68  ? 2.4729 2.6066  2.5957  0.3931  -0.5410 0.0607  141 GLN A CB  
504  C CG  . GLN A 68  ? 2.6580 2.7456  2.7797  0.4184  -0.5871 0.0567  141 GLN A CG  
505  C CD  . GLN A 68  ? 2.8270 2.8451  2.9198  0.4002  -0.6139 0.0772  141 GLN A CD  
506  O OE1 . GLN A 68  ? 2.9142 2.8853  3.0043  0.4213  -0.6485 0.0705  141 GLN A OE1 
507  N NE2 . GLN A 68  ? 2.9591 2.9709  3.0299  0.3607  -0.5989 0.1022  141 GLN A NE2 
508  N N   . TYR A 69  ? 1.8649 2.1196  2.0167  0.3731  -0.4927 0.0589  142 TYR A N   
509  C CA  . TYR A 69  ? 1.8648 2.1428  2.0190  0.3635  -0.4969 0.0655  142 TYR A CA  
510  C C   . TYR A 69  ? 1.8606 2.1999  2.0487  0.3841  -0.4860 0.0464  142 TYR A C   
511  O O   . TYR A 69  ? 2.3392 2.6908  2.5432  0.4052  -0.5095 0.0400  142 TYR A O   
512  C CB  . TYR A 69  ? 1.8219 2.1025  1.9541  0.3253  -0.4740 0.0821  142 TYR A CB  
513  C CG  . TYR A 69  ? 1.8781 2.1767  2.0064  0.3118  -0.4805 0.0899  142 TYR A CG  
514  C CD1 . TYR A 69  ? 2.1477 2.4139  2.2570  0.3050  -0.5123 0.1060  142 TYR A CD1 
515  C CD2 . TYR A 69  ? 2.0665 2.4132  2.2089  0.3043  -0.4568 0.0822  142 TYR A CD2 
516  C CE1 . TYR A 69  ? 2.5692 2.8530  2.6733  0.2920  -0.5192 0.1133  142 TYR A CE1 
517  C CE2 . TYR A 69  ? 2.4228 2.7853  2.5605  0.2909  -0.4642 0.0885  142 TYR A CE2 
518  C CZ  . TYR A 69  ? 2.5934 2.9255  2.7116  0.2853  -0.4949 0.1036  142 TYR A CZ  
519  O OH  . TYR A 69  ? 2.4961 2.8450  2.6080  0.2714  -0.5030 0.1101  142 TYR A OH  
520  N N   . HIS A 70  ? 1.8564 2.2360  2.0567  0.3778  -0.4516 0.0381  143 HIS A N   
521  C CA  . HIS A 70  ? 1.8175 2.2609  2.0493  0.3909  -0.4392 0.0236  143 HIS A CA  
522  C C   . HIS A 70  ? 2.0230 2.4891  2.2802  0.4299  -0.4483 0.0024  143 HIS A C   
523  O O   . HIS A 70  ? 2.0452 2.5637  2.3303  0.4476  -0.4502 -0.0093 143 HIS A O   
524  C CB  . HIS A 70  ? 1.7771 2.2528  2.0122  0.3690  -0.4018 0.0242  143 HIS A CB  
525  C CG  . HIS A 70  ? 1.9295 2.3910  2.1425  0.3343  -0.3916 0.0401  143 HIS A CG  
526  N ND1 . HIS A 70  ? 2.5082 2.9244  2.6915  0.3143  -0.3879 0.0532  143 HIS A ND1 
527  C CD2 . HIS A 70  ? 1.7837 2.2723  1.9995  0.3165  -0.3848 0.0438  143 HIS A CD2 
528  C CE1 . HIS A 70  ? 2.4672 2.8848  2.6355  0.2878  -0.3781 0.0625  143 HIS A CE1 
529  N NE2 . HIS A 70  ? 2.2639 2.7219  2.4504  0.2883  -0.3769 0.0567  143 HIS A NE2 
530  N N   . ARG A 71  ? 2.2772 2.7077  2.5252  0.4438  -0.4543 -0.0037 144 ARG A N   
531  C CA  . ARG A 71  ? 2.3079 2.7559  2.5757  0.4828  -0.4634 -0.0271 144 ARG A CA  
532  C C   . ARG A 71  ? 2.3177 2.8418  2.6134  0.4908  -0.4343 -0.0418 144 ARG A C   
533  O O   . ARG A 71  ? 2.3106 2.8800  2.6324  0.5218  -0.4410 -0.0605 144 ARG A O   
534  C CB  . ARG A 71  ? 2.3360 2.7731  2.6143  0.5129  -0.5012 -0.0351 144 ARG A CB  
535  C CG  . ARG A 71  ? 2.3690 2.7299  2.6196  0.5040  -0.5344 -0.0179 144 ARG A CG  
536  C CD  . ARG A 71  ? 2.3997 2.7376  2.6604  0.5430  -0.5750 -0.0314 144 ARG A CD  
537  N NE  . ARG A 71  ? 2.6408 3.0390  2.9341  0.5668  -0.5798 -0.0446 144 ARG A NE  
538  C CZ  . ARG A 71  ? 2.9976 3.3968  3.2943  0.5625  -0.6004 -0.0329 144 ARG A CZ  
539  N NH1 . ARG A 71  ? 2.9344 3.3950  3.2640  0.5852  -0.6038 -0.0459 144 ARG A NH1 
540  N NH2 . ARG A 71  ? 3.1833 3.5260  3.4504  0.5348  -0.6178 -0.0075 144 ARG A NH2 
541  N N   . ASN A 72  ? 2.2723 2.8124  2.5627  0.4625  -0.4026 -0.0326 145 ASN A N   
542  C CA  . ASN A 72  ? 1.9397 2.5484  2.2532  0.4627  -0.3746 -0.0412 145 ASN A CA  
543  C C   . ASN A 72  ? 2.1535 2.7539  2.4568  0.4555  -0.3523 -0.0421 145 ASN A C   
544  O O   . ASN A 72  ? 1.9519 2.4964  2.2304  0.4423  -0.3538 -0.0323 145 ASN A O   
545  C CB  . ASN A 72  ? 1.5791 2.2203  1.8990  0.4330  -0.3588 -0.0279 145 ASN A CB  
546  N N   . GLY A 73  ? 2.2921 2.9522  2.6153  0.4631  -0.3318 -0.0526 146 GLY A N   
547  C CA  . GLY A 73  ? 1.8780 2.5381  2.1936  0.4565  -0.3106 -0.0531 146 GLY A CA  
548  C C   . GLY A 73  ? 1.9367 2.5812  2.2395  0.4186  -0.2889 -0.0329 146 GLY A C   
549  O O   . GLY A 73  ? 1.5227 2.1531  1.8197  0.3970  -0.2899 -0.0198 146 GLY A O   
550  N N   . CYS A 74  ? 2.3762 3.0233  2.6741  0.4117  -0.2697 -0.0316 147 CYS A N   
551  C CA  . CYS A 74  ? 2.4392 3.0714  2.7265  0.3797  -0.2491 -0.0145 147 CYS A CA  
552  C C   . CYS A 74  ? 2.3195 2.9968  2.6227  0.3600  -0.2337 -0.0071 147 CYS A C   
553  O O   . CYS A 74  ? 2.3221 2.9808  2.6161  0.3335  -0.2212 0.0064  147 CYS A O   
554  C CB  . CYS A 74  ? 2.3213 2.9509  2.6026  0.3796  -0.2343 -0.0152 147 CYS A CB  
555  S SG  . CYS A 74  ? 2.9750 3.5672  3.2427  0.4076  -0.2535 -0.0294 147 CYS A SG  
556  N N   . ILE A 75  ? 2.0697 2.8058  2.3966  0.3723  -0.2352 -0.0159 148 ILE A N   
557  C CA  . ILE A 75  ? 1.6692 2.4530  2.0132  0.3519  -0.2222 -0.0079 148 ILE A CA  
558  C C   . ILE A 75  ? 1.8668 2.6544  2.2169  0.3491  -0.2381 -0.0065 148 ILE A C   
559  O O   . ILE A 75  ? 1.8247 2.5942  2.1670  0.3231  -0.2354 0.0054  148 ILE A O   
560  C CB  . ILE A 75  ? 1.2909 2.1494  1.6589  0.3627  -0.2107 -0.0157 148 ILE A CB  
561  C CG1 . ILE A 75  ? 1.5152 2.3683  1.8744  0.3737  -0.2008 -0.0213 148 ILE A CG1 
562  C CG2 . ILE A 75  ? 1.2914 2.1909  1.6729  0.3331  -0.1950 -0.0017 148 ILE A CG2 
563  C CD1 . ILE A 75  ? 1.3431 2.2724  1.7226  0.3887  -0.1908 -0.0316 148 ILE A CD1 
564  N N   . SER A 76  ? 2.1293 2.9409  2.4933  0.3771  -0.2557 -0.0198 149 SER A N   
565  C CA  . SER A 76  ? 2.1450 2.9688  2.5187  0.3773  -0.2727 -0.0188 149 SER A CA  
566  C C   . SER A 76  ? 1.9729 2.7303  2.3205  0.3618  -0.2856 -0.0081 149 SER A C   
567  O O   . SER A 76  ? 2.2705 3.0347  2.6213  0.3514  -0.2958 -0.0028 149 SER A O   
568  C CB  . SER A 76  ? 1.9620 2.8158  2.3542  0.4156  -0.2920 -0.0366 149 SER A CB  
569  O OG  . SER A 76  ? 2.0479 2.8478  2.4225  0.4378  -0.3069 -0.0450 149 SER A OG  
570  N N   . ILE A 77  ? 1.0240 1.7215  1.3457  0.3588  -0.2856 -0.0042 150 ILE A N   
571  C CA  . ILE A 77  ? 1.3964 2.0376  1.6922  0.3421  -0.2961 0.0072  150 ILE A CA  
572  C C   . ILE A 77  ? 1.6241 2.2625  1.9111  0.3086  -0.2793 0.0189  150 ILE A C   
573  O O   . ILE A 77  ? 1.6632 2.2742  1.9333  0.2932  -0.2878 0.0265  150 ILE A O   
574  C CB  . ILE A 77  ? 1.5401 2.1233  1.8118  0.3468  -0.3012 0.0094  150 ILE A CB  
575  C CG1 . ILE A 77  ? 1.2903 1.8236  1.5375  0.3358  -0.3196 0.0204  150 ILE A CG1 
576  C CG2 . ILE A 77  ? 1.0685 1.6407  1.3308  0.3298  -0.2763 0.0152  150 ILE A CG2 
577  C CD1 . ILE A 77  ? 1.1462 1.6249  1.3705  0.3378  -0.3281 0.0253  150 ILE A CD1 
578  N N   . TRP A 78  ? 1.9920 2.6573  2.2890  0.2969  -0.2570 0.0202  151 TRP A N   
579  C CA  . TRP A 78  ? 1.9364 2.5955  2.2260  0.2668  -0.2437 0.0295  151 TRP A CA  
580  C C   . TRP A 78  ? 1.9226 2.6211  2.2282  0.2560  -0.2495 0.0305  151 TRP A C   
581  O O   . TRP A 78  ? 1.9112 2.5924  2.2044  0.2329  -0.2488 0.0365  151 TRP A O   
582  C CB  . TRP A 78  ? 2.0889 2.7569  2.3828  0.2571  -0.2211 0.0326  151 TRP A CB  
583  C CG  . TRP A 78  ? 1.9599 2.5841  2.2350  0.2602  -0.2141 0.0344  151 TRP A CG  
584  C CD1 . TRP A 78  ? 2.1319 2.7600  2.4107  0.2766  -0.2094 0.0301  151 TRP A CD1 
585  C CD2 . TRP A 78  ? 1.8719 2.4456  2.1216  0.2463  -0.2116 0.0409  151 TRP A CD2 
586  N NE1 . TRP A 78  ? 2.3775 2.9596  2.6360  0.2724  -0.2049 0.0348  151 TRP A NE1 
587  C CE2 . TRP A 78  ? 2.2690 2.8196  2.5104  0.2543  -0.2055 0.0416  151 TRP A CE2 
588  C CE3 . TRP A 78  ? 1.9444 2.4935  2.1771  0.2280  -0.2138 0.0454  151 TRP A CE3 
589  C CZ2 . TRP A 78  ? 2.4371 2.9450  2.6566  0.2444  -0.2011 0.0479  151 TRP A CZ2 
590  C CZ3 . TRP A 78  ? 2.1803 2.6876  2.3897  0.2195  -0.2084 0.0499  151 TRP A CZ3 
591  C CH2 . TRP A 78  ? 2.4412 2.9301  2.6455  0.2276  -0.2018 0.0518  151 TRP A CH2 
592  N N   . ARG A 79  ? 2.1024 2.8558  2.4354  0.2726  -0.2557 0.0239  152 ARG A N   
593  C CA  . ARG A 79  ? 2.2012 2.9959  2.5515  0.2637  -0.2647 0.0254  152 ARG A CA  
594  C C   . ARG A 79  ? 2.1539 2.9157  2.4876  0.2613  -0.2853 0.0275  152 ARG A C   
595  O O   . ARG A 79  ? 2.3469 3.1214  2.6823  0.2426  -0.2910 0.0321  152 ARG A O   
596  C CB  . ARG A 79  ? 2.2199 3.0835  2.6036  0.2873  -0.2690 0.0164  152 ARG A CB  
597  C CG  . ARG A 79  ? 2.3063 3.2250  2.7136  0.2778  -0.2771 0.0189  152 ARG A CG  
598  C CD  . ARG A 79  ? 2.4159 3.4010  2.8556  0.3087  -0.2855 0.0074  152 ARG A CD  
599  N NE  . ARG A 79  ? 2.3601 3.3854  2.8139  0.3209  -0.2680 0.0014  152 ARG A NE  
600  C CZ  . ARG A 79  ? 2.1997 3.2874  2.6803  0.3503  -0.2704 -0.0117 152 ARG A CZ  
601  N NH1 . ARG A 79  ? 2.0051 3.1210  2.5037  0.3722  -0.2905 -0.0201 152 ARG A NH1 
602  N NH2 . ARG A 79  ? 2.2517 3.3757  2.7407  0.3589  -0.2531 -0.0169 152 ARG A NH2 
603  N N   . LYS A 80  ? 1.8905 2.6093  2.2067  0.2779  -0.2979 0.0254  153 LYS A N   
604  C CA  . LYS A 80  ? 1.7968 2.4821  2.0942  0.2751  -0.3191 0.0298  153 LYS A CA  
605  C C   . LYS A 80  ? 1.8163 2.4468  2.0785  0.2514  -0.3125 0.0384  153 LYS A C   
606  O O   . LYS A 80  ? 1.8359 2.4386  2.0778  0.2451  -0.3285 0.0439  153 LYS A O   
607  C CB  . LYS A 80  ? 1.6568 2.3253  1.9547  0.3055  -0.3407 0.0246  153 LYS A CB  
608  C CG  . LYS A 80  ? 2.1292 2.8502  2.4608  0.3360  -0.3456 0.0116  153 LYS A CG  
609  C CD  . LYS A 80  ? 2.3028 3.0849  2.6619  0.3337  -0.3511 0.0104  153 LYS A CD  
610  C CE  . LYS A 80  ? 2.0474 2.8881  2.4411  0.3673  -0.3566 -0.0040 153 LYS A CE  
611  N NZ  . LYS A 80  ? 1.8826 2.7482  2.2857  0.3743  -0.3336 -0.0113 153 LYS A NZ  
612  N N   . ILE A 81  ? 1.8571 2.4738  2.1114  0.2388  -0.2900 0.0398  154 ILE A N   
613  C CA  . ILE A 81  ? 1.8975 2.4685  2.1207  0.2187  -0.2817 0.0457  154 ILE A CA  
614  C C   . ILE A 81  ? 1.9841 2.5637  2.2081  0.1955  -0.2642 0.0461  154 ILE A C   
615  O O   . ILE A 81  ? 2.1438 2.7196  2.3568  0.1774  -0.2688 0.0471  154 ILE A O   
616  C CB  . ILE A 81  ? 1.6651 2.2018  1.8748  0.2270  -0.2736 0.0473  154 ILE A CB  
617  C CG1 . ILE A 81  ? 1.5863 2.1058  1.7922  0.2476  -0.2951 0.0478  154 ILE A CG1 
618  C CG2 . ILE A 81  ? 1.5777 2.0767  1.7585  0.2070  -0.2627 0.0527  154 ILE A CG2 
619  C CD1 . ILE A 81  ? 1.6294 2.1249  1.8139  0.2399  -0.3154 0.0550  154 ILE A CD1 
620  N N   . CYS A 82  ? 2.0397 2.6288  2.2755  0.1955  -0.2459 0.0452  155 CYS A N   
621  C CA  . CYS A 82  ? 2.0627 2.6553  2.3008  0.1744  -0.2310 0.0467  155 CYS A CA  
622  C C   . CYS A 82  ? 2.1373 2.7754  2.4054  0.1787  -0.2226 0.0472  155 CYS A C   
623  O O   . CYS A 82  ? 2.3668 3.0029  2.6389  0.1857  -0.2096 0.0480  155 CYS A O   
624  C CB  . CYS A 82  ? 2.1309 2.6801  2.3468  0.1663  -0.2163 0.0478  155 CYS A CB  
625  S SG  . CYS A 82  ? 2.4083 2.9129  2.5872  0.1589  -0.2232 0.0476  155 CYS A SG  
626  N N   . PRO A 83  ? 1.9493 2.6333  2.2390  0.1740  -0.2300 0.0475  156 PRO A N   
627  C CA  . PRO A 83  ? 2.0814 2.8198  2.4008  0.1783  -0.2223 0.0490  156 PRO A CA  
628  C C   . PRO A 83  ? 2.1364 2.8690  2.4568  0.1634  -0.2041 0.0553  156 PRO A C   
629  O O   . PRO A 83  ? 2.6491 3.4142  2.9857  0.1726  -0.1948 0.0565  156 PRO A O   
630  C CB  . PRO A 83  ? 2.0110 2.7956  2.3497  0.1668  -0.2335 0.0509  156 PRO A CB  
631  C CG  . PRO A 83  ? 1.8723 2.6170  2.1876  0.1497  -0.2438 0.0513  156 PRO A CG  
632  C CD  . PRO A 83  ? 1.8824 2.5754  2.1707  0.1635  -0.2460 0.0475  156 PRO A CD  
633  N N   . ILE A 84  ? 1.4229 2.1149  1.7256  0.1416  -0.1996 0.0588  157 ILE A N   
634  C CA  . ILE A 84  ? 1.5527 2.2336  1.8563  0.1282  -0.1850 0.0656  157 ILE A CA  
635  C C   . ILE A 84  ? 1.9830 2.6463  2.2808  0.1458  -0.1737 0.0647  157 ILE A C   
636  O O   . ILE A 84  ? 1.6538 2.3268  1.9601  0.1417  -0.1624 0.0712  157 ILE A O   
637  C CB  . ILE A 84  ? 1.4927 2.1263  1.7765  0.1060  -0.1851 0.0661  157 ILE A CB  
638  C CG1 . ILE A 84  ? 1.6977 2.2886  1.9541  0.1128  -0.1907 0.0576  157 ILE A CG1 
639  C CG2 . ILE A 84  ? 1.6531 2.3097  1.9482  0.0818  -0.1940 0.0706  157 ILE A CG2 
640  C CD1 . ILE A 84  ? 2.1194 2.6640  2.3532  0.0956  -0.1891 0.0540  157 ILE A CD1 
641  N N   . PHE A 85  ? 2.1784 2.8160  2.4613  0.1638  -0.1779 0.0583  158 PHE A N   
642  C CA  . PHE A 85  ? 1.9753 2.5948  2.2516  0.1797  -0.1699 0.0574  158 PHE A CA  
643  C C   . PHE A 85  ? 1.8397 2.4983  2.1327  0.2020  -0.1726 0.0533  158 PHE A C   
644  O O   . PHE A 85  ? 1.9958 2.6396  2.2825  0.2172  -0.1695 0.0509  158 PHE A O   
645  C CB  . PHE A 85  ? 1.6857 2.2574  1.9366  0.1849  -0.1742 0.0543  158 PHE A CB  
646  C CG  . PHE A 85  ? 1.7303 2.2645  1.9628  0.1671  -0.1684 0.0555  158 PHE A CG  
647  C CD1 . PHE A 85  ? 1.7419 2.2714  1.9794  0.1530  -0.1575 0.0594  158 PHE A CD1 
648  C CD2 . PHE A 85  ? 1.9886 2.4928  2.1982  0.1648  -0.1750 0.0525  158 PHE A CD2 
649  C CE1 . PHE A 85  ? 1.7818 2.2750  2.0024  0.1401  -0.1535 0.0574  158 PHE A CE1 
650  C CE2 . PHE A 85  ? 2.2234 2.6972  2.4151  0.1509  -0.1689 0.0504  158 PHE A CE2 
651  C CZ  . PHE A 85  ? 2.2582 2.7253  2.4559  0.1401  -0.1584 0.0515  158 PHE A CZ  
652  N N   . LYS A 86  ? 1.7775 2.4869  2.0913  0.2048  -0.1791 0.0512  159 LYS A N   
653  C CA  . LYS A 86  ? 1.4866 2.2404  1.8177  0.2284  -0.1811 0.0442  159 LYS A CA  
654  C C   . LYS A 86  ? 1.5596 2.3264  1.8949  0.2315  -0.1659 0.0469  159 LYS A C   
655  O O   . LYS A 86  ? 2.2309 3.0094  2.5684  0.2547  -0.1669 0.0384  159 LYS A O   
656  C CB  . LYS A 86  ? 1.4768 2.2933  1.8332  0.2268  -0.1870 0.0432  159 LYS A CB  
657  C CG  . LYS A 86  ? 1.5872 2.4454  1.9598  0.2574  -0.1965 0.0307  159 LYS A CG  
658  C CD  . LYS A 86  ? 2.1910 3.1147  2.5902  0.2541  -0.2025 0.0307  159 LYS A CD  
659  C CE  . LYS A 86  ? 2.1018 3.0646  2.5178  0.2883  -0.2150 0.0158  159 LYS A CE  
660  N NZ  . LYS A 86  ? 1.5975 2.6323  2.0429  0.2859  -0.2204 0.0159  159 LYS A NZ  
661  N N   . GLY A 87  ? 1.6158 2.3780  1.9508  0.2084  -0.1537 0.0583  160 GLY A N   
662  C CA  . GLY A 87  ? 1.7433 2.5157  2.0806  0.2088  -0.1404 0.0635  160 GLY A CA  
663  C C   . GLY A 87  ? 1.3599 2.0914  1.6802  0.2254  -0.1387 0.0585  160 GLY A C   
664  O O   . GLY A 87  ? 1.4048 2.1523  1.7273  0.2345  -0.1314 0.0582  160 GLY A O   
665  N N   . ILE A 88  ? 1.3390 2.0195  1.6412  0.2277  -0.1460 0.0555  161 ILE A N   
666  C CA  . ILE A 88  ? 1.4047 2.0487  1.6915  0.2425  -0.1476 0.0516  161 ILE A CA  
667  C C   . ILE A 88  ? 1.6016 2.2727  1.8953  0.2680  -0.1543 0.0406  161 ILE A C   
668  O O   . ILE A 88  ? 1.3740 2.0450  1.6649  0.2771  -0.1489 0.0392  161 ILE A O   
669  C CB  . ILE A 88  ? 1.6198 2.2171  1.8879  0.2408  -0.1576 0.0505  161 ILE A CB  
670  C CG1 . ILE A 88  ? 1.4790 2.0440  1.7357  0.2197  -0.1485 0.0583  161 ILE A CG1 
671  C CG2 . ILE A 88  ? 1.4951 2.0634  1.7499  0.2575  -0.1652 0.0464  161 ILE A CG2 
672  C CD1 . ILE A 88  ? 1.5164 2.0435  1.7532  0.2162  -0.1564 0.0572  161 ILE A CD1 
673  N N   . GLY A 89  ? 1.5881 2.2838  1.8912  0.2810  -0.1671 0.0316  162 GLY A N   
674  C CA  . GLY A 89  ? 1.3069 2.0297  1.6179  0.3089  -0.1752 0.0177  162 GLY A CA  
675  C C   . GLY A 89  ? 1.2908 2.0651  1.6151  0.3130  -0.1617 0.0159  162 GLY A C   
676  O O   . GLY A 89  ? 1.2971 2.0809  1.6199  0.3349  -0.1642 0.0043  162 GLY A O   
677  N N   . TYR A 90  ? 1.1792 1.9866  1.5150  0.2909  -0.1485 0.0276  163 TYR A N   
678  C CA  . TYR A 90  ? 1.4356 2.2916  1.7812  0.2895  -0.1349 0.0303  163 TYR A CA  
679  C C   . TYR A 90  ? 1.1722 1.9921  1.5023  0.2821  -0.1253 0.0385  163 TYR A C   
680  O O   . TYR A 90  ? 1.1521 1.9927  1.4807  0.2944  -0.1204 0.0334  163 TYR A O   
681  C CB  . TYR A 90  ? 1.4125 2.3164  1.7758  0.2652  -0.1267 0.0431  163 TYR A CB  
682  C CG  . TYR A 90  ? 1.3947 2.3581  1.7791  0.2749  -0.1338 0.0348  163 TYR A CG  
683  C CD1 . TYR A 90  ? 1.2513 2.2395  1.6414  0.3082  -0.1427 0.0150  163 TYR A CD1 
684  C CD2 . TYR A 90  ? 1.4616 2.4563  1.8612  0.2511  -0.1331 0.0461  163 TYR A CD2 
685  C CE1 . TYR A 90  ? 1.5653 2.6118  1.9775  0.3198  -0.1496 0.0065  163 TYR A CE1 
686  C CE2 . TYR A 90  ? 1.3110 2.3656  1.7324  0.2596  -0.1398 0.0393  163 TYR A CE2 
687  C CZ  . TYR A 90  ? 1.5367 2.6189  1.9653  0.2950  -0.1475 0.0193  163 TYR A CZ  
688  O OH  . TYR A 90  ? 1.7712 2.9165  2.2241  0.3061  -0.1547 0.0117  163 TYR A OH  
689  N N   . ALA A 91  ? 1.3307 2.0985  1.6492  0.2633  -0.1231 0.0500  164 ALA A N   
690  C CA  . ALA A 91  ? 1.2209 1.9557  1.5273  0.2566  -0.1147 0.0585  164 ALA A CA  
691  C C   . ALA A 91  ? 1.2872 2.0027  1.5816  0.2790  -0.1204 0.0475  164 ALA A C   
692  O O   . ALA A 91  ? 1.1874 1.9155  1.4794  0.2832  -0.1140 0.0484  164 ALA A O   
693  C CB  . ALA A 91  ? 1.5714 2.2529  1.8673  0.2388  -0.1136 0.0680  164 ALA A CB  
694  N N   . ILE A 92  ? 1.2434 1.9277  1.5292  0.2924  -0.1345 0.0378  165 ILE A N   
695  C CA  . ILE A 92  ? 1.3396 2.0018  1.6137  0.3133  -0.1447 0.0268  165 ILE A CA  
696  C C   . ILE A 92  ? 1.2542 1.9642  1.5356  0.3320  -0.1432 0.0146  165 ILE A C   
697  O O   . ILE A 92  ? 1.5955 2.2989  1.8679  0.3391  -0.1415 0.0118  165 ILE A O   
698  C CB  . ILE A 92  ? 1.2246 1.8559  1.4917  0.3251  -0.1638 0.0185  165 ILE A CB  
699  C CG1 . ILE A 92  ? 1.6951 2.2793  1.9501  0.3062  -0.1643 0.0306  165 ILE A CG1 
700  C CG2 . ILE A 92  ? 1.2862 1.8967  1.5428  0.3480  -0.1784 0.0058  165 ILE A CG2 
701  C CD1 . ILE A 92  ? 2.2339 2.7875  2.4795  0.3136  -0.1837 0.0263  165 ILE A CD1 
702  N N   . CYS A 93  ? 1.2535 2.0166  1.5516  0.3397  -0.1433 0.0069  166 CYS A N   
703  C CA  . CYS A 93  ? 1.3768 2.1966  1.6830  0.3582  -0.1399 -0.0062 166 CYS A CA  
704  C C   . CYS A 93  ? 1.3169 2.1554  1.6197  0.3449  -0.1237 0.0047  166 CYS A C   
705  O O   . CYS A 93  ? 0.9211 1.7594  1.2134  0.3589  -0.1244 -0.0042 166 CYS A O   
706  C CB  . CYS A 93  ? 0.9948 1.8796  1.3233  0.3615  -0.1383 -0.0109 166 CYS A CB  
707  S SG  . CYS A 93  ? 1.7688 2.6454  2.1041  0.3863  -0.1605 -0.0283 166 CYS A SG  
708  N N   . ILE A 94  ? 1.0036 1.8531  1.3135  0.3170  -0.1110 0.0247  167 ILE A N   
709  C CA  . ILE A 94  ? 1.3440 2.2061  1.6505  0.3018  -0.0977 0.0387  167 ILE A CA  
710  C C   . ILE A 94  ? 1.4419 2.2477  1.7299  0.3048  -0.1006 0.0401  167 ILE A C   
711  O O   . ILE A 94  ? 1.0034 1.8213  1.2837  0.3105  -0.0969 0.0384  167 ILE A O   
712  C CB  . ILE A 94  ? 1.4907 2.3579  1.8065  0.2704  -0.0884 0.0611  167 ILE A CB  
713  C CG1 . ILE A 94  ? 0.9785 1.9047  1.3138  0.2649  -0.0873 0.0610  167 ILE A CG1 
714  C CG2 . ILE A 94  ? 0.9100 1.7876  1.2225  0.2545  -0.0774 0.0776  167 ILE A CG2 
715  C CD1 . ILE A 94  ? 1.7184 2.6478  2.0625  0.2322  -0.0815 0.0829  167 ILE A CD1 
716  N N   . ILE A 95  ? 1.4692 2.2162  1.7495  0.3008  -0.1078 0.0429  168 ILE A N   
717  C CA  . ILE A 95  ? 1.5188 2.2152  1.7833  0.3028  -0.1117 0.0448  168 ILE A CA  
718  C C   . ILE A 95  ? 1.2338 1.9327  1.4885  0.3273  -0.1219 0.0270  168 ILE A C   
719  O O   . ILE A 95  ? 1.1220 1.8144  1.3671  0.3288  -0.1201 0.0284  168 ILE A O   
720  C CB  . ILE A 95  ? 1.4150 2.0577  1.6730  0.2964  -0.1190 0.0485  168 ILE A CB  
721  C CG1 . ILE A 95  ? 1.0138 1.6416  1.2755  0.2725  -0.1079 0.0661  168 ILE A CG1 
722  C CG2 . ILE A 95  ? 1.0443 1.6428  1.2866  0.3047  -0.1287 0.0454  168 ILE A CG2 
723  C CD1 . ILE A 95  ? 1.1335 1.7538  1.3922  0.2642  -0.0990 0.0779  168 ILE A CD1 
724  N N   . ALA A 96  ? 1.1742 1.8829  1.4314  0.3476  -0.1341 0.0092  169 ALA A N   
725  C CA  . ALA A 96  ? 1.0974 1.8057  1.3450  0.3739  -0.1466 -0.0112 169 ALA A CA  
726  C C   . ALA A 96  ? 1.0686 1.8277  1.3163  0.3795  -0.1359 -0.0162 169 ALA A C   
727  O O   . ALA A 96  ? 1.0808 1.8255  1.3140  0.3893  -0.1410 -0.0238 169 ALA A O   
728  C CB  . ALA A 96  ? 1.1262 1.8447  1.3805  0.3967  -0.1615 -0.0301 169 ALA A CB  
729  N N   . PHE A 97  ? 1.2505 2.0701  1.5132  0.3708  -0.1214 -0.0103 170 PHE A N   
730  C CA  . PHE A 97  ? 1.4752 2.3513  1.7371  0.3736  -0.1102 -0.0129 170 PHE A CA  
731  C C   . PHE A 97  ? 1.4591 2.3106  1.7077  0.3582  -0.1042 0.0022  170 PHE A C   
732  O O   . PHE A 97  ? 1.3653 2.2414  1.6036  0.3671  -0.1022 -0.0054 170 PHE A O   
733  C CB  . PHE A 97  ? 1.6653 2.6092  1.9461  0.3591  -0.0958 -0.0023 170 PHE A CB  
734  C CG  . PHE A 97  ? 1.4457 2.4469  1.7245  0.3519  -0.0821 0.0040  170 PHE A CG  
735  C CD1 . PHE A 97  ? 1.4403 2.4899  1.7134  0.3766  -0.0823 -0.0181 170 PHE A CD1 
736  C CD2 . PHE A 97  ? 1.1448 2.1506  1.4262  0.3207  -0.0703 0.0319  170 PHE A CD2 
737  C CE1 . PHE A 97  ? 1.0560 2.1625  1.3247  0.3687  -0.0694 -0.0116 170 PHE A CE1 
738  C CE2 . PHE A 97  ? 1.0260 2.0846  1.3040  0.3118  -0.0592 0.0406  170 PHE A CE2 
739  C CZ  . PHE A 97  ? 1.0390 2.1503  1.3100  0.3349  -0.0579 0.0194  170 PHE A CZ  
740  N N   . TYR A 98  ? 1.5645 2.3698  1.8130  0.3363  -0.1018 0.0227  171 TYR A N   
741  C CA  . TYR A 98  ? 1.2350 2.0146  1.4729  0.3241  -0.0981 0.0367  171 TYR A CA  
742  C C   . TYR A 98  ? 1.2650 1.9981  1.4860  0.3391  -0.1126 0.0244  171 TYR A C   
743  O O   . TYR A 98  ? 1.2778 2.0135  1.4870  0.3421  -0.1132 0.0230  171 TYR A O   
744  C CB  . TYR A 98  ? 1.4819 2.2297  1.7267  0.2988  -0.0914 0.0603  171 TYR A CB  
745  C CG  . TYR A 98  ? 1.5295 2.3166  1.7891  0.2799  -0.0796 0.0753  171 TYR A CG  
746  C CD1 . TYR A 98  ? 1.1594 2.0102  1.4231  0.2786  -0.0719 0.0762  171 TYR A CD1 
747  C CD2 . TYR A 98  ? 2.0400 2.8014  2.3084  0.2623  -0.0773 0.0886  171 TYR A CD2 
748  C CE1 . TYR A 98  ? 1.1447 2.0319  1.4219  0.2577  -0.0630 0.0928  171 TYR A CE1 
749  C CE2 . TYR A 98  ? 2.1896 2.9819  2.4706  0.2429  -0.0697 0.1029  171 TYR A CE2 
750  C CZ  . TYR A 98  ? 1.6925 2.5473  1.9784  0.2394  -0.0630 0.1064  171 TYR A CZ  
751  O OH  . TYR A 98  ? 1.5487 2.4349  1.8473  0.2167  -0.0572 0.1235  171 TYR A OH  
752  N N   . ILE A 99  ? 1.1539 1.8450  1.3728  0.3476  -0.1259 0.0161  172 ILE A N   
753  C CA  . ILE A 99  ? 1.1862 1.8277  1.3892  0.3571  -0.1421 0.0084  172 ILE A CA  
754  C C   . ILE A 99  ? 1.3725 2.0316  1.5639  0.3814  -0.1522 -0.0151 172 ILE A C   
755  O O   . ILE A 99  ? 1.2399 1.8757  1.4163  0.3842  -0.1603 -0.0181 172 ILE A O   
756  C CB  . ILE A 99  ? 1.5648 2.1615  1.7672  0.3591  -0.1557 0.0063  172 ILE A CB  
757  C CG1 . ILE A 99  ? 1.4919 2.0720  1.7027  0.3358  -0.1451 0.0273  172 ILE A CG1 
758  C CG2 . ILE A 99  ? 1.0768 1.6228  1.2624  0.3663  -0.1750 0.0004  172 ILE A CG2 
759  C CD1 . ILE A 99  ? 1.9151 2.4601  2.1246  0.3357  -0.1565 0.0263  172 ILE A CD1 
760  N N   . ALA A 100 ? 1.6703 2.3727  1.8687  0.3999  -0.1524 -0.0331 173 ALA A N   
761  C CA  . ALA A 100 ? 1.6761 2.4014  1.8639  0.4269  -0.1612 -0.0595 173 ALA A CA  
762  C C   . ALA A 100 ? 1.6057 2.3722  1.7857  0.4220  -0.1484 -0.0568 173 ALA A C   
763  O O   . ALA A 100 ? 1.6060 2.3868  1.7722  0.4432  -0.1560 -0.0791 173 ALA A O   
764  C CB  . ALA A 100 ? 1.3770 2.1482  1.5778  0.4489  -0.1625 -0.0794 173 ALA A CB  
765  N N   . SER A 101 ? 1.3819 2.1661  1.5691  0.3952  -0.1308 -0.0306 174 SER A N   
766  C CA  . SER A 101 ? 1.3721 2.1966  1.5512  0.3883  -0.1197 -0.0248 174 SER A CA  
767  C C   . SER A 101 ? 1.8318 2.6140  1.9916  0.3870  -0.1296 -0.0238 174 SER A C   
768  O O   . SER A 101 ? 2.1298 2.9413  2.2761  0.3915  -0.1276 -0.0302 174 SER A O   
769  C CB  . SER A 101 ? 1.3559 2.2079  1.5490  0.3594  -0.1011 0.0048  174 SER A CB  
770  O OG  . SER A 101 ? 1.3849 2.2848  1.5952  0.3584  -0.0923 0.0044  174 SER A OG  
771  N N   . TYR A 102 ? 1.4987 2.2161  1.6565  0.3797  -0.1406 -0.0155 175 TYR A N   
772  C CA  . TYR A 102 ? 1.4752 2.1520  1.6172  0.3756  -0.1514 -0.0121 175 TYR A CA  
773  C C   . TYR A 102 ? 1.7715 2.3977  1.9002  0.3932  -0.1757 -0.0321 175 TYR A C   
774  O O   . TYR A 102 ? 2.1762 2.7944  2.2865  0.4053  -0.1884 -0.0480 175 TYR A O   
775  C CB  . TYR A 102 ? 1.6381 2.2861  1.7886  0.3491  -0.1441 0.0180  175 TYR A CB  
776  C CG  . TYR A 102 ? 1.6538 2.2645  1.8163  0.3405  -0.1454 0.0279  175 TYR A CG  
777  C CD1 . TYR A 102 ? 1.4890 2.1195  1.6684  0.3314  -0.1318 0.0379  175 TYR A CD1 
778  C CD2 . TYR A 102 ? 1.4721 2.0290  1.6280  0.3392  -0.1605 0.0288  175 TYR A CD2 
779  C CE1 . TYR A 102 ? 1.7095 2.3071  1.8972  0.3235  -0.1330 0.0456  175 TYR A CE1 
780  C CE2 . TYR A 102 ? 1.4676 1.9953  1.6323  0.3303  -0.1608 0.0383  175 TYR A CE2 
781  C CZ  . TYR A 102 ? 1.4537 2.0017  1.6335  0.3234  -0.1468 0.0456  175 TYR A CZ  
782  O OH  . TYR A 102 ? 1.8487 2.3690  2.0347  0.3149  -0.1473 0.0535  175 TYR A OH  
783  N N   . TYR A 103 ? 1.6099 2.1998  1.7461  0.3934  -0.1841 -0.0309 176 TYR A N   
784  C CA  . TYR A 103 ? 1.6079 2.1396  1.7318  0.4029  -0.2094 -0.0419 176 TYR A CA  
785  C C   . TYR A 103 ? 1.7794 2.3106  1.8864  0.4312  -0.2278 -0.0735 176 TYR A C   
786  O O   . TYR A 103 ? 1.8098 2.2906  1.9009  0.4358  -0.2511 -0.0813 176 TYR A O   
787  C CB  . TYR A 103 ? 1.3413 1.8499  1.4762  0.4026  -0.2145 -0.0390 176 TYR A CB  
788  C CG  . TYR A 103 ? 1.4028 1.8484  1.5259  0.4067  -0.2415 -0.0437 176 TYR A CG  
789  C CD1 . TYR A 103 ? 1.6266 2.0556  1.7409  0.4331  -0.2640 -0.0696 176 TYR A CD1 
790  C CD2 . TYR A 103 ? 1.6263 2.0304  1.7476  0.3840  -0.2455 -0.0216 176 TYR A CD2 
791  C CE1 . TYR A 103 ? 2.1483 2.5153  2.2511  0.4347  -0.2918 -0.0714 176 TYR A CE1 
792  C CE2 . TYR A 103 ? 1.7044 2.0533  1.8145  0.3838  -0.2712 -0.0224 176 TYR A CE2 
793  C CZ  . TYR A 103 ? 1.9763 2.3039  2.0765  0.4081  -0.2953 -0.0463 176 TYR A CZ  
794  O OH  . TYR A 103 ? 1.9796 2.2478  2.0676  0.4059  -0.3240 -0.0448 176 TYR A OH  
795  N N   . ASN A 104 ? 1.8465 2.4339  1.9565  0.4504  -0.2188 -0.0924 177 ASN A N   
796  C CA  . ASN A 104 ? 1.8848 2.4769  1.9779  0.4806  -0.2351 -0.1260 177 ASN A CA  
797  C C   . ASN A 104 ? 1.9195 2.5218  1.9934  0.4777  -0.2344 -0.1293 177 ASN A C   
798  O O   . ASN A 104 ? 1.7265 2.3011  1.7798  0.4959  -0.2559 -0.1529 177 ASN A O   
799  C CB  . ASN A 104 ? 1.6976 2.3540  1.8020  0.5043  -0.2251 -0.1470 177 ASN A CB  
800  C CG  . ASN A 104 ? 1.8268 2.4671  1.9466  0.5153  -0.2342 -0.1521 177 ASN A CG  
801  O OD1 . ASN A 104 ? 2.2629 2.8701  2.3754  0.5409  -0.2584 -0.1760 177 ASN A OD1 
802  N ND2 . ASN A 104 ? 1.8522 2.5137  1.9924  0.4960  -0.2167 -0.1297 177 ASN A ND2 
803  N N   . THR A 105 ? 2.0633 2.7024  2.1425  0.4549  -0.2121 -0.1060 178 THR A N   
804  C CA  . THR A 105 ? 2.0044 2.6578  2.0653  0.4506  -0.2112 -0.1067 178 THR A CA  
805  C C   . THR A 105 ? 1.6688 2.2554  1.7148  0.4407  -0.2323 -0.1008 178 THR A C   
806  O O   . THR A 105 ? 1.6997 2.2832  1.7244  0.4456  -0.2424 -0.1125 178 THR A O   
807  C CB  . THR A 105 ? 1.9227 2.6243  1.9943  0.4258  -0.1852 -0.0783 178 THR A CB  
808  O OG1 . THR A 105 ? 1.9777 2.6444  2.0647  0.4001  -0.1802 -0.0473 178 THR A OG1 
809  C CG2 . THR A 105 ? 1.6037 2.3747  1.6894  0.4320  -0.1657 -0.0820 178 THR A CG2 
810  N N   . ILE A 106 ? 1.2137 1.7497  1.2698  0.4255  -0.2393 -0.0823 179 ILE A N   
811  C CA  . ILE A 106 ? 1.3490 1.8239  1.3926  0.4148  -0.2611 -0.0759 179 ILE A CA  
812  C C   . ILE A 106 ? 1.7059 2.1430  1.7281  0.4396  -0.2910 -0.1079 179 ILE A C   
813  O O   . ILE A 106 ? 2.2058 2.6183  2.2075  0.4397  -0.3084 -0.1161 179 ILE A O   
814  C CB  . ILE A 106 ? 1.2310 1.6677  1.2903  0.3942  -0.2613 -0.0503 179 ILE A CB  
815  C CG1 . ILE A 106 ? 1.2727 1.7465  1.3533  0.3746  -0.2324 -0.0235 179 ILE A CG1 
816  C CG2 . ILE A 106 ? 1.3533 1.7375  1.4020  0.3782  -0.2812 -0.0385 179 ILE A CG2 
817  C CD1 . ILE A 106 ? 1.6071 2.0520  1.7030  0.3577  -0.2294 -0.0023 179 ILE A CD1 
818  N N   . MET A 107 ? 1.6740 2.1044  1.7008  0.4614  -0.2993 -0.1271 180 MET A N   
819  C CA  . MET A 107 ? 1.7966 2.1937  1.8042  0.4903  -0.3286 -0.1614 180 MET A CA  
820  C C   . MET A 107 ? 1.7492 2.1888  1.7391  0.5116  -0.3260 -0.1895 180 MET A C   
821  O O   . MET A 107 ? 2.0560 2.4612  2.0229  0.5302  -0.3522 -0.2163 180 MET A O   
822  C CB  . MET A 107 ? 2.0906 2.4828  2.1099  0.5121  -0.3356 -0.1764 180 MET A CB  
823  C CG  . MET A 107 ? 1.8574 2.2010  1.8885  0.4938  -0.3441 -0.1527 180 MET A CG  
824  S SD  . MET A 107 ? 2.3809 2.7209  2.4241  0.5220  -0.3554 -0.1721 180 MET A SD  
825  C CE  . MET A 107 ? 1.7634 2.1998  1.8294  0.5272  -0.3163 -0.1722 180 MET A CE  
826  N N   . ALA A 108 ? 1.3249 1.8392  1.3240  0.5090  -0.2959 -0.1843 181 ALA A N   
827  C CA  . ALA A 108 ? 1.3410 1.9029  1.3212  0.5251  -0.2911 -0.2075 181 ALA A CA  
828  C C   . ALA A 108 ? 1.3270 1.8617  1.2857  0.5082  -0.3016 -0.1995 181 ALA A C   
829  O O   . ALA A 108 ? 1.8200 2.3519  1.7528  0.5264  -0.3169 -0.2277 181 ALA A O   
830  C CB  . ALA A 108 ? 1.2713 1.9207  1.2665  0.5199  -0.2569 -0.1973 181 ALA A CB  
831  N N   . TRP A 109 ? 1.5640 2.0795  1.5332  0.4745  -0.2944 -0.1622 182 TRP A N   
832  C CA  . TRP A 109 ? 1.6750 2.1612  1.6273  0.4567  -0.3070 -0.1517 182 TRP A CA  
833  C C   . TRP A 109 ? 1.8825 2.2940  1.8154  0.4658  -0.3442 -0.1702 182 TRP A C   
834  O O   . TRP A 109 ? 1.7261 2.1222  1.6331  0.4714  -0.3622 -0.1874 182 TRP A O   
835  C CB  . TRP A 109 ? 1.6760 2.1560  1.6480  0.4216  -0.2930 -0.1087 182 TRP A CB  
836  C CG  . TRP A 109 ? 1.7107 2.2544  1.7010  0.4099  -0.2604 -0.0878 182 TRP A CG  
837  C CD1 . TRP A 109 ? 1.6863 2.2959  1.6728  0.4212  -0.2429 -0.0991 182 TRP A CD1 
838  C CD2 . TRP A 109 ? 1.4339 1.9807  1.4485  0.3839  -0.2428 -0.0516 182 TRP A CD2 
839  N NE1 . TRP A 109 ? 1.5075 2.1572  1.5142  0.4014  -0.2173 -0.0698 182 TRP A NE1 
840  C CE2 . TRP A 109 ? 1.4423 2.0521  1.4665  0.3799  -0.2172 -0.0419 182 TRP A CE2 
841  C CE3 . TRP A 109 ? 1.2072 1.7113  1.2360  0.3639  -0.2466 -0.0270 182 TRP A CE3 
842  C CZ2 . TRP A 109 ? 1.1715 1.7952  1.2184  0.3578  -0.1979 -0.0097 182 TRP A CZ2 
843  C CZ3 . TRP A 109 ? 1.1596 1.6827  1.2112  0.3444  -0.2253 0.0026  182 TRP A CZ3 
844  C CH2 . TRP A 109 ? 1.4071 1.9858  1.4674  0.3420  -0.2023 0.0105  182 TRP A CH2 
845  N N   . ALA A 110 ? 1.9394 2.3023  1.8833  0.4660  -0.3579 -0.1662 183 ALA A N   
846  C CA  . ALA A 110 ? 1.8808 2.1679  1.8067  0.4721  -0.3964 -0.1806 183 ALA A CA  
847  C C   . ALA A 110 ? 1.9789 2.2606  1.8811  0.5101  -0.4165 -0.2271 183 ALA A C   
848  O O   . ALA A 110 ? 2.2340 2.4605  2.1120  0.5153  -0.4492 -0.2438 183 ALA A O   
849  C CB  . ALA A 110 ? 1.8591 2.1016  1.8012  0.4652  -0.4061 -0.1662 183 ALA A CB  
850  N N   . LEU A 111 ? 1.7613 2.1011  1.6701  0.5372  -0.3983 -0.2490 184 LEU A N   
851  C CA  . LEU A 111 ? 2.1859 2.5324  2.0741  0.5775  -0.4140 -0.2963 184 LEU A CA  
852  C C   . LEU A 111 ? 2.1322 2.5101  1.9941  0.5804  -0.4115 -0.3117 184 LEU A C   
853  O O   . LEU A 111 ? 1.7896 2.1346  1.6236  0.6028  -0.4392 -0.3463 184 LEU A O   
854  C CB  . LEU A 111 ? 2.0042 2.4135  1.9109  0.6045  -0.3931 -0.3130 184 LEU A CB  
855  C CG  . LEU A 111 ? 2.0111 2.4450  1.9010  0.6508  -0.4040 -0.3642 184 LEU A CG  
856  C CD1 . LEU A 111 ? 1.8076 2.1532  1.6798  0.6735  -0.4489 -0.3919 184 LEU A CD1 
857  C CD2 . LEU A 111 ? 1.7319 2.2380  1.6461  0.6725  -0.3801 -0.3742 184 LEU A CD2 
858  N N   . TYR A 112 ? 1.9155 2.3554  1.7849  0.5581  -0.3803 -0.2869 185 TYR A N   
859  C CA  . TYR A 112 ? 1.6985 2.1668  1.5420  0.5556  -0.3787 -0.2960 185 TYR A CA  
860  C C   . TYR A 112 ? 1.8362 2.2323  1.6597  0.5371  -0.4090 -0.2890 185 TYR A C   
861  O O   . TYR A 112 ? 1.9255 2.3175  1.7185  0.5461  -0.4243 -0.3124 185 TYR A O   
862  C CB  . TYR A 112 ? 1.5572 2.0998  1.4146  0.5312  -0.3419 -0.2643 185 TYR A CB  
863  C CG  . TYR A 112 ? 1.5081 2.0985  1.3388  0.5326  -0.3360 -0.2758 185 TYR A CG  
864  C CD1 . TYR A 112 ? 1.7676 2.4305  1.5873  0.5591  -0.3214 -0.3052 185 TYR A CD1 
865  C CD2 . TYR A 112 ? 1.5208 2.0884  1.3373  0.5069  -0.3451 -0.2568 185 TYR A CD2 
866  C CE1 . TYR A 112 ? 2.2215 2.9320  2.0142  0.5593  -0.3158 -0.3154 185 TYR A CE1 
867  C CE2 . TYR A 112 ? 1.5614 2.1732  1.3517  0.5071  -0.3409 -0.2665 185 TYR A CE2 
868  C CZ  . TYR A 112 ? 1.9473 2.6301  1.7246  0.5330  -0.3261 -0.2957 185 TYR A CZ  
869  O OH  . TYR A 112 ? 1.9640 2.6944  1.7126  0.5321  -0.3217 -0.3049 185 TYR A OH  
870  N N   . TYR A 113 ? 1.9495 2.2911  1.7893  0.5104  -0.4184 -0.2573 186 TYR A N   
871  C CA  . TYR A 113 ? 2.3480 2.6193  2.1712  0.4917  -0.4503 -0.2498 186 TYR A CA  
872  C C   . TYR A 113 ? 2.2813 2.4835  2.0816  0.5177  -0.4910 -0.2868 186 TYR A C   
873  O O   . TYR A 113 ? 2.0597 2.2173  1.8327  0.5151  -0.5205 -0.3000 186 TYR A O   
874  C CB  . TYR A 113 ? 2.2032 2.4444  2.0517  0.4558  -0.4471 -0.2048 186 TYR A CB  
875  C CG  . TYR A 113 ? 1.8929 2.1681  1.7511  0.4235  -0.4269 -0.1690 186 TYR A CG  
876  C CD1 . TYR A 113 ? 1.9162 2.2568  1.7972  0.4155  -0.3895 -0.1477 186 TYR A CD1 
877  C CD2 . TYR A 113 ? 1.9759 2.2166  1.8213  0.4006  -0.4475 -0.1560 186 TYR A CD2 
878  C CE1 . TYR A 113 ? 2.1207 2.4887  2.0114  0.3880  -0.3736 -0.1152 186 TYR A CE1 
879  C CE2 . TYR A 113 ? 2.4785 2.7515  2.3350  0.3730  -0.4305 -0.1234 186 TYR A CE2 
880  C CZ  . TYR A 113 ? 2.2801 2.6154  2.1591  0.3680  -0.3939 -0.1036 186 TYR A CZ  
881  O OH  . TYR A 113 ? 1.9625 2.3266  1.8532  0.3426  -0.3795 -0.0715 186 TYR A OH  
882  N N   . LEU A 114 ? 1.8786 2.0691  1.6898  0.5428  -0.4952 -0.3038 187 LEU A N   
883  C CA  . LEU A 114 ? 2.0747 2.1944  1.8662  0.5695  -0.5365 -0.3384 187 LEU A CA  
884  C C   . LEU A 114 ? 2.1787 2.3152  1.9387  0.6056  -0.5477 -0.3880 187 LEU A C   
885  O O   . LEU A 114 ? 2.5075 2.5791  2.2389  0.6143  -0.5862 -0.4118 187 LEU A O   
886  C CB  . LEU A 114 ? 2.1620 2.2713  1.9749  0.5889  -0.5371 -0.3434 187 LEU A CB  
887  C CG  . LEU A 114 ? 2.0664 2.1009  1.8628  0.6198  -0.5811 -0.3785 187 LEU A CG  
888  C CD1 . LEU A 114 ? 2.0003 1.9399  1.7824  0.5923  -0.6212 -0.3608 187 LEU A CD1 
889  C CD2 . LEU A 114 ? 1.8519 1.8915  1.6724  0.6405  -0.5769 -0.3823 187 LEU A CD2 
890  N N   . ILE A 115 ? 1.8341 2.0583  1.5981  0.6263  -0.5152 -0.4043 188 ILE A N   
891  C CA  . ILE A 115 ? 2.0499 2.3022  1.7835  0.6619  -0.5221 -0.4527 188 ILE A CA  
892  C C   . ILE A 115 ? 2.1290 2.3803  1.8337  0.6421  -0.5284 -0.4499 188 ILE A C   
893  O O   . ILE A 115 ? 2.3237 2.5687  1.9947  0.6677  -0.5474 -0.4915 188 ILE A O   
894  C CB  . ILE A 115 ? 1.9235 2.2799  1.6703  0.6861  -0.4837 -0.4675 188 ILE A CB  
895  C CG1 . ILE A 115 ? 2.0896 2.5201  1.8520  0.6512  -0.4429 -0.4264 188 ILE A CG1 
896  C CG2 . ILE A 115 ? 1.8609 2.2188  1.6365  0.7069  -0.4801 -0.4720 188 ILE A CG2 
897  C CD1 . ILE A 115 ? 1.7727 2.3082  1.5475  0.6685  -0.4058 -0.4356 188 ILE A CD1 
898  N N   . SER A 116 ? 1.9688 2.2271  1.6859  0.5983  -0.5137 -0.4031 189 SER A N   
899  C CA  . SER A 116 ? 2.3160 2.5689  2.0089  0.5755  -0.5222 -0.3949 189 SER A CA  
900  C C   . SER A 116 ? 2.3567 2.5110  2.0352  0.5572  -0.5656 -0.3891 189 SER A C   
901  O O   . SER A 116 ? 2.3330 2.4740  1.9900  0.5380  -0.5789 -0.3841 189 SER A O   
902  C CB  . SER A 116 ? 2.1791 2.4904  1.8939  0.5384  -0.4866 -0.3469 189 SER A CB  
903  O OG  . SER A 116 ? 1.9105 2.3125  1.6367  0.5510  -0.4485 -0.3493 189 SER A OG  
904  N N   . SER A 117 ? 2.4422 2.5288  2.1318  0.5609  -0.5890 -0.3881 190 SER A N   
905  C CA  . SER A 117 ? 2.7059 2.6978  2.3839  0.5400  -0.6317 -0.3784 190 SER A CA  
906  C C   . SER A 117 ? 2.7865 2.7114  2.4284  0.5719  -0.6770 -0.4281 190 SER A C   
907  O O   . SER A 117 ? 3.0618 2.9007  2.6912  0.5558  -0.7181 -0.4230 190 SER A O   
908  C CB  . SER A 117 ? 2.5199 2.4727  2.2286  0.5213  -0.6344 -0.3448 190 SER A CB  
909  O OG  . SER A 117 ? 2.9036 2.7693  2.6020  0.4967  -0.6755 -0.3308 190 SER A OG  
910  N N   . PHE A 118 ? 2.5955 2.5580  2.2204  0.6164  -0.6716 -0.4761 191 PHE A N   
911  C CA  . PHE A 118 ? 2.7379 2.6381  2.3280  0.6528  -0.7146 -0.5290 191 PHE A CA  
912  C C   . PHE A 118 ? 2.6016 2.4883  2.1514  0.6476  -0.7349 -0.5489 191 PHE A C   
913  O O   . PHE A 118 ? 3.0717 2.8996  2.5883  0.6758  -0.7744 -0.5941 191 PHE A O   
914  C CB  . PHE A 118 ? 2.8051 2.7553  2.3958  0.7071  -0.7006 -0.5756 191 PHE A CB  
915  C CG  . PHE A 118 ? 2.6725 2.6211  2.2984  0.7185  -0.6916 -0.5645 191 PHE A CG  
916  C CD1 . PHE A 118 ? 2.5962 2.4726  2.2400  0.6901  -0.7114 -0.5285 191 PHE A CD1 
917  C CD2 . PHE A 118 ? 2.4916 2.5147  2.1324  0.7563  -0.6634 -0.5892 191 PHE A CD2 
918  C CE1 . PHE A 118 ? 2.4552 2.3309  2.1294  0.6996  -0.7040 -0.5179 191 PHE A CE1 
919  C CE2 . PHE A 118 ? 2.4808 2.5035  2.1541  0.7660  -0.6563 -0.5787 191 PHE A CE2 
920  C CZ  . PHE A 118 ? 2.4352 2.3826  2.1243  0.7379  -0.6769 -0.5433 191 PHE A CZ  
921  N N   . THR A 119 ? 2.4256 2.3628  1.9768  0.6133  -0.7107 -0.5174 192 THR A N   
922  C CA  . THR A 119 ? 2.5979 2.5242  2.1113  0.6040  -0.7301 -0.5318 192 THR A CA  
923  C C   . THR A 119 ? 2.5785 2.4076  2.0834  0.5684  -0.7742 -0.5098 192 THR A C   
924  O O   . THR A 119 ? 2.5853 2.3858  2.1199  0.5358  -0.7744 -0.4651 192 THR A O   
925  C CB  . THR A 119 ? 2.7952 2.8148  2.3147  0.5803  -0.6885 -0.5039 192 THR A CB  
926  O OG1 . THR A 119 ? 3.0368 3.1480  2.5733  0.6045  -0.6448 -0.5117 192 THR A OG1 
927  C CG2 . THR A 119 ? 2.8740 2.8989  2.3494  0.5816  -0.7050 -0.5299 192 THR A CG2 
928  N N   . ASP A 120 ? 2.9809 2.7606  2.4436  0.5745  -0.8127 -0.5421 193 ASP A N   
929  C CA  . ASP A 120 ? 3.1026 2.7922  2.5542  0.5380  -0.8575 -0.5215 193 ASP A CA  
930  C C   . ASP A 120 ? 3.1145 2.8386  2.5887  0.4842  -0.8372 -0.4622 193 ASP A C   
931  O O   . ASP A 120 ? 3.2427 2.9120  2.7313  0.4467  -0.8587 -0.4251 193 ASP A O   
932  C CB  . ASP A 120 ? 3.3342 2.9717  2.7340  0.5546  -0.9009 -0.5693 193 ASP A CB  
933  C CG  . ASP A 120 ? 3.3731 3.0873  2.7496  0.5545  -0.8781 -0.5806 193 ASP A CG  
934  O OD1 . ASP A 120 ? 3.5795 3.3922  2.9729  0.5645  -0.8286 -0.5741 193 ASP A OD1 
935  O OD2 . ASP A 120 ? 3.2341 2.9096  2.5746  0.5426  -0.9111 -0.5947 193 ASP A OD2 
936  N N   . GLN A 121 ? 2.9704 2.7867  2.4486  0.4798  -0.7968 -0.4520 194 GLN A N   
937  C CA  . GLN A 121 ? 2.6626 2.5223  2.1664  0.4343  -0.7729 -0.3967 194 GLN A CA  
938  C C   . GLN A 121 ? 2.5054 2.4447  2.0495  0.4365  -0.7199 -0.3701 194 GLN A C   
939  O O   . GLN A 121 ? 2.4760 2.4847  2.0155  0.4641  -0.6897 -0.3918 194 GLN A O   
940  C CB  . GLN A 121 ? 2.9145 2.8112  2.3897  0.4231  -0.7732 -0.4020 194 GLN A CB  
941  C CG  . GLN A 121 ? 3.1792 2.9964  2.6156  0.4129  -0.8270 -0.4221 194 GLN A CG  
942  C CD  . GLN A 121 ? 3.2770 3.0321  2.7326  0.3670  -0.8540 -0.3778 194 GLN A CD  
943  O OE1 . GLN A 121 ? 3.1983 2.9878  2.6940  0.3367  -0.8279 -0.3275 194 GLN A OE1 
944  N NE2 . GLN A 121 ? 3.3515 3.0156  2.7784  0.3614  -0.9075 -0.3967 194 GLN A NE2 
945  N N   . LEU A 122 ? 2.9102 2.8406  2.4925  0.4068  -0.7096 -0.3237 195 LEU A N   
946  C CA  . LEU A 122 ? 2.7967 2.7907  2.4172  0.4086  -0.6638 -0.2992 195 LEU A CA  
947  C C   . LEU A 122 ? 2.6403 2.7204  2.2696  0.3944  -0.6265 -0.2763 195 LEU A C   
948  O O   . LEU A 122 ? 3.0716 3.1540  2.6930  0.3671  -0.6354 -0.2572 195 LEU A O   
949  C CB  . LEU A 122 ? 2.5860 2.5459  2.2420  0.3802  -0.6647 -0.2570 195 LEU A CB  
950  C CG  . LEU A 122 ? 2.6219 2.4941  2.2716  0.3885  -0.7032 -0.2715 195 LEU A CG  
951  C CD1 . LEU A 122 ? 2.9981 2.7954  2.6271  0.3614  -0.7503 -0.2652 195 LEU A CD1 
952  C CD2 . LEU A 122 ? 2.5714 2.4415  2.2587  0.3780  -0.6865 -0.2402 195 LEU A CD2 
953  N N   . PRO A 123 ? 2.0707 2.2222  1.7165  0.4113  -0.5862 -0.2765 196 PRO A N   
954  C CA  . PRO A 123 ? 2.0720 2.3043  1.7206  0.4004  -0.5541 -0.2585 196 PRO A CA  
955  C C   . PRO A 123 ? 2.3031 2.5493  1.9824  0.3597  -0.5409 -0.2042 196 PRO A C   
956  O O   . PRO A 123 ? 2.4315 2.7173  2.1040  0.3435  -0.5332 -0.1889 196 PRO A O   
957  C CB  . PRO A 123 ? 2.1235 2.4202  1.7866  0.4263  -0.5175 -0.2692 196 PRO A CB  
958  C CG  . PRO A 123 ? 2.0402 2.2931  1.6943  0.4606  -0.5361 -0.3091 196 PRO A CG  
959  C CD  . PRO A 123 ? 2.1206 2.2831  1.7786  0.4432  -0.5717 -0.2975 196 PRO A CD  
960  N N   . TRP A 124 ? 2.0979 2.3153  1.8104  0.3436  -0.5384 -0.1753 197 TRP A N   
961  C CA  . TRP A 124 ? 1.8618 2.0985  1.6067  0.3089  -0.5230 -0.1257 197 TRP A CA  
962  C C   . TRP A 124 ? 1.7650 1.9564  1.5044  0.2792  -0.5549 -0.1080 197 TRP A C   
963  O O   . TRP A 124 ? 1.8796 2.0850  1.6475  0.2507  -0.5455 -0.0674 197 TRP A O   
964  C CB  . TRP A 124 ? 1.6171 1.8520  1.4003  0.3049  -0.5029 -0.1025 197 TRP A CB  
965  C CG  . TRP A 124 ? 1.8571 2.0227  1.6405  0.3085  -0.5288 -0.1121 197 TRP A CG  
966  C CD1 . TRP A 124 ? 2.2003 2.3152  1.9929  0.2820  -0.5520 -0.0891 197 TRP A CD1 
967  C CD2 . TRP A 124 ? 1.8874 2.0297  1.6626  0.3396  -0.5343 -0.1448 197 TRP A CD2 
968  N NE1 . TRP A 124 ? 2.1114 2.1695  1.8999  0.2930  -0.5730 -0.1044 197 TRP A NE1 
969  C CE2 . TRP A 124 ? 1.8683 1.9403  1.6467  0.3296  -0.5631 -0.1391 197 TRP A CE2 
970  C CE3 . TRP A 124 ? 1.7788 1.9558  1.5452  0.3745  -0.5184 -0.1775 197 TRP A CE3 
971  C CZ2 . TRP A 124 ? 1.6910 1.7222  1.4637  0.3544  -0.5778 -0.1650 197 TRP A CZ2 
972  C CZ3 . TRP A 124 ? 1.7689 1.9092  1.5315  0.4007  -0.5318 -0.2047 197 TRP A CZ3 
973  C CH2 . TRP A 124 ? 1.6920 1.7577  1.4575  0.3911  -0.5620 -0.1983 197 TRP A CH2 
974  N N   . THR A 125 ? 1.8048 1.9430  1.5091  0.2853  -0.5931 -0.1376 198 THR A N   
975  C CA  . THR A 125 ? 1.7712 1.8695  1.4676  0.2546  -0.6258 -0.1211 198 THR A CA  
976  C C   . THR A 125 ? 1.7690 1.9148  1.4539  0.2416  -0.6203 -0.1114 198 THR A C   
977  O O   . THR A 125 ? 2.0096 2.1811  1.7198  0.2127  -0.6115 -0.0713 198 THR A O   
978  C CB  . THR A 125 ? 1.9608 1.9793  1.6219  0.2647  -0.6722 -0.1565 198 THR A CB  
979  O OG1 . THR A 125 ? 1.8590 1.8326  1.5321  0.2758  -0.6788 -0.1621 198 THR A OG1 
980  C CG2 . THR A 125 ? 2.4852 2.4615  2.1390  0.2289  -0.7082 -0.1368 198 THR A CG2 
981  N N   . SER A 126 ? 2.1368 2.2973  1.7835  0.2638  -0.6258 -0.1483 199 SER A N   
982  C CA  . SER A 126 ? 2.4172 2.6209  2.0466  0.2523  -0.6242 -0.1422 199 SER A CA  
983  C C   . SER A 126 ? 2.0610 2.3470  1.7145  0.2514  -0.5799 -0.1167 199 SER A C   
984  O O   . SER A 126 ? 1.8354 2.1494  1.5074  0.2686  -0.5506 -0.1179 199 SER A O   
985  C CB  . SER A 126 ? 2.6061 2.8001  2.1831  0.2772  -0.6449 -0.1927 199 SER A CB  
986  O OG  . SER A 126 ? 2.8347 2.9465  2.3871  0.2760  -0.6907 -0.2158 199 SER A OG  
987  N N   . CYS A 127 ? 2.2822 2.6053  1.9353  0.2300  -0.5774 -0.0923 200 CYS A N   
988  C CA  . CYS A 127 ? 2.0820 2.4791  1.7548  0.2259  -0.5411 -0.0653 200 CYS A CA  
989  C C   . CYS A 127 ? 2.1719 2.6202  1.8084  0.2437  -0.5311 -0.0908 200 CYS A C   
990  O O   . CYS A 127 ? 1.6709 2.1818  1.3196  0.2400  -0.5025 -0.0690 200 CYS A O   
991  C CB  . CYS A 127 ? 1.6606 2.0738  1.3586  0.1922  -0.5431 -0.0195 200 CYS A CB  
992  S SG  . CYS A 127 ? 3.3518 3.7625  3.1111  0.1743  -0.5235 0.0264  200 CYS A SG  
993  N N   . LYS A 128 ? 2.5121 2.9365  2.1036  0.2627  -0.5546 -0.1361 201 LYS A N   
994  C CA  . LYS A 128 ? 2.3010 2.7790  1.8547  0.2812  -0.5449 -0.1638 201 LYS A CA  
995  C C   . LYS A 128 ? 2.3689 2.8670  1.9206  0.3157  -0.5237 -0.1952 201 LYS A C   
996  O O   . LYS A 128 ? 2.8572 3.3093  2.3909  0.3402  -0.5425 -0.2355 201 LYS A O   
997  C CB  . LYS A 128 ? 2.3870 2.8330  1.8907  0.2844  -0.5821 -0.1984 201 LYS A CB  
998  N N   . ASN A 129 ? 2.0819 2.6496  1.6518  0.3175  -0.4864 -0.1767 202 ASN A N   
999  C CA  . ASN A 129 ? 2.2859 2.8857  1.8608  0.3463  -0.4620 -0.1991 202 ASN A CA  
1000 C C   . ASN A 129 ? 2.1409 2.8298  1.7189  0.3411  -0.4278 -0.1791 202 ASN A C   
1001 O O   . ASN A 129 ? 2.3008 3.0169  1.8856  0.3143  -0.4224 -0.1421 202 ASN A O   
1002 C CB  . ASN A 129 ? 2.4199 2.9838  2.0373  0.3476  -0.4533 -0.1844 202 ASN A CB  
1003 C CG  . ASN A 129 ? 2.2876 2.7644  1.9005  0.3535  -0.4875 -0.2046 202 ASN A CG  
1004 O OD1 . ASN A 129 ? 2.0778 2.5291  1.6700  0.3834  -0.5006 -0.2479 202 ASN A OD1 
1005 N ND2 . ASN A 129 ? 2.3277 2.7597  1.9607  0.3248  -0.5032 -0.1726 202 ASN A ND2 
1006 N N   . SER A 130 ? 2.0950 2.8305  1.6685  0.3667  -0.4060 -0.2030 203 SER A N   
1007 C CA  . SER A 130 ? 2.1823 3.0046  1.7601  0.3600  -0.3733 -0.1822 203 SER A CA  
1008 C C   . SER A 130 ? 2.1101 2.9404  1.7368  0.3359  -0.3513 -0.1304 203 SER A C   
1009 O O   . SER A 130 ? 2.2751 3.1595  1.9081  0.3166  -0.3333 -0.0973 203 SER A O   
1010 C CB  . SER A 130 ? 2.2760 3.1499  1.8397  0.3928  -0.3558 -0.2206 203 SER A CB  
1011 O OG  . SER A 130 ? 1.8674 2.7094  1.4601  0.4100  -0.3510 -0.2305 203 SER A OG  
1012 N N   . TRP A 131 ? 1.9634 2.7402  1.6237  0.3367  -0.3535 -0.1227 204 TRP A N   
1013 C CA  . TRP A 131 ? 1.9050 2.6873  1.6109  0.3183  -0.3323 -0.0794 204 TRP A CA  
1014 C C   . TRP A 131 ? 1.8354 2.5819  1.5634  0.2893  -0.3434 -0.0399 204 TRP A C   
1015 O O   . TRP A 131 ? 1.7722 2.5278  1.5363  0.2735  -0.3262 -0.0027 204 TRP A O   
1016 C CB  . TRP A 131 ? 1.9950 2.7456  1.7260  0.3350  -0.3263 -0.0917 204 TRP A CB  
1017 C CG  . TRP A 131 ? 1.8827 2.5557  1.6082  0.3440  -0.3557 -0.1142 204 TRP A CG  
1018 C CD1 . TRP A 131 ? 1.6534 2.2683  1.4016  0.3259  -0.3699 -0.0912 204 TRP A CD1 
1019 C CD2 . TRP A 131 ? 1.7437 2.3890  1.4388  0.3728  -0.3761 -0.1635 204 TRP A CD2 
1020 N NE1 . TRP A 131 ? 1.6080 2.1596  1.3410  0.3384  -0.3986 -0.1203 204 TRP A NE1 
1021 C CE2 . TRP A 131 ? 1.6755 2.2405  1.3760  0.3683  -0.4041 -0.1656 204 TRP A CE2 
1022 C CE3 . TRP A 131 ? 1.9415 2.6235  1.6056  0.4027  -0.3741 -0.2064 204 TRP A CE3 
1023 C CZ2 . TRP A 131 ? 1.7551 2.2685  1.4304  0.3919  -0.4324 -0.2080 204 TRP A CZ2 
1024 C CZ3 . TRP A 131 ? 2.4939 3.1267  2.1339  0.4297  -0.4009 -0.2517 204 TRP A CZ3 
1025 C CH2 . TRP A 131 ? 2.3482 2.8940  1.9936  0.4239  -0.4309 -0.2518 204 TRP A CH2 
1026 N N   . ASN A 132 ? 1.5733 2.2808  1.2814  0.2823  -0.3721 -0.0475 205 ASN A N   
1027 C CA  . ASN A 132 ? 1.5267 2.2031  1.2583  0.2556  -0.3838 -0.0112 205 ASN A CA  
1028 C C   . ASN A 132 ? 1.6276 2.3529  1.3610  0.2345  -0.3752 0.0233  205 ASN A C   
1029 O O   . ASN A 132 ? 1.7317 2.5057  1.4351  0.2378  -0.3703 0.0142  205 ASN A O   
1030 C CB  . ASN A 132 ? 1.7174 2.3349  1.4282  0.2528  -0.4199 -0.0298 205 ASN A CB  
1031 C CG  . ASN A 132 ? 1.9633 2.5178  1.6894  0.2608  -0.4316 -0.0424 205 ASN A CG  
1032 O OD1 . ASN A 132 ? 2.0298 2.5618  1.7358  0.2850  -0.4400 -0.0811 205 ASN A OD1 
1033 N ND2 . ASN A 132 ? 2.1511 2.6789  1.9133  0.2409  -0.4328 -0.0093 205 ASN A ND2 
1034 N N   . THR A 133 ? 1.6177 2.3314  1.3868  0.2131  -0.3741 0.0635  206 THR A N   
1035 C CA  . THR A 133 ? 1.6334 2.3849  1.4105  0.1927  -0.3696 0.1005  206 THR A CA  
1036 C C   . THR A 133 ? 1.6302 2.3571  1.4001  0.1757  -0.3982 0.1099  206 THR A C   
1037 O O   . THR A 133 ? 1.6427 2.3228  1.4004  0.1781  -0.4214 0.0882  206 THR A O   
1038 C CB  . THR A 133 ? 1.5196 2.2800  1.3442  0.1830  -0.3481 0.1392  206 THR A CB  
1039 O OG1 . THR A 133 ? 1.3599 2.0717  1.2157  0.1792  -0.3553 0.1469  206 THR A OG1 
1040 C CG2 . THR A 133 ? 1.5367 2.3250  1.3670  0.1966  -0.3213 0.1319  206 THR A CG2 
1041 N N   . GLY A 134 ? 1.4566 2.2152  1.2345  0.1572  -0.3982 0.1440  207 GLY A N   
1042 C CA  . GLY A 134 ? 1.4757 2.2170  1.2536  0.1389  -0.4243 0.1587  207 GLY A CA  
1043 C C   . GLY A 134 ? 1.4529 2.1564  1.2739  0.1288  -0.4301 0.1797  207 GLY A C   
1044 O O   . GLY A 134 ? 1.6784 2.3586  1.4987  0.1150  -0.4551 0.1843  207 GLY A O   
1045 N N   . ASN A 135 ? 1.5490 2.2486  1.4069  0.1343  -0.4078 0.1925  208 ASN A N   
1046 C CA  . ASN A 135 ? 1.4748 2.1429  1.3726  0.1266  -0.4106 0.2097  208 ASN A CA  
1047 C C   . ASN A 135 ? 1.5035 2.1201  1.3900  0.1315  -0.4273 0.1815  208 ASN A C   
1048 O O   . ASN A 135 ? 1.5121 2.1029  1.4261  0.1211  -0.4349 0.1954  208 ASN A O   
1049 C CB  . ASN A 135 ? 1.5194 2.1983  1.4560  0.1323  -0.3820 0.2287  208 ASN A CB  
1050 C CG  . ASN A 135 ? 1.4204 2.1394  1.3781  0.1240  -0.3701 0.2641  208 ASN A CG  
1051 O OD1 . ASN A 135 ? 1.5918 2.3142  1.5789  0.1118  -0.3765 0.2925  208 ASN A OD1 
1052 N ND2 . ASN A 135 ? 1.7052 2.4561  1.6491  0.1303  -0.3537 0.2635  208 ASN A ND2 
1053 N N   . CYS A 136 ? 2.1656 2.7680  2.0131  0.1474  -0.4338 0.1429  209 CYS A N   
1054 C CA  . CYS A 136 ? 2.2503 2.7984  2.0863  0.1541  -0.4520 0.1154  209 CYS A CA  
1055 C C   . CYS A 136 ? 2.2911 2.8072  2.1209  0.1342  -0.4854 0.1208  209 CYS A C   
1056 O O   . CYS A 136 ? 2.7065 3.2326  2.5085  0.1268  -0.5035 0.1160  209 CYS A O   
1057 C CB  . CYS A 136 ? 2.3451 2.8877  2.1388  0.1780  -0.4549 0.0709  209 CYS A CB  
1058 S SG  . CYS A 136 ? 2.2551 2.7307  2.0399  0.1941  -0.4712 0.0358  209 CYS A SG  
1059 N N   . THR A 137 ? 1.9543 2.4338  1.8092  0.1238  -0.4942 0.1315  210 THR A N   
1060 C CA  . THR A 137 ? 2.1247 2.5705  1.9757  0.1024  -0.5276 0.1373  210 THR A CA  
1061 C C   . THR A 137 ? 1.9730 2.3612  1.8227  0.1046  -0.5419 0.1210  210 THR A C   
1062 O O   . THR A 137 ? 1.5494 1.9343  1.4304  0.1061  -0.5244 0.1340  210 THR A O   
1063 C CB  . THR A 137 ? 1.9715 2.4449  1.8639  0.0786  -0.5248 0.1812  210 THR A CB  
1064 O OG1 . THR A 137 ? 1.7876 2.2770  1.7218  0.0830  -0.4957 0.2014  210 THR A OG1 
1065 C CG2 . THR A 137 ? 1.5148 2.0360  1.4023  0.0730  -0.5221 0.1968  210 THR A CG2 
1066 N N   . ASN A 138 ? 2.6663 3.0080  2.4789  0.1046  -0.5752 0.0929  211 ASN A N   
1067 C CA  . ASN A 138 ? 2.6545 2.9341  2.4596  0.1072  -0.5951 0.0751  211 ASN A CA  
1068 C C   . ASN A 138 ? 2.6958 2.9374  2.5008  0.0767  -0.6320 0.0897  211 ASN A C   
1069 O O   . ASN A 138 ? 2.7920 3.0597  2.6061  0.0546  -0.6400 0.1139  211 ASN A O   
1070 C CB  . ASN A 138 ? 2.6675 2.9169  2.4284  0.1362  -0.6060 0.0263  211 ASN A CB  
1071 C CG  . ASN A 138 ? 3.1808 3.4158  2.8979  0.1341  -0.6369 0.0029  211 ASN A CG  
1072 O OD1 . ASN A 138 ? 3.5890 3.8595  3.3056  0.1180  -0.6382 0.0211  211 ASN A OD1 
1073 N ND2 . ASN A 138 ? 3.1045 3.2862  2.7841  0.1513  -0.6634 -0.0384 211 ASN A ND2 
1074 N N   . TYR A 139 ? 2.9197 3.0996  2.7150  0.0746  -0.6562 0.0763  212 TYR A N   
1075 C CA  . TYR A 139 ? 2.9891 3.1250  2.7797  0.0443  -0.6958 0.0879  212 TYR A CA  
1076 C C   . TYR A 139 ? 3.1412 3.2235  2.8796  0.0517  -0.7351 0.0485  212 TYR A C   
1077 O O   . TYR A 139 ? 3.2275 3.3140  2.9347  0.0815  -0.7290 0.0124  212 TYR A O   
1078 C CB  . TYR A 139 ? 2.8223 2.9244  2.6373  0.0316  -0.7000 0.1046  212 TYR A CB  
1079 C CG  . TYR A 139 ? 2.6301 2.7854  2.4961  0.0139  -0.6712 0.1487  212 TYR A CG  
1080 C CD1 . TYR A 139 ? 2.6026 2.8023  2.4944  0.0335  -0.6283 0.1549  212 TYR A CD1 
1081 C CD2 . TYR A 139 ? 2.5959 2.7593  2.4846  -0.0221 -0.6875 0.1832  212 TYR A CD2 
1082 C CE1 . TYR A 139 ? 2.5384 2.7846  2.4756  0.0202  -0.6031 0.1917  212 TYR A CE1 
1083 C CE2 . TYR A 139 ? 2.7207 2.9373  2.6567  -0.0351 -0.6607 0.2207  212 TYR A CE2 
1084 C CZ  . TYR A 139 ? 2.6810 2.9368  2.6403  -0.0125 -0.6188 0.2234  212 TYR A CZ  
1085 O OH  . TYR A 139 ? 2.7784 3.0845  2.7834  -0.0226 -0.5933 0.2573  212 TYR A OH  
1086 N N   . PHE A 140 ? 3.2226 3.2556  2.9511  0.0238  -0.7766 0.0554  213 PHE A N   
1087 C CA  . PHE A 140 ? 3.2364 3.2245  2.9176  0.0218  -0.8184 0.0257  213 PHE A CA  
1088 C C   . PHE A 140 ? 3.1476 3.1909  2.8166  0.0217  -0.8097 0.0260  213 PHE A C   
1089 O O   . PHE A 140 ? 3.2742 3.2999  2.8984  0.0349  -0.8296 -0.0092 213 PHE A O   
1090 C CB  . PHE A 140 ? 3.2557 3.1862  2.8958  0.0566  -0.8338 -0.0263 213 PHE A CB  
1091 C CG  . PHE A 140 ? 3.3417 3.2041  2.9348  0.0513  -0.8859 -0.0566 213 PHE A CG  
1092 C CD1 . PHE A 140 ? 3.3397 3.1381  2.9323  0.0190  -0.9284 -0.0415 213 PHE A CD1 
1093 C CD2 . PHE A 140 ? 3.2922 3.1548  2.8401  0.0779  -0.8935 -0.1003 213 PHE A CD2 
1094 C CE1 . PHE A 140 ? 3.3128 3.0426  2.8610  0.0130  -0.9795 -0.0696 213 PHE A CE1 
1095 C CE2 . PHE A 140 ? 3.2682 3.0651  2.7708  0.0745  -0.9430 -0.1311 213 PHE A CE2 
1096 C CZ  . PHE A 140 ? 3.3160 3.0431  2.8186  0.0420  -0.9871 -0.1159 213 PHE A CZ  
1097 N N   . SER A 141 ? 3.1198 3.2306  2.8287  0.0075  -0.7806 0.0656  214 SER A N   
1098 C CA  . SER A 141 ? 3.3230 3.4934  3.0294  0.0043  -0.7692 0.0760  214 SER A CA  
1099 C C   . SER A 141 ? 3.6819 3.8711  3.4155  -0.0354 -0.7860 0.1176  214 SER A C   
1100 O O   . SER A 141 ? 3.4262 3.5796  3.1737  -0.0607 -0.8096 0.1339  214 SER A O   
1101 C CB  . SER A 141 ? 3.0161 3.2518  2.7471  0.0259  -0.7196 0.0860  214 SER A CB  
1102 O OG  . SER A 141 ? 2.8495 3.1420  2.5791  0.0209  -0.7103 0.0999  214 SER A OG  
1103 N N   . GLU A 142 ? 4.3498 4.5975  4.0905  -0.0415 -0.7751 0.1355  215 GLU A N   
1104 C CA  . GLU A 142 ? 4.6385 4.9161  4.4094  -0.0763 -0.7879 0.1763  215 GLU A CA  
1105 C C   . GLU A 142 ? 4.7543 5.0484  4.5808  -0.0908 -0.7709 0.2134  215 GLU A C   
1106 O O   . GLU A 142 ? 4.7195 5.0308  4.5697  -0.0714 -0.7357 0.2165  215 GLU A O   
1107 C CB  . GLU A 142 ? 4.5755 4.9209  4.3526  -0.0740 -0.7703 0.1923  215 GLU A CB  
1108 C CG  . GLU A 142 ? 4.4276 4.8217  4.2294  -0.0485 -0.7227 0.2001  215 GLU A CG  
1109 C CD  . GLU A 142 ? 4.3554 4.8130  4.1640  -0.0489 -0.7090 0.2199  215 GLU A CD  
1110 O OE1 . GLU A 142 ? 4.3539 4.8216  4.1507  -0.0693 -0.7353 0.2293  215 GLU A OE1 
1111 O OE2 . GLU A 142 ? 4.2978 4.7940  4.1231  -0.0300 -0.6734 0.2272  215 GLU A OE2 
1112 N N   . ASP A 143 ? 4.0924 4.3825  3.9385  -0.1260 -0.7968 0.2409  216 ASP A N   
1113 C CA  . ASP A 143 ? 3.6544 3.9683  3.5529  -0.1430 -0.7826 0.2775  216 ASP A CA  
1114 C C   . ASP A 143 ? 3.6144 4.0094  3.5585  -0.1419 -0.7512 0.3111  216 ASP A C   
1115 O O   . ASP A 143 ? 3.6515 4.0787  3.5854  -0.1271 -0.7395 0.3062  216 ASP A O   
1116 C CB  . ASP A 143 ? 3.4518 3.7343  3.3531  -0.1826 -0.8235 0.2944  216 ASP A CB  
1117 C CG  . ASP A 143 ? 3.1310 3.4196  3.0735  -0.1978 -0.8127 0.3219  216 ASP A CG  
1118 O OD1 . ASP A 143 ? 3.0128 3.3454  2.9908  -0.1808 -0.7719 0.3349  216 ASP A OD1 
1119 O OD2 . ASP A 143 ? 3.1253 3.3748  3.0636  -0.2279 -0.8459 0.3309  216 ASP A OD2 
1120 N N   . ASN A 144 ? 3.5284 3.9578  3.5231  -0.1566 -0.7374 0.3455  217 ASN A N   
1121 C CA  . ASN A 144 ? 3.3990 3.9035  3.4433  -0.1568 -0.7114 0.3795  217 ASN A CA  
1122 C C   . ASN A 144 ? 3.1040 3.6357  3.1589  -0.1218 -0.6690 0.3728  217 ASN A C   
1123 O O   . ASN A 144 ? 3.2355 3.8239  3.3331  -0.1174 -0.6454 0.3992  217 ASN A O   
1124 C CB  . ASN A 144 ? 3.7663 4.3048  3.8104  -0.1747 -0.7332 0.3954  217 ASN A CB  
1125 C CG  . ASN A 144 ? 4.1600 4.7418  4.2053  -0.1519 -0.7107 0.3964  217 ASN A CG  
1126 O OD1 . ASN A 144 ? 4.0431 4.6033  4.0472  -0.1316 -0.7072 0.3674  217 ASN A OD1 
1127 N ND2 . ASN A 144 ? 4.8721 5.5174  4.9655  -0.1556 -0.6963 0.4305  217 ASN A ND2 
1128 N N   . ILE A 145 ? 2.7905 3.2837  2.8097  -0.0969 -0.6596 0.3388  218 ILE A N   
1129 C CA  . ILE A 145 ? 2.5261 3.0447  2.5507  -0.0663 -0.6227 0.3320  218 ILE A CA  
1130 C C   . ILE A 145 ? 2.1504 2.7033  2.2267  -0.0606 -0.5904 0.3563  218 ILE A C   
1131 O O   . ILE A 145 ? 1.9248 2.4649  2.0205  -0.0713 -0.5909 0.3644  218 ILE A O   
1132 C CB  . ILE A 145 ? 2.4249 2.8974  2.4066  -0.0424 -0.6186 0.2916  218 ILE A CB  
1133 C CG1 . ILE A 145 ? 2.1490 2.5757  2.1329  -0.0433 -0.6212 0.2819  218 ILE A CG1 
1134 C CG2 . ILE A 145 ? 2.7054 3.1499  2.6343  -0.0430 -0.6480 0.2638  218 ILE A CG2 
1135 C CD1 . ILE A 145 ? 2.3883 2.7570  2.3415  -0.0627 -0.6633 0.2679  218 ILE A CD1 
1136 N N   . THR A 146 ? 1.9079 2.5046  2.0054  -0.0441 -0.5634 0.3682  219 THR A N   
1137 C CA  . THR A 146 ? 1.3300 1.9594  1.4743  -0.0337 -0.5318 0.3878  219 THR A CA  
1138 C C   . THR A 146 ? 1.4354 2.0625  1.5696  -0.0053 -0.5029 0.3716  219 THR A C   
1139 O O   . THR A 146 ? 1.3168 1.9528  1.4278  0.0043  -0.5019 0.3638  219 THR A O   
1140 C CB  . THR A 146 ? 1.6629 2.3496  1.8496  -0.0417 -0.5291 0.4219  219 THR A CB  
1141 O OG1 . THR A 146 ? 1.6108 2.3185  1.7858  -0.0302 -0.5250 0.4231  219 THR A OG1 
1142 C CG2 . THR A 146 ? 1.6300 2.3238  1.8221  -0.0720 -0.5613 0.4374  219 THR A CG2 
1143 N N   . TRP A 147 ? 1.9485 2.5663  2.0994  0.0065  -0.4803 0.3677  220 TRP A N   
1144 C CA  . TRP A 147 ? 1.6729 2.2860  1.8146  0.0313  -0.4542 0.3520  220 TRP A CA  
1145 C C   . TRP A 147 ? 1.5293 2.1863  1.7004  0.0419  -0.4327 0.3732  220 TRP A C   
1146 O O   . TRP A 147 ? 1.9671 2.6566  2.1779  0.0355  -0.4298 0.3996  220 TRP A O   
1147 C CB  . TRP A 147 ? 1.6267 2.2155  1.7773  0.0391  -0.4388 0.3421  220 TRP A CB  
1148 C CG  . TRP A 147 ? 1.8838 2.4514  2.0089  0.0608  -0.4233 0.3157  220 TRP A CG  
1149 C CD1 . TRP A 147 ? 2.0093 2.5940  2.1485  0.0787  -0.3945 0.3170  220 TRP A CD1 
1150 C CD2 . TRP A 147 ? 1.8870 2.4140  1.9690  0.0672  -0.4369 0.2837  220 TRP A CD2 
1151 N NE1 . TRP A 147 ? 1.8604 2.4225  1.9693  0.0942  -0.3884 0.2894  220 TRP A NE1 
1152 C CE2 . TRP A 147 ? 1.8123 2.3401  1.8864  0.0893  -0.4136 0.2676  220 TRP A CE2 
1153 C CE3 . TRP A 147 ? 2.0110 2.5004  2.0608  0.0570  -0.4681 0.2664  220 TRP A CE3 
1154 C CZ2 . TRP A 147 ? 1.7540 2.2520  1.7912  0.1032  -0.4188 0.2346  220 TRP A CZ2 
1155 C CZ3 . TRP A 147 ? 1.7886 2.2424  1.8002  0.0723  -0.4745 0.2321  220 TRP A CZ3 
1156 C CH2 . TRP A 147 ? 1.6641 2.1253  1.6707  0.0961  -0.4491 0.2163  220 TRP A CH2 
1157 N N   . THR A 148 ? 1.4974 2.1560  1.6492  0.0583  -0.4187 0.3616  221 THR A N   
1158 C CA  . THR A 148 ? 1.5007 2.1937  1.6734  0.0677  -0.4016 0.3807  221 THR A CA  
1159 C C   . THR A 148 ? 1.4772 2.1631  1.6572  0.0862  -0.3735 0.3723  221 THR A C   
1160 O O   . THR A 148 ? 1.7458 2.4032  1.9049  0.0932  -0.3684 0.3481  221 THR A O   
1161 C CB  . THR A 148 ? 1.7305 2.4378  1.8717  0.0659  -0.4128 0.3795  221 THR A CB  
1162 O OG1 . THR A 148 ? 1.4250 2.1262  1.5461  0.0488  -0.4422 0.3765  221 THR A OG1 
1163 C CG2 . THR A 148 ? 1.4011 2.1459  1.5695  0.0681  -0.4051 0.4089  221 THR A CG2 
1164 N N   . LEU A 149 ? 1.3122 2.0229  1.5228  0.0941  -0.3571 0.3929  222 LEU A N   
1165 C CA  . LEU A 149 ? 1.4066 2.1109  1.6265  0.1098  -0.3318 0.3876  222 LEU A CA  
1166 C C   . LEU A 149 ? 1.6328 2.3256  1.8130  0.1171  -0.3265 0.3655  222 LEU A C   
1167 O O   . LEU A 149 ? 1.8322 2.5087  2.0087  0.1274  -0.3110 0.3498  222 LEU A O   
1168 C CB  . LEU A 149 ? 1.4533 2.1827  1.7079  0.1164  -0.3206 0.4136  222 LEU A CB  
1169 C CG  . LEU A 149 ? 1.2033 1.9467  1.5050  0.1179  -0.3167 0.4315  222 LEU A CG  
1170 C CD1 . LEU A 149 ? 1.2304 1.9968  1.5619  0.1260  -0.3119 0.4561  222 LEU A CD1 
1171 C CD2 . LEU A 149 ? 1.1865 1.9117  1.5008  0.1261  -0.2990 0.4185  222 LEU A CD2 
1172 N N   . HIS A 150 ? 1.2849 1.9902  1.4353  0.1119  -0.3392 0.3637  223 HIS A N   
1173 C CA  . HIS A 150 ? 1.4281 2.1328  1.5403  0.1191  -0.3338 0.3427  223 HIS A CA  
1174 C C   . HIS A 150 ? 1.6522 2.3318  1.7271  0.1199  -0.3479 0.3104  223 HIS A C   
1175 O O   . HIS A 150 ? 1.9100 2.5899  1.9541  0.1294  -0.3425 0.2878  223 HIS A O   
1176 C CB  . HIS A 150 ? 1.4425 2.1790  1.5392  0.1138  -0.3387 0.3575  223 HIS A CB  
1177 C CG  . HIS A 150 ? 1.5206 2.2774  1.6518  0.1134  -0.3291 0.3901  223 HIS A CG  
1178 N ND1 . HIS A 150 ? 1.7815 2.5341  1.9352  0.1229  -0.3081 0.3955  223 HIS A ND1 
1179 C CD2 . HIS A 150 ? 1.4667 2.2456  1.6137  0.1053  -0.3398 0.4184  223 HIS A CD2 
1180 C CE1 . HIS A 150 ? 1.6622 2.4301  1.8435  0.1214  -0.3070 0.4250  223 HIS A CE1 
1181 N NE2 . HIS A 150 ? 1.4556 2.2405  1.6343  0.1114  -0.3259 0.4398  223 HIS A NE2 
1182 N N   . SER A 151 ? 1.4036 2.0624  1.4811  0.1103  -0.3666 0.3077  224 SER A N   
1183 C CA  . SER A 151 ? 1.3493 1.9775  1.3904  0.1103  -0.3851 0.2776  224 SER A CA  
1184 C C   . SER A 151 ? 1.2378 1.8367  1.2753  0.1237  -0.3740 0.2544  224 SER A C   
1185 O O   . SER A 151 ? 1.6063 2.2017  1.6745  0.1269  -0.3574 0.2645  224 SER A O   
1186 C CB  . SER A 151 ? 1.2668 1.8790  1.3129  0.0925  -0.4111 0.2851  224 SER A CB  
1187 O OG  . SER A 151 ? 1.9870 2.6251  2.0293  0.0802  -0.4257 0.3019  224 SER A OG  
1188 N N   . THR A 152 ? 1.3155 1.8936  1.3143  0.1328  -0.3843 0.2220  225 THR A N   
1189 C CA  . THR A 152 ? 1.3039 1.8532  1.2953  0.1474  -0.3779 0.1970  225 THR A CA  
1190 C C   . THR A 152 ? 1.4801 1.9880  1.4381  0.1482  -0.4062 0.1684  225 THR A C   
1191 O O   . THR A 152 ? 1.8802 2.3885  1.8101  0.1435  -0.4262 0.1592  225 THR A O   
1192 C CB  . THR A 152 ? 1.7518 2.3249  1.7316  0.1656  -0.3557 0.1827  225 THR A CB  
1193 O OG1 . THR A 152 ? 2.1627 2.7610  2.1094  0.1680  -0.3620 0.1720  225 THR A OG1 
1194 C CG2 . THR A 152 ? 1.7466 2.3479  1.7614  0.1648  -0.3292 0.2097  225 THR A CG2 
1195 N N   . SER A 153 ? 1.3929 1.8628  1.3530  0.1542  -0.4094 0.1543  226 SER A N   
1196 C CA  . SER A 153 ? 1.6721 2.0931  1.6030  0.1557  -0.4387 0.1278  226 SER A CA  
1197 C C   . SER A 153 ? 1.6384 2.0541  1.5346  0.1813  -0.4382 0.0889  226 SER A C   
1198 O O   . SER A 153 ? 1.9261 2.3718  1.8276  0.1971  -0.4122 0.0839  226 SER A O   
1199 C CB  . SER A 153 ? 1.5407 1.9234  1.4910  0.1488  -0.4443 0.1340  226 SER A CB  
1200 O OG  . SER A 153 ? 1.7158 2.0999  1.6773  0.1657  -0.4215 0.1262  226 SER A OG  
1201 N N   . PRO A 154 ? 1.6800 2.0589  1.5404  0.1862  -0.4677 0.0600  227 PRO A N   
1202 C CA  . PRO A 154 ? 1.6910 2.0694  1.5179  0.2143  -0.4677 0.0193  227 PRO A CA  
1203 C C   . PRO A 154 ? 1.8374 2.2019  1.6743  0.2343  -0.4542 0.0042  227 PRO A C   
1204 O O   . PRO A 154 ? 1.6886 2.0779  1.5114  0.2582  -0.4403 -0.0206 227 PRO A O   
1205 C CB  . PRO A 154 ? 1.7897 2.1198  1.5796  0.2136  -0.5073 -0.0070 227 PRO A CB  
1206 C CG  . PRO A 154 ? 2.2547 2.5457  2.0637  0.1860  -0.5279 0.0190  227 PRO A CG  
1207 C CD  . PRO A 154 ? 2.2291 2.5666  2.0773  0.1670  -0.5034 0.0620  227 PRO A CD  
1208 N N   . ALA A 155 ? 1.9097 2.2388  1.7703  0.2246  -0.4583 0.0187  228 ALA A N   
1209 C CA  . ALA A 155 ? 1.8640 2.1836  1.7369  0.2416  -0.4441 0.0086  228 ALA A CA  
1210 C C   . ALA A 155 ? 1.6738 2.0470  1.5750  0.2438  -0.4057 0.0283  228 ALA A C   
1211 O O   . ALA A 155 ? 1.5553 1.9474  1.4556  0.2644  -0.3885 0.0114  228 ALA A O   
1212 C CB  . ALA A 155 ? 1.7872 2.0551  1.6749  0.2279  -0.4607 0.0208  228 ALA A CB  
1213 N N   . GLU A 156 ? 1.8422 2.2403  1.7695  0.2228  -0.3934 0.0639  229 GLU A N   
1214 C CA  . GLU A 156 ? 1.6325 2.0781  1.5850  0.2238  -0.3603 0.0834  229 GLU A CA  
1215 C C   . GLU A 156 ? 1.6313 2.1215  1.5641  0.2368  -0.3480 0.0700  229 GLU A C   
1216 O O   . GLU A 156 ? 1.6028 2.1243  1.5451  0.2470  -0.3240 0.0697  229 GLU A O   
1217 C CB  . GLU A 156 ? 2.0155 2.4770  1.9971  0.2012  -0.3543 0.1214  229 GLU A CB  
1218 C CG  . GLU A 156 ? 2.1216 2.6273  2.1283  0.2011  -0.3246 0.1431  229 GLU A CG  
1219 C CD  . GLU A 156 ? 2.0811 2.6030  2.1146  0.1824  -0.3225 0.1775  229 GLU A CD  
1220 O OE1 . GLU A 156 ? 1.8534 2.3585  1.8857  0.1685  -0.3432 0.1848  229 GLU A OE1 
1221 O OE2 . GLU A 156 ? 2.1311 2.6823  2.1874  0.1817  -0.3015 0.1973  229 GLU A OE2 
1222 N N   . GLU A 157 ? 1.5256 2.0216  1.4299  0.2350  -0.3648 0.0595  230 GLU A N   
1223 C CA  . GLU A 157 ? 1.5403 2.0823  1.4211  0.2469  -0.3544 0.0450  230 GLU A CA  
1224 C C   . GLU A 157 ? 1.7052 2.2468  1.5663  0.2742  -0.3520 0.0066  230 GLU A C   
1225 O O   . GLU A 157 ? 1.6233 2.2130  1.4808  0.2854  -0.3309 0.0003  230 GLU A O   
1226 C CB  . GLU A 157 ? 1.8980 2.4442  1.7497  0.2386  -0.3753 0.0405  230 GLU A CB  
1227 C CG  . GLU A 157 ? 1.5408 2.1010  1.4123  0.2132  -0.3763 0.0793  230 GLU A CG  
1228 C CD  . GLU A 157 ? 1.6343 2.2530  1.5042  0.2091  -0.3580 0.0965  230 GLU A CD  
1229 O OE1 . GLU A 157 ? 1.8903 2.5386  1.7289  0.2214  -0.3552 0.0743  230 GLU A OE1 
1230 O OE2 . GLU A 157 ? 1.8663 2.5025  1.7662  0.1939  -0.3473 0.1324  230 GLU A OE2 
1231 N N   . PHE A 158 ? 1.6884 2.1773  1.5374  0.2848  -0.3744 -0.0185 231 PHE A N   
1232 C CA  . PHE A 158 ? 1.5950 2.0807  1.4257  0.3142  -0.3756 -0.0577 231 PHE A CA  
1233 C C   . PHE A 158 ? 1.5025 2.0072  1.3609  0.3229  -0.3497 -0.0515 231 PHE A C   
1234 O O   . PHE A 158 ? 1.6220 2.1680  1.4740  0.3421  -0.3336 -0.0700 231 PHE A O   
1235 C CB  . PHE A 158 ? 2.1401 2.5568  1.9525  0.3226  -0.4100 -0.0835 231 PHE A CB  
1236 C CG  . PHE A 158 ? 1.9205 2.3289  1.7147  0.3562  -0.4153 -0.1262 231 PHE A CG  
1237 C CD1 . PHE A 158 ? 2.0681 2.5078  1.8297  0.3783  -0.4173 -0.1605 231 PHE A CD1 
1238 C CD2 . PHE A 158 ? 1.5332 1.9054  1.3429  0.3667  -0.4188 -0.1325 231 PHE A CD2 
1239 C CE1 . PHE A 158 ? 1.6783 2.1148  1.4251  0.4125  -0.4221 -0.2019 231 PHE A CE1 
1240 C CE2 . PHE A 158 ? 1.6850 2.0505  1.4802  0.3998  -0.4252 -0.1721 231 PHE A CE2 
1241 C CZ  . PHE A 158 ? 1.6130 2.0114  1.3778  0.4238  -0.4266 -0.2075 231 PHE A CZ  
1242 N N   . TYR A 159 ? 1.7310 2.2093  1.6201  0.3083  -0.3456 -0.0257 232 TYR A N   
1243 C CA  . TYR A 159 ? 1.4801 1.9754  1.3955  0.3139  -0.3215 -0.0178 232 TYR A CA  
1244 C C   . TYR A 159 ? 1.4650 2.0222  1.3939  0.3070  -0.2924 0.0030  232 TYR A C   
1245 O O   . TYR A 159 ? 1.4248 2.0186  1.3568  0.3201  -0.2741 -0.0065 232 TYR A O   
1246 C CB  . TYR A 159 ? 1.4543 1.9096  1.3969  0.2985  -0.3240 0.0055  232 TYR A CB  
1247 C CG  . TYR A 159 ? 1.6631 2.1291  1.6302  0.3043  -0.3026 0.0111  232 TYR A CG  
1248 C CD1 . TYR A 159 ? 1.6622 2.1506  1.6230  0.3272  -0.2933 -0.0136 232 TYR A CD1 
1249 C CD2 . TYR A 159 ? 1.7440 2.2008  1.7404  0.2873  -0.2919 0.0403  232 TYR A CD2 
1250 C CE1 . TYR A 159 ? 1.5113 2.0101  1.4945  0.3310  -0.2752 -0.0078 232 TYR A CE1 
1251 C CE2 . TYR A 159 ? 1.4847 1.9497  1.5012  0.2920  -0.2737 0.0444  232 TYR A CE2 
1252 C CZ  . TYR A 159 ? 1.3410 1.8258  1.3508  0.3128  -0.2660 0.0210  232 TYR A CZ  
1253 O OH  . TYR A 159 ? 1.3360 1.8296  1.3656  0.3160  -0.2493 0.0255  232 TYR A OH  
1254 N N   . THR A 160 ? 1.5179 2.0872  1.4563  0.2855  -0.2892 0.0330  233 THR A N   
1255 C CA  . THR A 160 ? 1.4917 2.1123  1.4441  0.2761  -0.2651 0.0574  233 THR A CA  
1256 C C   . THR A 160 ? 1.6953 2.3681  1.6228  0.2878  -0.2569 0.0397  233 THR A C   
1257 O O   . THR A 160 ? 1.7078 2.4165  1.6421  0.2957  -0.2375 0.0365  233 THR A O   
1258 C CB  . THR A 160 ? 1.6080 2.2289  1.5725  0.2535  -0.2686 0.0902  233 THR A CB  
1259 O OG1 . THR A 160 ? 1.7826 2.3635  1.7720  0.2434  -0.2740 0.1061  233 THR A OG1 
1260 C CG2 . THR A 160 ? 1.6931 2.3597  1.6731  0.2435  -0.2470 0.1175  233 THR A CG2 
1261 N N   . ARG A 161 ? 1.5343 2.2145  1.4319  0.2884  -0.2719 0.0275  234 ARG A N   
1262 C CA  . ARG A 161 ? 1.2927 2.0321  1.1665  0.2929  -0.2626 0.0194  234 ARG A CA  
1263 C C   . ARG A 161 ? 1.3271 2.0836  1.1733  0.3208  -0.2651 -0.0246 234 ARG A C   
1264 O O   . ARG A 161 ? 1.5781 2.3939  1.4059  0.3261  -0.2535 -0.0329 234 ARG A O   
1265 C CB  . ARG A 161 ? 1.3173 2.0627  1.1712  0.2783  -0.2769 0.0302  234 ARG A CB  
1266 C CG  . ARG A 161 ? 1.3129 2.0495  1.1948  0.2531  -0.2749 0.0735  234 ARG A CG  
1267 C CD  . ARG A 161 ? 1.3123 2.0598  1.1747  0.2392  -0.2898 0.0844  234 ARG A CD  
1268 N NE  . ARG A 161 ? 1.3318 2.1385  1.1676  0.2406  -0.2810 0.0802  234 ARG A NE  
1269 C CZ  . ARG A 161 ? 1.5761 2.4274  1.4232  0.2268  -0.2639 0.1111  234 ARG A CZ  
1270 N NH1 . ARG A 161 ? 1.7964 2.7041  1.6160  0.2264  -0.2572 0.1073  234 ARG A NH1 
1271 N NH2 . ARG A 161 ? 1.7071 2.5467  1.5921  0.2133  -0.2546 0.1456  234 ARG A NH2 
1272 N N   . HIS A 162 ? 1.4135 2.1228  1.2563  0.3390  -0.2803 -0.0528 235 HIS A N   
1273 C CA  . HIS A 162 ? 1.6717 2.3928  1.4883  0.3694  -0.2863 -0.0982 235 HIS A CA  
1274 C C   . HIS A 162 ? 1.7212 2.4477  1.5582  0.3870  -0.2731 -0.1098 235 HIS A C   
1275 O O   . HIS A 162 ? 1.6711 2.4598  1.5098  0.3962  -0.2519 -0.1154 235 HIS A O   
1276 C CB  . HIS A 162 ? 1.7672 2.4274  1.5576  0.3800  -0.3202 -0.1269 235 HIS A CB  
1277 C CG  . HIS A 162 ? 1.7574 2.4265  1.5180  0.4143  -0.3299 -0.1770 235 HIS A CG  
1278 N ND1 . HIS A 162 ? 1.5327 2.2631  1.2644  0.4263  -0.3222 -0.1977 235 HIS A ND1 
1279 C CD2 . HIS A 162 ? 1.6565 2.2824  1.4119  0.4406  -0.3471 -0.2111 235 HIS A CD2 
1280 C CE1 . HIS A 162 ? 2.0986 2.8252  1.8091  0.4605  -0.3334 -0.2447 235 HIS A CE1 
1281 N NE2 . HIS A 162 ? 2.1303 2.7914  1.8552  0.4703  -0.3496 -0.2536 235 HIS A NE2 
1282 N N   . VAL A 163 ? 1.3578 2.0235  1.2103  0.3907  -0.2858 -0.1124 236 VAL A N   
1283 C CA  . VAL A 163 ? 1.6181 2.2861  1.4877  0.4091  -0.2769 -0.1260 236 VAL A CA  
1284 C C   . VAL A 163 ? 1.2882 1.9955  1.1898  0.3929  -0.2476 -0.0931 236 VAL A C   
1285 O O   . VAL A 163 ? 1.8411 2.6010  1.7489  0.4042  -0.2291 -0.1012 236 VAL A O   
1286 C CB  . VAL A 163 ? 1.3567 1.9471  1.2320  0.4148  -0.3007 -0.1349 236 VAL A CB  
1287 C CG1 . VAL A 163 ? 1.3415 1.8851  1.2283  0.3853  -0.3108 -0.1018 236 VAL A CG1 
1288 C CG2 . VAL A 163 ? 1.3430 1.9349  1.2433  0.4256  -0.2889 -0.1363 236 VAL A CG2 
1289 N N   . LEU A 164 ? 1.2556 1.9394  1.1784  0.3663  -0.2439 -0.0562 237 LEU A N   
1290 C CA  . LEU A 164 ? 1.2088 1.9229  1.1607  0.3510  -0.2189 -0.0258 237 LEU A CA  
1291 C C   . LEU A 164 ? 1.7791 2.5577  1.7253  0.3396  -0.2019 -0.0098 237 LEU A C   
1292 O O   . LEU A 164 ? 1.5004 2.3238  1.4608  0.3361  -0.1812 0.0011  237 LEU A O   
1293 C CB  . LEU A 164 ? 1.3451 2.0141  1.3211  0.3294  -0.2211 0.0056  237 LEU A CB  
1294 C CG  . LEU A 164 ? 1.5680 2.2540  1.5749  0.3153  -0.1989 0.0344  237 LEU A CG  
1295 C CD1 . LEU A 164 ? 1.7813 2.4795  1.7985  0.3303  -0.1889 0.0190  237 LEU A CD1 
1296 C CD2 . LEU A 164 ? 1.7915 2.4326  1.8194  0.2983  -0.2030 0.0596  237 LEU A CD2 
1297 N N   . GLN A 165 ? 1.7033 2.4876  1.6279  0.3321  -0.2118 -0.0071 238 GLN A N   
1298 C CA  . GLN A 165 ? 1.6632 2.5072  1.5781  0.3193  -0.1990 0.0099  238 GLN A CA  
1299 C C   . GLN A 165 ? 1.7633 2.6204  1.7084  0.2957  -0.1815 0.0517  238 GLN A C   
1300 O O   . GLN A 165 ? 1.6815 2.5936  1.6278  0.2870  -0.1652 0.0662  238 GLN A O   
1301 C CB  . GLN A 165 ? 1.6927 2.6006  1.5877  0.3376  -0.1885 -0.0171 238 GLN A CB  
1302 C CG  . GLN A 165 ? 2.4710 3.4349  2.3394  0.3292  -0.1850 -0.0122 238 GLN A CG  
1303 C CD  . GLN A 165 ? 2.4026 3.4300  2.2470  0.3514  -0.1772 -0.0463 238 GLN A CD  
1304 O OE1 . GLN A 165 ? 1.9064 2.9346  1.7554  0.3754  -0.1754 -0.0750 238 GLN A OE1 
1305 N NE2 . GLN A 165 ? 2.0412 3.1253  1.8597  0.3443  -0.1727 -0.0433 238 GLN A NE2 
1306 N N   . ILE A 166 ? 1.8386 2.6449  1.8079  0.2850  -0.1861 0.0712  239 ILE A N   
1307 C CA  . ILE A 166 ? 1.4903 2.2992  1.4897  0.2665  -0.1718 0.1067  239 ILE A CA  
1308 C C   . ILE A 166 ? 1.5553 2.3873  1.5536  0.2464  -0.1706 0.1377  239 ILE A C   
1309 O O   . ILE A 166 ? 1.7578 2.5999  1.7777  0.2317  -0.1591 0.1670  239 ILE A O   
1310 C CB  . ILE A 166 ? 1.1116 1.8622  1.1354  0.2637  -0.1773 0.1149  239 ILE A CB  
1311 C CG1 . ILE A 166 ? 1.0718 1.8246  1.1261  0.2530  -0.1606 0.1393  239 ILE A CG1 
1312 C CG2 . ILE A 166 ? 1.7082 2.4283  1.7318  0.2525  -0.1927 0.1290  239 ILE A CG2 
1313 C CD1 . ILE A 166 ? 1.3241 2.0270  1.4006  0.2522  -0.1635 0.1441  239 ILE A CD1 
1314 N N   . HIS A 167 ? 1.4222 2.2610  1.3952  0.2454  -0.1839 0.1319  240 HIS A N   
1315 C CA  . HIS A 167 ? 1.4181 2.2828  1.3872  0.2267  -0.1846 0.1611  240 HIS A CA  
1316 C C   . HIS A 167 ? 1.5129 2.4414  1.4721  0.2201  -0.1694 0.1704  240 HIS A C   
1317 O O   . HIS A 167 ? 1.2665 2.2179  1.2255  0.2019  -0.1687 0.2004  240 HIS A O   
1318 C CB  . HIS A 167 ? 1.7182 2.5752  1.6601  0.2272  -0.2043 0.1504  240 HIS A CB  
1319 C CG  . HIS A 167 ? 1.4118 2.3034  1.3157  0.2419  -0.2072 0.1170  240 HIS A CG  
1320 N ND1 . HIS A 167 ? 1.2844 2.1579  1.1753  0.2650  -0.2131 0.0774  240 HIS A ND1 
1321 C CD2 . HIS A 167 ? 1.2592 2.2037  1.1347  0.2381  -0.2055 0.1162  240 HIS A CD2 
1322 C CE1 . HIS A 167 ? 1.8359 2.7498  1.6927  0.2770  -0.2146 0.0514  240 HIS A CE1 
1323 N NE2 . HIS A 167 ? 1.2901 2.2498  1.1361  0.2603  -0.2092 0.0742  240 HIS A NE2 
1324 N N   . ARG A 168 ? 1.4513 2.4109  1.4030  0.2337  -0.1582 0.1470  241 ARG A N   
1325 C CA  . ARG A 168 ? 1.4519 2.4804  1.3936  0.2269  -0.1432 0.1544  241 ARG A CA  
1326 C C   . ARG A 168 ? 1.4772 2.5143  1.4490  0.2127  -0.1279 0.1820  241 ARG A C   
1327 O O   . ARG A 168 ? 1.5213 2.6159  1.4886  0.2023  -0.1156 0.1938  241 ARG A O   
1328 C CB  . ARG A 168 ? 1.4409 2.5073  1.3591  0.2505  -0.1392 0.1129  241 ARG A CB  
1329 C CG  . ARG A 168 ? 1.8168 2.9647  1.7100  0.2455  -0.1288 0.1132  241 ARG A CG  
1330 C CD  . ARG A 168 ? 1.4469 2.6208  1.3065  0.2724  -0.1339 0.0665  241 ARG A CD  
1331 N NE  . ARG A 168 ? 1.9807 3.2417  1.8156  0.2691  -0.1218 0.0642  241 ARG A NE  
1332 C CZ  . ARG A 168 ? 2.5298 3.8273  2.3290  0.2891  -0.1256 0.0277  241 ARG A CZ  
1333 N NH1 . ARG A 168 ? 2.5930 3.8410  2.3772  0.3135  -0.1436 -0.0095 241 ARG A NH1 
1334 N NH2 . ARG A 168 ? 2.7327 4.1169  2.5103  0.2840  -0.1125 0.0283  241 ARG A NH2 
1335 N N   . SER A 169 ? 1.5724 2.5554  1.5739  0.2108  -0.1291 0.1929  242 SER A N   
1336 C CA  . SER A 169 ? 1.5245 2.5062  1.5542  0.1979  -0.1173 0.2172  242 SER A CA  
1337 C C   . SER A 169 ? 1.1955 2.1322  1.2479  0.1835  -0.1238 0.2488  242 SER A C   
1338 O O   . SER A 169 ? 1.1418 2.0362  1.1975  0.1891  -0.1352 0.2448  242 SER A O   
1339 C CB  . SER A 169 ? 1.4628 2.4255  1.5079  0.2130  -0.1106 0.1952  242 SER A CB  
1340 O OG  . SER A 169 ? 1.3059 2.2077  1.3600  0.2238  -0.1209 0.1834  242 SER A OG  
1341 N N   . LYS A 170 ? 1.7335 2.6805  1.8022  0.1651  -0.1174 0.2803  243 LYS A N   
1342 C CA  . LYS A 170 ? 1.7062 2.6133  1.7980  0.1535  -0.1239 0.3103  243 LYS A CA  
1343 C C   . LYS A 170 ? 1.6629 2.5229  1.7838  0.1590  -0.1199 0.3086  243 LYS A C   
1344 O O   . LYS A 170 ? 1.6439 2.4675  1.7854  0.1546  -0.1253 0.3274  243 LYS A O   
1345 C CB  . LYS A 170 ? 2.1114 3.0467  2.2049  0.1304  -0.1232 0.3469  243 LYS A CB  
1346 C CG  . LYS A 170 ? 2.5527 3.5344  2.6171  0.1213  -0.1286 0.3550  243 LYS A CG  
1347 C CD  . LYS A 170 ? 2.5530 3.5549  2.6209  0.0958  -0.1312 0.3968  243 LYS A CD  
1348 C CE  . LYS A 170 ? 2.4575 3.4877  2.5323  0.0833  -0.1193 0.4063  243 LYS A CE  
1349 N NZ  . LYS A 170 ? 2.2384 3.2839  2.3158  0.0555  -0.1249 0.4498  243 LYS A NZ  
1350 N N   . GLY A 171 ? 1.7960 2.6582  1.9190  0.1692  -0.1110 0.2862  244 GLY A N   
1351 C CA  . GLY A 171 ? 1.7573 2.5779  1.9046  0.1738  -0.1072 0.2833  244 GLY A CA  
1352 C C   . GLY A 171 ? 1.7393 2.5825  1.8894  0.1746  -0.0958 0.2727  244 GLY A C   
1353 O O   . GLY A 171 ? 2.1178 3.0081  2.2509  0.1774  -0.0909 0.2599  244 GLY A O   
1354 N N   . LEU A 172 ? 1.6873 2.4984  1.8596  0.1729  -0.0920 0.2773  245 LEU A N   
1355 C CA  . LEU A 172 ? 0.9842 1.8146  1.1624  0.1707  -0.0825 0.2709  245 LEU A CA  
1356 C C   . LEU A 172 ? 1.0901 1.9694  1.2644  0.1510  -0.0778 0.2925  245 LEU A C   
1357 O O   . LEU A 172 ? 1.6383 2.5580  1.8100  0.1496  -0.0696 0.2841  245 LEU A O   
1358 C CB  . LEU A 172 ? 0.9695 1.7537  1.1707  0.1697  -0.0810 0.2748  245 LEU A CB  
1359 C CG  . LEU A 172 ? 0.9543 1.6973  1.1601  0.1871  -0.0833 0.2527  245 LEU A CG  
1360 C CD1 . LEU A 172 ? 1.0652 1.7696  1.2918  0.1837  -0.0808 0.2589  245 LEU A CD1 
1361 C CD2 . LEU A 172 ? 1.1743 1.9373  1.3679  0.2021  -0.0811 0.2234  245 LEU A CD2 
1362 N N   . GLN A 173 ? 1.5356 2.4142  1.7101  0.1348  -0.0836 0.3218  246 GLN A N   
1363 C CA  . GLN A 173 ? 1.5485 2.4708  1.7191  0.1118  -0.0814 0.3478  246 GLN A CA  
1364 C C   . GLN A 173 ? 1.9310 2.9233  2.0773  0.1135  -0.0749 0.3351  246 GLN A C   
1365 O O   . GLN A 173 ? 2.5548 3.5934  2.7005  0.1069  -0.0659 0.3329  246 GLN A O   
1366 C CB  . GLN A 173 ? 1.6244 2.5277  1.7983  0.0958  -0.0922 0.3818  246 GLN A CB  
1367 C CG  . GLN A 173 ? 1.7509 2.5885  1.9499  0.0959  -0.0991 0.3941  246 GLN A CG  
1368 C CD  . GLN A 173 ? 2.0280 2.8243  2.2324  0.1171  -0.1028 0.3761  246 GLN A CD  
1369 O OE1 . GLN A 173 ? 1.8030 2.6142  1.9915  0.1294  -0.1030 0.3573  246 GLN A OE1 
1370 N NE2 . GLN A 173 ? 2.1202 2.8653  2.3466  0.1210  -0.1066 0.3815  246 GLN A NE2 
1371 N N   . ASP A 174 ? 1.6132 2.6169  1.7393  0.1227  -0.0797 0.3258  247 ASP A N   
1372 C CA  . ASP A 174 ? 1.7306 2.7980  1.8308  0.1299  -0.0742 0.3066  247 ASP A CA  
1373 C C   . ASP A 174 ? 1.5845 2.6305  1.6744  0.1589  -0.0775 0.2675  247 ASP A C   
1374 O O   . ASP A 174 ? 1.7561 2.7737  1.8368  0.1652  -0.0879 0.2642  247 ASP A O   
1375 C CB  . ASP A 174 ? 1.8046 2.9077  1.8847  0.1135  -0.0791 0.3296  247 ASP A CB  
1376 C CG  . ASP A 174 ? 2.2053 3.3709  2.2547  0.1245  -0.0746 0.3054  247 ASP A CG  
1377 O OD1 . ASP A 174 ? 2.5314 3.7644  2.5727  0.1163  -0.0639 0.3069  247 ASP A OD1 
1378 O OD2 . ASP A 174 ? 2.1332 3.2821  2.1662  0.1412  -0.0825 0.2846  247 ASP A OD2 
1379 N N   . LEU A 175 ? 1.5332 2.5918  1.6253  0.1757  -0.0706 0.2388  248 LEU A N   
1380 C CA  . LEU A 175 ? 1.5217 2.5641  1.6016  0.2035  -0.0757 0.2005  248 LEU A CA  
1381 C C   . LEU A 175 ? 1.6708 2.7772  1.7260  0.2179  -0.0713 0.1737  248 LEU A C   
1382 O O   . LEU A 175 ? 1.5203 2.6128  1.5621  0.2424  -0.0783 0.1401  248 LEU A O   
1383 C CB  . LEU A 175 ? 1.1477 2.1498  1.2476  0.2163  -0.0746 0.1845  248 LEU A CB  
1384 C CG  . LEU A 175 ? 1.1190 2.1429  1.2386  0.2064  -0.0635 0.1940  248 LEU A CG  
1385 C CD1 . LEU A 175 ? 1.6097 2.6985  1.7211  0.2191  -0.0549 0.1704  248 LEU A CD1 
1386 C CD2 . LEU A 175 ? 1.0846 2.0488  1.2258  0.2108  -0.0658 0.1912  248 LEU A CD2 
1387 N N   . GLY A 176 ? 1.6768 2.8531  1.7251  0.2035  -0.0610 0.1875  249 GLY A N   
1388 C CA  . GLY A 176 ? 1.4904 2.7380  1.5180  0.2188  -0.0538 0.1602  249 GLY A CA  
1389 C C   . GLY A 176 ? 1.8253 3.0916  1.8197  0.2274  -0.0610 0.1460  249 GLY A C   
1390 O O   . GLY A 176 ? 2.3983 3.6400  2.3852  0.2124  -0.0695 0.1683  249 GLY A O   
1391 N N   . GLY A 177 ? 1.8117 3.1221  1.7860  0.2525  -0.0586 0.1081  250 GLY A N   
1392 C CA  . GLY A 177 ? 1.7670 3.1081  1.7524  0.2728  -0.0498 0.0810  250 GLY A CA  
1393 C C   . GLY A 177 ? 1.6179 2.9012  1.6050  0.3053  -0.0618 0.0426  250 GLY A C   
1394 O O   . GLY A 177 ? 1.5660 2.7713  1.5580  0.3052  -0.0752 0.0463  250 GLY A O   
1395 N N   . ILE A 178 ? 1.6748 2.9990  1.6581  0.3331  -0.0579 0.0063  251 ILE A N   
1396 C CA  . ILE A 178 ? 1.5034 2.7766  1.4897  0.3651  -0.0705 -0.0303 251 ILE A CA  
1397 C C   . ILE A 178 ? 1.4497 2.7112  1.4029  0.3905  -0.0855 -0.0663 251 ILE A C   
1398 O O   . ILE A 178 ? 1.6029 2.9272  1.5313  0.3946  -0.0802 -0.0772 251 ILE A O   
1399 C CB  . ILE A 178 ? 1.2251 2.5463  1.2292  0.3830  -0.0602 -0.0497 251 ILE A CB  
1400 C CG1 . ILE A 178 ? 1.3926 2.7289  1.4276  0.3545  -0.0465 -0.0129 251 ILE A CG1 
1401 C CG2 . ILE A 178 ? 1.2245 2.4873  1.2334  0.4151  -0.0759 -0.0843 251 ILE A CG2 
1402 C CD1 . ILE A 178 ? 1.5148 2.8995  1.5702  0.3688  -0.0371 -0.0284 251 ILE A CD1 
1403 N N   . SER A 179 ? 1.2885 2.4691  1.2399  0.4063  -0.1053 -0.0843 252 SER A N   
1404 C CA  . SER A 179 ? 1.4037 2.5606  1.3247  0.4327  -0.1241 -0.1224 252 SER A CA  
1405 C C   . SER A 179 ? 1.6390 2.8119  1.5595  0.4715  -0.1281 -0.1669 252 SER A C   
1406 O O   . SER A 179 ? 1.4476 2.5903  1.3922  0.4796  -0.1302 -0.1695 252 SER A O   
1407 C CB  . SER A 179 ? 1.7103 2.7706  1.6292  0.4267  -0.1462 -0.1163 252 SER A CB  
1408 O OG  . SER A 179 ? 2.5054 3.5538  2.4262  0.3941  -0.1435 -0.0771 252 SER A OG  
1409 N N   . TRP A 180 ? 1.6643 2.8856  1.5570  0.4966  -0.1300 -0.2028 253 TRP A N   
1410 C CA  . TRP A 180 ? 1.4058 2.6537  1.2985  0.5372  -0.1330 -0.2475 253 TRP A CA  
1411 C C   . TRP A 180 ? 1.6852 2.8428  1.5697  0.5648  -0.1629 -0.2799 253 TRP A C   
1412 O O   . TRP A 180 ? 1.9399 3.0911  1.8372  0.5937  -0.1690 -0.3064 253 TRP A O   
1413 C CB  . TRP A 180 ? 1.3846 2.7242  1.2503  0.5561  -0.1229 -0.2763 253 TRP A CB  
1414 C CG  . TRP A 180 ? 1.4877 2.8082  1.3137  0.5575  -0.1373 -0.2899 253 TRP A CG  
1415 C CD1 . TRP A 180 ? 1.6600 3.0035  1.4694  0.5262  -0.1301 -0.2602 253 TRP A CD1 
1416 C CD2 . TRP A 180 ? 1.5615 2.8338  1.3586  0.5913  -0.1634 -0.3365 253 TRP A CD2 
1417 N NE1 . TRP A 180 ? 2.0547 3.3706  1.8266  0.5379  -0.1493 -0.2854 253 TRP A NE1 
1418 C CE2 . TRP A 180 ? 1.8307 3.1012  1.5937  0.5775  -0.1702 -0.3329 253 TRP A CE2 
1419 C CE3 . TRP A 180 ? 1.5931 2.8208  1.3892  0.6317  -0.1840 -0.3806 253 TRP A CE3 
1420 C CZ2 . TRP A 180 ? 1.8439 3.0693  1.5715  0.6017  -0.1966 -0.3727 253 TRP A CZ2 
1421 C CZ3 . TRP A 180 ? 1.6529 2.8328  1.4141  0.6564  -0.2111 -0.4197 253 TRP A CZ3 
1422 C CH2 . TRP A 180 ? 1.7038 2.8828  1.4308  0.6409  -0.2171 -0.4161 253 TRP A CH2 
1423 N N   . GLN A 181 ? 1.7877 2.8760  1.6513  0.5558  -0.1833 -0.2772 254 GLN A N   
1424 C CA  . GLN A 181 ? 1.6897 2.6891  1.5433  0.5779  -0.2148 -0.3052 254 GLN A CA  
1425 C C   . GLN A 181 ? 1.5872 2.5285  1.4727  0.5735  -0.2204 -0.2898 254 GLN A C   
1426 O O   . GLN A 181 ? 1.7305 2.6447  1.6207  0.6033  -0.2351 -0.3191 254 GLN A O   
1427 C CB  . GLN A 181 ? 1.9636 2.9033  1.7922  0.5610  -0.2347 -0.2971 254 GLN A CB  
1428 C CG  . GLN A 181 ? 1.7601 2.7507  1.5530  0.5642  -0.2325 -0.3127 254 GLN A CG  
1429 C CD  . GLN A 181 ? 1.7511 2.8009  1.5483  0.5281  -0.2078 -0.2703 254 GLN A CD  
1430 O OE1 . GLN A 181 ? 1.7941 2.8717  1.6215  0.5079  -0.1867 -0.2368 254 GLN A OE1 
1431 N NE2 . GLN A 181 ? 2.2747 3.3413  2.0406  0.5194  -0.2122 -0.2713 254 GLN A NE2 
1432 N N   . LEU A 182 ? 1.5350 2.4565  1.4420  0.5371  -0.2098 -0.2442 255 LEU A N   
1433 C CA  . LEU A 182 ? 1.7710 2.6437  1.7068  0.5303  -0.2128 -0.2278 255 LEU A CA  
1434 C C   . LEU A 182 ? 1.7384 2.6650  1.6975  0.5458  -0.1968 -0.2363 255 LEU A C   
1435 O O   . LEU A 182 ? 1.5492 2.4363  1.5265  0.5538  -0.2054 -0.2385 255 LEU A O   
1436 C CB  . LEU A 182 ? 1.6759 2.5252  1.6289  0.4898  -0.2026 -0.1794 255 LEU A CB  
1437 C CG  . LEU A 182 ? 1.4381 2.2137  1.3797  0.4729  -0.2226 -0.1659 255 LEU A CG  
1438 C CD1 . LEU A 182 ? 1.6214 2.3209  1.5576  0.4907  -0.2516 -0.1881 255 LEU A CD1 
1439 C CD2 . LEU A 182 ? 1.5386 2.3332  1.4511  0.4690  -0.2270 -0.1711 255 LEU A CD2 
1440 N N   . ALA A 183 ? 1.6922 2.7110  1.6513  0.5487  -0.1743 -0.2395 256 ALA A N   
1441 C CA  . ALA A 183 ? 1.6656 2.7445  1.6460  0.5664  -0.1608 -0.2520 256 ALA A CA  
1442 C C   . ALA A 183 ? 1.9522 3.0193  1.9240  0.6126  -0.1802 -0.3015 256 ALA A C   
1443 O O   . ALA A 183 ? 2.3202 3.3858  2.3139  0.6293  -0.1827 -0.3112 256 ALA A O   
1444 C CB  . ALA A 183 ? 1.7037 2.8896  1.6842  0.5568  -0.1333 -0.2432 256 ALA A CB  
1445 N N   . LEU A 184 ? 1.8965 2.9529  1.8359  0.6346  -0.1960 -0.3341 257 LEU A N   
1446 C CA  . LEU A 184 ? 1.9700 3.0029  1.8990  0.6807  -0.2192 -0.3835 257 LEU A CA  
1447 C C   . LEU A 184 ? 2.0980 3.0223  2.0331  0.6831  -0.2485 -0.3823 257 LEU A C   
1448 O O   . LEU A 184 ? 1.8387 2.7447  1.7850  0.7131  -0.2626 -0.4067 257 LEU A O   
1449 C CB  . LEU A 184 ? 1.4755 2.5181  1.3653  0.7019  -0.2308 -0.4190 257 LEU A CB  
1450 C CG  . LEU A 184 ? 1.5588 2.7114  1.4390  0.7289  -0.2122 -0.4504 257 LEU A CG  
1451 C CD1 . LEU A 184 ? 1.4486 2.6959  1.3433  0.6959  -0.1757 -0.4130 257 LEU A CD1 
1452 C CD2 . LEU A 184 ? 2.0643 3.2124  1.9015  0.7497  -0.2276 -0.4871 257 LEU A CD2 
1453 N N   . CYS A 185 ? 2.1612 3.0151  2.0896  0.6514  -0.2586 -0.3530 258 CYS A N   
1454 C CA  . CYS A 185 ? 1.8161 2.5714  1.7500  0.6479  -0.2853 -0.3464 258 CYS A CA  
1455 C C   . CYS A 185 ? 1.7525 2.5098  1.7208  0.6419  -0.2756 -0.3272 258 CYS A C   
1456 O O   . CYS A 185 ? 2.0762 2.7892  2.0514  0.6633  -0.2962 -0.3438 258 CYS A O   
1457 C CB  . CYS A 185 ? 1.7178 2.4144  1.6420  0.6109  -0.2928 -0.3139 258 CYS A CB  
1458 S SG  . CYS A 185 ? 1.6795 2.3617  1.5619  0.6144  -0.3096 -0.3343 258 CYS A SG  
1459 N N   . ILE A 186 ? 1.7189 2.5260  1.7082  0.6127  -0.2460 -0.2921 259 ILE A N   
1460 C CA  . ILE A 186 ? 1.8283 2.6401  1.8490  0.6046  -0.2361 -0.2733 259 ILE A CA  
1461 C C   . ILE A 186 ? 1.7267 2.5972  1.7608  0.6390  -0.2318 -0.3030 259 ILE A C   
1462 O O   . ILE A 186 ? 1.3988 2.2581  1.4553  0.6431  -0.2343 -0.2987 259 ILE A O   
1463 C CB  . ILE A 186 ? 1.6659 2.5134  1.7038  0.5647  -0.2076 -0.2298 259 ILE A CB  
1464 C CG1 . ILE A 186 ? 1.2037 2.0223  1.2685  0.5494  -0.2049 -0.2060 259 ILE A CG1 
1465 C CG2 . ILE A 186 ? 1.5301 2.4801  1.5735  0.5662  -0.1809 -0.2315 259 ILE A CG2 
1466 C CD1 . ILE A 186 ? 1.1558 2.0045  1.2380  0.5131  -0.1795 -0.1664 259 ILE A CD1 
1467 N N   . MET A 187 ? 1.7029 2.6397  1.7237  0.6644  -0.2254 -0.3335 260 MET A N   
1468 C CA  . MET A 187 ? 1.7353 2.7273  1.7683  0.7034  -0.2248 -0.3675 260 MET A CA  
1469 C C   . MET A 187 ? 1.8147 2.7335  1.8400  0.7401  -0.2604 -0.4021 260 MET A C   
1470 O O   . MET A 187 ? 1.8014 2.7255  1.8475  0.7625  -0.2671 -0.4149 260 MET A O   
1471 C CB  . MET A 187 ? 1.6977 2.7854  1.7171  0.7215  -0.2078 -0.3922 260 MET A CB  
1472 C CG  . MET A 187 ? 1.4759 2.6627  1.5138  0.6955  -0.1721 -0.3640 260 MET A CG  
1473 S SD  . MET A 187 ? 2.5718 3.8776  2.5908  0.7145  -0.1523 -0.3915 260 MET A SD  
1474 C CE  . MET A 187 ? 1.4977 2.8308  1.5229  0.7778  -0.1675 -0.4506 260 MET A CE  
1475 N N   . LEU A 188 ? 1.8433 2.6918  1.8388  0.7457  -0.2857 -0.4167 261 LEU A N   
1476 C CA  . LEU A 188 ? 1.9360 2.7017  1.9222  0.7760  -0.3241 -0.4454 261 LEU A CA  
1477 C C   . LEU A 188 ? 1.9681 2.6636  1.9736  0.7565  -0.3368 -0.4164 261 LEU A C   
1478 O O   . LEU A 188 ? 1.8590 2.5158  1.8721  0.7830  -0.3605 -0.4350 261 LEU A O   
1479 C CB  . LEU A 188 ? 1.6754 2.3768  1.6247  0.7785  -0.3495 -0.4616 261 LEU A CB  
1480 C CG  . LEU A 188 ? 1.7642 2.3658  1.6995  0.8041  -0.3945 -0.4877 261 LEU A CG  
1481 C CD1 . LEU A 188 ? 1.7770 2.4057  1.7186  0.8582  -0.4065 -0.5347 261 LEU A CD1 
1482 C CD2 . LEU A 188 ? 2.1804 2.7236  2.0783  0.8009  -0.4183 -0.5006 261 LEU A CD2 
1483 N N   . ILE A 189 ? 2.0485 2.7282  2.0617  0.7110  -0.3217 -0.3712 262 ILE A N   
1484 C CA  . ILE A 189 ? 2.1928 2.8120  2.2226  0.6904  -0.3312 -0.3429 262 ILE A CA  
1485 C C   . ILE A 189 ? 2.1688 2.8400  2.2300  0.6971  -0.3152 -0.3382 262 ILE A C   
1486 O O   . ILE A 189 ? 2.0711 2.7005  2.1435  0.7074  -0.3339 -0.3401 262 ILE A O   
1487 C CB  . ILE A 189 ? 1.8753 2.4669  1.9038  0.6428  -0.3193 -0.2992 262 ILE A CB  
1488 C CG1 . ILE A 189 ? 1.7911 2.3239  1.7899  0.6369  -0.3409 -0.3042 262 ILE A CG1 
1489 C CG2 . ILE A 189 ? 1.7176 2.2617  1.7642  0.6208  -0.3238 -0.2696 262 ILE A CG2 
1490 C CD1 . ILE A 189 ? 1.9820 2.4978  1.9802  0.5941  -0.3290 -0.2646 262 ILE A CD1 
1491 N N   . PHE A 190 ? 1.9045 2.6677  1.9801  0.6897  -0.2821 -0.3304 263 PHE A N   
1492 C CA  . PHE A 190 ? 1.7808 2.6018  1.8865  0.6972  -0.2678 -0.3286 263 PHE A CA  
1493 C C   . PHE A 190 ? 1.6619 2.5007  1.7720  0.7471  -0.2855 -0.3718 263 PHE A C   
1494 O O   . PHE A 190 ? 1.8109 2.6744  1.9464  0.7577  -0.2844 -0.3725 263 PHE A O   
1495 C CB  . PHE A 190 ? 1.5794 2.4976  1.6974  0.6778  -0.2309 -0.3116 263 PHE A CB  
1496 C CG  . PHE A 190 ? 1.4888 2.3922  1.6129  0.6298  -0.2134 -0.2658 263 PHE A CG  
1497 C CD1 . PHE A 190 ? 1.1996 2.0343  1.3320  0.6095  -0.2231 -0.2419 263 PHE A CD1 
1498 C CD2 . PHE A 190 ? 1.5876 2.5458  1.7085  0.6058  -0.1884 -0.2471 263 PHE A CD2 
1499 C CE1 . PHE A 190 ? 1.1599 1.9819  1.2981  0.5690  -0.2074 -0.2032 263 PHE A CE1 
1500 C CE2 . PHE A 190 ? 1.4812 2.4218  1.6084  0.5647  -0.1747 -0.2066 263 PHE A CE2 
1501 C CZ  . PHE A 190 ? 1.2857 2.1586  1.4220  0.5477  -0.1838 -0.1862 263 PHE A CZ  
1502 N N   . THR A 191 ? 1.6474 2.4741  1.7336  0.7790  -0.3029 -0.4089 264 THR A N   
1503 C CA  . THR A 191 ? 1.6689 2.4979  1.7575  0.8307  -0.3255 -0.4534 264 THR A CA  
1504 C C   . THR A 191 ? 1.9848 2.7048  2.0690  0.8399  -0.3651 -0.4562 264 THR A C   
1505 O O   . THR A 191 ? 1.9034 2.6203  2.0045  0.8697  -0.3812 -0.4738 264 THR A O   
1506 C CB  . THR A 191 ? 1.5614 2.4183  1.6239  0.8632  -0.3302 -0.4951 264 THR A CB  
1507 O OG1 . THR A 191 ? 1.7607 2.7190  1.8244  0.8490  -0.2934 -0.4873 264 THR A OG1 
1508 C CG2 . THR A 191 ? 1.8360 2.7098  1.9043  0.9213  -0.3503 -0.5446 264 THR A CG2 
1509 N N   . VAL A 192 ? 2.0983 2.7307  2.1608  0.8136  -0.3822 -0.4376 265 VAL A N   
1510 C CA  . VAL A 192 ? 2.0765 2.6048  2.1322  0.8187  -0.4219 -0.4376 265 VAL A CA  
1511 C C   . VAL A 192 ? 1.7215 2.2332  1.8017  0.7936  -0.4179 -0.4022 265 VAL A C   
1512 O O   . VAL A 192 ? 1.6870 2.1380  1.7705  0.8064  -0.4481 -0.4058 265 VAL A O   
1513 C CB  . VAL A 192 ? 1.5635 2.0080  1.5881  0.7972  -0.4428 -0.4286 265 VAL A CB  
1514 C CG1 . VAL A 192 ? 1.6448 2.0758  1.6734  0.7429  -0.4232 -0.3785 265 VAL A CG1 
1515 C CG2 . VAL A 192 ? 1.6284 1.9704  1.6398  0.8152  -0.4912 -0.4431 265 VAL A CG2 
1516 N N   . ILE A 193 ? 1.5670 2.1296  1.6632  0.7578  -0.3829 -0.3679 266 ILE A N   
1517 C CA  . ILE A 193 ? 1.9419 2.4986  2.0612  0.7371  -0.3775 -0.3388 266 ILE A CA  
1518 C C   . ILE A 193 ? 1.6732 2.2992  1.8199  0.7655  -0.3697 -0.3559 266 ILE A C   
1519 O O   . ILE A 193 ? 1.5798 2.1894  1.7437  0.7615  -0.3774 -0.3427 266 ILE A O   
1520 C CB  . ILE A 193 ? 1.9507 2.5286  2.0767  0.6888  -0.3459 -0.2966 266 ILE A CB  
1521 C CG1 . ILE A 193 ? 2.1137 2.7946  2.2537  0.6861  -0.3094 -0.2965 266 ILE A CG1 
1522 C CG2 . ILE A 193 ? 1.5110 2.0310  1.6127  0.6618  -0.3517 -0.2798 266 ILE A CG2 
1523 C CD1 . ILE A 193 ? 1.8630 2.5627  2.0116  0.6409  -0.2809 -0.2559 266 ILE A CD1 
1524 N N   . TYR A 194 ? 1.7798 2.4869  1.9310  0.7937  -0.3549 -0.3848 267 TYR A N   
1525 C CA  . TYR A 194 ? 1.8061 2.5891  1.9856  0.8220  -0.3471 -0.4023 267 TYR A CA  
1526 C C   . TYR A 194 ? 1.8823 2.6165  2.0650  0.8641  -0.3852 -0.4313 267 TYR A C   
1527 O O   . TYR A 194 ? 2.0980 2.8413  2.3048  0.8702  -0.3907 -0.4255 267 TYR A O   
1528 C CB  . TYR A 194 ? 2.1057 2.9911  2.2869  0.8420  -0.3225 -0.4270 267 TYR A CB  
1529 C CG  . TYR A 194 ? 2.1572 3.1382  2.3704  0.8683  -0.3099 -0.4431 267 TYR A CG  
1530 C CD1 . TYR A 194 ? 1.8466 2.8417  2.0884  0.8527  -0.3048 -0.4192 267 TYR A CD1 
1531 C CD2 . TYR A 194 ? 2.4618 3.5225  2.6763  0.9087  -0.3034 -0.4827 267 TYR A CD2 
1532 C CE1 . TYR A 194 ? 1.9900 3.0757  2.2627  0.8753  -0.2943 -0.4327 267 TYR A CE1 
1533 C CE2 . TYR A 194 ? 2.3649 3.5207  2.6111  0.9328  -0.2915 -0.4970 267 TYR A CE2 
1534 C CZ  . TYR A 194 ? 2.2212 3.3890  2.4973  0.9153  -0.2874 -0.4710 267 TYR A CZ  
1535 O OH  . TYR A 194 ? 2.3303 3.5959  2.6397  0.9377  -0.2764 -0.4839 267 TYR A OH  
1536 N N   . PHE A 195 ? 1.9261 2.6053  2.0841  0.8934  -0.4139 -0.4626 268 PHE A N   
1537 C CA  . PHE A 195 ? 2.3264 2.9534  2.4856  0.9367  -0.4541 -0.4929 268 PHE A CA  
1538 C C   . PHE A 195 ? 2.2686 2.7922  2.4239  0.9153  -0.4841 -0.4655 268 PHE A C   
1539 O O   . PHE A 195 ? 2.7444 3.2228  2.9046  0.9463  -0.5187 -0.4830 268 PHE A O   
1540 C CB  . PHE A 195 ? 2.5322 3.1287  2.6639  0.9745  -0.4776 -0.5364 268 PHE A CB  
1541 C CG  . PHE A 195 ? 2.3689 3.0715  2.5038  1.0048  -0.4524 -0.5708 268 PHE A CG  
1542 C CD1 . PHE A 195 ? 2.0927 2.9075  2.2597  1.0107  -0.4207 -0.5696 268 PHE A CD1 
1543 C CD2 . PHE A 195 ? 2.5219 3.2150  2.6267  1.0258  -0.4606 -0.6036 268 PHE A CD2 
1544 C CE1 . PHE A 195 ? 2.1195 3.0391  2.2891  1.0363  -0.3967 -0.5992 268 PHE A CE1 
1545 C CE2 . PHE A 195 ? 2.4516 3.2478  2.5572  1.0532  -0.4365 -0.6354 268 PHE A CE2 
1546 C CZ  . PHE A 195 ? 2.4029 3.3145  2.5412  1.0580  -0.4039 -0.6325 268 PHE A CZ  
1547 N N   . SER A 196 ? 1.7622 2.2496  1.9089  0.8640  -0.4725 -0.4233 269 SER A N   
1548 C CA  . SER A 196 ? 1.9182 2.3202  2.0615  0.8380  -0.4957 -0.3928 269 SER A CA  
1549 C C   . SER A 196 ? 2.1099 2.5503  2.2803  0.8154  -0.4763 -0.3632 269 SER A C   
1550 O O   . SER A 196 ? 1.8740 2.2540  2.0420  0.7905  -0.4912 -0.3352 269 SER A O   
1551 C CB  . SER A 196 ? 1.9478 2.2879  2.0655  0.7958  -0.4961 -0.3648 269 SER A CB  
1552 O OG  . SER A 196 ? 2.0315 2.3416  2.1235  0.8131  -0.5119 -0.3911 269 SER A OG  
1553 N N   . ILE A 197 ? 2.1345 2.6748  2.3292  0.8220  -0.4443 -0.3683 270 ILE A N   
1554 C CA  . ILE A 197 ? 1.8894 2.4735  2.1091  0.7969  -0.4227 -0.3399 270 ILE A CA  
1555 C C   . ILE A 197 ? 2.1027 2.7598  2.3520  0.8339  -0.4220 -0.3637 270 ILE A C   
1556 O O   . ILE A 197 ? 2.4428 3.0878  2.7084  0.8369  -0.4362 -0.3554 270 ILE A O   
1557 C CB  . ILE A 197 ? 1.8297 2.4660  2.0514  0.7561  -0.3813 -0.3128 270 ILE A CB  
1558 C CG1 . ILE A 197 ? 2.1310 2.6937  2.3283  0.7175  -0.3834 -0.2847 270 ILE A CG1 
1559 C CG2 . ILE A 197 ? 1.8566 2.5457  2.1052  0.7355  -0.3604 -0.2899 270 ILE A CG2 
1560 C CD1 . ILE A 197 ? 2.3093 2.7984  2.5035  0.6963  -0.4038 -0.2594 270 ILE A CD1 
1561 N N   . TRP A 198 ? 2.0639 2.8018  2.3204  0.8613  -0.4049 -0.3925 271 TRP A N   
1562 C CA  . TRP A 198 ? 2.1722 3.0079  2.4606  0.8909  -0.3933 -0.4122 271 TRP A CA  
1563 C C   . TRP A 198 ? 2.3920 3.2026  2.6980  0.9238  -0.4258 -0.4260 271 TRP A C   
1564 O O   . TRP A 198 ? 2.2234 3.1003  2.5604  0.9282  -0.4160 -0.4222 271 TRP A O   
1565 C CB  . TRP A 198 ? 1.7795 2.6838  2.0645  0.9275  -0.3830 -0.4514 271 TRP A CB  
1566 C CG  . TRP A 198 ? 1.9478 2.7918  2.2136  0.9744  -0.4196 -0.4921 271 TRP A CG  
1567 C CD1 . TRP A 198 ? 1.9549 2.6814  2.1933  0.9712  -0.4538 -0.4900 271 TRP A CD1 
1568 C CD2 . TRP A 198 ? 1.9148 2.8132  2.1873  1.0316  -0.4273 -0.5416 271 TRP A CD2 
1569 N NE1 . TRP A 198 ? 2.1560 2.8541  2.3827  1.0219  -0.4841 -0.5348 271 TRP A NE1 
1570 C CE2 . TRP A 198 ? 2.0719 2.8722  2.3174  1.0594  -0.4674 -0.5681 271 TRP A CE2 
1571 C CE3 . TRP A 198 ? 1.8254 2.8347  2.1137  1.0476  -0.4004 -0.5616 271 TRP A CE3 
1572 C CZ2 . TRP A 198 ? 2.2482 3.0537  2.4795  1.1016  -0.4806 -0.6152 271 TRP A CZ2 
1573 C CZ3 . TRP A 198 ? 2.1806 3.1993  2.4548  1.0896  -0.4123 -0.6076 271 TRP A CZ3 
1574 C CH2 . TRP A 198 ? 2.4344 3.3512  2.6803  1.1172  -0.4522 -0.6350 271 TRP A CH2 
1575 N N   . LYS A 199 ? 2.4781 3.1934  2.7653  0.9456  -0.4661 -0.4407 272 LYS A N   
1576 C CA  . LYS A 199 ? 2.3375 3.0173  2.6392  0.9758  -0.5018 -0.4512 272 LYS A CA  
1577 C C   . LYS A 199 ? 2.3268 2.9546  2.6312  0.9365  -0.5098 -0.4094 272 LYS A C   
1578 O O   . LYS A 199 ? 2.5089 3.1005  2.8231  0.9548  -0.5407 -0.4117 272 LYS A O   
1579 C CB  . LYS A 199 ? 2.4006 2.9885  2.6755  1.0076  -0.5428 -0.4807 272 LYS A CB  
1580 C CG  . LYS A 199 ? 2.7154 3.3486  2.9831  1.0475  -0.5373 -0.5280 272 LYS A CG  
1581 C CD  . LYS A 199 ? 2.9712 3.5048  3.2106  1.0769  -0.5814 -0.5576 272 LYS A CD  
1582 C CE  . LYS A 199 ? 2.8818 3.3486  3.1263  1.0830  -0.6160 -0.5523 272 LYS A CE  
1583 N NZ  . LYS A 199 ? 2.8161 3.1805  3.0323  1.1089  -0.6620 -0.5793 272 LYS A NZ  
1584 N N   . GLY A 200 ? 2.0352 2.6588  2.3303  0.8838  -0.4834 -0.3722 273 GLY A N   
1585 C CA  . GLY A 200 ? 2.0678 2.6516  2.3641  0.8455  -0.4868 -0.3339 273 GLY A CA  
1586 C C   . GLY A 200 ? 2.3498 2.8213  2.6146  0.8226  -0.5129 -0.3147 273 GLY A C   
1587 O O   . GLY A 200 ? 2.4059 2.8345  2.6462  0.8211  -0.5184 -0.3218 273 GLY A O   
1588 N N   . VAL A 201 ? 2.4386 2.8647  2.7038  0.8026  -0.5297 -0.2888 274 VAL A N   
1589 C CA  . VAL A 201 ? 2.3249 2.6499  2.5617  0.7768  -0.5552 -0.2659 274 VAL A CA  
1590 C C   . VAL A 201 ? 2.3533 2.6019  2.5752  0.8113  -0.6023 -0.2887 274 VAL A C   
1591 O O   . VAL A 201 ? 2.0498 2.2119  2.2460  0.7908  -0.6271 -0.2714 274 VAL A O   
1592 C CB  . VAL A 201 ? 2.1583 2.4635  2.3985  0.7452  -0.5594 -0.2315 274 VAL A CB  
1593 C CG1 . VAL A 201 ? 1.8800 2.2466  2.1297  0.7071  -0.5152 -0.2079 274 VAL A CG1 
1594 C CG2 . VAL A 201 ? 2.4113 2.7305  2.6736  0.7776  -0.5839 -0.2440 274 VAL A CG2 
1595 N N   . LYS A 202 ? 2.5803 2.8592  2.8178  0.8632  -0.6164 -0.3273 275 LYS A N   
1596 C CA  . LYS A 202 ? 2.5978 2.8012  2.8210  0.9004  -0.6636 -0.3533 275 LYS A CA  
1597 C C   . LYS A 202 ? 2.7196 2.8825  2.9142  0.8975  -0.6657 -0.3654 275 LYS A C   
1598 O O   . LYS A 202 ? 2.9568 3.0234  3.1253  0.8884  -0.7006 -0.3578 275 LYS A O   
1599 C CB  . LYS A 202 ? 2.5191 2.7708  2.7640  0.9519  -0.6701 -0.3934 275 LYS A CB  
1600 N N   . THR A 203 ? 2.5720 2.8081  2.7702  0.9032  -0.6298 -0.3827 276 THR A N   
1601 C CA  . THR A 203 ? 2.4504 2.6547  2.6211  0.8994  -0.6299 -0.3942 276 THR A CA  
1602 C C   . THR A 203 ? 2.2071 2.3805  2.3592  0.8412  -0.6119 -0.3528 276 THR A C   
1603 O O   . THR A 203 ? 2.2356 2.3408  2.3606  0.8291  -0.6303 -0.3502 276 THR A O   
1604 C CB  . THR A 203 ? 2.5088 2.8057  2.6881  0.9267  -0.5990 -0.4275 276 THR A CB  
1605 O OG1 . THR A 203 ? 2.6141 3.0096  2.8199  0.9094  -0.5556 -0.4117 276 THR A OG1 
1606 C CG2 . THR A 203 ? 2.4722 2.7800  2.6599  0.9905  -0.6253 -0.4772 276 THR A CG2 
1607 N N   . SER A 204 ? 2.1402 2.3628  2.3071  0.8056  -0.5776 -0.3212 277 SER A N   
1608 C CA  . SER A 204 ? 2.0868 2.2863  2.2386  0.7534  -0.5588 -0.2839 277 SER A CA  
1609 C C   . SER A 204 ? 2.2144 2.3151  2.3458  0.7293  -0.5935 -0.2586 277 SER A C   
1610 O O   . SER A 204 ? 2.4619 2.5307  2.5759  0.6915  -0.5865 -0.2333 277 SER A O   
1611 C CB  . SER A 204 ? 2.1053 2.3737  2.2774  0.7237  -0.5186 -0.2578 277 SER A CB  
1612 O OG  . SER A 204 ? 2.2797 2.5307  2.4622  0.7153  -0.5316 -0.2394 277 SER A OG  
1613 N N   . GLY A 205 ? 2.3841 2.4384  2.5177  0.7493  -0.6312 -0.2634 278 GLY A N   
1614 C CA  . GLY A 205 ? 2.4066 2.3642  2.5185  0.7280  -0.6695 -0.2404 278 GLY A CA  
1615 C C   . GLY A 205 ? 2.2281 2.1122  2.3179  0.7518  -0.7103 -0.2644 278 GLY A C   
1616 O O   . GLY A 205 ? 2.1183 1.9231  2.1846  0.7258  -0.7375 -0.2437 278 GLY A O   
1617 N N   . LYS A 206 ? 2.3725 2.2838  2.4693  0.8012  -0.7156 -0.3086 279 LYS A N   
1618 C CA  . LYS A 206 ? 2.4728 2.3156  2.5475  0.8282  -0.7546 -0.3374 279 LYS A CA  
1619 C C   . LYS A 206 ? 2.6123 2.4589  2.6671  0.8103  -0.7361 -0.3403 279 LYS A C   
1620 O O   . LYS A 206 ? 2.9139 2.6808  2.9423  0.7993  -0.7672 -0.3377 279 LYS A O   
1621 C CB  . LYS A 206 ? 2.4798 2.3506  2.5690  0.8920  -0.7694 -0.3871 279 LYS A CB  
1622 C CG  . LYS A 206 ? 2.6651 2.4578  2.7531  0.9206  -0.8249 -0.3965 279 LYS A CG  
1623 C CD  . LYS A 206 ? 2.7304 2.5138  2.8312  0.8932  -0.8290 -0.3571 279 LYS A CD  
1624 C CE  . LYS A 206 ? 2.9413 2.6414  3.0341  0.9067  -0.8783 -0.3612 279 LYS A CE  
1625 N NZ  . LYS A 206 ? 3.1828 2.8735  3.2850  0.8776  -0.8829 -0.3216 279 LYS A NZ  
1626 N N   . VAL A 207 ? 2.4608 2.3986  2.5279  0.8058  -0.6875 -0.3442 280 VAL A N   
1627 C CA  . VAL A 207 ? 2.0826 2.0297  2.1318  0.7887  -0.6689 -0.3457 280 VAL A CA  
1628 C C   . VAL A 207 ? 2.1917 2.0967  2.2273  0.7319  -0.6643 -0.3000 280 VAL A C   
1629 O O   . VAL A 207 ? 2.4025 2.2756  2.4169  0.7149  -0.6692 -0.2969 280 VAL A O   
1630 C CB  . VAL A 207 ? 2.0002 2.0580  2.0667  0.7975  -0.6194 -0.3590 280 VAL A CB  
1631 C CG1 . VAL A 207 ? 1.9930 2.0614  2.0402  0.7809  -0.6019 -0.3605 280 VAL A CG1 
1632 C CG2 . VAL A 207 ? 2.1980 2.3053  2.2794  0.8542  -0.6238 -0.4044 280 VAL A CG2 
1633 N N   . VAL A 208 ? 2.2396 2.1458  2.2869  0.7024  -0.6558 -0.2645 281 VAL A N   
1634 C CA  . VAL A 208 ? 2.3162 2.1890  2.3521  0.6499  -0.6506 -0.2215 281 VAL A CA  
1635 C C   . VAL A 208 ? 2.3109 2.0834  2.3204  0.6390  -0.6981 -0.2142 281 VAL A C   
1636 O O   . VAL A 208 ? 2.1297 1.8755  2.1246  0.6009  -0.6963 -0.1884 281 VAL A O   
1637 C CB  . VAL A 208 ? 2.1028 1.9980  2.1552  0.6257  -0.6348 -0.1898 281 VAL A CB  
1638 C CG1 . VAL A 208 ? 1.9251 1.7499  1.9614  0.5865  -0.6588 -0.1524 281 VAL A CG1 
1639 C CG2 . VAL A 208 ? 1.8941 1.8721  1.9627  0.6051  -0.5821 -0.1765 281 VAL A CG2 
1640 N N   . TRP A 209 ? 2.9207 2.6369  2.9242  0.6723  -0.7425 -0.2367 282 TRP A N   
1641 C CA  . TRP A 209 ? 2.9809 2.5952  2.9583  0.6631  -0.7932 -0.2309 282 TRP A CA  
1642 C C   . TRP A 209 ? 2.9974 2.5933  2.9540  0.6506  -0.7934 -0.2372 282 TRP A C   
1643 O O   . TRP A 209 ? 2.9954 2.5353  2.9339  0.6122  -0.8117 -0.2087 282 TRP A O   
1644 C CB  . TRP A 209 ? 3.4250 2.9884  3.4004  0.7119  -0.8396 -0.2652 282 TRP A CB  
1645 C CG  . TRP A 209 ? 3.5114 3.0411  3.4951  0.7102  -0.8650 -0.2458 282 TRP A CG  
1646 C CD1 . TRP A 209 ? 3.2428 2.8293  3.2524  0.7265  -0.8468 -0.2470 282 TRP A CD1 
1647 C CD2 . TRP A 209 ? 3.5619 2.9936  3.5270  0.6896  -0.9155 -0.2208 282 TRP A CD2 
1648 N NE1 . TRP A 209 ? 3.1245 2.6545  3.1323  0.7183  -0.8823 -0.2248 282 TRP A NE1 
1649 C CE2 . TRP A 209 ? 3.3636 2.7981  3.3439  0.6952  -0.9249 -0.2077 282 TRP A CE2 
1650 C CE3 . TRP A 209 ? 3.6282 2.9707  3.5650  0.6646  -0.9548 -0.2064 282 TRP A CE3 
1651 C CZ2 . TRP A 209 ? 3.4481 2.7996  3.4152  0.6771  -0.9720 -0.1803 282 TRP A CZ2 
1652 C CZ3 . TRP A 209 ? 3.6822 2.9423  3.6065  0.6453  -1.0017 -0.1785 282 TRP A CZ3 
1653 C CH2 . TRP A 209 ? 3.5953 2.8604  3.5342  0.6517  -1.0098 -0.1653 282 TRP A CH2 
1654 N N   . VAL A 210 ? 1.8949 1.5411  1.8535  0.6814  -0.7733 -0.2736 283 VAL A N   
1655 C CA  . VAL A 210 ? 2.1809 1.8125  2.1185  0.6721  -0.7744 -0.2823 283 VAL A CA  
1656 C C   . VAL A 210 ? 2.2125 1.8980  2.1554  0.6281  -0.7297 -0.2493 283 VAL A C   
1657 O O   . VAL A 210 ? 2.0124 1.6634  1.9387  0.5957  -0.7376 -0.2304 283 VAL A O   
1658 C CB  . VAL A 210 ? 2.0497 1.7142  1.9840  0.7231  -0.7725 -0.3355 283 VAL A CB  
1659 C CG1 . VAL A 210 ? 2.2413 1.8850  2.1502  0.7138  -0.7780 -0.3460 283 VAL A CG1 
1660 C CG2 . VAL A 210 ? 2.4420 2.0551  2.3738  0.7710  -0.8170 -0.3704 283 VAL A CG2 
1661 N N   . THR A 211 ? 2.4409 2.2109  2.4079  0.6261  -0.6839 -0.2416 284 THR A N   
1662 C CA  . THR A 211 ? 2.4014 2.2262  2.3748  0.5909  -0.6411 -0.2158 284 THR A CA  
1663 C C   . THR A 211 ? 2.3223 2.1166  2.2944  0.5416  -0.6414 -0.1688 284 THR A C   
1664 O O   . THR A 211 ? 2.4783 2.2882  2.4475  0.5098  -0.6217 -0.1472 284 THR A O   
1665 C CB  . THR A 211 ? 2.2334 2.1527  2.2323  0.6026  -0.5955 -0.2210 284 THR A CB  
1666 O OG1 . THR A 211 ? 2.1282 2.0530  2.1442  0.5979  -0.5932 -0.2041 284 THR A OG1 
1667 C CG2 . THR A 211 ? 2.1023 2.0618  2.1035  0.6512  -0.5939 -0.2671 284 THR A CG2 
1668 N N   . ALA A 212 ? 1.9386 1.6946  1.9134  0.5348  -0.6626 -0.1522 285 ALA A N   
1669 C CA  . ALA A 212 ? 1.8991 1.6326  1.8717  0.4880  -0.6622 -0.1078 285 ALA A CA  
1670 C C   . ALA A 212 ? 2.2927 1.9468  2.2410  0.4648  -0.7023 -0.0937 285 ALA A C   
1671 O O   . ALA A 212 ? 2.5167 2.1699  2.4610  0.4240  -0.6930 -0.0616 285 ALA A O   
1672 C CB  . ALA A 212 ? 2.3759 2.1051  2.3592  0.4866  -0.6678 -0.0932 285 ALA A CB  
1673 N N   . THR A 213 ? 2.4592 2.0466  2.3918  0.4902  -0.7483 -0.1172 286 THR A N   
1674 C CA  . THR A 213 ? 2.5743 2.0766  2.4831  0.4661  -0.7935 -0.1013 286 THR A CA  
1675 C C   . THR A 213 ? 2.4941 1.9896  2.3883  0.4562  -0.7941 -0.1087 286 THR A C   
1676 O O   . THR A 213 ? 2.2931 1.7484  2.1741  0.4174  -0.8122 -0.0802 286 THR A O   
1677 C CB  . THR A 213 ? 2.5246 1.9501  2.4214  0.4973  -0.8470 -0.1237 286 THR A CB  
1678 O OG1 . THR A 213 ? 2.7240 2.1680  2.6227  0.5500  -0.8465 -0.1740 286 THR A OG1 
1679 C CG2 . THR A 213 ? 2.3904 1.8109  2.2988  0.4975  -0.8539 -0.1068 286 THR A CG2 
1680 N N   . PHE A 214 ? 2.5331 2.0699  2.4291  0.4892  -0.7756 -0.1454 287 PHE A N   
1681 C CA  . PHE A 214 ? 2.6817 2.2102  2.5610  0.4826  -0.7794 -0.1557 287 PHE A CA  
1682 C C   . PHE A 214 ? 2.5829 2.1446  2.4668  0.4351  -0.7512 -0.1175 287 PHE A C   
1683 O O   . PHE A 214 ? 2.4813 1.9998  2.3479  0.4107  -0.7749 -0.1065 287 PHE A O   
1684 C CB  . PHE A 214 ? 2.5426 2.1236  2.4239  0.5264  -0.7586 -0.2008 287 PHE A CB  
1685 C CG  . PHE A 214 ? 2.4114 1.9905  2.2743  0.5220  -0.7606 -0.2138 287 PHE A CG  
1686 C CD1 . PHE A 214 ? 2.5700 2.0739  2.4057  0.5355  -0.8079 -0.2380 287 PHE A CD1 
1687 C CD2 . PHE A 214 ? 2.4170 2.0674  2.2889  0.5046  -0.7171 -0.2020 287 PHE A CD2 
1688 C CE1 . PHE A 214 ? 2.7180 2.2204  2.5351  0.5306  -0.8109 -0.2506 287 PHE A CE1 
1689 C CE2 . PHE A 214 ? 2.4222 2.0723  2.2767  0.4999  -0.7200 -0.2128 287 PHE A CE2 
1690 C CZ  . PHE A 214 ? 2.5756 2.1530  2.4022  0.5125  -0.7664 -0.2373 287 PHE A CZ  
1691 N N   . PRO A 215 ? 2.2341 1.8693  2.1405  0.4208  -0.7038 -0.0973 288 PRO A N   
1692 C CA  . PRO A 215 ? 2.1724 1.8381  2.0839  0.3792  -0.6792 -0.0636 288 PRO A CA  
1693 C C   . PRO A 215 ? 2.1871 1.8001  2.0894  0.3365  -0.7065 -0.0259 288 PRO A C   
1694 O O   . PRO A 215 ? 2.0192 1.6392  1.9191  0.3054  -0.7015 -0.0050 288 PRO A O   
1695 C CB  . PRO A 215 ? 1.8390 1.5820  1.7764  0.3766  -0.6297 -0.0511 288 PRO A CB  
1696 C CG  . PRO A 215 ? 1.7975 1.5677  1.7420  0.4208  -0.6214 -0.0868 288 PRO A CG  
1697 C CD  . PRO A 215 ? 1.9562 1.6540  1.8848  0.4435  -0.6697 -0.1068 288 PRO A CD  
1698 N N   . TYR A 216 ? 2.2059 1.7696  2.1037  0.3327  -0.7357 -0.0151 289 TYR A N   
1699 C CA  . TYR A 216 ? 2.1222 1.6373  2.0095  0.2892  -0.7637 0.0232  289 TYR A CA  
1700 C C   . TYR A 216 ? 2.4977 1.9399  2.3604  0.2831  -0.8110 0.0157  289 TYR A C   
1701 O O   . TYR A 216 ? 2.7209 2.1472  2.5769  0.2424  -0.8225 0.0456  289 TYR A O   
1702 C CB  . TYR A 216 ? 1.9706 1.4552  1.8585  0.2854  -0.7822 0.0389  289 TYR A CB  
1703 C CG  . TYR A 216 ? 2.0309 1.5841  1.9406  0.2793  -0.7378 0.0550  289 TYR A CG  
1704 C CD1 . TYR A 216 ? 2.2408 1.8374  2.1656  0.3164  -0.7121 0.0284  289 TYR A CD1 
1705 C CD2 . TYR A 216 ? 2.0676 1.6444  1.9826  0.2363  -0.7218 0.0961  289 TYR A CD2 
1706 C CE1 . TYR A 216 ? 1.8753 1.5308  1.8187  0.3095  -0.6739 0.0426  289 TYR A CE1 
1707 C CE2 . TYR A 216 ? 1.9599 1.5964  1.8926  0.2319  -0.6827 0.1081  289 TYR A CE2 
1708 C CZ  . TYR A 216 ? 1.8598 1.5325  1.8061  0.2680  -0.6598 0.0813  289 TYR A CZ  
1709 O OH  . TYR A 216 ? 2.4422 2.1703  2.4047  0.2624  -0.6233 0.0928  289 TYR A OH  
1710 N N   . ILE A 217 ? 1.9473 1.3462  1.7964  0.3234  -0.8396 -0.0249 290 ILE A N   
1711 C CA  . ILE A 217 ? 2.1686 1.4962  1.9922  0.3218  -0.8853 -0.0382 290 ILE A CA  
1712 C C   . ILE A 217 ? 2.2786 1.6460  2.1007  0.3092  -0.8632 -0.0402 290 ILE A C   
1713 O O   . ILE A 217 ? 2.1486 1.4802  1.9573  0.2759  -0.8874 -0.0213 290 ILE A O   
1714 C CB  . ILE A 217 ? 2.5551 1.8347  2.3655  0.3745  -0.9173 -0.0872 290 ILE A CB  
1715 C CG1 . ILE A 217 ? 2.5881 1.8244  2.4010  0.3860  -0.9434 -0.0825 290 ILE A CG1 
1716 C CG2 . ILE A 217 ? 2.2849 1.4885  2.0665  0.3749  -0.9653 -0.1051 290 ILE A CG2 
1717 C CD1 . ILE A 217 ? 2.1864 1.3792  1.9901  0.4417  -0.9747 -0.1314 290 ILE A CD1 
1718 N N   . ALA A 218 ? 2.4015 1.8452  2.2377  0.3338  -0.8178 -0.0611 291 ALA A N   
1719 C CA  . ALA A 218 ? 2.2796 1.7662  2.1155  0.3227  -0.7950 -0.0617 291 ALA A CA  
1720 C C   . ALA A 218 ? 2.1669 1.6815  2.0151  0.2716  -0.7773 -0.0136 291 ALA A C   
1721 O O   . ALA A 218 ? 2.0920 1.6021  1.9323  0.2477  -0.7851 -0.0030 291 ALA A O   
1722 C CB  . ALA A 218 ? 2.2239 1.7905  2.0740  0.3558  -0.7487 -0.0880 291 ALA A CB  
1723 N N   . LEU A 219 ? 1.9449 1.4909  1.8124  0.2550  -0.7539 0.0151  292 LEU A N   
1724 C CA  . LEU A 219 ? 2.1858 1.7618  2.0657  0.2087  -0.7371 0.0595  292 LEU A CA  
1725 C C   . LEU A 219 ? 2.4409 1.9507  2.3044  0.1711  -0.7830 0.0863  292 LEU A C   
1726 O O   . LEU A 219 ? 2.5976 2.1270  2.4660  0.1332  -0.7781 0.1168  292 LEU A O   
1727 C CB  . LEU A 219 ? 2.1164 1.7394  2.0178  0.2025  -0.7033 0.0800  292 LEU A CB  
1728 C CG  . LEU A 219 ? 1.9806 1.6835  1.9039  0.2232  -0.6504 0.0683  292 LEU A CG  
1729 C CD1 . LEU A 219 ? 1.7091 1.4442  1.6492  0.2157  -0.6255 0.0877  292 LEU A CD1 
1730 C CD2 . LEU A 219 ? 2.1091 1.8622  2.0421  0.2071  -0.6234 0.0789  292 LEU A CD2 
1731 N N   . SER A 220 ? 2.3383 1.7706  2.1830  0.1802  -0.8290 0.0769  293 SER A N   
1732 C CA  . SER A 220 ? 2.3381 1.7000  2.1646  0.1433  -0.8782 0.1023  293 SER A CA  
1733 C C   . SER A 220 ? 2.3644 1.6957  2.1736  0.1393  -0.9028 0.0879  293 SER A C   
1734 O O   . SER A 220 ? 2.0862 1.4073  1.8917  0.0963  -0.9184 0.1188  293 SER A O   
1735 C CB  . SER A 220 ? 2.1941 1.4759  2.0046  0.1560  -0.9239 0.0954  293 SER A CB  
1736 O OG  . SER A 220 ? 2.7398 1.9498  2.5317  0.1171  -0.9743 0.1231  293 SER A OG  
1737 N N   . VAL A 221 ? 2.2396 1.5601  2.0379  0.1831  -0.9063 0.0410  294 VAL A N   
1738 C CA  . VAL A 221 ? 2.5326 1.8262  2.3117  0.1824  -0.9288 0.0231  294 VAL A CA  
1739 C C   . VAL A 221 ? 2.4240 1.7909  2.2186  0.1554  -0.8916 0.0448  294 VAL A C   
1740 O O   . VAL A 221 ? 2.2362 1.5835  2.0217  0.1224  -0.9134 0.0623  294 VAL A O   
1741 C CB  . VAL A 221 ? 2.5728 1.8536  2.3376  0.2383  -0.9336 -0.0340 294 VAL A CB  
1742 C CG1 . VAL A 221 ? 3.0062 2.2627  2.7486  0.2376  -0.9556 -0.0542 294 VAL A CG1 
1743 C CG2 . VAL A 221 ? 2.3603 1.5661  2.1114  0.2670  -0.9741 -0.0562 294 VAL A CG2 
1744 N N   . LEU A 222 ? 2.4489 1.9006  2.2678  0.1687  -0.8367 0.0446  295 LEU A N   
1745 C CA  . LEU A 222 ? 2.5605 2.0833  2.3970  0.1460  -0.8004 0.0657  295 LEU A CA  
1746 C C   . LEU A 222 ? 2.7301 2.2677  2.5811  0.0955  -0.7986 0.1164  295 LEU A C   
1747 O O   . LEU A 222 ? 2.9264 2.5044  2.7877  0.0697  -0.7847 0.1369  295 LEU A O   
1748 C CB  . LEU A 222 ? 2.5970 2.2006  2.4554  0.1732  -0.7452 0.0533  295 LEU A CB  
1749 C CG  . LEU A 222 ? 2.6287 2.2415  2.4764  0.2204  -0.7378 0.0058  295 LEU A CG  
1750 C CD1 . LEU A 222 ? 2.3185 2.0114  2.1899  0.2404  -0.6846 0.0011  295 LEU A CD1 
1751 C CD2 . LEU A 222 ? 2.8236 2.4297  2.6535  0.2191  -0.7519 -0.0092 295 LEU A CD2 
1752 N N   . LEU A 223 ? 2.4131 1.9227  2.2653  0.0810  -0.8122 0.1374  296 LEU A N   
1753 C CA  . LEU A 223 ? 2.2311 1.7564  2.0944  0.0317  -0.8128 0.1858  296 LEU A CA  
1754 C C   . LEU A 223 ? 2.3106 1.7761  2.1550  -0.0042 -0.8630 0.2034  296 LEU A C   
1755 O O   . LEU A 223 ? 1.9304 1.4295  1.7853  -0.0426 -0.8580 0.2351  296 LEU A O   
1756 C CB  . LEU A 223 ? 2.0873 1.6045  1.9553  0.0269  -0.8117 0.2029  296 LEU A CB  
1757 C CG  . LEU A 223 ? 2.1957 1.7342  2.0735  -0.0238 -0.8113 0.2532  296 LEU A CG  
1758 C CD1 . LEU A 223 ? 1.8164 1.4496  1.7225  -0.0360 -0.7597 0.2708  296 LEU A CD1 
1759 C CD2 . LEU A 223 ? 2.2249 1.7431  2.1000  -0.0272 -0.8185 0.2670  296 LEU A CD2 
1760 N N   . VAL A 224 ? 2.3301 1.7064  2.1470  0.0078  -0.9132 0.1830  297 VAL A N   
1761 C CA  . VAL A 224 ? 2.4294 1.7399  2.2253  -0.0253 -0.9656 0.1963  297 VAL A CA  
1762 C C   . VAL A 224 ? 2.3193 1.6515  2.1121  -0.0247 -0.9611 0.1819  297 VAL A C   
1763 O O   . VAL A 224 ? 2.1613 1.4822  1.9500  -0.0652 -0.9847 0.2073  297 VAL A O   
1764 C CB  . VAL A 224 ? 2.5668 1.7711  2.3329  -0.0067 -1.0221 0.1727  297 VAL A CB  
1765 C CG1 . VAL A 224 ? 2.4121 1.5409  2.1549  -0.0440 -1.0807 0.1882  297 VAL A CG1 
1766 C CG2 . VAL A 224 ? 2.7631 1.9492  2.5331  -0.0070 -1.0262 0.1888  297 VAL A CG2 
1767 N N   . ARG A 225 ? 2.5690 1.9361  2.3639  0.0189  -0.9312 0.1430  298 ARG A N   
1768 C CA  . ARG A 225 ? 2.6907 2.0849  2.4821  0.0205  -0.9240 0.1295  298 ARG A CA  
1769 C C   . ARG A 225 ? 2.5585 2.0385  2.3794  -0.0115 -0.8851 0.1664  298 ARG A C   
1770 O O   . ARG A 225 ? 2.6898 2.1758  2.5091  -0.0404 -0.8984 0.1818  298 ARG A O   
1771 C CB  . ARG A 225 ? 2.6184 2.0334  2.4038  0.0747  -0.9008 0.0801  298 ARG A CB  
1772 C CG  . ARG A 225 ? 2.6838 2.1401  2.4667  0.0788  -0.8858 0.0666  298 ARG A CG  
1773 C CD  . ARG A 225 ? 3.0153 2.4022  2.7671  0.0663  -0.9382 0.0543  298 ARG A CD  
1774 N NE  . ARG A 225 ? 2.9346 2.3165  2.6924  0.0114  -0.9580 0.0984  298 ARG A NE  
1775 C CZ  . ARG A 225 ? 2.9665 2.2896  2.7006  -0.0115 -1.0059 0.0985  298 ARG A CZ  
1776 N NH1 . ARG A 225 ? 3.0524 2.3128  2.7529  0.0179  -1.0393 0.0541  298 ARG A NH1 
1777 N NH2 . ARG A 225 ? 2.9609 2.2897  2.7046  -0.0638 -1.0209 0.1421  298 ARG A NH2 
1778 N N   . GLY A 226 ? 2.2283 1.7754  2.0765  -0.0060 -0.8379 0.1801  299 GLY A N   
1779 C CA  . GLY A 226 ? 2.3593 1.9892  2.2371  -0.0306 -0.7996 0.2116  299 GLY A CA  
1780 C C   . GLY A 226 ? 2.4018 2.0331  2.2882  -0.0834 -0.8170 0.2587  299 GLY A C   
1781 O O   . GLY A 226 ? 2.1012 1.7886  2.0071  -0.1092 -0.8008 0.2837  299 GLY A O   
1782 N N   . ALA A 227 ? 2.2908 1.8640  2.1639  -0.1007 -0.8506 0.2727  300 ALA A N   
1783 C CA  . ALA A 227 ? 2.1336 1.7091  2.0128  -0.1544 -0.8698 0.3199  300 ALA A CA  
1784 C C   . ALA A 227 ? 2.5863 2.1262  2.4516  -0.1855 -0.9115 0.3295  300 ALA A C   
1785 O O   . ALA A 227 ? 2.6176 2.1936  2.4974  -0.2302 -0.9138 0.3689  300 ALA A O   
1786 C CB  . ALA A 227 ? 2.0315 1.5511  1.8973  -0.1655 -0.8975 0.3334  300 ALA A CB  
1787 N N   . THR A 228 ? 2.8708 2.3430  2.7081  -0.1626 -0.9447 0.2935  301 THR A N   
1788 C CA  . THR A 228 ? 2.9630 2.3945  2.7832  -0.1898 -0.9874 0.2979  301 THR A CA  
1789 C C   . THR A 228 ? 2.8649 2.3629  2.6997  -0.1885 -0.9604 0.2940  301 THR A C   
1790 O O   . THR A 228 ? 2.9076 2.3869  2.7331  -0.2166 -0.9914 0.3035  301 THR A O   
1791 C CB  . THR A 228 ? 3.3021 2.6302  3.0836  -0.1638 -1.0367 0.2575  301 THR A CB  
1792 O OG1 . THR A 228 ? 3.4778 2.8193  3.2549  -0.1066 -1.0091 0.2093  301 THR A OG1 
1793 C CG2 . THR A 228 ? 3.3067 2.5581  3.0726  -0.1726 -1.0748 0.2672  301 THR A CG2 
1794 N N   . LEU A 229 ? 2.6108 2.1835  2.4677  -0.1579 -0.9060 0.2816  302 LEU A N   
1795 C CA  . LEU A 229 ? 2.5681 2.2034  2.4391  -0.1552 -0.8809 0.2789  302 LEU A CA  
1796 C C   . LEU A 229 ? 2.6030 2.3040  2.5044  -0.2011 -0.8687 0.3269  302 LEU A C   
1797 O O   . LEU A 229 ? 2.5355 2.2728  2.4582  -0.2183 -0.8494 0.3562  302 LEU A O   
1798 C CB  . LEU A 229 ? 2.4837 2.1766  2.3693  -0.1103 -0.8285 0.2536  302 LEU A CB  
1799 C CG  . LEU A 229 ? 2.5938 2.2400  2.4538  -0.0619 -0.8334 0.2049  302 LEU A CG  
1800 C CD1 . LEU A 229 ? 2.7730 2.4863  2.6512  -0.0248 -0.7798 0.1873  302 LEU A CD1 
1801 C CD2 . LEU A 229 ? 2.6701 2.2613  2.4972  -0.0539 -0.8724 0.1754  302 LEU A CD2 
1802 N N   . PRO A 230 ? 2.6402 2.3613  2.5443  -0.2209 -0.8796 0.3354  303 PRO A N   
1803 C CA  . PRO A 230 ? 2.6318 2.4221  2.5678  -0.2632 -0.8684 0.3806  303 PRO A CA  
1804 C C   . PRO A 230 ? 2.5755 2.4631  2.5492  -0.2456 -0.8083 0.3882  303 PRO A C   
1805 O O   . PRO A 230 ? 2.2987 2.2073  2.2740  -0.2055 -0.7786 0.3592  303 PRO A O   
1806 C CB  . PRO A 230 ? 2.6320 2.4116  2.5574  -0.2818 -0.8984 0.3799  303 PRO A CB  
1807 C CG  . PRO A 230 ? 2.6506 2.3954  2.5496  -0.2362 -0.8985 0.3307  303 PRO A CG  
1808 C CD  . PRO A 230 ? 2.6225 2.3064  2.5002  -0.2055 -0.9038 0.3035  303 PRO A CD  
1809 N N   . GLY A 231 ? 2.7152 2.6634  2.7194  -0.2768 -0.7917 0.4280  304 GLY A N   
1810 C CA  . GLY A 231 ? 2.3044 2.3426  2.3454  -0.2616 -0.7373 0.4366  304 GLY A CA  
1811 C C   . GLY A 231 ? 1.8704 1.9097  1.9123  -0.2262 -0.7046 0.4177  304 GLY A C   
1812 O O   . GLY A 231 ? 1.8053 1.9090  1.8731  -0.2047 -0.6599 0.4154  304 GLY A O   
1813 N N   . ALA A 232 ? 1.9580 1.9265  1.9727  -0.2193 -0.7272 0.4041  305 ALA A N   
1814 C CA  . ALA A 232 ? 2.3011 2.2702  2.3165  -0.1865 -0.6982 0.3863  305 ALA A CA  
1815 C C   . ALA A 232 ? 1.9512 1.9778  1.9923  -0.2034 -0.6697 0.4163  305 ALA A C   
1816 O O   . ALA A 232 ? 1.7998 1.8450  1.8479  -0.1771 -0.6378 0.4042  305 ALA A O   
1817 C CB  . ALA A 232 ? 2.3884 2.2663  2.3688  -0.1738 -0.7333 0.3638  305 ALA A CB  
1818 N N   . TRP A 233 ? 1.7574 1.8156  1.8122  -0.2472 -0.6804 0.4547  306 TRP A N   
1819 C CA  . TRP A 233 ? 1.9389 2.0589  2.0171  -0.2645 -0.6532 0.4832  306 TRP A CA  
1820 C C   . TRP A 233 ? 2.0806 2.2876  2.1933  -0.2423 -0.6008 0.4806  306 TRP A C   
1821 O O   . TRP A 233 ? 2.2952 2.5527  2.4256  -0.2451 -0.5720 0.4946  306 TRP A O   
1822 C CB  . TRP A 233 ? 1.9327 2.0712  2.0172  -0.3189 -0.6791 0.5259  306 TRP A CB  
1823 C CG  . TRP A 233 ? 1.8756 2.0589  1.9796  -0.3361 -0.6818 0.5391  306 TRP A CG  
1824 C CD1 . TRP A 233 ? 2.3260 2.4636  2.4137  -0.3511 -0.7214 0.5367  306 TRP A CD1 
1825 C CD2 . TRP A 233 ? 1.8510 2.1339  1.9948  -0.3389 -0.6447 0.5560  306 TRP A CD2 
1826 N NE1 . TRP A 233 ? 2.5875 2.7921  2.7028  -0.3649 -0.7112 0.5527  306 TRP A NE1 
1827 C CE2 . TRP A 233 ? 2.2438 2.5385  2.3949  -0.3567 -0.6643 0.5648  306 TRP A CE2 
1828 C CE3 . TRP A 233 ? 1.8016 2.1639  1.9754  -0.3268 -0.5981 0.5632  306 TRP A CE3 
1829 C CZ2 . TRP A 233 ? 2.0959 2.4810  2.2854  -0.3622 -0.6388 0.5818  306 TRP A CZ2 
1830 C CZ3 . TRP A 233 ? 1.7669 2.2164  1.9780  -0.3305 -0.5730 0.5780  306 TRP A CZ3 
1831 C CH2 . TRP A 233 ? 1.9119 2.3731  2.1316  -0.3478 -0.5934 0.5879  306 TRP A CH2 
1832 N N   . ARG A 234 ? 2.0159 2.2406  2.1376  -0.2205 -0.5892 0.4632  307 ARG A N   
1833 C CA  . ARG A 234 ? 1.8384 2.1398  1.9928  -0.1986 -0.5428 0.4612  307 ARG A CA  
1834 C C   . ARG A 234 ? 1.8198 2.1156  1.9715  -0.1595 -0.5120 0.4350  307 ARG A C   
1835 O O   . ARG A 234 ? 2.0898 2.4415  2.2651  -0.1502 -0.4759 0.4406  307 ARG A O   
1836 C CB  . ARG A 234 ? 1.8128 2.1319  1.9760  -0.1890 -0.5430 0.4529  307 ARG A CB  
1837 C CG  . ARG A 234 ? 1.9513 2.2798  2.1189  -0.2282 -0.5738 0.4789  307 ARG A CG  
1838 C CD  . ARG A 234 ? 1.8393 2.1913  2.0168  -0.2182 -0.5721 0.4718  307 ARG A CD  
1839 N NE  . ARG A 234 ? 2.0290 2.3862  2.2088  -0.2572 -0.6051 0.4961  307 ARG A NE  
1840 C CZ  . ARG A 234 ? 2.1062 2.5359  2.3198  -0.2841 -0.5972 0.5288  307 ARG A CZ  
1841 N NH1 . ARG A 234 ? 2.1289 2.6305  2.3756  -0.2735 -0.5568 0.5389  307 ARG A NH1 
1842 N NH2 . ARG A 234 ? 2.0448 2.4762  2.2589  -0.3213 -0.6303 0.5508  307 ARG A NH2 
1843 N N   . GLY A 235 ? 1.6590 1.8895  1.7825  -0.1357 -0.5262 0.4054  308 GLY A N   
1844 C CA  . GLY A 235 ? 1.9088 2.1333  2.0292  -0.1014 -0.5002 0.3818  308 GLY A CA  
1845 C C   . GLY A 235 ? 1.8690 2.0859  1.9852  -0.1114 -0.4978 0.3927  308 GLY A C   
1846 O O   . GLY A 235 ? 1.6166 1.8583  1.7424  -0.0912 -0.4664 0.3843  308 GLY A O   
1847 N N   . VAL A 236 ? 2.1564 2.3382  2.2572  -0.1442 -0.5323 0.4125  309 VAL A N   
1848 C CA  . VAL A 236 ? 2.1208 2.2987  2.2165  -0.1587 -0.5323 0.4278  309 VAL A CA  
1849 C C   . VAL A 236 ? 1.8962 2.1572  2.0210  -0.1765 -0.5010 0.4546  309 VAL A C   
1850 O O   . VAL A 236 ? 1.8438 2.1283  1.9727  -0.1713 -0.4782 0.4569  309 VAL A O   
1851 C CB  . VAL A 236 ? 2.0242 2.1366  2.0935  -0.1905 -0.5821 0.4434  309 VAL A CB  
1852 C CG1 . VAL A 236 ? 1.8785 1.9829  1.9393  -0.2050 -0.5842 0.4594  309 VAL A CG1 
1853 C CG2 . VAL A 236 ? 2.2125 2.2434  2.2537  -0.1688 -0.6141 0.4127  309 VAL A CG2 
1854 N N   . LEU A 237 ? 1.6521 1.9612  1.7975  -0.1970 -0.4996 0.4744  310 LEU A N   
1855 C CA  . LEU A 237 ? 1.6180 2.0145  1.7947  -0.2088 -0.4677 0.4964  310 LEU A CA  
1856 C C   . LEU A 237 ? 1.7396 2.1774  1.9359  -0.1694 -0.4229 0.4746  310 LEU A C   
1857 O O   . LEU A 237 ? 1.5169 1.9914  1.7220  -0.1645 -0.3963 0.4774  310 LEU A O   
1858 C CB  . LEU A 237 ? 2.0640 2.5041  2.2611  -0.2353 -0.4772 0.5196  310 LEU A CB  
1859 C CG  . LEU A 237 ? 2.0259 2.5650  2.2600  -0.2444 -0.4444 0.5408  310 LEU A CG  
1860 C CD1 . LEU A 237 ? 1.7406 2.3075  1.9723  -0.2734 -0.4426 0.5661  310 LEU A CD1 
1861 C CD2 . LEU A 237 ? 1.8192 2.3991  2.0750  -0.2651 -0.4553 0.5598  310 LEU A CD2 
1862 N N   . PHE A 238 ? 1.6533 2.0838  1.8547  -0.1418 -0.4156 0.4528  311 PHE A N   
1863 C CA  . PHE A 238 ? 1.7373 2.1977  1.9550  -0.1051 -0.3775 0.4322  311 PHE A CA  
1864 C C   . PHE A 238 ? 1.4072 1.8348  1.6080  -0.0847 -0.3671 0.4131  311 PHE A C   
1865 O O   . PHE A 238 ? 1.3644 1.8238  1.5791  -0.0625 -0.3342 0.4027  311 PHE A O   
1866 C CB  . PHE A 238 ? 2.0347 2.4825  2.2541  -0.0829 -0.3785 0.4138  311 PHE A CB  
1867 C CG  . PHE A 238 ? 1.8558 2.3277  2.0899  -0.0472 -0.3437 0.3942  311 PHE A CG  
1868 C CD1 . PHE A 238 ? 1.8267 2.3639  2.0939  -0.0408 -0.3160 0.4031  311 PHE A CD1 
1869 C CD2 . PHE A 238 ? 1.3210 1.7506  1.5368  -0.0202 -0.3402 0.3671  311 PHE A CD2 
1870 C CE1 . PHE A 238 ? 1.8557 2.4087  2.1355  -0.0093 -0.2875 0.3862  311 PHE A CE1 
1871 C CE2 . PHE A 238 ? 1.2778 1.7285  1.5067  0.0089  -0.3105 0.3517  311 PHE A CE2 
1872 C CZ  . PHE A 238 ? 1.8043 2.3135  2.0645  0.0137  -0.2851 0.3616  311 PHE A CZ  
1873 N N   . TYR A 239 ? 1.4940 1.8570  1.6650  -0.0915 -0.3964 0.4079  312 TYR A N   
1874 C CA  . TYR A 239 ? 1.5612 1.8914  1.7160  -0.0728 -0.3904 0.3904  312 TYR A CA  
1875 C C   . TYR A 239 ? 1.6745 2.0333  1.8318  -0.0901 -0.3790 0.4087  312 TYR A C   
1876 O O   . TYR A 239 ? 1.5577 1.9328  1.7188  -0.0710 -0.3527 0.3970  312 TYR A O   
1877 C CB  . TYR A 239 ? 1.5012 1.7524  1.6247  -0.0715 -0.4283 0.3776  312 TYR A CB  
1878 C CG  . TYR A 239 ? 1.6675 1.8816  1.7742  -0.0519 -0.4274 0.3594  312 TYR A CG  
1879 C CD1 . TYR A 239 ? 1.5783 1.8124  1.6940  -0.0204 -0.3953 0.3382  312 TYR A CD1 
1880 C CD2 . TYR A 239 ? 1.7139 1.8710  1.7958  -0.0653 -0.4612 0.3640  312 TYR A CD2 
1881 C CE1 . TYR A 239 ? 1.6110 1.8147  1.7129  -0.0033 -0.3954 0.3223  312 TYR A CE1 
1882 C CE2 . TYR A 239 ? 1.7047 1.8296  1.7729  -0.0464 -0.4620 0.3478  312 TYR A CE2 
1883 C CZ  . TYR A 239 ? 1.7355 1.8861  1.8143  -0.0155 -0.4284 0.3268  312 TYR A CZ  
1884 O OH  . TYR A 239 ? 1.6207 1.7429  1.6874  0.0023  -0.4298 0.3114  312 TYR A OH  
1885 N N   . LEU A 240 ? 2.0411 2.4073  2.1950  -0.1276 -0.3993 0.4379  313 LEU A N   
1886 C CA  . LEU A 240 ? 1.6305 2.0234  1.7820  -0.1489 -0.3928 0.4581  313 LEU A CA  
1887 C C   . LEU A 240 ? 1.7770 2.2580  1.9571  -0.1621 -0.3642 0.4778  313 LEU A C   
1888 O O   . LEU A 240 ? 1.3453 1.8595  1.5240  -0.1798 -0.3553 0.4944  313 LEU A O   
1889 C CB  . LEU A 240 ? 1.5709 1.9161  1.6979  -0.1849 -0.4355 0.4807  313 LEU A CB  
1890 C CG  . LEU A 240 ? 1.7272 1.9821  1.8244  -0.1722 -0.4681 0.4618  313 LEU A CG  
1891 C CD1 . LEU A 240 ? 1.7910 2.0001  1.8651  -0.2100 -0.5109 0.4878  313 LEU A CD1 
1892 C CD2 . LEU A 240 ? 1.4874 1.7301  1.5786  -0.1389 -0.4473 0.4366  313 LEU A CD2 
1893 N N   . LYS A 241 ? 2.1257 2.6479  2.3316  -0.1536 -0.3501 0.4764  314 LYS A N   
1894 C CA  . LYS A 241 ? 2.0957 2.7046  2.3314  -0.1651 -0.3256 0.4950  314 LYS A CA  
1895 C C   . LYS A 241 ? 2.1827 2.8330  2.4279  -0.1426 -0.2875 0.4824  314 LYS A C   
1896 O O   . LYS A 241 ? 2.5880 3.2322  2.8404  -0.1069 -0.2662 0.4563  314 LYS A O   
1897 C CB  . LYS A 241 ? 2.2702 2.9117  2.5328  -0.1555 -0.3190 0.4935  314 LYS A CB  
1898 C CG  . LYS A 241 ? 2.2600 2.9943  2.5568  -0.1658 -0.2961 0.5127  314 LYS A CG  
1899 C CD  . LYS A 241 ? 2.1878 2.9500  2.5113  -0.1556 -0.2932 0.5118  314 LYS A CD  
1900 C CE  . LYS A 241 ? 1.9316 2.7903  2.2924  -0.1632 -0.2712 0.5301  314 LYS A CE  
1901 N NZ  . LYS A 241 ? 1.9103 2.7970  2.2987  -0.1529 -0.2702 0.5306  314 LYS A NZ  
1902 N N   . PRO A 242 ? 1.6553 2.3486  1.8994  -0.1637 -0.2788 0.5006  315 PRO A N   
1903 C CA  . PRO A 242 ? 1.6008 2.3304  1.8498  -0.1425 -0.2443 0.4864  315 PRO A CA  
1904 C C   . PRO A 242 ? 1.6970 2.4927  1.9811  -0.1181 -0.2109 0.4765  315 PRO A C   
1905 O O   . PRO A 242 ? 2.0279 2.8824  2.3363  -0.1321 -0.2076 0.4944  315 PRO A O   
1906 C CB  . PRO A 242 ? 1.8321 2.5975  2.0701  -0.1774 -0.2476 0.5128  315 PRO A CB  
1907 C CG  . PRO A 242 ? 2.1195 2.8454  2.3407  -0.2160 -0.2893 0.5392  315 PRO A CG  
1908 C CD  . PRO A 242 ? 1.9787 2.6898  2.2153  -0.2096 -0.3014 0.5354  315 PRO A CD  
1909 N N   . ASN A 243 ? 1.4949 2.2806  1.7824  -0.0814 -0.1876 0.4483  316 ASN A N   
1910 C CA  . ASN A 243 ? 1.4156 2.2605  1.7332  -0.0554 -0.1544 0.4364  316 ASN A CA  
1911 C C   . ASN A 243 ? 1.5660 2.4223  1.8735  -0.0413 -0.1314 0.4212  316 ASN A C   
1912 O O   . ASN A 243 ? 1.5582 2.3630  1.8490  -0.0219 -0.1299 0.4001  316 ASN A O   
1913 C CB  . ASN A 243 ? 1.3281 2.1468  1.6597  -0.0246 -0.1504 0.4169  316 ASN A CB  
1914 C CG  . ASN A 243 ? 1.4597 2.3399  1.8267  -0.0015 -0.1231 0.4104  316 ASN A CG  
1915 O OD1 . ASN A 243 ? 1.8355 2.7684  2.2131  0.0038  -0.1006 0.4085  316 ASN A OD1 
1916 N ND2 . ASN A 243 ? 1.6920 2.5658  2.0769  0.0134  -0.1261 0.4064  316 ASN A ND2 
1917 N N   . TRP A 244 ? 1.9286 2.8551  2.2457  -0.0514 -0.1137 0.4314  317 TRP A N   
1918 C CA  . TRP A 244 ? 1.9586 2.9007  2.2632  -0.0409 -0.0928 0.4176  317 TRP A CA  
1919 C C   . TRP A 244 ? 2.0302 2.9999  2.3566  -0.0017 -0.0621 0.3907  317 TRP A C   
1920 O O   . TRP A 244 ? 2.1446 3.1148  2.4589  0.0126  -0.0456 0.3730  317 TRP A O   
1921 C CB  . TRP A 244 ? 2.3021 3.3080  2.6015  -0.0722 -0.0891 0.4410  317 TRP A CB  
1922 C CG  . TRP A 244 ? 2.3656 3.3409  2.6414  -0.1137 -0.1219 0.4699  317 TRP A CG  
1923 C CD1 . TRP A 244 ? 2.5788 3.5754  2.8637  -0.1457 -0.1415 0.4993  317 TRP A CD1 
1924 C CD2 . TRP A 244 ? 2.0071 2.9214  2.2464  -0.1279 -0.1416 0.4726  317 TRP A CD2 
1925 N NE1 . TRP A 244 ? 2.5332 3.4821  2.7884  -0.1795 -0.1733 0.5201  317 TRP A NE1 
1926 C CE2 . TRP A 244 ? 2.0419 2.9399  2.2693  -0.1681 -0.1741 0.5040  317 TRP A CE2 
1927 C CE3 . TRP A 244 ? 2.1326 3.0045  2.3490  -0.1108 -0.1367 0.4519  317 TRP A CE3 
1928 C CZ2 . TRP A 244 ? 2.0756 2.9135  2.2690  -0.1896 -0.2022 0.5149  317 TRP A CZ2 
1929 C CZ3 . TRP A 244 ? 2.3678 3.1850  2.5517  -0.1319 -0.1633 0.4629  317 TRP A CZ3 
1930 C CH2 . TRP A 244 ? 2.1444 2.9438  2.3173  -0.1700 -0.1960 0.4939  317 TRP A CH2 
1931 N N   . GLN A 245 ? 1.9342 2.9237  2.2914  0.0158  -0.0562 0.3873  318 GLN A N   
1932 C CA  . GLN A 245 ? 1.8828 2.8876  2.2610  0.0544  -0.0318 0.3620  318 GLN A CA  
1933 C C   . GLN A 245 ? 1.9339 2.8648  2.2988  0.0778  -0.0346 0.3391  318 GLN A C   
1934 O O   . GLN A 245 ? 1.8798 2.8119  2.2553  0.1079  -0.0164 0.3170  318 GLN A O   
1935 C CB  . GLN A 245 ? 1.8694 2.9186  2.2858  0.0647  -0.0276 0.3684  318 GLN A CB  
1936 C CG  . GLN A 245 ? 2.0767 3.2069  2.5111  0.0408  -0.0253 0.3929  318 GLN A CG  
1937 C CD  . GLN A 245 ? 2.1878 3.3876  2.6278  0.0486  0.0013  0.3849  318 GLN A CD  
1938 O OE1 . GLN A 245 ? 2.2420 3.4361  2.6822  0.0800  0.0205  0.3578  318 GLN A OE1 
1939 N NE2 . GLN A 245 ? 2.0935 3.3605  2.5370  0.0191  0.0018  0.4086  318 GLN A NE2 
1940 N N   . LYS A 246 ? 1.7471 2.6154  2.0895  0.0648  -0.0578 0.3437  319 LYS A N   
1941 C CA  . LYS A 246 ? 1.4508 2.2555  1.7805  0.0849  -0.0606 0.3231  319 LYS A CA  
1942 C C   . LYS A 246 ? 1.4359 2.2223  1.7431  0.0908  -0.0514 0.3075  319 LYS A C   
1943 O O   . LYS A 246 ? 1.2866 2.0429  1.5922  0.1140  -0.0431 0.2865  319 LYS A O   
1944 C CB  . LYS A 246 ? 1.3265 2.0758  1.6400  0.0714  -0.0884 0.3310  319 LYS A CB  
1945 C CG  . LYS A 246 ? 1.3314 2.0810  1.6644  0.0754  -0.0971 0.3371  319 LYS A CG  
1946 C CD  . LYS A 246 ? 1.3668 2.1025  1.7136  0.1067  -0.0841 0.3179  319 LYS A CD  
1947 C CE  . LYS A 246 ? 1.5287 2.2604  1.8906  0.1094  -0.0952 0.3247  319 LYS A CE  
1948 N NZ  . LYS A 246 ? 1.6917 2.4059  2.0640  0.1368  -0.0854 0.3090  319 LYS A NZ  
1949 N N   . LEU A 247 ? 1.3620 2.1668  1.6512  0.0684  -0.0537 0.3187  320 LEU A N   
1950 C CA  . LEU A 247 ? 1.3769 2.1666  1.6428  0.0720  -0.0463 0.3052  320 LEU A CA  
1951 C C   . LEU A 247 ? 1.7080 2.5310  1.9860  0.0979  -0.0184 0.2837  320 LEU A C   
1952 O O   . LEU A 247 ? 1.6231 2.4240  1.8842  0.1080  -0.0117 0.2662  320 LEU A O   
1953 C CB  . LEU A 247 ? 1.3442 2.1523  1.5882  0.0402  -0.0556 0.3252  320 LEU A CB  
1954 C CG  . LEU A 247 ? 1.4986 2.2609  1.7240  0.0141  -0.0877 0.3447  320 LEU A CG  
1955 C CD1 . LEU A 247 ? 1.5226 2.3069  1.7275  -0.0192 -0.0971 0.3674  320 LEU A CD1 
1956 C CD2 . LEU A 247 ? 1.6652 2.3557  1.8734  0.0275  -0.1006 0.3283  320 LEU A CD2 
1957 N N   . LEU A 248 ? 1.7144 2.5893  2.0214  0.1095  -0.0035 0.2837  321 LEU A N   
1958 C CA  . LEU A 248 ? 1.6818 2.5840  2.0020  0.1383  0.0208  0.2605  321 LEU A CA  
1959 C C   . LEU A 248 ? 1.7775 2.6291  2.1049  0.1662  0.0219  0.2398  321 LEU A C   
1960 O O   . LEU A 248 ? 2.0216 2.8723  2.3500  0.1886  0.0369  0.2172  321 LEU A O   
1961 C CB  . LEU A 248 ? 1.2812 2.2567  1.6327  0.1444  0.0348  0.2666  321 LEU A CB  
1962 C CG  . LEU A 248 ? 1.3238 2.3647  1.6719  0.1164  0.0371  0.2880  321 LEU A CG  
1963 C CD1 . LEU A 248 ? 1.6806 2.7982  2.0649  0.1259  0.0513  0.2928  321 LEU A CD1 
1964 C CD2 . LEU A 248 ? 1.3488 2.4052  1.6697  0.1113  0.0485  0.2784  321 LEU A CD2 
1965 N N   . GLU A 249 ? 1.4116 2.2222  1.7431  0.1644  0.0056  0.2470  322 GLU A N   
1966 C CA  . GLU A 249 ? 1.3498 2.1148  1.6867  0.1866  0.0052  0.2311  322 GLU A CA  
1967 C C   . GLU A 249 ? 1.3020 2.0170  1.6110  0.1851  -0.0001 0.2191  322 GLU A C   
1968 O O   . GLU A 249 ? 1.2946 1.9880  1.5822  0.1653  -0.0148 0.2288  322 GLU A O   
1969 C CB  . GLU A 249 ? 1.5591 2.3048  1.9085  0.1840  -0.0099 0.2437  322 GLU A CB  
1970 C CG  . GLU A 249 ? 2.0518 2.8470  2.4298  0.1836  -0.0076 0.2579  322 GLU A CG  
1971 C CD  . GLU A 249 ? 2.1417 2.9165  2.5278  0.1782  -0.0246 0.2707  322 GLU A CD  
1972 O OE1 . GLU A 249 ? 1.8932 2.6171  2.2623  0.1767  -0.0368 0.2670  322 GLU A OE1 
1973 O OE2 . GLU A 249 ? 2.2772 3.0899  2.6864  0.1759  -0.0259 0.2841  322 GLU A OE2 
1974 N N   . THR A 250 ? 1.7296 2.4254  2.0394  0.2060  0.0102  0.1982  323 THR A N   
1975 C CA  . THR A 250 ? 1.8003 2.4535  2.0863  0.2053  0.0059  0.1860  323 THR A CA  
1976 C C   . THR A 250 ? 1.6854 2.2929  1.9653  0.2011  -0.0108 0.1904  323 THR A C   
1977 O O   . THR A 250 ? 1.6915 2.2672  1.9520  0.1977  -0.0171 0.1833  323 THR A O   
1978 C CB  . THR A 250 ? 2.1778 2.8220  2.4675  0.2275  0.0195  0.1629  323 THR A CB  
1979 O OG1 . THR A 250 ? 2.1080 2.7119  2.3759  0.2250  0.0140  0.1524  323 THR A OG1 
1980 C CG2 . THR A 250 ? 2.3482 2.9817  2.6635  0.2468  0.0208  0.1596  323 THR A CG2 
1981 N N   . GLY A 251 ? 1.9766 2.5834  2.2724  0.2018  -0.0182 0.2013  324 GLY A N   
1982 C CA  . GLY A 251 ? 2.0762 2.6454  2.3662  0.2001  -0.0327 0.2034  324 GLY A CA  
1983 C C   . GLY A 251 ? 1.9721 2.5250  2.2421  0.1812  -0.0506 0.2134  324 GLY A C   
1984 O O   . GLY A 251 ? 2.2796 2.7989  2.5356  0.1813  -0.0606 0.2074  324 GLY A O   
1985 N N   . VAL A 252 ? 1.3212 1.8984  1.5906  0.1648  -0.0561 0.2289  325 VAL A N   
1986 C CA  . VAL A 252 ? 1.1971 1.7534  1.4485  0.1460  -0.0775 0.2403  325 VAL A CA  
1987 C C   . VAL A 252 ? 1.3628 1.8956  1.5895  0.1399  -0.0833 0.2342  325 VAL A C   
1988 O O   . VAL A 252 ? 1.9290 2.4281  2.1399  0.1335  -0.1024 0.2357  325 VAL A O   
1989 C CB  . VAL A 252 ? 1.1964 1.7850  1.4532  0.1264  -0.0835 0.2609  325 VAL A CB  
1990 C CG1 . VAL A 252 ? 1.8536 2.4654  2.1359  0.1327  -0.0802 0.2674  325 VAL A CG1 
1991 C CG2 . VAL A 252 ? 1.3736 2.0021  1.6287  0.1186  -0.0696 0.2644  325 VAL A CG2 
1992 N N   . TRP A 253 ? 1.4236 1.9735  1.6461  0.1428  -0.0681 0.2265  326 TRP A N   
1993 C CA  . TRP A 253 ? 1.4520 1.9806  1.6511  0.1374  -0.0738 0.2206  326 TRP A CA  
1994 C C   . TRP A 253 ? 1.5498 2.0411  1.7451  0.1518  -0.0776 0.2049  326 TRP A C   
1995 O O   . TRP A 253 ? 1.5901 2.0533  1.7685  0.1470  -0.0927 0.2037  326 TRP A O   
1996 C CB  . TRP A 253 ? 1.4510 2.0097  1.6454  0.1377  -0.0560 0.2143  326 TRP A CB  
1997 C CG  . TRP A 253 ? 1.5942 2.1948  1.7871  0.1194  -0.0536 0.2312  326 TRP A CG  
1998 C CD1 . TRP A 253 ? 1.6864 2.3313  1.8999  0.1204  -0.0417 0.2381  326 TRP A CD1 
1999 C CD2 . TRP A 253 ? 1.6530 2.2590  1.8231  0.0962  -0.0641 0.2450  326 TRP A CD2 
2000 N NE1 . TRP A 253 ? 1.3869 2.0687  1.5924  0.0983  -0.0429 0.2554  326 TRP A NE1 
2001 C CE2 . TRP A 253 ? 1.5190 2.1762  1.6968  0.0820  -0.0570 0.2609  326 TRP A CE2 
2002 C CE3 . TRP A 253 ? 1.7394 2.3133  1.8839  0.0857  -0.0798 0.2467  326 TRP A CE3 
2003 C CZ2 . TRP A 253 ? 1.7229 2.4004  1.8820  0.0552  -0.0650 0.2798  326 TRP A CZ2 
2004 C CZ3 . TRP A 253 ? 1.8269 2.4163  1.9527  0.0604  -0.0891 0.2652  326 TRP A CZ3 
2005 C CH2 . TRP A 253 ? 1.7211 2.3620  1.8533  0.0442  -0.0816 0.2823  326 TRP A CH2 
2006 N N   . ILE A 254 ? 1.7259 2.2183  1.9379  0.1692  -0.0651 0.1938  327 ILE A N   
2007 C CA  . ILE A 254 ? 1.4144 1.8779  1.6252  0.1806  -0.0684 0.1817  327 ILE A CA  
2008 C C   . ILE A 254 ? 1.2324 1.6757  1.4407  0.1785  -0.0863 0.1870  327 ILE A C   
2009 O O   . ILE A 254 ? 1.4573 1.8773  1.6552  0.1815  -0.0965 0.1798  327 ILE A O   
2010 C CB  . ILE A 254 ? 1.2680 1.7372  1.4973  0.1965  -0.0531 0.1723  327 ILE A CB  
2011 C CG1 . ILE A 254 ? 1.5356 2.0222  1.7657  0.2010  -0.0370 0.1635  327 ILE A CG1 
2012 C CG2 . ILE A 254 ? 1.4012 1.8457  1.6294  0.2046  -0.0566 0.1625  327 ILE A CG2 
2013 C CD1 . ILE A 254 ? 1.5533 2.0454  1.8034  0.2171  -0.0241 0.1557  327 ILE A CD1 
2014 N N   . ASP A 255 ? 1.6286 2.0825  1.8464  0.1741  -0.0909 0.1987  328 ASP A N   
2015 C CA  . ASP A 255 ? 1.5901 2.0243  1.8028  0.1720  -0.1094 0.2022  328 ASP A CA  
2016 C C   . ASP A 255 ? 1.6442 2.0549  1.8356  0.1612  -0.1293 0.2048  328 ASP A C   
2017 O O   . ASP A 255 ? 1.7587 2.1439  1.9410  0.1671  -0.1433 0.1971  328 ASP A O   
2018 C CB  . ASP A 255 ? 1.5769 2.0282  1.8022  0.1663  -0.1121 0.2155  328 ASP A CB  
2019 C CG  . ASP A 255 ? 1.9834 2.4530  2.2303  0.1791  -0.0968 0.2136  328 ASP A CG  
2020 O OD1 . ASP A 255 ? 2.3911 2.8627  2.6439  0.1902  -0.0823 0.2035  328 ASP A OD1 
2021 O OD2 . ASP A 255 ? 1.9319 2.4119  2.1895  0.1774  -0.1011 0.2227  328 ASP A OD2 
2022 N N   . ALA A 256 ? 1.6116 2.0319  1.7949  0.1456  -0.1316 0.2159  329 ALA A N   
2023 C CA  . ALA A 256 ? 1.8224 2.2174  1.9847  0.1336  -0.1530 0.2210  329 ALA A CA  
2024 C C   . ALA A 256 ? 1.9011 2.2773  2.0526  0.1431  -0.1538 0.2068  329 ALA A C   
2025 O O   . ALA A 256 ? 1.8245 2.1705  1.9632  0.1444  -0.1740 0.2035  329 ALA A O   
2026 C CB  . ALA A 256 ? 1.5880 2.0031  1.7436  0.1120  -0.1541 0.2387  329 ALA A CB  
2027 N N   . ALA A 257 ? 1.3404 1.7335  1.4973  0.1505  -0.1334 0.1975  330 ALA A N   
2028 C CA  . ALA A 257 ? 1.3260 1.7048  1.4739  0.1580  -0.1339 0.1847  330 ALA A CA  
2029 C C   . ALA A 257 ? 1.4110 1.7717  1.5634  0.1732  -0.1407 0.1724  330 ALA A C   
2030 O O   . ALA A 257 ? 1.8271 2.1670  1.9689  0.1765  -0.1564 0.1670  330 ALA A O   
2031 C CB  . ALA A 257 ? 1.7906 2.1899  1.9437  0.1627  -0.1113 0.1761  330 ALA A CB  
2032 N N   . ALA A 258 ? 1.2031 1.5742  1.3716  0.1831  -0.1296 0.1684  331 ALA A N   
2033 C CA  . ALA A 258 ? 1.3373 1.6992  1.5098  0.1962  -0.1348 0.1580  331 ALA A CA  
2034 C C   . ALA A 258 ? 1.3172 1.6585  1.4797  0.1962  -0.1578 0.1593  331 ALA A C   
2035 O O   . ALA A 258 ? 1.5517 1.8807  1.7094  0.2068  -0.1686 0.1482  331 ALA A O   
2036 C CB  . ALA A 258 ? 1.3173 1.6954  1.5072  0.2033  -0.1203 0.1575  331 ALA A CB  
2037 N N   . GLN A 259 ? 1.3622 1.7003  1.5217  0.1848  -0.1668 0.1721  332 GLN A N   
2038 C CA  . GLN A 259 ? 1.6768 1.9899  1.8255  0.1840  -0.1915 0.1730  332 GLN A CA  
2039 C C   . GLN A 259 ? 1.6545 1.9402  1.7865  0.1829  -0.2117 0.1701  332 GLN A C   
2040 O O   . GLN A 259 ? 1.3614 1.6251  1.4865  0.1945  -0.2295 0.1590  332 GLN A O   
2041 C CB  . GLN A 259 ? 1.6429 1.9587  1.7920  0.1678  -0.1982 0.1899  332 GLN A CB  
2042 C CG  . GLN A 259 ? 1.3323 1.6165  1.4681  0.1641  -0.2273 0.1916  332 GLN A CG  
2043 C CD  . GLN A 259 ? 1.4963 1.7731  1.6332  0.1820  -0.2323 0.1759  332 GLN A CD  
2044 O OE1 . GLN A 259 ? 1.6942 1.9951  1.8443  0.1916  -0.2136 0.1705  332 GLN A OE1 
2045 N NE2 . GLN A 259 ? 1.4416 1.6849  1.5638  0.1868  -0.2588 0.1682  332 GLN A NE2 
2046 N N   . ILE A 260 ? 1.4584 1.7459  1.5833  0.1700  -0.2101 0.1792  333 ILE A N   
2047 C CA  . ILE A 260 ? 1.7981 2.0585  1.9066  0.1676  -0.2316 0.1792  333 ILE A CA  
2048 C C   . ILE A 260 ? 1.7120 1.9723  1.8229  0.1855  -0.2278 0.1614  333 ILE A C   
2049 O O   . ILE A 260 ? 1.4706 1.7068  1.5734  0.1946  -0.2487 0.1538  333 ILE A O   
2050 C CB  . ILE A 260 ? 1.6798 1.9457  1.7777  0.1458  -0.2319 0.1967  333 ILE A CB  
2051 C CG1 . ILE A 260 ? 1.8816 2.1146  1.9608  0.1406  -0.2593 0.2007  333 ILE A CG1 
2052 C CG2 . ILE A 260 ? 1.6562 1.9536  1.7605  0.1460  -0.2045 0.1931  333 ILE A CG2 
2053 C CD1 . ILE A 260 ? 1.7671 1.9624  1.8368  0.1374  -0.2908 0.2062  333 ILE A CD1 
2054 N N   . PHE A 261 ? 1.4770 1.7643  1.6002  0.1912  -0.2028 0.1545  334 PHE A N   
2055 C CA  . PHE A 261 ? 1.2616 1.5536  1.3891  0.2056  -0.1990 0.1392  334 PHE A CA  
2056 C C   . PHE A 261 ? 1.3726 1.6596  1.5050  0.2236  -0.2085 0.1258  334 PHE A C   
2057 O O   . PHE A 261 ? 1.3754 1.6511  1.5037  0.2350  -0.2236 0.1157  334 PHE A O   
2058 C CB  . PHE A 261 ? 1.1837 1.5022  1.3234  0.2062  -0.1725 0.1354  334 PHE A CB  
2059 C CG  . PHE A 261 ? 1.2166 1.5447  1.3645  0.2194  -0.1677 0.1212  334 PHE A CG  
2060 C CD1 . PHE A 261 ? 1.4803 1.8048  1.6223  0.2207  -0.1744 0.1157  334 PHE A CD1 
2061 C CD2 . PHE A 261 ? 1.3994 1.7432  1.5611  0.2291  -0.1576 0.1148  334 PHE A CD2 
2062 C CE1 . PHE A 261 ? 1.6814 2.0200  1.8330  0.2312  -0.1706 0.1039  334 PHE A CE1 
2063 C CE2 . PHE A 261 ? 1.6845 2.0428  1.8544  0.2384  -0.1534 0.1040  334 PHE A CE2 
2064 C CZ  . PHE A 261 ? 1.7089 2.0658  1.8748  0.2394  -0.1597 0.0984  334 PHE A CZ  
2065 N N   . PHE A 262 ? 1.3362 1.6344  1.4776  0.2274  -0.2000 0.1250  335 PHE A N   
2066 C CA  . PHE A 262 ? 1.2000 1.4988  1.3439  0.2445  -0.2077 0.1113  335 PHE A CA  
2067 C C   . PHE A 262 ? 1.4357 1.7019  1.5656  0.2490  -0.2366 0.1082  335 PHE A C   
2068 O O   . PHE A 262 ? 1.6458 1.9077  1.7742  0.2672  -0.2484 0.0921  335 PHE A O   
2069 C CB  . PHE A 262 ? 1.1615 1.4799  1.3156  0.2453  -0.1933 0.1132  335 PHE A CB  
2070 C CG  . PHE A 262 ? 1.3370 1.6844  1.5055  0.2473  -0.1699 0.1113  335 PHE A CG  
2071 C CD1 . PHE A 262 ? 1.2203 1.5867  1.3950  0.2603  -0.1661 0.0990  335 PHE A CD1 
2072 C CD2 . PHE A 262 ? 1.1631 1.5199  1.3390  0.2361  -0.1529 0.1217  335 PHE A CD2 
2073 C CE1 . PHE A 262 ? 1.1668 1.5578  1.3542  0.2587  -0.1472 0.0999  335 PHE A CE1 
2074 C CE2 . PHE A 262 ? 1.1625 1.5390  1.3507  0.2375  -0.1349 0.1201  335 PHE A CE2 
2075 C CZ  . PHE A 262 ? 1.1615 1.5537  1.3553  0.2471  -0.1328 0.1106  335 PHE A CZ  
2076 N N   . SER A 263 ? 1.5717 1.8154  1.6914  0.2327  -0.2492 0.1231  336 SER A N   
2077 C CA  . SER A 263 ? 1.7428 1.9482  1.8478  0.2346  -0.2806 0.1217  336 SER A CA  
2078 C C   . SER A 263 ? 2.0534 2.2378  2.1506  0.2438  -0.2991 0.1141  336 SER A C   
2079 O O   . SER A 263 ? 1.7813 1.9418  1.8721  0.2605  -0.3220 0.1003  336 SER A O   
2080 C CB  . SER A 263 ? 1.6077 1.7966  1.7041  0.2104  -0.2906 0.1433  336 SER A CB  
2081 O OG  . SER A 263 ? 1.7570 1.9034  1.8383  0.2099  -0.3240 0.1433  336 SER A OG  
2082 N N   . LEU A 264 ? 2.0309 2.2240  2.1282  0.2345  -0.2908 0.1220  337 LEU A N   
2083 C CA  . LEU A 264 ? 1.5886 1.7651  1.6797  0.2433  -0.3083 0.1157  337 LEU A CA  
2084 C C   . LEU A 264 ? 1.5817 1.7833  1.6861  0.2667  -0.2984 0.0949  337 LEU A C   
2085 O O   . LEU A 264 ? 1.4003 1.5884  1.5029  0.2837  -0.3178 0.0828  337 LEU A O   
2086 C CB  . LEU A 264 ? 1.7262 1.9046  1.8101  0.2234  -0.3042 0.1320  337 LEU A CB  
2087 C CG  . LEU A 264 ? 1.6229 1.7796  1.6919  0.1983  -0.3177 0.1549  337 LEU A CG  
2088 C CD1 . LEU A 264 ? 2.0803 2.2451  2.1402  0.1801  -0.3130 0.1691  337 LEU A CD1 
2089 C CD2 . LEU A 264 ? 1.4742 1.5838  1.5302  0.2013  -0.3551 0.1560  337 LEU A CD2 
2090 N N   . GLY A 265 ? 1.8565 2.0955  1.9750  0.2677  -0.2699 0.0913  338 GLY A N   
2091 C CA  . GLY A 265 ? 1.9740 2.2433  2.1062  0.2854  -0.2589 0.0748  338 GLY A CA  
2092 C C   . GLY A 265 ? 1.7758 2.0510  1.9103  0.2896  -0.2631 0.0707  338 GLY A C   
2093 O O   . GLY A 265 ? 1.6768 1.9564  1.8159  0.3095  -0.2755 0.0557  338 GLY A O   
2094 N N   . PRO A 266 ? 1.6877 1.9656  1.8191  0.2719  -0.2532 0.0827  339 PRO A N   
2095 C CA  . PRO A 266 ? 1.8078 2.0955  1.9418  0.2745  -0.2555 0.0786  339 PRO A CA  
2096 C C   . PRO A 266 ? 1.7425 2.0692  1.8929  0.2764  -0.2318 0.0717  339 PRO A C   
2097 O O   . PRO A 266 ? 1.5241 1.8683  1.6832  0.2754  -0.2140 0.0712  339 PRO A O   
2098 C CB  . PRO A 266 ? 1.8176 2.0879  1.9362  0.2529  -0.2578 0.0951  339 PRO A CB  
2099 C CG  . PRO A 266 ? 1.5428 1.8181  1.6608  0.2387  -0.2394 0.1052  339 PRO A CG  
2100 C CD  . PRO A 266 ? 1.6272 1.9003  1.7515  0.2496  -0.2414 0.0997  339 PRO A CD  
2101 N N   . GLY A 267 ? 1.8279 2.1677  1.9825  0.2775  -0.2331 0.0677  340 GLY A N   
2102 C CA  . GLY A 267 ? 2.0350 2.4093  2.2042  0.2752  -0.2136 0.0633  340 GLY A CA  
2103 C C   . GLY A 267 ? 1.9148 2.3215  2.1013  0.2909  -0.2078 0.0515  340 GLY A C   
2104 O O   . GLY A 267 ? 1.5774 2.0144  1.7766  0.2862  -0.1921 0.0504  340 GLY A O   
2105 N N   . PHE A 268 ? 2.0035 2.4058  2.1899  0.3086  -0.2204 0.0428  341 PHE A N   
2106 C CA  . PHE A 268 ? 1.8429 2.2816  2.0437  0.3254  -0.2153 0.0298  341 PHE A CA  
2107 C C   . PHE A 268 ? 1.7021 2.1611  1.9125  0.3453  -0.2297 0.0156  341 PHE A C   
2108 O O   . PHE A 268 ? 1.1308 1.6299  1.3548  0.3603  -0.2247 0.0035  341 PHE A O   
2109 C CB  . PHE A 268 ? 1.7251 2.1511  1.9192  0.3351  -0.2197 0.0254  341 PHE A CB  
2110 C CG  . PHE A 268 ? 1.5716 2.0398  1.7775  0.3467  -0.2078 0.0153  341 PHE A CG  
2111 C CD1 . PHE A 268 ? 1.5291 2.0211  1.7420  0.3325  -0.1854 0.0245  341 PHE A CD1 
2112 C CD2 . PHE A 268 ? 1.6259 2.1107  1.8350  0.3721  -0.2200 -0.0036 341 PHE A CD2 
2113 C CE1 . PHE A 268 ? 1.1831 1.7164  1.4050  0.3404  -0.1751 0.0179  341 PHE A CE1 
2114 C CE2 . PHE A 268 ? 1.7816 2.3118  1.9998  0.3821  -0.2080 -0.0130 341 PHE A CE2 
2115 C CZ  . PHE A 268 ? 1.2318 1.7871  1.4558  0.3646  -0.1853 -0.0008 341 PHE A CZ  
2116 N N   . GLY A 269 ? 1.7640 2.2000  1.9680  0.3457  -0.2474 0.0173  342 GLY A N   
2117 C CA  . GLY A 269 ? 2.0693 2.5222  2.2835  0.3664  -0.2641 0.0042  342 GLY A CA  
2118 C C   . GLY A 269 ? 1.8451 2.2801  2.0558  0.3934  -0.2868 -0.0107 342 GLY A C   
2119 O O   . GLY A 269 ? 1.9494 2.3959  2.1693  0.4147  -0.3036 -0.0235 342 GLY A O   
2120 N N   . VAL A 270 ? 1.5203 1.9272  1.7184  0.3940  -0.2893 -0.0105 343 VAL A N   
2121 C CA  . VAL A 270 ? 1.8497 2.2303  2.0409  0.4189  -0.3145 -0.0257 343 VAL A CA  
2122 C C   . VAL A 270 ? 1.8686 2.1970  2.0467  0.4187  -0.3447 -0.0192 343 VAL A C   
2123 O O   . VAL A 270 ? 1.7103 2.0297  1.8918  0.4436  -0.3691 -0.0335 343 VAL A O   
2124 C CB  . VAL A 270 ? 1.6861 2.0486  1.8657  0.4161  -0.3104 -0.0257 343 VAL A CB  
2125 C CG1 . VAL A 270 ? 1.6401 1.9551  1.8058  0.4346  -0.3423 -0.0368 343 VAL A CG1 
2126 C CG2 . VAL A 270 ? 1.5412 1.9576  1.7335  0.4251  -0.2880 -0.0372 343 VAL A CG2 
2127 N N   . LEU A 271 ? 1.8359 2.1307  1.9988  0.3909  -0.3443 0.0027  344 LEU A N   
2128 C CA  . LEU A 271 ? 1.9115 2.1617  2.0605  0.3850  -0.3716 0.0136  344 LEU A CA  
2129 C C   . LEU A 271 ? 2.1863 2.4581  2.3466  0.3927  -0.3778 0.0102  344 LEU A C   
2130 O O   . LEU A 271 ? 2.3608 2.6025  2.5156  0.4022  -0.4074 0.0105  344 LEU A O   
2131 C CB  . LEU A 271 ? 1.7075 1.9330  1.8394  0.3512  -0.3642 0.0384  344 LEU A CB  
2132 C CG  . LEU A 271 ? 1.8671 2.0841  1.9921  0.3389  -0.3511 0.0448  344 LEU A CG  
2133 C CD1 . LEU A 271 ? 1.7803 1.9889  1.8934  0.3070  -0.3385 0.0679  344 LEU A CD1 
2134 C CD2 . LEU A 271 ? 1.7315 1.9058  1.8452  0.3504  -0.3787 0.0396  344 LEU A CD2 
2135 N N   . LEU A 272 ? 2.2539 2.5765  2.4302  0.3876  -0.3521 0.0082  345 LEU A N   
2136 C CA  . LEU A 272 ? 1.9244 2.2747  2.1142  0.3946  -0.3571 0.0042  345 LEU A CA  
2137 C C   . LEU A 272 ? 1.7219 2.0871  1.9271  0.4309  -0.3768 -0.0176 345 LEU A C   
2138 O O   . LEU A 272 ? 1.9223 2.2793  2.1309  0.4425  -0.4001 -0.0196 345 LEU A O   
2139 C CB  . LEU A 272 ? 1.6706 2.0727  1.8751  0.3808  -0.3262 0.0059  345 LEU A CB  
2140 C CG  . LEU A 272 ? 1.6089 2.0340  1.8214  0.3726  -0.3269 0.0102  345 LEU A CG  
2141 C CD1 . LEU A 272 ? 1.7461 2.1376  1.9369  0.3441  -0.3270 0.0294  345 LEU A CD1 
2142 C CD2 . LEU A 272 ? 1.5856 2.0687  1.8190  0.3682  -0.3015 0.0054  345 LEU A CD2 
2143 N N   . ALA A 273 ? 1.7525 2.1413  1.9669  0.4503  -0.3683 -0.0349 346 ALA A N   
2144 C CA  . ALA A 273 ? 1.9775 2.3879  2.2071  0.4882  -0.3846 -0.0595 346 ALA A CA  
2145 C C   . ALA A 273 ? 2.0656 2.4133  2.2803  0.5069  -0.4220 -0.0658 346 ALA A C   
2146 O O   . ALA A 273 ? 1.9270 2.2734  2.1512  0.5342  -0.4467 -0.0793 346 ALA A O   
2147 C CB  . ALA A 273 ? 1.8860 2.3444  2.1270  0.5021  -0.3632 -0.0764 346 ALA A CB  
2148 N N   . PHE A 274 ? 2.0940 2.3891  2.2861  0.4924  -0.4282 -0.0557 347 PHE A N   
2149 C CA  . PHE A 274 ? 2.0195 2.2480  2.1952  0.5050  -0.4666 -0.0582 347 PHE A CA  
2150 C C   . PHE A 274 ? 2.0012 2.1949  2.1700  0.4954  -0.4918 -0.0414 347 PHE A C   
2151 O O   . PHE A 274 ? 2.2355 2.3915  2.4017  0.5175  -0.5279 -0.0494 347 PHE A O   
2152 C CB  . PHE A 274 ? 2.2984 2.4817  2.4518  0.4853  -0.4671 -0.0468 347 PHE A CB  
2153 C CG  . PHE A 274 ? 2.2190 2.4085  2.3726  0.5072  -0.4651 -0.0694 347 PHE A CG  
2154 C CD1 . PHE A 274 ? 2.2651 2.4985  2.4365  0.5435  -0.4633 -0.0987 347 PHE A CD1 
2155 C CD2 . PHE A 274 ? 1.9900 2.1447  2.1255  0.4914  -0.4653 -0.0615 347 PHE A CD2 
2156 C CE1 . PHE A 274 ? 2.2281 2.4702  2.3969  0.5640  -0.4612 -0.1210 347 PHE A CE1 
2157 C CE2 . PHE A 274 ? 2.2410 2.4011  2.3744  0.5109  -0.4646 -0.0828 347 PHE A CE2 
2158 C CZ  . PHE A 274 ? 2.2883 2.4916  2.4371  0.5474  -0.4623 -0.1132 347 PHE A CZ  
2159 N N   . ALA A 275 ? 2.0658 2.2701  2.2303  0.4629  -0.4748 -0.0185 348 ALA A N   
2160 C CA  . ALA A 275 ? 2.3022 2.4812  2.4590  0.4524  -0.4969 -0.0022 348 ALA A CA  
2161 C C   . ALA A 275 ? 2.2765 2.4966  2.4566  0.4754  -0.5027 -0.0154 348 ALA A C   
2162 O O   . ALA A 275 ? 2.0008 2.1951  2.1773  0.4795  -0.5318 -0.0085 348 ALA A O   
2163 C CB  . ALA A 275 ? 2.2496 2.4293  2.3920  0.4112  -0.4765 0.0242  348 ALA A CB  
2164 N N   . SER A 276 ? 2.2984 2.5836  2.5025  0.4897  -0.4771 -0.0329 349 SER A N   
2165 C CA  . SER A 276 ? 2.3238 2.6579  2.5534  0.5106  -0.4808 -0.0452 349 SER A CA  
2166 C C   . SER A 276 ? 2.2689 2.5788  2.5052  0.5490  -0.5196 -0.0622 349 SER A C   
2167 O O   . SER A 276 ? 2.3630 2.6858  2.6121  0.5604  -0.5370 -0.0627 349 SER A O   
2168 C CB  . SER A 276 ? 2.3234 2.7331  2.5773  0.5195  -0.4480 -0.0611 349 SER A CB  
2169 O OG  . SER A 276 ? 2.2338 2.6970  2.5149  0.5415  -0.4527 -0.0739 349 SER A OG  
2170 N N   . TYR A 277 ? 2.0704 2.3442  2.2983  0.5701  -0.5352 -0.0769 350 TYR A N   
2171 C CA  . TYR A 277 ? 2.0836 2.3213  2.3144  0.6077  -0.5762 -0.0942 350 TYR A CA  
2172 C C   . TYR A 277 ? 2.0967 2.2442  2.2969  0.5899  -0.6090 -0.0734 350 TYR A C   
2173 O O   . TYR A 277 ? 2.2649 2.3720  2.4456  0.5796  -0.6098 -0.0706 350 TYR A O   
2174 C CB  . TYR A 277 ? 1.9841 2.2409  2.2247  0.6454  -0.5747 -0.1275 350 TYR A CB  
2175 C CG  . TYR A 277 ? 2.1660 2.5144  2.4309  0.6527  -0.5352 -0.1428 350 TYR A CG  
2176 C CD1 . TYR A 277 ? 1.9079 2.2788  2.1658  0.6282  -0.5000 -0.1362 350 TYR A CD1 
2177 C CD2 . TYR A 277 ? 2.7094 3.1238  3.0050  0.6833  -0.5345 -0.1624 350 TYR A CD2 
2178 C CE1 . TYR A 277 ? 1.9060 2.3588  2.1847  0.6319  -0.4661 -0.1470 350 TYR A CE1 
2179 C CE2 . TYR A 277 ? 2.5560 3.0578  2.8737  0.6866  -0.4992 -0.1735 350 TYR A CE2 
2180 C CZ  . TYR A 277 ? 2.0502 2.5689  2.3582  0.6598  -0.4657 -0.1650 350 TYR A CZ  
2181 O OH  . TYR A 277 ? 1.7453 2.3492  2.0739  0.6604  -0.4327 -0.1731 350 TYR A OH  
2182 N N   . ASN A 278 ? 2.1859 2.3039  2.3819  0.5852  -0.6374 -0.0579 351 ASN A N   
2183 C CA  . ASN A 278 ? 2.4375 2.4739  2.6044  0.5641  -0.6710 -0.0332 351 ASN A CA  
2184 C C   . ASN A 278 ? 2.5402 2.5684  2.7094  0.5615  -0.6961 -0.0179 351 ASN A C   
2185 O O   . ASN A 278 ? 2.2841 2.3712  2.4763  0.5712  -0.6832 -0.0248 351 ASN A O   
2186 C CB  . ASN A 278 ? 2.4350 2.4550  2.5773  0.5166  -0.6480 -0.0058 351 ASN A CB  
2187 C CG  . ASN A 278 ? 2.5218 2.4620  2.6362  0.5038  -0.6781 0.0081  351 ASN A CG  
2188 O OD1 . ASN A 278 ? 2.5640 2.4595  2.6770  0.5325  -0.7125 -0.0077 351 ASN A OD1 
2189 N ND2 . ASN A 278 ? 2.2886 2.2117  2.3808  0.4605  -0.6661 0.0373  351 ASN A ND2 
2190 N N   . LYS A 279 ? 2.7894 2.7450  2.9339  0.5460  -0.7331 0.0047  352 LYS A N   
2191 C CA  . LYS A 279 ? 2.8919 2.8335  3.0336  0.5390  -0.7599 0.0238  352 LYS A CA  
2192 C C   . LYS A 279 ? 2.9047 2.8822  3.0365  0.4956  -0.7291 0.0493  352 LYS A C   
2193 O O   . LYS A 279 ? 2.8633 2.8461  2.9796  0.4635  -0.6994 0.0617  352 LYS A O   
2194 C CB  . LYS A 279 ? 3.1141 2.9652  3.2297  0.5322  -0.8105 0.0433  352 LYS A CB  
2195 C CG  . LYS A 279 ? 3.1071 2.9087  3.2259  0.5710  -0.8428 0.0184  352 LYS A CG  
2196 C CD  . LYS A 279 ? 3.2629 2.9686  3.3525  0.5563  -0.8932 0.0423  352 LYS A CD  
2197 C CE  . LYS A 279 ? 3.2892 2.9697  3.3777  0.5582  -0.9323 0.0603  352 LYS A CE  
2198 N NZ  . LYS A 279 ? 3.0810 2.7817  3.1999  0.6088  -0.9451 0.0270  352 LYS A NZ  
2199 N N   . PHE A 280 ? 2.8540 2.8570  2.9953  0.4961  -0.7374 0.0559  353 PHE A N   
2200 C CA  . PHE A 280 ? 2.5718 2.6092  2.7028  0.4575  -0.7104 0.0769  353 PHE A CA  
2201 C C   . PHE A 280 ? 2.5355 2.5198  2.6287  0.4168  -0.7264 0.1122  353 PHE A C   
2202 O O   . PHE A 280 ? 2.3596 2.3609  2.4358  0.3805  -0.6966 0.1278  353 PHE A O   
2203 C CB  . PHE A 280 ? 2.4141 2.4982  2.5667  0.4700  -0.7149 0.0722  353 PHE A CB  
2204 C CG  . PHE A 280 ? 2.4974 2.6282  2.6446  0.4357  -0.6817 0.0850  353 PHE A CG  
2205 C CD1 . PHE A 280 ? 2.4643 2.6593  2.6321  0.4366  -0.6404 0.0685  353 PHE A CD1 
2206 C CD2 . PHE A 280 ? 2.6246 2.7341  2.7445  0.4021  -0.6931 0.1133  353 PHE A CD2 
2207 C CE1 . PHE A 280 ? 2.3226 2.5543  2.4844  0.4059  -0.6128 0.0787  353 PHE A CE1 
2208 C CE2 . PHE A 280 ? 2.5441 2.6946  2.6570  0.3724  -0.6637 0.1218  353 PHE A CE2 
2209 C CZ  . PHE A 280 ? 2.2704 2.4792  2.4045  0.3749  -0.6243 0.1038  353 PHE A CZ  
2210 N N   . ASN A 281 ? 2.6234 2.5448  2.7031  0.4223  -0.7740 0.1252  354 ASN A N   
2211 C CA  . ASN A 281 ? 2.5976 2.4679  2.6405  0.3823  -0.7930 0.1612  354 ASN A CA  
2212 C C   . ASN A 281 ? 2.5469 2.3755  2.5718  0.3676  -0.7911 0.1676  354 ASN A C   
2213 O O   . ASN A 281 ? 2.4103 2.1985  2.4050  0.3325  -0.8066 0.1987  354 ASN A O   
2214 C CB  . ASN A 281 ? 2.5380 2.3558  2.5728  0.3908  -0.8484 0.1766  354 ASN A CB  
2215 C CG  . ASN A 281 ? 2.6420 2.4843  2.6678  0.3691  -0.8517 0.1974  354 ASN A CG  
2216 O OD1 . ASN A 281 ? 2.9540 2.8389  3.0041  0.3913  -0.8496 0.1825  354 ASN A OD1 
2217 N ND2 . ASN A 281 ? 2.3175 2.1365  2.3078  0.3247  -0.8569 0.2322  354 ASN A ND2 
2218 N N   . ASN A 282 ? 2.4671 2.3076  2.5095  0.3921  -0.7732 0.1402  355 ASN A N   
2219 C CA  . ASN A 282 ? 2.6362 2.4399  2.6632  0.3792  -0.7716 0.1446  355 ASN A CA  
2220 C C   . ASN A 282 ? 2.5632 2.3916  2.5717  0.3341  -0.7347 0.1666  355 ASN A C   
2221 O O   . ASN A 282 ? 2.3631 2.2482  2.3778  0.3225  -0.6988 0.1656  355 ASN A O   
2222 C CB  . ASN A 282 ? 2.7241 2.5451  2.7743  0.4161  -0.7570 0.1083  355 ASN A CB  
2223 C CG  . ASN A 282 ? 2.8288 2.6136  2.8639  0.4038  -0.7558 0.1110  355 ASN A CG  
2224 O OD1 . ASN A 282 ? 2.9752 2.6945  2.9988  0.4122  -0.7956 0.1125  355 ASN A OD1 
2225 N ND2 . ASN A 282 ? 2.5175 2.3433  2.5528  0.3840  -0.7118 0.1117  355 ASN A ND2 
2226 N N   . ASN A 283 ? 2.4102 2.1956  2.3961  0.3089  -0.7451 0.1860  356 ASN A N   
2227 C CA  . ASN A 283 ? 2.2735 2.0793  2.2403  0.2655  -0.7157 0.2098  356 ASN A CA  
2228 C C   . ASN A 283 ? 2.6785 2.5247  2.6593  0.2695  -0.6717 0.1910  356 ASN A C   
2229 O O   . ASN A 283 ? 2.9264 2.7506  2.9132  0.2855  -0.6773 0.1768  356 ASN A O   
2230 C CB  . ASN A 283 ? 2.3505 2.0976  2.2883  0.2343  -0.7478 0.2419  356 ASN A CB  
2231 C CG  . ASN A 283 ? 2.7059 2.4800  2.6247  0.1898  -0.7182 0.2671  356 ASN A CG  
2232 O OD1 . ASN A 283 ? 2.9506 2.7408  2.8734  0.1834  -0.6917 0.2616  356 ASN A OD1 
2233 N ND2 . ASN A 283 ? 2.6684 2.4503  2.5664  0.1595  -0.7229 0.2946  356 ASN A ND2 
2234 N N   . CYS A 284 ? 2.7964 2.7000  2.7815  0.2551  -0.6296 0.1905  357 CYS A N   
2235 C CA  . CYS A 284 ? 2.5398 2.4810  2.5366  0.2548  -0.5882 0.1769  357 CYS A CA  
2236 C C   . CYS A 284 ? 2.2594 2.1896  2.2367  0.2207  -0.5786 0.1993  357 CYS A C   
2237 O O   . CYS A 284 ? 2.2883 2.2226  2.2725  0.2238  -0.5627 0.1907  357 CYS A O   
2238 C CB  . CYS A 284 ? 2.2570 2.2598  2.2669  0.2542  -0.5498 0.1667  357 CYS A CB  
2239 S SG  . CYS A 284 ? 2.7199 2.7491  2.7550  0.2891  -0.5576 0.1433  357 CYS A SG  
2240 N N   . TYR A 285 ? 2.1832 2.1034  2.1365  0.1875  -0.5883 0.2288  358 TYR A N   
2241 C CA  . TYR A 285 ? 2.1978 2.1232  2.1340  0.1523  -0.5740 0.2515  358 TYR A CA  
2242 C C   . TYR A 285 ? 2.4344 2.3158  2.3665  0.1499  -0.5957 0.2573  358 TYR A C   
2243 O O   . TYR A 285 ? 2.8815 2.7793  2.8202  0.1459  -0.5724 0.2527  358 TYR A O   
2244 C CB  . TYR A 285 ? 2.2390 2.1621  2.1484  0.1186  -0.5863 0.2824  358 TYR A CB  
2245 C CG  . TYR A 285 ? 2.2538 2.2028  2.1465  0.0814  -0.5636 0.3048  358 TYR A CG  
2246 C CD1 . TYR A 285 ? 2.1928 2.1981  2.0867  0.0724  -0.5222 0.2994  358 TYR A CD1 
2247 C CD2 . TYR A 285 ? 2.5874 2.5060  2.4635  0.0552  -0.5849 0.3313  358 TYR A CD2 
2248 C CE1 . TYR A 285 ? 2.4506 2.4845  2.3306  0.0417  -0.5011 0.3175  358 TYR A CE1 
2249 C CE2 . TYR A 285 ? 2.6021 2.5529  2.4651  0.0214  -0.5635 0.3521  358 TYR A CE2 
2250 C CZ  . TYR A 285 ? 2.6266 2.6367  2.4921  0.0164  -0.5208 0.3441  358 TYR A CZ  
2251 O OH  . TYR A 285 ? 2.8432 2.8899  2.6971  -0.0140 -0.4990 0.3623  358 TYR A OH  
2252 N N   . GLN A 286 ? 2.3942 2.2168  2.3152  0.1526  -0.6428 0.2675  359 GLN A N   
2253 C CA  . GLN A 286 ? 2.5311 2.3036  2.4450  0.1480  -0.6697 0.2743  359 GLN A CA  
2254 C C   . GLN A 286 ? 2.7726 2.5488  2.7078  0.1809  -0.6571 0.2414  359 GLN A C   
2255 O O   . GLN A 286 ? 2.9885 2.7544  2.9217  0.1713  -0.6542 0.2440  359 GLN A O   
2256 C CB  . GLN A 286 ? 2.5728 2.2763  2.4723  0.1500  -0.7261 0.2875  359 GLN A CB  
2257 C CG  . GLN A 286 ? 2.7600 2.4016  2.6495  0.1440  -0.7612 0.2953  359 GLN A CG  
2258 C CD  . GLN A 286 ? 3.0642 2.6316  2.9403  0.1495  -0.8202 0.3062  359 GLN A CD  
2259 O OE1 . GLN A 286 ? 3.3636 2.9280  3.2406  0.1621  -0.8346 0.3057  359 GLN A OE1 
2260 N NE2 . GLN A 286 ? 2.8871 2.3921  2.7506  0.1398  -0.8568 0.3165  359 GLN A NE2 
2261 N N   . ASP A 287 ? 2.7088 2.5032  2.6644  0.2189  -0.6497 0.2109  360 ASP A N   
2262 C CA  . ASP A 287 ? 2.6318 2.4392  2.6073  0.2509  -0.6352 0.1786  360 ASP A CA  
2263 C C   . ASP A 287 ? 2.4088 2.2637  2.3912  0.2367  -0.5904 0.1778  360 ASP A C   
2264 O O   . ASP A 287 ? 2.3188 2.1591  2.2989  0.2326  -0.5910 0.1769  360 ASP A O   
2265 C CB  . ASP A 287 ? 2.4542 2.2896  2.4515  0.2892  -0.6291 0.1497  360 ASP A CB  
2266 C CG  . ASP A 287 ? 2.5102 2.2973  2.5055  0.3124  -0.6759 0.1443  360 ASP A CG  
2267 O OD1 . ASP A 287 ? 2.4588 2.1962  2.4332  0.2914  -0.7104 0.1702  360 ASP A OD1 
2268 O OD2 . ASP A 287 ? 2.8251 2.6255  2.8401  0.3516  -0.6789 0.1148  360 ASP A OD2 
2269 N N   . ALA A 288 ? 1.9548 1.8646  1.9453  0.2294  -0.5536 0.1778  361 ALA A N   
2270 C CA  . ALA A 288 ? 1.7091 1.6639  1.7077  0.2184  -0.5116 0.1760  361 ALA A CA  
2271 C C   . ALA A 288 ? 2.0218 1.9626  2.0053  0.1862  -0.5131 0.2006  361 ALA A C   
2272 O O   . ALA A 288 ? 2.4728 2.4246  2.4632  0.1858  -0.4970 0.1955  361 ALA A O   
2273 C CB  . ALA A 288 ? 1.4029 1.4081  1.4071  0.2106  -0.4792 0.1767  361 ALA A CB  
2274 N N   . LEU A 289 ? 2.0045 1.9241  1.9673  0.1576  -0.5329 0.2289  362 LEU A N   
2275 C CA  . LEU A 289 ? 2.1430 2.0532  2.0915  0.1239  -0.5369 0.2555  362 LEU A CA  
2276 C C   . LEU A 289 ? 2.2851 2.1529  2.2338  0.1309  -0.5609 0.2507  362 LEU A C   
2277 O O   . LEU A 289 ? 2.6570 2.5424  2.6122  0.1246  -0.5423 0.2497  362 LEU A O   
2278 C CB  . LEU A 289 ? 2.2689 2.1587  2.1935  0.0932  -0.5619 0.2873  362 LEU A CB  
2279 C CG  . LEU A 289 ? 2.3952 2.2951  2.3041  0.0510  -0.5593 0.3202  362 LEU A CG  
2280 C CD1 . LEU A 289 ? 2.3884 2.3056  2.2779  0.0237  -0.5604 0.3450  362 LEU A CD1 
2281 C CD2 . LEU A 289 ? 2.2171 2.0603  2.1149  0.0377  -0.5994 0.3363  362 LEU A CD2 
2282 N N   . VAL A 290 ? 1.9501 1.7599  1.8910  0.1447  -0.6040 0.2471  363 VAL A N   
2283 C CA  . VAL A 290 ? 2.2365 1.9963  2.1731  0.1504  -0.6335 0.2423  363 VAL A CA  
2284 C C   . VAL A 290 ? 2.2814 2.0664  2.2365  0.1770  -0.6083 0.2122  363 VAL A C   
2285 O O   . VAL A 290 ? 1.8952 1.6715  1.8484  0.1673  -0.6091 0.2149  363 VAL A O   
2286 C CB  . VAL A 290 ? 1.9684 1.6617  1.8960  0.1695  -0.6838 0.2364  363 VAL A CB  
2287 C CG1 . VAL A 290 ? 1.9430 1.5857  1.8683  0.1858  -0.7121 0.2205  363 VAL A CG1 
2288 C CG2 . VAL A 290 ? 2.0842 1.7432  1.9893  0.1355  -0.7154 0.2733  363 VAL A CG2 
2289 N N   . THR A 291 ? 2.2822 2.1012  2.2550  0.2090  -0.5863 0.1846  364 THR A N   
2290 C CA  . THR A 291 ? 2.3827 2.2283  2.3719  0.2340  -0.5635 0.1568  364 THR A CA  
2291 C C   . THR A 291 ? 2.3369 2.2267  2.3320  0.2124  -0.5261 0.1673  364 THR A C   
2292 O O   . THR A 291 ? 2.2139 2.1017  2.2113  0.2145  -0.5227 0.1606  364 THR A O   
2293 C CB  . THR A 291 ? 2.0145 1.8956  2.0220  0.2676  -0.5460 0.1296  364 THR A CB  
2294 O OG1 . THR A 291 ? 1.9627 1.8885  1.9757  0.2532  -0.5169 0.1406  364 THR A OG1 
2295 C CG2 . THR A 291 ? 2.0889 1.9289  2.0938  0.2937  -0.5843 0.1165  364 THR A CG2 
2296 N N   . SER A 292 ? 1.9483 1.8781  1.9455  0.1924  -0.4987 0.1830  365 SER A N   
2297 C CA  . SER A 292 ? 1.4037 1.3766  1.4082  0.1743  -0.4636 0.1920  365 SER A CA  
2298 C C   . SER A 292 ? 1.4288 1.3799  1.4220  0.1471  -0.4787 0.2141  365 SER A C   
2299 O O   . SER A 292 ? 1.9979 1.9651  1.9990  0.1454  -0.4641 0.2113  365 SER A O   
2300 C CB  . SER A 292 ? 1.8458 1.8596  1.8512  0.1586  -0.4366 0.2038  365 SER A CB  
2301 O OG  . SER A 292 ? 1.9670 2.0012  1.9831  0.1814  -0.4239 0.1843  365 SER A OG  
2302 N N   . VAL A 293 ? 1.6463 1.5612  1.6208  0.1239  -0.5095 0.2380  366 VAL A N   
2303 C CA  . VAL A 293 ? 1.9027 1.7975  1.8663  0.0936  -0.5270 0.2625  366 VAL A CA  
2304 C C   . VAL A 293 ? 2.1494 2.0053  2.1132  0.1087  -0.5491 0.2471  366 VAL A C   
2305 O O   . VAL A 293 ? 2.1995 2.0636  2.1655  0.0938  -0.5443 0.2551  366 VAL A O   
2306 C CB  . VAL A 293 ? 2.1215 1.9812  2.0634  0.0650  -0.5603 0.2923  366 VAL A CB  
2307 C CG1 . VAL A 293 ? 2.2831 2.1211  2.2138  0.0311  -0.5819 0.3195  366 VAL A CG1 
2308 C CG2 . VAL A 293 ? 1.7524 1.6571  1.6916  0.0483  -0.5357 0.3073  366 VAL A CG2 
2309 N N   . VAL A 294 ? 2.4574 2.2732  2.4191  0.1395  -0.5738 0.2234  367 VAL A N   
2310 C CA  . VAL A 294 ? 2.6819 2.4602  2.6415  0.1579  -0.5958 0.2039  367 VAL A CA  
2311 C C   . VAL A 294 ? 2.6093 2.4346  2.5855  0.1716  -0.5599 0.1855  367 VAL A C   
2312 O O   . VAL A 294 ? 2.8801 2.6928  2.8536  0.1670  -0.5675 0.1839  367 VAL A O   
2313 C CB  . VAL A 294 ? 2.7492 2.4835  2.7053  0.1937  -0.6261 0.1779  367 VAL A CB  
2314 C CG1 . VAL A 294 ? 2.5618 2.2754  2.5190  0.2221  -0.6371 0.1476  367 VAL A CG1 
2315 C CG2 . VAL A 294 ? 2.9327 2.6032  2.8691  0.1778  -0.6732 0.1985  367 VAL A CG2 
2316 N N   . ASN A 295 ? 2.2531 2.1319  2.2459  0.1870  -0.5219 0.1729  368 ASN A N   
2317 C CA  . ASN A 295 ? 1.9310 1.8554  1.9394  0.1975  -0.4878 0.1590  368 ASN A CA  
2318 C C   . ASN A 295 ? 1.9391 1.8868  1.9497  0.1664  -0.4722 0.1828  368 ASN A C   
2319 O O   . ASN A 295 ? 2.1242 2.0739  2.1372  0.1665  -0.4709 0.1785  368 ASN A O   
2320 C CB  . ASN A 295 ? 1.9489 1.9232  1.9739  0.2145  -0.4529 0.1457  368 ASN A CB  
2321 C CG  . ASN A 295 ? 2.0877 2.1106  2.1288  0.2195  -0.4169 0.1377  368 ASN A CG  
2322 O OD1 . ASN A 295 ? 2.3377 2.3654  2.3834  0.2417  -0.4150 0.1162  368 ASN A OD1 
2323 N ND2 . ASN A 295 ? 2.1766 2.2363  2.2254  0.1994  -0.3890 0.1548  368 ASN A ND2 
2324 N N   . CYS A 296 ? 1.7112 1.6798  1.7209  0.1398  -0.4606 0.2078  369 CYS A N   
2325 C CA  . CYS A 296 ? 1.7342 1.7359  1.7495  0.1126  -0.4420 0.2294  369 CYS A CA  
2326 C C   . CYS A 296 ? 2.1126 2.0789  2.1166  0.0914  -0.4727 0.2452  369 CYS A C   
2327 O O   . CYS A 296 ? 2.6151 2.6010  2.6272  0.0839  -0.4626 0.2487  369 CYS A O   
2328 C CB  . CYS A 296 ? 1.8133 1.8455  1.8273  0.0901  -0.4257 0.2510  369 CYS A CB  
2329 S SG  . CYS A 296 ? 1.6255 1.7046  1.6538  0.1107  -0.3861 0.2334  369 CYS A SG  
2330 N N   . MET A 297 ? 2.2431 2.1556  2.2284  0.0805  -0.5124 0.2559  370 MET A N   
2331 C CA  . MET A 297 ? 2.4527 2.3243  2.4256  0.0587  -0.5465 0.2712  370 MET A CA  
2332 C C   . MET A 297 ? 2.5633 2.4099  2.5366  0.0827  -0.5581 0.2448  370 MET A C   
2333 O O   . MET A 297 ? 2.4265 2.2639  2.3972  0.0661  -0.5700 0.2539  370 MET A O   
2334 C CB  . MET A 297 ? 2.2688 2.0812  2.2203  0.0431  -0.5903 0.2878  370 MET A CB  
2335 C CG  . MET A 297 ? 2.4031 2.2406  2.3501  0.0158  -0.5817 0.3164  370 MET A CG  
2336 S SD  . MET A 297 ? 3.3503 3.2475  3.3040  -0.0279 -0.5580 0.3517  370 MET A SD  
2337 C CE  . MET A 297 ? 2.5975 2.4346  2.5324  -0.0631 -0.6106 0.3791  370 MET A CE  
2338 N N   . THR A 298 ? 2.3209 2.1601  2.2973  0.1211  -0.5549 0.2122  371 THR A N   
2339 C CA  . THR A 298 ? 2.0713 1.8986  2.0480  0.1466  -0.5601 0.1842  371 THR A CA  
2340 C C   . THR A 298 ? 2.3925 2.2732  2.3844  0.1408  -0.5262 0.1862  371 THR A C   
2341 O O   . THR A 298 ? 2.4438 2.3117  2.4313  0.1375  -0.5381 0.1828  371 THR A O   
2342 C CB  . THR A 298 ? 2.0099 1.8373  1.9905  0.1885  -0.5554 0.1500  371 THR A CB  
2343 O OG1 . THR A 298 ? 2.2609 2.0399  2.2295  0.1949  -0.5879 0.1492  371 THR A OG1 
2344 C CG2 . THR A 298 ? 2.2264 2.0421  2.2038  0.2153  -0.5634 0.1198  371 THR A CG2 
2345 N N   . SER A 299 ? 2.4937 2.4327  2.5031  0.1397  -0.4856 0.1916  372 SER A N   
2346 C CA  . SER A 299 ? 1.8956 1.8840  1.9206  0.1319  -0.4553 0.1977  372 SER A CA  
2347 C C   . SER A 299 ? 1.7966 1.7828  1.8190  0.0962  -0.4675 0.2268  372 SER A C   
2348 O O   . SER A 299 ? 1.7581 1.7590  1.7863  0.0910  -0.4634 0.2284  372 SER A O   
2349 C CB  . SER A 299 ? 1.5241 1.5680  1.5670  0.1352  -0.4141 0.2002  372 SER A CB  
2350 O OG  . SER A 299 ? 1.3414 1.3911  1.3881  0.1651  -0.4032 0.1754  372 SER A OG  
2351 N N   . PHE A 300 ? 1.7874 1.7575  1.8007  0.0699  -0.4837 0.2514  373 PHE A N   
2352 C CA  . PHE A 300 ? 1.8951 1.8726  1.9075  0.0321  -0.4936 0.2827  373 PHE A CA  
2353 C C   . PHE A 300 ? 2.0510 1.9818  2.0509  0.0245  -0.5299 0.2819  373 PHE A C   
2354 O O   . PHE A 300 ? 1.9656 1.9184  1.9731  0.0066  -0.5268 0.2947  373 PHE A O   
2355 C CB  . PHE A 300 ? 2.0903 2.0593  2.0922  0.0048  -0.5063 0.3095  373 PHE A CB  
2356 C CG  . PHE A 300 ? 2.2972 2.2878  2.3003  -0.0367 -0.5117 0.3447  373 PHE A CG  
2357 C CD1 . PHE A 300 ? 2.2681 2.3294  2.2914  -0.0474 -0.4749 0.3569  373 PHE A CD1 
2358 C CD2 . PHE A 300 ? 2.1155 2.0570  2.1005  -0.0652 -0.5548 0.3658  373 PHE A CD2 
2359 C CE1 . PHE A 300 ? 1.7635 1.8533  1.7903  -0.0850 -0.4787 0.3891  373 PHE A CE1 
2360 C CE2 . PHE A 300 ? 1.9546 1.9220  1.9419  -0.1063 -0.5599 0.4005  373 PHE A CE2 
2361 C CZ  . PHE A 300 ? 1.8212 1.8665  1.8302  -0.1158 -0.5207 0.4119  373 PHE A CZ  
2362 N N   . VAL A 301 ? 1.8662 1.7317  1.8469  0.0385  -0.5662 0.2661  374 VAL A N   
2363 C CA  . VAL A 301 ? 1.9392 1.7539  1.9053  0.0335  -0.6036 0.2615  374 VAL A CA  
2364 C C   . VAL A 301 ? 2.0196 1.8528  1.9925  0.0600  -0.5880 0.2336  374 VAL A C   
2365 O O   . VAL A 301 ? 1.8556 1.6759  1.8235  0.0488  -0.6042 0.2356  374 VAL A O   
2366 C CB  . VAL A 301 ? 1.8654 1.6006  1.8083  0.0430  -0.6498 0.2510  374 VAL A CB  
2367 C CG1 . VAL A 301 ? 1.7612 1.4743  1.6944  0.0080  -0.6719 0.2858  374 VAL A CG1 
2368 C CG2 . VAL A 301 ? 1.9110 1.6429  1.8556  0.0868  -0.6392 0.2171  374 VAL A CG2 
2369 N N   . SER A 302 ? 2.1065 1.9716  2.0902  0.0934  -0.5572 0.2086  375 SER A N   
2370 C CA  . SER A 302 ? 1.7658 1.6599  1.7572  0.1150  -0.5375 0.1867  375 SER A CA  
2371 C C   . SER A 302 ? 1.5007 1.4435  1.5080  0.0918  -0.5159 0.2081  375 SER A C   
2372 O O   . SER A 302 ? 1.4186 1.3677  1.4255  0.0959  -0.5171 0.1993  375 SER A O   
2373 C CB  . SER A 302 ? 1.6591 1.5882  1.6620  0.1481  -0.5053 0.1634  375 SER A CB  
2374 O OG  . SER A 302 ? 1.9329 1.8227  1.9240  0.1708  -0.5250 0.1436  375 SER A OG  
2375 N N   . GLY A 303 ? 1.8897 1.8695  1.9109  0.0681  -0.4966 0.2358  376 GLY A N   
2376 C CA  . GLY A 303 ? 1.7363 1.7637  1.7746  0.0461  -0.4787 0.2574  376 GLY A CA  
2377 C C   . GLY A 303 ? 1.5164 1.5160  1.5447  0.0212  -0.5117 0.2708  376 GLY A C   
2378 O O   . GLY A 303 ? 1.5074 1.5320  1.5446  0.0182  -0.5049 0.2719  376 GLY A O   
2379 N N   . PHE A 304 ? 1.7977 1.7437  1.8070  0.0018  -0.5499 0.2824  377 PHE A N   
2380 C CA  . PHE A 304 ? 2.0214 1.9325  2.0186  -0.0239 -0.5868 0.2951  377 PHE A CA  
2381 C C   . PHE A 304 ? 1.8935 1.7680  1.8764  0.0009  -0.6048 0.2636  377 PHE A C   
2382 O O   . PHE A 304 ? 1.9078 1.7861  1.8904  -0.0118 -0.6148 0.2679  377 PHE A O   
2383 C CB  . PHE A 304 ? 2.1281 1.9833  2.1061  -0.0502 -0.6270 0.3147  377 PHE A CB  
2384 C CG  . PHE A 304 ? 2.1152 2.0104  2.1042  -0.0821 -0.6131 0.3503  377 PHE A CG  
2385 C CD1 . PHE A 304 ? 1.9241 1.8502  1.9220  -0.1223 -0.6174 0.3842  377 PHE A CD1 
2386 C CD2 . PHE A 304 ? 2.2204 2.1268  2.2107  -0.0721 -0.5956 0.3497  377 PHE A CD2 
2387 C CE1 . PHE A 304 ? 1.9685 1.9390  1.9760  -0.1511 -0.6032 0.4160  377 PHE A CE1 
2388 C CE2 . PHE A 304 ? 2.2476 2.1941  2.2454  -0.1010 -0.5824 0.3809  377 PHE A CE2 
2389 C CZ  . PHE A 304 ? 2.1121 2.0923  2.1182  -0.1400 -0.5855 0.4137  377 PHE A CZ  
2390 N N   . VAL A 305 ? 2.1283 1.9711  2.0991  0.0366  -0.6088 0.2312  378 VAL A N   
2391 C CA  . VAL A 305 ? 2.1338 1.9461  2.0891  0.0633  -0.6248 0.1977  378 VAL A CA  
2392 C C   . VAL A 305 ? 2.0522 1.9221  2.0222  0.0714  -0.5935 0.1916  378 VAL A C   
2393 O O   . VAL A 305 ? 1.8623 1.7179  1.8212  0.0727  -0.6100 0.1804  378 VAL A O   
2394 C CB  . VAL A 305 ? 2.1311 1.9156  2.0760  0.1031  -0.6277 0.1637  378 VAL A CB  
2395 C CG1 . VAL A 305 ? 1.9604 1.7238  1.8894  0.1332  -0.6404 0.1266  378 VAL A CG1 
2396 C CG2 . VAL A 305 ? 2.6018 2.3231  2.5312  0.0953  -0.6642 0.1705  378 VAL A CG2 
2397 N N   . ILE A 306 ? 2.0824 2.0162  2.0767  0.0765  -0.5498 0.1992  379 ILE A N   
2398 C CA  . ILE A 306 ? 1.9200 1.9074  1.9295  0.0844  -0.5208 0.1956  379 ILE A CA  
2399 C C   . ILE A 306 ? 1.7419 1.7545  1.7632  0.0509  -0.5233 0.2252  379 ILE A C   
2400 O O   . ILE A 306 ? 1.6402 1.6620  1.6597  0.0501  -0.5278 0.2210  379 ILE A O   
2401 C CB  . ILE A 306 ? 1.5411 1.5821  1.5720  0.1020  -0.4765 0.1929  379 ILE A CB  
2402 C CG1 . ILE A 306 ? 1.7862 1.8100  1.8068  0.1366  -0.4737 0.1614  379 ILE A CG1 
2403 C CG2 . ILE A 306 ? 1.4015 1.4978  1.4507  0.1045  -0.4482 0.1968  379 ILE A CG2 
2404 C CD1 . ILE A 306 ? 1.6774 1.6891  1.6823  0.1606  -0.4838 0.1316  379 ILE A CD1 
2405 N N   . PHE A 307 ? 1.8390 1.8671  1.8725  0.0224  -0.5207 0.2558  380 PHE A N   
2406 C CA  . PHE A 307 ? 1.6122 1.6830  1.6643  -0.0069 -0.5146 0.2849  380 PHE A CA  
2407 C C   . PHE A 307 ? 1.7346 1.7676  1.7719  -0.0364 -0.5564 0.2984  380 PHE A C   
2408 O O   . PHE A 307 ? 1.5977 1.6665  1.6497  -0.0584 -0.5546 0.3189  380 PHE A O   
2409 C CB  . PHE A 307 ? 1.6419 1.7563  1.7145  -0.0246 -0.4914 0.3115  380 PHE A CB  
2410 C CG  . PHE A 307 ? 1.4457 1.6200  1.5429  -0.0045 -0.4461 0.3068  380 PHE A CG  
2411 C CD1 . PHE A 307 ? 1.4165 1.6444  1.5371  -0.0081 -0.4259 0.3174  380 PHE A CD1 
2412 C CD2 . PHE A 307 ? 1.7382 1.9128  1.8352  0.0182  -0.4257 0.2918  380 PHE A CD2 
2413 C CE1 . PHE A 307 ? 1.5803 1.8569  1.7230  0.0111  -0.3876 0.3129  380 PHE A CE1 
2414 C CE2 . PHE A 307 ? 1.6440 1.8682  1.7624  0.0354  -0.3870 0.2875  380 PHE A CE2 
2415 C CZ  . PHE A 307 ? 1.5704 1.8433  1.7112  0.0322  -0.3685 0.2978  380 PHE A CZ  
2416 N N   . THR A 308 ? 2.0809 2.0419  2.0902  -0.0376 -0.5956 0.2879  381 THR A N   
2417 C CA  . THR A 308 ? 2.1424 2.0603  2.1347  -0.0622 -0.6383 0.2953  381 THR A CA  
2418 C C   . THR A 308 ? 2.3040 2.2228  2.2891  -0.0440 -0.6404 0.2715  381 THR A C   
2419 O O   . THR A 308 ? 1.9317 1.8612  1.9194  -0.0669 -0.6538 0.2856  381 THR A O   
2420 C CB  . THR A 308 ? 2.0740 1.9077  2.0370  -0.0655 -0.6829 0.2878  381 THR A CB  
2421 O OG1 . THR A 308 ? 2.0476 1.8522  1.9973  -0.0229 -0.6788 0.2504  381 THR A OG1 
2422 C CG2 . THR A 308 ? 2.2700 2.1030  2.2379  -0.0956 -0.6884 0.3207  381 THR A CG2 
2423 N N   . VAL A 309 ? 2.5296 2.4425  2.5060  -0.0038 -0.6265 0.2363  382 VAL A N   
2424 C CA  . VAL A 309 ? 2.1532 2.0712  2.1199  0.0152  -0.6267 0.2121  382 VAL A CA  
2425 C C   . VAL A 309 ? 1.9056 1.8999  1.9001  0.0121  -0.5898 0.2268  382 VAL A C   
2426 O O   . VAL A 309 ? 2.1499 2.1564  2.1418  0.0065  -0.5969 0.2261  382 VAL A O   
2427 C CB  . VAL A 309 ? 2.0065 1.9020  1.9559  0.0584  -0.6222 0.1711  382 VAL A CB  
2428 C CG1 . VAL A 309 ? 1.9548 1.8575  1.8902  0.0772  -0.6237 0.1454  382 VAL A CG1 
2429 C CG2 . VAL A 309 ? 2.1189 1.9380  2.0435  0.0636  -0.6605 0.1570  382 VAL A CG2 
2430 N N   . LEU A 310 ? 1.7486 1.7937  1.7696  0.0162  -0.5517 0.2398  383 LEU A N   
2431 C CA  . LEU A 310 ? 1.4958 1.6101  1.5452  0.0133  -0.5191 0.2552  383 LEU A CA  
2432 C C   . LEU A 310 ? 1.6449 1.7837  1.7108  -0.0242 -0.5292 0.2896  383 LEU A C   
2433 O O   . LEU A 310 ? 1.7930 1.9779  1.8770  -0.0292 -0.5164 0.3006  383 LEU A O   
2434 C CB  . LEU A 310 ? 1.6937 1.8507  1.7657  0.0294  -0.4780 0.2572  383 LEU A CB  
2435 C CG  . LEU A 310 ? 1.4420 1.6184  1.5142  0.0638  -0.4522 0.2322  383 LEU A CG  
2436 C CD1 . LEU A 310 ? 1.8130 1.9399  1.8562  0.0875  -0.4696 0.1996  383 LEU A CD1 
2437 C CD2 . LEU A 310 ? 1.5666 1.7865  1.6639  0.0738  -0.4135 0.2391  383 LEU A CD2 
2438 N N   . GLY A 311 ? 1.6273 1.7385  1.6879  -0.0517 -0.5526 0.3084  384 GLY A N   
2439 C CA  . GLY A 311 ? 1.8254 1.9591  1.8992  -0.0906 -0.5672 0.3415  384 GLY A CA  
2440 C C   . GLY A 311 ? 1.9609 2.0617  2.0162  -0.1034 -0.6034 0.3371  384 GLY A C   
2441 O O   . GLY A 311 ? 1.5097 1.6491  1.5814  -0.1243 -0.6050 0.3572  384 GLY A O   
2442 N N   . TYR A 312 ? 2.2669 2.2966  2.2878  -0.0901 -0.6339 0.3097  385 TYR A N   
2443 C CA  . TYR A 312 ? 2.4634 2.4585  2.4622  -0.0961 -0.6676 0.2981  385 TYR A CA  
2444 C C   . TYR A 312 ? 2.3386 2.3802  2.3458  -0.0758 -0.6437 0.2853  385 TYR A C   
2445 O O   . TYR A 312 ? 2.3425 2.3929  2.3479  -0.0919 -0.6599 0.2924  385 TYR A O   
2446 C CB  . TYR A 312 ? 2.6030 2.5134  2.5629  -0.0786 -0.7023 0.2657  385 TYR A CB  
2447 C CG  . TYR A 312 ? 2.6107 2.4913  2.5439  -0.0648 -0.7248 0.2369  385 TYR A CG  
2448 C CD1 . TYR A 312 ? 2.6788 2.5300  2.5983  -0.0946 -0.7641 0.2469  385 TYR A CD1 
2449 C CD2 . TYR A 312 ? 2.5043 2.3880  2.4249  -0.0230 -0.7073 0.1997  385 TYR A CD2 
2450 C CE1 . TYR A 312 ? 2.9369 2.7605  2.8292  -0.0817 -0.7855 0.2188  385 TYR A CE1 
2451 C CE2 . TYR A 312 ? 2.6996 2.5607  2.5933  -0.0099 -0.7270 0.1721  385 TYR A CE2 
2452 C CZ  . TYR A 312 ? 2.8840 2.7137  2.7628  -0.0386 -0.7661 0.1807  385 TYR A CZ  
2453 O OH  . TYR A 312 ? 2.8002 2.6071  2.6496  -0.0253 -0.7864 0.1515  385 TYR A OH  
2454 N N   . MET A 313 ? 2.5379 2.6099  2.5539  -0.0422 -0.6064 0.2682  386 MET A N   
2455 C CA  . MET A 313 ? 2.0493 2.1673  2.0737  -0.0239 -0.5828 0.2592  386 MET A CA  
2456 C C   . MET A 313 ? 2.0042 2.1900  2.0651  -0.0442 -0.5630 0.2925  386 MET A C   
2457 O O   . MET A 313 ? 2.1543 2.3671  2.2193  -0.0470 -0.5641 0.2958  386 MET A O   
2458 C CB  . MET A 313 ? 2.1951 2.3286  2.2211  0.0134  -0.5493 0.2362  386 MET A CB  
2459 C CG  . MET A 313 ? 2.0783 2.2367  2.0971  0.0362  -0.5360 0.2169  386 MET A CG  
2460 S SD  . MET A 313 ? 2.0299 2.1292  2.0020  0.0474  -0.5753 0.1813  386 MET A SD  
2461 C CE  . MET A 313 ? 3.0615 3.2098  3.0305  0.0746  -0.5479 0.1634  386 MET A CE  
2462 N N   . ALA A 314 ? 1.8716 2.0879  1.9592  -0.0573 -0.5451 0.3169  387 ALA A N   
2463 C CA  . ALA A 314 ? 2.0023 2.2851  2.1263  -0.0759 -0.5282 0.3480  387 ALA A CA  
2464 C C   . ALA A 314 ? 1.9010 2.1805  2.0252  -0.1140 -0.5618 0.3712  387 ALA A C   
2465 O O   . ALA A 314 ? 1.5869 1.9231  1.7395  -0.1284 -0.5532 0.3942  387 ALA A O   
2466 C CB  . ALA A 314 ? 2.3290 2.6473  2.4792  -0.0778 -0.4998 0.3645  387 ALA A CB  
2467 N N   . GLU A 315 ? 2.1341 2.3485  2.2282  -0.1308 -0.6013 0.3662  388 GLU A N   
2468 C CA  . GLU A 315 ? 2.3380 2.5412  2.4277  -0.1684 -0.6384 0.3862  388 GLU A CA  
2469 C C   . GLU A 315 ? 2.2378 2.4269  2.3091  -0.1616 -0.6566 0.3690  388 GLU A C   
2470 O O   . GLU A 315 ? 2.4284 2.6464  2.5118  -0.1862 -0.6699 0.3890  388 GLU A O   
2471 C CB  . GLU A 315 ? 2.6495 2.7826  2.7130  -0.1910 -0.6773 0.3890  388 GLU A CB  
2472 C CG  . GLU A 315 ? 2.3190 2.4336  2.3760  -0.2345 -0.7203 0.4119  388 GLU A CG  
2473 C CD  . GLU A 315 ? 2.3004 2.4835  2.3947  -0.2714 -0.7106 0.4559  388 GLU A CD  
2474 O OE1 . GLU A 315 ? 2.5535 2.7409  2.6503  -0.3083 -0.7403 0.4786  388 GLU A OE1 
2475 O OE2 . GLU A 315 ? 2.3542 2.5888  2.4749  -0.2635 -0.6737 0.4671  388 GLU A OE2 
2476 N N   . MET A 316 ? 2.4208 2.5695  2.4627  -0.1287 -0.6576 0.3319  389 MET A N   
2477 C CA  . MET A 316 ? 2.5911 2.7323  2.6129  -0.1192 -0.6713 0.3129  389 MET A CA  
2478 C C   . MET A 316 ? 2.3572 2.5742  2.4086  -0.1102 -0.6382 0.3246  389 MET A C   
2479 O O   . MET A 316 ? 2.3531 2.5898  2.4058  -0.1240 -0.6520 0.3332  389 MET A O   
2480 C CB  . MET A 316 ? 2.7480 2.8364  2.7323  -0.0840 -0.6767 0.2695  389 MET A CB  
2481 C CG  . MET A 316 ? 2.7934 2.8563  2.7452  -0.0781 -0.7026 0.2457  389 MET A CG  
2482 S SD  . MET A 316 ? 2.4724 2.4616  2.3760  -0.0417 -0.7209 0.1936  389 MET A SD  
2483 C CE  . MET A 316 ? 2.2158 2.2516  2.1374  -0.0023 -0.6672 0.1811  389 MET A CE  
2484 N N   . ARG A 317 ? 2.3830 2.6408  2.4579  -0.0875 -0.5968 0.3252  390 ARG A N   
2485 C CA  . ARG A 317 ? 2.3785 2.7094  2.4895  -0.0827 -0.5655 0.3436  390 ARG A CA  
2486 C C   . ARG A 317 ? 2.4203 2.7940  2.5682  -0.1113 -0.5610 0.3800  390 ARG A C   
2487 O O   . ARG A 317 ? 2.8494 3.1968  2.9910  -0.1394 -0.5867 0.3926  390 ARG A O   
2488 C CB  . ARG A 317 ? 2.3467 2.6967  2.4649  -0.0473 -0.5269 0.3279  390 ARG A CB  
2489 C CG  . ARG A 317 ? 2.3566 2.6763  2.4400  -0.0207 -0.5302 0.2937  390 ARG A CG  
2490 C CD  . ARG A 317 ? 2.3182 2.6379  2.4012  0.0100  -0.5000 0.2753  390 ARG A CD  
2491 N NE  . ARG A 317 ? 2.2715 2.6484  2.3898  0.0197  -0.4633 0.2912  390 ARG A NE  
2492 C CZ  . ARG A 317 ? 2.4157 2.8033  2.5373  0.0452  -0.4351 0.2786  390 ARG A CZ  
2493 N NH1 . ARG A 317 ? 2.2704 2.6221  2.3639  0.0641  -0.4375 0.2501  390 ARG A NH1 
2494 N NH2 . ARG A 317 ? 2.5334 2.9678  2.6868  0.0523  -0.4058 0.2941  390 ARG A NH2 
2495 N N   . ASN A 318 ? 1.7744 2.2157  1.9612  -0.1055 -0.5302 0.3981  391 ASN A N   
2496 C CA  . ASN A 318 ? 1.6339 2.1251  1.8575  -0.1296 -0.5234 0.4307  391 ASN A CA  
2497 C C   . ASN A 318 ? 2.1787 2.6872  2.4195  -0.1147 -0.4905 0.4309  391 ASN A C   
2498 O O   . ASN A 318 ? 2.0335 2.5803  2.2965  -0.0900 -0.4574 0.4282  391 ASN A O   
2499 C CB  . ASN A 318 ? 1.5518 2.1101  1.8097  -0.1341 -0.5149 0.4514  391 ASN A CB  
2500 C CG  . ASN A 318 ? 2.0630 2.6142  2.3110  -0.1631 -0.5523 0.4626  391 ASN A CG  
2501 O OD1 . ASN A 318 ? 1.6952 2.2096  1.9252  -0.1915 -0.5835 0.4683  391 ASN A OD1 
2502 N ND2 . ASN A 318 ? 2.5036 3.0884  2.7626  -0.1573 -0.5516 0.4667  391 ASN A ND2 
2503 N N   . GLU A 319 ? 2.6263 3.1039  2.8553  -0.1311 -0.5021 0.4347  392 GLU A N   
2504 C CA  . GLU A 319 ? 2.7702 3.2695  3.0160  -0.1298 -0.4781 0.4432  392 GLU A CA  
2505 C C   . GLU A 319 ? 2.6236 3.1385  2.8790  -0.0926 -0.4397 0.4256  392 GLU A C   
2506 O O   . GLU A 319 ? 2.5114 2.9931  2.7463  -0.0672 -0.4365 0.4001  392 GLU A O   
2507 C CB  . GLU A 319 ? 2.7019 3.2707  2.9853  -0.1557 -0.4712 0.4770  392 GLU A CB  
2508 C CG  . GLU A 319 ? 2.9172 3.4877  3.2015  -0.1772 -0.4717 0.4924  392 GLU A CG  
2509 C CD  . GLU A 319 ? 3.1998 3.8480  3.5215  -0.2030 -0.4637 0.5255  392 GLU A CD  
2510 O OE1 . GLU A 319 ? 3.1065 3.7909  3.4467  -0.2162 -0.4738 0.5403  392 GLU A OE1 
2511 O OE2 . GLU A 319 ? 3.3976 4.0748  3.7305  -0.2098 -0.4470 0.5366  392 GLU A OE2 
2512 N N   . ASP A 320 ? 2.4770 3.0465  2.7646  -0.0902 -0.4110 0.4397  393 ASP A N   
2513 C CA  . ASP A 320 ? 2.1056 2.6959  2.4075  -0.0584 -0.3746 0.4270  393 ASP A CA  
2514 C C   . ASP A 320 ? 2.0189 2.5511  2.2892  -0.0369 -0.3731 0.3989  393 ASP A C   
2515 O O   . ASP A 320 ? 1.9666 2.4885  2.2300  -0.0125 -0.3640 0.3808  393 ASP A O   
2516 C CB  . ASP A 320 ? 2.4920 3.1234  2.8181  -0.0403 -0.3590 0.4281  393 ASP A CB  
2517 N N   . VAL A 321 ? 2.2502 2.7468  2.5017  -0.0468 -0.3828 0.3964  394 VAL A N   
2518 C CA  . VAL A 321 ? 2.0422 2.4808  2.2626  -0.0287 -0.3877 0.3701  394 VAL A CA  
2519 C C   . VAL A 321 ? 1.8722 2.3247  2.1009  0.0041  -0.3548 0.3528  394 VAL A C   
2520 O O   . VAL A 321 ? 2.0153 2.4316  2.2223  0.0241  -0.3561 0.3291  394 VAL A O   
2521 C CB  . VAL A 321 ? 1.8831 2.2884  2.0876  -0.0454 -0.4020 0.3748  394 VAL A CB  
2522 C CG1 . VAL A 321 ? 1.8024 2.1409  1.9726  -0.0293 -0.4180 0.3479  394 VAL A CG1 
2523 C CG2 . VAL A 321 ? 1.9641 2.3691  2.1681  -0.0838 -0.4313 0.4003  394 VAL A CG2 
2524 N N   . SER A 322 ? 1.8069 2.3123  2.0670  0.0103  -0.3262 0.3638  395 SER A N   
2525 C CA  . SER A 322 ? 1.7829 2.2998  2.0519  0.0395  -0.2974 0.3491  395 SER A CA  
2526 C C   . SER A 322 ? 1.8093 2.3246  2.0749  0.0553  -0.2978 0.3391  395 SER A C   
2527 O O   . SER A 322 ? 2.1479 2.6548  2.4085  0.0777  -0.2826 0.3229  395 SER A O   
2528 C CB  . SER A 322 ? 1.8526 2.4243  2.1559  0.0431  -0.2701 0.3624  395 SER A CB  
2529 O OG  . SER A 322 ? 2.3111 2.8903  2.6236  0.0701  -0.2454 0.3493  395 SER A OG  
2530 N N   . GLU A 323 ? 1.9999 2.5248  2.2674  0.0423  -0.3158 0.3496  396 GLU A N   
2531 C CA  . GLU A 323 ? 2.0292 2.5568  2.2922  0.0553  -0.3169 0.3423  396 GLU A CA  
2532 C C   . GLU A 323 ? 2.0702 2.5491  2.2956  0.0646  -0.3318 0.3176  396 GLU A C   
2533 O O   . GLU A 323 ? 2.1924 2.6704  2.4105  0.0848  -0.3200 0.3034  396 GLU A O   
2534 C CB  . GLU A 323 ? 2.2769 2.8310  2.5524  0.0377  -0.3331 0.3611  396 GLU A CB  
2535 C CG  . GLU A 323 ? 2.4362 3.0468  2.7523  0.0311  -0.3183 0.3847  396 GLU A CG  
2536 C CD  . GLU A 323 ? 2.4821 3.1225  2.8226  0.0560  -0.2886 0.3832  396 GLU A CD  
2537 O OE1 . GLU A 323 ? 2.6262 3.2642  2.9624  0.0702  -0.2864 0.3770  396 GLU A OE1 
2538 O OE2 . GLU A 323 ? 2.2912 2.9567  2.6539  0.0609  -0.2687 0.3881  396 GLU A OE2 
2539 N N   . VAL A 324 ? 1.7111 2.1501  1.9122  0.0502  -0.3590 0.3124  397 VAL A N   
2540 C CA  . VAL A 324 ? 1.6538 2.0455  1.8194  0.0625  -0.3742 0.2857  397 VAL A CA  
2541 C C   . VAL A 324 ? 1.6767 2.0521  1.8364  0.0816  -0.3574 0.2689  397 VAL A C   
2542 O O   . VAL A 324 ? 1.7655 2.1196  1.9038  0.1005  -0.3585 0.2452  397 VAL A O   
2543 C CB  . VAL A 324 ? 1.6959 2.0438  1.8376  0.0423  -0.4117 0.2844  397 VAL A CB  
2544 C CG1 . VAL A 324 ? 1.7223 2.0522  1.8667  0.0269  -0.4177 0.2948  397 VAL A CG1 
2545 C CG2 . VAL A 324 ? 2.0247 2.3274  2.1295  0.0582  -0.4303 0.2539  397 VAL A CG2 
2546 N N   . ALA A 325 ? 1.8032 2.1917  1.9813  0.0773  -0.3417 0.2804  398 ALA A N   
2547 C CA  . ALA A 325 ? 1.7511 2.1284  1.9262  0.0936  -0.3249 0.2669  398 ALA A CA  
2548 C C   . ALA A 325 ? 1.7126 2.1265  1.9092  0.1109  -0.2923 0.2672  398 ALA A C   
2549 O O   . ALA A 325 ? 1.6691 2.0798  1.8676  0.1223  -0.2762 0.2591  398 ALA A O   
2550 C CB  . ALA A 325 ? 1.6147 1.9821  1.7930  0.0782  -0.3285 0.2781  398 ALA A CB  
2551 N N   . LYS A 326 ? 1.9387 2.3857  2.1518  0.1120  -0.2842 0.2775  399 LYS A N   
2552 C CA  . LYS A 326 ? 2.1354 2.6134  2.3700  0.1271  -0.2567 0.2802  399 LYS A CA  
2553 C C   . LYS A 326 ? 2.0792 2.5420  2.2999  0.1465  -0.2453 0.2599  399 LYS A C   
2554 O O   . LYS A 326 ? 1.8353 2.3057  2.0679  0.1555  -0.2253 0.2583  399 LYS A O   
2555 C CB  . LYS A 326 ? 2.3426 2.8490  2.5898  0.1269  -0.2568 0.2917  399 LYS A CB  
2556 C CG  . LYS A 326 ? 2.4574 3.0022  2.7380  0.1185  -0.2489 0.3144  399 LYS A CG  
2557 C CD  . LYS A 326 ? 2.2699 2.8409  2.5628  0.1206  -0.2506 0.3255  399 LYS A CD  
2558 C CE  . LYS A 326 ? 2.0305 2.6438  2.3613  0.1186  -0.2398 0.3459  399 LYS A CE  
2559 N NZ  . LYS A 326 ? 1.7125 2.3505  2.0563  0.1205  -0.2443 0.3584  399 LYS A NZ  
2560 N N   . ASP A 327 ? 2.3091 2.7530  2.5046  0.1531  -0.2582 0.2435  400 ASP A N   
2561 C CA  . ASP A 327 ? 2.3169 2.7545  2.5003  0.1711  -0.2476 0.2246  400 ASP A CA  
2562 C C   . ASP A 327 ? 2.4048 2.8142  2.5780  0.1746  -0.2504 0.2118  400 ASP A C   
2563 O O   . ASP A 327 ? 2.3617 2.7407  2.5180  0.1681  -0.2723 0.2056  400 ASP A O   
2564 C CB  . ASP A 327 ? 2.2973 2.7303  2.4565  0.1782  -0.2602 0.2096  400 ASP A CB  
2565 C CG  . ASP A 327 ? 2.4071 2.8553  2.5617  0.1949  -0.2436 0.1973  400 ASP A CG  
2566 O OD1 . ASP A 327 ? 2.4710 2.9187  2.6336  0.2022  -0.2286 0.1932  400 ASP A OD1 
2567 O OD2 . ASP A 327 ? 2.3041 2.7671  2.4465  0.1993  -0.2461 0.1925  400 ASP A OD2 
2568 N N   . ALA A 328 ? 2.4536 2.8709  2.6367  0.1843  -0.2301 0.2084  401 ALA A N   
2569 C CA  . ALA A 328 ? 2.0453 2.4400  2.2205  0.1885  -0.2308 0.1972  401 ALA A CA  
2570 C C   . ALA A 328 ? 1.7880 2.1816  1.9511  0.2066  -0.2254 0.1767  401 ALA A C   
2571 O O   . ALA A 328 ? 1.8885 2.3052  2.0628  0.2139  -0.2057 0.1776  401 ALA A O   
2572 C CB  . ALA A 328 ? 2.1426 2.5495  2.3381  0.1842  -0.2127 0.2090  401 ALA A CB  
2573 N N   . GLY A 329 ? 2.0248 2.3924  2.1655  0.2138  -0.2440 0.1582  402 GLY A N   
2574 C CA  . GLY A 329 ? 2.0465 2.4183  2.1759  0.2325  -0.2404 0.1368  402 GLY A CA  
2575 C C   . GLY A 329 ? 2.2925 2.6407  2.3964  0.2417  -0.2647 0.1159  402 GLY A C   
2576 O O   . GLY A 329 ? 2.8051 3.1211  2.8982  0.2329  -0.2878 0.1171  402 GLY A O   
2577 N N   . PRO A 330 ? 2.0118 2.3761  2.1050  0.2598  -0.2608 0.0959  403 PRO A N   
2578 C CA  . PRO A 330 ? 2.1160 2.4601  2.1834  0.2729  -0.2838 0.0715  403 PRO A CA  
2579 C C   . PRO A 330 ? 1.7031 2.0402  1.7584  0.2628  -0.2997 0.0758  403 PRO A C   
2580 O O   . PRO A 330 ? 1.7238 2.0271  1.7577  0.2671  -0.3262 0.0598  403 PRO A O   
2581 C CB  . PRO A 330 ? 2.2414 2.6219  2.3046  0.2930  -0.2694 0.0527  403 PRO A CB  
2582 C CG  . PRO A 330 ? 2.1525 2.5569  2.2383  0.2903  -0.2443 0.0652  403 PRO A CG  
2583 C CD  . PRO A 330 ? 1.8597 2.2617  1.9634  0.2691  -0.2365 0.0937  403 PRO A CD  
2584 N N   . SER A 331 ? 1.4690 1.8352  1.5376  0.2496  -0.2863 0.0970  404 SER A N   
2585 C CA  . SER A 331 ? 1.5432 1.9066  1.6022  0.2384  -0.3015 0.1034  404 SER A CA  
2586 C C   . SER A 331 ? 1.6795 2.0021  1.7354  0.2222  -0.3260 0.1118  404 SER A C   
2587 O O   . SER A 331 ? 1.8028 2.1102  1.8430  0.2150  -0.3477 0.1094  404 SER A O   
2588 C CB  . SER A 331 ? 2.0432 2.4454  2.1220  0.2270  -0.2826 0.1281  404 SER A CB  
2589 O OG  . SER A 331 ? 1.9063 2.3448  1.9873  0.2383  -0.2620 0.1238  404 SER A OG  
2590 N N   . LEU A 332 ? 1.4582 1.7641  1.5274  0.2144  -0.3240 0.1226  405 LEU A N   
2591 C CA  . LEU A 332 ? 1.6790 1.9467  1.7432  0.1970  -0.3490 0.1316  405 LEU A CA  
2592 C C   . LEU A 332 ? 1.7406 1.9611  1.7757  0.2077  -0.3796 0.1061  405 LEU A C   
2593 O O   . LEU A 332 ? 1.8472 2.0360  1.8681  0.1949  -0.4078 0.1076  405 LEU A O   
2594 C CB  . LEU A 332 ? 1.1914 1.4570  1.2744  0.1868  -0.3384 0.1485  405 LEU A CB  
2595 C CG  . LEU A 332 ? 1.2406 1.4873  1.3280  0.1607  -0.3554 0.1703  405 LEU A CG  
2596 C CD1 . LEU A 332 ? 1.3000 1.5747  1.4136  0.1503  -0.3318 0.1920  405 LEU A CD1 
2597 C CD2 . LEU A 332 ? 1.3453 1.5377  1.4110  0.1586  -0.3863 0.1599  405 LEU A CD2 
2598 N N   . LEU A 333 ? 1.8811 2.0959  1.9077  0.2313  -0.3760 0.0823  406 LEU A N   
2599 C CA  . LEU A 333 ? 2.0544 2.2253  2.0543  0.2471  -0.4052 0.0541  406 LEU A CA  
2600 C C   . LEU A 333 ? 2.2079 2.3893  2.1867  0.2625  -0.4120 0.0306  406 LEU A C   
2601 O O   . LEU A 333 ? 2.7027 2.8443  2.6577  0.2641  -0.4432 0.0154  406 LEU A O   
2602 C CB  . LEU A 333 ? 2.0028 2.1667  2.0039  0.2682  -0.3997 0.0374  406 LEU A CB  
2603 C CG  . LEU A 333 ? 1.9371 2.0866  1.9538  0.2550  -0.3961 0.0568  406 LEU A CG  
2604 C CD1 . LEU A 333 ? 2.0464 2.1912  2.0630  0.2779  -0.3926 0.0379  406 LEU A CD1 
2605 C CD2 . LEU A 333 ? 2.0343 2.1331  2.0415  0.2332  -0.4280 0.0703  406 LEU A CD2 
2606 N N   . PHE A 334 ? 1.6773 1.9113  1.6628  0.2730  -0.3846 0.0276  407 PHE A N   
2607 C CA  . PHE A 334 ? 1.7287 1.9807  1.6922  0.2902  -0.3882 0.0029  407 PHE A CA  
2608 C C   . PHE A 334 ? 1.5487 1.8074  1.5036  0.2734  -0.3973 0.0139  407 PHE A C   
2609 O O   . PHE A 334 ? 1.9110 2.1699  1.8401  0.2851  -0.4104 -0.0089 407 PHE A O   
2610 C CB  . PHE A 334 ? 1.4291 1.7388  1.4021  0.3058  -0.3562 -0.0029 407 PHE A CB  
2611 C CG  . PHE A 334 ? 1.5920 1.9007  1.5652  0.3296  -0.3521 -0.0252 407 PHE A CG  
2612 C CD1 . PHE A 334 ? 1.9003 2.1984  1.8499  0.3562  -0.3685 -0.0615 407 PHE A CD1 
2613 C CD2 . PHE A 334 ? 1.3637 1.6839  1.3611  0.3267  -0.3325 -0.0110 407 PHE A CD2 
2614 C CE1 . PHE A 334 ? 2.0353 2.3366  1.9878  0.3799  -0.3653 -0.0822 407 PHE A CE1 
2615 C CE2 . PHE A 334 ? 1.3605 1.6825  1.3594  0.3479  -0.3297 -0.0305 407 PHE A CE2 
2616 C CZ  . PHE A 334 ? 1.7761 2.0901  1.7539  0.3748  -0.3460 -0.0656 407 PHE A CZ  
2617 N N   . ILE A 335 ? 1.3515 1.6184  1.3268  0.2476  -0.3910 0.0470  408 ILE A N   
2618 C CA  . ILE A 335 ? 1.3522 1.6300  1.3226  0.2311  -0.3995 0.0598  408 ILE A CA  
2619 C C   . ILE A 335 ? 1.6736 1.9110  1.6455  0.2068  -0.4257 0.0766  408 ILE A C   
2620 O O   . ILE A 335 ? 2.2578 2.4611  2.2055  0.2027  -0.4563 0.0644  408 ILE A O   
2621 C CB  . ILE A 335 ? 1.3867 1.7191  1.3816  0.2223  -0.3698 0.0856  408 ILE A CB  
2622 C CG1 . ILE A 335 ? 1.5629 1.9364  1.5541  0.2424  -0.3465 0.0716  408 ILE A CG1 
2623 C CG2 . ILE A 335 ? 1.6027 1.9460  1.5946  0.2046  -0.3810 0.1011  408 ILE A CG2 
2624 C CD1 . ILE A 335 ? 1.3293 1.7512  1.3423  0.2336  -0.3208 0.0971  408 ILE A CD1 
2625 N N   . THR A 336 ? 1.6140 1.8568  1.6137  0.1896  -0.4145 0.1044  409 THR A N   
2626 C CA  . THR A 336 ? 1.6899 1.9052  1.6948  0.1628  -0.4363 0.1252  409 THR A CA  
2627 C C   . THR A 336 ? 1.8937 2.0458  1.8731  0.1637  -0.4718 0.1073  409 THR A C   
2628 O O   . THR A 336 ? 2.0092 2.1304  1.9698  0.1517  -0.5028 0.1042  409 THR A O   
2629 C CB  . THR A 336 ? 1.6189 1.8547  1.6563  0.1491  -0.4154 0.1533  409 THR A CB  
2630 O OG1 . THR A 336 ? 2.0045 2.2938  2.0655  0.1498  -0.3857 0.1689  409 THR A OG1 
2631 C CG2 . THR A 336 ? 1.5746 1.7916  1.6185  0.1193  -0.4365 0.1770  409 THR A CG2 
2632 N N   . TYR A 337 ? 1.5778 1.7077  1.5561  0.1773  -0.4699 0.0959  410 TYR A N   
2633 C CA  . TYR A 337 ? 1.6238 1.6894  1.5798  0.1790  -0.5055 0.0806  410 TYR A CA  
2634 C C   . TYR A 337 ? 1.9773 2.0146  1.9001  0.1985  -0.5302 0.0459  410 TYR A C   
2635 O O   . TYR A 337 ? 1.8867 1.8694  1.7880  0.1898  -0.5683 0.0389  410 TYR A O   
2636 C CB  . TYR A 337 ? 1.5841 1.6378  1.5461  0.1942  -0.4965 0.0731  410 TYR A CB  
2637 C CG  . TYR A 337 ? 1.5944 1.5850  1.5446  0.1842  -0.5305 0.0750  410 TYR A CG  
2638 C CD1 . TYR A 337 ? 1.7017 1.6359  1.6230  0.2011  -0.5651 0.0455  410 TYR A CD1 
2639 C CD2 . TYR A 337 ? 1.6677 1.6552  1.6347  0.1580  -0.5291 0.1061  410 TYR A CD2 
2640 C CE1 . TYR A 337 ? 1.8308 1.7021  1.7410  0.1912  -0.5996 0.0489  410 TYR A CE1 
2641 C CE2 . TYR A 337 ? 2.1575 2.0878  2.1126  0.1458  -0.5616 0.1112  410 TYR A CE2 
2642 C CZ  . TYR A 337 ? 2.1360 2.0057  2.0629  0.1620  -0.5979 0.0835  410 TYR A CZ  
2643 O OH  . TYR A 337 ? 2.1395 1.9470  2.0540  0.1492  -0.6337 0.0902  410 TYR A OH  
2644 N N   . ALA A 338 ? 2.0637 2.1383  1.9808  0.2243  -0.5098 0.0237  411 ALA A N   
2645 C CA  . ALA A 338 ? 1.7629 1.8190  1.6471  0.2460  -0.5301 -0.0126 411 ALA A CA  
2646 C C   . ALA A 338 ? 1.6922 1.7395  1.5614  0.2264  -0.5515 -0.0066 411 ALA A C   
2647 O O   . ALA A 338 ? 1.7695 1.7664  1.6094  0.2298  -0.5878 -0.0282 411 ALA A O   
2648 C CB  . ALA A 338 ? 1.5194 1.6300  1.4029  0.2743  -0.4999 -0.0333 411 ALA A CB  
2649 N N   . GLU A 339 ? 2.1282 2.2229  2.0170  0.2064  -0.5312 0.0222  412 GLU A N   
2650 C CA  . GLU A 339 ? 2.1793 2.2699  2.0577  0.1847  -0.5515 0.0325  412 GLU A CA  
2651 C C   . GLU A 339 ? 2.2156 2.2501  2.0909  0.1575  -0.5874 0.0474  412 GLU A C   
2652 O O   . GLU A 339 ? 2.2736 2.2782  2.1273  0.1450  -0.6193 0.0422  412 GLU A O   
2653 C CB  . GLU A 339 ? 2.1609 2.3144  2.0666  0.1690  -0.5225 0.0638  412 GLU A CB  
2654 C CG  . GLU A 339 ? 2.6418 2.8002  2.5407  0.1463  -0.5413 0.0773  412 GLU A CG  
2655 C CD  . GLU A 339 ? 2.7137 2.9368  2.6382  0.1377  -0.5125 0.1038  412 GLU A CD  
2656 O OE1 . GLU A 339 ? 2.5237 2.7727  2.4327  0.1434  -0.5112 0.0953  412 GLU A OE1 
2657 O OE2 . GLU A 339 ? 2.8368 3.0846  2.7961  0.1260  -0.4920 0.1326  412 GLU A OE2 
2658 N N   . ALA A 340 ? 1.9842 2.0044  1.8797  0.1465  -0.5839 0.0667  413 ALA A N   
2659 C CA  . ALA A 340 ? 1.7649 1.7306  1.6555  0.1195  -0.6197 0.0817  413 ALA A CA  
2660 C C   . ALA A 340 ? 1.9421 1.8339  1.7980  0.1356  -0.6585 0.0484  413 ALA A C   
2661 O O   . ALA A 340 ? 2.5745 2.4116  2.4152  0.1140  -0.6985 0.0539  413 ALA A O   
2662 C CB  . ALA A 340 ? 1.8129 1.7898  1.7331  0.1029  -0.6037 0.1123  413 ALA A CB  
2663 N N   . ILE A 341 ? 1.9334 1.8229  1.7773  0.1732  -0.6488 0.0141  414 ILE A N   
2664 C CA  . ILE A 341 ? 2.1697 1.9911  1.9813  0.1948  -0.6857 -0.0221 414 ILE A CA  
2665 C C   . ILE A 341 ? 2.3729 2.1782  2.1517  0.2034  -0.7093 -0.0502 414 ILE A C   
2666 O O   . ILE A 341 ? 2.5018 2.2374  2.2528  0.2022  -0.7538 -0.0678 414 ILE A O   
2667 C CB  . ILE A 341 ? 2.0588 1.8902  1.8723  0.2336  -0.6663 -0.0492 414 ILE A CB  
2668 C CG1 . ILE A 341 ? 1.9750 1.8068  1.8152  0.2232  -0.6524 -0.0233 414 ILE A CG1 
2669 C CG2 . ILE A 341 ? 2.3555 2.1248  2.1355  0.2637  -0.7026 -0.0931 414 ILE A CG2 
2670 C CD1 . ILE A 341 ? 1.9590 1.8015  1.8034  0.2588  -0.6349 -0.0471 414 ILE A CD1 
2671 N N   . ALA A 342 ? 2.0461 1.9136  1.8264  0.2111  -0.6819 -0.0545 415 ALA A N   
2672 C CA  . ALA A 342 ? 2.1055 1.9654  1.8523  0.2208  -0.7014 -0.0827 415 ALA A CA  
2673 C C   . ALA A 342 ? 2.6026 2.4220  2.3374  0.1855  -0.7391 -0.0659 415 ALA A C   
2674 O O   . ALA A 342 ? 2.9204 2.7091  2.6209  0.1922  -0.7685 -0.0934 415 ALA A O   
2675 C CB  . ALA A 342 ? 2.3556 2.2962  2.1086  0.2309  -0.6628 -0.0832 415 ALA A CB  
2676 N N   . ASN A 343 ? 2.7454 2.5670  2.5074  0.1481  -0.7394 -0.0222 416 ASN A N   
2677 C CA  . ASN A 343 ? 2.8626 2.6544  2.6185  0.1101  -0.7737 -0.0006 416 ASN A CA  
2678 C C   . ASN A 343 ? 2.8934 2.5991  2.6345  0.0948  -0.8204 -0.0003 416 ASN A C   
2679 O O   . ASN A 343 ? 3.1870 2.8648  2.9252  0.0581  -0.8515 0.0222  416 ASN A O   
2680 C CB  . ASN A 343 ? 2.9054 2.7569  2.7007  0.0765  -0.7480 0.0483  416 ASN A CB  
2681 C CG  . ASN A 343 ? 3.0048 2.9312  2.8105  0.0844  -0.7138 0.0515  416 ASN A CG  
2682 O OD1 . ASN A 343 ? 2.9893 2.9744  2.8273  0.0863  -0.6737 0.0723  416 ASN A OD1 
2683 N ND2 . ASN A 343 ? 3.0069 2.9297  2.7836  0.0888  -0.7312 0.0309  416 ASN A ND2 
2684 N N   . MET A 344 ? 2.6051 2.2686  2.3375  0.1207  -0.8275 -0.0231 417 MET A N   
2685 C CA  . MET A 344 ? 2.7545 2.3341  2.4744  0.1059  -0.8725 -0.0195 417 MET A CA  
2686 C C   . MET A 344 ? 3.0089 2.5148  2.6866  0.1374  -0.9126 -0.0698 417 MET A C   
2687 O O   . MET A 344 ? 3.1384 2.6663  2.8023  0.1791  -0.8959 -0.1095 417 MET A O   
2688 C CB  . MET A 344 ? 2.7480 2.3289  2.4926  0.1075  -0.8551 -0.0015 417 MET A CB  
2689 C CG  . MET A 344 ? 2.6614 2.3105  2.4467  0.0781  -0.8175 0.0459  417 MET A CG  
2690 S SD  . MET A 344 ? 3.0647 2.7062  2.8726  0.0753  -0.8050 0.0669  417 MET A SD  
2691 C CE  . MET A 344 ? 2.4330 2.0789  2.2318  0.1336  -0.7838 0.0197  417 MET A CE  
2692 N N   . PRO A 345 ? 3.0509 2.4696  2.7071  0.1186  -0.9667 -0.0696 418 PRO A N   
2693 C CA  . PRO A 345 ? 3.0229 2.3638  2.6382  0.1511  -1.0088 -0.1199 418 PRO A CA  
2694 C C   . PRO A 345 ? 2.7790 2.1083  2.3956  0.1962  -0.9977 -0.1493 418 PRO A C   
2695 O O   . PRO A 345 ? 2.6319 1.9822  2.2770  0.1916  -0.9747 -0.1243 418 PRO A O   
2696 C CB  . PRO A 345 ? 3.3505 2.5998  2.9499  0.1130  -1.0686 -0.1014 418 PRO A CB  
2697 C CG  . PRO A 345 ? 3.3150 2.5939  2.9513  0.0691  -1.0525 -0.0430 418 PRO A CG  
2698 C CD  . PRO A 345 ? 3.0875 2.4751  2.7552  0.0660  -0.9937 -0.0232 418 PRO A CD  
2699 N N   . ALA A 346 ? 3.0464 2.3444  2.6315  0.2406  -1.0150 -0.2039 419 ALA A N   
2700 C CA  . ALA A 346 ? 3.1855 2.4842  2.7711  0.2905  -1.0023 -0.2392 419 ALA A CA  
2701 C C   . ALA A 346 ? 3.1899 2.5906  2.8105  0.3014  -0.9377 -0.2246 419 ALA A C   
2702 O O   . ALA A 346 ? 3.0266 2.4371  2.6684  0.3145  -0.9204 -0.2185 419 ALA A O   
2703 C CB  . ALA A 346 ? 3.0037 2.2185  2.5891  0.2889  -1.0402 -0.2333 419 ALA A CB  
2704 N N   . SER A 347 ? 3.1112 2.5870  2.7371  0.2946  -0.9037 -0.2184 420 SER A N   
2705 C CA  . SER A 347 ? 2.6825 2.2533  2.3414  0.2989  -0.8446 -0.1999 420 SER A CA  
2706 C C   . SER A 347 ? 2.4482 2.0494  2.1074  0.3490  -0.8213 -0.2378 420 SER A C   
2707 O O   . SER A 347 ? 2.3663 2.0191  2.0555  0.3536  -0.7829 -0.2213 420 SER A O   
2708 C CB  . SER A 347 ? 2.4622 2.0992  2.1224  0.2831  -0.8199 -0.1881 420 SER A CB  
2709 O OG  . SER A 347 ? 2.7262 2.3410  2.3476  0.2991  -0.8456 -0.2263 420 SER A OG  
2710 N N   . THR A 348 ? 2.5311 2.1038  2.1575  0.3872  -0.8442 -0.2893 421 THR A N   
2711 C CA  . THR A 348 ? 2.5289 2.1310  2.1561  0.4367  -0.8255 -0.3275 421 THR A CA  
2712 C C   . THR A 348 ? 2.5640 2.1290  2.2108  0.4442  -0.8330 -0.3190 421 THR A C   
2713 O O   . THR A 348 ? 2.6684 2.2874  2.3392  0.4632  -0.7975 -0.3187 421 THR A O   
2714 C CB  . THR A 348 ? 2.3979 1.9674  1.9844  0.4766  -0.8554 -0.3863 421 THR A CB  
2715 O OG1 . THR A 348 ? 2.2297 1.8453  1.7974  0.4708  -0.8435 -0.3943 421 THR A OG1 
2716 C CG2 . THR A 348 ? 2.2334 1.8354  1.8227  0.5299  -0.8384 -0.4273 421 THR A CG2 
2717 N N   . PHE A 349 ? 2.5979 2.0710  2.2347  0.4269  -0.8804 -0.3098 422 PHE A N   
2718 C CA  . PHE A 349 ? 2.4404 1.8710  2.0927  0.4308  -0.8933 -0.2991 422 PHE A CA  
2719 C C   . PHE A 349 ? 2.3266 1.8143  2.0181  0.4022  -0.8515 -0.2504 422 PHE A C   
2720 O O   . PHE A 349 ? 2.4377 1.9612  2.1499  0.4236  -0.8250 -0.2532 422 PHE A O   
2721 C CB  . PHE A 349 ? 2.9126 2.2338  2.5448  0.4086  -0.9544 -0.2912 422 PHE A CB  
2722 C CG  . PHE A 349 ? 2.8146 2.0904  2.4632  0.3983  -0.9700 -0.2663 422 PHE A CG  
2723 C CD1 . PHE A 349 ? 2.7561 1.9919  2.4000  0.4401  -0.9895 -0.2987 422 PHE A CD1 
2724 C CD2 . PHE A 349 ? 2.7133 1.9880  2.3816  0.3471  -0.9664 -0.2107 422 PHE A CD2 
2725 C CE1 . PHE A 349 ? 2.8913 2.0846  2.5489  0.4296  -1.0058 -0.2743 422 PHE A CE1 
2726 C CE2 . PHE A 349 ? 2.6154 1.8509  2.2960  0.3358  -0.9811 -0.1867 422 PHE A CE2 
2727 C CZ  . PHE A 349 ? 2.7330 1.9261  2.4077  0.3763  -1.0015 -0.2177 422 PHE A CZ  
2728 N N   . PHE A 350 ? 2.4284 1.9278  2.1307  0.3544  -0.8452 -0.2063 423 PHE A N   
2729 C CA  . PHE A 350 ? 2.5690 2.1180  2.3068  0.3262  -0.8088 -0.1606 423 PHE A CA  
2730 C C   . PHE A 350 ? 2.3930 2.0385  2.1526  0.3435  -0.7522 -0.1630 423 PHE A C   
2731 O O   . PHE A 350 ? 2.4873 2.1713  2.2755  0.3342  -0.7214 -0.1369 423 PHE A O   
2732 C CB  . PHE A 350 ? 2.4522 1.9975  2.1966  0.2738  -0.8156 -0.1161 423 PHE A CB  
2733 C CG  . PHE A 350 ? 2.3901 1.8466  2.1204  0.2466  -0.8680 -0.1005 423 PHE A CG  
2734 C CD1 . PHE A 350 ? 2.3325 1.7652  2.0782  0.2284  -0.8741 -0.0712 423 PHE A CD1 
2735 C CD2 . PHE A 350 ? 2.7979 2.1945  2.4980  0.2376  -0.9125 -0.1143 423 PHE A CD2 
2736 C CE1 . PHE A 350 ? 2.5230 1.8747  2.2548  0.2002  -0.9237 -0.0535 423 PHE A CE1 
2737 C CE2 . PHE A 350 ? 3.1964 2.5085  2.8830  0.2095  -0.9635 -0.0977 423 PHE A CE2 
2738 C CZ  . PHE A 350 ? 2.9520 2.2422  2.6548  0.1901  -0.9691 -0.0661 423 PHE A CZ  
2739 N N   . ALA A 351 ? 2.3847 2.0698  2.1303  0.3668  -0.7388 -0.1929 424 ALA A N   
2740 C CA  . ALA A 351 ? 2.2464 2.0206  2.0105  0.3843  -0.6883 -0.1965 424 ALA A CA  
2741 C C   . ALA A 351 ? 2.4053 2.1888  2.1737  0.4260  -0.6803 -0.2270 424 ALA A C   
2742 O O   . ALA A 351 ? 2.7601 2.5955  2.5555  0.4289  -0.6446 -0.2130 424 ALA A O   
2743 C CB  . ALA A 351 ? 2.2311 2.0489  1.9776  0.3919  -0.6772 -0.2149 424 ALA A CB  
2744 N N   . ILE A 352 ? 2.2492 1.9825  1.9918  0.4590  -0.7147 -0.2695 425 ILE A N   
2745 C CA  . ILE A 352 ? 2.2236 1.9667  1.9708  0.5024  -0.7104 -0.3018 425 ILE A CA  
2746 C C   . ILE A 352 ? 2.5866 2.3083  2.3587  0.4921  -0.7100 -0.2753 425 ILE A C   
2747 O O   . ILE A 352 ? 2.6908 2.4647  2.4857  0.5074  -0.6786 -0.2746 425 ILE A O   
2748 C CB  . ILE A 352 ? 2.1991 1.8815  1.9133  0.5398  -0.7539 -0.3525 425 ILE A CB  
2749 C CG1 . ILE A 352 ? 2.4472 2.1728  2.1375  0.5600  -0.7448 -0.3866 425 ILE A CG1 
2750 C CG2 . ILE A 352 ? 2.2067 1.8822  1.9295  0.5818  -0.7589 -0.3806 425 ILE A CG2 
2751 C CD1 . ILE A 352 ? 2.8500 2.5161  2.5047  0.5975  -0.7882 -0.4398 425 ILE A CD1 
2752 N N   . ILE A 353 ? 2.7939 2.4403  2.5612  0.4640  -0.7453 -0.2516 426 ILE A N   
2753 C CA  . ILE A 353 ? 2.6983 2.3228  2.4857  0.4529  -0.7475 -0.2258 426 ILE A CA  
2754 C C   . ILE A 353 ? 2.5832 2.2770  2.4018  0.4246  -0.7003 -0.1851 426 ILE A C   
2755 O O   . ILE A 353 ? 2.5617 2.2695  2.4007  0.4261  -0.6857 -0.1719 426 ILE A O   
2756 C CB  . ILE A 353 ? 2.5078 2.0373  2.2808  0.4258  -0.7980 -0.2071 426 ILE A CB  
2757 C CG1 . ILE A 353 ? 2.5362 2.0676  2.3103  0.3753  -0.7965 -0.1671 426 ILE A CG1 
2758 C CG2 . ILE A 353 ? 2.6085 2.0630  2.3492  0.4553  -0.8478 -0.2498 426 ILE A CG2 
2759 C CD1 . ILE A 353 ? 2.5451 1.9936  2.3088  0.3410  -0.8424 -0.1404 426 ILE A CD1 
2760 N N   . PHE A 354 ? 2.2284 1.9655  2.0510  0.3997  -0.6772 -0.1658 427 PHE A N   
2761 C CA  . PHE A 354 ? 2.0477 1.8482  1.8996  0.3751  -0.6340 -0.1293 427 PHE A CA  
2762 C C   . PHE A 354 ? 2.1547 2.0279  2.0230  0.4027  -0.5932 -0.1446 427 PHE A C   
2763 O O   . PHE A 354 ? 2.5707 2.4691  2.4616  0.4001  -0.5710 -0.1285 427 PHE A O   
2764 C CB  . PHE A 354 ? 2.2049 2.0294  2.0570  0.3435  -0.6241 -0.1058 427 PHE A CB  
2765 C CG  . PHE A 354 ? 2.1026 1.9874  1.9847  0.3191  -0.5830 -0.0690 427 PHE A CG  
2766 C CD1 . PHE A 354 ? 2.2681 2.1380  2.1658  0.2880  -0.5841 -0.0328 427 PHE A CD1 
2767 C CD2 . PHE A 354 ? 2.0566 2.0130  1.9502  0.3271  -0.5445 -0.0709 427 PHE A CD2 
2768 C CE1 . PHE A 354 ? 2.1557 2.0805  2.0803  0.2687  -0.5471 -0.0025 427 PHE A CE1 
2769 C CE2 . PHE A 354 ? 1.9560 1.9620  1.8767  0.3065  -0.5097 -0.0387 427 PHE A CE2 
2770 C CZ  . PHE A 354 ? 1.8076 1.7974  1.7439  0.2789  -0.5108 -0.0062 427 PHE A CZ  
2771 N N   . PHE A 355 ? 2.1982 2.1076  2.0543  0.4281  -0.5836 -0.1753 428 PHE A N   
2772 C CA  . PHE A 355 ? 2.0786 2.0628  1.9501  0.4514  -0.5453 -0.1878 428 PHE A CA  
2773 C C   . PHE A 355 ? 1.8776 1.8515  1.7551  0.4831  -0.5521 -0.2103 428 PHE A C   
2774 O O   . PHE A 355 ? 1.6568 1.6784  1.5577  0.4874  -0.5226 -0.2018 428 PHE A O   
2775 C CB  . PHE A 355 ? 2.0470 2.0739  1.9011  0.4699  -0.5360 -0.2152 428 PHE A CB  
2776 C CG  . PHE A 355 ? 2.0911 2.1310  1.9394  0.4398  -0.5301 -0.1931 428 PHE A CG  
2777 C CD1 . PHE A 355 ? 1.7150 1.7751  1.5865  0.4047  -0.5086 -0.1499 428 PHE A CD1 
2778 C CD2 . PHE A 355 ? 2.7086 2.7404  2.5283  0.4476  -0.5474 -0.2163 428 PHE A CD2 
2779 C CE1 . PHE A 355 ? 1.7326 1.8066  1.6015  0.3786  -0.5043 -0.1292 428 PHE A CE1 
2780 C CE2 . PHE A 355 ? 2.8020 2.8468  2.6172  0.4193  -0.5434 -0.1947 428 PHE A CE2 
2781 C CZ  . PHE A 355 ? 2.3526 2.4191  2.1938  0.3851  -0.5220 -0.1505 428 PHE A CZ  
2782 N N   . LEU A 356 ? 2.5122 2.4223  2.3692  0.5055  -0.5928 -0.2389 429 LEU A N   
2783 C CA  . LEU A 356 ? 2.5896 2.4807  2.4536  0.5347  -0.6052 -0.2575 429 LEU A CA  
2784 C C   . LEU A 356 ? 2.2695 2.1457  2.1554  0.5089  -0.6001 -0.2200 429 LEU A C   
2785 O O   . LEU A 356 ? 2.2493 2.1531  2.1537  0.5244  -0.5854 -0.2225 429 LEU A O   
2786 C CB  . LEU A 356 ? 2.5958 2.4069  2.4331  0.5589  -0.6562 -0.2903 429 LEU A CB  
2787 C CG  . LEU A 356 ? 2.5555 2.3502  2.3963  0.6017  -0.6731 -0.3223 429 LEU A CG  
2788 C CD1 . LEU A 356 ? 2.4488 2.3285  2.2978  0.6397  -0.6412 -0.3552 429 LEU A CD1 
2789 C CD2 . LEU A 356 ? 3.0453 2.7477  2.8582  0.6213  -0.7288 -0.3509 429 LEU A CD2 
2790 N N   . MET A 357 ? 2.0451 1.8826  1.9291  0.4686  -0.6116 -0.1847 430 MET A N   
2791 C CA  . MET A 357 ? 2.0711 1.9020  1.9741  0.4414  -0.6039 -0.1476 430 MET A CA  
2792 C C   . MET A 357 ? 1.9951 1.9059  1.9247  0.4353  -0.5543 -0.1313 430 MET A C   
2793 O O   . MET A 357 ? 2.0385 1.9608  1.9847  0.4363  -0.5433 -0.1213 430 MET A O   
2794 C CB  . MET A 357 ? 2.2348 2.0230  2.1313  0.3980  -0.6216 -0.1125 430 MET A CB  
2795 C CG  . MET A 357 ? 2.0438 1.8285  1.9573  0.3684  -0.6139 -0.0741 430 MET A CG  
2796 S SD  . MET A 357 ? 2.6693 2.4357  2.5822  0.3149  -0.6210 -0.0293 430 MET A SD  
2797 C CE  . MET A 357 ? 1.8561 1.7032  1.7833  0.3079  -0.5751 -0.0229 430 MET A CE  
2798 N N   . LEU A 358 ? 1.9141 1.8785  1.8470  0.4282  -0.5258 -0.1280 431 LEU A N   
2799 C CA  . LEU A 358 ? 1.7990 1.8356  1.7560  0.4225  -0.4811 -0.1130 431 LEU A CA  
2800 C C   . LEU A 358 ? 1.8206 1.8955  1.7876  0.4560  -0.4675 -0.1381 431 LEU A C   
2801 O O   . LEU A 358 ? 2.2122 2.3132  2.1995  0.4519  -0.4475 -0.1243 431 LEU A O   
2802 C CB  . LEU A 358 ? 2.1674 2.2502  2.1234  0.4122  -0.4585 -0.1078 431 LEU A CB  
2803 C CG  . LEU A 358 ? 2.1137 2.1991  2.0780  0.3736  -0.4483 -0.0703 431 LEU A CG  
2804 C CD1 . LEU A 358 ? 2.0407 2.0587  1.9934  0.3520  -0.4831 -0.0559 431 LEU A CD1 
2805 C CD2 . LEU A 358 ? 1.7501 1.8749  1.7093  0.3696  -0.4335 -0.0712 431 LEU A CD2 
2806 N N   . ILE A 359 ? 1.7105 1.7913  1.6631  0.4898  -0.4787 -0.1759 432 ILE A N   
2807 C CA  . ILE A 359 ? 2.0284 2.1538  1.9916  0.5237  -0.4661 -0.2018 432 ILE A CA  
2808 C C   . ILE A 359 ? 2.3181 2.4087  2.2916  0.5316  -0.4825 -0.1998 432 ILE A C   
2809 O O   . ILE A 359 ? 2.2105 2.3439  2.2050  0.5373  -0.4608 -0.1957 432 ILE A O   
2810 C CB  . ILE A 359 ? 1.9103 2.0435  1.8537  0.5608  -0.4801 -0.2458 432 ILE A CB  
2811 C CG1 . ILE A 359 ? 1.6974 1.8666  1.6282  0.5503  -0.4643 -0.2456 432 ILE A CG1 
2812 C CG2 . ILE A 359 ? 1.8109 2.0010  1.7681  0.5964  -0.4651 -0.2723 432 ILE A CG2 
2813 C CD1 . ILE A 359 ? 1.7500 1.9259  1.6566  0.5847  -0.4790 -0.2893 432 ILE A CD1 
2814 N N   . THR A 360 ? 2.4075 2.4190  2.3659  0.5301  -0.5227 -0.2010 433 THR A N   
2815 C CA  . THR A 360 ? 2.2085 2.1824  2.1748  0.5350  -0.5416 -0.1957 433 THR A CA  
2816 C C   . THR A 360 ? 2.0157 2.0037  2.0003  0.4999  -0.5197 -0.1550 433 THR A C   
2817 O O   . THR A 360 ? 2.0496 2.0382  2.0472  0.5050  -0.5200 -0.1500 433 THR A O   
2818 C CB  . THR A 360 ? 2.1219 2.0035  2.0661  0.5362  -0.5921 -0.2014 433 THR A CB  
2819 O OG1 . THR A 360 ? 1.9792 1.8274  1.9119  0.4975  -0.5999 -0.1734 433 THR A OG1 
2820 C CG2 . THR A 360 ? 2.2043 2.0676  2.1303  0.5779  -0.6171 -0.2478 433 THR A CG2 
2821 N N   . LEU A 361 ? 1.6707 1.6712  1.6566  0.4656  -0.5015 -0.1267 434 LEU A N   
2822 C CA  . LEU A 361 ? 1.7513 1.7684  1.7538  0.4343  -0.4794 -0.0908 434 LEU A CA  
2823 C C   . LEU A 361 ? 1.8954 1.9838  1.9200  0.4422  -0.4409 -0.0917 434 LEU A C   
2824 O O   . LEU A 361 ? 2.0189 2.1161  2.0573  0.4324  -0.4303 -0.0755 434 LEU A O   
2825 C CB  . LEU A 361 ? 1.7859 1.8006  1.7854  0.3989  -0.4711 -0.0630 434 LEU A CB  
2826 C CG  . LEU A 361 ? 1.6901 1.6371  1.6735  0.3755  -0.5059 -0.0460 434 LEU A CG  
2827 C CD1 . LEU A 361 ? 1.7230 1.6759  1.7009  0.3525  -0.5012 -0.0323 434 LEU A CD1 
2828 C CD2 . LEU A 361 ? 1.6420 1.5730  1.6335  0.3506  -0.5068 -0.0158 434 LEU A CD2 
2829 N N   . GLY A 362 ? 2.1133 2.2539  2.1405  0.4584  -0.4205 -0.1097 435 GLY A N   
2830 C CA  . GLY A 362 ? 2.2344 2.4431  2.2822  0.4634  -0.3860 -0.1090 435 GLY A CA  
2831 C C   . GLY A 362 ? 2.3707 2.5997  2.4267  0.4962  -0.3904 -0.1347 435 GLY A C   
2832 O O   . GLY A 362 ? 2.2780 2.5495  2.3533  0.4952  -0.3688 -0.1280 435 GLY A O   
2833 N N   . LEU A 363 ? 2.0963 2.2953  2.1384  0.5261  -0.4196 -0.1649 436 LEU A N   
2834 C CA  . LEU A 363 ? 1.8155 2.0453  1.8668  0.5634  -0.4224 -0.1947 436 LEU A CA  
2835 C C   . LEU A 363 ? 1.9450 2.1635  2.0118  0.5630  -0.4280 -0.1841 436 LEU A C   
2836 O O   . LEU A 363 ? 2.0755 2.3495  2.1618  0.5755  -0.4095 -0.1903 436 LEU A O   
2837 C CB  . LEU A 363 ? 1.9353 2.1276  1.9670  0.5976  -0.4561 -0.2311 436 LEU A CB  
2838 C CG  . LEU A 363 ? 1.7254 1.9612  1.7459  0.6158  -0.4452 -0.2573 436 LEU A CG  
2839 C CD1 . LEU A 363 ? 1.7486 1.9486  1.7509  0.6559  -0.4799 -0.2989 436 LEU A CD1 
2840 C CD2 . LEU A 363 ? 1.7546 2.0862  1.7951  0.6235  -0.4068 -0.2613 436 LEU A CD2 
2841 N N   . ASP A 364 ? 2.4424 2.5916  2.5005  0.5474  -0.4545 -0.1672 437 ASP A N   
2842 C CA  . ASP A 364 ? 2.4176 2.5537  2.4875  0.5461  -0.4625 -0.1563 437 ASP A CA  
2843 C C   . ASP A 364 ? 2.4772 2.6623  2.5658  0.5201  -0.4266 -0.1301 437 ASP A C   
2844 O O   . ASP A 364 ? 2.7736 2.9915  2.8792  0.5296  -0.4181 -0.1325 437 ASP A O   
2845 C CB  . ASP A 364 ? 2.4913 2.5436  2.5449  0.5303  -0.4989 -0.1401 437 ASP A CB  
2846 C CG  . ASP A 364 ? 2.6224 2.6415  2.6593  0.5001  -0.5020 -0.1211 437 ASP A CG  
2847 O OD1 . ASP A 364 ? 2.5916 2.6540  2.6341  0.4822  -0.4702 -0.1094 437 ASP A OD1 
2848 O OD2 . ASP A 364 ? 2.5337 2.4835  2.5527  0.4936  -0.5378 -0.1169 437 ASP A OD2 
2849 N N   . SER A 365 ? 2.1025 2.2928  2.1884  0.4880  -0.4067 -0.1057 438 SER A N   
2850 C CA  . SER A 365 ? 1.9503 2.1843  2.0526  0.4649  -0.3733 -0.0833 438 SER A CA  
2851 C C   . SER A 365 ? 1.7036 2.0108  1.8232  0.4810  -0.3468 -0.0978 438 SER A C   
2852 O O   . SER A 365 ? 1.7630 2.1043  1.8991  0.4724  -0.3279 -0.0872 438 SER A O   
2853 C CB  . SER A 365 ? 1.9257 2.1546  2.0228  0.4331  -0.3580 -0.0589 438 SER A CB  
2854 O OG  . SER A 365 ? 1.6525 1.8205  1.7346  0.4156  -0.3821 -0.0436 438 SER A OG  
2855 N N   . SER A 366 ? 1.6650 1.9987  1.7804  0.5031  -0.3455 -0.1216 439 SER A N   
2856 C CA  . SER A 366 ? 1.8438 2.2525  1.9752  0.5192  -0.3225 -0.1359 439 SER A CA  
2857 C C   . SER A 366 ? 2.1273 2.5509  2.2714  0.5470  -0.3345 -0.1549 439 SER A C   
2858 O O   . SER A 366 ? 1.6237 2.1037  1.7878  0.5473  -0.3147 -0.1527 439 SER A O   
2859 C CB  . SER A 366 ? 1.9824 2.4194  2.1032  0.5351  -0.3183 -0.1565 439 SER A CB  
2860 O OG  . SER A 366 ? 2.2870 2.8040  2.4229  0.5453  -0.2933 -0.1657 439 SER A OG  
2861 N N   . PHE A 367 ? 2.1660 2.5387  2.2994  0.5702  -0.3685 -0.1730 440 PHE A N   
2862 C CA  . PHE A 367 ? 1.6513 2.0312  1.7974  0.5983  -0.3845 -0.1904 440 PHE A CA  
2863 C C   . PHE A 367 ? 1.7526 2.1411  1.9148  0.5774  -0.3746 -0.1660 440 PHE A C   
2864 O O   . PHE A 367 ? 1.9852 2.4276  2.1681  0.5893  -0.3637 -0.1727 440 PHE A O   
2865 C CB  . PHE A 367 ? 1.7343 2.0385  1.8642  0.6190  -0.4276 -0.2055 440 PHE A CB  
2866 C CG  . PHE A 367 ? 1.7998 2.0884  1.9119  0.6440  -0.4430 -0.2345 440 PHE A CG  
2867 C CD1 . PHE A 367 ? 2.0138 2.3686  2.1283  0.6579  -0.4197 -0.2536 440 PHE A CD1 
2868 C CD2 . PHE A 367 ? 2.0080 2.2145  2.0993  0.6525  -0.4828 -0.2426 440 PHE A CD2 
2869 C CE1 . PHE A 367 ? 2.4112 2.7515  2.5064  0.6813  -0.4346 -0.2821 440 PHE A CE1 
2870 C CE2 . PHE A 367 ? 1.9227 2.1100  1.9955  0.6756  -0.4995 -0.2712 440 PHE A CE2 
2871 C CZ  . PHE A 367 ? 2.1849 2.4400  2.2591  0.6910  -0.4748 -0.2922 440 PHE A CZ  
2872 N N   . ALA A 368 ? 1.6347 1.9730  1.7870  0.5455  -0.3788 -0.1377 441 ALA A N   
2873 C CA  . ALA A 368 ? 1.9007 2.2432  2.0641  0.5250  -0.3710 -0.1156 441 ALA A CA  
2874 C C   . ALA A 368 ? 1.3785 1.7837  1.5575  0.5054  -0.3330 -0.1026 441 ALA A C   
2875 O O   . ALA A 368 ? 1.4616 1.9006  1.6571  0.5027  -0.3234 -0.0981 441 ALA A O   
2876 C CB  . ALA A 368 ? 1.9916 2.2677  2.1383  0.4968  -0.3856 -0.0902 441 ALA A CB  
2877 N N   . GLY A 369 ? 1.4171 1.8365  1.5908  0.4909  -0.3134 -0.0958 442 GLY A N   
2878 C CA  . GLY A 369 ? 1.3782 1.8515  1.5656  0.4718  -0.2803 -0.0825 442 GLY A CA  
2879 C C   . GLY A 369 ? 1.6135 2.1570  1.8207  0.4899  -0.2680 -0.0978 442 GLY A C   
2880 O O   . GLY A 369 ? 1.6220 2.2020  1.8447  0.4750  -0.2503 -0.0856 442 GLY A O   
2881 N N   . LEU A 370 ? 1.4069 1.9720  1.6138  0.5221  -0.2779 -0.1253 443 LEU A N   
2882 C CA  . LEU A 370 ? 1.4296 2.0670  1.6571  0.5423  -0.2686 -0.1416 443 LEU A CA  
2883 C C   . LEU A 370 ? 1.8814 2.5127  2.1218  0.5565  -0.2861 -0.1472 443 LEU A C   
2884 O O   . LEU A 370 ? 1.5600 2.2503  1.8221  0.5589  -0.2743 -0.1481 443 LEU A O   
2885 C CB  . LEU A 370 ? 1.9225 2.5913  2.1452  0.5747  -0.2725 -0.1718 443 LEU A CB  
2886 C CG  . LEU A 370 ? 2.0667 2.7657  2.2800  0.5635  -0.2517 -0.1687 443 LEU A CG  
2887 C CD1 . LEU A 370 ? 2.2747 3.0070  2.4812  0.5990  -0.2578 -0.2025 443 LEU A CD1 
2888 C CD2 . LEU A 370 ? 1.4527 2.2157  1.6830  0.5379  -0.2207 -0.1481 443 LEU A CD2 
2889 N N   . GLU A 371 ? 2.1738 2.7350  2.4012  0.5639  -0.3153 -0.1490 444 GLU A N   
2890 C CA  . GLU A 371 ? 1.8645 2.4158  2.1026  0.5803  -0.3366 -0.1551 444 GLU A CA  
2891 C C   . GLU A 371 ? 1.5569 2.1224  1.8072  0.5525  -0.3237 -0.1308 444 GLU A C   
2892 O O   . GLU A 371 ? 1.5408 2.1408  1.8099  0.5641  -0.3274 -0.1363 444 GLU A O   
2893 C CB  . GLU A 371 ? 1.6643 2.1309  1.8828  0.5892  -0.3727 -0.1576 444 GLU A CB  
2894 C CG  . GLU A 371 ? 1.7401 2.1932  1.9681  0.6163  -0.4017 -0.1706 444 GLU A CG  
2895 C CD  . GLU A 371 ? 2.3282 2.8261  2.5696  0.6620  -0.4091 -0.2068 444 GLU A CD  
2896 O OE1 . GLU A 371 ? 2.4004 2.9800  2.6645  0.6696  -0.3862 -0.2145 444 GLU A OE1 
2897 O OE2 . GLU A 371 ? 2.5556 3.0081  2.7847  0.6902  -0.4384 -0.2280 444 GLU A OE2 
2898 N N   . GLY A 372 ? 1.6402 2.1808  1.8800  0.5166  -0.3092 -0.1051 445 GLY A N   
2899 C CA  . GLY A 372 ? 1.7697 2.3216  2.0182  0.4903  -0.2969 -0.0843 445 GLY A CA  
2900 C C   . GLY A 372 ? 1.5925 2.2219  1.8639  0.4870  -0.2726 -0.0854 445 GLY A C   
2901 O O   . GLY A 372 ? 1.6583 2.3121  1.9442  0.4821  -0.2722 -0.0806 445 GLY A O   
2902 N N   . VAL A 373 ? 1.4078 2.0781  1.6822  0.4878  -0.2533 -0.0903 446 VAL A N   
2903 C CA  . VAL A 373 ? 1.4510 2.1976  1.7463  0.4809  -0.2306 -0.0882 446 VAL A CA  
2904 C C   . VAL A 373 ? 1.5325 2.3356  1.8482  0.5122  -0.2387 -0.1104 446 VAL A C   
2905 O O   . VAL A 373 ? 1.7539 2.6081  2.0905  0.5059  -0.2309 -0.1058 446 VAL A O   
2906 C CB  . VAL A 373 ? 1.5409 2.3144  1.8315  0.4710  -0.2092 -0.0845 446 VAL A CB  
2907 C CG1 . VAL A 373 ? 0.9868 1.8423  1.2985  0.4627  -0.1879 -0.0808 446 VAL A CG1 
2908 C CG2 . VAL A 373 ? 1.6025 2.3247  1.8772  0.4406  -0.2010 -0.0618 446 VAL A CG2 
2909 N N   . ILE A 374 ? 1.4939 2.2897  1.8044  0.5471  -0.2555 -0.1354 447 ILE A N   
2910 C CA  . ILE A 374 ? 1.7900 2.6405  2.1207  0.5824  -0.2646 -0.1602 447 ILE A CA  
2911 C C   . ILE A 374 ? 1.8054 2.6411  2.1483  0.5860  -0.2831 -0.1565 447 ILE A C   
2912 O O   . ILE A 374 ? 1.5062 2.4063  1.8745  0.5938  -0.2790 -0.1610 447 ILE A O   
2913 C CB  . ILE A 374 ? 1.7218 2.5550  2.0409  0.6211  -0.2824 -0.1902 447 ILE A CB  
2914 C CG1 . ILE A 374 ? 1.6938 2.5584  2.0026  0.6181  -0.2620 -0.1952 447 ILE A CG1 
2915 C CG2 . ILE A 374 ? 1.3892 2.2712  1.7296  0.6627  -0.2962 -0.2184 447 ILE A CG2 
2916 C CD1 . ILE A 374 ? 1.5293 2.3564  1.8178  0.6478  -0.2803 -0.2209 447 ILE A CD1 
2917 N N   . THR A 375 ? 1.9706 2.7244  2.2955  0.5786  -0.3040 -0.1468 448 THR A N   
2918 C CA  . THR A 375 ? 1.6500 2.3858  1.9828  0.5770  -0.3219 -0.1392 448 THR A CA  
2919 C C   . THR A 375 ? 1.3854 2.1587  1.7310  0.5438  -0.3013 -0.1175 448 THR A C   
2920 O O   . THR A 375 ? 1.3747 2.1810  1.7395  0.5480  -0.3077 -0.1177 448 THR A O   
2921 C CB  . THR A 375 ? 1.7103 2.3523  2.0174  0.5685  -0.3460 -0.1282 448 THR A CB  
2922 O OG1 . THR A 375 ? 1.9247 2.5281  2.2203  0.5997  -0.3697 -0.1490 448 THR A OG1 
2923 C CG2 . THR A 375 ? 1.5113 2.1347  1.8236  0.5640  -0.3648 -0.1179 448 THR A CG2 
2924 N N   . ALA A 376 ? 1.2459 2.0142  1.5816  0.5111  -0.2779 -0.0992 449 ALA A N   
2925 C CA  . ALA A 376 ? 1.4685 2.2632  1.8135  0.4783  -0.2602 -0.0790 449 ALA A CA  
2926 C C   . ALA A 376 ? 1.3078 2.1930  1.6821  0.4838  -0.2473 -0.0854 449 ALA A C   
2927 O O   . ALA A 376 ? 1.3776 2.2904  1.7674  0.4726  -0.2483 -0.0777 449 ALA A O   
2928 C CB  . ALA A 376 ? 2.0832 2.8535  2.4124  0.4470  -0.2395 -0.0610 449 ALA A CB  
2929 N N   . VAL A 377 ? 1.3681 2.3038  1.7498  0.4998  -0.2354 -0.0989 450 VAL A N   
2930 C CA  . VAL A 377 ? 1.4140 2.4444  1.8233  0.5018  -0.2208 -0.1026 450 VAL A CA  
2931 C C   . VAL A 377 ? 1.4983 2.5699  1.9299  0.5369  -0.2385 -0.1233 450 VAL A C   
2932 O O   . VAL A 377 ? 1.4823 2.6202  1.9397  0.5320  -0.2337 -0.1200 450 VAL A O   
2933 C CB  . VAL A 377 ? 1.4227 2.4981  1.8302  0.5050  -0.2011 -0.1085 450 VAL A CB  
2934 C CG1 . VAL A 377 ? 1.7935 2.9736  2.2292  0.5029  -0.1850 -0.1091 450 VAL A CG1 
2935 C CG2 . VAL A 377 ? 1.1201 2.1521  1.5071  0.4713  -0.1860 -0.0869 450 VAL A CG2 
2936 N N   . LEU A 378 ? 1.5913 2.6242  2.0141  0.5726  -0.2609 -0.1446 451 LEU A N   
2937 C CA  . LEU A 378 ? 1.6457 2.7109  2.0901  0.6096  -0.2812 -0.1655 451 LEU A CA  
2938 C C   . LEU A 378 ? 1.7131 2.7587  2.1658  0.5959  -0.2961 -0.1507 451 LEU A C   
2939 O O   . LEU A 378 ? 1.7170 2.8233  2.1979  0.6092  -0.3014 -0.1570 451 LEU A O   
2940 C CB  . LEU A 378 ? 1.7165 2.7300  2.1464  0.6496  -0.3061 -0.1907 451 LEU A CB  
2941 C CG  . LEU A 378 ? 1.6800 2.7266  2.1058  0.6761  -0.2970 -0.2152 451 LEU A CG  
2942 C CD1 . LEU A 378 ? 1.3620 2.3483  1.7734  0.7166  -0.3277 -0.2414 451 LEU A CD1 
2943 C CD2 . LEU A 378 ? 1.2998 2.4628  1.7566  0.6926  -0.2798 -0.2295 451 LEU A CD2 
2944 N N   . ASP A 379 ? 1.8599 2.8249  2.2884  0.5692  -0.3028 -0.1309 452 ASP A N   
2945 C CA  . ASP A 379 ? 1.8241 2.7698  2.2560  0.5523  -0.3156 -0.1156 452 ASP A CA  
2946 C C   . ASP A 379 ? 1.8144 2.8123  2.2608  0.5170  -0.2940 -0.0971 452 ASP A C   
2947 O O   . ASP A 379 ? 1.8329 2.8496  2.2933  0.5095  -0.3032 -0.0902 452 ASP A O   
2948 C CB  . ASP A 379 ? 2.0763 2.9242  2.4757  0.5345  -0.3290 -0.1008 452 ASP A CB  
2949 C CG  . ASP A 379 ? 2.2730 3.0629  2.6589  0.5664  -0.3580 -0.1156 452 ASP A CG  
2950 O OD1 . ASP A 379 ? 2.5102 3.3235  2.9042  0.6004  -0.3619 -0.1391 452 ASP A OD1 
2951 O OD2 . ASP A 379 ? 1.9409 2.6617  2.3071  0.5567  -0.3779 -0.1037 452 ASP A OD2 
2952 N N   . GLU A 380 ? 1.5536 2.5729  1.9962  0.4941  -0.2675 -0.0881 453 GLU A N   
2953 C CA  . GLU A 380 ? 1.5756 2.6392  2.0308  0.4588  -0.2491 -0.0697 453 GLU A CA  
2954 C C   . GLU A 380 ? 1.6389 2.8057  2.1292  0.4697  -0.2422 -0.0776 453 GLU A C   
2955 O O   . GLU A 380 ? 1.6571 2.8635  2.1646  0.4475  -0.2394 -0.0649 453 GLU A O   
2956 C CB  . GLU A 380 ? 2.0591 3.1038  2.4974  0.4299  -0.2261 -0.0553 453 GLU A CB  
2957 C CG  . GLU A 380 ? 1.9931 3.0719  2.4414  0.3914  -0.2098 -0.0351 453 GLU A CG  
2958 C CD  . GLU A 380 ? 1.5880 2.6508  2.0392  0.3742  -0.2224 -0.0253 453 GLU A CD  
2959 O OE1 . GLU A 380 ? 1.7593 2.8838  2.2342  0.3626  -0.2204 -0.0201 453 GLU A OE1 
2960 O OE2 . GLU A 380 ? 1.4665 2.4574  1.8956  0.3712  -0.2348 -0.0222 453 GLU A OE2 
2961 N N   . PHE A 381 ? 1.8552 3.0690  2.3565  0.5033  -0.2398 -0.0988 454 PHE A N   
2962 C CA  . PHE A 381 ? 1.8919 3.2133  2.4275  0.5182  -0.2323 -0.1090 454 PHE A CA  
2963 C C   . PHE A 381 ? 2.2326 3.5703  2.7820  0.5696  -0.2539 -0.1380 454 PHE A C   
2964 O O   . PHE A 381 ? 2.3006 3.6804  2.8559  0.6017  -0.2495 -0.1606 454 PHE A O   
2965 C CB  . PHE A 381 ? 1.6831 3.0617  2.2202  0.5111  -0.2064 -0.1088 454 PHE A CB  
2966 C CG  . PHE A 381 ? 1.6809 3.0692  2.2153  0.4613  -0.1865 -0.0796 454 PHE A CG  
2967 C CD1 . PHE A 381 ? 1.6961 2.9981  2.2025  0.4320  -0.1845 -0.0617 454 PHE A CD1 
2968 C CD2 . PHE A 381 ? 1.7508 3.2356  2.3109  0.4439  -0.1708 -0.0701 454 PHE A CD2 
2969 C CE1 . PHE A 381 ? 1.6824 2.9885  2.1865  0.3890  -0.1688 -0.0367 454 PHE A CE1 
2970 C CE2 . PHE A 381 ? 1.7735 3.2610  2.3302  0.3973  -0.1560 -0.0422 454 PHE A CE2 
2971 C CZ  . PHE A 381 ? 1.6751 3.0704  2.2037  0.3711  -0.1557 -0.0265 454 PHE A CZ  
2972 N N   . PRO A 382 ? 2.3422 3.6472  2.8963  0.5795  -0.2787 -0.1387 455 PRO A N   
2973 C CA  . PRO A 382 ? 2.2680 3.5786  2.8347  0.6302  -0.3033 -0.1659 455 PRO A CA  
2974 C C   . PRO A 382 ? 2.2843 3.7114  2.8928  0.6540  -0.2993 -0.1807 455 PRO A C   
2975 O O   . PRO A 382 ? 2.2871 3.7792  2.9182  0.6278  -0.2882 -0.1646 455 PRO A O   
2976 C CB  . PRO A 382 ? 2.4198 3.6564  2.9766  0.6248  -0.3308 -0.1553 455 PRO A CB  
2977 C CG  . PRO A 382 ? 2.4566 3.7053  3.0155  0.5767  -0.3179 -0.1272 455 PRO A CG  
2978 C CD  . PRO A 382 ? 2.4027 3.6678  2.9515  0.5458  -0.2866 -0.1153 455 PRO A CD  
2979 N N   . HIS A 383 ? 2.5018 3.9562  3.1201  0.7043  -0.3088 -0.2124 456 HIS A N   
2980 C CA  . HIS A 383 ? 2.6165 4.1741  3.2713  0.7360  -0.3073 -0.2331 456 HIS A CA  
2981 C C   . HIS A 383 ? 2.5126 4.1755  3.1831  0.7153  -0.2726 -0.2272 456 HIS A C   
2982 O O   . HIS A 383 ? 2.4649 4.1978  3.1487  0.7337  -0.2618 -0.2452 456 HIS A O   
2983 C CB  . HIS A 383 ? 2.6527 4.2215  3.3301  0.7338  -0.3256 -0.2249 456 HIS A CB  
2984 C CG  . HIS A 383 ? 2.7128 4.3184  3.4063  0.7702  -0.3327 -0.2505 456 HIS A CG  
2985 N ND1 . HIS A 383 ? 2.6107 4.3215  3.3337  0.7657  -0.3151 -0.2515 456 HIS A ND1 
2986 C CD2 . HIS A 383 ? 2.7938 4.3451  3.4779  0.8117  -0.3566 -0.2758 456 HIS A CD2 
2987 C CE1 . HIS A 383 ? 2.5506 4.2731  3.2823  0.8048  -0.3268 -0.2776 456 HIS A CE1 
2988 N NE2 . HIS A 383 ? 2.6846 4.3099  3.3931  0.8336  -0.3525 -0.2932 456 HIS A NE2 
2989 N N   . VAL A 384 ? 2.3434 4.0007  3.0024  0.6694  -0.2531 -0.1998 457 VAL A N   
2990 C CA  . VAL A 384 ? 2.2898 4.0251  2.9528  0.6523  -0.2223 -0.1951 457 VAL A CA  
2991 C C   . VAL A 384 ? 2.0217 3.7131  2.6542  0.6712  -0.2166 -0.2122 457 VAL A C   
2992 O O   . VAL A 384 ? 2.0117 3.7775  2.6490  0.6825  -0.1979 -0.2246 457 VAL A O   
2993 C CB  . VAL A 384 ? 2.2428 3.9776  2.9016  0.5904  -0.2048 -0.1568 457 VAL A CB  
2994 C CG1 . VAL A 384 ? 2.2063 3.8203  2.8362  0.5645  -0.2181 -0.1385 457 VAL A CG1 
2995 C CG2 . VAL A 384 ? 1.9482 3.7183  2.5953  0.5674  -0.1767 -0.1472 457 VAL A CG2 
2996 N N   . TRP A 385 ? 1.9428 3.5173  2.5437  0.6750  -0.2338 -0.2133 458 TRP A N   
2997 C CA  . TRP A 385 ? 2.2419 3.7608  2.8145  0.7007  -0.2384 -0.2339 458 TRP A CA  
2998 C C   . TRP A 385 ? 2.4754 3.9441  3.0480  0.7489  -0.2719 -0.2613 458 TRP A C   
2999 O O   . TRP A 385 ? 2.2801 3.7703  2.8774  0.7646  -0.2889 -0.2652 458 TRP A O   
3000 C CB  . TRP A 385 ? 2.3858 3.8107  2.9221  0.6625  -0.2321 -0.2104 458 TRP A CB  
3001 C CG  . TRP A 385 ? 2.2911 3.7585  2.8202  0.6328  -0.2020 -0.1962 458 TRP A CG  
3002 C CD1 . TRP A 385 ? 2.2975 3.7645  2.8236  0.5827  -0.1844 -0.1631 458 TRP A CD1 
3003 C CD2 . TRP A 385 ? 2.0624 3.5782  2.5850  0.6516  -0.1877 -0.2145 458 TRP A CD2 
3004 N NE1 . TRP A 385 ? 2.0831 3.5936  2.6022  0.5683  -0.1611 -0.1576 458 TRP A NE1 
3005 C CE2 . TRP A 385 ? 2.0389 3.5824  2.5551  0.6092  -0.1618 -0.1884 458 TRP A CE2 
3006 C CE3 . TRP A 385 ? 2.1025 3.6397  2.6228  0.7007  -0.1955 -0.2514 458 TRP A CE3 
3007 C CZ2 . TRP A 385 ? 2.1670 3.7612  2.6741  0.6125  -0.1431 -0.1957 458 TRP A CZ2 
3008 C CZ3 . TRP A 385 ? 2.1961 3.7848  2.7064  0.7051  -0.1759 -0.2612 458 TRP A CZ3 
3009 C CH2 . TRP A 385 ? 2.1795 3.7977  2.6832  0.6603  -0.1497 -0.2324 458 TRP A CH2 
3010 N N   . ALA A 386 ? 2.9386 4.3405  3.4837  0.7727  -0.2832 -0.2802 459 ALA A N   
3011 C CA  . ALA A 386 ? 3.0581 4.4030  3.5976  0.8198  -0.3168 -0.3085 459 ALA A CA  
3012 C C   . ALA A 386 ? 3.2399 4.6429  3.7900  0.8542  -0.3142 -0.3404 459 ALA A C   
3013 O O   . ALA A 386 ? 3.2705 4.6189  3.8103  0.8890  -0.3400 -0.3650 459 ALA A O   
3014 C CB  . ALA A 386 ? 3.0579 4.3293  3.5978  0.8140  -0.3459 -0.2938 459 ALA A CB  
3015 N N   . LYS A 387 ? 3.2852 4.7975  3.8552  0.8447  -0.2854 -0.3398 460 LYS A N   
3016 C CA  . LYS A 387 ? 3.1421 4.7169  3.7174  0.8784  -0.2797 -0.3724 460 LYS A CA  
3017 C C   . LYS A 387 ? 2.9191 4.4458  3.4637  0.9131  -0.2893 -0.4057 460 LYS A C   
3018 O O   . LYS A 387 ? 2.9254 4.4390  3.4656  0.9530  -0.3064 -0.4381 460 LYS A O   
3019 C CB  . LYS A 387 ? 3.0222 4.7208  3.6159  0.8564  -0.2441 -0.3629 460 LYS A CB  
3020 C CG  . LYS A 387 ? 2.8703 4.5907  3.4517  0.8253  -0.2192 -0.3446 460 LYS A CG  
3021 C CD  . LYS A 387 ? 2.8430 4.6821  3.4452  0.7947  -0.1875 -0.3264 460 LYS A CD  
3022 C CE  . LYS A 387 ? 2.7270 4.5935  3.3142  0.7698  -0.1632 -0.3129 460 LYS A CE  
3023 N NZ  . LYS A 387 ? 2.8312 4.8088  3.4375  0.7344  -0.1346 -0.2901 460 LYS A NZ  
3024 N N   . ARG A 388 ? 2.6332 4.1336  3.1564  0.8988  -0.2797 -0.3985 461 ARG A N   
3025 C CA  . ARG A 388 ? 2.7458 4.1684  3.2367  0.9250  -0.2972 -0.4227 461 ARG A CA  
3026 C C   . ARG A 388 ? 2.6255 3.9839  3.1012  0.8958  -0.2981 -0.3958 461 ARG A C   
3027 O O   . ARG A 388 ? 2.6114 4.0203  3.0941  0.8625  -0.2719 -0.3711 461 ARG A O   
3028 C CB  . ARG A 388 ? 2.9715 4.4571  3.4490  0.9475  -0.2797 -0.4535 461 ARG A CB  
3029 C CG  . ARG A 388 ? 3.0038 4.4561  3.4667  0.9974  -0.3040 -0.4975 461 ARG A CG  
3030 C CD  . ARG A 388 ? 2.8818 4.4172  3.3678  1.0171  -0.2981 -0.5143 461 ARG A CD  
3031 N NE  . ARG A 388 ? 2.9285 4.4086  3.4077  1.0616  -0.3309 -0.5483 461 ARG A NE  
3032 C CZ  . ARG A 388 ? 3.0764 4.5457  3.5327  1.1003  -0.3413 -0.5892 461 ARG A CZ  
3033 N NH1 . ARG A 388 ? 3.1319 4.6438  3.5688  1.1001  -0.3208 -0.6013 461 ARG A NH1 
3034 N NH2 . ARG A 388 ? 3.1592 4.5743  3.6112  1.1391  -0.3737 -0.6180 461 ARG A NH2 
3035 N N   . ARG A 389 ? 2.5761 3.8240  3.0312  0.9069  -0.3294 -0.3992 462 ARG A N   
3036 C CA  . ARG A 389 ? 2.4071 3.5839  2.8399  0.8735  -0.3290 -0.3725 462 ARG A CA  
3037 C C   . ARG A 389 ? 2.5139 3.6947  2.9210  0.8723  -0.3133 -0.3833 462 ARG A C   
3038 O O   . ARG A 389 ? 2.4203 3.5851  2.8114  0.8291  -0.2928 -0.3553 462 ARG A O   
3039 C CB  . ARG A 389 ? 2.2832 3.3372  2.6970  0.8768  -0.3660 -0.3679 462 ARG A CB  
3040 C CG  . ARG A 389 ? 2.0401 3.0085  2.4221  0.8315  -0.3621 -0.3373 462 ARG A CG  
3041 C CD  . ARG A 389 ? 2.2466 3.1130  2.6164  0.8204  -0.3929 -0.3200 462 ARG A CD  
3042 N NE  . ARG A 389 ? 2.4525 3.2549  2.7968  0.7735  -0.3838 -0.2877 462 ARG A NE  
3043 C CZ  . ARG A 389 ? 2.3212 3.0430  2.6520  0.7509  -0.4023 -0.2644 462 ARG A CZ  
3044 N NH1 . ARG A 389 ? 2.2663 2.9568  2.6051  0.7690  -0.4324 -0.2679 462 ARG A NH1 
3045 N NH2 . ARG A 389 ? 2.0813 2.7567  2.3908  0.7103  -0.3909 -0.2373 462 ARG A NH2 
3046 N N   . GLU A 390 ? 2.8900 4.0933  3.2928  0.9201  -0.3230 -0.4246 463 GLU A N   
3047 C CA  . GLU A 390 ? 3.0115 4.2254  3.3887  0.9212  -0.3087 -0.4377 463 GLU A CA  
3048 C C   . GLU A 390 ? 2.8582 4.1765  3.2456  0.8911  -0.2672 -0.4201 463 GLU A C   
3049 O O   . GLU A 390 ? 2.9375 4.2507  3.3014  0.8686  -0.2508 -0.4109 463 GLU A O   
3050 C CB  . GLU A 390 ? 3.0757 4.2934  3.4408  0.9735  -0.3249 -0.4867 463 GLU A CB  
3051 N N   . ARG A 391 ? 1.9812 3.3944  2.4034  0.8888  -0.2514 -0.4136 464 ARG A N   
3052 C CA  . ARG A 391 ? 1.6678 3.1800  2.1008  0.8558  -0.2143 -0.3926 464 ARG A CA  
3053 C C   . ARG A 391 ? 1.7575 3.2186  2.1778  0.7955  -0.2009 -0.3461 464 ARG A C   
3054 O O   . ARG A 391 ? 1.9049 3.3876  2.3102  0.7678  -0.1787 -0.3309 464 ARG A O   
3055 C CB  . ARG A 391 ? 2.0118 3.6189  2.4780  0.8568  -0.2025 -0.3918 464 ARG A CB  
3056 N N   . PHE A 392 ? 1.9570 3.3503  2.3826  0.7755  -0.2149 -0.3235 465 PHE A N   
3057 C CA  . PHE A 392 ? 1.8466 3.1894  2.2604  0.7217  -0.2035 -0.2824 465 PHE A CA  
3058 C C   . PHE A 392 ? 1.5516 2.8038  1.9290  0.7123  -0.2099 -0.2792 465 PHE A C   
3059 O O   . PHE A 392 ? 1.4104 2.6565  1.7750  0.6754  -0.1911 -0.2542 465 PHE A O   
3060 C CB  . PHE A 392 ? 1.8749 3.1710  2.3014  0.7054  -0.2177 -0.2624 465 PHE A CB  
3061 C CG  . PHE A 392 ? 1.6082 2.8506  2.0223  0.6538  -0.2073 -0.2238 465 PHE A CG  
3062 C CD1 . PHE A 392 ? 1.4043 2.7047  1.8321  0.6163  -0.1826 -0.1974 465 PHE A CD1 
3063 C CD2 . PHE A 392 ? 1.3389 2.4740  1.7277  0.6429  -0.2232 -0.2140 465 PHE A CD2 
3064 C CE1 . PHE A 392 ? 1.5867 2.8355  2.0031  0.5722  -0.1747 -0.1648 465 PHE A CE1 
3065 C CE2 . PHE A 392 ? 1.2255 2.3165  1.6039  0.5988  -0.2130 -0.1812 465 PHE A CE2 
3066 C CZ  . PHE A 392 ? 1.5123 2.6582  1.9043  0.5651  -0.1890 -0.1580 465 PHE A CZ  
3067 N N   . VAL A 393 ? 1.7125 2.8931  2.0736  0.7445  -0.2381 -0.3033 466 VAL A N   
3068 C CA  . VAL A 393 ? 1.6401 2.7357  1.9673  0.7358  -0.2469 -0.3009 466 VAL A CA  
3069 C C   . VAL A 393 ? 1.7550 2.9001  2.0678  0.7354  -0.2265 -0.3096 466 VAL A C   
3070 O O   . VAL A 393 ? 2.3510 3.4631  2.6443  0.7041  -0.2160 -0.2884 466 VAL A O   
3071 C CB  . VAL A 393 ? 1.6926 2.7078  2.0060  0.7724  -0.2842 -0.3272 466 VAL A CB  
3072 C CG1 . VAL A 393 ? 1.7676 2.7058  2.0463  0.7651  -0.2938 -0.3277 466 VAL A CG1 
3073 C CG2 . VAL A 393 ? 1.8857 2.8418  2.2082  0.7646  -0.3051 -0.3113 466 VAL A CG2 
3074 N N   . LEU A 394 ? 1.4976 2.7262  1.8200  0.7705  -0.2206 -0.3408 467 LEU A N   
3075 C CA  . LEU A 394 ? 1.5792 2.8667  1.8873  0.7699  -0.2000 -0.3493 467 LEU A CA  
3076 C C   . LEU A 394 ? 1.6346 2.9802  1.9514  0.7223  -0.1679 -0.3117 467 LEU A C   
3077 O O   . LEU A 394 ? 1.4559 2.7992  1.7525  0.6995  -0.1543 -0.2984 467 LEU A O   
3078 C CB  . LEU A 394 ? 1.4464 2.8211  1.7650  0.8189  -0.1995 -0.3918 467 LEU A CB  
3079 C CG  . LEU A 394 ? 1.6740 3.1225  1.9767  0.8263  -0.1795 -0.4081 467 LEU A CG  
3080 C CD1 . LEU A 394 ? 1.5684 3.0300  1.8622  0.8860  -0.1974 -0.4616 467 LEU A CD1 
3081 C CD2 . LEU A 394 ? 1.6265 3.2004  1.9531  0.8056  -0.1466 -0.3910 467 LEU A CD2 
3082 N N   . ALA A 395 ? 1.3101 2.7056  1.6567  0.7061  -0.1576 -0.2933 468 ALA A N   
3083 C CA  . ALA A 395 ? 1.3461 2.7905  1.7018  0.6593  -0.1309 -0.2562 468 ALA A CA  
3084 C C   . ALA A 395 ? 1.5469 2.9024  1.8840  0.6184  -0.1306 -0.2228 468 ALA A C   
3085 O O   . ALA A 395 ? 1.9875 3.3662  2.3201  0.5833  -0.1109 -0.1964 468 ALA A O   
3086 C CB  . ALA A 395 ? 1.5932 3.0968  1.9839  0.6497  -0.1251 -0.2437 468 ALA A CB  
3087 N N   . VAL A 396 ? 1.2770 2.5328  1.6037  0.6223  -0.1528 -0.2229 469 VAL A N   
3088 C CA  . VAL A 396 ? 1.0935 2.2674  1.4023  0.5875  -0.1531 -0.1945 469 VAL A CA  
3089 C C   . VAL A 396 ? 1.1857 2.3265  1.4653  0.5921  -0.1550 -0.2030 469 VAL A C   
3090 O O   . VAL A 396 ? 1.4128 2.5373  1.6808  0.5606  -0.1425 -0.1785 469 VAL A O   
3091 C CB  . VAL A 396 ? 1.4165 2.5040  1.7250  0.5869  -0.1752 -0.1892 469 VAL A CB  
3092 C CG1 . VAL A 396 ? 1.8063 2.8126  2.0952  0.5550  -0.1758 -0.1635 469 VAL A CG1 
3093 C CG2 . VAL A 396 ? 1.2908 2.4112  1.6266  0.5766  -0.1722 -0.1771 469 VAL A CG2 
3094 N N   . VAL A 397 ? 1.2915 2.4215  1.5588  0.6319  -0.1721 -0.2382 470 VAL A N   
3095 C CA  . VAL A 397 ? 1.2794 2.3694  1.5168  0.6374  -0.1785 -0.2486 470 VAL A CA  
3096 C C   . VAL A 397 ? 1.3053 2.4688  1.5361  0.6236  -0.1534 -0.2422 470 VAL A C   
3097 O O   . VAL A 397 ? 1.6348 2.7676  1.8467  0.6001  -0.1481 -0.2251 470 VAL A O   
3098 C CB  . VAL A 397 ? 1.4986 2.5622  1.7243  0.6852  -0.2048 -0.2908 470 VAL A CB  
3099 C CG1 . VAL A 397 ? 1.7683 2.8160  1.9637  0.6936  -0.2082 -0.3066 470 VAL A CG1 
3100 C CG2 . VAL A 397 ? 1.2747 2.2426  1.4985  0.6907  -0.2339 -0.2899 470 VAL A CG2 
3101 N N   . ILE A 398 ? 1.3123 2.5770  1.5589  0.6370  -0.1379 -0.2546 471 ILE A N   
3102 C CA  . ILE A 398 ? 1.4102 2.7522  1.6494  0.6226  -0.1144 -0.2474 471 ILE A CA  
3103 C C   . ILE A 398 ? 1.5234 2.8629  1.7678  0.5714  -0.0967 -0.2012 471 ILE A C   
3104 O O   . ILE A 398 ? 1.7802 3.1227  2.0071  0.5502  -0.0865 -0.1856 471 ILE A O   
3105 C CB  . ILE A 398 ? 1.5477 3.0066  1.8049  0.6465  -0.1012 -0.2689 471 ILE A CB  
3106 C CG1 . ILE A 398 ? 1.7866 3.2486  2.0337  0.7013  -0.1189 -0.3192 471 ILE A CG1 
3107 C CG2 . ILE A 398 ? 1.5212 3.0677  1.7737  0.6220  -0.0747 -0.2520 471 ILE A CG2 
3108 C CD1 . ILE A 398 ? 1.7833 3.3686  2.0449  0.7292  -0.1044 -0.3452 471 ILE A CD1 
3109 N N   . THR A 399 ? 1.3568 2.6879  1.6244  0.5513  -0.0945 -0.1791 472 THR A N   
3110 C CA  . THR A 399 ? 1.5753 2.8931  1.8476  0.5046  -0.0812 -0.1373 472 THR A CA  
3111 C C   . THR A 399 ? 1.6773 2.9015  1.9279  0.4884  -0.0894 -0.1228 472 THR A C   
3112 O O   . THR A 399 ? 1.4941 2.7175  1.7377  0.4580  -0.0777 -0.0962 472 THR A O   
3113 C CB  . THR A 399 ? 1.2283 2.5432  1.5268  0.4901  -0.0817 -0.1215 472 THR A CB  
3114 O OG1 . THR A 399 ? 1.5010 2.9087  1.8221  0.5057  -0.0749 -0.1351 472 THR A OG1 
3115 C CG2 . THR A 399 ? 1.2173 2.5208  1.5207  0.4433  -0.0690 -0.0808 472 THR A CG2 
3116 N N   . CYS A 400 ? 1.5337 2.6799  1.7742  0.5078  -0.1107 -0.1388 473 CYS A N   
3117 C CA  . CYS A 400 ? 1.4550 2.5188  1.6753  0.4941  -0.1194 -0.1269 473 CYS A CA  
3118 C C   . CYS A 400 ? 1.4182 2.4969  1.6153  0.4984  -0.1163 -0.1349 473 CYS A C   
3119 O O   . CYS A 400 ? 1.4412 2.4837  1.6262  0.4750  -0.1136 -0.1137 473 CYS A O   
3120 C CB  . CYS A 400 ? 1.1406 2.1240  1.3542  0.5135  -0.1447 -0.1423 473 CYS A CB  
3121 S SG  . CYS A 400 ? 2.0515 3.0028  2.2869  0.5031  -0.1506 -0.1282 473 CYS A SG  
3122 N N   . PHE A 401 ? 1.6161 2.7496  1.8066  0.5291  -0.1170 -0.1659 474 PHE A N   
3123 C CA  . PHE A 401 ? 1.2241 2.3771  1.3900  0.5337  -0.1141 -0.1756 474 PHE A CA  
3124 C C   . PHE A 401 ? 1.3557 2.5675  1.5234  0.5003  -0.0905 -0.1453 474 PHE A C   
3125 O O   . PHE A 401 ? 1.7970 2.9858  1.9470  0.4823  -0.0889 -0.1301 474 PHE A O   
3126 C CB  . PHE A 401 ? 1.3555 2.5592  1.5135  0.5763  -0.1197 -0.2187 474 PHE A CB  
3127 C CG  . PHE A 401 ? 1.1787 2.4181  1.3105  0.5810  -0.1141 -0.2302 474 PHE A CG  
3128 C CD1 . PHE A 401 ? 1.2328 2.4033  1.3372  0.5826  -0.1302 -0.2363 474 PHE A CD1 
3129 C CD2 . PHE A 401 ? 1.1854 2.5301  1.3192  0.5817  -0.0931 -0.2336 474 PHE A CD2 
3130 C CE1 . PHE A 401 ? 1.2382 2.4413  1.3168  0.5859  -0.1260 -0.2470 474 PHE A CE1 
3131 C CE2 . PHE A 401 ? 1.4025 2.7828  1.5095  0.5849  -0.0879 -0.2438 474 PHE A CE2 
3132 C CZ  . PHE A 401 ? 1.2386 2.5464  1.3174  0.5876  -0.1047 -0.2512 474 PHE A CZ  
3133 N N   . PHE A 402 ? 1.6294 2.9176  1.8185  0.4904  -0.0736 -0.1348 475 PHE A N   
3134 C CA  . PHE A 402 ? 1.6837 3.0234  1.8752  0.4546  -0.0538 -0.1017 475 PHE A CA  
3135 C C   . PHE A 402 ? 1.2940 2.5657  1.4896  0.4183  -0.0539 -0.0641 475 PHE A C   
3136 O O   . PHE A 402 ? 1.1415 2.4235  1.3301  0.3906  -0.0447 -0.0375 475 PHE A O   
3137 C CB  . PHE A 402 ? 1.6846 3.1201  1.8994  0.4492  -0.0379 -0.0968 475 PHE A CB  
3138 C CG  . PHE A 402 ? 1.4739 3.0021  1.6826  0.4776  -0.0306 -0.1270 475 PHE A CG  
3139 C CD1 . PHE A 402 ? 1.3342 2.9142  1.5222  0.4695  -0.0197 -0.1234 475 PHE A CD1 
3140 C CD2 . PHE A 402 ? 1.6098 3.1758  1.8333  0.5132  -0.0351 -0.1595 475 PHE A CD2 
3141 C CE1 . PHE A 402 ? 1.5257 3.1962  1.7063  0.4965  -0.0119 -0.1531 475 PHE A CE1 
3142 C CE2 . PHE A 402 ? 1.7148 3.3708  1.9334  0.5423  -0.0278 -0.1900 475 PHE A CE2 
3143 C CZ  . PHE A 402 ? 1.7158 3.4254  1.9122  0.5340  -0.0155 -0.1875 475 PHE A CZ  
3144 N N   . GLY A 403 ? 1.2751 2.4787  1.4816  0.4187  -0.0650 -0.0619 476 GLY A N   
3145 C CA  . GLY A 403 ? 1.5088 2.6454  1.7176  0.3892  -0.0662 -0.0314 476 GLY A CA  
3146 C C   . GLY A 403 ? 1.4451 2.5175  1.6322  0.3890  -0.0762 -0.0304 476 GLY A C   
3147 O O   . GLY A 403 ? 1.3257 2.3593  1.5132  0.3635  -0.0738 -0.0032 476 GLY A O   
3148 N N   . SER A 404 ? 1.5526 2.6134  1.7216  0.4174  -0.0886 -0.0600 477 SER A N   
3149 C CA  . SER A 404 ? 1.1050 2.1081  1.2528  0.4173  -0.1003 -0.0606 477 SER A CA  
3150 C C   . SER A 404 ? 1.1104 2.1553  1.2399  0.4111  -0.0927 -0.0571 477 SER A C   
3151 O O   . SER A 404 ? 1.3468 2.3501  1.4583  0.4091  -0.1024 -0.0563 477 SER A O   
3152 C CB  . SER A 404 ? 1.4783 2.4354  1.6137  0.4491  -0.1223 -0.0937 477 SER A CB  
3153 O OG  . SER A 404 ? 1.8664 2.7762  2.0159  0.4516  -0.1319 -0.0930 477 SER A OG  
3154 N N   . LEU A 405 ? 1.1349 2.2634  1.2682  0.4064  -0.0764 -0.0538 478 LEU A N   
3155 C CA  . LEU A 405 ? 1.1187 2.2920  1.2328  0.3983  -0.0689 -0.0482 478 LEU A CA  
3156 C C   . LEU A 405 ? 1.5137 2.6567  1.6277  0.3635  -0.0652 -0.0094 478 LEU A C   
3157 O O   . LEU A 405 ? 1.4512 2.5978  1.5454  0.3575  -0.0667 -0.0043 478 LEU A O   
3158 C CB  . LEU A 405 ? 1.1405 2.4169  1.2596  0.3987  -0.0517 -0.0510 478 LEU A CB  
3159 C CG  . LEU A 405 ? 1.5185 2.8420  1.6362  0.4375  -0.0540 -0.0931 478 LEU A CG  
3160 C CD1 . LEU A 405 ? 1.6425 3.0786  1.7663  0.4336  -0.0345 -0.0915 478 LEU A CD1 
3161 C CD2 . LEU A 405 ? 1.5610 2.8564  1.6498  0.4671  -0.0696 -0.1275 478 LEU A CD2 
3162 N N   . VAL A 406 ? 1.6441 2.7575  1.7797  0.3416  -0.0612 0.0172  479 VAL A N   
3163 C CA  . VAL A 406 ? 1.2964 2.3718  1.4341  0.3129  -0.0604 0.0514  479 VAL A CA  
3164 C C   . VAL A 406 ? 1.2597 2.2625  1.3850  0.3200  -0.0755 0.0457  479 VAL A C   
3165 O O   . VAL A 406 ? 1.4768 2.4615  1.5949  0.3044  -0.0772 0.0654  479 VAL A O   
3166 C CB  . VAL A 406 ? 1.2399 2.2960  1.4028  0.2919  -0.0546 0.0759  479 VAL A CB  
3167 C CG1 . VAL A 406 ? 1.2960 2.3201  1.4621  0.2641  -0.0535 0.1105  479 VAL A CG1 
3168 C CG2 . VAL A 406 ? 2.2080 3.3362  2.3841  0.2853  -0.0422 0.0793  479 VAL A CG2 
3169 N N   . THR A 407 ? 1.2196 2.1815  1.3430  0.3426  -0.0881 0.0201  480 THR A N   
3170 C CA  . THR A 407 ? 1.2023 2.0969  1.3142  0.3478  -0.1044 0.0149  480 THR A CA  
3171 C C   . THR A 407 ? 1.3223 2.2266  1.4071  0.3635  -0.1144 -0.0066 480 THR A C   
3172 O O   . THR A 407 ? 1.6150 2.4719  1.6883  0.3609  -0.1273 -0.0046 480 THR A O   
3173 C CB  . THR A 407 ? 1.3217 2.1661  1.4411  0.3624  -0.1162 -0.0008 480 THR A CB  
3174 O OG1 . THR A 407 ? 2.1065 2.9548  2.2489  0.3510  -0.1061 0.0138  480 THR A OG1 
3175 C CG2 . THR A 407 ? 1.5784 2.3520  1.6921  0.3573  -0.1309 0.0054  480 THR A CG2 
3176 N N   . LEU A 408 ? 1.2357 2.2030  1.3101  0.3791  -0.1087 -0.0272 481 LEU A N   
3177 C CA  . LEU A 408 ? 1.1092 2.0896  1.1552  0.3968  -0.1183 -0.0523 481 LEU A CA  
3178 C C   . LEU A 408 ? 1.1141 2.1313  1.1459  0.3774  -0.1103 -0.0326 481 LEU A C   
3179 O O   . LEU A 408 ? 1.7745 2.8096  1.7801  0.3897  -0.1170 -0.0522 481 LEU A O   
3180 C CB  . LEU A 408 ? 1.3725 2.4068  1.4128  0.4273  -0.1165 -0.0884 481 LEU A CB  
3181 C CG  . LEU A 408 ? 1.4775 2.4730  1.5265  0.4534  -0.1302 -0.1148 481 LEU A CG  
3182 C CD1 . LEU A 408 ? 1.4908 2.5533  1.5399  0.4831  -0.1251 -0.1473 481 LEU A CD1 
3183 C CD2 . LEU A 408 ? 1.1655 2.0833  1.1960  0.4662  -0.1561 -0.1321 481 LEU A CD2 
3184 N N   . THR A 409 ? 1.2686 2.2958  1.3159  0.3478  -0.0979 0.0052  482 THR A N   
3185 C CA  . THR A 409 ? 1.4992 2.5573  1.5341  0.3274  -0.0926 0.0281  482 THR A CA  
3186 C C   . THR A 409 ? 1.6831 2.6829  1.7058  0.3222  -0.1082 0.0344  482 THR A C   
3187 O O   . THR A 409 ? 1.2676 2.2055  1.2917  0.3325  -0.1226 0.0222  482 THR A O   
3188 C CB  . THR A 409 ? 1.5469 2.6265  1.6032  0.2978  -0.0780 0.0672  482 THR A CB  
3189 O OG1 . THR A 409 ? 1.2316 2.2452  1.3094  0.2874  -0.0822 0.0849  482 THR A OG1 
3190 C CG2 . THR A 409 ? 1.5164 2.6602  1.5845  0.2999  -0.0635 0.0626  482 THR A CG2 
3191 N N   . PHE A 410 ? 1.6812 2.7036  1.6922  0.3042  -0.1064 0.0557  483 PHE A N   
3192 C CA  . PHE A 410 ? 1.2038 2.1783  1.2049  0.2972  -0.1212 0.0645  483 PHE A CA  
3193 C C   . PHE A 410 ? 1.3895 2.3053  1.4171  0.2822  -0.1236 0.0906  483 PHE A C   
3194 O O   . PHE A 410 ? 1.8178 2.6821  1.8436  0.2829  -0.1379 0.0899  483 PHE A O   
3195 C CB  . PHE A 410 ? 1.3764 2.3931  1.3594  0.2811  -0.1190 0.0829  483 PHE A CB  
3196 C CG  . PHE A 410 ? 1.5551 2.6369  1.5093  0.2949  -0.1154 0.0574  483 PHE A CG  
3197 C CD1 . PHE A 410 ? 1.3441 2.4135  1.2736  0.3206  -0.1290 0.0180  483 PHE A CD1 
3198 C CD2 . PHE A 410 ? 1.5895 2.7460  1.5406  0.2819  -0.0992 0.0727  483 PHE A CD2 
3199 C CE1 . PHE A 410 ? 1.3824 2.5141  1.2844  0.3362  -0.1254 -0.0090 483 PHE A CE1 
3200 C CE2 . PHE A 410 ? 1.5484 2.7727  1.4724  0.2950  -0.0943 0.0484  483 PHE A CE2 
3201 C CZ  . PHE A 410 ? 1.5163 2.7290  1.4157  0.3238  -0.1068 0.0059  483 PHE A CZ  
3202 N N   . GLY A 411 ? 1.5095 2.4337  1.5612  0.2686  -0.1105 0.1130  484 GLY A N   
3203 C CA  . GLY A 411 ? 1.5713 2.4443  1.6478  0.2566  -0.1114 0.1351  484 GLY A CA  
3204 C C   . GLY A 411 ? 1.2422 2.0849  1.3347  0.2675  -0.1102 0.1210  484 GLY A C   
3205 O O   . GLY A 411 ? 1.3786 2.1944  1.4932  0.2571  -0.1056 0.1387  484 GLY A O   
3206 N N   . GLY A 412 ? 1.6631 2.5098  1.7437  0.2895  -0.1153 0.0884  485 GLY A N   
3207 C CA  . GLY A 412 ? 2.0100 2.8349  2.1045  0.3005  -0.1149 0.0748  485 GLY A CA  
3208 C C   . GLY A 412 ? 1.8029 2.5630  1.9101  0.2963  -0.1232 0.0826  485 GLY A C   
3209 O O   . GLY A 412 ? 1.9364 2.6800  2.0609  0.2946  -0.1183 0.0862  485 GLY A O   
3210 N N   . ALA A 413 ? 1.0906 1.8167  1.1889  0.2936  -0.1359 0.0858  486 ALA A N   
3211 C CA  . ALA A 413 ? 1.3204 1.9912  1.4298  0.2890  -0.1440 0.0931  486 ALA A CA  
3212 C C   . ALA A 413 ? 1.7166 2.3804  1.8506  0.2725  -0.1314 0.1201  486 ALA A C   
3213 O O   . ALA A 413 ? 1.8484 2.4809  1.9954  0.2718  -0.1313 0.1215  486 ALA A O   
3214 C CB  . ALA A 413 ? 1.0969 1.7421  1.1938  0.2855  -0.1594 0.0953  486 ALA A CB  
3215 N N   . TYR A 414 ? 1.2602 1.9516  1.3995  0.2591  -0.1222 0.1416  487 TYR A N   
3216 C CA  . TYR A 414 ? 1.1919 1.8752  1.3538  0.2452  -0.1120 0.1654  487 TYR A CA  
3217 C C   . TYR A 414 ? 1.5507 2.2382  1.7235  0.2478  -0.1031 0.1587  487 TYR A C   
3218 O O   . TYR A 414 ? 1.7709 2.4303  1.9597  0.2433  -0.0999 0.1661  487 TYR A O   
3219 C CB  . TYR A 414 ? 1.1728 1.8870  1.3362  0.2310  -0.1064 0.1887  487 TYR A CB  
3220 C CG  . TYR A 414 ? 1.3943 2.1096  1.5463  0.2275  -0.1158 0.1968  487 TYR A CG  
3221 C CD1 . TYR A 414 ? 1.5109 2.1899  1.6657  0.2293  -0.1261 0.1973  487 TYR A CD1 
3222 C CD2 . TYR A 414 ? 1.2303 1.9864  1.3684  0.2210  -0.1148 0.2050  487 TYR A CD2 
3223 C CE1 . TYR A 414 ? 1.2139 1.8956  1.3593  0.2249  -0.1360 0.2054  487 TYR A CE1 
3224 C CE2 . TYR A 414 ? 1.2326 1.9905  1.3591  0.2171  -0.1245 0.2127  487 TYR A CE2 
3225 C CZ  . TYR A 414 ? 1.2881 2.0079  1.4190  0.2193  -0.1355 0.2126  487 TYR A CZ  
3226 O OH  . TYR A 414 ? 1.8708 2.5938  1.9910  0.2144  -0.1464 0.2208  487 TYR A OH  
3227 N N   . VAL A 415 ? 1.2281 1.9536  1.3924  0.2555  -0.0993 0.1437  488 VAL A N   
3228 C CA  . VAL A 415 ? 0.9455 1.6800  1.1205  0.2582  -0.0922 0.1365  488 VAL A CA  
3229 C C   . VAL A 415 ? 1.2294 1.9247  1.4050  0.2714  -0.1004 0.1182  488 VAL A C   
3230 O O   . VAL A 415 ? 1.7355 2.4190  1.9238  0.2697  -0.0963 0.1185  488 VAL A O   
3231 C CB  . VAL A 415 ? 1.0825 1.8760  1.2496  0.2642  -0.0862 0.1248  488 VAL A CB  
3232 C CG1 . VAL A 415 ? 1.7641 2.5743  1.9461  0.2628  -0.0782 0.1227  488 VAL A CG1 
3233 C CG2 . VAL A 415 ? 1.0028 1.8363  1.1645  0.2494  -0.0803 0.1444  488 VAL A CG2 
3234 N N   . VAL A 416 ? 1.0755 1.7489  1.2365  0.2832  -0.1137 0.1030  489 VAL A N   
3235 C CA  . VAL A 416 ? 1.2689 1.9005  1.4293  0.2926  -0.1245 0.0897  489 VAL A CA  
3236 C C   . VAL A 416 ? 1.2215 1.8171  1.3963  0.2792  -0.1219 0.1081  489 VAL A C   
3237 O O   . VAL A 416 ? 1.2053 1.7836  1.3886  0.2794  -0.1203 0.1060  489 VAL A O   
3238 C CB  . VAL A 416 ? 1.1527 1.7634  1.2934  0.3045  -0.1424 0.0728  489 VAL A CB  
3239 C CG1 . VAL A 416 ? 1.1749 1.7410  1.3142  0.3119  -0.1561 0.0616  489 VAL A CG1 
3240 C CG2 . VAL A 416 ? 1.0446 1.6932  1.1695  0.3204  -0.1446 0.0514  489 VAL A CG2 
3241 N N   . LYS A 417 ? 1.4642 2.0505  1.6417  0.2684  -0.1218 0.1255  490 LYS A N   
3242 C CA  . LYS A 417 ? 1.4317 1.9901  1.6242  0.2580  -0.1184 0.1416  490 LYS A CA  
3243 C C   . LYS A 417 ? 1.4037 1.9693  1.6120  0.2511  -0.1049 0.1510  490 LYS A C   
3244 O O   . LYS A 417 ? 1.8766 2.4199  2.0932  0.2495  -0.1027 0.1512  490 LYS A O   
3245 C CB  . LYS A 417 ? 1.4673 2.0233  1.6627  0.2495  -0.1204 0.1588  490 LYS A CB  
3246 C CG  . LYS A 417 ? 1.6807 2.2102  1.8695  0.2498  -0.1340 0.1567  490 LYS A CG  
3247 C CD  . LYS A 417 ? 2.1211 2.6253  2.3239  0.2441  -0.1317 0.1651  490 LYS A CD  
3248 C CE  . LYS A 417 ? 2.3222 2.8080  2.5218  0.2394  -0.1444 0.1695  490 LYS A CE  
3249 N NZ  . LYS A 417 ? 2.8188 3.2903  3.0332  0.2328  -0.1399 0.1798  490 LYS A NZ  
3250 N N   . LEU A 418 ? 1.0078 1.6052  1.2192  0.2457  -0.0969 0.1591  491 LEU A N   
3251 C CA  . LEU A 418 ? 0.9119 1.5133  1.1378  0.2362  -0.0867 0.1702  491 LEU A CA  
3252 C C   . LEU A 418 ? 0.9229 1.5237  1.1505  0.2414  -0.0850 0.1557  491 LEU A C   
3253 O O   . LEU A 418 ? 1.6515 2.2325  1.8893  0.2363  -0.0811 0.1595  491 LEU A O   
3254 C CB  . LEU A 418 ? 0.9092 1.5473  1.1358  0.2267  -0.0812 0.1834  491 LEU A CB  
3255 C CG  . LEU A 418 ? 1.2548 1.8953  1.4957  0.2134  -0.0738 0.1978  491 LEU A CG  
3256 C CD1 . LEU A 418 ? 1.3678 1.9725  1.6217  0.2070  -0.0739 0.2135  491 LEU A CD1 
3257 C CD2 . LEU A 418 ? 1.4447 2.1287  1.6832  0.2024  -0.0701 0.2102  491 LEU A CD2 
3258 N N   . LEU A 419 ? 0.9977 1.6207  1.2151  0.2526  -0.0887 0.1380  492 LEU A N   
3259 C CA  . LEU A 419 ? 1.4990 2.1253  1.7193  0.2589  -0.0886 0.1244  492 LEU A CA  
3260 C C   . LEU A 419 ? 1.4421 2.0263  1.6608  0.2642  -0.0963 0.1166  492 LEU A C   
3261 O O   . LEU A 419 ? 2.0182 2.5917  2.2438  0.2617  -0.0941 0.1152  492 LEU A O   
3262 C CB  . LEU A 419 ? 1.2218 1.8855  1.4332  0.2731  -0.0917 0.1058  492 LEU A CB  
3263 C CG  . LEU A 419 ? 1.1126 1.8294  1.3308  0.2676  -0.0816 0.1093  492 LEU A CG  
3264 C CD1 . LEU A 419 ? 1.5224 2.2558  1.7438  0.2495  -0.0740 0.1328  492 LEU A CD1 
3265 C CD2 . LEU A 419 ? 1.1412 1.8989  1.3496  0.2858  -0.0847 0.0876  492 LEU A CD2 
3266 N N   . GLU A 420 ? 1.4285 1.9893  1.6371  0.2697  -0.1064 0.1128  493 GLU A N   
3267 C CA  . GLU A 420 ? 1.4922 2.0160  1.6973  0.2724  -0.1155 0.1075  493 GLU A CA  
3268 C C   . GLU A 420 ? 1.4857 1.9883  1.7015  0.2600  -0.1081 0.1223  493 GLU A C   
3269 O O   . GLU A 420 ? 1.6162 2.1037  1.8342  0.2586  -0.1078 0.1195  493 GLU A O   
3270 C CB  . GLU A 420 ? 1.7033 2.2081  1.8945  0.2784  -0.1303 0.1015  493 GLU A CB  
3271 C CG  . GLU A 420 ? 1.5946 2.0622  1.7799  0.2791  -0.1430 0.0976  493 GLU A CG  
3272 C CD  . GLU A 420 ? 2.2371 2.6844  2.4071  0.2847  -0.1617 0.0900  493 GLU A CD  
3273 O OE1 . GLU A 420 ? 2.4051 2.8249  2.5662  0.2896  -0.1773 0.0813  493 GLU A OE1 
3274 O OE2 . GLU A 420 ? 2.4998 2.9569  2.6656  0.2835  -0.1626 0.0933  493 GLU A OE2 
3275 N N   . GLU A 421 ? 1.3919 1.8944  1.6139  0.2521  -0.1027 0.1373  494 GLU A N   
3276 C CA  . GLU A 421 ? 1.3428 1.8266  1.5753  0.2442  -0.0966 0.1486  494 GLU A CA  
3277 C C   . GLU A 421 ? 1.2708 1.7594  1.5147  0.2384  -0.0855 0.1535  494 GLU A C   
3278 O O   . GLU A 421 ? 1.4803 1.9528  1.7275  0.2362  -0.0823 0.1517  494 GLU A O   
3279 C CB  . GLU A 421 ? 1.3804 1.8630  1.6177  0.2402  -0.0966 0.1621  494 GLU A CB  
3280 C CG  . GLU A 421 ? 1.9181 2.3841  2.1655  0.2358  -0.0924 0.1705  494 GLU A CG  
3281 C CD  . GLU A 421 ? 2.1642 2.6208  2.4067  0.2346  -0.1016 0.1729  494 GLU A CD  
3282 O OE1 . GLU A 421 ? 1.6747 2.1343  1.9067  0.2365  -0.1121 0.1700  494 GLU A OE1 
3283 O OE2 . GLU A 421 ? 2.4303 2.8782  2.6788  0.2311  -0.0989 0.1775  494 GLU A OE2 
3284 N N   . TYR A 422 ? 1.1556 1.6661  1.4042  0.2346  -0.0808 0.1601  495 TYR A N   
3285 C CA  . TYR A 422 ? 1.0889 1.5994  1.3487  0.2260  -0.0731 0.1683  495 TYR A CA  
3286 C C   . TYR A 422 ? 1.4199 1.9444  1.6793  0.2243  -0.0717 0.1599  495 TYR A C   
3287 O O   . TYR A 422 ? 1.5284 2.0483  1.7960  0.2155  -0.0674 0.1656  495 TYR A O   
3288 C CB  . TYR A 422 ? 1.0802 1.6053  1.3462  0.2187  -0.0707 0.1848  495 TYR A CB  
3289 C CG  . TYR A 422 ? 1.2162 1.7233  1.4903  0.2180  -0.0708 0.1972  495 TYR A CG  
3290 C CD1 . TYR A 422 ? 1.3869 1.8716  1.6635  0.2232  -0.0708 0.1930  495 TYR A CD1 
3291 C CD2 . TYR A 422 ? 1.6535 2.1695  1.9334  0.2119  -0.0712 0.2140  495 TYR A CD2 
3292 C CE1 . TYR A 422 ? 1.2508 1.7256  1.5376  0.2242  -0.0704 0.2036  495 TYR A CE1 
3293 C CE2 . TYR A 422 ? 1.7247 2.2260  2.0145  0.2132  -0.0725 0.2252  495 TYR A CE2 
3294 C CZ  . TYR A 422 ? 1.3744 1.8568  1.6686  0.2203  -0.0716 0.2191  495 TYR A CZ  
3295 O OH  . TYR A 422 ? 1.3524 1.8266  1.6591  0.2233  -0.0724 0.2296  495 TYR A OH  
3296 N N   . ALA A 423 ? 1.0858 1.6269  1.3367  0.2327  -0.0764 0.1463  496 ALA A N   
3297 C CA  . ALA A 423 ? 1.1750 1.7386  1.4287  0.2315  -0.0750 0.1396  496 ALA A CA  
3298 C C   . ALA A 423 ? 1.4194 1.9732  1.6675  0.2412  -0.0816 0.1233  496 ALA A C   
3299 O O   . ALA A 423 ? 1.5838 2.1259  1.8354  0.2365  -0.0806 0.1216  496 ALA A O   
3300 C CB  . ALA A 423 ? 1.0125 1.6203  1.2647  0.2332  -0.0738 0.1391  496 ALA A CB  
3301 N N   . THR A 424 ? 1.0393 1.5958  1.2775  0.2547  -0.0901 0.1113  497 THR A N   
3302 C CA  . THR A 424 ? 1.1902 1.7385  1.4231  0.2652  -0.0995 0.0963  497 THR A CA  
3303 C C   . THR A 424 ? 1.4661 1.9747  1.6949  0.2612  -0.1034 0.0984  497 THR A C   
3304 O O   . THR A 424 ? 1.4120 1.9134  1.6409  0.2608  -0.1063 0.0933  497 THR A O   
3305 C CB  . THR A 424 ? 1.0589 1.6139  1.2811  0.2818  -0.1106 0.0822  497 THR A CB  
3306 O OG1 . THR A 424 ? 1.7070 2.2359  1.9205  0.2812  -0.1160 0.0868  497 THR A OG1 
3307 C CG2 . THR A 424 ? 1.0604 1.6624  1.2851  0.2866  -0.1053 0.0784  497 THR A CG2 
3308 N N   . GLY A 425 ? 1.2476 1.7343  1.4728  0.2574  -0.1036 0.1066  498 GLY A N   
3309 C CA  . GLY A 425 ? 1.0620 1.5184  1.2824  0.2529  -0.1067 0.1094  498 GLY A CA  
3310 C C   . GLY A 425 ? 1.3100 1.7596  1.5359  0.2442  -0.0983 0.1124  498 GLY A C   
3311 O O   . GLY A 425 ? 1.2667 1.7043  1.4866  0.2439  -0.1034 0.1070  498 GLY A O   
3312 N N   . PRO A 426 ? 1.2065 1.6615  1.4426  0.2370  -0.0871 0.1209  499 PRO A N   
3313 C CA  . PRO A 426 ? 1.4107 1.8547  1.6503  0.2295  -0.0807 0.1215  499 PRO A CA  
3314 C C   . PRO A 426 ? 1.4979 1.9520  1.7377  0.2279  -0.0832 0.1138  499 PRO A C   
3315 O O   . PRO A 426 ? 1.9263 2.3675  2.1631  0.2231  -0.0824 0.1103  499 PRO A O   
3316 C CB  . PRO A 426 ? 1.3250 1.7707  1.5759  0.2238  -0.0719 0.1320  499 PRO A CB  
3317 C CG  . PRO A 426 ? 1.3210 1.7889  1.5747  0.2262  -0.0733 0.1369  499 PRO A CG  
3318 C CD  . PRO A 426 ? 1.2077 1.6748  1.4513  0.2350  -0.0816 0.1307  499 PRO A CD  
3319 N N   . ALA A 427 ? 1.1918 1.6723  1.4351  0.2320  -0.0861 0.1104  500 ALA A N   
3320 C CA  . ALA A 427 ? 1.4073 1.9041  1.6535  0.2310  -0.0890 0.1035  500 ALA A CA  
3321 C C   . ALA A 427 ? 1.4473 1.9363  1.6844  0.2404  -0.1004 0.0925  500 ALA A C   
3322 O O   . ALA A 427 ? 2.0084 2.4987  2.2456  0.2377  -0.1039 0.0877  500 ALA A O   
3323 C CB  . ALA A 427 ? 1.4479 1.9841  1.7031  0.2318  -0.0869 0.1044  500 ALA A CB  
3324 N N   . VAL A 428 ? 1.1433 1.6223  1.3719  0.2505  -0.1085 0.0891  501 VAL A N   
3325 C CA  . VAL A 428 ? 1.4666 1.9295  1.6851  0.2580  -0.1226 0.0812  501 VAL A CA  
3326 C C   . VAL A 428 ? 1.3756 1.8107  1.5855  0.2479  -0.1223 0.0863  501 VAL A C   
3327 O O   . VAL A 428 ? 1.6074 2.0350  1.8115  0.2471  -0.1301 0.0823  501 VAL A O   
3328 C CB  . VAL A 428 ? 1.0504 1.5046  1.2608  0.2699  -0.1342 0.0768  501 VAL A CB  
3329 C CG1 . VAL A 428 ? 0.9378 1.3658  1.1362  0.2748  -0.1518 0.0722  501 VAL A CG1 
3330 C CG2 . VAL A 428 ? 1.0817 1.5679  1.2980  0.2830  -0.1355 0.0672  501 VAL A CG2 
3331 N N   . LEU A 429 ? 1.5728 1.9955  1.7819  0.2405  -0.1135 0.0952  502 LEU A N   
3332 C CA  . LEU A 429 ? 1.5651 1.9697  1.7669  0.2313  -0.1100 0.0988  502 LEU A CA  
3333 C C   . LEU A 429 ? 1.5313 1.9398  1.7360  0.2247  -0.1039 0.0952  502 LEU A C   
3334 O O   . LEU A 429 ? 1.4401 1.8379  1.6348  0.2196  -0.1066 0.0929  502 LEU A O   
3335 C CB  . LEU A 429 ? 1.3948 1.7935  1.5993  0.2272  -0.1002 0.1075  502 LEU A CB  
3336 C CG  . LEU A 429 ? 1.2075 1.5963  1.4050  0.2275  -0.1070 0.1136  502 LEU A CG  
3337 C CD1 . LEU A 429 ? 1.2366 1.6309  1.4439  0.2268  -0.0975 0.1217  502 LEU A CD1 
3338 C CD2 . LEU A 429 ? 1.2615 1.6380  1.4468  0.2197  -0.1099 0.1166  502 LEU A CD2 
3339 N N   . THR A 430 ? 1.2684 1.6924  1.4855  0.2230  -0.0968 0.0955  503 THR A N   
3340 C CA  . THR A 430 ? 1.1086 1.5340  1.3288  0.2144  -0.0932 0.0928  503 THR A CA  
3341 C C   . THR A 430 ? 1.4494 1.8842  1.6664  0.2156  -0.1035 0.0856  503 THR A C   
3342 O O   . THR A 430 ? 1.3872 1.8113  1.5960  0.2093  -0.1057 0.0820  503 THR A O   
3343 C CB  . THR A 430 ? 1.2939 1.7340  1.5284  0.2096  -0.0862 0.0980  503 THR A CB  
3344 O OG1 . THR A 430 ? 1.3891 1.8179  1.6270  0.2092  -0.0784 0.1055  503 THR A OG1 
3345 C CG2 . THR A 430 ? 1.3796 1.8176  1.6169  0.1983  -0.0853 0.0960  503 THR A CG2 
3346 N N   . VAL A 431 ? 1.5676 2.0243  1.7909  0.2246  -0.1103 0.0824  504 VAL A N   
3347 C CA  . VAL A 431 ? 1.3194 1.7890  1.5432  0.2285  -0.1213 0.0751  504 VAL A CA  
3348 C C   . VAL A 431 ? 1.3156 1.7612  1.5236  0.2314  -0.1329 0.0728  504 VAL A C   
3349 O O   . VAL A 431 ? 1.5644 2.0098  1.7683  0.2288  -0.1410 0.0693  504 VAL A O   
3350 C CB  . VAL A 431 ? 1.4850 1.9874  1.7201  0.2414  -0.1257 0.0701  504 VAL A CB  
3351 C CG1 . VAL A 431 ? 1.7342 2.2260  1.9621  0.2556  -0.1330 0.0671  504 VAL A CG1 
3352 C CG2 . VAL A 431 ? 1.7165 2.2401  1.9574  0.2458  -0.1358 0.0625  504 VAL A CG2 
3353 N N   . ALA A 432 ? 1.3061 1.7319  1.5046  0.2347  -0.1352 0.0766  505 ALA A N   
3354 C CA  . ALA A 432 ? 1.3598 1.7622  1.5418  0.2328  -0.1466 0.0784  505 ALA A CA  
3355 C C   . ALA A 432 ? 1.5259 1.9174  1.6979  0.2190  -0.1392 0.0811  505 ALA A C   
3356 O O   . ALA A 432 ? 1.5865 1.9682  1.7453  0.2146  -0.1488 0.0812  505 ALA A O   
3357 C CB  . ALA A 432 ? 1.9057 2.2914  2.0806  0.2360  -0.1510 0.0840  505 ALA A CB  
3358 N N   . LEU A 433 ? 1.5693 1.9620  1.7465  0.2127  -0.1232 0.0827  506 LEU A N   
3359 C CA  . LEU A 433 ? 1.4933 1.8770  1.6611  0.2023  -0.1160 0.0810  506 LEU A CA  
3360 C C   . LEU A 433 ? 1.4413 1.8318  1.6094  0.1974  -0.1206 0.0745  506 LEU A C   
3361 O O   . LEU A 433 ? 1.8379 2.2202  1.9913  0.1902  -0.1238 0.0717  506 LEU A O   
3362 C CB  . LEU A 433 ? 1.6268 2.0077  1.8022  0.2002  -0.1003 0.0824  506 LEU A CB  
3363 C CG  . LEU A 433 ? 1.4689 1.8386  1.6342  0.1939  -0.0910 0.0786  506 LEU A CG  
3364 C CD1 . LEU A 433 ? 1.4971 1.8637  1.6629  0.1876  -0.0900 0.0704  506 LEU A CD1 
3365 C CD2 . LEU A 433 ? 1.3814 1.7468  1.5272  0.1901  -0.0957 0.0799  506 LEU A CD2 
3366 N N   . ILE A 434 ? 1.4125 1.8212  1.5967  0.1998  -0.1214 0.0726  507 ILE A N   
3367 C CA  . ILE A 434 ? 1.5079 1.9280  1.6952  0.1937  -0.1271 0.0678  507 ILE A CA  
3368 C C   . ILE A 434 ? 1.4563 1.8783  1.6351  0.1978  -0.1430 0.0655  507 ILE A C   
3369 O O   . ILE A 434 ? 1.2954 1.7163  1.4665  0.1900  -0.1491 0.0623  507 ILE A O   
3370 C CB  . ILE A 434 ? 1.4098 1.8569  1.6180  0.1941  -0.1246 0.0687  507 ILE A CB  
3371 C CG1 . ILE A 434 ? 1.3550 1.7973  1.5709  0.1900  -0.1115 0.0740  507 ILE A CG1 
3372 C CG2 . ILE A 434 ? 1.2288 1.6892  1.4416  0.1837  -0.1298 0.0655  507 ILE A CG2 
3373 C CD1 . ILE A 434 ? 1.4091 1.8333  1.6214  0.1770  -0.1061 0.0727  507 ILE A CD1 
3374 N N   . GLU A 435 ? 1.5411 1.9638  1.7206  0.2102  -0.1520 0.0671  508 GLU A N   
3375 C CA  . GLU A 435 ? 1.5976 2.0166  1.7690  0.2155  -0.1705 0.0659  508 GLU A CA  
3376 C C   . GLU A 435 ? 1.6555 2.0498  1.8033  0.2055  -0.1745 0.0707  508 GLU A C   
3377 O O   . GLU A 435 ? 1.6736 2.0660  1.8116  0.2006  -0.1858 0.0702  508 GLU A O   
3378 C CB  . GLU A 435 ? 1.6035 2.0236  1.7804  0.2324  -0.1815 0.0649  508 GLU A CB  
3379 C CG  . GLU A 435 ? 1.8563 2.3088  2.0548  0.2444  -0.1790 0.0583  508 GLU A CG  
3380 C CD  . GLU A 435 ? 2.1459 2.5989  2.3473  0.2642  -0.1925 0.0531  508 GLU A CD  
3381 O OE1 . GLU A 435 ? 2.4153 2.8397  2.6026  0.2679  -0.2078 0.0553  508 GLU A OE1 
3382 O OE2 . GLU A 435 ? 2.1487 2.6305  2.3655  0.2758  -0.1887 0.0466  508 GLU A OE2 
3383 N N   . ALA A 436 ? 2.1146 2.4939  2.2533  0.2016  -0.1655 0.0762  509 ALA A N   
3384 C CA  . ALA A 436 ? 2.3918 2.7554  2.5081  0.1908  -0.1674 0.0819  509 ALA A CA  
3385 C C   . ALA A 436 ? 2.0175 2.3835  2.1238  0.1793  -0.1599 0.0764  509 ALA A C   
3386 O O   . ALA A 436 ? 1.9573 2.3176  2.0440  0.1706  -0.1674 0.0786  509 ALA A O   
3387 C CB  . ALA A 436 ? 2.5670 2.9227  2.6795  0.1888  -0.1571 0.0887  509 ALA A CB  
3388 N N   . VAL A 437 ? 1.9476 2.3207  2.0659  0.1782  -0.1466 0.0694  510 VAL A N   
3389 C CA  . VAL A 437 ? 1.8033 2.1746  1.9120  0.1678  -0.1420 0.0618  510 VAL A CA  
3390 C C   . VAL A 437 ? 1.4569 1.8374  1.5663  0.1646  -0.1565 0.0587  510 VAL A C   
3391 O O   . VAL A 437 ? 1.9131 2.2897  2.0050  0.1551  -0.1614 0.0552  510 VAL A O   
3392 C CB  . VAL A 437 ? 1.6403 2.0103  1.7615  0.1670  -0.1269 0.0562  510 VAL A CB  
3393 C CG1 . VAL A 437 ? 1.4269 1.7919  1.5403  0.1567  -0.1265 0.0465  510 VAL A CG1 
3394 C CG2 . VAL A 437 ? 1.5671 1.9285  1.6851  0.1700  -0.1131 0.0581  510 VAL A CG2 
3395 N N   . ALA A 438 ? 1.5109 1.9072  1.6405  0.1730  -0.1639 0.0595  511 ALA A N   
3396 C CA  . ALA A 438 ? 1.7446 2.1570  1.8805  0.1712  -0.1769 0.0565  511 ALA A CA  
3397 C C   . ALA A 438 ? 1.4820 1.8887  1.6025  0.1721  -0.1952 0.0600  511 ALA A C   
3398 O O   . ALA A 438 ? 1.5270 1.9371  1.6388  0.1635  -0.2043 0.0577  511 ALA A O   
3399 C CB  . ALA A 438 ? 1.7450 2.1836  1.9080  0.1818  -0.1788 0.0560  511 ALA A CB  
3400 N N   . VAL A 439 ? 1.7164 2.1125  1.8325  0.1813  -0.2029 0.0665  512 VAL A N   
3401 C CA  . VAL A 439 ? 1.3319 1.7186  1.4336  0.1817  -0.2239 0.0723  512 VAL A CA  
3402 C C   . VAL A 439 ? 1.7834 2.1566  1.8560  0.1649  -0.2227 0.0763  512 VAL A C   
3403 O O   . VAL A 439 ? 2.1818 2.5546  2.2411  0.1583  -0.2375 0.0786  512 VAL A O   
3404 C CB  . VAL A 439 ? 1.6751 2.0485  1.7786  0.1945  -0.2351 0.0786  512 VAL A CB  
3405 C CG1 . VAL A 439 ? 1.3917 1.7496  1.4794  0.1938  -0.2603 0.0868  512 VAL A CG1 
3406 C CG2 . VAL A 439 ? 1.5644 1.9555  1.6947  0.2130  -0.2361 0.0715  512 VAL A CG2 
3407 N N   . SER A 440 ? 1.9747 2.3399  2.0369  0.1582  -0.2051 0.0768  513 SER A N   
3408 C CA  . SER A 440 ? 2.1095 2.4679  2.1429  0.1437  -0.2022 0.0798  513 SER A CA  
3409 C C   . SER A 440 ? 2.2011 2.5656  2.2256  0.1339  -0.1956 0.0683  513 SER A C   
3410 O O   . SER A 440 ? 2.4848 2.8492  2.4871  0.1234  -0.2050 0.0693  513 SER A O   
3411 C CB  . SER A 440 ? 2.2134 2.5672  2.2410  0.1419  -0.1857 0.0836  513 SER A CB  
3412 O OG  . SER A 440 ? 2.5165 2.8714  2.5164  0.1285  -0.1817 0.0863  513 SER A OG  
3413 N N   . TRP A 441 ? 2.2681 2.6360  2.3081  0.1363  -0.1812 0.0578  514 TRP A N   
3414 C CA  . TRP A 441 ? 2.3601 2.7265  2.3894  0.1266  -0.1742 0.0454  514 TRP A CA  
3415 C C   . TRP A 441 ? 2.3458 2.7211  2.3872  0.1228  -0.1850 0.0402  514 TRP A C   
3416 O O   . TRP A 441 ? 2.4538 2.8250  2.4853  0.1130  -0.1830 0.0298  514 TRP A O   
3417 C CB  . TRP A 441 ? 2.5451 2.9044  2.5815  0.1297  -0.1539 0.0374  514 TRP A CB  
3418 C CG  . TRP A 441 ? 2.5725 2.9287  2.5961  0.1318  -0.1419 0.0406  514 TRP A CG  
3419 C CD1 . TRP A 441 ? 2.4618 2.8214  2.4657  0.1273  -0.1470 0.0502  514 TRP A CD1 
3420 C CD2 . TRP A 441 ? 2.5626 2.9146  2.5935  0.1379  -0.1238 0.0357  514 TRP A CD2 
3421 N NE1 . TRP A 441 ? 2.4234 2.7855  2.4226  0.1293  -0.1320 0.0517  514 TRP A NE1 
3422 C CE2 . TRP A 441 ? 2.5628 2.9206  2.5791  0.1373  -0.1175 0.0419  514 TRP A CE2 
3423 C CE3 . TRP A 441 ? 2.3661 2.7106  2.4149  0.1431  -0.1137 0.0279  514 TRP A CE3 
3424 C CZ2 . TRP A 441 ? 2.5878 2.9477  2.6089  0.1437  -0.1005 0.0392  514 TRP A CZ2 
3425 C CZ3 . TRP A 441 ? 2.5325 2.8740  2.5850  0.1502  -0.0983 0.0253  514 TRP A CZ3 
3426 C CH2 . TRP A 441 ? 2.6264 2.9773  2.6661  0.1514  -0.0913 0.0302  514 TRP A CH2 
3427 N N   . PHE A 442 ? 2.4385 2.8275  2.5010  0.1307  -0.1971 0.0463  515 PHE A N   
3428 C CA  . PHE A 442 ? 2.1084 2.5144  2.1855  0.1269  -0.2079 0.0429  515 PHE A CA  
3429 C C   . PHE A 442 ? 2.0857 2.5011  2.1587  0.1290  -0.2298 0.0490  515 PHE A C   
3430 O O   . PHE A 442 ? 2.6075 3.0233  2.6642  0.1175  -0.2399 0.0468  515 PHE A O   
3431 C CB  . PHE A 442 ? 2.0873 2.5106  2.1969  0.1349  -0.2022 0.0433  515 PHE A CB  
3432 C CG  . PHE A 442 ? 2.0751 2.4940  2.1913  0.1253  -0.1894 0.0370  515 PHE A CG  
3433 C CD1 . PHE A 442 ? 2.0281 2.4285  2.1408  0.1273  -0.1729 0.0352  515 PHE A CD1 
3434 C CD2 . PHE A 442 ? 2.2209 2.6537  2.3476  0.1139  -0.1959 0.0340  515 PHE A CD2 
3435 C CE1 . PHE A 442 ? 2.1424 2.5336  2.2611  0.1194  -0.1642 0.0300  515 PHE A CE1 
3436 C CE2 . PHE A 442 ? 2.2606 2.6840  2.3925  0.1032  -0.1875 0.0298  515 PHE A CE2 
3437 C CZ  . PHE A 442 ? 2.0846 2.4849  2.2121  0.1067  -0.1722 0.0277  515 PHE A CZ  
3438 N N   . TYR A 443 ? 2.0602 2.4816  2.1472  0.1440  -0.2392 0.0560  516 TYR A N   
3439 C CA  . TYR A 443 ? 2.0285 2.4525  2.1106  0.1485  -0.2626 0.0625  516 TYR A CA  
3440 C C   . TYR A 443 ? 2.0970 2.4999  2.1442  0.1369  -0.2691 0.0694  516 TYR A C   
3441 O O   . TYR A 443 ? 2.7389 3.1428  2.7753  0.1334  -0.2894 0.0748  516 TYR A O   
3442 C CB  . TYR A 443 ? 1.9878 2.4147  2.0890  0.1691  -0.2714 0.0666  516 TYR A CB  
3443 C CG  . TYR A 443 ? 2.1074 2.5293  2.2040  0.1772  -0.2984 0.0736  516 TYR A CG  
3444 C CD1 . TYR A 443 ? 2.1095 2.5554  2.2227  0.1836  -0.3152 0.0709  516 TYR A CD1 
3445 C CD2 . TYR A 443 ? 2.2234 2.6171  2.3003  0.1781  -0.3088 0.0841  516 TYR A CD2 
3446 C CE1 . TYR A 443 ? 2.4214 2.8606  2.5317  0.1932  -0.3422 0.0774  516 TYR A CE1 
3447 C CE2 . TYR A 443 ? 2.3974 2.7810  2.4696  0.1850  -0.3367 0.0921  516 TYR A CE2 
3448 C CZ  . TYR A 443 ? 2.4797 2.8848  2.5687  0.1939  -0.3536 0.0881  516 TYR A CZ  
3449 O OH  . TYR A 443 ? 2.4907 2.8838  2.5763  0.2028  -0.3837 0.0961  516 TYR A OH  
3450 N N   . GLY A 444 ? 1.3101 1.6977  1.3397  0.1306  -0.2527 0.0699  517 GLY A N   
3451 C CA  . GLY A 444 ? 1.7288 2.1041  1.7243  0.1177  -0.2553 0.0765  517 GLY A CA  
3452 C C   . GLY A 444 ? 1.8817 2.2433  1.8700  0.1218  -0.2650 0.0916  517 GLY A C   
3453 O O   . GLY A 444 ? 1.9550 2.3133  1.9599  0.1349  -0.2812 0.0971  517 GLY A O   
3454 N N   . ILE A 445 ? 1.9377 2.2923  1.9012  0.1106  -0.2561 0.0978  518 ILE A N   
3455 C CA  . ILE A 445 ? 1.8268 2.1679  1.7809  0.1094  -0.2673 0.1150  518 ILE A CA  
3456 C C   . ILE A 445 ? 2.1970 2.5312  2.1289  0.0992  -0.2937 0.1292  518 ILE A C   
3457 O O   . ILE A 445 ? 2.1532 2.4706  2.0844  0.1020  -0.3142 0.1441  518 ILE A O   
3458 C CB  . ILE A 445 ? 2.0934 2.4365  2.0333  0.1006  -0.2466 0.1181  518 ILE A CB  
3459 C CG1 . ILE A 445 ? 1.7417 2.0709  1.6791  0.0996  -0.2579 0.1365  518 ILE A CG1 
3460 C CG2 . ILE A 445 ? 2.6091 2.9637  2.5165  0.0828  -0.2397 0.1170  518 ILE A CG2 
3461 C CD1 . ILE A 445 ? 1.7161 2.0319  1.6814  0.1184  -0.2689 0.1359  518 ILE A CD1 
3462 N N   . THR A 446 ? 2.3089 2.6534  2.2215  0.0869  -0.2956 0.1252  519 THR A N   
3463 C CA  . THR A 446 ? 2.2141 2.5537  2.1030  0.0752  -0.3212 0.1402  519 THR A CA  
3464 C C   . THR A 446 ? 2.0940 2.4252  2.0040  0.0897  -0.3490 0.1441  519 THR A C   
3465 O O   . THR A 446 ? 1.9766 2.2907  1.8778  0.0885  -0.3748 0.1615  519 THR A O   
3466 C CB  . THR A 446 ? 2.2845 2.6392  2.1475  0.0593  -0.3163 0.1324  519 THR A CB  
3467 O OG1 . THR A 446 ? 2.3724 2.7367  2.2559  0.0674  -0.3125 0.1143  519 THR A OG1 
3468 C CG2 . THR A 446 ? 2.0972 2.4622  1.9381  0.0480  -0.2894 0.1261  519 THR A CG2 
3469 N N   . GLN A 447 ? 1.8694 2.2138  1.8080  0.1038  -0.3452 0.1284  520 GLN A N   
3470 C CA  . GLN A 447 ? 1.7874 2.1317  1.7505  0.1214  -0.3693 0.1294  520 GLN A CA  
3471 C C   . GLN A 447 ? 1.7265 2.0527  1.7065  0.1391  -0.3771 0.1344  520 GLN A C   
3472 O O   . GLN A 447 ? 1.8057 2.1201  1.7941  0.1519  -0.4046 0.1410  520 GLN A O   
3473 C CB  . GLN A 447 ? 1.6474 2.0180  1.6387  0.1304  -0.3606 0.1121  520 GLN A CB  
3474 C CG  . GLN A 447 ? 2.0328 2.4148  2.0502  0.1484  -0.3850 0.1114  520 GLN A CG  
3475 C CD  . GLN A 447 ? 2.3835 2.7608  2.3827  0.1405  -0.4138 0.1232  520 GLN A CD  
3476 O OE1 . GLN A 447 ? 2.3307 2.7086  2.3011  0.1191  -0.4122 0.1268  520 GLN A OE1 
3477 N NE2 . GLN A 447 ? 2.4150 2.7876  2.4303  0.1588  -0.4413 0.1286  520 GLN A NE2 
3478 N N   . PHE A 448 ? 2.2463 2.5686  2.2309  0.1408  -0.3549 0.1308  521 PHE A N   
3479 C CA  . PHE A 448 ? 2.3143 2.6168  2.3102  0.1548  -0.3627 0.1358  521 PHE A CA  
3480 C C   . PHE A 448 ? 2.2858 2.5591  2.2563  0.1439  -0.3865 0.1572  521 PHE A C   
3481 O O   . PHE A 448 ? 2.0864 2.3371  2.0642  0.1571  -0.4126 0.1633  521 PHE A O   
3482 C CB  . PHE A 448 ? 2.0313 2.3377  2.0349  0.1555  -0.3338 0.1292  521 PHE A CB  
3483 C CG  . PHE A 448 ? 2.1461 2.4312  2.1568  0.1662  -0.3409 0.1349  521 PHE A CG  
3484 C CD1 . PHE A 448 ? 2.1804 2.4655  2.2176  0.1904  -0.3491 0.1249  521 PHE A CD1 
3485 C CD2 . PHE A 448 ? 2.2735 2.5414  2.2640  0.1515  -0.3396 0.1496  521 PHE A CD2 
3486 C CE1 . PHE A 448 ? 2.0969 2.3599  2.1383  0.2005  -0.3571 0.1280  521 PHE A CE1 
3487 C CE2 . PHE A 448 ? 2.1127 2.3590  2.1090  0.1594  -0.3482 0.1551  521 PHE A CE2 
3488 C CZ  . PHE A 448 ? 1.9970 2.2382  2.0177  0.1842  -0.3575 0.1435  521 PHE A CZ  
3489 N N   . CYS A 449 ? 2.3570 2.6311  2.2969  0.1193  -0.3788 0.1687  522 CYS A N   
3490 C CA  . CYS A 449 ? 2.6111 2.8620  2.5241  0.1034  -0.4021 0.1927  522 CYS A CA  
3491 C C   . CYS A 449 ? 2.7206 2.9602  2.6278  0.1052  -0.4363 0.2017  522 CYS A C   
3492 O O   . CYS A 449 ? 2.9148 3.1254  2.8095  0.1005  -0.4656 0.2213  522 CYS A O   
3493 C CB  . CYS A 449 ? 2.7999 3.0652  2.6811  0.0762  -0.3839 0.2018  522 CYS A CB  
3494 S SG  . CYS A 449 ? 2.3154 2.5951  2.2033  0.0745  -0.3461 0.1935  522 CYS A SG  
3495 N N   . ARG A 450 ? 2.3957 2.6569  2.3123  0.1110  -0.4353 0.1887  523 ARG A N   
3496 C CA  . ARG A 450 ? 2.4241 2.6783  2.3404  0.1160  -0.4687 0.1959  523 ARG A CA  
3497 C C   . ARG A 450 ? 2.4237 2.6619  2.3712  0.1461  -0.4906 0.1902  523 ARG A C   
3498 O O   . ARG A 450 ? 2.4622 2.6761  2.4063  0.1519  -0.5259 0.2030  523 ARG A O   
3499 C CB  . ARG A 450 ? 2.4034 2.6889  2.3217  0.1122  -0.4609 0.1834  523 ARG A CB  
3500 C CG  . ARG A 450 ? 2.4918 2.7748  2.4009  0.1092  -0.4942 0.1946  523 ARG A CG  
3501 C CD  . ARG A 450 ? 2.6333 2.9224  2.5798  0.1384  -0.5136 0.1843  523 ARG A CD  
3502 N NE  . ARG A 450 ? 2.9515 3.2389  2.8915  0.1371  -0.5473 0.1956  523 ARG A NE  
3503 C CZ  . ARG A 450 ? 2.9735 3.2695  2.9437  0.1618  -0.5695 0.1891  523 ARG A CZ  
3504 N NH1 . ARG A 450 ? 3.0156 3.3252  3.0235  0.1892  -0.5603 0.1708  523 ARG A NH1 
3505 N NH2 . ARG A 450 ? 2.6084 2.9027  2.5714  0.1594  -0.6012 0.2010  523 ARG A NH2 
3506 N N   . ASP A 451 ? 2.3130 2.5649  2.2904  0.1662  -0.4710 0.1708  524 ASP A N   
3507 C CA  . ASP A 451 ? 2.2370 2.4780  2.2430  0.1968  -0.4890 0.1622  524 ASP A CA  
3508 C C   . ASP A 451 ? 2.3712 2.5676  2.3655  0.1980  -0.5088 0.1761  524 ASP A C   
3509 O O   . ASP A 451 ? 2.5341 2.7041  2.5355  0.2160  -0.5421 0.1790  524 ASP A O   
3510 C CB  . ASP A 451 ? 1.9675 2.2379  2.0044  0.2144  -0.4612 0.1397  524 ASP A CB  
3511 C CG  . ASP A 451 ? 1.9892 2.3017  2.0383  0.2104  -0.4434 0.1276  524 ASP A CG  
3512 O OD1 . ASP A 451 ? 2.1374 2.4594  2.1832  0.2067  -0.4607 0.1313  524 ASP A OD1 
3513 O OD2 . ASP A 451 ? 2.0819 2.4166  2.1436  0.2099  -0.4139 0.1154  524 ASP A OD2 
3514 N N   . VAL A 452 ? 2.5228 2.7100  2.4997  0.1793  -0.4902 0.1845  525 VAL A N   
3515 C CA  . VAL A 452 ? 2.6188 2.7639  2.5808  0.1733  -0.5104 0.2018  525 VAL A CA  
3516 C C   . VAL A 452 ? 2.7070 2.8249  2.6426  0.1567  -0.5454 0.2267  525 VAL A C   
3517 O O   . VAL A 452 ? 2.9182 2.9935  2.8491  0.1616  -0.5790 0.2392  525 VAL A O   
3518 C CB  . VAL A 452 ? 2.5350 2.6849  2.4840  0.1530  -0.4817 0.2077  525 VAL A CB  
3519 C CG1 . VAL A 452 ? 2.5354 2.6439  2.4693  0.1431  -0.5039 0.2278  525 VAL A CG1 
3520 C CG2 . VAL A 452 ? 2.4191 2.5936  2.3944  0.1697  -0.4499 0.1847  525 VAL A CG2 
3521 N N   . LYS A 453 ? 2.1033 2.2432  2.0200  0.1365  -0.5401 0.2343  526 LYS A N   
3522 C CA  . LYS A 453 ? 2.0305 2.1490  1.9215  0.1201  -0.5743 0.2587  526 LYS A CA  
3523 C C   . LYS A 453 ? 2.3296 2.4302  2.2399  0.1469  -0.6109 0.2544  526 LYS A C   
3524 O O   . LYS A 453 ? 2.1058 2.1708  2.0005  0.1413  -0.6494 0.2757  526 LYS A O   
3525 C CB  . LYS A 453 ? 2.0472 2.1986  1.9135  0.0942  -0.5584 0.2641  526 LYS A CB  
3526 C CG  . LYS A 453 ? 2.5731 2.7078  2.4068  0.0714  -0.5906 0.2923  526 LYS A CG  
3527 C CD  . LYS A 453 ? 2.7802 2.9515  2.5871  0.0463  -0.5717 0.2942  526 LYS A CD  
3528 C CE  . LYS A 453 ? 2.9064 3.1096  2.7348  0.0627  -0.5581 0.2685  526 LYS A CE  
3529 N NZ  . LYS A 453 ? 2.7385 2.9736  2.5389  0.0387  -0.5411 0.2675  526 LYS A NZ  
3530 N N   . GLU A 454 ? 2.6302 2.7566  2.5748  0.1761  -0.6005 0.2280  527 GLU A N   
3531 C CA  . GLU A 454 ? 2.4861 2.6030  2.4539  0.2062  -0.6334 0.2207  527 GLU A CA  
3532 C C   . GLU A 454 ? 2.4187 2.4937  2.3996  0.2311  -0.6565 0.2169  527 GLU A C   
3533 O O   . GLU A 454 ? 2.6150 2.6524  2.5945  0.2430  -0.6984 0.2266  527 GLU A O   
3534 C CB  . GLU A 454 ? 2.2942 2.4615  2.2949  0.2268  -0.6133 0.1945  527 GLU A CB  
3535 C CG  . GLU A 454 ? 2.4012 2.5703  2.4340  0.2642  -0.6415 0.1813  527 GLU A CG  
3536 C CD  . GLU A 454 ? 2.8807 3.0201  2.9009  0.2637  -0.6868 0.2005  527 GLU A CD  
3537 O OE1 . GLU A 454 ? 2.8116 2.9108  2.8388  0.2861  -0.7209 0.2023  527 GLU A OE1 
3538 O OE2 . GLU A 454 ? 3.0712 3.2254  3.0734  0.2411  -0.6898 0.2137  527 GLU A OE2 
3539 N N   . MET A 455 ? 2.2770 2.3558  2.2699  0.2395  -0.6315 0.2024  528 MET A N   
3540 C CA  . MET A 455 ? 2.3364 2.3767  2.3412  0.2647  -0.6523 0.1948  528 MET A CA  
3541 C C   . MET A 455 ? 2.2214 2.2031  2.1962  0.2437  -0.6815 0.2223  528 MET A C   
3542 O O   . MET A 455 ? 2.2350 2.1700  2.2098  0.2595  -0.7236 0.2274  528 MET A O   
3543 C CB  . MET A 455 ? 2.3854 2.4484  2.4087  0.2767  -0.6171 0.1730  528 MET A CB  
3544 C CG  . MET A 455 ? 2.5448 2.6610  2.6022  0.3027  -0.5955 0.1453  528 MET A CG  
3545 S SD  . MET A 455 ? 2.5646 2.7039  2.6412  0.3160  -0.5588 0.1229  528 MET A SD  
3546 C CE  . MET A 455 ? 1.9578 2.0383  2.0322  0.3383  -0.5927 0.1200  528 MET A CE  
3547 N N   . LEU A 456 ? 2.2742 2.2581  2.2234  0.2081  -0.6611 0.2405  529 LEU A N   
3548 C CA  . LEU A 456 ? 2.4956 2.4310  2.4169  0.1834  -0.6853 0.2688  529 LEU A CA  
3549 C C   . LEU A 456 ? 2.6074 2.5252  2.4993  0.1566  -0.7143 0.2998  529 LEU A C   
3550 O O   . LEU A 456 ? 2.4567 2.3295  2.3257  0.1363  -0.7436 0.3267  529 LEU A O   
3551 C CB  . LEU A 456 ? 2.3891 2.3413  2.2980  0.1571  -0.6501 0.2753  529 LEU A CB  
3552 C CG  . LEU A 456 ? 2.0513 1.9962  1.9780  0.1737  -0.6355 0.2578  529 LEU A CG  
3553 C CD1 . LEU A 456 ? 1.9446 1.9306  1.9038  0.2049  -0.6062 0.2236  529 LEU A CD1 
3554 C CD2 . LEU A 456 ? 2.1247 2.0796  2.0343  0.1419  -0.6105 0.2732  529 LEU A CD2 
3555 N N   . GLY A 457 ? 2.9170 2.8691  2.8082  0.1541  -0.7085 0.2980  530 GLY A N   
3556 C CA  . GLY A 457 ? 3.1208 3.0626  2.9820  0.1270  -0.7335 0.3273  530 GLY A CA  
3557 C C   . GLY A 457 ? 2.9686 2.9389  2.7970  0.0845  -0.7070 0.3468  530 GLY A C   
3558 O O   . GLY A 457 ? 3.4426 3.4161  3.2438  0.0601  -0.7220 0.3693  530 GLY A O   
3559 N N   . PHE A 458 ? 2.5007 2.4940  2.3305  0.0758  -0.6684 0.3383  531 PHE A N   
3560 C CA  . PHE A 458 ? 2.4925 2.5185  2.2939  0.0395  -0.6401 0.3527  531 PHE A CA  
3561 C C   . PHE A 458 ? 2.5740 2.6431  2.3926  0.0477  -0.5902 0.3257  531 PHE A C   
3562 O O   . PHE A 458 ? 2.2851 2.3488  2.1316  0.0723  -0.5795 0.3055  531 PHE A O   
3563 C CB  . PHE A 458 ? 2.5204 2.5182  2.2965  0.0095  -0.6555 0.3846  531 PHE A CB  
3564 C CG  . PHE A 458 ? 2.5653 2.5354  2.3600  0.0229  -0.6554 0.3775  531 PHE A CG  
3565 C CD1 . PHE A 458 ? 2.6371 2.5513  2.4438  0.0435  -0.6957 0.3785  531 PHE A CD1 
3566 C CD2 . PHE A 458 ? 2.3309 2.3302  2.1305  0.0156  -0.6167 0.3692  531 PHE A CD2 
3567 C CE1 . PHE A 458 ? 2.6818 2.5693  2.5030  0.0555  -0.6970 0.3705  531 PHE A CE1 
3568 C CE2 . PHE A 458 ? 2.5009 2.4756  2.3164  0.0268  -0.6178 0.3632  531 PHE A CE2 
3569 C CZ  . PHE A 458 ? 2.6383 2.5569  2.4636  0.0460  -0.6579 0.3636  531 PHE A CZ  
3570 N N   . SER A 459 ? 2.7378 2.8489  2.5381  0.0270  -0.5612 0.3254  532 SER A N   
3571 C CA  . SER A 459 ? 2.6999 2.8493  2.5138  0.0331  -0.5158 0.3011  53